data_3L2V
# 
_entry.id   3L2V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3L2V         
NDB   NA0401       
RCSB  RCSB056763   
WWPDB D_1000056763 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3DLR 'Catalytic core domain of PFV IN'                                      unspecified 
PDB 3L2Q 'the same protein in apo form'                                         unspecified 
PDB 3L2R 'the same protein in complex with magnesium'                           unspecified 
PDB 3L2S 'the same protein in complex with manganese'                           unspecified 
PDB 3L2T 'the same protein in complex with magnesium and MK0518 (Raltegravir)'  unspecified 
PDB 3L2U 'the same protein in complex with magnesium and GS9137 (Elvitegravir)' unspecified 
PDB 3L2W 'the same protein in complex with manganese and GS9137 (Elvitegravir)' unspecified 
# 
_pdbx_database_status.entry_id                        3L2V 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-12-15 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hare, S.'       1 
'Gupta, S.S.'    2 
'Cherepanov, P.' 3 
# 
_citation.id                        primary 
_citation.title                     'Retroviral intasome assembly and inhibition of DNA strand transfer' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            464 
_citation.page_first                232 
_citation.page_last                 236 
_citation.year                      2010 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20118915 
_citation.pdbx_database_id_DOI      10.1038/nature08784 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hare, S.'       1 
primary 'Gupta, S.S.'    2 
primary 'Valkov, E.'     3 
primary 'Engelman, A.'   4 
primary 'Cherepanov, P.' 5 
# 
_cell.length_a           158.650 
_cell.length_b           158.650 
_cell.length_c           125.230 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3L2V 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.entry_id                         3L2V 
_symmetry.Int_Tables_number                92 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Integrase 44456.695 2 ? ? ? ?                                          
2 polymer     syn "5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*TP*GP*TP*A)-3'" 5864.817  1 ? ? ? 
'19 nucleotide preprocessed PFV donor DNA' 
3 polymer     syn "5'-D(*TP*AP*CP*AP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3'" 5163.401  1 ? ? ? 
'17 nucleotide preprocessed PFV donor DNA' 
4 non-polymer syn 'ZINC ION' 65.409    1 ? ? ? ?                                          
5 non-polymer syn 'MANGANESE (II) ION' 54.938    3 ? ? ? ?                                          
6 non-polymer syn 'AMMONIUM ION' 18.038    1 ? ? ? ?                                          
7 non-polymer syn 
;N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-dihydropyrimidine-4-carboxamide
;
444.416   1 ? ? ? ?                                          
8 non-polymer syn GLYCEROL 92.094    4 ? ? ? ?                                          
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IN, p42In' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DT)(DG)(DT)(DA)' ATTGTCATGGAATTTTGTA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DA)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TACAAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DT  n 
2 17  DG  n 
2 18  DT  n 
2 19  DA  n 
3 1   DT  n 
3 2   DA  n 
3 3   DC  n 
3 4   DA  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HSRV2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PC2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSSH6P-PFV-INFL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POL_FOAMV P14350 1 
;CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLY
WWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKA
PSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPT
KWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVG
QLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
752 ? 
2 PDB 3L2V      3L2V   2 ATTGTCATGGAATTTTGTA 1   ? 
3 PDB 3L2V      3L2V   3 TACAAAATTCCATGACA 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3L2V A 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
2 1 3L2V B 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
3 2 3L2V C 1 ? 19  ? 3L2V   1   ? 19   ? 1 19  
4 3 3L2V D 1 ? 17  ? 3L2V   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3L2V GLY A 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  1  
1 3L2V PRO A 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  2  
1 3L2V GLY A 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   3  
1 3L2V SER A 220 ? UNP P14350 GLY 968 VARIANT          217 4  
1 3L2V GLY A 221 ? UNP P14350 SER 969 VARIANT          218 5  
2 3L2V GLY B 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  6  
2 3L2V PRO B 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  7  
2 3L2V GLY B 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   8  
2 3L2V SER B 220 ? UNP P14350 GLY 968 VARIANT          217 9  
2 3L2V GLY B 221 ? UNP P14350 SER 969 VARIANT          218 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ?                               'Mn 2'            54.938  
NH4 non-polymer         . 'AMMONIUM ION' ?                               'H4 N 1'          18.038  
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
RLT non-polymer         . 
;N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-dihydropyrimidine-4-carboxamide
;
'RALTEGRAVIR, MK0518'           'C20 H21 F N6 O5' 444.416 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION' ?                               'Zn 2'            65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3L2V 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        1.070 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.94 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   68.80 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;1.35M ammonium sulfate, 25% (v/v) glycerol, 4.8% (v/v) 1,6-hexanediol, 50mM Mes-NaOH, pH 6.5, vapor diffusion, hanging drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   2009-10-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9796 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_wavelength_list        0.9796 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
# 
_reflns.entry_id                     3L2V 
_reflns.d_resolution_high            3.200 
_reflns.d_resolution_low             39.123 
_reflns.number_all                   26841 
_reflns.number_obs                   26841 
_reflns.pdbx_Rsym_value              0.110 
_reflns.pdbx_redundancy              6.200 
_reflns.percent_possible_obs         99.600 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.2 
_reflns_shell.d_res_low              3.37 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3L2V 
_refine.ls_d_res_high                            3.200 
_refine.ls_d_res_low                             38.48 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.540 
_refine.ls_number_reflns_obs                     25447 
_refine.ls_number_reflns_all                     26924 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : RESIDUAL ONLY' 
_refine.ls_R_factor_obs                          0.20643 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20508 
_refine.ls_R_factor_R_free                       0.23204 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1356 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               111.124 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.17 
_refine.aniso_B[2][2]                            1.17 
_refine.aniso_B[3][3]                            -2.33 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.617 
_refine.pdbx_overall_ESU_R_Free                  0.333 
_refine.overall_SU_ML                            0.279 
_refine.overall_SU_B                             34.587 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3DLR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.834 
_refine.B_iso_max                                189.34 
_refine.B_iso_min                                49.38 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4126 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4919 
_refine_hist.d_res_high                       3.200 
_refine_hist.d_res_low                        38.48 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 5119 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.428  2.160  ? 7146 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.778  5.000  ? 526  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.105 23.550 ? 169  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.305 15.000 ? 662  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.366 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.074  0.200  ? 810  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 3633 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.453  1.500  ? 2657 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.858  2.000  ? 4334 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.072  3.000  ? 2462 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.965  4.500  ? 2812 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 A 860 0.37 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 860 0.59 2.00 'medium thermal'    1 2 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.200 
_refine_ls_shell.d_res_low                        3.283 
_refine_ls_shell.number_reflns_R_work             1841 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.323 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.number_reflns_all                1929 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 119 A 200 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 119 B 200 1 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 241 A 257 2 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 241 B 257 2 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 263 A 273 3 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 263 B 273 3 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3L2V 
_struct.title                     
'Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with manganese and MK0518 (Raltegravir)' 
_struct.pdbx_descriptor           'Integrase/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3L2V 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, TETRAMER, DNA INTEGRATION, ENDONUCLEASE, METAL-BINDING, MULTIFUNCTIONAL ENZYME, NUCLEASE, NUCLEOTIDYLTRANSFERASE, NUCLEUS, TRANSFERASE, VIRAL NUCLEOPROTEIN, VIRION, ZINC, DNA-BINDING, ZINC BINDING, HHCC MOTIF, VIRAL PROTEIN, RECOMBINATION, RECOMBINATION-DNA complex
;
_struct_keywords.pdbx_keywords   RECOMBINATION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 15  ? GLN A 20  ? LEU A 12  GLN A 17  1 ? 6  
HELX_P HELX_P2  2  PRO A 53  ? SER A 55  ? PRO A 50  SER A 52  5 ? 3  
HELX_P HELX_P3  3  ASP A 56  ? ASN A 66  ? ASP A 53  ASN A 63  1 ? 11 
HELX_P HELX_P4  4  GLY A 71  ? TYR A 83  ? GLY A 68  TYR A 80  1 ? 13 
HELX_P HELX_P5  5  ASN A 87  ? GLY A 97  ? ASN A 84  GLY A 94  1 ? 11 
HELX_P HELX_P6  6  CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P7  7  SER A 165 ? THR A 177 ? SER A 162 THR A 174 1 ? 13 
HELX_P HELX_P8  8  GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P9  9  SER A 195 ? ARG A 205 ? SER A 192 ARG A 202 1 ? 11 
HELX_P HELX_P10 10 HIS A 216 ? SER A 219 ? HIS A 213 SER A 216 5 ? 4  
HELX_P HELX_P11 11 SER A 220 ? LEU A 238 ? SER A 217 LEU A 235 1 ? 19 
HELX_P HELX_P12 12 TRP A 245 ? ASP A 247 ? TRP A 242 ASP A 244 5 ? 3  
HELX_P HELX_P13 13 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P14 14 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P15 15 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P16 16 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P17 17 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P18 18 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P19 19 SER B 220 ? VAL B 239 ? SER B 217 VAL B 236 1 ? 20 
HELX_P HELX_P20 20 LEU B 248 ? ASN B 258 ? LEU B 245 ASN B 255 1 ? 11 
HELX_P HELX_P21 21 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F MN  .   MN  ? ? ? 1_555 I RLT .  OAG ? ? A MN  394 A RLT 397 1_555 ? ? ? ? ? ? ?            1.779 ? 
metalc2  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 62  A ZN  393 1_555 ? ? ? ? ? ? ?            1.937 ? 
metalc3  metalc ? ? G MN  .   MN  ? ? ? 1_555 I RLT .  OAH ? ? A MN  395 A RLT 397 1_555 ? ? ? ? ? ? ?            1.960 ? 
metalc4  metalc ? ? G MN  .   MN  ? ? ? 1_555 I RLT .  OAE ? ? A MN  395 A RLT 397 1_555 ? ? ? ? ? ? ?            2.003 ? 
metalc5  metalc ? ? A ASP 131 OD2 ? ? ? 1_555 G MN  .  MN  ? ? A ASP 128 A MN  395 1_555 ? ? ? ? ? ? ?            2.099 ? 
metalc6  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 66  A ZN  393 1_555 ? ? ? ? ? ? ?            2.147 ? 
metalc7  metalc ? ? B ASP 188 OD1 ? ? ? 1_555 N MN  .  MN  ? ? B ASP 185 B MN  393 1_555 ? ? ? ? ? ? ?            2.197 ? 
metalc8  metalc ? ? A CYS 99  SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 96  A ZN  393 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc9  metalc ? ? A GLU 224 OE1 ? ? ? 1_555 G MN  .  MN  ? ? A GLU 221 A MN  395 1_555 ? ? ? ? ? ? ?            2.242 ? 
metalc10 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 F MN  .  MN  ? ? A ASP 128 A MN  394 1_555 ? ? ? ? ? ? ?            2.297 ? 
metalc11 metalc ? ? A CYS 102 SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 99  A ZN  393 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc12 metalc ? ? A ASP 188 OD1 ? ? ? 1_555 F MN  .  MN  ? ? A ASP 185 A MN  394 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc13 metalc ? ? A GLU 224 OE2 ? ? ? 1_555 G MN  .  MN  ? ? A GLU 221 A MN  395 1_555 ? ? ? ? ? ? ?            2.383 ? 
metalc14 metalc ? ? F MN  .   MN  ? ? ? 1_555 I RLT .  OAH ? ? A MN  394 A RLT 397 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc15 metalc ? ? B ASP 131 OD1 ? ? ? 1_555 N MN  .  MN  ? ? B ASP 128 B MN  393 1_555 ? ? ? ? ? ? ?            2.485 ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  16 N3  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  16 O2  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  16 N4  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA  15 N1  ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA  15 N6  ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  14 N1  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  14 O6  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  14 N2  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT  13 N3  ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT  13 O4  ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D DA  12 N1  ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D DA  12 N6  ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC  11 N3  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC  11 O2  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC  11 N4  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC  10 N3  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC  10 O2  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC  10 N4  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D DT  9  N3  ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D DT  9  O4  ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT  8  N3  ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT  8  O4  ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D DA  7  N1  ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D DA  7  N6  ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA  6  N1  ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA  6  N6  ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA  5  N1  ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA  5  N6  ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DT  16  N3  ? ? ? 1_555 D DA  4  N1  ? ? C DT  16  D DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DT  16  O4  ? ? ? 1_555 D DA  4  N6  ? ? C DT  16  D DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D DC  3  N3  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D DC  3  O2  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D DC  3  N4  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DT  18  N3  ? ? ? 1_555 D DA  2  N1  ? ? C DT  18  D DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DT  18  O4  ? ? ? 1_555 D DA  2  N6  ? ? C DT  18  D DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D DT  1  N3  ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 3.75  
2 HIS 360 A . ? HIS 357 A LEU 361 A ? LEU 358 A 1 -2.93 
3 LEU 361 A . ? LEU 358 A GLY 362 A ? GLY 359 A 1 -0.76 
4 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 3.61  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
A 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
A 3 GLY A 47  ? ILE A 50  ? GLY A 44  ILE A 47  
B 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
B 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
C 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
C 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
C 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
C 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
C 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
D 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
D 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
D 3 TRP A 340 ? ASN A 351 ? TRP A 337 ASN A 348 
D 4 LEU A 325 ? ARG A 329 ? LEU A 322 ARG A 326 
D 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
E 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
E 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
E 3 PHE B 128 ? ILE B 133 ? PHE B 125 ILE B 130 
E 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
E 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 36  ? N GLU A 33  O LYS A 39  ? O LYS A 36  
A 2 3 N VAL A 42  ? N VAL A 39  O LYS A 49  ? O LYS A 46  
B 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
C 1 2 O THR A 161 ? O THR A 158 N TYR A 144 ? N TYR A 141 
C 2 3 O VAL A 149 ? O VAL A 146 N PHE A 129 ? N PHE A 126 
C 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
C 4 5 N ILE A 185 ? N ILE A 182 O GLU A 210 ? O GLU A 207 
D 1 2 O VAL A 367 ? O VAL A 364 N VAL A 355 ? N VAL A 352 
D 2 3 O VAL A 356 ? O VAL A 353 N LEU A 347 ? N LEU A 344 
D 3 4 O HIS A 341 ? O HIS A 338 N GLU A 328 ? N GLU A 325 
D 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
E 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
E 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
E 3 4 N PHE B 128 ? N PHE B 125 O VAL B 184 ? O VAL B 181 
E 4 5 N ILE B 185 ? N ILE B 182 O GLU B 210 ? O GLU B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 393'  
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MN A 394'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 395'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MN B 393'  
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NH4 A 396' 
AC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE RLT A 397' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 801' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 802' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 803' 
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE GOL A 804' 
1   ?        ? ? ? ? ?  ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 65  ? HIS A 62  . ? 1_555 ? 
2  AC1 4  HIS A 69  ? HIS A 66  . ? 1_555 ? 
3  AC1 4  CYS A 99  ? CYS A 96  . ? 1_555 ? 
4  AC1 4  CYS A 102 ? CYS A 99  . ? 1_555 ? 
5  AC2 3  ASP A 131 ? ASP A 128 . ? 1_555 ? 
6  AC2 3  ASP A 188 ? ASP A 185 . ? 1_555 ? 
7  AC2 3  RLT I .   ? RLT A 397 . ? 1_555 ? 
8  AC3 5  ASP A 131 ? ASP A 128 . ? 1_555 ? 
9  AC3 5  GLU A 224 ? GLU A 221 . ? 1_555 ? 
10 AC3 5  ASN A 227 ? ASN A 224 . ? 1_555 ? 
11 AC3 5  RLT I .   ? RLT A 397 . ? 1_555 ? 
12 AC3 5  DA  D 17  ? DA  D 17  . ? 1_555 ? 
13 AC4 3  ASP B 131 ? ASP B 128 . ? 1_555 ? 
14 AC4 3  ASP B 188 ? ASP B 185 . ? 1_555 ? 
15 AC4 3  DA  C 19  ? DA  C 19  . ? 3_555 ? 
16 AC5 1  ASP A 119 ? ASP A 116 . ? 1_555 ? 
17 AC6 11 ASP A 131 ? ASP A 128 . ? 1_555 ? 
18 AC6 11 ASP A 188 ? ASP A 185 . ? 1_555 ? 
19 AC6 11 GLN A 189 ? GLN A 186 . ? 1_555 ? 
20 AC6 11 TYR A 215 ? TYR A 212 . ? 1_555 ? 
21 AC6 11 PRO A 217 ? PRO A 214 . ? 1_555 ? 
22 AC6 11 GLU A 224 ? GLU A 221 . ? 1_555 ? 
23 AC6 11 MN  F .   ? MN  A 394 . ? 1_555 ? 
24 AC6 11 MN  G .   ? MN  A 395 . ? 1_555 ? 
25 AC6 11 DG  C 4   ? DG  C 4   . ? 1_555 ? 
26 AC6 11 DC  D 16  ? DC  D 16  . ? 1_555 ? 
27 AC6 11 DA  D 17  ? DA  D 17  . ? 1_555 ? 
28 AC7 4  PRO A 138 ? PRO A 135 . ? 1_555 ? 
29 AC7 4  SER A 139 ? SER A 136 . ? 1_555 ? 
30 AC7 4  GLN A 140 ? GLN A 137 . ? 1_555 ? 
31 AC7 4  LYS A 244 ? LYS A 241 . ? 1_555 ? 
32 AC8 3  HIS A 341 ? HIS A 338 . ? 1_555 ? 
33 AC8 3  LYS A 342 ? LYS A 339 . ? 1_555 ? 
34 AC8 3  HIS A 360 ? HIS A 357 . ? 1_555 ? 
35 AC9 3  SER A 165 ? SER A 162 . ? 1_555 ? 
36 AC9 3  THR A 166 ? THR A 163 . ? 1_555 ? 
37 AC9 3  SER A 167 ? SER A 164 . ? 1_555 ? 
38 BC1 2  THR A 194 ? THR A 191 . ? 1_555 ? 
39 BC1 2  PHE A 211 ? PHE A 208 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3L2V 
_atom_sites.fract_transf_matrix[1][1]   0.006303 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006303 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007985 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
F  
MN 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 13  ? -79.532 15.940 -62.866 1.00 180.81 ? 10  ALA A N     1 
ATOM   2    C  CA    . ALA A 1 13  ? -79.841 16.038 -61.409 1.00 181.47 ? 10  ALA A CA    1 
ATOM   3    C  C     . ALA A 1 13  ? -80.936 17.086 -61.153 1.00 181.73 ? 10  ALA A C     1 
ATOM   4    O  O     . ALA A 1 13  ? -81.952 17.109 -61.856 1.00 183.14 ? 10  ALA A O     1 
ATOM   5    C  CB    . ALA A 1 13  ? -78.559 16.349 -60.610 1.00 178.99 ? 10  ALA A CB    1 
ATOM   6    N  N     . GLU A 1 14  ? -80.722 17.942 -60.150 1.00 180.53 ? 11  GLU A N     1 
ATOM   7    C  CA    . GLU A 1 14  ? -81.643 19.042 -59.812 1.00 180.91 ? 11  GLU A CA    1 
ATOM   8    C  C     . GLU A 1 14  ? -81.472 20.255 -60.746 1.00 178.54 ? 11  GLU A C     1 
ATOM   9    O  O     . GLU A 1 14  ? -82.318 21.153 -60.779 1.00 179.22 ? 11  GLU A O     1 
ATOM   10   C  CB    . GLU A 1 14  ? -81.487 19.453 -58.332 1.00 180.91 ? 11  GLU A CB    1 
ATOM   11   C  CG    . GLU A 1 14  ? -80.506 20.622 -58.034 1.00 178.46 ? 11  GLU A CG    1 
ATOM   12   C  CD    . GLU A 1 14  ? -79.022 20.220 -57.958 1.00 177.20 ? 11  GLU A CD    1 
ATOM   13   O  OE1   . GLU A 1 14  ? -78.668 19.047 -58.235 1.00 178.55 ? 11  GLU A OE1   1 
ATOM   14   O  OE2   . GLU A 1 14  ? -78.198 21.100 -57.615 1.00 174.86 ? 11  GLU A OE2   1 
ATOM   15   N  N     . LEU A 1 15  ? -80.367 20.268 -61.492 1.00 176.00 ? 12  LEU A N     1 
ATOM   16   C  CA    . LEU A 1 15  ? -80.080 21.312 -62.479 1.00 173.97 ? 12  LEU A CA    1 
ATOM   17   C  C     . LEU A 1 15  ? -81.005 21.183 -63.687 1.00 175.42 ? 12  LEU A C     1 
ATOM   18   O  O     . LEU A 1 15  ? -81.184 22.141 -64.444 1.00 174.98 ? 12  LEU A O     1 
ATOM   19   C  CB    . LEU A 1 15  ? -78.621 21.240 -62.953 1.00 171.62 ? 12  LEU A CB    1 
ATOM   20   C  CG    . LEU A 1 15  ? -77.457 21.099 -61.969 1.00 169.81 ? 12  LEU A CG    1 
ATOM   21   C  CD1   . LEU A 1 15  ? -77.171 19.626 -61.668 1.00 171.04 ? 12  LEU A CD1   1 
ATOM   22   C  CD2   . LEU A 1 15  ? -76.227 21.757 -62.561 1.00 166.99 ? 12  LEU A CD2   1 
ATOM   23   N  N     . ASP A 1 16  ? -81.573 19.991 -63.868 1.00 177.20 ? 13  ASP A N     1 
ATOM   24   C  CA    . ASP A 1 16  ? -82.511 19.728 -64.951 1.00 178.76 ? 13  ASP A CA    1 
ATOM   25   C  C     . ASP A 1 16  ? -83.571 20.836 -65.029 1.00 179.42 ? 13  ASP A C     1 
ATOM   26   O  O     . ASP A 1 16  ? -83.697 21.502 -66.061 1.00 178.97 ? 13  ASP A O     1 
ATOM   27   C  CB    . ASP A 1 16  ? -83.162 18.348 -64.759 1.00 181.67 ? 13  ASP A CB    1 
ATOM   28   C  CG    . ASP A 1 16  ? -83.714 17.754 -66.062 1.00 183.39 ? 13  ASP A CG    1 
ATOM   29   O  OD1   . ASP A 1 16  ? -84.203 18.508 -66.933 1.00 183.42 ? 13  ASP A OD1   1 
ATOM   30   O  OD2   . ASP A 1 16  ? -83.674 16.512 -66.208 1.00 184.80 ? 13  ASP A OD2   1 
ATOM   31   N  N     . GLN A 1 17  ? -84.292 21.051 -63.925 1.00 180.53 ? 14  GLN A N     1 
ATOM   32   C  CA    . GLN A 1 17  ? -85.396 22.029 -63.855 1.00 181.81 ? 14  GLN A CA    1 
ATOM   33   C  C     . GLN A 1 17  ? -85.019 23.406 -64.396 1.00 179.81 ? 14  GLN A C     1 
ATOM   34   O  O     . GLN A 1 17  ? -85.817 24.055 -65.083 1.00 181.20 ? 14  GLN A O     1 
ATOM   35   C  CB    . GLN A 1 17  ? -85.899 22.189 -62.409 1.00 183.23 ? 14  GLN A CB    1 
ATOM   36   C  CG    . GLN A 1 17  ? -86.743 21.037 -61.878 1.00 186.02 ? 14  GLN A CG    1 
ATOM   37   C  CD    . GLN A 1 17  ? -85.910 19.894 -61.314 1.00 185.12 ? 14  GLN A CD    1 
ATOM   38   O  OE1   . GLN A 1 17  ? -84.678 19.941 -61.300 1.00 182.09 ? 14  GLN A OE1   1 
ATOM   39   N  NE2   . GLN A 1 17  ? -86.588 18.857 -60.842 1.00 187.88 ? 14  GLN A NE2   1 
ATOM   40   N  N     . LEU A 1 18  ? -83.794 23.823 -64.080 1.00 176.68 ? 15  LEU A N     1 
ATOM   41   C  CA    . LEU A 1 18  ? -83.308 25.182 -64.311 1.00 174.73 ? 15  LEU A CA    1 
ATOM   42   C  C     . LEU A 1 18  ? -83.200 25.540 -65.790 1.00 174.04 ? 15  LEU A C     1 
ATOM   43   O  O     . LEU A 1 18  ? -83.595 26.636 -66.196 1.00 174.67 ? 15  LEU A O     1 
ATOM   44   C  CB    . LEU A 1 18  ? -81.951 25.362 -63.617 1.00 172.21 ? 15  LEU A CB    1 
ATOM   45   C  CG    . LEU A 1 18  ? -81.374 26.762 -63.387 1.00 171.06 ? 15  LEU A CG    1 
ATOM   46   C  CD1   . LEU A 1 18  ? -82.212 27.578 -62.395 1.00 173.08 ? 15  LEU A CD1   1 
ATOM   47   C  CD2   . LEU A 1 18  ? -79.947 26.624 -62.897 1.00 168.44 ? 15  LEU A CD2   1 
ATOM   48   N  N     . LEU A 1 19  ? -82.665 24.613 -66.584 1.00 172.81 ? 16  LEU A N     1 
ATOM   49   C  CA    . LEU A 1 19  ? -82.558 24.783 -68.032 1.00 172.39 ? 16  LEU A CA    1 
ATOM   50   C  C     . LEU A 1 19  ? -83.933 24.983 -68.669 1.00 174.63 ? 16  LEU A C     1 
ATOM   51   O  O     . LEU A 1 19  ? -84.051 25.545 -69.759 1.00 175.05 ? 16  LEU A O     1 
ATOM   52   C  CB    . LEU A 1 19  ? -81.862 23.569 -68.658 1.00 171.83 ? 16  LEU A CB    1 
ATOM   53   C  CG    . LEU A 1 19  ? -80.336 23.460 -68.584 1.00 169.21 ? 16  LEU A CG    1 
ATOM   54   C  CD1   . LEU A 1 19  ? -79.905 22.005 -68.445 1.00 168.89 ? 16  LEU A CD1   1 
ATOM   55   C  CD2   . LEU A 1 19  ? -79.684 24.104 -69.804 1.00 168.31 ? 16  LEU A CD2   1 
ATOM   56   N  N     . GLN A 1 20  ? -84.966 24.537 -67.958 1.00 176.05 ? 17  GLN A N     1 
ATOM   57   C  CA    . GLN A 1 20  ? -86.342 24.573 -68.436 1.00 178.45 ? 17  GLN A CA    1 
ATOM   58   C  C     . GLN A 1 20  ? -87.094 25.824 -67.973 1.00 179.39 ? 17  GLN A C     1 
ATOM   59   O  O     . GLN A 1 20  ? -88.302 25.948 -68.194 1.00 182.10 ? 17  GLN A O     1 
ATOM   60   C  CB    . GLN A 1 20  ? -87.067 23.303 -67.992 1.00 180.46 ? 17  GLN A CB    1 
ATOM   61   C  CG    . GLN A 1 20  ? -86.260 22.027 -68.254 1.00 179.79 ? 17  GLN A CG    1 
ATOM   62   C  CD    . GLN A 1 20  ? -86.986 20.763 -67.834 1.00 182.73 ? 17  GLN A CD    1 
ATOM   63   O  OE1   . GLN A 1 20  ? -87.751 20.758 -66.865 1.00 184.94 ? 17  GLN A OE1   1 
ATOM   64   N  NE2   . GLN A 1 20  ? -86.742 19.676 -68.559 1.00 183.08 ? 17  GLN A NE2   1 
ATOM   65   N  N     . GLY A 1 21  ? -86.372 26.742 -67.330 1.00 177.24 ? 18  GLY A N     1 
ATOM   66   C  CA    . GLY A 1 21  ? -86.908 28.050 -66.951 1.00 177.91 ? 18  GLY A CA    1 
ATOM   67   C  C     . GLY A 1 21  ? -87.552 28.148 -65.577 1.00 178.96 ? 18  GLY A C     1 
ATOM   68   O  O     . GLY A 1 21  ? -88.061 29.209 -65.207 1.00 180.56 ? 18  GLY A O     1 
ATOM   69   N  N     . HIS A 1 22  ? -87.533 27.054 -64.818 1.00 178.37 ? 19  HIS A N     1 
ATOM   70   C  CA    . HIS A 1 22  ? -88.128 27.033 -63.478 1.00 179.69 ? 19  HIS A CA    1 
ATOM   71   C  C     . HIS A 1 22  ? -87.114 27.437 -62.397 1.00 177.19 ? 19  HIS A C     1 
ATOM   72   O  O     . HIS A 1 22  ? -85.926 27.117 -62.489 1.00 174.28 ? 19  HIS A O     1 
ATOM   73   C  CB    . HIS A 1 22  ? -88.756 25.662 -63.190 1.00 181.44 ? 19  HIS A CB    1 
ATOM   74   C  CG    . HIS A 1 22  ? -89.830 25.278 -64.162 1.00 184.09 ? 19  HIS A CG    1 
ATOM   75   N  ND1   . HIS A 1 22  ? -91.164 25.560 -63.950 1.00 187.91 ? 19  HIS A ND1   1 
ATOM   76   C  CD2   . HIS A 1 22  ? -89.766 24.652 -65.362 1.00 183.86 ? 19  HIS A CD2   1 
ATOM   77   C  CE1   . HIS A 1 22  ? -91.876 25.116 -64.972 1.00 189.34 ? 19  HIS A CE1   1 
ATOM   78   N  NE2   . HIS A 1 22  ? -91.051 24.563 -65.844 1.00 187.05 ? 19  HIS A NE2   1 
ATOM   79   N  N     . TYR A 1 23  ? -87.598 28.144 -61.377 1.00 178.42 ? 20  TYR A N     1 
ATOM   80   C  CA    . TYR A 1 23  ? -86.743 28.757 -60.348 1.00 176.37 ? 20  TYR A CA    1 
ATOM   81   C  C     . TYR A 1 23  ? -86.235 27.783 -59.272 1.00 175.09 ? 20  TYR A C     1 
ATOM   82   O  O     . TYR A 1 23  ? -86.900 26.797 -58.962 1.00 176.96 ? 20  TYR A O     1 
ATOM   83   C  CB    . TYR A 1 23  ? -87.500 29.921 -59.690 1.00 179.02 ? 20  TYR A CB    1 
ATOM   84   C  CG    . TYR A 1 23  ? -86.756 30.606 -58.569 1.00 178.06 ? 20  TYR A CG    1 
ATOM   85   C  CD1   . TYR A 1 23  ? -85.665 31.433 -58.836 1.00 175.91 ? 20  TYR A CD1   1 
ATOM   86   C  CD2   . TYR A 1 23  ? -87.140 30.427 -57.236 1.00 179.96 ? 20  TYR A CD2   1 
ATOM   87   C  CE1   . TYR A 1 23  ? -84.969 32.069 -57.802 1.00 175.11 ? 20  TYR A CE1   1 
ATOM   88   C  CE2   . TYR A 1 23  ? -86.450 31.058 -56.192 1.00 179.04 ? 20  TYR A CE2   1 
ATOM   89   C  CZ    . TYR A 1 23  ? -85.367 31.877 -56.486 1.00 176.39 ? 20  TYR A CZ    1 
ATOM   90   O  OH    . TYR A 1 23  ? -84.678 32.507 -55.475 1.00 175.13 ? 20  TYR A OH    1 
ATOM   91   N  N     . ILE A 1 24  ? -85.055 28.071 -58.714 1.00 172.06 ? 21  ILE A N     1 
ATOM   92   C  CA    . ILE A 1 24  ? -84.478 27.314 -57.579 1.00 170.79 ? 21  ILE A CA    1 
ATOM   93   C  C     . ILE A 1 24  ? -83.869 28.276 -56.542 1.00 169.42 ? 21  ILE A C     1 
ATOM   94   O  O     . ILE A 1 24  ? -83.348 29.325 -56.916 1.00 167.97 ? 21  ILE A O     1 
ATOM   95   C  CB    . ILE A 1 24  ? -83.393 26.290 -58.047 1.00 168.23 ? 21  ILE A CB    1 
ATOM   96   C  CG1   . ILE A 1 24  ? -83.965 25.321 -59.096 1.00 169.33 ? 21  ILE A CG1   1 
ATOM   97   C  CG2   . ILE A 1 24  ? -82.800 25.518 -56.850 1.00 167.72 ? 21  ILE A CG2   1 
ATOM   98   C  CD1   . ILE A 1 24  ? -82.935 24.426 -59.766 1.00 167.43 ? 21  ILE A CD1   1 
ATOM   99   N  N     . LYS A 1 25  ? -83.940 27.914 -55.254 1.00 169.90 ? 22  LYS A N     1 
ATOM   100  C  CA    . LYS A 1 25  ? -83.330 28.706 -54.174 1.00 168.76 ? 22  LYS A CA    1 
ATOM   101  C  C     . LYS A 1 25  ? -81.867 28.992 -54.502 1.00 164.82 ? 22  LYS A C     1 
ATOM   102  O  O     . LYS A 1 25  ? -81.099 28.070 -54.782 1.00 162.97 ? 22  LYS A O     1 
ATOM   103  C  CB    . LYS A 1 25  ? -83.446 27.988 -52.827 1.00 170.02 ? 22  LYS A CB    1 
ATOM   104  N  N     . GLY A 1 26  ? -81.492 30.270 -54.466 1.00 163.89 ? 23  GLY A N     1 
ATOM   105  C  CA    . GLY A 1 26  ? -80.249 30.729 -55.086 1.00 160.42 ? 23  GLY A CA    1 
ATOM   106  C  C     . GLY A 1 26  ? -80.534 30.896 -56.568 1.00 160.23 ? 23  GLY A C     1 
ATOM   107  O  O     . GLY A 1 26  ? -81.597 31.413 -56.932 1.00 162.74 ? 23  GLY A O     1 
ATOM   108  N  N     . TYR A 1 27  ? -79.598 30.454 -57.421 1.00 157.53 ? 24  TYR A N     1 
ATOM   109  C  CA    . TYR A 1 27  ? -79.787 30.451 -58.889 1.00 157.22 ? 24  TYR A CA    1 
ATOM   110  C  C     . TYR A 1 27  ? -80.682 31.576 -59.430 1.00 159.24 ? 24  TYR A C     1 
ATOM   111  O  O     . TYR A 1 27  ? -81.769 31.300 -59.943 1.00 161.11 ? 24  TYR A O     1 
ATOM   112  C  CB    . TYR A 1 27  ? -80.337 29.097 -59.368 1.00 157.74 ? 24  TYR A CB    1 
ATOM   113  C  CG    . TYR A 1 27  ? -79.486 27.897 -59.018 1.00 155.72 ? 24  TYR A CG    1 
ATOM   114  C  CD1   . TYR A 1 27  ? -78.428 27.502 -59.835 1.00 153.20 ? 24  TYR A CD1   1 
ATOM   115  C  CD2   . TYR A 1 27  ? -79.749 27.146 -57.875 1.00 156.67 ? 24  TYR A CD2   1 
ATOM   116  C  CE1   . TYR A 1 27  ? -77.648 26.394 -59.518 1.00 152.19 ? 24  TYR A CE1   1 
ATOM   117  C  CE2   . TYR A 1 27  ? -78.976 26.038 -57.546 1.00 155.61 ? 24  TYR A CE2   1 
ATOM   118  C  CZ    . TYR A 1 27  ? -77.929 25.666 -58.372 1.00 153.41 ? 24  TYR A CZ    1 
ATOM   119  O  OH    . TYR A 1 27  ? -77.165 24.570 -58.044 1.00 152.81 ? 24  TYR A OH    1 
ATOM   120  N  N     . PRO A 1 28  ? -80.227 32.841 -59.330 1.00 159.09 ? 25  PRO A N     1 
ATOM   121  C  CA    . PRO A 1 28  ? -81.109 33.965 -59.649 1.00 161.86 ? 25  PRO A CA    1 
ATOM   122  C  C     . PRO A 1 28  ? -81.466 34.054 -61.129 1.00 162.73 ? 25  PRO A C     1 
ATOM   123  O  O     . PRO A 1 28  ? -80.573 34.013 -61.978 1.00 161.13 ? 25  PRO A O     1 
ATOM   124  C  CB    . PRO A 1 28  ? -80.293 35.190 -59.221 1.00 161.45 ? 25  PRO A CB    1 
ATOM   125  C  CG    . PRO A 1 28  ? -78.881 34.751 -59.255 1.00 158.15 ? 25  PRO A CG    1 
ATOM   126  C  CD    . PRO A 1 28  ? -78.874 33.288 -58.939 1.00 156.81 ? 25  PRO A CD    1 
ATOM   127  N  N     . LYS A 1 29  ? -82.765 34.169 -61.420 1.00 165.65 ? 26  LYS A N     1 
ATOM   128  C  CA    . LYS A 1 29  ? -83.257 34.362 -62.791 1.00 166.96 ? 26  LYS A CA    1 
ATOM   129  C  C     . LYS A 1 29  ? -82.822 35.730 -63.316 1.00 167.73 ? 26  LYS A C     1 
ATOM   130  O  O     . LYS A 1 29  ? -82.414 36.591 -62.534 1.00 167.93 ? 26  LYS A O     1 
ATOM   131  C  CB    . LYS A 1 29  ? -84.783 34.214 -62.857 1.00 170.08 ? 26  LYS A CB    1 
ATOM   132  N  N     . GLN A 1 30  ? -82.918 35.909 -64.636 1.00 168.40 ? 27  GLN A N     1 
ATOM   133  C  CA    . GLN A 1 30  ? -82.430 37.094 -65.380 1.00 169.28 ? 27  GLN A CA    1 
ATOM   134  C  C     . GLN A 1 30  ? -81.173 36.756 -66.188 1.00 166.68 ? 27  GLN A C     1 
ATOM   135  O  O     . GLN A 1 30  ? -80.895 37.391 -67.209 1.00 167.78 ? 27  GLN A O     1 
ATOM   136  C  CB    . GLN A 1 30  ? -82.209 38.340 -64.498 1.00 170.50 ? 27  GLN A CB    1 
ATOM   137  C  CG    . GLN A 1 30  ? -80.773 38.537 -63.996 1.00 167.79 ? 27  GLN A CG    1 
ATOM   138  C  CD    . GLN A 1 30  ? -80.639 39.685 -63.012 1.00 169.24 ? 27  GLN A CD    1 
ATOM   139  O  OE1   . GLN A 1 30  ? -79.610 40.361 -62.976 1.00 168.60 ? 27  GLN A OE1   1 
ATOM   140  N  NE2   . GLN A 1 30  ? -81.673 39.908 -62.204 1.00 171.45 ? 27  GLN A NE2   1 
ATOM   141  N  N     . TYR A 1 31  ? -80.414 35.768 -65.716 1.00 163.49 ? 28  TYR A N     1 
ATOM   142  C  CA    . TYR A 1 31  ? -79.324 35.206 -66.499 1.00 161.16 ? 28  TYR A CA    1 
ATOM   143  C  C     . TYR A 1 31  ? -79.881 34.037 -67.269 1.00 160.87 ? 28  TYR A C     1 
ATOM   144  O  O     . TYR A 1 31  ? -80.689 33.278 -66.740 1.00 161.00 ? 28  TYR A O     1 
ATOM   145  C  CB    . TYR A 1 31  ? -78.197 34.689 -65.608 1.00 158.44 ? 28  TYR A CB    1 
ATOM   146  C  CG    . TYR A 1 31  ? -77.702 35.657 -64.570 1.00 158.34 ? 28  TYR A CG    1 
ATOM   147  C  CD1   . TYR A 1 31  ? -77.157 36.889 -64.938 1.00 159.48 ? 28  TYR A CD1   1 
ATOM   148  C  CD2   . TYR A 1 31  ? -77.755 35.330 -63.217 1.00 157.42 ? 28  TYR A CD2   1 
ATOM   149  C  CE1   . TYR A 1 31  ? -76.698 37.776 -63.985 1.00 159.88 ? 28  TYR A CE1   1 
ATOM   150  C  CE2   . TYR A 1 31  ? -77.296 36.208 -62.255 1.00 157.80 ? 28  TYR A CE2   1 
ATOM   151  C  CZ    . TYR A 1 31  ? -76.768 37.428 -62.645 1.00 158.96 ? 28  TYR A CZ    1 
ATOM   152  O  OH    . TYR A 1 31  ? -76.310 38.302 -61.695 1.00 159.28 ? 28  TYR A OH    1 
ATOM   153  N  N     . THR A 1 32  ? -79.454 33.890 -68.516 1.00 160.71 ? 29  THR A N     1 
ATOM   154  C  CA    . THR A 1 32  ? -79.857 32.731 -69.300 1.00 160.62 ? 29  THR A CA    1 
ATOM   155  C  C     . THR A 1 32  ? -78.917 31.555 -69.009 1.00 157.90 ? 29  THR A C     1 
ATOM   156  O  O     . THR A 1 32  ? -77.689 31.684 -69.087 1.00 156.52 ? 29  THR A O     1 
ATOM   157  C  CB    . THR A 1 32  ? -79.980 33.039 -70.825 1.00 162.36 ? 29  THR A CB    1 
ATOM   158  O  OG1   . THR A 1 32  ? -79.067 34.085 -71.187 1.00 162.84 ? 29  THR A OG1   1 
ATOM   159  C  CG2   . THR A 1 32  ? -81.415 33.472 -71.186 1.00 164.91 ? 29  THR A CG2   1 
ATOM   160  N  N     . TYR A 1 33  ? -79.517 30.426 -68.639 1.00 157.45 ? 30  TYR A N     1 
ATOM   161  C  CA    . TYR A 1 33  ? -78.797 29.207 -68.289 1.00 155.38 ? 30  TYR A CA    1 
ATOM   162  C  C     . TYR A 1 33  ? -78.880 28.218 -69.446 1.00 155.72 ? 30  TYR A C     1 
ATOM   163  O  O     . TYR A 1 33  ? -79.945 27.668 -69.720 1.00 157.29 ? 30  TYR A O     1 
ATOM   164  C  CB    . TYR A 1 33  ? -79.411 28.574 -67.033 1.00 155.36 ? 30  TYR A CB    1 
ATOM   165  C  CG    . TYR A 1 33  ? -79.357 29.425 -65.778 1.00 155.33 ? 30  TYR A CG    1 
ATOM   166  C  CD1   . TYR A 1 33  ? -78.379 29.207 -64.806 1.00 153.69 ? 30  TYR A CD1   1 
ATOM   167  C  CD2   . TYR A 1 33  ? -80.295 30.433 -65.550 1.00 157.65 ? 30  TYR A CD2   1 
ATOM   168  C  CE1   . TYR A 1 33  ? -78.329 29.982 -63.641 1.00 153.77 ? 30  TYR A CE1   1 
ATOM   169  C  CE2   . TYR A 1 33  ? -80.253 31.217 -64.389 1.00 157.92 ? 30  TYR A CE2   1 
ATOM   170  C  CZ    . TYR A 1 33  ? -79.268 30.985 -63.441 1.00 155.85 ? 30  TYR A CZ    1 
ATOM   171  O  OH    . TYR A 1 33  ? -79.224 31.755 -62.297 1.00 156.10 ? 30  TYR A OH    1 
ATOM   172  N  N     . PHE A 1 34  ? -77.767 27.980 -70.125 1.00 154.55 ? 31  PHE A N     1 
ATOM   173  C  CA    . PHE A 1 34  ? -77.801 27.106 -71.294 1.00 155.35 ? 31  PHE A CA    1 
ATOM   174  C  C     . PHE A 1 34  ? -76.942 25.848 -71.150 1.00 154.04 ? 31  PHE A C     1 
ATOM   175  O  O     . PHE A 1 34  ? -76.331 25.621 -70.102 1.00 152.56 ? 31  PHE A O     1 
ATOM   176  C  CB    . PHE A 1 34  ? -77.442 27.887 -72.563 1.00 156.49 ? 31  PHE A CB    1 
ATOM   177  C  CG    . PHE A 1 34  ? -76.064 28.485 -72.543 1.00 155.78 ? 31  PHE A CG    1 
ATOM   178  C  CD1   . PHE A 1 34  ? -75.013 27.855 -73.206 1.00 155.70 ? 31  PHE A CD1   1 
ATOM   179  C  CD2   . PHE A 1 34  ? -75.819 29.685 -71.873 1.00 155.62 ? 31  PHE A CD2   1 
ATOM   180  C  CE1   . PHE A 1 34  ? -73.734 28.402 -73.199 1.00 155.18 ? 31  PHE A CE1   1 
ATOM   181  C  CE2   . PHE A 1 34  ? -74.546 30.242 -71.858 1.00 155.18 ? 31  PHE A CE2   1 
ATOM   182  C  CZ    . PHE A 1 34  ? -73.498 29.598 -72.524 1.00 154.98 ? 31  PHE A CZ    1 
ATOM   183  N  N     . LEU A 1 35  ? -76.920 25.033 -72.207 1.00 154.72 ? 32  LEU A N     1 
ATOM   184  C  CA    . LEU A 1 35  ? -76.169 23.780 -72.224 1.00 154.03 ? 32  LEU A CA    1 
ATOM   185  C  C     . LEU A 1 35  ? -75.145 23.760 -73.359 1.00 154.21 ? 32  LEU A C     1 
ATOM   186  O  O     . LEU A 1 35  ? -75.458 24.117 -74.495 1.00 155.64 ? 32  LEU A O     1 
ATOM   187  C  CB    . LEU A 1 35  ? -77.129 22.584 -72.328 1.00 155.46 ? 32  LEU A CB    1 
ATOM   188  C  CG    . LEU A 1 35  ? -76.552 21.169 -72.167 1.00 155.52 ? 32  LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1 35  ? -77.411 20.340 -71.222 1.00 155.65 ? 32  LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1 35  ? -76.378 20.467 -73.518 1.00 157.10 ? 32  LEU A CD2   1 
ATOM   191  N  N     . GLU A 1 36  ? -73.923 23.346 -73.032 1.00 153.00 ? 33  GLU A N     1 
ATOM   192  C  CA    . GLU A 1 36  ? -72.834 23.215 -74.002 1.00 153.48 ? 33  GLU A CA    1 
ATOM   193  C  C     . GLU A 1 36  ? -71.883 22.112 -73.574 1.00 152.94 ? 33  GLU A C     1 
ATOM   194  O  O     . GLU A 1 36  ? -71.335 22.149 -72.469 1.00 151.41 ? 33  GLU A O     1 
ATOM   195  C  CB    . GLU A 1 36  ? -72.056 24.527 -74.149 1.00 153.01 ? 33  GLU A CB    1 
ATOM   196  C  CG    . GLU A 1 36  ? -72.358 25.311 -75.429 1.00 155.39 ? 33  GLU A CG    1 
ATOM   197  C  CD    . GLU A 1 36  ? -71.506 26.578 -75.586 1.00 155.97 ? 33  GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1 36  ? -70.671 26.873 -74.703 1.00 154.38 ? 33  GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1 36  ? -71.677 27.286 -76.605 1.00 158.15 ? 33  GLU A OE2   1 
ATOM   200  N  N     . ASP A 1 37  ? -71.683 21.141 -74.464 1.00 154.44 ? 34  ASP A N     1 
ATOM   201  C  CA    . ASP A 1 37  ? -70.788 19.997 -74.230 1.00 154.67 ? 34  ASP A CA    1 
ATOM   202  C  C     . ASP A 1 37  ? -71.236 19.144 -73.037 1.00 153.86 ? 34  ASP A C     1 
ATOM   203  O  O     . ASP A 1 37  ? -70.405 18.597 -72.304 1.00 153.42 ? 34  ASP A O     1 
ATOM   204  C  CB    . ASP A 1 37  ? -69.325 20.450 -74.053 1.00 153.99 ? 34  ASP A CB    1 
ATOM   205  C  CG    . ASP A 1 37  ? -68.895 21.482 -75.086 1.00 154.91 ? 34  ASP A CG    1 
ATOM   206  O  OD1   . ASP A 1 37  ? -68.222 21.100 -76.069 1.00 156.67 ? 34  ASP A OD1   1 
ATOM   207  O  OD2   . ASP A 1 37  ? -69.231 22.676 -74.914 1.00 154.44 ? 34  ASP A OD2   1 
ATOM   208  N  N     . GLY A 1 38  ? -72.552 19.041 -72.852 1.00 153.80 ? 35  GLY A N     1 
ATOM   209  C  CA    . GLY A 1 38  ? -73.137 18.285 -71.743 1.00 153.19 ? 35  GLY A CA    1 
ATOM   210  C  C     . GLY A 1 38  ? -72.820 18.858 -70.372 1.00 150.64 ? 35  GLY A C     1 
ATOM   211  O  O     . GLY A 1 38  ? -72.832 18.131 -69.377 1.00 150.78 ? 35  GLY A O     1 
ATOM   212  N  N     . LYS A 1 39  ? -72.518 20.156 -70.328 1.00 148.55 ? 36  LYS A N     1 
ATOM   213  C  CA    . LYS A 1 39  ? -72.291 20.890 -69.076 1.00 146.11 ? 36  LYS A CA    1 
ATOM   214  C  C     . LYS A 1 39  ? -73.306 22.022 -68.988 1.00 145.22 ? 36  LYS A C     1 
ATOM   215  O  O     . LYS A 1 39  ? -73.734 22.559 -70.013 1.00 146.08 ? 36  LYS A O     1 
ATOM   216  C  CB    . LYS A 1 39  ? -70.882 21.490 -69.029 1.00 144.90 ? 36  LYS A CB    1 
ATOM   217  C  CG    . LYS A 1 39  ? -69.731 20.500 -68.959 1.00 145.39 ? 36  LYS A CG    1 
ATOM   218  C  CD    . LYS A 1 39  ? -68.449 21.171 -69.446 1.00 145.26 ? 36  LYS A CD    1 
ATOM   219  C  CE    . LYS A 1 39  ? -67.285 20.201 -69.524 1.00 146.26 ? 36  LYS A CE    1 
ATOM   220  N  NZ    . LYS A 1 39  ? -66.734 19.911 -68.177 1.00 145.11 ? 36  LYS A NZ    1 
ATOM   221  N  N     . VAL A 1 40  ? -73.685 22.394 -67.770 1.00 143.50 ? 37  VAL A N     1 
ATOM   222  C  CA    . VAL A 1 40  ? -74.663 23.456 -67.588 1.00 142.82 ? 37  VAL A CA    1 
ATOM   223  C  C     . VAL A 1 40  ? -73.948 24.793 -67.428 1.00 141.06 ? 37  VAL A C     1 
ATOM   224  O  O     . VAL A 1 40  ? -73.372 25.079 -66.381 1.00 139.89 ? 37  VAL A O     1 
ATOM   225  C  CB    . VAL A 1 40  ? -75.572 23.189 -66.379 1.00 143.16 ? 37  VAL A CB    1 
ATOM   226  C  CG1   . VAL A 1 40  ? -76.846 24.004 -66.497 1.00 144.17 ? 37  VAL A CG1   1 
ATOM   227  C  CG2   . VAL A 1 40  ? -75.889 21.700 -66.267 1.00 144.35 ? 37  VAL A CG2   1 
ATOM   228  N  N     . LYS A 1 41  ? -73.983 25.608 -68.473 1.00 141.05 ? 38  LYS A N     1 
ATOM   229  C  CA    . LYS A 1 41  ? -73.263 26.879 -68.474 1.00 139.73 ? 38  LYS A CA    1 
ATOM   230  C  C     . LYS A 1 41  ? -74.173 28.061 -68.134 1.00 139.88 ? 38  LYS A C     1 
ATOM   231  O  O     . LYS A 1 41  ? -75.395 27.964 -68.242 1.00 140.99 ? 38  LYS A O     1 
ATOM   232  C  CB    . LYS A 1 41  ? -72.579 27.096 -69.830 1.00 140.64 ? 38  LYS A CB    1 
ATOM   233  C  CG    . LYS A 1 41  ? -71.398 26.161 -70.123 1.00 140.16 ? 38  LYS A CG    1 
ATOM   234  C  CD    . LYS A 1 41  ? -70.573 26.689 -71.297 1.00 141.38 ? 38  LYS A CD    1 
ATOM   235  C  CE    . LYS A 1 41  ? -69.133 26.175 -71.281 1.00 141.24 ? 38  LYS A CE    1 
ATOM   236  N  NZ    . LYS A 1 41  ? -68.999 24.791 -71.823 1.00 142.50 ? 38  LYS A NZ    1 
ATOM   237  N  N     . VAL A 1 42  ? -73.569 29.175 -67.725 1.00 138.91 ? 39  VAL A N     1 
ATOM   238  C  CA    . VAL A 1 42  ? -74.319 30.391 -67.400 1.00 139.61 ? 39  VAL A CA    1 
ATOM   239  C  C     . VAL A 1 42  ? -73.600 31.691 -67.806 1.00 139.93 ? 39  VAL A C     1 
ATOM   240  O  O     . VAL A 1 42  ? -72.407 31.871 -67.537 1.00 138.63 ? 39  VAL A O     1 
ATOM   241  C  CB    . VAL A 1 42  ? -74.719 30.432 -65.899 1.00 138.92 ? 39  VAL A CB    1 
ATOM   242  C  CG1   . VAL A 1 42  ? -73.487 30.537 -64.994 1.00 137.26 ? 39  VAL A CG1   1 
ATOM   243  C  CG2   . VAL A 1 42  ? -75.680 31.573 -65.628 1.00 140.42 ? 39  VAL A CG2   1 
ATOM   244  N  N     . SER A 1 43  ? -74.346 32.583 -68.457 1.00 141.81 ? 40  SER A N     1 
ATOM   245  C  CA    . SER A 1 43  ? -73.856 33.914 -68.816 1.00 142.92 ? 40  SER A CA    1 
ATOM   246  C  C     . SER A 1 43  ? -73.946 34.865 -67.617 1.00 142.87 ? 40  SER A C     1 
ATOM   247  O  O     . SER A 1 43  ? -75.037 35.102 -67.090 1.00 143.93 ? 40  SER A O     1 
ATOM   248  C  CB    . SER A 1 43  ? -74.653 34.469 -70.003 1.00 145.45 ? 40  SER A CB    1 
ATOM   249  O  OG    . SER A 1 43  ? -74.345 35.831 -70.244 1.00 146.82 ? 40  SER A OG    1 
ATOM   250  N  N     . ARG A 1 44  ? -72.803 35.403 -67.190 1.00 141.87 ? 41  ARG A N     1 
ATOM   251  C  CA    . ARG A 1 44  ? -72.748 36.322 -66.040 1.00 141.73 ? 41  ARG A CA    1 
ATOM   252  C  C     . ARG A 1 44  ? -71.948 37.585 -66.333 1.00 142.71 ? 41  ARG A C     1 
ATOM   253  O  O     . ARG A 1 44  ? -71.104 37.584 -67.230 1.00 142.92 ? 41  ARG A O     1 
ATOM   254  C  CB    . ARG A 1 44  ? -72.156 35.622 -64.817 1.00 139.35 ? 41  ARG A CB    1 
ATOM   255  C  CG    . ARG A 1 44  ? -73.128 34.690 -64.128 1.00 139.43 ? 41  ARG A CG    1 
ATOM   256  C  CD    . ARG A 1 44  ? -72.485 33.986 -62.945 1.00 138.34 ? 41  ARG A CD    1 
ATOM   257  N  NE    . ARG A 1 44  ? -72.076 34.917 -61.894 1.00 138.72 ? 41  ARG A NE    1 
ATOM   258  C  CZ    . ARG A 1 44  ? -72.915 35.516 -61.053 1.00 140.10 ? 41  ARG A CZ    1 
ATOM   259  N  NH1   . ARG A 1 44  ? -74.225 35.300 -61.137 1.00 141.43 ? 41  ARG A NH1   1 
ATOM   260  N  NH2   . ARG A 1 44  ? -72.442 36.341 -60.128 1.00 140.48 ? 41  ARG A NH2   1 
ATOM   261  N  N     . PRO A 1 45  ? -72.217 38.676 -65.584 1.00 143.62 ? 42  PRO A N     1 
ATOM   262  C  CA    . PRO A 1 45  ? -71.388 39.865 -65.698 1.00 144.75 ? 42  PRO A CA    1 
ATOM   263  C  C     . PRO A 1 45  ? -69.903 39.520 -65.837 1.00 142.76 ? 42  PRO A C     1 
ATOM   264  O  O     . PRO A 1 45  ? -69.282 39.911 -66.824 1.00 144.13 ? 42  PRO A O     1 
ATOM   265  C  CB    . PRO A 1 45  ? -71.677 40.600 -64.390 1.00 145.16 ? 42  PRO A CB    1 
ATOM   266  C  CG    . PRO A 1 45  ? -73.122 40.302 -64.139 1.00 145.91 ? 42  PRO A CG    1 
ATOM   267  C  CD    . PRO A 1 45  ? -73.399 38.931 -64.734 1.00 144.47 ? 42  PRO A CD    1 
ATOM   268  N  N     . GLU A 1 46  ? -69.356 38.761 -64.887 1.00 139.74 ? 43  GLU A N     1 
ATOM   269  C  CA    . GLU A 1 46  ? -67.946 38.343 -64.934 1.00 137.78 ? 43  GLU A CA    1 
ATOM   270  C  C     . GLU A 1 46  ? -67.572 37.581 -66.238 1.00 137.49 ? 43  GLU A C     1 
ATOM   271  O  O     . GLU A 1 46  ? -66.411 37.591 -66.666 1.00 137.64 ? 43  GLU A O     1 
ATOM   272  C  CB    . GLU A 1 46  ? -67.583 37.529 -63.677 1.00 134.95 ? 43  GLU A CB    1 
ATOM   273  N  N     . GLY A 1 47  ? -68.564 36.953 -66.872 1.00 137.09 ? 44  GLY A N     1 
ATOM   274  C  CA    . GLY A 1 47  ? -68.346 36.114 -68.057 1.00 136.35 ? 44  GLY A CA    1 
ATOM   275  C  C     . GLY A 1 47  ? -69.208 34.857 -68.021 1.00 134.52 ? 44  GLY A C     1 
ATOM   276  O  O     . GLY A 1 47  ? -70.108 34.735 -67.180 1.00 134.05 ? 44  GLY A O     1 
ATOM   277  N  N     . VAL A 1 48  ? -68.932 33.914 -68.921 1.00 133.55 ? 45  VAL A N     1 
ATOM   278  C  CA    . VAL A 1 48  ? -69.711 32.669 -68.993 1.00 131.78 ? 45  VAL A CA    1 
ATOM   279  C  C     . VAL A 1 48  ? -69.029 31.516 -68.246 1.00 128.98 ? 45  VAL A C     1 
ATOM   280  O  O     . VAL A 1 48  ? -67.965 31.042 -68.656 1.00 128.77 ? 45  VAL A O     1 
ATOM   281  C  CB    . VAL A 1 48  ? -70.023 32.275 -70.455 1.00 133.50 ? 45  VAL A CB    1 
ATOM   282  C  CG1   . VAL A 1 48  ? -70.735 30.929 -70.517 1.00 132.65 ? 45  VAL A CG1   1 
ATOM   283  C  CG2   . VAL A 1 48  ? -70.862 33.357 -71.126 1.00 135.73 ? 45  VAL A CG2   1 
ATOM   284  N  N     . LYS A 1 49  ? -69.650 31.076 -67.152 1.00 126.73 ? 46  LYS A N     1 
ATOM   285  C  CA    . LYS A 1 49  ? -69.064 30.057 -66.279 1.00 124.02 ? 46  LYS A CA    1 
ATOM   286  C  C     . LYS A 1 49  ? -69.851 28.753 -66.296 1.00 123.60 ? 46  LYS A C     1 
ATOM   287  O  O     . LYS A 1 49  ? -71.024 28.730 -66.664 1.00 124.73 ? 46  LYS A O     1 
ATOM   288  C  CB    . LYS A 1 49  ? -68.941 30.570 -64.837 1.00 122.64 ? 46  LYS A CB    1 
ATOM   289  C  CG    . LYS A 1 49  ? -68.088 31.824 -64.655 1.00 122.09 ? 46  LYS A CG    1 
ATOM   290  C  CD    . LYS A 1 49  ? -66.704 31.694 -65.298 1.00 121.00 ? 46  LYS A CD    1 
ATOM   291  C  CE    . LYS A 1 49  ? -65.795 32.876 -64.971 1.00 120.56 ? 46  LYS A CE    1 
ATOM   292  N  NZ    . LYS A 1 49  ? -66.476 34.198 -65.021 1.00 121.89 ? 46  LYS A NZ    1 
ATOM   293  N  N     . ILE A 1 50  ? -69.188 27.675 -65.888 1.00 122.09 ? 47  ILE A N     1 
ATOM   294  C  CA    . ILE A 1 50  ? -69.795 26.351 -65.779 1.00 121.77 ? 47  ILE A CA    1 
ATOM   295  C  C     . ILE A 1 50  ? -70.403 26.163 -64.385 1.00 120.94 ? 47  ILE A C     1 
ATOM   296  O  O     . ILE A 1 50  ? -69.846 26.629 -63.394 1.00 119.96 ? 47  ILE A O     1 
ATOM   297  C  CB    . ILE A 1 50  ? -68.735 25.259 -66.047 1.00 121.70 ? 47  ILE A CB    1 
ATOM   298  C  CG1   . ILE A 1 50  ? -68.075 25.487 -67.418 1.00 122.63 ? 47  ILE A CG1   1 
ATOM   299  C  CG2   . ILE A 1 50  ? -69.344 23.867 -65.942 1.00 122.41 ? 47  ILE A CG2   1 
ATOM   300  C  CD1   . ILE A 1 50  ? -66.756 24.753 -67.635 1.00 122.77 ? 47  ILE A CD1   1 
ATOM   301  N  N     . ILE A 1 51  ? -71.550 25.498 -64.303 1.00 121.50 ? 48  ILE A N     1 
ATOM   302  C  CA    . ILE A 1 51  ? -72.138 25.182 -63.007 1.00 121.15 ? 48  ILE A CA    1 
ATOM   303  C  C     . ILE A 1 51  ? -72.112 23.689 -62.764 1.00 121.92 ? 48  ILE A C     1 
ATOM   304  O  O     . ILE A 1 51  ? -72.864 22.944 -63.377 1.00 123.37 ? 48  ILE A O     1 
ATOM   305  C  CB    . ILE A 1 51  ? -73.586 25.638 -62.876 1.00 122.23 ? 48  ILE A CB    1 
ATOM   306  C  CG1   . ILE A 1 51  ? -73.764 27.064 -63.397 1.00 122.32 ? 48  ILE A CG1   1 
ATOM   307  C  CG2   . ILE A 1 51  ? -74.026 25.512 -61.423 1.00 122.24 ? 48  ILE A CG2   1 
ATOM   308  C  CD1   . ILE A 1 51  ? -75.200 27.396 -63.783 1.00 123.96 ? 48  ILE A CD1   1 
ATOM   309  N  N     . PRO A 1 52  ? -71.246 23.244 -61.858 1.00 121.38 ? 49  PRO A N     1 
ATOM   310  C  CA    . PRO A 1 52  ? -71.136 21.832 -61.516 1.00 122.51 ? 49  PRO A CA    1 
ATOM   311  C  C     . PRO A 1 52  ? -72.359 21.339 -60.772 1.00 124.03 ? 49  PRO A C     1 
ATOM   312  O  O     . PRO A 1 52  ? -72.954 22.100 -60.003 1.00 123.67 ? 49  PRO A O     1 
ATOM   313  C  CB    . PRO A 1 52  ? -69.934 21.780 -60.568 1.00 121.39 ? 49  PRO A CB    1 
ATOM   314  C  CG    . PRO A 1 52  ? -69.235 23.066 -60.747 1.00 119.95 ? 49  PRO A CG    1 
ATOM   315  C  CD    . PRO A 1 52  ? -70.253 24.068 -61.157 1.00 119.93 ? 49  PRO A CD    1 
ATOM   316  N  N     . PRO A 1 53  ? -72.733 20.067 -61.000 1.00 126.06 ? 50  PRO A N     1 
ATOM   317  C  CA    . PRO A 1 53  ? -73.755 19.405 -60.192 1.00 128.09 ? 50  PRO A CA    1 
ATOM   318  C  C     . PRO A 1 53  ? -73.314 19.321 -58.737 1.00 127.84 ? 50  PRO A C     1 
ATOM   319  O  O     . PRO A 1 53  ? -72.149 19.028 -58.460 1.00 126.99 ? 50  PRO A O     1 
ATOM   320  C  CB    . PRO A 1 53  ? -73.831 17.997 -60.801 1.00 130.30 ? 50  PRO A CB    1 
ATOM   321  C  CG    . PRO A 1 53  ? -72.544 17.825 -61.564 1.00 129.02 ? 50  PRO A CG    1 
ATOM   322  C  CD    . PRO A 1 53  ? -72.221 19.190 -62.070 1.00 126.78 ? 50  PRO A CD    1 
ATOM   323  N  N     . GLN A 1 54  ? -74.239 19.586 -57.824 1.00 128.89 ? 51  GLN A N     1 
ATOM   324  C  CA    . GLN A 1 54  ? -73.973 19.519 -56.386 1.00 129.22 ? 51  GLN A CA    1 
ATOM   325  C  C     . GLN A 1 54  ? -72.891 18.498 -55.986 1.00 129.43 ? 51  GLN A C     1 
ATOM   326  O  O     . GLN A 1 54  ? -71.967 18.836 -55.244 1.00 128.06 ? 51  GLN A O     1 
ATOM   327  C  CB    . GLN A 1 54  ? -75.283 19.243 -55.635 1.00 132.00 ? 51  GLN A CB    1 
ATOM   328  C  CG    . GLN A 1 54  ? -75.141 18.941 -54.143 1.00 133.40 ? 51  GLN A CG    1 
ATOM   329  C  CD    . GLN A 1 54  ? -75.155 20.187 -53.278 1.00 132.60 ? 51  GLN A CD    1 
ATOM   330  O  OE1   . GLN A 1 54  ? -76.026 21.048 -53.420 1.00 133.09 ? 51  GLN A OE1   1 
ATOM   331  N  NE2   . GLN A 1 54  ? -74.199 20.280 -52.358 1.00 131.83 ? 51  GLN A NE2   1 
ATOM   332  N  N     . SER A 1 55  ? -72.998 17.266 -56.490 1.00 131.45 ? 52  SER A N     1 
ATOM   333  C  CA    . SER A 1 55  ? -72.127 16.167 -56.048 1.00 132.59 ? 52  SER A CA    1 
ATOM   334  C  C     . SER A 1 55  ? -70.655 16.319 -56.464 1.00 130.77 ? 52  SER A C     1 
ATOM   335  O  O     . SER A 1 55  ? -69.771 15.686 -55.886 1.00 131.33 ? 52  SER A O     1 
ATOM   336  C  CB    . SER A 1 55  ? -72.682 14.817 -56.510 1.00 135.63 ? 52  SER A CB    1 
ATOM   337  O  OG    . SER A 1 55  ? -72.390 14.593 -57.877 1.00 135.18 ? 52  SER A OG    1 
ATOM   338  N  N     . ASP A 1 56  ? -70.397 17.165 -57.456 1.00 129.03 ? 53  ASP A N     1 
ATOM   339  C  CA    . ASP A 1 56  ? -69.030 17.415 -57.921 1.00 127.70 ? 53  ASP A CA    1 
ATOM   340  C  C     . ASP A 1 56  ? -68.317 18.536 -57.170 1.00 125.07 ? 53  ASP A C     1 
ATOM   341  O  O     . ASP A 1 56  ? -67.089 18.627 -57.204 1.00 124.20 ? 53  ASP A O     1 
ATOM   342  C  CB    . ASP A 1 56  ? -69.028 17.749 -59.418 1.00 127.56 ? 53  ASP A CB    1 
ATOM   343  C  CG    . ASP A 1 56  ? -68.924 16.515 -60.296 1.00 130.57 ? 53  ASP A CG    1 
ATOM   344  O  OD1   . ASP A 1 56  ? -68.372 15.486 -59.832 1.00 133.07 ? 53  ASP A OD1   1 
ATOM   345  O  OD2   . ASP A 1 56  ? -69.388 16.587 -61.457 1.00 131.38 ? 53  ASP A OD2   1 
ATOM   346  N  N     . ARG A 1 57  ? -69.089 19.382 -56.498 1.00 123.99 ? 54  ARG A N     1 
ATOM   347  C  CA    . ARG A 1 57  ? -68.581 20.660 -56.013 1.00 121.40 ? 54  ARG A CA    1 
ATOM   348  C  C     . ARG A 1 57  ? -67.572 20.595 -54.875 1.00 120.42 ? 54  ARG A C     1 
ATOM   349  O  O     . ARG A 1 57  ? -66.648 21.404 -54.828 1.00 118.67 ? 54  ARG A O     1 
ATOM   350  C  CB    . ARG A 1 57  ? -69.725 21.593 -55.648 1.00 121.40 ? 54  ARG A CB    1 
ATOM   351  C  CG    . ARG A 1 57  ? -70.469 22.124 -56.850 1.00 121.65 ? 54  ARG A CG    1 
ATOM   352  C  CD    . ARG A 1 57  ? -71.627 22.968 -56.393 1.00 122.71 ? 54  ARG A CD    1 
ATOM   353  N  NE    . ARG A 1 57  ? -72.740 22.928 -57.332 1.00 124.04 ? 54  ARG A NE    1 
ATOM   354  C  CZ    . ARG A 1 57  ? -73.925 23.475 -57.097 1.00 124.95 ? 54  ARG A CZ    1 
ATOM   355  N  NH1   . ARG A 1 57  ? -74.154 24.109 -55.952 1.00 124.68 ? 54  ARG A NH1   1 
ATOM   356  N  NH2   . ARG A 1 57  ? -74.879 23.385 -58.009 1.00 126.48 ? 54  ARG A NH2   1 
ATOM   357  N  N     . GLN A 1 58  ? -67.736 19.651 -53.957 1.00 121.61 ? 55  GLN A N     1 
ATOM   358  C  CA    . GLN A 1 58  ? -66.720 19.472 -52.927 1.00 121.01 ? 55  GLN A CA    1 
ATOM   359  C  C     . GLN A 1 58  ? -65.396 19.084 -53.590 1.00 119.89 ? 55  GLN A C     1 
ATOM   360  O  O     . GLN A 1 58  ? -64.360 19.699 -53.324 1.00 118.31 ? 55  GLN A O     1 
ATOM   361  C  CB    . GLN A 1 58  ? -67.146 18.423 -51.901 1.00 123.77 ? 55  GLN A CB    1 
ATOM   362  C  CG    . GLN A 1 58  ? -66.073 18.122 -50.846 1.00 125.24 ? 55  GLN A CG    1 
ATOM   363  C  CD    . GLN A 1 58  ? -66.371 16.877 -49.996 1.00 129.76 ? 55  GLN A CD    1 
ATOM   364  O  OE1   . GLN A 1 58  ? -67.366 16.175 -50.207 1.00 131.83 ? 55  GLN A OE1   1 
ATOM   365  N  NE2   . GLN A 1 58  ? -65.497 16.604 -49.028 1.00 130.91 ? 55  GLN A NE2   1 
ATOM   366  N  N     . LYS A 1 59  ? -65.460 18.078 -54.467 1.00 120.66 ? 56  LYS A N     1 
ATOM   367  C  CA    . LYS A 1 59  ? -64.315 17.590 -55.251 1.00 119.97 ? 56  LYS A CA    1 
ATOM   368  C  C     . LYS A 1 59  ? -63.606 18.715 -56.001 1.00 116.57 ? 56  LYS A C     1 
ATOM   369  O  O     . LYS A 1 59  ? -62.390 18.688 -56.148 1.00 116.30 ? 56  LYS A O     1 
ATOM   370  C  CB    . LYS A 1 59  ? -64.779 16.504 -56.240 1.00 122.76 ? 56  LYS A CB    1 
ATOM   371  C  CG    . LYS A 1 59  ? -63.688 15.908 -57.158 1.00 124.93 ? 56  LYS A CG    1 
ATOM   372  C  CD    . LYS A 1 59  ? -64.254 15.497 -58.538 1.00 128.28 ? 56  LYS A CD    1 
ATOM   373  C  CE    . LYS A 1 59  ? -65.044 14.179 -58.480 1.00 132.20 ? 56  LYS A CE    1 
ATOM   374  N  NZ    . LYS A 1 59  ? -65.538 13.750 -59.821 1.00 133.78 ? 56  LYS A NZ    1 
ATOM   375  N  N     . ILE A 1 60  ? -64.376 19.693 -56.472 1.00 113.98 ? 57  ILE A N     1 
ATOM   376  C  CA    . ILE A 1 60  ? -63.834 20.856 -57.182 1.00 110.84 ? 57  ILE A CA    1 
ATOM   377  C  C     . ILE A 1 60  ? -63.031 21.760 -56.248 1.00 108.37 ? 57  ILE A C     1 
ATOM   378  O  O     . ILE A 1 60  ? -61.841 21.992 -56.482 1.00 107.70 ? 57  ILE A O     1 
ATOM   379  C  CB    . ILE A 1 60  ? -64.953 21.658 -57.901 1.00 110.37 ? 57  ILE A CB    1 
ATOM   380  C  CG1   . ILE A 1 60  ? -65.493 20.846 -59.077 1.00 111.17 ? 57  ILE A CG1   1 
ATOM   381  C  CG2   . ILE A 1 60  ? -64.455 23.040 -58.345 1.00 108.59 ? 57  ILE A CG2   1 
ATOM   382  C  CD1   . ILE A 1 60  ? -66.217 21.649 -60.097 1.00 109.87 ? 57  ILE A CD1   1 
ATOM   383  N  N     . VAL A 1 61  ? -63.695 22.245 -55.196 1.00 106.65 ? 58  VAL A N     1 
ATOM   384  C  CA    . VAL A 1 61  ? -63.106 23.125 -54.176 1.00 104.34 ? 58  VAL A CA    1 
ATOM   385  C  C     . VAL A 1 61  ? -61.788 22.559 -53.605 1.00 103.85 ? 58  VAL A C     1 
ATOM   386  O  O     . VAL A 1 61  ? -60.789 23.277 -53.435 1.00 102.48 ? 58  VAL A O     1 
ATOM   387  C  CB    . VAL A 1 61  ? -64.135 23.394 -53.037 1.00 104.40 ? 58  VAL A CB    1 
ATOM   388  C  CG1   . VAL A 1 61  ? -63.530 24.213 -51.912 1.00 102.96 ? 58  VAL A CG1   1 
ATOM   389  C  CG2   . VAL A 1 61  ? -65.355 24.100 -53.584 1.00 104.21 ? 58  VAL A CG2   1 
ATOM   390  N  N     . LEU A 1 62  ? -61.801 21.261 -53.337 1.00 104.62 ? 59  LEU A N     1 
ATOM   391  C  CA    . LEU A 1 62  ? -60.648 20.566 -52.812 1.00 104.53 ? 59  LEU A CA    1 
ATOM   392  C  C     . LEU A 1 62  ? -59.489 20.586 -53.792 1.00 104.04 ? 59  LEU A C     1 
ATOM   393  O  O     . LEU A 1 62  ? -58.354 20.821 -53.397 1.00 103.64 ? 59  LEU A O     1 
ATOM   394  C  CB    . LEU A 1 62  ? -61.025 19.127 -52.497 1.00 106.87 ? 59  LEU A CB    1 
ATOM   395  C  CG    . LEU A 1 62  ? -60.024 18.371 -51.639 1.00 108.23 ? 59  LEU A CG    1 
ATOM   396  C  CD1   . LEU A 1 62  ? -60.178 18.788 -50.167 1.00 107.55 ? 59  LEU A CD1   1 
ATOM   397  C  CD2   . LEU A 1 62  ? -60.185 16.854 -51.842 1.00 110.85 ? 59  LEU A CD2   1 
ATOM   398  N  N     . GLN A 1 63  ? -59.778 20.333 -55.066 1.00 104.30 ? 60  GLN A N     1 
ATOM   399  C  CA    . GLN A 1 63  ? -58.749 20.317 -56.104 1.00 104.45 ? 60  GLN A CA    1 
ATOM   400  C  C     . GLN A 1 63  ? -58.081 21.672 -56.192 1.00 102.22 ? 60  GLN A C     1 
ATOM   401  O  O     . GLN A 1 63  ? -56.852 21.762 -56.196 1.00 102.44 ? 60  GLN A O     1 
ATOM   402  C  CB    . GLN A 1 63  ? -59.341 19.953 -57.461 1.00 105.69 ? 60  GLN A CB    1 
ATOM   403  C  CG    . GLN A 1 63  ? -59.281 18.477 -57.802 1.00 109.84 ? 60  GLN A CG    1 
ATOM   404  C  CD    . GLN A 1 63  ? -60.041 18.153 -59.081 1.00 113.55 ? 60  GLN A CD    1 
ATOM   405  O  OE1   . GLN A 1 63  ? -60.072 18.954 -60.027 1.00 114.04 ? 60  GLN A OE1   1 
ATOM   406  N  NE2   . GLN A 1 63  ? -60.663 16.974 -59.118 1.00 116.33 ? 60  GLN A NE2   1 
ATOM   407  N  N     . ALA A 1 64  ? -58.901 22.722 -56.255 1.00 100.18 ? 61  ALA A N     1 
ATOM   408  C  CA    . ALA A 1 64  ? -58.407 24.092 -56.289 1.00 98.08  ? 61  ALA A CA    1 
ATOM   409  C  C     . ALA A 1 64  ? -57.561 24.357 -55.058 1.00 96.85  ? 61  ALA A C     1 
ATOM   410  O  O     . ALA A 1 64  ? -56.386 24.705 -55.178 1.00 96.92  ? 61  ALA A O     1 
ATOM   411  C  CB    . ALA A 1 64  ? -59.550 25.077 -56.373 1.00 97.17  ? 61  ALA A CB    1 
ATOM   412  N  N     . HIS A 1 65  ? -58.142 24.158 -53.876 1.00 95.66  ? 62  HIS A N     1 
ATOM   413  C  CA    . HIS A 1 65  ? -57.406 24.415 -52.643 1.00 94.29  ? 62  HIS A CA    1 
ATOM   414  C  C     . HIS A 1 65  ? -56.056 23.690 -52.609 1.00 94.98  ? 62  HIS A C     1 
ATOM   415  O  O     . HIS A 1 65  ? -55.029 24.311 -52.343 1.00 94.64  ? 62  HIS A O     1 
ATOM   416  C  CB    . HIS A 1 65  ? -58.238 24.091 -51.400 1.00 93.87  ? 62  HIS A CB    1 
ATOM   417  C  CG    . HIS A 1 65  ? -57.459 24.148 -50.122 1.00 92.24  ? 62  HIS A CG    1 
ATOM   418  N  ND1   . HIS A 1 65  ? -57.281 25.313 -49.407 1.00 90.16  ? 62  HIS A ND1   1 
ATOM   419  C  CD2   . HIS A 1 65  ? -56.806 23.182 -49.433 1.00 91.92  ? 62  HIS A CD2   1 
ATOM   420  C  CE1   . HIS A 1 65  ? -56.560 25.061 -48.330 1.00 89.63  ? 62  HIS A CE1   1 
ATOM   421  N  NE2   . HIS A 1 65  ? -56.259 23.774 -48.323 1.00 90.90  ? 62  HIS A NE2   1 
ATOM   422  N  N     . ASN A 1 66  ? -56.060 22.398 -52.915 1.00 96.18  ? 63  ASN A N     1 
ATOM   423  C  CA    . ASN A 1 66  ? -54.861 21.578 -52.784 1.00 97.54  ? 63  ASN A CA    1 
ATOM   424  C  C     . ASN A 1 66  ? -53.699 21.981 -53.705 1.00 98.14  ? 63  ASN A C     1 
ATOM   425  O  O     . ASN A 1 66  ? -52.623 21.380 -53.652 1.00 99.74  ? 63  ASN A O     1 
ATOM   426  C  CB    . ASN A 1 66  ? -55.200 20.096 -52.989 1.00 99.62  ? 63  ASN A CB    1 
ATOM   427  C  CG    . ASN A 1 66  ? -55.815 19.441 -51.761 1.00 99.59  ? 63  ASN A CG    1 
ATOM   428  O  OD1   . ASN A 1 66  ? -55.926 20.035 -50.686 1.00 98.42  ? 63  ASN A OD1   1 
ATOM   429  N  ND2   . ASN A 1 66  ? -56.208 18.190 -51.922 1.00 101.51 ? 63  ASN A ND2   1 
ATOM   430  N  N     . LEU A 1 67  ? -53.903 22.988 -54.550 1.00 97.38  ? 64  LEU A N     1 
ATOM   431  C  CA    . LEU A 1 67  ? -52.824 23.454 -55.418 1.00 97.96  ? 64  LEU A CA    1 
ATOM   432  C  C     . LEU A 1 67  ? -51.721 24.086 -54.598 1.00 97.75  ? 64  LEU A C     1 
ATOM   433  O  O     . LEU A 1 67  ? -50.565 23.702 -54.731 1.00 99.11  ? 64  LEU A O     1 
ATOM   434  C  CB    . LEU A 1 67  ? -53.345 24.417 -56.470 1.00 97.38  ? 64  LEU A CB    1 
ATOM   435  C  CG    . LEU A 1 67  ? -54.183 23.688 -57.518 1.00 98.20  ? 64  LEU A CG    1 
ATOM   436  C  CD1   . LEU A 1 67  ? -55.081 24.656 -58.274 1.00 97.17  ? 64  LEU A CD1   1 
ATOM   437  C  CD2   . LEU A 1 67  ? -53.290 22.889 -58.464 1.00 100.58 ? 64  LEU A CD2   1 
ATOM   438  N  N     . ALA A 1 68  ? -52.087 25.034 -53.735 1.00 96.48  ? 65  ALA A N     1 
ATOM   439  C  CA    . ALA A 1 68  ? -51.129 25.672 -52.823 1.00 96.26  ? 65  ALA A CA    1 
ATOM   440  C  C     . ALA A 1 68  ? -51.659 25.804 -51.383 1.00 95.24  ? 65  ALA A C     1 
ATOM   441  O  O     . ALA A 1 68  ? -51.077 26.504 -50.545 1.00 94.69  ? 65  ALA A O     1 
ATOM   442  C  CB    . ALA A 1 68  ? -50.696 27.021 -53.372 1.00 96.00  ? 65  ALA A CB    1 
ATOM   443  N  N     . HIS A 1 69  ? -52.750 25.102 -51.090 1.00 95.43  ? 66  HIS A N     1 
ATOM   444  C  CA    . HIS A 1 69  ? -53.330 25.095 -49.745 1.00 94.85  ? 66  HIS A CA    1 
ATOM   445  C  C     . HIS A 1 69  ? -53.627 26.517 -49.347 1.00 93.45  ? 66  HIS A C     1 
ATOM   446  O  O     . HIS A 1 69  ? -53.226 26.990 -48.280 1.00 93.23  ? 66  HIS A O     1 
ATOM   447  C  CB    . HIS A 1 69  ? -52.409 24.396 -48.739 1.00 95.60  ? 66  HIS A CB    1 
ATOM   448  C  CG    . HIS A 1 69  ? -52.496 22.904 -48.798 1.00 97.10  ? 66  HIS A CG    1 
ATOM   449  N  ND1   . HIS A 1 69  ? -53.174 22.163 -47.859 1.00 97.47  ? 66  HIS A ND1   1 
ATOM   450  C  CD2   . HIS A 1 69  ? -52.021 22.021 -49.707 1.00 98.52  ? 66  HIS A CD2   1 
ATOM   451  C  CE1   . HIS A 1 69  ? -53.100 20.884 -48.179 1.00 100.24 ? 66  HIS A CE1   1 
ATOM   452  N  NE2   . HIS A 1 69  ? -52.404 20.770 -49.295 1.00 100.47 ? 66  HIS A NE2   1 
ATOM   453  N  N     . THR A 1 70  ? -54.340 27.184 -50.246 1.00 92.88  ? 67  THR A N     1 
ATOM   454  C  CA    . THR A 1 70  ? -54.629 28.593 -50.126 1.00 91.93  ? 67  THR A CA    1 
ATOM   455  C  C     . THR A 1 70  ? -55.876 28.864 -49.284 1.00 91.33  ? 67  THR A C     1 
ATOM   456  O  O     . THR A 1 70  ? -56.732 27.989 -49.120 1.00 91.45  ? 67  THR A O     1 
ATOM   457  C  CB    . THR A 1 70  ? -54.751 29.217 -51.511 1.00 92.35  ? 67  THR A CB    1 
ATOM   458  O  OG1   . THR A 1 70  ? -55.664 28.453 -52.313 1.00 91.75  ? 67  THR A OG1   1 
ATOM   459  C  CG2   . THR A 1 70  ? -53.379 29.228 -52.167 1.00 93.65  ? 67  THR A CG2   1 
ATOM   460  N  N     . GLY A 1 71  ? -55.951 30.077 -48.737 1.00 90.80  ? 68  GLY A N     1 
ATOM   461  C  CA    . GLY A 1 71  ? -57.067 30.493 -47.895 1.00 90.73  ? 68  GLY A CA    1 
ATOM   462  C  C     . GLY A 1 71  ? -58.335 30.757 -48.688 1.00 91.09  ? 68  GLY A C     1 
ATOM   463  O  O     . GLY A 1 71  ? -58.447 30.374 -49.859 1.00 91.06  ? 68  GLY A O     1 
ATOM   464  N  N     . ARG A 1 72  ? -59.293 31.417 -48.041 1.00 91.34  ? 69  ARG A N     1 
ATOM   465  C  CA    . ARG A 1 72  ? -60.596 31.707 -48.642 1.00 91.63  ? 69  ARG A CA    1 
ATOM   466  C  C     . ARG A 1 72  ? -60.462 32.413 -49.996 1.00 91.77  ? 69  ARG A C     1 
ATOM   467  O  O     . ARG A 1 72  ? -60.811 31.849 -51.037 1.00 91.97  ? 69  ARG A O     1 
ATOM   468  C  CB    . ARG A 1 72  ? -61.446 32.544 -47.675 1.00 92.21  ? 69  ARG A CB    1 
ATOM   469  C  CG    . ARG A 1 72  ? -62.928 32.598 -48.004 1.00 92.57  ? 69  ARG A CG    1 
ATOM   470  C  CD    . ARG A 1 72  ? -63.453 34.004 -47.868 1.00 92.55  ? 69  ARG A CD    1 
ATOM   471  N  NE    . ARG A 1 72  ? -63.045 34.604 -46.603 1.00 93.72  ? 69  ARG A NE    1 
ATOM   472  C  CZ    . ARG A 1 72  ? -62.826 35.907 -46.417 1.00 94.48  ? 69  ARG A CZ    1 
ATOM   473  N  NH1   . ARG A 1 72  ? -62.966 36.765 -47.427 1.00 94.77  ? 69  ARG A NH1   1 
ATOM   474  N  NH2   . ARG A 1 72  ? -62.457 36.353 -45.220 1.00 93.53  ? 69  ARG A NH2   1 
ATOM   475  N  N     . GLU A 1 73  ? -59.935 33.632 -49.985 1.00 91.79  ? 70  GLU A N     1 
ATOM   476  C  CA    . GLU A 1 73  ? -59.928 34.430 -51.193 1.00 92.53  ? 70  GLU A CA    1 
ATOM   477  C  C     . GLU A 1 73  ? -59.073 33.821 -52.306 1.00 92.50  ? 70  GLU A C     1 
ATOM   478  O  O     . GLU A 1 73  ? -59.536 33.665 -53.440 1.00 92.82  ? 70  GLU A O     1 
ATOM   479  C  CB    . GLU A 1 73  ? -59.558 35.871 -50.875 1.00 93.31  ? 70  GLU A CB    1 
ATOM   480  C  CG    . GLU A 1 73  ? -60.681 36.596 -50.148 1.00 94.58  ? 70  GLU A CG    1 
ATOM   481  C  CD    . GLU A 1 73  ? -62.016 36.554 -50.908 1.00 95.69  ? 70  GLU A CD    1 
ATOM   482  O  OE1   . GLU A 1 73  ? -62.040 36.949 -52.100 1.00 95.84  ? 70  GLU A OE1   1 
ATOM   483  O  OE2   . GLU A 1 73  ? -63.038 36.141 -50.307 1.00 95.42  ? 70  GLU A OE2   1 
ATOM   484  N  N     . ALA A 1 74  ? -57.842 33.441 -51.973 1.00 92.26  ? 71  ALA A N     1 
ATOM   485  C  CA    . ALA A 1 74  ? -56.969 32.767 -52.938 1.00 92.45  ? 71  ALA A CA    1 
ATOM   486  C  C     . ALA A 1 74  ? -57.632 31.530 -53.600 1.00 92.44  ? 71  ALA A C     1 
ATOM   487  O  O     . ALA A 1 74  ? -57.571 31.374 -54.816 1.00 93.26  ? 71  ALA A O     1 
ATOM   488  C  CB    . ALA A 1 74  ? -55.626 32.416 -52.298 1.00 91.89  ? 71  ALA A CB    1 
ATOM   489  N  N     . THR A 1 75  ? -58.283 30.673 -52.816 1.00 91.81  ? 72  THR A N     1 
ATOM   490  C  CA    . THR A 1 75  ? -58.954 29.506 -53.384 1.00 92.11  ? 72  THR A CA    1 
ATOM   491  C  C     . THR A 1 75  ? -60.097 29.899 -54.307 1.00 92.41  ? 72  THR A C     1 
ATOM   492  O  O     . THR A 1 75  ? -60.161 29.435 -55.451 1.00 93.12  ? 72  THR A O     1 
ATOM   493  C  CB    . THR A 1 75  ? -59.508 28.570 -52.311 1.00 92.07  ? 72  THR A CB    1 
ATOM   494  O  OG1   . THR A 1 75  ? -58.482 28.298 -51.351 1.00 92.78  ? 72  THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 75  ? -59.974 27.257 -52.938 1.00 92.66  ? 72  THR A CG2   1 
ATOM   496  N  N     . LEU A 1 76  ? -60.992 30.752 -53.808 1.00 92.06  ? 73  LEU A N     1 
ATOM   497  C  CA    . LEU A 1 76  ? -62.174 31.158 -54.566 1.00 92.36  ? 73  LEU A CA    1 
ATOM   498  C  C     . LEU A 1 76  ? -61.801 31.728 -55.935 1.00 92.90  ? 73  LEU A C     1 
ATOM   499  O  O     . LEU A 1 76  ? -62.465 31.456 -56.943 1.00 93.33  ? 73  LEU A O     1 
ATOM   500  C  CB    . LEU A 1 76  ? -62.995 32.180 -53.785 1.00 92.45  ? 73  LEU A CB    1 
ATOM   501  C  CG    . LEU A 1 76  ? -64.012 32.864 -54.694 1.00 93.40  ? 73  LEU A CG    1 
ATOM   502  C  CD1   . LEU A 1 76  ? -65.265 32.026 -54.820 1.00 94.25  ? 73  LEU A CD1   1 
ATOM   503  C  CD2   . LEU A 1 76  ? -64.339 34.215 -54.174 1.00 94.43  ? 73  LEU A CD2   1 
ATOM   504  N  N     . LEU A 1 77  ? -60.721 32.506 -55.948 1.00 92.85  ? 74  LEU A N     1 
ATOM   505  C  CA    . LEU A 1 77  ? -60.246 33.184 -57.145 1.00 93.68  ? 74  LEU A CA    1 
ATOM   506  C  C     . LEU A 1 77  ? -59.829 32.251 -58.270 1.00 94.10  ? 74  LEU A C     1 
ATOM   507  O  O     . LEU A 1 77  ? -59.948 32.616 -59.443 1.00 95.21  ? 74  LEU A O     1 
ATOM   508  C  CB    . LEU A 1 77  ? -59.107 34.130 -56.797 1.00 93.85  ? 74  LEU A CB    1 
ATOM   509  C  CG    . LEU A 1 77  ? -59.592 35.560 -56.631 1.00 94.60  ? 74  LEU A CG    1 
ATOM   510  C  CD1   . LEU A 1 77  ? -58.541 36.402 -55.949 1.00 94.33  ? 74  LEU A CD1   1 
ATOM   511  C  CD2   . LEU A 1 77  ? -59.959 36.128 -57.998 1.00 96.92  ? 74  LEU A CD2   1 
ATOM   512  N  N     . LYS A 1 78  ? -59.336 31.065 -57.913 1.00 93.34  ? 75  LYS A N     1 
ATOM   513  C  CA    . LYS A 1 78  ? -59.059 30.039 -58.902 1.00 94.13  ? 75  LYS A CA    1 
ATOM   514  C  C     . LYS A 1 78  ? -60.385 29.522 -59.442 1.00 94.62  ? 75  LYS A C     1 
ATOM   515  O  O     . LYS A 1 78  ? -60.633 29.556 -60.651 1.00 95.71  ? 75  LYS A O     1 
ATOM   516  C  CB    . LYS A 1 78  ? -58.236 28.898 -58.305 1.00 93.55  ? 75  LYS A CB    1 
ATOM   517  C  CG    . LYS A 1 78  ? -56.737 29.164 -58.226 1.00 94.20  ? 75  LYS A CG    1 
ATOM   518  C  CD    . LYS A 1 78  ? -56.109 29.339 -59.601 1.00 96.55  ? 75  LYS A CD    1 
ATOM   519  C  CE    . LYS A 1 78  ? -54.632 28.975 -59.570 1.00 97.75  ? 75  LYS A CE    1 
ATOM   520  N  NZ    . LYS A 1 78  ? -54.047 28.716 -60.933 1.00 99.98  ? 75  LYS A NZ    1 
ATOM   521  N  N     . ILE A 1 79  ? -61.253 29.085 -58.535 1.00 94.11  ? 76  ILE A N     1 
ATOM   522  C  CA    . ILE A 1 79  ? -62.522 28.491 -58.923 1.00 94.80  ? 76  ILE A CA    1 
ATOM   523  C  C     . ILE A 1 79  ? -63.322 29.462 -59.792 1.00 96.28  ? 76  ILE A C     1 
ATOM   524  O  O     . ILE A 1 79  ? -63.898 29.059 -60.808 1.00 97.49  ? 76  ILE A O     1 
ATOM   525  C  CB    . ILE A 1 79  ? -63.339 28.018 -57.700 1.00 93.96  ? 76  ILE A CB    1 
ATOM   526  C  CG1   . ILE A 1 79  ? -62.496 27.096 -56.826 1.00 92.37  ? 76  ILE A CG1   1 
ATOM   527  C  CG2   . ILE A 1 79  ? -64.557 27.240 -58.148 1.00 94.98  ? 76  ILE A CG2   1 
ATOM   528  C  CD1   . ILE A 1 79  ? -62.894 27.089 -55.391 1.00 89.61  ? 76  ILE A CD1   1 
ATOM   529  N  N     . ALA A 1 80  ? -63.326 30.739 -59.413 1.00 96.91  ? 77  ALA A N     1 
ATOM   530  C  CA    . ALA A 1 80  ? -64.054 31.768 -60.160 1.00 98.70  ? 77  ALA A CA    1 
ATOM   531  C  C     . ALA A 1 80  ? -63.757 31.714 -61.647 1.00 100.37 ? 77  ALA A C     1 
ATOM   532  O  O     . ALA A 1 80  ? -64.651 31.933 -62.461 1.00 101.51 ? 77  ALA A O     1 
ATOM   533  C  CB    . ALA A 1 80  ? -63.734 33.138 -59.628 1.00 98.98  ? 77  ALA A CB    1 
ATOM   534  N  N     . ASN A 1 81  ? -62.504 31.416 -61.991 1.00 101.02 ? 78  ASN A N     1 
ATOM   535  C  CA    . ASN A 1 81  ? -62.082 31.340 -63.387 1.00 103.26 ? 78  ASN A CA    1 
ATOM   536  C  C     . ASN A 1 81  ? -62.982 30.446 -64.230 1.00 104.31 ? 78  ASN A C     1 
ATOM   537  O  O     . ASN A 1 81  ? -63.488 30.871 -65.268 1.00 105.79 ? 78  ASN A O     1 
ATOM   538  C  CB    . ASN A 1 81  ? -60.633 30.871 -63.488 1.00 103.27 ? 78  ASN A CB    1 
ATOM   539  C  CG    . ASN A 1 81  ? -59.668 31.834 -62.844 1.00 103.63 ? 78  ASN A CG    1 
ATOM   540  O  OD1   . ASN A 1 81  ? -60.043 32.938 -62.447 1.00 104.94 ? 78  ASN A OD1   1 
ATOM   541  N  ND2   . ASN A 1 81  ? -58.411 31.426 -62.738 1.00 104.31 ? 78  ASN A ND2   1 
ATOM   542  N  N     . LEU A 1 82  ? -63.196 29.220 -63.756 1.00 104.08 ? 79  LEU A N     1 
ATOM   543  C  CA    . LEU A 1 82  ? -63.942 28.211 -64.501 1.00 105.17 ? 79  LEU A CA    1 
ATOM   544  C  C     . LEU A 1 82  ? -65.410 28.106 -64.129 1.00 105.58 ? 79  LEU A C     1 
ATOM   545  O  O     . LEU A 1 82  ? -66.258 27.977 -65.020 1.00 106.71 ? 79  LEU A O     1 
ATOM   546  C  CB    . LEU A 1 82  ? -63.300 26.837 -64.340 1.00 104.86 ? 79  LEU A CB    1 
ATOM   547  C  CG    . LEU A 1 82  ? -61.910 26.620 -64.919 1.00 105.15 ? 79  LEU A CG    1 
ATOM   548  C  CD1   . LEU A 1 82  ? -61.720 25.140 -65.194 1.00 105.70 ? 79  LEU A CD1   1 
ATOM   549  C  CD2   . LEU A 1 82  ? -61.697 27.439 -66.179 1.00 105.84 ? 79  LEU A CD2   1 
ATOM   550  N  N     . TYR A 1 83  ? -65.706 28.151 -62.829 1.00 105.09 ? 80  TYR A N     1 
ATOM   551  C  CA    . TYR A 1 83  ? -67.046 27.826 -62.350 1.00 106.02 ? 80  TYR A CA    1 
ATOM   552  C  C     . TYR A 1 83  ? -67.814 28.941 -61.669 1.00 106.46 ? 80  TYR A C     1 
ATOM   553  O  O     . TYR A 1 83  ? -67.260 29.985 -61.323 1.00 106.16 ? 80  TYR A O     1 
ATOM   554  C  CB    . TYR A 1 83  ? -66.993 26.638 -61.404 1.00 105.51 ? 80  TYR A CB    1 
ATOM   555  C  CG    . TYR A 1 83  ? -66.224 25.467 -61.942 1.00 106.83 ? 80  TYR A CG    1 
ATOM   556  C  CD1   . TYR A 1 83  ? -66.808 24.563 -62.838 1.00 108.36 ? 80  TYR A CD1   1 
ATOM   557  C  CD2   . TYR A 1 83  ? -64.909 25.248 -61.544 1.00 107.10 ? 80  TYR A CD2   1 
ATOM   558  C  CE1   . TYR A 1 83  ? -66.090 23.469 -63.325 1.00 109.65 ? 80  TYR A CE1   1 
ATOM   559  C  CE2   . TYR A 1 83  ? -64.184 24.166 -62.020 1.00 108.36 ? 80  TYR A CE2   1 
ATOM   560  C  CZ    . TYR A 1 83  ? -64.773 23.281 -62.906 1.00 109.75 ? 80  TYR A CZ    1 
ATOM   561  O  OH    . TYR A 1 83  ? -64.023 22.218 -63.356 1.00 111.39 ? 80  TYR A OH    1 
ATOM   562  N  N     . TRP A 1 84  ? -69.112 28.692 -61.509 1.00 107.89 ? 81  TRP A N     1 
ATOM   563  C  CA    . TRP A 1 84  ? -69.985 29.470 -60.639 1.00 108.97 ? 81  TRP A CA    1 
ATOM   564  C  C     . TRP A 1 84  ? -71.066 28.571 -60.042 1.00 109.88 ? 81  TRP A C     1 
ATOM   565  O  O     . TRP A 1 84  ? -71.595 27.694 -60.731 1.00 110.99 ? 81  TRP A O     1 
ATOM   566  C  CB    . TRP A 1 84  ? -70.659 30.620 -61.393 1.00 110.37 ? 81  TRP A CB    1 
ATOM   567  C  CG    . TRP A 1 84  ? -71.503 31.463 -60.473 1.00 112.08 ? 81  TRP A CG    1 
ATOM   568  C  CD1   . TRP A 1 84  ? -71.103 32.579 -59.796 1.00 112.84 ? 81  TRP A CD1   1 
ATOM   569  C  CD2   . TRP A 1 84  ? -72.873 31.237 -60.097 1.00 114.13 ? 81  TRP A CD2   1 
ATOM   570  N  NE1   . TRP A 1 84  ? -72.136 33.069 -59.031 1.00 114.56 ? 81  TRP A NE1   1 
ATOM   571  C  CE2   . TRP A 1 84  ? -73.234 32.265 -59.196 1.00 115.31 ? 81  TRP A CE2   1 
ATOM   572  C  CE3   . TRP A 1 84  ? -73.831 30.274 -60.441 1.00 115.41 ? 81  TRP A CE3   1 
ATOM   573  C  CZ2   . TRP A 1 84  ? -74.516 32.358 -58.629 1.00 117.15 ? 81  TRP A CZ2   1 
ATOM   574  C  CZ3   . TRP A 1 84  ? -75.108 30.364 -59.872 1.00 117.56 ? 81  TRP A CZ3   1 
ATOM   575  C  CH2   . TRP A 1 84  ? -75.435 31.401 -58.977 1.00 118.05 ? 81  TRP A CH2   1 
ATOM   576  N  N     . TRP A 1 85  ? -71.377 28.787 -58.764 1.00 109.91 ? 82  TRP A N     1 
ATOM   577  C  CA    . TRP A 1 85  ? -72.613 28.289 -58.160 1.00 111.53 ? 82  TRP A CA    1 
ATOM   578  C  C     . TRP A 1 85  ? -73.045 29.202 -56.999 1.00 112.21 ? 82  TRP A C     1 
ATOM   579  O  O     . TRP A 1 85  ? -72.341 30.170 -56.689 1.00 111.46 ? 82  TRP A O     1 
ATOM   580  C  CB    . TRP A 1 85  ? -72.525 26.802 -57.773 1.00 111.72 ? 82  TRP A CB    1 
ATOM   581  C  CG    . TRP A 1 85  ? -71.518 26.468 -56.737 1.00 111.27 ? 82  TRP A CG    1 
ATOM   582  C  CD1   . TRP A 1 85  ? -71.666 26.568 -55.379 1.00 112.58 ? 82  TRP A CD1   1 
ATOM   583  C  CD2   . TRP A 1 85  ? -70.209 25.942 -56.960 1.00 110.26 ? 82  TRP A CD2   1 
ATOM   584  N  NE1   . TRP A 1 85  ? -70.517 26.150 -54.745 1.00 111.48 ? 82  TRP A NE1   1 
ATOM   585  C  CE2   . TRP A 1 85  ? -69.609 25.759 -55.695 1.00 110.11 ? 82  TRP A CE2   1 
ATOM   586  C  CE3   . TRP A 1 85  ? -69.480 25.613 -58.108 1.00 109.51 ? 82  TRP A CE3   1 
ATOM   587  C  CZ2   . TRP A 1 85  ? -68.315 25.266 -55.550 1.00 108.61 ? 82  TRP A CZ2   1 
ATOM   588  C  CZ3   . TRP A 1 85  ? -68.197 25.124 -57.962 1.00 108.27 ? 82  TRP A CZ3   1 
ATOM   589  C  CH2   . TRP A 1 85  ? -67.627 24.956 -56.694 1.00 108.04 ? 82  TRP A CH2   1 
ATOM   590  N  N     . PRO A 1 86  ? -74.218 28.937 -56.378 1.00 113.97 ? 83  PRO A N     1 
ATOM   591  C  CA    . PRO A 1 86  ? -74.605 29.874 -55.333 1.00 114.90 ? 83  PRO A CA    1 
ATOM   592  C  C     . PRO A 1 86  ? -73.851 29.617 -54.037 1.00 114.08 ? 83  PRO A C     1 
ATOM   593  O  O     . PRO A 1 86  ? -73.635 28.462 -53.669 1.00 113.81 ? 83  PRO A O     1 
ATOM   594  C  CB    . PRO A 1 86  ? -76.106 29.615 -55.167 1.00 117.46 ? 83  PRO A CB    1 
ATOM   595  C  CG    . PRO A 1 86  ? -76.308 28.216 -55.582 1.00 117.40 ? 83  PRO A CG    1 
ATOM   596  C  CD    . PRO A 1 86  ? -75.242 27.893 -56.592 1.00 115.50 ? 83  PRO A CD    1 
ATOM   597  N  N     . ASN A 1 87  ? -73.442 30.697 -53.374 1.00 114.01 ? 84  ASN A N     1 
ATOM   598  C  CA    . ASN A 1 87  ? -72.739 30.630 -52.084 1.00 113.57 ? 84  ASN A CA    1 
ATOM   599  C  C     . ASN A 1 87  ? -71.380 29.923 -52.134 1.00 111.40 ? 84  ASN A C     1 
ATOM   600  O  O     . ASN A 1 87  ? -71.004 29.194 -51.214 1.00 111.41 ? 84  ASN A O     1 
ATOM   601  C  CB    . ASN A 1 87  ? -73.642 30.013 -51.013 1.00 115.50 ? 84  ASN A CB    1 
ATOM   602  C  CG    . ASN A 1 87  ? -74.877 30.838 -50.763 1.00 118.75 ? 84  ASN A CG    1 
ATOM   603  O  OD1   . ASN A 1 87  ? -74.787 32.042 -50.512 1.00 120.54 ? 84  ASN A OD1   1 
ATOM   604  N  ND2   . ASN A 1 87  ? -76.045 30.200 -50.831 1.00 121.06 ? 84  ASN A ND2   1 
ATOM   605  N  N     . MET A 1 88  ? -70.646 30.162 -53.213 1.00 109.91 ? 85  MET A N     1 
ATOM   606  C  CA    . MET A 1 88  ? -69.331 29.588 -53.418 1.00 108.04 ? 85  MET A CA    1 
ATOM   607  C  C     . MET A 1 88  ? -68.456 29.559 -52.164 1.00 106.77 ? 85  MET A C     1 
ATOM   608  O  O     . MET A 1 88  ? -67.926 28.516 -51.778 1.00 106.51 ? 85  MET A O     1 
ATOM   609  C  CB    . MET A 1 88  ? -68.617 30.385 -54.488 1.00 107.58 ? 85  MET A CB    1 
ATOM   610  C  CG    . MET A 1 88  ? -69.433 30.583 -55.725 1.00 110.17 ? 85  MET A CG    1 
ATOM   611  S  SD    . MET A 1 88  ? -68.399 30.366 -57.180 1.00 113.34 ? 85  MET A SD    1 
ATOM   612  C  CE    . MET A 1 88  ? -67.966 28.635 -57.045 1.00 112.01 ? 85  MET A CE    1 
ATOM   613  N  N     . ARG A 1 89  ? -68.294 30.708 -51.526 1.00 106.03 ? 86  ARG A N     1 
ATOM   614  C  CA    . ARG A 1 89  ? -67.412 30.783 -50.379 1.00 104.30 ? 86  ARG A CA    1 
ATOM   615  C  C     . ARG A 1 89  ? -67.844 29.852 -49.258 1.00 104.84 ? 86  ARG A C     1 
ATOM   616  O  O     . ARG A 1 89  ? -67.020 29.095 -48.759 1.00 104.05 ? 86  ARG A O     1 
ATOM   617  C  CB    . ARG A 1 89  ? -67.284 32.213 -49.899 1.00 104.41 ? 86  ARG A CB    1 
ATOM   618  C  CG    . ARG A 1 89  ? -66.608 33.096 -50.899 1.00 102.60 ? 86  ARG A CG    1 
ATOM   619  C  CD    . ARG A 1 89  ? -66.581 34.476 -50.345 1.00 102.70 ? 86  ARG A CD    1 
ATOM   620  N  NE    . ARG A 1 89  ? -65.635 35.349 -51.030 1.00 101.39 ? 86  ARG A NE    1 
ATOM   621  C  CZ    . ARG A 1 89  ? -65.876 35.950 -52.187 1.00 101.12 ? 86  ARG A CZ    1 
ATOM   622  N  NH1   . ARG A 1 89  ? -67.022 35.745 -52.820 1.00 101.96 ? 86  ARG A NH1   1 
ATOM   623  N  NH2   . ARG A 1 89  ? -64.961 36.743 -52.715 1.00 100.57 ? 86  ARG A NH2   1 
ATOM   624  N  N     . LYS A 1 90  ? -69.130 29.872 -48.892 1.00 106.31 ? 87  LYS A N     1 
ATOM   625  C  CA    . LYS A 1 90  ? -69.642 28.972 -47.838 1.00 107.46 ? 87  LYS A CA    1 
ATOM   626  C  C     . LYS A 1 90  ? -69.020 27.573 -47.972 1.00 106.77 ? 87  LYS A C     1 
ATOM   627  O  O     . LYS A 1 90  ? -68.510 27.025 -46.993 1.00 106.89 ? 87  LYS A O     1 
ATOM   628  C  CB    . LYS A 1 90  ? -71.185 28.919 -47.805 1.00 109.51 ? 87  LYS A CB    1 
ATOM   629  N  N     . ASP A 1 91  ? -69.026 27.033 -49.194 1.00 106.10 ? 88  ASP A N     1 
ATOM   630  C  CA    . ASP A 1 91  ? -68.384 25.757 -49.506 1.00 105.78 ? 88  ASP A CA    1 
ATOM   631  C  C     . ASP A 1 91  ? -66.877 25.763 -49.311 1.00 103.92 ? 88  ASP A C     1 
ATOM   632  O  O     . ASP A 1 91  ? -66.334 24.818 -48.743 1.00 104.73 ? 88  ASP A O     1 
ATOM   633  C  CB    . ASP A 1 91  ? -68.650 25.364 -50.948 1.00 105.98 ? 88  ASP A CB    1 
ATOM   634  C  CG    . ASP A 1 91  ? -69.971 24.701 -51.130 1.00 108.85 ? 88  ASP A CG    1 
ATOM   635  O  OD1   . ASP A 1 91  ? -70.198 23.653 -50.486 1.00 110.78 ? 88  ASP A OD1   1 
ATOM   636  O  OD2   . ASP A 1 91  ? -70.770 25.224 -51.939 1.00 110.87 ? 88  ASP A OD2   1 
ATOM   637  N  N     . VAL A 1 92  ? -66.200 26.795 -49.818 1.00 101.78 ? 89  VAL A N     1 
ATOM   638  C  CA    . VAL A 1 92  ? -64.750 26.914 -49.674 1.00 99.73  ? 89  VAL A CA    1 
ATOM   639  C  C     . VAL A 1 92  ? -64.366 26.869 -48.199 1.00 99.88  ? 89  VAL A C     1 
ATOM   640  O  O     . VAL A 1 92  ? -63.492 26.090 -47.796 1.00 99.83  ? 89  VAL A O     1 
ATOM   641  C  CB    . VAL A 1 92  ? -64.230 28.206 -50.316 1.00 98.34  ? 89  VAL A CB    1 
ATOM   642  C  CG1   . VAL A 1 92  ? -62.856 28.564 -49.804 1.00 96.57  ? 89  VAL A CG1   1 
ATOM   643  C  CG2   . VAL A 1 92  ? -64.195 28.054 -51.798 1.00 98.30  ? 89  VAL A CG2   1 
ATOM   644  N  N     . VAL A 1 93  ? -65.049 27.684 -47.397 1.00 100.22 ? 90  VAL A N     1 
ATOM   645  C  CA    . VAL A 1 93  ? -64.771 27.778 -45.971 1.00 100.33 ? 90  VAL A CA    1 
ATOM   646  C  C     . VAL A 1 93  ? -65.010 26.440 -45.280 1.00 101.96 ? 90  VAL A C     1 
ATOM   647  O  O     . VAL A 1 93  ? -64.296 26.091 -44.340 1.00 101.94 ? 90  VAL A O     1 
ATOM   648  C  CB    . VAL A 1 93  ? -65.600 28.875 -45.288 1.00 100.93 ? 90  VAL A CB    1 
ATOM   649  C  CG1   . VAL A 1 93  ? -64.904 29.329 -44.017 1.00 100.86 ? 90  VAL A CG1   1 
ATOM   650  C  CG2   . VAL A 1 93  ? -65.790 30.059 -46.212 1.00 100.19 ? 90  VAL A CG2   1 
ATOM   651  N  N     . LYS A 1 94  ? -66.002 25.687 -45.761 1.00 103.66 ? 91  LYS A N     1 
ATOM   652  C  CA    . LYS A 1 94  ? -66.284 24.351 -45.231 1.00 105.98 ? 91  LYS A CA    1 
ATOM   653  C  C     . LYS A 1 94  ? -65.053 23.455 -45.380 1.00 105.86 ? 91  LYS A C     1 
ATOM   654  O  O     . LYS A 1 94  ? -64.763 22.628 -44.510 1.00 107.22 ? 91  LYS A O     1 
ATOM   655  C  CB    . LYS A 1 94  ? -67.514 23.722 -45.908 1.00 107.37 ? 91  LYS A CB    1 
ATOM   656  N  N     . GLN A 1 95  ? -64.321 23.649 -46.472 1.00 104.74 ? 92  GLN A N     1 
ATOM   657  C  CA    . GLN A 1 95  ? -63.107 22.890 -46.725 1.00 105.28 ? 92  GLN A CA    1 
ATOM   658  C  C     . GLN A 1 95  ? -61.938 23.356 -45.877 1.00 104.34 ? 92  GLN A C     1 
ATOM   659  O  O     . GLN A 1 95  ? -61.228 22.536 -45.285 1.00 105.43 ? 92  GLN A O     1 
ATOM   660  C  CB    . GLN A 1 95  ? -62.728 22.945 -48.200 1.00 104.54 ? 92  GLN A CB    1 
ATOM   661  C  CG    . GLN A 1 95  ? -63.585 22.051 -49.062 1.00 108.16 ? 92  GLN A CG    1 
ATOM   662  C  CD    . GLN A 1 95  ? -63.519 20.600 -48.633 1.00 112.80 ? 92  GLN A CD    1 
ATOM   663  O  OE1   . GLN A 1 95  ? -62.438 20.081 -48.321 1.00 113.85 ? 92  GLN A OE1   1 
ATOM   664  N  NE2   . GLN A 1 95  ? -64.678 19.934 -48.608 1.00 114.83 ? 92  GLN A NE2   1 
ATOM   665  N  N     . LEU A 1 96  ? -61.731 24.668 -45.814 1.00 102.70 ? 93  LEU A N     1 
ATOM   666  C  CA    . LEU A 1 96  ? -60.615 25.201 -45.042 1.00 101.78 ? 93  LEU A CA    1 
ATOM   667  C  C     . LEU A 1 96  ? -60.641 24.716 -43.593 1.00 103.26 ? 93  LEU A C     1 
ATOM   668  O  O     . LEU A 1 96  ? -59.596 24.666 -42.931 1.00 103.45 ? 93  LEU A O     1 
ATOM   669  C  CB    . LEU A 1 96  ? -60.595 26.726 -45.081 1.00 100.38 ? 93  LEU A CB    1 
ATOM   670  C  CG    . LEU A 1 96  ? -60.586 27.424 -46.436 1.00 98.40  ? 93  LEU A CG    1 
ATOM   671  C  CD1   . LEU A 1 96  ? -60.266 28.868 -46.183 1.00 97.90  ? 93  LEU A CD1   1 
ATOM   672  C  CD2   . LEU A 1 96  ? -59.568 26.829 -47.367 1.00 97.07  ? 93  LEU A CD2   1 
ATOM   673  N  N     . GLY A 1 97  ? -61.834 24.359 -43.115 1.00 104.71 ? 94  GLY A N     1 
ATOM   674  C  CA    . GLY A 1 97  ? -62.016 23.861 -41.755 1.00 106.29 ? 94  GLY A CA    1 
ATOM   675  C  C     . GLY A 1 97  ? -61.577 22.421 -41.609 1.00 107.73 ? 94  GLY A C     1 
ATOM   676  O  O     . GLY A 1 97  ? -61.223 21.989 -40.517 1.00 108.89 ? 94  GLY A O     1 
ATOM   677  N  N     . ARG A 1 98  ? -61.593 21.687 -42.719 1.00 107.93 ? 95  ARG A N     1 
ATOM   678  C  CA    . ARG A 1 98  ? -61.294 20.251 -42.728 1.00 110.04 ? 95  ARG A CA    1 
ATOM   679  C  C     . ARG A 1 98  ? -59.900 19.907 -43.238 1.00 108.94 ? 95  ARG A C     1 
ATOM   680  O  O     . ARG A 1 98  ? -59.512 18.732 -43.217 1.00 111.06 ? 95  ARG A O     1 
ATOM   681  C  CB    . ARG A 1 98  ? -62.312 19.489 -43.577 1.00 111.65 ? 95  ARG A CB    1 
ATOM   682  C  CG    . ARG A 1 98  ? -63.723 19.613 -43.100 1.00 114.64 ? 95  ARG A CG    1 
ATOM   683  C  CD    . ARG A 1 98  ? -64.587 18.565 -43.759 1.00 120.17 ? 95  ARG A CD    1 
ATOM   684  N  NE    . ARG A 1 98  ? -65.758 18.284 -42.933 1.00 125.61 ? 95  ARG A NE    1 
ATOM   685  C  CZ    . ARG A 1 98  ? -66.927 18.914 -43.035 1.00 127.26 ? 95  ARG A CZ    1 
ATOM   686  N  NH1   . ARG A 1 98  ? -67.107 19.871 -43.945 1.00 125.13 ? 95  ARG A NH1   1 
ATOM   687  N  NH2   . ARG A 1 98  ? -67.925 18.578 -42.225 1.00 131.07 ? 95  ARG A NH2   1 
ATOM   688  N  N     . CYS A 1 99  ? -59.156 20.903 -43.721 1.00 105.85 ? 96  CYS A N     1 
ATOM   689  C  CA    . CYS A 1 99  ? -57.802 20.637 -44.191 1.00 104.78 ? 96  CYS A CA    1 
ATOM   690  C  C     . CYS A 1 99  ? -56.874 20.502 -42.992 1.00 104.94 ? 96  CYS A C     1 
ATOM   691  O  O     . CYS A 1 99  ? -56.389 21.499 -42.465 1.00 103.55 ? 96  CYS A O     1 
ATOM   692  C  CB    . CYS A 1 99  ? -57.308 21.720 -45.154 1.00 102.38 ? 96  CYS A CB    1 
ATOM   693  S  SG    . CYS A 1 99  ? -55.624 21.405 -45.732 1.00 102.03 ? 96  CYS A SG    1 
ATOM   694  N  N     . GLN A 1 100 ? -56.637 19.267 -42.557 1.00 106.77 ? 97  GLN A N     1 
ATOM   695  C  CA    . GLN A 1 100 ? -55.804 19.021 -41.385 1.00 107.45 ? 97  GLN A CA    1 
ATOM   696  C  C     . GLN A 1 100 ? -54.482 19.773 -41.511 1.00 104.77 ? 97  GLN A C     1 
ATOM   697  O  O     . GLN A 1 100 ? -53.977 20.324 -40.534 1.00 103.93 ? 97  GLN A O     1 
ATOM   698  C  CB    . GLN A 1 100 ? -55.570 17.515 -41.201 1.00 111.22 ? 97  GLN A CB    1 
ATOM   699  C  CG    . GLN A 1 100 ? -54.712 17.104 -39.977 1.00 115.27 ? 97  GLN A CG    1 
ATOM   700  C  CD    . GLN A 1 100 ? -55.480 17.089 -38.640 1.00 120.23 ? 97  GLN A CD    1 
ATOM   701  O  OE1   . GLN A 1 100 ? -56.692 17.354 -38.585 1.00 121.82 ? 97  GLN A OE1   1 
ATOM   702  N  NE2   . GLN A 1 100 ? -54.764 16.775 -37.554 1.00 122.70 ? 97  GLN A NE2   1 
ATOM   703  N  N     . GLN A 1 101 ? -53.957 19.815 -42.733 1.00 103.19 ? 98  GLN A N     1 
ATOM   704  C  CA    . GLN A 1 101 ? -52.675 20.448 -43.029 1.00 101.24 ? 98  GLN A CA    1 
ATOM   705  C  C     . GLN A 1 101 ? -52.622 21.945 -42.771 1.00 98.18  ? 98  GLN A C     1 
ATOM   706  O  O     . GLN A 1 101 ? -51.764 22.411 -42.021 1.00 97.76  ? 98  GLN A O     1 
ATOM   707  C  CB    . GLN A 1 101 ? -52.290 20.173 -44.467 1.00 101.48 ? 98  GLN A CB    1 
ATOM   708  C  CG    . GLN A 1 101 ? -51.627 18.843 -44.623 1.00 104.86 ? 98  GLN A CG    1 
ATOM   709  C  CD    . GLN A 1 101 ? -52.243 18.035 -45.729 1.00 106.75 ? 98  GLN A CD    1 
ATOM   710  O  OE1   . GLN A 1 101 ? -53.430 17.696 -45.677 1.00 106.76 ? 98  GLN A OE1   1 
ATOM   711  N  NE2   . GLN A 1 101 ? -51.441 17.713 -46.743 1.00 108.15 ? 98  GLN A NE2   1 
ATOM   712  N  N     . CYS A 1 102 ? -53.526 22.695 -43.396 1.00 95.89  ? 99  CYS A N     1 
ATOM   713  C  CA    . CYS A 1 102 ? -53.599 24.136 -43.193 1.00 93.01  ? 99  CYS A CA    1 
ATOM   714  C  C     . CYS A 1 102 ? -53.795 24.541 -41.734 1.00 92.69  ? 99  CYS A C     1 
ATOM   715  O  O     . CYS A 1 102 ? -53.249 25.543 -41.290 1.00 91.57  ? 99  CYS A O     1 
ATOM   716  C  CB    . CYS A 1 102 ? -54.687 24.733 -44.068 1.00 91.93  ? 99  CYS A CB    1 
ATOM   717  S  SG    . CYS A 1 102 ? -54.159 24.783 -45.754 1.00 90.74  ? 99  CYS A SG    1 
ATOM   718  N  N     . LEU A 1 103 ? -54.550 23.747 -40.985 1.00 93.78  ? 100 LEU A N     1 
ATOM   719  C  CA    . LEU A 1 103 ? -54.869 24.090 -39.603 1.00 94.12  ? 100 LEU A CA    1 
ATOM   720  C  C     . LEU A 1 103 ? -53.662 24.043 -38.677 1.00 94.38  ? 100 LEU A C     1 
ATOM   721  O  O     . LEU A 1 103 ? -53.549 24.848 -37.755 1.00 94.03  ? 100 LEU A O     1 
ATOM   722  C  CB    . LEU A 1 103 ? -55.977 23.188 -39.050 1.00 96.13  ? 100 LEU A CB    1 
ATOM   723  C  CG    . LEU A 1 103 ? -57.317 23.189 -39.784 1.00 96.25  ? 100 LEU A CG    1 
ATOM   724  C  CD1   . LEU A 1 103 ? -58.121 22.001 -39.346 1.00 98.50  ? 100 LEU A CD1   1 
ATOM   725  C  CD2   . LEU A 1 103 ? -58.087 24.484 -39.566 1.00 95.66  ? 100 LEU A CD2   1 
ATOM   726  N  N     . ILE A 1 104 ? -52.762 23.101 -38.914 1.00 95.33  ? 101 ILE A N     1 
ATOM   727  C  CA    . ILE A 1 104 ? -51.640 22.919 -38.008 1.00 95.93  ? 101 ILE A CA    1 
ATOM   728  C  C     . ILE A 1 104 ? -50.383 23.655 -38.458 1.00 94.87  ? 101 ILE A C     1 
ATOM   729  O  O     . ILE A 1 104 ? -49.391 23.678 -37.725 1.00 95.57  ? 101 ILE A O     1 
ATOM   730  C  CB    . ILE A 1 104 ? -51.327 21.426 -37.760 1.00 98.29  ? 101 ILE A CB    1 
ATOM   731  C  CG1   . ILE A 1 104 ? -50.946 20.735 -39.067 1.00 98.40  ? 101 ILE A CG1   1 
ATOM   732  C  CG2   . ILE A 1 104 ? -52.507 20.746 -37.089 1.00 99.66  ? 101 ILE A CG2   1 
ATOM   733  C  CD1   . ILE A 1 104 ? -50.205 19.450 -38.878 1.00 100.94 ? 101 ILE A CD1   1 
ATOM   734  N  N     . THR A 1 105 ? -50.429 24.270 -39.640 1.00 93.56  ? 102 THR A N     1 
ATOM   735  C  CA    . THR A 1 105 ? -49.238 24.932 -40.195 1.00 93.28  ? 102 THR A CA    1 
ATOM   736  C  C     . THR A 1 105 ? -49.355 26.441 -40.299 1.00 91.37  ? 102 THR A C     1 
ATOM   737  O  O     . THR A 1 105 ? -48.385 27.128 -40.013 1.00 91.18  ? 102 THR A O     1 
ATOM   738  C  CB    . THR A 1 105 ? -48.887 24.406 -41.579 1.00 93.75  ? 102 THR A CB    1 
ATOM   739  O  OG1   . THR A 1 105 ? -50.103 24.225 -42.307 1.00 95.34  ? 102 THR A OG1   1 
ATOM   740  C  CG2   . THR A 1 105 ? -48.205 23.080 -41.494 1.00 96.20  ? 102 THR A CG2   1 
ATOM   741  N  N     . ASN A 1 106 ? -50.522 26.941 -40.722 1.00 90.54  ? 103 ASN A N     1 
ATOM   742  C  CA    . ASN A 1 106 ? -50.796 28.388 -40.828 1.00 89.73  ? 103 ASN A CA    1 
ATOM   743  C  C     . ASN A 1 106 ? -50.658 29.088 -39.481 1.00 89.67  ? 103 ASN A C     1 
ATOM   744  O  O     . ASN A 1 106 ? -50.939 28.483 -38.451 1.00 90.65  ? 103 ASN A O     1 
ATOM   745  C  CB    . ASN A 1 106 ? -52.220 28.651 -41.346 1.00 89.48  ? 103 ASN A CB    1 
ATOM   746  C  CG    . ASN A 1 106 ? -52.405 28.313 -42.822 1.00 90.10  ? 103 ASN A CG    1 
ATOM   747  O  OD1   . ASN A 1 106 ? -51.447 28.018 -43.546 1.00 91.09  ? 103 ASN A OD1   1 
ATOM   748  N  ND2   . ASN A 1 106 ? -53.657 28.361 -43.275 1.00 90.17  ? 103 ASN A ND2   1 
ATOM   749  N  N     . ALA A 1 107 ? -50.245 30.355 -39.474 1.00 89.04  ? 104 ALA A N     1 
ATOM   750  C  CA    . ALA A 1 107 ? -50.161 31.088 -38.209 1.00 88.96  ? 104 ALA A CA    1 
ATOM   751  C  C     . ALA A 1 107 ? -51.470 31.810 -37.969 1.00 88.53  ? 104 ALA A C     1 
ATOM   752  O  O     . ALA A 1 107 ? -52.319 31.848 -38.846 1.00 87.63  ? 104 ALA A O     1 
ATOM   753  C  CB    . ALA A 1 107 ? -48.961 32.056 -38.173 1.00 89.02  ? 104 ALA A CB    1 
ATOM   754  N  N     . SER A 1 108 ? -51.626 32.358 -36.768 1.00 89.09  ? 105 SER A N     1 
ATOM   755  C  CA    . SER A 1 108 ? -52.837 33.067 -36.382 1.00 89.85  ? 105 SER A CA    1 
ATOM   756  C  C     . SER A 1 108 ? -52.845 34.490 -36.904 1.00 89.67  ? 105 SER A C     1 
ATOM   757  O  O     . SER A 1 108 ? -51.797 35.094 -37.090 1.00 89.91  ? 105 SER A O     1 
ATOM   758  C  CB    . SER A 1 108 ? -52.947 33.112 -34.864 1.00 90.93  ? 105 SER A CB    1 
ATOM   759  O  OG    . SER A 1 108 ? -54.092 33.845 -34.474 1.00 92.61  ? 105 SER A OG    1 
ATOM   760  N  N     . ASN A 1 109 ? -54.028 35.035 -37.132 1.00 89.95  ? 106 ASN A N     1 
ATOM   761  C  CA    . ASN A 1 109 ? -54.133 36.460 -37.408 1.00 90.41  ? 106 ASN A CA    1 
ATOM   762  C  C     . ASN A 1 109 ? -54.907 37.182 -36.297 1.00 91.33  ? 106 ASN A C     1 
ATOM   763  O  O     . ASN A 1 109 ? -55.431 38.274 -36.510 1.00 92.33  ? 106 ASN A O     1 
ATOM   764  C  CB    . ASN A 1 109 ? -54.774 36.699 -38.774 1.00 90.44  ? 106 ASN A CB    1 
ATOM   765  C  CG    . ASN A 1 109 ? -56.218 36.234 -38.822 1.00 92.33  ? 106 ASN A CG    1 
ATOM   766  O  OD1   . ASN A 1 109 ? -56.615 35.321 -38.089 1.00 94.24  ? 106 ASN A OD1   1 
ATOM   767  N  ND2   . ASN A 1 109 ? -57.015 36.863 -39.678 1.00 94.20  ? 106 ASN A ND2   1 
ATOM   768  N  N     . LYS A 1 110 ? -54.964 36.556 -35.119 1.00 91.29  ? 107 LYS A N     1 
ATOM   769  C  CA    . LYS A 1 110 ? -55.663 37.083 -33.939 1.00 92.38  ? 107 LYS A CA    1 
ATOM   770  C  C     . LYS A 1 110 ? -54.725 37.202 -32.739 1.00 92.10  ? 107 LYS A C     1 
ATOM   771  O  O     . LYS A 1 110 ? -54.152 36.214 -32.304 1.00 91.58  ? 107 LYS A O     1 
ATOM   772  C  CB    . LYS A 1 110 ? -56.843 36.178 -33.563 1.00 93.32  ? 107 LYS A CB    1 
ATOM   773  C  CG    . LYS A 1 110 ? -58.151 36.528 -34.230 1.00 94.68  ? 107 LYS A CG    1 
ATOM   774  C  CD    . LYS A 1 110 ? -58.450 35.609 -35.378 1.00 95.07  ? 107 LYS A CD    1 
ATOM   775  C  CE    . LYS A 1 110 ? -59.589 36.189 -36.194 1.00 97.65  ? 107 LYS A CE    1 
ATOM   776  N  NZ    . LYS A 1 110 ? -59.623 35.650 -37.588 1.00 97.39  ? 107 LYS A NZ    1 
ATOM   777  N  N     . ALA A 1 111 ? -54.571 38.404 -32.199 1.00 92.64  ? 108 ALA A N     1 
ATOM   778  C  CA    . ALA A 1 111 ? -53.688 38.604 -31.059 1.00 92.77  ? 108 ALA A CA    1 
ATOM   779  C  C     . ALA A 1 111 ? -54.395 38.111 -29.834 1.00 94.03  ? 108 ALA A C     1 
ATOM   780  O  O     . ALA A 1 111 ? -55.616 38.121 -29.800 1.00 95.12  ? 108 ALA A O     1 
ATOM   781  C  CB    . ALA A 1 111 ? -53.344 40.058 -30.900 1.00 93.93  ? 108 ALA A CB    1 
ATOM   782  N  N     . SER A 1 112 ? -53.633 37.673 -28.834 1.00 94.24  ? 109 SER A N     1 
ATOM   783  C  CA    . SER A 1 112 ? -54.222 37.247 -27.564 1.00 96.08  ? 109 SER A CA    1 
ATOM   784  C  C     . SER A 1 112 ? -54.695 38.467 -26.769 1.00 98.36  ? 109 SER A C     1 
ATOM   785  O  O     . SER A 1 112 ? -54.343 39.603 -27.096 1.00 98.48  ? 109 SER A O     1 
ATOM   786  C  CB    . SER A 1 112 ? -53.247 36.388 -26.758 1.00 95.66  ? 109 SER A CB    1 
ATOM   787  O  OG    . SER A 1 112 ? -52.013 37.040 -26.617 1.00 94.98  ? 109 SER A OG    1 
ATOM   788  N  N     . GLY A 1 113 ? -55.511 38.241 -25.745 1.00 100.67 ? 110 GLY A N     1 
ATOM   789  C  CA    . GLY A 1 113 ? -56.140 39.344 -25.021 1.00 103.14 ? 110 GLY A CA    1 
ATOM   790  C  C     . GLY A 1 113 ? -55.121 40.168 -24.272 1.00 103.60 ? 110 GLY A C     1 
ATOM   791  O  O     . GLY A 1 113 ? -53.951 39.789 -24.218 1.00 101.97 ? 110 GLY A O     1 
ATOM   792  N  N     . PRO A 1 114 ? -55.557 41.291 -23.677 1.00 106.23 ? 111 PRO A N     1 
ATOM   793  C  CA    . PRO A 1 114 ? -54.687 42.148 -22.865 1.00 107.58 ? 111 PRO A CA    1 
ATOM   794  C  C     . PRO A 1 114 ? -54.106 41.343 -21.726 1.00 108.18 ? 111 PRO A C     1 
ATOM   795  O  O     . PRO A 1 114 ? -54.823 40.520 -21.158 1.00 109.78 ? 111 PRO A O     1 
ATOM   796  C  CB    . PRO A 1 114 ? -55.647 43.179 -22.268 1.00 110.64 ? 111 PRO A CB    1 
ATOM   797  C  CG    . PRO A 1 114 ? -56.839 43.090 -23.031 1.00 111.17 ? 111 PRO A CG    1 
ATOM   798  C  CD    . PRO A 1 114 ? -56.951 41.736 -23.627 1.00 108.71 ? 111 PRO A CD    1 
ATOM   799  N  N     . ILE A 1 115 ? -52.839 41.578 -21.389 1.00 97.26  ? 112 ILE A N     1 
ATOM   800  C  CA    . ILE A 1 115 ? -52.212 40.902 -20.249 1.00 96.31  ? 112 ILE A CA    1 
ATOM   801  C  C     . ILE A 1 115 ? -52.901 41.244 -18.921 1.00 97.08  ? 112 ILE A C     1 
ATOM   802  O  O     . ILE A 1 115 ? -53.722 42.163 -18.856 1.00 98.13  ? 112 ILE A O     1 
ATOM   803  C  CB    . ILE A 1 115 ? -50.705 41.217 -20.145 1.00 94.34  ? 112 ILE A CB    1 
ATOM   804  C  CG1   . ILE A 1 115 ? -50.496 42.710 -19.888 1.00 93.75  ? 112 ILE A CG1   1 
ATOM   805  C  CG2   . ILE A 1 115 ? -49.967 40.759 -21.409 1.00 94.41  ? 112 ILE A CG2   1 
ATOM   806  C  CD1   . ILE A 1 115 ? -49.119 43.063 -19.439 1.00 90.99  ? 112 ILE A CD1   1 
ATOM   807  N  N     . LEU A 1 116 ? -52.570 40.492 -17.873 1.00 97.01  ? 113 LEU A N     1 
ATOM   808  C  CA    . LEU A 1 116 ? -53.104 40.730 -16.526 1.00 97.97  ? 113 LEU A CA    1 
ATOM   809  C  C     . LEU A 1 116 ? -52.003 41.279 -15.660 1.00 96.62  ? 113 LEU A C     1 
ATOM   810  O  O     . LEU A 1 116 ? -50.845 40.909 -15.842 1.00 95.43  ? 113 LEU A O     1 
ATOM   811  C  CB    . LEU A 1 116 ? -53.577 39.430 -15.875 1.00 98.76  ? 113 LEU A CB    1 
ATOM   812  C  CG    . LEU A 1 116 ? -54.850 38.694 -16.283 1.00 100.64 ? 113 LEU A CG    1 
ATOM   813  C  CD1   . LEU A 1 116 ? -54.808 37.327 -15.613 1.00 100.41 ? 113 LEU A CD1   1 
ATOM   814  C  CD2   . LEU A 1 116 ? -56.124 39.472 -15.918 1.00 101.95 ? 113 LEU A CD2   1 
ATOM   815  N  N     . ARG A 1 117 ? -52.347 42.129 -14.699 1.00 97.22  ? 114 ARG A N     1 
ATOM   816  C  CA    . ARG A 1 117 ? -51.326 42.622 -13.793 1.00 96.37  ? 114 ARG A CA    1 
ATOM   817  C  C     . ARG A 1 117 ? -51.611 42.180 -12.369 1.00 97.37  ? 114 ARG A C     1 
ATOM   818  O  O     . ARG A 1 117 ? -52.133 42.969 -11.593 1.00 98.18  ? 114 ARG A O     1 
ATOM   819  C  CB    . ARG A 1 117 ? -51.203 44.150 -13.856 1.00 96.00  ? 114 ARG A CB    1 
ATOM   820  C  CG    . ARG A 1 117 ? -50.989 44.780 -15.242 1.00 95.24  ? 114 ARG A CG    1 
ATOM   821  C  CD    . ARG A 1 117 ? -49.825 44.203 -16.037 1.00 92.95  ? 114 ARG A CD    1 
ATOM   822  N  NE    . ARG A 1 117 ? -48.572 44.109 -15.289 1.00 91.95  ? 114 ARG A NE    1 
ATOM   823  C  CZ    . ARG A 1 117 ? -47.691 45.101 -15.156 1.00 91.64  ? 114 ARG A CZ    1 
ATOM   824  N  NH1   . ARG A 1 117 ? -47.931 46.283 -15.705 1.00 92.81  ? 114 ARG A NH1   1 
ATOM   825  N  NH2   . ARG A 1 117 ? -46.574 44.919 -14.460 1.00 89.63  ? 114 ARG A NH2   1 
ATOM   826  N  N     . PRO A 1 118 ? -51.246 40.926 -12.010 1.00 97.70  ? 115 PRO A N     1 
ATOM   827  C  CA    . PRO A 1 118 ? -51.569 40.367 -10.688 1.00 99.05  ? 115 PRO A CA    1 
ATOM   828  C  C     . PRO A 1 118 ? -51.136 41.328 -9.600  1.00 99.40  ? 115 PRO A C     1 
ATOM   829  O  O     . PRO A 1 118 ? -50.262 42.147 -9.848  1.00 98.43  ? 115 PRO A O     1 
ATOM   830  C  CB    . PRO A 1 118 ? -50.725 39.094 -10.620 1.00 98.25  ? 115 PRO A CB    1 
ATOM   831  C  CG    . PRO A 1 118 ? -50.359 38.778 -12.003 1.00 97.17  ? 115 PRO A CG    1 
ATOM   832  C  CD    . PRO A 1 118 ? -50.335 40.054 -12.767 1.00 96.64  ? 115 PRO A CD    1 
ATOM   833  N  N     . ASP A 1 119 ? -51.730 41.233 -8.415  1.00 101.66 ? 116 ASP A N     1 
ATOM   834  C  CA    . ASP A 1 119 ? -51.492 42.214 -7.349  1.00 102.87 ? 116 ASP A CA    1 
ATOM   835  C  C     . ASP A 1 119 ? -50.181 41.927 -6.647  1.00 102.24 ? 116 ASP A C     1 
ATOM   836  O  O     . ASP A 1 119 ? -49.743 40.778 -6.631  1.00 101.90 ? 116 ASP A O     1 
ATOM   837  C  CB    . ASP A 1 119 ? -52.623 42.180 -6.324  1.00 104.93 ? 116 ASP A CB    1 
ATOM   838  C  CG    . ASP A 1 119 ? -53.970 41.829 -6.938  1.00 108.00 ? 116 ASP A CG    1 
ATOM   839  O  OD1   . ASP A 1 119 ? -54.961 42.490 -6.571  1.00 111.69 ? 116 ASP A OD1   1 
ATOM   840  O  OD2   . ASP A 1 119 ? -54.050 40.899 -7.779  1.00 108.78 ? 116 ASP A OD2   1 
ATOM   841  N  N     . ARG A 1 120 ? -49.554 42.961 -6.075  1.00 102.79 ? 117 ARG A N     1 
ATOM   842  C  CA    . ARG A 1 120 ? -48.327 42.771 -5.292  1.00 103.14 ? 117 ARG A CA    1 
ATOM   843  C  C     . ARG A 1 120 ? -48.652 41.878 -4.150  1.00 104.30 ? 117 ARG A C     1 
ATOM   844  O  O     . ARG A 1 120 ? -49.689 42.056 -3.511  1.00 106.04 ? 117 ARG A O     1 
ATOM   845  C  CB    . ARG A 1 120 ? -47.804 44.070 -4.688  1.00 103.29 ? 117 ARG A CB    1 
ATOM   846  C  CG    . ARG A 1 120 ? -47.012 44.888 -5.641  1.00 105.36 ? 117 ARG A CG    1 
ATOM   847  C  CD    . ARG A 1 120 ? -46.776 46.308 -5.144  1.00 109.65 ? 117 ARG A CD    1 
ATOM   848  N  NE    . ARG A 1 120 ? -46.437 47.075 -6.329  1.00 113.08 ? 117 ARG A NE    1 
ATOM   849  C  CZ    . ARG A 1 120 ? -45.265 46.985 -6.964  1.00 114.15 ? 117 ARG A CZ    1 
ATOM   850  N  NH1   . ARG A 1 120 ? -44.291 46.192 -6.493  1.00 112.93 ? 117 ARG A NH1   1 
ATOM   851  N  NH2   . ARG A 1 120 ? -45.068 47.701 -8.072  1.00 115.27 ? 117 ARG A NH2   1 
ATOM   852  N  N     . PRO A 1 121 ? -47.775 40.913 -3.879  1.00 104.04 ? 118 PRO A N     1 
ATOM   853  C  CA    . PRO A 1 121 ? -47.867 40.201 -2.627  1.00 105.73 ? 118 PRO A CA    1 
ATOM   854  C  C     . PRO A 1 121 ? -47.992 41.215 -1.492  1.00 107.05 ? 118 PRO A C     1 
ATOM   855  O  O     . PRO A 1 121 ? -47.542 42.357 -1.623  1.00 106.44 ? 118 PRO A O     1 
ATOM   856  C  CB    . PRO A 1 121 ? -46.540 39.463 -2.572  1.00 104.66 ? 118 PRO A CB    1 
ATOM   857  C  CG    . PRO A 1 121 ? -46.270 39.151 -3.996  1.00 103.12 ? 118 PRO A CG    1 
ATOM   858  C  CD    . PRO A 1 121 ? -46.735 40.355 -4.753  1.00 102.58 ? 118 PRO A CD    1 
ATOM   859  N  N     . GLN A 1 122 ? -48.629 40.816 -0.402  1.00 109.51 ? 119 GLN A N     1 
ATOM   860  C  CA    . GLN A 1 122 ? -48.990 41.770 0.632   1.00 111.17 ? 119 GLN A CA    1 
ATOM   861  C  C     . GLN A 1 122 ? -47.858 42.017 1.586   1.00 110.09 ? 119 GLN A C     1 
ATOM   862  O  O     . GLN A 1 122 ? -47.595 43.153 1.975   1.00 109.81 ? 119 GLN A O     1 
ATOM   863  C  CB    . GLN A 1 122 ? -50.199 41.275 1.401   1.00 114.02 ? 119 GLN A CB    1 
ATOM   864  C  CG    . GLN A 1 122 ? -51.465 41.295 0.584   1.00 117.92 ? 119 GLN A CG    1 
ATOM   865  C  CD    . GLN A 1 122 ? -52.609 41.842 1.394   1.00 123.66 ? 119 GLN A CD    1 
ATOM   866  O  OE1   . GLN A 1 122 ? -52.708 41.586 2.608   1.00 126.67 ? 119 GLN A OE1   1 
ATOM   867  N  NE2   . GLN A 1 122 ? -53.475 42.618 0.741   1.00 125.55 ? 119 GLN A NE2   1 
ATOM   868  N  N     . LYS A 1 123 ? -47.195 40.930 1.952   1.00 109.54 ? 120 LYS A N     1 
ATOM   869  C  CA    . LYS A 1 123 ? -46.112 40.959 2.908   1.00 108.84 ? 120 LYS A CA    1 
ATOM   870  C  C     . LYS A 1 123 ? -44.826 40.428 2.256   1.00 106.30 ? 120 LYS A C     1 
ATOM   871  O  O     . LYS A 1 123 ? -44.882 39.619 1.332   1.00 105.84 ? 120 LYS A O     1 
ATOM   872  C  CB    . LYS A 1 123 ? -46.494 40.141 4.165   1.00 111.23 ? 120 LYS A CB    1 
ATOM   873  C  CG    . LYS A 1 123 ? -47.771 40.610 4.949   1.00 114.32 ? 120 LYS A CG    1 
ATOM   874  C  CD    . LYS A 1 123 ? -47.663 42.089 5.417   1.00 116.53 ? 120 LYS A CD    1 
ATOM   875  C  CE    . LYS A 1 123 ? -48.857 42.594 6.255   1.00 119.41 ? 120 LYS A CE    1 
ATOM   876  N  NZ    . LYS A 1 123 ? -48.803 42.182 7.702   1.00 121.72 ? 120 LYS A NZ    1 
ATOM   877  N  N     . PRO A 1 124 ? -43.658 40.904 2.712   1.00 104.68 ? 121 PRO A N     1 
ATOM   878  C  CA    . PRO A 1 124 ? -42.426 40.266 2.278   1.00 102.89 ? 121 PRO A CA    1 
ATOM   879  C  C     . PRO A 1 124 ? -42.469 38.818 2.703   1.00 103.35 ? 121 PRO A C     1 
ATOM   880  O  O     . PRO A 1 124 ? -43.053 38.505 3.743   1.00 104.83 ? 121 PRO A O     1 
ATOM   881  C  CB    . PRO A 1 124 ? -41.356 40.979 3.084   1.00 102.64 ? 121 PRO A CB    1 
ATOM   882  C  CG    . PRO A 1 124 ? -41.955 42.277 3.466   1.00 103.49 ? 121 PRO A CG    1 
ATOM   883  C  CD    . PRO A 1 124 ? -43.414 42.069 3.578   1.00 104.88 ? 121 PRO A CD    1 
ATOM   884  N  N     . PHE A 1 125 ? -41.861 37.945 1.903   1.00 101.93 ? 122 PHE A N     1 
ATOM   885  C  CA    . PHE A 1 125 ? -41.868 36.494 2.143   1.00 102.03 ? 122 PHE A CA    1 
ATOM   886  C  C     . PHE A 1 125 ? -43.238 35.832 1.903   1.00 102.89 ? 122 PHE A C     1 
ATOM   887  O  O     . PHE A 1 125 ? -43.399 34.642 2.181   1.00 104.10 ? 122 PHE A O     1 
ATOM   888  C  CB    . PHE A 1 125 ? -41.364 36.138 3.550   1.00 103.08 ? 122 PHE A CB    1 
ATOM   889  C  CG    . PHE A 1 125 ? -40.061 36.791 3.926   1.00 101.83 ? 122 PHE A CG    1 
ATOM   890  C  CD1   . PHE A 1 125 ? -40.040 37.885 4.783   1.00 101.57 ? 122 PHE A CD1   1 
ATOM   891  C  CD2   . PHE A 1 125 ? -38.848 36.296 3.452   1.00 100.48 ? 122 PHE A CD2   1 
ATOM   892  C  CE1   . PHE A 1 125 ? -38.828 38.490 5.147   1.00 100.32 ? 122 PHE A CE1   1 
ATOM   893  C  CE2   . PHE A 1 125 ? -37.637 36.898 3.811   1.00 98.77  ? 122 PHE A CE2   1 
ATOM   894  C  CZ    . PHE A 1 125 ? -37.632 37.995 4.658   1.00 98.68  ? 122 PHE A CZ    1 
ATOM   895  N  N     . ASP A 1 126 ? -44.221 36.585 1.404   1.00 102.20 ? 123 ASP A N     1 
ATOM   896  C  CA    . ASP A 1 126 ? -45.478 35.980 0.963   1.00 102.67 ? 123 ASP A CA    1 
ATOM   897  C  C     . ASP A 1 126 ? -45.201 35.105 -0.249  1.00 101.20 ? 123 ASP A C     1 
ATOM   898  O  O     . ASP A 1 126 ? -45.780 34.033 -0.399  1.00 102.29 ? 123 ASP A O     1 
ATOM   899  C  CB    . ASP A 1 126 ? -46.523 37.040 0.583   1.00 103.20 ? 123 ASP A CB    1 
ATOM   900  C  CG    . ASP A 1 126 ? -47.400 37.482 1.760   1.00 106.18 ? 123 ASP A CG    1 
ATOM   901  O  OD1   . ASP A 1 126 ? -47.162 37.045 2.911   1.00 108.75 ? 123 ASP A OD1   1 
ATOM   902  O  OD2   . ASP A 1 126 ? -48.344 38.278 1.522   1.00 107.66 ? 123 ASP A OD2   1 
ATOM   903  N  N     . LYS A 1 127 ? -44.311 35.572 -1.118  1.00 98.80  ? 124 LYS A N     1 
ATOM   904  C  CA    . LYS A 1 127 ? -44.016 34.868 -2.350  1.00 97.24  ? 124 LYS A CA    1 
ATOM   905  C  C     . LYS A 1 127 ? -42.637 35.211 -2.880  1.00 95.57  ? 124 LYS A C     1 
ATOM   906  O  O     . LYS A 1 127 ? -42.293 36.387 -3.052  1.00 94.85  ? 124 LYS A O     1 
ATOM   907  C  CB    . LYS A 1 127 ? -45.063 35.195 -3.401  1.00 96.91  ? 124 LYS A CB    1 
ATOM   908  C  CG    . LYS A 1 127 ? -44.828 34.527 -4.709  1.00 95.63  ? 124 LYS A CG    1 
ATOM   909  C  CD    . LYS A 1 127 ? -45.920 34.862 -5.678  1.00 95.15  ? 124 LYS A CD    1 
ATOM   910  C  CE    . LYS A 1 127 ? -47.014 33.831 -5.619  1.00 96.83  ? 124 LYS A CE    1 
ATOM   911  N  NZ    . LYS A 1 127 ? -47.976 34.042 -6.718  1.00 97.67  ? 124 LYS A NZ    1 
ATOM   912  N  N     . PHE A 1 128 ? -41.855 34.166 -3.121  1.00 95.01  ? 125 PHE A N     1 
ATOM   913  C  CA    . PHE A 1 128 ? -40.569 34.273 -3.786  1.00 93.31  ? 125 PHE A CA    1 
ATOM   914  C  C     . PHE A 1 128 ? -40.747 33.857 -5.229  1.00 92.75  ? 125 PHE A C     1 
ATOM   915  O  O     . PHE A 1 128 ? -41.525 32.934 -5.524  1.00 93.51  ? 125 PHE A O     1 
ATOM   916  C  CB    . PHE A 1 128 ? -39.564 33.324 -3.144  1.00 93.60  ? 125 PHE A CB    1 
ATOM   917  C  CG    . PHE A 1 128 ? -38.919 33.860 -1.919  1.00 93.37  ? 125 PHE A CG    1 
ATOM   918  C  CD1   . PHE A 1 128 ? -39.335 35.066 -1.363  1.00 93.54  ? 125 PHE A CD1   1 
ATOM   919  C  CD2   . PHE A 1 128 ? -37.903 33.142 -1.301  1.00 93.61  ? 125 PHE A CD2   1 
ATOM   920  C  CE1   . PHE A 1 128 ? -38.731 35.564 -0.215  1.00 94.48  ? 125 PHE A CE1   1 
ATOM   921  C  CE2   . PHE A 1 128 ? -37.285 33.620 -0.151  1.00 94.44  ? 125 PHE A CE2   1 
ATOM   922  C  CZ    . PHE A 1 128 ? -37.697 34.836 0.396   1.00 95.06  ? 125 PHE A CZ    1 
ATOM   923  N  N     . PHE A 1 129 ? -40.029 34.547 -6.117  1.00 91.15  ? 126 PHE A N     1 
ATOM   924  C  CA    . PHE A 1 129 ? -39.891 34.162 -7.515  1.00 90.05  ? 126 PHE A CA    1 
ATOM   925  C  C     . PHE A 1 129 ? -38.442 33.754 -7.756  1.00 89.26  ? 126 PHE A C     1 
ATOM   926  O  O     . PHE A 1 129 ? -37.519 34.474 -7.376  1.00 88.38  ? 126 PHE A O     1 
ATOM   927  C  CB    . PHE A 1 129 ? -40.228 35.341 -8.407  1.00 89.12  ? 126 PHE A CB    1 
ATOM   928  C  CG    . PHE A 1 129 ? -41.686 35.697 -8.447  1.00 90.48  ? 126 PHE A CG    1 
ATOM   929  C  CD1   . PHE A 1 129 ? -42.530 35.142 -9.410  1.00 91.60  ? 126 PHE A CD1   1 
ATOM   930  C  CD2   . PHE A 1 129 ? -42.215 36.625 -7.560  1.00 91.31  ? 126 PHE A CD2   1 
ATOM   931  C  CE1   . PHE A 1 129 ? -43.883 35.487 -9.476  1.00 91.40  ? 126 PHE A CE1   1 
ATOM   932  C  CE2   . PHE A 1 129 ? -43.569 36.973 -7.622  1.00 91.78  ? 126 PHE A CE2   1 
ATOM   933  C  CZ    . PHE A 1 129 ? -44.398 36.400 -8.585  1.00 91.73  ? 126 PHE A CZ    1 
ATOM   934  N  N     . ILE A 1 130 ? -38.232 32.600 -8.377  1.00 89.63  ? 127 ILE A N     1 
ATOM   935  C  CA    . ILE A 1 130 ? -36.870 32.158 -8.663  1.00 89.78  ? 127 ILE A CA    1 
ATOM   936  C  C     . ILE A 1 130 ? -36.615 31.848 -10.143 1.00 90.28  ? 127 ILE A C     1 
ATOM   937  O  O     . ILE A 1 130 ? -37.548 31.573 -10.907 1.00 91.04  ? 127 ILE A O     1 
ATOM   938  C  CB    . ILE A 1 130 ? -36.449 30.965 -7.797  1.00 90.40  ? 127 ILE A CB    1 
ATOM   939  C  CG1   . ILE A 1 130 ? -37.383 29.781 -8.013  1.00 91.48  ? 127 ILE A CG1   1 
ATOM   940  C  CG2   . ILE A 1 130 ? -36.417 31.358 -6.341  1.00 90.68  ? 127 ILE A CG2   1 
ATOM   941  C  CD1   . ILE A 1 130 ? -36.807 28.461 -7.525  1.00 92.71  ? 127 ILE A CD1   1 
ATOM   942  N  N     . ASP A 1 131 ? -35.348 31.910 -10.545 1.00 90.47  ? 128 ASP A N     1 
ATOM   943  C  CA    . ASP A 1 131 ? -34.949 31.560 -11.906 1.00 90.96  ? 128 ASP A CA    1 
ATOM   944  C  C     . ASP A 1 131 ? -33.440 31.382 -11.974 1.00 91.17  ? 128 ASP A C     1 
ATOM   945  O  O     . ASP A 1 131 ? -32.715 31.885 -11.121 1.00 91.00  ? 128 ASP A O     1 
ATOM   946  C  CB    . ASP A 1 131 ? -35.397 32.644 -12.890 1.00 90.43  ? 128 ASP A CB    1 
ATOM   947  C  CG    . ASP A 1 131 ? -35.408 32.161 -14.324 1.00 91.32  ? 128 ASP A CG    1 
ATOM   948  O  OD1   . ASP A 1 131 ? -36.128 31.177 -14.614 1.00 93.20  ? 128 ASP A OD1   1 
ATOM   949  O  OD2   . ASP A 1 131 ? -34.708 32.776 -15.161 1.00 90.72  ? 128 ASP A OD2   1 
ATOM   950  N  N     . TYR A 1 132 ? -32.968 30.652 -12.973 1.00 91.94  ? 129 TYR A N     1 
ATOM   951  C  CA    . TYR A 1 132 ? -31.548 30.546 -13.199 1.00 92.72  ? 129 TYR A CA    1 
ATOM   952  C  C     . TYR A 1 132 ? -31.159 31.371 -14.393 1.00 92.76  ? 129 TYR A C     1 
ATOM   953  O  O     . TYR A 1 132 ? -31.856 31.378 -15.417 1.00 93.14  ? 129 TYR A O     1 
ATOM   954  C  CB    . TYR A 1 132 ? -31.136 29.104 -13.442 1.00 93.97  ? 129 TYR A CB    1 
ATOM   955  C  CG    . TYR A 1 132 ? -30.762 28.380 -12.187 1.00 95.80  ? 129 TYR A CG    1 
ATOM   956  C  CD1   . TYR A 1 132 ? -31.641 27.480 -11.591 1.00 97.51  ? 129 TYR A CD1   1 
ATOM   957  C  CD2   . TYR A 1 132 ? -29.533 28.607 -11.576 1.00 97.44  ? 129 TYR A CD2   1 
ATOM   958  C  CE1   . TYR A 1 132 ? -31.305 26.821 -10.425 1.00 99.27  ? 129 TYR A CE1   1 
ATOM   959  C  CE2   . TYR A 1 132 ? -29.181 27.947 -10.408 1.00 99.07  ? 129 TYR A CE2   1 
ATOM   960  C  CZ    . TYR A 1 132 ? -30.073 27.058 -9.840  1.00 100.26 ? 129 TYR A CZ    1 
ATOM   961  O  OH    . TYR A 1 132 ? -29.732 26.409 -8.676  1.00 103.26 ? 129 TYR A OH    1 
ATOM   962  N  N     . ILE A 1 133 ? -30.040 32.065 -14.241 1.00 92.91  ? 130 ILE A N     1 
ATOM   963  C  CA    . ILE A 1 133 ? -29.361 32.735 -15.331 1.00 93.21  ? 130 ILE A CA    1 
ATOM   964  C  C     . ILE A 1 133 ? -28.196 31.840 -15.771 1.00 95.06  ? 130 ILE A C     1 
ATOM   965  O  O     . ILE A 1 133 ? -27.597 31.146 -14.937 1.00 95.67  ? 130 ILE A O     1 
ATOM   966  C  CB    . ILE A 1 133 ? -28.858 34.099 -14.863 1.00 92.21  ? 130 ILE A CB    1 
ATOM   967  C  CG1   . ILE A 1 133 ? -29.986 35.121 -14.930 1.00 91.25  ? 130 ILE A CG1   1 
ATOM   968  C  CG2   . ILE A 1 133 ? -27.688 34.578 -15.684 1.00 92.41  ? 130 ILE A CG2   1 
ATOM   969  C  CD1   . ILE A 1 133 ? -29.573 36.493 -14.395 1.00 90.35  ? 130 ILE A CD1   1 
ATOM   970  N  N     . GLY A 1 134 ? -27.899 31.831 -17.073 1.00 96.25  ? 131 GLY A N     1 
ATOM   971  C  CA    . GLY A 1 134 ? -26.745 31.103 -17.591 1.00 98.35  ? 131 GLY A CA    1 
ATOM   972  C  C     . GLY A 1 134 ? -27.032 30.169 -18.755 1.00 100.14 ? 131 GLY A C     1 
ATOM   973  O  O     . GLY A 1 134 ? -28.186 30.029 -19.170 1.00 99.86  ? 131 GLY A O     1 
ATOM   974  N  N     . PRO A 1 135 ? -25.981 29.500 -19.281 1.00 102.04 ? 132 PRO A N     1 
ATOM   975  C  CA    . PRO A 1 135 ? -24.594 29.527 -18.789 1.00 103.19 ? 132 PRO A CA    1 
ATOM   976  C  C     . PRO A 1 135 ? -23.892 30.836 -19.096 1.00 103.43 ? 132 PRO A C     1 
ATOM   977  O  O     . PRO A 1 135 ? -24.217 31.476 -20.088 1.00 103.13 ? 132 PRO A O     1 
ATOM   978  C  CB    . PRO A 1 135 ? -23.913 28.390 -19.562 1.00 104.55 ? 132 PRO A CB    1 
ATOM   979  C  CG    . PRO A 1 135 ? -24.995 27.686 -20.311 1.00 104.68 ? 132 PRO A CG    1 
ATOM   980  C  CD    . PRO A 1 135 ? -26.117 28.643 -20.469 1.00 103.08 ? 132 PRO A CD    1 
ATOM   981  N  N     . LEU A 1 136 ? -22.949 31.219 -18.235 1.00 104.50 ? 133 LEU A N     1 
ATOM   982  C  CA    . LEU A 1 136 ? -22.113 32.412 -18.430 1.00 105.34 ? 133 LEU A CA    1 
ATOM   983  C  C     . LEU A 1 136 ? -20.651 32.043 -18.774 1.00 108.13 ? 133 LEU A C     1 
ATOM   984  O  O     . LEU A 1 136 ? -20.316 30.856 -18.915 1.00 109.61 ? 133 LEU A O     1 
ATOM   985  C  CB    . LEU A 1 136 ? -22.157 33.306 -17.183 1.00 103.93 ? 133 LEU A CB    1 
ATOM   986  C  CG    . LEU A 1 136 ? -23.497 33.747 -16.586 1.00 101.74 ? 133 LEU A CG    1 
ATOM   987  C  CD1   . LEU A 1 136 ? -23.305 34.886 -15.610 1.00 99.31  ? 133 LEU A CD1   1 
ATOM   988  C  CD2   . LEU A 1 136 ? -24.475 34.164 -17.649 1.00 100.90 ? 133 LEU A CD2   1 
ATOM   989  N  N     . PRO A 1 137 ? -19.775 33.051 -18.957 1.00 109.38 ? 134 PRO A N     1 
ATOM   990  C  CA    . PRO A 1 137 ? -18.360 32.708 -18.936 1.00 111.65 ? 134 PRO A CA    1 
ATOM   991  C  C     . PRO A 1 137 ? -17.972 32.133 -17.576 1.00 112.80 ? 134 PRO A C     1 
ATOM   992  O  O     . PRO A 1 137 ? -18.483 32.584 -16.548 1.00 112.01 ? 134 PRO A O     1 
ATOM   993  C  CB    . PRO A 1 137 ? -17.675 34.054 -19.145 1.00 111.61 ? 134 PRO A CB    1 
ATOM   994  C  CG    . PRO A 1 137 ? -18.626 34.832 -19.936 1.00 110.33 ? 134 PRO A CG    1 
ATOM   995  C  CD    . PRO A 1 137 ? -20.002 34.395 -19.520 1.00 108.78 ? 134 PRO A CD    1 
ATOM   996  N  N     . PRO A 1 138 ? -17.095 31.124 -17.565 1.00 115.03 ? 135 PRO A N     1 
ATOM   997  C  CA    . PRO A 1 138 ? -16.671 30.572 -16.298 1.00 116.23 ? 135 PRO A CA    1 
ATOM   998  C  C     . PRO A 1 138 ? -15.879 31.556 -15.465 1.00 116.85 ? 135 PRO A C     1 
ATOM   999  O  O     . PRO A 1 138 ? -14.843 32.052 -15.913 1.00 118.02 ? 135 PRO A O     1 
ATOM   1000 C  CB    . PRO A 1 138 ? -15.777 29.402 -16.713 1.00 118.31 ? 135 PRO A CB    1 
ATOM   1001 C  CG    . PRO A 1 138 ? -16.294 29.000 -18.032 1.00 118.19 ? 135 PRO A CG    1 
ATOM   1002 C  CD    . PRO A 1 138 ? -16.666 30.286 -18.694 1.00 116.56 ? 135 PRO A CD    1 
ATOM   1003 N  N     . SER A 1 139 ? -16.395 31.852 -14.275 1.00 116.47 ? 136 SER A N     1 
ATOM   1004 C  CA    . SER A 1 139 ? -15.597 32.444 -13.222 1.00 117.68 ? 136 SER A CA    1 
ATOM   1005 C  C     . SER A 1 139 ? -15.485 31.469 -12.044 1.00 119.10 ? 136 SER A C     1 
ATOM   1006 O  O     . SER A 1 139 ? -16.494 30.899 -11.610 1.00 118.70 ? 136 SER A O     1 
ATOM   1007 C  CB    . SER A 1 139 ? -16.179 33.779 -12.776 1.00 116.01 ? 136 SER A CB    1 
ATOM   1008 O  OG    . SER A 1 139 ? -15.214 34.510 -12.037 1.00 117.05 ? 136 SER A OG    1 
ATOM   1009 N  N     . GLN A 1 140 ? -14.257 31.261 -11.557 1.00 121.25 ? 137 GLN A N     1 
ATOM   1010 C  CA    . GLN A 1 140 ? -13.959 30.418 -10.379 1.00 122.84 ? 137 GLN A CA    1 
ATOM   1011 C  C     . GLN A 1 140 ? -14.603 29.025 -10.448 1.00 122.80 ? 137 GLN A C     1 
ATOM   1012 O  O     . GLN A 1 140 ? -14.788 28.352 -9.426  1.00 123.40 ? 137 GLN A O     1 
ATOM   1013 C  CB    . GLN A 1 140 ? -14.358 31.122 -9.067  1.00 122.45 ? 137 GLN A CB    1 
ATOM   1014 C  CG    . GLN A 1 140 ? -13.935 32.582 -8.931  1.00 123.84 ? 137 GLN A CG    1 
ATOM   1015 C  CD    . GLN A 1 140 ? -12.497 32.744 -8.496  1.00 128.29 ? 137 GLN A CD    1 
ATOM   1016 O  OE1   . GLN A 1 140 ? -11.922 31.853 -7.872  1.00 131.06 ? 137 GLN A OE1   1 
ATOM   1017 N  NE2   . GLN A 1 140 ? -11.907 33.894 -8.815  1.00 129.44 ? 137 GLN A NE2   1 
ATOM   1018 N  N     . GLY A 1 141 ? -14.946 28.603 -11.660 1.00 122.20 ? 138 GLY A N     1 
ATOM   1019 C  CA    . GLY A 1 141 ? -15.540 27.293 -11.872 1.00 122.05 ? 138 GLY A CA    1 
ATOM   1020 C  C     . GLY A 1 141 ? -17.051 27.280 -11.812 1.00 119.86 ? 138 GLY A C     1 
ATOM   1021 O  O     . GLY A 1 141 ? -17.663 26.218 -11.910 1.00 120.39 ? 138 GLY A O     1 
ATOM   1022 N  N     . TYR A 1 142 ? -17.651 28.457 -11.657 1.00 117.52 ? 139 TYR A N     1 
ATOM   1023 C  CA    . TYR A 1 142 ? -19.102 28.591 -11.597 1.00 115.21 ? 139 TYR A CA    1 
ATOM   1024 C  C     . TYR A 1 142 ? -19.667 29.052 -12.936 1.00 113.13 ? 139 TYR A C     1 
ATOM   1025 O  O     . TYR A 1 142 ? -19.011 29.777 -13.670 1.00 113.17 ? 139 TYR A O     1 
ATOM   1026 C  CB    . TYR A 1 142 ? -19.484 29.570 -10.496 1.00 114.61 ? 139 TYR A CB    1 
ATOM   1027 C  CG    . TYR A 1 142 ? -19.267 29.040 -9.099  1.00 117.13 ? 139 TYR A CG    1 
ATOM   1028 C  CD1   . TYR A 1 142 ? -20.338 28.571 -8.344  1.00 118.12 ? 139 TYR A CD1   1 
ATOM   1029 C  CD2   . TYR A 1 142 ? -17.994 29.013 -8.527  1.00 119.94 ? 139 TYR A CD2   1 
ATOM   1030 C  CE1   . TYR A 1 142 ? -20.152 28.091 -7.055  1.00 120.23 ? 139 TYR A CE1   1 
ATOM   1031 C  CE2   . TYR A 1 142 ? -17.797 28.529 -7.236  1.00 122.04 ? 139 TYR A CE2   1 
ATOM   1032 C  CZ    . TYR A 1 142 ? -18.883 28.072 -6.509  1.00 122.06 ? 139 TYR A CZ    1 
ATOM   1033 O  OH    . TYR A 1 142 ? -18.709 27.589 -5.236  1.00 124.54 ? 139 TYR A OH    1 
ATOM   1034 N  N     . LEU A 1 143 ? -20.887 28.638 -13.254 1.00 111.07 ? 140 LEU A N     1 
ATOM   1035 C  CA    . LEU A 1 143 ? -21.456 28.938 -14.566 1.00 109.01 ? 140 LEU A CA    1 
ATOM   1036 C  C     . LEU A 1 143 ? -22.823 29.613 -14.529 1.00 106.47 ? 140 LEU A C     1 
ATOM   1037 O  O     . LEU A 1 143 ? -23.167 30.360 -15.440 1.00 105.69 ? 140 LEU A O     1 
ATOM   1038 C  CB    . LEU A 1 143 ? -21.542 27.669 -15.420 1.00 110.17 ? 140 LEU A CB    1 
ATOM   1039 C  CG    . LEU A 1 143 ? -20.276 26.987 -15.939 1.00 111.49 ? 140 LEU A CG    1 
ATOM   1040 C  CD1   . LEU A 1 143 ? -20.589 25.546 -16.315 1.00 112.62 ? 140 LEU A CD1   1 
ATOM   1041 C  CD2   . LEU A 1 143 ? -19.683 27.733 -17.119 1.00 111.42 ? 140 LEU A CD2   1 
ATOM   1042 N  N     . TYR A 1 144 ? -23.615 29.332 -13.503 1.00 104.69 ? 141 TYR A N     1 
ATOM   1043 C  CA    . TYR A 1 144 ? -24.959 29.894 -13.434 1.00 102.30 ? 141 TYR A CA    1 
ATOM   1044 C  C     . TYR A 1 144 ? -25.183 30.726 -12.170 1.00 100.73 ? 141 TYR A C     1 
ATOM   1045 O  O     . TYR A 1 144 ? -24.483 30.570 -11.166 1.00 101.16 ? 141 TYR A O     1 
ATOM   1046 C  CB    . TYR A 1 144 ? -26.021 28.794 -13.526 1.00 102.63 ? 141 TYR A CB    1 
ATOM   1047 C  CG    . TYR A 1 144 ? -26.011 27.978 -14.797 1.00 103.21 ? 141 TYR A CG    1 
ATOM   1048 C  CD1   . TYR A 1 144 ? -26.982 28.160 -15.773 1.00 102.50 ? 141 TYR A CD1   1 
ATOM   1049 C  CD2   . TYR A 1 144 ? -25.048 26.990 -15.002 1.00 105.24 ? 141 TYR A CD2   1 
ATOM   1050 C  CE1   . TYR A 1 144 ? -26.983 27.392 -16.935 1.00 104.21 ? 141 TYR A CE1   1 
ATOM   1051 C  CE2   . TYR A 1 144 ? -25.031 26.223 -16.159 1.00 106.41 ? 141 TYR A CE2   1 
ATOM   1052 C  CZ    . TYR A 1 144 ? -26.000 26.428 -17.122 1.00 105.98 ? 141 TYR A CZ    1 
ATOM   1053 O  OH    . TYR A 1 144 ? -25.975 25.664 -18.264 1.00 106.84 ? 141 TYR A OH    1 
ATOM   1054 N  N     . VAL A 1 145 ? -26.163 31.619 -12.233 1.00 98.42  ? 142 VAL A N     1 
ATOM   1055 C  CA    . VAL A 1 145 ? -26.575 32.376 -11.062 1.00 96.79  ? 142 VAL A CA    1 
ATOM   1056 C  C     . VAL A 1 145 ? -28.023 32.017 -10.733 1.00 95.92  ? 142 VAL A C     1 
ATOM   1057 O  O     . VAL A 1 145 ? -28.883 31.989 -11.627 1.00 95.80  ? 142 VAL A O     1 
ATOM   1058 C  CB    . VAL A 1 145 ? -26.447 33.902 -11.275 1.00 95.83  ? 142 VAL A CB    1 
ATOM   1059 C  CG1   . VAL A 1 145 ? -26.948 34.649 -10.048 1.00 95.50  ? 142 VAL A CG1   1 
ATOM   1060 C  CG2   . VAL A 1 145 ? -25.015 34.281 -11.557 1.00 95.82  ? 142 VAL A CG2   1 
ATOM   1061 N  N     . LEU A 1 146 ? -28.281 31.712 -9.463  1.00 94.99  ? 143 LEU A N     1 
ATOM   1062 C  CA    . LEU A 1 146 ? -29.639 31.549 -8.996  1.00 93.72  ? 143 LEU A CA    1 
ATOM   1063 C  C     . LEU A 1 146 ? -30.111 32.882 -8.452  1.00 92.52  ? 143 LEU A C     1 
ATOM   1064 O  O     . LEU A 1 146 ? -29.523 33.427 -7.525  1.00 92.88  ? 143 LEU A O     1 
ATOM   1065 C  CB    . LEU A 1 146 ? -29.740 30.472 -7.925  1.00 94.50  ? 143 LEU A CB    1 
ATOM   1066 C  CG    . LEU A 1 146 ? -31.123 30.331 -7.281  1.00 93.95  ? 143 LEU A CG    1 
ATOM   1067 C  CD1   . LEU A 1 146 ? -32.155 29.814 -8.270  1.00 93.30  ? 143 LEU A CD1   1 
ATOM   1068 C  CD2   . LEU A 1 146 ? -31.044 29.417 -6.093  1.00 94.42  ? 143 LEU A CD2   1 
ATOM   1069 N  N     . VAL A 1 147 ? -31.178 33.397 -9.043  1.00 91.20  ? 144 VAL A N     1 
ATOM   1070 C  CA    . VAL A 1 147 ? -31.730 34.676 -8.664  1.00 89.66  ? 144 VAL A CA    1 
ATOM   1071 C  C     . VAL A 1 147 ? -33.034 34.419 -7.966  1.00 89.60  ? 144 VAL A C     1 
ATOM   1072 O  O     . VAL A 1 147 ? -33.917 33.763 -8.515  1.00 89.79  ? 144 VAL A O     1 
ATOM   1073 C  CB    . VAL A 1 147 ? -31.991 35.549 -9.895  1.00 88.92  ? 144 VAL A CB    1 
ATOM   1074 C  CG1   . VAL A 1 147 ? -32.562 36.888 -9.487  1.00 87.93  ? 144 VAL A CG1   1 
ATOM   1075 C  CG2   . VAL A 1 147 ? -30.707 35.732 -10.680 1.00 88.71  ? 144 VAL A CG2   1 
ATOM   1076 N  N     . VAL A 1 148 ? -33.142 34.948 -6.754  1.00 89.32  ? 145 VAL A N     1 
ATOM   1077 C  CA    . VAL A 1 148 ? -34.358 34.870 -5.954  1.00 89.31  ? 145 VAL A CA    1 
ATOM   1078 C  C     . VAL A 1 148 ? -34.884 36.283 -5.705  1.00 88.67  ? 145 VAL A C     1 
ATOM   1079 O  O     . VAL A 1 148 ? -34.163 37.114 -5.174  1.00 88.69  ? 145 VAL A O     1 
ATOM   1080 C  CB    . VAL A 1 148 ? -34.052 34.222 -4.595  1.00 90.15  ? 145 VAL A CB    1 
ATOM   1081 C  CG1   . VAL A 1 148 ? -35.319 34.018 -3.824  1.00 90.88  ? 145 VAL A CG1   1 
ATOM   1082 C  CG2   . VAL A 1 148 ? -33.317 32.905 -4.775  1.00 90.22  ? 145 VAL A CG2   1 
ATOM   1083 N  N     . VAL A 1 149 ? -36.122 36.571 -6.083  1.00 88.57  ? 146 VAL A N     1 
ATOM   1084 C  CA    . VAL A 1 149 ? -36.678 37.906 -5.832  1.00 88.61  ? 146 VAL A CA    1 
ATOM   1085 C  C     . VAL A 1 149 ? -37.893 37.869 -4.918  1.00 89.98  ? 146 VAL A C     1 
ATOM   1086 O  O     . VAL A 1 149 ? -38.824 37.086 -5.136  1.00 90.81  ? 146 VAL A O     1 
ATOM   1087 C  CB    . VAL A 1 149 ? -37.129 38.598 -7.117  1.00 87.82  ? 146 VAL A CB    1 
ATOM   1088 C  CG1   . VAL A 1 149 ? -37.462 40.055 -6.836  1.00 87.56  ? 146 VAL A CG1   1 
ATOM   1089 C  CG2   . VAL A 1 149 ? -36.075 38.495 -8.174  1.00 87.41  ? 146 VAL A CG2   1 
ATOM   1090 N  N     . ASP A 1 150 ? -37.914 38.725 -3.904  1.00 90.71  ? 147 ASP A N     1 
ATOM   1091 C  CA    . ASP A 1 150 ? -39.117 38.807 -3.106  1.00 92.30  ? 147 ASP A CA    1 
ATOM   1092 C  C     . ASP A 1 150 ? -40.161 39.589 -3.880  1.00 92.33  ? 147 ASP A C     1 
ATOM   1093 O  O     . ASP A 1 150 ? -39.941 40.739 -4.251  1.00 91.68  ? 147 ASP A O     1 
ATOM   1094 C  CB    . ASP A 1 150 ? -38.886 39.425 -1.734  1.00 92.90  ? 147 ASP A CB    1 
ATOM   1095 C  CG    . ASP A 1 150 ? -40.192 39.777 -1.042  1.00 94.85  ? 147 ASP A CG    1 
ATOM   1096 O  OD1   . ASP A 1 150 ? -40.999 38.865 -0.703  1.00 96.29  ? 147 ASP A OD1   1 
ATOM   1097 O  OD2   . ASP A 1 150 ? -40.419 40.987 -0.869  1.00 95.59  ? 147 ASP A OD2   1 
ATOM   1098 N  N     . GLY A 1 151 ? -41.291 38.932 -4.128  1.00 93.37  ? 148 GLY A N     1 
ATOM   1099 C  CA    . GLY A 1 151 ? -42.406 39.519 -4.850  1.00 93.54  ? 148 GLY A CA    1 
ATOM   1100 C  C     . GLY A 1 151 ? -42.876 40.843 -4.290  1.00 93.91  ? 148 GLY A C     1 
ATOM   1101 O  O     . GLY A 1 151 ? -43.178 41.753 -5.044  1.00 93.71  ? 148 GLY A O     1 
ATOM   1102 N  N     . MET A 1 152 ? -42.945 40.967 -2.972  1.00 94.83  ? 149 MET A N     1 
ATOM   1103 C  CA    . MET A 1 152 ? -43.458 42.197 -2.395  1.00 95.61  ? 149 MET A CA    1 
ATOM   1104 C  C     . MET A 1 152 ? -42.482 43.356 -2.588  1.00 94.61  ? 149 MET A C     1 
ATOM   1105 O  O     . MET A 1 152 ? -42.800 44.335 -3.265  1.00 94.66  ? 149 MET A O     1 
ATOM   1106 C  CB    . MET A 1 152 ? -43.797 42.004 -0.918  1.00 97.00  ? 149 MET A CB    1 
ATOM   1107 C  CG    . MET A 1 152 ? -44.684 43.094 -0.324  1.00 99.01  ? 149 MET A CG    1 
ATOM   1108 S  SD    . MET A 1 152 ? -43.853 44.613 0.217   1.00 101.18 ? 149 MET A SD    1 
ATOM   1109 C  CE    . MET A 1 152 ? -44.297 45.777 -1.074  1.00 100.12 ? 149 MET A CE    1 
ATOM   1110 N  N     . THR A 1 153 ? -41.298 43.222 -2.002  1.00 94.16  ? 150 THR A N     1 
ATOM   1111 C  CA    . THR A 1 153 ? -40.312 44.296 -1.917  1.00 93.44  ? 150 THR A CA    1 
ATOM   1112 C  C     . THR A 1 153 ? -39.458 44.444 -3.175  1.00 92.68  ? 150 THR A C     1 
ATOM   1113 O  O     . THR A 1 153 ? -38.907 45.519 -3.457  1.00 92.31  ? 150 THR A O     1 
ATOM   1114 C  CB    . THR A 1 153 ? -39.344 43.996 -0.794  1.00 93.50  ? 150 THR A CB    1 
ATOM   1115 O  OG1   . THR A 1 153 ? -38.845 42.665 -0.974  1.00 92.60  ? 150 THR A OG1   1 
ATOM   1116 C  CG2   . THR A 1 153 ? -40.043 44.096 0.539   1.00 94.50  ? 150 THR A CG2   1 
ATOM   1117 N  N     . GLY A 1 154 ? -39.327 43.351 -3.918  1.00 92.65  ? 151 GLY A N     1 
ATOM   1118 C  CA    . GLY A 1 154 ? -38.388 43.295 -5.025  1.00 91.43  ? 151 GLY A CA    1 
ATOM   1119 C  C     . GLY A 1 154 ? -36.977 43.000 -4.540  1.00 90.94  ? 151 GLY A C     1 
ATOM   1120 O  O     . GLY A 1 154 ? -36.055 43.010 -5.337  1.00 90.96  ? 151 GLY A O     1 
ATOM   1121 N  N     . PHE A 1 155 ? -36.795 42.743 -3.243  1.00 90.98  ? 152 PHE A N     1 
ATOM   1122 C  CA    . PHE A 1 155 ? -35.467 42.434 -2.688  1.00 90.25  ? 152 PHE A CA    1 
ATOM   1123 C  C     . PHE A 1 155 ? -34.918 41.153 -3.302  1.00 89.70  ? 152 PHE A C     1 
ATOM   1124 O  O     . PHE A 1 155 ? -35.655 40.195 -3.504  1.00 89.90  ? 152 PHE A O     1 
ATOM   1125 C  CB    . PHE A 1 155 ? -35.549 42.289 -1.165  1.00 91.41  ? 152 PHE A CB    1 
ATOM   1126 C  CG    . PHE A 1 155 ? -34.237 42.469 -0.458  1.00 90.60  ? 152 PHE A CG    1 
ATOM   1127 C  CD1   . PHE A 1 155 ? -33.870 43.713 0.032   1.00 89.60  ? 152 PHE A CD1   1 
ATOM   1128 C  CD2   . PHE A 1 155 ? -33.380 41.390 -0.263  1.00 90.66  ? 152 PHE A CD2   1 
ATOM   1129 C  CE1   . PHE A 1 155 ? -32.662 43.886 0.689   1.00 90.20  ? 152 PHE A CE1   1 
ATOM   1130 C  CE2   . PHE A 1 155 ? -32.166 41.549 0.393   1.00 91.02  ? 152 PHE A CE2   1 
ATOM   1131 C  CZ    . PHE A 1 155 ? -31.801 42.800 0.869   1.00 91.01  ? 152 PHE A CZ    1 
ATOM   1132 N  N     . THR A 1 156 ? -33.625 41.137 -3.589  1.00 89.10  ? 153 THR A N     1 
ATOM   1133 C  CA    . THR A 1 156 ? -33.046 40.062 -4.385  1.00 89.05  ? 153 THR A CA    1 
ATOM   1134 C  C     . THR A 1 156 ? -31.822 39.388 -3.778  1.00 89.48  ? 153 THR A C     1 
ATOM   1135 O  O     . THR A 1 156 ? -30.920 40.052 -3.273  1.00 89.69  ? 153 THR A O     1 
ATOM   1136 C  CB    . THR A 1 156 ? -32.706 40.562 -5.800  1.00 88.30  ? 153 THR A CB    1 
ATOM   1137 O  OG1   . THR A 1 156 ? -33.904 40.615 -6.577  1.00 88.85  ? 153 THR A OG1   1 
ATOM   1138 C  CG2   . THR A 1 156 ? -31.754 39.626 -6.494  1.00 88.49  ? 153 THR A CG2   1 
ATOM   1139 N  N     . TRP A 1 157 ? -31.804 38.060 -3.846  1.00 89.91  ? 154 TRP A N     1 
ATOM   1140 C  CA    . TRP A 1 157 ? -30.656 37.278 -3.438  1.00 90.69  ? 154 TRP A CA    1 
ATOM   1141 C  C     . TRP A 1 157 ? -30.054 36.568 -4.628  1.00 90.80  ? 154 TRP A C     1 
ATOM   1142 O  O     . TRP A 1 157 ? -30.789 36.023 -5.461  1.00 90.53  ? 154 TRP A O     1 
ATOM   1143 C  CB    . TRP A 1 157 ? -31.068 36.239 -2.428  1.00 91.72  ? 154 TRP A CB    1 
ATOM   1144 C  CG    . TRP A 1 157 ? -31.415 36.804 -1.118  1.00 92.53  ? 154 TRP A CG    1 
ATOM   1145 C  CD1   . TRP A 1 157 ? -30.571 37.007 -0.065  1.00 93.61  ? 154 TRP A CD1   1 
ATOM   1146 C  CD2   . TRP A 1 157 ? -32.710 37.234 -0.687  1.00 92.30  ? 154 TRP A CD2   1 
ATOM   1147 N  NE1   . TRP A 1 157 ? -31.261 37.538 0.997   1.00 93.90  ? 154 TRP A NE1   1 
ATOM   1148 C  CE2   . TRP A 1 157 ? -32.575 37.692 0.641   1.00 92.57  ? 154 TRP A CE2   1 
ATOM   1149 C  CE3   . TRP A 1 157 ? -33.974 37.274 -1.294  1.00 91.29  ? 154 TRP A CE3   1 
ATOM   1150 C  CZ2   . TRP A 1 157 ? -33.647 38.183 1.370   1.00 91.63  ? 154 TRP A CZ2   1 
ATOM   1151 C  CZ3   . TRP A 1 157 ? -35.037 37.769 -0.569  1.00 91.09  ? 154 TRP A CZ3   1 
ATOM   1152 C  CH2   . TRP A 1 157 ? -34.866 38.215 0.752   1.00 91.79  ? 154 TRP A CH2   1 
ATOM   1153 N  N     . LEU A 1 158 ? -28.717 36.568 -4.686  1.00 91.39  ? 155 LEU A N     1 
ATOM   1154 C  CA    . LEU A 1 158 ? -27.953 35.963 -5.782  1.00 91.60  ? 155 LEU A CA    1 
ATOM   1155 C  C     . LEU A 1 158 ? -27.060 34.870 -5.267  1.00 92.87  ? 155 LEU A C     1 
ATOM   1156 O  O     . LEU A 1 158 ? -26.478 34.992 -4.201  1.00 93.59  ? 155 LEU A O     1 
ATOM   1157 C  CB    . LEU A 1 158 ? -27.100 37.010 -6.490  1.00 91.08  ? 155 LEU A CB    1 
ATOM   1158 C  CG    . LEU A 1 158 ? -27.857 38.245 -6.982  1.00 90.59  ? 155 LEU A CG    1 
ATOM   1159 C  CD1   . LEU A 1 158 ? -26.933 39.211 -7.727  1.00 90.52  ? 155 LEU A CD1   1 
ATOM   1160 C  CD2   . LEU A 1 158 ? -29.030 37.828 -7.863  1.00 90.51  ? 155 LEU A CD2   1 
ATOM   1161 N  N     . TYR A 1 159 ? -26.962 33.795 -6.033  1.00 93.72  ? 156 TYR A N     1 
ATOM   1162 C  CA    . TYR A 1 159 ? -26.176 32.636 -5.638  1.00 95.65  ? 156 TYR A CA    1 
ATOM   1163 C  C     . TYR A 1 159 ? -25.502 32.023 -6.857  1.00 96.58  ? 156 TYR A C     1 
ATOM   1164 O  O     . TYR A 1 159 ? -26.195 31.591 -7.790  1.00 96.55  ? 156 TYR A O     1 
ATOM   1165 C  CB    . TYR A 1 159 ? -27.071 31.586 -4.987  1.00 96.15  ? 156 TYR A CB    1 
ATOM   1166 C  CG    . TYR A 1 159 ? -27.714 32.052 -3.723  1.00 96.07  ? 156 TYR A CG    1 
ATOM   1167 C  CD1   . TYR A 1 159 ? -27.076 31.897 -2.507  1.00 97.03  ? 156 TYR A CD1   1 
ATOM   1168 C  CD2   . TYR A 1 159 ? -28.952 32.661 -3.741  1.00 95.77  ? 156 TYR A CD2   1 
ATOM   1169 C  CE1   . TYR A 1 159 ? -27.653 32.333 -1.333  1.00 97.51  ? 156 TYR A CE1   1 
ATOM   1170 C  CE2   . TYR A 1 159 ? -29.543 33.098 -2.569  1.00 96.95  ? 156 TYR A CE2   1 
ATOM   1171 C  CZ    . TYR A 1 159 ? -28.888 32.928 -1.369  1.00 97.59  ? 156 TYR A CZ    1 
ATOM   1172 O  OH    . TYR A 1 159 ? -29.473 33.358 -0.204  1.00 99.02  ? 156 TYR A OH    1 
ATOM   1173 N  N     . PRO A 1 160 ? -24.151 31.982 -6.863  1.00 97.69  ? 157 PRO A N     1 
ATOM   1174 C  CA    . PRO A 1 160 ? -23.411 31.353 -7.964  1.00 98.41  ? 157 PRO A CA    1 
ATOM   1175 C  C     . PRO A 1 160 ? -23.568 29.838 -7.895  1.00 99.93  ? 157 PRO A C     1 
ATOM   1176 O  O     . PRO A 1 160 ? -23.480 29.279 -6.808  1.00 100.92 ? 157 PRO A O     1 
ATOM   1177 C  CB    . PRO A 1 160 ? -21.953 31.738 -7.684  1.00 98.83  ? 157 PRO A CB    1 
ATOM   1178 C  CG    . PRO A 1 160 ? -21.977 32.689 -6.535  1.00 98.46  ? 157 PRO A CG    1 
ATOM   1179 C  CD    . PRO A 1 160 ? -23.253 32.471 -5.804  1.00 98.23  ? 157 PRO A CD    1 
ATOM   1180 N  N     . THR A 1 161 ? -23.841 29.186 -9.023  1.00 100.61 ? 158 THR A N     1 
ATOM   1181 C  CA    . THR A 1 161 ? -23.885 27.710 -9.069  1.00 102.57 ? 158 THR A CA    1 
ATOM   1182 C  C     . THR A 1 161 ? -23.112 27.145 -10.267 1.00 104.02 ? 158 THR A C     1 
ATOM   1183 O  O     . THR A 1 161 ? -22.873 27.842 -11.259 1.00 103.57 ? 158 THR A O     1 
ATOM   1184 C  CB    . THR A 1 161 ? -25.338 27.105 -9.042  1.00 102.20 ? 158 THR A CB    1 
ATOM   1185 O  OG1   . THR A 1 161 ? -25.878 27.029 -10.369 1.00 101.01 ? 158 THR A OG1   1 
ATOM   1186 C  CG2   . THR A 1 161 ? -26.281 27.890 -8.124  1.00 100.95 ? 158 THR A CG2   1 
ATOM   1187 N  N     . LYS A 1 162 ? -22.729 25.877 -10.171 1.00 106.14 ? 159 LYS A N     1 
ATOM   1188 C  CA    . LYS A 1 162 ? -21.970 25.246 -11.235 1.00 107.92 ? 159 LYS A CA    1 
ATOM   1189 C  C     . LYS A 1 162 ? -22.896 24.636 -12.285 1.00 107.73 ? 159 LYS A C     1 
ATOM   1190 O  O     . LYS A 1 162 ? -22.477 24.392 -13.416 1.00 108.45 ? 159 LYS A O     1 
ATOM   1191 C  CB    . LYS A 1 162 ? -21.003 24.204 -10.667 1.00 110.20 ? 159 LYS A CB    1 
ATOM   1192 C  CG    . LYS A 1 162 ? -20.021 24.764 -9.635  1.00 112.79 ? 159 LYS A CG    1 
ATOM   1193 C  CD    . LYS A 1 162 ? -18.982 23.734 -9.200  1.00 118.22 ? 159 LYS A CD    1 
ATOM   1194 C  CE    . LYS A 1 162 ? -17.999 24.351 -8.211  1.00 120.66 ? 159 LYS A CE    1 
ATOM   1195 N  NZ    . LYS A 1 162 ? -16.696 23.633 -8.229  1.00 124.37 ? 159 LYS A NZ    1 
ATOM   1196 N  N     . ALA A 1 163 ? -24.153 24.401 -11.908 1.00 107.20 ? 160 ALA A N     1 
ATOM   1197 C  CA    . ALA A 1 163 ? -25.160 23.836 -12.810 1.00 107.10 ? 160 ALA A CA    1 
ATOM   1198 C  C     . ALA A 1 163 ? -26.557 24.240 -12.347 1.00 106.20 ? 160 ALA A C     1 
ATOM   1199 O  O     . ALA A 1 163 ? -26.765 24.439 -11.155 1.00 106.29 ? 160 ALA A O     1 
ATOM   1200 C  CB    . ALA A 1 163 ? -25.039 22.326 -12.853 1.00 108.64 ? 160 ALA A CB    1 
ATOM   1201 N  N     . PRO A 1 164 ? -27.527 24.361 -13.278 1.00 105.74 ? 161 PRO A N     1 
ATOM   1202 C  CA    . PRO A 1 164 ? -28.865 24.771 -12.839 1.00 105.01 ? 161 PRO A CA    1 
ATOM   1203 C  C     . PRO A 1 164 ? -29.634 23.582 -12.286 1.00 106.17 ? 161 PRO A C     1 
ATOM   1204 O  O     . PRO A 1 164 ? -30.636 23.168 -12.875 1.00 106.40 ? 161 PRO A O     1 
ATOM   1205 C  CB    . PRO A 1 164 ? -29.517 25.275 -14.130 1.00 104.38 ? 161 PRO A CB    1 
ATOM   1206 C  CG    . PRO A 1 164 ? -28.749 24.626 -15.262 1.00 104.89 ? 161 PRO A CG    1 
ATOM   1207 C  CD    . PRO A 1 164 ? -27.499 24.007 -14.711 1.00 106.00 ? 161 PRO A CD    1 
ATOM   1208 N  N     . SER A 1 165 ? -29.158 23.050 -11.159 1.00 107.12 ? 162 SER A N     1 
ATOM   1209 C  CA    . SER A 1 165 ? -29.582 21.736 -10.664 1.00 108.71 ? 162 SER A CA    1 
ATOM   1210 C  C     . SER A 1 165 ? -30.397 21.799 -9.378  1.00 108.82 ? 162 SER A C     1 
ATOM   1211 O  O     . SER A 1 165 ? -30.261 22.740 -8.589  1.00 108.16 ? 162 SER A O     1 
ATOM   1212 C  CB    . SER A 1 165 ? -28.363 20.830 -10.452 1.00 110.18 ? 162 SER A CB    1 
ATOM   1213 O  OG    . SER A 1 165 ? -27.504 21.350 -9.445  1.00 110.04 ? 162 SER A OG    1 
ATOM   1214 N  N     . THR A 1 166 ? -31.231 20.780 -9.171  1.00 109.71 ? 163 THR A N     1 
ATOM   1215 C  CA    . THR A 1 166 ? -32.021 20.674 -7.956  1.00 109.95 ? 163 THR A CA    1 
ATOM   1216 C  C     . THR A 1 166 ? -31.100 20.752 -6.754  1.00 110.32 ? 163 THR A C     1 
ATOM   1217 O  O     . THR A 1 166 ? -31.332 21.540 -5.840  1.00 109.89 ? 163 THR A O     1 
ATOM   1218 C  CB    . THR A 1 166 ? -32.794 19.355 -7.890  1.00 111.47 ? 163 THR A CB    1 
ATOM   1219 O  OG1   . THR A 1 166 ? -33.496 19.143 -9.122  1.00 111.79 ? 163 THR A OG1   1 
ATOM   1220 C  CG2   . THR A 1 166 ? -33.779 19.384 -6.737  1.00 111.81 ? 163 THR A CG2   1 
ATOM   1221 N  N     . SER A 1 167 ? -30.039 19.950 -6.779  1.00 111.30 ? 164 SER A N     1 
ATOM   1222 C  CA    . SER A 1 167 ? -29.148 19.822 -5.630  1.00 112.22 ? 164 SER A CA    1 
ATOM   1223 C  C     . SER A 1 167 ? -28.578 21.173 -5.207  1.00 110.48 ? 164 SER A C     1 
ATOM   1224 O  O     . SER A 1 167 ? -28.659 21.542 -4.040  1.00 111.00 ? 164 SER A O     1 
ATOM   1225 C  CB    . SER A 1 167 ? -28.033 18.803 -5.898  1.00 113.88 ? 164 SER A CB    1 
ATOM   1226 O  OG    . SER A 1 167 ? -27.068 19.322 -6.797  1.00 114.21 ? 164 SER A OG    1 
ATOM   1227 N  N     . ALA A 1 168 ? -28.040 21.916 -6.166  1.00 108.65 ? 165 ALA A N     1 
ATOM   1228 C  CA    . ALA A 1 168 ? -27.486 23.246 -5.903  1.00 106.73 ? 165 ALA A CA    1 
ATOM   1229 C  C     . ALA A 1 168 ? -28.540 24.284 -5.495  1.00 104.78 ? 165 ALA A C     1 
ATOM   1230 O  O     . ALA A 1 168 ? -28.241 25.190 -4.712  1.00 104.32 ? 165 ALA A O     1 
ATOM   1231 C  CB    . ALA A 1 168 ? -26.699 23.742 -7.117  1.00 106.17 ? 165 ALA A CB    1 
ATOM   1232 N  N     . THR A 1 169 ? -29.756 24.154 -6.033  1.00 103.22 ? 166 THR A N     1 
ATOM   1233 C  CA    . THR A 1 169 ? -30.853 25.062 -5.705  1.00 101.04 ? 166 THR A CA    1 
ATOM   1234 C  C     . THR A 1 169 ? -31.201 24.924 -4.235  1.00 101.76 ? 166 THR A C     1 
ATOM   1235 O  O     . THR A 1 169 ? -31.428 25.915 -3.537  1.00 101.08 ? 166 THR A O     1 
ATOM   1236 C  CB    . THR A 1 169 ? -32.099 24.748 -6.512  1.00 100.54 ? 166 THR A CB    1 
ATOM   1237 O  OG1   . THR A 1 169 ? -31.747 24.612 -7.886  1.00 99.33  ? 166 THR A OG1   1 
ATOM   1238 C  CG2   . THR A 1 169 ? -33.109 25.854 -6.370  1.00 98.99  ? 166 THR A CG2   1 
ATOM   1239 N  N     . VAL A 1 170 ? -31.232 23.678 -3.776  1.00 102.91 ? 167 VAL A N     1 
ATOM   1240 C  CA    . VAL A 1 170 ? -31.507 23.360 -2.380  1.00 103.83 ? 167 VAL A CA    1 
ATOM   1241 C  C     . VAL A 1 170 ? -30.439 23.954 -1.455  1.00 103.82 ? 167 VAL A C     1 
ATOM   1242 O  O     . VAL A 1 170 ? -30.778 24.613 -0.468  1.00 103.58 ? 167 VAL A O     1 
ATOM   1243 C  CB    . VAL A 1 170 ? -31.638 21.834 -2.180  1.00 105.55 ? 167 VAL A CB    1 
ATOM   1244 C  CG1   . VAL A 1 170 ? -31.670 21.483 -0.709  1.00 107.35 ? 167 VAL A CG1   1 
ATOM   1245 C  CG2   . VAL A 1 170 ? -32.885 21.323 -2.872  1.00 105.27 ? 167 VAL A CG2   1 
ATOM   1246 N  N     . LYS A 1 171 ? -29.165 23.728 -1.797  1.00 103.94 ? 168 LYS A N     1 
ATOM   1247 C  CA    . LYS A 1 171 ? -28.024 24.257 -1.046  1.00 104.19 ? 168 LYS A CA    1 
ATOM   1248 C  C     . LYS A 1 171 ? -28.176 25.753 -0.847  1.00 102.38 ? 168 LYS A C     1 
ATOM   1249 O  O     . LYS A 1 171 ? -28.131 26.243 0.286   1.00 102.81 ? 168 LYS A O     1 
ATOM   1250 C  CB    . LYS A 1 171 ? -26.707 23.983 -1.769  1.00 104.50 ? 168 LYS A CB    1 
ATOM   1251 C  CG    . LYS A 1 171 ? -26.394 22.519 -1.979  1.00 108.28 ? 168 LYS A CG    1 
ATOM   1252 C  CD    . LYS A 1 171 ? -24.906 22.294 -2.259  1.00 112.58 ? 168 LYS A CD    1 
ATOM   1253 C  CE    . LYS A 1 171 ? -24.695 21.090 -3.190  1.00 115.30 ? 168 LYS A CE    1 
ATOM   1254 N  NZ    . LYS A 1 171 ? -23.545 20.228 -2.763  1.00 118.47 ? 168 LYS A NZ    1 
ATOM   1255 N  N     . SER A 1 172 ? -28.369 26.467 -1.957  1.00 100.38 ? 169 SER A N     1 
ATOM   1256 C  CA    . SER A 1 172 ? -28.565 27.915 -1.944  1.00 98.55  ? 169 SER A CA    1 
ATOM   1257 C  C     . SER A 1 172 ? -29.726 28.331 -1.059  1.00 98.31  ? 169 SER A C     1 
ATOM   1258 O  O     . SER A 1 172 ? -29.568 29.159 -0.165  1.00 98.16  ? 169 SER A O     1 
ATOM   1259 C  CB    . SER A 1 172 ? -28.815 28.434 -3.353  1.00 96.94  ? 169 SER A CB    1 
ATOM   1260 O  OG    . SER A 1 172 ? -27.645 28.340 -4.124  1.00 97.34  ? 169 SER A OG    1 
ATOM   1261 N  N     . LEU A 1 173 ? -30.894 27.747 -1.307  1.00 98.25  ? 170 LEU A N     1 
ATOM   1262 C  CA    . LEU A 1 173 ? -32.103 28.149 -0.594  1.00 98.02  ? 170 LEU A CA    1 
ATOM   1263 C  C     . LEU A 1 173 ? -32.077 27.860 0.910   1.00 99.42  ? 170 LEU A C     1 
ATOM   1264 O  O     . LEU A 1 173 ? -32.658 28.614 1.683   1.00 99.54  ? 170 LEU A O     1 
ATOM   1265 C  CB    . LEU A 1 173 ? -33.359 27.570 -1.254  1.00 97.96  ? 170 LEU A CB    1 
ATOM   1266 C  CG    . LEU A 1 173 ? -33.816 28.225 -2.561  1.00 95.55  ? 170 LEU A CG    1 
ATOM   1267 C  CD1   . LEU A 1 173 ? -35.152 27.652 -2.986  1.00 95.83  ? 170 LEU A CD1   1 
ATOM   1268 C  CD2   . LEU A 1 173 ? -33.934 29.730 -2.414  1.00 93.90  ? 170 LEU A CD2   1 
ATOM   1269 N  N     . ASN A 1 174 ? -31.401 26.787 1.319   1.00 100.49 ? 171 ASN A N     1 
ATOM   1270 C  CA    . ASN A 1 174 ? -31.179 26.530 2.740   1.00 101.95 ? 171 ASN A CA    1 
ATOM   1271 C  C     . ASN A 1 174 ? -30.509 27.700 3.446   1.00 101.34 ? 171 ASN A C     1 
ATOM   1272 O  O     . ASN A 1 174 ? -30.881 28.052 4.560   1.00 102.18 ? 171 ASN A O     1 
ATOM   1273 C  CB    . ASN A 1 174 ? -30.362 25.260 2.947   1.00 103.70 ? 171 ASN A CB    1 
ATOM   1274 C  CG    . ASN A 1 174 ? -31.177 24.012 2.731   1.00 105.52 ? 171 ASN A CG    1 
ATOM   1275 O  OD1   . ASN A 1 174 ? -32.406 24.036 2.814   1.00 106.82 ? 171 ASN A OD1   1 
ATOM   1276 N  ND2   . ASN A 1 174 ? -30.499 22.905 2.454   1.00 107.26 ? 171 ASN A ND2   1 
ATOM   1277 N  N     . VAL A 1 175 ? -29.521 28.302 2.791   1.00 99.94  ? 172 VAL A N     1 
ATOM   1278 C  CA    . VAL A 1 175 ? -28.895 29.516 3.306   1.00 98.98  ? 172 VAL A CA    1 
ATOM   1279 C  C     . VAL A 1 175 ? -29.929 30.643 3.402   1.00 98.02  ? 172 VAL A C     1 
ATOM   1280 O  O     . VAL A 1 175 ? -30.066 31.278 4.443   1.00 98.36  ? 172 VAL A O     1 
ATOM   1281 C  CB    . VAL A 1 175 ? -27.707 29.957 2.420   1.00 97.92  ? 172 VAL A CB    1 
ATOM   1282 C  CG1   . VAL A 1 175 ? -27.320 31.432 2.678   1.00 96.49  ? 172 VAL A CG1   1 
ATOM   1283 C  CG2   . VAL A 1 175 ? -26.536 29.016 2.607   1.00 98.42  ? 172 VAL A CG2   1 
ATOM   1284 N  N     . LEU A 1 176 ? -30.660 30.874 2.313   1.00 96.70  ? 173 LEU A N     1 
ATOM   1285 C  CA    . LEU A 1 176 ? -31.607 31.978 2.254   1.00 95.81  ? 173 LEU A CA    1 
ATOM   1286 C  C     . LEU A 1 176 ? -32.682 31.872 3.342   1.00 97.15  ? 173 LEU A C     1 
ATOM   1287 O  O     . LEU A 1 176 ? -32.924 32.840 4.073   1.00 97.19  ? 173 LEU A O     1 
ATOM   1288 C  CB    . LEU A 1 176 ? -32.225 32.081 0.853   1.00 94.39  ? 173 LEU A CB    1 
ATOM   1289 C  CG    . LEU A 1 176 ? -33.306 33.123 0.539   1.00 93.15  ? 173 LEU A CG    1 
ATOM   1290 C  CD1   . LEU A 1 176 ? -33.065 34.470 1.201   1.00 92.40  ? 173 LEU A CD1   1 
ATOM   1291 C  CD2   . LEU A 1 176 ? -33.370 33.292 -0.957  1.00 92.09  ? 173 LEU A CD2   1 
ATOM   1292 N  N     . THR A 1 177 ? -33.296 30.695 3.464   1.00 98.35  ? 174 THR A N     1 
ATOM   1293 C  CA    . THR A 1 177 ? -34.367 30.481 4.431   1.00 99.82  ? 174 THR A CA    1 
ATOM   1294 C  C     . THR A 1 177 ? -33.880 30.449 5.868   1.00 101.94 ? 174 THR A C     1 
ATOM   1295 O  O     . THR A 1 177 ? -34.683 30.350 6.787   1.00 103.20 ? 174 THR A O     1 
ATOM   1296 C  CB    . THR A 1 177 ? -35.131 29.205 4.151   1.00 100.52 ? 174 THR A CB    1 
ATOM   1297 O  OG1   . THR A 1 177 ? -34.212 28.203 3.714   1.00 101.22 ? 174 THR A OG1   1 
ATOM   1298 C  CG2   . THR A 1 177 ? -36.167 29.439 3.075   1.00 99.39  ? 174 THR A CG2   1 
ATOM   1299 N  N     . SER A 1 178 ? -32.567 30.531 6.062   1.00 102.80 ? 175 SER A N     1 
ATOM   1300 C  CA    . SER A 1 178 ? -32.006 30.773 7.388   1.00 104.86 ? 175 SER A CA    1 
ATOM   1301 C  C     . SER A 1 178 ? -32.511 32.100 7.903   1.00 104.66 ? 175 SER A C     1 
ATOM   1302 O  O     . SER A 1 178 ? -32.675 32.266 9.113   1.00 106.29 ? 175 SER A O     1 
ATOM   1303 C  CB    . SER A 1 178 ? -30.485 30.829 7.350   1.00 104.97 ? 175 SER A CB    1 
ATOM   1304 O  OG    . SER A 1 178 ? -29.948 29.557 7.052   1.00 107.49 ? 175 SER A OG    1 
ATOM   1305 N  N     . ILE A 1 179 ? -32.750 33.039 6.984   1.00 103.12 ? 176 ILE A N     1 
ATOM   1306 C  CA    . ILE A 1 179 ? -33.240 34.364 7.355   1.00 103.10 ? 176 ILE A CA    1 
ATOM   1307 C  C     . ILE A 1 179 ? -34.740 34.321 7.625   1.00 104.01 ? 176 ILE A C     1 
ATOM   1308 O  O     . ILE A 1 179 ? -35.186 34.704 8.717   1.00 105.81 ? 176 ILE A O     1 
ATOM   1309 C  CB    . ILE A 1 179 ? -32.840 35.479 6.350   1.00 101.26 ? 176 ILE A CB    1 
ATOM   1310 C  CG1   . ILE A 1 179 ? -31.390 35.967 6.609   1.00 102.56 ? 176 ILE A CG1   1 
ATOM   1311 C  CG2   . ILE A 1 179 ? -33.759 36.685 6.496   1.00 99.50  ? 176 ILE A CG2   1 
ATOM   1312 C  CD1   . ILE A 1 179 ? -30.205 34.981 6.252   1.00 104.18 ? 176 ILE A CD1   1 
ATOM   1313 N  N     . ALA A 1 180 ? -35.516 33.825 6.665   1.00 103.27 ? 177 ALA A N     1 
ATOM   1314 C  CA    . ALA A 1 180 ? -36.955 33.629 6.885   1.00 103.95 ? 177 ALA A CA    1 
ATOM   1315 C  C     . ALA A 1 180 ? -37.504 32.607 5.917   1.00 103.58 ? 177 ALA A C     1 
ATOM   1316 O  O     . ALA A 1 180 ? -36.841 32.256 4.950   1.00 102.76 ? 177 ALA A O     1 
ATOM   1317 C  CB    . ALA A 1 180 ? -37.695 34.930 6.746   1.00 103.26 ? 177 ALA A CB    1 
ATOM   1318 N  N     . ILE A 1 181 ? -38.710 32.117 6.179   1.00 104.57 ? 178 ILE A N     1 
ATOM   1319 C  CA    . ILE A 1 181 ? -39.324 31.145 5.284   1.00 104.37 ? 178 ILE A CA    1 
ATOM   1320 C  C     . ILE A 1 181 ? -40.512 31.781 4.587   1.00 103.73 ? 178 ILE A C     1 
ATOM   1321 O  O     . ILE A 1 181 ? -41.349 32.401 5.246   1.00 104.30 ? 178 ILE A O     1 
ATOM   1322 C  CB    . ILE A 1 181 ? -39.704 29.827 6.007   1.00 106.44 ? 178 ILE A CB    1 
ATOM   1323 C  CG1   . ILE A 1 181 ? -38.436 29.036 6.330   1.00 107.08 ? 178 ILE A CG1   1 
ATOM   1324 C  CG2   . ILE A 1 181 ? -40.646 28.966 5.160   1.00 106.50 ? 178 ILE A CG2   1 
ATOM   1325 C  CD1   . ILE A 1 181 ? -38.674 27.577 6.678   1.00 109.09 ? 178 ILE A CD1   1 
ATOM   1326 N  N     . PRO A 1 182 ? -40.565 31.648 3.245   1.00 102.46 ? 179 PRO A N     1 
ATOM   1327 C  CA    . PRO A 1 182 ? -41.636 32.184 2.417   1.00 101.85 ? 179 PRO A CA    1 
ATOM   1328 C  C     . PRO A 1 182 ? -42.842 31.273 2.427   1.00 103.34 ? 179 PRO A C     1 
ATOM   1329 O  O     . PRO A 1 182 ? -42.706 30.089 2.713   1.00 104.63 ? 179 PRO A O     1 
ATOM   1330 C  CB    . PRO A 1 182 ? -41.021 32.166 1.025   1.00 100.36 ? 179 PRO A CB    1 
ATOM   1331 C  CG    . PRO A 1 182 ? -40.106 30.988 1.048   1.00 100.56 ? 179 PRO A CG    1 
ATOM   1332 C  CD    . PRO A 1 182 ? -39.535 30.967 2.430   1.00 101.56 ? 179 PRO A CD    1 
ATOM   1333 N  N     . LYS A 1 183 ? -44.010 31.816 2.109   1.00 103.55 ? 180 LYS A N     1 
ATOM   1334 C  CA    . LYS A 1 183 ? -45.205 30.996 1.947   1.00 105.17 ? 180 LYS A CA    1 
ATOM   1335 C  C     . LYS A 1 183 ? -45.162 30.215 0.635   1.00 104.24 ? 180 LYS A C     1 
ATOM   1336 O  O     . LYS A 1 183 ? -45.481 29.024 0.600   1.00 105.38 ? 180 LYS A O     1 
ATOM   1337 C  CB    . LYS A 1 183 ? -46.461 31.863 1.974   1.00 105.98 ? 180 LYS A CB    1 
ATOM   1338 C  CG    . LYS A 1 183 ? -46.927 32.251 3.351   1.00 109.20 ? 180 LYS A CG    1 
ATOM   1339 C  CD    . LYS A 1 183 ? -48.061 33.247 3.272   1.00 112.51 ? 180 LYS A CD    1 
ATOM   1340 C  CE    . LYS A 1 183 ? -48.387 33.785 4.650   1.00 116.66 ? 180 LYS A CE    1 
ATOM   1341 N  NZ    . LYS A 1 183 ? -49.264 34.984 4.576   1.00 118.88 ? 180 LYS A NZ    1 
ATOM   1342 N  N     . VAL A 1 184 ? -44.762 30.898 -0.437  1.00 102.26 ? 181 VAL A N     1 
ATOM   1343 C  CA    . VAL A 1 184 ? -44.872 30.369 -1.795  1.00 101.26 ? 181 VAL A CA    1 
ATOM   1344 C  C     . VAL A 1 184 ? -43.636 30.684 -2.632  1.00 99.34  ? 181 VAL A C     1 
ATOM   1345 O  O     . VAL A 1 184 ? -43.103 31.793 -2.577  1.00 98.17  ? 181 VAL A O     1 
ATOM   1346 C  CB    . VAL A 1 184 ? -46.104 30.959 -2.531  1.00 101.32 ? 181 VAL A CB    1 
ATOM   1347 C  CG1   . VAL A 1 184 ? -46.334 30.241 -3.850  1.00 100.91 ? 181 VAL A CG1   1 
ATOM   1348 C  CG2   . VAL A 1 184 ? -47.355 30.893 -1.666  1.00 102.70 ? 181 VAL A CG2   1 
ATOM   1349 N  N     . ILE A 1 185 ? -43.198 29.703 -3.414  1.00 99.08  ? 182 ILE A N     1 
ATOM   1350 C  CA    . ILE A 1 185 ? -42.141 29.910 -4.393  1.00 97.62  ? 182 ILE A CA    1 
ATOM   1351 C  C     . ILE A 1 185 ? -42.673 29.673 -5.812  1.00 97.90  ? 182 ILE A C     1 
ATOM   1352 O  O     . ILE A 1 185 ? -43.161 28.586 -6.142  1.00 98.99  ? 182 ILE A O     1 
ATOM   1353 C  CB    . ILE A 1 185 ? -40.936 29.002 -4.128  1.00 97.38  ? 182 ILE A CB    1 
ATOM   1354 C  CG1   . ILE A 1 185 ? -40.169 29.475 -2.901  1.00 96.77  ? 182 ILE A CG1   1 
ATOM   1355 C  CG2   . ILE A 1 185 ? -40.005 29.007 -5.309  1.00 96.42  ? 182 ILE A CG2   1 
ATOM   1356 C  CD1   . ILE A 1 185 ? -39.121 28.489 -2.432  1.00 96.52  ? 182 ILE A CD1   1 
ATOM   1357 N  N     . HIS A 1 186 ? -42.581 30.701 -6.647  1.00 97.14  ? 183 HIS A N     1 
ATOM   1358 C  CA    . HIS A 1 186 ? -42.975 30.584 -8.041  1.00 97.32  ? 183 HIS A CA    1 
ATOM   1359 C  C     . HIS A 1 186 ? -41.758 30.418 -8.957  1.00 97.05  ? 183 HIS A C     1 
ATOM   1360 O  O     . HIS A 1 186 ? -40.773 31.156 -8.857  1.00 95.95  ? 183 HIS A O     1 
ATOM   1361 C  CB    . HIS A 1 186 ? -43.809 31.786 -8.466  1.00 96.62  ? 183 HIS A CB    1 
ATOM   1362 C  CG    . HIS A 1 186 ? -44.279 31.713 -9.881  1.00 95.92  ? 183 HIS A CG    1 
ATOM   1363 N  ND1   . HIS A 1 186 ? -45.600 31.524 -10.216 1.00 96.54  ? 183 HIS A ND1   1 
ATOM   1364 C  CD2   . HIS A 1 186 ? -43.601 31.788 -11.049 1.00 95.10  ? 183 HIS A CD2   1 
ATOM   1365 C  CE1   . HIS A 1 186 ? -45.719 31.502 -11.531 1.00 96.81  ? 183 HIS A CE1   1 
ATOM   1366 N  NE2   . HIS A 1 186 ? -44.519 31.656 -12.060 1.00 95.64  ? 183 HIS A NE2   1 
ATOM   1367 N  N     . SER A 1 187 ? -41.841 29.459 -9.868  1.00 98.39  ? 184 SER A N     1 
ATOM   1368 C  CA    . SER A 1 187 ? -40.724 29.164 -10.750 1.00 98.63  ? 184 SER A CA    1 
ATOM   1369 C  C     . SER A 1 187 ? -41.201 28.763 -12.133 1.00 99.55  ? 184 SER A C     1 
ATOM   1370 O  O     . SER A 1 187 ? -42.369 28.406 -12.300 1.00 100.60 ? 184 SER A O     1 
ATOM   1371 C  CB    . SER A 1 187 ? -39.928 28.012 -10.162 1.00 99.11  ? 184 SER A CB    1 
ATOM   1372 O  OG    . SER A 1 187 ? -40.695 26.828 -10.216 1.00 100.67 ? 184 SER A OG    1 
ATOM   1373 N  N     . ASP A 1 188 ? -40.302 28.809 -13.120 1.00 99.74  ? 185 ASP A N     1 
ATOM   1374 C  CA    . ASP A 1 188 ? -40.603 28.171 -14.401 1.00 101.19 ? 185 ASP A CA    1 
ATOM   1375 C  C     . ASP A 1 188 ? -40.452 26.663 -14.286 1.00 102.79 ? 185 ASP A C     1 
ATOM   1376 O  O     . ASP A 1 188 ? -39.936 26.156 -13.293 1.00 102.92 ? 185 ASP A O     1 
ATOM   1377 C  CB    . ASP A 1 188 ? -39.848 28.773 -15.620 1.00 100.74 ? 185 ASP A CB    1 
ATOM   1378 C  CG    . ASP A 1 188 ? -38.309 28.815 -15.468 1.00 100.21 ? 185 ASP A CG    1 
ATOM   1379 O  OD1   . ASP A 1 188 ? -37.720 29.804 -15.996 1.00 98.38  ? 185 ASP A OD1   1 
ATOM   1380 O  OD2   . ASP A 1 188 ? -37.698 27.877 -14.884 1.00 99.80  ? 185 ASP A OD2   1 
ATOM   1381 N  N     . GLN A 1 189 ? -40.926 25.948 -15.295 1.00 104.56 ? 186 GLN A N     1 
ATOM   1382 C  CA    . GLN A 1 189 ? -40.966 24.500 -15.228 1.00 106.80 ? 186 GLN A CA    1 
ATOM   1383 C  C     . GLN A 1 189 ? -39.633 23.873 -15.600 1.00 107.21 ? 186 GLN A C     1 
ATOM   1384 O  O     . GLN A 1 189 ? -39.582 22.734 -16.060 1.00 108.47 ? 186 GLN A O     1 
ATOM   1385 C  CB    . GLN A 1 189 ? -42.083 23.958 -16.110 1.00 108.08 ? 186 GLN A CB    1 
ATOM   1386 C  CG    . GLN A 1 189 ? -43.456 24.484 -15.738 1.00 109.57 ? 186 GLN A CG    1 
ATOM   1387 C  CD    . GLN A 1 189 ? -44.558 23.590 -16.226 1.00 112.15 ? 186 GLN A CD    1 
ATOM   1388 O  OE1   . GLN A 1 189 ? -44.316 22.440 -16.586 1.00 114.01 ? 186 GLN A OE1   1 
ATOM   1389 N  NE2   . GLN A 1 189 ? -45.784 24.106 -16.237 1.00 113.07 ? 186 GLN A NE2   1 
ATOM   1390 N  N     . GLY A 1 190 ? -38.556 24.622 -15.380 1.00 106.71 ? 187 GLY A N     1 
ATOM   1391 C  CA    . GLY A 1 190 ? -37.200 24.120 -15.574 1.00 107.27 ? 187 GLY A CA    1 
ATOM   1392 C  C     . GLY A 1 190 ? -36.905 22.899 -14.719 1.00 108.56 ? 187 GLY A C     1 
ATOM   1393 O  O     . GLY A 1 190 ? -37.366 22.800 -13.580 1.00 108.86 ? 187 GLY A O     1 
ATOM   1394 N  N     . ALA A 1 191 ? -36.120 21.981 -15.278 1.00 109.64 ? 188 ALA A N     1 
ATOM   1395 C  CA    . ALA A 1 191 ? -35.832 20.679 -14.668 1.00 111.09 ? 188 ALA A CA    1 
ATOM   1396 C  C     . ALA A 1 191 ? -35.498 20.754 -13.181 1.00 110.95 ? 188 ALA A C     1 
ATOM   1397 O  O     . ALA A 1 191 ? -35.847 19.863 -12.414 1.00 112.19 ? 188 ALA A O     1 
ATOM   1398 C  CB    . ALA A 1 191 ? -34.700 19.978 -15.433 1.00 111.90 ? 188 ALA A CB    1 
ATOM   1399 N  N     . ALA A 1 192 ? -34.837 21.834 -12.786 1.00 109.71 ? 189 ALA A N     1 
ATOM   1400 C  CA    . ALA A 1 192 ? -34.333 21.980 -11.431 1.00 109.78 ? 189 ALA A CA    1 
ATOM   1401 C  C     . ALA A 1 192 ? -35.426 22.123 -10.386 1.00 110.06 ? 189 ALA A C     1 
ATOM   1402 O  O     . ALA A 1 192 ? -35.243 21.695 -9.248  1.00 111.00 ? 189 ALA A O     1 
ATOM   1403 C  CB    . ALA A 1 192 ? -33.405 23.159 -11.355 1.00 108.62 ? 189 ALA A CB    1 
ATOM   1404 N  N     . PHE A 1 193 ? -36.552 22.725 -10.768 1.00 109.46 ? 190 PHE A N     1 
ATOM   1405 C  CA    . PHE A 1 193 ? -37.618 23.044 -9.812  1.00 109.33 ? 190 PHE A CA    1 
ATOM   1406 C  C     . PHE A 1 193 ? -38.813 22.089 -9.862  1.00 111.03 ? 190 PHE A C     1 
ATOM   1407 O  O     . PHE A 1 193 ? -39.634 22.069 -8.942  1.00 111.72 ? 190 PHE A O     1 
ATOM   1408 C  CB    . PHE A 1 193 ? -38.120 24.474 -10.017 1.00 107.74 ? 190 PHE A CB    1 
ATOM   1409 C  CG    . PHE A 1 193 ? -37.039 25.482 -10.272 1.00 104.73 ? 190 PHE A CG    1 
ATOM   1410 C  CD1   . PHE A 1 193 ? -35.907 25.533 -9.479  1.00 103.47 ? 190 PHE A CD1   1 
ATOM   1411 C  CD2   . PHE A 1 193 ? -37.178 26.407 -11.290 1.00 102.85 ? 190 PHE A CD2   1 
ATOM   1412 C  CE1   . PHE A 1 193 ? -34.916 26.477 -9.718  1.00 101.87 ? 190 PHE A CE1   1 
ATOM   1413 C  CE2   . PHE A 1 193 ? -36.192 27.360 -11.531 1.00 101.18 ? 190 PHE A CE2   1 
ATOM   1414 C  CZ    . PHE A 1 193 ? -35.059 27.391 -10.743 1.00 100.34 ? 190 PHE A CZ    1 
ATOM   1415 N  N     . THR A 1 194 ? -38.919 21.318 -10.940 1.00 111.77 ? 191 THR A N     1 
ATOM   1416 C  CA    . THR A 1 194 ? -40.035 20.407 -11.118 1.00 113.47 ? 191 THR A CA    1 
ATOM   1417 C  C     . THR A 1 194 ? -39.742 19.063 -10.502 1.00 115.24 ? 191 THR A C     1 
ATOM   1418 O  O     . THR A 1 194 ? -40.661 18.330 -10.164 1.00 116.88 ? 191 THR A O     1 
ATOM   1419 C  CB    . THR A 1 194 ? -40.364 20.199 -12.588 1.00 113.54 ? 191 THR A CB    1 
ATOM   1420 O  OG1   . THR A 1 194 ? -39.150 20.180 -13.347 1.00 113.25 ? 191 THR A OG1   1 
ATOM   1421 C  CG2   . THR A 1 194 ? -41.259 21.311 -13.090 1.00 112.68 ? 191 THR A CG2   1 
ATOM   1422 N  N     . SER A 1 195 ? -38.459 18.751 -10.354 1.00 115.44 ? 192 SER A N     1 
ATOM   1423 C  CA    . SER A 1 195 ? -38.007 17.483 -9.766  1.00 117.42 ? 192 SER A CA    1 
ATOM   1424 C  C     . SER A 1 195 ? -38.717 17.133 -8.455  1.00 118.56 ? 192 SER A C     1 
ATOM   1425 O  O     . SER A 1 195 ? -39.133 18.025 -7.706  1.00 118.16 ? 192 SER A O     1 
ATOM   1426 C  CB    . SER A 1 195 ? -36.498 17.532 -9.511  1.00 117.21 ? 192 SER A CB    1 
ATOM   1427 O  OG    . SER A 1 195 ? -36.215 18.296 -8.349  1.00 116.76 ? 192 SER A OG    1 
ATOM   1428 N  N     . SER A 1 196 ? -38.834 15.837 -8.173  1.00 120.02 ? 193 SER A N     1 
ATOM   1429 C  CA    . SER A 1 196 ? -39.490 15.381 -6.946  1.00 121.19 ? 193 SER A CA    1 
ATOM   1430 C  C     . SER A 1 196 ? -38.694 15.747 -5.697  1.00 120.48 ? 193 SER A C     1 
ATOM   1431 O  O     . SER A 1 196 ? -39.275 16.007 -4.643  1.00 120.84 ? 193 SER A O     1 
ATOM   1432 C  CB    . SER A 1 196 ? -39.731 13.871 -6.989  1.00 123.58 ? 193 SER A CB    1 
ATOM   1433 O  OG    . SER A 1 196 ? -38.520 13.175 -7.245  1.00 124.86 ? 193 SER A OG    1 
ATOM   1434 N  N     . THR A 1 197 ? -37.368 15.767 -5.830  1.00 119.42 ? 194 THR A N     1 
ATOM   1435 C  CA    . THR A 1 197 ? -36.465 16.071 -4.715  1.00 118.93 ? 194 THR A CA    1 
ATOM   1436 C  C     . THR A 1 197 ? -36.730 17.465 -4.185  1.00 117.10 ? 194 THR A C     1 
ATOM   1437 O  O     . THR A 1 197 ? -36.763 17.679 -2.974  1.00 117.69 ? 194 THR A O     1 
ATOM   1438 C  CB    . THR A 1 197 ? -34.974 15.997 -5.118  1.00 118.51 ? 194 THR A CB    1 
ATOM   1439 O  OG1   . THR A 1 197 ? -34.738 14.842 -5.931  1.00 119.97 ? 194 THR A OG1   1 
ATOM   1440 C  CG2   . THR A 1 197 ? -34.089 15.927 -3.887  1.00 118.98 ? 194 THR A CG2   1 
ATOM   1441 N  N     . PHE A 1 198 ? -36.911 18.409 -5.105  1.00 114.82 ? 195 PHE A N     1 
ATOM   1442 C  CA    . PHE A 1 198 ? -37.221 19.780 -4.738  1.00 112.88 ? 195 PHE A CA    1 
ATOM   1443 C  C     . PHE A 1 198 ? -38.601 19.859 -4.103  1.00 113.80 ? 195 PHE A C     1 
ATOM   1444 O  O     . PHE A 1 198 ? -38.748 20.381 -3.002  1.00 114.00 ? 195 PHE A O     1 
ATOM   1445 C  CB    . PHE A 1 198 ? -37.131 20.697 -5.957  1.00 110.82 ? 195 PHE A CB    1 
ATOM   1446 C  CG    . PHE A 1 198 ? -37.209 22.156 -5.621  1.00 108.09 ? 195 PHE A CG    1 
ATOM   1447 C  CD1   . PHE A 1 198 ? -36.258 22.744 -4.790  1.00 106.61 ? 195 PHE A CD1   1 
ATOM   1448 C  CD2   . PHE A 1 198 ? -38.223 22.945 -6.143  1.00 105.98 ? 195 PHE A CD2   1 
ATOM   1449 C  CE1   . PHE A 1 198 ? -36.327 24.090 -4.472  1.00 104.47 ? 195 PHE A CE1   1 
ATOM   1450 C  CE2   . PHE A 1 198 ? -38.302 24.291 -5.835  1.00 103.89 ? 195 PHE A CE2   1 
ATOM   1451 C  CZ    . PHE A 1 198 ? -37.354 24.867 -4.996  1.00 103.37 ? 195 PHE A CZ    1 
ATOM   1452 N  N     . ALA A 1 199 ? -39.597 19.307 -4.793  1.00 114.58 ? 196 ALA A N     1 
ATOM   1453 C  CA    . ALA A 1 199 ? -40.981 19.277 -4.318  1.00 115.68 ? 196 ALA A CA    1 
ATOM   1454 C  C     . ALA A 1 199 ? -41.099 18.882 -2.846  1.00 117.35 ? 196 ALA A C     1 
ATOM   1455 O  O     . ALA A 1 199 ? -41.935 19.420 -2.114  1.00 117.56 ? 196 ALA A O     1 
ATOM   1456 C  CB    . ALA A 1 199 ? -41.803 18.341 -5.185  1.00 116.83 ? 196 ALA A CB    1 
ATOM   1457 N  N     . GLU A 1 200 ? -40.252 17.949 -2.423  1.00 118.74 ? 197 GLU A N     1 
ATOM   1458 C  CA    . GLU A 1 200 ? -40.267 17.462 -1.048  1.00 121.09 ? 197 GLU A CA    1 
ATOM   1459 C  C     . GLU A 1 200 ? -39.552 18.412 -0.117  1.00 120.09 ? 197 GLU A C     1 
ATOM   1460 O  O     . GLU A 1 200 ? -40.083 18.764 0.936   1.00 120.76 ? 197 GLU A O     1 
ATOM   1461 C  CB    . GLU A 1 200 ? -39.675 16.059 -0.956  1.00 122.94 ? 197 GLU A CB    1 
ATOM   1462 C  CG    . GLU A 1 200 ? -40.546 15.033 -1.647  1.00 126.59 ? 197 GLU A CG    1 
ATOM   1463 C  CD    . GLU A 1 200 ? -40.143 13.620 -1.319  1.00 132.31 ? 197 GLU A CD    1 
ATOM   1464 O  OE1   . GLU A 1 200 ? -40.326 13.200 -0.145  1.00 135.39 ? 197 GLU A OE1   1 
ATOM   1465 O  OE2   . GLU A 1 200 ? -39.652 12.929 -2.244  1.00 133.85 ? 197 GLU A OE2   1 
ATOM   1466 N  N     . TRP A 1 201 ? -38.355 18.836 -0.518  1.00 118.67 ? 198 TRP A N     1 
ATOM   1467 C  CA    . TRP A 1 201 ? -37.625 19.862 0.207   1.00 117.63 ? 198 TRP A CA    1 
ATOM   1468 C  C     . TRP A 1 201 ? -38.595 20.962 0.586   1.00 117.01 ? 198 TRP A C     1 
ATOM   1469 O  O     . TRP A 1 201 ? -38.588 21.444 1.714   1.00 117.65 ? 198 TRP A O     1 
ATOM   1470 C  CB    . TRP A 1 201 ? -36.513 20.456 -0.653  1.00 115.69 ? 198 TRP A CB    1 
ATOM   1471 C  CG    . TRP A 1 201 ? -35.865 21.627 0.010   1.00 114.74 ? 198 TRP A CG    1 
ATOM   1472 C  CD1   . TRP A 1 201 ? -34.850 21.584 0.921   1.00 115.99 ? 198 TRP A CD1   1 
ATOM   1473 C  CD2   . TRP A 1 201 ? -36.205 23.012 -0.149  1.00 112.80 ? 198 TRP A CD2   1 
ATOM   1474 N  NE1   . TRP A 1 201 ? -34.521 22.854 1.329   1.00 114.86 ? 198 TRP A NE1   1 
ATOM   1475 C  CE2   . TRP A 1 201 ? -35.339 23.751 0.692   1.00 113.10 ? 198 TRP A CE2   1 
ATOM   1476 C  CE3   . TRP A 1 201 ? -37.152 23.701 -0.919  1.00 111.20 ? 198 TRP A CE3   1 
ATOM   1477 C  CZ2   . TRP A 1 201 ? -35.386 25.150 0.779   1.00 111.71 ? 198 TRP A CZ2   1 
ATOM   1478 C  CZ3   . TRP A 1 201 ? -37.200 25.092 -0.835  1.00 110.21 ? 198 TRP A CZ3   1 
ATOM   1479 C  CH2   . TRP A 1 201 ? -36.319 25.801 0.009   1.00 110.37 ? 198 TRP A CH2   1 
ATOM   1480 N  N     . ALA A 1 202 ? -39.431 21.342 -0.374  1.00 116.04 ? 199 ALA A N     1 
ATOM   1481 C  CA    . ALA A 1 202 ? -40.381 22.419 -0.194  1.00 115.58 ? 199 ALA A CA    1 
ATOM   1482 C  C     . ALA A 1 202 ? -41.517 22.035 0.744   1.00 117.66 ? 199 ALA A C     1 
ATOM   1483 O  O     . ALA A 1 202 ? -41.943 22.853 1.559   1.00 117.85 ? 199 ALA A O     1 
ATOM   1484 C  CB    . ALA A 1 202 ? -40.918 22.872 -1.532  1.00 114.19 ? 199 ALA A CB    1 
ATOM   1485 N  N     . LYS A 1 203 ? -42.005 20.800 0.637   1.00 119.50 ? 200 LYS A N     1 
ATOM   1486 C  CA    . LYS A 1 203 ? -43.088 20.353 1.512   1.00 121.92 ? 200 LYS A CA    1 
ATOM   1487 C  C     . LYS A 1 203 ? -42.600 20.205 2.952   1.00 122.89 ? 200 LYS A C     1 
ATOM   1488 O  O     . LYS A 1 203 ? -43.327 20.549 3.885   1.00 124.01 ? 200 LYS A O     1 
ATOM   1489 C  CB    . LYS A 1 203 ? -43.710 19.050 1.018   1.00 123.89 ? 200 LYS A CB    1 
ATOM   1490 C  CG    . LYS A 1 203 ? -45.126 18.812 1.535   1.00 127.30 ? 200 LYS A CG    1 
ATOM   1491 C  CD    . LYS A 1 203 ? -45.594 17.412 1.193   1.00 131.57 ? 200 LYS A CD    1 
ATOM   1492 C  CE    . LYS A 1 203 ? -47.103 17.366 1.067   1.00 134.40 ? 200 LYS A CE    1 
ATOM   1493 N  NZ    . LYS A 1 203 ? -47.574 15.960 0.927   1.00 138.17 ? 200 LYS A NZ    1 
ATOM   1494 N  N     . GLU A 1 204 ? -41.369 19.707 3.110   1.00 122.25 ? 201 GLU A N     1 
ATOM   1495 C  CA    . GLU A 1 204 ? -40.685 19.627 4.406   1.00 122.79 ? 201 GLU A CA    1 
ATOM   1496 C  C     . GLU A 1 204 ? -40.776 20.930 5.174   1.00 121.07 ? 201 GLU A C     1 
ATOM   1497 O  O     . GLU A 1 204 ? -40.819 20.913 6.395   1.00 122.86 ? 201 GLU A O     1 
ATOM   1498 C  CB    . GLU A 1 204 ? -39.203 19.283 4.226   1.00 122.73 ? 201 GLU A CB    1 
ATOM   1499 C  CG    . GLU A 1 204 ? -38.812 17.828 4.517   1.00 126.94 ? 201 GLU A CG    1 
ATOM   1500 C  CD    . GLU A 1 204 ? -37.502 17.391 3.811   1.00 129.42 ? 201 GLU A CD    1 
ATOM   1501 O  OE1   . GLU A 1 204 ? -36.745 18.250 3.268   1.00 127.51 ? 201 GLU A OE1   1 
ATOM   1502 O  OE2   . GLU A 1 204 ? -37.237 16.163 3.800   1.00 132.23 ? 201 GLU A OE2   1 
ATOM   1503 N  N     . ARG A 1 205 ? -40.812 22.051 4.458   1.00 117.52 ? 202 ARG A N     1 
ATOM   1504 C  CA    . ARG A 1 205 ? -40.775 23.365 5.085   1.00 115.52 ? 202 ARG A CA    1 
ATOM   1505 C  C     . ARG A 1 205 ? -42.115 24.089 5.056   1.00 114.95 ? 202 ARG A C     1 
ATOM   1506 O  O     . ARG A 1 205 ? -42.228 25.214 5.536   1.00 114.28 ? 202 ARG A O     1 
ATOM   1507 C  CB    . ARG A 1 205 ? -39.690 24.222 4.439   1.00 113.17 ? 202 ARG A CB    1 
ATOM   1508 C  CG    . ARG A 1 205 ? -38.337 23.542 4.410   1.00 112.98 ? 202 ARG A CG    1 
ATOM   1509 C  CD    . ARG A 1 205 ? -37.188 24.526 4.141   1.00 110.77 ? 202 ARG A CD    1 
ATOM   1510 N  NE    . ARG A 1 205 ? -35.855 23.917 4.230   1.00 110.61 ? 202 ARG A NE    1 
ATOM   1511 C  CZ    . ARG A 1 205 ? -35.576 22.627 4.043   1.00 111.83 ? 202 ARG A CZ    1 
ATOM   1512 N  NH1   . ARG A 1 205 ? -36.525 21.746 3.736   1.00 112.84 ? 202 ARG A NH1   1 
ATOM   1513 N  NH2   . ARG A 1 205 ? -34.325 22.212 4.153   1.00 112.30 ? 202 ARG A NH2   1 
ATOM   1514 N  N     . GLY A 1 206 ? -43.132 23.437 4.508   1.00 115.12 ? 203 GLY A N     1 
ATOM   1515 C  CA    . GLY A 1 206 ? -44.459 24.035 4.431   1.00 115.05 ? 203 GLY A CA    1 
ATOM   1516 C  C     . GLY A 1 206 ? -44.485 25.222 3.494   1.00 112.56 ? 203 GLY A C     1 
ATOM   1517 O  O     . GLY A 1 206 ? -45.117 26.235 3.767   1.00 112.15 ? 203 GLY A O     1 
ATOM   1518 N  N     . ILE A 1 207 ? -43.772 25.089 2.386   1.00 111.11 ? 204 ILE A N     1 
ATOM   1519 C  CA    . ILE A 1 207 ? -43.729 26.119 1.355   1.00 109.14 ? 204 ILE A CA    1 
ATOM   1520 C  C     . ILE A 1 207 ? -44.457 25.588 0.132   1.00 109.14 ? 204 ILE A C     1 
ATOM   1521 O  O     . ILE A 1 207 ? -44.104 24.525 -0.391  1.00 109.51 ? 204 ILE A O     1 
ATOM   1522 C  CB    . ILE A 1 207 ? -42.272 26.485 0.949   1.00 107.32 ? 204 ILE A CB    1 
ATOM   1523 C  CG1   . ILE A 1 207 ? -41.413 26.766 2.186   1.00 107.70 ? 204 ILE A CG1   1 
ATOM   1524 C  CG2   . ILE A 1 207 ? -42.266 27.671 -0.012  1.00 105.12 ? 204 ILE A CG2   1 
ATOM   1525 C  CD1   . ILE A 1 207 ? -39.997 27.161 1.866   1.00 106.67 ? 204 ILE A CD1   1 
ATOM   1526 N  N     . HIS A 1 208 ? -45.472 26.321 -0.320  1.00 108.87 ? 205 HIS A N     1 
ATOM   1527 C  CA    . HIS A 1 208 ? -46.209 25.917 -1.511  1.00 108.88 ? 205 HIS A CA    1 
ATOM   1528 C  C     . HIS A 1 208 ? -45.416 26.249 -2.777  1.00 106.73 ? 205 HIS A C     1 
ATOM   1529 O  O     . HIS A 1 208 ? -44.965 27.385 -2.965  1.00 105.26 ? 205 HIS A O     1 
ATOM   1530 C  CB    . HIS A 1 208 ? -47.614 26.533 -1.542  1.00 109.68 ? 205 HIS A CB    1 
ATOM   1531 C  CG    . HIS A 1 208 ? -48.455 26.057 -2.688  1.00 110.76 ? 205 HIS A CG    1 
ATOM   1532 N  ND1   . HIS A 1 208 ? -48.862 26.892 -3.710  1.00 110.23 ? 205 HIS A ND1   1 
ATOM   1533 C  CD2   . HIS A 1 208 ? -48.952 24.831 -2.983  1.00 112.90 ? 205 HIS A CD2   1 
ATOM   1534 C  CE1   . HIS A 1 208 ? -49.579 26.203 -4.582  1.00 111.32 ? 205 HIS A CE1   1 
ATOM   1535 N  NE2   . HIS A 1 208 ? -49.646 24.950 -4.165  1.00 113.56 ? 205 HIS A NE2   1 
ATOM   1536 N  N     . LEU A 1 209 ? -45.222 25.237 -3.620  1.00 106.61 ? 206 LEU A N     1 
ATOM   1537 C  CA    . LEU A 1 209 ? -44.596 25.426 -4.915  1.00 104.77 ? 206 LEU A CA    1 
ATOM   1538 C  C     . LEU A 1 209 ? -45.649 25.777 -5.938  1.00 104.96 ? 206 LEU A C     1 
ATOM   1539 O  O     . LEU A 1 209 ? -46.747 25.227 -5.919  1.00 106.64 ? 206 LEU A O     1 
ATOM   1540 C  CB    . LEU A 1 209 ? -43.834 24.182 -5.347  1.00 104.69 ? 206 LEU A CB    1 
ATOM   1541 C  CG    . LEU A 1 209 ? -42.521 23.941 -4.609  1.00 103.97 ? 206 LEU A CG    1 
ATOM   1542 C  CD1   . LEU A 1 209 ? -41.720 22.886 -5.331  1.00 103.93 ? 206 LEU A CD1   1 
ATOM   1543 C  CD2   . LEU A 1 209 ? -41.704 25.215 -4.469  1.00 101.89 ? 206 LEU A CD2   1 
ATOM   1544 N  N     . GLU A 1 210 ? -45.308 26.706 -6.823  1.00 103.70 ? 207 GLU A N     1 
ATOM   1545 C  CA    . GLU A 1 210 ? -46.221 27.176 -7.855  1.00 103.89 ? 207 GLU A CA    1 
ATOM   1546 C  C     . GLU A 1 210 ? -45.416 27.424 -9.125  1.00 102.51 ? 207 GLU A C     1 
ATOM   1547 O  O     . GLU A 1 210 ? -44.307 27.966 -9.081  1.00 101.44 ? 207 GLU A O     1 
ATOM   1548 C  CB    . GLU A 1 210 ? -46.954 28.423 -7.360  1.00 103.77 ? 207 GLU A CB    1 
ATOM   1549 C  CG    . GLU A 1 210 ? -47.605 29.306 -8.407  1.00 104.32 ? 207 GLU A CG    1 
ATOM   1550 C  CD    . GLU A 1 210 ? -48.078 30.631 -7.803  1.00 105.64 ? 207 GLU A CD    1 
ATOM   1551 O  OE1   . GLU A 1 210 ? -48.942 30.604 -6.900  1.00 108.39 ? 207 GLU A OE1   1 
ATOM   1552 O  OE2   . GLU A 1 210 ? -47.581 31.700 -8.215  1.00 104.25 ? 207 GLU A OE2   1 
ATOM   1553 N  N     . PHE A 1 211 ? -45.969 26.993 -10.250 1.00 102.82 ? 208 PHE A N     1 
ATOM   1554 C  CA    . PHE A 1 211 ? -45.248 27.013 -11.509 1.00 101.56 ? 208 PHE A CA    1 
ATOM   1555 C  C     . PHE A 1 211 ? -46.038 27.775 -12.550 1.00 101.36 ? 208 PHE A C     1 
ATOM   1556 O  O     . PHE A 1 211 ? -47.270 27.680 -12.614 1.00 102.54 ? 208 PHE A O     1 
ATOM   1557 C  CB    . PHE A 1 211 ? -45.035 25.593 -12.025 1.00 102.60 ? 208 PHE A CB    1 
ATOM   1558 C  CG    . PHE A 1 211 ? -44.365 24.669 -11.048 1.00 103.06 ? 208 PHE A CG    1 
ATOM   1559 C  CD1   . PHE A 1 211 ? -42.988 24.476 -11.090 1.00 102.96 ? 208 PHE A CD1   1 
ATOM   1560 C  CD2   . PHE A 1 211 ? -45.107 23.959 -10.119 1.00 104.52 ? 208 PHE A CD2   1 
ATOM   1561 C  CE1   . PHE A 1 211 ? -42.349 23.604 -10.203 1.00 103.08 ? 208 PHE A CE1   1 
ATOM   1562 C  CE2   . PHE A 1 211 ? -44.478 23.090 -9.230  1.00 105.70 ? 208 PHE A CE2   1 
ATOM   1563 C  CZ    . PHE A 1 211 ? -43.092 22.915 -9.276  1.00 104.62 ? 208 PHE A CZ    1 
ATOM   1564 N  N     . SER A 1 212 ? -45.316 28.520 -13.377 1.00 100.03 ? 209 SER A N     1 
ATOM   1565 C  CA    . SER A 1 212 ? -45.919 29.216 -14.511 1.00 99.81  ? 209 SER A CA    1 
ATOM   1566 C  C     . SER A 1 212 ? -46.208 28.226 -15.635 1.00 100.51 ? 209 SER A C     1 
ATOM   1567 O  O     . SER A 1 212 ? -45.598 27.156 -15.694 1.00 100.70 ? 209 SER A O     1 
ATOM   1568 C  CB    . SER A 1 212 ? -45.037 30.385 -14.987 1.00 98.37  ? 209 SER A CB    1 
ATOM   1569 O  OG    . SER A 1 212 ? -43.644 30.153 -14.795 1.00 97.64  ? 209 SER A OG    1 
ATOM   1570 N  N     . THR A 1 213 ? -47.152 28.574 -16.505 1.00 100.92 ? 210 THR A N     1 
ATOM   1571 C  CA    . THR A 1 213 ? -47.506 27.723 -17.640 1.00 102.11 ? 210 THR A CA    1 
ATOM   1572 C  C     . THR A 1 213 ? -46.259 27.476 -18.487 1.00 101.48 ? 210 THR A C     1 
ATOM   1573 O  O     . THR A 1 213 ? -45.340 28.298 -18.473 1.00 100.43 ? 210 THR A O     1 
ATOM   1574 C  CB    . THR A 1 213 ? -48.592 28.373 -18.510 1.00 102.73 ? 210 THR A CB    1 
ATOM   1575 O  OG1   . THR A 1 213 ? -48.248 29.740 -18.731 1.00 102.73 ? 210 THR A OG1   1 
ATOM   1576 C  CG2   . THR A 1 213 ? -49.934 28.341 -17.825 1.00 103.92 ? 210 THR A CG2   1 
ATOM   1577 N  N     . PRO A 1 214 ? -46.204 26.339 -19.213 1.00 102.47 ? 211 PRO A N     1 
ATOM   1578 C  CA    . PRO A 1 214 ? -45.048 26.001 -20.052 1.00 102.04 ? 211 PRO A CA    1 
ATOM   1579 C  C     . PRO A 1 214 ? -44.732 27.043 -21.126 1.00 101.44 ? 211 PRO A C     1 
ATOM   1580 O  O     . PRO A 1 214 ? -45.653 27.575 -21.760 1.00 101.94 ? 211 PRO A O     1 
ATOM   1581 C  CB    . PRO A 1 214 ? -45.480 24.701 -20.721 1.00 103.49 ? 211 PRO A CB    1 
ATOM   1582 C  CG    . PRO A 1 214 ? -46.433 24.125 -19.795 1.00 104.55 ? 211 PRO A CG    1 
ATOM   1583 C  CD    . PRO A 1 214 ? -47.199 25.259 -19.226 1.00 104.09 ? 211 PRO A CD    1 
ATOM   1584 N  N     . TYR A 1 215 ? -43.436 27.315 -21.305 1.00 100.45 ? 212 TYR A N     1 
ATOM   1585 C  CA    . TYR A 1 215 ? -42.923 28.251 -22.311 1.00 100.05 ? 212 TYR A CA    1 
ATOM   1586 C  C     . TYR A 1 215 ? -43.601 29.627 -22.296 1.00 99.52  ? 212 TYR A C     1 
ATOM   1587 O  O     . TYR A 1 215 ? -44.187 30.069 -23.299 1.00 100.12 ? 212 TYR A O     1 
ATOM   1588 C  CB    . TYR A 1 215 ? -43.014 27.644 -23.702 1.00 101.41 ? 212 TYR A CB    1 
ATOM   1589 C  CG    . TYR A 1 215 ? -42.177 26.418 -23.905 1.00 102.69 ? 212 TYR A CG    1 
ATOM   1590 C  CD1   . TYR A 1 215 ? -40.846 26.517 -24.316 1.00 103.61 ? 212 TYR A CD1   1 
ATOM   1591 C  CD2   . TYR A 1 215 ? -42.721 25.156 -23.721 1.00 104.74 ? 212 TYR A CD2   1 
ATOM   1592 C  CE1   . TYR A 1 215 ? -40.075 25.380 -24.531 1.00 105.59 ? 212 TYR A CE1   1 
ATOM   1593 C  CE2   . TYR A 1 215 ? -41.970 24.016 -23.924 1.00 106.89 ? 212 TYR A CE2   1 
ATOM   1594 C  CZ    . TYR A 1 215 ? -40.650 24.129 -24.328 1.00 107.52 ? 212 TYR A CZ    1 
ATOM   1595 O  OH    . TYR A 1 215 ? -39.916 22.981 -24.525 1.00 109.77 ? 212 TYR A OH    1 
ATOM   1596 N  N     . HIS A 1 216 ? -43.500 30.292 -21.148 1.00 98.34  ? 213 HIS A N     1 
ATOM   1597 C  CA    . HIS A 1 216 ? -44.099 31.595 -20.924 1.00 97.66  ? 213 HIS A CA    1 
ATOM   1598 C  C     . HIS A 1 216 ? -43.252 32.244 -19.834 1.00 96.44  ? 213 HIS A C     1 
ATOM   1599 O  O     . HIS A 1 216 ? -43.656 32.273 -18.671 1.00 96.28  ? 213 HIS A O     1 
ATOM   1600 C  CB    . HIS A 1 216 ? -45.551 31.415 -20.466 1.00 98.46  ? 213 HIS A CB    1 
ATOM   1601 C  CG    . HIS A 1 216 ? -46.442 32.579 -20.764 1.00 98.14  ? 213 HIS A CG    1 
ATOM   1602 N  ND1   . HIS A 1 216 ? -46.771 33.525 -19.818 1.00 97.83  ? 213 HIS A ND1   1 
ATOM   1603 C  CD2   . HIS A 1 216 ? -47.096 32.935 -21.894 1.00 98.74  ? 213 HIS A CD2   1 
ATOM   1604 C  CE1   . HIS A 1 216 ? -47.576 34.425 -20.357 1.00 98.47  ? 213 HIS A CE1   1 
ATOM   1605 N  NE2   . HIS A 1 216 ? -47.793 34.087 -21.615 1.00 98.91  ? 213 HIS A NE2   1 
ATOM   1606 N  N     . PRO A 1 217 ? -42.049 32.741 -20.193 1.00 95.65  ? 214 PRO A N     1 
ATOM   1607 C  CA    . PRO A 1 217 ? -41.217 33.327 -19.156 1.00 94.45  ? 214 PRO A CA    1 
ATOM   1608 C  C     . PRO A 1 217 ? -41.900 34.508 -18.499 1.00 94.11  ? 214 PRO A C     1 
ATOM   1609 O  O     . PRO A 1 217 ? -41.647 34.770 -17.327 1.00 93.76  ? 214 PRO A O     1 
ATOM   1610 C  CB    . PRO A 1 217 ? -39.979 33.780 -19.923 1.00 93.73  ? 214 PRO A CB    1 
ATOM   1611 C  CG    . PRO A 1 217 ? -39.901 32.869 -21.080 1.00 94.61  ? 214 PRO A CG    1 
ATOM   1612 C  CD    . PRO A 1 217 ? -41.340 32.708 -21.486 1.00 95.88  ? 214 PRO A CD    1 
ATOM   1613 N  N     . GLN A 1 218 ? -42.786 35.183 -19.232 1.00 94.59  ? 215 GLN A N     1 
ATOM   1614 C  CA    . GLN A 1 218 ? -43.459 36.369 -18.718 1.00 94.81  ? 215 GLN A CA    1 
ATOM   1615 C  C     . GLN A 1 218 ? -44.123 36.143 -17.374 1.00 95.01  ? 215 GLN A C     1 
ATOM   1616 O  O     . GLN A 1 218 ? -44.349 37.094 -16.626 1.00 95.02  ? 215 GLN A O     1 
ATOM   1617 C  CB    . GLN A 1 218 ? -44.523 36.872 -19.674 1.00 95.69  ? 215 GLN A CB    1 
ATOM   1618 C  CG    . GLN A 1 218 ? -44.276 36.591 -21.117 1.00 98.19  ? 215 GLN A CG    1 
ATOM   1619 C  CD    . GLN A 1 218 ? -45.488 36.978 -21.950 1.00 102.58 ? 215 GLN A CD    1 
ATOM   1620 O  OE1   . GLN A 1 218 ? -46.480 37.514 -21.423 1.00 104.26 ? 215 GLN A OE1   1 
ATOM   1621 N  NE2   . GLN A 1 218 ? -45.424 36.714 -23.257 1.00 104.00 ? 215 GLN A NE2   1 
ATOM   1622 N  N     . SER A 1 219 ? -44.458 34.894 -17.068 1.00 95.72  ? 216 SER A N     1 
ATOM   1623 C  CA    . SER A 1 219 ? -45.121 34.580 -15.800 1.00 95.99  ? 216 SER A CA    1 
ATOM   1624 C  C     . SER A 1 219 ? -44.124 34.710 -14.639 1.00 95.14  ? 216 SER A C     1 
ATOM   1625 O  O     . SER A 1 219 ? -44.422 35.345 -13.623 1.00 95.44  ? 216 SER A O     1 
ATOM   1626 C  CB    . SER A 1 219 ? -45.768 33.195 -15.848 1.00 97.15  ? 216 SER A CB    1 
ATOM   1627 O  OG    . SER A 1 219 ? -46.598 33.042 -16.994 1.00 97.48  ? 216 SER A OG    1 
ATOM   1628 N  N     . SER A 1 220 ? -42.924 34.151 -14.811 1.00 94.18  ? 217 SER A N     1 
ATOM   1629 C  CA    . SER A 1 220 ? -41.819 34.377 -13.871 1.00 92.70  ? 217 SER A CA    1 
ATOM   1630 C  C     . SER A 1 220 ? -41.246 35.795 -14.012 1.00 90.89  ? 217 SER A C     1 
ATOM   1631 O  O     . SER A 1 220 ? -40.118 36.070 -13.600 1.00 89.84  ? 217 SER A O     1 
ATOM   1632 C  CB    . SER A 1 220 ? -40.728 33.315 -14.078 1.00 92.98  ? 217 SER A CB    1 
ATOM   1633 O  OG    . SER A 1 220 ? -40.985 32.130 -13.325 1.00 94.43  ? 217 SER A OG    1 
ATOM   1634 N  N     . GLY A 1 221 ? -42.070 36.685 -14.560 1.00 90.38  ? 218 GLY A N     1 
ATOM   1635 C  CA    . GLY A 1 221 ? -41.658 37.997 -15.054 1.00 89.21  ? 218 GLY A CA    1 
ATOM   1636 C  C     . GLY A 1 221 ? -41.039 38.926 -14.039 1.00 88.13  ? 218 GLY A C     1 
ATOM   1637 O  O     . GLY A 1 221 ? -40.218 39.778 -14.372 1.00 87.46  ? 218 GLY A O     1 
ATOM   1638 N  N     . LYS A 1 222 ? -41.430 38.762 -12.789 1.00 88.02  ? 219 LYS A N     1 
ATOM   1639 C  CA    . LYS A 1 222 ? -40.848 39.558 -11.742 1.00 87.03  ? 219 LYS A CA    1 
ATOM   1640 C  C     . LYS A 1 222 ? -39.375 39.201 -11.542 1.00 85.92  ? 219 LYS A C     1 
ATOM   1641 O  O     . LYS A 1 222 ? -38.577 40.079 -11.274 1.00 85.43  ? 219 LYS A O     1 
ATOM   1642 C  CB    . LYS A 1 222 ? -41.654 39.414 -10.457 1.00 87.87  ? 219 LYS A CB    1 
ATOM   1643 C  CG    . LYS A 1 222 ? -41.376 40.500 -9.455  1.00 88.10  ? 219 LYS A CG    1 
ATOM   1644 C  CD    . LYS A 1 222 ? -42.656 41.084 -8.910  1.00 89.30  ? 219 LYS A CD    1 
ATOM   1645 C  CE    . LYS A 1 222 ? -42.369 42.358 -8.134  1.00 89.44  ? 219 LYS A CE    1 
ATOM   1646 N  NZ    . LYS A 1 222 ? -43.619 43.152 -7.987  1.00 91.23  ? 219 LYS A NZ    1 
ATOM   1647 N  N     . VAL A 1 223 ? -39.006 37.932 -11.694 1.00 85.77  ? 220 VAL A N     1 
ATOM   1648 C  CA    . VAL A 1 223 ? -37.591 37.559 -11.595 1.00 85.22  ? 220 VAL A CA    1 
ATOM   1649 C  C     . VAL A 1 223 ? -36.887 37.916 -12.877 1.00 84.78  ? 220 VAL A C     1 
ATOM   1650 O  O     . VAL A 1 223 ? -35.758 38.420 -12.850 1.00 84.76  ? 220 VAL A O     1 
ATOM   1651 C  CB    . VAL A 1 223 ? -37.351 36.056 -11.449 1.00 85.71  ? 220 VAL A CB    1 
ATOM   1652 C  CG1   . VAL A 1 223 ? -35.986 35.801 -10.792 1.00 85.20  ? 220 VAL A CG1   1 
ATOM   1653 C  CG2   . VAL A 1 223 ? -38.430 35.429 -10.662 1.00 87.56  ? 220 VAL A CG2   1 
ATOM   1654 N  N     . GLU A 1 224 ? -37.536 37.607 -14.001 1.00 84.57  ? 221 GLU A N     1 
ATOM   1655 C  CA    . GLU A 1 224 ? -36.948 37.835 -15.305 1.00 83.63  ? 221 GLU A CA    1 
ATOM   1656 C  C     . GLU A 1 224 ? -36.524 39.282 -15.392 1.00 83.14  ? 221 GLU A C     1 
ATOM   1657 O  O     . GLU A 1 224 ? -35.385 39.579 -15.736 1.00 82.79  ? 221 GLU A O     1 
ATOM   1658 C  CB    . GLU A 1 224 ? -37.930 37.494 -16.422 1.00 84.03  ? 221 GLU A CB    1 
ATOM   1659 C  CG    . GLU A 1 224 ? -38.409 36.053 -16.431 1.00 83.04  ? 221 GLU A CG    1 
ATOM   1660 C  CD    . GLU A 1 224 ? -37.315 35.059 -16.713 1.00 80.56  ? 221 GLU A CD    1 
ATOM   1661 O  OE1   . GLU A 1 224 ? -36.138 35.434 -16.662 1.00 79.04  ? 221 GLU A OE1   1 
ATOM   1662 O  OE2   . GLU A 1 224 ? -37.631 33.881 -16.980 1.00 81.36  ? 221 GLU A OE2   1 
ATOM   1663 N  N     . ARG A 1 225 ? -37.427 40.180 -15.022 1.00 83.15  ? 222 ARG A N     1 
ATOM   1664 C  CA    . ARG A 1 225 ? -37.109 41.598 -15.039 1.00 83.20  ? 222 ARG A CA    1 
ATOM   1665 C  C     . ARG A 1 225 ? -35.946 41.973 -14.124 1.00 83.20  ? 222 ARG A C     1 
ATOM   1666 O  O     . ARG A 1 225 ? -35.255 42.960 -14.389 1.00 83.49  ? 222 ARG A O     1 
ATOM   1667 C  CB    . ARG A 1 225 ? -38.341 42.449 -14.737 1.00 83.42  ? 222 ARG A CB    1 
ATOM   1668 C  CG    . ARG A 1 225 ? -38.163 43.919 -15.011 1.00 82.74  ? 222 ARG A CG    1 
ATOM   1669 C  CD    . ARG A 1 225 ? -37.458 44.179 -16.334 1.00 83.42  ? 222 ARG A CD    1 
ATOM   1670 N  NE    . ARG A 1 225 ? -37.516 45.600 -16.634 1.00 85.43  ? 222 ARG A NE    1 
ATOM   1671 C  CZ    . ARG A 1 225 ? -36.654 46.510 -16.186 1.00 85.56  ? 222 ARG A CZ    1 
ATOM   1672 N  NH1   . ARG A 1 225 ? -35.622 46.151 -15.427 1.00 85.29  ? 222 ARG A NH1   1 
ATOM   1673 N  NH2   . ARG A 1 225 ? -36.827 47.788 -16.510 1.00 85.37  ? 222 ARG A NH2   1 
ATOM   1674 N  N     . LYS A 1 226 ? -35.711 41.198 -13.067 1.00 83.57  ? 223 LYS A N     1 
ATOM   1675 C  CA    . LYS A 1 226 ? -34.515 41.418 -12.248 1.00 83.75  ? 223 LYS A CA    1 
ATOM   1676 C  C     . LYS A 1 226 ? -33.265 40.876 -12.946 1.00 83.77  ? 223 LYS A C     1 
ATOM   1677 O  O     . LYS A 1 226 ? -32.176 41.423 -12.793 1.00 83.54  ? 223 LYS A O     1 
ATOM   1678 C  CB    . LYS A 1 226 ? -34.669 40.850 -10.829 1.00 83.99  ? 223 LYS A CB    1 
ATOM   1679 C  CG    . LYS A 1 226 ? -34.067 41.727 -9.701  1.00 84.65  ? 223 LYS A CG    1 
ATOM   1680 C  CD    . LYS A 1 226 ? -34.691 43.142 -9.665  1.00 86.77  ? 223 LYS A CD    1 
ATOM   1681 C  CE    . LYS A 1 226 ? -34.965 43.680 -8.240  1.00 88.63  ? 223 LYS A CE    1 
ATOM   1682 N  NZ    . LYS A 1 226 ? -33.771 44.189 -7.439  1.00 90.15  ? 223 LYS A NZ    1 
ATOM   1683 N  N     . ASN A 1 227 ? -33.430 39.824 -13.736 1.00 84.35  ? 224 ASN A N     1 
ATOM   1684 C  CA    . ASN A 1 227 ? -32.318 39.291 -14.494 1.00 85.36  ? 224 ASN A CA    1 
ATOM   1685 C  C     . ASN A 1 227 ? -31.733 40.337 -15.421 1.00 86.08  ? 224 ASN A C     1 
ATOM   1686 O  O     . ASN A 1 227 ? -30.521 40.533 -15.470 1.00 86.17  ? 224 ASN A O     1 
ATOM   1687 C  CB    . ASN A 1 227 ? -32.756 38.063 -15.270 1.00 85.65  ? 224 ASN A CB    1 
ATOM   1688 C  CG    . ASN A 1 227 ? -33.093 36.922 -14.365 1.00 86.07  ? 224 ASN A CG    1 
ATOM   1689 O  OD1   . ASN A 1 227 ? -32.862 37.000 -13.166 1.00 85.95  ? 224 ASN A OD1   1 
ATOM   1690 N  ND2   . ASN A 1 227 ? -33.635 35.847 -14.922 1.00 87.72  ? 224 ASN A ND2   1 
ATOM   1691 N  N     . SER A 1 228 ? -32.613 41.018 -16.141 1.00 87.16  ? 225 SER A N     1 
ATOM   1692 C  CA    . SER A 1 228 ? -32.227 42.123 -16.990 1.00 88.38  ? 225 SER A CA    1 
ATOM   1693 C  C     . SER A 1 228 ? -31.317 43.071 -16.227 1.00 88.57  ? 225 SER A C     1 
ATOM   1694 O  O     . SER A 1 228 ? -30.177 43.305 -16.619 1.00 88.90  ? 225 SER A O     1 
ATOM   1695 C  CB    . SER A 1 228 ? -33.469 42.871 -17.464 1.00 88.58  ? 225 SER A CB    1 
ATOM   1696 O  OG    . SER A 1 228 ? -33.172 43.625 -18.625 1.00 90.78  ? 225 SER A OG    1 
ATOM   1697 N  N     . ASP A 1 229 ? -31.815 43.585 -15.113 1.00 88.92  ? 226 ASP A N     1 
ATOM   1698 C  CA    . ASP A 1 229 ? -31.064 44.552 -14.335 1.00 89.53  ? 226 ASP A CA    1 
ATOM   1699 C  C     . ASP A 1 229 ? -29.739 44.040 -13.801 1.00 88.97  ? 226 ASP A C     1 
ATOM   1700 O  O     . ASP A 1 229 ? -28.788 44.816 -13.683 1.00 88.85  ? 226 ASP A O     1 
ATOM   1701 C  CB    . ASP A 1 229 ? -31.925 45.100 -13.209 1.00 90.37  ? 226 ASP A CB    1 
ATOM   1702 C  CG    . ASP A 1 229 ? -32.674 46.352 -13.618 1.00 93.72  ? 226 ASP A CG    1 
ATOM   1703 O  OD1   . ASP A 1 229 ? -32.880 46.556 -14.851 1.00 96.71  ? 226 ASP A OD1   1 
ATOM   1704 O  OD2   . ASP A 1 229 ? -33.042 47.136 -12.701 1.00 97.56  ? 226 ASP A OD2   1 
ATOM   1705 N  N     . ILE A 1 230 ? -29.688 42.744 -13.479 1.00 88.49  ? 227 ILE A N     1 
ATOM   1706 C  CA    . ILE A 1 230 ? -28.441 42.084 -13.084 1.00 88.25  ? 227 ILE A CA    1 
ATOM   1707 C  C     . ILE A 1 230 ? -27.444 42.067 -14.258 1.00 88.46  ? 227 ILE A C     1 
ATOM   1708 O  O     . ILE A 1 230 ? -26.394 42.715 -14.192 1.00 88.77  ? 227 ILE A O     1 
ATOM   1709 C  CB    . ILE A 1 230 ? -28.670 40.656 -12.545 1.00 88.19  ? 227 ILE A CB    1 
ATOM   1710 C  CG1   . ILE A 1 230 ? -29.524 40.688 -11.287 1.00 87.90  ? 227 ILE A CG1   1 
ATOM   1711 C  CG2   . ILE A 1 230 ? -27.357 40.005 -12.202 1.00 88.57  ? 227 ILE A CG2   1 
ATOM   1712 C  CD1   . ILE A 1 230 ? -30.108 39.348 -10.919 1.00 87.89  ? 227 ILE A CD1   1 
ATOM   1713 N  N     . LYS A 1 231 ? -27.780 41.353 -15.331 1.00 88.12  ? 228 LYS A N     1 
ATOM   1714 C  CA    . LYS A 1 231 ? -26.918 41.309 -16.504 1.00 88.24  ? 228 LYS A CA    1 
ATOM   1715 C  C     . LYS A 1 231 ? -26.477 42.707 -16.942 1.00 88.20  ? 228 LYS A C     1 
ATOM   1716 O  O     . LYS A 1 231 ? -25.303 42.911 -17.224 1.00 88.87  ? 228 LYS A O     1 
ATOM   1717 C  CB    . LYS A 1 231 ? -27.577 40.557 -17.657 1.00 88.42  ? 228 LYS A CB    1 
ATOM   1718 C  CG    . LYS A 1 231 ? -27.444 39.039 -17.595 1.00 88.92  ? 228 LYS A CG    1 
ATOM   1719 C  CD    . LYS A 1 231 ? -28.164 38.395 -18.763 1.00 89.74  ? 228 LYS A CD    1 
ATOM   1720 C  CE    . LYS A 1 231 ? -27.557 37.062 -19.096 1.00 91.84  ? 228 LYS A CE    1 
ATOM   1721 N  NZ    . LYS A 1 231 ? -27.478 36.870 -20.583 1.00 95.27  ? 228 LYS A NZ    1 
ATOM   1722 N  N     . ARG A 1 232 ? -27.393 43.674 -16.965 1.00 87.73  ? 229 ARG A N     1 
ATOM   1723 C  CA    . ARG A 1 232 ? -27.040 45.053 -17.361 1.00 88.03  ? 229 ARG A CA    1 
ATOM   1724 C  C     . ARG A 1 232 ? -25.938 45.662 -16.482 1.00 88.07  ? 229 ARG A C     1 
ATOM   1725 O  O     . ARG A 1 232 ? -24.920 46.116 -17.001 1.00 88.81  ? 229 ARG A O     1 
ATOM   1726 C  CB    . ARG A 1 232 ? -28.279 45.963 -17.406 1.00 87.90  ? 229 ARG A CB    1 
ATOM   1727 C  CG    . ARG A 1 232 ? -28.054 47.379 -17.945 1.00 88.55  ? 229 ARG A CG    1 
ATOM   1728 C  CD    . ARG A 1 232 ? -29.391 48.065 -18.257 1.00 91.30  ? 229 ARG A CD    1 
ATOM   1729 N  NE    . ARG A 1 232 ? -30.200 48.318 -17.057 1.00 93.93  ? 229 ARG A NE    1 
ATOM   1730 C  CZ    . ARG A 1 232 ? -30.489 49.528 -16.563 1.00 95.14  ? 229 ARG A CZ    1 
ATOM   1731 N  NH1   . ARG A 1 232 ? -30.049 50.628 -17.172 1.00 96.00  ? 229 ARG A NH1   1 
ATOM   1732 N  NH2   . ARG A 1 232 ? -31.231 49.640 -15.459 1.00 94.67  ? 229 ARG A NH2   1 
ATOM   1733 N  N     . LEU A 1 233 ? -26.133 45.657 -15.165 1.00 87.44  ? 230 LEU A N     1 
ATOM   1734 C  CA    . LEU A 1 233 ? -25.124 46.188 -14.240 1.00 87.46  ? 230 LEU A CA    1 
ATOM   1735 C  C     . LEU A 1 233 ? -23.778 45.430 -14.247 1.00 88.05  ? 230 LEU A C     1 
ATOM   1736 O  O     . LEU A 1 233 ? -22.714 46.046 -14.135 1.00 88.61  ? 230 LEU A O     1 
ATOM   1737 C  CB    . LEU A 1 233 ? -25.673 46.259 -12.819 1.00 86.93  ? 230 LEU A CB    1 
ATOM   1738 C  CG    . LEU A 1 233 ? -24.693 46.852 -11.811 1.00 87.09  ? 230 LEU A CG    1 
ATOM   1739 C  CD1   . LEU A 1 233 ? -24.811 48.344 -11.797 1.00 88.08  ? 230 LEU A CD1   1 
ATOM   1740 C  CD2   . LEU A 1 233 ? -24.963 46.321 -10.453 1.00 87.43  ? 230 LEU A CD2   1 
ATOM   1741 N  N     . LEU A 1 234 ? -23.824 44.104 -14.358 1.00 87.82  ? 231 LEU A N     1 
ATOM   1742 C  CA    . LEU A 1 234 ? -22.603 43.318 -14.497 1.00 88.46  ? 231 LEU A CA    1 
ATOM   1743 C  C     . LEU A 1 234 ? -21.865 43.699 -15.773 1.00 89.28  ? 231 LEU A C     1 
ATOM   1744 O  O     . LEU A 1 234 ? -20.658 43.946 -15.750 1.00 90.52  ? 231 LEU A O     1 
ATOM   1745 C  CB    . LEU A 1 234 ? -22.908 41.829 -14.517 1.00 88.32  ? 231 LEU A CB    1 
ATOM   1746 C  CG    . LEU A 1 234 ? -23.191 41.161 -13.186 1.00 87.95  ? 231 LEU A CG    1 
ATOM   1747 C  CD1   . LEU A 1 234 ? -23.957 39.884 -13.434 1.00 86.81  ? 231 LEU A CD1   1 
ATOM   1748 C  CD2   . LEU A 1 234 ? -21.890 40.887 -12.459 1.00 89.47  ? 231 LEU A CD2   1 
ATOM   1749 N  N     . THR A 1 235 ? -22.589 43.748 -16.886 1.00 88.88  ? 232 THR A N     1 
ATOM   1750 C  CA    . THR A 1 235 ? -22.010 44.200 -18.141 1.00 89.70  ? 232 THR A CA    1 
ATOM   1751 C  C     . THR A 1 235 ? -21.231 45.506 -17.919 1.00 90.50  ? 232 THR A C     1 
ATOM   1752 O  O     . THR A 1 235 ? -20.061 45.618 -18.303 1.00 91.70  ? 232 THR A O     1 
ATOM   1753 C  CB    . THR A 1 235 ? -23.097 44.433 -19.200 1.00 89.18  ? 232 THR A CB    1 
ATOM   1754 O  OG1   . THR A 1 235 ? -23.754 43.202 -19.497 1.00 88.68  ? 232 THR A OG1   1 
ATOM   1755 C  CG2   . THR A 1 235 ? -22.493 44.939 -20.455 1.00 90.39  ? 232 THR A CG2   1 
ATOM   1756 N  N     . LYS A 1 236 ? -21.890 46.472 -17.274 1.00 89.87  ? 233 LYS A N     1 
ATOM   1757 C  CA    . LYS A 1 236 ? -21.347 47.801 -17.065 1.00 90.05  ? 233 LYS A CA    1 
ATOM   1758 C  C     . LYS A 1 236 ? -20.111 47.758 -16.200 1.00 91.04  ? 233 LYS A C     1 
ATOM   1759 O  O     . LYS A 1 236 ? -19.200 48.568 -16.360 1.00 92.03  ? 233 LYS A O     1 
ATOM   1760 C  CB    . LYS A 1 236 ? -22.386 48.684 -16.397 1.00 88.93  ? 233 LYS A CB    1 
ATOM   1761 C  CG    . LYS A 1 236 ? -23.465 49.197 -17.317 1.00 88.30  ? 233 LYS A CG    1 
ATOM   1762 C  CD    . LYS A 1 236 ? -24.224 50.341 -16.643 1.00 88.40  ? 233 LYS A CD    1 
ATOM   1763 C  CE    . LYS A 1 236 ? -25.619 50.565 -17.214 1.00 86.87  ? 233 LYS A CE    1 
ATOM   1764 N  NZ    . LYS A 1 236 ? -26.582 50.827 -16.108 1.00 86.64  ? 233 LYS A NZ    1 
ATOM   1765 N  N     . LEU A 1 237 ? -20.079 46.816 -15.269 1.00 91.20  ? 234 LEU A N     1 
ATOM   1766 C  CA    . LEU A 1 237 ? -18.953 46.733 -14.354 1.00 92.64  ? 234 LEU A CA    1 
ATOM   1767 C  C     . LEU A 1 237 ? -17.790 45.990 -14.973 1.00 94.47  ? 234 LEU A C     1 
ATOM   1768 O  O     . LEU A 1 237 ? -16.682 45.996 -14.440 1.00 95.59  ? 234 LEU A O     1 
ATOM   1769 C  CB    . LEU A 1 237 ? -19.371 46.111 -13.022 1.00 91.78  ? 234 LEU A CB    1 
ATOM   1770 C  CG    . LEU A 1 237 ? -20.150 47.121 -12.184 1.00 91.25  ? 234 LEU A CG    1 
ATOM   1771 C  CD1   . LEU A 1 237 ? -20.489 46.575 -10.826 1.00 91.15  ? 234 LEU A CD1   1 
ATOM   1772 C  CD2   . LEU A 1 237 ? -19.356 48.424 -12.059 1.00 93.13  ? 234 LEU A CD2   1 
ATOM   1773 N  N     . LEU A 1 238 ? -18.043 45.379 -16.121 1.00 95.27  ? 235 LEU A N     1 
ATOM   1774 C  CA    . LEU A 1 238 ? -17.048 44.544 -16.749 1.00 97.38  ? 235 LEU A CA    1 
ATOM   1775 C  C     . LEU A 1 238 ? -16.532 45.076 -18.082 1.00 99.31  ? 235 LEU A C     1 
ATOM   1776 O  O     . LEU A 1 238 ? -15.791 44.374 -18.775 1.00 100.80 ? 235 LEU A O     1 
ATOM   1777 C  CB    . LEU A 1 238 ? -17.594 43.129 -16.916 1.00 96.78  ? 235 LEU A CB    1 
ATOM   1778 C  CG    . LEU A 1 238 ? -17.860 42.353 -15.634 1.00 95.54  ? 235 LEU A CG    1 
ATOM   1779 C  CD1   . LEU A 1 238 ? -18.455 41.044 -16.028 1.00 95.57  ? 235 LEU A CD1   1 
ATOM   1780 C  CD2   . LEU A 1 238 ? -16.596 42.135 -14.822 1.00 96.28  ? 235 LEU A CD2   1 
ATOM   1781 N  N     . VAL A 1 239 ? -16.909 46.302 -18.447 1.00 100.10 ? 236 VAL A N     1 
ATOM   1782 C  CA    . VAL A 1 239 ? -16.406 46.905 -19.685 1.00 102.21 ? 236 VAL A CA    1 
ATOM   1783 C  C     . VAL A 1 239 ? -14.905 47.032 -19.527 1.00 104.61 ? 236 VAL A C     1 
ATOM   1784 O  O     . VAL A 1 239 ? -14.440 47.424 -18.462 1.00 105.09 ? 236 VAL A O     1 
ATOM   1785 C  CB    . VAL A 1 239 ? -16.999 48.296 -19.958 1.00 101.62 ? 236 VAL A CB    1 
ATOM   1786 C  CG1   . VAL A 1 239 ? -16.781 48.655 -21.417 1.00 103.20 ? 236 VAL A CG1   1 
ATOM   1787 C  CG2   . VAL A 1 239 ? -18.487 48.335 -19.617 1.00 99.85  ? 236 VAL A CG2   1 
ATOM   1788 N  N     . GLY A 1 240 ? -14.143 46.665 -20.547 1.00 106.89 ? 237 GLY A N     1 
ATOM   1789 C  CA    . GLY A 1 240 ? -12.698 46.677 -20.407 1.00 110.12 ? 237 GLY A CA    1 
ATOM   1790 C  C     . GLY A 1 240 ? -12.173 45.393 -19.793 1.00 111.63 ? 237 GLY A C     1 
ATOM   1791 O  O     . GLY A 1 240 ? -11.502 44.630 -20.470 1.00 113.48 ? 237 GLY A O     1 
ATOM   1792 N  N     . ARG A 1 241 ? -12.487 45.136 -18.523 1.00 111.69 ? 238 ARG A N     1 
ATOM   1793 C  CA    . ARG A 1 241 ? -11.973 43.952 -17.795 1.00 113.21 ? 238 ARG A CA    1 
ATOM   1794 C  C     . ARG A 1 241 ? -12.391 42.600 -18.397 1.00 113.71 ? 238 ARG A C     1 
ATOM   1795 O  O     . ARG A 1 241 ? -13.376 42.521 -19.139 1.00 112.62 ? 238 ARG A O     1 
ATOM   1796 C  CB    . ARG A 1 241 ? -12.382 43.996 -16.311 1.00 112.13 ? 238 ARG A CB    1 
ATOM   1797 C  CG    . ARG A 1 241 ? -12.472 45.391 -15.746 1.00 112.52 ? 238 ARG A CG    1 
ATOM   1798 C  CD    . ARG A 1 241 ? -12.122 45.454 -14.271 1.00 115.05 ? 238 ARG A CD    1 
ATOM   1799 N  NE    . ARG A 1 241 ? -11.233 46.590 -14.034 1.00 118.36 ? 238 ARG A NE    1 
ATOM   1800 C  CZ    . ARG A 1 241 ? -11.617 47.867 -13.999 1.00 119.23 ? 238 ARG A CZ    1 
ATOM   1801 N  NH1   . ARG A 1 241 ? -12.896 48.195 -14.161 1.00 118.41 ? 238 ARG A NH1   1 
ATOM   1802 N  NH2   . ARG A 1 241 ? -10.718 48.824 -13.793 1.00 120.84 ? 238 ARG A NH2   1 
ATOM   1803 N  N     . PRO A 1 242 ? -11.628 41.532 -18.090 1.00 115.68 ? 239 PRO A N     1 
ATOM   1804 C  CA    . PRO A 1 242 ? -12.087 40.169 -18.366 1.00 116.28 ? 239 PRO A CA    1 
ATOM   1805 C  C     . PRO A 1 242 ? -13.294 39.838 -17.493 1.00 115.31 ? 239 PRO A C     1 
ATOM   1806 O  O     . PRO A 1 242 ? -13.363 40.302 -16.346 1.00 115.03 ? 239 PRO A O     1 
ATOM   1807 C  CB    . PRO A 1 242 ? -10.897 39.302 -17.949 1.00 117.95 ? 239 PRO A CB    1 
ATOM   1808 C  CG    . PRO A 1 242 ? -9.729  40.207 -17.982 1.00 119.34 ? 239 PRO A CG    1 
ATOM   1809 C  CD    . PRO A 1 242 ? -10.237 41.557 -17.607 1.00 117.57 ? 239 PRO A CD    1 
ATOM   1810 N  N     . THR A 1 243 ? -14.218 39.039 -18.030 1.00 115.46 ? 240 THR A N     1 
ATOM   1811 C  CA    . THR A 1 243 ? -15.514 38.743 -17.388 1.00 114.52 ? 240 THR A CA    1 
ATOM   1812 C  C     . THR A 1 243 ? -15.399 37.930 -16.087 1.00 115.09 ? 240 THR A C     1 
ATOM   1813 O  O     . THR A 1 243 ? -15.721 36.739 -16.057 1.00 115.34 ? 240 THR A O     1 
ATOM   1814 C  CB    . THR A 1 243 ? -16.480 37.996 -18.361 1.00 114.05 ? 240 THR A CB    1 
ATOM   1815 O  OG1   . THR A 1 243 ? -16.044 36.642 -18.534 1.00 115.21 ? 240 THR A OG1   1 
ATOM   1816 C  CG2   . THR A 1 243 ? -16.551 38.680 -19.722 1.00 114.06 ? 240 THR A CG2   1 
ATOM   1817 N  N     . LYS A 1 244 ? -14.935 38.579 -15.021 1.00 115.78 ? 241 LYS A N     1 
ATOM   1818 C  CA    . LYS A 1 244 ? -14.795 37.940 -13.715 1.00 116.37 ? 241 LYS A CA    1 
ATOM   1819 C  C     . LYS A 1 244 ? -15.944 38.355 -12.815 1.00 114.69 ? 241 LYS A C     1 
ATOM   1820 O  O     . LYS A 1 244 ? -15.782 39.206 -11.936 1.00 114.87 ? 241 LYS A O     1 
ATOM   1821 C  CB    . LYS A 1 244 ? -13.448 38.287 -13.071 1.00 118.11 ? 241 LYS A CB    1 
ATOM   1822 C  CG    . LYS A 1 244 ? -12.419 37.184 -13.186 1.00 120.42 ? 241 LYS A CG    1 
ATOM   1823 C  CD    . LYS A 1 244 ? -11.075 37.575 -12.606 1.00 123.37 ? 241 LYS A CD    1 
ATOM   1824 C  CE    . LYS A 1 244 ? -10.246 38.341 -13.625 1.00 125.00 ? 241 LYS A CE    1 
ATOM   1825 N  NZ    . LYS A 1 244 ? -8.847  38.521 -13.152 1.00 127.86 ? 241 LYS A NZ    1 
ATOM   1826 N  N     . TRP A 1 245 ? -17.103 37.746 -13.037 1.00 113.23 ? 242 TRP A N     1 
ATOM   1827 C  CA    . TRP A 1 245 ? -18.318 38.168 -12.356 1.00 111.38 ? 242 TRP A CA    1 
ATOM   1828 C  C     . TRP A 1 245 ? -18.507 37.597 -10.957 1.00 111.38 ? 242 TRP A C     1 
ATOM   1829 O  O     . TRP A 1 245 ? -19.167 38.221 -10.130 1.00 110.87 ? 242 TRP A O     1 
ATOM   1830 C  CB    . TRP A 1 245 ? -19.542 37.875 -13.211 1.00 110.27 ? 242 TRP A CB    1 
ATOM   1831 C  CG    . TRP A 1 245 ? -19.603 36.477 -13.701 1.00 110.23 ? 242 TRP A CG    1 
ATOM   1832 C  CD1   . TRP A 1 245 ? -19.086 36.003 -14.862 1.00 111.06 ? 242 TRP A CD1   1 
ATOM   1833 C  CD2   . TRP A 1 245 ? -20.226 35.361 -13.053 1.00 109.18 ? 242 TRP A CD2   1 
ATOM   1834 N  NE1   . TRP A 1 245 ? -19.344 34.661 -14.985 1.00 110.78 ? 242 TRP A NE1   1 
ATOM   1835 C  CE2   . TRP A 1 245 ? -20.044 34.241 -13.887 1.00 109.51 ? 242 TRP A CE2   1 
ATOM   1836 C  CE3   . TRP A 1 245 ? -20.920 35.199 -11.850 1.00 108.29 ? 242 TRP A CE3   1 
ATOM   1837 C  CZ2   . TRP A 1 245 ? -20.529 32.972 -13.559 1.00 109.28 ? 242 TRP A CZ2   1 
ATOM   1838 C  CZ3   . TRP A 1 245 ? -21.405 33.933 -11.527 1.00 107.98 ? 242 TRP A CZ3   1 
ATOM   1839 C  CH2   . TRP A 1 245 ? -21.207 32.839 -12.380 1.00 107.86 ? 242 TRP A CH2   1 
ATOM   1840 N  N     . TYR A 1 246 ? -17.938 36.424 -10.687 1.00 112.11 ? 243 TYR A N     1 
ATOM   1841 C  CA    . TYR A 1 246 ? -18.115 35.772 -9.388  1.00 111.93 ? 243 TYR A CA    1 
ATOM   1842 C  C     . TYR A 1 246 ? -18.007 36.756 -8.222  1.00 111.23 ? 243 TYR A C     1 
ATOM   1843 O  O     . TYR A 1 246 ? -18.960 36.920 -7.468  1.00 110.54 ? 243 TYR A O     1 
ATOM   1844 C  CB    . TYR A 1 246 ? -17.128 34.618 -9.210  1.00 113.75 ? 243 TYR A CB    1 
ATOM   1845 C  CG    . TYR A 1 246 ? -17.301 33.852 -7.920  1.00 114.96 ? 243 TYR A CG    1 
ATOM   1846 C  CD1   . TYR A 1 246 ? -18.076 32.700 -7.876  1.00 115.62 ? 243 TYR A CD1   1 
ATOM   1847 C  CD2   . TYR A 1 246 ? -16.688 34.277 -6.744  1.00 116.67 ? 243 TYR A CD2   1 
ATOM   1848 C  CE1   . TYR A 1 246 ? -18.242 31.990 -6.699  1.00 116.81 ? 243 TYR A CE1   1 
ATOM   1849 C  CE2   . TYR A 1 246 ? -16.850 33.575 -5.560  1.00 118.09 ? 243 TYR A CE2   1 
ATOM   1850 C  CZ    . TYR A 1 246 ? -17.627 32.431 -5.550  1.00 118.17 ? 243 TYR A CZ    1 
ATOM   1851 O  OH    . TYR A 1 246 ? -17.793 31.726 -4.387  1.00 120.11 ? 243 TYR A OH    1 
ATOM   1852 N  N     . ASP A 1 247 ? -16.864 37.424 -8.094  1.00 111.26 ? 244 ASP A N     1 
ATOM   1853 C  CA    . ASP A 1 247 ? -16.636 38.334 -6.977  1.00 110.62 ? 244 ASP A CA    1 
ATOM   1854 C  C     . ASP A 1 247 ? -17.487 39.587 -7.066  1.00 108.15 ? 244 ASP A C     1 
ATOM   1855 O  O     . ASP A 1 247 ? -17.604 40.325 -6.092  1.00 108.38 ? 244 ASP A O     1 
ATOM   1856 C  CB    . ASP A 1 247 ? -15.162 38.727 -6.861  1.00 112.54 ? 244 ASP A CB    1 
ATOM   1857 C  CG    . ASP A 1 247 ? -14.240 37.555 -7.043  1.00 115.73 ? 244 ASP A CG    1 
ATOM   1858 O  OD1   . ASP A 1 247 ? -13.678 37.062 -6.043  1.00 118.45 ? 244 ASP A OD1   1 
ATOM   1859 O  OD2   . ASP A 1 247 ? -14.092 37.109 -8.199  1.00 118.82 ? 244 ASP A OD2   1 
ATOM   1860 N  N     . LEU A 1 248 ? -18.085 39.843 -8.219  1.00 105.61 ? 245 LEU A N     1 
ATOM   1861 C  CA    . LEU A 1 248 ? -18.937 41.016 -8.334  1.00 103.07 ? 245 LEU A CA    1 
ATOM   1862 C  C     . LEU A 1 248 ? -20.351 40.826 -7.775  1.00 101.39 ? 245 LEU A C     1 
ATOM   1863 O  O     . LEU A 1 248 ? -20.956 41.789 -7.293  1.00 101.00 ? 245 LEU A O     1 
ATOM   1864 C  CB    . LEU A 1 248 ? -18.995 41.507 -9.771  1.00 102.54 ? 245 LEU A CB    1 
ATOM   1865 C  CG    . LEU A 1 248 ? -17.770 42.287 -10.215 1.00 102.56 ? 245 LEU A CG    1 
ATOM   1866 C  CD1   . LEU A 1 248 ? -18.016 42.800 -11.596 1.00 101.95 ? 245 LEU A CD1   1 
ATOM   1867 C  CD2   . LEU A 1 248 ? -17.509 43.430 -9.268  1.00 101.82 ? 245 LEU A CD2   1 
ATOM   1868 N  N     . LEU A 1 249 ? -20.865 39.594 -7.831  1.00 100.00 ? 246 LEU A N     1 
ATOM   1869 C  CA    . LEU A 1 249 ? -22.236 39.289 -7.414  1.00 97.75  ? 246 LEU A CA    1 
ATOM   1870 C  C     . LEU A 1 249 ? -22.705 40.012 -6.147  1.00 96.77  ? 246 LEU A C     1 
ATOM   1871 O  O     . LEU A 1 249 ? -23.689 40.753 -6.210  1.00 95.91  ? 246 LEU A O     1 
ATOM   1872 C  CB    . LEU A 1 249 ? -22.455 37.783 -7.300  1.00 98.23  ? 246 LEU A CB    1 
ATOM   1873 C  CG    . LEU A 1 249 ? -22.698 37.037 -8.606  1.00 97.74  ? 246 LEU A CG    1 
ATOM   1874 C  CD1   . LEU A 1 249 ? -22.788 35.580 -8.308  1.00 98.50  ? 246 LEU A CD1   1 
ATOM   1875 C  CD2   . LEU A 1 249 ? -23.981 37.492 -9.255  1.00 96.57  ? 246 LEU A CD2   1 
ATOM   1876 N  N     . PRO A 1 250 ? -22.013 39.811 -5.001  1.00 96.78  ? 247 PRO A N     1 
ATOM   1877 C  CA    . PRO A 1 250 ? -22.326 40.588 -3.804  1.00 96.19  ? 247 PRO A CA    1 
ATOM   1878 C  C     . PRO A 1 250 ? -22.569 42.074 -4.089  1.00 94.94  ? 247 PRO A C     1 
ATOM   1879 O  O     . PRO A 1 250 ? -23.628 42.596 -3.736  1.00 94.45  ? 247 PRO A O     1 
ATOM   1880 C  CB    . PRO A 1 250 ? -21.078 40.412 -2.935  1.00 97.56  ? 247 PRO A CB    1 
ATOM   1881 C  CG    . PRO A 1 250 ? -20.176 39.458 -3.682  1.00 98.30  ? 247 PRO A CG    1 
ATOM   1882 C  CD    . PRO A 1 250 ? -21.013 38.781 -4.693  1.00 97.83  ? 247 PRO A CD    1 
ATOM   1883 N  N     . VAL A 1 251 ? -21.619 42.742 -4.740  1.00 94.28  ? 248 VAL A N     1 
ATOM   1884 C  CA    . VAL A 1 251 ? -21.755 44.168 -5.021  1.00 93.02  ? 248 VAL A CA    1 
ATOM   1885 C  C     . VAL A 1 251 ? -23.055 44.446 -5.781  1.00 91.43  ? 248 VAL A C     1 
ATOM   1886 O  O     . VAL A 1 251 ? -23.863 45.287 -5.376  1.00 91.07  ? 248 VAL A O     1 
ATOM   1887 C  CB    . VAL A 1 251 ? -20.559 44.717 -5.807  1.00 93.47  ? 248 VAL A CB    1 
ATOM   1888 C  CG1   . VAL A 1 251 ? -20.321 46.185 -5.444  1.00 93.48  ? 248 VAL A CG1   1 
ATOM   1889 C  CG2   . VAL A 1 251 ? -19.325 43.893 -5.517  1.00 94.65  ? 248 VAL A CG2   1 
ATOM   1890 N  N     . VAL A 1 252 ? -23.261 43.722 -6.871  1.00 90.31  ? 249 VAL A N     1 
ATOM   1891 C  CA    . VAL A 1 252 ? -24.488 43.833 -7.634  1.00 88.84  ? 249 VAL A CA    1 
ATOM   1892 C  C     . VAL A 1 252 ? -25.709 43.681 -6.714  1.00 88.51  ? 249 VAL A C     1 
ATOM   1893 O  O     . VAL A 1 252 ? -26.591 44.558 -6.696  1.00 87.92  ? 249 VAL A O     1 
ATOM   1894 C  CB    . VAL A 1 252 ? -24.520 42.784 -8.759  1.00 88.91  ? 249 VAL A CB    1 
ATOM   1895 C  CG1   . VAL A 1 252 ? -25.797 42.902 -9.595  1.00 87.60  ? 249 VAL A CG1   1 
ATOM   1896 C  CG2   . VAL A 1 252 ? -23.258 42.887 -9.635  1.00 89.05  ? 249 VAL A CG2   1 
ATOM   1897 N  N     . GLN A 1 253 ? -25.737 42.587 -5.940  1.00 88.66  ? 250 GLN A N     1 
ATOM   1898 C  CA    . GLN A 1 253 ? -26.844 42.298 -5.012  1.00 88.53  ? 250 GLN A CA    1 
ATOM   1899 C  C     . GLN A 1 253 ? -27.195 43.530 -4.188  1.00 88.11  ? 250 GLN A C     1 
ATOM   1900 O  O     . GLN A 1 253 ? -28.294 44.057 -4.310  1.00 87.53  ? 250 GLN A O     1 
ATOM   1901 C  CB    . GLN A 1 253 ? -26.512 41.118 -4.098  1.00 89.43  ? 250 GLN A CB    1 
ATOM   1902 C  CG    . GLN A 1 253 ? -27.724 40.372 -3.578  1.00 90.50  ? 250 GLN A CG    1 
ATOM   1903 C  CD    . GLN A 1 253 ? -27.378 39.393 -2.466  1.00 93.81  ? 250 GLN A CD    1 
ATOM   1904 O  OE1   . GLN A 1 253 ? -27.361 38.174 -2.669  1.00 95.84  ? 250 GLN A OE1   1 
ATOM   1905 N  NE2   . GLN A 1 253 ? -27.098 39.921 -1.283  1.00 94.65  ? 250 GLN A NE2   1 
ATOM   1906 N  N     . LEU A 1 254 ? -26.236 43.988 -3.384  1.00 88.47  ? 251 LEU A N     1 
ATOM   1907 C  CA    . LEU A 1 254 ? -26.329 45.243 -2.642  1.00 88.48  ? 251 LEU A CA    1 
ATOM   1908 C  C     . LEU A 1 254 ? -26.773 46.423 -3.481  1.00 88.15  ? 251 LEU A C     1 
ATOM   1909 O  O     . LEU A 1 254 ? -27.724 47.109 -3.117  1.00 88.26  ? 251 LEU A O     1 
ATOM   1910 C  CB    . LEU A 1 254 ? -24.982 45.602 -2.027  1.00 89.04  ? 251 LEU A CB    1 
ATOM   1911 C  CG    . LEU A 1 254 ? -24.832 45.768 -0.517  1.00 89.11  ? 251 LEU A CG    1 
ATOM   1912 C  CD1   . LEU A 1 254 ? -23.437 46.271 -0.240  1.00 89.69  ? 251 LEU A CD1   1 
ATOM   1913 C  CD2   . LEU A 1 254 ? -25.831 46.751 0.030   1.00 87.89  ? 251 LEU A CD2   1 
ATOM   1914 N  N     . ALA A 1 255 ? -26.073 46.670 -4.587  1.00 88.21  ? 252 ALA A N     1 
ATOM   1915 C  CA    . ALA A 1 255 ? -26.326 47.841 -5.408  1.00 88.30  ? 252 ALA A CA    1 
ATOM   1916 C  C     . ALA A 1 255 ? -27.783 47.872 -5.829  1.00 88.42  ? 252 ALA A C     1 
ATOM   1917 O  O     . ALA A 1 255 ? -28.473 48.893 -5.665  1.00 88.34  ? 252 ALA A O     1 
ATOM   1918 C  CB    . ALA A 1 255 ? -25.422 47.835 -6.614  1.00 88.10  ? 252 ALA A CB    1 
ATOM   1919 N  N     . LEU A 1 256 ? -28.248 46.729 -6.331  1.00 89.04  ? 253 LEU A N     1 
ATOM   1920 C  CA    . LEU A 1 256 ? -29.598 46.596 -6.854  1.00 89.72  ? 253 LEU A CA    1 
ATOM   1921 C  C     . LEU A 1 256 ? -30.691 46.641 -5.785  1.00 90.65  ? 253 LEU A C     1 
ATOM   1922 O  O     . LEU A 1 256 ? -31.825 47.041 -6.065  1.00 90.84  ? 253 LEU A O     1 
ATOM   1923 C  CB    . LEU A 1 256 ? -29.712 45.311 -7.664  1.00 89.44  ? 253 LEU A CB    1 
ATOM   1924 C  CG    . LEU A 1 256 ? -29.025 45.345 -9.030  1.00 90.02  ? 253 LEU A CG    1 
ATOM   1925 C  CD1   . LEU A 1 256 ? -29.134 43.981 -9.710  1.00 91.17  ? 253 LEU A CD1   1 
ATOM   1926 C  CD2   . LEU A 1 256 ? -29.569 46.454 -9.949  1.00 89.52  ? 253 LEU A CD2   1 
ATOM   1927 N  N     . ASN A 1 257 ? -30.351 46.217 -4.571  1.00 91.86  ? 254 ASN A N     1 
ATOM   1928 C  CA    . ASN A 1 257 ? -31.319 46.144 -3.496  1.00 92.94  ? 254 ASN A CA    1 
ATOM   1929 C  C     . ASN A 1 257 ? -31.495 47.493 -2.865  1.00 94.09  ? 254 ASN A C     1 
ATOM   1930 O  O     . ASN A 1 257 ? -32.504 47.760 -2.209  1.00 94.58  ? 254 ASN A O     1 
ATOM   1931 C  CB    . ASN A 1 257 ? -30.896 45.112 -2.460  1.00 93.39  ? 254 ASN A CB    1 
ATOM   1932 C  CG    . ASN A 1 257 ? -31.241 43.697 -2.878  1.00 93.43  ? 254 ASN A CG    1 
ATOM   1933 O  OD1   . ASN A 1 257 ? -32.165 43.472 -3.684  1.00 93.46  ? 254 ASN A OD1   1 
ATOM   1934 N  ND2   . ASN A 1 257 ? -30.505 42.727 -2.331  1.00 92.79  ? 254 ASN A ND2   1 
ATOM   1935 N  N     . ASN A 1 258 ? -30.509 48.352 -3.087  1.00 95.21  ? 255 ASN A N     1 
ATOM   1936 C  CA    . ASN A 1 258 ? -30.568 49.709 -2.593  1.00 96.82  ? 255 ASN A CA    1 
ATOM   1937 C  C     . ASN A 1 258 ? -30.786 50.731 -3.706  1.00 97.38  ? 255 ASN A C     1 
ATOM   1938 O  O     . ASN A 1 258 ? -30.459 51.896 -3.524  1.00 98.27  ? 255 ASN A O     1 
ATOM   1939 C  CB    . ASN A 1 258 ? -29.314 50.041 -1.786  1.00 97.31  ? 255 ASN A CB    1 
ATOM   1940 C  CG    . ASN A 1 258 ? -29.351 49.468 -0.385  1.00 98.55  ? 255 ASN A CG    1 
ATOM   1941 O  OD1   . ASN A 1 258 ? -30.063 49.968 0.481   1.00 100.51 ? 255 ASN A OD1   1 
ATOM   1942 N  ND2   . ASN A 1 258 ? -28.565 48.428 -0.148  1.00 99.21  ? 255 ASN A ND2   1 
ATOM   1943 N  N     . THR A 1 259 ? -31.357 50.308 -4.837  1.00 97.79  ? 256 THR A N     1 
ATOM   1944 C  CA    . THR A 1 259 ? -31.697 51.221 -5.942  1.00 98.50  ? 256 THR A CA    1 
ATOM   1945 C  C     . THR A 1 259 ? -33.176 51.652 -5.967  1.00 99.28  ? 256 THR A C     1 
ATOM   1946 O  O     . THR A 1 259 ? -34.081 50.815 -5.989  1.00 99.67  ? 256 THR A O     1 
ATOM   1947 C  CB    . THR A 1 259 ? -31.306 50.597 -7.286  1.00 97.96  ? 256 THR A CB    1 
ATOM   1948 O  OG1   . THR A 1 259 ? -29.882 50.501 -7.349  1.00 98.67  ? 256 THR A OG1   1 
ATOM   1949 C  CG2   . THR A 1 259 ? -31.792 51.436 -8.451  1.00 98.12  ? 256 THR A CG2   1 
ATOM   1950 N  N     . TYR A 1 260 ? -33.414 52.959 -5.981  1.00 100.25 ? 257 TYR A N     1 
ATOM   1951 C  CA    . TYR A 1 260 ? -34.774 53.489 -6.016  1.00 101.35 ? 257 TYR A CA    1 
ATOM   1952 C  C     . TYR A 1 260 ? -35.521 53.080 -7.289  1.00 100.93 ? 257 TYR A C     1 
ATOM   1953 O  O     . TYR A 1 260 ? -35.001 53.247 -8.385  1.00 101.35 ? 257 TYR A O     1 
ATOM   1954 C  CB    . TYR A 1 260 ? -34.738 55.017 -5.944  1.00 102.37 ? 257 TYR A CB    1 
ATOM   1955 C  CG    . TYR A 1 260 ? -34.532 55.585 -4.562  1.00 104.71 ? 257 TYR A CG    1 
ATOM   1956 C  CD1   . TYR A 1 260 ? -35.613 55.876 -3.750  1.00 106.93 ? 257 TYR A CD1   1 
ATOM   1957 C  CD2   . TYR A 1 260 ? -33.256 55.843 -4.077  1.00 106.80 ? 257 TYR A CD2   1 
ATOM   1958 C  CE1   . TYR A 1 260 ? -35.433 56.395 -2.496  1.00 109.29 ? 257 TYR A CE1   1 
ATOM   1959 C  CE2   . TYR A 1 260 ? -33.063 56.362 -2.816  1.00 108.65 ? 257 TYR A CE2   1 
ATOM   1960 C  CZ    . TYR A 1 260 ? -34.158 56.636 -2.031  1.00 109.99 ? 257 TYR A CZ    1 
ATOM   1961 O  OH    . TYR A 1 260 ? -33.990 57.157 -0.772  1.00 112.63 ? 257 TYR A OH    1 
ATOM   1962 N  N     . SER A 1 261 ? -36.729 52.537 -7.158  1.00 100.41 ? 258 SER A N     1 
ATOM   1963 C  CA    . SER A 1 261 ? -37.622 52.447 -8.313  1.00 99.45  ? 258 SER A CA    1 
ATOM   1964 C  C     . SER A 1 261 ? -38.250 53.819 -8.472  1.00 99.17  ? 258 SER A C     1 
ATOM   1965 O  O     . SER A 1 261 ? -38.938 54.275 -7.570  1.00 99.80  ? 258 SER A O     1 
ATOM   1966 C  CB    . SER A 1 261 ? -38.715 51.398 -8.102  1.00 99.81  ? 258 SER A CB    1 
ATOM   1967 O  OG    . SER A 1 261 ? -39.775 51.580 -9.034  1.00 100.41 ? 258 SER A OG    1 
ATOM   1968 N  N     . PRO A 1 262 ? -38.014 54.493 -9.609  1.00 98.40  ? 259 PRO A N     1 
ATOM   1969 C  CA    . PRO A 1 262 ? -38.540 55.845 -9.762  1.00 98.76  ? 259 PRO A CA    1 
ATOM   1970 C  C     . PRO A 1 262 ? -40.055 55.958 -9.562  1.00 99.34  ? 259 PRO A C     1 
ATOM   1971 O  O     . PRO A 1 262 ? -40.530 57.010 -9.127  1.00 99.95  ? 259 PRO A O     1 
ATOM   1972 C  CB    . PRO A 1 262 ? -38.146 56.205 -11.192 1.00 98.60  ? 259 PRO A CB    1 
ATOM   1973 C  CG    . PRO A 1 262 ? -36.918 55.441 -11.412 1.00 97.72  ? 259 PRO A CG    1 
ATOM   1974 C  CD    . PRO A 1 262 ? -37.158 54.126 -10.746 1.00 97.75  ? 259 PRO A CD    1 
ATOM   1975 N  N     . VAL A 1 263 ? -40.784 54.877 -9.847  1.00 99.05  ? 260 VAL A N     1 
ATOM   1976 C  CA    . VAL A 1 263 ? -42.244 54.829 -9.715  1.00 99.69  ? 260 VAL A CA    1 
ATOM   1977 C  C     . VAL A 1 263 ? -42.705 54.740 -8.266  1.00 100.07 ? 260 VAL A C     1 
ATOM   1978 O  O     . VAL A 1 263 ? -43.765 55.256 -7.904  1.00 101.46 ? 260 VAL A O     1 
ATOM   1979 C  CB    . VAL A 1 263 ? -42.822 53.601 -10.416 1.00 99.49  ? 260 VAL A CB    1 
ATOM   1980 C  CG1   . VAL A 1 263 ? -44.277 53.849 -10.772 1.00 100.30 ? 260 VAL A CG1   1 
ATOM   1981 C  CG2   . VAL A 1 263 ? -42.000 53.262 -11.651 1.00 99.44  ? 260 VAL A CG2   1 
ATOM   1982 N  N     . LEU A 1 264 ? -41.924 54.057 -7.445  1.00 99.01  ? 261 LEU A N     1 
ATOM   1983 C  CA    . LEU A 1 264 ? -42.314 53.815 -6.073  1.00 99.29  ? 261 LEU A CA    1 
ATOM   1984 C  C     . LEU A 1 264 ? -41.713 54.861 -5.152  1.00 99.72  ? 261 LEU A C     1 
ATOM   1985 O  O     . LEU A 1 264 ? -42.247 55.153 -4.085  1.00 100.63 ? 261 LEU A O     1 
ATOM   1986 C  CB    . LEU A 1 264 ? -41.865 52.415 -5.662  1.00 98.40  ? 261 LEU A CB    1 
ATOM   1987 C  CG    . LEU A 1 264 ? -42.388 51.283 -6.549  1.00 97.20  ? 261 LEU A CG    1 
ATOM   1988 C  CD1   . LEU A 1 264 ? -41.740 49.964 -6.180  1.00 95.11  ? 261 LEU A CD1   1 
ATOM   1989 C  CD2   . LEU A 1 264 ? -43.914 51.186 -6.476  1.00 97.42  ? 261 LEU A CD2   1 
ATOM   1990 N  N     . LYS A 1 265 ? -40.606 55.438 -5.598  1.00 99.40  ? 262 LYS A N     1 
ATOM   1991 C  CA    . LYS A 1 265 ? -39.754 56.277 -4.764  1.00 99.96  ? 262 LYS A CA    1 
ATOM   1992 C  C     . LYS A 1 265 ? -39.211 55.529 -3.526  1.00 100.07 ? 262 LYS A C     1 
ATOM   1993 O  O     . LYS A 1 265 ? -39.149 56.083 -2.433  1.00 100.70 ? 262 LYS A O     1 
ATOM   1994 C  CB    . LYS A 1 265 ? -40.463 57.593 -4.415  1.00 101.17 ? 262 LYS A CB    1 
ATOM   1995 C  CG    . LYS A 1 265 ? -40.975 58.361 -5.642  1.00 101.78 ? 262 LYS A CG    1 
ATOM   1996 C  CD    . LYS A 1 265 ? -40.871 59.882 -5.450  1.00 103.91 ? 262 LYS A CD    1 
ATOM   1997 C  CE    . LYS A 1 265 ? -42.151 60.504 -4.903  1.00 105.62 ? 262 LYS A CE    1 
ATOM   1998 N  NZ    . LYS A 1 265 ? -43.251 60.352 -5.899  1.00 106.49 ? 262 LYS A NZ    1 
ATOM   1999 N  N     . TYR A 1 266 ? -38.811 54.268 -3.734  1.00 99.95  ? 263 TYR A N     1 
ATOM   2000 C  CA    . TYR A 1 266 ? -38.288 53.376 -2.687  1.00 100.25 ? 263 TYR A CA    1 
ATOM   2001 C  C     . TYR A 1 266 ? -37.366 52.276 -3.221  1.00 98.96  ? 263 TYR A C     1 
ATOM   2002 O  O     . TYR A 1 266 ? -37.666 51.636 -4.231  1.00 98.49  ? 263 TYR A O     1 
ATOM   2003 C  CB    . TYR A 1 266 ? -39.432 52.710 -1.917  1.00 101.57 ? 263 TYR A CB    1 
ATOM   2004 C  CG    . TYR A 1 266 ? -40.268 53.675 -1.118  1.00 104.49 ? 263 TYR A CG    1 
ATOM   2005 C  CD1   . TYR A 1 266 ? -39.757 54.293 0.026   1.00 106.46 ? 263 TYR A CD1   1 
ATOM   2006 C  CD2   . TYR A 1 266 ? -41.569 53.984 -1.510  1.00 106.48 ? 263 TYR A CD2   1 
ATOM   2007 C  CE1   . TYR A 1 266 ? -40.525 55.192 0.757   1.00 108.55 ? 263 TYR A CE1   1 
ATOM   2008 C  CE2   . TYR A 1 266 ? -42.343 54.882 -0.789  1.00 108.36 ? 263 TYR A CE2   1 
ATOM   2009 C  CZ    . TYR A 1 266 ? -41.818 55.476 0.341   1.00 109.31 ? 263 TYR A CZ    1 
ATOM   2010 O  OH    . TYR A 1 266 ? -42.588 56.357 1.053   1.00 111.15 ? 263 TYR A OH    1 
ATOM   2011 N  N     . THR A 1 267 ? -36.252 52.061 -2.522  1.00 98.34  ? 264 THR A N     1 
ATOM   2012 C  CA    . THR A 1 267 ? -35.345 50.942 -2.785  1.00 97.12  ? 264 THR A CA    1 
ATOM   2013 C  C     . THR A 1 267 ? -35.944 49.677 -2.192  1.00 96.64  ? 264 THR A C     1 
ATOM   2014 O  O     . THR A 1 267 ? -36.632 49.745 -1.177  1.00 97.75  ? 264 THR A O     1 
ATOM   2015 C  CB    . THR A 1 267 ? -33.981 51.152 -2.121  1.00 97.36  ? 264 THR A CB    1 
ATOM   2016 O  OG1   . THR A 1 267 ? -34.059 50.797 -0.736  1.00 98.82  ? 264 THR A OG1   1 
ATOM   2017 C  CG2   . THR A 1 267 ? -33.528 52.596 -2.237  1.00 97.95  ? 264 THR A CG2   1 
ATOM   2018 N  N     . PRO A 1 268 ? -35.690 48.516 -2.808  1.00 95.26  ? 265 PRO A N     1 
ATOM   2019 C  CA    . PRO A 1 268 ? -36.249 47.294 -2.239  1.00 95.21  ? 265 PRO A CA    1 
ATOM   2020 C  C     . PRO A 1 268 ? -35.920 47.171 -0.760  1.00 95.39  ? 265 PRO A C     1 
ATOM   2021 O  O     . PRO A 1 268 ? -36.807 46.926 0.060   1.00 96.07  ? 265 PRO A O     1 
ATOM   2022 C  CB    . PRO A 1 268 ? -35.546 46.196 -3.023  1.00 94.57  ? 265 PRO A CB    1 
ATOM   2023 C  CG    . PRO A 1 268 ? -35.246 46.811 -4.319  1.00 94.25  ? 265 PRO A CG    1 
ATOM   2024 C  CD    . PRO A 1 268 ? -35.096 48.284 -4.130  1.00 94.33  ? 265 PRO A CD    1 
ATOM   2025 N  N     . HIS A 1 269 ? -34.646 47.379 -0.435  1.00 94.56  ? 266 HIS A N     1 
ATOM   2026 C  CA    . HIS A 1 269 ? -34.165 47.292 0.933   1.00 94.48  ? 266 HIS A CA    1 
ATOM   2027 C  C     . HIS A 1 269 ? -35.069 48.069 1.863   1.00 94.70  ? 266 HIS A C     1 
ATOM   2028 O  O     . HIS A 1 269 ? -35.448 47.558 2.907   1.00 95.68  ? 266 HIS A O     1 
ATOM   2029 C  CB    . HIS A 1 269 ? -32.726 47.799 1.039   1.00 94.37  ? 266 HIS A CB    1 
ATOM   2030 C  CG    . HIS A 1 269 ? -32.286 48.085 2.442   1.00 95.10  ? 266 HIS A CG    1 
ATOM   2031 N  ND1   . HIS A 1 269 ? -31.261 47.398 3.052   1.00 95.08  ? 266 HIS A ND1   1 
ATOM   2032 C  CD2   . HIS A 1 269 ? -32.730 48.987 3.350   1.00 95.30  ? 266 HIS A CD2   1 
ATOM   2033 C  CE1   . HIS A 1 269 ? -31.097 47.863 4.277   1.00 96.50  ? 266 HIS A CE1   1 
ATOM   2034 N  NE2   . HIS A 1 269 ? -31.978 48.824 4.483   1.00 96.15  ? 266 HIS A NE2   1 
ATOM   2035 N  N     . GLN A 1 270 ? -35.407 49.297 1.483   1.00 93.79  ? 267 GLN A N     1 
ATOM   2036 C  CA    . GLN A 1 270 ? -36.306 50.116 2.280   1.00 94.48  ? 267 GLN A CA    1 
ATOM   2037 C  C     . GLN A 1 270 ? -37.645 49.424 2.520   1.00 94.62  ? 267 GLN A C     1 
ATOM   2038 O  O     . GLN A 1 270 ? -38.116 49.353 3.652   1.00 95.70  ? 267 GLN A O     1 
ATOM   2039 C  CB    . GLN A 1 270 ? -36.526 51.479 1.636   1.00 94.38  ? 267 GLN A CB    1 
ATOM   2040 C  CG    . GLN A 1 270 ? -35.423 52.485 1.902   1.00 95.25  ? 267 GLN A CG    1 
ATOM   2041 C  CD    . GLN A 1 270 ? -35.384 53.574 0.850   1.00 95.73  ? 267 GLN A CD    1 
ATOM   2042 O  OE1   . GLN A 1 270 ? -36.177 53.571 -0.091  1.00 95.83  ? 267 GLN A OE1   1 
ATOM   2043 N  NE2   . GLN A 1 270 ? -34.454 54.507 0.997   1.00 96.62  ? 267 GLN A NE2   1 
ATOM   2044 N  N     . LEU A 1 271 ? -38.239 48.888 1.466   1.00 93.46  ? 268 LEU A N     1 
ATOM   2045 C  CA    . LEU A 1 271 ? -39.494 48.182 1.609   1.00 93.83  ? 268 LEU A CA    1 
ATOM   2046 C  C     . LEU A 1 271 ? -39.362 46.921 2.467   1.00 94.33  ? 268 LEU A C     1 
ATOM   2047 O  O     . LEU A 1 271 ? -40.326 46.499 3.103   1.00 95.54  ? 268 LEU A O     1 
ATOM   2048 C  CB    . LEU A 1 271 ? -40.066 47.843 0.241   1.00 93.33  ? 268 LEU A CB    1 
ATOM   2049 C  CG    . LEU A 1 271 ? -40.204 48.980 -0.777  1.00 93.04  ? 268 LEU A CG    1 
ATOM   2050 C  CD1   . LEU A 1 271 ? -40.818 48.427 -2.028  1.00 92.52  ? 268 LEU A CD1   1 
ATOM   2051 C  CD2   . LEU A 1 271 ? -41.061 50.116 -0.255  1.00 94.71  ? 268 LEU A CD2   1 
ATOM   2052 N  N     . LEU A 1 272 ? -38.177 46.320 2.501   1.00 93.54  ? 269 LEU A N     1 
ATOM   2053 C  CA    . LEU A 1 272 ? -37.977 45.152 3.359   1.00 94.02  ? 269 LEU A CA    1 
ATOM   2054 C  C     . LEU A 1 272 ? -37.722 45.512 4.822   1.00 95.45  ? 269 LEU A C     1 
ATOM   2055 O  O     . LEU A 1 272 ? -38.256 44.849 5.709   1.00 96.92  ? 269 LEU A O     1 
ATOM   2056 C  CB    . LEU A 1 272 ? -36.883 44.220 2.821   1.00 92.92  ? 269 LEU A CB    1 
ATOM   2057 C  CG    . LEU A 1 272 ? -36.705 42.856 3.502   1.00 92.60  ? 269 LEU A CG    1 
ATOM   2058 C  CD1   . LEU A 1 272 ? -38.021 42.137 3.645   1.00 92.40  ? 269 LEU A CD1   1 
ATOM   2059 C  CD2   . LEU A 1 272 ? -35.731 41.991 2.737   1.00 90.50  ? 269 LEU A CD2   1 
ATOM   2060 N  N     . PHE A 1 273 ? -36.937 46.560 5.071   1.00 95.21  ? 270 PHE A N     1 
ATOM   2061 C  CA    . PHE A 1 273 ? -36.528 46.902 6.435   1.00 96.62  ? 270 PHE A CA    1 
ATOM   2062 C  C     . PHE A 1 273 ? -37.112 48.183 7.021   1.00 97.81  ? 270 PHE A C     1 
ATOM   2063 O  O     . PHE A 1 273 ? -37.099 48.368 8.235   1.00 99.18  ? 270 PHE A O     1 
ATOM   2064 C  CB    . PHE A 1 273 ? -35.012 46.948 6.535   1.00 96.01  ? 270 PHE A CB    1 
ATOM   2065 C  CG    . PHE A 1 273 ? -34.347 45.680 6.127   1.00 95.61  ? 270 PHE A CG    1 
ATOM   2066 C  CD1   . PHE A 1 273 ? -33.590 45.632 4.973   1.00 94.56  ? 270 PHE A CD1   1 
ATOM   2067 C  CD2   . PHE A 1 273 ? -34.468 44.531 6.899   1.00 96.52  ? 270 PHE A CD2   1 
ATOM   2068 C  CE1   . PHE A 1 273 ? -32.956 44.456 4.596   1.00 94.46  ? 270 PHE A CE1   1 
ATOM   2069 C  CE2   . PHE A 1 273 ? -33.840 43.351 6.526   1.00 95.90  ? 270 PHE A CE2   1 
ATOM   2070 C  CZ    . PHE A 1 273 ? -33.091 43.311 5.373   1.00 94.75  ? 270 PHE A CZ    1 
ATOM   2071 N  N     . GLY A 1 274 ? -37.603 49.074 6.172   1.00 97.70  ? 271 GLY A N     1 
ATOM   2072 C  CA    . GLY A 1 274 ? -38.143 50.345 6.643   1.00 99.65  ? 271 GLY A CA    1 
ATOM   2073 C  C     . GLY A 1 274 ? -37.102 51.366 7.071   1.00 100.71 ? 271 GLY A C     1 
ATOM   2074 O  O     . GLY A 1 274 ? -37.463 52.482 7.456   1.00 101.65 ? 271 GLY A O     1 
ATOM   2075 N  N     . ILE A 1 275 ? -35.822 50.977 7.039   1.00 101.05 ? 272 ILE A N     1 
ATOM   2076 C  CA    . ILE A 1 275 ? -34.683 51.888 7.257   1.00 102.12 ? 272 ILE A CA    1 
ATOM   2077 C  C     . ILE A 1 275 ? -33.525 51.541 6.316   1.00 101.64 ? 272 ILE A C     1 
ATOM   2078 O  O     . ILE A 1 275 ? -33.352 50.379 5.939   1.00 101.21 ? 272 ILE A O     1 
ATOM   2079 C  CB    . ILE A 1 275 ? -34.132 51.853 8.710   1.00 103.50 ? 272 ILE A CB    1 
ATOM   2080 C  CG1   . ILE A 1 275 ? -33.318 50.603 8.970   1.00 104.12 ? 272 ILE A CG1   1 
ATOM   2081 C  CG2   . ILE A 1 275 ? -35.203 51.820 9.712   1.00 105.60 ? 272 ILE A CG2   1 
ATOM   2082 C  CD1   . ILE A 1 275 ? -31.846 50.822 8.824   1.00 105.44 ? 272 ILE A CD1   1 
ATOM   2083 N  N     . ASP A 1 276 ? -32.722 52.540 5.958   1.00 102.24 ? 273 ASP A N     1 
ATOM   2084 C  CA    . ASP A 1 276 ? -31.517 52.306 5.165   1.00 102.29 ? 273 ASP A CA    1 
ATOM   2085 C  C     . ASP A 1 276 ? -30.391 51.855 6.083   1.00 102.97 ? 273 ASP A C     1 
ATOM   2086 O  O     . ASP A 1 276 ? -30.215 52.413 7.160   1.00 104.33 ? 273 ASP A O     1 
ATOM   2087 C  CB    . ASP A 1 276 ? -31.070 53.596 4.462   1.00 102.63 ? 273 ASP A CB    1 
ATOM   2088 C  CG    . ASP A 1 276 ? -31.885 53.927 3.198   1.00 103.99 ? 273 ASP A CG    1 
ATOM   2089 O  OD1   . ASP A 1 276 ? -32.102 53.037 2.331   1.00 104.35 ? 273 ASP A OD1   1 
ATOM   2090 O  OD2   . ASP A 1 276 ? -32.278 55.116 3.067   1.00 107.28 ? 273 ASP A OD2   1 
ATOM   2091 N  N     . SER A 1 277 ? -29.617 50.860 5.660   1.00 102.43 ? 274 SER A N     1 
ATOM   2092 C  CA    . SER A 1 277 ? -28.416 50.443 6.407   1.00 103.29 ? 274 SER A CA    1 
ATOM   2093 C  C     . SER A 1 277 ? -27.269 51.459 6.252   1.00 103.37 ? 274 SER A C     1 
ATOM   2094 O  O     . SER A 1 277 ? -27.498 52.599 5.850   1.00 103.15 ? 274 SER A O     1 
ATOM   2095 C  CB    . SER A 1 277 ? -27.965 49.040 5.980   1.00 102.79 ? 274 SER A CB    1 
ATOM   2096 O  OG    . SER A 1 277 ? -27.939 48.925 4.566   1.00 101.99 ? 274 SER A OG    1 
ATOM   2097 N  N     . ASN A 1 278 ? -26.042 51.054 6.575   1.00 103.93 ? 275 ASN A N     1 
ATOM   2098 C  CA    . ASN A 1 278 ? -24.888 51.940 6.437   1.00 104.11 ? 275 ASN A CA    1 
ATOM   2099 C  C     . ASN A 1 278 ? -24.353 51.951 5.016   1.00 102.86 ? 275 ASN A C     1 
ATOM   2100 O  O     . ASN A 1 278 ? -23.187 51.648 4.741   1.00 102.98 ? 275 ASN A O     1 
ATOM   2101 C  CB    . ASN A 1 278 ? -23.785 51.587 7.424   1.00 105.79 ? 275 ASN A CB    1 
ATOM   2102 C  CG    . ASN A 1 278 ? -22.764 52.691 7.561   1.00 106.93 ? 275 ASN A CG    1 
ATOM   2103 O  OD1   . ASN A 1 278 ? -23.061 53.854 7.285   1.00 107.87 ? 275 ASN A OD1   1 
ATOM   2104 N  ND2   . ASN A 1 278 ? -21.555 52.337 7.985   1.00 107.60 ? 275 ASN A ND2   1 
ATOM   2105 N  N     . THR A 1 279 ? -25.250 52.318 4.120   1.00 101.69 ? 276 THR A N     1 
ATOM   2106 C  CA    . THR A 1 279 ? -24.985 52.429 2.714   1.00 100.76 ? 276 THR A CA    1 
ATOM   2107 C  C     . THR A 1 279 ? -24.640 53.891 2.391   1.00 100.89 ? 276 THR A C     1 
ATOM   2108 O  O     . THR A 1 279 ? -24.989 54.802 3.162   1.00 101.72 ? 276 THR A O     1 
ATOM   2109 C  CB    . THR A 1 279 ? -26.243 51.964 1.976   1.00 99.81  ? 276 THR A CB    1 
ATOM   2110 O  OG1   . THR A 1 279 ? -26.357 50.548 2.141   1.00 100.05 ? 276 THR A OG1   1 
ATOM   2111 C  CG2   . THR A 1 279 ? -26.251 52.334 0.467   1.00 99.18  ? 276 THR A CG2   1 
ATOM   2112 N  N     . PRO A 1 280 ? -23.899 54.116 1.288   1.00 100.22 ? 277 PRO A N     1 
ATOM   2113 C  CA    . PRO A 1 280 ? -23.785 55.428 0.663   1.00 99.96  ? 277 PRO A CA    1 
ATOM   2114 C  C     . PRO A 1 280 ? -25.146 56.101 0.474   1.00 99.38  ? 277 PRO A C     1 
ATOM   2115 O  O     . PRO A 1 280 ? -26.108 55.453 0.051   1.00 98.36  ? 277 PRO A O     1 
ATOM   2116 C  CB    . PRO A 1 280 ? -23.193 55.091 -0.698  1.00 99.28  ? 277 PRO A CB    1 
ATOM   2117 C  CG    . PRO A 1 280 ? -22.364 53.875 -0.449  1.00 99.63  ? 277 PRO A CG    1 
ATOM   2118 C  CD    . PRO A 1 280 ? -22.874 53.187 0.779   1.00 100.04 ? 277 PRO A CD    1 
ATOM   2119 N  N     . PHE A 1 281 ? -25.216 57.387 0.810   1.00 100.11 ? 278 PHE A N     1 
ATOM   2120 C  CA    . PHE A 1 281 ? -26.423 58.195 0.616   1.00 100.08 ? 278 PHE A CA    1 
ATOM   2121 C  C     . PHE A 1 281 ? -27.661 57.650 1.312   1.00 100.90 ? 278 PHE A C     1 
ATOM   2122 O  O     . PHE A 1 281 ? -28.775 57.772 0.801   1.00 100.46 ? 278 PHE A O     1 
ATOM   2123 C  CB    . PHE A 1 281 ? -26.714 58.372 -0.867  1.00 98.68  ? 278 PHE A CB    1 
ATOM   2124 C  CG    . PHE A 1 281 ? -25.676 59.139 -1.585  1.00 97.26  ? 278 PHE A CG    1 
ATOM   2125 C  CD1   . PHE A 1 281 ? -25.829 60.493 -1.788  1.00 96.38  ? 278 PHE A CD1   1 
ATOM   2126 C  CD2   . PHE A 1 281 ? -24.541 58.507 -2.059  1.00 96.18  ? 278 PHE A CD2   1 
ATOM   2127 C  CE1   . PHE A 1 281 ? -24.874 61.205 -2.450  1.00 96.99  ? 278 PHE A CE1   1 
ATOM   2128 C  CE2   . PHE A 1 281 ? -23.577 59.209 -2.723  1.00 96.29  ? 278 PHE A CE2   1 
ATOM   2129 C  CZ    . PHE A 1 281 ? -23.739 60.563 -2.921  1.00 97.25  ? 278 PHE A CZ    1 
ATOM   2130 N  N     . ALA A 1 282 ? -27.459 57.063 2.487   1.00 102.82 ? 279 ALA A N     1 
ATOM   2131 C  CA    . ALA A 1 282 ? -28.548 56.486 3.269   1.00 104.07 ? 279 ALA A CA    1 
ATOM   2132 C  C     . ALA A 1 282 ? -29.511 57.566 3.753   1.00 105.43 ? 279 ALA A C     1 
ATOM   2133 O  O     . ALA A 1 282 ? -29.102 58.531 4.417   1.00 106.36 ? 279 ALA A O     1 
ATOM   2134 C  CB    . ALA A 1 282 ? -27.994 55.696 4.444   1.00 104.96 ? 279 ALA A CB    1 
ATOM   2135 N  N     . ASN A 1 283 ? -30.785 57.384 3.403   1.00 105.94 ? 280 ASN A N     1 
ATOM   2136 C  CA    . ASN A 1 283 ? -31.850 58.325 3.731   1.00 107.53 ? 280 ASN A CA    1 
ATOM   2137 C  C     . ASN A 1 283 ? -32.146 58.379 5.218   1.00 109.20 ? 280 ASN A C     1 
ATOM   2138 O  O     . ASN A 1 283 ? -32.377 57.342 5.849   1.00 109.17 ? 280 ASN A O     1 
ATOM   2139 C  CB    . ASN A 1 283 ? -33.126 57.977 2.967   1.00 107.09 ? 280 ASN A CB    1 
ATOM   2140 C  CG    . ASN A 1 283 ? -34.281 58.892 3.318   1.00 109.07 ? 280 ASN A CG    1 
ATOM   2141 O  OD1   . ASN A 1 283 ? -34.787 58.878 4.447   1.00 110.79 ? 280 ASN A OD1   1 
ATOM   2142 N  ND2   . ASN A 1 283 ? -34.710 59.694 2.347   1.00 110.07 ? 280 ASN A ND2   1 
ATOM   2143 N  N     . GLN A 1 284 ? -32.179 59.604 5.745   1.00 110.82 ? 281 GLN A N     1 
ATOM   2144 C  CA    . GLN A 1 284 ? -32.304 59.843 7.178   1.00 113.04 ? 281 GLN A CA    1 
ATOM   2145 C  C     . GLN A 1 284 ? -33.687 60.233 7.662   1.00 113.84 ? 281 GLN A C     1 
ATOM   2146 O  O     . GLN A 1 284 ? -33.920 60.280 8.869   1.00 115.39 ? 281 GLN A O     1 
ATOM   2147 C  CB    . GLN A 1 284 ? -31.323 60.921 7.599   1.00 114.08 ? 281 GLN A CB    1 
ATOM   2148 C  CG    . GLN A 1 284 ? -30.001 60.363 8.034   1.00 116.54 ? 281 GLN A CG    1 
ATOM   2149 C  CD    . GLN A 1 284 ? -28.852 61.157 7.459   1.00 119.36 ? 281 GLN A CD    1 
ATOM   2150 O  OE1   . GLN A 1 284 ? -28.553 61.057 6.263   1.00 119.27 ? 281 GLN A OE1   1 
ATOM   2151 N  NE2   . GLN A 1 284 ? -28.199 61.957 8.304   1.00 121.49 ? 281 GLN A NE2   1 
ATOM   2152 N  N     . ASP A 1 285 ? -34.600 60.498 6.731   1.00 113.16 ? 282 ASP A N     1 
ATOM   2153 C  CA    . ASP A 1 285 ? -35.926 61.064 7.046   1.00 113.94 ? 282 ASP A CA    1 
ATOM   2154 C  C     . ASP A 1 285 ? -36.632 60.571 8.327   1.00 114.92 ? 282 ASP A C     1 
ATOM   2155 O  O     . ASP A 1 285 ? -37.323 61.345 8.977   1.00 116.36 ? 282 ASP A O     1 
ATOM   2156 C  CB    . ASP A 1 285 ? -36.873 60.922 5.845   1.00 113.21 ? 282 ASP A CB    1 
ATOM   2157 C  CG    . ASP A 1 285 ? -36.484 61.812 4.667   1.00 112.83 ? 282 ASP A CG    1 
ATOM   2158 O  OD1   . ASP A 1 285 ? -35.579 62.673 4.795   1.00 113.56 ? 282 ASP A OD1   1 
ATOM   2159 O  OD2   . ASP A 1 285 ? -37.110 61.644 3.599   1.00 112.36 ? 282 ASP A OD2   1 
ATOM   2160 N  N     . THR A 1 286 ? -36.458 59.302 8.688   1.00 114.21 ? 283 THR A N     1 
ATOM   2161 C  CA    . THR A 1 286 ? -37.181 58.727 9.824   1.00 115.03 ? 283 THR A CA    1 
ATOM   2162 C  C     . THR A 1 286 ? -36.332 58.657 11.091  1.00 115.82 ? 283 THR A C     1 
ATOM   2163 O  O     . THR A 1 286 ? -36.674 57.940 12.036  1.00 116.71 ? 283 THR A O     1 
ATOM   2164 C  CB    . THR A 1 286 ? -37.636 57.308 9.518   1.00 114.32 ? 283 THR A CB    1 
ATOM   2165 O  OG1   . THR A 1 286 ? -36.508 56.433 9.658   1.00 114.08 ? 283 THR A OG1   1 
ATOM   2166 C  CG2   . THR A 1 286 ? -38.182 57.198 8.100   1.00 112.99 ? 283 THR A CG2   1 
ATOM   2167 N  N     . LEU A 1 287 ? -35.233 59.404 11.106  1.00 115.47 ? 284 LEU A N     1 
ATOM   2168 C  CA    . LEU A 1 287 ? -34.226 59.302 12.164  1.00 116.33 ? 284 LEU A CA    1 
ATOM   2169 C  C     . LEU A 1 287 ? -34.775 59.596 13.558  1.00 118.12 ? 284 LEU A C     1 
ATOM   2170 O  O     . LEU A 1 287 ? -34.201 59.166 14.568  1.00 119.22 ? 284 LEU A O     1 
ATOM   2171 C  CB    . LEU A 1 287 ? -33.048 60.231 11.865  1.00 116.14 ? 284 LEU A CB    1 
ATOM   2172 C  CG    . LEU A 1 287 ? -31.653 59.663 12.145  1.00 116.62 ? 284 LEU A CG    1 
ATOM   2173 C  CD1   . LEU A 1 287 ? -31.397 58.330 11.401  1.00 115.82 ? 284 LEU A CD1   1 
ATOM   2174 C  CD2   . LEU A 1 287 ? -30.601 60.696 11.783  1.00 116.71 ? 284 LEU A CD2   1 
ATOM   2175 N  N     . ASP A 1 288 ? -35.895 60.314 13.596  1.00 118.28 ? 285 ASP A N     1 
ATOM   2176 C  CA    . ASP A 1 288 ? -36.516 60.744 14.848  1.00 119.83 ? 285 ASP A CA    1 
ATOM   2177 C  C     . ASP A 1 288 ? -37.603 59.835 15.384  1.00 119.79 ? 285 ASP A C     1 
ATOM   2178 O  O     . ASP A 1 288 ? -38.008 59.966 16.532  1.00 121.53 ? 285 ASP A O     1 
ATOM   2179 C  CB    . ASP A 1 288 ? -37.095 62.144 14.684  1.00 120.80 ? 285 ASP A CB    1 
ATOM   2180 C  CG    . ASP A 1 288 ? -36.067 63.222 14.914  1.00 122.45 ? 285 ASP A CG    1 
ATOM   2181 O  OD1   . ASP A 1 288 ? -35.161 63.035 15.766  1.00 124.33 ? 285 ASP A OD1   1 
ATOM   2182 O  OD2   . ASP A 1 288 ? -36.174 64.266 14.240  1.00 123.59 ? 285 ASP A OD2   1 
ATOM   2183 N  N     . LEU A 1 289 ? -38.086 58.921 14.559  1.00 117.56 ? 286 LEU A N     1 
ATOM   2184 C  CA    . LEU A 1 289 ? -39.161 58.054 14.990  1.00 117.67 ? 286 LEU A CA    1 
ATOM   2185 C  C     . LEU A 1 289 ? -38.572 56.896 15.764  1.00 117.73 ? 286 LEU A C     1 
ATOM   2186 O  O     . LEU A 1 289 ? -37.463 56.467 15.474  1.00 116.65 ? 286 LEU A O     1 
ATOM   2187 C  CB    . LEU A 1 289 ? -39.968 57.564 13.792  1.00 116.15 ? 286 LEU A CB    1 
ATOM   2188 C  CG    . LEU A 1 289 ? -40.386 58.629 12.775  1.00 115.11 ? 286 LEU A CG    1 
ATOM   2189 C  CD1   . LEU A 1 289 ? -41.556 58.129 11.956  1.00 115.00 ? 286 LEU A CD1   1 
ATOM   2190 C  CD2   . LEU A 1 289 ? -40.743 59.953 13.443  1.00 116.79 ? 286 LEU A CD2   1 
ATOM   2191 N  N     . THR A 1 290 ? -39.298 56.421 16.773  1.00 119.03 ? 287 THR A N     1 
ATOM   2192 C  CA    . THR A 1 290 ? -38.952 55.186 17.456  1.00 119.21 ? 287 THR A CA    1 
ATOM   2193 C  C     . THR A 1 290 ? -39.002 54.118 16.386  1.00 116.73 ? 287 THR A C     1 
ATOM   2194 O  O     . THR A 1 290 ? -39.591 54.332 15.331  1.00 115.18 ? 287 THR A O     1 
ATOM   2195 C  CB    . THR A 1 290 ? -40.034 54.772 18.460  1.00 121.71 ? 287 THR A CB    1 
ATOM   2196 O  OG1   . THR A 1 290 ? -41.208 54.363 17.726  1.00 122.38 ? 287 THR A OG1   1 
ATOM   2197 C  CG2   . THR A 1 290 ? -40.393 55.909 19.424  1.00 123.59 ? 287 THR A CG2   1 
ATOM   2198 N  N     . ARG A 1 291 ? -38.431 52.954 16.659  1.00 116.29 ? 288 ARG A N     1 
ATOM   2199 C  CA    . ARG A 1 291 ? -38.566 51.855 15.724  1.00 114.28 ? 288 ARG A CA    1 
ATOM   2200 C  C     . ARG A 1 291 ? -40.040 51.614 15.419  1.00 114.89 ? 288 ARG A C     1 
ATOM   2201 O  O     . ARG A 1 291 ? -40.407 51.462 14.263  1.00 113.20 ? 288 ARG A O     1 
ATOM   2202 C  CB    . ARG A 1 291 ? -37.900 50.581 16.257  1.00 114.54 ? 288 ARG A CB    1 
ATOM   2203 C  CG    . ARG A 1 291 ? -37.880 49.413 15.258  1.00 111.11 ? 288 ARG A CG    1 
ATOM   2204 C  CD    . ARG A 1 291 ? -37.415 49.846 13.864  1.00 104.40 ? 288 ARG A CD    1 
ATOM   2205 N  NE    . ARG A 1 291 ? -37.368 48.723 12.937  1.00 99.99  ? 288 ARG A NE    1 
ATOM   2206 C  CZ    . ARG A 1 291 ? -37.331 48.839 11.614  1.00 96.56  ? 288 ARG A CZ    1 
ATOM   2207 N  NH1   . ARG A 1 291 ? -37.348 50.036 11.051  1.00 94.24  ? 288 ARG A NH1   1 
ATOM   2208 N  NH2   . ARG A 1 291 ? -37.294 47.752 10.853  1.00 94.96  ? 288 ARG A NH2   1 
ATOM   2209 N  N     . GLU A 1 292 ? -40.872 51.613 16.459  1.00 117.66 ? 289 GLU A N     1 
ATOM   2210 C  CA    . GLU A 1 292 ? -42.305 51.314 16.338  1.00 119.10 ? 289 GLU A CA    1 
ATOM   2211 C  C     . GLU A 1 292 ? -43.026 52.253 15.383  1.00 118.22 ? 289 GLU A C     1 
ATOM   2212 O  O     . GLU A 1 292 ? -43.719 51.797 14.473  1.00 117.52 ? 289 GLU A O     1 
ATOM   2213 C  CB    . GLU A 1 292 ? -42.998 51.328 17.706  1.00 122.12 ? 289 GLU A CB    1 
ATOM   2214 C  CG    . GLU A 1 292 ? -42.463 50.283 18.678  1.00 125.30 ? 289 GLU A CG    1 
ATOM   2215 C  CD    . GLU A 1 292 ? -43.537 49.742 19.613  1.00 130.49 ? 289 GLU A CD    1 
ATOM   2216 O  OE1   . GLU A 1 292 ? -44.054 50.516 20.460  1.00 133.38 ? 289 GLU A OE1   1 
ATOM   2217 O  OE2   . GLU A 1 292 ? -43.857 48.535 19.500  1.00 131.04 ? 289 GLU A OE2   1 
ATOM   2218 N  N     . GLU A 1 293 ? -42.855 53.558 15.588  1.00 118.53 ? 290 GLU A N     1 
ATOM   2219 C  CA    . GLU A 1 293 ? -43.503 54.557 14.749  1.00 118.06 ? 290 GLU A CA    1 
ATOM   2220 C  C     . GLU A 1 293 ? -43.127 54.314 13.299  1.00 115.74 ? 290 GLU A C     1 
ATOM   2221 O  O     . GLU A 1 293 ? -43.990 54.154 12.437  1.00 115.24 ? 290 GLU A O     1 
ATOM   2222 C  CB    . GLU A 1 293 ? -43.114 55.956 15.208  1.00 118.53 ? 290 GLU A CB    1 
ATOM   2223 C  CG    . GLU A 1 293 ? -43.608 56.242 16.618  1.00 122.19 ? 290 GLU A CG    1 
ATOM   2224 C  CD    . GLU A 1 293 ? -43.041 57.510 17.214  1.00 123.90 ? 290 GLU A CD    1 
ATOM   2225 O  OE1   . GLU A 1 293 ? -42.225 58.176 16.541  1.00 123.12 ? 290 GLU A OE1   1 
ATOM   2226 O  OE2   . GLU A 1 293 ? -43.417 57.839 18.360  1.00 125.97 ? 290 GLU A OE2   1 
ATOM   2227 N  N     . GLU A 1 294 ? -41.823 54.251 13.065  1.00 114.75 ? 291 GLU A N     1 
ATOM   2228 C  CA    . GLU A 1 294 ? -41.224 53.888 11.794  1.00 112.76 ? 291 GLU A CA    1 
ATOM   2229 C  C     . GLU A 1 294 ? -41.825 52.618 11.193  1.00 112.33 ? 291 GLU A C     1 
ATOM   2230 O  O     . GLU A 1 294 ? -42.236 52.617 10.033  1.00 111.23 ? 291 GLU A O     1 
ATOM   2231 C  CB    . GLU A 1 294 ? -39.745 53.680 12.043  1.00 112.17 ? 291 GLU A CB    1 
ATOM   2232 C  CG    . GLU A 1 294 ? -38.867 53.492 10.845  1.00 111.23 ? 291 GLU A CG    1 
ATOM   2233 C  CD    . GLU A 1 294 ? -37.418 53.538 11.266  1.00 112.92 ? 291 GLU A CD    1 
ATOM   2234 O  OE1   . GLU A 1 294 ? -37.052 52.804 12.212  1.00 115.23 ? 291 GLU A OE1   1 
ATOM   2235 O  OE2   . GLU A 1 294 ? -36.646 54.320 10.678  1.00 112.71 ? 291 GLU A OE2   1 
ATOM   2236 N  N     . LEU A 1 295 ? -41.878 51.549 11.988  1.00 113.52 ? 292 LEU A N     1 
ATOM   2237 C  CA    . LEU A 1 295 ? -42.364 50.243 11.531  1.00 113.36 ? 292 LEU A CA    1 
ATOM   2238 C  C     . LEU A 1 295 ? -43.791 50.239 11.008  1.00 114.27 ? 292 LEU A C     1 
ATOM   2239 O  O     . LEU A 1 295 ? -44.113 49.491 10.084  1.00 113.47 ? 292 LEU A O     1 
ATOM   2240 C  CB    . LEU A 1 295 ? -42.220 49.185 12.624  1.00 114.63 ? 292 LEU A CB    1 
ATOM   2241 C  CG    . LEU A 1 295 ? -41.033 48.247 12.418  1.00 113.31 ? 292 LEU A CG    1 
ATOM   2242 C  CD1   . LEU A 1 295 ? -40.990 47.131 13.464  1.00 114.28 ? 292 LEU A CD1   1 
ATOM   2243 C  CD2   . LEU A 1 295 ? -41.078 47.674 11.012  1.00 111.06 ? 292 LEU A CD2   1 
ATOM   2244 N  N     . SER A 1 296 ? -44.651 51.060 11.599  1.00 116.42 ? 293 SER A N     1 
ATOM   2245 C  CA    . SER A 1 296 ? -46.020 51.143 11.119  1.00 117.62 ? 293 SER A CA    1 
ATOM   2246 C  C     . SER A 1 296 ? -46.132 52.109 9.945   1.00 116.52 ? 293 SER A C     1 
ATOM   2247 O  O     . SER A 1 296 ? -46.965 51.904 9.065   1.00 116.64 ? 293 SER A O     1 
ATOM   2248 C  CB    . SER A 1 296 ? -46.999 51.495 12.241  1.00 120.30 ? 293 SER A CB    1 
ATOM   2249 O  OG    . SER A 1 296 ? -46.806 52.823 12.682  1.00 121.20 ? 293 SER A OG    1 
ATOM   2250 N  N     . LEU A 1 297 ? -45.294 53.147 9.914   1.00 116.00 ? 294 LEU A N     1 
ATOM   2251 C  CA    . LEU A 1 297 ? -45.236 54.017 8.736   1.00 114.88 ? 294 LEU A CA    1 
ATOM   2252 C  C     . LEU A 1 297 ? -44.872 53.186 7.515   1.00 113.24 ? 294 LEU A C     1 
ATOM   2253 O  O     . LEU A 1 297 ? -45.446 53.363 6.443   1.00 112.60 ? 294 LEU A O     1 
ATOM   2254 C  CB    . LEU A 1 297 ? -44.236 55.160 8.907   1.00 114.34 ? 294 LEU A CB    1 
ATOM   2255 C  CG    . LEU A 1 297 ? -43.997 55.996 7.642   1.00 112.74 ? 294 LEU A CG    1 
ATOM   2256 C  CD1   . LEU A 1 297 ? -45.143 56.951 7.381   1.00 113.92 ? 294 LEU A CD1   1 
ATOM   2257 C  CD2   . LEU A 1 297 ? -42.685 56.750 7.697   1.00 112.23 ? 294 LEU A CD2   1 
ATOM   2258 N  N     . LEU A 1 298 ? -43.924 52.269 7.698   1.00 112.93 ? 295 LEU A N     1 
ATOM   2259 C  CA    . LEU A 1 298 ? -43.537 51.335 6.648   1.00 111.86 ? 295 LEU A CA    1 
ATOM   2260 C  C     . LEU A 1 298 ? -44.712 50.465 6.243   1.00 112.91 ? 295 LEU A C     1 
ATOM   2261 O  O     . LEU A 1 298 ? -44.953 50.249 5.052   1.00 112.14 ? 295 LEU A O     1 
ATOM   2262 C  CB    . LEU A 1 298 ? -42.361 50.455 7.091   1.00 111.16 ? 295 LEU A CB    1 
ATOM   2263 C  CG    . LEU A 1 298 ? -42.103 49.176 6.292   1.00 109.13 ? 295 LEU A CG    1 
ATOM   2264 C  CD1   . LEU A 1 298 ? -41.520 49.482 4.931   1.00 106.08 ? 295 LEU A CD1   1 
ATOM   2265 C  CD2   . LEU A 1 298 ? -41.191 48.277 7.080   1.00 109.30 ? 295 LEU A CD2   1 
ATOM   2266 N  N     . GLN A 1 299 ? -45.440 49.976 7.241   1.00 115.18 ? 296 GLN A N     1 
ATOM   2267 C  CA    . GLN A 1 299 ? -46.570 49.090 7.002   1.00 116.80 ? 296 GLN A CA    1 
ATOM   2268 C  C     . GLN A 1 299 ? -47.658 49.781 6.183   1.00 116.87 ? 296 GLN A C     1 
ATOM   2269 O  O     . GLN A 1 299 ? -48.371 49.142 5.398   1.00 116.56 ? 296 GLN A O     1 
ATOM   2270 C  CB    . GLN A 1 299 ? -47.127 48.595 8.330   1.00 119.30 ? 296 GLN A CB    1 
ATOM   2271 C  CG    . GLN A 1 299 ? -47.658 47.185 8.253   1.00 122.06 ? 296 GLN A CG    1 
ATOM   2272 C  CD    . GLN A 1 299 ? -47.859 46.567 9.618   1.00 126.05 ? 296 GLN A CD    1 
ATOM   2273 O  OE1   . GLN A 1 299 ? -47.313 45.498 9.905   1.00 127.32 ? 296 GLN A OE1   1 
ATOM   2274 N  NE2   . GLN A 1 299 ? -48.646 47.231 10.470  1.00 127.72 ? 296 GLN A NE2   1 
ATOM   2275 N  N     . GLU A 1 300 ? -47.759 51.092 6.374   1.00 117.33 ? 297 GLU A N     1 
ATOM   2276 C  CA    . GLU A 1 300 ? -48.629 51.928 5.575   1.00 117.87 ? 297 GLU A CA    1 
ATOM   2277 C  C     . GLU A 1 300 ? -48.112 51.957 4.131   1.00 115.20 ? 297 GLU A C     1 
ATOM   2278 O  O     . GLU A 1 300 ? -48.802 51.482 3.231   1.00 115.18 ? 297 GLU A O     1 
ATOM   2279 C  CB    . GLU A 1 300 ? -48.742 53.334 6.195   1.00 119.36 ? 297 GLU A CB    1 
ATOM   2280 C  CG    . GLU A 1 300 ? -49.731 54.286 5.506   1.00 122.78 ? 297 GLU A CG    1 
ATOM   2281 C  CD    . GLU A 1 300 ? -49.229 54.790 4.136   1.00 125.45 ? 297 GLU A CD    1 
ATOM   2282 O  OE1   . GLU A 1 300 ? -47.983 54.914 3.932   1.00 125.00 ? 297 GLU A OE1   1 
ATOM   2283 O  OE2   . GLU A 1 300 ? -50.088 55.056 3.254   1.00 127.67 ? 297 GLU A OE2   1 
ATOM   2284 N  N     . ILE A 1 301 ? -46.903 52.486 3.922   1.00 113.09 ? 298 ILE A N     1 
ATOM   2285 C  CA    . ILE A 1 301 ? -46.307 52.635 2.579   1.00 110.83 ? 298 ILE A CA    1 
ATOM   2286 C  C     . ILE A 1 301 ? -46.526 51.420 1.684   1.00 109.88 ? 298 ILE A C     1 
ATOM   2287 O  O     . ILE A 1 301 ? -46.937 51.552 0.525   1.00 109.66 ? 298 ILE A O     1 
ATOM   2288 C  CB    . ILE A 1 301 ? -44.792 52.903 2.651   1.00 109.45 ? 298 ILE A CB    1 
ATOM   2289 C  CG1   . ILE A 1 301 ? -44.524 54.325 3.136   1.00 110.06 ? 298 ILE A CG1   1 
ATOM   2290 C  CG2   . ILE A 1 301 ? -44.135 52.691 1.290   1.00 107.50 ? 298 ILE A CG2   1 
ATOM   2291 C  CD1   . ILE A 1 301 ? -43.087 54.541 3.580   1.00 109.51 ? 298 ILE A CD1   1 
ATOM   2292 N  N     . ARG A 1 302 ? -46.244 50.245 2.238   1.00 109.34 ? 299 ARG A N     1 
ATOM   2293 C  CA    . ARG A 1 302 ? -46.397 48.981 1.544   1.00 108.22 ? 299 ARG A CA    1 
ATOM   2294 C  C     . ARG A 1 302 ? -47.777 48.794 0.891   1.00 109.17 ? 299 ARG A C     1 
ATOM   2295 O  O     . ARG A 1 302 ? -47.869 48.248 -0.209  1.00 108.52 ? 299 ARG A O     1 
ATOM   2296 C  CB    . ARG A 1 302 ? -46.125 47.839 2.511   1.00 108.63 ? 299 ARG A CB    1 
ATOM   2297 C  CG    . ARG A 1 302 ? -44.728 47.791 3.084   1.00 106.85 ? 299 ARG A CG    1 
ATOM   2298 C  CD    . ARG A 1 302 ? -44.432 46.358 3.403   1.00 106.57 ? 299 ARG A CD    1 
ATOM   2299 N  NE    . ARG A 1 302 ? -43.103 46.114 3.944   1.00 106.19 ? 299 ARG A NE    1 
ATOM   2300 C  CZ    . ARG A 1 302 ? -42.869 45.651 5.166   1.00 107.49 ? 299 ARG A CZ    1 
ATOM   2301 N  NH1   . ARG A 1 302 ? -43.883 45.405 5.996   1.00 109.68 ? 299 ARG A NH1   1 
ATOM   2302 N  NH2   . ARG A 1 302 ? -41.618 45.438 5.556   1.00 106.49 ? 299 ARG A NH2   1 
ATOM   2303 N  N     . THR A 1 303 ? -48.840 49.241 1.565   1.00 110.76 ? 300 THR A N     1 
ATOM   2304 C  CA    . THR A 1 303 ? -50.211 49.105 1.042   1.00 111.82 ? 300 THR A CA    1 
ATOM   2305 C  C     . THR A 1 303 ? -50.563 50.169 0.006   1.00 111.36 ? 300 THR A C     1 
ATOM   2306 O  O     . THR A 1 303 ? -51.330 49.908 -0.929  1.00 111.90 ? 300 THR A O     1 
ATOM   2307 C  CB    . THR A 1 303 ? -51.277 49.174 2.156   1.00 114.13 ? 300 THR A CB    1 
ATOM   2308 O  OG1   . THR A 1 303 ? -51.237 50.466 2.772   1.00 114.86 ? 300 THR A OG1   1 
ATOM   2309 C  CG2   . THR A 1 303 ? -51.041 48.097 3.205   1.00 114.69 ? 300 THR A CG2   1 
ATOM   2310 N  N     . SER A 1 304 ? -50.005 51.363 0.186   1.00 110.48 ? 301 SER A N     1 
ATOM   2311 C  CA    . SER A 1 304 ? -50.286 52.502 -0.682  1.00 110.20 ? 301 SER A CA    1 
ATOM   2312 C  C     . SER A 1 304 ? -49.421 52.536 -1.947  1.00 107.77 ? 301 SER A C     1 
ATOM   2313 O  O     . SER A 1 304 ? -49.373 53.554 -2.639  1.00 107.37 ? 301 SER A O     1 
ATOM   2314 C  CB    . SER A 1 304 ? -50.085 53.800 0.096   1.00 110.97 ? 301 SER A CB    1 
ATOM   2315 O  OG    . SER A 1 304 ? -48.698 54.069 0.229   1.00 110.52 ? 301 SER A OG    1 
ATOM   2316 N  N     . LEU A 1 305 ? -48.748 51.428 -2.245  1.00 106.14 ? 302 LEU A N     1 
ATOM   2317 C  CA    . LEU A 1 305 ? -47.876 51.340 -3.413  1.00 104.12 ? 302 LEU A CA    1 
ATOM   2318 C  C     . LEU A 1 305 ? -48.602 51.383 -4.735  1.00 104.42 ? 302 LEU A C     1 
ATOM   2319 O  O     . LEU A 1 305 ? -49.677 50.798 -4.890  1.00 105.53 ? 302 LEU A O     1 
ATOM   2320 C  CB    . LEU A 1 305 ? -47.022 50.082 -3.372  1.00 102.79 ? 302 LEU A CB    1 
ATOM   2321 C  CG    . LEU A 1 305 ? -45.779 50.201 -2.516  1.00 101.01 ? 302 LEU A CG    1 
ATOM   2322 C  CD1   . LEU A 1 305 ? -44.853 49.106 -2.906  1.00 98.75  ? 302 LEU A CD1   1 
ATOM   2323 C  CD2   . LEU A 1 305 ? -45.136 51.556 -2.726  1.00 100.74 ? 302 LEU A CD2   1 
ATOM   2324 N  N     . TYR A 1 306 ? -47.979 52.067 -5.687  1.00 103.68 ? 303 TYR A N     1 
ATOM   2325 C  CA    . TYR A 1 306 ? -48.480 52.152 -7.035  1.00 104.27 ? 303 TYR A CA    1 
ATOM   2326 C  C     . TYR A 1 306 ? -48.718 50.777 -7.659  1.00 104.17 ? 303 TYR A C     1 
ATOM   2327 O  O     . TYR A 1 306 ? -47.828 49.912 -7.691  1.00 103.20 ? 303 TYR A O     1 
ATOM   2328 C  CB    . TYR A 1 306 ? -47.512 52.924 -7.920  1.00 103.39 ? 303 TYR A CB    1 
ATOM   2329 C  CG    . TYR A 1 306 ? -47.892 52.776 -9.372  1.00 104.74 ? 303 TYR A CG    1 
ATOM   2330 C  CD1   . TYR A 1 306 ? -48.955 53.514 -9.896  1.00 107.56 ? 303 TYR A CD1   1 
ATOM   2331 C  CD2   . TYR A 1 306 ? -47.231 51.864 -10.211 1.00 104.16 ? 303 TYR A CD2   1 
ATOM   2332 C  CE1   . TYR A 1 306 ? -49.342 53.381 -11.221 1.00 108.64 ? 303 TYR A CE1   1 
ATOM   2333 C  CE2   . TYR A 1 306 ? -47.608 51.724 -11.546 1.00 105.12 ? 303 TYR A CE2   1 
ATOM   2334 C  CZ    . TYR A 1 306 ? -48.671 52.489 -12.041 1.00 107.46 ? 303 TYR A CZ    1 
ATOM   2335 O  OH    . TYR A 1 306 ? -49.094 52.383 -13.349 1.00 108.90 ? 303 TYR A OH    1 
ATOM   2336 N  N     . HIS A 1 307 ? -49.917 50.579 -8.186  1.00 105.37 ? 304 HIS A N     1 
ATOM   2337 C  CA    . HIS A 1 307 ? -50.175 49.342 -8.878  1.00 105.36 ? 304 HIS A CA    1 
ATOM   2338 C  C     . HIS A 1 307 ? -50.859 49.507 -10.226 1.00 105.35 ? 304 HIS A C     1 
ATOM   2339 O  O     . HIS A 1 307 ? -51.984 49.996 -10.288 1.00 107.04 ? 304 HIS A O     1 
ATOM   2340 C  CB    . HIS A 1 307 ? -50.959 48.365 -8.015  1.00 107.03 ? 304 HIS A CB    1 
ATOM   2341 C  CG    . HIS A 1 307 ? -51.080 47.022 -8.650  1.00 108.96 ? 304 HIS A CG    1 
ATOM   2342 N  ND1   . HIS A 1 307 ? -50.033 46.123 -8.673  1.00 109.26 ? 304 HIS A ND1   1 
ATOM   2343 C  CD2   . HIS A 1 307 ? -52.086 46.456 -9.359  1.00 111.29 ? 304 HIS A CD2   1 
ATOM   2344 C  CE1   . HIS A 1 307 ? -50.402 45.047 -9.347  1.00 110.15 ? 304 HIS A CE1   1 
ATOM   2345 N  NE2   . HIS A 1 307 ? -51.643 45.223 -9.773  1.00 111.52 ? 304 HIS A NE2   1 
ATOM   2346 N  N     . PRO A 1 308 ? -50.190 49.048 -11.303 1.00 103.64 ? 305 PRO A N     1 
ATOM   2347 C  CA    . PRO A 1 308 ? -50.609 49.157 -12.705 1.00 103.73 ? 305 PRO A CA    1 
ATOM   2348 C  C     . PRO A 1 308 ? -51.930 48.469 -12.988 1.00 105.13 ? 305 PRO A C     1 
ATOM   2349 O  O     . PRO A 1 308 ? -52.273 47.499 -12.309 1.00 105.56 ? 305 PRO A O     1 
ATOM   2350 C  CB    . PRO A 1 308 ? -49.513 48.394 -13.445 1.00 102.24 ? 305 PRO A CB    1 
ATOM   2351 C  CG    . PRO A 1 308 ? -48.940 47.478 -12.429 1.00 101.39 ? 305 PRO A CG    1 
ATOM   2352 C  CD    . PRO A 1 308 ? -48.942 48.275 -11.181 1.00 101.89 ? 305 PRO A CD    1 
ATOM   2353 N  N     . SER A 1 309 ? -52.664 48.961 -13.984 1.00 105.87 ? 306 SER A N     1 
ATOM   2354 C  CA    . SER A 1 309 ? -53.860 48.251 -14.461 1.00 107.18 ? 306 SER A CA    1 
ATOM   2355 C  C     . SER A 1 309 ? -53.603 47.608 -15.820 1.00 106.41 ? 306 SER A C     1 
ATOM   2356 O  O     . SER A 1 309 ? -52.641 47.954 -16.508 1.00 105.49 ? 306 SER A O     1 
ATOM   2357 C  CB    . SER A 1 309 ? -55.106 49.159 -14.488 1.00 109.40 ? 306 SER A CB    1 
ATOM   2358 O  OG    . SER A 1 309 ? -54.794 50.487 -14.884 1.00 109.88 ? 306 SER A OG    1 
ATOM   2359 N  N     . THR A 1 310 ? -54.449 46.659 -16.201 1.00 106.97 ? 307 THR A N     1 
ATOM   2360 C  CA    . THR A 1 310 ? -54.284 45.995 -17.487 1.00 106.44 ? 307 THR A CA    1 
ATOM   2361 C  C     . THR A 1 310 ? -54.512 47.010 -18.623 1.00 107.08 ? 307 THR A C     1 
ATOM   2362 O  O     . THR A 1 310 ? -55.298 47.949 -18.466 1.00 108.41 ? 307 THR A O     1 
ATOM   2363 C  CB    . THR A 1 310 ? -55.209 44.767 -17.622 1.00 107.55 ? 307 THR A CB    1 
ATOM   2364 O  OG1   . THR A 1 310 ? -56.560 45.207 -17.730 1.00 109.75 ? 307 THR A OG1   1 
ATOM   2365 C  CG2   . THR A 1 310 ? -55.081 43.854 -16.411 1.00 106.63 ? 307 THR A CG2   1 
ATOM   2366 N  N     . PRO A 1 311 ? -53.804 46.838 -19.755 1.00 106.22 ? 308 PRO A N     1 
ATOM   2367 C  CA    . PRO A 1 311 ? -53.890 47.706 -20.930 1.00 106.91 ? 308 PRO A CA    1 
ATOM   2368 C  C     . PRO A 1 311 ? -55.120 47.448 -21.818 1.00 109.04 ? 308 PRO A C     1 
ATOM   2369 O  O     . PRO A 1 311 ? -55.726 46.370 -21.741 1.00 109.57 ? 308 PRO A O     1 
ATOM   2370 C  CB    . PRO A 1 311 ? -52.636 47.328 -21.705 1.00 105.54 ? 308 PRO A CB    1 
ATOM   2371 C  CG    . PRO A 1 311 ? -52.483 45.879 -21.414 1.00 105.10 ? 308 PRO A CG    1 
ATOM   2372 C  CD    . PRO A 1 311 ? -52.816 45.763 -19.958 1.00 104.72 ? 308 PRO A CD    1 
ATOM   2373 N  N     . PRO A 1 312 ? -55.482 48.430 -22.670 1.00 119.78 ? 309 PRO A N     1 
ATOM   2374 C  CA    . PRO A 1 312 ? -56.606 48.226 -23.568 1.00 119.31 ? 309 PRO A CA    1 
ATOM   2375 C  C     . PRO A 1 312 ? -56.368 47.013 -24.437 1.00 115.58 ? 309 PRO A C     1 
ATOM   2376 O  O     . PRO A 1 312 ? -55.232 46.727 -24.785 1.00 113.86 ? 309 PRO A O     1 
ATOM   2377 C  CB    . PRO A 1 312 ? -56.596 49.492 -24.427 1.00 122.17 ? 309 PRO A CB    1 
ATOM   2378 C  CG    . PRO A 1 312 ? -56.003 50.520 -23.545 1.00 125.29 ? 309 PRO A CG    1 
ATOM   2379 C  CD    . PRO A 1 312 ? -54.937 49.796 -22.791 1.00 123.11 ? 309 PRO A CD    1 
ATOM   2380 N  N     . ALA A 1 313 ? -57.439 46.300 -24.759 1.00 114.94 ? 310 ALA A N     1 
ATOM   2381 C  CA    . ALA A 1 313 ? -57.382 45.178 -25.693 1.00 112.37 ? 310 ALA A CA    1 
ATOM   2382 C  C     . ALA A 1 313 ? -56.913 45.667 -27.049 1.00 112.33 ? 310 ALA A C     1 
ATOM   2383 O  O     . ALA A 1 313 ? -57.297 46.759 -27.474 1.00 115.09 ? 310 ALA A O     1 
ATOM   2384 C  CB    . ALA A 1 313 ? -58.765 44.527 -25.816 1.00 112.58 ? 310 ALA A CB    1 
ATOM   2385 N  N     . SER A 1 314 ? -56.080 44.879 -27.726 1.00 109.89 ? 311 SER A N     1 
ATOM   2386 C  CA    . SER A 1 314 ? -55.733 45.212 -29.105 1.00 109.74 ? 311 SER A CA    1 
ATOM   2387 C  C     . SER A 1 314 ? -56.982 44.939 -29.926 1.00 110.15 ? 311 SER A C     1 
ATOM   2388 O  O     . SER A 1 314 ? -57.770 44.050 -29.581 1.00 109.20 ? 311 SER A O     1 
ATOM   2389 C  CB    . SER A 1 314 ? -54.544 44.402 -29.611 1.00 107.29 ? 311 SER A CB    1 
ATOM   2390 O  OG    . SER A 1 314 ? -54.974 43.239 -30.287 1.00 104.93 ? 311 SER A OG    1 
ATOM   2391 N  N     . SER A 1 315 ? -57.165 45.716 -30.995 1.00 111.95 ? 312 SER A N     1 
ATOM   2392 C  CA    . SER A 1 315 ? -58.443 45.751 -31.730 1.00 113.56 ? 312 SER A CA    1 
ATOM   2393 C  C     . SER A 1 315 ? -58.897 44.394 -32.302 1.00 111.46 ? 312 SER A C     1 
ATOM   2394 O  O     . SER A 1 315 ? -60.090 44.185 -32.520 1.00 112.80 ? 312 SER A O     1 
ATOM   2395 C  CB    . SER A 1 315 ? -58.444 46.850 -32.809 1.00 115.87 ? 312 SER A CB    1 
ATOM   2396 O  OG    . SER A 1 315 ? -57.555 46.550 -33.871 1.00 114.75 ? 312 SER A OG    1 
ATOM   2397 N  N     . ARG A 1 316 ? -57.956 43.477 -32.523 1.00 108.67 ? 313 ARG A N     1 
ATOM   2398 C  CA    . ARG A 1 316 ? -58.299 42.160 -33.041 1.00 107.11 ? 313 ARG A CA    1 
ATOM   2399 C  C     . ARG A 1 316 ? -57.814 41.042 -32.137 1.00 105.44 ? 313 ARG A C     1 
ATOM   2400 O  O     . ARG A 1 316 ? -57.039 40.185 -32.557 1.00 103.79 ? 313 ARG A O     1 
ATOM   2401 C  CB    . ARG A 1 316 ? -57.737 41.978 -34.441 1.00 106.29 ? 313 ARG A CB    1 
ATOM   2402 C  CG    . ARG A 1 316 ? -58.228 43.018 -35.414 1.00 108.60 ? 313 ARG A CG    1 
ATOM   2403 C  CD    . ARG A 1 316 ? -58.950 42.359 -36.561 1.00 108.33 ? 313 ARG A CD    1 
ATOM   2404 N  NE    . ARG A 1 316 ? -59.059 43.238 -37.718 1.00 108.73 ? 313 ARG A NE    1 
ATOM   2405 C  CZ    . ARG A 1 316 ? -58.349 43.087 -38.829 1.00 107.52 ? 313 ARG A CZ    1 
ATOM   2406 N  NH1   . ARG A 1 316 ? -57.473 42.090 -38.937 1.00 105.09 ? 313 ARG A NH1   1 
ATOM   2407 N  NH2   . ARG A 1 316 ? -58.519 43.927 -39.837 1.00 109.39 ? 313 ARG A NH2   1 
ATOM   2408 N  N     . SER A 1 317 ? -58.280 41.051 -30.893 1.00 106.34 ? 314 SER A N     1 
ATOM   2409 C  CA    . SER A 1 317 ? -57.870 40.050 -29.915 1.00 105.37 ? 314 SER A CA    1 
ATOM   2410 C  C     . SER A 1 317 ? -58.938 38.991 -29.733 1.00 105.89 ? 314 SER A C     1 
ATOM   2411 O  O     . SER A 1 317 ? -60.049 39.121 -30.239 1.00 107.42 ? 314 SER A O     1 
ATOM   2412 C  CB    . SER A 1 317 ? -57.579 40.707 -28.567 1.00 106.13 ? 314 SER A CB    1 
ATOM   2413 O  OG    . SER A 1 317 ? -58.783 40.955 -27.864 1.00 108.46 ? 314 SER A OG    1 
ATOM   2414 N  N     . TRP A 1 318 ? -58.604 37.946 -28.992 1.00 105.33 ? 315 TRP A N     1 
ATOM   2415 C  CA    . TRP A 1 318 ? -59.576 36.916 -28.681 1.00 106.47 ? 315 TRP A CA    1 
ATOM   2416 C  C     . TRP A 1 318 ? -59.524 36.497 -27.217 1.00 106.94 ? 315 TRP A C     1 
ATOM   2417 O  O     . TRP A 1 318 ? -58.487 36.595 -26.553 1.00 106.26 ? 315 TRP A O     1 
ATOM   2418 C  CB    . TRP A 1 318 ? -59.388 35.705 -29.594 1.00 105.97 ? 315 TRP A CB    1 
ATOM   2419 C  CG    . TRP A 1 318 ? -58.155 34.918 -29.313 1.00 105.02 ? 315 TRP A CG    1 
ATOM   2420 C  CD1   . TRP A 1 318 ? -56.881 35.243 -29.663 1.00 104.03 ? 315 TRP A CD1   1 
ATOM   2421 C  CD2   . TRP A 1 318 ? -58.075 33.667 -28.627 1.00 106.37 ? 315 TRP A CD2   1 
ATOM   2422 N  NE1   . TRP A 1 318 ? -56.006 34.273 -29.237 1.00 103.89 ? 315 TRP A NE1   1 
ATOM   2423 C  CE2   . TRP A 1 318 ? -56.715 33.288 -28.605 1.00 105.36 ? 315 TRP A CE2   1 
ATOM   2424 C  CE3   . TRP A 1 318 ? -59.023 32.823 -28.033 1.00 109.21 ? 315 TRP A CE3   1 
ATOM   2425 C  CZ2   . TRP A 1 318 ? -56.274 32.104 -28.012 1.00 106.69 ? 315 TRP A CZ2   1 
ATOM   2426 C  CZ3   . TRP A 1 318 ? -58.583 31.646 -27.437 1.00 110.56 ? 315 TRP A CZ3   1 
ATOM   2427 C  CH2   . TRP A 1 318 ? -57.217 31.301 -27.430 1.00 109.32 ? 315 TRP A CH2   1 
ATOM   2428 N  N     . SER A 1 319 ? -60.661 36.037 -26.716 1.00 108.44 ? 316 SER A N     1 
ATOM   2429 C  CA    . SER A 1 319 ? -60.693 35.449 -25.398 1.00 108.95 ? 316 SER A CA    1 
ATOM   2430 C  C     . SER A 1 319 ? -61.220 34.030 -25.428 1.00 109.98 ? 316 SER A C     1 
ATOM   2431 O  O     . SER A 1 319 ? -62.066 33.674 -26.278 1.00 110.96 ? 316 SER A O     1 
ATOM   2432 C  CB    . SER A 1 319 ? -61.449 36.331 -24.410 1.00 110.45 ? 316 SER A CB    1 
ATOM   2433 O  OG    . SER A 1 319 ? -60.583 37.365 -23.983 1.00 109.87 ? 316 SER A OG    1 
ATOM   2434 N  N     . PRO A 1 320 ? -60.699 33.201 -24.502 1.00 109.95 ? 317 PRO A N     1 
ATOM   2435 C  CA    . PRO A 1 320 ? -61.005 31.785 -24.490 1.00 110.95 ? 317 PRO A CA    1 
ATOM   2436 C  C     . PRO A 1 320 ? -62.348 31.520 -23.823 1.00 112.78 ? 317 PRO A C     1 
ATOM   2437 O  O     . PRO A 1 320 ? -62.572 31.923 -22.674 1.00 113.33 ? 317 PRO A O     1 
ATOM   2438 C  CB    . PRO A 1 320 ? -59.850 31.185 -23.681 1.00 110.80 ? 317 PRO A CB    1 
ATOM   2439 C  CG    . PRO A 1 320 ? -59.205 32.342 -22.938 1.00 109.55 ? 317 PRO A CG    1 
ATOM   2440 C  CD    . PRO A 1 320 ? -59.905 33.598 -23.320 1.00 109.43 ? 317 PRO A CD    1 
ATOM   2441 N  N     . VAL A 1 321 ? -63.229 30.867 -24.574 1.00 113.66 ? 318 VAL A N     1 
ATOM   2442 C  CA    . VAL A 1 321 ? -64.545 30.437 -24.101 1.00 115.87 ? 318 VAL A CA    1 
ATOM   2443 C  C     . VAL A 1 321 ? -64.481 28.930 -23.817 1.00 117.30 ? 318 VAL A C     1 
ATOM   2444 O  O     . VAL A 1 321 ? -63.807 28.190 -24.540 1.00 117.04 ? 318 VAL A O     1 
ATOM   2445 C  CB    . VAL A 1 321 ? -65.634 30.744 -25.177 1.00 117.11 ? 318 VAL A CB    1 
ATOM   2446 C  CG1   . VAL A 1 321 ? -67.018 30.240 -24.752 1.00 121.20 ? 318 VAL A CG1   1 
ATOM   2447 C  CG2   . VAL A 1 321 ? -65.677 32.247 -25.492 1.00 115.61 ? 318 VAL A CG2   1 
ATOM   2448 N  N     . VAL A 1 322 ? -65.161 28.477 -22.766 1.00 118.74 ? 319 VAL A N     1 
ATOM   2449 C  CA    . VAL A 1 322 ? -65.243 27.039 -22.466 1.00 120.69 ? 319 VAL A CA    1 
ATOM   2450 C  C     . VAL A 1 322 ? -65.783 26.248 -23.665 1.00 121.81 ? 319 VAL A C     1 
ATOM   2451 O  O     . VAL A 1 322 ? -66.740 26.674 -24.308 1.00 122.42 ? 319 VAL A O     1 
ATOM   2452 C  CB    . VAL A 1 322 ? -66.112 26.772 -21.228 1.00 123.75 ? 319 VAL A CB    1 
ATOM   2453 C  CG1   . VAL A 1 322 ? -66.019 25.316 -20.820 1.00 127.06 ? 319 VAL A CG1   1 
ATOM   2454 C  CG2   . VAL A 1 322 ? -65.692 27.689 -20.076 1.00 122.10 ? 319 VAL A CG2   1 
ATOM   2455 N  N     . GLY A 1 323 ? -65.154 25.117 -23.975 1.00 122.15 ? 320 GLY A N     1 
ATOM   2456 C  CA    . GLY A 1 323 ? -65.554 24.296 -25.122 1.00 123.40 ? 320 GLY A CA    1 
ATOM   2457 C  C     . GLY A 1 323 ? -65.259 24.905 -26.489 1.00 119.87 ? 320 GLY A C     1 
ATOM   2458 O  O     . GLY A 1 323 ? -66.065 24.805 -27.414 1.00 121.14 ? 320 GLY A O     1 
ATOM   2459 N  N     . GLN A 1 324 ? -64.091 25.529 -26.609 1.00 115.59 ? 321 GLN A N     1 
ATOM   2460 C  CA    . GLN A 1 324 ? -63.662 26.194 -27.840 1.00 112.20 ? 321 GLN A CA    1 
ATOM   2461 C  C     . GLN A 1 324 ? -62.593 25.354 -28.532 1.00 111.80 ? 321 GLN A C     1 
ATOM   2462 O  O     . GLN A 1 324 ? -61.753 24.738 -27.869 1.00 112.50 ? 321 GLN A O     1 
ATOM   2463 C  CB    . GLN A 1 324 ? -63.108 27.591 -27.515 1.00 108.33 ? 321 GLN A CB    1 
ATOM   2464 C  CG    . GLN A 1 324 ? -62.885 28.529 -28.702 1.00 105.66 ? 321 GLN A CG    1 
ATOM   2465 C  CD    . GLN A 1 324 ? -62.339 29.902 -28.287 1.00 103.39 ? 321 GLN A CD    1 
ATOM   2466 O  OE1   . GLN A 1 324 ? -61.857 30.100 -27.169 1.00 102.66 ? 321 GLN A OE1   1 
ATOM   2467 N  NE2   . GLN A 1 324 ? -62.412 30.852 -29.198 1.00 102.63 ? 321 GLN A NE2   1 
ATOM   2468 N  N     . LEU A 1 325 ? -62.629 25.322 -29.860 1.00 110.81 ? 322 LEU A N     1 
ATOM   2469 C  CA    . LEU A 1 325 ? -61.586 24.657 -30.613 1.00 109.96 ? 322 LEU A CA    1 
ATOM   2470 C  C     . LEU A 1 325 ? -60.365 25.541 -30.699 1.00 105.74 ? 322 LEU A C     1 
ATOM   2471 O  O     . LEU A 1 325 ? -60.400 26.614 -31.315 1.00 103.66 ? 322 LEU A O     1 
ATOM   2472 C  CB    . LEU A 1 325 ? -62.067 24.264 -31.993 1.00 111.44 ? 322 LEU A CB    1 
ATOM   2473 C  CG    . LEU A 1 325 ? -62.708 22.889 -31.983 1.00 116.46 ? 322 LEU A CG    1 
ATOM   2474 C  CD1   . LEU A 1 325 ? -62.581 22.305 -33.369 1.00 119.24 ? 322 LEU A CD1   1 
ATOM   2475 C  CD2   . LEU A 1 325 ? -62.029 21.996 -30.965 1.00 118.15 ? 322 LEU A CD2   1 
ATOM   2476 N  N     . VAL A 1 326 ? -59.283 25.056 -30.090 1.00 104.99 ? 323 VAL A N     1 
ATOM   2477 C  CA    . VAL A 1 326 ? -58.114 25.848 -29.738 1.00 100.98 ? 323 VAL A CA    1 
ATOM   2478 C  C     . VAL A 1 326 ? -56.872 24.995 -29.953 1.00 101.47 ? 323 VAL A C     1 
ATOM   2479 O  O     . VAL A 1 326 ? -56.885 23.813 -29.675 1.00 104.99 ? 323 VAL A O     1 
ATOM   2480 C  CB    . VAL A 1 326 ? -58.234 26.240 -28.250 1.00 100.66 ? 323 VAL A CB    1 
ATOM   2481 C  CG1   . VAL A 1 326 ? -56.930 26.668 -27.688 1.00 99.40  ? 323 VAL A CG1   1 
ATOM   2482 C  CG2   . VAL A 1 326 ? -59.254 27.349 -28.067 1.00 99.46  ? 323 VAL A CG2   1 
ATOM   2483 N  N     . GLN A 1 327 ? -55.787 25.570 -30.444 1.00 98.78  ? 324 GLN A N     1 
ATOM   2484 C  CA    . GLN A 1 327 ? -54.599 24.754 -30.691 1.00 99.99  ? 324 GLN A CA    1 
ATOM   2485 C  C     . GLN A 1 327 ? -53.329 25.268 -30.021 1.00 98.18  ? 324 GLN A C     1 
ATOM   2486 O  O     . GLN A 1 327 ? -53.073 26.469 -29.978 1.00 95.05  ? 324 GLN A O     1 
ATOM   2487 C  CB    . GLN A 1 327 ? -54.363 24.582 -32.194 1.00 100.24 ? 324 GLN A CB    1 
ATOM   2488 C  CG    . GLN A 1 327 ? -55.505 23.913 -32.956 1.00 102.69 ? 324 GLN A CG    1 
ATOM   2489 C  CD    . GLN A 1 327 ? -55.276 23.916 -34.453 1.00 104.04 ? 324 GLN A CD    1 
ATOM   2490 O  OE1   . GLN A 1 327 ? -56.060 24.499 -35.210 1.00 104.58 ? 324 GLN A OE1   1 
ATOM   2491 N  NE2   . GLN A 1 327 ? -54.174 23.312 -34.892 1.00 105.94 ? 324 GLN A NE2   1 
ATOM   2492 N  N     . GLU A 1 328 ? -52.533 24.325 -29.529 1.00 100.59 ? 325 GLU A N     1 
ATOM   2493 C  CA    . GLU A 1 328 ? -51.304 24.613 -28.806 1.00 100.18 ? 325 GLU A CA    1 
ATOM   2494 C  C     . GLU A 1 328 ? -50.116 24.665 -29.753 1.00 99.48  ? 325 GLU A C     1 
ATOM   2495 O  O     . GLU A 1 328 ? -50.020 23.840 -30.656 1.00 101.43 ? 325 GLU A O     1 
ATOM   2496 C  CB    . GLU A 1 328 ? -51.067 23.525 -27.758 1.00 104.27 ? 325 GLU A CB    1 
ATOM   2497 C  CG    . GLU A 1 328 ? -50.012 23.886 -26.712 1.00 105.25 ? 325 GLU A CG    1 
ATOM   2498 C  CD    . GLU A 1 328 ? -49.694 22.761 -25.721 1.00 110.81 ? 325 GLU A CD    1 
ATOM   2499 O  OE1   . GLU A 1 328 ? -50.031 21.571 -25.969 1.00 114.92 ? 325 GLU A OE1   1 
ATOM   2500 O  OE2   . GLU A 1 328 ? -49.086 23.091 -24.682 1.00 111.49 ? 325 GLU A OE2   1 
ATOM   2501 N  N     . ARG A 1 329 ? -49.210 25.621 -29.542 1.00 97.20  ? 326 ARG A N     1 
ATOM   2502 C  CA    . ARG A 1 329 ? -48.001 25.735 -30.371 1.00 96.92  ? 326 ARG A CA    1 
ATOM   2503 C  C     . ARG A 1 329 ? -47.041 24.598 -30.080 1.00 99.84  ? 326 ARG A C     1 
ATOM   2504 O  O     . ARG A 1 329 ? -46.984 24.106 -28.960 1.00 102.01 ? 326 ARG A O     1 
ATOM   2505 C  CB    . ARG A 1 329 ? -47.295 27.087 -30.190 1.00 94.59  ? 326 ARG A CB    1 
ATOM   2506 C  CG    . ARG A 1 329 ? -45.959 27.173 -30.965 1.00 98.38  ? 326 ARG A CG    1 
ATOM   2507 C  CD    . ARG A 1 329 ? -45.487 28.589 -31.332 1.00 100.71 ? 326 ARG A CD    1 
ATOM   2508 N  NE    . ARG A 1 329 ? -46.020 29.596 -30.418 1.00 103.59 ? 326 ARG A NE    1 
ATOM   2509 C  CZ    . ARG A 1 329 ? -46.698 30.673 -30.809 1.00 103.71 ? 326 ARG A CZ    1 
ATOM   2510 N  NH1   . ARG A 1 329 ? -46.903 30.896 -32.108 1.00 103.08 ? 326 ARG A NH1   1 
ATOM   2511 N  NH2   . ARG A 1 329 ? -47.158 31.533 -29.900 1.00 103.40 ? 326 ARG A NH2   1 
ATOM   2512 N  N     . VAL A 1 330 ? -46.294 24.177 -31.093 1.00 100.17 ? 327 VAL A N     1 
ATOM   2513 C  CA    . VAL A 1 330 ? -45.326 23.110 -30.906 1.00 103.76 ? 327 VAL A CA    1 
ATOM   2514 C  C     . VAL A 1 330 ? -44.190 23.576 -30.006 1.00 103.90 ? 327 VAL A C     1 
ATOM   2515 O  O     . VAL A 1 330 ? -43.761 24.717 -30.088 1.00 101.22 ? 327 VAL A O     1 
ATOM   2516 C  CB    . VAL A 1 330 ? -44.776 22.568 -32.246 1.00 105.17 ? 327 VAL A CB    1 
ATOM   2517 C  CG1   . VAL A 1 330 ? -43.493 21.785 -32.037 1.00 109.35 ? 327 VAL A CG1   1 
ATOM   2518 C  CG2   . VAL A 1 330 ? -45.793 21.682 -32.919 1.00 106.35 ? 327 VAL A CG2   1 
ATOM   2519 N  N     . ALA A 1 331 ? -43.735 22.678 -29.136 1.00 107.59 ? 328 ALA A N     1 
ATOM   2520 C  CA    . ALA A 1 331 ? -42.550 22.878 -28.310 1.00 108.56 ? 328 ALA A CA    1 
ATOM   2521 C  C     . ALA A 1 331 ? -41.371 23.373 -29.139 1.00 107.40 ? 328 ALA A C     1 
ATOM   2522 O  O     . ALA A 1 331 ? -41.203 24.574 -29.335 1.00 103.78 ? 328 ALA A O     1 
ATOM   2523 C  CB    . ALA A 1 331 ? -42.191 21.568 -27.591 1.00 114.49 ? 328 ALA A CB    1 
ATOM   2524 N  N     . ARG A 1 332 ? -40.563 22.443 -29.631 1.00 110.56 ? 329 ARG A N     1 
ATOM   2525 C  CA    . ARG A 1 332 ? -39.388 22.803 -30.408 1.00 110.24 ? 329 ARG A CA    1 
ATOM   2526 C  C     . ARG A 1 332 ? -39.550 22.308 -31.842 1.00 109.76 ? 329 ARG A C     1 
ATOM   2527 O  O     . ARG A 1 332 ? -39.005 21.264 -32.204 1.00 114.36 ? 329 ARG A O     1 
ATOM   2528 C  CB    . ARG A 1 332 ? -38.113 22.237 -29.764 1.00 115.37 ? 329 ARG A CB    1 
ATOM   2529 N  N     . PRO A 1 333 ? -40.294 23.065 -32.668 1.00 104.48 ? 330 PRO A N     1 
ATOM   2530 C  CA    . PRO A 1 333 ? -40.653 22.609 -34.005 1.00 103.78 ? 330 PRO A CA    1 
ATOM   2531 C  C     . PRO A 1 333 ? -39.427 22.166 -34.738 1.00 106.29 ? 330 PRO A C     1 
ATOM   2532 O  O     . PRO A 1 333 ? -38.412 22.829 -34.650 1.00 106.10 ? 330 PRO A O     1 
ATOM   2533 C  CB    . PRO A 1 333 ? -41.204 23.868 -34.666 1.00 98.69  ? 330 PRO A CB    1 
ATOM   2534 C  CG    . PRO A 1 333 ? -41.654 24.734 -33.534 1.00 96.54  ? 330 PRO A CG    1 
ATOM   2535 C  CD    . PRO A 1 333 ? -40.666 24.474 -32.452 1.00 99.71  ? 330 PRO A CD    1 
ATOM   2536 N  N     . ALA A 1 334 ? -39.505 21.040 -35.430 1.00 109.27 ? 331 ALA A N     1 
ATOM   2537 C  CA    . ALA A 1 334 ? -38.392 20.605 -36.264 1.00 112.38 ? 331 ALA A CA    1 
ATOM   2538 C  C     . ALA A 1 334 ? -38.376 21.390 -37.571 1.00 108.81 ? 331 ALA A C     1 
ATOM   2539 O  O     . ALA A 1 334 ? -39.308 22.139 -37.868 1.00 104.30 ? 331 ALA A O     1 
ATOM   2540 C  CB    . ALA A 1 334 ? -38.457 19.102 -36.527 1.00 118.12 ? 331 ALA A CB    1 
ATOM   2541 N  N     . SER A 1 335 ? -37.308 21.223 -38.343 1.00 111.16 ? 332 SER A N     1 
ATOM   2542 C  CA    . SER A 1 335 ? -37.142 21.955 -39.594 1.00 108.48 ? 332 SER A CA    1 
ATOM   2543 C  C     . SER A 1 335 ? -38.151 21.484 -40.640 1.00 107.73 ? 332 SER A C     1 
ATOM   2544 O  O     . SER A 1 335 ? -38.158 20.305 -41.010 1.00 112.09 ? 332 SER A O     1 
ATOM   2545 C  CB    . SER A 1 335 ? -35.713 21.791 -40.115 1.00 112.03 ? 332 SER A CB    1 
ATOM   2546 O  OG    . SER A 1 335 ? -35.442 22.732 -41.138 1.00 109.32 ? 332 SER A OG    1 
ATOM   2547 N  N     . LEU A 1 336 ? -39.000 22.408 -41.099 1.00 102.54 ? 333 LEU A N     1 
ATOM   2548 C  CA    . LEU A 1 336 ? -40.034 22.123 -42.113 1.00 101.18 ? 333 LEU A CA    1 
ATOM   2549 C  C     . LEU A 1 336 ? -41.283 21.429 -41.572 1.00 101.65 ? 333 LEU A C     1 
ATOM   2550 O  O     . LEU A 1 336 ? -42.109 20.962 -42.361 1.00 102.49 ? 333 LEU A O     1 
ATOM   2551 C  CB    . LEU A 1 336 ? -39.481 21.283 -43.278 1.00 104.71 ? 333 LEU A CB    1 
ATOM   2552 C  CG    . LEU A 1 336 ? -38.446 21.833 -44.249 1.00 103.76 ? 333 LEU A CG    1 
ATOM   2553 C  CD1   . LEU A 1 336 ? -38.116 20.774 -45.273 1.00 107.45 ? 333 LEU A CD1   1 
ATOM   2554 C  CD2   . LEU A 1 336 ? -38.983 23.064 -44.932 1.00 98.54  ? 333 LEU A CD2   1 
ATOM   2555 N  N     . ARG A 1 337 ? -41.421 21.343 -40.249 1.00 101.38 ? 334 ARG A N     1 
ATOM   2556 C  CA    . ARG A 1 337 ? -42.576 20.672 -39.648 1.00 101.89 ? 334 ARG A CA    1 
ATOM   2557 C  C     . ARG A 1 337 ? -43.555 21.666 -38.977 1.00 97.68  ? 334 ARG A C     1 
ATOM   2558 O  O     . ARG A 1 337 ? -43.165 22.790 -38.650 1.00 94.42  ? 334 ARG A O     1 
ATOM   2559 C  CB    . ARG A 1 337 ? -42.114 19.549 -38.723 1.00 106.35 ? 334 ARG A CB    1 
ATOM   2560 C  CG    . ARG A 1 337 ? -41.384 18.439 -39.453 1.00 110.40 ? 334 ARG A CG    1 
ATOM   2561 C  CD    . ARG A 1 337 ? -41.838 17.088 -38.953 1.00 114.87 ? 334 ARG A CD    1 
ATOM   2562 N  NE    . ARG A 1 337 ? -41.243 15.955 -39.667 1.00 120.72 ? 334 ARG A NE    1 
ATOM   2563 C  CZ    . ARG A 1 337 ? -41.606 15.536 -40.880 1.00 121.61 ? 334 ARG A CZ    1 
ATOM   2564 N  NH1   . ARG A 1 337 ? -42.553 16.168 -41.557 1.00 117.84 ? 334 ARG A NH1   1 
ATOM   2565 N  NH2   . ARG A 1 337 ? -41.007 14.489 -41.430 1.00 126.92 ? 334 ARG A NH2   1 
ATOM   2566 N  N     . PRO A 1 338 ? -44.839 21.276 -38.820 1.00 98.14  ? 335 PRO A N     1 
ATOM   2567 C  CA    . PRO A 1 338 ? -45.904 22.201 -38.416 1.00 94.70  ? 335 PRO A CA    1 
ATOM   2568 C  C     . PRO A 1 338 ? -45.659 22.951 -37.126 1.00 93.55  ? 335 PRO A C     1 
ATOM   2569 O  O     . PRO A 1 338 ? -45.250 22.360 -36.143 1.00 96.30  ? 335 PRO A O     1 
ATOM   2570 C  CB    . PRO A 1 338 ? -47.110 21.285 -38.256 1.00 96.67  ? 335 PRO A CB    1 
ATOM   2571 C  CG    . PRO A 1 338 ? -46.875 20.241 -39.251 1.00 100.54 ? 335 PRO A CG    1 
ATOM   2572 C  CD    . PRO A 1 338 ? -45.400 19.973 -39.218 1.00 102.51 ? 335 PRO A CD    1 
ATOM   2573 N  N     . ARG A 1 339 ? -45.926 24.249 -37.132 1.00 90.68  ? 336 ARG A N     1 
ATOM   2574 C  CA    . ARG A 1 339 ? -45.721 25.074 -35.950 1.00 89.89  ? 336 ARG A CA    1 
ATOM   2575 C  C     . ARG A 1 339 ? -46.824 24.929 -34.881 1.00 89.94  ? 336 ARG A C     1 
ATOM   2576 O  O     . ARG A 1 339 ? -46.691 25.488 -33.799 1.00 88.83  ? 336 ARG A O     1 
ATOM   2577 C  CB    . ARG A 1 339 ? -45.551 26.540 -36.375 1.00 86.83  ? 336 ARG A CB    1 
ATOM   2578 C  CG    . ARG A 1 339 ? -44.096 27.103 -36.451 1.00 89.18  ? 336 ARG A CG    1 
ATOM   2579 C  CD    . ARG A 1 339 ? -43.096 26.209 -37.209 1.00 95.90  ? 336 ARG A CD    1 
ATOM   2580 N  NE    . ARG A 1 339 ? -41.754 26.806 -37.307 1.00 98.12  ? 336 ARG A NE    1 
ATOM   2581 C  CZ    . ARG A 1 339 ? -40.649 26.135 -37.646 1.00 102.60 ? 336 ARG A CZ    1 
ATOM   2582 N  NH1   . ARG A 1 339 ? -40.693 24.829 -37.918 1.00 105.44 ? 336 ARG A NH1   1 
ATOM   2583 N  NH2   . ARG A 1 339 ? -39.486 26.773 -37.712 1.00 104.18 ? 336 ARG A NH2   1 
ATOM   2584 N  N     . TRP A 1 340 ? -47.889 24.171 -35.179 1.00 92.00  ? 337 TRP A N     1 
ATOM   2585 C  CA    . TRP A 1 340 ? -49.028 23.948 -34.246 1.00 92.96  ? 337 TRP A CA    1 
ATOM   2586 C  C     . TRP A 1 340 ? -49.457 22.490 -34.096 1.00 97.71  ? 337 TRP A C     1 
ATOM   2587 O  O     . TRP A 1 340 ? -49.349 21.709 -35.044 1.00 100.35 ? 337 TRP A O     1 
ATOM   2588 C  CB    . TRP A 1 340 ? -50.258 24.717 -34.696 1.00 90.19  ? 337 TRP A CB    1 
ATOM   2589 C  CG    . TRP A 1 340 ? -50.027 26.157 -34.827 1.00 87.65  ? 337 TRP A CG    1 
ATOM   2590 C  CD1   . TRP A 1 340 ? -49.687 26.827 -35.956 1.00 86.46  ? 337 TRP A CD1   1 
ATOM   2591 C  CD2   . TRP A 1 340 ? -50.116 27.134 -33.789 1.00 86.84  ? 337 TRP A CD2   1 
ATOM   2592 N  NE1   . TRP A 1 340 ? -49.561 28.168 -35.693 1.00 83.89  ? 337 TRP A NE1   1 
ATOM   2593 C  CE2   . TRP A 1 340 ? -49.823 28.383 -34.367 1.00 84.14  ? 337 TRP A CE2   1 
ATOM   2594 C  CE3   . TRP A 1 340 ? -50.425 27.077 -32.421 1.00 88.38  ? 337 TRP A CE3   1 
ATOM   2595 C  CZ2   . TRP A 1 340 ? -49.813 29.566 -33.625 1.00 83.42  ? 337 TRP A CZ2   1 
ATOM   2596 C  CZ3   . TRP A 1 340 ? -50.421 28.256 -31.682 1.00 85.89  ? 337 TRP A CZ3   1 
ATOM   2597 C  CH2   . TRP A 1 340 ? -50.114 29.481 -32.287 1.00 84.12  ? 337 TRP A CH2   1 
ATOM   2598 N  N     . HIS A 1 341 ? -49.966 22.138 -32.910 1.00 99.63  ? 338 HIS A N     1 
ATOM   2599 C  CA    . HIS A 1 341 ? -50.544 20.801 -32.638 1.00 104.62 ? 338 HIS A CA    1 
ATOM   2600 C  C     . HIS A 1 341 ? -51.969 20.718 -33.190 1.00 104.90 ? 338 HIS A C     1 
ATOM   2601 O  O     . HIS A 1 341 ? -52.541 21.758 -33.567 1.00 101.32 ? 338 HIS A O     1 
ATOM   2602 C  CB    . HIS A 1 341 ? -50.578 20.505 -31.133 1.00 106.23 ? 338 HIS A CB    1 
ATOM   2603 C  CG    . HIS A 1 341 ? -49.231 20.275 -30.525 1.00 107.86 ? 338 HIS A CG    1 
ATOM   2604 N  ND1   . HIS A 1 341 ? -48.511 19.116 -30.723 1.00 113.04 ? 338 HIS A ND1   1 
ATOM   2605 C  CD2   . HIS A 1 341 ? -48.479 21.048 -29.706 1.00 105.95 ? 338 HIS A CD2   1 
ATOM   2606 C  CE1   . HIS A 1 341 ? -47.369 19.187 -30.061 1.00 113.81 ? 338 HIS A CE1   1 
ATOM   2607 N  NE2   . HIS A 1 341 ? -47.324 20.350 -29.436 1.00 109.94 ? 338 HIS A NE2   1 
ATOM   2608 N  N     . LYS A 1 342 ? -52.542 19.501 -33.224 1.00 109.52 ? 339 LYS A N     1 
ATOM   2609 C  CA    . LYS A 1 342 ? -53.927 19.296 -33.696 1.00 110.68 ? 339 LYS A CA    1 
ATOM   2610 C  C     . LYS A 1 342 ? -54.901 20.033 -32.788 1.00 108.88 ? 339 LYS A C     1 
ATOM   2611 O  O     . LYS A 1 342 ? -54.480 20.511 -31.719 1.00 107.56 ? 339 LYS A O     1 
ATOM   2612 C  CB    . LYS A 1 342 ? -54.301 17.819 -33.763 1.00 116.42 ? 339 LYS A CB    1 
ATOM   2613 N  N     . PRO A 1 343 ? -56.199 20.161 -33.218 1.00 109.38 ? 340 PRO A N     1 
ATOM   2614 C  CA    . PRO A 1 343 ? -57.162 20.920 -32.415 1.00 107.55 ? 340 PRO A CA    1 
ATOM   2615 C  C     . PRO A 1 343 ? -57.390 20.257 -31.086 1.00 110.14 ? 340 PRO A C     1 
ATOM   2616 O  O     . PRO A 1 343 ? -57.306 19.040 -30.996 1.00 114.76 ? 340 PRO A O     1 
ATOM   2617 C  CB    . PRO A 1 343 ? -58.457 20.994 -33.276 1.00 108.24 ? 340 PRO A CB    1 
ATOM   2618 C  CG    . PRO A 1 343 ? -57.988 20.916 -34.658 1.00 108.50 ? 340 PRO A CG    1 
ATOM   2619 C  CD    . PRO A 1 343 ? -56.816 19.994 -34.535 1.00 110.44 ? 340 PRO A CD    1 
ATOM   2620 N  N     . SER A 1 344 ? -57.658 21.062 -30.064 1.00 107.84 ? 341 SER A N     1 
ATOM   2621 C  CA    . SER A 1 344 ? -58.002 20.550 -28.741 1.00 110.79 ? 341 SER A CA    1 
ATOM   2622 C  C     . SER A 1 344 ? -59.013 21.491 -28.084 1.00 108.71 ? 341 SER A C     1 
ATOM   2623 O  O     . SER A 1 344 ? -59.263 22.589 -28.582 1.00 105.26 ? 341 SER A O     1 
ATOM   2624 C  CB    . SER A 1 344 ? -56.748 20.357 -27.879 1.00 111.11 ? 341 SER A CB    1 
ATOM   2625 O  OG    . SER A 1 344 ? -55.762 21.346 -28.152 1.00 107.76 ? 341 SER A OG    1 
ATOM   2626 N  N     . THR A 1 345 ? -59.601 21.062 -26.976 1.00 111.42 ? 342 THR A N     1 
ATOM   2627 C  CA    . THR A 1 345 ? -60.761 21.753 -26.431 1.00 110.77 ? 342 THR A CA    1 
ATOM   2628 C  C     . THR A 1 345 ? -60.450 22.446 -25.122 1.00 109.30 ? 342 THR A C     1 
ATOM   2629 O  O     . THR A 1 345 ? -59.704 21.922 -24.298 1.00 111.07 ? 342 THR A O     1 
ATOM   2630 C  CB    . THR A 1 345 ? -61.904 20.773 -26.211 1.00 115.46 ? 342 THR A CB    1 
ATOM   2631 O  OG1   . THR A 1 345 ? -61.945 19.868 -27.315 1.00 118.11 ? 342 THR A OG1   1 
ATOM   2632 C  CG2   . THR A 1 345 ? -63.220 21.505 -26.120 1.00 114.77 ? 342 THR A CG2   1 
ATOM   2633 N  N     . VAL A 1 346 ? -61.030 23.627 -24.943 1.00 106.78 ? 343 VAL A N     1 
ATOM   2634 C  CA    . VAL A 1 346 ? -60.939 24.364 -23.687 1.00 105.93 ? 343 VAL A CA    1 
ATOM   2635 C  C     . VAL A 1 346 ? -61.755 23.650 -22.603 1.00 110.25 ? 343 VAL A C     1 
ATOM   2636 O  O     . VAL A 1 346 ? -62.985 23.554 -22.703 1.00 112.42 ? 343 VAL A O     1 
ATOM   2637 C  CB    . VAL A 1 346 ? -61.470 25.809 -23.852 1.00 102.65 ? 343 VAL A CB    1 
ATOM   2638 C  CG1   . VAL A 1 346 ? -61.644 26.476 -22.495 1.00 102.23 ? 343 VAL A CG1   1 
ATOM   2639 C  CG2   . VAL A 1 346 ? -60.544 26.621 -24.728 1.00 98.83  ? 343 VAL A CG2   1 
ATOM   2640 N  N     . LEU A 1 347 ? -61.077 23.152 -21.574 1.00 112.19 ? 344 LEU A N     1 
ATOM   2641 C  CA    . LEU A 1 347 ? -61.773 22.478 -20.492 1.00 116.52 ? 344 LEU A CA    1 
ATOM   2642 C  C     . LEU A 1 347 ? -62.308 23.474 -19.477 1.00 115.68 ? 344 LEU A C     1 
ATOM   2643 O  O     . LEU A 1 347 ? -63.518 23.578 -19.302 1.00 117.50 ? 344 LEU A O     1 
ATOM   2644 C  CB    . LEU A 1 347 ? -60.892 21.419 -19.832 1.00 119.54 ? 344 LEU A CB    1 
ATOM   2645 C  CG    . LEU A 1 347 ? -60.526 20.192 -20.675 1.00 122.57 ? 344 LEU A CG    1 
ATOM   2646 C  CD1   . LEU A 1 347 ? -59.872 19.139 -19.781 1.00 127.21 ? 344 LEU A CD1   1 
ATOM   2647 C  CD2   . LEU A 1 347 ? -61.760 19.617 -21.364 1.00 125.66 ? 344 LEU A CD2   1 
ATOM   2648 N  N     . LYS A 1 348 ? -61.414 24.205 -18.815 1.00 113.78 ? 345 LYS A N     1 
ATOM   2649 C  CA    . LYS A 1 348 ? -61.818 25.273 -17.898 1.00 113.01 ? 345 LYS A CA    1 
ATOM   2650 C  C     . LYS A 1 348 ? -61.055 26.533 -18.269 1.00 109.19 ? 345 LYS A C     1 
ATOM   2651 O  O     . LYS A 1 348 ? -60.018 26.459 -18.934 1.00 107.82 ? 345 LYS A O     1 
ATOM   2652 C  CB    . LYS A 1 348 ? -61.563 24.886 -16.431 1.00 115.26 ? 345 LYS A CB    1 
ATOM   2653 N  N     . VAL A 1 349 ? -61.577 27.686 -17.861 1.00 108.32 ? 346 VAL A N     1 
ATOM   2654 C  CA    . VAL A 1 349 ? -60.901 28.968 -18.082 1.00 105.40 ? 346 VAL A CA    1 
ATOM   2655 C  C     . VAL A 1 349 ? -60.467 29.556 -16.739 1.00 105.88 ? 346 VAL A C     1 
ATOM   2656 O  O     . VAL A 1 349 ? -61.242 30.231 -16.054 1.00 106.87 ? 346 VAL A O     1 
ATOM   2657 C  CB    . VAL A 1 349 ? -61.803 29.970 -18.847 1.00 103.94 ? 346 VAL A CB    1 
ATOM   2658 C  CG1   . VAL A 1 349 ? -61.186 31.365 -18.866 1.00 101.27 ? 346 VAL A CG1   1 
ATOM   2659 C  CG2   . VAL A 1 349 ? -62.049 29.487 -20.256 1.00 103.88 ? 346 VAL A CG2   1 
ATOM   2660 N  N     . LEU A 1 350 ? -59.223 29.289 -16.363 1.00 105.90 ? 347 LEU A N     1 
ATOM   2661 C  CA    . LEU A 1 350 ? -58.700 29.711 -15.070 1.00 106.61 ? 347 LEU A CA    1 
ATOM   2662 C  C     . LEU A 1 350 ? -58.752 31.227 -14.880 1.00 105.12 ? 347 LEU A C     1 
ATOM   2663 O  O     . LEU A 1 350 ? -59.125 31.710 -13.818 1.00 106.40 ? 347 LEU A O     1 
ATOM   2664 C  CB    . LEU A 1 350 ? -57.285 29.176 -14.888 1.00 106.76 ? 347 LEU A CB    1 
ATOM   2665 C  CG    . LEU A 1 350 ? -57.165 27.656 -14.975 1.00 108.98 ? 347 LEU A CG    1 
ATOM   2666 C  CD1   . LEU A 1 350 ? -55.741 27.222 -14.708 1.00 109.95 ? 347 LEU A CD1   1 
ATOM   2667 C  CD2   . LEU A 1 350 ? -58.120 26.968 -14.015 1.00 111.91 ? 347 LEU A CD2   1 
ATOM   2668 N  N     . ASN A 1 351 ? -58.384 31.969 -15.919 1.00 103.04 ? 348 ASN A N     1 
ATOM   2669 C  CA    . ASN A 1 351 ? -58.525 33.424 -15.948 1.00 102.05 ? 348 ASN A CA    1 
ATOM   2670 C  C     . ASN A 1 351 ? -58.567 33.840 -17.414 1.00 100.34 ? 348 ASN A C     1 
ATOM   2671 O  O     . ASN A 1 351 ? -58.309 33.000 -18.281 1.00 100.00 ? 348 ASN A O     1 
ATOM   2672 C  CB    . ASN A 1 351 ? -57.392 34.118 -15.162 1.00 101.85 ? 348 ASN A CB    1 
ATOM   2673 C  CG    . ASN A 1 351 ? -56.012 33.872 -15.751 1.00 100.09 ? 348 ASN A CG    1 
ATOM   2674 O  OD1   . ASN A 1 351 ? -55.867 33.641 -16.942 1.00 97.90  ? 348 ASN A OD1   1 
ATOM   2675 N  ND2   . ASN A 1 351 ? -54.986 33.943 -14.907 1.00 100.71 ? 348 ASN A ND2   1 
ATOM   2676 N  N     . PRO A 1 352 ? -58.866 35.122 -17.716 1.00 99.80  ? 349 PRO A N     1 
ATOM   2677 C  CA    . PRO A 1 352 ? -59.035 35.433 -19.139 1.00 98.23  ? 349 PRO A CA    1 
ATOM   2678 C  C     . PRO A 1 352 ? -57.761 35.184 -19.951 1.00 96.57  ? 349 PRO A C     1 
ATOM   2679 O  O     . PRO A 1 352 ? -57.773 35.420 -21.158 1.00 95.59  ? 349 PRO A O     1 
ATOM   2680 C  CB    . PRO A 1 352 ? -59.375 36.931 -19.149 1.00 98.26  ? 349 PRO A CB    1 
ATOM   2681 C  CG    . PRO A 1 352 ? -59.600 37.315 -17.727 1.00 100.48 ? 349 PRO A CG    1 
ATOM   2682 C  CD    . PRO A 1 352 ? -58.841 36.342 -16.891 1.00 100.61 ? 349 PRO A CD    1 
ATOM   2683 N  N     . ARG A 1 353 ? -56.691 34.707 -19.295 1.00 96.69  ? 350 ARG A N     1 
ATOM   2684 C  CA    . ARG A 1 353 ? -55.377 34.498 -19.932 1.00 95.20  ? 350 ARG A CA    1 
ATOM   2685 C  C     . ARG A 1 353 ? -54.709 33.145 -19.713 1.00 96.24  ? 350 ARG A C     1 
ATOM   2686 O  O     . ARG A 1 353 ? -53.622 32.884 -20.242 1.00 95.80  ? 350 ARG A O     1 
ATOM   2687 C  CB    . ARG A 1 353 ? -54.414 35.615 -19.567 1.00 94.62  ? 350 ARG A CB    1 
ATOM   2688 C  CG    . ARG A 1 353 ? -54.538 36.747 -20.518 1.00 92.76  ? 350 ARG A CG    1 
ATOM   2689 C  CD    . ARG A 1 353 ? -53.506 37.786 -20.264 1.00 92.70  ? 350 ARG A CD    1 
ATOM   2690 N  NE    . ARG A 1 353 ? -52.149 37.407 -20.661 1.00 92.13  ? 350 ARG A NE    1 
ATOM   2691 C  CZ    . ARG A 1 353 ? -51.725 37.228 -21.914 1.00 90.06  ? 350 ARG A CZ    1 
ATOM   2692 N  NH1   . ARG A 1 353 ? -52.563 37.343 -22.950 1.00 87.75  ? 350 ARG A NH1   1 
ATOM   2693 N  NH2   . ARG A 1 353 ? -50.446 36.911 -22.120 1.00 89.07  ? 350 ARG A NH2   1 
ATOM   2694 N  N     . THR A 1 354 ? -55.366 32.291 -18.942 1.00 98.09  ? 351 THR A N     1 
ATOM   2695 C  CA    . THR A 1 354 ? -54.847 30.963 -18.656 1.00 100.02 ? 351 THR A CA    1 
ATOM   2696 C  C     . THR A 1 354 ? -55.972 29.951 -18.838 1.00 101.39 ? 351 THR A C     1 
ATOM   2697 O  O     . THR A 1 354 ? -57.106 30.185 -18.409 1.00 102.23 ? 351 THR A O     1 
ATOM   2698 C  CB    . THR A 1 354 ? -54.278 30.874 -17.223 1.00 102.05 ? 351 THR A CB    1 
ATOM   2699 O  OG1   . THR A 1 354 ? -53.612 32.101 -16.886 1.00 101.35 ? 351 THR A OG1   1 
ATOM   2700 C  CG2   . THR A 1 354 ? -53.291 29.725 -17.110 1.00 104.38 ? 351 THR A CG2   1 
ATOM   2701 N  N     . VAL A 1 355 ? -55.657 28.834 -19.486 1.00 102.04 ? 352 VAL A N     1 
ATOM   2702 C  CA    . VAL A 1 355 ? -56.665 27.859 -19.870 1.00 103.45 ? 352 VAL A CA    1 
ATOM   2703 C  C     . VAL A 1 355 ? -56.198 26.454 -19.541 1.00 106.83 ? 352 VAL A C     1 
ATOM   2704 O  O     . VAL A 1 355 ? -55.003 26.181 -19.564 1.00 107.16 ? 352 VAL A O     1 
ATOM   2705 C  CB    . VAL A 1 355 ? -56.963 27.973 -21.368 1.00 101.48 ? 352 VAL A CB    1 
ATOM   2706 C  CG1   . VAL A 1 355 ? -57.871 26.875 -21.824 1.00 104.20 ? 352 VAL A CG1   1 
ATOM   2707 C  CG2   . VAL A 1 355 ? -57.628 29.279 -21.643 1.00 99.25  ? 352 VAL A CG2   1 
ATOM   2708 N  N     . VAL A 1 356 ? -57.142 25.575 -19.207 1.00 110.02 ? 353 VAL A N     1 
ATOM   2709 C  CA    . VAL A 1 356 ? -56.869 24.139 -19.143 1.00 114.11 ? 353 VAL A CA    1 
ATOM   2710 C  C     . VAL A 1 356 ? -57.467 23.481 -20.371 1.00 115.32 ? 353 VAL A C     1 
ATOM   2711 O  O     . VAL A 1 356 ? -58.633 23.704 -20.697 1.00 114.87 ? 353 VAL A O     1 
ATOM   2712 C  CB    . VAL A 1 356 ? -57.414 23.464 -17.869 1.00 117.72 ? 353 VAL A CB    1 
ATOM   2713 C  CG1   . VAL A 1 356 ? -56.991 22.002 -17.824 1.00 121.98 ? 353 VAL A CG1   1 
ATOM   2714 C  CG2   . VAL A 1 356 ? -56.895 24.164 -16.637 1.00 117.03 ? 353 VAL A CG2   1 
ATOM   2715 N  N     . ILE A 1 357 ? -56.649 22.688 -21.053 1.00 117.44 ? 354 ILE A N     1 
ATOM   2716 C  CA    . ILE A 1 357 ? -57.060 22.040 -22.286 1.00 119.66 ? 354 ILE A CA    1 
ATOM   2717 C  C     . ILE A 1 357 ? -56.846 20.538 -22.245 1.00 126.18 ? 354 ILE A C     1 
ATOM   2718 O  O     . ILE A 1 357 ? -55.872 20.051 -21.655 1.00 128.46 ? 354 ILE A O     1 
ATOM   2719 C  CB    . ILE A 1 357 ? -56.286 22.557 -23.506 1.00 116.15 ? 354 ILE A CB    1 
ATOM   2720 C  CG1   . ILE A 1 357 ? -54.789 22.320 -23.321 1.00 116.12 ? 354 ILE A CG1   1 
ATOM   2721 C  CG2   . ILE A 1 357 ? -56.594 24.012 -23.767 1.00 111.51 ? 354 ILE A CG2   1 
ATOM   2722 C  CD1   . ILE A 1 357 ? -54.055 22.165 -24.615 1.00 114.88 ? 354 ILE A CD1   1 
ATOM   2723 N  N     . LEU A 1 358 ? -57.770 19.821 -22.884 1.00 130.25 ? 355 LEU A N     1 
ATOM   2724 C  CA    . LEU A 1 358 ? -57.629 18.398 -23.157 1.00 136.90 ? 355 LEU A CA    1 
ATOM   2725 C  C     . LEU A 1 358 ? -56.897 18.246 -24.491 1.00 137.20 ? 355 LEU A C     1 
ATOM   2726 O  O     . LEU A 1 358 ? -57.480 18.466 -25.559 1.00 136.08 ? 355 LEU A O     1 
ATOM   2727 C  CB    . LEU A 1 358 ? -59.004 17.747 -23.227 1.00 140.24 ? 355 LEU A CB    1 
ATOM   2728 C  CG    . LEU A 1 358 ? -59.039 16.295 -23.681 1.00 145.99 ? 355 LEU A CG    1 
ATOM   2729 C  CD1   . LEU A 1 358 ? -58.351 15.442 -22.648 1.00 150.60 ? 355 LEU A CD1   1 
ATOM   2730 C  CD2   . LEU A 1 358 ? -60.481 15.868 -23.863 1.00 149.51 ? 355 LEU A CD2   1 
ATOM   2731 N  N     . ASP A 1 359 ? -55.622 17.865 -24.418 1.00 139.72 ? 356 ASP A N     1 
ATOM   2732 C  CA    . ASP A 1 359 ? -54.701 17.944 -25.566 1.00 139.43 ? 356 ASP A CA    1 
ATOM   2733 C  C     . ASP A 1 359 ? -54.602 16.653 -26.385 1.00 144.85 ? 356 ASP A C     1 
ATOM   2734 O  O     . ASP A 1 359 ? -55.609 15.964 -26.620 1.00 148.45 ? 356 ASP A O     1 
ATOM   2735 C  CB    . ASP A 1 359 ? -53.297 18.345 -25.078 1.00 138.34 ? 356 ASP A CB    1 
ATOM   2736 C  CG    . ASP A 1 359 ? -52.614 17.247 -24.217 1.00 145.55 ? 356 ASP A CG    1 
ATOM   2737 O  OD1   . ASP A 1 359 ? -51.373 17.340 -24.065 1.00 147.22 ? 356 ASP A OD1   1 
ATOM   2738 O  OD2   . ASP A 1 359 ? -53.288 16.301 -23.705 1.00 150.92 ? 356 ASP A OD2   1 
ATOM   2739 N  N     . HIS A 1 360 ? -53.361 16.351 -26.787 1.00 146.06 ? 357 HIS A N     1 
ATOM   2740 C  CA    . HIS A 1 360 ? -52.955 15.135 -27.514 1.00 151.44 ? 357 HIS A CA    1 
ATOM   2741 C  C     . HIS A 1 360 ? -52.342 14.006 -26.606 1.00 157.56 ? 357 HIS A C     1 
ATOM   2742 O  O     . HIS A 1 360 ? -51.134 13.993 -26.356 1.00 158.17 ? 357 HIS A O     1 
ATOM   2743 C  CB    . HIS A 1 360 ? -51.963 15.545 -28.617 1.00 148.76 ? 357 HIS A CB    1 
ATOM   2744 C  CG    . HIS A 1 360 ? -50.875 16.456 -28.127 1.00 145.82 ? 357 HIS A CG    1 
ATOM   2745 N  ND1   . HIS A 1 360 ? -49.545 16.087 -28.109 1.00 148.38 ? 357 HIS A ND1   1 
ATOM   2746 C  CD2   . HIS A 1 360 ? -50.927 17.706 -27.596 1.00 141.31 ? 357 HIS A CD2   1 
ATOM   2747 C  CE1   . HIS A 1 360 ? -48.822 17.075 -27.606 1.00 145.11 ? 357 HIS A CE1   1 
ATOM   2748 N  NE2   . HIS A 1 360 ? -49.636 18.067 -27.284 1.00 141.38 ? 357 HIS A NE2   1 
ATOM   2749 N  N     . LEU A 1 361 ? -53.142 13.057 -26.110 1.00 162.40 ? 358 LEU A N     1 
ATOM   2750 C  CA    . LEU A 1 361 ? -54.592 12.985 -26.280 1.00 162.49 ? 358 LEU A CA    1 
ATOM   2751 C  C     . LEU A 1 361 ? -55.098 11.806 -25.446 1.00 169.67 ? 358 LEU A C     1 
ATOM   2752 O  O     . LEU A 1 361 ? -54.966 10.639 -25.841 1.00 176.27 ? 358 LEU A O     1 
ATOM   2753 C  CB    . LEU A 1 361 ? -54.993 12.814 -27.756 1.00 162.42 ? 358 LEU A CB    1 
ATOM   2754 C  CG    . LEU A 1 361 ? -56.385 13.316 -28.172 1.00 159.84 ? 358 LEU A CG    1 
ATOM   2755 C  CD1   . LEU A 1 361 ? -56.318 14.118 -29.488 1.00 154.20 ? 358 LEU A CD1   1 
ATOM   2756 C  CD2   . LEU A 1 361 ? -57.406 12.167 -28.249 1.00 166.38 ? 358 LEU A CD2   1 
ATOM   2757 N  N     . GLY A 1 362 ? -55.658 12.105 -24.277 1.00 168.72 ? 359 GLY A N     1 
ATOM   2758 C  CA    . GLY A 1 362 ? -55.770 13.478 -23.805 1.00 160.97 ? 359 GLY A CA    1 
ATOM   2759 C  C     . GLY A 1 362 ? -55.395 13.609 -22.342 1.00 161.08 ? 359 GLY A C     1 
ATOM   2760 O  O     . GLY A 1 362 ? -55.828 12.811 -21.489 1.00 166.13 ? 359 GLY A O     1 
ATOM   2761 N  N     . ASN A 1 363 ? -54.576 14.622 -22.065 1.00 155.31 ? 360 ASN A N     1 
ATOM   2762 C  CA    . ASN A 1 363 ? -54.199 14.973 -20.703 1.00 154.13 ? 360 ASN A CA    1 
ATOM   2763 C  C     . ASN A 1 363 ? -54.540 16.434 -20.470 1.00 146.60 ? 360 ASN A C     1 
ATOM   2764 O  O     . ASN A 1 363 ? -54.454 17.252 -21.388 1.00 141.39 ? 360 ASN A O     1 
ATOM   2765 C  CB    . ASN A 1 363 ? -52.705 14.742 -20.465 1.00 155.95 ? 360 ASN A CB    1 
ATOM   2766 C  CG    . ASN A 1 363 ? -52.125 13.684 -21.381 1.00 160.42 ? 360 ASN A CG    1 
ATOM   2767 O  OD1   . ASN A 1 363 ? -51.927 13.926 -22.584 1.00 157.55 ? 360 ASN A OD1   1 
ATOM   2768 N  ND2   . ASN A 1 363 ? -51.849 12.502 -20.821 1.00 167.05 ? 360 ASN A ND2   1 
ATOM   2769 N  N     . ASN A 1 364 ? -54.946 16.749 -19.244 1.00 145.74 ? 361 ASN A N     1 
ATOM   2770 C  CA    . ASN A 1 364 ? -55.226 18.122 -18.878 1.00 139.32 ? 361 ASN A CA    1 
ATOM   2771 C  C     . ASN A 1 364 ? -53.926 18.901 -18.873 1.00 135.41 ? 361 ASN A C     1 
ATOM   2772 O  O     . ASN A 1 364 ? -52.965 18.509 -18.212 1.00 138.27 ? 361 ASN A O     1 
ATOM   2773 C  CB    . ASN A 1 364 ? -55.881 18.190 -17.501 1.00 141.13 ? 361 ASN A CB    1 
ATOM   2774 C  CG    . ASN A 1 364 ? -57.104 17.301 -17.390 1.00 145.70 ? 361 ASN A CG    1 
ATOM   2775 O  OD1   . ASN A 1 364 ? -57.417 16.535 -18.299 1.00 148.39 ? 361 ASN A OD1   1 
ATOM   2776 N  ND2   . ASN A 1 364 ? -57.802 17.397 -16.265 1.00 147.73 ? 361 ASN A ND2   1 
ATOM   2777 N  N     . ARG A 1 365 ? -53.890 19.988 -19.633 1.00 128.99 ? 362 ARG A N     1 
ATOM   2778 C  CA    . ARG A 1 365 ? -52.730 20.847 -19.667 1.00 124.70 ? 362 ARG A CA    1 
ATOM   2779 C  C     . ARG A 1 365 ? -53.158 22.219 -19.261 1.00 119.67 ? 362 ARG A C     1 
ATOM   2780 O  O     . ARG A 1 365 ? -54.196 22.694 -19.706 1.00 117.03 ? 362 ARG A O     1 
ATOM   2781 C  CB    . ARG A 1 365 ? -52.181 20.908 -21.078 1.00 123.02 ? 362 ARG A CB    1 
ATOM   2782 C  CG    . ARG A 1 365 ? -51.512 19.628 -21.534 1.00 127.93 ? 362 ARG A CG    1 
ATOM   2783 C  CD    . ARG A 1 365 ? -50.008 19.702 -21.382 1.00 128.24 ? 362 ARG A CD    1 
ATOM   2784 N  NE    . ARG A 1 365 ? -49.404 20.669 -22.299 1.00 121.93 ? 362 ARG A NE    1 
ATOM   2785 C  CZ    . ARG A 1 365 ? -48.122 21.006 -22.270 1.00 121.34 ? 362 ARG A CZ    1 
ATOM   2786 N  NH1   . ARG A 1 365 ? -47.310 20.455 -21.375 1.00 124.72 ? 362 ARG A NH1   1 
ATOM   2787 N  NH2   . ARG A 1 365 ? -47.648 21.886 -23.135 1.00 118.34 ? 362 ARG A NH2   1 
ATOM   2788 N  N     . THR A 1 366 ? -52.368 22.848 -18.401 1.00 118.50 ? 363 THR A N     1 
ATOM   2789 C  CA    . THR A 1 366 ? -52.557 24.259 -18.096 1.00 114.33 ? 363 THR A CA    1 
ATOM   2790 C  C     . THR A 1 366 ? -51.615 25.069 -18.972 1.00 111.04 ? 363 THR A C     1 
ATOM   2791 O  O     . THR A 1 366 ? -50.412 24.818 -19.003 1.00 112.27 ? 363 THR A O     1 
ATOM   2792 C  CB    . THR A 1 366 ? -52.309 24.575 -16.629 1.00 115.54 ? 363 THR A CB    1 
ATOM   2793 O  OG1   . THR A 1 366 ? -53.108 23.706 -15.821 1.00 119.85 ? 363 THR A OG1   1 
ATOM   2794 C  CG2   . THR A 1 366 ? -52.709 26.005 -16.333 1.00 111.85 ? 363 THR A CG2   1 
ATOM   2795 N  N     . VAL A 1 367 ? -52.179 26.042 -19.678 1.00 107.19 ? 364 VAL A N     1 
ATOM   2796 C  CA    . VAL A 1 367 ? -51.505 26.709 -20.774 1.00 104.19 ? 364 VAL A CA    1 
ATOM   2797 C  C     . VAL A 1 367 ? -51.845 28.191 -20.793 1.00 100.97 ? 364 VAL A C     1 
ATOM   2798 O  O     . VAL A 1 367 ? -52.898 28.601 -20.322 1.00 100.54 ? 364 VAL A O     1 
ATOM   2799 C  CB    . VAL A 1 367 ? -51.930 26.075 -22.105 1.00 103.86 ? 364 VAL A CB    1 
ATOM   2800 C  CG1   . VAL A 1 367 ? -51.521 26.936 -23.253 1.00 101.06 ? 364 VAL A CG1   1 
ATOM   2801 C  CG2   . VAL A 1 367 ? -51.320 24.692 -22.258 1.00 107.53 ? 364 VAL A CG2   1 
ATOM   2802 N  N     . SER A 1 368 ? -50.944 28.994 -21.339 1.00 99.41  ? 365 SER A N     1 
ATOM   2803 C  CA    . SER A 1 368 ? -51.190 30.414 -21.490 1.00 97.15  ? 365 SER A CA    1 
ATOM   2804 C  C     . SER A 1 368 ? -51.705 30.663 -22.879 1.00 95.33  ? 365 SER A C     1 
ATOM   2805 O  O     . SER A 1 368 ? -51.246 30.038 -23.831 1.00 95.44  ? 365 SER A O     1 
ATOM   2806 C  CB    . SER A 1 368 ? -49.899 31.196 -21.300 1.00 96.83  ? 365 SER A CB    1 
ATOM   2807 O  OG    . SER A 1 368 ? -50.183 32.549 -21.013 1.00 96.11  ? 365 SER A OG    1 
ATOM   2808 N  N     . ILE A 1 369 ? -52.641 31.594 -23.007 1.00 94.28  ? 366 ILE A N     1 
ATOM   2809 C  CA    . ILE A 1 369 ? -53.187 31.925 -24.315 1.00 93.36  ? 366 ILE A CA    1 
ATOM   2810 C  C     . ILE A 1 369 ? -52.084 32.226 -25.340 1.00 92.35  ? 366 ILE A C     1 
ATOM   2811 O  O     . ILE A 1 369 ? -52.233 31.936 -26.528 1.00 91.81  ? 366 ILE A O     1 
ATOM   2812 C  CB    . ILE A 1 369 ? -54.062 33.171 -24.281 1.00 92.47  ? 366 ILE A CB    1 
ATOM   2813 C  CG1   . ILE A 1 369 ? -54.961 33.223 -23.068 1.00 94.13  ? 366 ILE A CG1   1 
ATOM   2814 C  CG2   . ILE A 1 369 ? -54.975 33.185 -25.470 1.00 92.44  ? 366 ILE A CG2   1 
ATOM   2815 C  CD1   . ILE A 1 369 ? -55.745 34.518 -23.060 1.00 94.66  ? 366 ILE A CD1   1 
ATOM   2816 N  N     . ASP A 1 370 ? -50.989 32.826 -24.885 1.00 92.48  ? 367 ASP A N     1 
ATOM   2817 C  CA    . ASP A 1 370 ? -49.892 33.181 -25.782 1.00 92.08  ? 367 ASP A CA    1 
ATOM   2818 C  C     . ASP A 1 370 ? -49.326 31.973 -26.543 1.00 92.49  ? 367 ASP A C     1 
ATOM   2819 O  O     . ASP A 1 370 ? -48.659 32.120 -27.572 1.00 91.87  ? 367 ASP A O     1 
ATOM   2820 C  CB    . ASP A 1 370 ? -48.795 33.936 -25.021 1.00 93.27  ? 367 ASP A CB    1 
ATOM   2821 C  CG    . ASP A 1 370 ? -49.218 35.358 -24.637 1.00 94.40  ? 367 ASP A CG    1 
ATOM   2822 O  OD1   . ASP A 1 370 ? -50.372 35.739 -24.952 1.00 96.09  ? 367 ASP A OD1   1 
ATOM   2823 O  OD2   . ASP A 1 370 ? -48.407 36.097 -24.019 1.00 96.54  ? 367 ASP A OD2   1 
ATOM   2824 N  N     . ASN A 1 371 ? -49.617 30.779 -26.047 1.00 93.70  ? 368 ASN A N     1 
ATOM   2825 C  CA    . ASN A 1 371 ? -49.223 29.582 -26.742 1.00 94.65  ? 368 ASN A CA    1 
ATOM   2826 C  C     . ASN A 1 371 ? -50.394 28.936 -27.451 1.00 94.44  ? 368 ASN A C     1 
ATOM   2827 O  O     . ASN A 1 371 ? -50.332 27.771 -27.827 1.00 96.51  ? 368 ASN A O     1 
ATOM   2828 C  CB    . ASN A 1 371 ? -48.556 28.621 -25.774 1.00 97.63  ? 368 ASN A CB    1 
ATOM   2829 C  CG    . ASN A 1 371 ? -47.190 29.098 -25.348 1.00 98.37  ? 368 ASN A CG    1 
ATOM   2830 O  OD1   . ASN A 1 371 ? -46.550 29.881 -26.043 1.00 96.99  ? 368 ASN A OD1   1 
ATOM   2831 N  ND2   . ASN A 1 371 ? -46.734 28.628 -24.197 1.00 102.35 ? 368 ASN A ND2   1 
ATOM   2832 N  N     . LEU A 1 372 ? -51.457 29.704 -27.653 1.00 92.46  ? 369 LEU A N     1 
ATOM   2833 C  CA    . LEU A 1 372 ? -52.665 29.178 -28.290 1.00 92.79  ? 369 LEU A CA    1 
ATOM   2834 C  C     . LEU A 1 372 ? -53.119 29.998 -29.474 1.00 90.80  ? 369 LEU A C     1 
ATOM   2835 O  O     . LEU A 1 372 ? -52.937 31.219 -29.501 1.00 89.19  ? 369 LEU A O     1 
ATOM   2836 C  CB    . LEU A 1 372 ? -53.828 29.090 -27.293 1.00 93.50  ? 369 LEU A CB    1 
ATOM   2837 C  CG    . LEU A 1 372 ? -53.679 28.100 -26.142 1.00 95.78  ? 369 LEU A CG    1 
ATOM   2838 C  CD1   . LEU A 1 372 ? -54.895 28.158 -25.234 1.00 96.59  ? 369 LEU A CD1   1 
ATOM   2839 C  CD2   . LEU A 1 372 ? -53.430 26.678 -26.653 1.00 97.33  ? 369 LEU A CD2   1 
ATOM   2840 N  N     . LYS A 1 373 ? -53.716 29.314 -30.445 1.00 91.40  ? 370 LYS A N     1 
ATOM   2841 C  CA    . LYS A 1 373 ? -54.484 29.979 -31.486 1.00 90.08  ? 370 LYS A CA    1 
ATOM   2842 C  C     . LYS A 1 373 ? -55.856 29.361 -31.531 1.00 91.85  ? 370 LYS A C     1 
ATOM   2843 O  O     . LYS A 1 373 ? -55.991 28.165 -31.301 1.00 94.33  ? 370 LYS A O     1 
ATOM   2844 C  CB    . LYS A 1 373 ? -53.812 29.875 -32.857 1.00 89.64  ? 370 LYS A CB    1 
ATOM   2845 C  CG    . LYS A 1 373 ? -53.780 28.494 -33.484 1.00 90.55  ? 370 LYS A CG    1 
ATOM   2846 C  CD    . LYS A 1 373 ? -53.925 28.625 -34.975 1.00 89.13  ? 370 LYS A CD    1 
ATOM   2847 C  CE    . LYS A 1 373 ? -53.201 27.516 -35.705 1.00 89.85  ? 370 LYS A CE    1 
ATOM   2848 N  NZ    . LYS A 1 373 ? -53.525 27.531 -37.158 1.00 89.06  ? 370 LYS A NZ    1 
ATOM   2849 N  N     . PRO A 1 374 ? -56.886 30.172 -31.801 1.00 91.35  ? 371 PRO A N     1 
ATOM   2850 C  CA    . PRO A 1 374 ? -58.217 29.610 -31.949 1.00 93.73  ? 371 PRO A CA    1 
ATOM   2851 C  C     . PRO A 1 374 ? -58.293 28.897 -33.279 1.00 95.37  ? 371 PRO A C     1 
ATOM   2852 O  O     . PRO A 1 374 ? -57.869 29.457 -34.295 1.00 94.49  ? 371 PRO A O     1 
ATOM   2853 C  CB    . PRO A 1 374 ? -59.121 30.844 -31.987 1.00 92.85  ? 371 PRO A CB    1 
ATOM   2854 C  CG    . PRO A 1 374 ? -58.278 31.977 -31.566 1.00 90.58  ? 371 PRO A CG    1 
ATOM   2855 C  CD    . PRO A 1 374 ? -56.889 31.633 -31.928 1.00 89.32  ? 371 PRO A CD    1 
ATOM   2856 N  N     . THR A 1 375 ? -58.800 27.670 -33.301 1.00 98.48  ? 372 THR A N     1 
ATOM   2857 C  CA    . THR A 1 375 ? -58.986 27.027 -34.590 1.00 100.48 ? 372 THR A CA    1 
ATOM   2858 C  C     . THR A 1 375 ? -59.967 27.887 -35.367 1.00 100.28 ? 372 THR A C     1 
ATOM   2859 O  O     . THR A 1 375 ? -61.021 28.275 -34.861 1.00 101.12 ? 372 THR A O     1 
ATOM   2860 C  CB    . THR A 1 375 ? -59.473 25.584 -34.473 1.00 104.48 ? 372 THR A CB    1 
ATOM   2861 O  OG1   . THR A 1 375 ? -58.422 24.786 -33.912 1.00 105.67 ? 372 THR A OG1   1 
ATOM   2862 C  CG2   . THR A 1 375 ? -59.838 25.019 -35.849 1.00 106.73 ? 372 THR A CG2   1 
ATOM   2863 N  N     . SER A 1 376 ? -59.570 28.227 -36.582 1.00 99.59  ? 373 SER A N     1 
ATOM   2864 C  CA    . SER A 1 376 ? -60.362 29.077 -37.445 1.00 99.79  ? 373 SER A CA    1 
ATOM   2865 C  C     . SER A 1 376 ? -61.308 28.193 -38.247 1.00 103.13 ? 373 SER A C     1 
ATOM   2866 O  O     . SER A 1 376 ? -60.897 27.128 -38.701 1.00 104.85 ? 373 SER A O     1 
ATOM   2867 C  CB    . SER A 1 376 ? -59.416 29.827 -38.371 1.00 97.56  ? 373 SER A CB    1 
ATOM   2868 O  OG    . SER A 1 376 ? -58.482 28.912 -38.934 1.00 98.35  ? 373 SER A OG    1 
ATOM   2869 N  N     . HIS A 1 377 ? -62.558 28.643 -38.423 1.00 104.84 ? 374 HIS A N     1 
ATOM   2870 C  CA    . HIS A 1 377 ? -63.655 27.851 -39.052 1.00 108.87 ? 374 HIS A CA    1 
ATOM   2871 C  C     . HIS A 1 377 ? -64.272 26.787 -38.096 1.00 111.46 ? 374 HIS A C     1 
ATOM   2872 O  O     . HIS A 1 377 ? -64.907 27.098 -37.067 1.00 111.19 ? 374 HIS A O     1 
ATOM   2873 C  CB    . HIS A 1 377 ? -63.292 27.169 -40.421 1.00 110.44 ? 374 HIS A CB    1 
ATOM   2874 C  CG    . HIS A 1 377 ? -62.296 27.936 -41.320 1.00 109.08 ? 374 HIS A CG    1 
ATOM   2875 N  ND1   . HIS A 1 377 ? -62.529 29.216 -41.848 1.00 109.54 ? 374 HIS A ND1   1 
ATOM   2876 C  CD2   . HIS A 1 377 ? -61.097 27.555 -41.850 1.00 108.03 ? 374 HIS A CD2   1 
ATOM   2877 C  CE1   . HIS A 1 377 ? -61.505 29.585 -42.479 1.00 107.50 ? 374 HIS A CE1   1 
ATOM   2878 N  NE2   . HIS A 1 377 ? -60.623 28.597 -42.557 1.00 106.22 ? 374 HIS A NE2   1 
ATOM   2879 N  N     . ASP B 1 119 ? -31.493 61.748 23.153  1.00 144.81 ? 116 ASP B N     1 
ATOM   2880 C  CA    . ASP B 1 119 ? -30.744 61.518 21.881  1.00 141.86 ? 116 ASP B CA    1 
ATOM   2881 C  C     . ASP B 1 119 ? -31.677 60.984 20.775  1.00 139.10 ? 116 ASP B C     1 
ATOM   2882 O  O     . ASP B 1 119 ? -32.903 61.151 20.860  1.00 140.25 ? 116 ASP B O     1 
ATOM   2883 C  CB    . ASP B 1 119 ? -29.568 60.561 22.134  1.00 140.48 ? 116 ASP B CB    1 
ATOM   2884 C  CG    . ASP B 1 119 ? -28.326 60.918 21.310  1.00 140.55 ? 116 ASP B CG    1 
ATOM   2885 O  OD1   . ASP B 1 119 ? -28.459 61.183 20.080  1.00 140.25 ? 116 ASP B OD1   1 
ATOM   2886 O  OD2   . ASP B 1 119 ? -27.212 60.924 21.901  1.00 142.14 ? 116 ASP B OD2   1 
ATOM   2887 N  N     . ARG B 1 120 ? -31.091 60.368 19.739  1.00 135.53 ? 117 ARG B N     1 
ATOM   2888 C  CA    . ARG B 1 120 ? -31.841 59.730 18.645  1.00 132.41 ? 117 ARG B CA    1 
ATOM   2889 C  C     . ARG B 1 120 ? -32.116 58.265 19.010  1.00 130.22 ? 117 ARG B C     1 
ATOM   2890 O  O     . ARG B 1 120 ? -31.181 57.540 19.363  1.00 129.41 ? 117 ARG B O     1 
ATOM   2891 C  CB    . ARG B 1 120 ? -31.065 59.825 17.322  1.00 130.20 ? 117 ARG B CB    1 
ATOM   2892 N  N     . PRO B 1 121 ? -33.396 57.829 18.939  1.00 129.40 ? 118 PRO B N     1 
ATOM   2893 C  CA    . PRO B 1 121 ? -33.811 56.477 19.344  1.00 127.78 ? 118 PRO B CA    1 
ATOM   2894 C  C     . PRO B 1 121 ? -33.145 55.382 18.515  1.00 124.24 ? 118 PRO B C     1 
ATOM   2895 O  O     . PRO B 1 121 ? -32.865 55.583 17.331  1.00 122.88 ? 118 PRO B O     1 
ATOM   2896 C  CB    . PRO B 1 121 ? -35.320 56.479 19.086  1.00 128.46 ? 118 PRO B CB    1 
ATOM   2897 C  CG    . PRO B 1 121 ? -35.517 57.517 18.050  1.00 128.84 ? 118 PRO B CG    1 
ATOM   2898 C  CD    . PRO B 1 121 ? -34.524 58.591 18.377  1.00 130.36 ? 118 PRO B CD    1 
ATOM   2899 N  N     . GLN B 1 122 ? -32.921 54.228 19.134  1.00 122.67 ? 119 GLN B N     1 
ATOM   2900 C  CA    . GLN B 1 122 ? -32.110 53.164 18.548  1.00 119.61 ? 119 GLN B CA    1 
ATOM   2901 C  C     . GLN B 1 122 ? -32.796 52.387 17.426  1.00 116.73 ? 119 GLN B C     1 
ATOM   2902 O  O     . GLN B 1 122 ? -34.003 52.171 17.467  1.00 117.33 ? 119 GLN B O     1 
ATOM   2903 C  CB    . GLN B 1 122 ? -31.691 52.204 19.643  1.00 120.37 ? 119 GLN B CB    1 
ATOM   2904 C  CG    . GLN B 1 122 ? -30.320 51.602 19.426  1.00 121.29 ? 119 GLN B CG    1 
ATOM   2905 C  CD    . GLN B 1 122 ? -29.908 50.696 20.570  1.00 124.87 ? 119 GLN B CD    1 
ATOM   2906 O  OE1   . GLN B 1 122 ? -30.496 50.747 21.664  1.00 127.89 ? 119 GLN B OE1   1 
ATOM   2907 N  NE2   . GLN B 1 122 ? -28.892 49.856 20.328  1.00 123.97 ? 119 GLN B NE2   1 
ATOM   2908 N  N     . LYS B 1 123 ? -32.003 51.944 16.448  1.00 113.55 ? 120 LYS B N     1 
ATOM   2909 C  CA    . LYS B 1 123 ? -32.512 51.369 15.194  1.00 110.83 ? 120 LYS B CA    1 
ATOM   2910 C  C     . LYS B 1 123 ? -31.729 50.127 14.678  1.00 108.04 ? 120 LYS B C     1 
ATOM   2911 O  O     . LYS B 1 123 ? -30.576 49.896 15.067  1.00 107.73 ? 120 LYS B O     1 
ATOM   2912 C  CB    . LYS B 1 123 ? -32.522 52.462 14.121  1.00 110.77 ? 120 LYS B CB    1 
ATOM   2913 C  CG    . LYS B 1 123 ? -33.314 53.708 14.484  1.00 113.43 ? 120 LYS B CG    1 
ATOM   2914 C  CD    . LYS B 1 123 ? -34.734 53.630 13.964  1.00 115.16 ? 120 LYS B CD    1 
ATOM   2915 C  CE    . LYS B 1 123 ? -35.467 54.949 14.122  1.00 118.39 ? 120 LYS B CE    1 
ATOM   2916 N  NZ    . LYS B 1 123 ? -34.719 56.158 13.654  1.00 119.87 ? 120 LYS B NZ    1 
ATOM   2917 N  N     . PRO B 1 124 ? -32.353 49.318 13.796  1.00 106.00 ? 121 PRO B N     1 
ATOM   2918 C  CA    . PRO B 1 124 ? -31.664 48.175 13.215  1.00 103.76 ? 121 PRO B CA    1 
ATOM   2919 C  C     . PRO B 1 124 ? -30.509 48.617 12.339  1.00 102.11 ? 121 PRO B C     1 
ATOM   2920 O  O     . PRO B 1 124 ? -30.633 49.581 11.595  1.00 102.20 ? 121 PRO B O     1 
ATOM   2921 C  CB    . PRO B 1 124 ? -32.734 47.534 12.332  1.00 103.23 ? 121 PRO B CB    1 
ATOM   2922 C  CG    . PRO B 1 124 ? -33.993 47.991 12.866  1.00 104.91 ? 121 PRO B CG    1 
ATOM   2923 C  CD    . PRO B 1 124 ? -33.745 49.378 13.329  1.00 106.50 ? 121 PRO B CD    1 
ATOM   2924 N  N     . PHE B 1 125 ? -29.394 47.904 12.424  1.00 100.61 ? 122 PHE B N     1 
ATOM   2925 C  CA    . PHE B 1 125 ? -28.202 48.215 11.642  1.00 98.81  ? 122 PHE B CA    1 
ATOM   2926 C  C     . PHE B 1 125 ? -27.336 49.256 12.331  1.00 99.29  ? 122 PHE B C     1 
ATOM   2927 O  O     . PHE B 1 125 ? -26.272 49.609 11.820  1.00 98.99  ? 122 PHE B O     1 
ATOM   2928 C  CB    . PHE B 1 125 ? -28.567 48.649 10.217  1.00 98.05  ? 122 PHE B CB    1 
ATOM   2929 C  CG    . PHE B 1 125 ? -29.441 47.664 9.496   1.00 96.93  ? 122 PHE B CG    1 
ATOM   2930 C  CD1   . PHE B 1 125 ? -30.499 48.095 8.725   1.00 96.11  ? 122 PHE B CD1   1 
ATOM   2931 C  CD2   . PHE B 1 125 ? -29.213 46.297 9.606   1.00 96.75  ? 122 PHE B CD2   1 
ATOM   2932 C  CE1   . PHE B 1 125 ? -31.317 47.189 8.058   1.00 95.59  ? 122 PHE B CE1   1 
ATOM   2933 C  CE2   . PHE B 1 125 ? -30.021 45.383 8.944   1.00 96.19  ? 122 PHE B CE2   1 
ATOM   2934 C  CZ    . PHE B 1 125 ? -31.080 45.832 8.167   1.00 95.54  ? 122 PHE B CZ    1 
ATOM   2935 N  N     . ASP B 1 126 ? -27.783 49.723 13.497  1.00 99.90  ? 123 ASP B N     1 
ATOM   2936 C  CA    . ASP B 1 126 ? -27.031 50.694 14.274  1.00 100.59 ? 123 ASP B CA    1 
ATOM   2937 C  C     . ASP B 1 126 ? -25.748 50.104 14.832  1.00 99.86  ? 123 ASP B C     1 
ATOM   2938 O  O     . ASP B 1 126 ? -24.729 50.786 14.946  1.00 100.31 ? 123 ASP B O     1 
ATOM   2939 C  CB    . ASP B 1 126 ? -27.884 51.236 15.413  1.00 102.51 ? 123 ASP B CB    1 
ATOM   2940 C  CG    . ASP B 1 126 ? -28.704 52.436 15.000  1.00 104.30 ? 123 ASP B CG    1 
ATOM   2941 O  OD1   . ASP B 1 126 ? -28.705 52.769 13.787  1.00 104.31 ? 123 ASP B OD1   1 
ATOM   2942 O  OD2   . ASP B 1 126 ? -29.342 53.047 15.891  1.00 106.71 ? 123 ASP B OD2   1 
ATOM   2943 N  N     . LYS B 1 127 ? -25.814 48.828 15.182  1.00 98.72  ? 124 LYS B N     1 
ATOM   2944 C  CA    . LYS B 1 127 ? -24.713 48.152 15.834  1.00 98.14  ? 124 LYS B CA    1 
ATOM   2945 C  C     . LYS B 1 127 ? -24.908 46.639 15.729  1.00 97.05  ? 124 LYS B C     1 
ATOM   2946 O  O     . LYS B 1 127 ? -26.003 46.109 15.964  1.00 97.17  ? 124 LYS B O     1 
ATOM   2947 C  CB    . LYS B 1 127 ? -24.618 48.599 17.296  1.00 99.89  ? 124 LYS B CB    1 
ATOM   2948 C  CG    . LYS B 1 127 ? -23.431 48.045 18.063  1.00 100.29 ? 124 LYS B CG    1 
ATOM   2949 C  CD    . LYS B 1 127 ? -23.397 48.573 19.482  1.00 102.17 ? 124 LYS B CD    1 
ATOM   2950 C  CE    . LYS B 1 127 ? -22.667 49.905 19.572  1.00 103.59 ? 124 LYS B CE    1 
ATOM   2951 N  NZ    . LYS B 1 127 ? -22.717 50.464 20.958  1.00 106.86 ? 124 LYS B NZ    1 
ATOM   2952 N  N     . PHE B 1 128 ? -23.833 45.961 15.351  1.00 95.90  ? 125 PHE B N     1 
ATOM   2953 C  CA    . PHE B 1 128 ? -23.809 44.516 15.212  1.00 95.13  ? 125 PHE B CA    1 
ATOM   2954 C  C     . PHE B 1 128 ? -22.825 43.980 16.223  1.00 95.78  ? 125 PHE B C     1 
ATOM   2955 O  O     . PHE B 1 128 ? -21.662 44.404 16.228  1.00 96.17  ? 125 PHE B O     1 
ATOM   2956 C  CB    . PHE B 1 128 ? -23.310 44.146 13.816  1.00 93.89  ? 125 PHE B CB    1 
ATOM   2957 C  CG    . PHE B 1 128 ? -24.397 44.014 12.781  1.00 93.30  ? 125 PHE B CG    1 
ATOM   2958 C  CD1   . PHE B 1 128 ? -25.699 44.474 13.025  1.00 94.18  ? 125 PHE B CD1   1 
ATOM   2959 C  CD2   . PHE B 1 128 ? -24.111 43.447 11.549  1.00 91.68  ? 125 PHE B CD2   1 
ATOM   2960 C  CE1   . PHE B 1 128 ? -26.698 44.347 12.060  1.00 93.38  ? 125 PHE B CE1   1 
ATOM   2961 C  CE2   . PHE B 1 128 ? -25.094 43.323 10.583  1.00 91.66  ? 125 PHE B CE2   1 
ATOM   2962 C  CZ    . PHE B 1 128 ? -26.392 43.770 10.837  1.00 92.33  ? 125 PHE B CZ    1 
ATOM   2963 N  N     . PHE B 1 129 ? -23.272 43.063 17.079  1.00 96.03  ? 126 PHE B N     1 
ATOM   2964 C  CA    . PHE B 1 129 ? -22.367 42.406 18.024  1.00 96.35  ? 126 PHE B CA    1 
ATOM   2965 C  C     . PHE B 1 129 ? -21.890 41.087 17.444  1.00 95.58  ? 126 PHE B C     1 
ATOM   2966 O  O     . PHE B 1 129 ? -22.703 40.265 17.016  1.00 95.22  ? 126 PHE B O     1 
ATOM   2967 C  CB    . PHE B 1 129 ? -23.048 42.190 19.373  1.00 97.73  ? 126 PHE B CB    1 
ATOM   2968 C  CG    . PHE B 1 129 ? -23.378 43.465 20.094  1.00 98.83  ? 126 PHE B CG    1 
ATOM   2969 C  CD1   . PHE B 1 129 ? -22.437 44.085 20.900  1.00 100.19 ? 126 PHE B CD1   1 
ATOM   2970 C  CD2   . PHE B 1 129 ? -24.632 44.046 19.972  1.00 98.94  ? 126 PHE B CD2   1 
ATOM   2971 C  CE1   . PHE B 1 129 ? -22.742 45.266 21.572  1.00 101.25 ? 126 PHE B CE1   1 
ATOM   2972 C  CE2   . PHE B 1 129 ? -24.942 45.227 20.640  1.00 99.73  ? 126 PHE B CE2   1 
ATOM   2973 C  CZ    . PHE B 1 129 ? -23.999 45.833 21.438  1.00 100.87 ? 126 PHE B CZ    1 
ATOM   2974 N  N     . ILE B 1 130 ? -20.573 40.893 17.403  1.00 95.55  ? 127 ILE B N     1 
ATOM   2975 C  CA    . ILE B 1 130 ? -20.012 39.644 16.873  1.00 95.36  ? 127 ILE B CA    1 
ATOM   2976 C  C     . ILE B 1 130 ? -19.091 38.903 17.831  1.00 96.87  ? 127 ILE B C     1 
ATOM   2977 O  O     . ILE B 1 130 ? -18.356 39.506 18.628  1.00 97.85  ? 127 ILE B O     1 
ATOM   2978 C  CB    . ILE B 1 130 ? -19.286 39.843 15.534  1.00 94.09  ? 127 ILE B CB    1 
ATOM   2979 C  CG1   . ILE B 1 130 ? -18.113 40.804 15.689  1.00 93.99  ? 127 ILE B CG1   1 
ATOM   2980 C  CG2   . ILE B 1 130 ? -20.253 40.348 14.475  1.00 93.46  ? 127 ILE B CG2   1 
ATOM   2981 C  CD1   . ILE B 1 130 ? -17.084 40.655 14.610  1.00 93.35  ? 127 ILE B CD1   1 
ATOM   2982 N  N     . ASP B 1 131 ? -19.140 37.582 17.753  1.00 97.56  ? 128 ASP B N     1 
ATOM   2983 C  CA    . ASP B 1 131 ? -18.275 36.756 18.570  1.00 99.44  ? 128 ASP B CA    1 
ATOM   2984 C  C     . ASP B 1 131 ? -18.172 35.374 17.977  1.00 99.71  ? 128 ASP B C     1 
ATOM   2985 O  O     . ASP B 1 131 ? -19.012 34.971 17.167  1.00 99.05  ? 128 ASP B O     1 
ATOM   2986 C  CB    . ASP B 1 131 ? -18.796 36.669 20.008  1.00 101.23 ? 128 ASP B CB    1 
ATOM   2987 C  CG    . ASP B 1 131 ? -17.695 36.346 21.010  1.00 103.66 ? 128 ASP B CG    1 
ATOM   2988 O  OD1   . ASP B 1 131 ? -16.599 36.947 20.903  1.00 105.02 ? 128 ASP B OD1   1 
ATOM   2989 O  OD2   . ASP B 1 131 ? -17.925 35.497 21.904  1.00 105.33 ? 128 ASP B OD2   1 
ATOM   2990 N  N     . TYR B 1 132 ? -17.128 34.659 18.380  1.00 101.12 ? 129 TYR B N     1 
ATOM   2991 C  CA    . TYR B 1 132 ? -16.931 33.283 17.963  1.00 102.22 ? 129 TYR B CA    1 
ATOM   2992 C  C     . TYR B 1 132 ? -17.304 32.320 19.068  1.00 104.21 ? 129 TYR B C     1 
ATOM   2993 O  O     . TYR B 1 132 ? -16.894 32.504 20.219  1.00 105.43 ? 129 TYR B O     1 
ATOM   2994 C  CB    . TYR B 1 132 ? -15.479 33.045 17.563  1.00 102.37 ? 129 TYR B CB    1 
ATOM   2995 C  CG    . TYR B 1 132 ? -15.204 33.317 16.114  1.00 101.70 ? 129 TYR B CG    1 
ATOM   2996 C  CD1   . TYR B 1 132 ? -14.466 34.425 15.721  1.00 101.60 ? 129 TYR B CD1   1 
ATOM   2997 C  CD2   . TYR B 1 132 ? -15.687 32.468 15.132  1.00 102.79 ? 129 TYR B CD2   1 
ATOM   2998 C  CE1   . TYR B 1 132 ? -14.216 34.678 14.385  1.00 101.56 ? 129 TYR B CE1   1 
ATOM   2999 C  CE2   . TYR B 1 132 ? -15.443 32.712 13.793  1.00 102.71 ? 129 TYR B CE2   1 
ATOM   3000 C  CZ    . TYR B 1 132 ? -14.710 33.816 13.427  1.00 102.00 ? 129 TYR B CZ    1 
ATOM   3001 O  OH    . TYR B 1 132 ? -14.480 34.052 12.093  1.00 103.14 ? 129 TYR B OH    1 
ATOM   3002 N  N     . ILE B 1 133 ? -18.097 31.314 18.702  1.00 104.97 ? 130 ILE B N     1 
ATOM   3003 C  CA    . ILE B 1 133 ? -18.298 30.120 19.515  1.00 107.33 ? 130 ILE B CA    1 
ATOM   3004 C  C     . ILE B 1 133 ? -17.475 28.995 18.895  1.00 108.62 ? 130 ILE B C     1 
ATOM   3005 O  O     . ILE B 1 133 ? -17.529 28.781 17.684  1.00 107.86 ? 130 ILE B O     1 
ATOM   3006 C  CB    . ILE B 1 133 ? -19.778 29.696 19.561  1.00 107.60 ? 130 ILE B CB    1 
ATOM   3007 C  CG1   . ILE B 1 133 ? -20.594 30.692 20.375  1.00 106.79 ? 130 ILE B CG1   1 
ATOM   3008 C  CG2   . ILE B 1 133 ? -19.923 28.300 20.159  1.00 109.51 ? 130 ILE B CG2   1 
ATOM   3009 C  CD1   . ILE B 1 133 ? -22.073 30.533 20.174  1.00 106.04 ? 130 ILE B CD1   1 
ATOM   3010 N  N     . GLY B 1 134 ? -16.714 28.287 19.723  1.00 111.12 ? 131 GLY B N     1 
ATOM   3011 C  CA    . GLY B 1 134 ? -15.884 27.190 19.253  1.00 113.18 ? 131 GLY B CA    1 
ATOM   3012 C  C     . GLY B 1 134 ? -14.647 26.997 20.104  1.00 115.51 ? 131 GLY B C     1 
ATOM   3013 O  O     . GLY B 1 134 ? -14.341 27.840 20.952  1.00 115.39 ? 131 GLY B O     1 
ATOM   3014 N  N     . PRO B 1 135 ? -13.913 25.893 19.873  1.00 117.75 ? 132 PRO B N     1 
ATOM   3015 C  CA    . PRO B 1 135 ? -14.160 24.900 18.825  1.00 118.78 ? 132 PRO B CA    1 
ATOM   3016 C  C     . PRO B 1 135 ? -15.296 23.950 19.173  1.00 121.00 ? 132 PRO B C     1 
ATOM   3017 O  O     . PRO B 1 135 ? -15.568 23.714 20.350  1.00 122.44 ? 132 PRO B O     1 
ATOM   3018 C  CB    . PRO B 1 135 ? -12.839 24.111 18.760  1.00 120.12 ? 132 PRO B CB    1 
ATOM   3019 C  CG    . PRO B 1 135 ? -11.881 24.830 19.669  1.00 120.10 ? 132 PRO B CG    1 
ATOM   3020 C  CD    . PRO B 1 135 ? -12.729 25.540 20.668  1.00 119.52 ? 132 PRO B CD    1 
ATOM   3021 N  N     . LEU B 1 136 ? -15.951 23.423 18.141  1.00 121.84 ? 133 LEU B N     1 
ATOM   3022 C  CA    . LEU B 1 136 ? -16.990 22.406 18.295  1.00 124.46 ? 133 LEU B CA    1 
ATOM   3023 C  C     . LEU B 1 136 ? -16.544 21.113 17.617  1.00 127.36 ? 133 LEU B C     1 
ATOM   3024 O  O     . LEU B 1 136 ? -15.617 21.139 16.801  1.00 127.06 ? 133 LEU B O     1 
ATOM   3025 C  CB    . LEU B 1 136 ? -18.295 22.876 17.662  1.00 122.73 ? 133 LEU B CB    1 
ATOM   3026 C  CG    . LEU B 1 136 ? -18.678 24.343 17.803  1.00 119.81 ? 133 LEU B CG    1 
ATOM   3027 C  CD1   . LEU B 1 136 ? -20.002 24.577 17.122  1.00 118.14 ? 133 LEU B CD1   1 
ATOM   3028 C  CD2   . LEU B 1 136 ? -18.752 24.749 19.255  1.00 120.10 ? 133 LEU B CD2   1 
ATOM   3029 N  N     . PRO B 1 137 ? -17.179 19.971 17.966  1.00 130.71 ? 134 PRO B N     1 
ATOM   3030 C  CA    . PRO B 1 137 ? -16.994 18.746 17.192  1.00 133.30 ? 134 PRO B CA    1 
ATOM   3031 C  C     . PRO B 1 137 ? -17.188 19.021 15.703  1.00 132.72 ? 134 PRO B C     1 
ATOM   3032 O  O     . PRO B 1 137 ? -18.146 19.704 15.340  1.00 131.38 ? 134 PRO B O     1 
ATOM   3033 C  CB    . PRO B 1 137 ? -18.116 17.851 17.702  1.00 135.44 ? 134 PRO B CB    1 
ATOM   3034 C  CG    . PRO B 1 137 ? -18.293 18.260 19.116  1.00 135.57 ? 134 PRO B CG    1 
ATOM   3035 C  CD    . PRO B 1 137 ? -17.896 19.709 19.227  1.00 132.33 ? 134 PRO B CD    1 
ATOM   3036 N  N     . PRO B 1 138 ? -16.276 18.516 14.847  1.00 134.06 ? 135 PRO B N     1 
ATOM   3037 C  CA    . PRO B 1 138 ? -16.327 18.795 13.410  1.00 133.44 ? 135 PRO B CA    1 
ATOM   3038 C  C     . PRO B 1 138 ? -17.625 18.343 12.755  1.00 134.66 ? 135 PRO B C     1 
ATOM   3039 O  O     . PRO B 1 138 ? -18.057 17.206 12.947  1.00 137.21 ? 135 PRO B O     1 
ATOM   3040 C  CB    . PRO B 1 138 ? -15.152 17.988 12.848  1.00 135.01 ? 135 PRO B CB    1 
ATOM   3041 C  CG    . PRO B 1 138 ? -14.236 17.808 13.988  1.00 135.86 ? 135 PRO B CG    1 
ATOM   3042 C  CD    . PRO B 1 138 ? -15.103 17.699 15.203  1.00 136.10 ? 135 PRO B CD    1 
ATOM   3043 N  N     . SER B 1 139 ? -18.248 19.254 12.013  1.00 133.35 ? 136 SER B N     1 
ATOM   3044 C  CA    . SER B 1 139 ? -19.368 18.924 11.138  1.00 134.56 ? 136 SER B CA    1 
ATOM   3045 C  C     . SER B 1 139 ? -19.084 19.495 9.766   1.00 133.77 ? 136 SER B C     1 
ATOM   3046 O  O     . SER B 1 139 ? -18.830 20.695 9.628   1.00 131.55 ? 136 SER B O     1 
ATOM   3047 C  CB    . SER B 1 139 ? -20.683 19.496 11.658  1.00 133.58 ? 136 SER B CB    1 
ATOM   3048 O  OG    . SER B 1 139 ? -21.757 19.096 10.825  1.00 134.16 ? 136 SER B OG    1 
ATOM   3049 N  N     . GLN B 1 140 ? -19.128 18.627 8.757   1.00 136.10 ? 137 GLN B N     1 
ATOM   3050 C  CA    . GLN B 1 140 ? -18.812 18.995 7.375   1.00 136.02 ? 137 GLN B CA    1 
ATOM   3051 C  C     . GLN B 1 140 ? -17.451 19.692 7.299   1.00 134.44 ? 137 GLN B C     1 
ATOM   3052 O  O     . GLN B 1 140 ? -17.223 20.533 6.432   1.00 133.12 ? 137 GLN B O     1 
ATOM   3053 C  CB    . GLN B 1 140 ? -19.899 19.900 6.770   1.00 134.61 ? 137 GLN B CB    1 
ATOM   3054 C  CG    . GLN B 1 140 ? -21.336 19.539 7.136   1.00 137.59 ? 137 GLN B CG    1 
ATOM   3055 C  CD    . GLN B 1 140 ? -21.947 18.480 6.242   1.00 142.63 ? 137 GLN B CD    1 
ATOM   3056 O  OE1   . GLN B 1 140 ? -21.634 18.393 5.055   1.00 144.37 ? 137 GLN B OE1   1 
ATOM   3057 N  NE2   . GLN B 1 140 ? -22.841 17.676 6.808   1.00 145.60 ? 137 GLN B NE2   1 
ATOM   3058 N  N     . GLY B 1 141 ? -16.554 19.343 8.219   1.00 134.81 ? 138 GLY B N     1 
ATOM   3059 C  CA    . GLY B 1 141 ? -15.238 19.971 8.286   1.00 133.31 ? 138 GLY B CA    1 
ATOM   3060 C  C     . GLY B 1 141 ? -15.231 21.413 8.783   1.00 130.14 ? 138 GLY B C     1 
ATOM   3061 O  O     . GLY B 1 141 ? -14.266 22.150 8.538   1.00 129.28 ? 138 GLY B O     1 
ATOM   3062 N  N     . TYR B 1 142 ? -16.299 21.819 9.475   1.00 128.42 ? 139 TYR B N     1 
ATOM   3063 C  CA    . TYR B 1 142 ? -16.360 23.133 10.124  1.00 125.39 ? 139 TYR B CA    1 
ATOM   3064 C  C     . TYR B 1 142 ? -16.167 22.984 11.621  1.00 124.89 ? 139 TYR B C     1 
ATOM   3065 O  O     . TYR B 1 142 ? -16.390 21.904 12.171  1.00 126.82 ? 139 TYR B O     1 
ATOM   3066 C  CB    . TYR B 1 142 ? -17.674 23.844 9.811   1.00 124.36 ? 139 TYR B CB    1 
ATOM   3067 C  CG    . TYR B 1 142 ? -17.749 24.321 8.381   1.00 124.87 ? 139 TYR B CG    1 
ATOM   3068 C  CD1   . TYR B 1 142 ? -17.638 25.674 8.070   1.00 123.69 ? 139 TYR B CD1   1 
ATOM   3069 C  CD2   . TYR B 1 142 ? -17.914 23.413 7.330   1.00 127.75 ? 139 TYR B CD2   1 
ATOM   3070 C  CE1   . TYR B 1 142 ? -17.701 26.113 6.747   1.00 123.94 ? 139 TYR B CE1   1 
ATOM   3071 C  CE2   . TYR B 1 142 ? -17.969 23.842 6.005   1.00 127.90 ? 139 TYR B CE2   1 
ATOM   3072 C  CZ    . TYR B 1 142 ? -17.862 25.191 5.723   1.00 125.76 ? 139 TYR B CZ    1 
ATOM   3073 O  OH    . TYR B 1 142 ? -17.918 25.615 4.420   1.00 126.05 ? 139 TYR B OH    1 
ATOM   3074 N  N     . LEU B 1 143 ? -15.748 24.065 12.276  1.00 122.10 ? 140 LEU B N     1 
ATOM   3075 C  CA    . LEU B 1 143 ? -15.321 23.983 13.680  1.00 121.40 ? 140 LEU B CA    1 
ATOM   3076 C  C     . LEU B 1 143 ? -15.815 25.111 14.584  1.00 118.84 ? 140 LEU B C     1 
ATOM   3077 O  O     . LEU B 1 143 ? -15.906 24.937 15.806  1.00 119.74 ? 140 LEU B O     1 
ATOM   3078 C  CB    . LEU B 1 143 ? -13.789 23.869 13.772  1.00 122.11 ? 140 LEU B CB    1 
ATOM   3079 C  CG    . LEU B 1 143 ? -13.108 22.578 13.303  1.00 123.83 ? 140 LEU B CG    1 
ATOM   3080 C  CD1   . LEU B 1 143 ? -11.617 22.819 13.086  1.00 124.12 ? 140 LEU B CD1   1 
ATOM   3081 C  CD2   . LEU B 1 143 ? -13.339 21.441 14.296  1.00 125.78 ? 140 LEU B CD2   1 
ATOM   3082 N  N     . TYR B 1 144 ? -16.125 26.256 13.984  1.00 115.24 ? 141 TYR B N     1 
ATOM   3083 C  CA    . TYR B 1 144 ? -16.487 27.449 14.739  1.00 112.59 ? 141 TYR B CA    1 
ATOM   3084 C  C     . TYR B 1 144 ? -17.770 28.077 14.209  1.00 110.20 ? 141 TYR B C     1 
ATOM   3085 O  O     . TYR B 1 144 ? -18.115 27.911 13.045  1.00 109.80 ? 141 TYR B O     1 
ATOM   3086 C  CB    . TYR B 1 144 ? -15.338 28.465 14.698  1.00 111.75 ? 141 TYR B CB    1 
ATOM   3087 C  CG    . TYR B 1 144 ? -14.098 28.037 15.458  1.00 113.39 ? 141 TYR B CG    1 
ATOM   3088 C  CD1   . TYR B 1 144 ? -13.900 28.441 16.776  1.00 114.56 ? 141 TYR B CD1   1 
ATOM   3089 C  CD2   . TYR B 1 144 ? -13.120 27.232 14.860  1.00 114.87 ? 141 TYR B CD2   1 
ATOM   3090 C  CE1   . TYR B 1 144 ? -12.767 28.055 17.492  1.00 116.82 ? 141 TYR B CE1   1 
ATOM   3091 C  CE2   . TYR B 1 144 ? -11.977 26.833 15.565  1.00 116.87 ? 141 TYR B CE2   1 
ATOM   3092 C  CZ    . TYR B 1 144 ? -11.810 27.253 16.885  1.00 118.01 ? 141 TYR B CZ    1 
ATOM   3093 O  OH    . TYR B 1 144 ? -10.699 26.885 17.612  1.00 119.60 ? 141 TYR B OH    1 
ATOM   3094 N  N     . VAL B 1 145 ? -18.486 28.786 15.069  1.00 108.34 ? 142 VAL B N     1 
ATOM   3095 C  CA    . VAL B 1 145 ? -19.648 29.538 14.623  1.00 105.86 ? 142 VAL B CA    1 
ATOM   3096 C  C     . VAL B 1 145 ? -19.428 31.002 14.946  1.00 103.75 ? 142 VAL B C     1 
ATOM   3097 O  O     . VAL B 1 145 ? -19.190 31.364 16.096  1.00 104.28 ? 142 VAL B O     1 
ATOM   3098 C  CB    . VAL B 1 145 ? -20.961 29.046 15.277  1.00 106.90 ? 142 VAL B CB    1 
ATOM   3099 C  CG1   . VAL B 1 145 ? -22.155 29.856 14.774  1.00 105.48 ? 142 VAL B CG1   1 
ATOM   3100 C  CG2   . VAL B 1 145 ? -21.181 27.575 14.991  1.00 108.31 ? 142 VAL B CG2   1 
ATOM   3101 N  N     . LEU B 1 146 ? -19.483 31.836 13.918  1.00 101.20 ? 143 LEU B N     1 
ATOM   3102 C  CA    . LEU B 1 146 ? -19.442 33.272 14.103  1.00 99.17  ? 143 LEU B CA    1 
ATOM   3103 C  C     . LEU B 1 146 ? -20.861 33.763 14.331  1.00 98.44  ? 143 LEU B C     1 
ATOM   3104 O  O     . LEU B 1 146 ? -21.747 33.523 13.519  1.00 98.22  ? 143 LEU B O     1 
ATOM   3105 C  CB    . LEU B 1 146 ? -18.821 33.950 12.882  1.00 97.96  ? 143 LEU B CB    1 
ATOM   3106 C  CG    . LEU B 1 146 ? -18.929 35.471 12.766  1.00 96.49  ? 143 LEU B CG    1 
ATOM   3107 C  CD1   . LEU B 1 146 ? -18.267 36.169 13.932  1.00 96.80  ? 143 LEU B CD1   1 
ATOM   3108 C  CD2   . LEU B 1 146 ? -18.312 35.935 11.478  1.00 95.12  ? 143 LEU B CD2   1 
ATOM   3109 N  N     . VAL B 1 147 ? -21.063 34.455 15.441  1.00 98.10  ? 144 VAL B N     1 
ATOM   3110 C  CA    . VAL B 1 147 ? -22.396 34.862 15.866  1.00 97.85  ? 144 VAL B CA    1 
ATOM   3111 C  C     . VAL B 1 147 ? -22.563 36.362 15.712  1.00 96.75  ? 144 VAL B C     1 
ATOM   3112 O  O     . VAL B 1 147 ? -21.811 37.146 16.303  1.00 96.97  ? 144 VAL B O     1 
ATOM   3113 C  CB    . VAL B 1 147 ? -22.643 34.480 17.342  1.00 99.39  ? 144 VAL B CB    1 
ATOM   3114 C  CG1   . VAL B 1 147 ? -23.932 35.083 17.859  1.00 99.52  ? 144 VAL B CG1   1 
ATOM   3115 C  CG2   . VAL B 1 147 ? -22.665 32.982 17.498  1.00 100.84 ? 144 VAL B CG2   1 
ATOM   3116 N  N     . VAL B 1 148 ? -23.553 36.757 14.919  1.00 95.65  ? 145 VAL B N     1 
ATOM   3117 C  CA    . VAL B 1 148 ? -23.857 38.165 14.725  1.00 94.39  ? 145 VAL B CA    1 
ATOM   3118 C  C     . VAL B 1 148 ? -25.274 38.449 15.164  1.00 94.98  ? 145 VAL B C     1 
ATOM   3119 O  O     . VAL B 1 148 ? -26.229 37.947 14.570  1.00 94.88  ? 145 VAL B O     1 
ATOM   3120 C  CB    . VAL B 1 148 ? -23.696 38.594 13.270  1.00 93.03  ? 145 VAL B CB    1 
ATOM   3121 C  CG1   . VAL B 1 148 ? -23.926 40.087 13.148  1.00 92.36  ? 145 VAL B CG1   1 
ATOM   3122 C  CG2   . VAL B 1 148 ? -22.318 38.225 12.767  1.00 92.16  ? 145 VAL B CG2   1 
ATOM   3123 N  N     . VAL B 1 149 ? -25.393 39.257 16.214  1.00 95.81  ? 146 VAL B N     1 
ATOM   3124 C  CA    . VAL B 1 149 ? -26.686 39.729 16.700  1.00 96.73  ? 146 VAL B CA    1 
ATOM   3125 C  C     . VAL B 1 149 ? -26.844 41.229 16.455  1.00 97.07  ? 146 VAL B C     1 
ATOM   3126 O  O     . VAL B 1 149 ? -25.927 42.019 16.725  1.00 97.14  ? 146 VAL B O     1 
ATOM   3127 C  CB    . VAL B 1 149 ? -26.849 39.490 18.192  1.00 97.95  ? 146 VAL B CB    1 
ATOM   3128 C  CG1   . VAL B 1 149 ? -28.278 39.782 18.600  1.00 98.33  ? 146 VAL B CG1   1 
ATOM   3129 C  CG2   . VAL B 1 149 ? -26.454 38.076 18.547  1.00 98.24  ? 146 VAL B CG2   1 
ATOM   3130 N  N     . ASP B 1 150 ? -28.004 41.627 15.941  1.00 97.70  ? 147 ASP B N     1 
ATOM   3131 C  CA    . ASP B 1 150 ? -28.277 43.048 15.778  1.00 98.40  ? 147 ASP B CA    1 
ATOM   3132 C  C     . ASP B 1 150 ? -28.717 43.706 17.101  1.00 100.23 ? 147 ASP B C     1 
ATOM   3133 O  O     . ASP B 1 150 ? -29.693 43.293 17.753  1.00 101.09 ? 147 ASP B O     1 
ATOM   3134 C  CB    . ASP B 1 150 ? -29.280 43.317 14.658  1.00 98.01  ? 147 ASP B CB    1 
ATOM   3135 C  CG    . ASP B 1 150 ? -29.769 44.755 14.660  1.00 99.52  ? 147 ASP B CG    1 
ATOM   3136 O  OD1   . ASP B 1 150 ? -28.926 45.682 14.551  1.00 100.09 ? 147 ASP B OD1   1 
ATOM   3137 O  OD2   . ASP B 1 150 ? -30.995 44.956 14.803  1.00 101.07 ? 147 ASP B OD2   1 
ATOM   3138 N  N     . GLY B 1 151 ? -27.977 44.752 17.460  1.00 100.85 ? 148 GLY B N     1 
ATOM   3139 C  CA    . GLY B 1 151 ? -28.116 45.450 18.738  1.00 102.74 ? 148 GLY B CA    1 
ATOM   3140 C  C     . GLY B 1 151 ? -29.512 45.832 19.165  1.00 103.97 ? 148 GLY B C     1 
ATOM   3141 O  O     . GLY B 1 151 ? -29.866 45.659 20.323  1.00 105.90 ? 148 GLY B O     1 
ATOM   3142 N  N     . MET B 1 152 ? -30.300 46.347 18.230  1.00 103.48 ? 149 MET B N     1 
ATOM   3143 C  CA    . MET B 1 152 ? -31.635 46.855 18.543  1.00 104.82 ? 149 MET B CA    1 
ATOM   3144 C  C     . MET B 1 152 ? -32.722 45.775 18.462  1.00 104.86 ? 149 MET B C     1 
ATOM   3145 O  O     . MET B 1 152 ? -33.508 45.633 19.386  1.00 106.49 ? 149 MET B O     1 
ATOM   3146 C  CB    . MET B 1 152 ? -31.964 48.072 17.663  1.00 104.60 ? 149 MET B CB    1 
ATOM   3147 C  CG    . MET B 1 152 ? -33.244 48.792 18.029  1.00 106.38 ? 149 MET B CG    1 
ATOM   3148 S  SD    . MET B 1 152 ? -34.613 48.187 17.027  1.00 107.67 ? 149 MET B SD    1 
ATOM   3149 C  CE    . MET B 1 152 ? -35.917 47.949 18.267  1.00 110.69 ? 149 MET B CE    1 
ATOM   3150 N  N     . THR B 1 153 ? -32.747 45.012 17.374  1.00 103.41 ? 150 THR B N     1 
ATOM   3151 C  CA    . THR B 1 153 ? -33.776 43.994 17.162  1.00 103.65 ? 150 THR B CA    1 
ATOM   3152 C  C     . THR B 1 153 ? -33.481 42.669 17.860  1.00 104.35 ? 150 THR B C     1 
ATOM   3153 O  O     . THR B 1 153 ? -34.406 41.965 18.268  1.00 105.85 ? 150 THR B O     1 
ATOM   3154 C  CB    . THR B 1 153 ? -33.933 43.659 15.681  1.00 102.16 ? 150 THR B CB    1 
ATOM   3155 O  OG1   . THR B 1 153 ? -32.687 43.147 15.181  1.00 99.99  ? 150 THR B OG1   1 
ATOM   3156 C  CG2   . THR B 1 153 ? -34.356 44.886 14.895  1.00 101.95 ? 150 THR B CG2   1 
ATOM   3157 N  N     . GLY B 1 154 ? -32.207 42.304 17.969  1.00 103.44 ? 151 GLY B N     1 
ATOM   3158 C  CA    . GLY B 1 154 ? -31.853 40.981 18.494  1.00 103.72 ? 151 GLY B CA    1 
ATOM   3159 C  C     . GLY B 1 154 ? -31.856 39.905 17.419  1.00 102.60 ? 151 GLY B C     1 
ATOM   3160 O  O     . GLY B 1 154 ? -31.757 38.702 17.706  1.00 103.15 ? 151 GLY B O     1 
ATOM   3161 N  N     . PHE B 1 155 ? -31.969 40.338 16.168  1.00 101.09 ? 152 PHE B N     1 
ATOM   3162 C  CA    . PHE B 1 155 ? -31.896 39.415 15.063  1.00 99.81  ? 152 PHE B CA    1 
ATOM   3163 C  C     . PHE B 1 155 ? -30.501 38.810 14.969  1.00 99.05  ? 152 PHE B C     1 
ATOM   3164 O  O     . PHE B 1 155 ? -29.491 39.503 15.135  1.00 98.25  ? 152 PHE B O     1 
ATOM   3165 C  CB    . PHE B 1 155 ? -32.269 40.095 13.761  1.00 98.64  ? 152 PHE B CB    1 
ATOM   3166 C  CG    . PHE B 1 155 ? -32.721 39.142 12.715  1.00 98.02  ? 152 PHE B CG    1 
ATOM   3167 C  CD1   . PHE B 1 155 ? -34.055 38.745 12.656  1.00 98.51  ? 152 PHE B CD1   1 
ATOM   3168 C  CD2   . PHE B 1 155 ? -31.818 38.616 11.803  1.00 96.43  ? 152 PHE B CD2   1 
ATOM   3169 C  CE1   . PHE B 1 155 ? -34.491 37.849 11.689  1.00 98.10  ? 152 PHE B CE1   1 
ATOM   3170 C  CE2   . PHE B 1 155 ? -32.240 37.717 10.838  1.00 96.87  ? 152 PHE B CE2   1 
ATOM   3171 C  CZ    . PHE B 1 155 ? -33.591 37.330 10.782  1.00 97.54  ? 152 PHE B CZ    1 
ATOM   3172 N  N     . THR B 1 156 ? -30.464 37.511 14.693  1.00 99.28  ? 153 THR B N     1 
ATOM   3173 C  CA    . THR B 1 156 ? -29.230 36.748 14.735  1.00 98.80  ? 153 THR B CA    1 
ATOM   3174 C  C     . THR B 1 156 ? -28.852 36.096 13.414  1.00 97.85  ? 153 THR B C     1 
ATOM   3175 O  O     . THR B 1 156 ? -29.679 35.471 12.752  1.00 98.04  ? 153 THR B O     1 
ATOM   3176 C  CB    . THR B 1 156 ? -29.318 35.663 15.810  1.00 100.35 ? 153 THR B CB    1 
ATOM   3177 O  OG1   . THR B 1 156 ? -29.474 36.289 17.092  1.00 101.54 ? 153 THR B OG1   1 
ATOM   3178 C  CG2   . THR B 1 156 ? -28.056 34.793 15.809  1.00 100.26 ? 153 THR B CG2   1 
ATOM   3179 N  N     . TRP B 1 157 ? -27.585 36.245 13.053  1.00 96.89  ? 154 TRP B N     1 
ATOM   3180 C  CA    . TRP B 1 157 ? -27.000 35.448 11.998  1.00 96.56  ? 154 TRP B CA    1 
ATOM   3181 C  C     . TRP B 1 157 ? -25.962 34.496 12.576  1.00 97.06  ? 154 TRP B C     1 
ATOM   3182 O  O     . TRP B 1 157 ? -25.270 34.838 13.531  1.00 97.17  ? 154 TRP B O     1 
ATOM   3183 C  CB    . TRP B 1 157 ? -26.379 36.350 10.945  1.00 95.47  ? 154 TRP B CB    1 
ATOM   3184 C  CG    . TRP B 1 157 ? -27.395 37.175 10.206  1.00 95.54  ? 154 TRP B CG    1 
ATOM   3185 C  CD1   . TRP B 1 157 ? -28.029 36.846 9.034   1.00 95.85  ? 154 TRP B CD1   1 
ATOM   3186 C  CD2   . TRP B 1 157 ? -27.904 38.463 10.592  1.00 94.80  ? 154 TRP B CD2   1 
ATOM   3187 N  NE1   . TRP B 1 157 ? -28.897 37.856 8.666   1.00 95.35  ? 154 TRP B NE1   1 
ATOM   3188 C  CE2   . TRP B 1 157 ? -28.837 38.859 9.601   1.00 94.34  ? 154 TRP B CE2   1 
ATOM   3189 C  CE3   . TRP B 1 157 ? -27.659 39.322 11.674  1.00 94.08  ? 154 TRP B CE3   1 
ATOM   3190 C  CZ2   . TRP B 1 157 ? -29.519 40.078 9.658   1.00 92.87  ? 154 TRP B CZ2   1 
ATOM   3191 C  CZ3   . TRP B 1 157 ? -28.339 40.531 11.728  1.00 93.62  ? 154 TRP B CZ3   1 
ATOM   3192 C  CH2   . TRP B 1 157 ? -29.261 40.894 10.726  1.00 93.09  ? 154 TRP B CH2   1 
ATOM   3193 N  N     . LEU B 1 158 ? -25.886 33.297 12.001  1.00 97.75  ? 155 LEU B N     1 
ATOM   3194 C  CA    . LEU B 1 158 ? -24.908 32.279 12.381  1.00 98.76  ? 155 LEU B CA    1 
ATOM   3195 C  C     . LEU B 1 158 ? -24.103 31.830 11.170  1.00 98.71  ? 155 LEU B C     1 
ATOM   3196 O  O     . LEU B 1 158 ? -24.676 31.438 10.160  1.00 99.11  ? 155 LEU B O     1 
ATOM   3197 C  CB    . LEU B 1 158 ? -25.612 31.081 13.013  1.00 100.40 ? 155 LEU B CB    1 
ATOM   3198 C  CG    . LEU B 1 158 ? -26.390 31.360 14.309  1.00 101.97 ? 155 LEU B CG    1 
ATOM   3199 C  CD1   . LEU B 1 158 ? -26.929 30.078 14.958  1.00 103.59 ? 155 LEU B CD1   1 
ATOM   3200 C  CD2   . LEU B 1 158 ? -25.534 32.130 15.311  1.00 102.21 ? 155 LEU B CD2   1 
ATOM   3201 N  N     . TYR B 1 159 ? -22.779 31.908 11.258  1.00 98.88  ? 156 TYR B N     1 
ATOM   3202 C  CA    . TYR B 1 159 ? -21.922 31.510 10.148  1.00 99.46  ? 156 TYR B CA    1 
ATOM   3203 C  C     . TYR B 1 159 ? -20.897 30.490 10.598  1.00 101.11 ? 156 TYR B C     1 
ATOM   3204 O  O     . TYR B 1 159 ? -20.119 30.762 11.518  1.00 101.46 ? 156 TYR B O     1 
ATOM   3205 C  CB    . TYR B 1 159 ? -21.228 32.724 9.522   1.00 98.27  ? 156 TYR B CB    1 
ATOM   3206 C  CG    . TYR B 1 159 ? -22.200 33.667 8.862   1.00 97.84  ? 156 TYR B CG    1 
ATOM   3207 C  CD1   . TYR B 1 159 ? -22.566 33.512 7.525   1.00 97.67  ? 156 TYR B CD1   1 
ATOM   3208 C  CD2   . TYR B 1 159 ? -22.781 34.703 9.586   1.00 97.81  ? 156 TYR B CD2   1 
ATOM   3209 C  CE1   . TYR B 1 159 ? -23.488 34.372 6.932   1.00 97.27  ? 156 TYR B CE1   1 
ATOM   3210 C  CE2   . TYR B 1 159 ? -23.696 35.563 9.004   1.00 97.42  ? 156 TYR B CE2   1 
ATOM   3211 C  CZ    . TYR B 1 159 ? -24.046 35.394 7.685   1.00 97.39  ? 156 TYR B CZ    1 
ATOM   3212 O  OH    . TYR B 1 159 ? -24.959 36.264 7.147   1.00 97.90  ? 156 TYR B OH    1 
ATOM   3213 N  N     . PRO B 1 160 ? -20.887 29.309 9.954   1.00 102.52 ? 157 PRO B N     1 
ATOM   3214 C  CA    . PRO B 1 160 ? -19.923 28.280 10.315  1.00 104.05 ? 157 PRO B CA    1 
ATOM   3215 C  C     . PRO B 1 160 ? -18.568 28.599 9.706   1.00 103.96 ? 157 PRO B C     1 
ATOM   3216 O  O     . PRO B 1 160 ? -18.498 28.984 8.549   1.00 103.25 ? 157 PRO B O     1 
ATOM   3217 C  CB    . PRO B 1 160 ? -20.508 27.011 9.692   1.00 105.51 ? 157 PRO B CB    1 
ATOM   3218 C  CG    . PRO B 1 160 ? -21.596 27.462 8.751   1.00 104.70 ? 157 PRO B CG    1 
ATOM   3219 C  CD    . PRO B 1 160 ? -21.654 28.949 8.750   1.00 102.71 ? 157 PRO B CD    1 
ATOM   3220 N  N     . THR B 1 161 ? -17.504 28.478 10.489  1.00 105.17 ? 158 THR B N     1 
ATOM   3221 C  CA    . THR B 1 161 ? -16.156 28.728 9.979   1.00 106.00 ? 158 THR B CA    1 
ATOM   3222 C  C     . THR B 1 161 ? -15.201 27.597 10.366  1.00 108.46 ? 158 THR B C     1 
ATOM   3223 O  O     . THR B 1 161 ? -15.512 26.779 11.241  1.00 109.65 ? 158 THR B O     1 
ATOM   3224 C  CB    . THR B 1 161 ? -15.571 30.096 10.443  1.00 104.65 ? 158 THR B CB    1 
ATOM   3225 O  OG1   . THR B 1 161 ? -15.065 29.983 11.777  1.00 105.14 ? 158 THR B OG1   1 
ATOM   3226 C  CG2   . THR B 1 161 ? -16.607 31.208 10.386  1.00 103.03 ? 158 THR B CG2   1 
ATOM   3227 N  N     . LYS B 1 162 ? -14.042 27.562 9.708   1.00 109.70 ? 159 LYS B N     1 
ATOM   3228 C  CA    . LYS B 1 162 ? -13.039 26.523 9.954   1.00 112.41 ? 159 LYS B CA    1 
ATOM   3229 C  C     . LYS B 1 162 ? -11.951 26.967 10.938  1.00 112.43 ? 159 LYS B C     1 
ATOM   3230 O  O     . LYS B 1 162 ? -11.106 26.156 11.346  1.00 114.01 ? 159 LYS B O     1 
ATOM   3231 C  CB    . LYS B 1 162 ? -12.412 26.056 8.636   1.00 113.69 ? 159 LYS B CB    1 
ATOM   3232 C  CG    . LYS B 1 162 ? -13.407 25.438 7.656   1.00 116.56 ? 159 LYS B CG    1 
ATOM   3233 C  CD    . LYS B 1 162 ? -12.711 24.686 6.518   1.00 122.20 ? 159 LYS B CD    1 
ATOM   3234 C  CE    . LYS B 1 162 ? -13.693 24.371 5.384   1.00 124.99 ? 159 LYS B CE    1 
ATOM   3235 N  NZ    . LYS B 1 162 ? -13.325 23.125 4.646   1.00 129.06 ? 159 LYS B NZ    1 
ATOM   3236 N  N     . ALA B 1 163 ? -11.987 28.251 11.309  1.00 110.96 ? 160 ALA B N     1 
ATOM   3237 C  CA    . ALA B 1 163 ? -11.016 28.866 12.223  1.00 110.85 ? 160 ALA B CA    1 
ATOM   3238 C  C     . ALA B 1 163 ? -11.480 30.256 12.652  1.00 109.22 ? 160 ALA B C     1 
ATOM   3239 O  O     . ALA B 1 163 ? -12.086 30.971 11.856  1.00 107.82 ? 160 ALA B O     1 
ATOM   3240 C  CB    . ALA B 1 163 ? -9.641  28.959 11.561  1.00 111.49 ? 160 ALA B CB    1 
ATOM   3241 N  N     . PRO B 1 164 ? -11.180 30.651 13.908  1.00 109.57 ? 161 PRO B N     1 
ATOM   3242 C  CA    . PRO B 1 164 ? -11.540 31.983 14.386  1.00 108.50 ? 161 PRO B CA    1 
ATOM   3243 C  C     . PRO B 1 164 ? -10.532 33.019 13.885  1.00 108.05 ? 161 PRO B C     1 
ATOM   3244 O  O     . PRO B 1 164 ? -9.865  33.683 14.677  1.00 108.44 ? 161 PRO B O     1 
ATOM   3245 C  CB    . PRO B 1 164 ? -11.457 31.834 15.907  1.00 109.51 ? 161 PRO B CB    1 
ATOM   3246 C  CG    . PRO B 1 164 ? -10.405 30.810 16.127  1.00 110.86 ? 161 PRO B CG    1 
ATOM   3247 C  CD    . PRO B 1 164 ? -10.394 29.906 14.916  1.00 111.17 ? 161 PRO B CD    1 
ATOM   3248 N  N     . SER B 1 165 ? -10.429 33.143 12.570  1.00 107.46 ? 162 SER B N     1 
ATOM   3249 C  CA    . SER B 1 165 ? -9.413  33.969 11.952  1.00 107.55 ? 162 SER B CA    1 
ATOM   3250 C  C     . SER B 1 165 ? -10.048 35.141 11.254  1.00 106.34 ? 162 SER B C     1 
ATOM   3251 O  O     . SER B 1 165 ? -11.162 35.031 10.735  1.00 105.82 ? 162 SER B O     1 
ATOM   3252 C  CB    . SER B 1 165 ? -8.653  33.153 10.912  1.00 108.45 ? 162 SER B CB    1 
ATOM   3253 O  OG    . SER B 1 165 ? -9.530  32.733 9.877   1.00 107.99 ? 162 SER B OG    1 
ATOM   3254 N  N     . THR B 1 166 ? -9.323  36.253 11.220  1.00 106.17 ? 163 THR B N     1 
ATOM   3255 C  CA    . THR B 1 166 ? -9.702  37.413 10.422  1.00 105.14 ? 163 THR B CA    1 
ATOM   3256 C  C     . THR B 1 166 ? -10.245 36.983 9.066   1.00 104.59 ? 163 THR B C     1 
ATOM   3257 O  O     . THR B 1 166 ? -11.335 37.398 8.652   1.00 103.43 ? 163 THR B O     1 
ATOM   3258 C  CB    . THR B 1 166 ? -8.487  38.291 10.165  1.00 105.78 ? 163 THR B CB    1 
ATOM   3259 O  OG1   . THR B 1 166 ? -7.766  38.460 11.387  1.00 107.18 ? 163 THR B OG1   1 
ATOM   3260 C  CG2   . THR B 1 166 ? -8.904  39.646 9.603   1.00 104.69 ? 163 THR B CG2   1 
ATOM   3261 N  N     . SER B 1 167 ? -9.460  36.146 8.389   1.00 105.46 ? 164 SER B N     1 
ATOM   3262 C  CA    . SER B 1 167 ? -9.802  35.615 7.079   1.00 105.33 ? 164 SER B CA    1 
ATOM   3263 C  C     . SER B 1 167 ? -11.248 35.108 7.055   1.00 104.28 ? 164 SER B C     1 
ATOM   3264 O  O     . SER B 1 167 ? -12.091 35.668 6.355   1.00 103.84 ? 164 SER B O     1 
ATOM   3265 C  CB    . SER B 1 167 ? -8.815  34.512 6.692   1.00 106.76 ? 164 SER B CB    1 
ATOM   3266 O  OG    . SER B 1 167 ? -9.420  33.588 5.812   1.00 107.43 ? 164 SER B OG    1 
ATOM   3267 N  N     . ALA B 1 168 ? -11.536 34.077 7.848   1.00 104.04 ? 165 ALA B N     1 
ATOM   3268 C  CA    . ALA B 1 168 ? -12.871 33.477 7.886   1.00 102.91 ? 165 ALA B CA    1 
ATOM   3269 C  C     . ALA B 1 168 ? -13.954 34.459 8.333   1.00 101.06 ? 165 ALA B C     1 
ATOM   3270 O  O     . ALA B 1 168 ? -15.108 34.344 7.916   1.00 100.63 ? 165 ALA B O     1 
ATOM   3271 C  CB    . ALA B 1 168 ? -12.875 32.241 8.770   1.00 104.11 ? 165 ALA B CB    1 
ATOM   3272 N  N     . THR B 1 169 ? -13.581 35.415 9.181   1.00 99.76  ? 166 THR B N     1 
ATOM   3273 C  CA    . THR B 1 169 ? -14.499 36.463 9.605   1.00 97.87  ? 166 THR B CA    1 
ATOM   3274 C  C     . THR B 1 169 ? -14.920 37.304 8.404   1.00 97.03  ? 166 THR B C     1 
ATOM   3275 O  O     . THR B 1 169 ? -16.119 37.557 8.200   1.00 96.52  ? 166 THR B O     1 
ATOM   3276 C  CB    . THR B 1 169 ? -13.870 37.363 10.669  1.00 97.77  ? 166 THR B CB    1 
ATOM   3277 O  OG1   . THR B 1 169 ? -13.550 36.577 11.815  1.00 97.76  ? 166 THR B OG1   1 
ATOM   3278 C  CG2   . THR B 1 169 ? -14.826 38.456 11.082  1.00 96.79  ? 166 THR B CG2   1 
ATOM   3279 N  N     . VAL B 1 170 ? -13.932 37.714 7.605   1.00 96.69  ? 167 VAL B N     1 
ATOM   3280 C  CA    . VAL B 1 170 ? -14.186 38.555 6.434   1.00 95.69  ? 167 VAL B CA    1 
ATOM   3281 C  C     . VAL B 1 170 ? -15.097 37.852 5.434   1.00 95.14  ? 167 VAL B C     1 
ATOM   3282 O  O     . VAL B 1 170 ? -16.088 38.438 4.997   1.00 94.52  ? 167 VAL B O     1 
ATOM   3283 C  CB    . VAL B 1 170 ? -12.877 39.052 5.761   1.00 96.36  ? 167 VAL B CB    1 
ATOM   3284 C  CG1   . VAL B 1 170 ? -13.171 39.726 4.430   1.00 96.36  ? 167 VAL B CG1   1 
ATOM   3285 C  CG2   . VAL B 1 170 ? -12.152 40.018 6.668   1.00 96.36  ? 167 VAL B CG2   1 
ATOM   3286 N  N     . LYS B 1 171 ? -14.776 36.600 5.099   1.00 95.51  ? 168 LYS B N     1 
ATOM   3287 C  CA    . LYS B 1 171 ? -15.588 35.826 4.157   1.00 95.71  ? 168 LYS B CA    1 
ATOM   3288 C  C     . LYS B 1 171 ? -17.036 35.806 4.668   1.00 94.99  ? 168 LYS B C     1 
ATOM   3289 O  O     . LYS B 1 171 ? -17.987 36.115 3.931   1.00 94.93  ? 168 LYS B O     1 
ATOM   3290 C  CB    . LYS B 1 171 ? -15.029 34.406 3.948   1.00 96.53  ? 168 LYS B CB    1 
ATOM   3291 N  N     . SER B 1 172 ? -17.193 35.502 5.949   1.00 94.50  ? 169 SER B N     1 
ATOM   3292 C  CA    . SER B 1 172 ? -18.512 35.428 6.530   1.00 93.89  ? 169 SER B CA    1 
ATOM   3293 C  C     . SER B 1 172 ? -19.219 36.763 6.480   1.00 92.74  ? 169 SER B C     1 
ATOM   3294 O  O     . SER B 1 172 ? -20.341 36.839 5.992   1.00 92.93  ? 169 SER B O     1 
ATOM   3295 C  CB    . SER B 1 172 ? -18.445 34.897 7.951   1.00 94.35  ? 169 SER B CB    1 
ATOM   3296 O  OG    . SER B 1 172 ? -18.230 33.499 7.927   1.00 95.64  ? 169 SER B OG    1 
ATOM   3297 N  N     . LEU B 1 173 ? -18.563 37.818 6.950   1.00 91.89  ? 170 LEU B N     1 
ATOM   3298 C  CA    . LEU B 1 173 ? -19.207 39.127 6.986   1.00 90.95  ? 170 LEU B CA    1 
ATOM   3299 C  C     . LEU B 1 173 ? -19.483 39.733 5.598   1.00 90.92  ? 170 LEU B C     1 
ATOM   3300 O  O     . LEU B 1 173 ? -20.457 40.491 5.432   1.00 90.82  ? 170 LEU B O     1 
ATOM   3301 C  CB    . LEU B 1 173 ? -18.453 40.084 7.896   1.00 90.72  ? 170 LEU B CB    1 
ATOM   3302 C  CG    . LEU B 1 173 ? -18.567 39.692 9.364   1.00 90.26  ? 170 LEU B CG    1 
ATOM   3303 C  CD1   . LEU B 1 173 ? -17.913 40.720 10.258  1.00 90.45  ? 170 LEU B CD1   1 
ATOM   3304 C  CD2   . LEU B 1 173 ? -20.015 39.543 9.719   1.00 89.42  ? 170 LEU B CD2   1 
ATOM   3305 N  N     . ASN B 1 174 ? -18.660 39.379 4.609   1.00 90.96  ? 171 ASN B N     1 
ATOM   3306 C  CA    . ASN B 1 174 ? -18.982 39.689 3.224   1.00 91.13  ? 171 ASN B CA    1 
ATOM   3307 C  C     . ASN B 1 174 ? -20.371 39.199 2.841   1.00 90.98  ? 171 ASN B C     1 
ATOM   3308 O  O     . ASN B 1 174 ? -21.143 39.940 2.220   1.00 91.32  ? 171 ASN B O     1 
ATOM   3309 C  CB    . ASN B 1 174 ? -17.943 39.128 2.270   1.00 92.11  ? 171 ASN B CB    1 
ATOM   3310 C  CG    . ASN B 1 174 ? -16.669 39.928 2.283   1.00 93.43  ? 171 ASN B CG    1 
ATOM   3311 O  OD1   . ASN B 1 174 ? -16.666 41.106 2.655   1.00 94.68  ? 171 ASN B OD1   1 
ATOM   3312 N  ND2   . ASN B 1 174 ? -15.569 39.298 1.884   1.00 94.99  ? 171 ASN B ND2   1 
ATOM   3313 N  N     . VAL B 1 175 ? -20.703 37.967 3.224   1.00 90.58  ? 172 VAL B N     1 
ATOM   3314 C  CA    . VAL B 1 175 ? -22.056 37.486 3.017   1.00 89.96  ? 172 VAL B CA    1 
ATOM   3315 C  C     . VAL B 1 175 ? -23.050 38.426 3.690   1.00 89.36  ? 172 VAL B C     1 
ATOM   3316 O  O     . VAL B 1 175 ? -23.888 39.003 3.013   1.00 89.50  ? 172 VAL B O     1 
ATOM   3317 C  CB    . VAL B 1 175 ? -22.242 36.037 3.474   1.00 90.41  ? 172 VAL B CB    1 
ATOM   3318 C  CG1   . VAL B 1 175 ? -23.712 35.743 3.774   1.00 90.63  ? 172 VAL B CG1   1 
ATOM   3319 C  CG2   . VAL B 1 175 ? -21.737 35.100 2.415   1.00 90.85  ? 172 VAL B CG2   1 
ATOM   3320 N  N     . LEU B 1 176 ? -22.943 38.621 4.998   1.00 88.99  ? 173 LEU B N     1 
ATOM   3321 C  CA    . LEU B 1 176 ? -23.955 39.398 5.692   1.00 88.98  ? 173 LEU B CA    1 
ATOM   3322 C  C     . LEU B 1 176 ? -24.071 40.790 5.119   1.00 89.12  ? 173 LEU B C     1 
ATOM   3323 O  O     . LEU B 1 176 ? -25.191 41.310 4.983   1.00 89.34  ? 173 LEU B O     1 
ATOM   3324 C  CB    . LEU B 1 176 ? -23.692 39.474 7.195   1.00 89.07  ? 173 LEU B CB    1 
ATOM   3325 C  CG    . LEU B 1 176 ? -24.649 40.272 8.096   1.00 88.28  ? 173 LEU B CG    1 
ATOM   3326 C  CD1   . LEU B 1 176 ? -26.090 39.969 7.808   1.00 88.05  ? 173 LEU B CD1   1 
ATOM   3327 C  CD2   . LEU B 1 176 ? -24.359 39.936 9.535   1.00 88.93  ? 173 LEU B CD2   1 
ATOM   3328 N  N     . THR B 1 177 ? -22.931 41.385 4.762   1.00 89.18  ? 174 THR B N     1 
ATOM   3329 C  CA    . THR B 1 177 ? -22.948 42.763 4.264   1.00 89.68  ? 174 THR B CA    1 
ATOM   3330 C  C     . THR B 1 177 ? -23.408 42.920 2.803   1.00 90.60  ? 174 THR B C     1 
ATOM   3331 O  O     . THR B 1 177 ? -23.402 44.020 2.267   1.00 91.18  ? 174 THR B O     1 
ATOM   3332 C  CB    . THR B 1 177 ? -21.632 43.514 4.521   1.00 89.44  ? 174 THR B CB    1 
ATOM   3333 O  OG1   . THR B 1 177 ? -20.542 42.739 4.032   1.00 90.01  ? 174 THR B OG1   1 
ATOM   3334 C  CG2   . THR B 1 177 ? -21.437 43.761 6.003   1.00 88.92  ? 174 THR B CG2   1 
ATOM   3335 N  N     . SER B 1 178 ? -23.817 41.823 2.171   1.00 91.48  ? 175 SER B N     1 
ATOM   3336 C  CA    . SER B 1 178 ? -24.571 41.889 0.923   1.00 92.55  ? 175 SER B CA    1 
ATOM   3337 C  C     . SER B 1 178 ? -26.028 42.243 1.202   1.00 92.73  ? 175 SER B C     1 
ATOM   3338 O  O     . SER B 1 178 ? -26.766 42.677 0.306   1.00 93.37  ? 175 SER B O     1 
ATOM   3339 C  CB    . SER B 1 178 ? -24.540 40.538 0.224   1.00 93.31  ? 175 SER B CB    1 
ATOM   3340 O  OG    . SER B 1 178 ? -23.214 40.153 -0.040  1.00 94.84  ? 175 SER B OG    1 
ATOM   3341 N  N     . ILE B 1 179 ? -26.452 42.037 2.441   1.00 92.62  ? 176 ILE B N     1 
ATOM   3342 C  CA    . ILE B 1 179 ? -27.819 42.339 2.790   1.00 93.24  ? 176 ILE B CA    1 
ATOM   3343 C  C     . ILE B 1 179 ? -27.863 43.742 3.383   1.00 93.15  ? 176 ILE B C     1 
ATOM   3344 O  O     . ILE B 1 179 ? -28.576 44.621 2.862   1.00 93.72  ? 176 ILE B O     1 
ATOM   3345 C  CB    . ILE B 1 179 ? -28.454 41.239 3.703   1.00 93.67  ? 176 ILE B CB    1 
ATOM   3346 C  CG1   . ILE B 1 179 ? -28.772 39.973 2.891   1.00 94.52  ? 176 ILE B CG1   1 
ATOM   3347 C  CG2   . ILE B 1 179 ? -29.764 41.715 4.322   1.00 93.65  ? 176 ILE B CG2   1 
ATOM   3348 C  CD1   . ILE B 1 179 ? -27.567 39.144 2.454   1.00 94.89  ? 176 ILE B CD1   1 
ATOM   3349 N  N     . ALA B 1 180 ? -27.070 43.960 4.432   1.00 92.64  ? 177 ALA B N     1 
ATOM   3350 C  CA    . ALA B 1 180 ? -27.056 45.252 5.118   1.00 92.93  ? 177 ALA B CA    1 
ATOM   3351 C  C     . ALA B 1 180 ? -25.711 45.548 5.762   1.00 92.80  ? 177 ALA B C     1 
ATOM   3352 O  O     . ALA B 1 180 ? -24.949 44.643 6.074   1.00 92.69  ? 177 ALA B O     1 
ATOM   3353 C  CB    . ALA B 1 180 ? -28.160 45.313 6.152   1.00 93.24  ? 177 ALA B CB    1 
ATOM   3354 N  N     . ILE B 1 181 ? -25.418 46.825 5.958   1.00 93.02  ? 178 ILE B N     1 
ATOM   3355 C  CA    . ILE B 1 181 ? -24.154 47.202 6.551   1.00 93.07  ? 178 ILE B CA    1 
ATOM   3356 C  C     . ILE B 1 181 ? -24.456 47.954 7.827   1.00 93.84  ? 178 ILE B C     1 
ATOM   3357 O  O     . ILE B 1 181 ? -25.237 48.906 7.814   1.00 94.65  ? 178 ILE B O     1 
ATOM   3358 C  CB    . ILE B 1 181 ? -23.301 48.064 5.594   1.00 93.33  ? 178 ILE B CB    1 
ATOM   3359 C  CG1   . ILE B 1 181 ? -23.167 47.364 4.224   1.00 92.94  ? 178 ILE B CG1   1 
ATOM   3360 C  CG2   . ILE B 1 181 ? -21.946 48.372 6.237   1.00 93.64  ? 178 ILE B CG2   1 
ATOM   3361 C  CD1   . ILE B 1 181 ? -22.504 48.183 3.112   1.00 93.08  ? 178 ILE B CD1   1 
ATOM   3362 N  N     . PRO B 1 182 ? -23.876 47.504 8.949   1.00 93.98  ? 179 PRO B N     1 
ATOM   3363 C  CA    . PRO B 1 182 ? -24.059 48.218 10.211  1.00 94.76  ? 179 PRO B CA    1 
ATOM   3364 C  C     . PRO B 1 182 ? -23.189 49.455 10.236  1.00 95.47  ? 179 PRO B C     1 
ATOM   3365 O  O     . PRO B 1 182 ? -22.190 49.518 9.515   1.00 95.21  ? 179 PRO B O     1 
ATOM   3366 C  CB    . PRO B 1 182 ? -23.558 47.219 11.256  1.00 94.77  ? 179 PRO B CB    1 
ATOM   3367 C  CG    . PRO B 1 182 ? -22.575 46.376 10.530  1.00 94.04  ? 179 PRO B CG    1 
ATOM   3368 C  CD    . PRO B 1 182 ? -23.081 46.274 9.113   1.00 93.49  ? 179 PRO B CD    1 
ATOM   3369 N  N     . LYS B 1 183 ? -23.572 50.435 11.045  1.00 96.56  ? 180 LYS B N     1 
ATOM   3370 C  CA    . LYS B 1 183 ? -22.712 51.581 11.292  1.00 97.64  ? 180 LYS B CA    1 
ATOM   3371 C  C     . LYS B 1 183 ? -21.561 51.140 12.181  1.00 97.68  ? 180 LYS B C     1 
ATOM   3372 O  O     . LYS B 1 183 ? -20.425 51.571 11.995  1.00 98.20  ? 180 LYS B O     1 
ATOM   3373 C  CB    . LYS B 1 183 ? -23.494 52.717 11.932  1.00 98.96  ? 180 LYS B CB    1 
ATOM   3374 C  CG    . LYS B 1 183 ? -24.392 53.416 10.955  1.00 100.96 ? 180 LYS B CG    1 
ATOM   3375 C  CD    . LYS B 1 183 ? -25.489 54.175 11.660  1.00 106.06 ? 180 LYS B CD    1 
ATOM   3376 C  CE    . LYS B 1 183 ? -26.309 54.968 10.663  1.00 108.65 ? 180 LYS B CE    1 
ATOM   3377 N  NZ    . LYS B 1 183 ? -27.114 55.985 11.376  1.00 112.57 ? 180 LYS B NZ    1 
ATOM   3378 N  N     . VAL B 1 184 ? -21.856 50.249 13.125  1.00 97.46  ? 181 VAL B N     1 
ATOM   3379 C  CA    . VAL B 1 184 ? -20.873 49.822 14.117  1.00 97.65  ? 181 VAL B CA    1 
ATOM   3380 C  C     . VAL B 1 184 ? -20.847 48.312 14.343  1.00 96.98  ? 181 VAL B C     1 
ATOM   3381 O  O     . VAL B 1 184 ? -21.884 47.654 14.353  1.00 96.70  ? 181 VAL B O     1 
ATOM   3382 C  CB    . VAL B 1 184 ? -21.091 50.543 15.455  1.00 98.98  ? 181 VAL B CB    1 
ATOM   3383 C  CG1   . VAL B 1 184 ? -20.167 49.988 16.516  1.00 99.46  ? 181 VAL B CG1   1 
ATOM   3384 C  CG2   . VAL B 1 184 ? -20.862 52.038 15.285  1.00 99.70  ? 181 VAL B CG2   1 
ATOM   3385 N  N     . ILE B 1 185 ? -19.643 47.776 14.502  1.00 97.05  ? 182 ILE B N     1 
ATOM   3386 C  CA    . ILE B 1 185 ? -19.459 46.404 14.950  1.00 96.93  ? 182 ILE B CA    1 
ATOM   3387 C  C     . ILE B 1 185 ? -18.761 46.425 16.312  1.00 98.72  ? 182 ILE B C     1 
ATOM   3388 O  O     . ILE B 1 185 ? -17.738 47.092 16.495  1.00 99.75  ? 182 ILE B O     1 
ATOM   3389 C  CB    . ILE B 1 185 ? -18.648 45.565 13.933  1.00 95.77  ? 182 ILE B CB    1 
ATOM   3390 C  CG1   . ILE B 1 185 ? -19.445 45.374 12.647  1.00 94.26  ? 182 ILE B CG1   1 
ATOM   3391 C  CG2   . ILE B 1 185 ? -18.278 44.201 14.510  1.00 95.63  ? 182 ILE B CG2   1 
ATOM   3392 C  CD1   . ILE B 1 185 ? -18.641 44.769 11.509  1.00 92.39  ? 182 ILE B CD1   1 
ATOM   3393 N  N     . HIS B 1 186 ? -19.330 45.701 17.265  1.00 99.52  ? 183 HIS B N     1 
ATOM   3394 C  CA    . HIS B 1 186 ? -18.739 45.556 18.581  1.00 101.45 ? 183 HIS B CA    1 
ATOM   3395 C  C     . HIS B 1 186 ? -18.254 44.112 18.751  1.00 101.78 ? 183 HIS B C     1 
ATOM   3396 O  O     . HIS B 1 186 ? -18.919 43.173 18.291  1.00 100.95 ? 183 HIS B O     1 
ATOM   3397 C  CB    . HIS B 1 186 ? -19.772 45.923 19.645  1.00 102.57 ? 183 HIS B CB    1 
ATOM   3398 C  CG    . HIS B 1 186 ? -19.303 45.706 21.049  1.00 103.85 ? 183 HIS B CG    1 
ATOM   3399 N  ND1   . HIS B 1 186 ? -19.102 46.746 21.928  1.00 105.42 ? 183 HIS B ND1   1 
ATOM   3400 C  CD2   . HIS B 1 186 ? -19.005 44.572 21.728  1.00 103.72 ? 183 HIS B CD2   1 
ATOM   3401 C  CE1   . HIS B 1 186 ? -18.689 46.264 23.087  1.00 107.36 ? 183 HIS B CE1   1 
ATOM   3402 N  NE2   . HIS B 1 186 ? -18.622 44.947 22.991  1.00 106.40 ? 183 HIS B NE2   1 
ATOM   3403 N  N     . SER B 1 187 ? -17.098 43.943 19.400  1.00 103.37 ? 184 SER B N     1 
ATOM   3404 C  CA    . SER B 1 187 ? -16.504 42.615 19.622  1.00 104.12 ? 184 SER B CA    1 
ATOM   3405 C  C     . SER B 1 187 ? -15.507 42.600 20.774  1.00 106.18 ? 184 SER B C     1 
ATOM   3406 O  O     . SER B 1 187 ? -15.064 43.663 21.226  1.00 107.14 ? 184 SER B O     1 
ATOM   3407 C  CB    . SER B 1 187 ? -15.784 42.137 18.365  1.00 102.86 ? 184 SER B CB    1 
ATOM   3408 O  OG    . SER B 1 187 ? -14.530 42.785 18.237  1.00 103.68 ? 184 SER B OG    1 
ATOM   3409 N  N     . ASP B 1 188 ? -15.150 41.393 21.230  1.00 107.17 ? 185 ASP B N     1 
ATOM   3410 C  CA    . ASP B 1 188 ? -14.066 41.235 22.198  1.00 109.34 ? 185 ASP B CA    1 
ATOM   3411 C  C     . ASP B 1 188 ? -12.721 41.424 21.502  1.00 109.80 ? 185 ASP B C     1 
ATOM   3412 O  O     . ASP B 1 188 ? -12.661 41.478 20.277  1.00 108.62 ? 185 ASP B O     1 
ATOM   3413 C  CB    . ASP B 1 188 ? -14.150 39.909 22.981  1.00 110.04 ? 185 ASP B CB    1 
ATOM   3414 C  CG    . ASP B 1 188 ? -14.176 38.665 22.096  1.00 108.25 ? 185 ASP B CG    1 
ATOM   3415 O  OD1   . ASP B 1 188 ? -14.675 37.637 22.586  1.00 108.14 ? 185 ASP B OD1   1 
ATOM   3416 O  OD2   . ASP B 1 188 ? -13.691 38.674 20.950  1.00 106.27 ? 185 ASP B OD2   1 
ATOM   3417 N  N     . GLN B 1 189 ? -11.643 41.551 22.266  1.00 112.15 ? 186 GLN B N     1 
ATOM   3418 C  CA    . GLN B 1 189 ? -10.350 41.857 21.661  1.00 112.93 ? 186 GLN B CA    1 
ATOM   3419 C  C     . GLN B 1 189 ? -9.626  40.612 21.136  1.00 113.02 ? 186 GLN B C     1 
ATOM   3420 O  O     . GLN B 1 189 ? -8.391  40.538 21.144  1.00 114.00 ? 186 GLN B O     1 
ATOM   3421 C  CB    . GLN B 1 189 ? -9.484  42.670 22.621  1.00 114.93 ? 186 GLN B CB    1 
ATOM   3422 C  CG    . GLN B 1 189 ? -10.030 44.062 22.867  1.00 116.12 ? 186 GLN B CG    1 
ATOM   3423 C  CD    . GLN B 1 189 ? -8.944  45.114 23.012  1.00 119.08 ? 186 GLN B CD    1 
ATOM   3424 O  OE1   . GLN B 1 189 ? -7.751  44.803 23.001  1.00 120.65 ? 186 GLN B OE1   1 
ATOM   3425 N  NE2   . GLN B 1 189 ? -9.355  46.373 23.149  1.00 120.35 ? 186 GLN B NE2   1 
ATOM   3426 N  N     . GLY B 1 190 ? -10.411 39.645 20.662  1.00 112.37 ? 187 GLY B N     1 
ATOM   3427 C  CA    . GLY B 1 190 ? -9.887  38.421 20.068  1.00 112.71 ? 187 GLY B CA    1 
ATOM   3428 C  C     . GLY B 1 190 ? -9.012  38.725 18.871  1.00 112.43 ? 187 GLY B C     1 
ATOM   3429 O  O     . GLY B 1 190 ? -9.245  39.703 18.159  1.00 111.71 ? 187 GLY B O     1 
ATOM   3430 N  N     . ALA B 1 191 ? -8.006  37.884 18.646  1.00 113.38 ? 188 ALA B N     1 
ATOM   3431 C  CA    . ALA B 1 191 ? -6.999  38.150 17.621  1.00 113.43 ? 188 ALA B CA    1 
ATOM   3432 C  C     . ALA B 1 191 ? -7.628  38.492 16.279  1.00 111.96 ? 188 ALA B C     1 
ATOM   3433 O  O     . ALA B 1 191 ? -7.090  39.317 15.535  1.00 112.01 ? 188 ALA B O     1 
ATOM   3434 C  CB    . ALA B 1 191 ? -6.062  36.976 17.478  1.00 114.29 ? 188 ALA B CB    1 
ATOM   3435 N  N     . ALA B 1 192 ? -8.775  37.871 15.995  1.00 110.91 ? 189 ALA B N     1 
ATOM   3436 C  CA    . ALA B 1 192 ? -9.402  37.953 14.675  1.00 109.51 ? 189 ALA B CA    1 
ATOM   3437 C  C     . ALA B 1 192 ? -9.924  39.337 14.358  1.00 108.64 ? 189 ALA B C     1 
ATOM   3438 O  O     . ALA B 1 192 ? -9.914  39.748 13.206  1.00 107.93 ? 189 ALA B O     1 
ATOM   3439 C  CB    . ALA B 1 192 ? -10.515 36.925 14.537  1.00 108.98 ? 189 ALA B CB    1 
ATOM   3440 N  N     . PHE B 1 193 ? -10.367 40.051 15.387  1.00 108.99 ? 190 PHE B N     1 
ATOM   3441 C  CA    . PHE B 1 193 ? -11.029 41.343 15.201  1.00 108.57 ? 190 PHE B CA    1 
ATOM   3442 C  C     . PHE B 1 193 ? -10.070 42.513 15.405  1.00 109.95 ? 190 PHE B C     1 
ATOM   3443 O  O     . PHE B 1 193 ? -10.312 43.624 14.914  1.00 109.66 ? 190 PHE B O     1 
ATOM   3444 C  CB    . PHE B 1 193 ? -12.237 41.491 16.146  1.00 108.32 ? 190 PHE B CB    1 
ATOM   3445 C  CG    . PHE B 1 193 ? -13.137 40.271 16.217  1.00 106.50 ? 190 PHE B CG    1 
ATOM   3446 C  CD1   . PHE B 1 193 ? -13.637 39.673 15.063  1.00 104.53 ? 190 PHE B CD1   1 
ATOM   3447 C  CD2   . PHE B 1 193 ? -13.505 39.744 17.447  1.00 106.23 ? 190 PHE B CD2   1 
ATOM   3448 C  CE1   . PHE B 1 193 ? -14.467 38.556 15.136  1.00 103.62 ? 190 PHE B CE1   1 
ATOM   3449 C  CE2   . PHE B 1 193 ? -14.337 38.639 17.529  1.00 105.77 ? 190 PHE B CE2   1 
ATOM   3450 C  CZ    . PHE B 1 193 ? -14.819 38.043 16.368  1.00 104.34 ? 190 PHE B CZ    1 
ATOM   3451 N  N     . THR B 1 194 ? -8.991  42.259 16.140  1.00 111.68 ? 191 THR B N     1 
ATOM   3452 C  CA    . THR B 1 194 ? -7.994  43.290 16.422  1.00 113.41 ? 191 THR B CA    1 
ATOM   3453 C  C     . THR B 1 194 ? -6.990  43.465 15.278  1.00 113.83 ? 191 THR B C     1 
ATOM   3454 O  O     . THR B 1 194 ? -6.432  44.552 15.111  1.00 115.09 ? 191 THR B O     1 
ATOM   3455 C  CB    . THR B 1 194 ? -7.259  43.045 17.759  1.00 114.92 ? 191 THR B CB    1 
ATOM   3456 O  OG1   . THR B 1 194 ? -6.872  41.671 17.853  1.00 115.16 ? 191 THR B OG1   1 
ATOM   3457 C  CG2   . THR B 1 194 ? -8.168  43.377 18.919  1.00 115.22 ? 191 THR B CG2   1 
ATOM   3458 N  N     . SER B 1 195 ? -6.781  42.409 14.489  1.00 113.31 ? 192 SER B N     1 
ATOM   3459 C  CA    . SER B 1 195 ? -5.867  42.447 13.338  1.00 113.49 ? 192 SER B CA    1 
ATOM   3460 C  C     . SER B 1 195 ? -6.093  43.658 12.433  1.00 112.99 ? 192 SER B C     1 
ATOM   3461 O  O     . SER B 1 195 ? -7.219  44.177 12.327  1.00 112.06 ? 192 SER B O     1 
ATOM   3462 C  CB    . SER B 1 195 ? -6.005  41.180 12.501  1.00 112.81 ? 192 SER B CB    1 
ATOM   3463 O  OG    . SER B 1 195 ? -7.050  41.298 11.558  1.00 112.04 ? 192 SER B OG    1 
ATOM   3464 N  N     . SER B 1 196 ? -5.019  44.085 11.771  1.00 113.51 ? 193 SER B N     1 
ATOM   3465 C  CA    . SER B 1 196 ? -5.068  45.248 10.885  1.00 113.14 ? 193 SER B CA    1 
ATOM   3466 C  C     . SER B 1 196 ? -5.815  44.985 9.584   1.00 111.09 ? 193 SER B C     1 
ATOM   3467 O  O     . SER B 1 196 ? -6.347  45.915 8.986   1.00 110.77 ? 193 SER B O     1 
ATOM   3468 C  CB    . SER B 1 196 ? -3.665  45.763 10.600  1.00 114.96 ? 193 SER B CB    1 
ATOM   3469 O  OG    . SER B 1 196 ? -2.777  44.672 10.524  1.00 116.58 ? 193 SER B OG    1 
ATOM   3470 N  N     . THR B 1 197 ? -5.857  43.726 9.155   1.00 109.76 ? 194 THR B N     1 
ATOM   3471 C  CA    . THR B 1 197 ? -6.652  43.355 7.988   1.00 108.21 ? 194 THR B CA    1 
ATOM   3472 C  C     . THR B 1 197 ? -8.138  43.579 8.251   1.00 106.47 ? 194 THR B C     1 
ATOM   3473 O  O     . THR B 1 197 ? -8.824  44.163 7.417   1.00 105.93 ? 194 THR B O     1 
ATOM   3474 C  CB    . THR B 1 197 ? -6.437  41.895 7.545   1.00 108.13 ? 194 THR B CB    1 
ATOM   3475 O  OG1   . THR B 1 197 ? -5.047  41.573 7.610   1.00 109.88 ? 194 THR B OG1   1 
ATOM   3476 C  CG2   . THR B 1 197 ? -6.928  41.690 6.118   1.00 107.42 ? 194 THR B CG2   1 
ATOM   3477 N  N     . PHE B 1 198 ? -8.635  43.118 9.400   1.00 105.54 ? 195 PHE B N     1 
ATOM   3478 C  CA    . PHE B 1 198 ? -10.030 43.341 9.741   1.00 104.02 ? 195 PHE B CA    1 
ATOM   3479 C  C     . PHE B 1 198 ? -10.219 44.831 9.855   1.00 104.31 ? 195 PHE B C     1 
ATOM   3480 O  O     . PHE B 1 198 ? -11.168 45.387 9.313   1.00 103.60 ? 195 PHE B O     1 
ATOM   3481 C  CB    . PHE B 1 198 ? -10.447 42.632 11.041  1.00 103.89 ? 195 PHE B CB    1 
ATOM   3482 C  CG    . PHE B 1 198 ? -11.962 42.621 11.288  1.00 102.45 ? 195 PHE B CG    1 
ATOM   3483 C  CD1   . PHE B 1 198 ? -12.819 41.830 10.505  1.00 100.74 ? 195 PHE B CD1   1 
ATOM   3484 C  CD2   . PHE B 1 198 ? -12.530 43.399 12.299  1.00 101.42 ? 195 PHE B CD2   1 
ATOM   3485 C  CE1   . PHE B 1 198 ? -14.206 41.829 10.720  1.00 98.18  ? 195 PHE B CE1   1 
ATOM   3486 C  CE2   . PHE B 1 198 ? -13.912 43.396 12.512  1.00 99.32  ? 195 PHE B CE2   1 
ATOM   3487 C  CZ    . PHE B 1 198 ? -14.744 42.606 11.722  1.00 97.91  ? 195 PHE B CZ    1 
ATOM   3488 N  N     . ALA B 1 199 ? -9.279  45.478 10.528  1.00 105.68 ? 196 ALA B N     1 
ATOM   3489 C  CA    . ALA B 1 199 ? -9.309  46.924 10.684  1.00 106.79 ? 196 ALA B CA    1 
ATOM   3490 C  C     . ALA B 1 199 ? -9.483  47.667 9.350   1.00 106.89 ? 196 ALA B C     1 
ATOM   3491 O  O     . ALA B 1 199 ? -10.260 48.625 9.276   1.00 106.84 ? 196 ALA B O     1 
ATOM   3492 C  CB    . ALA B 1 199 ? -8.062  47.395 11.405  1.00 108.61 ? 196 ALA B CB    1 
ATOM   3493 N  N     . GLU B 1 200 ? -8.766  47.219 8.311   1.00 107.25 ? 197 GLU B N     1 
ATOM   3494 C  CA    . GLU B 1 200 ? -8.865  47.800 6.958   1.00 107.35 ? 197 GLU B CA    1 
ATOM   3495 C  C     . GLU B 1 200 ? -10.187 47.434 6.264   1.00 105.90 ? 197 GLU B C     1 
ATOM   3496 O  O     . GLU B 1 200 ? -10.853 48.299 5.687   1.00 105.90 ? 197 GLU B O     1 
ATOM   3497 C  CB    . GLU B 1 200 ? -7.653  47.417 6.094   1.00 108.11 ? 197 GLU B CB    1 
ATOM   3498 N  N     . TRP B 1 201 ? -10.564 46.158 6.341   1.00 104.89 ? 198 TRP B N     1 
ATOM   3499 C  CA    . TRP B 1 201 ? -11.853 45.681 5.845   1.00 103.68 ? 198 TRP B CA    1 
ATOM   3500 C  C     . TRP B 1 201 ? -12.992 46.604 6.267   1.00 103.49 ? 198 TRP B C     1 
ATOM   3501 O  O     . TRP B 1 201 ? -13.848 46.961 5.452   1.00 103.23 ? 198 TRP B O     1 
ATOM   3502 C  CB    . TRP B 1 201 ? -12.134 44.256 6.346   1.00 102.93 ? 198 TRP B CB    1 
ATOM   3503 C  CG    . TRP B 1 201 ? -13.454 43.710 5.893   1.00 101.39 ? 198 TRP B CG    1 
ATOM   3504 C  CD1   . TRP B 1 201 ? -13.703 43.061 4.728   1.00 101.02 ? 198 TRP B CD1   1 
ATOM   3505 C  CD2   . TRP B 1 201 ? -14.709 43.786 6.586   1.00 100.53 ? 198 TRP B CD2   1 
ATOM   3506 N  NE1   . TRP B 1 201 ? -15.028 42.717 4.646   1.00 100.16 ? 198 TRP B NE1   1 
ATOM   3507 C  CE2   . TRP B 1 201 ? -15.673 43.158 5.770   1.00 99.96  ? 198 TRP B CE2   1 
ATOM   3508 C  CE3   . TRP B 1 201 ? -15.112 44.321 7.816   1.00 100.49 ? 198 TRP B CE3   1 
ATOM   3509 C  CZ2   . TRP B 1 201 ? -17.025 43.045 6.145   1.00 99.23  ? 198 TRP B CZ2   1 
ATOM   3510 C  CZ3   . TRP B 1 201 ? -16.458 44.212 8.187   1.00 99.79  ? 198 TRP B CZ3   1 
ATOM   3511 C  CH2   . TRP B 1 201 ? -17.395 43.578 7.353   1.00 98.77  ? 198 TRP B CH2   1 
ATOM   3512 N  N     . ALA B 1 202 ? -12.998 46.988 7.540   1.00 103.94 ? 199 ALA B N     1 
ATOM   3513 C  CA    . ALA B 1 202 ? -14.093 47.778 8.080   1.00 104.19 ? 199 ALA B CA    1 
ATOM   3514 C  C     . ALA B 1 202 ? -14.045 49.218 7.612   1.00 105.54 ? 199 ALA B C     1 
ATOM   3515 O  O     . ALA B 1 202 ? -15.089 49.803 7.324   1.00 105.39 ? 199 ALA B O     1 
ATOM   3516 C  CB    . ALA B 1 202 ? -14.115 47.709 9.574   1.00 104.45 ? 199 ALA B CB    1 
ATOM   3517 N  N     . LYS B 1 203 ? -12.841 49.784 7.525   1.00 107.38 ? 200 LYS B N     1 
ATOM   3518 C  CA    . LYS B 1 203 ? -12.683 51.155 7.034   1.00 109.28 ? 200 LYS B CA    1 
ATOM   3519 C  C     . LYS B 1 203 ? -13.167 51.286 5.598   1.00 109.06 ? 200 LYS B C     1 
ATOM   3520 O  O     . LYS B 1 203 ? -13.827 52.268 5.270   1.00 109.37 ? 200 LYS B O     1 
ATOM   3521 C  CB    . LYS B 1 203 ? -11.238 51.642 7.140   1.00 111.02 ? 200 LYS B CB    1 
ATOM   3522 C  CG    . LYS B 1 203 ? -11.097 53.149 6.897   1.00 114.14 ? 200 LYS B CG    1 
ATOM   3523 C  CD    . LYS B 1 203 ? -9.641  53.613 6.922   1.00 118.49 ? 200 LYS B CD    1 
ATOM   3524 C  CE    . LYS B 1 203 ? -9.554  55.132 7.094   1.00 121.97 ? 200 LYS B CE    1 
ATOM   3525 N  NZ    . LYS B 1 203 ? -8.212  55.588 7.586   1.00 125.00 ? 200 LYS B NZ    1 
ATOM   3526 N  N     . GLU B 1 204 ? -12.835 50.297 4.763   1.00 109.00 ? 201 GLU B N     1 
ATOM   3527 C  CA    . GLU B 1 204 ? -13.309 50.223 3.380   1.00 109.51 ? 201 GLU B CA    1 
ATOM   3528 C  C     . GLU B 1 204 ? -14.824 50.357 3.295   1.00 108.44 ? 201 GLU B C     1 
ATOM   3529 O  O     . GLU B 1 204 ? -15.347 51.151 2.503   1.00 109.10 ? 201 GLU B O     1 
ATOM   3530 C  CB    . GLU B 1 204 ? -12.901 48.900 2.734   1.00 109.41 ? 201 GLU B CB    1 
ATOM   3531 C  CG    . GLU B 1 204 ? -11.499 48.876 2.133   1.00 113.63 ? 201 GLU B CG    1 
ATOM   3532 C  CD    . GLU B 1 204 ? -10.957 47.446 1.897   1.00 117.37 ? 201 GLU B CD    1 
ATOM   3533 O  OE1   . GLU B 1 204 ? -11.744 46.458 1.983   1.00 117.85 ? 201 GLU B OE1   1 
ATOM   3534 O  OE2   . GLU B 1 204 ? -9.734  47.316 1.626   1.00 119.14 ? 201 GLU B OE2   1 
ATOM   3535 N  N     . ARG B 1 205 ? -15.532 49.590 4.117   1.00 107.03 ? 202 ARG B N     1 
ATOM   3536 C  CA    . ARG B 1 205 ? -16.985 49.576 4.052   1.00 105.98 ? 202 ARG B CA    1 
ATOM   3537 C  C     . ARG B 1 205 ? -17.632 50.698 4.867   1.00 106.45 ? 202 ARG B C     1 
ATOM   3538 O  O     . ARG B 1 205 ? -18.858 50.793 4.929   1.00 106.04 ? 202 ARG B O     1 
ATOM   3539 C  CB    . ARG B 1 205 ? -17.518 48.210 4.476   1.00 104.82 ? 202 ARG B CB    1 
ATOM   3540 C  CG    . ARG B 1 205 ? -16.755 47.060 3.870   1.00 104.30 ? 202 ARG B CG    1 
ATOM   3541 C  CD    . ARG B 1 205 ? -17.682 45.925 3.463   1.00 104.18 ? 202 ARG B CD    1 
ATOM   3542 N  NE    . ARG B 1 205 ? -17.024 44.841 2.725   1.00 104.16 ? 202 ARG B NE    1 
ATOM   3543 C  CZ    . ARG B 1 205 ? -15.720 44.768 2.448   1.00 105.08 ? 202 ARG B CZ    1 
ATOM   3544 N  NH1   . ARG B 1 205 ? -14.868 45.715 2.835   1.00 105.57 ? 202 ARG B NH1   1 
ATOM   3545 N  NH2   . ARG B 1 205 ? -15.259 43.727 1.773   1.00 105.27 ? 202 ARG B NH2   1 
ATOM   3546 N  N     . GLY B 1 206 ? -16.805 51.547 5.477   1.00 107.51 ? 203 GLY B N     1 
ATOM   3547 C  CA    . GLY B 1 206 ? -17.283 52.646 6.318   1.00 108.40 ? 203 GLY B CA    1 
ATOM   3548 C  C     . GLY B 1 206 ? -17.964 52.188 7.601   1.00 108.00 ? 203 GLY B C     1 
ATOM   3549 O  O     . GLY B 1 206 ? -18.943 52.793 8.037   1.00 108.34 ? 203 GLY B O     1 
ATOM   3550 N  N     . ILE B 1 207 ? -17.454 51.109 8.192   1.00 107.40 ? 204 ILE B N     1 
ATOM   3551 C  CA    . ILE B 1 207 ? -17.951 50.596 9.464   1.00 107.18 ? 204 ILE B CA    1 
ATOM   3552 C  C     . ILE B 1 207 ? -17.009 51.048 10.559  1.00 108.79 ? 204 ILE B C     1 
ATOM   3553 O  O     . ILE B 1 207 ? -15.813 50.781 10.486  1.00 109.27 ? 204 ILE B O     1 
ATOM   3554 C  CB    . ILE B 1 207 ? -17.967 49.058 9.485   1.00 105.83 ? 204 ILE B CB    1 
ATOM   3555 C  CG1   . ILE B 1 207 ? -18.899 48.512 8.412   1.00 104.51 ? 204 ILE B CG1   1 
ATOM   3556 C  CG2   . ILE B 1 207 ? -18.384 48.546 10.852  1.00 105.81 ? 204 ILE B CG2   1 
ATOM   3557 C  CD1   . ILE B 1 207 ? -18.786 47.030 8.235   1.00 103.37 ? 204 ILE B CD1   1 
ATOM   3558 N  N     . HIS B 1 208 ? -17.527 51.722 11.576  1.00 110.21 ? 205 HIS B N     1 
ATOM   3559 C  CA    . HIS B 1 208 ? -16.700 52.002 12.741  1.00 112.33 ? 205 HIS B CA    1 
ATOM   3560 C  C     . HIS B 1 208 ? -16.604 50.751 13.627  1.00 111.88 ? 205 HIS B C     1 
ATOM   3561 O  O     . HIS B 1 208 ? -17.593 50.049 13.843  1.00 111.17 ? 205 HIS B O     1 
ATOM   3562 C  CB    . HIS B 1 208 ? -17.217 53.218 13.522  1.00 114.25 ? 205 HIS B CB    1 
ATOM   3563 C  CG    . HIS B 1 208 ? -16.349 53.604 14.685  1.00 117.56 ? 205 HIS B CG    1 
ATOM   3564 N  ND1   . HIS B 1 208 ? -16.642 53.244 15.987  1.00 119.22 ? 205 HIS B ND1   1 
ATOM   3565 C  CD2   . HIS B 1 208 ? -15.192 54.308 14.742  1.00 120.21 ? 205 HIS B CD2   1 
ATOM   3566 C  CE1   . HIS B 1 208 ? -15.707 53.715 16.795  1.00 121.33 ? 205 HIS B CE1   1 
ATOM   3567 N  NE2   . HIS B 1 208 ? -14.815 54.363 16.065  1.00 122.51 ? 205 HIS B NE2   1 
ATOM   3568 N  N     . LEU B 1 209 ? -15.403 50.466 14.119  1.00 112.66 ? 206 LEU B N     1 
ATOM   3569 C  CA    . LEU B 1 209 ? -15.185 49.316 14.994  1.00 112.51 ? 206 LEU B CA    1 
ATOM   3570 C  C     . LEU B 1 209 ? -15.122 49.701 16.469  1.00 114.35 ? 206 LEU B C     1 
ATOM   3571 O  O     . LEU B 1 209 ? -14.490 50.696 16.840  1.00 115.88 ? 206 LEU B O     1 
ATOM   3572 C  CB    . LEU B 1 209 ? -13.910 48.571 14.604  1.00 112.21 ? 206 LEU B CB    1 
ATOM   3573 C  CG    . LEU B 1 209 ? -13.903 47.776 13.302  1.00 110.12 ? 206 LEU B CG    1 
ATOM   3574 C  CD1   . LEU B 1 209 ? -12.624 46.980 13.214  1.00 109.85 ? 206 LEU B CD1   1 
ATOM   3575 C  CD2   . LEU B 1 209 ? -15.092 46.848 13.225  1.00 109.10 ? 206 LEU B CD2   1 
ATOM   3576 N  N     . GLU B 1 210 ? -15.768 48.888 17.300  1.00 114.48 ? 207 GLU B N     1 
ATOM   3577 C  CA    . GLU B 1 210 ? -15.866 49.147 18.729  1.00 116.42 ? 207 GLU B CA    1 
ATOM   3578 C  C     . GLU B 1 210 ? -15.413 47.935 19.525  1.00 116.82 ? 207 GLU B C     1 
ATOM   3579 O  O     . GLU B 1 210 ? -15.773 46.799 19.210  1.00 115.67 ? 207 GLU B O     1 
ATOM   3580 C  CB    . GLU B 1 210 ? -17.298 49.505 19.093  1.00 116.47 ? 207 GLU B CB    1 
ATOM   3581 C  CG    . GLU B 1 210 ? -17.485 49.861 20.540  1.00 119.04 ? 207 GLU B CG    1 
ATOM   3582 C  CD    . GLU B 1 210 ? -18.900 50.280 20.844  1.00 120.41 ? 207 GLU B CD    1 
ATOM   3583 O  OE1   . GLU B 1 210 ? -19.344 51.313 20.291  1.00 120.57 ? 207 GLU B OE1   1 
ATOM   3584 O  OE2   . GLU B 1 210 ? -19.565 49.577 21.639  1.00 121.16 ? 207 GLU B OE2   1 
ATOM   3585 N  N     . PHE B 1 211 ? -14.625 48.182 20.563  1.00 118.87 ? 208 PHE B N     1 
ATOM   3586 C  CA    . PHE B 1 211 ? -14.040 47.099 21.332  1.00 119.75 ? 208 PHE B CA    1 
ATOM   3587 C  C     . PHE B 1 211 ? -14.356 47.210 22.806  1.00 121.95 ? 208 PHE B C     1 
ATOM   3588 O  O     . PHE B 1 211 ? -14.208 48.277 23.407  1.00 123.71 ? 208 PHE B O     1 
ATOM   3589 C  CB    . PHE B 1 211 ? -12.522 47.070 21.145  1.00 120.29 ? 208 PHE B CB    1 
ATOM   3590 C  CG    . PHE B 1 211 ? -12.089 46.817 19.733  1.00 119.11 ? 208 PHE B CG    1 
ATOM   3591 C  CD1   . PHE B 1 211 ? -11.969 45.514 19.251  1.00 118.56 ? 208 PHE B CD1   1 
ATOM   3592 C  CD2   . PHE B 1 211 ? -11.798 47.877 18.879  1.00 119.62 ? 208 PHE B CD2   1 
ATOM   3593 C  CE1   . PHE B 1 211 ? -11.567 45.265 17.934  1.00 117.44 ? 208 PHE B CE1   1 
ATOM   3594 C  CE2   . PHE B 1 211 ? -11.396 47.643 17.564  1.00 118.66 ? 208 PHE B CE2   1 
ATOM   3595 C  CZ    . PHE B 1 211 ? -11.281 46.330 17.091  1.00 117.49 ? 208 PHE B CZ    1 
ATOM   3596 N  N     . SER B 1 212 ? -14.793 46.098 23.383  1.00 122.30 ? 209 SER B N     1 
ATOM   3597 C  CA    . SER B 1 212 ? -14.871 45.968 24.831  1.00 124.80 ? 209 SER B CA    1 
ATOM   3598 C  C     . SER B 1 212 ? -13.442 45.954 25.385  1.00 126.69 ? 209 SER B C     1 
ATOM   3599 O  O     . SER B 1 212 ? -12.513 45.581 24.670  1.00 125.68 ? 209 SER B O     1 
ATOM   3600 C  CB    . SER B 1 212 ? -15.639 44.693 25.213  1.00 124.48 ? 209 SER B CB    1 
ATOM   3601 O  OG    . SER B 1 212 ? -15.154 43.543 24.535  1.00 122.18 ? 209 SER B OG    1 
ATOM   3602 N  N     . THR B 1 213 ? -13.249 46.382 26.633  1.00 129.76 ? 210 THR B N     1 
ATOM   3603 C  CA    . THR B 1 213 ? -11.921 46.264 27.249  1.00 132.07 ? 210 THR B CA    1 
ATOM   3604 C  C     . THR B 1 213 ? -11.668 44.795 27.589  1.00 132.43 ? 210 THR B C     1 
ATOM   3605 O  O     . THR B 1 213 ? -12.620 44.028 27.747  1.00 131.85 ? 210 THR B O     1 
ATOM   3606 C  CB    . THR B 1 213 ? -11.715 47.173 28.498  1.00 135.03 ? 210 THR B CB    1 
ATOM   3607 O  OG1   . THR B 1 213 ? -12.595 46.770 29.553  1.00 137.01 ? 210 THR B OG1   1 
ATOM   3608 C  CG2   . THR B 1 213 ? -11.937 48.648 28.164  1.00 135.37 ? 210 THR B CG2   1 
ATOM   3609 N  N     . PRO B 1 214 ? -10.387 44.388 27.667  1.00 133.78 ? 211 PRO B N     1 
ATOM   3610 C  CA    . PRO B 1 214 ? -10.079 42.989 27.955  1.00 134.45 ? 211 PRO B CA    1 
ATOM   3611 C  C     . PRO B 1 214 ? -10.713 42.478 29.248  1.00 136.78 ? 211 PRO B C     1 
ATOM   3612 O  O     . PRO B 1 214 ? -10.609 43.130 30.296  1.00 139.17 ? 211 PRO B O     1 
ATOM   3613 C  CB    . PRO B 1 214 ? -8.547  42.987 28.064  1.00 135.68 ? 211 PRO B CB    1 
ATOM   3614 C  CG    . PRO B 1 214 ? -8.118  44.087 27.169  1.00 134.47 ? 211 PRO B CG    1 
ATOM   3615 C  CD    . PRO B 1 214 ? -9.167  45.156 27.347  1.00 134.51 ? 211 PRO B CD    1 
ATOM   3616 N  N     . TYR B 1 215 ? -11.376 41.322 29.143  1.00 136.46 ? 212 TYR B N     1 
ATOM   3617 C  CA    . TYR B 1 215 ? -11.937 40.592 30.282  1.00 138.86 ? 212 TYR B CA    1 
ATOM   3618 C  C     . TYR B 1 215 ? -13.186 41.218 30.917  1.00 139.94 ? 212 TYR B C     1 
ATOM   3619 O  O     . TYR B 1 215 ? -13.819 40.592 31.762  1.00 141.68 ? 212 TYR B O     1 
ATOM   3620 C  CB    . TYR B 1 215 ? -10.863 40.322 31.345  1.00 141.69 ? 212 TYR B CB    1 
ATOM   3621 C  CG    . TYR B 1 215 ? -9.541  39.832 30.773  1.00 142.30 ? 212 TYR B CG    1 
ATOM   3622 C  CD1   . TYR B 1 215 ? -9.358  38.490 30.443  1.00 142.47 ? 212 TYR B CD1   1 
ATOM   3623 C  CD2   . TYR B 1 215 ? -8.472  40.712 30.602  1.00 143.88 ? 212 TYR B CD2   1 
ATOM   3624 C  CE1   . TYR B 1 215 ? -8.146  38.036 30.026  1.00 143.19 ? 212 TYR B CE1   1 
ATOM   3625 C  CE2   . TYR B 1 215 ? -7.257  40.273 30.112  1.00 144.67 ? 212 TYR B CE2   1 
ATOM   3626 C  CZ    . TYR B 1 215 ? -7.102  38.937 29.820  1.00 144.33 ? 212 TYR B CZ    1 
ATOM   3627 O  OH    . TYR B 1 215 ? -5.894  38.504 29.392  1.00 145.28 ? 212 TYR B OH    1 
ATOM   3628 N  N     . HIS B 1 216 ? -13.537 42.446 30.524  1.00 139.51 ? 213 HIS B N     1 
ATOM   3629 C  CA    . HIS B 1 216 ? -14.794 43.062 30.967  1.00 140.37 ? 213 HIS B CA    1 
ATOM   3630 C  C     . HIS B 1 216 ? -15.718 43.301 29.755  1.00 137.76 ? 213 HIS B C     1 
ATOM   3631 O  O     . HIS B 1 216 ? -15.807 44.427 29.242  1.00 137.00 ? 213 HIS B O     1 
ATOM   3632 C  CB    . HIS B 1 216 ? -14.533 44.346 31.777  1.00 142.69 ? 213 HIS B CB    1 
ATOM   3633 N  N     . PRO B 1 217 ? -16.408 42.230 29.294  1.00 136.45 ? 214 PRO B N     1 
ATOM   3634 C  CA    . PRO B 1 217 ? -17.155 42.262 28.030  1.00 134.02 ? 214 PRO B CA    1 
ATOM   3635 C  C     . PRO B 1 217 ? -18.498 43.021 28.099  1.00 134.28 ? 214 PRO B C     1 
ATOM   3636 O  O     . PRO B 1 217 ? -19.559 42.396 28.201  1.00 134.36 ? 214 PRO B O     1 
ATOM   3637 C  CB    . PRO B 1 217 ? -17.375 40.764 27.710  1.00 133.11 ? 214 PRO B CB    1 
ATOM   3638 C  CG    . PRO B 1 217 ? -16.593 39.990 28.764  1.00 134.93 ? 214 PRO B CG    1 
ATOM   3639 C  CD    . PRO B 1 217 ? -16.522 40.905 29.937  1.00 137.35 ? 214 PRO B CD    1 
ATOM   3640 N  N     . GLN B 1 218 ? -18.442 44.354 28.029  1.00 134.64 ? 215 GLN B N     1 
ATOM   3641 C  CA    . GLN B 1 218 ? -19.651 45.191 27.999  1.00 134.74 ? 215 GLN B CA    1 
ATOM   3642 C  C     . GLN B 1 218 ? -20.362 45.146 26.618  1.00 131.96 ? 215 GLN B C     1 
ATOM   3643 O  O     . GLN B 1 218 ? -19.760 45.423 25.569  1.00 130.35 ? 215 GLN B O     1 
ATOM   3644 C  CB    . GLN B 1 218 ? -19.335 46.640 28.434  1.00 136.32 ? 215 GLN B CB    1 
ATOM   3645 N  N     . SER B 1 219 ? -21.638 44.758 26.655  1.00 131.39 ? 216 SER B N     1 
ATOM   3646 C  CA    . SER B 1 219 ? -22.551 44.732 25.506  1.00 128.74 ? 216 SER B CA    1 
ATOM   3647 C  C     . SER B 1 219 ? -23.970 44.862 26.075  1.00 129.69 ? 216 SER B C     1 
ATOM   3648 O  O     . SER B 1 219 ? -24.135 44.931 27.293  1.00 132.25 ? 216 SER B O     1 
ATOM   3649 C  CB    . SER B 1 219 ? -22.384 43.441 24.693  1.00 126.88 ? 216 SER B CB    1 
ATOM   3650 O  OG    . SER B 1 219 ? -22.664 42.284 25.462  1.00 127.59 ? 216 SER B OG    1 
ATOM   3651 N  N     . SER B 1 220 ? -24.987 44.902 25.218  1.00 127.74 ? 217 SER B N     1 
ATOM   3652 C  CA    . SER B 1 220 ? -26.355 45.227 25.648  1.00 128.45 ? 217 SER B CA    1 
ATOM   3653 C  C     . SER B 1 220 ? -27.019 44.163 26.550  1.00 129.44 ? 217 SER B C     1 
ATOM   3654 O  O     . SER B 1 220 ? -26.753 42.963 26.405  1.00 128.87 ? 217 SER B O     1 
ATOM   3655 C  CB    . SER B 1 220 ? -27.222 45.515 24.418  1.00 126.84 ? 217 SER B CB    1 
ATOM   3656 O  OG    . SER B 1 220 ? -28.584 45.658 24.766  1.00 128.83 ? 217 SER B OG    1 
ATOM   3657 N  N     . GLY B 1 221 ? -27.876 44.614 27.475  1.00 130.87 ? 218 GLY B N     1 
ATOM   3658 C  CA    . GLY B 1 221 ? -28.645 43.713 28.337  1.00 131.49 ? 218 GLY B CA    1 
ATOM   3659 C  C     . GLY B 1 221 ? -29.364 42.669 27.503  1.00 129.20 ? 218 GLY B C     1 
ATOM   3660 O  O     . GLY B 1 221 ? -29.199 41.465 27.704  1.00 129.18 ? 218 GLY B O     1 
ATOM   3661 N  N     . LYS B 1 222 ? -30.141 43.156 26.543  1.00 127.22 ? 219 LYS B N     1 
ATOM   3662 C  CA    . LYS B 1 222 ? -30.832 42.325 25.551  1.00 125.05 ? 219 LYS B CA    1 
ATOM   3663 C  C     . LYS B 1 222 ? -29.916 41.354 24.781  1.00 122.48 ? 219 LYS B C     1 
ATOM   3664 O  O     . LYS B 1 222 ? -30.316 40.229 24.475  1.00 121.94 ? 219 LYS B O     1 
ATOM   3665 C  CB    . LYS B 1 222 ? -31.596 43.236 24.575  1.00 124.01 ? 219 LYS B CB    1 
ATOM   3666 C  CG    . LYS B 1 222 ? -32.362 42.530 23.466  1.00 122.26 ? 219 LYS B CG    1 
ATOM   3667 C  CD    . LYS B 1 222 ? -33.077 43.552 22.612  1.00 121.52 ? 219 LYS B CD    1 
ATOM   3668 C  CE    . LYS B 1 222 ? -33.888 42.887 21.512  1.00 120.70 ? 219 LYS B CE    1 
ATOM   3669 N  NZ    . LYS B 1 222 ? -35.257 42.489 21.944  1.00 122.25 ? 219 LYS B NZ    1 
ATOM   3670 N  N     . VAL B 1 223 ? -28.699 41.796 24.471  1.00 120.79 ? 220 VAL B N     1 
ATOM   3671 C  CA    . VAL B 1 223 ? -27.754 40.989 23.689  1.00 118.69 ? 220 VAL B CA    1 
ATOM   3672 C  C     . VAL B 1 223 ? -27.148 39.862 24.520  1.00 119.67 ? 220 VAL B C     1 
ATOM   3673 O  O     . VAL B 1 223 ? -27.070 38.726 24.044  1.00 119.12 ? 220 VAL B O     1 
ATOM   3674 C  CB    . VAL B 1 223 ? -26.638 41.848 23.018  1.00 117.18 ? 220 VAL B CB    1 
ATOM   3675 C  CG1   . VAL B 1 223 ? -25.475 40.978 22.525  1.00 115.69 ? 220 VAL B CG1   1 
ATOM   3676 C  CG2   . VAL B 1 223 ? -27.216 42.662 21.870  1.00 115.51 ? 220 VAL B CG2   1 
ATOM   3677 N  N     . GLU B 1 224 ? -26.732 40.181 25.753  1.00 121.21 ? 221 GLU B N     1 
ATOM   3678 C  CA    . GLU B 1 224 ? -26.175 39.191 26.685  1.00 122.07 ? 221 GLU B CA    1 
ATOM   3679 C  C     . GLU B 1 224 ? -27.125 37.996 26.778  1.00 122.53 ? 221 GLU B C     1 
ATOM   3680 O  O     . GLU B 1 224 ? -26.714 36.849 26.563  1.00 121.99 ? 221 GLU B O     1 
ATOM   3681 C  CB    . GLU B 1 224 ? -25.914 39.815 28.064  1.00 124.17 ? 221 GLU B CB    1 
ATOM   3682 N  N     . ARG B 1 225 ? -28.401 38.288 27.045  1.00 123.28 ? 222 ARG B N     1 
ATOM   3683 C  CA    . ARG B 1 225 ? -29.445 37.269 27.098  1.00 124.16 ? 222 ARG B CA    1 
ATOM   3684 C  C     . ARG B 1 225 ? -29.496 36.475 25.787  1.00 122.21 ? 222 ARG B C     1 
ATOM   3685 O  O     . ARG B 1 225 ? -29.256 35.272 25.802  1.00 122.60 ? 222 ARG B O     1 
ATOM   3686 C  CB    . ARG B 1 225 ? -30.811 37.873 27.472  1.00 122.23 ? 222 ARG B CB    1 
ATOM   3687 N  N     . LYS B 1 226 ? -29.756 37.137 24.657  1.00 120.44 ? 223 LYS B N     1 
ATOM   3688 C  CA    . LYS B 1 226 ? -29.769 36.434 23.357  1.00 118.85 ? 223 LYS B CA    1 
ATOM   3689 C  C     . LYS B 1 226 ? -28.496 35.620 23.144  1.00 118.37 ? 223 LYS B C     1 
ATOM   3690 O  O     . LYS B 1 226 ? -28.548 34.482 22.676  1.00 118.28 ? 223 LYS B O     1 
ATOM   3691 C  CB    . LYS B 1 226 ? -30.004 37.378 22.166  1.00 116.60 ? 223 LYS B CB    1 
ATOM   3692 C  CG    . LYS B 1 226 ? -30.362 36.651 20.863  1.00 115.01 ? 223 LYS B CG    1 
ATOM   3693 C  CD    . LYS B 1 226 ? -31.653 35.806 20.981  1.00 117.24 ? 223 LYS B CD    1 
ATOM   3694 C  CE    . LYS B 1 226 ? -32.796 36.316 20.088  1.00 117.67 ? 223 LYS B CE    1 
ATOM   3695 N  NZ    . LYS B 1 226 ? -32.595 36.029 18.597  1.00 116.64 ? 223 LYS B NZ    1 
ATOM   3696 N  N     . ASN B 1 227 ? -27.363 36.206 23.516  1.00 118.49 ? 224 ASN B N     1 
ATOM   3697 C  CA    . ASN B 1 227 ? -26.073 35.547 23.368  1.00 118.41 ? 224 ASN B CA    1 
ATOM   3698 C  C     . ASN B 1 227 ? -25.962 34.312 24.265  1.00 120.48 ? 224 ASN B C     1 
ATOM   3699 O  O     . ASN B 1 227 ? -25.285 33.337 23.917  1.00 120.40 ? 224 ASN B O     1 
ATOM   3700 C  CB    . ASN B 1 227 ? -24.931 36.537 23.615  1.00 117.89 ? 224 ASN B CB    1 
ATOM   3701 C  CG    . ASN B 1 227 ? -23.858 36.449 22.556  1.00 116.48 ? 224 ASN B CG    1 
ATOM   3702 O  OD1   . ASN B 1 227 ? -23.018 35.549 22.590  1.00 117.26 ? 224 ASN B OD1   1 
ATOM   3703 N  ND2   . ASN B 1 227 ? -23.883 37.379 21.597  1.00 114.59 ? 224 ASN B ND2   1 
ATOM   3704 N  N     . SER B 1 228 ? -26.648 34.355 25.405  1.00 122.60 ? 225 SER B N     1 
ATOM   3705 C  CA    . SER B 1 228 ? -26.740 33.201 26.287  1.00 124.94 ? 225 SER B CA    1 
ATOM   3706 C  C     . SER B 1 228 ? -27.614 32.116 25.663  1.00 125.33 ? 225 SER B C     1 
ATOM   3707 O  O     . SER B 1 228 ? -27.217 30.952 25.619  1.00 126.05 ? 225 SER B O     1 
ATOM   3708 C  CB    . SER B 1 228 ? -27.284 33.608 27.660  1.00 127.42 ? 225 SER B CB    1 
ATOM   3709 O  OG    . SER B 1 228 ? -27.715 32.482 28.403  1.00 129.34 ? 225 SER B OG    1 
ATOM   3710 N  N     . ASP B 1 229 ? -28.792 32.507 25.175  1.00 125.05 ? 226 ASP B N     1 
ATOM   3711 C  CA    . ASP B 1 229 ? -29.744 31.580 24.553  1.00 125.68 ? 226 ASP B CA    1 
ATOM   3712 C  C     . ASP B 1 229 ? -29.096 30.715 23.482  1.00 124.52 ? 226 ASP B C     1 
ATOM   3713 O  O     . ASP B 1 229 ? -29.300 29.501 23.457  1.00 125.79 ? 226 ASP B O     1 
ATOM   3714 C  CB    . ASP B 1 229 ? -30.907 32.345 23.916  1.00 125.10 ? 226 ASP B CB    1 
ATOM   3715 C  CG    . ASP B 1 229 ? -31.695 33.170 24.918  1.00 127.21 ? 226 ASP B CG    1 
ATOM   3716 O  OD1   . ASP B 1 229 ? -31.531 32.945 26.137  1.00 130.72 ? 226 ASP B OD1   1 
ATOM   3717 O  OD2   . ASP B 1 229 ? -32.484 34.043 24.482  1.00 126.38 ? 226 ASP B OD2   1 
ATOM   3718 N  N     . ILE B 1 230 ? -28.325 31.357 22.602  1.00 122.38 ? 227 ILE B N     1 
ATOM   3719 C  CA    . ILE B 1 230 ? -27.602 30.677 21.527  1.00 121.17 ? 227 ILE B CA    1 
ATOM   3720 C  C     . ILE B 1 230 ? -26.737 29.549 22.080  1.00 122.76 ? 227 ILE B C     1 
ATOM   3721 O  O     . ILE B 1 230 ? -26.891 28.395 21.671  1.00 123.59 ? 227 ILE B O     1 
ATOM   3722 C  CB    . ILE B 1 230 ? -26.738 31.659 20.718  1.00 118.67 ? 227 ILE B CB    1 
ATOM   3723 C  CG1   . ILE B 1 230 ? -27.623 32.742 20.094  1.00 117.48 ? 227 ILE B CG1   1 
ATOM   3724 C  CG2   . ILE B 1 230 ? -25.965 30.913 19.634  1.00 117.88 ? 227 ILE B CG2   1 
ATOM   3725 C  CD1   . ILE B 1 230 ? -26.879 33.952 19.568  1.00 115.23 ? 227 ILE B CD1   1 
ATOM   3726 N  N     . LYS B 1 231 ? -25.854 29.887 23.023  1.00 123.56 ? 228 LYS B N     1 
ATOM   3727 C  CA    . LYS B 1 231 ? -24.990 28.903 23.686  1.00 125.37 ? 228 LYS B CA    1 
ATOM   3728 C  C     . LYS B 1 231 ? -25.781 27.727 24.300  1.00 128.12 ? 228 LYS B C     1 
ATOM   3729 O  O     . LYS B 1 231 ? -25.431 26.570 24.057  1.00 129.15 ? 228 LYS B O     1 
ATOM   3730 C  CB    . LYS B 1 231 ? -24.059 29.574 24.709  1.00 125.57 ? 228 LYS B CB    1 
ATOM   3731 N  N     . ARG B 1 232 ? -26.849 28.007 25.058  1.00 129.62 ? 229 ARG B N     1 
ATOM   3732 C  CA    . ARG B 1 232 ? -27.713 26.929 25.571  1.00 132.51 ? 229 ARG B CA    1 
ATOM   3733 C  C     . ARG B 1 232 ? -28.289 26.125 24.407  1.00 132.19 ? 229 ARG B C     1 
ATOM   3734 O  O     . ARG B 1 232 ? -28.106 24.910 24.338  1.00 133.79 ? 229 ARG B O     1 
ATOM   3735 C  CB    . ARG B 1 232 ? -28.846 27.437 26.494  1.00 134.18 ? 229 ARG B CB    1 
ATOM   3736 C  CG    . ARG B 1 232 ? -29.389 26.351 27.479  1.00 138.11 ? 229 ARG B CG    1 
ATOM   3737 C  CD    . ARG B 1 232 ? -30.664 26.766 28.272  1.00 140.22 ? 229 ARG B CD    1 
ATOM   3738 N  NE    . ARG B 1 232 ? -31.917 26.204 27.734  1.00 140.18 ? 229 ARG B NE    1 
ATOM   3739 C  CZ    . ARG B 1 232 ? -32.681 25.294 28.349  1.00 142.12 ? 229 ARG B CZ    1 
ATOM   3740 N  NH1   . ARG B 1 232 ? -32.344 24.819 29.543  1.00 144.05 ? 229 ARG B NH1   1 
ATOM   3741 N  NH2   . ARG B 1 232 ? -33.796 24.861 27.769  1.00 142.02 ? 229 ARG B NH2   1 
ATOM   3742 N  N     . LEU B 1 233 ? -28.945 26.816 23.477  1.00 130.49 ? 230 LEU B N     1 
ATOM   3743 C  CA    . LEU B 1 233 ? -29.636 26.170 22.362  1.00 130.41 ? 230 LEU B CA    1 
ATOM   3744 C  C     . LEU B 1 233 ? -28.698 25.360 21.484  1.00 130.06 ? 230 LEU B C     1 
ATOM   3745 O  O     . LEU B 1 233 ? -29.119 24.388 20.858  1.00 131.03 ? 230 LEU B O     1 
ATOM   3746 C  CB    . LEU B 1 233 ? -30.400 27.197 21.527  1.00 128.33 ? 230 LEU B CB    1 
ATOM   3747 C  CG    . LEU B 1 233 ? -31.389 26.710 20.463  1.00 128.24 ? 230 LEU B CG    1 
ATOM   3748 C  CD1   . LEU B 1 233 ? -32.221 25.500 20.902  1.00 130.94 ? 230 LEU B CD1   1 
ATOM   3749 C  CD2   . LEU B 1 233 ? -32.293 27.864 20.070  1.00 127.02 ? 230 LEU B CD2   1 
ATOM   3750 N  N     . LEU B 1 234 ? -27.431 25.763 21.446  1.00 129.10 ? 231 LEU B N     1 
ATOM   3751 C  CA    . LEU B 1 234 ? -26.419 25.000 20.731  1.00 129.28 ? 231 LEU B CA    1 
ATOM   3752 C  C     . LEU B 1 234 ? -26.068 23.706 21.456  1.00 132.35 ? 231 LEU B C     1 
ATOM   3753 O  O     . LEU B 1 234 ? -26.159 22.636 20.861  1.00 133.41 ? 231 LEU B O     1 
ATOM   3754 C  CB    . LEU B 1 234 ? -25.169 25.837 20.438  1.00 127.07 ? 231 LEU B CB    1 
ATOM   3755 C  CG    . LEU B 1 234 ? -25.200 26.764 19.209  1.00 124.42 ? 231 LEU B CG    1 
ATOM   3756 C  CD1   . LEU B 1 234 ? -23.812 27.333 18.969  1.00 123.31 ? 231 LEU B CD1   1 
ATOM   3757 C  CD2   . LEU B 1 234 ? -25.694 26.081 17.937  1.00 123.18 ? 231 LEU B CD2   1 
ATOM   3758 N  N     . THR B 1 235 ? -25.702 23.795 22.735  1.00 134.26 ? 232 THR B N     1 
ATOM   3759 C  CA    . THR B 1 235 ? -25.369 22.596 23.515  1.00 137.74 ? 232 THR B CA    1 
ATOM   3760 C  C     . THR B 1 235 ? -26.546 21.635 23.539  1.00 140.66 ? 232 THR B C     1 
ATOM   3761 O  O     . THR B 1 235 ? -26.361 20.422 23.419  1.00 142.70 ? 232 THR B O     1 
ATOM   3762 C  CB    . THR B 1 235 ? -24.993 22.896 24.985  1.00 139.02 ? 232 THR B CB    1 
ATOM   3763 O  OG1   . THR B 1 235 ? -24.442 24.218 25.095  1.00 137.02 ? 232 THR B OG1   1 
ATOM   3764 C  CG2   . THR B 1 235 ? -23.969 21.867 25.493  1.00 140.72 ? 232 THR B CG2   1 
ATOM   3765 N  N     . LYS B 1 236 ? -27.747 22.191 23.696  1.00 141.43 ? 233 LYS B N     1 
ATOM   3766 C  CA    . LYS B 1 236 ? -28.970 21.405 23.794  1.00 144.59 ? 233 LYS B CA    1 
ATOM   3767 C  C     . LYS B 1 236 ? -29.099 20.458 22.607  1.00 145.48 ? 233 LYS B C     1 
ATOM   3768 O  O     . LYS B 1 236 ? -29.043 19.234 22.769  1.00 148.10 ? 233 LYS B O     1 
ATOM   3769 C  CB    . LYS B 1 236 ? -30.200 22.315 23.905  1.00 143.99 ? 233 LYS B CB    1 
ATOM   3770 N  N     . LEU B 1 237 ? -29.236 21.024 21.413  1.00 143.89 ? 234 LEU B N     1 
ATOM   3771 C  CA    . LEU B 1 237 ? -29.433 20.204 20.221  1.00 145.08 ? 234 LEU B CA    1 
ATOM   3772 C  C     . LEU B 1 237 ? -28.112 19.759 19.569  1.00 144.59 ? 234 LEU B C     1 
ATOM   3773 O  O     . LEU B 1 237 ? -28.116 19.057 18.554  1.00 145.23 ? 234 LEU B O     1 
ATOM   3774 C  CB    . LEU B 1 237 ? -30.400 20.882 19.227  1.00 143.74 ? 234 LEU B CB    1 
ATOM   3775 C  CG    . LEU B 1 237 ? -31.861 21.130 19.682  1.00 145.41 ? 234 LEU B CG    1 
ATOM   3776 C  CD1   . LEU B 1 237 ? -32.615 22.015 18.663  1.00 143.60 ? 234 LEU B CD1   1 
ATOM   3777 C  CD2   . LEU B 1 237 ? -32.662 19.830 20.010  1.00 148.45 ? 234 LEU B CD2   1 
ATOM   3778 N  N     . LEU B 1 238 ? -26.990 20.163 20.164  1.00 143.92 ? 235 LEU B N     1 
ATOM   3779 C  CA    . LEU B 1 238 ? -25.686 19.629 19.783  1.00 144.02 ? 235 LEU B CA    1 
ATOM   3780 C  C     . LEU B 1 238 ? -25.593 18.175 20.251  1.00 147.50 ? 235 LEU B C     1 
ATOM   3781 O  O     . LEU B 1 238 ? -25.502 17.274 19.424  1.00 148.58 ? 235 LEU B O     1 
ATOM   3782 C  CB    . LEU B 1 238 ? -24.547 20.488 20.345  1.00 142.38 ? 235 LEU B CB    1 
ATOM   3783 C  CG    . LEU B 1 238 ? -23.092 20.144 20.013  1.00 142.25 ? 235 LEU B CG    1 
ATOM   3784 C  CD1   . LEU B 1 238 ? -22.302 21.414 19.740  1.00 139.15 ? 235 LEU B CD1   1 
ATOM   3785 C  CD2   . LEU B 1 238 ? -22.442 19.306 21.132  1.00 144.91 ? 235 LEU B CD2   1 
ATOM   3786 N  N     . VAL B 1 239 ? -25.647 17.949 21.566  1.00 149.61 ? 236 VAL B N     1 
ATOM   3787 C  CA    . VAL B 1 239 ? -25.647 16.587 22.127  1.00 153.35 ? 236 VAL B CA    1 
ATOM   3788 C  C     . VAL B 1 239 ? -26.699 15.685 21.446  1.00 155.46 ? 236 VAL B C     1 
ATOM   3789 O  O     . VAL B 1 239 ? -27.758 16.165 21.005  1.00 154.75 ? 236 VAL B O     1 
ATOM   3790 C  CB    . VAL B 1 239 ? -25.833 16.589 23.679  1.00 155.32 ? 236 VAL B CB    1 
ATOM   3791 C  CG1   . VAL B 1 239 ? -27.317 16.698 24.071  1.00 156.04 ? 236 VAL B CG1   1 
ATOM   3792 C  CG2   . VAL B 1 239 ? -25.197 15.344 24.299  1.00 158.34 ? 236 VAL B CG2   1 
ATOM   3793 N  N     . GLY B 1 240 ? -26.393 14.390 21.349  1.00 158.14 ? 237 GLY B N     1 
ATOM   3794 C  CA    . GLY B 1 240 ? -27.252 13.448 20.634  1.00 160.14 ? 237 GLY B CA    1 
ATOM   3795 C  C     . GLY B 1 240 ? -26.918 13.359 19.152  1.00 158.71 ? 237 GLY B C     1 
ATOM   3796 O  O     . GLY B 1 240 ? -27.076 12.300 18.543  1.00 161.04 ? 237 GLY B O     1 
ATOM   3797 N  N     . ARG B 1 241 ? -26.485 14.477 18.566  1.00 155.09 ? 238 ARG B N     1 
ATOM   3798 C  CA    . ARG B 1 241 ? -25.953 14.512 17.195  1.00 153.54 ? 238 ARG B CA    1 
ATOM   3799 C  C     . ARG B 1 241 ? -24.817 15.547 17.097  1.00 150.24 ? 238 ARG B C     1 
ATOM   3800 O  O     . ARG B 1 241 ? -24.908 16.517 16.329  1.00 147.44 ? 238 ARG B O     1 
ATOM   3801 C  CB    . ARG B 1 241 ? -27.070 14.760 16.157  1.00 152.99 ? 238 ARG B CB    1 
ATOM   3802 C  CG    . ARG B 1 241 ? -27.539 16.214 16.002  1.00 149.82 ? 238 ARG B CG    1 
ATOM   3803 C  CD    . ARG B 1 241 ? -29.023 16.313 15.686  1.00 150.52 ? 238 ARG B CD    1 
ATOM   3804 N  NE    . ARG B 1 241 ? -29.819 16.206 16.908  1.00 152.86 ? 238 ARG B NE    1 
ATOM   3805 C  CZ    . ARG B 1 241 ? -31.072 16.634 17.042  1.00 153.16 ? 238 ARG B CZ    1 
ATOM   3806 N  NH1   . ARG B 1 241 ? -31.695 17.211 16.018  1.00 151.19 ? 238 ARG B NH1   1 
ATOM   3807 N  NH2   . ARG B 1 241 ? -31.700 16.485 18.207  1.00 154.95 ? 238 ARG B NH2   1 
ATOM   3808 N  N     . PRO B 1 242 ? -23.731 15.337 17.878  1.00 150.65 ? 239 PRO B N     1 
ATOM   3809 C  CA    . PRO B 1 242 ? -22.673 16.355 18.023  1.00 147.80 ? 239 PRO B CA    1 
ATOM   3810 C  C     . PRO B 1 242 ? -21.932 16.613 16.717  1.00 145.70 ? 239 PRO B C     1 
ATOM   3811 O  O     . PRO B 1 242 ? -21.189 17.591 16.600  1.00 143.25 ? 239 PRO B O     1 
ATOM   3812 C  CB    . PRO B 1 242 ? -21.725 15.726 19.048  1.00 149.77 ? 239 PRO B CB    1 
ATOM   3813 C  CG    . PRO B 1 242 ? -21.900 14.254 18.857  1.00 153.21 ? 239 PRO B CG    1 
ATOM   3814 C  CD    . PRO B 1 242 ? -23.359 14.068 18.537  1.00 153.96 ? 239 PRO B CD    1 
ATOM   3815 N  N     . THR B 1 243 ? -22.168 15.729 15.750  1.00 146.76 ? 240 THR B N     1 
ATOM   3816 C  CA    . THR B 1 243 ? -21.456 15.693 14.481  1.00 145.32 ? 240 THR B CA    1 
ATOM   3817 C  C     . THR B 1 243 ? -22.232 16.342 13.323  1.00 143.05 ? 240 THR B C     1 
ATOM   3818 O  O     . THR B 1 243 ? -21.653 16.616 12.273  1.00 141.84 ? 240 THR B O     1 
ATOM   3819 C  CB    . THR B 1 243 ? -21.079 14.227 14.119  1.00 148.61 ? 240 THR B CB    1 
ATOM   3820 O  OG1   . THR B 1 243 ? -20.532 14.187 12.797  1.00 148.28 ? 240 THR B OG1   1 
ATOM   3821 C  CG2   . THR B 1 243 ? -22.301 13.282 14.210  1.00 151.07 ? 240 THR B CG2   1 
ATOM   3822 N  N     . LYS B 1 244 ? -23.527 16.584 13.518  1.00 142.36 ? 241 LYS B N     1 
ATOM   3823 C  CA    . LYS B 1 244 ? -24.396 17.060 12.438  1.00 140.66 ? 241 LYS B CA    1 
ATOM   3824 C  C     . LYS B 1 244 ? -25.094 18.397 12.745  1.00 137.72 ? 241 LYS B C     1 
ATOM   3825 O  O     . LYS B 1 244 ? -26.253 18.599 12.375  1.00 137.56 ? 241 LYS B O     1 
ATOM   3826 C  CB    . LYS B 1 244 ? -25.419 15.974 12.071  1.00 143.47 ? 241 LYS B CB    1 
ATOM   3827 N  N     . TRP B 1 245 ? -24.371 19.306 13.403  1.00 135.31 ? 242 TRP B N     1 
ATOM   3828 C  CA    . TRP B 1 245 ? -24.909 20.616 13.809  1.00 132.66 ? 242 TRP B CA    1 
ATOM   3829 C  C     . TRP B 1 245 ? -24.879 21.663 12.704  1.00 130.05 ? 242 TRP B C     1 
ATOM   3830 O  O     . TRP B 1 245 ? -25.423 22.758 12.852  1.00 128.36 ? 242 TRP B O     1 
ATOM   3831 C  CB    . TRP B 1 245 ? -24.149 21.168 15.017  1.00 131.84 ? 242 TRP B CB    1 
ATOM   3832 C  CG    . TRP B 1 245 ? -22.673 21.278 14.801  1.00 130.57 ? 242 TRP B CG    1 
ATOM   3833 C  CD1   . TRP B 1 245 ? -21.742 20.334 15.104  1.00 132.60 ? 242 TRP B CD1   1 
ATOM   3834 C  CD2   . TRP B 1 245 ? -21.948 22.388 14.238  1.00 127.28 ? 242 TRP B CD2   1 
ATOM   3835 N  NE1   . TRP B 1 245 ? -20.484 20.777 14.770  1.00 130.79 ? 242 TRP B NE1   1 
ATOM   3836 C  CE2   . TRP B 1 245 ? -20.580 22.034 14.236  1.00 127.48 ? 242 TRP B CE2   1 
ATOM   3837 C  CE3   . TRP B 1 245 ? -22.318 23.640 13.739  1.00 124.58 ? 242 TRP B CE3   1 
ATOM   3838 C  CZ2   . TRP B 1 245 ? -19.580 22.887 13.753  1.00 124.89 ? 242 TRP B CZ2   1 
ATOM   3839 C  CZ3   . TRP B 1 245 ? -21.315 24.489 13.256  1.00 122.29 ? 242 TRP B CZ3   1 
ATOM   3840 C  CH2   . TRP B 1 245 ? -19.966 24.104 13.270  1.00 122.17 ? 242 TRP B CH2   1 
ATOM   3841 N  N     . TYR B 1 246 ? -24.214 21.334 11.605  1.00 129.90 ? 243 TYR B N     1 
ATOM   3842 C  CA    . TYR B 1 246 ? -24.089 22.257 10.484  1.00 127.45 ? 243 TYR B CA    1 
ATOM   3843 C  C     . TYR B 1 246 ? -25.429 22.428 9.775   1.00 126.76 ? 243 TYR B C     1 
ATOM   3844 O  O     . TYR B 1 246 ? -25.892 23.546 9.580   1.00 124.90 ? 243 TYR B O     1 
ATOM   3845 C  CB    . TYR B 1 246 ? -23.033 21.743 9.510   1.00 128.22 ? 243 TYR B CB    1 
ATOM   3846 C  CG    . TYR B 1 246 ? -22.855 22.594 8.284   1.00 127.48 ? 243 TYR B CG    1 
ATOM   3847 C  CD1   . TYR B 1 246 ? -21.695 23.339 8.099   1.00 126.73 ? 243 TYR B CD1   1 
ATOM   3848 C  CD2   . TYR B 1 246 ? -23.844 22.648 7.298   1.00 128.62 ? 243 TYR B CD2   1 
ATOM   3849 C  CE1   . TYR B 1 246 ? -21.523 24.123 6.968   1.00 126.10 ? 243 TYR B CE1   1 
ATOM   3850 C  CE2   . TYR B 1 246 ? -23.687 23.431 6.172   1.00 127.90 ? 243 TYR B CE2   1 
ATOM   3851 C  CZ    . TYR B 1 246 ? -22.523 24.163 6.010   1.00 126.57 ? 243 TYR B CZ    1 
ATOM   3852 O  OH    . TYR B 1 246 ? -22.361 24.933 4.885   1.00 126.22 ? 243 TYR B OH    1 
ATOM   3853 N  N     . ASP B 1 247 ? -26.037 21.304 9.404   1.00 128.24 ? 244 ASP B N     1 
ATOM   3854 C  CA    . ASP B 1 247 ? -27.319 21.279 8.703   1.00 128.02 ? 244 ASP B CA    1 
ATOM   3855 C  C     . ASP B 1 247 ? -28.440 21.856 9.565   1.00 126.41 ? 244 ASP B C     1 
ATOM   3856 O  O     . ASP B 1 247 ? -29.491 22.252 9.057   1.00 126.16 ? 244 ASP B O     1 
ATOM   3857 C  CB    . ASP B 1 247 ? -27.676 19.842 8.287   1.00 131.63 ? 244 ASP B CB    1 
ATOM   3858 C  CG    . ASP B 1 247 ? -26.493 19.087 7.672   1.00 134.09 ? 244 ASP B CG    1 
ATOM   3859 O  OD1   . ASP B 1 247 ? -26.445 18.962 6.427   1.00 135.62 ? 244 ASP B OD1   1 
ATOM   3860 O  OD2   . ASP B 1 247 ? -25.612 18.620 8.434   1.00 136.50 ? 244 ASP B OD2   1 
ATOM   3861 N  N     . LEU B 1 248 ? -28.210 21.909 10.870  1.00 124.93 ? 245 LEU B N     1 
ATOM   3862 C  CA    . LEU B 1 248 ? -29.204 22.441 11.788  1.00 123.45 ? 245 LEU B CA    1 
ATOM   3863 C  C     . LEU B 1 248 ? -29.187 23.960 11.949  1.00 119.89 ? 245 LEU B C     1 
ATOM   3864 O  O     . LEU B 1 248 ? -30.183 24.546 12.382  1.00 119.72 ? 245 LEU B O     1 
ATOM   3865 C  CB    . LEU B 1 248 ? -29.074 21.774 13.152  1.00 125.07 ? 245 LEU B CB    1 
ATOM   3866 C  CG    . LEU B 1 248 ? -29.665 20.375 13.254  1.00 127.94 ? 245 LEU B CG    1 
ATOM   3867 C  CD1   . LEU B 1 248 ? -29.794 20.021 14.730  1.00 129.62 ? 245 LEU B CD1   1 
ATOM   3868 C  CD2   . LEU B 1 248 ? -31.016 20.279 12.531  1.00 127.60 ? 245 LEU B CD2   1 
ATOM   3869 N  N     . LEU B 1 249 ? -28.066 24.592 11.606  1.00 116.73 ? 246 LEU B N     1 
ATOM   3870 C  CA    . LEU B 1 249 ? -27.917 26.037 11.784  1.00 113.14 ? 246 LEU B CA    1 
ATOM   3871 C  C     . LEU B 1 249 ? -29.074 26.884 11.224  1.00 111.50 ? 246 LEU B C     1 
ATOM   3872 O  O     . LEU B 1 249 ? -29.500 27.820 11.887  1.00 110.89 ? 246 LEU B O     1 
ATOM   3873 C  CB    . LEU B 1 249 ? -26.572 26.535 11.254  1.00 111.56 ? 246 LEU B CB    1 
ATOM   3874 C  CG    . LEU B 1 249 ? -25.306 26.329 12.084  1.00 111.22 ? 246 LEU B CG    1 
ATOM   3875 C  CD1   . LEU B 1 249 ? -24.159 26.982 11.352  1.00 109.95 ? 246 LEU B CD1   1 
ATOM   3876 C  CD2   . LEU B 1 249 ? -25.418 26.927 13.467  1.00 110.79 ? 246 LEU B CD2   1 
ATOM   3877 N  N     . PRO B 1 250 ? -29.589 26.565 10.015  1.00 110.91 ? 247 PRO B N     1 
ATOM   3878 C  CA    . PRO B 1 250 ? -30.797 27.260 9.550   1.00 109.85 ? 247 PRO B CA    1 
ATOM   3879 C  C     . PRO B 1 250 ? -31.959 27.181 10.548  1.00 110.39 ? 247 PRO B C     1 
ATOM   3880 O  O     . PRO B 1 250 ? -32.557 28.199 10.893  1.00 109.48 ? 247 PRO B O     1 
ATOM   3881 C  CB    . PRO B 1 250 ? -31.172 26.498 8.276   1.00 110.84 ? 247 PRO B CB    1 
ATOM   3882 C  CG    . PRO B 1 250 ? -29.911 25.971 7.776   1.00 111.17 ? 247 PRO B CG    1 
ATOM   3883 C  CD    . PRO B 1 250 ? -29.050 25.673 8.974   1.00 111.65 ? 247 PRO B CD    1 
ATOM   3884 N  N     . VAL B 1 251 ? -32.259 25.975 11.013  1.00 111.91 ? 248 VAL B N     1 
ATOM   3885 C  CA    . VAL B 1 251 ? -33.366 25.753 11.945  1.00 112.73 ? 248 VAL B CA    1 
ATOM   3886 C  C     . VAL B 1 251 ? -33.170 26.521 13.238  1.00 111.46 ? 248 VAL B C     1 
ATOM   3887 O  O     . VAL B 1 251 ? -34.123 27.055 13.792  1.00 111.93 ? 248 VAL B O     1 
ATOM   3888 C  CB    . VAL B 1 251 ? -33.548 24.260 12.305  1.00 115.43 ? 248 VAL B CB    1 
ATOM   3889 C  CG1   . VAL B 1 251 ? -34.892 24.060 12.977  1.00 116.93 ? 248 VAL B CG1   1 
ATOM   3890 C  CG2   . VAL B 1 251 ? -33.428 23.367 11.061  1.00 116.37 ? 248 VAL B CG2   1 
ATOM   3891 N  N     . VAL B 1 252 ? -31.932 26.556 13.716  1.00 109.89 ? 249 VAL B N     1 
ATOM   3892 C  CA    . VAL B 1 252 ? -31.598 27.274 14.932  1.00 108.89 ? 249 VAL B CA    1 
ATOM   3893 C  C     . VAL B 1 252 ? -31.815 28.767 14.730  1.00 106.73 ? 249 VAL B C     1 
ATOM   3894 O  O     . VAL B 1 252 ? -32.553 29.404 15.476  1.00 107.16 ? 249 VAL B O     1 
ATOM   3895 C  CB    . VAL B 1 252 ? -30.137 27.011 15.343  1.00 108.46 ? 249 VAL B CB    1 
ATOM   3896 C  CG1   . VAL B 1 252 ? -29.727 27.915 16.499  1.00 107.62 ? 249 VAL B CG1   1 
ATOM   3897 C  CG2   . VAL B 1 252 ? -29.946 25.551 15.706  1.00 110.29 ? 249 VAL B CG2   1 
ATOM   3898 N  N     . GLN B 1 253 ? -31.170 29.312 13.709  1.00 104.61 ? 250 GLN B N     1 
ATOM   3899 C  CA    . GLN B 1 253 ? -31.266 30.726 13.405  1.00 102.83 ? 250 GLN B CA    1 
ATOM   3900 C  C     . GLN B 1 253 ? -32.742 31.118 13.362  1.00 103.06 ? 250 GLN B C     1 
ATOM   3901 O  O     . GLN B 1 253 ? -33.157 32.050 14.039  1.00 102.75 ? 250 GLN B O     1 
ATOM   3902 C  CB    . GLN B 1 253 ? -30.563 31.023 12.075  1.00 101.43 ? 250 GLN B CB    1 
ATOM   3903 C  CG    . GLN B 1 253 ? -29.743 32.284 12.072  1.00 101.04 ? 250 GLN B CG    1 
ATOM   3904 C  CD    . GLN B 1 253 ? -29.094 32.549 10.725  1.00 103.25 ? 250 GLN B CD    1 
ATOM   3905 O  OE1   . GLN B 1 253 ? -27.971 32.104 10.480  1.00 105.35 ? 250 GLN B OE1   1 
ATOM   3906 N  NE2   . GLN B 1 253 ? -29.799 33.271 9.837   1.00 103.70 ? 250 GLN B NE2   1 
ATOM   3907 N  N     . LEU B 1 254 ? -33.528 30.364 12.596  1.00 103.82 ? 251 LEU B N     1 
ATOM   3908 C  CA    . LEU B 1 254 ? -34.969 30.586 12.462  1.00 104.63 ? 251 LEU B CA    1 
ATOM   3909 C  C     . LEU B 1 254 ? -35.709 30.611 13.799  1.00 106.37 ? 251 LEU B C     1 
ATOM   3910 O  O     . LEU B 1 254 ? -36.589 31.443 14.016  1.00 106.34 ? 251 LEU B O     1 
ATOM   3911 C  CB    . LEU B 1 254 ? -35.598 29.505 11.575  1.00 105.76 ? 251 LEU B CB    1 
ATOM   3912 C  CG    . LEU B 1 254 ? -35.762 29.694 10.067  1.00 104.55 ? 251 LEU B CG    1 
ATOM   3913 C  CD1   . LEU B 1 254 ? -36.363 28.431 9.504   1.00 105.57 ? 251 LEU B CD1   1 
ATOM   3914 C  CD2   . LEU B 1 254 ? -36.629 30.909 9.705   1.00 103.48 ? 251 LEU B CD2   1 
ATOM   3915 N  N     . ALA B 1 255 ? -35.356 29.676 14.676  1.00 108.31 ? 252 ALA B N     1 
ATOM   3916 C  CA    . ALA B 1 255 ? -35.992 29.535 15.983  1.00 110.54 ? 252 ALA B CA    1 
ATOM   3917 C  C     . ALA B 1 255 ? -35.675 30.748 16.839  1.00 110.09 ? 252 ALA B C     1 
ATOM   3918 O  O     . ALA B 1 255 ? -36.572 31.392 17.365  1.00 110.70 ? 252 ALA B O     1 
ATOM   3919 C  CB    . ALA B 1 255 ? -35.525 28.263 16.662  1.00 111.91 ? 252 ALA B CB    1 
ATOM   3920 N  N     . LEU B 1 256 ? -34.390 31.066 16.946  1.00 109.56 ? 253 LEU B N     1 
ATOM   3921 C  CA    . LEU B 1 256 ? -33.925 32.212 17.717  1.00 109.76 ? 253 LEU B CA    1 
ATOM   3922 C  C     . LEU B 1 256 ? -34.603 33.504 17.308  1.00 109.54 ? 253 LEU B C     1 
ATOM   3923 O  O     . LEU B 1 256 ? -35.109 34.239 18.152  1.00 110.56 ? 253 LEU B O     1 
ATOM   3924 C  CB    . LEU B 1 256 ? -32.414 32.380 17.561  1.00 108.10 ? 253 LEU B CB    1 
ATOM   3925 C  CG    . LEU B 1 256 ? -31.513 31.294 18.137  1.00 109.10 ? 253 LEU B CG    1 
ATOM   3926 C  CD1   . LEU B 1 256 ? -30.132 31.485 17.577  1.00 107.70 ? 253 LEU B CD1   1 
ATOM   3927 C  CD2   . LEU B 1 256 ? -31.493 31.348 19.658  1.00 110.99 ? 253 LEU B CD2   1 
ATOM   3928 N  N     . ASN B 1 257 ? -34.614 33.770 16.010  1.00 109.03 ? 254 ASN B N     1 
ATOM   3929 C  CA    . ASN B 1 257 ? -35.112 35.034 15.499  1.00 109.20 ? 254 ASN B CA    1 
ATOM   3930 C  C     . ASN B 1 257 ? -36.629 35.172 15.568  1.00 111.67 ? 254 ASN B C     1 
ATOM   3931 O  O     . ASN B 1 257 ? -37.162 36.281 15.584  1.00 111.47 ? 254 ASN B O     1 
ATOM   3932 C  CB    . ASN B 1 257 ? -34.593 35.270 14.082  1.00 107.21 ? 254 ASN B CB    1 
ATOM   3933 C  CG    . ASN B 1 257 ? -33.114 35.594 14.058  1.00 105.57 ? 254 ASN B CG    1 
ATOM   3934 O  OD1   . ASN B 1 257 ? -32.599 36.278 14.956  1.00 105.48 ? 254 ASN B OD1   1 
ATOM   3935 N  ND2   . ASN B 1 257 ? -32.418 35.092 13.044  1.00 103.29 ? 254 ASN B ND2   1 
ATOM   3936 N  N     . ASN B 1 258 ? -37.318 34.041 15.630  1.00 114.83 ? 255 ASN B N     1 
ATOM   3937 C  CA    . ASN B 1 258 ? -38.765 34.048 15.785  1.00 118.06 ? 255 ASN B CA    1 
ATOM   3938 C  C     . ASN B 1 258 ? -39.248 33.754 17.204  1.00 121.49 ? 255 ASN B C     1 
ATOM   3939 O  O     . ASN B 1 258 ? -40.376 33.289 17.410  1.00 123.72 ? 255 ASN B O     1 
ATOM   3940 C  CB    . ASN B 1 258 ? -39.400 33.102 14.780  1.00 118.57 ? 255 ASN B CB    1 
ATOM   3941 C  CG    . ASN B 1 258 ? -39.792 33.805 13.532  1.00 117.49 ? 255 ASN B CG    1 
ATOM   3942 O  OD1   . ASN B 1 258 ? -40.630 34.703 13.563  1.00 118.08 ? 255 ASN B OD1   1 
ATOM   3943 N  ND2   . ASN B 1 258 ? -39.183 33.426 12.419  1.00 117.10 ? 255 ASN B ND2   1 
ATOM   3944 N  N     . THR B 1 259 ? -38.396 34.050 18.180  1.00 122.80 ? 256 THR B N     1 
ATOM   3945 C  CA    . THR B 1 259 ? -38.718 33.782 19.576  1.00 126.58 ? 256 THR B CA    1 
ATOM   3946 C  C     . THR B 1 259 ? -39.031 35.074 20.322  1.00 128.02 ? 256 THR B C     1 
ATOM   3947 O  O     . THR B 1 259 ? -38.222 36.012 20.335  1.00 126.51 ? 256 THR B O     1 
ATOM   3948 C  CB    . THR B 1 259 ? -37.592 32.958 20.266  1.00 126.78 ? 256 THR B CB    1 
ATOM   3949 O  OG1   . THR B 1 259 ? -37.728 31.580 19.899  1.00 128.04 ? 256 THR B OG1   1 
ATOM   3950 C  CG2   . THR B 1 259 ? -37.667 33.059 21.786  1.00 128.91 ? 256 THR B CG2   1 
ATOM   3951 N  N     . TYR B 1 260 ? -40.219 35.106 20.929  1.00 131.78 ? 257 TYR B N     1 
ATOM   3952 C  CA    . TYR B 1 260 ? -40.698 36.254 21.717  1.00 134.37 ? 257 TYR B CA    1 
ATOM   3953 C  C     . TYR B 1 260 ? -39.731 36.690 22.827  1.00 135.08 ? 257 TYR B C     1 
ATOM   3954 O  O     . TYR B 1 260 ? -39.425 35.897 23.730  1.00 136.82 ? 257 TYR B O     1 
ATOM   3955 C  CB    . TYR B 1 260 ? -42.095 35.959 22.309  1.00 137.56 ? 257 TYR B CB    1 
ATOM   3956 C  CG    . TYR B 1 260 ? -43.193 36.046 21.274  1.00 139.89 ? 257 TYR B CG    1 
ATOM   3957 C  CD1   . TYR B 1 260 ? -43.816 37.270 21.001  1.00 141.53 ? 257 TYR B CD1   1 
ATOM   3958 C  CD2   . TYR B 1 260 ? -43.589 34.914 20.531  1.00 142.34 ? 257 TYR B CD2   1 
ATOM   3959 C  CE1   . TYR B 1 260 ? -44.817 37.373 20.022  1.00 142.92 ? 257 TYR B CE1   1 
ATOM   3960 C  CE2   . TYR B 1 260 ? -44.596 35.006 19.546  1.00 143.51 ? 257 TYR B CE2   1 
ATOM   3961 C  CZ    . TYR B 1 260 ? -45.199 36.244 19.304  1.00 143.70 ? 257 TYR B CZ    1 
ATOM   3962 O  OH    . TYR B 1 260 ? -46.185 36.368 18.356  1.00 144.96 ? 257 TYR B OH    1 
ATOM   3963 N  N     . SER B 1 261 ? -39.244 37.936 22.741  1.00 134.54 ? 258 SER B N     1 
ATOM   3964 C  CA    . SER B 1 261 ? -38.547 38.592 23.868  1.00 135.91 ? 258 SER B CA    1 
ATOM   3965 C  C     . SER B 1 261 ? -39.566 39.028 24.952  1.00 139.20 ? 258 SER B C     1 
ATOM   3966 O  O     . SER B 1 261 ? -40.659 39.520 24.612  1.00 139.79 ? 258 SER B O     1 
ATOM   3967 C  CB    . SER B 1 261 ? -37.694 39.790 23.404  1.00 133.79 ? 258 SER B CB    1 
ATOM   3968 O  OG    . SER B 1 261 ? -36.945 40.345 24.489  1.00 134.49 ? 258 SER B OG    1 
ATOM   3969 N  N     . PRO B 1 262 ? -39.221 38.827 26.253  1.00 141.41 ? 259 PRO B N     1 
ATOM   3970 C  CA    . PRO B 1 262 ? -40.125 39.199 27.355  1.00 144.61 ? 259 PRO B CA    1 
ATOM   3971 C  C     . PRO B 1 262 ? -40.486 40.684 27.313  1.00 144.65 ? 259 PRO B C     1 
ATOM   3972 O  O     . PRO B 1 262 ? -41.641 41.044 27.601  1.00 146.81 ? 259 PRO B O     1 
ATOM   3973 C  CB    . PRO B 1 262 ? -39.313 38.866 28.614  1.00 146.26 ? 259 PRO B CB    1 
ATOM   3974 C  CG    . PRO B 1 262 ? -38.326 37.830 28.166  1.00 144.53 ? 259 PRO B CG    1 
ATOM   3975 C  CD    . PRO B 1 262 ? -37.972 38.215 26.758  1.00 141.20 ? 259 PRO B CD    1 
ATOM   3976 N  N     . VAL B 1 263 ? -39.507 41.527 26.954  1.00 142.47 ? 260 VAL B N     1 
ATOM   3977 C  CA    . VAL B 1 263 ? -39.776 42.927 26.616  1.00 141.80 ? 260 VAL B CA    1 
ATOM   3978 C  C     . VAL B 1 263 ? -40.241 42.985 25.161  1.00 139.38 ? 260 VAL B C     1 
ATOM   3979 O  O     . VAL B 1 263 ? -39.747 42.224 24.307  1.00 136.98 ? 260 VAL B O     1 
ATOM   3980 C  CB    . VAL B 1 263 ? -38.542 43.867 26.803  1.00 140.85 ? 260 VAL B CB    1 
ATOM   3981 C  CG1   . VAL B 1 263 ? -38.996 45.336 26.899  1.00 141.54 ? 260 VAL B CG1   1 
ATOM   3982 C  CG2   . VAL B 1 263 ? -37.729 43.480 28.035  1.00 142.10 ? 260 VAL B CG2   1 
ATOM   3983 N  N     . LEU B 1 264 ? -41.201 43.883 24.906  1.00 139.84 ? 261 LEU B N     1 
ATOM   3984 C  CA    . LEU B 1 264 ? -41.742 44.181 23.565  1.00 137.62 ? 261 LEU B CA    1 
ATOM   3985 C  C     . LEU B 1 264 ? -42.833 43.203 23.138  1.00 137.54 ? 261 LEU B C     1 
ATOM   3986 O  O     . LEU B 1 264 ? -43.730 43.564 22.371  1.00 137.27 ? 261 LEU B O     1 
ATOM   3987 C  CB    . LEU B 1 264 ? -40.625 44.231 22.505  1.00 134.70 ? 261 LEU B CB    1 
ATOM   3988 C  CG    . LEU B 1 264 ? -39.345 45.023 22.857  1.00 134.61 ? 261 LEU B CG    1 
ATOM   3989 C  CD1   . LEU B 1 264 ? -38.068 44.358 22.300  1.00 132.19 ? 261 LEU B CD1   1 
ATOM   3990 C  CD2   . LEU B 1 264 ? -39.463 46.495 22.442  1.00 135.05 ? 261 LEU B CD2   1 
ATOM   3991 N  N     . LYS B 1 265 ? -42.758 41.980 23.675  1.00 137.65 ? 262 LYS B N     1 
ATOM   3992 C  CA    . LYS B 1 265 ? -43.492 40.809 23.165  1.00 137.07 ? 262 LYS B CA    1 
ATOM   3993 C  C     . LYS B 1 265 ? -43.389 40.753 21.629  1.00 133.55 ? 262 LYS B C     1 
ATOM   3994 O  O     . LYS B 1 265 ? -44.387 40.543 20.922  1.00 133.84 ? 262 LYS B O     1 
ATOM   3995 C  CB    . LYS B 1 265 ? -44.948 40.754 23.679  1.00 140.17 ? 262 LYS B CB    1 
ATOM   3996 N  N     . TYR B 1 266 ? -42.162 40.974 21.142  1.00 129.76 ? 263 TYR B N     1 
ATOM   3997 C  CA    . TYR B 1 266 ? -41.842 40.908 19.713  1.00 126.25 ? 263 TYR B CA    1 
ATOM   3998 C  C     . TYR B 1 266 ? -40.679 39.977 19.422  1.00 123.62 ? 263 TYR B C     1 
ATOM   3999 O  O     . TYR B 1 266 ? -39.662 39.980 20.124  1.00 123.54 ? 263 TYR B O     1 
ATOM   4000 C  CB    . TYR B 1 266 ? -41.522 42.289 19.137  1.00 124.84 ? 263 TYR B CB    1 
ATOM   4001 C  CG    . TYR B 1 266 ? -42.719 43.192 18.993  1.00 127.09 ? 263 TYR B CG    1 
ATOM   4002 C  CD1   . TYR B 1 266 ? -43.940 42.701 18.516  1.00 129.08 ? 263 TYR B CD1   1 
ATOM   4003 C  CD2   . TYR B 1 266 ? -42.634 44.544 19.313  1.00 128.48 ? 263 TYR B CD2   1 
ATOM   4004 C  CE1   . TYR B 1 266 ? -45.050 43.527 18.381  1.00 130.57 ? 263 TYR B CE1   1 
ATOM   4005 C  CE2   . TYR B 1 266 ? -43.737 45.383 19.173  1.00 130.35 ? 263 TYR B CE2   1 
ATOM   4006 C  CZ    . TYR B 1 266 ? -44.941 44.866 18.710  1.00 131.15 ? 263 TYR B CZ    1 
ATOM   4007 O  OH    . TYR B 1 266 ? -46.032 45.688 18.576  1.00 132.70 ? 263 TYR B OH    1 
ATOM   4008 N  N     . THR B 1 267 ? -40.836 39.180 18.379  1.00 121.34 ? 264 THR B N     1 
ATOM   4009 C  CA    . THR B 1 267 ? -39.739 38.385 17.887  1.00 118.61 ? 264 THR B CA    1 
ATOM   4010 C  C     . THR B 1 267 ? -38.757 39.351 17.211  1.00 115.35 ? 264 THR B C     1 
ATOM   4011 O  O     . THR B 1 267 ? -39.184 40.347 16.623  1.00 114.93 ? 264 THR B O     1 
ATOM   4012 C  CB    . THR B 1 267 ? -40.238 37.288 16.910  1.00 118.83 ? 264 THR B CB    1 
ATOM   4013 O  OG1   . THR B 1 267 ? -40.782 37.885 15.721  1.00 117.98 ? 264 THR B OG1   1 
ATOM   4014 C  CG2   . THR B 1 267 ? -41.314 36.431 17.582  1.00 121.36 ? 264 THR B CG2   1 
ATOM   4015 N  N     . PRO B 1 268 ? -37.441 39.096 17.331  1.00 113.04 ? 265 PRO B N     1 
ATOM   4016 C  CA    . PRO B 1 268 ? -36.493 39.865 16.535  1.00 110.20 ? 265 PRO B CA    1 
ATOM   4017 C  C     . PRO B 1 268 ? -36.951 39.990 15.077  1.00 108.36 ? 265 PRO B C     1 
ATOM   4018 O  O     . PRO B 1 268 ? -36.816 41.056 14.475  1.00 107.56 ? 265 PRO B O     1 
ATOM   4019 C  CB    . PRO B 1 268 ? -35.219 39.029 16.620  1.00 109.36 ? 265 PRO B CB    1 
ATOM   4020 C  CG    . PRO B 1 268 ? -35.309 38.349 17.936  1.00 111.50 ? 265 PRO B CG    1 
ATOM   4021 C  CD    . PRO B 1 268 ? -36.757 38.259 18.332  1.00 113.73 ? 265 PRO B CD    1 
ATOM   4022 N  N     . HIS B 1 269 ? -37.506 38.909 14.535  1.00 107.61 ? 266 HIS B N     1 
ATOM   4023 C  CA    . HIS B 1 269 ? -38.046 38.900 13.190  1.00 105.97 ? 266 HIS B CA    1 
ATOM   4024 C  C     . HIS B 1 269 ? -39.021 40.043 12.994  1.00 105.85 ? 266 HIS B C     1 
ATOM   4025 O  O     . HIS B 1 269 ? -38.920 40.795 12.030  1.00 104.87 ? 266 HIS B O     1 
ATOM   4026 C  CB    . HIS B 1 269 ? -38.744 37.572 12.919  1.00 107.07 ? 266 HIS B CB    1 
ATOM   4027 C  CG    . HIS B 1 269 ? -39.360 37.479 11.559  1.00 106.82 ? 266 HIS B CG    1 
ATOM   4028 N  ND1   . HIS B 1 269 ? -40.497 38.177 11.209  1.00 107.21 ? 266 HIS B ND1   1 
ATOM   4029 C  CD2   . HIS B 1 269 ? -39.008 36.757 10.466  1.00 106.30 ? 266 HIS B CD2   1 
ATOM   4030 C  CE1   . HIS B 1 269 ? -40.815 37.897 9.958   1.00 107.61 ? 266 HIS B CE1   1 
ATOM   4031 N  NE2   . HIS B 1 269 ? -39.927 37.037 9.485   1.00 107.46 ? 266 HIS B NE2   1 
ATOM   4032 N  N     . GLN B 1 270 ? -39.962 40.175 13.914  1.00 106.95 ? 267 GLN B N     1 
ATOM   4033 C  CA    . GLN B 1 270 ? -40.967 41.220 13.811  1.00 107.34 ? 267 GLN B CA    1 
ATOM   4034 C  C     . GLN B 1 270 ? -40.357 42.616 13.817  1.00 105.82 ? 267 GLN B C     1 
ATOM   4035 O  O     . GLN B 1 270 ? -40.740 43.461 13.017  1.00 105.29 ? 267 GLN B O     1 
ATOM   4036 C  CB    . GLN B 1 270 ? -41.997 41.088 14.928  1.00 109.91 ? 267 GLN B CB    1 
ATOM   4037 C  CG    . GLN B 1 270 ? -43.107 40.110 14.631  1.00 111.99 ? 267 GLN B CG    1 
ATOM   4038 C  CD    . GLN B 1 270 ? -43.797 39.634 15.887  1.00 115.97 ? 267 GLN B CD    1 
ATOM   4039 O  OE1   . GLN B 1 270 ? -43.516 40.110 16.986  1.00 116.89 ? 267 GLN B OE1   1 
ATOM   4040 N  NE2   . GLN B 1 270 ? -44.704 38.676 15.732  1.00 118.96 ? 267 GLN B NE2   1 
ATOM   4041 N  N     . LEU B 1 271 ? -39.403 42.849 14.710  1.00 105.04 ? 268 LEU B N     1 
ATOM   4042 C  CA    . LEU B 1 271 ? -38.761 44.156 14.811  1.00 104.21 ? 268 LEU B CA    1 
ATOM   4043 C  C     . LEU B 1 271 ? -37.979 44.540 13.558  1.00 101.87 ? 268 LEU B C     1 
ATOM   4044 O  O     . LEU B 1 271 ? -37.888 45.719 13.217  1.00 101.62 ? 268 LEU B O     1 
ATOM   4045 C  CB    . LEU B 1 271 ? -37.839 44.212 16.029  1.00 104.75 ? 268 LEU B CB    1 
ATOM   4046 C  CG    . LEU B 1 271 ? -38.528 44.226 17.395  1.00 107.88 ? 268 LEU B CG    1 
ATOM   4047 C  CD1   . LEU B 1 271 ? -37.495 44.321 18.527  1.00 108.83 ? 268 LEU B CD1   1 
ATOM   4048 C  CD2   . LEU B 1 271 ? -39.545 45.373 17.480  1.00 109.94 ? 268 LEU B CD2   1 
ATOM   4049 N  N     . LEU B 1 272 ? -37.418 43.545 12.881  1.00 100.11 ? 269 LEU B N     1 
ATOM   4050 C  CA    . LEU B 1 272 ? -36.646 43.795 11.684  1.00 98.12  ? 269 LEU B CA    1 
ATOM   4051 C  C     . LEU B 1 272 ? -37.549 44.052 10.488  1.00 98.25  ? 269 LEU B C     1 
ATOM   4052 O  O     . LEU B 1 272 ? -37.354 45.017 9.761   1.00 97.69  ? 269 LEU B O     1 
ATOM   4053 C  CB    . LEU B 1 272 ? -35.712 42.623 11.401  1.00 97.06  ? 269 LEU B CB    1 
ATOM   4054 C  CG    . LEU B 1 272 ? -34.661 42.825 10.305  1.00 95.11  ? 269 LEU B CG    1 
ATOM   4055 C  CD1   . LEU B 1 272 ? -33.800 44.041 10.610  1.00 93.72  ? 269 LEU B CD1   1 
ATOM   4056 C  CD2   . LEU B 1 272 ? -33.798 41.579 10.130  1.00 93.09  ? 269 LEU B CD2   1 
ATOM   4057 N  N     . PHE B 1 273 ? -38.546 43.197 10.301  1.00 99.28  ? 270 PHE B N     1 
ATOM   4058 C  CA    . PHE B 1 273 ? -39.388 43.259 9.116   1.00 99.84  ? 270 PHE B CA    1 
ATOM   4059 C  C     . PHE B 1 273 ? -40.747 43.929 9.291   1.00 101.98 ? 270 PHE B C     1 
ATOM   4060 O  O     . PHE B 1 273 ? -41.394 44.267 8.302   1.00 102.31 ? 270 PHE B O     1 
ATOM   4061 C  CB    . PHE B 1 273 ? -39.573 41.862 8.545   1.00 99.75  ? 270 PHE B CB    1 
ATOM   4062 C  CG    . PHE B 1 273 ? -38.289 41.169 8.259   1.00 97.88  ? 270 PHE B CG    1 
ATOM   4063 C  CD1   . PHE B 1 273 ? -37.886 40.096 9.019   1.00 97.77  ? 270 PHE B CD1   1 
ATOM   4064 C  CD2   . PHE B 1 273 ? -37.472 41.601 7.239   1.00 96.54  ? 270 PHE B CD2   1 
ATOM   4065 C  CE1   . PHE B 1 273 ? -36.690 39.452 8.760   1.00 96.93  ? 270 PHE B CE1   1 
ATOM   4066 C  CE2   . PHE B 1 273 ? -36.275 40.961 6.975   1.00 95.90  ? 270 PHE B CE2   1 
ATOM   4067 C  CZ    . PHE B 1 273 ? -35.882 39.887 7.739   1.00 95.61  ? 270 PHE B CZ    1 
ATOM   4068 N  N     . GLY B 1 274 ? -41.190 44.104 10.534  1.00 103.94 ? 271 GLY B N     1 
ATOM   4069 C  CA    . GLY B 1 274 ? -42.473 44.756 10.809  1.00 106.64 ? 271 GLY B CA    1 
ATOM   4070 C  C     . GLY B 1 274 ? -43.685 44.012 10.278  1.00 108.70 ? 271 GLY B C     1 
ATOM   4071 O  O     . GLY B 1 274 ? -44.681 44.627 9.884   1.00 109.56 ? 271 GLY B O     1 
ATOM   4072 N  N     . ILE B 1 275 ? -43.575 42.684 10.265  1.00 109.65 ? 272 ILE B N     1 
ATOM   4073 C  CA    . ILE B 1 275 ? -44.628 41.767 9.845   1.00 112.10 ? 272 ILE B CA    1 
ATOM   4074 C  C     . ILE B 1 275 ? -44.399 40.430 10.556  1.00 113.41 ? 272 ILE B C     1 
ATOM   4075 O  O     . ILE B 1 275 ? -43.357 40.232 11.177  1.00 112.64 ? 272 ILE B O     1 
ATOM   4076 C  CB    . ILE B 1 275 ? -44.652 41.570 8.297   1.00 111.32 ? 272 ILE B CB    1 
ATOM   4077 C  CG1   . ILE B 1 275 ? -43.294 41.119 7.761   1.00 109.60 ? 272 ILE B CG1   1 
ATOM   4078 C  CG2   . ILE B 1 275 ? -45.089 42.842 7.590   1.00 111.76 ? 272 ILE B CG2   1 
ATOM   4079 C  CD1   . ILE B 1 275 ? -43.190 39.637 7.522   1.00 110.55 ? 272 ILE B CD1   1 
ATOM   4080 N  N     . ASP B 1 276 ? -45.361 39.516 10.457  1.00 116.12 ? 273 ASP B N     1 
ATOM   4081 C  CA    . ASP B 1 276 ? -45.239 38.191 11.068  1.00 118.09 ? 273 ASP B CA    1 
ATOM   4082 C  C     . ASP B 1 276 ? -44.561 37.169 10.169  1.00 117.31 ? 273 ASP B C     1 
ATOM   4083 O  O     . ASP B 1 276 ? -44.758 37.172 8.950   1.00 117.27 ? 273 ASP B O     1 
ATOM   4084 C  CB    . ASP B 1 276 ? -46.614 37.674 11.471  1.00 121.34 ? 273 ASP B CB    1 
ATOM   4085 C  CG    . ASP B 1 276 ? -47.152 38.369 12.699  1.00 125.04 ? 273 ASP B CG    1 
ATOM   4086 O  OD1   . ASP B 1 276 ? -46.331 38.990 13.424  1.00 126.63 ? 273 ASP B OD1   1 
ATOM   4087 O  OD2   . ASP B 1 276 ? -48.386 38.290 12.946  1.00 129.14 ? 273 ASP B OD2   1 
ATOM   4088 N  N     . SER B 1 277 ? -43.764 36.290 10.774  1.00 117.08 ? 274 SER B N     1 
ATOM   4089 C  CA    . SER B 1 277 ? -43.133 35.209 10.031  1.00 116.49 ? 274 SER B CA    1 
ATOM   4090 C  C     . SER B 1 277 ? -44.152 34.109 9.836   1.00 118.71 ? 274 SER B C     1 
ATOM   4091 O  O     . SER B 1 277 ? -45.151 34.060 10.542  1.00 120.34 ? 274 SER B O     1 
ATOM   4092 C  CB    . SER B 1 277 ? -41.943 34.649 10.793  1.00 115.78 ? 274 SER B CB    1 
ATOM   4093 O  OG    . SER B 1 277 ? -42.372 33.699 11.751  1.00 117.46 ? 274 SER B OG    1 
ATOM   4094 N  N     . ASN B 1 278 ? -43.876 33.225 8.885   1.00 118.93 ? 275 ASN B N     1 
ATOM   4095 C  CA    . ASN B 1 278 ? -44.737 32.091 8.593   1.00 121.60 ? 275 ASN B CA    1 
ATOM   4096 C  C     . ASN B 1 278 ? -44.211 30.834 9.280   1.00 122.93 ? 275 ASN B C     1 
ATOM   4097 O  O     . ASN B 1 278 ? -44.602 29.714 8.950   1.00 124.90 ? 275 ASN B O     1 
ATOM   4098 C  CB    . ASN B 1 278 ? -44.856 31.903 7.083   1.00 121.35 ? 275 ASN B CB    1 
ATOM   4099 C  CG    . ASN B 1 278 ? -44.688 33.205 6.331   1.00 119.55 ? 275 ASN B CG    1 
ATOM   4100 O  OD1   . ASN B 1 278 ? -45.665 33.885 6.021   1.00 119.77 ? 275 ASN B OD1   1 
ATOM   4101 N  ND2   . ASN B 1 278 ? -43.434 33.581 6.070   1.00 117.56 ? 275 ASN B ND2   1 
ATOM   4102 N  N     . THR B 1 279 ? -43.305 31.045 10.231  1.00 122.34 ? 276 THR B N     1 
ATOM   4103 C  CA    . THR B 1 279 ? -42.809 29.996 11.117  1.00 123.99 ? 276 THR B CA    1 
ATOM   4104 C  C     . THR B 1 279 ? -42.731 30.572 12.530  1.00 124.50 ? 276 THR B C     1 
ATOM   4105 O  O     . THR B 1 279 ? -41.674 31.081 12.929  1.00 122.81 ? 276 THR B O     1 
ATOM   4106 C  CB    . THR B 1 279 ? -41.399 29.476 10.715  1.00 122.49 ? 276 THR B CB    1 
ATOM   4107 O  OG1   . THR B 1 279 ? -40.479 30.571 10.625  1.00 119.59 ? 276 THR B OG1   1 
ATOM   4108 C  CG2   . THR B 1 279 ? -41.436 28.716 9.389   1.00 123.29 ? 276 THR B CG2   1 
ATOM   4109 N  N     . PRO B 1 280 ? -43.855 30.527 13.282  1.00 127.06 ? 277 PRO B N     1 
ATOM   4110 C  CA    . PRO B 1 280 ? -43.833 30.971 14.682  1.00 127.90 ? 277 PRO B CA    1 
ATOM   4111 C  C     . PRO B 1 280 ? -43.334 29.882 15.653  1.00 129.75 ? 277 PRO B C     1 
ATOM   4112 O  O     . PRO B 1 280 ? -43.177 28.724 15.254  1.00 130.52 ? 277 PRO B O     1 
ATOM   4113 C  CB    . PRO B 1 280 ? -45.303 31.339 14.960  1.00 129.99 ? 277 PRO B CB    1 
ATOM   4114 C  CG    . PRO B 1 280 ? -46.022 31.260 13.602  1.00 129.70 ? 277 PRO B CG    1 
ATOM   4115 C  CD    . PRO B 1 280 ? -45.232 30.275 12.816  1.00 129.01 ? 277 PRO B CD    1 
ATOM   4116 N  N     . PHE B 1 281 ? -43.066 30.271 16.902  1.00 130.71 ? 278 PHE B N     1 
ATOM   4117 C  CA    . PHE B 1 281 ? -42.680 29.341 17.975  1.00 133.10 ? 278 PHE B CA    1 
ATOM   4118 C  C     . PHE B 1 281 ? -43.440 29.690 19.258  1.00 135.44 ? 278 PHE B C     1 
ATOM   4119 O  O     . PHE B 1 281 ? -43.537 28.882 20.191  1.00 138.05 ? 278 PHE B O     1 
ATOM   4120 C  CB    . PHE B 1 281 ? -41.166 29.394 18.240  1.00 131.33 ? 278 PHE B CB    1 
ATOM   4121 C  CG    . PHE B 1 281 ? -40.333 28.579 17.266  1.00 131.50 ? 278 PHE B CG    1 
ATOM   4122 C  CD1   . PHE B 1 281 ? -39.813 27.336 17.642  1.00 133.57 ? 278 PHE B CD1   1 
ATOM   4123 C  CD2   . PHE B 1 281 ? -40.042 29.067 15.975  1.00 130.05 ? 278 PHE B CD2   1 
ATOM   4124 C  CE1   . PHE B 1 281 ? -39.024 26.588 16.736  1.00 133.34 ? 278 PHE B CE1   1 
ATOM   4125 C  CE2   . PHE B 1 281 ? -39.257 28.325 15.060  1.00 128.70 ? 278 PHE B CE2   1 
ATOM   4126 C  CZ    . PHE B 1 281 ? -38.749 27.090 15.438  1.00 130.36 ? 278 PHE B CZ    1 
ATOM   4127 O  "O5'" . DA  C 2 1   ? -54.597 27.624 -9.439  1.00 146.67 ? 1   DA  C "O5'" 1 
ATOM   4128 C  "C5'" . DA  C 2 1   ? -54.872 26.452 -10.217 1.00 147.96 ? 1   DA  C "C5'" 1 
ATOM   4129 C  "C4'" . DA  C 2 1   ? -53.758 25.413 -10.097 1.00 146.67 ? 1   DA  C "C4'" 1 
ATOM   4130 O  "O4'" . DA  C 2 1   ? -54.259 24.057 -10.196 1.00 149.14 ? 1   DA  C "O4'" 1 
ATOM   4131 C  "C3'" . DA  C 2 1   ? -52.655 25.481 -11.142 1.00 143.74 ? 1   DA  C "C3'" 1 
ATOM   4132 O  "O3'" . DA  C 2 1   ? -51.436 25.264 -10.464 1.00 140.80 ? 1   DA  C "O3'" 1 
ATOM   4133 C  "C2'" . DA  C 2 1   ? -52.945 24.389 -12.171 1.00 144.71 ? 1   DA  C "C2'" 1 
ATOM   4134 C  "C1'" . DA  C 2 1   ? -53.803 23.411 -11.377 1.00 148.62 ? 1   DA  C "C1'" 1 
ATOM   4135 N  N9    . DA  C 2 1   ? -54.960 22.873 -12.111 1.00 151.95 ? 1   DA  C N9    1 
ATOM   4136 C  C8    . DA  C 2 1   ? -54.920 21.873 -13.054 1.00 152.98 ? 1   DA  C C8    1 
ATOM   4137 N  N7    . DA  C 2 1   ? -56.090 21.551 -13.568 1.00 155.41 ? 1   DA  C N7    1 
ATOM   4138 C  C5    . DA  C 2 1   ? -56.972 22.405 -12.911 1.00 156.82 ? 1   DA  C C5    1 
ATOM   4139 C  C6    . DA  C 2 1   ? -58.380 22.574 -13.001 1.00 159.56 ? 1   DA  C C6    1 
ATOM   4140 N  N6    . DA  C 2 1   ? -59.152 21.850 -13.830 1.00 161.17 ? 1   DA  C N6    1 
ATOM   4141 N  N1    . DA  C 2 1   ? -58.958 23.515 -12.204 1.00 160.18 ? 1   DA  C N1    1 
ATOM   4142 C  C2    . DA  C 2 1   ? -58.186 24.241 -11.374 1.00 157.77 ? 1   DA  C C2    1 
ATOM   4143 N  N3    . DA  C 2 1   ? -56.862 24.169 -11.207 1.00 155.12 ? 1   DA  C N3    1 
ATOM   4144 C  C4    . DA  C 2 1   ? -56.299 23.229 -12.006 1.00 154.72 ? 1   DA  C C4    1 
ATOM   4145 P  P     . DT  C 2 2   ? -50.223 26.312 -10.576 1.00 137.62 ? 2   DT  C P     1 
ATOM   4146 O  OP1   . DT  C 2 2   ? -49.202 25.617 -11.409 1.00 136.70 ? 2   DT  C OP1   1 
ATOM   4147 O  OP2   . DT  C 2 2   ? -49.883 26.788 -9.202  1.00 136.80 ? 2   DT  C OP2   1 
ATOM   4148 O  "O5'" . DT  C 2 2   ? -50.818 27.559 -11.412 1.00 133.38 ? 2   DT  C "O5'" 1 
ATOM   4149 C  "C5'" . DT  C 2 2   ? -50.818 27.541 -12.848 1.00 126.36 ? 2   DT  C "C5'" 1 
ATOM   4150 C  "C4'" . DT  C 2 2   ? -51.398 28.818 -13.401 1.00 121.33 ? 2   DT  C "C4'" 1 
ATOM   4151 O  "O4'" . DT  C 2 2   ? -52.707 29.081 -12.869 1.00 122.80 ? 2   DT  C "O4'" 1 
ATOM   4152 C  "C3'" . DT  C 2 2   ? -50.547 30.006 -13.046 1.00 117.00 ? 2   DT  C "C3'" 1 
ATOM   4153 O  "O3'" . DT  C 2 2   ? -49.706 30.118 -14.200 1.00 110.45 ? 2   DT  C "O3'" 1 
ATOM   4154 C  "C2'" . DT  C 2 2   ? -51.571 31.120 -12.798 1.00 119.96 ? 2   DT  C "C2'" 1 
ATOM   4155 C  "C1'" . DT  C 2 2   ? -52.948 30.464 -12.762 1.00 124.00 ? 2   DT  C "C1'" 1 
ATOM   4156 N  N1    . DT  C 2 2   ? -53.780 30.611 -11.506 1.00 129.35 ? 2   DT  C N1    1 
ATOM   4157 C  C2    . DT  C 2 2   ? -55.059 30.060 -11.509 1.00 133.91 ? 2   DT  C C2    1 
ATOM   4158 O  O2    . DT  C 2 2   ? -55.557 29.496 -12.458 1.00 135.72 ? 2   DT  C O2    1 
ATOM   4159 N  N3    . DT  C 2 2   ? -55.778 30.181 -10.346 1.00 136.94 ? 2   DT  C N3    1 
ATOM   4160 C  C4    . DT  C 2 2   ? -55.359 30.793 -9.174  1.00 136.95 ? 2   DT  C C4    1 
ATOM   4161 O  O4    . DT  C 2 2   ? -56.123 30.827 -8.205  1.00 140.08 ? 2   DT  C O4    1 
ATOM   4162 C  C5    . DT  C 2 2   ? -54.009 31.359 -9.202  1.00 133.00 ? 2   DT  C C5    1 
ATOM   4163 C  C7    . DT  C 2 2   ? -53.432 32.050 -7.994  1.00 130.92 ? 2   DT  C C7    1 
ATOM   4164 C  C6    . DT  C 2 2   ? -53.300 31.234 -10.351 1.00 130.42 ? 2   DT  C C6    1 
ATOM   4165 P  P     . DT  C 2 3   ? -48.907 31.399 -14.724 1.00 103.82 ? 3   DT  C P     1 
ATOM   4166 O  OP1   . DT  C 2 3   ? -48.268 30.987 -15.994 1.00 102.87 ? 3   DT  C OP1   1 
ATOM   4167 O  OP2   . DT  C 2 3   ? -48.095 31.968 -13.623 1.00 103.34 ? 3   DT  C OP2   1 
ATOM   4168 O  "O5'" . DT  C 2 3   ? -50.068 32.439 -15.009 1.00 102.34 ? 3   DT  C "O5'" 1 
ATOM   4169 C  "C5'" . DT  C 2 3   ? -50.440 32.872 -16.276 1.00 101.59 ? 3   DT  C "C5'" 1 
ATOM   4170 C  "C4'" . DT  C 2 3   ? -51.174 34.172 -16.037 1.00 101.93 ? 3   DT  C "C4'" 1 
ATOM   4171 O  "O4'" . DT  C 2 3   ? -51.836 34.110 -14.742 1.00 103.69 ? 3   DT  C "O4'" 1 
ATOM   4172 C  "C3'" . DT  C 2 3   ? -50.277 35.407 -15.996 1.00 99.36  ? 3   DT  C "C3'" 1 
ATOM   4173 O  "O3'" . DT  C 2 3   ? -50.889 36.493 -16.685 1.00 96.75  ? 3   DT  C "O3'" 1 
ATOM   4174 C  "C2'" . DT  C 2 3   ? -50.175 35.714 -14.510 1.00 100.30 ? 3   DT  C "C2'" 1 
ATOM   4175 C  "C1'" . DT  C 2 3   ? -51.565 35.308 -14.050 1.00 104.39 ? 3   DT  C "C1'" 1 
ATOM   4176 N  N1    . DT  C 2 3   ? -51.606 35.164 -12.563 1.00 107.60 ? 3   DT  C N1    1 
ATOM   4177 C  C2    . DT  C 2 3   ? -52.397 36.042 -11.844 1.00 110.45 ? 3   DT  C C2    1 
ATOM   4178 O  O2    . DT  C 2 3   ? -53.087 36.907 -12.358 1.00 112.19 ? 3   DT  C O2    1 
ATOM   4179 N  N3    . DT  C 2 3   ? -52.362 35.873 -10.481 1.00 112.00 ? 3   DT  C N3    1 
ATOM   4180 C  C4    . DT  C 2 3   ? -51.625 34.934 -9.778  1.00 111.39 ? 3   DT  C C4    1 
ATOM   4181 O  O4    . DT  C 2 3   ? -51.672 34.868 -8.552  1.00 113.34 ? 3   DT  C O4    1 
ATOM   4182 C  C5    . DT  C 2 3   ? -50.812 34.050 -10.584 1.00 109.18 ? 3   DT  C C5    1 
ATOM   4183 C  C7    . DT  C 2 3   ? -49.974 32.991 -9.929  1.00 108.50 ? 3   DT  C C7    1 
ATOM   4184 C  C6    . DT  C 2 3   ? -50.834 34.211 -11.917 1.00 107.85 ? 3   DT  C C6    1 
ATOM   4185 P  P     . DG  C 2 4   ? -50.317 37.023 -18.076 1.00 93.20  ? 4   DG  C P     1 
ATOM   4186 O  OP1   . DG  C 2 4   ? -51.108 38.219 -18.418 1.00 94.42  ? 4   DG  C OP1   1 
ATOM   4187 O  OP2   . DG  C 2 4   ? -50.187 35.894 -19.027 1.00 92.48  ? 4   DG  C OP2   1 
ATOM   4188 O  "O5'" . DG  C 2 4   ? -48.891 37.599 -17.670 1.00 91.25  ? 4   DG  C "O5'" 1 
ATOM   4189 C  "C5'" . DG  C 2 4   ? -48.883 38.886 -17.067 1.00 90.12  ? 4   DG  C "C5'" 1 
ATOM   4190 C  "C4'" . DG  C 2 4   ? -47.613 39.087 -16.269 1.00 88.92  ? 4   DG  C "C4'" 1 
ATOM   4191 O  "O4'" . DG  C 2 4   ? -46.509 39.024 -17.203 1.00 89.50  ? 4   DG  C "O4'" 1 
ATOM   4192 C  "C3'" . DG  C 2 4   ? -47.488 40.422 -15.539 1.00 88.38  ? 4   DG  C "C3'" 1 
ATOM   4193 O  "O3'" . DG  C 2 4   ? -46.909 40.194 -14.261 1.00 87.39  ? 4   DG  C "O3'" 1 
ATOM   4194 C  "C2'" . DG  C 2 4   ? -46.551 41.247 -16.427 1.00 88.22  ? 4   DG  C "C2'" 1 
ATOM   4195 C  "C1'" . DG  C 2 4   ? -45.666 40.161 -17.039 1.00 88.69  ? 4   DG  C "C1'" 1 
ATOM   4196 N  N9    . DG  C 2 4   ? -44.964 40.517 -18.295 1.00 88.33  ? 4   DG  C N9    1 
ATOM   4197 C  C8    . DG  C 2 4   ? -45.500 40.775 -19.535 1.00 88.10  ? 4   DG  C C8    1 
ATOM   4198 N  N7    . DG  C 2 4   ? -44.615 41.066 -20.446 1.00 87.75  ? 4   DG  C N7    1 
ATOM   4199 C  C5    . DG  C 2 4   ? -43.410 40.986 -19.776 1.00 87.45  ? 4   DG  C C5    1 
ATOM   4200 C  C6    . DG  C 2 4   ? -42.095 41.195 -20.240 1.00 88.30  ? 4   DG  C C6    1 
ATOM   4201 O  O6    . DG  C 2 4   ? -41.722 41.506 -21.370 1.00 90.04  ? 4   DG  C O6    1 
ATOM   4202 N  N1    . DG  C 2 4   ? -41.133 41.019 -19.255 1.00 88.48  ? 4   DG  C N1    1 
ATOM   4203 C  C2    . DG  C 2 4   ? -41.418 40.688 -17.954 1.00 88.62  ? 4   DG  C C2    1 
ATOM   4204 N  N2    . DG  C 2 4   ? -40.354 40.575 -17.147 1.00 89.38  ? 4   DG  C N2    1 
ATOM   4205 N  N3    . DG  C 2 4   ? -42.650 40.490 -17.488 1.00 88.11  ? 4   DG  C N3    1 
ATOM   4206 C  C4    . DG  C 2 4   ? -43.597 40.652 -18.456 1.00 87.73  ? 4   DG  C C4    1 
ATOM   4207 P  P     . DT  C 2 5   ? -46.824 41.319 -13.118 1.00 87.64  ? 5   DT  C P     1 
ATOM   4208 O  OP1   . DT  C 2 5   ? -46.671 40.561 -11.839 1.00 86.08  ? 5   DT  C OP1   1 
ATOM   4209 O  OP2   . DT  C 2 5   ? -47.976 42.245 -13.303 1.00 87.98  ? 5   DT  C OP2   1 
ATOM   4210 O  "O5'" . DT  C 2 5   ? -45.488 42.146 -13.474 1.00 84.42  ? 5   DT  C "O5'" 1 
ATOM   4211 C  "C5'" . DT  C 2 5   ? -44.243 41.521 -13.238 1.00 85.26  ? 5   DT  C "C5'" 1 
ATOM   4212 C  "C4'" . DT  C 2 5   ? -43.025 42.395 -13.476 1.00 85.55  ? 5   DT  C "C4'" 1 
ATOM   4213 O  "O4'" . DT  C 2 5   ? -42.671 42.462 -14.888 1.00 85.29  ? 5   DT  C "O4'" 1 
ATOM   4214 C  "C3'" . DT  C 2 5   ? -43.160 43.822 -12.964 1.00 85.88  ? 5   DT  C "C3'" 1 
ATOM   4215 O  "O3'" . DT  C 2 5   ? -42.296 43.900 -11.844 1.00 86.42  ? 5   DT  C "O3'" 1 
ATOM   4216 C  "C2'" . DT  C 2 5   ? -42.777 44.738 -14.144 1.00 84.88  ? 5   DT  C "C2'" 1 
ATOM   4217 C  "C1'" . DT  C 2 5   ? -42.224 43.777 -15.207 1.00 83.90  ? 5   DT  C "C1'" 1 
ATOM   4218 N  N1    . DT  C 2 5   ? -42.597 44.037 -16.649 1.00 81.92  ? 5   DT  C N1    1 
ATOM   4219 C  C2    . DT  C 2 5   ? -41.599 44.225 -17.567 1.00 80.85  ? 5   DT  C C2    1 
ATOM   4220 O  O2    . DT  C 2 5   ? -40.431 44.218 -17.257 1.00 81.32  ? 5   DT  C O2    1 
ATOM   4221 N  N3    . DT  C 2 5   ? -42.003 44.424 -18.865 1.00 80.55  ? 5   DT  C N3    1 
ATOM   4222 C  C4    . DT  C 2 5   ? -43.292 44.445 -19.345 1.00 80.75  ? 5   DT  C C4    1 
ATOM   4223 O  O4    . DT  C 2 5   ? -43.540 44.634 -20.527 1.00 79.41  ? 5   DT  C O4    1 
ATOM   4224 C  C5    . DT  C 2 5   ? -44.304 44.238 -18.334 1.00 82.12  ? 5   DT  C C5    1 
ATOM   4225 C  C7    . DT  C 2 5   ? -45.759 44.242 -18.695 1.00 83.23  ? 5   DT  C C7    1 
ATOM   4226 C  C6    . DT  C 2 5   ? -43.916 44.040 -17.060 1.00 82.39  ? 5   DT  C C6    1 
ATOM   4227 P  P     . DC  C 2 6   ? -42.135 45.235 -10.985 1.00 87.51  ? 6   DC  C P     1 
ATOM   4228 O  OP1   . DC  C 2 6   ? -41.412 44.854 -9.750  1.00 88.13  ? 6   DC  C OP1   1 
ATOM   4229 O  OP2   . DC  C 2 6   ? -43.425 45.949 -10.886 1.00 87.38  ? 6   DC  C OP2   1 
ATOM   4230 O  "O5'" . DC  C 2 6   ? -41.205 46.132 -11.926 1.00 87.13  ? 6   DC  C "O5'" 1 
ATOM   4231 C  "C5'" . DC  C 2 6   ? -39.831 45.832 -12.128 1.00 86.75  ? 6   DC  C "C5'" 1 
ATOM   4232 C  "C4'" . DC  C 2 6   ? -39.193 46.923 -12.967 1.00 86.02  ? 6   DC  C "C4'" 1 
ATOM   4233 O  "O4'" . DC  C 2 6   ? -39.623 46.876 -14.358 1.00 86.07  ? 6   DC  C "O4'" 1 
ATOM   4234 C  "C3'" . DC  C 2 6   ? -39.467 48.341 -12.497 1.00 85.33  ? 6   DC  C "C3'" 1 
ATOM   4235 O  "O3'" . DC  C 2 6   ? -38.224 48.946 -12.631 1.00 85.22  ? 6   DC  C "O3'" 1 
ATOM   4236 C  "C2'" . DC  C 2 6   ? -40.455 48.894 -13.529 1.00 85.60  ? 6   DC  C "C2'" 1 
ATOM   4237 C  "C1'" . DC  C 2 6   ? -40.008 48.170 -14.795 1.00 85.93  ? 6   DC  C "C1'" 1 
ATOM   4238 N  N1    . DC  C 2 6   ? -41.005 48.029 -15.912 1.00 86.60  ? 6   DC  C N1    1 
ATOM   4239 C  C2    . DC  C 2 6   ? -40.531 47.784 -17.204 1.00 87.51  ? 6   DC  C C2    1 
ATOM   4240 O  O2    . DC  C 2 6   ? -39.307 47.723 -17.376 1.00 87.94  ? 6   DC  C O2    1 
ATOM   4241 N  N3    . DC  C 2 6   ? -41.416 47.633 -18.235 1.00 88.29  ? 6   DC  C N3    1 
ATOM   4242 C  C4    . DC  C 2 6   ? -42.731 47.713 -18.016 1.00 88.18  ? 6   DC  C C4    1 
ATOM   4243 N  N4    . DC  C 2 6   ? -43.570 47.567 -19.047 1.00 87.56  ? 6   DC  C N4    1 
ATOM   4244 C  C5    . DC  C 2 6   ? -43.232 47.951 -16.702 1.00 88.97  ? 6   DC  C C5    1 
ATOM   4245 C  C6    . DC  C 2 6   ? -42.347 48.102 -15.699 1.00 88.01  ? 6   DC  C C6    1 
ATOM   4246 P  P     . DA  C 2 7   ? -37.692 50.055 -11.641 1.00 85.09  ? 7   DA  C P     1 
ATOM   4247 O  OP1   . DA  C 2 7   ? -37.256 49.380 -10.392 1.00 84.67  ? 7   DA  C OP1   1 
ATOM   4248 O  OP2   . DA  C 2 7   ? -38.654 51.198 -11.656 1.00 83.63  ? 7   DA  C OP2   1 
ATOM   4249 O  "O5'" . DA  C 2 7   ? -36.403 50.535 -12.452 1.00 85.88  ? 7   DA  C "O5'" 1 
ATOM   4250 C  "C5'" . DA  C 2 7   ? -35.142 49.877 -12.415 1.00 87.48  ? 7   DA  C "C5'" 1 
ATOM   4251 C  "C4'" . DA  C 2 7   ? -34.366 50.259 -13.673 1.00 88.69  ? 7   DA  C "C4'" 1 
ATOM   4252 O  "O4'" . DA  C 2 7   ? -35.163 50.012 -14.862 1.00 88.30  ? 7   DA  C "O4'" 1 
ATOM   4253 C  "C3'" . DA  C 2 7   ? -33.937 51.719 -13.800 1.00 88.76  ? 7   DA  C "C3'" 1 
ATOM   4254 O  "O3'" . DA  C 2 7   ? -32.678 51.722 -14.441 1.00 89.92  ? 7   DA  C "O3'" 1 
ATOM   4255 C  "C2'" . DA  C 2 7   ? -35.010 52.367 -14.674 1.00 87.61  ? 7   DA  C "C2'" 1 
ATOM   4256 C  "C1'" . DA  C 2 7   ? -35.395 51.214 -15.592 1.00 88.22  ? 7   DA  C "C1'" 1 
ATOM   4257 N  N9    . DA  C 2 7   ? -36.806 51.158 -15.938 1.00 87.45  ? 7   DA  C N9    1 
ATOM   4258 C  C8    . DA  C 2 7   ? -37.808 51.015 -15.033 1.00 88.17  ? 7   DA  C C8    1 
ATOM   4259 N  N7    . DA  C 2 7   ? -39.002 50.970 -15.569 1.00 89.42  ? 7   DA  C N7    1 
ATOM   4260 C  C5    . DA  C 2 7   ? -38.766 51.074 -16.924 1.00 88.06  ? 7   DA  C C5    1 
ATOM   4261 C  C6    . DA  C 2 7   ? -39.653 51.081 -18.019 1.00 87.95  ? 7   DA  C C6    1 
ATOM   4262 N  N6    . DA  C 2 7   ? -40.974 50.971 -17.860 1.00 88.84  ? 7   DA  C N6    1 
ATOM   4263 N  N1    . DA  C 2 7   ? -39.138 51.195 -19.256 1.00 86.87  ? 7   DA  C N1    1 
ATOM   4264 C  C2    . DA  C 2 7   ? -37.809 51.299 -19.340 1.00 87.94  ? 7   DA  C C2    1 
ATOM   4265 N  N3    . DA  C 2 7   ? -36.868 51.307 -18.384 1.00 87.91  ? 7   DA  C N3    1 
ATOM   4266 C  C4    . DA  C 2 7   ? -37.417 51.189 -17.174 1.00 87.49  ? 7   DA  C C4    1 
ATOM   4267 P  P     . DT  C 2 8   ? -31.877 53.085 -14.626 1.00 91.06  ? 8   DT  C P     1 
ATOM   4268 O  OP1   . DT  C 2 8   ? -30.434 52.788 -14.821 1.00 91.88  ? 8   DT  C OP1   1 
ATOM   4269 O  OP2   . DT  C 2 8   ? -32.299 53.998 -13.536 1.00 91.64  ? 8   DT  C OP2   1 
ATOM   4270 O  "O5'" . DT  C 2 8   ? -32.537 53.657 -15.966 1.00 90.85  ? 8   DT  C "O5'" 1 
ATOM   4271 C  "C5'" . DT  C 2 8   ? -32.344 53.070 -17.236 1.00 92.18  ? 8   DT  C "C5'" 1 
ATOM   4272 C  "C4'" . DT  C 2 8   ? -32.965 53.926 -18.326 1.00 92.16  ? 8   DT  C "C4'" 1 
ATOM   4273 O  "O4'" . DT  C 2 8   ? -34.375 53.640 -18.422 1.00 91.07  ? 8   DT  C "O4'" 1 
ATOM   4274 C  "C3'" . DT  C 2 8   ? -32.856 55.427 -18.109 1.00 93.30  ? 8   DT  C "C3'" 1 
ATOM   4275 O  "O3'" . DT  C 2 8   ? -31.965 55.973 -19.077 1.00 97.36  ? 8   DT  C "O3'" 1 
ATOM   4276 C  "C2'" . DT  C 2 8   ? -34.278 55.980 -18.235 1.00 91.02  ? 8   DT  C "C2'" 1 
ATOM   4277 C  "C1'" . DT  C 2 8   ? -35.049 54.813 -18.824 1.00 90.04  ? 8   DT  C "C1'" 1 
ATOM   4278 N  N1    . DT  C 2 8   ? -36.446 54.678 -18.335 1.00 87.87  ? 8   DT  C N1    1 
ATOM   4279 C  C2    . DT  C 2 8   ? -37.471 54.549 -19.252 1.00 87.26  ? 8   DT  C C2    1 
ATOM   4280 O  O2    . DT  C 2 8   ? -37.309 54.560 -20.461 1.00 87.19  ? 8   DT  C O2    1 
ATOM   4281 N  N3    . DT  C 2 8   ? -38.716 54.412 -18.694 1.00 86.82  ? 8   DT  C N3    1 
ATOM   4282 C  C4    . DT  C 2 8   ? -39.031 54.394 -17.346 1.00 86.67  ? 8   DT  C C4    1 
ATOM   4283 O  O4    . DT  C 2 8   ? -40.192 54.274 -16.949 1.00 87.00  ? 8   DT  C O4    1 
ATOM   4284 C  C5    . DT  C 2 8   ? -37.904 54.530 -16.451 1.00 86.19  ? 8   DT  C C5    1 
ATOM   4285 C  C7    . DT  C 2 8   ? -38.096 54.530 -14.968 1.00 86.30  ? 8   DT  C C7    1 
ATOM   4286 C  C6    . DT  C 2 8   ? -36.686 54.657 -16.978 1.00 86.55  ? 8   DT  C C6    1 
ATOM   4287 P  P     . DG  C 2 9   ? -31.515 57.519 -18.966 1.00 101.22 ? 9   DG  C P     1 
ATOM   4288 O  OP1   . DG  C 2 9   ? -30.126 57.642 -19.480 1.00 102.61 ? 9   DG  C OP1   1 
ATOM   4289 O  OP2   . DG  C 2 9   ? -31.868 58.104 -17.626 1.00 98.62  ? 9   DG  C OP2   1 
ATOM   4290 O  "O5'" . DG  C 2 9   ? -32.496 58.130 -20.069 1.00 98.96  ? 9   DG  C "O5'" 1 
ATOM   4291 C  "C5'" . DG  C 2 9   ? -32.323 57.985 -21.474 1.00 96.63  ? 9   DG  C "C5'" 1 
ATOM   4292 C  "C4'" . DG  C 2 9   ? -33.344 58.941 -22.056 1.00 94.78  ? 9   DG  C "C4'" 1 
ATOM   4293 O  "O4'" . DG  C 2 9   ? -34.644 58.658 -21.460 1.00 93.98  ? 9   DG  C "O4'" 1 
ATOM   4294 C  "C3'" . DG  C 2 9   ? -33.077 60.414 -21.756 1.00 94.05  ? 9   DG  C "C3'" 1 
ATOM   4295 O  "O3'" . DG  C 2 9   ? -33.600 61.242 -22.768 1.00 94.39  ? 9   DG  C "O3'" 1 
ATOM   4296 C  "C2'" . DG  C 2 9   ? -33.898 60.665 -20.499 1.00 93.28  ? 9   DG  C "C2'" 1 
ATOM   4297 C  "C1'" . DG  C 2 9   ? -35.130 59.792 -20.751 1.00 92.96  ? 9   DG  C "C1'" 1 
ATOM   4298 N  N9    . DG  C 2 9   ? -35.794 59.331 -19.528 1.00 91.07  ? 9   DG  C N9    1 
ATOM   4299 C  C8    . DG  C 2 9   ? -35.248 59.293 -18.264 1.00 91.35  ? 9   DG  C C8    1 
ATOM   4300 N  N7    . DG  C 2 9   ? -36.054 58.833 -17.349 1.00 90.15  ? 9   DG  C N7    1 
ATOM   4301 C  C5    . DG  C 2 9   ? -37.211 58.549 -18.054 1.00 88.71  ? 9   DG  C C5    1 
ATOM   4302 C  C6    . DG  C 2 9   ? -38.432 58.017 -17.583 1.00 87.62  ? 9   DG  C C6    1 
ATOM   4303 O  O6    . DG  C 2 9   ? -38.711 57.696 -16.422 1.00 87.25  ? 9   DG  C O6    1 
ATOM   4304 N  N1    . DG  C 2 9   ? -39.365 57.871 -18.606 1.00 87.28  ? 9   DG  C N1    1 
ATOM   4305 C  C2    . DG  C 2 9   ? -39.125 58.198 -19.925 1.00 87.77  ? 9   DG  C C2    1 
ATOM   4306 N  N2    . DG  C 2 9   ? -40.134 57.989 -20.788 1.00 87.72  ? 9   DG  C N2    1 
ATOM   4307 N  N3    . DG  C 2 9   ? -37.980 58.705 -20.372 1.00 88.15  ? 9   DG  C N3    1 
ATOM   4308 C  C4    . DG  C 2 9   ? -37.070 58.848 -19.390 1.00 88.84  ? 9   DG  C C4    1 
ATOM   4309 P  P     . DG  C 2 10  ? -32.794 61.591 -24.102 1.00 96.14  ? 10  DG  C P     1 
ATOM   4310 O  OP1   . DG  C 2 10  ? -32.508 60.346 -24.853 1.00 97.70  ? 10  DG  C OP1   1 
ATOM   4311 O  OP2   . DG  C 2 10  ? -31.684 62.495 -23.744 1.00 96.74  ? 10  DG  C OP2   1 
ATOM   4312 O  "O5'" . DG  C 2 10  ? -33.890 62.399 -24.932 1.00 95.88  ? 10  DG  C "O5'" 1 
ATOM   4313 C  "C5'" . DG  C 2 10  ? -34.722 63.287 -24.257 1.00 96.12  ? 10  DG  C "C5'" 1 
ATOM   4314 C  "C4'" . DG  C 2 10  ? -36.106 63.172 -24.843 1.00 97.23  ? 10  DG  C "C4'" 1 
ATOM   4315 O  "O4'" . DG  C 2 10  ? -36.903 62.351 -23.966 1.00 96.81  ? 10  DG  C "O4'" 1 
ATOM   4316 C  "C3'" . DG  C 2 10  ? -36.848 64.490 -24.926 1.00 99.03  ? 10  DG  C "C3'" 1 
ATOM   4317 O  "O3'" . DG  C 2 10  ? -37.836 64.416 -25.930 1.00 101.47 ? 10  DG  C "O3'" 1 
ATOM   4318 C  "C2'" . DG  C 2 10  ? -37.482 64.603 -23.546 1.00 97.61  ? 10  DG  C "C2'" 1 
ATOM   4319 C  "C1'" . DG  C 2 10  ? -37.866 63.152 -23.311 1.00 96.59  ? 10  DG  C "C1'" 1 
ATOM   4320 N  N9    . DG  C 2 10  ? -37.889 62.787 -21.900 1.00 95.52  ? 10  DG  C N9    1 
ATOM   4321 C  C8    . DG  C 2 10  ? -36.915 62.969 -20.947 1.00 95.19  ? 10  DG  C C8    1 
ATOM   4322 N  N7    . DG  C 2 10  ? -37.262 62.526 -19.772 1.00 93.99  ? 10  DG  C N7    1 
ATOM   4323 C  C5    . DG  C 2 10  ? -38.538 62.022 -19.964 1.00 93.05  ? 10  DG  C C5    1 
ATOM   4324 C  C6    . DG  C 2 10  ? -39.426 61.418 -19.057 1.00 91.92  ? 10  DG  C C6    1 
ATOM   4325 O  O6    . DG  C 2 10  ? -39.242 61.197 -17.861 1.00 92.23  ? 10  DG  C O6    1 
ATOM   4326 N  N1    . DG  C 2 10  ? -40.623 61.051 -19.656 1.00 91.40  ? 10  DG  C N1    1 
ATOM   4327 C  C2    . DG  C 2 10  ? -40.917 61.250 -20.981 1.00 92.64  ? 10  DG  C C2    1 
ATOM   4328 N  N2    . DG  C 2 10  ? -42.112 60.835 -21.397 1.00 93.75  ? 10  DG  C N2    1 
ATOM   4329 N  N3    . DG  C 2 10  ? -40.105 61.815 -21.855 1.00 93.74  ? 10  DG  C N3    1 
ATOM   4330 C  C4    . DG  C 2 10  ? -38.938 62.176 -21.267 1.00 94.15  ? 10  DG  C C4    1 
ATOM   4331 P  P     . DA  C 2 11  ? -38.615 65.737 -26.378 1.00 103.50 ? 11  DA  C P     1 
ATOM   4332 O  OP1   . DA  C 2 11  ? -38.708 65.717 -27.860 1.00 104.56 ? 11  DA  C OP1   1 
ATOM   4333 O  OP2   . DA  C 2 11  ? -38.019 66.907 -25.689 1.00 102.77 ? 11  DA  C OP2   1 
ATOM   4334 O  "O5'" . DA  C 2 11  ? -40.045 65.486 -25.726 1.00 102.06 ? 11  DA  C "O5'" 1 
ATOM   4335 C  "C5'" . DA  C 2 11  ? -40.917 64.569 -26.333 1.00 103.79 ? 11  DA  C "C5'" 1 
ATOM   4336 C  "C4'" . DA  C 2 11  ? -42.226 64.627 -25.583 1.00 105.19 ? 11  DA  C "C4'" 1 
ATOM   4337 O  "O4'" . DA  C 2 11  ? -42.002 64.156 -24.227 1.00 104.02 ? 11  DA  C "O4'" 1 
ATOM   4338 C  "C3'" . DA  C 2 11  ? -42.806 66.036 -25.502 1.00 106.74 ? 11  DA  C "C3'" 1 
ATOM   4339 O  "O3'" . DA  C 2 11  ? -44.145 66.061 -26.073 1.00 108.50 ? 11  DA  C "O3'" 1 
ATOM   4340 C  "C2'" . DA  C 2 11  ? -42.663 66.408 -24.019 1.00 105.51 ? 11  DA  C "C2'" 1 
ATOM   4341 C  "C1'" . DA  C 2 11  ? -42.546 65.064 -23.300 1.00 103.77 ? 11  DA  C "C1'" 1 
ATOM   4342 N  N9    . DA  C 2 11  ? -41.642 65.135 -22.165 1.00 102.57 ? 11  DA  C N9    1 
ATOM   4343 C  C8    . DA  C 2 11  ? -40.373 65.641 -22.197 1.00 102.91 ? 11  DA  C C8    1 
ATOM   4344 N  N7    . DA  C 2 11  ? -39.747 65.601 -21.045 1.00 102.07 ? 11  DA  C N7    1 
ATOM   4345 C  C5    . DA  C 2 11  ? -40.677 65.031 -20.199 1.00 101.25 ? 11  DA  C C5    1 
ATOM   4346 C  C6    . DA  C 2 11  ? -40.612 64.716 -18.833 1.00 100.62 ? 11  DA  C C6    1 
ATOM   4347 N  N6    . DA  C 2 11  ? -39.519 64.965 -18.112 1.00 100.84 ? 11  DA  C N6    1 
ATOM   4348 N  N1    . DA  C 2 11  ? -41.699 64.150 -18.255 1.00 100.42 ? 11  DA  C N1    1 
ATOM   4349 C  C2    . DA  C 2 11  ? -42.781 63.911 -19.019 1.00 100.94 ? 11  DA  C C2    1 
ATOM   4350 N  N3    . DA  C 2 11  ? -42.959 64.165 -20.326 1.00 101.49 ? 11  DA  C N3    1 
ATOM   4351 C  C4    . DA  C 2 11  ? -41.857 64.730 -20.865 1.00 101.77 ? 11  DA  C C4    1 
ATOM   4352 P  P     . DA  C 2 12  ? -45.476 66.589 -25.344 1.00 110.28 ? 12  DA  C P     1 
ATOM   4353 O  OP1   . DA  C 2 12  ? -46.587 66.242 -26.255 1.00 111.95 ? 12  DA  C OP1   1 
ATOM   4354 O  OP2   . DA  C 2 12  ? -45.284 67.991 -24.866 1.00 110.02 ? 12  DA  C OP2   1 
ATOM   4355 O  "O5'" . DA  C 2 12  ? -45.602 65.642 -24.057 1.00 109.48 ? 12  DA  C "O5'" 1 
ATOM   4356 C  "C5'" . DA  C 2 12  ? -46.833 65.037 -23.634 1.00 109.35 ? 12  DA  C "C5'" 1 
ATOM   4357 C  "C4'" . DA  C 2 12  ? -47.236 65.436 -22.212 1.00 108.34 ? 12  DA  C "C4'" 1 
ATOM   4358 O  "O4'" . DA  C 2 12  ? -46.135 65.527 -21.251 1.00 106.32 ? 12  DA  C "O4'" 1 
ATOM   4359 C  "C3'" . DA  C 2 12  ? -47.924 66.782 -22.101 1.00 109.40 ? 12  DA  C "C3'" 1 
ATOM   4360 O  "O3'" . DA  C 2 12  ? -48.747 66.685 -20.975 1.00 109.60 ? 12  DA  C "O3'" 1 
ATOM   4361 C  "C2'" . DA  C 2 12  ? -46.747 67.696 -21.788 1.00 108.67 ? 12  DA  C "C2'" 1 
ATOM   4362 C  "C1'" . DA  C 2 12  ? -46.122 66.834 -20.696 1.00 106.77 ? 12  DA  C "C1'" 1 
ATOM   4363 N  N9    . DA  C 2 12  ? -44.757 67.179 -20.319 1.00 105.86 ? 12  DA  C N9    1 
ATOM   4364 C  C8    . DA  C 2 12  ? -43.745 67.619 -21.134 1.00 106.24 ? 12  DA  C C8    1 
ATOM   4365 N  N7    . DA  C 2 12  ? -42.606 67.844 -20.521 1.00 105.51 ? 12  DA  C N7    1 
ATOM   4366 C  C5    . DA  C 2 12  ? -42.897 67.528 -19.204 1.00 104.83 ? 12  DA  C C5    1 
ATOM   4367 C  C6    . DA  C 2 12  ? -42.113 67.549 -18.035 1.00 104.00 ? 12  DA  C C6    1 
ATOM   4368 N  N6    . DA  C 2 12  ? -40.834 67.918 -18.043 1.00 103.94 ? 12  DA  C N6    1 
ATOM   4369 N  N1    . DA  C 2 12  ? -42.689 67.176 -16.872 1.00 103.87 ? 12  DA  C N1    1 
ATOM   4370 C  C2    . DA  C 2 12  ? -43.977 66.799 -16.888 1.00 104.60 ? 12  DA  C C2    1 
ATOM   4371 N  N3    . DA  C 2 12  ? -44.823 66.743 -17.921 1.00 105.13 ? 12  DA  C N3    1 
ATOM   4372 C  C4    . DA  C 2 12  ? -44.215 67.120 -19.060 1.00 105.15 ? 12  DA  C C4    1 
ATOM   4373 P  P     . DT  C 2 13  ? -50.268 67.128 -21.012 1.00 111.25 ? 13  DT  C P     1 
ATOM   4374 O  OP1   . DT  C 2 13  ? -51.019 66.038 -21.659 1.00 111.89 ? 13  DT  C OP1   1 
ATOM   4375 O  OP2   . DT  C 2 13  ? -50.332 68.517 -21.508 1.00 112.63 ? 13  DT  C OP2   1 
ATOM   4376 O  "O5'" . DT  C 2 13  ? -50.647 67.181 -19.462 1.00 113.62 ? 13  DT  C "O5'" 1 
ATOM   4377 C  "C5'" . DT  C 2 13  ? -50.100 66.223 -18.542 1.00 114.09 ? 13  DT  C "C5'" 1 
ATOM   4378 C  "C4'" . DT  C 2 13  ? -49.575 66.865 -17.260 1.00 114.26 ? 13  DT  C "C4'" 1 
ATOM   4379 O  "O4'" . DT  C 2 13  ? -48.196 67.284 -17.412 1.00 113.15 ? 13  DT  C "O4'" 1 
ATOM   4380 C  "C3'" . DT  C 2 13  ? -50.329 68.083 -16.724 1.00 115.98 ? 13  DT  C "C3'" 1 
ATOM   4381 O  "O3'" . DT  C 2 13  ? -50.591 67.806 -15.374 1.00 116.71 ? 13  DT  C "O3'" 1 
ATOM   4382 C  "C2'" . DT  C 2 13  ? -49.319 69.214 -16.847 1.00 115.58 ? 13  DT  C "C2'" 1 
ATOM   4383 C  "C1'" . DT  C 2 13  ? -48.038 68.430 -16.608 1.00 114.05 ? 13  DT  C "C1'" 1 
ATOM   4384 N  N1    . DT  C 2 13  ? -46.766 69.133 -16.977 1.00 114.32 ? 13  DT  C N1    1 
ATOM   4385 C  C2    . DT  C 2 13  ? -45.774 69.279 -16.015 1.00 113.81 ? 13  DT  C C2    1 
ATOM   4386 O  O2    . DT  C 2 13  ? -45.869 68.860 -14.871 1.00 114.34 ? 13  DT  C O2    1 
ATOM   4387 N  N3    . DT  C 2 13  ? -44.645 69.940 -16.448 1.00 113.00 ? 13  DT  C N3    1 
ATOM   4388 C  C4    . DT  C 2 13  ? -44.425 70.455 -17.718 1.00 112.90 ? 13  DT  C C4    1 
ATOM   4389 O  O4    . DT  C 2 13  ? -43.386 71.029 -18.012 1.00 112.63 ? 13  DT  C O4    1 
ATOM   4390 C  C5    . DT  C 2 13  ? -45.496 70.278 -18.669 1.00 113.54 ? 13  DT  C C5    1 
ATOM   4391 C  C7    . DT  C 2 13  ? -45.361 70.801 -20.065 1.00 113.69 ? 13  DT  C C7    1 
ATOM   4392 C  C6    . DT  C 2 13  ? -46.601 69.634 -18.263 1.00 114.59 ? 13  DT  C C6    1 
ATOM   4393 P  P     . DT  C 2 14  ? -51.641 68.603 -14.466 1.00 119.71 ? 14  DT  C P     1 
ATOM   4394 O  OP1   . DT  C 2 14  ? -52.620 67.614 -13.948 1.00 120.13 ? 14  DT  C OP1   1 
ATOM   4395 O  OP2   . DT  C 2 14  ? -52.064 69.875 -15.106 1.00 120.89 ? 14  DT  C OP2   1 
ATOM   4396 O  "O5'" . DT  C 2 14  ? -50.689 69.009 -13.259 1.00 118.55 ? 14  DT  C "O5'" 1 
ATOM   4397 C  "C5'" . DT  C 2 14  ? -50.008 67.979 -12.546 1.00 115.58 ? 14  DT  C "C5'" 1 
ATOM   4398 C  "C4'" . DT  C 2 14  ? -49.064 68.624 -11.566 1.00 112.90 ? 14  DT  C "C4'" 1 
ATOM   4399 O  "O4'" . DT  C 2 14  ? -47.962 69.178 -12.316 1.00 110.42 ? 14  DT  C "O4'" 1 
ATOM   4400 C  "C3'" . DT  C 2 14  ? -49.719 69.754 -10.792 1.00 114.20 ? 14  DT  C "C3'" 1 
ATOM   4401 O  "O3'" . DT  C 2 14  ? -49.476 69.475 -9.432  1.00 115.09 ? 14  DT  C "O3'" 1 
ATOM   4402 C  "C2'" . DT  C 2 14  ? -49.041 71.011 -11.337 1.00 113.48 ? 14  DT  C "C2'" 1 
ATOM   4403 C  "C1'" . DT  C 2 14  ? -47.717 70.481 -11.866 1.00 110.49 ? 14  DT  C "C1'" 1 
ATOM   4404 N  N1    . DT  C 2 14  ? -47.110 71.253 -12.991 1.00 109.30 ? 14  DT  C N1    1 
ATOM   4405 C  C2    . DT  C 2 14  ? -45.789 71.603 -12.860 1.00 108.33 ? 14  DT  C C2    1 
ATOM   4406 O  O2    . DT  C 2 14  ? -45.134 71.313 -11.885 1.00 109.49 ? 14  DT  C O2    1 
ATOM   4407 N  N3    . DT  C 2 14  ? -45.246 72.306 -13.897 1.00 107.60 ? 14  DT  C N3    1 
ATOM   4408 C  C4    . DT  C 2 14  ? -45.892 72.690 -15.047 1.00 107.97 ? 14  DT  C C4    1 
ATOM   4409 O  O4    . DT  C 2 14  ? -45.309 73.324 -15.915 1.00 107.48 ? 14  DT  C O4    1 
ATOM   4410 C  C5    . DT  C 2 14  ? -47.281 72.297 -15.141 1.00 109.33 ? 14  DT  C C5    1 
ATOM   4411 C  C7    . DT  C 2 14  ? -48.079 72.668 -16.358 1.00 110.55 ? 14  DT  C C7    1 
ATOM   4412 C  C6    . DT  C 2 14  ? -47.823 71.602 -14.123 1.00 109.76 ? 14  DT  C C6    1 
ATOM   4413 P  P     . DT  C 2 15  ? -49.686 70.493 -8.210  1.00 117.97 ? 15  DT  C P     1 
ATOM   4414 O  OP1   . DT  C 2 15  ? -50.796 69.931 -7.405  1.00 119.51 ? 15  DT  C OP1   1 
ATOM   4415 O  OP2   . DT  C 2 15  ? -49.727 71.917 -8.645  1.00 118.16 ? 15  DT  C OP2   1 
ATOM   4416 O  "O5'" . DT  C 2 15  ? -48.304 70.286 -7.420  1.00 116.60 ? 15  DT  C "O5'" 1 
ATOM   4417 C  "C5'" . DT  C 2 15  ? -47.076 70.066 -8.116  1.00 113.88 ? 15  DT  C "C5'" 1 
ATOM   4418 C  "C4'" . DT  C 2 15  ? -45.945 70.971 -7.650  1.00 113.81 ? 15  DT  C "C4'" 1 
ATOM   4419 O  "O4'" . DT  C 2 15  ? -45.541 71.818 -8.749  1.00 113.65 ? 15  DT  C "O4'" 1 
ATOM   4420 C  "C3'" . DT  C 2 15  ? -46.187 71.959 -6.515  1.00 116.01 ? 15  DT  C "C3'" 1 
ATOM   4421 O  "O3'" . DT  C 2 15  ? -44.941 72.061 -5.818  1.00 115.61 ? 15  DT  C "O3'" 1 
ATOM   4422 C  "C2'" . DT  C 2 15  ? -46.585 73.256 -7.239  1.00 116.76 ? 15  DT  C "C2'" 1 
ATOM   4423 C  "C1'" . DT  C 2 15  ? -45.594 73.197 -8.392  1.00 114.67 ? 15  DT  C "C1'" 1 
ATOM   4424 N  N1    . DT  C 2 15  ? -45.886 73.966 -9.668  1.00 114.43 ? 15  DT  C N1    1 
ATOM   4425 C  C2    . DT  C 2 15  ? -44.812 74.558 -10.313 1.00 113.21 ? 15  DT  C C2    1 
ATOM   4426 O  O2    . DT  C 2 15  ? -43.667 74.515 -9.887  1.00 112.54 ? 15  DT  C O2    1 
ATOM   4427 N  N3    . DT  C 2 15  ? -45.128 75.209 -11.483 1.00 113.16 ? 15  DT  C N3    1 
ATOM   4428 C  C4    . DT  C 2 15  ? -46.382 75.327 -12.062 1.00 113.94 ? 15  DT  C C4    1 
ATOM   4429 O  O4    . DT  C 2 15  ? -46.557 75.933 -13.113 1.00 113.77 ? 15  DT  C O4    1 
ATOM   4430 C  C5    . DT  C 2 15  ? -47.463 74.681 -11.354 1.00 115.12 ? 15  DT  C C5    1 
ATOM   4431 C  C7    . DT  C 2 15  ? -48.860 74.743 -11.907 1.00 116.38 ? 15  DT  C C7    1 
ATOM   4432 C  C6    . DT  C 2 15  ? -47.169 74.033 -10.207 1.00 115.29 ? 15  DT  C C6    1 
ATOM   4433 P  P     . DT  C 2 16  ? -44.757 72.843 -4.428  1.00 117.72 ? 16  DT  C P     1 
ATOM   4434 O  OP1   . DT  C 2 16  ? -44.083 71.889 -3.522  1.00 117.36 ? 16  DT  C OP1   1 
ATOM   4435 O  OP2   . DT  C 2 16  ? -46.018 73.514 -4.040  1.00 119.74 ? 16  DT  C OP2   1 
ATOM   4436 O  "O5'" . DT  C 2 16  ? -43.734 74.016 -4.775  1.00 117.39 ? 16  DT  C "O5'" 1 
ATOM   4437 C  "C5'" . DT  C 2 16  ? -42.528 73.682 -5.452  1.00 116.29 ? 16  DT  C "C5'" 1 
ATOM   4438 C  "C4'" . DT  C 2 16  ? -41.808 74.924 -5.923  1.00 115.60 ? 16  DT  C "C4'" 1 
ATOM   4439 O  "O4'" . DT  C 2 16  ? -42.360 75.388 -7.184  1.00 114.88 ? 16  DT  C "O4'" 1 
ATOM   4440 C  "C3'" . DT  C 2 16  ? -41.888 76.076 -4.934  1.00 117.25 ? 16  DT  C "C3'" 1 
ATOM   4441 O  "O3'" . DT  C 2 16  ? -40.562 76.513 -4.809  1.00 117.80 ? 16  DT  C "O3'" 1 
ATOM   4442 C  "C2'" . DT  C 2 16  ? -42.801 77.104 -5.615  1.00 117.73 ? 16  DT  C "C2'" 1 
ATOM   4443 C  "C1'" . DT  C 2 16  ? -42.600 76.778 -7.099  1.00 115.45 ? 16  DT  C "C1'" 1 
ATOM   4444 N  N1    . DT  C 2 16  ? -43.693 77.149 -8.075  1.00 114.43 ? 16  DT  C N1    1 
ATOM   4445 C  C2    . DT  C 2 16  ? -43.314 77.751 -9.258  1.00 113.01 ? 16  DT  C C2    1 
ATOM   4446 O  O2    . DT  C 2 16  ? -42.159 77.995 -9.543  1.00 111.85 ? 16  DT  C O2    1 
ATOM   4447 N  N3    . DT  C 2 16  ? -44.334 78.072 -10.113 1.00 113.66 ? 16  DT  C N3    1 
ATOM   4448 C  C4    . DT  C 2 16  ? -45.681 77.844 -9.917  1.00 115.53 ? 16  DT  C C4    1 
ATOM   4449 O  O4    . DT  C 2 16  ? -46.514 78.174 -10.763 1.00 115.95 ? 16  DT  C O4    1 
ATOM   4450 C  C5    . DT  C 2 16  ? -46.023 77.203 -8.658  1.00 116.54 ? 16  DT  C C5    1 
ATOM   4451 C  C7    . DT  C 2 16  ? -47.459 76.903 -8.326  1.00 118.67 ? 16  DT  C C7    1 
ATOM   4452 C  C6    . DT  C 2 16  ? -45.027 76.885 -7.808  1.00 115.71 ? 16  DT  C C6    1 
ATOM   4453 P  P     . DG  C 2 17  ? -40.016 77.307 -3.539  1.00 120.33 ? 17  DG  C P     1 
ATOM   4454 O  OP1   . DG  C 2 17  ? -38.717 76.700 -3.166  1.00 119.45 ? 17  DG  C OP1   1 
ATOM   4455 O  OP2   . DG  C 2 17  ? -41.105 77.500 -2.556  1.00 121.51 ? 17  DG  C OP2   1 
ATOM   4456 O  "O5'" . DG  C 2 17  ? -39.715 78.734 -4.176  1.00 121.26 ? 17  DG  C "O5'" 1 
ATOM   4457 C  "C5'" . DG  C 2 17  ? -38.557 78.943 -4.968  1.00 120.67 ? 17  DG  C "C5'" 1 
ATOM   4458 C  "C4'" . DG  C 2 17  ? -38.595 80.364 -5.484  1.00 121.83 ? 17  DG  C "C4'" 1 
ATOM   4459 O  "O4'" . DG  C 2 17  ? -39.754 80.532 -6.331  1.00 121.13 ? 17  DG  C "O4'" 1 
ATOM   4460 C  "C3'" . DG  C 2 17  ? -38.693 81.432 -4.399  1.00 124.64 ? 17  DG  C "C3'" 1 
ATOM   4461 O  "O3'" . DG  C 2 17  ? -37.705 82.399 -4.713  1.00 126.30 ? 17  DG  C "O3'" 1 
ATOM   4462 C  "C2'" . DG  C 2 17  ? -40.128 81.959 -4.481  1.00 125.05 ? 17  DG  C "C2'" 1 
ATOM   4463 C  "C1'" . DG  C 2 17  ? -40.516 81.655 -5.926  1.00 123.03 ? 17  DG  C "C1'" 1 
ATOM   4464 N  N9    . DG  C 2 17  ? -41.916 81.298 -6.160  1.00 122.61 ? 17  DG  C N9    1 
ATOM   4465 C  C8    . DG  C 2 17  ? -42.786 80.648 -5.312  1.00 123.36 ? 17  DG  C C8    1 
ATOM   4466 N  N7    . DG  C 2 17  ? -43.969 80.461 -5.826  1.00 123.23 ? 17  DG  C N7    1 
ATOM   4467 C  C5    . DG  C 2 17  ? -43.876 81.022 -7.096  1.00 122.20 ? 17  DG  C C5    1 
ATOM   4468 C  C6    . DG  C 2 17  ? -44.840 81.114 -8.130  1.00 122.09 ? 17  DG  C C6    1 
ATOM   4469 O  O6    . DG  C 2 17  ? -46.008 80.710 -8.102  1.00 123.55 ? 17  DG  C O6    1 
ATOM   4470 N  N1    . DG  C 2 17  ? -44.347 81.758 -9.272  1.00 121.02 ? 17  DG  C N1    1 
ATOM   4471 C  C2    . DG  C 2 17  ? -43.063 82.246 -9.397  1.00 120.30 ? 17  DG  C C2    1 
ATOM   4472 N  N2    . DG  C 2 17  ? -42.744 82.829 -10.563 1.00 119.46 ? 17  DG  C N2    1 
ATOM   4473 N  N3    . DG  C 2 17  ? -42.145 82.157 -8.437  1.00 120.68 ? 17  DG  C N3    1 
ATOM   4474 C  C4    . DG  C 2 17  ? -42.619 81.538 -7.320  1.00 121.67 ? 17  DG  C C4    1 
ATOM   4475 P  P     . DT  C 2 18  ? -37.426 83.715 -3.849  1.00 129.35 ? 18  DT  C P     1 
ATOM   4476 O  OP1   . DT  C 2 18  ? -36.027 84.127 -4.140  1.00 129.66 ? 18  DT  C OP1   1 
ATOM   4477 O  OP2   . DT  C 2 18  ? -37.859 83.529 -2.441  1.00 131.19 ? 18  DT  C OP2   1 
ATOM   4478 O  "O5'" . DT  C 2 18  ? -38.456 84.718 -4.552  1.00 128.77 ? 18  DT  C "O5'" 1 
ATOM   4479 C  "C5'" . DT  C 2 18  ? -38.193 85.150 -5.882  1.00 126.32 ? 18  DT  C "C5'" 1 
ATOM   4480 C  "C4'" . DT  C 2 18  ? -39.390 85.856 -6.478  1.00 125.78 ? 18  DT  C "C4'" 1 
ATOM   4481 O  "O4'" . DT  C 2 18  ? -40.533 84.988 -6.447  1.00 125.50 ? 18  DT  C "O4'" 1 
ATOM   4482 C  "C3'" . DT  C 2 18  ? -39.901 87.078 -5.730  1.00 127.62 ? 18  DT  C "C3'" 1 
ATOM   4483 O  "O3'" . DT  C 2 18  ? -39.169 88.218 -6.140  1.00 126.27 ? 18  DT  C "O3'" 1 
ATOM   4484 C  "C2'" . DT  C 2 18  ? -41.371 87.153 -6.154  1.00 128.63 ? 18  DT  C "C2'" 1 
ATOM   4485 C  "C1'" . DT  C 2 18  ? -41.591 85.823 -6.856  1.00 127.50 ? 18  DT  C "C1'" 1 
ATOM   4486 N  N1    . DT  C 2 18  ? -42.875 85.214 -6.494  1.00 129.90 ? 18  DT  C N1    1 
ATOM   4487 C  C2    . DT  C 2 18  ? -43.862 85.137 -7.455  1.00 131.05 ? 18  DT  C C2    1 
ATOM   4488 O  O2    . DT  C 2 18  ? -43.727 85.541 -8.597  1.00 131.56 ? 18  DT  C O2    1 
ATOM   4489 N  N3    . DT  C 2 18  ? -45.026 84.552 -7.033  1.00 132.62 ? 18  DT  C N3    1 
ATOM   4490 C  C4    . DT  C 2 18  ? -45.284 84.055 -5.768  1.00 134.34 ? 18  DT  C C4    1 
ATOM   4491 O  O4    . DT  C 2 18  ? -46.368 83.551 -5.501  1.00 136.24 ? 18  DT  C O4    1 
ATOM   4492 C  C5    . DT  C 2 18  ? -44.202 84.170 -4.804  1.00 134.20 ? 18  DT  C C5    1 
ATOM   4493 C  C7    . DT  C 2 18  ? -44.348 83.674 -3.395  1.00 135.22 ? 18  DT  C C7    1 
ATOM   4494 C  C6    . DT  C 2 18  ? -43.061 84.739 -5.210  1.00 132.38 ? 18  DT  C C6    1 
ATOM   4495 P  P     . DA  C 2 19  ? -39.718 89.686 -5.870  1.00 127.02 ? 19  DA  C P     1 
ATOM   4496 O  OP1   . DA  C 2 19  ? -38.641 90.593 -6.314  1.00 127.39 ? 19  DA  C OP1   1 
ATOM   4497 O  OP2   . DA  C 2 19  ? -40.203 89.767 -4.470  1.00 128.46 ? 19  DA  C OP2   1 
ATOM   4498 O  "O5'" . DA  C 2 19  ? -40.957 89.789 -6.893  1.00 127.57 ? 19  DA  C "O5'" 1 
ATOM   4499 C  "C5'" . DA  C 2 19  ? -41.710 90.992 -6.950  1.00 132.50 ? 19  DA  C "C5'" 1 
ATOM   4500 C  "C4'" . DA  C 2 19  ? -42.910 90.952 -7.881  1.00 134.20 ? 19  DA  C "C4'" 1 
ATOM   4501 O  "O4'" . DA  C 2 19  ? -43.381 89.592 -8.012  1.00 133.53 ? 19  DA  C "O4'" 1 
ATOM   4502 C  "C3'" . DA  C 2 19  ? -44.106 91.759 -7.370  1.00 137.70 ? 19  DA  C "C3'" 1 
ATOM   4503 O  "O3'" . DA  C 2 19  ? -44.030 93.116 -7.842  1.00 139.13 ? 19  DA  C "O3'" 1 
ATOM   4504 C  "C2'" . DA  C 2 19  ? -45.314 91.012 -7.945  1.00 138.23 ? 19  DA  C "C2'" 1 
ATOM   4505 C  "C1'" . DA  C 2 19  ? -44.797 89.572 -8.060  1.00 137.19 ? 19  DA  C "C1'" 1 
ATOM   4506 N  N9    . DA  C 2 19  ? -45.239 88.651 -7.004  1.00 140.47 ? 19  DA  C N9    1 
ATOM   4507 C  C8    . DA  C 2 19  ? -44.610 88.422 -5.797  1.00 142.17 ? 19  DA  C C8    1 
ATOM   4508 N  N7    . DA  C 2 19  ? -45.209 87.535 -5.026  1.00 143.30 ? 19  DA  C N7    1 
ATOM   4509 C  C5    . DA  C 2 19  ? -46.313 87.143 -5.786  1.00 143.11 ? 19  DA  C C5    1 
ATOM   4510 C  C6    . DA  C 2 19  ? -47.360 86.218 -5.534  1.00 143.22 ? 19  DA  C C6    1 
ATOM   4511 N  N6    . DA  C 2 19  ? -47.426 85.520 -4.394  1.00 142.84 ? 19  DA  C N6    1 
ATOM   4512 N  N1    . DA  C 2 19  ? -48.320 86.051 -6.490  1.00 143.31 ? 19  DA  C N1    1 
ATOM   4513 C  C2    . DA  C 2 19  ? -48.235 86.770 -7.629  1.00 142.90 ? 19  DA  C C2    1 
ATOM   4514 N  N3    . DA  C 2 19  ? -47.302 87.673 -7.978  1.00 142.06 ? 19  DA  C N3    1 
ATOM   4515 C  C4    . DA  C 2 19  ? -46.354 87.816 -7.011  1.00 142.07 ? 19  DA  C C4    1 
ATOM   4516 O  "O5'" . DT  D 3 1   ? -56.601 89.694 -9.446  1.00 180.58 ? 1   DT  D "O5'" 1 
ATOM   4517 C  "C5'" . DT  D 3 1   ? -57.000 88.629 -10.304 1.00 178.95 ? 1   DT  D "C5'" 1 
ATOM   4518 C  "C4'" . DT  D 3 1   ? -55.884 87.629 -10.586 1.00 174.66 ? 1   DT  D "C4'" 1 
ATOM   4519 O  "O4'" . DT  D 3 1   ? -54.903 87.494 -9.501  1.00 174.16 ? 1   DT  D "O4'" 1 
ATOM   4520 C  "C3'" . DT  D 3 1   ? -56.424 86.219 -10.833 1.00 173.00 ? 1   DT  D "C3'" 1 
ATOM   4521 O  "O3'" . DT  D 3 1   ? -56.100 85.767 -12.173 1.00 168.01 ? 1   DT  D "O3'" 1 
ATOM   4522 C  "C2'" . DT  D 3 1   ? -55.807 85.403 -9.690  1.00 172.86 ? 1   DT  D "C2'" 1 
ATOM   4523 C  "C1'" . DT  D 3 1   ? -54.469 86.133 -9.546  1.00 172.41 ? 1   DT  D "C1'" 1 
ATOM   4524 N  N1    . DT  D 3 1   ? -53.507 85.641 -8.436  1.00 172.16 ? 1   DT  D N1    1 
ATOM   4525 C  C2    . DT  D 3 1   ? -52.425 86.414 -8.003  1.00 171.85 ? 1   DT  D C2    1 
ATOM   4526 O  O2    . DT  D 3 1   ? -52.152 87.536 -8.421  1.00 171.76 ? 1   DT  D O2    1 
ATOM   4527 N  N3    . DT  D 3 1   ? -51.657 85.814 -7.012  1.00 171.29 ? 1   DT  D N3    1 
ATOM   4528 C  C4    . DT  D 3 1   ? -51.837 84.560 -6.431  1.00 170.79 ? 1   DT  D C4    1 
ATOM   4529 O  O4    . DT  D 3 1   ? -51.092 84.138 -5.551  1.00 170.13 ? 1   DT  D O4    1 
ATOM   4530 C  C5    . DT  D 3 1   ? -52.961 83.795 -6.929  1.00 171.28 ? 1   DT  D C5    1 
ATOM   4531 C  C7    . DT  D 3 1   ? -53.267 82.424 -6.380  1.00 170.49 ? 1   DT  D C7    1 
ATOM   4532 C  C6    . DT  D 3 1   ? -53.721 84.367 -7.894  1.00 172.04 ? 1   DT  D C6    1 
ATOM   4533 P  P     . DA  D 3 2   ? -54.726 85.047 -12.630 1.00 161.63 ? 2   DA  D P     1 
ATOM   4534 O  OP1   . DA  D 3 2   ? -54.844 84.800 -14.086 1.00 161.13 ? 2   DA  D OP1   1 
ATOM   4535 O  OP2   . DA  D 3 2   ? -54.405 83.904 -11.740 1.00 159.76 ? 2   DA  D OP2   1 
ATOM   4536 O  "O5'" . DA  D 3 2   ? -53.631 86.183 -12.375 1.00 157.84 ? 2   DA  D "O5'" 1 
ATOM   4537 C  "C5'" . DA  D 3 2   ? -53.331 87.122 -13.392 1.00 153.23 ? 2   DA  D "C5'" 1 
ATOM   4538 C  "C4'" . DA  D 3 2   ? -51.878 86.935 -13.760 1.00 146.56 ? 2   DA  D "C4'" 1 
ATOM   4539 O  "O4'" . DA  D 3 2   ? -51.153 86.734 -12.523 1.00 145.24 ? 2   DA  D "O4'" 1 
ATOM   4540 C  "C3'" . DA  D 3 2   ? -51.638 85.698 -14.620 1.00 142.04 ? 2   DA  D "C3'" 1 
ATOM   4541 O  "O3'" . DA  D 3 2   ? -51.452 86.135 -15.979 1.00 137.45 ? 2   DA  D "O3'" 1 
ATOM   4542 C  "C2'" . DA  D 3 2   ? -50.444 84.984 -13.964 1.00 140.48 ? 2   DA  D "C2'" 1 
ATOM   4543 C  "C1'" . DA  D 3 2   ? -50.096 85.831 -12.734 1.00 142.70 ? 2   DA  D "C1'" 1 
ATOM   4544 N  N9    . DA  D 3 2   ? -50.011 85.080 -11.489 1.00 143.97 ? 2   DA  D N9    1 
ATOM   4545 C  C8    . DA  D 3 2   ? -50.972 84.274 -10.935 1.00 145.85 ? 2   DA  D C8    1 
ATOM   4546 N  N7    . DA  D 3 2   ? -50.614 83.720 -9.795  1.00 146.00 ? 2   DA  D N7    1 
ATOM   4547 C  C5    . DA  D 3 2   ? -49.331 84.209 -9.590  1.00 144.92 ? 2   DA  D C5    1 
ATOM   4548 C  C6    . DA  D 3 2   ? -48.391 83.997 -8.558  1.00 144.28 ? 2   DA  D C6    1 
ATOM   4549 N  N6    . DA  D 3 2   ? -48.637 83.221 -7.517  1.00 145.34 ? 2   DA  D N6    1 
ATOM   4550 N  N1    . DA  D 3 2   ? -47.193 84.593 -8.641  1.00 143.03 ? 2   DA  D N1    1 
ATOM   4551 C  C2    . DA  D 3 2   ? -46.955 85.418 -9.705  1.00 142.92 ? 2   DA  D C2    1 
ATOM   4552 N  N3    . DA  D 3 2   ? -47.761 85.695 -10.741 1.00 143.28 ? 2   DA  D N3    1 
ATOM   4553 C  C4    . DA  D 3 2   ? -48.944 85.055 -10.620 1.00 144.10 ? 2   DA  D C4    1 
ATOM   4554 P  P     . DC  D 3 3   ? -50.471 85.440 -17.036 1.00 131.18 ? 3   DC  D P     1 
ATOM   4555 O  OP1   . DC  D 3 3   ? -50.714 86.099 -18.342 1.00 131.66 ? 3   DC  D OP1   1 
ATOM   4556 O  OP2   . DC  D 3 3   ? -50.512 83.963 -16.912 1.00 129.13 ? 3   DC  D OP2   1 
ATOM   4557 O  "O5'" . DC  D 3 3   ? -49.066 85.896 -16.460 1.00 127.65 ? 3   DC  D "O5'" 1 
ATOM   4558 C  "C5'" . DC  D 3 3   ? -47.967 85.908 -17.307 1.00 123.76 ? 3   DC  D "C5'" 1 
ATOM   4559 C  "C4'" . DC  D 3 3   ? -46.729 85.648 -16.494 1.00 120.09 ? 3   DC  D "C4'" 1 
ATOM   4560 O  "O4'" . DC  D 3 3   ? -47.064 85.151 -15.190 1.00 119.76 ? 3   DC  D "O4'" 1 
ATOM   4561 C  "C3'" . DC  D 3 3   ? -45.875 84.568 -17.107 1.00 117.12 ? 3   DC  D "C3'" 1 
ATOM   4562 O  "O3'" . DC  D 3 3   ? -45.032 85.265 -17.996 1.00 115.69 ? 3   DC  D "O3'" 1 
ATOM   4563 C  "C2'" . DC  D 3 3   ? -45.155 83.946 -15.909 1.00 116.08 ? 3   DC  D "C2'" 1 
ATOM   4564 C  "C1'" . DC  D 3 3   ? -45.916 84.482 -14.697 1.00 118.23 ? 3   DC  D "C1'" 1 
ATOM   4565 N  N1    . DC  D 3 3   ? -46.359 83.474 -13.656 1.00 118.26 ? 3   DC  D N1    1 
ATOM   4566 C  C2    . DC  D 3 3   ? -45.640 83.302 -12.449 1.00 118.04 ? 3   DC  D C2    1 
ATOM   4567 O  O2    . DC  D 3 3   ? -44.605 83.948 -12.225 1.00 118.75 ? 3   DC  D O2    1 
ATOM   4568 N  N3    . DC  D 3 3   ? -46.090 82.404 -11.536 1.00 117.58 ? 3   DC  D N3    1 
ATOM   4569 C  C4    . DC  D 3 3   ? -47.204 81.714 -11.775 1.00 117.78 ? 3   DC  D C4    1 
ATOM   4570 N  N4    . DC  D 3 3   ? -47.599 80.841 -10.849 1.00 118.32 ? 3   DC  D N4    1 
ATOM   4571 C  C5    . DC  D 3 3   ? -47.958 81.875 -12.978 1.00 118.48 ? 3   DC  D C5    1 
ATOM   4572 C  C6    . DC  D 3 3   ? -47.504 82.757 -13.875 1.00 118.69 ? 3   DC  D C6    1 
ATOM   4573 P  P     . DA  D 3 4   ? -44.077 84.523 -19.020 1.00 113.09 ? 4   DA  D P     1 
ATOM   4574 O  OP1   . DA  D 3 4   ? -43.579 85.540 -19.983 1.00 113.55 ? 4   DA  D OP1   1 
ATOM   4575 O  OP2   . DA  D 3 4   ? -44.803 83.326 -19.510 1.00 112.62 ? 4   DA  D OP2   1 
ATOM   4576 O  "O5'" . DA  D 3 4   ? -42.910 84.030 -18.040 1.00 111.07 ? 4   DA  D "O5'" 1 
ATOM   4577 C  "C5'" . DA  D 3 4   ? -41.591 84.508 -18.164 1.00 111.14 ? 4   DA  D "C5'" 1 
ATOM   4578 C  "C4'" . DA  D 3 4   ? -40.587 83.481 -17.662 1.00 110.42 ? 4   DA  D "C4'" 1 
ATOM   4579 O  "O4'" . DA  D 3 4   ? -41.096 82.834 -16.481 1.00 109.44 ? 4   DA  D "O4'" 1 
ATOM   4580 C  "C3'" . DA  D 3 4   ? -40.198 82.371 -18.640 1.00 110.32 ? 4   DA  D "C3'" 1 
ATOM   4581 O  "O3'" . DA  D 3 4   ? -38.753 82.380 -18.794 1.00 112.01 ? 4   DA  D "O3'" 1 
ATOM   4582 C  "C2'" . DA  D 3 4   ? -40.811 81.088 -18.076 1.00 107.37 ? 4   DA  D "C2'" 1 
ATOM   4583 C  "C1'" . DA  D 3 4   ? -41.062 81.437 -16.618 1.00 107.03 ? 4   DA  D "C1'" 1 
ATOM   4584 N  N9    . DA  D 3 4   ? -42.354 80.995 -16.148 1.00 106.70 ? 4   DA  D N9    1 
ATOM   4585 C  C8    . DA  D 3 4   ? -43.503 80.920 -16.878 1.00 107.78 ? 4   DA  D C8    1 
ATOM   4586 N  N7    . DA  D 3 4   ? -44.539 80.484 -16.198 1.00 108.03 ? 4   DA  D N7    1 
ATOM   4587 C  C5    . DA  D 3 4   ? -44.031 80.268 -14.935 1.00 106.72 ? 4   DA  D C5    1 
ATOM   4588 C  C6    . DA  D 3 4   ? -44.633 79.808 -13.756 1.00 106.48 ? 4   DA  D C6    1 
ATOM   4589 N  N6    . DA  D 3 4   ? -45.917 79.474 -13.697 1.00 107.22 ? 4   DA  D N6    1 
ATOM   4590 N  N1    . DA  D 3 4   ? -43.860 79.699 -12.656 1.00 106.02 ? 4   DA  D N1    1 
ATOM   4591 C  C2    . DA  D 3 4   ? -42.565 80.045 -12.746 1.00 105.49 ? 4   DA  D C2    1 
ATOM   4592 N  N3    . DA  D 3 4   ? -41.878 80.490 -13.803 1.00 105.36 ? 4   DA  D N3    1 
ATOM   4593 C  C4    . DA  D 3 4   ? -42.682 80.581 -14.879 1.00 106.31 ? 4   DA  D C4    1 
ATOM   4594 P  P     . DA  D 3 5   ? -37.751 81.215 -18.348 1.00 112.18 ? 5   DA  D P     1 
ATOM   4595 O  OP1   . DA  D 3 5   ? -36.389 81.773 -18.552 1.00 112.29 ? 5   DA  D OP1   1 
ATOM   4596 O  OP2   . DA  D 3 5   ? -38.195 79.969 -19.018 1.00 110.72 ? 5   DA  D OP2   1 
ATOM   4597 O  "O5'" . DA  D 3 5   ? -38.021 81.029 -16.779 1.00 114.44 ? 5   DA  D "O5'" 1 
ATOM   4598 C  "C5'" . DA  D 3 5   ? -36.977 80.804 -15.822 1.00 117.20 ? 5   DA  D "C5'" 1 
ATOM   4599 C  "C4'" . DA  D 3 5   ? -37.077 79.407 -15.216 1.00 117.93 ? 5   DA  D "C4'" 1 
ATOM   4600 O  "O4'" . DA  D 3 5   ? -38.451 79.079 -14.836 1.00 117.41 ? 5   DA  D "O4'" 1 
ATOM   4601 C  "C3'" . DA  D 3 5   ? -36.642 78.278 -16.151 1.00 118.25 ? 5   DA  D "C3'" 1 
ATOM   4602 O  "O3'" . DA  D 3 5   ? -36.202 77.142 -15.398 1.00 120.21 ? 5   DA  D "O3'" 1 
ATOM   4603 C  "C2'" . DA  D 3 5   ? -37.974 77.904 -16.781 1.00 116.85 ? 5   DA  D "C2'" 1 
ATOM   4604 C  "C1'" . DA  D 3 5   ? -38.754 77.853 -15.474 1.00 115.91 ? 5   DA  D "C1'" 1 
ATOM   4605 N  N9    . DA  D 3 5   ? -40.185 77.631 -15.606 1.00 115.20 ? 5   DA  D N9    1 
ATOM   4606 C  C8    . DA  D 3 5   ? -40.941 77.623 -16.751 1.00 115.30 ? 5   DA  D C8    1 
ATOM   4607 N  N7    . DA  D 3 5   ? -42.214 77.374 -16.549 1.00 114.89 ? 5   DA  D N7    1 
ATOM   4608 C  C5    . DA  D 3 5   ? -42.288 77.197 -15.178 1.00 114.68 ? 5   DA  D C5    1 
ATOM   4609 C  C6    . DA  D 3 5   ? -43.363 76.901 -14.325 1.00 114.59 ? 5   DA  D C6    1 
ATOM   4610 N  N6    . DA  D 3 5   ? -44.603 76.740 -14.776 1.00 114.20 ? 5   DA  D N6    1 
ATOM   4611 N  N1    . DA  D 3 5   ? -43.107 76.790 -12.998 1.00 115.42 ? 5   DA  D N1    1 
ATOM   4612 C  C2    . DA  D 3 5   ? -41.847 76.960 -12.551 1.00 115.26 ? 5   DA  D C2    1 
ATOM   4613 N  N3    . DA  D 3 5   ? -40.747 77.245 -13.259 1.00 114.94 ? 5   DA  D N3    1 
ATOM   4614 C  C4    . DA  D 3 5   ? -41.045 77.347 -14.576 1.00 115.06 ? 5   DA  D C4    1 
ATOM   4615 P  P     . DA  D 3 6   ? -34.695 76.878 -14.918 1.00 121.92 ? 6   DA  D P     1 
ATOM   4616 O  OP1   . DA  D 3 6   ? -34.117 78.138 -14.344 1.00 122.30 ? 6   DA  D OP1   1 
ATOM   4617 O  OP2   . DA  D 3 6   ? -34.069 76.109 -16.026 1.00 121.14 ? 6   DA  D OP2   1 
ATOM   4618 O  "O5'" . DA  D 3 6   ? -34.889 75.851 -13.706 1.00 119.19 ? 6   DA  D "O5'" 1 
ATOM   4619 C  "C5'" . DA  D 3 6   ? -34.976 76.364 -12.378 1.00 116.67 ? 6   DA  D "C5'" 1 
ATOM   4620 C  "C4'" . DA  D 3 6   ? -35.871 75.443 -11.582 1.00 113.39 ? 6   DA  D "C4'" 1 
ATOM   4621 O  "O4'" . DA  D 3 6   ? -37.204 75.450 -12.158 1.00 111.91 ? 6   DA  D "O4'" 1 
ATOM   4622 C  "C3'" . DA  D 3 6   ? -35.393 73.998 -11.569 1.00 110.81 ? 6   DA  D "C3'" 1 
ATOM   4623 O  "O3'" . DA  D 3 6   ? -35.149 73.692 -10.206 1.00 109.68 ? 6   DA  D "O3'" 1 
ATOM   4624 C  "C2'" . DA  D 3 6   ? -36.536 73.214 -12.222 1.00 109.36 ? 6   DA  D "C2'" 1 
ATOM   4625 C  "C1'" . DA  D 3 6   ? -37.737 74.147 -12.154 1.00 109.05 ? 6   DA  D "C1'" 1 
ATOM   4626 N  N9    . DA  D 3 6   ? -38.652 74.061 -13.290 1.00 107.01 ? 6   DA  D N9    1 
ATOM   4627 C  C8    . DA  D 3 6   ? -38.348 74.221 -14.615 1.00 105.93 ? 6   DA  D C8    1 
ATOM   4628 N  N7    . DA  D 3 6   ? -39.385 74.102 -15.412 1.00 105.01 ? 6   DA  D N7    1 
ATOM   4629 C  C5    . DA  D 3 6   ? -40.437 73.849 -14.554 1.00 105.03 ? 6   DA  D C5    1 
ATOM   4630 C  C6    . DA  D 3 6   ? -41.810 73.625 -14.769 1.00 104.92 ? 6   DA  D C6    1 
ATOM   4631 N  N6    . DA  D 3 6   ? -42.355 73.619 -15.980 1.00 105.17 ? 6   DA  D N6    1 
ATOM   4632 N  N1    . DA  D 3 6   ? -42.606 73.406 -13.700 1.00 105.36 ? 6   DA  D N1    1 
ATOM   4633 C  C2    . DA  D 3 6   ? -42.053 73.410 -12.482 1.00 105.41 ? 6   DA  D C2    1 
ATOM   4634 N  N3    . DA  D 3 6   ? -40.774 73.609 -12.153 1.00 105.93 ? 6   DA  D N3    1 
ATOM   4635 C  C4    . DA  D 3 6   ? -40.009 73.824 -13.241 1.00 106.00 ? 6   DA  D C4    1 
ATOM   4636 P  P     . DA  D 3 7   ? -34.954 72.231 -9.602  1.00 108.06 ? 7   DA  D P     1 
ATOM   4637 O  OP1   . DA  D 3 7   ? -33.679 72.273 -8.846  1.00 109.29 ? 7   DA  D OP1   1 
ATOM   4638 O  OP2   . DA  D 3 7   ? -35.213 71.186 -10.622 1.00 107.28 ? 7   DA  D OP2   1 
ATOM   4639 O  "O5'" . DA  D 3 7   ? -36.150 72.133 -8.553  1.00 108.01 ? 7   DA  D "O5'" 1 
ATOM   4640 C  "C5'" . DA  D 3 7   ? -37.480 72.519 -8.881  1.00 107.60 ? 7   DA  D "C5'" 1 
ATOM   4641 C  "C4'" . DA  D 3 7   ? -38.471 71.376 -8.708  1.00 106.59 ? 7   DA  D "C4'" 1 
ATOM   4642 O  "O4'" . DA  D 3 7   ? -39.314 71.309 -9.887  1.00 106.35 ? 7   DA  D "O4'" 1 
ATOM   4643 C  "C3'" . DA  D 3 7   ? -37.912 69.960 -8.512  1.00 104.82 ? 7   DA  D "C3'" 1 
ATOM   4644 O  "O3'" . DA  D 3 7   ? -38.757 69.246 -7.583  1.00 103.19 ? 7   DA  D "O3'" 1 
ATOM   4645 C  "C2'" . DA  D 3 7   ? -37.953 69.402 -9.930  1.00 104.29 ? 7   DA  D "C2'" 1 
ATOM   4646 C  "C1'" . DA  D 3 7   ? -39.254 70.005 -10.437 1.00 105.24 ? 7   DA  D "C1'" 1 
ATOM   4647 N  N9    . DA  D 3 7   ? -39.372 70.091 -11.895 1.00 105.54 ? 7   DA  D N9    1 
ATOM   4648 C  C8    . DA  D 3 7   ? -38.377 70.237 -12.834 1.00 105.29 ? 7   DA  D C8    1 
ATOM   4649 N  N7    . DA  D 3 7   ? -38.803 70.282 -14.078 1.00 104.56 ? 7   DA  D N7    1 
ATOM   4650 C  C5    . DA  D 3 7   ? -40.173 70.163 -13.938 1.00 105.27 ? 7   DA  D C5    1 
ATOM   4651 C  C6    . DA  D 3 7   ? -41.217 70.144 -14.879 1.00 105.78 ? 7   DA  D C6    1 
ATOM   4652 N  N6    . DA  D 3 7   ? -40.984 70.253 -16.186 1.00 105.72 ? 7   DA  D N6    1 
ATOM   4653 N  N1    . DA  D 3 7   ? -42.491 70.014 -14.428 1.00 106.48 ? 7   DA  D N1    1 
ATOM   4654 C  C2    . DA  D 3 7   ? -42.700 69.908 -13.105 1.00 106.48 ? 7   DA  D C2    1 
ATOM   4655 N  N3    . DA  D 3 7   ? -41.802 69.914 -12.116 1.00 106.18 ? 7   DA  D N3    1 
ATOM   4656 C  C4    . DA  D 3 7   ? -40.548 70.043 -12.607 1.00 105.72 ? 7   DA  D C4    1 
ATOM   4657 P  P     . DT  D 3 8   ? -38.677 67.684 -7.235  1.00 100.58 ? 8   DT  D P     1 
ATOM   4658 O  OP1   . DT  D 3 8   ? -39.001 67.523 -5.797  1.00 101.02 ? 8   DT  D OP1   1 
ATOM   4659 O  OP2   . DT  D 3 8   ? -37.433 67.121 -7.804  1.00 99.30  ? 8   DT  D OP2   1 
ATOM   4660 O  "O5'" . DT  D 3 8   ? -39.876 67.092 -8.089  1.00 99.59  ? 8   DT  D "O5'" 1 
ATOM   4661 C  "C5'" . DT  D 3 8   ? -41.197 67.212 -7.614  1.00 100.93 ? 8   DT  D "C5'" 1 
ATOM   4662 C  "C4'" . DT  D 3 8   ? -42.140 66.722 -8.689  1.00 101.19 ? 8   DT  D "C4'" 1 
ATOM   4663 O  "O4'" . DT  D 3 8   ? -41.693 67.162 -9.988  1.00 101.35 ? 8   DT  D "O4'" 1 
ATOM   4664 C  "C3'" . DT  D 3 8   ? -42.204 65.215 -8.783  1.00 100.46 ? 8   DT  D "C3'" 1 
ATOM   4665 O  "O3'" . DT  D 3 8   ? -43.434 64.905 -8.191  1.00 102.12 ? 8   DT  D "O3'" 1 
ATOM   4666 C  "C2'" . DT  D 3 8   ? -42.122 64.890 -10.280 1.00 99.22  ? 8   DT  D "C2'" 1 
ATOM   4667 C  "C1'" . DT  D 3 8   ? -42.177 66.259 -10.951 1.00 99.59  ? 8   DT  D "C1'" 1 
ATOM   4668 N  N1    . DT  D 3 8   ? -41.355 66.472 -12.200 1.00 98.37  ? 8   DT  D N1    1 
ATOM   4669 C  C2    . DT  D 3 8   ? -42.006 66.553 -13.415 1.00 98.17  ? 8   DT  D C2    1 
ATOM   4670 O  O2    . DT  D 3 8   ? -43.208 66.437 -13.533 1.00 98.99  ? 8   DT  D O2    1 
ATOM   4671 N  N3    . DT  D 3 8   ? -41.201 66.762 -14.510 1.00 97.88  ? 8   DT  D N3    1 
ATOM   4672 C  C4    . DT  D 3 8   ? -39.828 66.909 -14.508 1.00 97.48  ? 8   DT  D C4    1 
ATOM   4673 O  O4    . DT  D 3 8   ? -39.159 67.090 -15.524 1.00 97.01  ? 8   DT  D O4    1 
ATOM   4674 C  C5    . DT  D 3 8   ? -39.217 66.825 -13.213 1.00 97.67  ? 8   DT  D C5    1 
ATOM   4675 C  C7    . DT  D 3 8   ? -37.735 66.972 -13.151 1.00 98.83  ? 8   DT  D C7    1 
ATOM   4676 C  C6    . DT  D 3 8   ? -39.980 66.619 -12.128 1.00 97.66  ? 8   DT  D C6    1 
ATOM   4677 P  P     . DT  D 3 9   ? -43.927 63.402 -8.017  1.00 102.31 ? 9   DT  D P     1 
ATOM   4678 O  OP1   . DT  D 3 9   ? -44.995 63.427 -6.983  1.00 102.94 ? 9   DT  D OP1   1 
ATOM   4679 O  OP2   . DT  D 3 9   ? -42.752 62.500 -7.906  1.00 100.85 ? 9   DT  D OP2   1 
ATOM   4680 O  "O5'" . DT  D 3 9   ? -44.584 63.153 -9.449  1.00 102.07 ? 9   DT  D "O5'" 1 
ATOM   4681 C  "C5'" . DT  D 3 9   ? -45.634 64.011 -9.891  1.00 103.60 ? 9   DT  D "C5'" 1 
ATOM   4682 C  "C4'" . DT  D 3 9   ? -46.047 63.636 -11.300 1.00 103.44 ? 9   DT  D "C4'" 1 
ATOM   4683 O  "O4'" . DT  D 3 9   ? -45.040 64.028 -12.267 1.00 103.08 ? 9   DT  D "O4'" 1 
ATOM   4684 C  "C3'" . DT  D 3 9   ? -46.255 62.145 -11.519 1.00 103.00 ? 9   DT  D "C3'" 1 
ATOM   4685 O  "O3'" . DT  D 3 9   ? -47.459 62.006 -12.258 1.00 103.74 ? 9   DT  D "O3'" 1 
ATOM   4686 C  "C2'" . DT  D 3 9   ? -45.013 61.711 -12.292 1.00 101.17 ? 9   DT  D "C2'" 1 
ATOM   4687 C  "C1'" . DT  D 3 9   ? -44.810 62.949 -13.151 1.00 101.46 ? 9   DT  D "C1'" 1 
ATOM   4688 N  N1    . DT  D 3 9   ? -43.450 63.073 -13.768 1.00 100.30 ? 9   DT  D N1    1 
ATOM   4689 C  C2    . DT  D 3 9   ? -43.337 63.361 -15.120 1.00 100.16 ? 9   DT  D C2    1 
ATOM   4690 O  O2    . DT  D 3 9   ? -44.281 63.523 -15.874 1.00 100.70 ? 9   DT  D O2    1 
ATOM   4691 N  N3    . DT  D 3 9   ? -42.049 63.446 -15.574 1.00 99.67  ? 9   DT  D N3    1 
ATOM   4692 C  C4    . DT  D 3 9   ? -40.896 63.284 -14.829 1.00 99.47  ? 9   DT  D C4    1 
ATOM   4693 O  O4    . DT  D 3 9   ? -39.785 63.387 -15.337 1.00 100.09 ? 9   DT  D O4    1 
ATOM   4694 C  C5    . DT  D 3 9   ? -41.084 62.988 -13.430 1.00 99.25  ? 9   DT  D C5    1 
ATOM   4695 C  C7    . DT  D 3 9   ? -39.908 62.793 -12.522 1.00 99.28  ? 9   DT  D C7    1 
ATOM   4696 C  C6    . DT  D 3 9   ? -42.333 62.899 -12.973 1.00 99.57  ? 9   DT  D C6    1 
ATOM   4697 P  P     . DC  D 3 10  ? -48.119 60.581 -12.561 1.00 102.70 ? 10  DC  D P     1 
ATOM   4698 O  OP1   . DC  D 3 10  ? -49.580 60.688 -12.337 1.00 103.32 ? 10  DC  D OP1   1 
ATOM   4699 O  OP2   . DC  D 3 10  ? -47.335 59.507 -11.897 1.00 101.55 ? 10  DC  D OP2   1 
ATOM   4700 O  "O5'" . DC  D 3 10  ? -47.833 60.554 -14.130 1.00 101.39 ? 10  DC  D "O5'" 1 
ATOM   4701 C  "C5'" . DC  D 3 10  ? -48.495 61.507 -14.948 1.00 101.50 ? 10  DC  D "C5'" 1 
ATOM   4702 C  "C4'" . DC  D 3 10  ? -48.105 61.288 -16.386 1.00 100.03 ? 10  DC  D "C4'" 1 
ATOM   4703 O  "O4'" . DC  D 3 10  ? -46.683 61.452 -16.487 1.00 98.62  ? 10  DC  D "O4'" 1 
ATOM   4704 C  "C3'" . DC  D 3 10  ? -48.412 59.893 -16.901 1.00 99.63  ? 10  DC  D "C3'" 1 
ATOM   4705 O  "O3'" . DC  D 3 10  ? -49.171 60.067 -18.081 1.00 100.34 ? 10  DC  D "O3'" 1 
ATOM   4706 C  "C2'" . DC  D 3 10  ? -47.045 59.239 -17.131 1.00 98.32  ? 10  DC  D "C2'" 1 
ATOM   4707 C  "C1'" . DC  D 3 10  ? -46.148 60.450 -17.318 1.00 97.96  ? 10  DC  D "C1'" 1 
ATOM   4708 N  N1    . DC  D 3 10  ? -44.746 60.324 -16.860 1.00 97.32  ? 10  DC  D N1    1 
ATOM   4709 C  C2    . DC  D 3 10  ? -43.683 60.345 -17.777 1.00 97.28  ? 10  DC  D C2    1 
ATOM   4710 O  O2    . DC  D 3 10  ? -43.926 60.432 -18.985 1.00 98.30  ? 10  DC  D O2    1 
ATOM   4711 N  N3    . DC  D 3 10  ? -42.404 60.256 -17.317 1.00 96.49  ? 10  DC  D N3    1 
ATOM   4712 C  C4    . DC  D 3 10  ? -42.182 60.169 -16.005 1.00 95.86  ? 10  DC  D C4    1 
ATOM   4713 N  N4    . DC  D 3 10  ? -40.930 60.079 -15.568 1.00 95.45  ? 10  DC  D N4    1 
ATOM   4714 C  C5    . DC  D 3 10  ? -43.246 60.154 -15.063 1.00 96.92  ? 10  DC  D C5    1 
ATOM   4715 C  C6    . DC  D 3 10  ? -44.499 60.240 -15.523 1.00 97.34  ? 10  DC  D C6    1 
ATOM   4716 P  P     . DC  D 3 11  ? -49.756 58.824 -18.897 1.00 100.22 ? 11  DC  D P     1 
ATOM   4717 O  OP1   . DC  D 3 11  ? -50.815 59.345 -19.805 1.00 100.23 ? 11  DC  D OP1   1 
ATOM   4718 O  OP2   . DC  D 3 11  ? -50.016 57.720 -17.924 1.00 98.98  ? 11  DC  D OP2   1 
ATOM   4719 O  "O5'" . DC  D 3 11  ? -48.454 58.442 -19.751 1.00 97.57  ? 11  DC  D "O5'" 1 
ATOM   4720 C  "C5'" . DC  D 3 11  ? -48.366 58.511 -21.162 1.00 95.99  ? 11  DC  D "C5'" 1 
ATOM   4721 C  "C4'" . DC  D 3 11  ? -47.182 57.653 -21.519 1.00 94.13  ? 11  DC  D "C4'" 1 
ATOM   4722 O  "O4'" . DC  D 3 11  ? -46.081 57.989 -20.633 1.00 92.57  ? 11  DC  D "O4'" 1 
ATOM   4723 C  "C3'" . DC  D 3 11  ? -47.446 56.168 -21.296 1.00 94.71  ? 11  DC  D "C3'" 1 
ATOM   4724 O  "O3'" . DC  D 3 11  ? -47.010 55.440 -22.413 1.00 96.02  ? 11  DC  D "O3'" 1 
ATOM   4725 C  "C2'" . DC  D 3 11  ? -46.608 55.820 -20.073 1.00 93.15  ? 11  DC  D "C2'" 1 
ATOM   4726 C  "C1'" . DC  D 3 11  ? -45.442 56.767 -20.325 1.00 91.89  ? 11  DC  D "C1'" 1 
ATOM   4727 N  N1    . DC  D 3 11  ? -44.442 56.863 -19.206 1.00 90.03  ? 11  DC  D N1    1 
ATOM   4728 C  C2    . DC  D 3 11  ? -43.101 57.191 -19.475 1.00 88.94  ? 11  DC  D C2    1 
ATOM   4729 O  O2    . DC  D 3 11  ? -42.737 57.423 -20.635 1.00 87.56  ? 11  DC  D O2    1 
ATOM   4730 N  N3    . DC  D 3 11  ? -42.227 57.253 -18.430 1.00 88.88  ? 11  DC  D N3    1 
ATOM   4731 C  C4    . DC  D 3 11  ? -42.640 56.997 -17.183 1.00 88.40  ? 11  DC  D C4    1 
ATOM   4732 N  N4    . DC  D 3 11  ? -41.750 57.062 -16.194 1.00 87.84  ? 11  DC  D N4    1 
ATOM   4733 C  C5    . DC  D 3 11  ? -43.993 56.659 -16.893 1.00 89.21  ? 11  DC  D C5    1 
ATOM   4734 C  C6    . DC  D 3 11  ? -44.845 56.599 -17.923 1.00 90.07  ? 11  DC  D C6    1 
ATOM   4735 P  P     . DA  D 3 12  ? -48.079 55.002 -23.505 1.00 99.19  ? 12  DA  D P     1 
ATOM   4736 O  OP1   . DA  D 3 12  ? -49.039 56.115 -23.671 1.00 100.58 ? 12  DA  D OP1   1 
ATOM   4737 O  OP2   . DA  D 3 12  ? -48.525 53.625 -23.198 1.00 99.28  ? 12  DA  D OP2   1 
ATOM   4738 O  "O5'" . DA  D 3 12  ? -47.216 54.894 -24.833 1.00 100.13 ? 12  DA  D "O5'" 1 
ATOM   4739 C  "C5'" . DA  D 3 12  ? -46.469 55.983 -25.326 1.00 100.61 ? 12  DA  D "C5'" 1 
ATOM   4740 C  "C4'" . DA  D 3 12  ? -45.164 55.487 -25.944 1.00 100.55 ? 12  DA  D "C4'" 1 
ATOM   4741 O  "O4'" . DA  D 3 12  ? -44.110 55.398 -24.959 1.00 98.77  ? 12  DA  D "O4'" 1 
ATOM   4742 C  "C3'" . DA  D 3 12  ? -45.108 54.128 -26.626 1.00 101.67 ? 12  DA  D "C3'" 1 
ATOM   4743 O  "O3'" . DA  D 3 12  ? -44.048 54.313 -27.501 1.00 103.77 ? 12  DA  D "O3'" 1 
ATOM   4744 C  "C2'" . DA  D 3 12  ? -44.690 53.178 -25.514 1.00 99.49  ? 12  DA  D "C2'" 1 
ATOM   4745 C  "C1'" . DA  D 3 12  ? -43.697 54.060 -24.765 1.00 97.99  ? 12  DA  D "C1'" 1 
ATOM   4746 N  N9    . DA  D 3 12  ? -43.665 53.929 -23.319 1.00 96.40  ? 12  DA  D N9    1 
ATOM   4747 C  C8    . DA  D 3 12  ? -44.705 53.621 -22.497 1.00 96.97  ? 12  DA  D C8    1 
ATOM   4748 N  N7    . DA  D 3 12  ? -44.382 53.596 -21.227 1.00 96.82  ? 12  DA  D N7    1 
ATOM   4749 C  C5    . DA  D 3 12  ? -43.041 53.935 -21.218 1.00 94.80  ? 12  DA  D C5    1 
ATOM   4750 C  C6    . DA  D 3 12  ? -42.113 54.090 -20.172 1.00 93.30  ? 12  DA  D C6    1 
ATOM   4751 N  N6    . DA  D 3 12  ? -42.420 53.918 -18.890 1.00 91.76  ? 12  DA  D N6    1 
ATOM   4752 N  N1    . DA  D 3 12  ? -40.855 54.437 -20.497 1.00 93.61  ? 12  DA  D N1    1 
ATOM   4753 C  C2    . DA  D 3 12  ? -40.552 54.614 -21.791 1.00 94.90  ? 12  DA  D C2    1 
ATOM   4754 N  N3    . DA  D 3 12  ? -41.339 54.495 -22.861 1.00 95.46  ? 12  DA  D N3    1 
ATOM   4755 C  C4    . DA  D 3 12  ? -42.584 54.147 -22.501 1.00 95.18  ? 12  DA  D C4    1 
ATOM   4756 P  P     . DT  D 3 13  ? -43.758 53.456 -28.812 1.00 107.19 ? 13  DT  D P     1 
ATOM   4757 O  OP1   . DT  D 3 13  ? -43.589 54.482 -29.885 1.00 108.10 ? 13  DT  D OP1   1 
ATOM   4758 O  OP2   . DT  D 3 13  ? -44.697 52.302 -28.965 1.00 106.57 ? 13  DT  D OP2   1 
ATOM   4759 O  "O5'" . DT  D 3 13  ? -42.325 52.866 -28.396 1.00 104.69 ? 13  DT  D "O5'" 1 
ATOM   4760 C  "C5'" . DT  D 3 13  ? -41.329 53.710 -27.801 1.00 101.37 ? 13  DT  D "C5'" 1 
ATOM   4761 C  "C4'" . DT  D 3 13  ? -40.141 52.886 -27.334 1.00 99.31  ? 13  DT  D "C4'" 1 
ATOM   4762 O  "O4'" . DT  D 3 13  ? -40.205 52.674 -25.905 1.00 97.50  ? 13  DT  D "O4'" 1 
ATOM   4763 C  "C3'" . DT  D 3 13  ? -40.020 51.490 -27.928 1.00 99.39  ? 13  DT  D "C3'" 1 
ATOM   4764 O  "O3'" . DT  D 3 13  ? -38.649 51.310 -28.308 1.00 98.89  ? 13  DT  D "O3'" 1 
ATOM   4765 C  "C2'" . DT  D 3 13  ? -40.497 50.557 -26.800 1.00 98.15  ? 13  DT  D "C2'" 1 
ATOM   4766 C  "C1'" . DT  D 3 13  ? -39.952 51.316 -25.602 1.00 96.66  ? 13  DT  D "C1'" 1 
ATOM   4767 N  N1    . DT  D 3 13  ? -40.559 51.138 -24.258 1.00 95.79  ? 13  DT  D N1    1 
ATOM   4768 C  C2    . DT  D 3 13  ? -39.719 51.274 -23.166 1.00 95.89  ? 13  DT  D C2    1 
ATOM   4769 O  O2    . DT  D 3 13  ? -38.516 51.482 -23.278 1.00 96.82  ? 13  DT  D O2    1 
ATOM   4770 N  N3    . DT  D 3 13  ? -40.336 51.141 -21.934 1.00 94.86  ? 13  DT  D N3    1 
ATOM   4771 C  C4    . DT  D 3 13  ? -41.686 50.908 -21.703 1.00 94.07  ? 13  DT  D C4    1 
ATOM   4772 O  O4    . DT  D 3 13  ? -42.150 50.798 -20.570 1.00 93.52  ? 13  DT  D O4    1 
ATOM   4773 C  C5    . DT  D 3 13  ? -42.500 50.796 -22.889 1.00 94.14  ? 13  DT  D C5    1 
ATOM   4774 C  C7    . DT  D 3 13  ? -43.967 50.537 -22.763 1.00 94.49  ? 13  DT  D C7    1 
ATOM   4775 C  C6    . DT  D 3 13  ? -41.915 50.922 -24.091 1.00 95.32  ? 13  DT  D C6    1 
ATOM   4776 P  P     . DG  D 3 14  ? -38.220 50.109 -29.278 1.00 99.13  ? 14  DG  D P     1 
ATOM   4777 O  OP1   . DG  D 3 14  ? -37.429 50.669 -30.394 1.00 101.18 ? 14  DG  D OP1   1 
ATOM   4778 O  OP2   . DG  D 3 14  ? -39.435 49.330 -29.599 1.00 99.75  ? 14  DG  D OP2   1 
ATOM   4779 O  "O5'" . DG  D 3 14  ? -37.275 49.209 -28.354 1.00 96.68  ? 14  DG  D "O5'" 1 
ATOM   4780 C  "C5'" . DG  D 3 14  ? -37.033 49.618 -27.040 1.00 93.96  ? 14  DG  D "C5'" 1 
ATOM   4781 C  "C4'" . DG  D 3 14  ? -36.112 48.685 -26.297 1.00 93.58  ? 14  DG  D "C4'" 1 
ATOM   4782 O  "O4'" . DG  D 3 14  ? -36.664 48.443 -24.983 1.00 93.26  ? 14  DG  D "O4'" 1 
ATOM   4783 C  "C3'" . DG  D 3 14  ? -35.878 47.313 -26.888 1.00 94.58  ? 14  DG  D "C3'" 1 
ATOM   4784 O  "O3'" . DG  D 3 14  ? -34.496 46.995 -26.614 1.00 95.14  ? 14  DG  D "O3'" 1 
ATOM   4785 C  "C2'" . DG  D 3 14  ? -36.931 46.431 -26.199 1.00 93.45  ? 14  DG  D "C2'" 1 
ATOM   4786 C  "C1'" . DG  D 3 14  ? -37.202 47.144 -24.871 1.00 92.52  ? 14  DG  D "C1'" 1 
ATOM   4787 N  N9    . DG  D 3 14  ? -38.612 47.287 -24.448 1.00 91.79  ? 14  DG  D N9    1 
ATOM   4788 C  C8    . DG  D 3 14  ? -39.744 47.379 -25.231 1.00 91.73  ? 14  DG  D C8    1 
ATOM   4789 N  N7    . DG  D 3 14  ? -40.851 47.499 -24.547 1.00 90.12  ? 14  DG  D N7    1 
ATOM   4790 C  C5    . DG  D 3 14  ? -40.442 47.494 -23.227 1.00 89.07  ? 14  DG  D C5    1 
ATOM   4791 C  C6    . DG  D 3 14  ? -41.192 47.594 -22.028 1.00 88.35  ? 14  DG  D C6    1 
ATOM   4792 O  O6    . DG  D 3 14  ? -42.411 47.710 -21.886 1.00 88.92  ? 14  DG  D O6    1 
ATOM   4793 N  N1    . DG  D 3 14  ? -40.397 47.547 -20.891 1.00 87.21  ? 14  DG  D N1    1 
ATOM   4794 C  C2    . DG  D 3 14  ? -39.034 47.426 -20.915 1.00 87.33  ? 14  DG  D C2    1 
ATOM   4795 N  N2    . DG  D 3 14  ? -38.433 47.406 -19.723 1.00 87.40  ? 14  DG  D N2    1 
ATOM   4796 N  N3    . DG  D 3 14  ? -38.309 47.327 -22.022 1.00 88.44  ? 14  DG  D N3    1 
ATOM   4797 C  C4    . DG  D 3 14  ? -39.072 47.368 -23.145 1.00 89.68  ? 14  DG  D C4    1 
ATOM   4798 P  P     . DA  D 3 15  ? -33.851 45.534 -26.818 1.00 95.56  ? 15  DA  D P     1 
ATOM   4799 O  OP1   . DA  D 3 15  ? -32.407 45.740 -27.059 1.00 97.35  ? 15  DA  D OP1   1 
ATOM   4800 O  OP2   . DA  D 3 15  ? -34.681 44.660 -27.686 1.00 95.65  ? 15  DA  D OP2   1 
ATOM   4801 O  "O5'" . DA  D 3 15  ? -34.058 44.945 -25.358 1.00 94.19  ? 15  DA  D "O5'" 1 
ATOM   4802 C  "C5'" . DA  D 3 15  ? -33.037 45.038 -24.381 1.00 92.20  ? 15  DA  D "C5'" 1 
ATOM   4803 C  "C4'" . DA  D 3 15  ? -33.293 44.007 -23.309 1.00 88.95  ? 15  DA  D "C4'" 1 
ATOM   4804 O  "O4'" . DA  D 3 15  ? -34.642 44.224 -22.818 1.00 87.35  ? 15  DA  D "O4'" 1 
ATOM   4805 C  "C3'" . DA  D 3 15  ? -33.203 42.580 -23.824 1.00 88.37  ? 15  DA  D "C3'" 1 
ATOM   4806 O  "O3'" . DA  D 3 15  ? -32.469 41.884 -22.854 1.00 87.94  ? 15  DA  D "O3'" 1 
ATOM   4807 C  "C2'" . DA  D 3 15  ? -34.672 42.145 -23.943 1.00 87.67  ? 15  DA  D "C2'" 1 
ATOM   4808 C  "C1'" . DA  D 3 15  ? -35.371 43.014 -22.888 1.00 85.75  ? 15  DA  D "C1'" 1 
ATOM   4809 N  N9    . DA  D 3 15  ? -36.806 43.318 -23.042 1.00 83.28  ? 15  DA  D N9    1 
ATOM   4810 C  C8    . DA  D 3 15  ? -37.618 43.341 -24.145 1.00 83.54  ? 15  DA  D C8    1 
ATOM   4811 N  N7    . DA  D 3 15  ? -38.877 43.643 -23.912 1.00 81.83  ? 15  DA  D N7    1 
ATOM   4812 C  C5    . DA  D 3 15  ? -38.883 43.833 -22.552 1.00 81.30  ? 15  DA  D C5    1 
ATOM   4813 C  C6    . DA  D 3 15  ? -39.895 44.183 -21.649 1.00 81.12  ? 15  DA  D C6    1 
ATOM   4814 N  N6    . DA  D 3 15  ? -41.154 44.410 -22.014 1.00 81.09  ? 15  DA  D N6    1 
ATOM   4815 N  N1    . DA  D 3 15  ? -39.564 44.299 -20.342 1.00 81.29  ? 15  DA  D N1    1 
ATOM   4816 C  C2    . DA  D 3 15  ? -38.301 44.069 -19.950 1.00 80.98  ? 15  DA  D C2    1 
ATOM   4817 N  N3    . DA  D 3 15  ? -37.263 43.735 -20.712 1.00 81.63  ? 15  DA  D N3    1 
ATOM   4818 C  C4    . DA  D 3 15  ? -37.629 43.637 -22.005 1.00 81.80  ? 15  DA  D C4    1 
ATOM   4819 P  P     . DC  D 3 16  ? -31.957 40.376 -23.034 1.00 90.25  ? 16  DC  D P     1 
ATOM   4820 O  OP1   . DC  D 3 16  ? -30.493 40.474 -23.155 1.00 92.66  ? 16  DC  D OP1   1 
ATOM   4821 O  OP2   . DC  D 3 16  ? -32.754 39.583 -24.006 1.00 91.01  ? 16  DC  D OP2   1 
ATOM   4822 O  "O5'" . DC  D 3 16  ? -32.277 39.695 -21.630 1.00 90.04  ? 16  DC  D "O5'" 1 
ATOM   4823 C  "C5'" . DC  D 3 16  ? -32.007 40.331 -20.394 1.00 89.35  ? 16  DC  D "C5'" 1 
ATOM   4824 C  "C4'" . DC  D 3 16  ? -32.812 39.604 -19.348 1.00 89.08  ? 16  DC  D "C4'" 1 
ATOM   4825 O  "O4'" . DC  D 3 16  ? -34.115 40.218 -19.276 1.00 86.33  ? 16  DC  D "O4'" 1 
ATOM   4826 C  "C3'" . DC  D 3 16  ? -33.062 38.145 -19.688 1.00 90.88  ? 16  DC  D "C3'" 1 
ATOM   4827 O  "O3'" . DC  D 3 16  ? -31.969 37.407 -19.132 1.00 96.36  ? 16  DC  D "O3'" 1 
ATOM   4828 C  "C2'" . DC  D 3 16  ? -34.452 37.853 -19.108 1.00 86.80  ? 16  DC  D "C2'" 1 
ATOM   4829 C  "C1'" . DC  D 3 16  ? -35.105 39.245 -19.028 1.00 84.03  ? 16  DC  D "C1'" 1 
ATOM   4830 N  N1    . DC  D 3 16  ? -36.237 39.593 -19.975 1.00 81.72  ? 16  DC  D N1    1 
ATOM   4831 C  C2    . DC  D 3 16  ? -37.432 40.181 -19.461 1.00 79.46  ? 16  DC  D C2    1 
ATOM   4832 O  O2    . DC  D 3 16  ? -37.564 40.384 -18.248 1.00 78.02  ? 16  DC  D O2    1 
ATOM   4833 N  N3    . DC  D 3 16  ? -38.452 40.498 -20.312 1.00 77.88  ? 16  DC  D N3    1 
ATOM   4834 C  C4    . DC  D 3 16  ? -38.298 40.261 -21.624 1.00 78.47  ? 16  DC  D C4    1 
ATOM   4835 N  N4    . DC  D 3 16  ? -39.311 40.599 -22.408 1.00 76.91  ? 16  DC  D N4    1 
ATOM   4836 C  C5    . DC  D 3 16  ? -37.105 39.679 -22.186 1.00 79.94  ? 16  DC  D C5    1 
ATOM   4837 C  C6    . DC  D 3 16  ? -36.105 39.373 -21.335 1.00 81.33  ? 16  DC  D C6    1 
ATOM   4838 P  P     . DA  D 3 17  ? -31.681 35.900 -19.552 1.00 101.15 ? 17  DA  D P     1 
ATOM   4839 O  OP1   . DA  D 3 17  ? -32.861 35.126 -19.091 1.00 100.12 ? 17  DA  D OP1   1 
ATOM   4840 O  OP2   . DA  D 3 17  ? -30.328 35.512 -19.100 1.00 101.85 ? 17  DA  D OP2   1 
ATOM   4841 O  "O5'" . DA  D 3 17  ? -31.566 36.001 -21.151 1.00 105.29 ? 17  DA  D "O5'" 1 
ATOM   4842 C  "C5'" . DA  D 3 17  ? -32.633 35.686 -22.048 1.00 110.30 ? 17  DA  D "C5'" 1 
ATOM   4843 C  "C4'" . DA  D 3 17  ? -32.338 34.512 -22.966 1.00 115.75 ? 17  DA  D "C4'" 1 
ATOM   4844 O  "O4'" . DA  D 3 17  ? -31.688 33.462 -22.224 1.00 118.66 ? 17  DA  D "O4'" 1 
ATOM   4845 C  "C3'" . DA  D 3 17  ? -33.589 33.849 -23.522 1.00 117.46 ? 17  DA  D "C3'" 1 
ATOM   4846 O  "O3'" . DA  D 3 17  ? -33.907 34.443 -24.773 1.00 119.26 ? 17  DA  D "O3'" 1 
ATOM   4847 C  "C2'" . DA  D 3 17  ? -33.250 32.361 -23.651 1.00 119.79 ? 17  DA  D "C2'" 1 
ATOM   4848 C  "C1'" . DA  D 3 17  ? -32.057 32.183 -22.714 1.00 121.38 ? 17  DA  D "C1'" 1 
ATOM   4849 N  N9    . DA  D 3 17  ? -32.283 31.355 -21.530 1.00 123.04 ? 17  DA  D N9    1 
ATOM   4850 C  C8    . DA  D 3 17  ? -32.565 31.836 -20.275 1.00 122.98 ? 17  DA  D C8    1 
ATOM   4851 N  N7    . DA  D 3 17  ? -32.710 30.908 -19.355 1.00 124.17 ? 17  DA  D N7    1 
ATOM   4852 C  C5    . DA  D 3 17  ? -32.504 29.725 -20.055 1.00 125.35 ? 17  DA  D C5    1 
ATOM   4853 C  C6    . DA  D 3 17  ? -32.527 28.374 -19.637 1.00 125.83 ? 17  DA  D C6    1 
ATOM   4854 N  N6    . DA  D 3 17  ? -32.770 28.027 -18.367 1.00 125.15 ? 17  DA  D N6    1 
ATOM   4855 N  N1    . DA  D 3 17  ? -32.289 27.420 -20.573 1.00 126.98 ? 17  DA  D N1    1 
ATOM   4856 C  C2    . DA  D 3 17  ? -32.037 27.805 -21.839 1.00 127.67 ? 17  DA  D C2    1 
ATOM   4857 N  N3    . DA  D 3 17  ? -31.988 29.044 -22.350 1.00 127.02 ? 17  DA  D N3    1 
ATOM   4858 C  C4    . DA  D 3 17  ? -32.233 29.976 -21.402 1.00 125.35 ? 17  DA  D C4    1 
HETATM 4859 ZN ZN    . ZN  E 4 .   ? -54.966 23.050 -47.076 1.00 90.44  ? 393 ZN  A ZN    1 
HETATM 4860 MN MN    . MN  F 5 .   ? -35.352 29.580 -16.071 1.00 79.75  ? 394 MN  A MN    1 
HETATM 4861 MN MN    . MN  G 5 .   ? -35.300 33.396 -17.077 1.00 77.56  ? 395 MN  A MN    1 
HETATM 4862 N  N     . NH4 H 6 .   ? -54.201 38.303 -8.328  1.00 49.38  ? 396 NH4 A N     1 
HETATM 4863 C  CAA   . RLT I 7 .   ? -41.455 23.537 -19.399 1.00 114.47 ? 397 RLT A CAA   1 
HETATM 4864 C  CAB   . RLT I 7 .   ? -36.452 27.389 -19.737 1.00 83.29  ? 397 RLT A CAB   1 
HETATM 4865 C  CAC   . RLT I 7 .   ? -38.142 29.893 -23.203 1.00 83.17  ? 397 RLT A CAC   1 
HETATM 4866 C  CAD   . RLT I 7 .   ? -35.955 28.664 -23.328 1.00 84.26  ? 397 RLT A CAD   1 
HETATM 4867 O  OAE   . RLT I 7 .   ? -36.043 33.850 -18.881 1.00 73.84  ? 397 RLT A OAE   1 
HETATM 4868 O  OAF   . RLT I 7 .   ? -39.623 28.550 -20.825 1.00 105.38 ? 397 RLT A OAF   1 
HETATM 4869 O  OAG   . RLT I 7 .   ? -35.762 28.921 -17.672 1.00 81.60  ? 397 RLT A OAG   1 
HETATM 4870 O  OAH   . RLT I 7 .   ? -35.578 31.507 -17.520 1.00 80.19  ? 397 RLT A OAH   1 
HETATM 4871 F  FAI   . RLT I 7 .   ? -40.853 38.146 -20.841 1.00 76.67  ? 397 RLT A FAI   1 
HETATM 4872 C  CAJ   . RLT I 7 .   ? -39.479 36.810 -22.232 1.00 71.46  ? 397 RLT A CAJ   1 
HETATM 4873 C  CAK   . RLT I 7 .   ? -38.869 37.186 -19.926 1.00 72.05  ? 397 RLT A CAK   1 
HETATM 4874 C  CAL   . RLT I 7 .   ? -38.344 36.032 -22.397 1.00 70.27  ? 397 RLT A CAL   1 
HETATM 4875 C  CAM   . RLT I 7 .   ? -37.729 36.406 -20.090 1.00 70.86  ? 397 RLT A CAM   1 
HETATM 4876 C  CAN   . RLT I 7 .   ? -36.270 34.988 -21.566 1.00 71.21  ? 397 RLT A CAN   1 
HETATM 4877 N  NAO   . RLT I 7 .   ? -39.554 24.034 -21.008 1.00 112.08 ? 397 RLT A NAO   1 
HETATM 4878 N  NAP   . RLT I 7 .   ? -38.943 25.012 -21.466 1.00 110.52 ? 397 RLT A NAP   1 
HETATM 4879 N  NAQ   . RLT I 7 .   ? -36.625 30.964 -20.979 1.00 80.07  ? 397 RLT A NAQ   1 
HETATM 4880 N  NAR   . RLT I 7 .   ? -36.296 33.595 -21.142 1.00 73.53  ? 397 RLT A NAR   1 
HETATM 4881 N  NAS   . RLT I 7 .   ? -37.818 27.711 -22.023 1.00 93.84  ? 397 RLT A NAS   1 
HETATM 4882 O  OAT   . RLT I 7 .   ? -40.491 25.853 -20.069 1.00 110.56 ? 397 RLT A OAT   1 
HETATM 4883 C  CAU   . RLT I 7 .   ? -36.186 33.148 -19.889 1.00 75.92  ? 397 RLT A CAU   1 
HETATM 4884 C  CAV   . RLT I 7 .   ? -38.961 27.599 -21.267 1.00 103.61 ? 397 RLT A CAV   1 
HETATM 4885 C  CAW   . RLT I 7 .   ? -40.500 24.477 -20.158 1.00 112.96 ? 397 RLT A CAW   1 
HETATM 4886 C  CAX   . RLT I 7 .   ? -39.741 37.386 -20.998 1.00 73.00  ? 397 RLT A CAX   1 
HETATM 4887 C  CAY   . RLT I 7 .   ? -37.486 35.838 -21.334 1.00 70.40  ? 397 RLT A CAY   1 
HETATM 4888 C  CAZ   . RLT I 7 .   ? -35.952 30.909 -18.683 1.00 79.50  ? 397 RLT A CAZ   1 
HETATM 4889 C  CBA   . RLT I 7 .   ? -39.456 26.147 -20.943 1.00 108.34 ? 397 RLT A CBA   1 
HETATM 4890 C  CBB   . RLT I 7 .   ? -36.257 31.611 -19.845 1.00 78.17  ? 397 RLT A CBB   1 
HETATM 4891 C  CBC   . RLT I 7 .   ? -36.725 29.629 -21.076 1.00 82.82  ? 397 RLT A CBC   1 
HETATM 4892 C  CBD   . RLT I 7 .   ? -36.032 29.542 -18.703 1.00 80.79  ? 397 RLT A CBD   1 
HETATM 4893 N  NBE   . RLT I 7 .   ? -36.412 28.879 -19.874 1.00 81.88  ? 397 RLT A NBE   1 
HETATM 4894 C  CBF   . RLT I 7 .   ? -37.165 28.981 -22.449 1.00 85.71  ? 397 RLT A CBF   1 
HETATM 4895 C  C1    . GOL J 8 .   ? -12.206 33.207 -12.116 1.00 99.64  ? 801 GOL A C1    1 
HETATM 4896 O  O1    . GOL J 8 .   ? -11.489 34.395 -11.845 1.00 97.77  ? 801 GOL A O1    1 
HETATM 4897 C  C2    . GOL J 8 .   ? -12.106 32.688 -13.566 1.00 100.55 ? 801 GOL A C2    1 
HETATM 4898 O  O2    . GOL J 8 .   ? -11.081 31.722 -13.745 1.00 101.61 ? 801 GOL A O2    1 
HETATM 4899 C  C3    . GOL J 8 .   ? -12.103 33.762 -14.669 1.00 100.11 ? 801 GOL A C3    1 
HETATM 4900 O  O3    . GOL J 8 .   ? -12.695 34.976 -14.222 1.00 96.63  ? 801 GOL A O3    1 
HETATM 4901 C  C1    . GOL K 8 .   ? -48.918 16.136 -32.010 1.00 109.80 ? 802 GOL A C1    1 
HETATM 4902 O  O1    . GOL K 8 .   ? -49.393 17.101 -31.103 1.00 109.38 ? 802 GOL A O1    1 
HETATM 4903 C  C2    . GOL K 8 .   ? -50.062 15.919 -32.977 1.00 110.14 ? 802 GOL A C2    1 
HETATM 4904 O  O2    . GOL K 8 .   ? -49.697 16.424 -34.236 1.00 110.23 ? 802 GOL A O2    1 
HETATM 4905 C  C3    . GOL K 8 .   ? -51.233 16.750 -32.482 1.00 110.37 ? 802 GOL A C3    1 
HETATM 4906 O  O3    . GOL K 8 .   ? -52.347 16.387 -33.256 1.00 112.86 ? 802 GOL A O3    1 
HETATM 4907 C  C1    . GOL L 8 .   ? -28.165 17.189 -9.537  1.00 133.74 ? 803 GOL A C1    1 
HETATM 4908 O  O1    . GOL L 8 .   ? -27.687 17.019 -10.853 1.00 133.73 ? 803 GOL A O1    1 
HETATM 4909 C  C2    . GOL L 8 .   ? -29.662 16.895 -9.502  1.00 134.13 ? 803 GOL A C2    1 
HETATM 4910 O  O2    . GOL L 8 .   ? -30.390 17.907 -10.174 1.00 133.48 ? 803 GOL A O2    1 
HETATM 4911 C  C3    . GOL L 8 .   ? -30.093 16.821 -8.041  1.00 134.38 ? 803 GOL A C3    1 
HETATM 4912 O  O3    . GOL L 8 .   ? -30.969 15.735 -7.835  1.00 134.45 ? 803 GOL A O3    1 
HETATM 4913 C  C1    . GOL M 8 .   ? -46.142 20.138 -11.198 1.00 123.71 ? 804 GOL A C1    1 
HETATM 4914 O  O1    . GOL M 8 .   ? -44.917 20.030 -10.497 1.00 124.03 ? 804 GOL A O1    1 
HETATM 4915 C  C2    . GOL M 8 .   ? -45.956 20.331 -12.714 1.00 123.02 ? 804 GOL A C2    1 
HETATM 4916 O  O2    . GOL M 8 .   ? -44.681 19.930 -13.177 1.00 122.41 ? 804 GOL A O2    1 
HETATM 4917 C  C3    . GOL M 8 .   ? -46.239 21.775 -13.123 1.00 122.29 ? 804 GOL A C3    1 
HETATM 4918 O  O3    . GOL M 8 .   ? -47.631 22.010 -13.126 1.00 121.63 ? 804 GOL A O3    1 
HETATM 4919 MN MN    . MN  N 5 .   ? -14.730 35.583 21.809  1.00 101.88 ? 393 MN  B MN    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ALA A 13  ? 2.2227 2.3686 2.2785 0.0000 0.0000 0.0000 10  ALA A N     
2    C CA    . ALA A 13  ? 2.2166 2.3988 2.2796 0.0000 0.0000 0.0000 10  ALA A CA    
3    C C     . ALA A 13  ? 2.1791 2.4611 2.2649 0.0000 0.0000 0.0000 10  ALA A C     
4    O O     . ALA A 13  ? 2.1775 2.5058 2.2752 0.0000 0.0000 0.0000 10  ALA A O     
5    C CB    . ALA A 13  ? 2.2030 2.3426 2.2551 0.0000 0.0000 0.0000 10  ALA A CB    
6    N N     . GLU A 14  ? 2.1501 2.4664 2.2428 0.0000 0.0000 0.0000 11  GLU A N     
7    C CA    . GLU A 14  ? 2.1159 2.5266 2.2312 0.0000 0.0000 0.0000 11  GLU A CA    
8    C C     . GLU A 14  ? 2.0845 2.4966 2.2025 0.0000 0.0000 0.0000 11  GLU A C     
9    O O     . GLU A 14  ? 2.0638 2.5457 2.1998 0.0000 0.0000 0.0000 11  GLU A O     
10   C CB    . GLU A 14  ? 2.1015 2.5496 2.2224 0.0000 0.0000 0.0000 11  GLU A CB    
11   C CG    . GLU A 14  ? 2.0787 2.5054 2.1966 0.0000 0.0000 0.0000 11  GLU A CG    
12   C CD    . GLU A 14  ? 2.1019 2.4342 2.1968 0.0000 0.0000 0.0000 11  GLU A CD    
13   O OE1   . GLU A 14  ? 2.1432 2.4173 2.2235 0.0000 0.0000 0.0000 11  GLU A OE1   
14   O OE2   . GLU A 14  ? 2.0784 2.3954 2.1703 0.0000 0.0000 0.0000 11  GLU A OE2   
15   N N     . LEU A 15  ? 2.0841 2.4203 2.1828 0.0000 0.0000 0.0000 12  LEU A N     
16   C CA    . LEU A 15  ? 2.0634 2.3898 2.1568 0.0000 0.0000 0.0000 12  LEU A CA    
17   C C     . LEU A 15  ? 2.0719 2.4234 2.1697 0.0000 0.0000 0.0000 12  LEU A C     
18   O O     . LEU A 15  ? 2.0625 2.4269 2.1590 0.0000 0.0000 0.0000 12  LEU A O     
19   C CB    . LEU A 15  ? 2.0674 2.3160 2.1375 0.0000 0.0000 0.0000 12  LEU A CB    
20   C CG    . LEU A 15  ? 2.0612 2.2683 2.1225 0.0000 0.0000 0.0000 12  LEU A CG    
21   C CD1   . LEU A 15  ? 2.0932 2.2582 2.1473 0.0000 0.0000 0.0000 12  LEU A CD1   
22   C CD2   . LEU A 15  ? 2.0458 2.2093 2.0898 0.0000 0.0000 0.0000 12  LEU A CD2   
23   N N     . ASP A 16  ? 2.0927 2.4466 2.1934 0.0000 0.0000 0.0000 13  ASP A N     
24   C CA    . ASP A 16  ? 2.1016 2.4829 2.2078 0.0000 0.0000 0.0000 13  ASP A CA    
25   C C     . ASP A 16  ? 2.0768 2.5379 2.2025 0.0000 0.0000 0.0000 13  ASP A C     
26   O O     . ASP A 16  ? 2.0726 2.5341 2.1933 0.0000 0.0000 0.0000 13  ASP A O     
27   C CB    . ASP A 16  ? 2.1351 2.5214 2.2461 0.0000 0.0000 0.0000 13  ASP A CB    
28   C CG    . ASP A 16  ? 2.1591 2.5410 2.2678 0.0000 0.0000 0.0000 13  ASP A CG    
29   O OD1   . ASP A 16  ? 2.1463 2.5631 2.2599 0.0000 0.0000 0.0000 13  ASP A OD1   
30   O OD2   . ASP A 16  ? 2.1931 2.5343 2.2940 0.0000 0.0000 0.0000 13  ASP A OD2   
31   N N     . GLN A 17  ? 2.0611 2.5906 2.2078 0.0000 0.0000 0.0000 14  GLN A N     
32   C CA    . GLN A 17  ? 2.0400 2.6577 2.2101 0.0000 0.0000 0.0000 14  GLN A CA    
33   C C     . GLN A 17  ? 2.0235 2.6222 2.1864 0.0000 0.0000 0.0000 14  GLN A C     
34   O O     . GLN A 17  ? 2.0249 2.6635 2.1965 0.0000 0.0000 0.0000 14  GLN A O     
35   C CB    . GLN A 17  ? 2.0261 2.7185 2.2172 0.0000 0.0000 0.0000 14  GLN A CB    
36   C CG    . GLN A 17  ? 2.0394 2.7862 2.2423 0.0000 0.0000 0.0000 14  GLN A CG    
37   C CD    . GLN A 17  ? 2.0580 2.7351 2.2407 0.0000 0.0000 0.0000 14  GLN A CD    
38   O OE1   . GLN A 17  ? 2.0544 2.6473 2.2170 0.0000 0.0000 0.0000 14  GLN A OE1   
39   N NE2   . GLN A 17  ? 2.0795 2.7922 2.2667 0.0000 0.0000 0.0000 14  GLN A NE2   
40   N N     . LEU A 18  ? 2.0109 2.5462 2.1560 0.0000 0.0000 0.0000 15  LEU A N     
41   C CA    . LEU A 18  ? 1.9974 2.5089 2.1328 0.0000 0.0000 0.0000 15  LEU A CA    
42   C C     . LEU A 18  ? 2.0070 2.4826 2.1230 0.0000 0.0000 0.0000 15  LEU A C     
43   O O     . LEU A 18  ? 2.0105 2.5000 2.1262 0.0000 0.0000 0.0000 15  LEU A O     
44   C CB    . LEU A 18  ? 1.9906 2.4423 2.1103 0.0000 0.0000 0.0000 15  LEU A CB    
45   C CG    . LEU A 18  ? 1.9860 2.4156 2.0978 0.0000 0.0000 0.0000 15  LEU A CG    
46   C CD1   . LEU A 18  ? 1.9796 2.4791 2.1174 0.0000 0.0000 0.0000 15  LEU A CD1   
47   C CD2   . LEU A 18  ? 1.9797 2.3466 2.0738 0.0000 0.0000 0.0000 15  LEU A CD2   
48   N N     . LEU A 19  ? 2.0127 2.4421 2.1111 0.0000 0.0000 0.0000 16  LEU A N     
49   C CA    . LEU A 19  ? 2.0231 2.4258 2.1011 0.0000 0.0000 0.0000 16  LEU A CA    
50   C C     . LEU A 19  ? 2.0267 2.4889 2.1195 0.0000 0.0000 0.0000 16  LEU A C     
51   O O     . LEU A 19  ? 2.0404 2.4928 2.1179 0.0000 0.0000 0.0000 16  LEU A O     
52   C CB    . LEU A 19  ? 2.0366 2.3936 2.0987 0.0000 0.0000 0.0000 16  LEU A CB    
53   C CG    . LEU A 19  ? 2.0324 2.3248 2.0719 0.0000 0.0000 0.0000 16  LEU A CG    
54   C CD1   . LEU A 19  ? 2.0386 2.3014 2.0773 0.0000 0.0000 0.0000 16  LEU A CD1   
55   C CD2   . LEU A 19  ? 2.0400 2.3038 2.0512 0.0000 0.0000 0.0000 16  LEU A CD2   
56   N N     . GLN A 20  ? 2.0129 2.5413 2.1350 0.0000 0.0000 0.0000 17  GLN A N     
57   C CA    . GLN A 20  ? 2.0132 2.6122 2.1549 0.0000 0.0000 0.0000 17  GLN A CA    
58   C C     . GLN A 20  ? 1.9994 2.6565 2.1600 0.0000 0.0000 0.0000 17  GLN A C     
59   O O     . GLN A 20  ? 2.0023 2.7321 2.1844 0.0000 0.0000 0.0000 17  GLN A O     
60   C CB    . GLN A 20  ? 2.0165 2.6617 2.1786 0.0000 0.0000 0.0000 17  GLN A CB    
61   C CG    . GLN A 20  ? 2.0365 2.6145 2.1802 0.0000 0.0000 0.0000 17  GLN A CG    
62   C CD    . GLN A 20  ? 2.0569 2.6695 2.2164 0.0000 0.0000 0.0000 17  GLN A CD    
63   O OE1   . GLN A 20  ? 2.0540 2.7363 2.2364 0.0000 0.0000 0.0000 17  GLN A OE1   
64   N NE2   . GLN A 20  ? 2.0817 2.6470 2.2276 0.0000 0.0000 0.0000 17  GLN A NE2   
65   N N     . GLY A 21  ? 1.9851 2.6110 2.1382 0.0000 0.0000 0.0000 18  GLY A N     
66   C CA    . GLY A 21  ? 1.9768 2.6401 2.1431 0.0000 0.0000 0.0000 18  GLY A CA    
67   C C     . GLY A 21  ? 1.9516 2.6966 2.1517 0.0000 0.0000 0.0000 18  GLY A C     
68   O O     . GLY A 21  ? 1.9536 2.7383 2.1685 0.0000 0.0000 0.0000 18  GLY A O     
69   N N     . HIS A 22  ? 1.9317 2.7028 2.1427 0.0000 0.0000 0.0000 19  HIS A N     
70   C CA    . HIS A 22  ? 1.9096 2.7677 2.1500 0.0000 0.0000 0.0000 19  HIS A CA    
71   C C     . HIS A 22  ? 1.8931 2.7136 2.1258 0.0000 0.0000 0.0000 19  HIS A C     
72   O O     . HIS A 22  ? 1.8942 2.6267 2.1010 0.0000 0.0000 0.0000 19  HIS A O     
73   C CB    . HIS A 22  ? 1.9090 2.8220 2.1630 0.0000 0.0000 0.0000 19  HIS A CB    
74   C CG    . HIS A 22  ? 1.9228 2.8839 2.1880 0.0000 0.0000 0.0000 19  HIS A CG    
75   N ND1   . HIS A 22  ? 1.9211 2.9996 2.2191 0.0000 0.0000 0.0000 19  HIS A ND1   
76   C CD2   . HIS A 22  ? 1.9415 2.8540 2.1903 0.0000 0.0000 0.0000 19  HIS A CD2   
77   C CE1   . HIS A 22  ? 1.9317 3.0295 2.2328 0.0000 0.0000 0.0000 19  HIS A CE1   
78   N NE2   . HIS A 22  ? 1.9465 2.9430 2.2174 0.0000 0.0000 0.0000 19  HIS A NE2   
79   N N     . TYR A 23  ? 1.8766 2.7698 2.1329 0.0000 0.0000 0.0000 20  TYR A N     
80   C CA    . TYR A 23  ? 1.8612 2.7273 2.1127 0.0000 0.0000 0.0000 20  TYR A CA    
81   C C     . TYR A 23  ? 1.8440 2.7148 2.0940 0.0000 0.0000 0.0000 20  TYR A C     
82   O O     . TYR A 23  ? 1.8430 2.7754 2.1054 0.0000 0.0000 0.0000 20  TYR A O     
83   C CB    . TYR A 23  ? 1.8591 2.8056 2.1374 0.0000 0.0000 0.0000 20  TYR A CB    
84   C CG    . TYR A 23  ? 1.8525 2.7836 2.1296 0.0000 0.0000 0.0000 20  TYR A CG    
85   C CD1   . TYR A 23  ? 1.8682 2.6958 2.1195 0.0000 0.0000 0.0000 20  TYR A CD1   
86   C CD2   . TYR A 23  ? 1.8376 2.8619 2.1383 0.0000 0.0000 0.0000 20  TYR A CD2   
87   C CE1   . TYR A 23  ? 1.8635 2.6759 2.1139 0.0000 0.0000 0.0000 20  TYR A CE1   
88   C CE2   . TYR A 23  ? 1.8302 2.8428 2.1297 0.0000 0.0000 0.0000 20  TYR A CE2   
89   C CZ    . TYR A 23  ? 1.8409 2.7451 2.1160 0.0000 0.0000 0.0000 20  TYR A CZ    
90   O OH    . TYR A 23  ? 1.8297 2.7205 2.1037 0.0000 0.0000 0.0000 20  TYR A OH    
91   N N     . ILE A 24  ? 1.8334 2.6377 2.0663 0.0000 0.0000 0.0000 21  ILE A N     
92   C CA    . ILE A 24  ? 1.8186 2.6226 2.0480 0.0000 0.0000 0.0000 21  ILE A CA    
93   C C     . ILE A 24  ? 1.8010 2.6037 2.0324 0.0000 0.0000 0.0000 21  ILE A C     
94   O O     . ILE A 24  ? 1.8036 2.5532 2.0255 0.0000 0.0000 0.0000 21  ILE A O     
95   C CB    . ILE A 24  ? 1.8294 2.5330 2.0297 0.0000 0.0000 0.0000 21  ILE A CB    
96   C CG1   . ILE A 24  ? 1.8454 2.5452 2.0430 0.0000 0.0000 0.0000 21  ILE A CG1   
97   C CG2   . ILE A 24  ? 1.8267 2.5246 2.0213 0.0000 0.0000 0.0000 21  ILE A CG2   
98   C CD1   . ILE A 24  ? 1.8637 2.4643 2.0337 0.0000 0.0000 0.0000 21  ILE A CD1   
99   N N     . LYS A 25  ? 1.7843 2.6449 2.0261 0.0000 0.0000 0.0000 22  LYS A N     
100  C CA    . LYS A 25  ? 1.7686 2.6317 2.0120 0.0000 0.0000 0.0000 22  LYS A CA    
101  C C     . LYS A 25  ? 1.7686 2.5102 1.9837 0.0000 0.0000 0.0000 22  LYS A C     
102  O O     . LYS A 25  ? 1.7743 2.4492 1.9688 0.0000 0.0000 0.0000 22  LYS A O     
103  C CB    . LYS A 25  ? 1.7598 2.6900 2.0102 0.0000 0.0000 0.0000 22  LYS A CB    
104  N N     . GLY A 26  ? 1.7659 2.4811 1.9800 0.0000 0.0000 0.0000 23  GLY A N     
105  C CA    . GLY A 26  ? 1.7679 2.3727 1.9546 0.0000 0.0000 0.0000 23  GLY A CA    
106  C C     . GLY A 26  ? 1.7817 2.3482 1.9579 0.0000 0.0000 0.0000 23  GLY A C     
107  O O     . GLY A 26  ? 1.7913 2.4086 1.9837 0.0000 0.0000 0.0000 23  GLY A O     
108  N N     . TYR A 27  ? 1.7843 2.2675 1.9338 0.0000 0.0000 0.0000 24  TYR A N     
109  C CA    . TYR A 27  ? 1.7968 2.2447 1.9323 0.0000 0.0000 0.0000 24  TYR A CA    
110  C C     . TYR A 27  ? 1.8119 2.2833 1.9551 0.0000 0.0000 0.0000 24  TYR A C     
111  O O     . TYR A 27  ? 1.8140 2.3365 1.9712 0.0000 0.0000 0.0000 24  TYR A O     
112  C CB    . TYR A 27  ? 1.7938 2.2660 1.9336 0.0000 0.0000 0.0000 24  TYR A CB    
113  C CG    . TYR A 27  ? 1.7840 2.2201 1.9126 0.0000 0.0000 0.0000 24  TYR A CG    
114  C CD1   . TYR A 27  ? 1.7862 2.1456 1.8893 0.0000 0.0000 0.0000 24  TYR A CD1   
115  C CD2   . TYR A 27  ? 1.7763 2.2578 1.9187 0.0000 0.0000 0.0000 24  TYR A CD2   
116  C CE1   . TYR A 27  ? 1.7881 2.1128 1.8817 0.0000 0.0000 0.0000 24  TYR A CE1   
117  C CE2   . TYR A 27  ? 1.7810 2.2211 1.9105 0.0000 0.0000 0.0000 24  TYR A CE2   
118  C CZ    . TYR A 27  ? 1.7876 2.1474 1.8939 0.0000 0.0000 0.0000 24  TYR A CZ    
119  O OH    . TYR A 27  ? 1.7980 2.1155 1.8925 0.0000 0.0000 0.0000 24  TYR A OH    
120  N N     . PRO A 28  ? 1.8267 2.2580 1.9598 0.0000 0.0000 0.0000 25  PRO A N     
121  C CA    . PRO A 28  ? 1.8520 2.3040 1.9937 0.0000 0.0000 0.0000 25  PRO A CA    
122  C C     . PRO A 28  ? 1.8790 2.3006 2.0034 0.0000 0.0000 0.0000 25  PRO A C     
123  O O     . PRO A 28  ? 1.8942 2.2412 1.9867 0.0000 0.0000 0.0000 25  PRO A O     
124  C CB    . PRO A 28  ? 1.8713 2.2645 1.9986 0.0000 0.0000 0.0000 25  PRO A CB    
125  C CG    . PRO A 28  ? 1.8609 2.1853 1.9626 0.0000 0.0000 0.0000 25  PRO A CG    
126  C CD    . PRO A 28  ? 1.8278 2.1898 1.9402 0.0000 0.0000 0.0000 25  PRO A CD    
127  N N     . LYS A 29  ? 1.8873 2.3737 2.0328 0.0000 0.0000 0.0000 26  LYS A N     
128  C CA    . LYS A 29  ? 1.9157 2.3813 2.0465 0.0000 0.0000 0.0000 26  LYS A CA    
129  C C     . LYS A 29  ? 1.9610 2.3484 2.0636 0.0000 0.0000 0.0000 26  LYS A C     
130  O O     . LYS A 29  ? 1.9712 2.3355 2.0738 0.0000 0.0000 0.0000 26  LYS A O     
131  C CB    . LYS A 29  ? 1.9122 2.4745 2.0758 0.0000 0.0000 0.0000 26  LYS A CB    
132  N N     . GLN A 30  ? 1.9917 2.3380 2.0686 0.0000 0.0000 0.0000 27  GLN A N     
133  C CA    . GLN A 30  ? 2.0444 2.3039 2.0834 0.0000 0.0000 0.0000 27  GLN A CA    
134  C C     . GLN A 30  ? 2.0495 2.2361 2.0474 0.0000 0.0000 0.0000 27  GLN A C     
135  O O     . GLN A 30  ? 2.0957 2.2226 2.0568 0.0000 0.0000 0.0000 27  GLN A O     
136  C CB    . GLN A 30  ? 2.0696 2.2988 2.1100 0.0000 0.0000 0.0000 27  GLN A CB    
137  C CG    . GLN A 30  ? 2.0648 2.2276 2.0829 0.0000 0.0000 0.0000 27  GLN A CG    
138  C CD    . GLN A 30  ? 2.0882 2.2294 2.1127 0.0000 0.0000 0.0000 27  GLN A CD    
139  O OE1   . GLN A 30  ? 2.1161 2.1788 2.1111 0.0000 0.0000 0.0000 27  GLN A OE1   
140  N NE2   . GLN A 30  ? 2.0786 2.2936 2.1419 0.0000 0.0000 0.0000 27  GLN A NE2   
141  N N     . TYR A 31  ? 2.0045 2.1995 2.0079 0.0000 0.0000 0.0000 28  TYR A N     
142  C CA    . TYR A 31  ? 2.0012 2.1493 1.9729 0.0000 0.0000 0.0000 28  TYR A CA    
143  C C     . TYR A 31  ? 1.9815 2.1702 1.9607 0.0000 0.0000 0.0000 28  TYR A C     
144  O O     . TYR A 31  ? 1.9507 2.2028 1.9636 0.0000 0.0000 0.0000 28  TYR A O     
145  C CB    . TYR A 31  ? 1.9702 2.1053 1.9445 0.0000 0.0000 0.0000 28  TYR A CB    
146  C CG    . TYR A 31  ? 1.9771 2.0862 1.9530 0.0000 0.0000 0.0000 28  TYR A CG    
147  C CD1   . TYR A 31  ? 2.0243 2.0668 1.9685 0.0000 0.0000 0.0000 28  TYR A CD1   
148  C CD2   . TYR A 31  ? 1.9417 2.0913 1.9484 0.0000 0.0000 0.0000 28  TYR A CD2   
149  C CE1   . TYR A 31  ? 2.0382 2.0529 1.9836 0.0000 0.0000 0.0000 28  TYR A CE1   
150  C CE2   . TYR A 31  ? 1.9528 2.0813 1.9615 0.0000 0.0000 0.0000 28  TYR A CE2   
151  C CZ    . TYR A 31  ? 2.0003 2.0600 1.9793 0.0000 0.0000 0.0000 28  TYR A CZ    
152  O OH    . TYR A 31  ? 2.0121 2.0470 1.9928 0.0000 0.0000 0.0000 28  TYR A OH    
153  N N     . THR A 32  ? 2.0014 2.1567 1.9482 0.0000 0.0000 0.0000 29  THR A N     
154  C CA    . THR A 32  ? 1.9876 2.1761 1.9390 0.0000 0.0000 0.0000 29  THR A CA    
155  C C     . THR A 32  ? 1.9540 2.1381 1.9073 0.0000 0.0000 0.0000 29  THR A C     
156  O O     . THR A 32  ? 1.9589 2.0998 1.8882 0.0000 0.0000 0.0000 29  THR A O     
157  C CB    . THR A 32  ? 2.0282 2.1950 1.9459 0.0000 0.0000 0.0000 29  THR A CB    
158  O OG1   . THR A 32  ? 2.0683 2.1723 1.9465 0.0000 0.0000 0.0000 29  THR A OG1   
159  C CG2   . THR A 32  ? 2.0437 2.2468 1.9754 0.0000 0.0000 0.0000 29  THR A CG2   
160  N N     . TYR A 33  ? 1.9235 2.1533 1.9055 0.0000 0.0000 0.0000 30  TYR A N     
161  C CA    . TYR A 33  ? 1.8978 2.1218 1.8843 0.0000 0.0000 0.0000 30  TYR A CA    
162  C C     . TYR A 33  ? 1.9043 2.1313 1.8808 0.0000 0.0000 0.0000 30  TYR A C     
163  O O     . TYR A 33  ? 1.9053 2.1721 1.8990 0.0000 0.0000 0.0000 30  TYR A O     
164  C CB    . TYR A 33  ? 1.8711 2.1391 1.8929 0.0000 0.0000 0.0000 30  TYR A CB    
165  C CG    . TYR A 33  ? 1.8635 2.1396 1.8987 0.0000 0.0000 0.0000 30  TYR A CG    
166  C CD1   . TYR A 33  ? 1.8504 2.1037 1.8855 0.0000 0.0000 0.0000 30  TYR A CD1   
167  C CD2   . TYR A 33  ? 1.8772 2.1866 1.9262 0.0000 0.0000 0.0000 30  TYR A CD2   
168  C CE1   . TYR A 33  ? 1.8437 2.1077 1.8913 0.0000 0.0000 0.0000 30  TYR A CE1   
169  C CE2   . TYR A 33  ? 1.8725 2.1928 1.9350 0.0000 0.0000 0.0000 30  TYR A CE2   
170  C CZ    . TYR A 33  ? 1.8541 2.1520 1.9154 0.0000 0.0000 0.0000 30  TYR A CZ    
171  O OH    . TYR A 33  ? 1.8485 2.1598 1.9229 0.0000 0.0000 0.0000 30  TYR A OH    
172  N N     . PHE A 34  ? 1.9106 2.1014 1.8601 0.0000 0.0000 0.0000 31  PHE A N     
173  C CA    . PHE A 34  ? 1.9227 2.1187 1.8610 0.0000 0.0000 0.0000 31  PHE A CA    
174  C C     . PHE A 34  ? 1.9109 2.0915 1.8505 0.0000 0.0000 0.0000 31  PHE A C     
175  O O     . PHE A 34  ? 1.8940 2.0593 1.8434 0.0000 0.0000 0.0000 31  PHE A O     
176  C CB    . PHE A 34  ? 1.9544 2.1348 1.8566 0.0000 0.0000 0.0000 31  PHE A CB    
177  C CG    . PHE A 34  ? 1.9664 2.1110 1.8415 0.0000 0.0000 0.0000 31  PHE A CG    
178  C CD1   . PHE A 34  ? 1.9739 2.1124 1.8296 0.0000 0.0000 0.0000 31  PHE A CD1   
179  C CD2   . PHE A 34  ? 1.9742 2.0952 1.8435 0.0000 0.0000 0.0000 31  PHE A CD2   
180  C CE1   . PHE A 34  ? 1.9827 2.0993 1.8142 0.0000 0.0000 0.0000 31  PHE A CE1   
181  C CE2   . PHE A 34  ? 1.9875 2.0773 1.8311 0.0000 0.0000 0.0000 31  PHE A CE2   
182  C CZ    . PHE A 34  ? 1.9909 2.0820 1.8156 0.0000 0.0000 0.0000 31  PHE A CZ    
183  N N     . LEU A 35  ? 1.9213 2.1062 1.8511 0.0000 0.0000 0.0000 32  LEU A N     
184  C CA    . LEU A 35  ? 1.9178 2.0862 1.8483 0.0000 0.0000 0.0000 32  LEU A CA    
185  C C     . LEU A 35  ? 1.9325 2.0934 1.8334 0.0000 0.0000 0.0000 32  LEU A C     
186  O O     . LEU A 35  ? 1.9508 2.1290 1.8337 0.0000 0.0000 0.0000 32  LEU A O     
187  C CB    . LEU A 35  ? 1.9243 2.1079 1.8747 0.0000 0.0000 0.0000 32  LEU A CB    
188  C CG    . LEU A 35  ? 1.9323 2.0896 1.8870 0.0000 0.0000 0.0000 32  LEU A CG    
189  C CD1   . LEU A 35  ? 1.9245 2.0846 1.9050 0.0000 0.0000 0.0000 32  LEU A CD1   
190  C CD2   . LEU A 35  ? 1.9568 2.1156 1.8969 0.0000 0.0000 0.0000 32  LEU A CD2   
191  N N     . GLU A 36  ? 1.9256 2.0664 1.8213 0.0000 0.0000 0.0000 33  GLU A N     
192  C CA    . GLU A 36  ? 1.9385 2.0842 1.8090 0.0000 0.0000 0.0000 33  GLU A CA    
193  C C     . GLU A 36  ? 1.9346 2.0631 1.8134 0.0000 0.0000 0.0000 33  GLU A C     
194  O O     . GLU A 36  ? 1.9190 2.0261 1.8077 0.0000 0.0000 0.0000 33  GLU A O     
195  C CB    . GLU A 36  ? 1.9408 2.0870 1.7858 0.0000 0.0000 0.0000 33  GLU A CB    
196  C CG    . GLU A 36  ? 1.9737 2.1409 1.7896 0.0000 0.0000 0.0000 33  GLU A CG    
197  C CD    . GLU A 36  ? 1.9931 2.1546 1.7784 0.0000 0.0000 0.0000 33  GLU A CD    
198  O OE1   . GLU A 36  ? 1.9778 2.1217 1.7663 0.0000 0.0000 0.0000 33  GLU A OE1   
199  O OE2   . GLU A 36  ? 2.0266 2.2001 1.7823 0.0000 0.0000 0.0000 33  GLU A OE2   
200  N N     . ASP A 37  ? 1.9520 2.0899 1.8261 0.0000 0.0000 0.0000 34  ASP A N     
201  C CA    . ASP A 37  ? 1.9587 2.0787 1.8394 0.0000 0.0000 0.0000 34  ASP A CA    
202  C C     . ASP A 37  ? 1.9533 2.0336 1.8589 0.0000 0.0000 0.0000 34  ASP A C     
203  O O     . ASP A 37  ? 1.9548 2.0082 1.8661 0.0000 0.0000 0.0000 34  ASP A O     
204  C CB    . ASP A 37  ? 1.9521 2.0791 1.8197 0.0000 0.0000 0.0000 34  ASP A CB    
205  C CG    . ASP A 37  ? 1.9597 2.1276 1.7987 0.0000 0.0000 0.0000 34  ASP A CG    
206  O OD1   . ASP A 37  ? 1.9757 2.1769 1.8002 0.0000 0.0000 0.0000 34  ASP A OD1   
207  O OD2   . ASP A 37  ? 1.9570 2.1246 1.7866 0.0000 0.0000 0.0000 34  ASP A OD2   
208  N N     . GLY A 38  ? 1.9479 2.0285 1.8671 0.0000 0.0000 0.0000 35  GLY A N     
209  C CA    . GLY A 38  ? 1.9428 1.9947 1.8829 0.0000 0.0000 0.0000 35  GLY A CA    
210  C C     . GLY A 38  ? 1.9120 1.9516 1.8599 0.0000 0.0000 0.0000 35  GLY A C     
211  O O     . GLY A 38  ? 1.9195 1.9304 1.8789 0.0000 0.0000 0.0000 35  GLY A O     
212  N N     . LYS A 39  ? 1.8818 1.9410 1.8214 0.0000 0.0000 0.0000 36  LYS A N     
213  C CA    . LYS A 39  ? 1.8505 1.9035 1.7974 0.0000 0.0000 0.0000 36  LYS A CA    
214  C C     . LYS A 39  ? 1.8280 1.9098 1.7798 0.0000 0.0000 0.0000 36  LYS A C     
215  O O     . LYS A 39  ? 1.8358 1.9378 1.7768 0.0000 0.0000 0.0000 36  LYS A O     
216  C CB    . LYS A 39  ? 1.8427 1.8885 1.7744 0.0000 0.0000 0.0000 36  LYS A CB    
217  C CG    . LYS A 39  ? 1.8575 1.8804 1.7864 0.0000 0.0000 0.0000 36  LYS A CG    
218  C CD    . LYS A 39  ? 1.8569 1.8951 1.7673 0.0000 0.0000 0.0000 36  LYS A CD    
219  C CE    . LYS A 39  ? 1.8735 1.9012 1.7824 0.0000 0.0000 0.0000 36  LYS A CE    
220  N NZ    . LYS A 39  ? 1.8655 1.8622 1.7859 0.0000 0.0000 0.0000 36  LYS A NZ    
221  N N     . VAL A 40  ? 1.7998 1.8854 1.7673 0.0000 0.0000 0.0000 37  VAL A N     
222  C CA    . VAL A 40  ? 1.7782 1.8945 1.7538 0.0000 0.0000 0.0000 37  VAL A CA    
223  C C     . VAL A 40  ? 1.7632 1.8710 1.7253 0.0000 0.0000 0.0000 37  VAL A C     
224  O O     . VAL A 40  ? 1.7508 1.8466 1.7176 0.0000 0.0000 0.0000 37  VAL A O     
225  C CB    . VAL A 40  ? 1.7668 1.9051 1.7677 0.0000 0.0000 0.0000 37  VAL A CB    
226  C CG1   . VAL A 40  ? 1.7605 1.9439 1.7735 0.0000 0.0000 0.0000 37  VAL A CG1   
227  C CG2   . VAL A 40  ? 1.7818 1.9116 1.7912 0.0000 0.0000 0.0000 37  VAL A CG2   
228  N N     . LYS A 41  ? 1.7681 1.8798 1.7112 0.0000 0.0000 0.0000 38  LYS A N     
229  C CA    . LYS A 41  ? 1.7631 1.8590 1.6871 0.0000 0.0000 0.0000 38  LYS A CA    
230  C C     . LYS A 41  ? 1.7595 1.8655 1.6898 0.0000 0.0000 0.0000 38  LYS A C     
231  O O     . LYS A 41  ? 1.7590 1.8931 1.7050 0.0000 0.0000 0.0000 38  LYS A O     
232  C CB    . LYS A 41  ? 1.7869 1.8775 1.6794 0.0000 0.0000 0.0000 38  LYS A CB    
233  C CG    . LYS A 41  ? 1.7854 1.8705 1.6696 0.0000 0.0000 0.0000 38  LYS A CG    
234  C CD    . LYS A 41  ? 1.8100 1.9013 1.6607 0.0000 0.0000 0.0000 38  LYS A CD    
235  C CE    . LYS A 41  ? 1.8103 1.9028 1.6533 0.0000 0.0000 0.0000 38  LYS A CE    
236  N NZ    . LYS A 41  ? 1.8198 1.9249 1.6695 0.0000 0.0000 0.0000 38  LYS A NZ    
237  N N     . VAL A 42  ? 1.7585 1.8424 1.6770 0.0000 0.0000 0.0000 39  VAL A N     
238  C CA    . VAL A 42  ? 1.7658 1.8510 1.6879 0.0000 0.0000 0.0000 39  VAL A CA    
239  C C     . VAL A 42  ? 1.7934 1.8400 1.6835 0.0000 0.0000 0.0000 39  VAL A C     
240  O O     . VAL A 42  ? 1.7895 1.8121 1.6659 0.0000 0.0000 0.0000 39  VAL A O     
241  C CB    . VAL A 42  ? 1.7405 1.8443 1.6936 0.0000 0.0000 0.0000 39  VAL A CB    
242  C CG1   . VAL A 42  ? 1.7293 1.8072 1.6788 0.0000 0.0000 0.0000 39  VAL A CG1   
243  C CG2   . VAL A 42  ? 1.7523 1.8688 1.7142 0.0000 0.0000 0.0000 39  VAL A CG2   
244  N N     . SER A 43  ? 1.8234 1.8639 1.7010 0.0000 0.0000 0.0000 40  SER A N     
245  C CA    . SER A 43  ? 1.8632 1.8595 1.7077 0.0000 0.0000 0.0000 40  SER A CA    
246  C C     . SER A 43  ? 1.8641 1.8420 1.7222 0.0000 0.0000 0.0000 40  SER A C     
247  O O     . SER A 43  ? 1.8613 1.8622 1.7450 0.0000 0.0000 0.0000 40  SER A O     
248  C CB    . SER A 43  ? 1.9043 1.8950 1.7270 0.0000 0.0000 0.0000 40  SER A CB    
249  O OG    . SER A 43  ? 1.9494 1.8897 1.7395 0.0000 0.0000 0.0000 40  SER A OG    
250  N N     . ARG A 44  ? 1.8687 1.8111 1.7105 0.0000 0.0000 0.0000 41  ARG A N     
251  C CA    . ARG A 44  ? 1.8705 1.7916 1.7230 0.0000 0.0000 0.0000 41  ARG A CA    
252  C C     . ARG A 44  ? 1.9160 1.7759 1.7303 0.0000 0.0000 0.0000 41  ARG A C     
253  O O     . ARG A 44  ? 1.9361 1.7778 1.7165 0.0000 0.0000 0.0000 41  ARG A O     
254  C CB    . ARG A 44  ? 1.8247 1.7668 1.7033 0.0000 0.0000 0.0000 41  ARG A CB    
255  C CG    . ARG A 44  ? 1.7941 1.7912 1.7123 0.0000 0.0000 0.0000 41  ARG A CG    
256  C CD    . ARG A 44  ? 1.7686 1.7809 1.7066 0.0000 0.0000 0.0000 41  ARG A CD    
257  N NE    . ARG A 44  ? 1.7784 1.7724 1.7199 0.0000 0.0000 0.0000 41  ARG A NE    
258  C CZ    . ARG A 44  ? 1.7814 1.7971 1.7448 0.0000 0.0000 0.0000 41  ARG A CZ    
259  N NH1   . ARG A 44  ? 1.7759 1.8373 1.7604 0.0000 0.0000 0.0000 41  ARG A NH1   
260  N NH2   . ARG A 44  ? 1.7919 1.7887 1.7569 0.0000 0.0000 0.0000 41  ARG A NH2   
261  N N     . PRO A 45  ? 1.9362 1.7661 1.7546 0.0000 0.0000 0.0000 42  PRO A N     
262  C CA    . PRO A 45  ? 1.9844 1.7487 1.7667 0.0000 0.0000 0.0000 42  PRO A CA    
263  C C     . PRO A 45  ? 1.9683 1.7260 1.7299 0.0000 0.0000 0.0000 42  PRO A C     
264  O O     . PRO A 45  ? 2.0088 1.7381 1.7293 0.0000 0.0000 0.0000 42  PRO A O     
265  C CB    . PRO A 45  ? 1.9856 1.7380 1.7920 0.0000 0.0000 0.0000 42  PRO A CB    
266  C CG    . PRO A 45  ? 1.9668 1.7683 1.8088 0.0000 0.0000 0.0000 42  PRO A CG    
267  C CD    . PRO A 45  ? 1.9262 1.7827 1.7801 0.0000 0.0000 0.0000 42  PRO A CD    
268  N N     . GLU A 46  ? 1.9103 1.6996 1.6994 0.0000 0.0000 0.0000 43  GLU A N     
269  C CA    . GLU A 46  ? 1.8890 1.6819 1.6643 0.0000 0.0000 0.0000 43  GLU A CA    
270  C C     . GLU A 46  ? 1.8843 1.7015 1.6380 0.0000 0.0000 0.0000 43  GLU A C     
271  O O     . GLU A 46  ? 1.8947 1.7114 1.6237 0.0000 0.0000 0.0000 43  GLU A O     
272  C CB    . GLU A 46  ? 1.8303 1.6555 1.6415 0.0000 0.0000 0.0000 43  GLU A CB    
273  N N     . GLY A 47  ? 1.8672 1.7109 1.6305 0.0000 0.0000 0.0000 44  GLY A N     
274  C CA    . GLY A 47  ? 1.8531 1.7266 1.6012 0.0000 0.0000 0.0000 44  GLY A CA    
275  C C     . GLY A 47  ? 1.8046 1.7206 1.5860 0.0000 0.0000 0.0000 44  GLY A C     
276  O O     . GLY A 47  ? 1.7850 1.7102 1.5981 0.0000 0.0000 0.0000 44  GLY A O     
277  N N     . VAL A 48  ? 1.7850 1.7304 1.5591 0.0000 0.0000 0.0000 45  VAL A N     
278  C CA    . VAL A 48  ? 1.7417 1.7217 1.5436 0.0000 0.0000 0.0000 45  VAL A CA    
279  C C     . VAL A 48  ? 1.6927 1.6899 1.5180 0.0000 0.0000 0.0000 45  VAL A C     
280  O O     . VAL A 48  ? 1.6910 1.6982 1.5035 0.0000 0.0000 0.0000 45  VAL A O     
281  C CB    . VAL A 48  ? 1.7636 1.7633 1.5453 0.0000 0.0000 0.0000 45  VAL A CB    
282  C CG1   . VAL A 48  ? 1.7329 1.7644 1.5429 0.0000 0.0000 0.0000 45  VAL A CG1   
283  C CG2   . VAL A 48  ? 1.8056 1.7857 1.5657 0.0000 0.0000 0.0000 45  VAL A CG2   
284  N N     . LYS A 49  ? 1.6511 1.6546 1.5095 0.0000 0.0000 0.0000 46  LYS A N     
285  C CA    . LYS A 49  ? 1.6076 1.6184 1.4864 0.0000 0.0000 0.0000 46  LYS A CA    
286  C C     . LYS A 49  ? 1.5881 1.6195 1.4888 0.0000 0.0000 0.0000 46  LYS A C     
287  O O     . LYS A 49  ? 1.5949 1.6412 1.5032 0.0000 0.0000 0.0000 46  LYS A O     
288  C CB    . LYS A 49  ? 1.5881 1.5882 1.4835 0.0000 0.0000 0.0000 46  LYS A CB    
289  C CG    . LYS A 49  ? 1.5966 1.5703 1.4719 0.0000 0.0000 0.0000 46  LYS A CG    
290  C CD    . LYS A 49  ? 1.5916 1.5630 1.4429 0.0000 0.0000 0.0000 46  LYS A CD    
291  C CE    . LYS A 49  ? 1.6004 1.5474 1.4329 0.0000 0.0000 0.0000 46  LYS A CE    
292  N NZ    . LYS A 49  ? 1.6311 1.5486 1.4514 0.0000 0.0000 0.0000 46  LYS A NZ    
293  N N     . ILE A 50  ? 1.5662 1.5966 1.4760 0.0000 0.0000 0.0000 47  ILE A N     
294  C CA    . ILE A 50  ? 1.5532 1.5921 1.4813 0.0000 0.0000 0.0000 47  ILE A CA    
295  C C     . ILE A 50  ? 1.5332 1.5761 1.4860 0.0000 0.0000 0.0000 47  ILE A C     
296  O O     . ILE A 50  ? 1.5224 1.5569 1.4787 0.0000 0.0000 0.0000 47  ILE A O     
297  C CB    . ILE A 50  ? 1.5574 1.5866 1.4802 0.0000 0.0000 0.0000 47  ILE A CB    
298  C CG1   . ILE A 50  ? 1.5738 1.6138 1.4717 0.0000 0.0000 0.0000 47  ILE A CG1   
299  C CG2   . ILE A 50  ? 1.5623 1.5880 1.5007 0.0000 0.0000 0.0000 47  ILE A CG2   
300  C CD1   . ILE A 50  ? 1.5774 1.6186 1.4686 0.0000 0.0000 0.0000 47  ILE A CD1   
301  N N     . ILE A 51  ? 1.5288 1.5898 1.4980 0.0000 0.0000 0.0000 48  ILE A N     
302  C CA    . ILE A 51  ? 1.5124 1.5876 1.5032 0.0000 0.0000 0.0000 48  ILE A CA    
303  C C     . ILE A 51  ? 1.5244 1.5870 1.5210 0.0000 0.0000 0.0000 48  ILE A C     
304  O O     . ILE A 51  ? 1.5390 1.6094 1.5392 0.0000 0.0000 0.0000 48  ILE A O     
305  C CB    . ILE A 51  ? 1.5069 1.6232 1.5141 0.0000 0.0000 0.0000 48  ILE A CB    
306  C CG1   . ILE A 51  ? 1.5096 1.6301 1.5078 0.0000 0.0000 0.0000 48  ILE A CG1   
307  C CG2   . ILE A 51  ? 1.4916 1.6338 1.5190 0.0000 0.0000 0.0000 48  ILE A CG2   
308  C CD1   . ILE A 51  ? 1.5131 1.6732 1.5238 0.0000 0.0000 0.0000 48  ILE A CD1   
309  N N     . PRO A 52  ? 1.5254 1.5648 1.5218 0.0000 0.0000 0.0000 49  PRO A N     
310  C CA    . PRO A 52  ? 1.5469 1.5623 1.5453 0.0000 0.0000 0.0000 49  PRO A CA    
311  C C     . PRO A 52  ? 1.5529 1.5932 1.5665 0.0000 0.0000 0.0000 49  PRO A C     
312  O O     . PRO A 52  ? 1.5317 1.6101 1.5570 0.0000 0.0000 0.0000 49  PRO A O     
313  C CB    . PRO A 52  ? 1.5429 1.5323 1.5370 0.0000 0.0000 0.0000 49  PRO A CB    
314  C CG    . PRO A 52  ? 1.5244 1.5216 1.5117 0.0000 0.0000 0.0000 49  PRO A CG    
315  C CD    . PRO A 52  ? 1.5118 1.5415 1.5036 0.0000 0.0000 0.0000 49  PRO A CD    
316  N N     . PRO A 53  ? 1.5852 1.6067 1.5980 0.0000 0.0000 0.0000 50  PRO A N     
317  C CA    . PRO A 53  ? 1.6006 1.6423 1.6240 0.0000 0.0000 0.0000 50  PRO A CA    
318  C C     . PRO A 53  ? 1.5993 1.6351 1.6228 0.0000 0.0000 0.0000 50  PRO A C     
319  O O     . PRO A 53  ? 1.6076 1.5975 1.6200 0.0000 0.0000 0.0000 50  PRO A O     
320  C CB    . PRO A 53  ? 1.6454 1.6447 1.6608 0.0000 0.0000 0.0000 50  PRO A CB    
321  C CG    . PRO A 53  ? 1.6495 1.6018 1.6509 0.0000 0.0000 0.0000 50  PRO A CG    
322  C CD    . PRO A 53  ? 1.6112 1.5936 1.6122 0.0000 0.0000 0.0000 50  PRO A CD    
323  N N     . GLN A 54  ? 1.5909 1.6792 1.6271 0.0000 0.0000 0.0000 51  GLN A N     
324  C CA    . GLN A 54  ? 1.5929 1.6880 1.6288 0.0000 0.0000 0.0000 51  GLN A CA    
325  C C     . GLN A 54  ? 1.6252 1.6492 1.6435 0.0000 0.0000 0.0000 51  GLN A C     
326  O O     . GLN A 54  ? 1.6143 1.6234 1.6279 0.0000 0.0000 0.0000 51  GLN A O     
327  C CB    . GLN A 54  ? 1.6033 1.7611 1.6508 0.0000 0.0000 0.0000 51  GLN A CB    
328  C CG    . GLN A 54  ? 1.6184 1.7884 1.6618 0.0000 0.0000 0.0000 51  GLN A CG    
329  C CD    . GLN A 54  ? 1.5841 1.8139 1.6404 0.0000 0.0000 0.0000 51  GLN A CD    
330  O OE1   . GLN A 54  ? 1.5616 1.8591 1.6361 0.0000 0.0000 0.0000 51  GLN A OE1   
331  N NE2   . GLN A 54  ? 1.5855 1.7908 1.6328 0.0000 0.0000 0.0000 51  GLN A NE2   
332  N N     . SER A 55  ? 1.6692 1.6477 1.6777 0.0000 0.0000 0.0000 52  SER A N     
333  C CA    . SER A 55  ? 1.7133 1.6202 1.7044 0.0000 0.0000 0.0000 52  SER A CA    
334  C C     . SER A 55  ? 1.7084 1.5686 1.6916 0.0000 0.0000 0.0000 52  SER A C     
335  O O     . SER A 55  ? 1.7363 1.5463 1.7075 0.0000 0.0000 0.0000 52  SER A O     
336  C CB    . SER A 55  ? 1.7687 1.6339 1.7507 0.0000 0.0000 0.0000 52  SER A CB    
337  O OG    . SER A 55  ? 1.7733 1.6091 1.7539 0.0000 0.0000 0.0000 52  SER A OG    
338  N N     . ASP A 56  ? 1.6779 1.5581 1.6667 0.0000 0.0000 0.0000 53  ASP A N     
339  C CA    . ASP A 56  ? 1.6724 1.5253 1.6543 0.0000 0.0000 0.0000 53  ASP A CA    
340  C C     . ASP A 56  ? 1.6304 1.5064 1.6153 0.0000 0.0000 0.0000 53  ASP A C     
341  O O     . ASP A 56  ? 1.6287 1.4828 1.6074 0.0000 0.0000 0.0000 53  ASP A O     
342  C CB    . ASP A 56  ? 1.6667 1.5315 1.6485 0.0000 0.0000 0.0000 53  ASP A CB    
343  C CG    . ASP A 56  ? 1.7214 1.5439 1.6957 0.0000 0.0000 0.0000 53  ASP A CG    
344  O OD1   . ASP A 56  ? 1.7729 1.5436 1.7394 0.0000 0.0000 0.0000 53  ASP A OD1   
345  O OD2   . ASP A 56  ? 1.7259 1.5651 1.7010 0.0000 0.0000 0.0000 53  ASP A OD2   
346  N N     . ARG A 57  ? 1.5974 1.5211 1.5927 0.0000 0.0000 0.0000 54  ARG A N     
347  C CA    . ARG A 57  ? 1.5543 1.5043 1.5539 0.0000 0.0000 0.0000 54  ARG A CA    
348  C C     . ARG A 57  ? 1.5500 1.4806 1.5447 0.0000 0.0000 0.0000 54  ARG A C     
349  O O     . ARG A 57  ? 1.5280 1.4595 1.5213 0.0000 0.0000 0.0000 54  ARG A O     
350  C CB    . ARG A 57  ? 1.5304 1.5384 1.5438 0.0000 0.0000 0.0000 54  ARG A CB    
351  C CG    . ARG A 57  ? 1.5246 1.5550 1.5424 0.0000 0.0000 0.0000 54  ARG A CG    
352  C CD    . ARG A 57  ? 1.5131 1.6029 1.5465 0.0000 0.0000 0.0000 54  ARG A CD    
353  N NE    . ARG A 57  ? 1.5191 1.6349 1.5591 0.0000 0.0000 0.0000 54  ARG A NE    
354  C CZ    . ARG A 57  ? 1.5057 1.6801 1.5616 0.0000 0.0000 0.0000 54  ARG A CZ    
355  N NH1   . ARG A 57  ? 1.4850 1.7001 1.5521 0.0000 0.0000 0.0000 54  ARG A NH1   
356  N NH2   . ARG A 57  ? 1.5157 1.7127 1.5772 0.0000 0.0000 0.0000 54  ARG A NH2   
357  N N     . GLN A 58  ? 1.5723 1.4855 1.5628 0.0000 0.0000 0.0000 55  GLN A N     
358  C CA    . GLN A 58  ? 1.5752 1.4642 1.5584 0.0000 0.0000 0.0000 55  GLN A CA    
359  C C     . GLN A 58  ? 1.5793 1.4222 1.5539 0.0000 0.0000 0.0000 55  GLN A C     
360  O O     . GLN A 58  ? 1.5584 1.4038 1.5329 0.0000 0.0000 0.0000 55  GLN A O     
361  C CB    . GLN A 58  ? 1.6187 1.4906 1.5935 0.0000 0.0000 0.0000 55  GLN A CB    
362  C CG    . GLN A 58  ? 1.6513 1.4918 1.6153 0.0000 0.0000 0.0000 55  GLN A CG    
363  C CD    . GLN A 58  ? 1.7258 1.5308 1.6738 0.0000 0.0000 0.0000 55  GLN A CD    
364  O OE1   . GLN A 58  ? 1.7543 1.5560 1.6986 0.0000 0.0000 0.0000 55  GLN A OE1   
365  N NE2   . GLN A 58  ? 1.7534 1.5306 1.6899 0.0000 0.0000 0.0000 55  GLN A NE2   
366  N N     . LYS A 59  ? 1.6030 1.4098 1.5716 0.0000 0.0000 0.0000 56  LYS A N     
367  C CA    . LYS A 59  ? 1.6081 1.3799 1.5703 0.0000 0.0000 0.0000 56  LYS A CA    
368  C C     . LYS A 59  ? 1.5522 1.3586 1.5185 0.0000 0.0000 0.0000 56  LYS A C     
369  O O     . LYS A 59  ? 1.5527 1.3505 1.5156 0.0000 0.0000 0.0000 56  LYS A O     
370  C CB    . LYS A 59  ? 1.6558 1.3953 1.6134 0.0000 0.0000 0.0000 56  LYS A CB    
371  C CG    . LYS A 59  ? 1.6945 1.4053 1.6470 0.0000 0.0000 0.0000 56  LYS A CG    
372  C CD    . LYS A 59  ? 1.7367 1.4480 1.6893 0.0000 0.0000 0.0000 56  LYS A CD    
373  C CE    . LYS A 59  ? 1.8056 1.4653 1.7522 0.0000 0.0000 0.0000 56  LYS A CE    
374  N NZ    . LYS A 59  ? 1.8256 1.4851 1.7725 0.0000 0.0000 0.0000 56  LYS A NZ    
375  N N     . ILE A 60  ? 1.5040 1.3504 1.4762 0.0000 0.0000 0.0000 57  ILE A N     
376  C CA    . ILE A 60  ? 1.4547 1.3306 1.4263 0.0000 0.0000 0.0000 57  ILE A CA    
377  C C     . ILE A 60  ? 1.4189 1.3068 1.3919 0.0000 0.0000 0.0000 57  ILE A C     
378  O O     . ILE A 60  ? 1.4117 1.3004 1.3799 0.0000 0.0000 0.0000 57  ILE A O     
379  C CB    . ILE A 60  ? 1.4371 1.3444 1.4122 0.0000 0.0000 0.0000 57  ILE A CB    
380  C CG1   . ILE A 60  ? 1.4510 1.3498 1.4230 0.0000 0.0000 0.0000 57  ILE A CG1   
381  C CG2   . ILE A 60  ? 1.4080 1.3393 1.3787 0.0000 0.0000 0.0000 57  ILE A CG2   
382  C CD1   . ILE A 60  ? 1.4251 1.3533 1.3963 0.0000 0.0000 0.0000 57  ILE A CD1   
383  N N     . VAL A 61  ? 1.3898 1.2928 1.3698 0.0000 0.0000 0.0000 58  VAL A N     
384  C CA    . VAL A 61  ? 1.3552 1.2713 1.3379 0.0000 0.0000 0.0000 58  VAL A CA    
385  C C     . VAL A 61  ? 1.3587 1.2507 1.3363 0.0000 0.0000 0.0000 58  VAL A C     
386  O O     . VAL A 61  ? 1.3387 1.2398 1.3152 0.0000 0.0000 0.0000 58  VAL A O     
387  C CB    . VAL A 61  ? 1.3451 1.2850 1.3368 0.0000 0.0000 0.0000 58  VAL A CB    
388  C CG1   . VAL A 61  ? 1.3214 1.2747 1.3159 0.0000 0.0000 0.0000 58  VAL A CG1   
389  C CG2   . VAL A 61  ? 1.3296 1.3010 1.3288 0.0000 0.0000 0.0000 58  VAL A CG2   
390  N N     . LEU A 62  ? 1.3805 1.2403 1.3544 0.0000 0.0000 0.0000 59  LEU A N     
391  C CA    . LEU A 62  ? 1.3907 1.2218 1.3591 0.0000 0.0000 0.0000 59  LEU A CA    
392  C C     . LEU A 62  ? 1.3845 1.2176 1.3508 0.0000 0.0000 0.0000 59  LEU A C     
393  O O     . LEU A 62  ? 1.3776 1.2163 1.3439 0.0000 0.0000 0.0000 59  LEU A O     
394  C CB    . LEU A 62  ? 1.4376 1.2239 1.3989 0.0000 0.0000 0.0000 59  LEU A CB    
395  C CG    . LEU A 62  ? 1.4696 1.2194 1.4233 0.0000 0.0000 0.0000 59  LEU A CG    
396  C CD1   . LEU A 62  ? 1.4566 1.2204 1.4096 0.0000 0.0000 0.0000 59  LEU A CD1   
397  C CD2   . LEU A 62  ? 1.5261 1.2166 1.4691 0.0000 0.0000 0.0000 59  LEU A CD2   
398  N N     . GLN A 63  ? 1.3877 1.2230 1.3522 0.0000 0.0000 0.0000 60  GLN A N     
399  C CA    . GLN A 63  ? 1.3855 1.2357 1.3474 0.0000 0.0000 0.0000 60  GLN A CA    
400  C C     . GLN A 63  ? 1.3437 1.2349 1.3054 0.0000 0.0000 0.0000 60  GLN A C     
401  O O     . GLN A 63  ? 1.3414 1.2484 1.3025 0.0000 0.0000 0.0000 60  GLN A O     
402  C CB    . GLN A 63  ? 1.4009 1.2549 1.3599 0.0000 0.0000 0.0000 60  GLN A CB    
403  C CG    . GLN A 63  ? 1.4671 1.2824 1.4239 0.0000 0.0000 0.0000 60  GLN A CG    
404  C CD    . GLN A 63  ? 1.5132 1.3334 1.4679 0.0000 0.0000 0.0000 60  GLN A CD    
405  O OE1   . GLN A 63  ? 1.5064 1.3677 1.4588 0.0000 0.0000 0.0000 60  GLN A OE1   
406  N NE2   . GLN A 63  ? 1.5635 1.3396 1.5168 0.0000 0.0000 0.0000 60  GLN A NE2   
407  N N     . ALA A 64  ? 1.3121 1.2202 1.2740 0.0000 0.0000 0.0000 61  ALA A N     
408  C CA    . ALA A 64  ? 1.2773 1.2135 1.2360 0.0000 0.0000 0.0000 61  ALA A CA    
409  C C     . ALA A 64  ? 1.2605 1.1959 1.2235 0.0000 0.0000 0.0000 61  ALA A C     
410  O O     . ALA A 64  ? 1.2560 1.2104 1.2162 0.0000 0.0000 0.0000 61  ALA A O     
411  C CB    . ALA A 64  ? 1.2634 1.2064 1.2222 0.0000 0.0000 0.0000 61  ALA A CB    
412  N N     . HIS A 65  ? 1.2488 1.1678 1.2180 0.0000 0.0000 0.0000 62  HIS A N     
413  C CA    . HIS A 65  ? 1.2301 1.1499 1.2026 0.0000 0.0000 0.0000 62  HIS A CA    
414  C C     . HIS A 65  ? 1.2407 1.1561 1.2119 0.0000 0.0000 0.0000 62  HIS A C     
415  O O     . HIS A 65  ? 1.2296 1.1651 1.2014 0.0000 0.0000 0.0000 62  HIS A O     
416  C CB    . HIS A 65  ? 1.2273 1.1351 1.2043 0.0000 0.0000 0.0000 62  HIS A CB    
417  C CG    . HIS A 65  ? 1.2063 1.1136 1.1847 0.0000 0.0000 0.0000 62  HIS A CG    
418  N ND1   . HIS A 65  ? 1.1713 1.1006 1.1536 0.0000 0.0000 0.0000 62  HIS A ND1   
419  C CD2   . HIS A 65  ? 1.2107 1.0959 1.1860 0.0000 0.0000 0.0000 62  HIS A CD2   
420  C CE1   . HIS A 65  ? 1.1658 1.0917 1.1482 0.0000 0.0000 0.0000 62  HIS A CE1   
421  N NE2   . HIS A 65  ? 1.1925 1.0912 1.1701 0.0000 0.0000 0.0000 62  HIS A NE2   
422  N N     . ASN A 66  ? 1.2650 1.1549 1.2345 0.0000 0.0000 0.0000 63  ASN A N     
423  C CA    . ASN A 66  ? 1.2850 1.1665 1.2545 0.0000 0.0000 0.0000 63  ASN A CA    
424  C C     . ASN A 66  ? 1.2784 1.2019 1.2485 0.0000 0.0000 0.0000 63  ASN A C     
425  O O     . ASN A 66  ? 1.2959 1.2252 1.2687 0.0000 0.0000 0.0000 63  ASN A O     
426  C CB    . ASN A 66  ? 1.3272 1.1644 1.2933 0.0000 0.0000 0.0000 63  ASN A CB    
427  C CG    . ASN A 66  ? 1.3425 1.1370 1.3044 0.0000 0.0000 0.0000 63  ASN A CG    
428  O OD1   . ASN A 66  ? 1.3243 1.1280 1.2872 0.0000 0.0000 0.0000 63  ASN A OD1   
429  N ND2   . ASN A 66  ? 1.3845 1.1324 1.3400 0.0000 0.0000 0.0000 63  ASN A ND2   
430  N N     . LEU A 67  ? 1.2591 1.2151 1.2259 0.0000 0.0000 0.0000 64  LEU A N     
431  C CA    . LEU A 67  ? 1.2513 1.2557 1.2152 0.0000 0.0000 0.0000 64  LEU A CA    
432  C C     . LEU A 67  ? 1.2396 1.2675 1.2071 0.0000 0.0000 0.0000 64  LEU A C     
433  O O     . LEU A 67  ? 1.2457 1.3029 1.2170 0.0000 0.0000 0.0000 64  LEU A O     
434  C CB    . LEU A 67  ? 1.2393 1.2671 1.1936 0.0000 0.0000 0.0000 64  LEU A CB    
435  C CG    . LEU A 67  ? 1.2542 1.2718 1.2051 0.0000 0.0000 0.0000 64  LEU A CG    
436  C CD1   . LEU A 67  ? 1.2420 1.2671 1.1829 0.0000 0.0000 0.0000 64  LEU A CD1   
437  C CD2   . LEU A 67  ? 1.2737 1.3235 1.2243 0.0000 0.0000 0.0000 64  LEU A CD2   
438  N N     . ALA A 68  ? 1.2269 1.2446 1.1943 0.0000 0.0000 0.0000 65  ALA A N     
439  C CA    . ALA A 68  ? 1.2171 1.2523 1.1881 0.0000 0.0000 0.0000 65  ALA A CA    
440  C C     . ALA A 68  ? 1.2129 1.2170 1.1886 0.0000 0.0000 0.0000 65  ALA A C     
441  O O     . ALA A 68  ? 1.2012 1.2169 1.1796 0.0000 0.0000 0.0000 65  ALA A O     
442  C CB    . ALA A 68  ? 1.2047 1.2750 1.1679 0.0000 0.0000 0.0000 65  ALA A CB    
443  N N     . HIS A 69  ? 1.2266 1.1961 1.2030 0.0000 0.0000 0.0000 66  HIS A N     
444  C CA    . HIS A 69  ? 1.2251 1.1743 1.2043 0.0000 0.0000 0.0000 66  HIS A CA    
445  C C     . HIS A 69  ? 1.2015 1.1672 1.1821 0.0000 0.0000 0.0000 66  HIS A C     
446  O O     . HIS A 69  ? 1.1955 1.1677 1.1793 0.0000 0.0000 0.0000 66  HIS A O     
447  C CB    . HIS A 69  ? 1.2368 1.1775 1.2180 0.0000 0.0000 0.0000 66  HIS A CB    
448  C CG    . HIS A 69  ? 1.2688 1.1741 1.2465 0.0000 0.0000 0.0000 66  HIS A CG    
449  N ND1   . HIS A 69  ? 1.2867 1.1572 1.2595 0.0000 0.0000 0.0000 66  HIS A ND1   
450  C CD2   . HIS A 69  ? 1.2894 1.1877 1.2663 0.0000 0.0000 0.0000 66  HIS A CD2   
451  C CE1   . HIS A 69  ? 1.3357 1.1699 1.3031 0.0000 0.0000 0.0000 66  HIS A CE1   
452  N NE2   . HIS A 69  ? 1.3321 1.1821 1.3033 0.0000 0.0000 0.0000 66  HIS A NE2   
453  N N     . THR A 70  ? 1.1940 1.1640 1.1711 0.0000 0.0000 0.0000 67  THR A N     
454  C CA    . THR A 70  ? 1.1795 1.1580 1.1553 0.0000 0.0000 0.0000 67  THR A CA    
455  C C     . THR A 70  ? 1.1719 1.1441 1.1540 0.0000 0.0000 0.0000 67  THR A C     
456  O O     . THR A 70  ? 1.1749 1.1396 1.1602 0.0000 0.0000 0.0000 67  THR A O     
457  C CB    . THR A 70  ? 1.1863 1.1705 1.1522 0.0000 0.0000 0.0000 67  THR A CB    
458  O OG1   . THR A 70  ? 1.1821 1.1572 1.1470 0.0000 0.0000 0.0000 67  THR A OG1   
459  C CG2   . THR A 70  ? 1.1972 1.2044 1.1565 0.0000 0.0000 0.0000 67  THR A CG2   
460  N N     . GLY A 71  ? 1.1625 1.1412 1.1464 0.0000 0.0000 0.0000 68  GLY A N     
461  C CA    . GLY A 71  ? 1.1567 1.1420 1.1486 0.0000 0.0000 0.0000 68  GLY A CA    
462  C C     . GLY A 71  ? 1.1615 1.1457 1.1537 0.0000 0.0000 0.0000 68  GLY A C     
463  O O     . GLY A 71  ? 1.1663 1.1415 1.1519 0.0000 0.0000 0.0000 68  GLY A O     
464  N N     . ARG A 72  ? 1.1571 1.1556 1.1577 0.0000 0.0000 0.0000 69  ARG A N     
465  C CA    . ARG A 72  ? 1.1576 1.1625 1.1616 0.0000 0.0000 0.0000 69  ARG A CA    
466  C C     . ARG A 72  ? 1.1711 1.1532 1.1625 0.0000 0.0000 0.0000 69  ARG A C     
467  O O     . ARG A 72  ? 1.1771 1.1541 1.1633 0.0000 0.0000 0.0000 69  ARG A O     
468  C CB    . ARG A 72  ? 1.1522 1.1829 1.1685 0.0000 0.0000 0.0000 69  ARG A CB    
469  C CG    . ARG A 72  ? 1.1462 1.1996 1.1715 0.0000 0.0000 0.0000 69  ARG A CG    
470  C CD    . ARG A 72  ? 1.1427 1.2007 1.1730 0.0000 0.0000 0.0000 69  ARG A CD    
471  N NE    . ARG A 72  ? 1.1505 1.2230 1.1874 0.0000 0.0000 0.0000 69  ARG A NE    
472  C CZ    . ARG A 72  ? 1.1663 1.2218 1.2018 0.0000 0.0000 0.0000 69  ARG A CZ    
473  N NH1   . ARG A 72  ? 1.1857 1.2046 1.2107 0.0000 0.0000 0.0000 69  ARG A NH1   
474  N NH2   . ARG A 72  ? 1.1463 1.2185 1.1888 0.0000 0.0000 0.0000 69  ARG A NH2   
475  N N     . GLU A 73  ? 1.1787 1.1460 1.1628 0.0000 0.0000 0.0000 70  GLU A N     
476  C CA    . GLU A 73  ? 1.2013 1.1450 1.1694 0.0000 0.0000 0.0000 70  GLU A CA    
477  C C     . GLU A 73  ? 1.2073 1.1462 1.1609 0.0000 0.0000 0.0000 70  GLU A C     
478  O O     . GLU A 73  ? 1.2158 1.1506 1.1604 0.0000 0.0000 0.0000 70  GLU A O     
479  C CB    . GLU A 73  ? 1.2209 1.1429 1.1814 0.0000 0.0000 0.0000 70  GLU A CB    
480  C CG    . GLU A 73  ? 1.2309 1.1583 1.2046 0.0000 0.0000 0.0000 70  GLU A CG    
481  C CD    . GLU A 73  ? 1.2426 1.1744 1.2189 0.0000 0.0000 0.0000 70  GLU A CD    
482  O OE1   . GLU A 73  ? 1.2596 1.1640 1.2178 0.0000 0.0000 0.0000 70  GLU A OE1   
483  O OE2   . GLU A 73  ? 1.2210 1.1880 1.2165 0.0000 0.0000 0.0000 70  GLU A OE2   
484  N N     . ALA A 74  ? 1.2024 1.1482 1.1547 0.0000 0.0000 0.0000 71  ALA A N     
485  C CA    . ALA A 74  ? 1.2055 1.1597 1.1476 0.0000 0.0000 0.0000 71  ALA A CA    
486  C C     . ALA A 74  ? 1.2019 1.1621 1.1481 0.0000 0.0000 0.0000 71  ALA A C     
487  O O     . ALA A 74  ? 1.2151 1.1788 1.1495 0.0000 0.0000 0.0000 71  ALA A O     
488  C CB    . ALA A 74  ? 1.1926 1.1609 1.1381 0.0000 0.0000 0.0000 71  ALA A CB    
489  N N     . THR A 75  ? 1.1884 1.1505 1.1494 0.0000 0.0000 0.0000 72  THR A N     
490  C CA    . THR A 75  ? 1.1913 1.1533 1.1553 0.0000 0.0000 0.0000 72  THR A CA    
491  C C     . THR A 75  ? 1.1969 1.1575 1.1570 0.0000 0.0000 0.0000 72  THR A C     
492  O O     . THR A 75  ? 1.2083 1.1693 1.1604 0.0000 0.0000 0.0000 72  THR A O     
493  C CB    . THR A 75  ? 1.1863 1.1487 1.1634 0.0000 0.0000 0.0000 72  THR A CB    
494  O OG1   . THR A 75  ? 1.1947 1.1563 1.1741 0.0000 0.0000 0.0000 72  THR A OG1   
495  C CG2   . THR A 75  ? 1.1964 1.1507 1.1735 0.0000 0.0000 0.0000 72  THR A CG2   
496  N N     . LEU A 76  ? 1.1898 1.1521 1.1560 0.0000 0.0000 0.0000 73  LEU A N     
497  C CA    . LEU A 76  ? 1.1938 1.1570 1.1586 0.0000 0.0000 0.0000 73  LEU A CA    
498  C C     . LEU A 76  ? 1.2117 1.1623 1.1556 0.0000 0.0000 0.0000 73  LEU A C     
499  O O     . LEU A 76  ? 1.2183 1.1709 1.1570 0.0000 0.0000 0.0000 73  LEU A O     
500  C CB    . LEU A 76  ? 1.1897 1.1590 1.1640 0.0000 0.0000 0.0000 73  LEU A CB    
501  C CG    . LEU A 76  ? 1.2047 1.1701 1.1740 0.0000 0.0000 0.0000 73  LEU A CG    
502  C CD1   . LEU A 76  ? 1.2021 1.1934 1.1856 0.0000 0.0000 0.0000 73  LEU A CD1   
503  C CD2   . LEU A 76  ? 1.2198 1.1774 1.1908 0.0000 0.0000 0.0000 73  LEU A CD2   
504  N N     . LEU A 77  ? 1.2188 1.1595 1.1496 0.0000 0.0000 0.0000 74  LEU A N     
505  C CA    . LEU A 77  ? 1.2403 1.1722 1.1467 0.0000 0.0000 0.0000 74  LEU A CA    
506  C C     . LEU A 77  ? 1.2426 1.1926 1.1400 0.0000 0.0000 0.0000 74  LEU A C     
507  O O     . LEU A 77  ? 1.2632 1.2131 1.1411 0.0000 0.0000 0.0000 74  LEU A O     
508  C CB    . LEU A 77  ? 1.2497 1.1721 1.1441 0.0000 0.0000 0.0000 74  LEU A CB    
509  C CG    . LEU A 77  ? 1.2728 1.1638 1.1577 0.0000 0.0000 0.0000 74  LEU A CG    
510  C CD1   . LEU A 77  ? 1.2757 1.1544 1.1541 0.0000 0.0000 0.0000 74  LEU A CD1   
511  C CD2   . LEU A 77  ? 1.3161 1.1910 1.1753 0.0000 0.0000 0.0000 74  LEU A CD2   
512  N N     . LYS A 78  ? 1.2239 1.1887 1.1340 0.0000 0.0000 0.0000 75  LYS A N     
513  C CA    . LYS A 78  ? 1.2296 1.2117 1.1353 0.0000 0.0000 0.0000 75  LYS A CA    
514  C C     . LYS A 78  ? 1.2359 1.2129 1.1463 0.0000 0.0000 0.0000 75  LYS A C     
515  O O     . LYS A 78  ? 1.2515 1.2367 1.1482 0.0000 0.0000 0.0000 75  LYS A O     
516  C CB    . LYS A 78  ? 1.2152 1.2059 1.1336 0.0000 0.0000 0.0000 75  LYS A CB    
517  C CG    . LYS A 78  ? 1.2185 1.2301 1.1305 0.0000 0.0000 0.0000 75  LYS A CG    
518  C CD    . LYS A 78  ? 1.2441 1.2872 1.1372 0.0000 0.0000 0.0000 75  LYS A CD    
519  C CE    . LYS A 78  ? 1.2468 1.3266 1.1408 0.0000 0.0000 0.0000 75  LYS A CE    
520  N NZ    . LYS A 78  ? 1.2641 1.3904 1.1441 0.0000 0.0000 0.0000 75  LYS A NZ    
521  N N     . ILE A 79  ? 1.2262 1.1944 1.1551 0.0000 0.0000 0.0000 76  ILE A N     
522  C CA    . ILE A 79  ? 1.2322 1.2014 1.1684 0.0000 0.0000 0.0000 76  ILE A CA    
523  C C     . ILE A 79  ? 1.2546 1.2241 1.1797 0.0000 0.0000 0.0000 76  ILE A C     
524  O O     . ILE A 79  ? 1.2696 1.2452 1.1895 0.0000 0.0000 0.0000 76  ILE A O     
525  C CB    . ILE A 79  ? 1.2150 1.1838 1.1713 0.0000 0.0000 0.0000 76  ILE A CB    
526  C CG1   . ILE A 79  ? 1.1953 1.1566 1.1577 0.0000 0.0000 0.0000 76  ILE A CG1   
527  C CG2   . ILE A 79  ? 1.2234 1.1984 1.1870 0.0000 0.0000 0.0000 76  ILE A CG2   
528  C CD1   . ILE A 79  ? 1.1548 1.1194 1.1307 0.0000 0.0000 0.0000 76  ILE A CD1   
529  N N     . ALA A 80  ? 1.2675 1.2274 1.1874 0.0000 0.0000 0.0000 77  ALA A N     
530  C CA    . ALA A 80  ? 1.2975 1.2485 1.2042 0.0000 0.0000 0.0000 77  ALA A CA    
531  C C     . ALA A 80  ? 1.3254 1.2797 1.2084 0.0000 0.0000 0.0000 77  ALA A C     
532  O O     . ALA A 80  ? 1.3425 1.2962 1.2183 0.0000 0.0000 0.0000 77  ALA A O     
533  C CB    . ALA A 80  ? 1.3108 1.2408 1.2093 0.0000 0.0000 0.0000 77  ALA A CB    
534  N N     . ASN A 81  ? 1.3343 1.2985 1.2055 0.0000 0.0000 0.0000 78  ASN A N     
535  C CA    . ASN A 81  ? 1.3651 1.3456 1.2126 0.0000 0.0000 0.0000 78  ASN A CA    
536  C C     . ASN A 81  ? 1.3728 1.3659 1.2246 0.0000 0.0000 0.0000 78  ASN A C     
537  O O     . ASN A 81  ? 1.3970 1.3918 1.2306 0.0000 0.0000 0.0000 78  ASN A O     
538  C CB    . ASN A 81  ? 1.3587 1.3641 1.2010 0.0000 0.0000 0.0000 78  ASN A CB    
539  C CG    . ASN A 81  ? 1.3684 1.3665 1.2025 0.0000 0.0000 0.0000 78  ASN A CG    
540  O OD1   . ASN A 81  ? 1.3969 1.3656 1.2247 0.0000 0.0000 0.0000 78  ASN A OD1   
541  N ND2   . ASN A 81  ? 1.3677 1.3933 1.2022 0.0000 0.0000 0.0000 78  ASN A ND2   
542  N N     . LEU A 82  ? 1.3606 1.3590 1.2349 0.0000 0.0000 0.0000 79  LEU A N     
543  C CA    . LEU A 82  ? 1.3693 1.3778 1.2489 0.0000 0.0000 0.0000 79  LEU A CA    
544  C C     . LEU A 82  ? 1.3713 1.3723 1.2679 0.0000 0.0000 0.0000 79  LEU A C     
545  O O     . LEU A 82  ? 1.3843 1.3935 1.2767 0.0000 0.0000 0.0000 79  LEU A O     
546  C CB    . LEU A 82  ? 1.3597 1.3740 1.2505 0.0000 0.0000 0.0000 79  LEU A CB    
547  C CG    . LEU A 82  ? 1.3600 1.3976 1.2378 0.0000 0.0000 0.0000 79  LEU A CG    
548  C CD1   . LEU A 82  ? 1.3619 1.4041 1.2499 0.0000 0.0000 0.0000 79  LEU A CD1   
549  C CD2   . LEU A 82  ? 1.3695 1.4317 1.2203 0.0000 0.0000 0.0000 79  LEU A CD2   
550  N N     . TYR A 83  ? 1.3615 1.3541 1.2772 0.0000 0.0000 0.0000 80  TYR A N     
551  C CA    . TYR A 83  ? 1.3645 1.3639 1.2997 0.0000 0.0000 0.0000 80  TYR A CA    
552  C C     . TYR A 83  ? 1.3661 1.3695 1.3094 0.0000 0.0000 0.0000 80  TYR A C     
553  O O     . TYR A 83  ? 1.3693 1.3601 1.3042 0.0000 0.0000 0.0000 80  TYR A O     
554  C CB    . TYR A 83  ? 1.3531 1.3500 1.3058 0.0000 0.0000 0.0000 80  TYR A CB    
555  C CG    . TYR A 83  ? 1.3750 1.3620 1.3220 0.0000 0.0000 0.0000 80  TYR A CG    
556  C CD1   . TYR A 83  ? 1.3936 1.3830 1.3405 0.0000 0.0000 0.0000 80  TYR A CD1   
557  C CD2   . TYR A 83  ? 1.3832 1.3602 1.3261 0.0000 0.0000 0.0000 80  TYR A CD2   
558  C CE1   . TYR A 83  ? 1.4150 1.3938 1.3574 0.0000 0.0000 0.0000 80  TYR A CE1   
559  C CE2   . TYR A 83  ? 1.4024 1.3730 1.3419 0.0000 0.0000 0.0000 80  TYR A CE2   
560  C CZ    . TYR A 83  ? 1.4204 1.3903 1.3595 0.0000 0.0000 0.0000 80  TYR A CZ    
561  O OH    . TYR A 83  ? 1.4446 1.4067 1.3809 0.0000 0.0000 0.0000 80  TYR A OH    
562  N N     . TRP A 84  ? 1.3719 1.3956 1.3317 0.0000 0.0000 0.0000 81  TRP A N     
563  C CA    . TRP A 84  ? 1.3743 1.4160 1.3500 0.0000 0.0000 0.0000 81  TRP A CA    
564  C C     . TRP A 84  ? 1.3666 1.4427 1.3658 0.0000 0.0000 0.0000 81  TRP A C     
565  O O     . TRP A 84  ? 1.3774 1.4616 1.3781 0.0000 0.0000 0.0000 81  TRP A O     
566  C CB    . TRP A 84  ? 1.3954 1.4361 1.3619 0.0000 0.0000 0.0000 81  TRP A CB    
567  C CG    . TRP A 84  ? 1.4042 1.4658 1.3887 0.0000 0.0000 0.0000 81  TRP A CG    
568  C CD1   . TRP A 84  ? 1.4203 1.4653 1.4020 0.0000 0.0000 0.0000 81  TRP A CD1   
569  C CD2   . TRP A 84  ? 1.4059 1.5152 1.4152 0.0000 0.0000 0.0000 81  TRP A CD2   
570  N NE1   . TRP A 84  ? 1.4232 1.5026 1.4270 0.0000 0.0000 0.0000 81  TRP A NE1   
571  C CE2   . TRP A 84  ? 1.4118 1.5361 1.4333 0.0000 0.0000 0.0000 81  TRP A CE2   
572  C CE3   . TRP A 84  ? 1.4061 1.5506 1.4285 0.0000 0.0000 0.0000 81  TRP A CE3   
573  C CZ2   . TRP A 84  ? 1.4070 1.5892 1.4548 0.0000 0.0000 0.0000 81  TRP A CZ2   
574  C CZ3   . TRP A 84  ? 1.4061 1.6068 1.4539 0.0000 0.0000 0.0000 81  TRP A CZ3   
575  C CH2   . TRP A 84  ? 1.4004 1.6237 1.4611 0.0000 0.0000 0.0000 81  TRP A CH2   
576  N N     . TRP A 85  ? 1.3535 1.4529 1.3698 0.0000 0.0000 0.0000 82  TRP A N     
577  C CA    . TRP A 85  ? 1.3503 1.4984 1.3888 0.0000 0.0000 0.0000 82  TRP A CA    
578  C C     . TRP A 85  ? 1.3415 1.5257 1.3962 0.0000 0.0000 0.0000 82  TRP A C     
579  O O     . TRP A 85  ? 1.3421 1.5033 1.3896 0.0000 0.0000 0.0000 82  TRP A O     
580  C CB    . TRP A 85  ? 1.3519 1.4991 1.3939 0.0000 0.0000 0.0000 82  TRP A CB    
581  C CG    . TRP A 85  ? 1.3540 1.4809 1.3928 0.0000 0.0000 0.0000 82  TRP A CG    
582  C CD1   . TRP A 85  ? 1.3571 1.5129 1.4074 0.0000 0.0000 0.0000 82  TRP A CD1   
583  C CD2   . TRP A 85  ? 1.3624 1.4413 1.3855 0.0000 0.0000 0.0000 82  TRP A CD2   
584  N NE1   . TRP A 85  ? 1.3573 1.4800 1.3986 0.0000 0.0000 0.0000 82  TRP A NE1   
585  C CE2   . TRP A 85  ? 1.3607 1.4365 1.3864 0.0000 0.0000 0.0000 82  TRP A CE2   
586  C CE3   . TRP A 85  ? 1.3695 1.4144 1.3769 0.0000 0.0000 0.0000 82  TRP A CE3   
587  C CZ2   . TRP A 85  ? 1.3586 1.3953 1.3728 0.0000 0.0000 0.0000 82  TRP A CZ2   
588  C CZ3   . TRP A 85  ? 1.3679 1.3805 1.3654 0.0000 0.0000 0.0000 82  TRP A CZ3   
589  C CH2   . TRP A 85  ? 1.3656 1.3727 1.3669 0.0000 0.0000 0.0000 82  TRP A CH2   
590  N N     . PRO A 86  ? 1.3363 1.5816 1.4127 0.0000 0.0000 0.0000 83  PRO A N     
591  C CA    . PRO A 86  ? 1.3287 1.6159 1.4209 0.0000 0.0000 0.0000 83  PRO A CA    
592  C C     . PRO A 86  ? 1.3177 1.6057 1.4110 0.0000 0.0000 0.0000 83  PRO A C     
593  O O     . PRO A 86  ? 1.3158 1.6021 1.4065 0.0000 0.0000 0.0000 83  PRO A O     
594  C CB    . PRO A 86  ? 1.3274 1.6928 1.4427 0.0000 0.0000 0.0000 83  PRO A CB    
595  C CG    . PRO A 86  ? 1.3286 1.6917 1.4405 0.0000 0.0000 0.0000 83  PRO A CG    
596  C CD    . PRO A 86  ? 1.3388 1.6232 1.4264 0.0000 0.0000 0.0000 83  PRO A CD    
597  N N     . ASN A 87  ? 1.3172 1.6027 1.4122 0.0000 0.0000 0.0000 84  ASN A N     
598  C CA    . ASN A 87  ? 1.3092 1.6003 1.4058 0.0000 0.0000 0.0000 84  ASN A CA    
599  C C     . ASN A 87  ? 1.3081 1.5391 1.3855 0.0000 0.0000 0.0000 84  ASN A C     
600  O O     . ASN A 87  ? 1.3056 1.5444 1.3831 0.0000 0.0000 0.0000 84  ASN A O     
601  C CB    . ASN A 87  ? 1.3014 1.6705 1.4167 0.0000 0.0000 0.0000 84  ASN A CB    
602  C CG    . ASN A 87  ? 1.3103 1.7534 1.4481 0.0000 0.0000 0.0000 84  ASN A CG    
603  O OD1   . ASN A 87  ? 1.3314 1.7744 1.4741 0.0000 0.0000 0.0000 84  ASN A OD1   
604  N ND2   . ASN A 87  ? 1.3132 1.8212 1.4652 0.0000 0.0000 0.0000 84  ASN A ND2   
605  N N     . MET A 88  ? 1.3137 1.4886 1.3737 0.0000 0.0000 0.0000 85  MET A N     
606  C CA    . MET A 88  ? 1.3123 1.4374 1.3554 0.0000 0.0000 0.0000 85  MET A CA    
607  C C     . MET A 88  ? 1.2969 1.4193 1.3405 0.0000 0.0000 0.0000 85  MET A C     
608  O O     . MET A 88  ? 1.2990 1.4094 1.3384 0.0000 0.0000 0.0000 85  MET A O     
609  C CB    . MET A 88  ? 1.3267 1.4086 1.3522 0.0000 0.0000 0.0000 85  MET A CB    
610  C CG    . MET A 88  ? 1.3605 1.4434 1.3822 0.0000 0.0000 0.0000 85  MET A CG    
611  S SD    . MET A 88  ? 1.4249 1.4615 1.4201 0.0000 0.0000 0.0000 85  MET A SD    
612  C CE    . MET A 88  ? 1.4082 1.4418 1.4060 0.0000 0.0000 0.0000 85  MET A CE    
613  N N     . ARG A 89  ? 1.2834 1.4139 1.3312 0.0000 0.0000 0.0000 86  ARG A N     
614  C CA    . ARG A 89  ? 1.2624 1.3904 1.3100 0.0000 0.0000 0.0000 86  ARG A CA    
615  C C     . ARG A 89  ? 1.2523 1.4214 1.3097 0.0000 0.0000 0.0000 86  ARG A C     
616  O O     . ARG A 89  ? 1.2514 1.4011 1.3010 0.0000 0.0000 0.0000 86  ARG A O     
617  C CB    . ARG A 89  ? 1.2617 1.3923 1.3129 0.0000 0.0000 0.0000 86  ARG A CB    
618  C CG    . ARG A 89  ? 1.2614 1.3411 1.2960 0.0000 0.0000 0.0000 86  ARG A CG    
619  C CD    . ARG A 89  ? 1.2627 1.3392 1.3003 0.0000 0.0000 0.0000 86  ARG A CD    
620  N NE    . ARG A 89  ? 1.2712 1.2928 1.2883 0.0000 0.0000 0.0000 86  ARG A NE    
621  C CZ    . ARG A 89  ? 1.2827 1.2738 1.2855 0.0000 0.0000 0.0000 86  ARG A CZ    
622  N NH1   . ARG A 89  ? 1.2850 1.2949 1.2940 0.0000 0.0000 0.0000 86  ARG A NH1   
623  N NH2   . ARG A 89  ? 1.2988 1.2426 1.2797 0.0000 0.0000 0.0000 86  ARG A NH2   
624  N N     . LYS A 90  ? 1.2461 1.4739 1.3192 0.0000 0.0000 0.0000 87  LYS A N     
625  C CA    . LYS A 90  ? 1.2426 1.5185 1.3221 0.0000 0.0000 0.0000 87  LYS A CA    
626  C C     . LYS A 90  ? 1.2533 1.4861 1.3174 0.0000 0.0000 0.0000 87  LYS A C     
627  O O     . LYS A 90  ? 1.2570 1.4892 1.3150 0.0000 0.0000 0.0000 87  LYS A O     
628  C CB    . LYS A 90  ? 1.2386 1.5870 1.3353 0.0000 0.0000 0.0000 87  LYS A CB    
629  N N     . ASP A 91  ? 1.2600 1.4546 1.3168 0.0000 0.0000 0.0000 88  ASP A N     
630  C CA    . ASP A 91  ? 1.2773 1.4224 1.3195 0.0000 0.0000 0.0000 88  ASP A CA    
631  C C     . ASP A 91  ? 1.2737 1.3709 1.3039 0.0000 0.0000 0.0000 88  ASP A C     
632  O O     . ASP A 91  ? 1.2946 1.3689 1.3158 0.0000 0.0000 0.0000 88  ASP A O     
633  C CB    . ASP A 91  ? 1.2902 1.4084 1.3283 0.0000 0.0000 0.0000 88  ASP A CB    
634  C CG    . ASP A 91  ? 1.3128 1.4648 1.3582 0.0000 0.0000 0.0000 88  ASP A CG    
635  O OD1   . ASP A 91  ? 1.3379 1.4922 1.3792 0.0000 0.0000 0.0000 88  ASP A OD1   
636  O OD2   . ASP A 91  ? 1.3280 1.5028 1.3818 0.0000 0.0000 0.0000 88  ASP A OD2   
637  N N     . VAL A 92  ? 1.2524 1.3336 1.2811 0.0000 0.0000 0.0000 89  VAL A N     
638  C CA    . VAL A 92  ? 1.2413 1.2875 1.2603 0.0000 0.0000 0.0000 89  VAL A CA    
639  C C     . VAL A 92  ? 1.2377 1.2988 1.2586 0.0000 0.0000 0.0000 89  VAL A C     
640  O O     . VAL A 92  ? 1.2487 1.2834 1.2609 0.0000 0.0000 0.0000 89  VAL A O     
641  C CB    . VAL A 92  ? 1.2280 1.2643 1.2443 0.0000 0.0000 0.0000 89  VAL A CB    
642  C CG1   . VAL A 92  ? 1.2135 1.2320 1.2236 0.0000 0.0000 0.0000 89  VAL A CG1   
643  C CG2   . VAL A 92  ? 1.2377 1.2520 1.2453 0.0000 0.0000 0.0000 89  VAL A CG2   
644  N N     . VAL A 93  ? 1.2232 1.3293 1.2553 0.0000 0.0000 0.0000 90  VAL A N     
645  C CA    . VAL A 93  ? 1.2157 1.3466 1.2499 0.0000 0.0000 0.0000 90  VAL A CA    
646  C C     . VAL A 93  ? 1.2370 1.3728 1.2643 0.0000 0.0000 0.0000 90  VAL A C     
647  O O     . VAL A 93  ? 1.2417 1.3701 1.2614 0.0000 0.0000 0.0000 90  VAL A O     
648  C CB    . VAL A 93  ? 1.1992 1.3872 1.2484 0.0000 0.0000 0.0000 90  VAL A CB    
649  C CG1   . VAL A 93  ? 1.1932 1.3963 1.2429 0.0000 0.0000 0.0000 90  VAL A CG1   
650  C CG2   . VAL A 93  ? 1.1916 1.3693 1.2458 0.0000 0.0000 0.0000 90  VAL A CG2   
651  N N     . LYS A 94  ? 1.2553 1.4002 1.2832 0.0000 0.0000 0.0000 91  LYS A N     
652  C CA    . LYS A 94  ? 1.2900 1.4298 1.3070 0.0000 0.0000 0.0000 91  LYS A CA    
653  C C     . LYS A 94  ? 1.3174 1.3869 1.3177 0.0000 0.0000 0.0000 91  LYS A C     
654  O O     . LYS A 94  ? 1.3438 1.3989 1.3311 0.0000 0.0000 0.0000 91  LYS A O     
655  C CB    . LYS A 94  ? 1.3014 1.4569 1.3214 0.0000 0.0000 0.0000 91  LYS A CB    
656  N N     . GLN A 95  ? 1.3168 1.3464 1.3165 0.0000 0.0000 0.0000 92  GLN A N     
657  C CA    . GLN A 95  ? 1.3467 1.3192 1.3340 0.0000 0.0000 0.0000 92  GLN A CA    
658  C C     . GLN A 95  ? 1.3364 1.3064 1.3217 0.0000 0.0000 0.0000 92  GLN A C     
659  O O     . GLN A 95  ? 1.3640 1.3037 1.3380 0.0000 0.0000 0.0000 92  GLN A O     
660  C CB    . GLN A 95  ? 1.3463 1.2919 1.3341 0.0000 0.0000 0.0000 92  GLN A CB    
661  C CG    . GLN A 95  ? 1.3980 1.3281 1.3834 0.0000 0.0000 0.0000 92  GLN A CG    
662  C CD    . GLN A 95  ? 1.4750 1.3637 1.4471 0.0000 0.0000 0.0000 92  GLN A CD    
663  O OE1   . GLN A 95  ? 1.5040 1.3549 1.4669 0.0000 0.0000 0.0000 92  GLN A OE1   
664  N NE2   . GLN A 95  ? 1.4994 1.3940 1.4695 0.0000 0.0000 0.0000 92  GLN A NE2   
665  N N     . LEU A 96  ? 1.3028 1.3013 1.2979 0.0000 0.0000 0.0000 93  LEU A N     
666  C CA    . LEU A 96  ? 1.2914 1.2901 1.2856 0.0000 0.0000 0.0000 93  LEU A CA    
667  C C     . LEU A 96  ? 1.3076 1.3199 1.2960 0.0000 0.0000 0.0000 93  LEU A C     
668  O O     . LEU A 96  ? 1.3158 1.3158 1.2990 0.0000 0.0000 0.0000 93  LEU A O     
669  C CB    . LEU A 96  ? 1.2610 1.2874 1.2655 0.0000 0.0000 0.0000 93  LEU A CB    
670  C CG    . LEU A 96  ? 1.2391 1.2543 1.2454 0.0000 0.0000 0.0000 93  LEU A CG    
671  C CD1   . LEU A 96  ? 1.2265 1.2556 1.2376 0.0000 0.0000 0.0000 93  LEU A CD1   
672  C CD2   . LEU A 96  ? 1.2367 1.2171 1.2343 0.0000 0.0000 0.0000 93  LEU A CD2   
673  N N     . GLY A 97  ? 1.3157 1.3583 1.3043 0.0000 0.0000 0.0000 94  GLY A N     
674  C CA    . GLY A 97  ? 1.3316 1.3956 1.3111 0.0000 0.0000 0.0000 94  GLY A CA    
675  C C     . GLY A 97  ? 1.3748 1.3844 1.3342 0.0000 0.0000 0.0000 94  GLY A C     
676  O O     . GLY A 97  ? 1.3945 1.4022 1.3408 0.0000 0.0000 0.0000 94  GLY A O     
677  N N     . ARG A 98  ? 1.3940 1.3570 1.3497 0.0000 0.0000 0.0000 95  ARG A N     
678  C CA    . ARG A 98  ? 1.4478 1.3494 1.3839 0.0000 0.0000 0.0000 95  ARG A CA    
679  C C     . ARG A 98  ? 1.4532 1.3005 1.3856 0.0000 0.0000 0.0000 95  ARG A C     
680  O O     . ARG A 98  ? 1.5044 1.2947 1.4208 0.0000 0.0000 0.0000 95  ARG A O     
681  C CB    . ARG A 98  ? 1.4747 1.3593 1.4081 0.0000 0.0000 0.0000 95  ARG A CB    
682  C CG    . ARG A 98  ? 1.4925 1.4345 1.4287 0.0000 0.0000 0.0000 95  ARG A CG    
683  C CD    . ARG A 98  ? 1.5746 1.4887 1.5025 0.0000 0.0000 0.0000 95  ARG A CD    
684  N NE    . ARG A 98  ? 1.6291 1.5927 1.5508 0.0000 0.0000 0.0000 95  ARG A NE    
685  C CZ    . ARG A 98  ? 1.6195 1.6581 1.5578 0.0000 0.0000 0.0000 95  ARG A CZ    
686  N NH1   . ARG A 98  ? 1.5769 1.6400 1.5374 0.0000 0.0000 0.0000 95  ARG A NH1   
687  N NH2   . ARG A 98  ? 1.6521 1.7442 1.5837 0.0000 0.0000 0.0000 95  ARG A NH2   
688  N N     . CYS A 99  ? 1.4034 1.2684 1.3498 0.0000 0.0000 0.0000 96  CYS A N     
689  C CA    . CYS A 99  ? 1.4019 1.2323 1.3469 0.0000 0.0000 0.0000 96  CYS A CA    
690  C C     . CYS A 99  ? 1.4088 1.2326 1.3459 0.0000 0.0000 0.0000 96  CYS A C     
691  O O     . CYS A 99  ? 1.3765 1.2362 1.3219 0.0000 0.0000 0.0000 96  CYS A O     
692  C CB    . CYS A 99  ? 1.3582 1.2141 1.3177 0.0000 0.0000 0.0000 96  CYS A CB    
693  S SG    . CYS A 99  ? 1.3613 1.1950 1.3206 0.0000 0.0000 0.0000 96  CYS A SG    
694  N N     . GLN A 100 ? 1.4542 1.2287 1.3738 0.0000 0.0000 0.0000 97  GLN A N     
695  C CA    . GLN A 100 ? 1.4703 1.2336 1.3788 0.0000 0.0000 0.0000 97  GLN A CA    
696  C C     . GLN A 100 ? 1.4253 1.2084 1.3470 0.0000 0.0000 0.0000 97  GLN A C     
697  O O     . GLN A 100 ? 1.4058 1.2148 1.3282 0.0000 0.0000 0.0000 97  GLN A O     
698  C CB    . GLN A 100 ? 1.5495 1.2408 1.4356 0.0000 0.0000 0.0000 97  GLN A CB    
699  C CG    . GLN A 100 ? 1.6135 1.2831 1.4833 0.0000 0.0000 0.0000 97  GLN A CG    
700  C CD    . GLN A 100 ? 1.6751 1.3655 1.5277 0.0000 0.0000 0.0000 97  GLN A CD    
701  O OE1   . GLN A 100 ? 1.6829 1.4089 1.5368 0.0000 0.0000 0.0000 97  GLN A OE1   
702  N NE2   . GLN A 100 ? 1.7171 1.3915 1.5533 0.0000 0.0000 0.0000 97  GLN A NE2   
703  N N     . GLN A 101 ? 1.4038 1.1810 1.3358 0.0000 0.0000 0.0000 98  GLN A N     
704  C CA    . GLN A 101 ? 1.3671 1.1686 1.3111 0.0000 0.0000 0.0000 98  GLN A CA    
705  C C     . GLN A 101 ? 1.3060 1.1620 1.2626 0.0000 0.0000 0.0000 98  GLN A C     
706  O O     . GLN A 101 ? 1.2933 1.1684 1.2526 0.0000 0.0000 0.0000 98  GLN A O     
707  C CB    . GLN A 101 ? 1.3701 1.1647 1.3209 0.0000 0.0000 0.0000 98  GLN A CB    
708  C CG    . GLN A 101 ? 1.4317 1.1783 1.3741 0.0000 0.0000 0.0000 98  GLN A CG    
709  C CD    . GLN A 101 ? 1.4675 1.1816 1.4069 0.0000 0.0000 0.0000 98  GLN A CD    
710  O OE1   . GLN A 101 ? 1.4782 1.1690 1.4092 0.0000 0.0000 0.0000 98  GLN A OE1   
711  N NE2   . GLN A 101 ? 1.4816 1.1995 1.4280 0.0000 0.0000 0.0000 98  GLN A NE2   
712  N N     . CYS A 102 ? 1.2673 1.1452 1.2310 0.0000 0.0000 0.0000 99  CYS A N     
713  C CA    . CYS A 102 ? 1.2134 1.1333 1.1871 0.0000 0.0000 0.0000 99  CYS A CA    
714  C C     . CYS A 102 ? 1.2030 1.1436 1.1753 0.0000 0.0000 0.0000 99  CYS A C     
715  O O     . CYS A 102 ? 1.1776 1.1450 1.1567 0.0000 0.0000 0.0000 99  CYS A O     
716  C CB    . CYS A 102 ? 1.1940 1.1259 1.1729 0.0000 0.0000 0.0000 99  CYS A CB    
717  S SG    . CYS A 102 ? 1.1800 1.1066 1.1612 0.0000 0.0000 0.0000 99  CYS A SG    
718  N N     . LEU A 103 ? 1.2238 1.1537 1.1858 0.0000 0.0000 0.0000 100 LEU A N     
719  C CA    . LEU A 103 ? 1.2191 1.1788 1.1780 0.0000 0.0000 0.0000 100 LEU A CA    
720  C C     . LEU A 103 ? 1.2244 1.1827 1.1788 0.0000 0.0000 0.0000 100 LEU A C     
721  O O     . LEU A 103 ? 1.2068 1.2009 1.1650 0.0000 0.0000 0.0000 100 LEU A O     
722  C CB    . LEU A 103 ? 1.2507 1.2058 1.1962 0.0000 0.0000 0.0000 100 LEU A CB    
723  C CG    . LEU A 103 ? 1.2467 1.2131 1.1971 0.0000 0.0000 0.0000 100 LEU A CG    
724  C CD1   . LEU A 103 ? 1.2865 1.2366 1.2196 0.0000 0.0000 0.0000 100 LEU A CD1   
725  C CD2   . LEU A 103 ? 1.2144 1.2401 1.1803 0.0000 0.0000 0.0000 100 LEU A CD2   
726  N N     . ILE A 104 ? 1.2524 1.1710 1.1990 0.0000 0.0000 0.0000 101 ILE A N     
727  C CA    . ILE A 104 ? 1.2626 1.1785 1.2037 0.0000 0.0000 0.0000 101 ILE A CA    
728  C C     . ILE A 104 ? 1.2381 1.1728 1.1938 0.0000 0.0000 0.0000 101 ILE A C     
729  O O     . ILE A 104 ? 1.2446 1.1870 1.1994 0.0000 0.0000 0.0000 101 ILE A O     
730  C CB    . ILE A 104 ? 1.3170 1.1784 1.2390 0.0000 0.0000 0.0000 101 ILE A CB    
731  C CG1   . ILE A 104 ? 1.3296 1.1541 1.2551 0.0000 0.0000 0.0000 101 ILE A CG1   
732  C CG2   . ILE A 104 ? 1.3456 1.1925 1.2485 0.0000 0.0000 0.0000 101 ILE A CG2   
733  C CD1   . ILE A 104 ? 1.3846 1.1553 1.2955 0.0000 0.0000 0.0000 101 ILE A CD1   
734  N N     . THR A 105 ? 1.2138 1.1596 1.1814 0.0000 0.0000 0.0000 102 THR A N     
735  C CA    . THR A 105 ? 1.1990 1.1673 1.1780 0.0000 0.0000 0.0000 102 THR A CA    
736  C C     . THR A 105 ? 1.1599 1.1629 1.1488 0.0000 0.0000 0.0000 102 THR A C     
737  O O     . THR A 105 ? 1.1476 1.1744 1.1424 0.0000 0.0000 0.0000 102 THR A O     
738  C CB    . THR A 105 ? 1.2080 1.1642 1.1897 0.0000 0.0000 0.0000 102 THR A CB    
739  O OG1   . THR A 105 ? 1.2349 1.1740 1.2137 0.0000 0.0000 0.0000 102 THR A OG1   
740  C CG2   . THR A 105 ? 1.2512 1.1774 1.2265 0.0000 0.0000 0.0000 102 THR A CG2   
741  N N     . ASN A 106 ? 1.1487 1.1525 1.1388 0.0000 0.0000 0.0000 103 ASN A N     
742  C CA    . ASN A 106 ? 1.1286 1.1550 1.1258 0.0000 0.0000 0.0000 103 ASN A CA    
743  C C     . ASN A 106 ? 1.1195 1.1682 1.1194 0.0000 0.0000 0.0000 103 ASN A C     
744  O O     . ASN A 106 ? 1.1327 1.1840 1.1275 0.0000 0.0000 0.0000 103 ASN A O     
745  C CB    . ASN A 106 ? 1.1265 1.1490 1.1243 0.0000 0.0000 0.0000 103 ASN A CB    
746  C CG    . ASN A 106 ? 1.1406 1.1463 1.1365 0.0000 0.0000 0.0000 103 ASN A CG    
747  O OD1   . ASN A 106 ? 1.1545 1.1571 1.1494 0.0000 0.0000 0.0000 103 ASN A OD1   
748  N ND2   . ASN A 106 ? 1.1427 1.1444 1.1390 0.0000 0.0000 0.0000 103 ASN A ND2   
749  N N     . ALA A 107 ? 1.1042 1.1686 1.1101 0.0000 0.0000 0.0000 104 ALA A N     
750  C CA    . ALA A 107 ? 1.0948 1.1811 1.1041 0.0000 0.0000 0.0000 104 ALA A CA    
751  C C     . ALA A 107 ? 1.0847 1.1812 1.0977 0.0000 0.0000 0.0000 104 ALA A C     
752  O O     . ALA A 107 ? 1.0770 1.1623 1.0902 0.0000 0.0000 0.0000 104 ALA A O     
753  C CB    . ALA A 107 ? 1.0907 1.1874 1.1041 0.0000 0.0000 0.0000 104 ALA A CB    
754  N N     . SER A 108 ? 1.0820 1.2046 1.0985 0.0000 0.0000 0.0000 105 SER A N     
755  C CA    . SER A 108 ? 1.0824 1.2267 1.1048 0.0000 0.0000 0.0000 105 SER A CA    
756  C C     . SER A 108 ? 1.0820 1.2150 1.1102 0.0000 0.0000 0.0000 105 SER A C     
757  O O     . SER A 108 ? 1.0902 1.2087 1.1173 0.0000 0.0000 0.0000 105 SER A O     
758  C CB    . SER A 108 ? 1.0825 1.2664 1.1059 0.0000 0.0000 0.0000 105 SER A CB    
759  O OG    . SER A 108 ? 1.0904 1.3065 1.1220 0.0000 0.0000 0.0000 105 SER A OG    
760  N N     . ASN A 109 ? 1.0816 1.2211 1.1151 0.0000 0.0000 0.0000 106 ASN A N     
761  C CA    . ASN A 109 ? 1.0911 1.2158 1.1284 0.0000 0.0000 0.0000 106 ASN A CA    
762  C C     . ASN A 109 ? 1.0868 1.2490 1.1345 0.0000 0.0000 0.0000 106 ASN A C     
763  O O     . ASN A 109 ? 1.1012 1.2533 1.1536 0.0000 0.0000 0.0000 106 ASN A O     
764  C CB    . ASN A 109 ? 1.1025 1.1971 1.1366 0.0000 0.0000 0.0000 106 ASN A CB    
765  C CG    . ASN A 109 ? 1.1160 1.2356 1.1565 0.0000 0.0000 0.0000 106 ASN A CG    
766  O OD1   . ASN A 109 ? 1.1276 1.2824 1.1708 0.0000 0.0000 0.0000 106 ASN A OD1   
767  N ND2   . ASN A 109 ? 1.1449 1.2479 1.1866 0.0000 0.0000 0.0000 106 ASN A ND2   
768  N N     . LYS A 110 ? 1.0708 1.2771 1.1207 0.0000 0.0000 0.0000 107 LYS A N     
769  C CA    . LYS A 110 ? 1.0638 1.3229 1.1232 0.0000 0.0000 0.0000 107 LYS A CA    
770  C C     . LYS A 110 ? 1.0538 1.3338 1.1119 0.0000 0.0000 0.0000 107 LYS A C     
771  O O     . LYS A 110 ? 1.0474 1.3352 1.0971 0.0000 0.0000 0.0000 107 LYS A O     
772  C CB    . LYS A 110 ? 1.0579 1.3685 1.1193 0.0000 0.0000 0.0000 107 LYS A CB    
773  C CG    . LYS A 110 ? 1.0681 1.3905 1.1388 0.0000 0.0000 0.0000 107 LYS A CG    
774  C CD    . LYS A 110 ? 1.0856 1.3772 1.1495 0.0000 0.0000 0.0000 107 LYS A CD    
775  C CE    . LYS A 110 ? 1.1145 1.4079 1.1878 0.0000 0.0000 0.0000 107 LYS A CE    
776  N NZ    . LYS A 110 ? 1.1297 1.3751 1.1954 0.0000 0.0000 0.0000 107 LYS A NZ    
777  N N     . ALA A 111 ? 1.0560 1.3423 1.1215 0.0000 0.0000 0.0000 108 ALA A N     
778  C CA    . ALA A 111 ? 1.0507 1.3585 1.1156 0.0000 0.0000 0.0000 108 ALA A CA    
779  C C     . ALA A 111 ? 1.0415 1.4225 1.1087 0.0000 0.0000 0.0000 108 ALA A C     
780  O O     . ALA A 111 ? 1.0403 1.4596 1.1143 0.0000 0.0000 0.0000 108 ALA A O     
781  C CB    . ALA A 111 ? 1.0698 1.3579 1.1412 0.0000 0.0000 0.0000 108 ALA A CB    
782  N N     . SER A 112 ? 1.0382 1.4436 1.0987 0.0000 0.0000 0.0000 109 SER A N     
783  C CA    . SER A 112 ? 1.0370 1.5180 1.0956 0.0000 0.0000 0.0000 109 SER A CA    
784  C C     . SER A 112 ? 1.0451 1.5743 1.1179 0.0000 0.0000 0.0000 109 SER A C     
785  O O     . SER A 112 ? 1.0561 1.5480 1.1376 0.0000 0.0000 0.0000 109 SER A O     
786  C CB    . SER A 112 ? 1.0341 1.5223 1.0781 0.0000 0.0000 0.0000 109 SER A CB    
787  O OG    . SER A 112 ? 1.0344 1.4936 1.0807 0.0000 0.0000 0.0000 109 SER A OG    
788  N N     . GLY A 113 ? 1.0461 1.6589 1.1201 0.0000 0.0000 0.0000 110 GLY A N     
789  C CA    . GLY A 113 ? 1.0526 1.7240 1.1425 0.0000 0.0000 0.0000 110 GLY A CA    
790  C C     . GLY A 113 ? 1.0602 1.7239 1.1522 0.0000 0.0000 0.0000 110 GLY A C     
791  O O     . GLY A 113 ? 1.0565 1.6808 1.1372 0.0000 0.0000 0.0000 110 GLY A O     
792  N N     . PRO A 114 ? 1.0751 1.7790 1.1821 0.0000 0.0000 0.0000 111 PRO A N     
793  C CA    . PRO A 114 ? 1.0915 1.7946 1.2016 0.0000 0.0000 0.0000 111 PRO A CA    
794  C C     . PRO A 114 ? 1.0855 1.8425 1.1823 0.0000 0.0000 0.0000 111 PRO A C     
795  O O     . PRO A 114 ? 1.0834 1.9144 1.1734 0.0000 0.0000 0.0000 111 PRO A O     
796  C CB    . PRO A 114 ? 1.1032 1.8690 1.2318 0.0000 0.0000 0.0000 111 PRO A CB    
797  C CG    . PRO A 114 ? 1.1039 1.8794 1.2407 0.0000 0.0000 0.0000 111 PRO A CG    
798  C CD    . PRO A 114 ? 1.0810 1.8459 1.2036 0.0000 0.0000 0.0000 111 PRO A CD    
799  N N     . ILE A 115 ? 1.1621 1.2269 1.3065 0.0000 0.0000 0.0000 112 ILE A N     
800  C CA    . ILE A 115 ? 1.1448 1.2243 1.2905 0.0000 0.0000 0.0000 112 ILE A CA    
801  C C     . ILE A 115 ? 1.1234 1.2478 1.3173 0.0000 0.0000 0.0000 112 ILE A C     
802  O O     . ILE A 115 ? 1.1194 1.2639 1.3452 0.0000 0.0000 0.0000 112 ILE A O     
803  C CB    . ILE A 115 ? 1.1415 1.1991 1.2439 0.0000 0.0000 0.0000 112 ILE A CB    
804  C CG1   . ILE A 115 ? 1.1309 1.1953 1.2360 0.0000 0.0000 0.0000 112 ILE A CG1   
805  C CG2   . ILE A 115 ? 1.1732 1.1869 1.2271 0.0000 0.0000 0.0000 112 ILE A CG2   
806  C CD1   . ILE A 115 ? 1.1090 1.1636 1.1847 0.0000 0.0000 0.0000 112 ILE A CD1   
807  N N     . LEU A 116 ? 1.1165 1.2551 1.3145 0.0000 0.0000 0.0000 113 LEU A N     
808  C CA    . LEU A 116 ? 1.1025 1.2809 1.3389 0.0000 0.0000 0.0000 113 LEU A CA    
809  C C     . LEU A 116 ? 1.0928 1.2710 1.3072 0.0000 0.0000 0.0000 113 LEU A C     
810  O O     . LEU A 116 ? 1.0994 1.2520 1.2745 0.0000 0.0000 0.0000 113 LEU A O     
811  C CB    . LEU A 116 ? 1.1013 1.2947 1.3563 0.0000 0.0000 0.0000 113 LEU A CB    
812  C CG    . LEU A 116 ? 1.1091 1.3150 1.3996 0.0000 0.0000 0.0000 113 LEU A CG    
813  C CD1   . LEU A 116 ? 1.1059 1.3135 1.3956 0.0000 0.0000 0.0000 113 LEU A CD1   
814  C CD2   . LEU A 116 ? 1.0940 1.3397 1.4400 0.0000 0.0000 0.0000 113 LEU A CD2   
815  N N     . ARG A 117 ? 1.0821 1.2893 1.3226 0.0000 0.0000 0.0000 114 ARG A N     
816  C CA    . ARG A 117 ? 1.0779 1.2858 1.2980 0.0000 0.0000 0.0000 114 ARG A CA    
817  C C     . ARG A 117 ? 1.0746 1.3111 1.3140 0.0000 0.0000 0.0000 114 ARG A C     
818  O O     . ARG A 117 ? 1.0674 1.3302 1.3327 0.0000 0.0000 0.0000 114 ARG A O     
819  C CB    . ARG A 117 ? 1.0721 1.2814 1.2939 0.0000 0.0000 0.0000 114 ARG A CB    
820  C CG    . ARG A 117 ? 1.0794 1.2587 1.2806 0.0000 0.0000 0.0000 114 ARG A CG    
821  C CD    . ARG A 117 ? 1.0781 1.2210 1.2327 0.0000 0.0000 0.0000 114 ARG A CD    
822  N NE    . ARG A 117 ? 1.0750 1.2139 1.2049 0.0000 0.0000 0.0000 114 ARG A NE    
823  C CZ    . ARG A 117 ? 1.0799 1.2103 1.1916 0.0000 0.0000 0.0000 114 ARG A CZ    
824  N NH1   . ARG A 117 ? 1.0967 1.2197 1.2101 0.0000 0.0000 0.0000 114 ARG A NH1   
825  N NH2   . ARG A 117 ? 1.0613 1.1903 1.1540 0.0000 0.0000 0.0000 114 ARG A NH2   
826  N N     . PRO A 118 ? 1.0861 1.3154 1.3106 0.0000 0.0000 0.0000 115 PRO A N     
827  C CA    . PRO A 118 ? 1.0909 1.3432 1.3295 0.0000 0.0000 0.0000 115 PRO A CA    
828  C C     . PRO A 118 ? 1.0915 1.3585 1.3266 0.0000 0.0000 0.0000 115 PRO A C     
829  O O     . PRO A 118 ? 1.0913 1.3442 1.3044 0.0000 0.0000 0.0000 115 PRO A O     
830  C CB    . PRO A 118 ? 1.0995 1.3281 1.3054 0.0000 0.0000 0.0000 115 PRO A CB    
831  C CG    . PRO A 118 ? 1.1023 1.3011 1.2887 0.0000 0.0000 0.0000 115 PRO A CG    
832  C CD    . PRO A 118 ? 1.0963 1.2918 1.2839 0.0000 0.0000 0.0000 115 PRO A CD    
833  N N     . ASP A 119 ? 1.1045 1.3982 1.3597 0.0000 0.0000 0.0000 116 ASP A N     
834  C CA    . ASP A 119 ? 1.1149 1.4244 1.3694 0.0000 0.0000 0.0000 116 ASP A CA    
835  C C     . ASP A 119 ? 1.1264 1.4190 1.3393 0.0000 0.0000 0.0000 116 ASP A C     
836  O O     . ASP A 119 ? 1.1339 1.4110 1.3268 0.0000 0.0000 0.0000 116 ASP A O     
837  C CB    . ASP A 119 ? 1.1182 1.4617 1.4072 0.0000 0.0000 0.0000 116 ASP A CB    
838  C CG    . ASP A 119 ? 1.1364 1.4976 1.4694 0.0000 0.0000 0.0000 116 ASP A CG    
839  O OD1   . ASP A 119 ? 1.1600 1.5514 1.5322 0.0000 0.0000 0.0000 116 ASP A OD1   
840  O OD2   . ASP A 119 ? 1.1525 1.4982 1.4823 0.0000 0.0000 0.0000 116 ASP A OD2   
841  N N     . ARG A 120 ? 1.1366 1.4317 1.3373 0.0000 0.0000 0.0000 117 ARG A N     
842  C CA    . ARG A 120 ? 1.1573 1.4398 1.3216 0.0000 0.0000 0.0000 117 ARG A CA    
843  C C     . ARG A 120 ? 1.1694 1.4624 1.3312 0.0000 0.0000 0.0000 117 ARG A C     
844  O O     . ARG A 120 ? 1.1746 1.4921 1.3622 0.0000 0.0000 0.0000 117 ARG A O     
845  C CB    . ARG A 120 ? 1.1598 1.4480 1.3167 0.0000 0.0000 0.0000 117 ARG A CB    
846  C CG    . ARG A 120 ? 1.1961 1.4659 1.3411 0.0000 0.0000 0.0000 117 ARG A CG    
847  C CD    . ARG A 120 ? 1.2478 1.5248 1.3937 0.0000 0.0000 0.0000 117 ARG A CD    
848  N NE    . ARG A 120 ? 1.2978 1.5576 1.4411 0.0000 0.0000 0.0000 117 ARG A NE    
849  C CZ    . ARG A 120 ? 1.3281 1.5643 1.4447 0.0000 0.0000 0.0000 117 ARG A CZ    
850  N NH1   . ARG A 120 ? 1.3231 1.5518 1.4160 0.0000 0.0000 0.0000 117 ARG A NH1   
851  N NH2   . ARG A 120 ? 1.3488 1.5684 1.4625 0.0000 0.0000 0.0000 117 ARG A NH2   
852  N N     . PRO A 121 ? 1.1828 1.4567 1.3137 0.0000 0.0000 0.0000 118 PRO A N     
853  C CA    . PRO A 121 ? 1.2065 1.4855 1.3252 0.0000 0.0000 0.0000 118 PRO A CA    
854  C C     . PRO A 121 ? 1.2165 1.5148 1.3362 0.0000 0.0000 0.0000 118 PRO A C     
855  O O     . PRO A 121 ? 1.2086 1.5084 1.3271 0.0000 0.0000 0.0000 118 PRO A O     
856  C CB    . PRO A 121 ? 1.2145 1.4667 1.2952 0.0000 0.0000 0.0000 118 PRO A CB    
857  C CG    . PRO A 121 ? 1.2002 1.4348 1.2832 0.0000 0.0000 0.0000 118 PRO A CG    
858  C CD    . PRO A 121 ? 1.1816 1.4276 1.2883 0.0000 0.0000 0.0000 118 PRO A CD    
859  N N     . GLN A 122 ? 1.2428 1.5544 1.3639 0.0000 0.0000 0.0000 119 GLN A N     
860  C CA    . GLN A 122 ? 1.2553 1.5873 1.3813 0.0000 0.0000 0.0000 119 GLN A CA    
861  C C     . GLN A 122 ? 1.2592 1.5789 1.3448 0.0000 0.0000 0.0000 119 GLN A C     
862  O O     . GLN A 122 ? 1.2542 1.5810 1.3372 0.0000 0.0000 0.0000 119 GLN A O     
863  C CB    . GLN A 122 ? 1.2783 1.6307 1.4230 0.0000 0.0000 0.0000 119 GLN A CB    
864  C CG    . GLN A 122 ? 1.3046 1.6774 1.4984 0.0000 0.0000 0.0000 119 GLN A CG    
865  C CD    . GLN A 122 ? 1.3566 1.7615 1.5805 0.0000 0.0000 0.0000 119 GLN A CD    
866  O OE1   . GLN A 122 ? 1.3990 1.8086 1.6052 0.0000 0.0000 0.0000 119 GLN A OE1   
867  N NE2   . GLN A 122 ? 1.3585 1.7850 1.6270 0.0000 0.0000 0.0000 119 GLN A NE2   
868  N N     . LYS A 123 ? 1.2691 1.5693 1.3235 0.0000 0.0000 0.0000 120 LYS A N     
869  C CA    . LYS A 123 ? 1.2781 1.5650 1.2923 0.0000 0.0000 0.0000 120 LYS A CA    
870  C C     . LYS A 123 ? 1.2614 1.5232 1.2542 0.0000 0.0000 0.0000 120 LYS A C     
871  O O     . LYS A 123 ? 1.2566 1.5075 1.2575 0.0000 0.0000 0.0000 120 LYS A O     
872  C CB    . LYS A 123 ? 1.3160 1.6017 1.3085 0.0000 0.0000 0.0000 120 LYS A CB    
873  C CG    . LYS A 123 ? 1.3399 1.6518 1.3521 0.0000 0.0000 0.0000 120 LYS A CG    
874  C CD    . LYS A 123 ? 1.3623 1.6885 1.3769 0.0000 0.0000 0.0000 120 LYS A CD    
875  C CE    . LYS A 123 ? 1.3842 1.7361 1.4169 0.0000 0.0000 0.0000 120 LYS A CE    
876  N NZ    . LYS A 123 ? 1.4283 1.7742 1.4223 0.0000 0.0000 0.0000 120 LYS A NZ    
877  N N     . PRO A 124 ? 1.2524 1.5054 1.2195 0.0000 0.0000 0.0000 121 PRO A N     
878  C CA    . PRO A 124 ? 1.2437 1.4748 1.1909 0.0000 0.0000 0.0000 121 PRO A CA    
879  C C     . PRO A 124 ? 1.2612 1.4767 1.1890 0.0000 0.0000 0.0000 121 PRO A C     
880  O O     . PRO A 124 ? 1.2828 1.5019 1.1986 0.0000 0.0000 0.0000 121 PRO A O     
881  C CB    . PRO A 124 ? 1.2491 1.4782 1.1725 0.0000 0.0000 0.0000 121 PRO A CB    
882  C CG    . PRO A 124 ? 1.2488 1.4975 1.1860 0.0000 0.0000 0.0000 121 PRO A CG    
883  C CD    . PRO A 124 ? 1.2545 1.5179 1.2127 0.0000 0.0000 0.0000 121 PRO A CD    
884  N N     . PHE A 125 ? 1.2510 1.4476 1.1744 0.0000 0.0000 0.0000 122 PHE A N     
885  C CA    . PHE A 125 ? 1.2646 1.4416 1.1703 0.0000 0.0000 0.0000 122 PHE A CA    
886  C C     . PHE A 125 ? 1.2674 1.4493 1.1926 0.0000 0.0000 0.0000 122 PHE A C     
887  O O     . PHE A 125 ? 1.2930 1.4584 1.2039 0.0000 0.0000 0.0000 122 PHE A O     
888  C CB    . PHE A 125 ? 1.2934 1.4606 1.1626 0.0000 0.0000 0.0000 122 PHE A CB    
889  C CG    . PHE A 125 ? 1.2844 1.4490 1.1356 0.0000 0.0000 0.0000 122 PHE A CG    
890  C CD1   . PHE A 125 ? 1.2784 1.4579 1.1230 0.0000 0.0000 0.0000 122 PHE A CD1   
891  C CD2   . PHE A 125 ? 1.2762 1.4237 1.1179 0.0000 0.0000 0.0000 122 PHE A CD2   
892  C CE1   . PHE A 125 ? 1.2684 1.4457 1.0976 0.0000 0.0000 0.0000 122 PHE A CE1   
893  C CE2   . PHE A 125 ? 1.2585 1.4064 1.0880 0.0000 0.0000 0.0000 122 PHE A CE2   
894  C CZ    . PHE A 125 ? 1.2545 1.4171 1.0776 0.0000 0.0000 0.0000 122 PHE A CZ    
895  N N     . ASP A 126 ? 1.2402 1.4442 1.1987 0.0000 0.0000 0.0000 123 ASP A N     
896  C CA    . ASP A 126 ? 1.2353 1.4460 1.2195 0.0000 0.0000 0.0000 123 ASP A CA    
897  C C     . ASP A 126 ? 1.2226 1.4129 1.2098 0.0000 0.0000 0.0000 123 ASP A C     
898  O O     . ASP A 126 ? 1.2384 1.4192 1.2289 0.0000 0.0000 0.0000 123 ASP A O     
899  C CB    . ASP A 126 ? 1.2197 1.4591 1.2425 0.0000 0.0000 0.0000 123 ASP A CB    
900  C CG    . ASP A 126 ? 1.2475 1.5097 1.2772 0.0000 0.0000 0.0000 123 ASP A CG    
901  O OD1   . ASP A 126 ? 1.2925 1.5471 1.2925 0.0000 0.0000 0.0000 123 ASP A OD1   
902  O OD2   . ASP A 126 ? 1.2463 1.5334 1.3109 0.0000 0.0000 0.0000 123 ASP A OD2   
903  N N     . LYS A 127 ? 1.1953 1.3778 1.1808 0.0000 0.0000 0.0000 124 LYS A N     
904  C CA    . LYS A 127 ? 1.1815 1.3444 1.1687 0.0000 0.0000 0.0000 124 LYS A CA    
905  C C     . LYS A 127 ? 1.1700 1.3197 1.1417 0.0000 0.0000 0.0000 124 LYS A C     
906  O O     . LYS A 127 ? 1.1548 1.3162 1.1327 0.0000 0.0000 0.0000 124 LYS A O     
907  C CB    . LYS A 127 ? 1.1625 1.3371 1.1827 0.0000 0.0000 0.0000 124 LYS A CB    
908  C CG    . LYS A 127 ? 1.1535 1.3068 1.1731 0.0000 0.0000 0.0000 124 LYS A CG    
909  C CD    . LYS A 127 ? 1.1334 1.2980 1.1839 0.0000 0.0000 0.0000 124 LYS A CD    
910  C CE    . LYS A 127 ? 1.1494 1.3149 1.2149 0.0000 0.0000 0.0000 124 LYS A CE    
911  N NZ    . LYS A 127 ? 1.1475 1.3208 1.2427 0.0000 0.0000 0.0000 124 LYS A NZ    
912  N N     . PHE A 128 ? 1.1774 1.3025 1.1300 0.0000 0.0000 0.0000 125 PHE A N     
913  C CA    . PHE A 128 ? 1.1641 1.2756 1.1057 0.0000 0.0000 0.0000 125 PHE A CA    
914  C C     . PHE A 128 ? 1.1586 1.2562 1.1093 0.0000 0.0000 0.0000 125 PHE A C     
915  O O     . PHE A 128 ? 1.1699 1.2580 1.1251 0.0000 0.0000 0.0000 125 PHE A O     
916  C CB    . PHE A 128 ? 1.1829 1.2751 1.0984 0.0000 0.0000 0.0000 125 PHE A CB    
917  C CG    . PHE A 128 ? 1.1818 1.2832 1.0826 0.0000 0.0000 0.0000 125 PHE A CG    
918  C CD1   . PHE A 128 ? 1.1732 1.2982 1.0828 0.0000 0.0000 0.0000 125 PHE A CD1   
919  C CD2   . PHE A 128 ? 1.1981 1.2832 1.0754 0.0000 0.0000 0.0000 125 PHE A CD2   
920  C CE1   . PHE A 128 ? 1.1883 1.3199 1.0816 0.0000 0.0000 0.0000 125 PHE A CE1   
921  C CE2   . PHE A 128 ? 1.2115 1.3037 1.0731 0.0000 0.0000 0.0000 125 PHE A CE2   
922  C CZ    . PHE A 128 ? 1.2094 1.3246 1.0778 0.0000 0.0000 0.0000 125 PHE A CZ    
923  N N     . PHE A 129 ? 1.1387 1.2340 1.0907 0.0000 0.0000 0.0000 126 PHE A N     
924  C CA    . PHE A 129 ? 1.1307 1.2078 1.0829 0.0000 0.0000 0.0000 126 PHE A CA    
925  C C     . PHE A 129 ? 1.1324 1.1922 1.0667 0.0000 0.0000 0.0000 126 PHE A C     
926  O O     . PHE A 129 ? 1.1197 1.1879 1.0503 0.0000 0.0000 0.0000 126 PHE A O     
927  C CB    . PHE A 129 ? 1.1112 1.1979 1.0772 0.0000 0.0000 0.0000 126 PHE A CB    
928  C CG    . PHE A 129 ? 1.1156 1.2181 1.1039 0.0000 0.0000 0.0000 126 PHE A CG    
929  C CD1   . PHE A 129 ? 1.1300 1.2229 1.1272 0.0000 0.0000 0.0000 126 PHE A CD1   
930  C CD2   . PHE A 129 ? 1.1134 1.2409 1.1152 0.0000 0.0000 0.0000 126 PHE A CD2   
931  C CE1   . PHE A 129 ? 1.1133 1.2235 1.1359 0.0000 0.0000 0.0000 126 PHE A CE1   
932  C CE2   . PHE A 129 ? 1.1053 1.2498 1.1323 0.0000 0.0000 0.0000 126 PHE A CE2   
933  C CZ    . PHE A 129 ? 1.1031 1.2400 1.1421 0.0000 0.0000 0.0000 126 PHE A CZ    
934  N N     . ILE A 130 ? 1.1482 1.1842 1.0731 0.0000 0.0000 0.0000 127 ILE A N     
935  C CA    . ILE A 130 ? 1.1600 1.1800 1.0713 0.0000 0.0000 0.0000 127 ILE A CA    
936  C C     . ILE A 130 ? 1.1744 1.1742 1.0818 0.0000 0.0000 0.0000 127 ILE A C     
937  O O     . ILE A 130 ? 1.1857 1.1770 1.0965 0.0000 0.0000 0.0000 127 ILE A O     
938  C CB    . ILE A 130 ? 1.1770 1.1832 1.0746 0.0000 0.0000 0.0000 127 ILE A CB    
939  C CG1   . ILE A 130 ? 1.1978 1.1855 1.0926 0.0000 0.0000 0.0000 127 ILE A CG1   
940  C CG2   . ILE A 130 ? 1.1757 1.1991 1.0706 0.0000 0.0000 0.0000 127 ILE A CG2   
941  C CD1   . ILE A 130 ? 1.2270 1.1909 1.1048 0.0000 0.0000 0.0000 127 ILE A CD1   
942  N N     . ASP A 131 ? 1.1814 1.1741 1.0819 0.0000 0.0000 0.0000 128 ASP A N     
943  C CA    . ASP A 131 ? 1.1973 1.1688 1.0901 0.0000 0.0000 0.0000 128 ASP A CA    
944  C C     . ASP A 131 ? 1.2033 1.1697 1.0910 0.0000 0.0000 0.0000 128 ASP A C     
945  O O     . ASP A 131 ? 1.1936 1.1771 1.0868 0.0000 0.0000 0.0000 128 ASP A O     
946  C CB    . ASP A 131 ? 1.1877 1.1639 1.0844 0.0000 0.0000 0.0000 128 ASP A CB    
947  C CG    . ASP A 131 ? 1.2118 1.1620 1.0961 0.0000 0.0000 0.0000 128 ASP A CG    
948  O OD1   . ASP A 131 ? 1.2425 1.1762 1.1225 0.0000 0.0000 0.0000 128 ASP A OD1   
949  O OD2   . ASP A 131 ? 1.2079 1.1533 1.0857 0.0000 0.0000 0.0000 128 ASP A OD2   
950  N N     . TYR A 132 ? 1.2239 1.1672 1.1021 0.0000 0.0000 0.0000 129 TYR A N     
951  C CA    . TYR A 132 ? 1.2352 1.1753 1.1124 0.0000 0.0000 0.0000 129 TYR A CA    
952  C C     . TYR A 132 ? 1.2370 1.1754 1.1119 0.0000 0.0000 0.0000 129 TYR A C     
953  O O     . TYR A 132 ? 1.2503 1.1733 1.1153 0.0000 0.0000 0.0000 129 TYR A O     
954  C CB    . TYR A 132 ? 1.2627 1.1770 1.1306 0.0000 0.0000 0.0000 129 TYR A CB    
955  C CG    . TYR A 132 ? 1.2848 1.2009 1.1544 0.0000 0.0000 0.0000 129 TYR A CG    
956  C CD1   . TYR A 132 ? 1.3130 1.2166 1.1755 0.0000 0.0000 0.0000 129 TYR A CD1   
957  C CD2   . TYR A 132 ? 1.2981 1.2280 1.1763 0.0000 0.0000 0.0000 129 TYR A CD2   
958  C CE1   . TYR A 132 ? 1.3369 1.2385 1.1963 0.0000 0.0000 0.0000 129 TYR A CE1   
959  C CE2   . TYR A 132 ? 1.3192 1.2487 1.1962 0.0000 0.0000 0.0000 129 TYR A CE2   
960  C CZ    . TYR A 132 ? 1.3435 1.2572 1.2089 0.0000 0.0000 0.0000 129 TYR A CZ    
961  O OH    . TYR A 132 ? 1.3847 1.2943 1.2444 0.0000 0.0000 0.0000 129 TYR A OH    
962  N N     . ILE A 133 ? 1.2312 1.1846 1.1145 0.0000 0.0000 0.0000 130 ILE A N     
963  C CA    . ILE A 133 ? 1.2372 1.1871 1.1174 0.0000 0.0000 0.0000 130 ILE A CA    
964  C C     . ILE A 133 ? 1.2653 1.2023 1.1441 0.0000 0.0000 0.0000 130 ILE A C     
965  O O     . ILE A 133 ? 1.2685 1.2104 1.1562 0.0000 0.0000 0.0000 130 ILE A O     
966  C CB    . ILE A 133 ? 1.2115 1.1873 1.1047 0.0000 0.0000 0.0000 130 ILE A CB    
967  C CG1   . ILE A 133 ? 1.1979 1.1800 1.0894 0.0000 0.0000 0.0000 130 ILE A CG1   
968  C CG2   . ILE A 133 ? 1.2137 1.1890 1.1084 0.0000 0.0000 0.0000 130 ILE A CG2   
969  C CD1   . ILE A 133 ? 1.1746 1.1801 1.0781 0.0000 0.0000 0.0000 130 ILE A CD1   
970  N N     . GLY A 134 ? 1.2905 1.2096 1.1571 0.0000 0.0000 0.0000 131 GLY A N     
971  C CA    . GLY A 134 ? 1.3206 1.2289 1.1874 0.0000 0.0000 0.0000 131 GLY A CA    
972  C C     . GLY A 134 ? 1.3619 1.2363 1.2068 0.0000 0.0000 0.0000 131 GLY A C     
973  O O     . GLY A 134 ? 1.3690 1.2273 1.1979 0.0000 0.0000 0.0000 131 GLY A O     
974  N N     . PRO A 135 ? 1.3896 1.2531 1.2345 0.0000 0.0000 0.0000 132 PRO A N     
975  C CA    . PRO A 135 ? 1.3896 1.2732 1.2580 0.0000 0.0000 0.0000 132 PRO A CA    
976  C C     . PRO A 135 ? 1.3825 1.2869 1.2607 0.0000 0.0000 0.0000 132 PRO A C     
977  O O     . PRO A 135 ? 1.3885 1.2813 1.2486 0.0000 0.0000 0.0000 132 PRO A O     
978  C CB    . PRO A 135 ? 1.4169 1.2769 1.2787 0.0000 0.0000 0.0000 132 PRO A CB    
979  C CG    . PRO A 135 ? 1.4395 1.2654 1.2725 0.0000 0.0000 0.0000 132 PRO A CG    
980  C CD    . PRO A 135 ? 1.4220 1.2511 1.2434 0.0000 0.0000 0.0000 132 PRO A CD    
981  N N     . LEU A 136 ? 1.3772 1.3104 1.2828 0.0000 0.0000 0.0000 133 LEU A N     
982  C CA    . LEU A 136 ? 1.3758 1.3308 1.2958 0.0000 0.0000 0.0000 133 LEU A CA    
983  C C     . LEU A 136 ? 1.4021 1.3648 1.3418 0.0000 0.0000 0.0000 133 LEU A C     
984  O O     . LEU A 136 ? 1.4250 1.3741 1.3655 0.0000 0.0000 0.0000 133 LEU A O     
985  C CB    . LEU A 136 ? 1.3417 1.3268 1.2805 0.0000 0.0000 0.0000 133 LEU A CB    
986  C CG    . LEU A 136 ? 1.3178 1.3029 1.2448 0.0000 0.0000 0.0000 133 LEU A CG    
987  C CD1   . LEU A 136 ? 1.2716 1.2858 1.2159 0.0000 0.0000 0.0000 133 LEU A CD1   
988  C CD2   . LEU A 136 ? 1.3227 1.2865 1.2244 0.0000 0.0000 0.0000 133 LEU A CD2   
989  N N     . PRO A 137 ? 1.4052 1.3890 1.3618 0.0000 0.0000 0.0000 134 PRO A N     
990  C CA    . PRO A 137 ? 1.4184 1.4191 1.4046 0.0000 0.0000 0.0000 134 PRO A CA    
991  C C     . PRO A 137 ? 1.4176 1.4381 1.4303 0.0000 0.0000 0.0000 134 PRO A C     
992  O O     . PRO A 137 ? 1.4025 1.4359 1.4174 0.0000 0.0000 0.0000 134 PRO A O     
993  C CB    . PRO A 137 ? 1.4053 1.4286 1.4068 0.0000 0.0000 0.0000 134 PRO A CB    
994  C CG    . PRO A 137 ? 1.4071 1.4098 1.3752 0.0000 0.0000 0.0000 134 PRO A CG    
995  C CD    . PRO A 137 ? 1.4004 1.3863 1.3464 0.0000 0.0000 0.0000 134 PRO A CD    
996  N N     . PRO A 138 ? 1.4396 1.4606 1.4703 0.0000 0.0000 0.0000 135 PRO A N     
997  C CA    . PRO A 138 ? 1.4416 1.4789 1.4956 0.0000 0.0000 0.0000 135 PRO A CA    
998  C C     . PRO A 138 ? 1.4260 1.5016 1.5121 0.0000 0.0000 0.0000 135 PRO A C     
999  O O     . PRO A 138 ? 1.4258 1.5210 1.5373 0.0000 0.0000 0.0000 135 PRO A O     
1000 C CB    . PRO A 138 ? 1.4658 1.4949 1.5344 0.0000 0.0000 0.0000 135 PRO A CB    
1001 C CG    . PRO A 138 ? 1.4856 1.4815 1.5235 0.0000 0.0000 0.0000 135 PRO A CG    
1002 C CD    . PRO A 138 ? 1.4685 1.4681 1.4922 0.0000 0.0000 0.0000 135 PRO A CD    
1003 N N     . SER A 139 ? 1.4186 1.5040 1.5026 0.0000 0.0000 0.0000 136 SER A N     
1004 C CA    . SER A 139 ? 1.4127 1.5315 1.5270 0.0000 0.0000 0.0000 136 SER A CA    
1005 C C     . SER A 139 ? 1.4292 1.5474 1.5484 0.0000 0.0000 0.0000 136 SER A C     
1006 O O     . SER A 139 ? 1.4406 1.5370 1.5322 0.0000 0.0000 0.0000 136 SER A O     
1007 C CB    . SER A 139 ? 1.3898 1.5215 1.4965 0.0000 0.0000 0.0000 136 SER A CB    
1008 O OG    . SER A 139 ? 1.3813 1.5462 1.5200 0.0000 0.0000 0.0000 136 SER A OG    
1009 N N     . GLN A 140 ? 1.4372 1.5783 1.5916 0.0000 0.0000 0.0000 137 GLN A N     
1010 C CA    . GLN A 140 ? 1.4544 1.5968 1.6160 0.0000 0.0000 0.0000 137 GLN A CA    
1011 C C     . GLN A 140 ? 1.4749 1.5807 1.6102 0.0000 0.0000 0.0000 137 GLN A C     
1012 O O     . GLN A 140 ? 1.4888 1.5853 1.6147 0.0000 0.0000 0.0000 137 GLN A O     
1013 C CB    . GLN A 140 ? 1.4478 1.6035 1.6015 0.0000 0.0000 0.0000 137 GLN A CB    
1014 C CG    . GLN A 140 ? 1.4482 1.6355 1.6216 0.0000 0.0000 0.0000 137 GLN A CG    
1015 C CD    . GLN A 140 ? 1.4790 1.6988 1.6966 0.0000 0.0000 0.0000 137 GLN A CD    
1016 O OE1   . GLN A 140 ? 1.5095 1.7304 1.7400 0.0000 0.0000 0.0000 137 GLN A OE1   
1017 N NE2   . GLN A 140 ? 1.4766 1.7229 1.7186 0.0000 0.0000 0.0000 137 GLN A NE2   
1018 N N     . GLY A 141 ? 1.4796 1.5626 1.6009 0.0000 0.0000 0.0000 138 GLY A N     
1019 C CA    . GLY A 141 ? 1.4981 1.5444 1.5950 0.0000 0.0000 0.0000 138 GLY A CA    
1020 C C     . GLY A 141 ? 1.4916 1.5134 1.5490 0.0000 0.0000 0.0000 138 GLY A C     
1021 O O     . GLY A 141 ? 1.5161 1.5065 1.5517 0.0000 0.0000 0.0000 138 GLY A O     
1022 N N     . TYR A 142 ? 1.4598 1.4958 1.5097 0.0000 0.0000 0.0000 139 TYR A N     
1023 C CA    . TYR A 142 ? 1.4471 1.4654 1.4650 0.0000 0.0000 0.0000 139 TYR A CA    
1024 C C     . TYR A 142 ? 1.4294 1.4360 1.4331 0.0000 0.0000 0.0000 139 TYR A C     
1025 O O     . TYR A 142 ? 1.4208 1.4410 1.4381 0.0000 0.0000 0.0000 139 TYR A O     
1026 C CB    . TYR A 142 ? 1.4325 1.4722 1.4498 0.0000 0.0000 0.0000 139 TYR A CB    
1027 C CG    . TYR A 142 ? 1.4630 1.5058 1.4814 0.0000 0.0000 0.0000 139 TYR A CG    
1028 C CD1   . TYR A 142 ? 1.4904 1.5154 1.4821 0.0000 0.0000 0.0000 139 TYR A CD1   
1029 C CD2   . TYR A 142 ? 1.4828 1.5460 1.5284 0.0000 0.0000 0.0000 139 TYR A CD2   
1030 C CE1   . TYR A 142 ? 1.5189 1.5432 1.5060 0.0000 0.0000 0.0000 139 TYR A CE1   
1031 C CE2   . TYR A 142 ? 1.5104 1.5736 1.5529 0.0000 0.0000 0.0000 139 TYR A CE2   
1032 C CZ    . TYR A 142 ? 1.5283 1.5704 1.5390 0.0000 0.0000 0.0000 139 TYR A CZ    
1033 O OH    . TYR A 142 ? 1.5639 1.6022 1.5660 0.0000 0.0000 0.0000 139 TYR A OH    
1034 N N     . LEU A 143 ? 1.4212 1.4019 1.3970 0.0000 0.0000 0.0000 140 LEU A N     
1035 C CA    . LEU A 143 ? 1.4061 1.3709 1.3650 0.0000 0.0000 0.0000 140 LEU A CA    
1036 C C     . LEU A 143 ? 1.3814 1.3429 1.3210 0.0000 0.0000 0.0000 140 LEU A C     
1037 O O     . LEU A 143 ? 1.3756 1.3341 1.3061 0.0000 0.0000 0.0000 140 LEU A O     
1038 C CB    . LEU A 143 ? 1.4367 1.3683 1.3809 0.0000 0.0000 0.0000 140 LEU A CB    
1039 C CG    . LEU A 143 ? 1.4491 1.3776 1.4093 0.0000 0.0000 0.0000 140 LEU A CG    
1040 C CD1   . LEU A 143 ? 1.4812 1.3736 1.4242 0.0000 0.0000 0.0000 140 LEU A CD1   
1041 C CD2   . LEU A 143 ? 1.4448 1.3797 1.4090 0.0000 0.0000 0.0000 140 LEU A CD2   
1042 N N     . TYR A 144 ? 1.3614 1.3221 1.2943 0.0000 0.0000 0.0000 141 TYR A N     
1043 C CA    . TYR A 144 ? 1.3364 1.2955 1.2549 0.0000 0.0000 0.0000 141 TYR A CA    
1044 C C     . TYR A 144 ? 1.3054 1.2899 1.2320 0.0000 0.0000 0.0000 141 TYR A C     
1045 O O     . TYR A 144 ? 1.3029 1.3003 1.2404 0.0000 0.0000 0.0000 141 TYR A O     
1046 C CB    . TYR A 144 ? 1.3562 1.2876 1.2557 0.0000 0.0000 0.0000 141 TYR A CB    
1047 C CG    . TYR A 144 ? 1.3775 1.2798 1.2642 0.0000 0.0000 0.0000 141 TYR A CG    
1048 C CD1   . TYR A 144 ? 1.3793 1.2659 1.2494 0.0000 0.0000 0.0000 141 TYR A CD1   
1049 C CD2   . TYR A 144 ? 1.4063 1.2954 1.2968 0.0000 0.0000 0.0000 141 TYR A CD2   
1050 C CE1   . TYR A 144 ? 1.4159 1.2732 1.2704 0.0000 0.0000 0.0000 141 TYR A CE1   
1051 C CE2   . TYR A 144 ? 1.4352 1.2958 1.3120 0.0000 0.0000 0.0000 141 TYR A CE2   
1052 C CZ    . TYR A 144 ? 1.4418 1.2859 1.2991 0.0000 0.0000 0.0000 141 TYR A CZ    
1053 O OH    . TYR A 144 ? 1.4684 1.2821 1.3088 0.0000 0.0000 0.0000 141 TYR A OH    
1054 N N     . VAL A 145 ? 1.2761 1.2667 1.1966 0.0000 0.0000 0.0000 142 VAL A N     
1055 C CA    . VAL A 145 ? 1.2472 1.2585 1.1719 0.0000 0.0000 0.0000 142 VAL A CA    
1056 C C     . VAL A 145 ? 1.2440 1.2453 1.1554 0.0000 0.0000 0.0000 142 VAL A C     
1057 O O     . VAL A 145 ? 1.2497 1.2376 1.1528 0.0000 0.0000 0.0000 142 VAL A O     
1058 C CB    . VAL A 145 ? 1.2255 1.2566 1.1589 0.0000 0.0000 0.0000 142 VAL A CB    
1059 C CG1   . VAL A 145 ? 1.2141 1.2645 1.1500 0.0000 0.0000 0.0000 142 VAL A CG1   
1060 C CG2   . VAL A 145 ? 1.2161 1.2593 1.1655 0.0000 0.0000 0.0000 142 VAL A CG2   
1061 N N     . LEU A 146 ? 1.2311 1.2381 1.1400 0.0000 0.0000 0.0000 143 LEU A N     
1062 C CA    . LEU A 146 ? 1.2192 1.2226 1.1190 0.0000 0.0000 0.0000 143 LEU A CA    
1063 C C     . LEU A 146 ? 1.1940 1.2213 1.1002 0.0000 0.0000 0.0000 143 LEU A C     
1064 O O     . LEU A 146 ? 1.1914 1.2356 1.1019 0.0000 0.0000 0.0000 143 LEU A O     
1065 C CB    . LEU A 146 ? 1.2358 1.2290 1.1256 0.0000 0.0000 0.0000 143 LEU A CB    
1066 C CG    . LEU A 146 ? 1.2320 1.2242 1.1136 0.0000 0.0000 0.0000 143 LEU A CG    
1067 C CD1   . LEU A 146 ? 1.2302 1.2054 1.1092 0.0000 0.0000 0.0000 143 LEU A CD1   
1068 C CD2   . LEU A 146 ? 1.2455 1.2281 1.1141 0.0000 0.0000 0.0000 143 LEU A CD2   
1069 N N     . VAL A 147 ? 1.1769 1.2045 1.0837 0.0000 0.0000 0.0000 144 VAL A N     
1070 C CA    . VAL A 147 ? 1.1484 1.1963 1.0622 0.0000 0.0000 0.0000 144 VAL A CA    
1071 C C     . VAL A 147 ? 1.1476 1.1980 1.0589 0.0000 0.0000 0.0000 144 VAL A C     
1072 O O     . VAL A 147 ? 1.1551 1.1923 1.0642 0.0000 0.0000 0.0000 144 VAL A O     
1073 C CB    . VAL A 147 ? 1.1381 1.1846 1.0560 0.0000 0.0000 0.0000 144 VAL A CB    
1074 C CG1   . VAL A 147 ? 1.1165 1.1822 1.0422 0.0000 0.0000 0.0000 144 VAL A CG1   
1075 C CG2   . VAL A 147 ? 1.1365 1.1785 1.0554 0.0000 0.0000 0.0000 144 VAL A CG2   
1076 N N     . VAL A 148 ? 1.1381 1.2056 1.0501 0.0000 0.0000 0.0000 145 VAL A N     
1077 C CA    . VAL A 148 ? 1.1361 1.2101 1.0470 0.0000 0.0000 0.0000 145 VAL A CA    
1078 C C     . VAL A 148 ? 1.1174 1.2129 1.0389 0.0000 0.0000 0.0000 145 VAL A C     
1079 O O     . VAL A 148 ? 1.1133 1.2211 1.0353 0.0000 0.0000 0.0000 145 VAL A O     
1080 C CB    . VAL A 148 ? 1.1517 1.2246 1.0490 0.0000 0.0000 0.0000 145 VAL A CB    
1081 C CG1   . VAL A 148 ? 1.1605 1.2377 1.0548 0.0000 0.0000 0.0000 145 VAL A CG1   
1082 C CG2   . VAL A 148 ? 1.1635 1.2140 1.0504 0.0000 0.0000 0.0000 145 VAL A CG2   
1083 N N     . VAL A 149 ? 1.1114 1.2114 1.0427 0.0000 0.0000 0.0000 146 VAL A N     
1084 C CA    . VAL A 149 ? 1.1015 1.2210 1.0443 0.0000 0.0000 0.0000 146 VAL A CA    
1085 C C     . VAL A 149 ? 1.1129 1.2452 1.0609 0.0000 0.0000 0.0000 146 VAL A C     
1086 O O     . VAL A 149 ? 1.1235 1.2507 1.0762 0.0000 0.0000 0.0000 146 VAL A O     
1087 C CB    . VAL A 149 ? 1.0885 1.2057 1.0426 0.0000 0.0000 0.0000 146 VAL A CB    
1088 C CG1   . VAL A 149 ? 1.0757 1.2105 1.0405 0.0000 0.0000 0.0000 146 VAL A CG1   
1089 C CG2   . VAL A 149 ? 1.0908 1.1923 1.0379 0.0000 0.0000 0.0000 146 VAL A CG2   
1090 N N     . ASP A 150 ? 1.1166 1.2655 1.0646 0.0000 0.0000 0.0000 147 ASP A N     
1091 C CA    . ASP A 150 ? 1.1298 1.2925 1.0846 0.0000 0.0000 0.0000 147 ASP A CA    
1092 C C     . ASP A 150 ? 1.1188 1.2921 1.0972 0.0000 0.0000 0.0000 147 ASP A C     
1093 O O     . ASP A 150 ? 1.1062 1.2854 1.0918 0.0000 0.0000 0.0000 147 ASP A O     
1094 C CB    . ASP A 150 ? 1.1365 1.3121 1.0811 0.0000 0.0000 0.0000 147 ASP A CB    
1095 C CG    . ASP A 150 ? 1.1520 1.3446 1.1074 0.0000 0.0000 0.0000 147 ASP A CG    
1096 O OD1   . ASP A 150 ? 1.1707 1.3620 1.1258 0.0000 0.0000 0.0000 147 ASP A OD1   
1097 O OD2   . ASP A 150 ? 1.1530 1.3603 1.1186 0.0000 0.0000 0.0000 147 ASP A OD2   
1098 N N     . GLY A 151 ? 1.1275 1.3019 1.1182 0.0000 0.0000 0.0000 148 GLY A N     
1099 C CA    . GLY A 151 ? 1.1177 1.3027 1.1337 0.0000 0.0000 0.0000 148 GLY A CA    
1100 C C     . GLY A 151 ? 1.1106 1.3170 1.1405 0.0000 0.0000 0.0000 148 GLY A C     
1101 O O     . GLY A 151 ? 1.1020 1.3120 1.1467 0.0000 0.0000 0.0000 148 GLY A O     
1102 N N     . MET A 152 ? 1.1204 1.3390 1.1438 0.0000 0.0000 0.0000 149 MET A N     
1103 C CA    . MET A 152 ? 1.1193 1.3577 1.1559 0.0000 0.0000 0.0000 149 MET A CA    
1104 C C     . MET A 152 ? 1.1105 1.3451 1.1392 0.0000 0.0000 0.0000 149 MET A C     
1105 O O     . MET A 152 ? 1.1045 1.3427 1.1493 0.0000 0.0000 0.0000 149 MET A O     
1106 C CB    . MET A 152 ? 1.1358 1.3862 1.1635 0.0000 0.0000 0.0000 149 MET A CB    
1107 C CG    . MET A 152 ? 1.1474 1.4207 1.1940 0.0000 0.0000 0.0000 149 MET A CG    
1108 S SD    . MET A 152 ? 1.1777 1.4539 1.2128 0.0000 0.0000 0.0000 149 MET A SD    
1109 C CE    . MET A 152 ? 1.1532 1.4328 1.2181 0.0000 0.0000 0.0000 149 MET A CE    
1110 N N     . THR A 153 ? 1.1157 1.3420 1.1201 0.0000 0.0000 0.0000 150 THR A N     
1111 C CA    . THR A 153 ? 1.1096 1.3345 1.1061 0.0000 0.0000 0.0000 150 THR A CA    
1112 C C     . THR A 153 ? 1.1054 1.3150 1.1009 0.0000 0.0000 0.0000 150 THR A C     
1113 O O     . THR A 153 ? 1.1008 1.3092 1.0973 0.0000 0.0000 0.0000 150 THR A O     
1114 C CB    . THR A 153 ? 1.1193 1.3419 1.0914 0.0000 0.0000 0.0000 150 THR A CB    
1115 O OG1   . THR A 153 ? 1.1167 1.3254 1.0762 0.0000 0.0000 0.0000 150 THR A OG1   
1116 C CG2   . THR A 153 ? 1.1294 1.3651 1.0960 0.0000 0.0000 0.0000 150 THR A CG2   
1117 N N     . GLY A 154 ? 1.1105 1.3069 1.1027 0.0000 0.0000 0.0000 151 GLY A N     
1118 C CA    . GLY A 154 ? 1.1025 1.2826 1.0889 0.0000 0.0000 0.0000 151 GLY A CA    
1119 C C     . GLY A 154 ? 1.1034 1.2785 1.0734 0.0000 0.0000 0.0000 151 GLY A C     
1120 O O     . GLY A 154 ? 1.1085 1.2727 1.0748 0.0000 0.0000 0.0000 151 GLY A O     
1121 N N     . PHE A 155 ? 1.1047 1.2875 1.0646 0.0000 0.0000 0.0000 152 PHE A N     
1122 C CA    . PHE A 155 ? 1.1016 1.2806 1.0468 0.0000 0.0000 0.0000 152 PHE A CA    
1123 C C     . PHE A 155 ? 1.1020 1.2651 1.0412 0.0000 0.0000 0.0000 152 PHE A C     
1124 O O     . PHE A 155 ? 1.1072 1.2630 1.0457 0.0000 0.0000 0.0000 152 PHE A O     
1125 C CB    . PHE A 155 ? 1.1182 1.3052 1.0497 0.0000 0.0000 0.0000 152 PHE A CB    
1126 C CG    . PHE A 155 ? 1.1119 1.2996 1.0309 0.0000 0.0000 0.0000 152 PHE A CG    
1127 C CD1   . PHE A 155 ? 1.0955 1.2936 1.0155 0.0000 0.0000 0.0000 152 PHE A CD1   
1128 C CD2   . PHE A 155 ? 1.1200 1.2975 1.0272 0.0000 0.0000 0.0000 152 PHE A CD2   
1129 C CE1   . PHE A 155 ? 1.1057 1.3054 1.0162 0.0000 0.0000 0.0000 152 PHE A CE1   
1130 C CE2   . PHE A 155 ? 1.1267 1.3064 1.0254 0.0000 0.0000 0.0000 152 PHE A CE2   
1131 C CZ    . PHE A 155 ? 1.1219 1.3135 1.0227 0.0000 0.0000 0.0000 152 PHE A CZ    
1132 N N     . THR A 156 ? 1.0969 1.2551 1.0333 0.0000 0.0000 0.0000 153 THR A N     
1133 C CA    . THR A 156 ? 1.1023 1.2450 1.0360 0.0000 0.0000 0.0000 153 THR A CA    
1134 C C     . THR A 156 ? 1.1116 1.2514 1.0369 0.0000 0.0000 0.0000 153 THR A C     
1135 O O     . THR A 156 ? 1.1104 1.2602 1.0371 0.0000 0.0000 0.0000 153 THR A O     
1136 C CB    . THR A 156 ? 1.0923 1.2281 1.0346 0.0000 0.0000 0.0000 153 THR A CB    
1137 O OG1   . THR A 156 ? 1.0995 1.2299 1.0465 0.0000 0.0000 0.0000 153 THR A OG1   
1138 C CG2   . THR A 156 ? 1.1004 1.2223 1.0394 0.0000 0.0000 0.0000 153 THR A CG2   
1139 N N     . TRP A 157 ? 1.1245 1.2498 1.0418 0.0000 0.0000 0.0000 154 TRP A N     
1140 C CA    . TRP A 157 ? 1.1386 1.2578 1.0494 0.0000 0.0000 0.0000 154 TRP A CA    
1141 C C     . TRP A 157 ? 1.1428 1.2478 1.0591 0.0000 0.0000 0.0000 154 TRP A C     
1142 O O     . TRP A 157 ? 1.1443 1.2359 1.0595 0.0000 0.0000 0.0000 154 TRP A O     
1143 C CB    . TRP A 157 ? 1.1604 1.2705 1.0540 0.0000 0.0000 0.0000 154 TRP A CB    
1144 C CG    . TRP A 157 ? 1.1702 1.2922 1.0534 0.0000 0.0000 0.0000 154 TRP A CG    
1145 C CD1   . TRP A 157 ? 1.1852 1.3130 1.0586 0.0000 0.0000 0.0000 154 TRP A CD1   
1146 C CD2   . TRP A 157 ? 1.1656 1.2949 1.0465 0.0000 0.0000 0.0000 154 TRP A CD2   
1147 N NE1   . TRP A 157 ? 1.1902 1.3263 1.0514 0.0000 0.0000 0.0000 154 TRP A NE1   
1148 C CE2   . TRP A 157 ? 1.1707 1.3089 1.0377 0.0000 0.0000 0.0000 154 TRP A CE2   
1149 C CE3   . TRP A 157 ? 1.1493 1.2792 1.0399 0.0000 0.0000 0.0000 154 TRP A CE3   
1150 C CZ2   . TRP A 157 ? 1.1574 1.3048 1.0192 0.0000 0.0000 0.0000 154 TRP A CZ2   
1151 C CZ3   . TRP A 157 ? 1.1432 1.2848 1.0330 0.0000 0.0000 0.0000 154 TRP A CZ3   
1152 C CH2   . TRP A 157 ? 1.1541 1.3042 1.0293 0.0000 0.0000 0.0000 154 TRP A CH2   
1153 N N     . LEU A 158 ? 1.1472 1.2554 1.0700 0.0000 0.0000 0.0000 155 LEU A N     
1154 C CA    . LEU A 158 ? 1.1513 1.2482 1.0810 0.0000 0.0000 0.0000 155 LEU A CA    
1155 C C     . LEU A 158 ? 1.1707 1.2602 1.0975 0.0000 0.0000 0.0000 155 LEU A C     
1156 O O     . LEU A 158 ? 1.1769 1.2765 1.1027 0.0000 0.0000 0.0000 155 LEU A O     
1157 C CB    . LEU A 158 ? 1.1356 1.2443 1.0806 0.0000 0.0000 0.0000 155 LEU A CB    
1158 C CG    . LEU A 158 ? 1.1267 1.2412 1.0739 0.0000 0.0000 0.0000 155 LEU A CG    
1159 C CD1   . LEU A 158 ? 1.1192 1.2411 1.0790 0.0000 0.0000 0.0000 155 LEU A CD1   
1160 C CD2   . LEU A 158 ? 1.1338 1.2318 1.0732 0.0000 0.0000 0.0000 155 LEU A CD2   
1161 N N     . TYR A 159 ? 1.1887 1.2589 1.1133 0.0000 0.0000 0.0000 156 TYR A N     
1162 C CA    . TYR A 159 ? 1.2179 1.2768 1.1397 0.0000 0.0000 0.0000 156 TYR A CA    
1163 C C     . TYR A 159 ? 1.2308 1.2773 1.1615 0.0000 0.0000 0.0000 156 TYR A C     
1164 O O     . TYR A 159 ? 1.2386 1.2676 1.1622 0.0000 0.0000 0.0000 156 TYR A O     
1165 C CB    . TYR A 159 ? 1.2374 1.2770 1.1389 0.0000 0.0000 0.0000 156 TYR A CB    
1166 C CG    . TYR A 159 ? 1.2370 1.2866 1.1267 0.0000 0.0000 0.0000 156 TYR A CG    
1167 C CD1   . TYR A 159 ? 1.2507 1.3039 1.1322 0.0000 0.0000 0.0000 156 TYR A CD1   
1168 C CD2   . TYR A 159 ? 1.2323 1.2876 1.1187 0.0000 0.0000 0.0000 156 TYR A CD2   
1169 C CE1   . TYR A 159 ? 1.2593 1.3197 1.1259 0.0000 0.0000 0.0000 156 TYR A CE1   
1170 C CE2   . TYR A 159 ? 1.2478 1.3127 1.1233 0.0000 0.0000 0.0000 156 TYR A CE2   
1171 C CZ    . TYR A 159 ? 1.2592 1.3257 1.1230 0.0000 0.0000 0.0000 156 TYR A CZ    
1172 O OH    . TYR A 159 ? 1.2798 1.3537 1.1288 0.0000 0.0000 0.0000 156 TYR A OH    
1173 N N     . PRO A 160 ? 1.2363 1.2921 1.1833 0.0000 0.0000 0.0000 157 PRO A N     
1174 C CA    . PRO A 160 ? 1.2458 1.2908 1.2026 0.0000 0.0000 0.0000 157 PRO A CA    
1175 C C     . PRO A 160 ? 1.2783 1.2961 1.2224 0.0000 0.0000 0.0000 157 PRO A C     
1176 O O     . PRO A 160 ? 1.2944 1.3085 1.2314 0.0000 0.0000 0.0000 157 PRO A O     
1177 C CB    . PRO A 160 ? 1.2355 1.3027 1.2169 0.0000 0.0000 0.0000 157 PRO A CB    
1178 C CG    . PRO A 160 ? 1.2231 1.3120 1.2060 0.0000 0.0000 0.0000 157 PRO A CG    
1179 C CD    . PRO A 160 ? 1.2325 1.3095 1.1903 0.0000 0.0000 0.0000 157 PRO A CD    
1180 N N     . THR A 161 ? 1.2962 1.2923 1.2344 0.0000 0.0000 0.0000 158 THR A N     
1181 C CA    . THR A 161 ? 1.3342 1.3015 1.2614 0.0000 0.0000 0.0000 158 THR A CA    
1182 C C     . THR A 161 ? 1.3539 1.3086 1.2896 0.0000 0.0000 0.0000 158 THR A C     
1183 O O     . THR A 161 ? 1.3430 1.3058 1.2864 0.0000 0.0000 0.0000 158 THR A O     
1184 C CB    . THR A 161 ? 1.3453 1.2890 1.2489 0.0000 0.0000 0.0000 158 THR A CB    
1185 O OG1   . THR A 161 ? 1.3369 1.2659 1.2350 0.0000 0.0000 0.0000 158 THR A OG1   
1186 C CG2   . THR A 161 ? 1.3267 1.2857 1.2234 0.0000 0.0000 0.0000 158 THR A CG2   
1187 N N     . LYS A 162 ? 1.3892 1.3221 1.3217 0.0000 0.0000 0.0000 159 LYS A N     
1188 C CA    . LYS A 162 ? 1.4135 1.3330 1.3540 0.0000 0.0000 0.0000 159 LYS A CA    
1189 C C     . LYS A 162 ? 1.4287 1.3170 1.3476 0.0000 0.0000 0.0000 159 LYS A C     
1190 O O     . LYS A 162 ? 1.4410 1.3182 1.3613 0.0000 0.0000 0.0000 159 LYS A O     
1191 C CB    . LYS A 162 ? 1.4418 1.3530 1.3923 0.0000 0.0000 0.0000 159 LYS A CB    
1192 C CG    . LYS A 162 ? 1.4568 1.3989 1.4300 0.0000 0.0000 0.0000 159 LYS A CG    
1193 C CD    . LYS A 162 ? 1.5237 1.4578 1.5102 0.0000 0.0000 0.0000 159 LYS A CD    
1194 C CE    . LYS A 162 ? 1.5357 1.5023 1.5464 0.0000 0.0000 0.0000 159 LYS A CE    
1195 N NZ    . LYS A 162 ? 1.5730 1.5419 1.6104 0.0000 0.0000 0.0000 159 LYS A NZ    
1196 N N     . ALA A 163 ? 1.4333 1.3078 1.3322 0.0000 0.0000 0.0000 160 ALA A N     
1197 C CA    . ALA A 163 ? 1.4481 1.2939 1.3273 0.0000 0.0000 0.0000 160 ALA A CA    
1198 C C     . ALA A 163 ? 1.4395 1.2885 1.3070 0.0000 0.0000 0.0000 160 ALA A C     
1199 O O     . ALA A 163 ? 1.4359 1.2979 1.3045 0.0000 0.0000 0.0000 160 ALA A O     
1200 C CB    . ALA A 163 ? 1.4826 1.2939 1.3515 0.0000 0.0000 0.0000 160 ALA A CB    
1201 N N     . PRO A 164 ? 1.4414 1.2786 1.2976 0.0000 0.0000 0.0000 161 PRO A N     
1202 C CA    . PRO A 164 ? 1.4318 1.2756 1.2824 0.0000 0.0000 0.0000 161 PRO A CA    
1203 C C     . PRO A 164 ? 1.4588 1.2784 1.2968 0.0000 0.0000 0.0000 161 PRO A C     
1204 O O     . PRO A 164 ? 1.4709 1.2726 1.2993 0.0000 0.0000 0.0000 161 PRO A O     
1205 C CB    . PRO A 164 ? 1.4276 1.2661 1.2724 0.0000 0.0000 0.0000 161 PRO A CB    
1206 C CG    . PRO A 164 ? 1.4441 1.2593 1.2819 0.0000 0.0000 0.0000 161 PRO A CG    
1207 C CD    . PRO A 164 ? 1.4552 1.2700 1.3021 0.0000 0.0000 0.0000 161 PRO A CD    
1208 N N     . SER A 165 ? 1.4714 1.2896 1.3089 0.0000 0.0000 0.0000 162 SER A N     
1209 C CA    . SER A 165 ? 1.5064 1.2946 1.3294 0.0000 0.0000 0.0000 162 SER A CA    
1210 C C     . SER A 165 ? 1.5074 1.3031 1.3241 0.0000 0.0000 0.0000 162 SER A C     
1211 O O     . SER A 165 ? 1.4872 1.3115 1.3108 0.0000 0.0000 0.0000 162 SER A O     
1212 C CB    . SER A 165 ? 1.5310 1.3020 1.3535 0.0000 0.0000 0.0000 162 SER A CB    
1213 O OG    . SER A 165 ? 1.5181 1.3127 1.3504 0.0000 0.0000 0.0000 162 SER A OG    
1214 N N     . THR A 166 ? 1.5323 1.3012 1.3349 0.0000 0.0000 0.0000 163 THR A N     
1215 C CA    . THR A 166 ? 1.5375 1.3088 1.3312 0.0000 0.0000 0.0000 163 THR A CA    
1216 C C     . THR A 166 ? 1.5412 1.3200 1.3304 0.0000 0.0000 0.0000 163 THR A C     
1217 O O     . THR A 166 ? 1.5276 1.3303 1.3173 0.0000 0.0000 0.0000 163 THR A O     
1218 C CB    . THR A 166 ? 1.5742 1.3091 1.3520 0.0000 0.0000 0.0000 163 THR A CB    
1219 O OG1   . THR A 166 ? 1.5809 1.3044 1.3624 0.0000 0.0000 0.0000 163 THR A OG1   
1220 C CG2   . THR A 166 ? 1.5792 1.3199 1.3490 0.0000 0.0000 0.0000 163 THR A CG2   
1221 N N     . SER A 167 ? 1.5617 1.3202 1.3470 0.0000 0.0000 0.0000 164 SER A N     
1222 C CA    . SER A 167 ? 1.5748 1.3348 1.3541 0.0000 0.0000 0.0000 164 SER A CA    
1223 C C     . SER A 167 ? 1.5344 1.3348 1.3287 0.0000 0.0000 0.0000 164 SER A C     
1224 O O     . SER A 167 ? 1.5403 1.3518 1.3255 0.0000 0.0000 0.0000 164 SER A O     
1225 C CB    . SER A 167 ? 1.6047 1.3387 1.3835 0.0000 0.0000 0.0000 164 SER A CB    
1226 O OG    . SER A 167 ? 1.5954 1.3473 1.3967 0.0000 0.0000 0.0000 164 SER A OG    
1227 N N     . ALA A 168 ? 1.4977 1.3179 1.3126 0.0000 0.0000 0.0000 165 ALA A N     
1228 C CA    . ALA A 168 ? 1.4555 1.3131 1.2866 0.0000 0.0000 0.0000 165 ALA A CA    
1229 C C     . ALA A 168 ? 1.4239 1.3039 1.2534 0.0000 0.0000 0.0000 165 ALA A C     
1230 O O     . ALA A 168 ? 1.4083 1.3132 1.2420 0.0000 0.0000 0.0000 165 ALA A O     
1231 C CB    . ALA A 168 ? 1.4374 1.3073 1.2894 0.0000 0.0000 0.0000 165 ALA A CB    
1232 N N     . THR A 169 ? 1.4085 1.2799 1.2335 0.0000 0.0000 0.0000 166 THR A N     
1233 C CA    . THR A 169 ? 1.3735 1.2656 1.2001 0.0000 0.0000 0.0000 166 THR A CA    
1234 C C     . THR A 169 ? 1.3877 1.2804 1.1984 0.0000 0.0000 0.0000 166 THR A C     
1235 O O     . THR A 169 ? 1.3701 1.2875 1.1830 0.0000 0.0000 0.0000 166 THR A O     
1236 C CB    . THR A 169 ? 1.3711 1.2516 1.1975 0.0000 0.0000 0.0000 166 THR A CB    
1237 O OG1   . THR A 169 ? 1.3567 1.2274 1.1901 0.0000 0.0000 0.0000 166 THR A OG1   
1238 C CG2   . THR A 169 ? 1.3396 1.2463 1.1751 0.0000 0.0000 0.0000 166 THR A CG2   
1239 N N     . VAL A 170 ? 1.4183 1.2811 1.2108 0.0000 0.0000 0.0000 167 VAL A N     
1240 C CA    . VAL A 170 ? 1.4396 1.2952 1.2103 0.0000 0.0000 0.0000 167 VAL A CA    
1241 C C     . VAL A 170 ? 1.4350 1.3067 1.2030 0.0000 0.0000 0.0000 167 VAL A C     
1242 O O     . VAL A 170 ? 1.4299 1.3171 1.1887 0.0000 0.0000 0.0000 167 VAL A O     
1243 C CB    . VAL A 170 ? 1.4820 1.2967 1.2319 0.0000 0.0000 0.0000 167 VAL A CB    
1244 C CG1   . VAL A 170 ? 1.5177 1.3208 1.2402 0.0000 0.0000 0.0000 167 VAL A CG1   
1245 C CG2   . VAL A 170 ? 1.4825 1.2836 1.2339 0.0000 0.0000 0.0000 167 VAL A CG2   
1246 N N     . LYS A 171 ? 1.4345 1.3030 1.2117 0.0000 0.0000 0.0000 168 LYS A N     
1247 C CA    . LYS A 171 ? 1.4313 1.3162 1.2112 0.0000 0.0000 0.0000 168 LYS A CA    
1248 C C     . LYS A 171 ? 1.3922 1.3136 1.1843 0.0000 0.0000 0.0000 168 LYS A C     
1249 O O     . LYS A 171 ? 1.3984 1.3301 1.1778 0.0000 0.0000 0.0000 168 LYS A O     
1250 C CB    . LYS A 171 ? 1.4289 1.3131 1.2285 0.0000 0.0000 0.0000 168 LYS A CB    
1251 C CG    . LYS A 171 ? 1.4923 1.3399 1.2821 0.0000 0.0000 0.0000 168 LYS A CG    
1252 C CD    . LYS A 171 ? 1.5392 1.3900 1.3483 0.0000 0.0000 0.0000 168 LYS A CD    
1253 C CE    . LYS A 171 ? 1.5833 1.4032 1.3945 0.0000 0.0000 0.0000 168 LYS A CE    
1254 N NZ    . LYS A 171 ? 1.6285 1.4321 1.4408 0.0000 0.0000 0.0000 168 LYS A NZ    
1255 N N     . SER A 172 ? 1.3540 1.2919 1.1681 0.0000 0.0000 0.0000 169 SER A N     
1256 C CA    . SER A 172 ? 1.3158 1.2856 1.1430 0.0000 0.0000 0.0000 169 SER A CA    
1257 C C     . SER A 172 ? 1.3156 1.2918 1.1280 0.0000 0.0000 0.0000 169 SER A C     
1258 O O     . SER A 172 ? 1.3091 1.3032 1.1174 0.0000 0.0000 0.0000 169 SER A O     
1259 C CB    . SER A 172 ? 1.2861 1.2641 1.1332 0.0000 0.0000 0.0000 169 SER A CB    
1260 O OG    . SER A 172 ? 1.2858 1.2643 1.1482 0.0000 0.0000 0.0000 169 SER A OG    
1261 N N     . LEU A 173 ? 1.3219 1.2837 1.1272 0.0000 0.0000 0.0000 170 LEU A N     
1262 C CA    . LEU A 173 ? 1.3190 1.2896 1.1155 0.0000 0.0000 0.0000 170 LEU A CA    
1263 C C     . LEU A 173 ? 1.3486 1.3116 1.1175 0.0000 0.0000 0.0000 170 LEU A C     
1264 O O     . LEU A 173 ? 1.3466 1.3259 1.1096 0.0000 0.0000 0.0000 170 LEU A O     
1265 C CB    . LEU A 173 ? 1.3211 1.2800 1.1209 0.0000 0.0000 0.0000 170 LEU A CB    
1266 C CG    . LEU A 173 ? 1.2781 1.2503 1.1022 0.0000 0.0000 0.0000 170 LEU A CG    
1267 C CD1   . LEU A 173 ? 1.2840 1.2463 1.1107 0.0000 0.0000 0.0000 170 LEU A CD1   
1268 C CD2   . LEU A 173 ? 1.2422 1.2459 1.0797 0.0000 0.0000 0.0000 170 LEU A CD2   
1269 N N     . ASN A 174 ? 1.3767 1.3140 1.1275 0.0000 0.0000 0.0000 171 ASN A N     
1270 C CA    . ASN A 174 ? 1.4088 1.3357 1.1292 0.0000 0.0000 0.0000 171 ASN A CA    
1271 C C     . ASN A 174 ? 1.3922 1.3447 1.1136 0.0000 0.0000 0.0000 171 ASN A C     
1272 O O     . ASN A 174 ? 1.4091 1.3649 1.1085 0.0000 0.0000 0.0000 171 ASN A O     
1273 C CB    . ASN A 174 ? 1.4473 1.3419 1.1509 0.0000 0.0000 0.0000 171 ASN A CB    
1274 C CG    . ASN A 174 ? 1.4858 1.3481 1.1755 0.0000 0.0000 0.0000 171 ASN A CG    
1275 O OD1   . ASN A 174 ? 1.5033 1.3666 1.1889 0.0000 0.0000 0.0000 171 ASN A OD1   
1276 N ND2   . ASN A 174 ? 1.5193 1.3528 1.2033 0.0000 0.0000 0.0000 171 ASN A ND2   
1277 N N     . VAL A 175 ? 1.3602 1.3301 1.1067 0.0000 0.0000 0.0000 172 VAL A N     
1278 C CA    . VAL A 175 ? 1.3371 1.3335 1.0900 0.0000 0.0000 0.0000 172 VAL A CA    
1279 C C     . VAL A 175 ? 1.3162 1.3343 1.0739 0.0000 0.0000 0.0000 172 VAL A C     
1280 O O     . VAL A 175 ? 1.3227 1.3501 1.0645 0.0000 0.0000 0.0000 172 VAL A O     
1281 C CB    . VAL A 175 ? 1.3083 1.3202 1.0920 0.0000 0.0000 0.0000 172 VAL A CB    
1282 C CG1   . VAL A 175 ? 1.2756 1.3181 1.0725 0.0000 0.0000 0.0000 172 VAL A CG1   
1283 C CG2   . VAL A 175 ? 1.3210 1.3168 1.1016 0.0000 0.0000 0.0000 172 VAL A CG2   
1284 N N     . LEU A 176 ? 1.2901 1.3151 1.0690 0.0000 0.0000 0.0000 173 LEU A N     
1285 C CA    . LEU A 176 ? 1.2682 1.3147 1.0573 0.0000 0.0000 0.0000 173 LEU A CA    
1286 C C     . LEU A 176 ? 1.2939 1.3373 1.0601 0.0000 0.0000 0.0000 173 LEU A C     
1287 O O     . LEU A 176 ? 1.2903 1.3506 1.0518 0.0000 0.0000 0.0000 173 LEU A O     
1288 C CB    . LEU A 176 ? 1.2409 1.2908 1.0546 0.0000 0.0000 0.0000 173 LEU A CB    
1289 C CG    . LEU A 176 ? 1.2135 1.2833 1.0425 0.0000 0.0000 0.0000 173 LEU A CG    
1290 C CD1   . LEU A 176 ? 1.1958 1.2882 1.0268 0.0000 0.0000 0.0000 173 LEU A CD1   
1291 C CD2   . LEU A 176 ? 1.1920 1.2630 1.0440 0.0000 0.0000 0.0000 173 LEU A CD2   
1292 N N     . THR A 177 ? 1.3216 1.3422 1.0729 0.0000 0.0000 0.0000 174 THR A N     
1293 C CA    . THR A 177 ? 1.3488 1.3649 1.0789 0.0000 0.0000 0.0000 174 THR A CA    
1294 C C     . THR A 177 ? 1.3902 1.3979 1.0851 0.0000 0.0000 0.0000 174 THR A C     
1295 O O     . THR A 177 ? 1.4151 1.4185 1.0875 0.0000 0.0000 0.0000 174 THR A O     
1296 C CB    . THR A 177 ? 1.3678 1.3600 1.0916 0.0000 0.0000 0.0000 174 THR A CB    
1297 O OG1   . THR A 177 ? 1.3865 1.3543 1.1052 0.0000 0.0000 0.0000 174 THR A OG1   
1298 C CG2   . THR A 177 ? 1.3390 1.3441 1.0932 0.0000 0.0000 0.0000 174 THR A CG2   
1299 N N     . SER A 178 ? 1.4036 1.4090 1.0936 0.0000 0.0000 0.0000 175 SER A N     
1300 C CA    . SER A 178 ? 1.4411 1.4431 1.1001 0.0000 0.0000 0.0000 175 SER A CA    
1301 C C     . SER A 178 ? 1.4295 1.4570 1.0901 0.0000 0.0000 0.0000 175 SER A C     
1302 O O     . SER A 178 ? 1.4624 1.4852 1.0908 0.0000 0.0000 0.0000 175 SER A O     
1303 C CB    . SER A 178 ? 1.4406 1.4431 1.1046 0.0000 0.0000 0.0000 175 SER A CB    
1304 O OG    . SER A 178 ? 1.4830 1.4595 1.1418 0.0000 0.0000 0.0000 175 SER A OG    
1305 N N     . ILE A 179 ? 1.3901 1.4421 1.0858 0.0000 0.0000 0.0000 176 ILE A N     
1306 C CA    . ILE A 179 ? 1.3799 1.4560 1.0815 0.0000 0.0000 0.0000 176 ILE A CA    
1307 C C     . ILE A 179 ? 1.3918 1.4707 1.0895 0.0000 0.0000 0.0000 176 ILE A C     
1308 O O     . ILE A 179 ? 1.4214 1.5030 1.0958 0.0000 0.0000 0.0000 176 ILE A O     
1309 C CB    . ILE A 179 ? 1.3367 1.4359 1.0747 0.0000 0.0000 0.0000 176 ILE A CB    
1310 C CG1   . ILE A 179 ? 1.3517 1.4560 1.0891 0.0000 0.0000 0.0000 176 ILE A CG1   
1311 C CG2   . ILE A 179 ? 1.3039 1.4244 1.0523 0.0000 0.0000 0.0000 176 ILE A CG2   
1312 C CD1   . ILE A 179 ? 1.3767 1.4660 1.1155 0.0000 0.0000 0.0000 176 ILE A CD1   
1313 N N     . ALA A 180 ? 1.3754 1.4532 1.0952 0.0000 0.0000 0.0000 177 ALA A N     
1314 C CA    . ALA A 180 ? 1.3826 1.4636 1.1033 0.0000 0.0000 0.0000 177 ALA A CA    
1315 C C     . ALA A 180 ? 1.3767 1.4457 1.1133 0.0000 0.0000 0.0000 177 ALA A C     
1316 O O     . ALA A 180 ? 1.3641 1.4257 1.1145 0.0000 0.0000 0.0000 177 ALA A O     
1317 C CB    . ALA A 180 ? 1.3563 1.4662 1.1009 0.0000 0.0000 0.0000 177 ALA A CB    
1318 N N     . ILE A 181 ? 1.3904 1.4573 1.1255 0.0000 0.0000 0.0000 178 ILE A N     
1319 C CA    . ILE A 181 ? 1.3864 1.4419 1.1374 0.0000 0.0000 0.0000 178 ILE A CA    
1320 C C     . ILE A 181 ? 1.3574 1.4383 1.1456 0.0000 0.0000 0.0000 178 ILE A C     
1321 O O     . ILE A 181 ? 1.3573 1.4568 1.1490 0.0000 0.0000 0.0000 178 ILE A O     
1322 C CB    . ILE A 181 ? 1.4318 1.4594 1.1530 0.0000 0.0000 0.0000 178 ILE A CB    
1323 C CG1   . ILE A 181 ? 1.4601 1.4580 1.1504 0.0000 0.0000 0.0000 178 ILE A CG1   
1324 C CG2   . ILE A 181 ? 1.4280 1.4484 1.1700 0.0000 0.0000 0.0000 178 ILE A CG2   
1325 C CD1   . ILE A 181 ? 1.5060 1.4690 1.1700 0.0000 0.0000 0.0000 178 ILE A CD1   
1326 N N     . PRO A 182 ? 1.3320 1.4135 1.1477 0.0000 0.0000 0.0000 179 PRO A N     
1327 C CA    . PRO A 182 ? 1.3049 1.4078 1.1571 0.0000 0.0000 0.0000 179 PRO A CA    
1328 C C     . PRO A 182 ? 1.3228 1.4210 1.1827 0.0000 0.0000 0.0000 179 PRO A C     
1329 O O     . PRO A 182 ? 1.3549 1.4273 1.1932 0.0000 0.0000 0.0000 179 PRO A O     
1330 C CB    . PRO A 182 ? 1.2830 1.3792 1.1509 0.0000 0.0000 0.0000 179 PRO A CB    
1331 C CG    . PRO A 182 ? 1.3040 1.3696 1.1473 0.0000 0.0000 0.0000 179 PRO A CG    
1332 C CD    . PRO A 182 ? 1.3289 1.3890 1.1407 0.0000 0.0000 0.0000 179 PRO A CD    
1333 N N     . LYS A 183 ? 1.3066 1.4293 1.1986 0.0000 0.0000 0.0000 180 LYS A N     
1334 C CA    . LYS A 183 ? 1.3219 1.4441 1.2299 0.0000 0.0000 0.0000 180 LYS A CA    
1335 C C     . LYS A 183 ? 1.3116 1.4167 1.2323 0.0000 0.0000 0.0000 180 LYS A C     
1336 O O     . LYS A 183 ? 1.3353 1.4199 1.2488 0.0000 0.0000 0.0000 180 LYS A O     
1337 C CB    . LYS A 183 ? 1.3087 1.4656 1.2525 0.0000 0.0000 0.0000 180 LYS A CB    
1338 C CG    . LYS A 183 ? 1.3485 1.5198 1.2810 0.0000 0.0000 0.0000 180 LYS A CG    
1339 C CD    . LYS A 183 ? 1.3648 1.5728 1.3374 0.0000 0.0000 0.0000 180 LYS A CD    
1340 C CE    . LYS A 183 ? 1.4171 1.6396 1.3758 0.0000 0.0000 0.0000 180 LYS A CE    
1341 N NZ    . LYS A 183 ? 1.4204 1.6789 1.4175 0.0000 0.0000 0.0000 180 LYS A NZ    
1342 N N     . VAL A 184 ? 1.2789 1.3904 1.2161 0.0000 0.0000 0.0000 181 VAL A N     
1343 C CA    . VAL A 184 ? 1.2655 1.3645 1.2174 0.0000 0.0000 0.0000 181 VAL A CA    
1344 C C     . VAL A 184 ? 1.2484 1.3353 1.1910 0.0000 0.0000 0.0000 181 VAL A C     
1345 O O     . VAL A 184 ? 1.2281 1.3295 1.1723 0.0000 0.0000 0.0000 181 VAL A O     
1346 C CB    . VAL A 184 ? 1.2448 1.3685 1.2366 0.0000 0.0000 0.0000 181 VAL A CB    
1347 C CG1   . VAL A 184 ? 1.2414 1.3485 1.2441 0.0000 0.0000 0.0000 181 VAL A CG1   
1348 C CG2   . VAL A 184 ? 1.2498 1.3940 1.2584 0.0000 0.0000 0.0000 181 VAL A CG2   
1349 N N     . ILE A 185 ? 1.2571 1.3170 1.1904 0.0000 0.0000 0.0000 182 ILE A N     
1350 C CA    . ILE A 185 ? 1.2444 1.2925 1.1724 0.0000 0.0000 0.0000 182 ILE A CA    
1351 C C     . ILE A 185 ? 1.2448 1.2855 1.1892 0.0000 0.0000 0.0000 182 ILE A C     
1352 O O     . ILE A 185 ? 1.2649 1.2875 1.2086 0.0000 0.0000 0.0000 182 ILE A O     
1353 C CB    . ILE A 185 ? 1.2599 1.2805 1.1597 0.0000 0.0000 0.0000 182 ILE A CB    
1354 C CG1   . ILE A 185 ? 1.2551 1.2837 1.1380 0.0000 0.0000 0.0000 182 ILE A CG1   
1355 C CG2   . ILE A 185 ? 1.2526 1.2599 1.1511 0.0000 0.0000 0.0000 182 ILE A CG2   
1356 C CD1   . ILE A 185 ? 1.2698 1.2718 1.1256 0.0000 0.0000 0.0000 182 ILE A CD1   
1357 N N     . HIS A 186 ? 1.2270 1.2797 1.1842 0.0000 0.0000 0.0000 183 HIS A N     
1358 C CA    . HIS A 186 ? 1.2290 1.2722 1.1966 0.0000 0.0000 0.0000 183 HIS A CA    
1359 C C     . HIS A 186 ? 1.2392 1.2596 1.1886 0.0000 0.0000 0.0000 183 HIS A C     
1360 O O     . HIS A 186 ? 1.2260 1.2515 1.1679 0.0000 0.0000 0.0000 183 HIS A O     
1361 C CB    . HIS A 186 ? 1.2034 1.2715 1.1962 0.0000 0.0000 0.0000 183 HIS A CB    
1362 C CG    . HIS A 186 ? 1.1951 1.2527 1.1965 0.0000 0.0000 0.0000 183 HIS A CG    
1363 N ND1   . HIS A 186 ? 1.1921 1.2585 1.2173 0.0000 0.0000 0.0000 183 HIS A ND1   
1364 C CD2   . HIS A 186 ? 1.1958 1.2338 1.1838 0.0000 0.0000 0.0000 183 HIS A CD2   
1365 C CE1   . HIS A 186 ? 1.2006 1.2524 1.2253 0.0000 0.0000 0.0000 183 HIS A CE1   
1366 N NE2   . HIS A 186 ? 1.2001 1.2334 1.2004 0.0000 0.0000 0.0000 183 HIS A NE2   
1367 N N     . SER A 187 ? 1.2667 1.2621 1.2097 0.0000 0.0000 0.0000 184 SER A N     
1368 C CA    . SER A 187 ? 1.2835 1.2554 1.2085 0.0000 0.0000 0.0000 184 SER A CA    
1369 C C     . SER A 187 ? 1.3016 1.2546 1.2264 0.0000 0.0000 0.0000 184 SER A C     
1370 O O     . SER A 187 ? 1.3100 1.2644 1.2479 0.0000 0.0000 0.0000 184 SER A O     
1371 C CB    . SER A 187 ? 1.3029 1.2535 1.2092 0.0000 0.0000 0.0000 184 SER A CB    
1372 O OG    . SER A 187 ? 1.3292 1.2615 1.2341 0.0000 0.0000 0.0000 184 SER A OG    
1373 N N     . ASP A 188 ? 1.3150 1.2501 1.2248 0.0000 0.0000 0.0000 185 ASP A N     
1374 C CA    . ASP A 188 ? 1.3447 1.2539 1.2459 0.0000 0.0000 0.0000 185 ASP A CA    
1375 C C     . ASP A 188 ? 1.3784 1.2601 1.2671 0.0000 0.0000 0.0000 185 ASP A C     
1376 O O     . ASP A 188 ? 1.3820 1.2625 1.2659 0.0000 0.0000 0.0000 185 ASP A O     
1377 C CB    . ASP A 188 ? 1.3477 1.2451 1.2349 0.0000 0.0000 0.0000 185 ASP A CB    
1378 C CG    . ASP A 188 ? 1.3473 1.2393 1.2208 0.0000 0.0000 0.0000 185 ASP A CG    
1379 O OD1   . ASP A 188 ? 1.3233 1.2211 1.1934 0.0000 0.0000 0.0000 185 ASP A OD1   
1380 O OD2   . ASP A 188 ? 1.3479 1.2291 1.2148 0.0000 0.0000 0.0000 185 ASP A OD2   
1381 N N     . GLN A 189 ? 1.4110 1.2686 1.2931 0.0000 0.0000 0.0000 186 GLN A N     
1382 C CA    . GLN A 189 ? 1.4524 1.2816 1.3238 0.0000 0.0000 0.0000 186 GLN A CA    
1383 C C     . GLN A 189 ? 1.4744 1.2764 1.3228 0.0000 0.0000 0.0000 186 GLN A C     
1384 O O     . GLN A 189 ? 1.5053 1.2757 1.3403 0.0000 0.0000 0.0000 186 GLN A O     
1385 C CB    . GLN A 189 ? 1.4724 1.2867 1.3475 0.0000 0.0000 0.0000 186 GLN A CB    
1386 C CG    . GLN A 189 ? 1.4722 1.3153 1.3756 0.0000 0.0000 0.0000 186 GLN A CG    
1387 C CD    . GLN A 189 ? 1.5074 1.3356 1.4182 0.0000 0.0000 0.0000 186 GLN A CD    
1388 O OE1   . GLN A 189 ? 1.5478 1.3427 1.4413 0.0000 0.0000 0.0000 186 GLN A OE1   
1389 N NE2   . GLN A 189 ? 1.5016 1.3546 1.4401 0.0000 0.0000 0.0000 186 GLN A NE2   
1390 N N     . GLY A 190 ? 1.4645 1.2795 1.3104 0.0000 0.0000 0.0000 187 GLY A N     
1391 C CA    . GLY A 190 ? 1.4832 1.2792 1.3134 0.0000 0.0000 0.0000 187 GLY A CA    
1392 C C     . GLY A 190 ? 1.5074 1.2860 1.3315 0.0000 0.0000 0.0000 187 GLY A C     
1393 O O     . GLY A 190 ? 1.5046 1.2956 1.3361 0.0000 0.0000 0.0000 187 GLY A O     
1394 N N     . ALA A 191 ? 1.5363 1.2846 1.3451 0.0000 0.0000 0.0000 188 ALA A N     
1395 C CA    . ALA A 191 ? 1.5662 1.2891 1.3658 0.0000 0.0000 0.0000 188 ALA A CA    
1396 C C     . ALA A 191 ? 1.5571 1.2965 1.3618 0.0000 0.0000 0.0000 188 ALA A C     
1397 O O     . ALA A 191 ? 1.5799 1.3041 1.3787 0.0000 0.0000 0.0000 188 ALA A O     
1398 C CB    . ALA A 191 ? 1.5905 1.2851 1.3762 0.0000 0.0000 0.0000 188 ALA A CB    
1399 N N     . ALA A 192 ? 1.5287 1.2975 1.3424 0.0000 0.0000 0.0000 189 ALA A N     
1400 C CA    . ALA A 192 ? 1.5238 1.3076 1.3397 0.0000 0.0000 0.0000 189 ALA A CA    
1401 C C     . ALA A 192 ? 1.5215 1.3192 1.3409 0.0000 0.0000 0.0000 189 ALA A C     
1402 O O     . ALA A 192 ? 1.5372 1.3314 1.3490 0.0000 0.0000 0.0000 189 ALA A O     
1403 C CB    . ALA A 192 ? 1.4963 1.3085 1.3221 0.0000 0.0000 0.0000 189 ALA A CB    
1404 N N     . PHE A 193 ? 1.5052 1.3181 1.3358 0.0000 0.0000 0.0000 190 PHE A N     
1405 C CA    . PHE A 193 ? 1.4942 1.3267 1.3332 0.0000 0.0000 0.0000 190 PHE A CA    
1406 C C     . PHE A 193 ? 1.5217 1.3366 1.3605 0.0000 0.0000 0.0000 190 PHE A C     
1407 O O     . PHE A 193 ? 1.5250 1.3511 1.3687 0.0000 0.0000 0.0000 190 PHE A O     
1408 C CB    . PHE A 193 ? 1.4565 1.3234 1.3135 0.0000 0.0000 0.0000 190 PHE A CB    
1409 C CG    . PHE A 193 ? 1.4128 1.2949 1.2716 0.0000 0.0000 0.0000 190 PHE A CG    
1410 C CD1   . PHE A 193 ? 1.3978 1.2834 1.2500 0.0000 0.0000 0.0000 190 PHE A CD1   
1411 C CD2   . PHE A 193 ? 1.3826 1.2753 1.2500 0.0000 0.0000 0.0000 190 PHE A CD2   
1412 C CE1   . PHE A 193 ? 1.3707 1.2720 1.2279 0.0000 0.0000 0.0000 190 PHE A CE1   
1413 C CE2   . PHE A 193 ? 1.3565 1.2623 1.2255 0.0000 0.0000 0.0000 190 PHE A CE2   
1414 C CZ    . PHE A 193 ? 1.3453 1.2565 1.2108 0.0000 0.0000 0.0000 190 PHE A CZ    
1415 N N     . THR A 194 ? 1.5419 1.3294 1.3753 0.0000 0.0000 0.0000 191 THR A N     
1416 C CA    . THR A 194 ? 1.5689 1.3385 1.4038 0.0000 0.0000 0.0000 191 THR A CA    
1417 C C     . THR A 194 ? 1.6088 1.3447 1.4252 0.0000 0.0000 0.0000 191 THR A C     
1418 O O     . THR A 194 ? 1.6332 1.3574 1.4502 0.0000 0.0000 0.0000 191 THR A O     
1419 C CB    . THR A 194 ? 1.5750 1.3283 1.4107 0.0000 0.0000 0.0000 191 THR A CB    
1420 O OG1   . THR A 194 ? 1.5813 1.3189 1.4029 0.0000 0.0000 0.0000 191 THR A OG1   
1421 C CG2   . THR A 194 ? 1.5471 1.3305 1.4036 0.0000 0.0000 0.0000 191 THR A CG2   
1422 N N     . SER A 195 ? 1.6215 1.3419 1.4227 0.0000 0.0000 0.0000 192 SER A N     
1423 C CA    . SER A 195 ? 1.6649 1.3500 1.4464 0.0000 0.0000 0.0000 192 SER A CA    
1424 C C     . SER A 195 ? 1.6809 1.3664 1.4573 0.0000 0.0000 0.0000 192 SER A C     
1425 O O     . SER A 195 ? 1.6617 1.3800 1.4478 0.0000 0.0000 0.0000 192 SER A O     
1426 C CB    . SER A 195 ? 1.6666 1.3481 1.4388 0.0000 0.0000 0.0000 192 SER A CB    
1427 O OG    . SER A 195 ? 1.6511 1.3599 1.4252 0.0000 0.0000 0.0000 192 SER A OG    
1428 N N     . SER A 196 ? 1.7178 1.3651 1.4772 0.0000 0.0000 0.0000 193 SER A N     
1429 C CA    . SER A 196 ? 1.7379 1.3791 1.4876 0.0000 0.0000 0.0000 193 SER A CA    
1430 C C     . SER A 196 ? 1.7304 1.3813 1.4660 0.0000 0.0000 0.0000 193 SER A C     
1431 O O     . SER A 196 ? 1.7316 1.3962 1.4636 0.0000 0.0000 0.0000 193 SER A O     
1432 C CB    . SER A 196 ? 1.7904 1.3830 1.5222 0.0000 0.0000 0.0000 193 SER A CB    
1433 O OG    . SER A 196 ? 1.8232 1.3834 1.5375 0.0000 0.0000 0.0000 193 SER A OG    
1434 N N     . THR A 197 ? 1.7218 1.3656 1.4499 0.0000 0.0000 0.0000 194 THR A N     
1435 C CA    . THR A 197 ? 1.7177 1.3686 1.4326 0.0000 0.0000 0.0000 194 THR A CA    
1436 C C     . THR A 197 ? 1.6747 1.3716 1.4029 0.0000 0.0000 0.0000 194 THR A C     
1437 O O     . THR A 197 ? 1.6843 1.3882 1.3992 0.0000 0.0000 0.0000 194 THR A O     
1438 C CB    . THR A 197 ? 1.7153 1.3583 1.4291 0.0000 0.0000 0.0000 194 THR A CB    
1439 O OG1   . THR A 197 ? 1.7493 1.3528 1.4563 0.0000 0.0000 0.0000 194 THR A OG1   
1440 C CG2   . THR A 197 ? 1.7285 1.3675 1.4248 0.0000 0.0000 0.0000 194 THR A CG2   
1441 N N     . PHE A 198 ? 1.6283 1.3538 1.3804 0.0000 0.0000 0.0000 195 PHE A N     
1442 C CA    . PHE A 198 ? 1.5847 1.3527 1.3517 0.0000 0.0000 0.0000 195 PHE A CA    
1443 C C     . PHE A 198 ? 1.5913 1.3706 1.3619 0.0000 0.0000 0.0000 195 PHE A C     
1444 O O     . PHE A 198 ? 1.5901 1.3867 1.3546 0.0000 0.0000 0.0000 195 PHE A O     
1445 C CB    . PHE A 198 ? 1.5436 1.3339 1.3332 0.0000 0.0000 0.0000 195 PHE A CB    
1446 C CG    . PHE A 198 ? 1.4907 1.3218 1.2947 0.0000 0.0000 0.0000 195 PHE A CG    
1447 C CD1   . PHE A 198 ? 1.4695 1.3143 1.2670 0.0000 0.0000 0.0000 195 PHE A CD1   
1448 C CD2   . PHE A 198 ? 1.4492 1.3040 1.2737 0.0000 0.0000 0.0000 195 PHE A CD2   
1449 C CE1   . PHE A 198 ? 1.4265 1.3065 1.2362 0.0000 0.0000 0.0000 195 PHE A CE1   
1450 C CE2   . PHE A 198 ? 1.4067 1.2966 1.2441 0.0000 0.0000 0.0000 195 PHE A CE2   
1451 C CZ    . PHE A 198 ? 1.3988 1.3007 1.2282 0.0000 0.0000 0.0000 195 PHE A CZ    
1452 N N     . ALA A 199 ? 1.6015 1.3702 1.3819 0.0000 0.0000 0.0000 196 ALA A N     
1453 C CA    . ALA A 199 ? 1.6087 1.3885 1.3983 0.0000 0.0000 0.0000 196 ALA A CA    
1454 C C     . ALA A 199 ? 1.6405 1.4113 1.4071 0.0000 0.0000 0.0000 196 ALA A C     
1455 O O     . ALA A 199 ? 1.6327 1.4277 1.4065 0.0000 0.0000 0.0000 196 ALA A O     
1456 C CB    . ALA A 199 ? 1.6281 1.3855 1.4255 0.0000 0.0000 0.0000 196 ALA A CB    
1457 N N     . GLU A 200 ? 1.6796 1.4144 1.4176 0.0000 0.0000 0.0000 197 GLU A N     
1458 C CA    . GLU A 200 ? 1.7246 1.4427 1.4334 0.0000 0.0000 0.0000 197 GLU A CA    
1459 C C     . GLU A 200 ? 1.7079 1.4486 1.4063 0.0000 0.0000 0.0000 197 GLU A C     
1460 O O     . GLU A 200 ? 1.7156 1.4688 1.4040 0.0000 0.0000 0.0000 197 GLU A O     
1461 C CB    . GLU A 200 ? 1.7745 1.4415 1.4552 0.0000 0.0000 0.0000 197 GLU A CB    
1462 C CG    . GLU A 200 ? 1.8276 1.4683 1.5139 0.0000 0.0000 0.0000 197 GLU A CG    
1463 C CD    . GLU A 200 ? 1.9285 1.5154 1.5832 0.0000 0.0000 0.0000 197 GLU A CD    
1464 O OE1   . GLU A 200 ? 1.9825 1.5520 1.6098 0.0000 0.0000 0.0000 197 GLU A OE1   
1465 O OE2   . GLU A 200 ? 1.9566 1.5168 1.6121 0.0000 0.0000 0.0000 197 GLU A OE2   
1466 N N     . TRP A 201 ? 1.6870 1.4332 1.3885 0.0000 0.0000 0.0000 198 TRP A N     
1467 C CA    . TRP A 201 ? 1.6669 1.4383 1.3641 0.0000 0.0000 0.0000 198 TRP A CA    
1468 C C     . TRP A 201 ? 1.6413 1.4508 1.3538 0.0000 0.0000 0.0000 198 TRP A C     
1469 O O     . TRP A 201 ? 1.6510 1.4714 1.3477 0.0000 0.0000 0.0000 198 TRP A O     
1470 C CB    . TRP A 201 ? 1.6322 1.4171 1.3464 0.0000 0.0000 0.0000 198 TRP A CB    
1471 C CG    . TRP A 201 ? 1.6100 1.4247 1.3251 0.0000 0.0000 0.0000 198 TRP A CG    
1472 C CD1   . TRP A 201 ? 1.6352 1.4426 1.3294 0.0000 0.0000 0.0000 198 TRP A CD1   
1473 C CD2   . TRP A 201 ? 1.5646 1.4194 1.3018 0.0000 0.0000 0.0000 198 TRP A CD2   
1474 N NE1   . TRP A 201 ? 1.6071 1.4480 1.3092 0.0000 0.0000 0.0000 198 TRP A NE1   
1475 C CE2   . TRP A 201 ? 1.5666 1.4362 1.2946 0.0000 0.0000 0.0000 198 TRP A CE2   
1476 C CE3   . TRP A 201 ? 1.5276 1.4061 1.2914 0.0000 0.0000 0.0000 198 TRP A CE3   
1477 C CZ2   . TRP A 201 ? 1.5316 1.4375 1.2755 0.0000 0.0000 0.0000 198 TRP A CZ2   
1478 C CZ3   . TRP A 201 ? 1.4979 1.4121 1.2775 0.0000 0.0000 0.0000 198 TRP A CZ3   
1479 C CH2   . TRP A 201 ? 1.4992 1.4260 1.2684 0.0000 0.0000 0.0000 198 TRP A CH2   
1480 N N     . ALA A 202 ? 1.6127 1.4410 1.3554 0.0000 0.0000 0.0000 199 ALA A N     
1481 C CA    . ALA A 202 ? 1.5872 1.4533 1.3511 0.0000 0.0000 0.0000 199 ALA A CA    
1482 C C     . ALA A 202 ? 1.6169 1.4814 1.3724 0.0000 0.0000 0.0000 199 ALA A C     
1483 O O     . ALA A 202 ? 1.6104 1.5004 1.3670 0.0000 0.0000 0.0000 199 ALA A O     
1484 C CB    . ALA A 202 ? 1.5524 1.4359 1.3502 0.0000 0.0000 0.0000 199 ALA A CB    
1485 N N     . LYS A 203 ? 1.6533 1.4873 1.4001 0.0000 0.0000 0.0000 200 LYS A N     
1486 C CA    . LYS A 203 ? 1.6878 1.5182 1.4265 0.0000 0.0000 0.0000 200 LYS A CA    
1487 C C     . LYS A 203 ? 1.7188 1.5341 1.4165 0.0000 0.0000 0.0000 200 LYS A C     
1488 O O     . LYS A 203 ? 1.7299 1.5599 1.4219 0.0000 0.0000 0.0000 200 LYS A O     
1489 C CB    . LYS A 203 ? 1.7230 1.5220 1.4623 0.0000 0.0000 0.0000 200 LYS A CB    
1490 C CG    . LYS A 203 ? 1.7598 1.5679 1.5093 0.0000 0.0000 0.0000 200 LYS A CG    
1491 C CD    . LYS A 203 ? 1.8283 1.5986 1.5720 0.0000 0.0000 0.0000 200 LYS A CD    
1492 C CE    . LYS A 203 ? 1.8464 1.6376 1.6225 0.0000 0.0000 0.0000 200 LYS A CE    
1493 N NZ    . LYS A 203 ? 1.9104 1.6622 1.6772 0.0000 0.0000 0.0000 200 LYS A NZ    
1494 N N     . GLU A 204 ? 1.7296 1.5158 1.3995 0.0000 0.0000 0.0000 201 GLU A N     
1495 C CA    . GLU A 204 ? 1.7555 1.5257 1.3843 0.0000 0.0000 0.0000 201 GLU A CA    
1496 C C     . GLU A 204 ? 1.7210 1.5279 1.3510 0.0000 0.0000 0.0000 201 GLU A C     
1497 O O     . GLU A 204 ? 1.7575 1.5561 1.3546 0.0000 0.0000 0.0000 201 GLU A O     
1498 C CB    . GLU A 204 ? 1.7677 1.5151 1.3805 0.0000 0.0000 0.0000 201 GLU A CB    
1499 C CG    . GLU A 204 ? 1.8497 1.5445 1.4288 0.0000 0.0000 0.0000 201 GLU A CG    
1500 C CD    . GLU A 204 ? 1.8869 1.5626 1.4677 0.0000 0.0000 0.0000 201 GLU A CD    
1501 O OE1   . GLU A 204 ? 1.8462 1.5492 1.4493 0.0000 0.0000 0.0000 201 GLU A OE1   
1502 O OE2   . GLU A 204 ? 1.9440 1.5761 1.5042 0.0000 0.0000 0.0000 201 GLU A OE2   
1503 N N     . ARG A 205 ? 1.6515 1.4965 1.3171 0.0000 0.0000 0.0000 202 ARG A N     
1504 C CA    . ARG A 205 ? 1.6138 1.4930 1.2825 0.0000 0.0000 0.0000 202 ARG A CA    
1505 C C     . ARG A 205 ? 1.5856 1.4988 1.2831 0.0000 0.0000 0.0000 202 ARG A C     
1506 O O     . ARG A 205 ? 1.5656 1.5080 1.2686 0.0000 0.0000 0.0000 202 ARG A O     
1507 C CB    . ARG A 205 ? 1.5729 1.4693 1.2577 0.0000 0.0000 0.0000 202 ARG A CB    
1508 C CG    . ARG A 205 ? 1.5874 1.4546 1.2508 0.0000 0.0000 0.0000 202 ARG A CG    
1509 C CD    . ARG A 205 ? 1.5486 1.4364 1.2236 0.0000 0.0000 0.0000 202 ARG A CD    
1510 N NE    . ARG A 205 ? 1.5606 1.4242 1.2179 0.0000 0.0000 0.0000 202 ARG A NE    
1511 C CZ    . ARG A 205 ? 1.5930 1.4202 1.2359 0.0000 0.0000 0.0000 202 ARG A CZ    
1512 N NH1   . ARG A 205 ? 1.6125 1.4204 1.2546 0.0000 0.0000 0.0000 202 ARG A NH1   
1513 N NH2   . ARG A 205 ? 1.6086 1.4185 1.2397 0.0000 0.0000 0.0000 202 ARG A NH2   
1514 N N     . GLY A 206 ? 1.5826 1.4920 1.2994 0.0000 0.0000 0.0000 203 GLY A N     
1515 C CA    . GLY A 206 ? 1.5596 1.5025 1.3093 0.0000 0.0000 0.0000 203 GLY A CA    
1516 C C     . GLY A 206 ? 1.5032 1.4815 1.2921 0.0000 0.0000 0.0000 203 GLY A C     
1517 O O     . GLY A 206 ? 1.4803 1.4920 1.2888 0.0000 0.0000 0.0000 203 GLY A O     
1518 N N     . ILE A 207 ? 1.4849 1.4535 1.2833 0.0000 0.0000 0.0000 204 ILE A N     
1519 C CA    . ILE A 207 ? 1.4399 1.4354 1.2715 0.0000 0.0000 0.0000 204 ILE A CA    
1520 C C     . ILE A 207 ? 1.4318 1.4238 1.2912 0.0000 0.0000 0.0000 204 ILE A C     
1521 O O     . ILE A 207 ? 1.4506 1.4114 1.2988 0.0000 0.0000 0.0000 204 ILE A O     
1522 C CB    . ILE A 207 ? 1.4229 1.4111 1.2436 0.0000 0.0000 0.0000 204 ILE A CB    
1523 C CG1   . ILE A 207 ? 1.4396 1.4242 1.2283 0.0000 0.0000 0.0000 204 ILE A CG1   
1524 C CG2   . ILE A 207 ? 1.3757 1.3914 1.2271 0.0000 0.0000 0.0000 204 ILE A CG2   
1525 C CD1   . ILE A 207 ? 1.4296 1.4112 1.2122 0.0000 0.0000 0.0000 204 ILE A CD1   
1526 N N     . HIS A 208 ? 1.4062 1.4289 1.3014 0.0000 0.0000 0.0000 205 HIS A N     
1527 C CA    . HIS A 208 ? 1.3973 1.4189 1.3205 0.0000 0.0000 0.0000 205 HIS A CA    
1528 C C     . HIS A 208 ? 1.3707 1.3860 1.2986 0.0000 0.0000 0.0000 205 HIS A C     
1529 O O     . HIS A 208 ? 1.3435 1.3780 1.2781 0.0000 0.0000 0.0000 205 HIS A O     
1530 C CB    . HIS A 208 ? 1.3828 1.4396 1.3450 0.0000 0.0000 0.0000 205 HIS A CB    
1531 C CG    . HIS A 208 ? 1.3870 1.4428 1.3784 0.0000 0.0000 0.0000 205 HIS A CG    
1532 N ND1   . HIS A 208 ? 1.3625 1.4399 1.3857 0.0000 0.0000 0.0000 205 HIS A ND1   
1533 C CD2   . HIS A 208 ? 1.4212 1.4550 1.4134 0.0000 0.0000 0.0000 205 HIS A CD2   
1534 C CE1   . HIS A 208 ? 1.3726 1.4423 1.4148 0.0000 0.0000 0.0000 205 HIS A CE1   
1535 N NE2   . HIS A 208 ? 1.4154 1.4591 1.4401 0.0000 0.0000 0.0000 205 HIS A NE2   
1536 N N     . LEU A 209 ? 1.3808 1.3671 1.3028 0.0000 0.0000 0.0000 206 LEU A N     
1537 C CA    . LEU A 209 ? 1.3592 1.3368 1.2847 0.0000 0.0000 0.0000 206 LEU A CA    
1538 C C     . LEU A 209 ? 1.3455 1.3390 1.3034 0.0000 0.0000 0.0000 206 LEU A C     
1539 O O     . LEU A 209 ? 1.3605 1.3564 1.3349 0.0000 0.0000 0.0000 206 LEU A O     
1540 C CB    . LEU A 209 ? 1.3797 1.3167 1.2814 0.0000 0.0000 0.0000 206 LEU A CB    
1541 C CG    . LEU A 209 ? 1.3865 1.3065 1.2576 0.0000 0.0000 0.0000 206 LEU A CG    
1542 C CD1   . LEU A 209 ? 1.4039 1.2868 1.2582 0.0000 0.0000 0.0000 206 LEU A CD1   
1543 C CD2   . LEU A 209 ? 1.3517 1.2952 1.2244 0.0000 0.0000 0.0000 206 LEU A CD2   
1544 N N     . GLU A 210 ? 1.3230 1.3271 1.2900 0.0000 0.0000 0.0000 207 GLU A N     
1545 C CA    . GLU A 210 ? 1.3114 1.3295 1.3066 0.0000 0.0000 0.0000 207 GLU A CA    
1546 C C     . GLU A 210 ? 1.3027 1.3045 1.2876 0.0000 0.0000 0.0000 207 GLU A C     
1547 O O     . GLU A 210 ? 1.2952 1.2950 1.2642 0.0000 0.0000 0.0000 207 GLU A O     
1548 C CB    . GLU A 210 ? 1.2880 1.3453 1.3096 0.0000 0.0000 0.0000 207 GLU A CB    
1549 C CG    . GLU A 210 ? 1.2802 1.3546 1.3288 0.0000 0.0000 0.0000 207 GLU A CG    
1550 C CD    . GLU A 210 ? 1.2775 1.3882 1.3482 0.0000 0.0000 0.0000 207 GLU A CD    
1551 O OE1   . GLU A 210 ? 1.2993 1.4311 1.3880 0.0000 0.0000 0.0000 207 GLU A OE1   
1552 O OE2   . GLU A 210 ? 1.2580 1.3754 1.3275 0.0000 0.0000 0.0000 207 GLU A OE2   
1553 N N     . PHE A 211 ? 1.3081 1.2974 1.3011 0.0000 0.0000 0.0000 208 PHE A N     
1554 C CA    . PHE A 211 ? 1.3046 1.2719 1.2823 0.0000 0.0000 0.0000 208 PHE A CA    
1555 C C     . PHE A 211 ? 1.2915 1.2709 1.2890 0.0000 0.0000 0.0000 208 PHE A C     
1556 O O     . PHE A 211 ? 1.2933 1.2864 1.3165 0.0000 0.0000 0.0000 208 PHE A O     
1557 C CB    . PHE A 211 ? 1.3363 1.2663 1.2959 0.0000 0.0000 0.0000 208 PHE A CB    
1558 C CG    . PHE A 211 ? 1.3545 1.2672 1.2942 0.0000 0.0000 0.0000 208 PHE A CG    
1559 C CD1   . PHE A 211 ? 1.3679 1.2615 1.2827 0.0000 0.0000 0.0000 208 PHE A CD1   
1560 C CD2   . PHE A 211 ? 1.3705 1.2845 1.3163 0.0000 0.0000 0.0000 208 PHE A CD2   
1561 C CE1   . PHE A 211 ? 1.3816 1.2573 1.2777 0.0000 0.0000 0.0000 208 PHE A CE1   
1562 C CE2   . PHE A 211 ? 1.3998 1.2933 1.3230 0.0000 0.0000 0.0000 208 PHE A CE2   
1563 C CZ    . PHE A 211 ? 1.4009 1.2748 1.2992 0.0000 0.0000 0.0000 208 PHE A CZ    
1564 N N     . SER A 212 ? 1.2806 1.2541 1.2659 0.0000 0.0000 0.0000 209 SER A N     
1565 C CA    . SER A 212 ? 1.2732 1.2502 1.2691 0.0000 0.0000 0.0000 209 SER A CA    
1566 C C     . SER A 212 ? 1.2955 1.2423 1.2810 0.0000 0.0000 0.0000 209 SER A C     
1567 O O     . SER A 212 ? 1.3142 1.2335 1.2785 0.0000 0.0000 0.0000 209 SER A O     
1568 C CB    . SER A 212 ? 1.2588 1.2371 1.2418 0.0000 0.0000 0.0000 209 SER A CB    
1569 O OG    . SER A 212 ? 1.2633 1.2261 1.2206 0.0000 0.0000 0.0000 209 SER A OG    
1570 N N     . THR A 213 ? 1.2943 1.2453 1.2949 0.0000 0.0000 0.0000 210 THR A N     
1571 C CA    . THR A 213 ? 1.3225 1.2446 1.3126 0.0000 0.0000 0.0000 210 THR A CA    
1572 C C     . THR A 213 ? 1.3394 1.2265 1.2897 0.0000 0.0000 0.0000 210 THR A C     
1573 O O     . THR A 213 ? 1.3294 1.2200 1.2667 0.0000 0.0000 0.0000 210 THR A O     
1574 C CB    . THR A 213 ? 1.3203 1.2529 1.3301 0.0000 0.0000 0.0000 210 THR A CB    
1575 O OG1   . THR A 213 ? 1.3169 1.2620 1.3243 0.0000 0.0000 0.0000 210 THR A OG1   
1576 C CG2   . THR A 213 ? 1.3102 1.2749 1.3633 0.0000 0.0000 0.0000 210 THR A CG2   
1577 N N     . PRO A 214 ? 1.3696 1.2228 1.3010 0.0000 0.0000 0.0000 211 PRO A N     
1578 C CA    . PRO A 214 ? 1.3882 1.2069 1.2821 0.0000 0.0000 0.0000 211 PRO A CA    
1579 C C     . PRO A 214 ? 1.3879 1.2010 1.2655 0.0000 0.0000 0.0000 211 PRO A C     
1580 O O     . PRO A 214 ? 1.3890 1.2079 1.2764 0.0000 0.0000 0.0000 211 PRO A O     
1581 C CB    . PRO A 214 ? 1.4209 1.2073 1.3039 0.0000 0.0000 0.0000 211 PRO A CB    
1582 C CG    . PRO A 214 ? 1.4191 1.2222 1.3310 0.0000 0.0000 0.0000 211 PRO A CG    
1583 C CD    . PRO A 214 ? 1.3883 1.2335 1.3332 0.0000 0.0000 0.0000 211 PRO A CD    
1584 N N     . TYR A 215 ? 1.3872 1.1888 1.2404 0.0000 0.0000 0.0000 212 TYR A N     
1585 C CA    . TYR A 215 ? 1.3927 1.1844 1.2245 0.0000 0.0000 0.0000 212 TYR A CA    
1586 C C     . TYR A 215 ? 1.3710 1.1892 1.2212 0.0000 0.0000 0.0000 212 TYR A C     
1587 O O     . TYR A 215 ? 1.3849 1.1923 1.2269 0.0000 0.0000 0.0000 212 TYR A O     
1588 C CB    . TYR A 215 ? 1.4327 1.1857 1.2346 0.0000 0.0000 0.0000 212 TYR A CB    
1589 C CG    . TYR A 215 ? 1.4670 1.1892 1.2455 0.0000 0.0000 0.0000 212 TYR A CG    
1590 C CD1   . TYR A 215 ? 1.4929 1.1988 1.2451 0.0000 0.0000 0.0000 212 TYR A CD1   
1591 C CD2   . TYR A 215 ? 1.4960 1.2044 1.2795 0.0000 0.0000 0.0000 212 TYR A CD2   
1592 C CE1   . TYR A 215 ? 1.5340 1.2114 1.2666 0.0000 0.0000 0.0000 212 TYR A CE1   
1593 C CE2   . TYR A 215 ? 1.5408 1.2180 1.3025 0.0000 0.0000 0.0000 212 TYR A CE2   
1594 C CZ    . TYR A 215 ? 1.5620 1.2242 1.2989 0.0000 0.0000 0.0000 212 TYR A CZ    
1595 O OH    . TYR A 215 ? 1.6071 1.2388 1.3248 0.0000 0.0000 0.0000 212 TYR A OH    
1596 N N     . HIS A 216 ? 1.3375 1.1882 1.2109 0.0000 0.0000 0.0000 213 HIS A N     
1597 C CA    . HIS A 216 ? 1.3128 1.1909 1.2071 0.0000 0.0000 0.0000 213 HIS A CA    
1598 C C     . HIS A 216 ? 1.2874 1.1880 1.1888 0.0000 0.0000 0.0000 213 HIS A C     
1599 O O     . HIS A 216 ? 1.2681 1.1954 1.1947 0.0000 0.0000 0.0000 213 HIS A O     
1600 C CB    . HIS A 216 ? 1.3037 1.2041 1.2331 0.0000 0.0000 0.0000 213 HIS A CB    
1601 C CG    . HIS A 216 ? 1.2871 1.2058 1.2358 0.0000 0.0000 0.0000 213 HIS A CG    
1602 N ND1   . HIS A 216 ? 1.2623 1.2156 1.2393 0.0000 0.0000 0.0000 213 HIS A ND1   
1603 C CD2   . HIS A 216 ? 1.3007 1.2066 1.2443 0.0000 0.0000 0.0000 213 HIS A CD2   
1604 C CE1   . HIS A 216 ? 1.2631 1.2247 1.2536 0.0000 0.0000 0.0000 213 HIS A CE1   
1605 N NE2   . HIS A 216 ? 1.2848 1.2180 1.2553 0.0000 0.0000 0.0000 213 HIS A NE2   
1606 N N     . PRO A 217 ? 1.2888 1.1780 1.1673 0.0000 0.0000 0.0000 214 PRO A N     
1607 C CA    . PRO A 217 ? 1.2640 1.1744 1.1502 0.0000 0.0000 0.0000 214 PRO A CA    
1608 C C     . PRO A 217 ? 1.2411 1.1822 1.1524 0.0000 0.0000 0.0000 214 PRO A C     
1609 O O     . PRO A 217 ? 1.2244 1.1883 1.1498 0.0000 0.0000 0.0000 214 PRO A O     
1610 C CB    . PRO A 217 ? 1.2698 1.1621 1.1295 0.0000 0.0000 0.0000 214 PRO A CB    
1611 C CG    . PRO A 217 ? 1.3007 1.1588 1.1353 0.0000 0.0000 0.0000 214 PRO A CG    
1612 C CD    . PRO A 217 ? 1.3139 1.1706 1.1585 0.0000 0.0000 0.0000 214 PRO A CD    
1613 N N     . GLN A 218 ? 1.2456 1.1862 1.1622 0.0000 0.0000 0.0000 215 GLN A N     
1614 C CA    . GLN A 218 ? 1.2311 1.1989 1.1721 0.0000 0.0000 0.0000 215 GLN A CA    
1615 C C     . GLN A 218 ? 1.2131 1.2116 1.1851 0.0000 0.0000 0.0000 215 GLN A C     
1616 O O     . GLN A 218 ? 1.1989 1.2222 1.1894 0.0000 0.0000 0.0000 215 GLN A O     
1617 C CB    . GLN A 218 ? 1.2423 1.2047 1.1888 0.0000 0.0000 0.0000 215 GLN A CB    
1618 C CG    . GLN A 218 ? 1.2969 1.2229 1.2107 0.0000 0.0000 0.0000 215 GLN A CG    
1619 C CD    . GLN A 218 ? 1.3511 1.2732 1.2731 0.0000 0.0000 0.0000 215 GLN A CD    
1620 O OE1   . GLN A 218 ? 1.3519 1.3014 1.3080 0.0000 0.0000 0.0000 215 GLN A OE1   
1621 N NE2   . GLN A 218 ? 1.3908 1.2789 1.2817 0.0000 0.0000 0.0000 215 GLN A NE2   
1622 N N     . SER A 219 ? 1.2216 1.2171 1.1982 0.0000 0.0000 0.0000 216 SER A N     
1623 C CA    . SER A 219 ? 1.2074 1.2293 1.2104 0.0000 0.0000 0.0000 216 SER A CA    
1624 C C     . SER A 219 ? 1.1957 1.2276 1.1917 0.0000 0.0000 0.0000 216 SER A C     
1625 O O     . SER A 219 ? 1.1848 1.2431 1.1985 0.0000 0.0000 0.0000 216 SER A O     
1626 C CB    . SER A 219 ? 1.2238 1.2360 1.2316 0.0000 0.0000 0.0000 216 SER A CB    
1627 O OG    . SER A 219 ? 1.2305 1.2309 1.2422 0.0000 0.0000 0.0000 216 SER A OG    
1628 N N     . SER A 220 ? 1.1991 1.2099 1.1693 0.0000 0.0000 0.0000 217 SER A N     
1629 C CA    . SER A 220 ? 1.1805 1.1989 1.1427 0.0000 0.0000 0.0000 217 SER A CA    
1630 C C     . SER A 220 ? 1.1551 1.1826 1.1157 0.0000 0.0000 0.0000 217 SER A C     
1631 O O     . SER A 220 ? 1.1449 1.1734 1.0953 0.0000 0.0000 0.0000 217 SER A O     
1632 C CB    . SER A 220 ? 1.2000 1.1936 1.1392 0.0000 0.0000 0.0000 217 SER A CB    
1633 O OG    . SER A 220 ? 1.2190 1.2093 1.1595 0.0000 0.0000 0.0000 217 SER A OG    
1634 N N     . GLY A 221 ? 1.1425 1.1768 1.1148 0.0000 0.0000 0.0000 218 GLY A N     
1635 C CA    . GLY A 221 ? 1.1294 1.1635 1.0965 0.0000 0.0000 0.0000 218 GLY A CA    
1636 C C     . GLY A 221 ? 1.1076 1.1611 1.0798 0.0000 0.0000 0.0000 218 GLY A C     
1637 O O     . GLY A 221 ? 1.1045 1.1526 1.0659 0.0000 0.0000 0.0000 218 GLY A O     
1638 N N     . LYS A 222 ? 1.0939 1.1691 1.0814 0.0000 0.0000 0.0000 219 LYS A N     
1639 C CA    . LYS A 222 ? 1.0748 1.1671 1.0646 0.0000 0.0000 0.0000 219 LYS A CA    
1640 C C     . LYS A 222 ? 1.0706 1.1529 1.0413 0.0000 0.0000 0.0000 219 LYS A C     
1641 O O     . LYS A 222 ? 1.0634 1.1514 1.0309 0.0000 0.0000 0.0000 219 LYS A O     
1642 C CB    . LYS A 222 ? 1.0720 1.1877 1.0789 0.0000 0.0000 0.0000 219 LYS A CB    
1643 C CG    . LYS A 222 ? 1.0670 1.2017 1.0786 0.0000 0.0000 0.0000 219 LYS A CG    
1644 C CD    . LYS A 222 ? 1.0665 1.2239 1.1026 0.0000 0.0000 0.0000 219 LYS A CD    
1645 C CE    . LYS A 222 ? 1.0623 1.2346 1.1013 0.0000 0.0000 0.0000 219 LYS A CE    
1646 N NZ    . LYS A 222 ? 1.0700 1.2612 1.1350 0.0000 0.0000 0.0000 219 LYS A NZ    
1647 N N     . VAL A 223 ? 1.0773 1.1445 1.0369 0.0000 0.0000 0.0000 220 VAL A N     
1648 C CA    . VAL A 223 ? 1.0785 1.1363 1.0232 0.0000 0.0000 0.0000 220 VAL A CA    
1649 C C     . VAL A 223 ? 1.0827 1.1230 1.0157 0.0000 0.0000 0.0000 220 VAL A C     
1650 O O     . VAL A 223 ? 1.0837 1.1252 1.0117 0.0000 0.0000 0.0000 220 VAL A O     
1651 C CB    . VAL A 223 ? 1.0926 1.1359 1.0281 0.0000 0.0000 0.0000 220 VAL A CB    
1652 C CG1   . VAL A 223 ? 1.0887 1.1324 1.0160 0.0000 0.0000 0.0000 220 VAL A CG1   
1653 C CG2   . VAL A 223 ? 1.1105 1.1616 1.0547 0.0000 0.0000 0.0000 220 VAL A CG2   
1654 N N     . GLU A 224 ? 1.0875 1.1106 1.0152 0.0000 0.0000 0.0000 221 GLU A N     
1655 C CA    . GLU A 224 ? 1.0882 1.0900 0.9992 0.0000 0.0000 0.0000 221 GLU A CA    
1656 C C     . GLU A 224 ? 1.0790 1.0887 0.9911 0.0000 0.0000 0.0000 221 GLU A C     
1657 O O     . GLU A 224 ? 1.0802 1.0831 0.9822 0.0000 0.0000 0.0000 221 GLU A O     
1658 C CB    . GLU A 224 ? 1.1016 1.0850 1.0062 0.0000 0.0000 0.0000 221 GLU A CB    
1659 C CG    . GLU A 224 ? 1.0931 1.0658 0.9964 0.0000 0.0000 0.0000 221 GLU A CG    
1660 C CD    . GLU A 224 ? 1.0738 1.0272 0.9600 0.0000 0.0000 0.0000 221 GLU A CD    
1661 O OE1   . GLU A 224 ? 1.0560 1.0107 0.9363 0.0000 0.0000 0.0000 221 GLU A OE1   
1662 O OE2   . GLU A 224 ? 1.0913 1.0284 0.9715 0.0000 0.0000 0.0000 221 GLU A OE2   
1663 N N     . ARG A 225 ? 1.0694 1.0942 0.9956 0.0000 0.0000 0.0000 222 ARG A N     
1664 C CA    . ARG A 225 ? 1.0677 1.0984 0.9952 0.0000 0.0000 0.0000 222 ARG A CA    
1665 C C     . ARG A 225 ? 1.0621 1.1067 0.9924 0.0000 0.0000 0.0000 222 ARG A C     
1666 O O     . ARG A 225 ? 1.0680 1.1104 0.9939 0.0000 0.0000 0.0000 222 ARG A O     
1667 C CB    . ARG A 225 ? 1.0602 1.1049 1.0047 0.0000 0.0000 0.0000 222 ARG A CB    
1668 C CG    . ARG A 225 ? 1.0524 1.0957 0.9955 0.0000 0.0000 0.0000 222 ARG A CG    
1669 C CD    . ARG A 225 ? 1.0782 1.0940 0.9974 0.0000 0.0000 0.0000 222 ARG A CD    
1670 N NE    . ARG A 225 ? 1.1059 1.1171 1.0231 0.0000 0.0000 0.0000 222 ARG A NE    
1671 C CZ    . ARG A 225 ? 1.1054 1.1226 1.0229 0.0000 0.0000 0.0000 222 ARG A CZ    
1672 N NH1   . ARG A 225 ? 1.0969 1.1264 1.0175 0.0000 0.0000 0.0000 222 ARG A NH1   
1673 N NH2   . ARG A 225 ? 1.1065 1.1159 1.0212 0.0000 0.0000 0.0000 222 ARG A NH2   
1674 N N     . LYS A 226 ? 1.0606 1.1178 0.9970 0.0000 0.0000 0.0000 223 LYS A N     
1675 C CA    . LYS A 226 ? 1.0587 1.1273 0.9963 0.0000 0.0000 0.0000 223 LYS A CA    
1676 C C     . LYS A 226 ? 1.0673 1.1215 0.9940 0.0000 0.0000 0.0000 223 LYS A C     
1677 O O     . LYS A 226 ? 1.0619 1.1220 0.9904 0.0000 0.0000 0.0000 223 LYS A O     
1678 C CB    . LYS A 226 ? 1.0537 1.1390 0.9984 0.0000 0.0000 0.0000 223 LYS A CB    
1679 C CG    . LYS A 226 ? 1.0538 1.1582 1.0043 0.0000 0.0000 0.0000 223 LYS A CG    
1680 C CD    . LYS A 226 ? 1.0751 1.1884 1.0335 0.0000 0.0000 0.0000 223 LYS A CD    
1681 C CE    . LYS A 226 ? 1.0895 1.2234 1.0549 0.0000 0.0000 0.0000 223 LYS A CE    
1682 N NZ    . LYS A 226 ? 1.1062 1.2494 1.0696 0.0000 0.0000 0.0000 223 LYS A NZ    
1683 N N     . ASN A 227 ? 1.0842 1.1198 1.0011 0.0000 0.0000 0.0000 224 ASN A N     
1684 C CA    . ASN A 227 ? 1.1053 1.1260 1.0119 0.0000 0.0000 0.0000 224 ASN A CA    
1685 C C     . ASN A 227 ? 1.1195 1.1323 1.0188 0.0000 0.0000 0.0000 224 ASN A C     
1686 O O     . ASN A 227 ? 1.1191 1.1350 1.0200 0.0000 0.0000 0.0000 224 ASN A O     
1687 C CB    . ASN A 227 ? 1.1204 1.1190 1.0150 0.0000 0.0000 0.0000 224 ASN A CB    
1688 C CG    . ASN A 227 ? 1.1224 1.1253 1.0225 0.0000 0.0000 0.0000 224 ASN A CG    
1689 O OD1   . ASN A 227 ? 1.1114 1.1327 1.0215 0.0000 0.0000 0.0000 224 ASN A OD1   
1690 N ND2   . ASN A 227 ? 1.1526 1.1365 1.0439 0.0000 0.0000 0.0000 224 ASN A ND2   
1691 N N     . SER A 228 ? 1.1391 1.1417 1.0311 0.0000 0.0000 0.0000 225 SER A N     
1692 C CA    . SER A 228 ? 1.1614 1.1534 1.0432 0.0000 0.0000 0.0000 225 SER A CA    
1693 C C     . SER A 228 ? 1.1533 1.1642 1.0476 0.0000 0.0000 0.0000 225 SER A C     
1694 O O     . SER A 228 ? 1.1599 1.1672 1.0509 0.0000 0.0000 0.0000 225 SER A O     
1695 C CB    . SER A 228 ? 1.1681 1.1521 1.0455 0.0000 0.0000 0.0000 225 SER A CB    
1696 O OG    . SER A 228 ? 1.2098 1.1718 1.0676 0.0000 0.0000 0.0000 225 SER A OG    
1697 N N     . ASP A 229 ? 1.1459 1.1772 1.0554 0.0000 0.0000 0.0000 226 ASP A N     
1698 C CA    . ASP A 229 ? 1.1443 1.1927 1.0649 0.0000 0.0000 0.0000 226 ASP A CA    
1699 C C     . ASP A 229 ? 1.1306 1.1906 1.0592 0.0000 0.0000 0.0000 226 ASP A C     
1700 O O     . ASP A 229 ? 1.1246 1.1920 1.0594 0.0000 0.0000 0.0000 226 ASP A O     
1701 C CB    . ASP A 229 ? 1.1447 1.2113 1.0778 0.0000 0.0000 0.0000 226 ASP A CB    
1702 C CG    . ASP A 229 ? 1.1897 1.2500 1.1212 0.0000 0.0000 0.0000 226 ASP A CG    
1703 O OD1   . ASP A 229 ? 1.2397 1.2779 1.1571 0.0000 0.0000 0.0000 226 ASP A OD1   
1704 O OD2   . ASP A 229 ? 1.2295 1.3052 1.1720 0.0000 0.0000 0.0000 226 ASP A OD2   
1705 N N     . ILE A 230 ? 1.1238 1.1851 1.0535 0.0000 0.0000 0.0000 227 ILE A N     
1706 C CA    . ILE A 230 ? 1.1154 1.1850 1.0528 0.0000 0.0000 0.0000 227 ILE A CA    
1707 C C     . ILE A 230 ? 1.1241 1.1807 1.0564 0.0000 0.0000 0.0000 227 ILE A C     
1708 O O     . ILE A 230 ? 1.1212 1.1880 1.0635 0.0000 0.0000 0.0000 227 ILE A O     
1709 C CB    . ILE A 230 ? 1.1151 1.1837 1.0519 0.0000 0.0000 0.0000 227 ILE A CB    
1710 C CG1   . ILE A 230 ? 1.1053 1.1879 1.0465 0.0000 0.0000 0.0000 227 ILE A CG1   
1711 C CG2   . ILE A 230 ? 1.1146 1.1903 1.0603 0.0000 0.0000 0.0000 227 ILE A CG2   
1712 C CD1   . ILE A 230 ? 1.1092 1.1850 1.0453 0.0000 0.0000 0.0000 227 ILE A CD1   
1713 N N     . LYS A 231 ? 1.1326 1.1666 1.0491 0.0000 0.0000 0.0000 228 LYS A N     
1714 C CA    . LYS A 231 ? 1.1420 1.1611 1.0496 0.0000 0.0000 0.0000 228 LYS A CA    
1715 C C     . LYS A 231 ? 1.1419 1.1611 1.0483 0.0000 0.0000 0.0000 228 LYS A C     
1716 O O     . LYS A 231 ? 1.1465 1.1701 1.0598 0.0000 0.0000 0.0000 228 LYS A O     
1717 C CB    . LYS A 231 ? 1.1614 1.1520 1.0461 0.0000 0.0000 0.0000 228 LYS A CB    
1718 C CG    . LYS A 231 ? 1.1701 1.1543 1.0544 0.0000 0.0000 0.0000 228 LYS A CG    
1719 C CD    . LYS A 231 ? 1.1986 1.1528 1.0584 0.0000 0.0000 0.0000 228 LYS A CD    
1720 C CE    . LYS A 231 ? 1.2305 1.1725 1.0865 0.0000 0.0000 0.0000 228 LYS A CE    
1721 N NZ    . LYS A 231 ? 1.2927 1.2048 1.1223 0.0000 0.0000 0.0000 228 LYS A NZ    
1722 N N     . ARG A 232 ? 1.1396 1.1546 1.0391 0.0000 0.0000 0.0000 229 ARG A N     
1723 C CA    . ARG A 232 ? 1.1457 1.1571 1.0419 0.0000 0.0000 0.0000 229 ARG A CA    
1724 C C     . ARG A 232 ? 1.1304 1.1665 1.0495 0.0000 0.0000 0.0000 229 ARG A C     
1725 O O     . ARG A 232 ? 1.1398 1.1741 1.0606 0.0000 0.0000 0.0000 229 ARG A O     
1726 C CB    . ARG A 232 ? 1.1497 1.1528 1.0371 0.0000 0.0000 0.0000 229 ARG A CB    
1727 C CG    . ARG A 232 ? 1.1647 1.1563 1.0433 0.0000 0.0000 0.0000 229 ARG A CG    
1728 C CD    . ARG A 232 ? 1.2087 1.1853 1.0749 0.0000 0.0000 0.0000 229 ARG A CD    
1729 N NE    . ARG A 232 ? 1.2286 1.2266 1.1137 0.0000 0.0000 0.0000 229 ARG A NE    
1730 C CZ    . ARG A 232 ? 1.2398 1.2432 1.1317 0.0000 0.0000 0.0000 229 ARG A CZ    
1731 N NH1   . ARG A 232 ? 1.2597 1.2471 1.1409 0.0000 0.0000 0.0000 229 ARG A NH1   
1732 N NH2   . ARG A 232 ? 1.2219 1.2451 1.1303 0.0000 0.0000 0.0000 229 ARG A NH2   
1733 N N     . LEU A 233 ? 1.1093 1.1679 1.0452 0.0000 0.0000 0.0000 230 LEU A N     
1734 C CA    . LEU A 233 ? 1.0945 1.1768 1.0516 0.0000 0.0000 0.0000 230 LEU A CA    
1735 C C     . LEU A 233 ? 1.0933 1.1867 1.0654 0.0000 0.0000 0.0000 230 LEU A C     
1736 O O     . LEU A 233 ? 1.0909 1.1972 1.0787 0.0000 0.0000 0.0000 230 LEU A O     
1737 C CB    . LEU A 233 ? 1.0783 1.1794 1.0452 0.0000 0.0000 0.0000 230 LEU A CB    
1738 C CG    . LEU A 233 ? 1.0662 1.1905 1.0525 0.0000 0.0000 0.0000 230 LEU A CG    
1739 C CD1   . LEU A 233 ? 1.0792 1.2022 1.0652 0.0000 0.0000 0.0000 230 LEU A CD1   
1740 C CD2   . LEU A 233 ? 1.0630 1.2038 1.0552 0.0000 0.0000 0.0000 230 LEU A CD2   
1741 N N     . LEU A 234 ? 1.0928 1.1819 1.0623 0.0000 0.0000 0.0000 231 LEU A N     
1742 C CA    . LEU A 234 ? 1.0934 1.1903 1.0772 0.0000 0.0000 0.0000 231 LEU A CA    
1743 C C     . LEU A 234 ? 1.1092 1.1943 1.0886 0.0000 0.0000 0.0000 231 LEU A C     
1744 O O     . LEU A 234 ? 1.1129 1.2134 1.1128 0.0000 0.0000 0.0000 231 LEU A O     
1745 C CB    . LEU A 234 ? 1.0967 1.1846 1.0743 0.0000 0.0000 0.0000 231 LEU A CB    
1746 C CG    . LEU A 234 ? 1.0849 1.1863 1.0704 0.0000 0.0000 0.0000 231 LEU A CG    
1747 C CD1   . LEU A 234 ? 1.0817 1.1647 1.0521 0.0000 0.0000 0.0000 231 LEU A CD1   
1748 C CD2   . LEU A 234 ? 1.0886 1.2119 1.0988 0.0000 0.0000 0.0000 231 LEU A CD2   
1749 N N     . THR A 235 ? 1.1223 1.1798 1.0748 0.0000 0.0000 0.0000 232 THR A N     
1750 C CA    . THR A 235 ? 1.1421 1.1834 1.0828 0.0000 0.0000 0.0000 232 THR A CA    
1751 C C     . THR A 235 ? 1.1424 1.1978 1.0984 0.0000 0.0000 0.0000 232 THR A C     
1752 O O     . THR A 235 ? 1.1506 1.2136 1.1202 0.0000 0.0000 0.0000 232 THR A O     
1753 C CB    . THR A 235 ? 1.1582 1.1664 1.0636 0.0000 0.0000 0.0000 232 THR A CB    
1754 O OG1   . THR A 235 ? 1.1612 1.1552 1.0530 0.0000 0.0000 0.0000 232 THR A OG1   
1755 C CG2   . THR A 235 ? 1.1859 1.1744 1.0741 0.0000 0.0000 0.0000 232 THR A CG2   
1756 N N     . LYS A 236 ? 1.1332 1.1927 1.0888 0.0000 0.0000 0.0000 233 LYS A N     
1757 C CA    . LYS A 236 ? 1.1292 1.1971 1.0953 0.0000 0.0000 0.0000 233 LYS A CA    
1758 C C     . LYS A 236 ? 1.1193 1.2193 1.1204 0.0000 0.0000 0.0000 233 LYS A C     
1759 O O     . LYS A 236 ? 1.1249 1.2325 1.1394 0.0000 0.0000 0.0000 233 LYS A O     
1760 C CB    . LYS A 236 ? 1.1175 1.1840 1.0774 0.0000 0.0000 0.0000 233 LYS A CB    
1761 C CG    . LYS A 236 ? 1.1302 1.1656 1.0594 0.0000 0.0000 0.0000 233 LYS A CG    
1762 C CD    . LYS A 236 ? 1.1306 1.1677 1.0604 0.0000 0.0000 0.0000 233 LYS A CD    
1763 C CE    . LYS A 236 ? 1.1277 1.1401 1.0330 0.0000 0.0000 0.0000 233 LYS A CE    
1764 N NZ    . LYS A 236 ? 1.1166 1.1432 1.0321 0.0000 0.0000 0.0000 233 LYS A NZ    
1765 N N     . LEU A 237 ? 1.1104 1.2285 1.1264 0.0000 0.0000 0.0000 234 LEU A N     
1766 C CA    . LEU A 237 ? 1.1072 1.2560 1.1565 0.0000 0.0000 0.0000 234 LEU A CA    
1767 C C     . LEU A 237 ? 1.1224 1.2782 1.1888 0.0000 0.0000 0.0000 234 LEU A C     
1768 O O     . LEU A 237 ? 1.1173 1.2992 1.2155 0.0000 0.0000 0.0000 234 LEU A O     
1769 C CB    . LEU A 237 ? 1.0892 1.2529 1.1450 0.0000 0.0000 0.0000 234 LEU A CB    
1770 C CG    . LEU A 237 ? 1.0839 1.2501 1.1330 0.0000 0.0000 0.0000 234 LEU A CG    
1771 C CD1   . LEU A 237 ? 1.0765 1.2571 1.1297 0.0000 0.0000 0.0000 234 LEU A CD1   
1772 C CD2   . LEU A 237 ? 1.0987 1.2762 1.1636 0.0000 0.0000 0.0000 234 LEU A CD2   
1773 N N     . LEU A 238 ? 1.1473 1.2796 1.1929 0.0000 0.0000 0.0000 235 LEU A N     
1774 C CA    . LEU A 238 ? 1.1682 1.3046 1.2273 0.0000 0.0000 0.0000 235 LEU A CA    
1775 C C     . LEU A 238 ? 1.2011 1.3221 1.2500 0.0000 0.0000 0.0000 235 LEU A C     
1776 O O     . LEU A 238 ? 1.2180 1.3384 1.2737 0.0000 0.0000 0.0000 235 LEU A O     
1777 C CB    . LEU A 238 ? 1.1702 1.2923 1.2149 0.0000 0.0000 0.0000 235 LEU A CB    
1778 C CG    . LEU A 238 ? 1.1455 1.2825 1.2022 0.0000 0.0000 0.0000 235 LEU A CG    
1779 C CD1   . LEU A 238 ? 1.1590 1.2753 1.1970 0.0000 0.0000 0.0000 235 LEU A CD1   
1780 C CD2   . LEU A 238 ? 1.1311 1.3000 1.2269 0.0000 0.0000 0.0000 235 LEU A CD2   
1781 N N     . VAL A 239 ? 1.2216 1.3287 1.2531 0.0000 0.0000 0.0000 236 VAL A N     
1782 C CA    . VAL A 239 ? 1.2586 1.3483 1.2766 0.0000 0.0000 0.0000 236 VAL A CA    
1783 C C     . VAL A 239 ? 1.2655 1.3852 1.3242 0.0000 0.0000 0.0000 236 VAL A C     
1784 O O     . VAL A 239 ? 1.2509 1.3999 1.3420 0.0000 0.0000 0.0000 236 VAL A O     
1785 C CB    . VAL A 239 ? 1.2655 1.3355 1.2603 0.0000 0.0000 0.0000 236 VAL A CB    
1786 C CG1   . VAL A 239 ? 1.3052 1.3450 1.2709 0.0000 0.0000 0.0000 236 VAL A CG1   
1787 C CG2   . VAL A 239 ? 1.2569 1.3104 1.2264 0.0000 0.0000 0.0000 236 VAL A CG2   
1788 N N     . GLY A 240 ? 1.2963 1.4100 1.3550 0.0000 0.0000 0.0000 237 GLY A N     
1789 C CA    . GLY A 240 ? 1.3116 1.4575 1.4149 0.0000 0.0000 0.0000 237 GLY A CA    
1790 C C     . GLY A 240 ? 1.3116 1.4829 1.4471 0.0000 0.0000 0.0000 237 GLY A C     
1791 O O     . GLY A 240 ? 1.3316 1.5041 1.4759 0.0000 0.0000 0.0000 237 GLY A O     
1792 N N     . ARG A 241 ? 1.3012 1.4904 1.4520 0.0000 0.0000 0.0000 238 ARG A N     
1793 C CA    . ARG A 241 ? 1.3025 1.5150 1.4838 0.0000 0.0000 0.0000 238 ARG A CA    
1794 C C     . ARG A 241 ? 1.3235 1.5138 1.4833 0.0000 0.0000 0.0000 238 ARG A C     
1795 O O     . ARG A 241 ? 1.3353 1.4916 1.4524 0.0000 0.0000 0.0000 238 ARG A O     
1796 C CB    . ARG A 241 ? 1.2798 1.5091 1.4715 0.0000 0.0000 0.0000 238 ARG A CB    
1797 C CG    . ARG A 241 ? 1.2804 1.5188 1.4759 0.0000 0.0000 0.0000 238 ARG A CG    
1798 C CD    . ARG A 241 ? 1.2926 1.5613 1.5176 0.0000 0.0000 0.0000 238 ARG A CD    
1799 N NE    . ARG A 241 ? 1.3170 1.6086 1.5716 0.0000 0.0000 0.0000 238 ARG A NE    
1800 C CZ    . ARG A 241 ? 1.3353 1.6183 1.5764 0.0000 0.0000 0.0000 238 ARG A CZ    
1801 N NH1   . ARG A 241 ? 1.3485 1.6022 1.5483 0.0000 0.0000 0.0000 238 ARG A NH1   
1802 N NH2   . ARG A 241 ? 1.3388 1.6428 1.6097 0.0000 0.0000 0.0000 238 ARG A NH2   
1803 N N     . PRO A 242 ? 1.3323 1.5409 1.5222 0.0000 0.0000 0.0000 239 PRO A N     
1804 C CA    . PRO A 242 ? 1.3528 1.5410 1.5244 0.0000 0.0000 0.0000 239 PRO A CA    
1805 C C     . PRO A 242 ? 1.3522 1.5283 1.5007 0.0000 0.0000 0.0000 239 PRO A C     
1806 O O     . PRO A 242 ? 1.3374 1.5330 1.5003 0.0000 0.0000 0.0000 239 PRO A O     
1807 C CB    . PRO A 242 ? 1.3493 1.5658 1.5665 0.0000 0.0000 0.0000 239 PRO A CB    
1808 C CG    . PRO A 242 ? 1.3434 1.5911 1.5999 0.0000 0.0000 0.0000 239 PRO A CG    
1809 C CD    . PRO A 242 ? 1.3250 1.5731 1.5689 0.0000 0.0000 0.0000 239 PRO A CD    
1810 N N     . THR A 243 ? 1.3764 1.5208 1.4898 0.0000 0.0000 0.0000 240 THR A N     
1811 C CA    . THR A 243 ? 1.3782 1.5074 1.4658 0.0000 0.0000 0.0000 240 THR A CA    
1812 C C     . THR A 243 ? 1.3733 1.5189 1.4806 0.0000 0.0000 0.0000 240 THR A C     
1813 O O     . THR A 243 ? 1.3848 1.5152 1.4822 0.0000 0.0000 0.0000 240 THR A O     
1814 C CB    . THR A 243 ? 1.3982 1.4893 1.4459 0.0000 0.0000 0.0000 240 THR A CB    
1815 O OG1   . THR A 243 ? 1.4125 1.4978 1.4672 0.0000 0.0000 0.0000 240 THR A OG1   
1816 C CG2   . THR A 243 ? 1.4135 1.4837 1.4365 0.0000 0.0000 0.0000 240 THR A CG2   
1817 N N     . LYS A 244 ? 1.3641 1.5383 1.4969 0.0000 0.0000 0.0000 241 LYS A N     
1818 C CA    . LYS A 244 ? 1.3614 1.5504 1.5096 0.0000 0.0000 0.0000 241 LYS A CA    
1819 C C     . LYS A 244 ? 1.3496 1.5331 1.4752 0.0000 0.0000 0.0000 241 LYS A C     
1820 O O     . LYS A 244 ? 1.3412 1.5446 1.4787 0.0000 0.0000 0.0000 241 LYS A O     
1821 C CB    . LYS A 244 ? 1.3567 1.5817 1.5492 0.0000 0.0000 0.0000 241 LYS A CB    
1822 C CG    . LYS A 244 ? 1.3734 1.6077 1.5942 0.0000 0.0000 0.0000 241 LYS A CG    
1823 C CD    . LYS A 244 ? 1.3819 1.6545 1.6510 0.0000 0.0000 0.0000 241 LYS A CD    
1824 C CE    . LYS A 244 ? 1.3910 1.6767 1.6818 0.0000 0.0000 0.0000 241 LYS A CE    
1825 N NZ    . LYS A 244 ? 1.3961 1.7212 1.7409 0.0000 0.0000 0.0000 241 LYS A NZ    
1826 N N     . TRP A 245 ? 1.3505 1.5071 1.4445 0.0000 0.0000 0.0000 242 TRP A N     
1827 C CA    . TRP A 245 ? 1.3366 1.4868 1.4086 0.0000 0.0000 0.0000 242 TRP A CA    
1828 C C     . TRP A 245 ? 1.3335 1.4914 1.4070 0.0000 0.0000 0.0000 242 TRP A C     
1829 O O     . TRP A 245 ? 1.3282 1.4914 1.3928 0.0000 0.0000 0.0000 242 TRP A O     
1830 C CB    . TRP A 245 ? 1.3433 1.4634 1.3829 0.0000 0.0000 0.0000 242 TRP A CB    
1831 C CG    . TRP A 245 ? 1.3524 1.4525 1.3831 0.0000 0.0000 0.0000 242 TRP A CG    
1832 C CD1   . TRP A 245 ? 1.3676 1.4548 1.3972 0.0000 0.0000 0.0000 242 TRP A CD1   
1833 C CD2   . TRP A 245 ? 1.3469 1.4351 1.3666 0.0000 0.0000 0.0000 242 TRP A CD2   
1834 N NE1   . TRP A 245 ? 1.3741 1.4417 1.3934 0.0000 0.0000 0.0000 242 TRP A NE1   
1835 C CE2   . TRP A 245 ? 1.3601 1.4275 1.3734 0.0000 0.0000 0.0000 242 TRP A CE2   
1836 C CE3   . TRP A 245 ? 1.3366 1.4281 1.3497 0.0000 0.0000 0.0000 242 TRP A CE3   
1837 C CZ2   . TRP A 245 ? 1.3672 1.4163 1.3687 0.0000 0.0000 0.0000 242 TRP A CZ2   
1838 C CZ3   . TRP A 245 ? 1.3429 1.4166 1.3435 0.0000 0.0000 0.0000 242 TRP A CZ3   
1839 C CH2   . TRP A 245 ? 1.3502 1.4025 1.3456 0.0000 0.0000 0.0000 242 TRP A CH2   
1840 N N     . TYR A 246 ? 1.3399 1.4968 1.4231 0.0000 0.0000 0.0000 243 TYR A N     
1841 C CA    . TYR A 246 ? 1.3382 1.4969 1.4176 0.0000 0.0000 0.0000 243 TYR A CA    
1842 C C     . TYR A 246 ? 1.3196 1.5007 1.4060 0.0000 0.0000 0.0000 243 TYR A C     
1843 O O     . TYR A 246 ? 1.3197 1.4951 1.3852 0.0000 0.0000 0.0000 243 TYR A O     
1844 C CB    . TYR A 246 ? 1.3547 1.5151 1.4522 0.0000 0.0000 0.0000 243 TYR A CB    
1845 C CG    . TYR A 246 ? 1.3742 1.5308 1.4630 0.0000 0.0000 0.0000 243 TYR A CG    
1846 C CD1   . TYR A 246 ? 1.4000 1.5287 1.4645 0.0000 0.0000 0.0000 243 TYR A CD1   
1847 C CD2   . TYR A 246 ? 1.3838 1.5627 1.4866 0.0000 0.0000 0.0000 243 TYR A CD2   
1848 C CE1   . TYR A 246 ? 1.4213 1.5429 1.4740 0.0000 0.0000 0.0000 243 TYR A CE1   
1849 C CE2   . TYR A 246 ? 1.4085 1.5804 1.4979 0.0000 0.0000 0.0000 243 TYR A CE2   
1850 C CZ    . TYR A 246 ? 1.4279 1.5705 1.4916 0.0000 0.0000 0.0000 243 TYR A CZ    
1851 O OH    . TYR A 246 ? 1.4614 1.5937 1.5084 0.0000 0.0000 0.0000 243 TYR A OH    
1852 N N     . ASP A 247 ? 1.3018 1.5080 1.4175 0.0000 0.0000 0.0000 244 ASP A N     
1853 C CA    . ASP A 247 ? 1.2841 1.5114 1.4076 0.0000 0.0000 0.0000 244 ASP A CA    
1854 C C     . ASP A 247 ? 1.2585 1.4841 1.3667 0.0000 0.0000 0.0000 244 ASP A C     
1855 O O     . ASP A 247 ? 1.2581 1.4953 1.3643 0.0000 0.0000 0.0000 244 ASP A O     
1856 C CB    . ASP A 247 ? 1.2859 1.5417 1.4485 0.0000 0.0000 0.0000 244 ASP A CB    
1857 C CG    . ASP A 247 ? 1.3182 1.5767 1.5021 0.0000 0.0000 0.0000 244 ASP A CG    
1858 O OD1   . ASP A 247 ? 1.3455 1.6144 1.5406 0.0000 0.0000 0.0000 244 ASP A OD1   
1859 O OD2   . ASP A 247 ? 1.3594 1.6079 1.5473 0.0000 0.0000 0.0000 244 ASP A OD2   
1860 N N     . LEU A 248 ? 1.2355 1.4455 1.3317 0.0000 0.0000 0.0000 245 LEU A N     
1861 C CA    . LEU A 248 ? 1.2094 1.4156 1.2911 0.0000 0.0000 0.0000 245 LEU A CA    
1862 C C     . LEU A 248 ? 1.2022 1.3941 1.2559 0.0000 0.0000 0.0000 245 LEU A C     
1863 O O     . LEU A 248 ? 1.1986 1.3945 1.2446 0.0000 0.0000 0.0000 245 LEU A O     
1864 C CB    . LEU A 248 ? 1.2076 1.4021 1.2863 0.0000 0.0000 0.0000 245 LEU A CB    
1865 C CG    . LEU A 248 ? 1.1934 1.4048 1.2984 0.0000 0.0000 0.0000 245 LEU A CG    
1866 C CD1   . LEU A 248 ? 1.1956 1.3895 1.2885 0.0000 0.0000 0.0000 245 LEU A CD1   
1867 C CD2   . LEU A 248 ? 1.1738 1.4048 1.2903 0.0000 0.0000 0.0000 245 LEU A CD2   
1868 N N     . LEU A 249 ? 1.1946 1.3703 1.2347 0.0000 0.0000 0.0000 246 LEU A N     
1869 C CA    . LEU A 249 ? 1.1789 1.3406 1.1946 0.0000 0.0000 0.0000 246 LEU A CA    
1870 C C     . LEU A 249 ? 1.1647 1.3381 1.1739 0.0000 0.0000 0.0000 246 LEU A C     
1871 O O     . LEU A 249 ? 1.1583 1.3287 1.1572 0.0000 0.0000 0.0000 246 LEU A O     
1872 C CB    . LEU A 249 ? 1.1936 1.3394 1.1992 0.0000 0.0000 0.0000 246 LEU A CB    
1873 C CG    . LEU A 249 ? 1.1965 1.3213 1.1960 0.0000 0.0000 0.0000 246 LEU A CG    
1874 C CD1   . LEU A 249 ? 1.2140 1.3235 1.2050 0.0000 0.0000 0.0000 246 LEU A CD1   
1875 C CD2   . LEU A 249 ? 1.1915 1.3034 1.1744 0.0000 0.0000 0.0000 246 LEU A CD2   
1876 N N     . PRO A 250 ? 1.1588 1.3449 1.1735 0.0000 0.0000 0.0000 247 PRO A N     
1877 C CA    . PRO A 250 ? 1.1503 1.3473 1.1572 0.0000 0.0000 0.0000 247 PRO A CA    
1878 C C     . PRO A 250 ? 1.1303 1.3352 1.1419 0.0000 0.0000 0.0000 247 PRO A C     
1879 O O     . PRO A 250 ? 1.1300 1.3315 1.1272 0.0000 0.0000 0.0000 247 PRO A O     
1880 C CB    . PRO A 250 ? 1.1582 1.3703 1.1784 0.0000 0.0000 0.0000 247 PRO A CB    
1881 C CG    . PRO A 250 ? 1.1627 1.3723 1.1999 0.0000 0.0000 0.0000 247 PRO A CG    
1882 C CD    . PRO A 250 ? 1.1680 1.3563 1.1929 0.0000 0.0000 0.0000 247 PRO A CD    
1883 N N     . VAL A 251 ? 1.1118 1.3264 1.1440 0.0000 0.0000 0.0000 248 VAL A N     
1884 C CA    . VAL A 251 ? 1.0929 1.3122 1.1291 0.0000 0.0000 0.0000 248 VAL A CA    
1885 C C     . VAL A 251 ? 1.0839 1.2861 1.1038 0.0000 0.0000 0.0000 248 VAL A C     
1886 O O     . VAL A 251 ? 1.0824 1.2845 1.0935 0.0000 0.0000 0.0000 248 VAL A O     
1887 C CB    . VAL A 251 ? 1.0876 1.3163 1.1476 0.0000 0.0000 0.0000 248 VAL A CB    
1888 C CG1   . VAL A 251 ? 1.0816 1.3211 1.1489 0.0000 0.0000 0.0000 248 VAL A CG1   
1889 C CG2   . VAL A 251 ? 1.0913 1.3334 1.1714 0.0000 0.0000 0.0000 248 VAL A CG2   
1890 N N     . VAL A 252 ? 1.0759 1.2634 1.0923 0.0000 0.0000 0.0000 249 VAL A N     
1891 C CA    . VAL A 252 ? 1.0680 1.2383 1.0692 0.0000 0.0000 0.0000 249 VAL A CA    
1892 C C     . VAL A 252 ? 1.0685 1.2382 1.0563 0.0000 0.0000 0.0000 249 VAL A C     
1893 O O     . VAL A 252 ? 1.0632 1.2316 1.0459 0.0000 0.0000 0.0000 249 VAL A O     
1894 C CB    . VAL A 252 ? 1.0763 1.2295 1.0725 0.0000 0.0000 0.0000 249 VAL A CB    
1895 C CG1   . VAL A 252 ? 1.0709 1.2060 1.0516 0.0000 0.0000 0.0000 249 VAL A CG1   
1896 C CG2   . VAL A 252 ? 1.0729 1.2279 1.0829 0.0000 0.0000 0.0000 249 VAL A CG2   
1897 N N     . GLN A 253 ? 1.0721 1.2423 1.0543 0.0000 0.0000 0.0000 250 GLN A N     
1898 C CA    . GLN A 253 ? 1.0754 1.2446 1.0436 0.0000 0.0000 0.0000 250 GLN A CA    
1899 C C     . GLN A 253 ? 1.0664 1.2477 1.0337 0.0000 0.0000 0.0000 250 GLN A C     
1900 O O     . GLN A 253 ? 1.0614 1.2400 1.0245 0.0000 0.0000 0.0000 250 GLN A O     
1901 C CB    . GLN A 253 ? 1.0895 1.2580 1.0506 0.0000 0.0000 0.0000 250 GLN A CB    
1902 C CG    . GLN A 253 ? 1.1116 1.2709 1.0561 0.0000 0.0000 0.0000 250 GLN A CG    
1903 C CD    . GLN A 253 ? 1.1582 1.3152 1.0909 0.0000 0.0000 0.0000 250 GLN A CD    
1904 O OE1   . GLN A 253 ? 1.1905 1.3334 1.1175 0.0000 0.0000 0.0000 250 GLN A OE1   
1905 N NE2   . GLN A 253 ? 1.1672 1.3355 1.0938 0.0000 0.0000 0.0000 250 GLN A NE2   
1906 N N     . LEU A 254 ? 1.0648 1.2591 1.0374 0.0000 0.0000 0.0000 251 LEU A N     
1907 C CA    . LEU A 254 ? 1.0615 1.2664 1.0339 0.0000 0.0000 0.0000 251 LEU A CA    
1908 C C     . LEU A 254 ? 1.0564 1.2579 1.0348 0.0000 0.0000 0.0000 251 LEU A C     
1909 O O     . LEU A 254 ? 1.0598 1.2616 1.0321 0.0000 0.0000 0.0000 251 LEU A O     
1910 C CB    . LEU A 254 ? 1.0609 1.2792 1.0432 0.0000 0.0000 0.0000 251 LEU A CB    
1911 C CG    . LEU A 254 ? 1.0624 1.2897 1.0336 0.0000 0.0000 0.0000 251 LEU A CG    
1912 C CD1   . LEU A 254 ? 1.0599 1.3008 1.0471 0.0000 0.0000 0.0000 251 LEU A CD1   
1913 C CD2   . LEU A 254 ? 1.0506 1.2784 1.0106 0.0000 0.0000 0.0000 251 LEU A CD2   
1914 N N     . ALA A 255 ? 1.0548 1.2523 1.0445 0.0000 0.0000 0.0000 252 ALA A N     
1915 C CA    . ALA A 255 ? 1.0571 1.2480 1.0500 0.0000 0.0000 0.0000 252 ALA A CA    
1916 C C     . ALA A 255 ? 1.0656 1.2451 1.0488 0.0000 0.0000 0.0000 252 ALA A C     
1917 O O     . ALA A 255 ? 1.0653 1.2442 1.0471 0.0000 0.0000 0.0000 252 ALA A O     
1918 C CB    . ALA A 255 ? 1.0536 1.2382 1.0554 0.0000 0.0000 0.0000 252 ALA A CB    
1919 N N     . LEU A 256 ? 1.0782 1.2488 1.0560 0.0000 0.0000 0.0000 253 LEU A N     
1920 C CA    . LEU A 256 ? 1.0923 1.2526 1.0641 0.0000 0.0000 0.0000 253 LEU A CA    
1921 C C     . LEU A 256 ? 1.1021 1.2712 1.0708 0.0000 0.0000 0.0000 253 LEU A C     
1922 O O     . LEU A 256 ? 1.1052 1.2712 1.0749 0.0000 0.0000 0.0000 253 LEU A O     
1923 C CB    . LEU A 256 ? 1.0945 1.2423 1.0616 0.0000 0.0000 0.0000 253 LEU A CB    
1924 C CG    . LEU A 256 ? 1.1065 1.2406 1.0733 0.0000 0.0000 0.0000 253 LEU A CG    
1925 C CD1   . LEU A 256 ? 1.1276 1.2486 1.0878 0.0000 0.0000 0.0000 253 LEU A CD1   
1926 C CD2   . LEU A 256 ? 1.1051 1.2277 1.0685 0.0000 0.0000 0.0000 253 LEU A CD2   
1927 N N     . ASN A 257 ? 1.1152 1.2951 1.0801 0.0000 0.0000 0.0000 254 ASN A N     
1928 C CA    . ASN A 257 ? 1.1285 1.3158 1.0871 0.0000 0.0000 0.0000 254 ASN A CA    
1929 C C     . ASN A 257 ? 1.1394 1.3355 1.1000 0.0000 0.0000 0.0000 254 ASN A C     
1930 O O     . ASN A 257 ? 1.1446 1.3463 1.1028 0.0000 0.0000 0.0000 254 ASN A O     
1931 C CB    . ASN A 257 ? 1.1364 1.3273 1.0845 0.0000 0.0000 0.0000 254 ASN A CB    
1932 C CG    . ASN A 257 ? 1.1420 1.3223 1.0857 0.0000 0.0000 0.0000 254 ASN A CG    
1933 O OD1   . ASN A 257 ? 1.1435 1.3166 1.0910 0.0000 0.0000 0.0000 254 ASN A OD1   
1934 N ND2   . ASN A 257 ? 1.1373 1.3152 1.0730 0.0000 0.0000 0.0000 254 ASN A ND2   
1935 N N     . ASN A 258 ? 1.1517 1.3485 1.1175 0.0000 0.0000 0.0000 255 ASN A N     
1936 C CA    . ASN A 258 ? 1.1698 1.3716 1.1375 0.0000 0.0000 0.0000 255 ASN A CA    
1937 C C     . ASN A 258 ? 1.1777 1.3692 1.1532 0.0000 0.0000 0.0000 255 ASN A C     
1938 O O     . ASN A 258 ? 1.1880 1.3797 1.1661 0.0000 0.0000 0.0000 255 ASN A O     
1939 C CB    . ASN A 258 ? 1.1735 1.3837 1.1402 0.0000 0.0000 0.0000 255 ASN A CB    
1940 C CG    . ASN A 258 ? 1.1908 1.4096 1.1442 0.0000 0.0000 0.0000 255 ASN A CG    
1941 O OD1   . ASN A 258 ? 1.2171 1.4399 1.1621 0.0000 0.0000 0.0000 255 ASN A OD1   
1942 N ND2   . ASN A 258 ? 1.1997 1.4201 1.1498 0.0000 0.0000 0.0000 255 ASN A ND2   
1943 N N     . THR A 259 ? 1.1860 1.3663 1.1632 0.0000 0.0000 0.0000 256 THR A N     
1944 C CA    . THR A 259 ? 1.1986 1.3651 1.1788 0.0000 0.0000 0.0000 256 THR A CA    
1945 C C     . THR A 259 ? 1.2077 1.3731 1.1914 0.0000 0.0000 0.0000 256 THR A C     
1946 O O     . THR A 259 ? 1.2113 1.3794 1.1965 0.0000 0.0000 0.0000 256 THR A O     
1947 C CB    . THR A 259 ? 1.1975 1.3495 1.1750 0.0000 0.0000 0.0000 256 THR A CB    
1948 O OG1   . THR A 259 ? 1.2053 1.3593 1.1843 0.0000 0.0000 0.0000 256 THR A OG1   
1949 C CG2   . THR A 259 ? 1.2063 1.3403 1.1815 0.0000 0.0000 0.0000 256 THR A CG2   
1950 N N     . TYR A 260 ? 1.2204 1.3815 1.2071 0.0000 0.0000 0.0000 257 TYR A N     
1951 C CA    . TYR A 260 ? 1.2321 1.3930 1.2258 0.0000 0.0000 0.0000 257 TYR A CA    
1952 C C     . TYR A 260 ? 1.2305 1.3783 1.2259 0.0000 0.0000 0.0000 257 TYR A C     
1953 O O     . TYR A 260 ? 1.2442 1.3742 1.2324 0.0000 0.0000 0.0000 257 TYR A O     
1954 C CB    . TYR A 260 ? 1.2467 1.4004 1.2423 0.0000 0.0000 0.0000 257 TYR A CB    
1955 C CG    . TYR A 260 ? 1.2719 1.4390 1.2674 0.0000 0.0000 0.0000 257 TYR A CG    
1956 C CD1   . TYR A 260 ? 1.2944 1.4724 1.2961 0.0000 0.0000 0.0000 257 TYR A CD1   
1957 C CD2   . TYR A 260 ? 1.2999 1.4688 1.2894 0.0000 0.0000 0.0000 257 TYR A CD2   
1958 C CE1   . TYR A 260 ? 1.3224 1.5102 1.3200 0.0000 0.0000 0.0000 257 TYR A CE1   
1959 C CE2   . TYR A 260 ? 1.3208 1.5001 1.3074 0.0000 0.0000 0.0000 257 TYR A CE2   
1960 C CZ    . TYR A 260 ? 1.3344 1.5218 1.3229 0.0000 0.0000 0.0000 257 TYR A CZ    
1961 O OH    . TYR A 260 ? 1.3673 1.5628 1.3492 0.0000 0.0000 0.0000 257 TYR A OH    
1962 N N     . SER A 261 ? 1.2182 1.3744 1.2224 0.0000 0.0000 0.0000 258 SER A N     
1963 C CA    . SER A 261 ? 1.2087 1.3528 1.2172 0.0000 0.0000 0.0000 258 SER A CA    
1964 C C     . SER A 261 ? 1.2044 1.3428 1.2207 0.0000 0.0000 0.0000 258 SER A C     
1965 O O     . SER A 261 ? 1.2033 1.3568 1.2320 0.0000 0.0000 0.0000 258 SER A O     
1966 C CB    . SER A 261 ? 1.2053 1.3622 1.2248 0.0000 0.0000 0.0000 258 SER A CB    
1967 O OG    . SER A 261 ? 1.2123 1.3615 1.2412 0.0000 0.0000 0.0000 258 SER A OG    
1968 N N     . PRO A 262 ? 1.2054 1.3203 1.2129 0.0000 0.0000 0.0000 259 PRO A N     
1969 C CA    . PRO A 262 ? 1.2114 1.3168 1.2242 0.0000 0.0000 0.0000 259 PRO A CA    
1970 C C     . PRO A 262 ? 1.2077 1.3253 1.2417 0.0000 0.0000 0.0000 259 PRO A C     
1971 O O     . PRO A 262 ? 1.2112 1.3311 1.2555 0.0000 0.0000 0.0000 259 PRO A O     
1972 C CB    . PRO A 262 ? 1.2253 1.3001 1.2210 0.0000 0.0000 0.0000 259 PRO A CB    
1973 C CG    . PRO A 262 ? 1.2200 1.2916 1.2013 0.0000 0.0000 0.0000 259 PRO A CG    
1974 C CD    . PRO A 262 ? 1.2101 1.3040 1.1999 0.0000 0.0000 0.0000 259 PRO A CD    
1975 N N     . VAL A 263 ? 1.1983 1.3244 1.2405 0.0000 0.0000 0.0000 260 VAL A N     
1976 C CA    . VAL A 263 ? 1.1931 1.3343 1.2602 0.0000 0.0000 0.0000 260 VAL A CA    
1977 C C     . VAL A 263 ? 1.1827 1.3530 1.2667 0.0000 0.0000 0.0000 260 VAL A C     
1978 O O     . VAL A 263 ? 1.1882 1.3720 1.2948 0.0000 0.0000 0.0000 260 VAL A O     
1979 C CB    . VAL A 263 ? 1.1889 1.3311 1.2600 0.0000 0.0000 0.0000 260 VAL A CB    
1980 C CG1   . VAL A 263 ? 1.1883 1.3377 1.2851 0.0000 0.0000 0.0000 260 VAL A CG1   
1981 C CG2   . VAL A 263 ? 1.2062 1.3204 1.2515 0.0000 0.0000 0.0000 260 VAL A CG2   
1982 N N     . LEU A 264 ? 1.1699 1.3496 1.2424 0.0000 0.0000 0.0000 261 LEU A N     
1983 C CA    . LEU A 264 ? 1.1621 1.3665 1.2440 0.0000 0.0000 0.0000 261 LEU A CA    
1984 C C     . LEU A 264 ? 1.1697 1.3754 1.2440 0.0000 0.0000 0.0000 261 LEU A C     
1985 O O     . LEU A 264 ? 1.1725 1.3952 1.2557 0.0000 0.0000 0.0000 261 LEU A O     
1986 C CB    . LEU A 264 ? 1.1522 1.3634 1.2232 0.0000 0.0000 0.0000 261 LEU A CB    
1987 C CG    . LEU A 264 ? 1.1364 1.3442 1.2127 0.0000 0.0000 0.0000 261 LEU A CG    
1988 C CD1   . LEU A 264 ? 1.1145 1.3233 1.1760 0.0000 0.0000 0.0000 261 LEU A CD1   
1989 C CD2   . LEU A 264 ? 1.1239 1.3490 1.2284 0.0000 0.0000 0.0000 261 LEU A CD2   
1990 N N     . LYS A 265 ? 1.1775 1.3641 1.2351 0.0000 0.0000 0.0000 262 LYS A N     
1991 C CA    . LYS A 265 ? 1.1885 1.3741 1.2354 0.0000 0.0000 0.0000 262 LYS A CA    
1992 C C     . LYS A 265 ? 1.1880 1.3896 1.2247 0.0000 0.0000 0.0000 262 LYS A C     
1993 O O     . LYS A 265 ? 1.1942 1.4043 1.2278 0.0000 0.0000 0.0000 262 LYS A O     
1994 C CB    . LYS A 265 ? 1.1998 1.3857 1.2587 0.0000 0.0000 0.0000 262 LYS A CB    
1995 C CG    . LYS A 265 ? 1.2112 1.3779 1.2781 0.0000 0.0000 0.0000 262 LYS A CG    
1996 C CD    . LYS A 265 ? 1.2426 1.3963 1.3091 0.0000 0.0000 0.0000 262 LYS A CD    
1997 C CE    . LYS A 265 ? 1.2524 1.4191 1.3418 0.0000 0.0000 0.0000 262 LYS A CE    
1998 N NZ    . LYS A 265 ? 1.2579 1.4224 1.3660 0.0000 0.0000 0.0000 262 LYS A NZ    
1999 N N     . TYR A 266 ? 1.1885 1.3914 1.2178 0.0000 0.0000 0.0000 263 TYR A N     
2000 C CA    . TYR A 266 ? 1.1924 1.4068 1.2098 0.0000 0.0000 0.0000 263 TYR A CA    
2001 C C     . TYR A 266 ? 1.1822 1.3891 1.1889 0.0000 0.0000 0.0000 263 TYR A C     
2002 O O     . TYR A 266 ? 1.1773 1.3766 1.1883 0.0000 0.0000 0.0000 263 TYR A O     
2003 C CB    . TYR A 266 ? 1.2008 1.4324 1.2260 0.0000 0.0000 0.0000 263 TYR A CB    
2004 C CG    . TYR A 266 ? 1.2309 1.4736 1.2657 0.0000 0.0000 0.0000 263 TYR A CG    
2005 C CD1   . TYR A 266 ? 1.2592 1.5055 1.2804 0.0000 0.0000 0.0000 263 TYR A CD1   
2006 C CD2   . TYR A 266 ? 1.2459 1.4956 1.3043 0.0000 0.0000 0.0000 263 TYR A CD2   
2007 C CE1   . TYR A 266 ? 1.2801 1.5352 1.3090 0.0000 0.0000 0.0000 263 TYR A CE1   
2008 C CE2   . TYR A 266 ? 1.2621 1.5229 1.3321 0.0000 0.0000 0.0000 263 TYR A CE2   
2009 C CZ    . TYR A 266 ? 1.2787 1.5415 1.3330 0.0000 0.0000 0.0000 263 TYR A CZ    
2010 O OH    . TYR A 266 ? 1.2953 1.5678 1.3600 0.0000 0.0000 0.0000 263 TYR A OH    
2011 N N     . THR A 267 ? 1.1781 1.3869 1.1713 0.0000 0.0000 0.0000 264 THR A N     
2012 C CA    . THR A 267 ? 1.1670 1.3716 1.1515 0.0000 0.0000 0.0000 264 THR A CA    
2013 C C     . THR A 267 ? 1.1596 1.3720 1.1403 0.0000 0.0000 0.0000 264 THR A C     
2014 O O     . THR A 267 ? 1.1705 1.3939 1.1496 0.0000 0.0000 0.0000 264 THR A O     
2015 C CB    . THR A 267 ? 1.1727 1.3792 1.1472 0.0000 0.0000 0.0000 264 THR A CB    
2016 O OG1   . THR A 267 ? 1.1911 1.4086 1.1549 0.0000 0.0000 0.0000 264 THR A OG1   
2017 C CG2   . THR A 267 ? 1.1805 1.3826 1.1583 0.0000 0.0000 0.0000 264 THR A CG2   
2018 N N     . PRO A 268 ? 1.1455 1.3507 1.1234 0.0000 0.0000 0.0000 265 PRO A N     
2019 C CA    . PRO A 268 ? 1.1450 1.3546 1.1179 0.0000 0.0000 0.0000 265 PRO A CA    
2020 C C     . PRO A 268 ? 1.1494 1.3675 1.1075 0.0000 0.0000 0.0000 265 PRO A C     
2021 O O     . PRO A 268 ? 1.1562 1.3824 1.1116 0.0000 0.0000 0.0000 265 PRO A O     
2022 C CB    . PRO A 268 ? 1.1427 1.3400 1.1107 0.0000 0.0000 0.0000 265 PRO A CB    
2023 C CG    . PRO A 268 ? 1.1396 1.3267 1.1148 0.0000 0.0000 0.0000 265 PRO A CG    
2024 C CD    . PRO A 268 ? 1.1378 1.3289 1.1172 0.0000 0.0000 0.0000 265 PRO A CD    
2025 N N     . HIS A 269 ? 1.1427 1.3588 1.0914 0.0000 0.0000 0.0000 266 HIS A N     
2026 C CA    . HIS A 269 ? 1.1457 1.3672 1.0770 0.0000 0.0000 0.0000 266 HIS A CA    
2027 C C     . HIS A 269 ? 1.1463 1.3773 1.0746 0.0000 0.0000 0.0000 266 HIS A C     
2028 O O     . HIS A 269 ? 1.1627 1.3970 1.0757 0.0000 0.0000 0.0000 266 HIS A O     
2029 C CB    . HIS A 269 ? 1.1454 1.3663 1.0739 0.0000 0.0000 0.0000 266 HIS A CB    
2030 C CG    . HIS A 269 ? 1.1585 1.3851 1.0697 0.0000 0.0000 0.0000 266 HIS A CG    
2031 N ND1   . HIS A 269 ? 1.1631 1.3883 1.0613 0.0000 0.0000 0.0000 266 HIS A ND1   
2032 C CD2   . HIS A 269 ? 1.1616 1.3941 1.0651 0.0000 0.0000 0.0000 266 HIS A CD2   
2033 C CE1   . HIS A 269 ? 1.1853 1.4145 1.0666 0.0000 0.0000 0.0000 266 HIS A CE1   
2034 N NE2   . HIS A 269 ? 1.1788 1.4122 1.0621 0.0000 0.0000 0.0000 266 HIS A NE2   
2035 N N     . GLN A 270 ? 1.1295 1.3631 1.0711 0.0000 0.0000 0.0000 267 GLN A N     
2036 C CA    . GLN A 270 ? 1.1351 1.3777 1.0771 0.0000 0.0000 0.0000 267 GLN A CA    
2037 C C     . GLN A 270 ? 1.1329 1.3828 1.0796 0.0000 0.0000 0.0000 267 GLN A C     
2038 O O     . GLN A 270 ? 1.1482 1.4052 1.0828 0.0000 0.0000 0.0000 267 GLN A O     
2039 C CB    . GLN A 270 ? 1.1288 1.3700 1.0872 0.0000 0.0000 0.0000 267 GLN A CB    
2040 C CG    . GLN A 270 ? 1.1435 1.3805 1.0950 0.0000 0.0000 0.0000 267 GLN A CG    
2041 C CD    . GLN A 270 ? 1.1473 1.3758 1.1142 0.0000 0.0000 0.0000 267 GLN A CD    
2042 O OE1   . GLN A 270 ? 1.1449 1.3701 1.1261 0.0000 0.0000 0.0000 267 GLN A OE1   
2043 N NE2   . GLN A 270 ? 1.1615 1.3851 1.1246 0.0000 0.0000 0.0000 267 GLN A NE2   
2044 N N     . LEU A 271 ? 1.1132 1.3611 1.0768 0.0000 0.0000 0.0000 268 LEU A N     
2045 C CA    . LEU A 271 ? 1.1123 1.3682 1.0846 0.0000 0.0000 0.0000 268 LEU A CA    
2046 C C     . LEU A 271 ? 1.1263 1.3801 1.0776 0.0000 0.0000 0.0000 268 LEU A C     
2047 O O     . LEU A 271 ? 1.1388 1.4009 1.0903 0.0000 0.0000 0.0000 268 LEU A O     
2048 C CB    . LEU A 271 ? 1.1000 1.3522 1.0937 0.0000 0.0000 0.0000 268 LEU A CB    
2049 C CG    . LEU A 271 ? 1.0915 1.3406 1.1030 0.0000 0.0000 0.0000 268 LEU A CG    
2050 C CD1   . LEU A 271 ? 1.0816 1.3252 1.1087 0.0000 0.0000 0.0000 268 LEU A CD1   
2051 C CD2   . LEU A 271 ? 1.1040 1.3656 1.1289 0.0000 0.0000 0.0000 268 LEU A CD2   
2052 N N     . LEU A 272 ? 1.1261 1.3685 1.0596 0.0000 0.0000 0.0000 269 LEU A N     
2053 C CA    . LEU A 272 ? 1.1417 1.3784 1.0520 0.0000 0.0000 0.0000 269 LEU A CA    
2054 C C     . LEU A 272 ? 1.1674 1.4070 1.0524 0.0000 0.0000 0.0000 269 LEU A C     
2055 O O     . LEU A 272 ? 1.1918 1.4309 1.0598 0.0000 0.0000 0.0000 269 LEU A O     
2056 C CB    . LEU A 272 ? 1.1352 1.3576 1.0376 0.0000 0.0000 0.0000 269 LEU A CB    
2057 C CG    . LEU A 272 ? 1.1423 1.3541 1.0220 0.0000 0.0000 0.0000 269 LEU A CG    
2058 C CD1   . LEU A 272 ? 1.1381 1.3516 1.0209 0.0000 0.0000 0.0000 269 LEU A CD1   
2059 C CD2   . LEU A 272 ? 1.1205 1.3186 0.9996 0.0000 0.0000 0.0000 269 LEU A CD2   
2060 N N     . PHE A 273 ? 1.1651 1.4063 1.0460 0.0000 0.0000 0.0000 270 PHE A N     
2061 C CA    . PHE A 273 ? 1.1922 1.4334 1.0456 0.0000 0.0000 0.0000 270 PHE A CA    
2062 C C     . PHE A 273 ? 1.2034 1.4544 1.0587 0.0000 0.0000 0.0000 270 PHE A C     
2063 O O     . PHE A 273 ? 1.2294 1.4801 1.0591 0.0000 0.0000 0.0000 270 PHE A O     
2064 C CB    . PHE A 273 ? 1.1907 1.4246 1.0324 0.0000 0.0000 0.0000 270 PHE A CB    
2065 C CG    . PHE A 273 ? 1.1904 1.4142 1.0281 0.0000 0.0000 0.0000 270 PHE A CG    
2066 C CD1   . PHE A 273 ? 1.1715 1.3928 1.0287 0.0000 0.0000 0.0000 270 PHE A CD1   
2067 C CD2   . PHE A 273 ? 1.2132 1.4280 1.0261 0.0000 0.0000 0.0000 270 PHE A CD2   
2068 C CE1   . PHE A 273 ? 1.1743 1.3859 1.0287 0.0000 0.0000 0.0000 270 PHE A CE1   
2069 C CE2   . PHE A 273 ? 1.2104 1.4136 1.0197 0.0000 0.0000 0.0000 270 PHE A CE2   
2070 C CZ    . PHE A 273 ? 1.1888 1.3912 1.0199 0.0000 0.0000 0.0000 270 PHE A CZ    
2071 N N     . GLY A 274 ? 1.1904 1.4479 1.0737 0.0000 0.0000 0.0000 271 GLY A N     
2072 C CA    . GLY A 274 ? 1.2110 1.4763 1.0989 0.0000 0.0000 0.0000 271 GLY A CA    
2073 C C     . GLY A 274 ? 1.2302 1.4907 1.1058 0.0000 0.0000 0.0000 271 GLY A C     
2074 O O     . GLY A 274 ? 1.2400 1.5042 1.1180 0.0000 0.0000 0.0000 271 GLY A O     
2075 N N     . ILE A 275 ? 1.2411 1.4937 1.1046 0.0000 0.0000 0.0000 272 ILE A N     
2076 C CA    . ILE A 275 ? 1.2579 1.5067 1.1154 0.0000 0.0000 0.0000 272 ILE A CA    
2077 C C     . ILE A 275 ? 1.2495 1.4936 1.1185 0.0000 0.0000 0.0000 272 ILE A C     
2078 O O     . ILE A 275 ? 1.2450 1.4865 1.1139 0.0000 0.0000 0.0000 272 ILE A O     
2079 C CB    . ILE A 275 ? 1.2879 1.5338 1.1110 0.0000 0.0000 0.0000 272 ILE A CB    
2080 C CG1   . ILE A 275 ? 1.3032 1.5435 1.1092 0.0000 0.0000 0.0000 272 ILE A CG1   
2081 C CG2   . ILE A 275 ? 1.3195 1.5683 1.1245 0.0000 0.0000 0.0000 272 ILE A CG2   
2082 C CD1   . ILE A 275 ? 1.3200 1.5581 1.1280 0.0000 0.0000 0.0000 272 ILE A CD1   
2083 N N     . ASP A 276 ? 1.2545 1.4969 1.1332 0.0000 0.0000 0.0000 273 ASP A N     
2084 C CA    . ASP A 276 ? 1.2523 1.4919 1.1422 0.0000 0.0000 0.0000 273 ASP A CA    
2085 C C     . ASP A 276 ? 1.2666 1.5072 1.1385 0.0000 0.0000 0.0000 273 ASP A C     
2086 O O     . ASP A 276 ? 1.2895 1.5308 1.1436 0.0000 0.0000 0.0000 273 ASP A O     
2087 C CB    . ASP A 276 ? 1.2518 1.4887 1.1589 0.0000 0.0000 0.0000 273 ASP A CB    
2088 C CG    . ASP A 276 ? 1.2639 1.4962 1.1911 0.0000 0.0000 0.0000 273 ASP A CG    
2089 O OD1   . ASP A 276 ? 1.2664 1.4967 1.2017 0.0000 0.0000 0.0000 273 ASP A OD1   
2090 O OD2   . ASP A 276 ? 1.3045 1.5332 1.2384 0.0000 0.0000 0.0000 273 ASP A OD2   
2091 N N     . SER A 277 ? 1.2587 1.4984 1.1348 0.0000 0.0000 0.0000 274 SER A N     
2092 C CA    . SER A 277 ? 1.2731 1.5143 1.1373 0.0000 0.0000 0.0000 274 SER A CA    
2093 C C     . SER A 277 ? 1.2675 1.5137 1.1464 0.0000 0.0000 0.0000 274 SER A C     
2094 O O     . SER A 277 ? 1.2610 1.5068 1.1514 0.0000 0.0000 0.0000 274 SER A O     
2095 C CB    . SER A 277 ? 1.2667 1.5052 1.1337 0.0000 0.0000 0.0000 274 SER A CB    
2096 O OG    . SER A 277 ? 1.2484 1.4862 1.1407 0.0000 0.0000 0.0000 274 SER A OG    
2097 N N     . ASN A 278 ? 1.2729 1.5234 1.1526 0.0000 0.0000 0.0000 275 ASN A N     
2098 C CA    . ASN A 278 ? 1.2669 1.5244 1.1642 0.0000 0.0000 0.0000 275 ASN A CA    
2099 C C     . ASN A 278 ? 1.2398 1.5000 1.1684 0.0000 0.0000 0.0000 275 ASN A C     
2100 O O     . ASN A 278 ? 1.2330 1.5010 1.1788 0.0000 0.0000 0.0000 275 ASN A O     
2101 C CB    . ASN A 278 ? 1.2895 1.5525 1.1774 0.0000 0.0000 0.0000 275 ASN A CB    
2102 C CG    . ASN A 278 ? 1.2962 1.5673 1.1994 0.0000 0.0000 0.0000 275 ASN A CG    
2103 O OD1   . ASN A 278 ? 1.3066 1.5755 1.2166 0.0000 0.0000 0.0000 275 ASN A OD1   
2104 N ND2   . ASN A 278 ? 1.2994 1.5796 1.2094 0.0000 0.0000 0.0000 275 ASN A ND2   
2105 N N     . THR A 279 ? 1.2249 1.4784 1.1603 0.0000 0.0000 0.0000 276 THR A N     
2106 C CA    . THR A 279 ? 1.2062 1.4574 1.1646 0.0000 0.0000 0.0000 276 THR A CA    
2107 C C     . THR A 279 ? 1.2043 1.4542 1.1749 0.0000 0.0000 0.0000 276 THR A C     
2108 O O     . THR A 279 ? 1.2190 1.4671 1.1789 0.0000 0.0000 0.0000 276 THR A O     
2109 C CB    . THR A 279 ? 1.1984 1.4404 1.1534 0.0000 0.0000 0.0000 276 THR A CB    
2110 O OG1   . THR A 279 ? 1.2043 1.4462 1.1510 0.0000 0.0000 0.0000 276 THR A OG1   
2111 C CG2   . THR A 279 ? 1.1872 1.4217 1.1597 0.0000 0.0000 0.0000 276 THR A CG2   
2112 N N     . PRO A 280 ? 1.1889 1.4384 1.1806 0.0000 0.0000 0.0000 277 PRO A N     
2113 C CA    . PRO A 280 ? 1.1847 1.4269 1.1865 0.0000 0.0000 0.0000 277 PRO A CA    
2114 C C     . PRO A 280 ? 1.1856 1.4141 1.1761 0.0000 0.0000 0.0000 277 PRO A C     
2115 O O     . PRO A 280 ? 1.1764 1.3998 1.1611 0.0000 0.0000 0.0000 277 PRO A O     
2116 C CB    . PRO A 280 ? 1.1710 1.4107 1.1903 0.0000 0.0000 0.0000 277 PRO A CB    
2117 C CG    . PRO A 280 ? 1.1686 1.4217 1.1950 0.0000 0.0000 0.0000 277 PRO A CG    
2118 C CD    . PRO A 280 ? 1.1788 1.4362 1.1861 0.0000 0.0000 0.0000 277 PRO A CD    
2119 N N     . PHE A 281 ? 1.1973 1.4203 1.1863 0.0000 0.0000 0.0000 278 PHE A N     
2120 C CA    . PHE A 281 ? 1.2038 1.4133 1.1857 0.0000 0.0000 0.0000 278 PHE A CA    
2121 C C     . PHE A 281 ? 1.2179 1.4305 1.1853 0.0000 0.0000 0.0000 278 PHE A C     
2122 O O     . PHE A 281 ? 1.2148 1.4197 1.1824 0.0000 0.0000 0.0000 278 PHE A O     
2123 C CB    . PHE A 281 ? 1.1879 1.3833 1.1783 0.0000 0.0000 0.0000 278 PHE A CB    
2124 C CG    . PHE A 281 ? 1.1684 1.3567 1.1704 0.0000 0.0000 0.0000 278 PHE A CG    
2125 C CD1   . PHE A 281 ? 1.1625 1.3353 1.1641 0.0000 0.0000 0.0000 278 PHE A CD1   
2126 C CD2   . PHE A 281 ? 1.1478 1.3445 1.1620 0.0000 0.0000 0.0000 278 PHE A CD2   
2127 C CE1   . PHE A 281 ? 1.1697 1.3344 1.1811 0.0000 0.0000 0.0000 278 PHE A CE1   
2128 C CE2   . PHE A 281 ? 1.1468 1.3383 1.1733 0.0000 0.0000 0.0000 278 PHE A CE2   
2129 C CZ    . PHE A 281 ? 1.1653 1.3403 1.1896 0.0000 0.0000 0.0000 278 PHE A CZ    
2130 N N     . ALA A 282 ? 1.2426 1.4662 1.1978 0.0000 0.0000 0.0000 279 ALA A N     
2131 C CA    . ALA A 282 ? 1.2627 1.4896 1.2019 0.0000 0.0000 0.0000 279 ALA A CA    
2132 C C     . ALA A 282 ? 1.2838 1.5053 1.2166 0.0000 0.0000 0.0000 279 ALA A C     
2133 O O     . ALA A 282 ? 1.2982 1.5175 1.2254 0.0000 0.0000 0.0000 279 ALA A O     
2134 C CB    . ALA A 282 ? 1.2764 1.5124 1.1993 0.0000 0.0000 0.0000 279 ALA A CB    
2135 N N     . ASN A 283 ? 1.2900 1.5097 1.2253 0.0000 0.0000 0.0000 280 ASN A N     
2136 C CA    . ASN A 283 ? 1.3118 1.5278 1.2461 0.0000 0.0000 0.0000 280 ASN A CA    
2137 C C     . ASN A 283 ? 1.3377 1.5600 1.2516 0.0000 0.0000 0.0000 280 ASN A C     
2138 O O     . ASN A 283 ? 1.3390 1.5691 1.2398 0.0000 0.0000 0.0000 280 ASN A O     
2139 C CB    . ASN A 283 ? 1.3023 1.5181 1.2484 0.0000 0.0000 0.0000 280 ASN A CB    
2140 C CG    . ASN A 283 ? 1.3267 1.5414 1.2762 0.0000 0.0000 0.0000 280 ASN A CG    
2141 O OD1   . ASN A 283 ? 1.3498 1.5722 1.2874 0.0000 0.0000 0.0000 280 ASN A OD1   
2142 N ND2   . ASN A 283 ? 1.3379 1.5417 1.3027 0.0000 0.0000 0.0000 280 ASN A ND2   
2143 N N     . GLN A 284 ? 1.3617 1.5780 1.2710 0.0000 0.0000 0.0000 281 GLN A N     
2144 C CA    . GLN A 284 ? 1.3966 1.6156 1.2827 0.0000 0.0000 0.0000 281 GLN A CA    
2145 C C     . GLN A 284 ? 1.4072 1.6278 1.2905 0.0000 0.0000 0.0000 281 GLN A C     
2146 O O     . GLN A 284 ? 1.4334 1.6565 1.2944 0.0000 0.0000 0.0000 281 GLN A O     
2147 C CB    . GLN A 284 ? 1.4145 1.6255 1.2946 0.0000 0.0000 0.0000 281 GLN A CB    
2148 C CG    . GLN A 284 ? 1.4473 1.6630 1.3176 0.0000 0.0000 0.0000 281 GLN A CG    
2149 C CD    . GLN A 284 ? 1.4798 1.6898 1.3654 0.0000 0.0000 0.0000 281 GLN A CD    
2150 O OE1   . GLN A 284 ? 1.4721 1.6806 1.3790 0.0000 0.0000 0.0000 281 GLN A OE1   
2151 N NE2   . GLN A 284 ? 1.5119 1.7181 1.3860 0.0000 0.0000 0.0000 281 GLN A NE2   
2152 N N     . ASP A 285 ? 1.3914 1.6107 1.2972 0.0000 0.0000 0.0000 282 ASP A N     
2153 C CA    . ASP A 285 ? 1.3986 1.6205 1.3103 0.0000 0.0000 0.0000 282 ASP A CA    
2154 C C     . ASP A 285 ? 1.4137 1.6466 1.3061 0.0000 0.0000 0.0000 282 ASP A C     
2155 O O     . ASP A 285 ? 1.4331 1.6659 1.3223 0.0000 0.0000 0.0000 282 ASP A O     
2156 C CB    . ASP A 285 ? 1.3794 1.6031 1.3190 0.0000 0.0000 0.0000 282 ASP A CB    
2157 C CG    . ASP A 285 ? 1.3747 1.5823 1.3301 0.0000 0.0000 0.0000 282 ASP A CG    
2158 O OD1   . ASP A 285 ? 1.3905 1.5859 1.3383 0.0000 0.0000 0.0000 282 ASP A OD1   
2159 O OD2   . ASP A 285 ? 1.3627 1.5689 1.3374 0.0000 0.0000 0.0000 282 ASP A OD2   
2160 N N     . THR A 286 ? 1.4067 1.6475 1.2852 0.0000 0.0000 0.0000 283 THR A N     
2161 C CA    . THR A 286 ? 1.4210 1.6702 1.2792 0.0000 0.0000 0.0000 283 THR A CA    
2162 C C     . THR A 286 ? 1.4457 1.6893 1.2658 0.0000 0.0000 0.0000 283 THR A C     
2163 O O     . THR A 286 ? 1.4640 1.7111 1.2593 0.0000 0.0000 0.0000 283 THR A O     
2164 C CB    . THR A 286 ? 1.4076 1.6660 1.2702 0.0000 0.0000 0.0000 283 THR A CB    
2165 O OG1   . THR A 286 ? 1.4123 1.6660 1.2562 0.0000 0.0000 0.0000 283 THR A OG1   
2166 C CG2   . THR A 286 ? 1.3776 1.6393 1.2760 0.0000 0.0000 0.0000 283 THR A CG2   
2167 N N     . LEU A 287 ? 1.4461 1.6800 1.2610 0.0000 0.0000 0.0000 284 LEU A N     
2168 C CA    . LEU A 287 ? 1.4701 1.6983 1.2516 0.0000 0.0000 0.0000 284 LEU A CA    
2169 C C     . LEU A 287 ? 1.5046 1.7301 1.2531 0.0000 0.0000 0.0000 284 LEU A C     
2170 O O     . LEU A 287 ? 1.5318 1.7527 1.2452 0.0000 0.0000 0.0000 284 LEU A O     
2171 C CB    . LEU A 287 ? 1.4683 1.6879 1.2566 0.0000 0.0000 0.0000 284 LEU A CB    
2172 C CG    . LEU A 287 ? 1.4790 1.6981 1.2541 0.0000 0.0000 0.0000 284 LEU A CG    
2173 C CD1   . LEU A 287 ? 1.4623 1.6887 1.2497 0.0000 0.0000 0.0000 284 LEU A CD1   
2174 C CD2   . LEU A 287 ? 1.4779 1.6906 1.2661 0.0000 0.0000 0.0000 284 LEU A CD2   
2175 N N     . ASP A 288 ? 1.5023 1.7301 1.2617 0.0000 0.0000 0.0000 285 ASP A N     
2176 C CA    . ASP A 288 ? 1.5323 1.7575 1.2631 0.0000 0.0000 0.0000 285 ASP A CA    
2177 C C     . ASP A 288 ? 1.5321 1.7674 1.2521 0.0000 0.0000 0.0000 285 ASP A C     
2178 O O     . ASP A 288 ? 1.5655 1.7979 1.2543 0.0000 0.0000 0.0000 285 ASP A O     
2179 C CB    . ASP A 288 ? 1.5399 1.7612 1.2888 0.0000 0.0000 0.0000 285 ASP A CB    
2180 C CG    . ASP A 288 ? 1.5696 1.7753 1.3075 0.0000 0.0000 0.0000 285 ASP A CG    
2181 O OD1   . ASP A 288 ? 1.6070 1.8056 1.3112 0.0000 0.0000 0.0000 285 ASP A OD1   
2182 O OD2   . ASP A 288 ? 1.5779 1.7773 1.3408 0.0000 0.0000 0.0000 285 ASP A OD2   
2183 N N     . LEU A 289 ? 1.4918 1.7382 1.2366 0.0000 0.0000 0.0000 286 LEU A N     
2184 C CA    . LEU A 289 ? 1.4916 1.7484 1.2308 0.0000 0.0000 0.0000 286 LEU A CA    
2185 C C     . LEU A 289 ? 1.5080 1.7580 1.2072 0.0000 0.0000 0.0000 286 LEU A C     
2186 O O     . LEU A 289 ? 1.4986 1.7416 1.1918 0.0000 0.0000 0.0000 286 LEU A O     
2187 C CB    . LEU A 289 ? 1.4532 1.7237 1.2361 0.0000 0.0000 0.0000 286 LEU A CB    
2188 C CG    . LEU A 289 ? 1.4251 1.6991 1.2495 0.0000 0.0000 0.0000 286 LEU A CG    
2189 C CD1   . LEU A 289 ? 1.4059 1.6958 1.2677 0.0000 0.0000 0.0000 286 LEU A CD1   
2190 C CD2   . LEU A 289 ? 1.4493 1.7196 1.2687 0.0000 0.0000 0.0000 286 LEU A CD2   
2191 N N     . THR A 290 ? 1.5334 1.7845 1.2045 0.0000 0.0000 0.0000 287 THR A N     
2192 C CA    . THR A 290 ? 1.5512 1.7942 1.1842 0.0000 0.0000 0.0000 287 THR A CA    
2193 C C     . THR A 290 ? 1.5077 1.7576 1.1697 0.0000 0.0000 0.0000 287 THR A C     
2194 O O     . THR A 290 ? 1.4691 1.7315 1.1756 0.0000 0.0000 0.0000 287 THR A O     
2195 C CB    . THR A 290 ? 1.5907 1.8360 1.1978 0.0000 0.0000 0.0000 287 THR A CB    
2196 O OG1   . THR A 290 ? 1.5794 1.8430 1.2275 0.0000 0.0000 0.0000 287 THR A OG1   
2197 C CG2   . THR A 290 ? 1.6226 1.8646 1.2084 0.0000 0.0000 0.0000 287 THR A CG2   
2198 N N     . ARG A 291 ? 1.5141 1.7544 1.1499 0.0000 0.0000 0.0000 288 ARG A N     
2199 C CA    . ARG A 291 ? 1.4791 1.7239 1.1390 0.0000 0.0000 0.0000 288 ARG A CA    
2200 C C     . ARG A 291 ? 1.4729 1.7329 1.1595 0.0000 0.0000 0.0000 288 ARG A C     
2201 O O     . ARG A 291 ? 1.4343 1.7046 1.1624 0.0000 0.0000 0.0000 288 ARG A O     
2202 C CB    . ARG A 291 ? 1.4998 1.7296 1.1226 0.0000 0.0000 0.0000 288 ARG A CB    
2203 C CG    . ARG A 291 ? 1.4482 1.6793 1.0943 0.0000 0.0000 0.0000 288 ARG A CG    
2204 C CD    . ARG A 291 ? 1.3455 1.5846 1.0365 0.0000 0.0000 0.0000 288 ARG A CD    
2205 N NE    . ARG A 291 ? 1.2838 1.5219 0.9932 0.0000 0.0000 0.0000 288 ARG A NE    
2206 C CZ    . ARG A 291 ? 1.2250 1.4700 0.9739 0.0000 0.0000 0.0000 288 ARG A CZ    
2207 N NH1   . ARG A 291 ? 1.1846 1.4374 0.9589 0.0000 0.0000 0.0000 288 ARG A NH1   
2208 N NH2   . ARG A 291 ? 1.2019 1.4436 0.9624 0.0000 0.0000 0.0000 288 ARG A NH2   
2209 N N     . GLU A 292 ? 1.5153 1.7770 1.1784 0.0000 0.0000 0.0000 289 GLU A N     
2210 C CA    . GLU A 292 ? 1.5198 1.7981 1.2074 0.0000 0.0000 0.0000 289 GLU A CA    
2211 C C     . GLU A 292 ? 1.4842 1.7815 1.2261 0.0000 0.0000 0.0000 289 GLU A C     
2212 O O     . GLU A 292 ? 1.4582 1.7684 1.2387 0.0000 0.0000 0.0000 289 GLU A O     
2213 C CB    . GLU A 292 ? 1.5708 1.8475 1.2217 0.0000 0.0000 0.0000 289 GLU A CB    
2214 C CG    . GLU A 292 ? 1.6374 1.8927 1.2309 0.0000 0.0000 0.0000 289 GLU A CG    
2215 C CD    . GLU A 292 ? 1.7103 1.9674 1.2804 0.0000 0.0000 0.0000 289 GLU A CD    
2216 O OE1   . GLU A 292 ? 1.7511 2.0117 1.3051 0.0000 0.0000 0.0000 289 GLU A OE1   
2217 O OE2   . GLU A 292 ? 1.7192 1.9733 1.2865 0.0000 0.0000 0.0000 289 GLU A OE2   
2218 N N     . GLU A 293 ? 1.4877 1.7847 1.2312 0.0000 0.0000 0.0000 290 GLU A N     
2219 C CA    . GLU A 293 ? 1.4611 1.7722 1.2524 0.0000 0.0000 0.0000 290 GLU A CA    
2220 C C     . GLU A 293 ? 1.4198 1.7317 1.2460 0.0000 0.0000 0.0000 290 GLU A C     
2221 O O     . GLU A 293 ? 1.3953 1.7213 1.2618 0.0000 0.0000 0.0000 290 GLU A O     
2222 C CB    . GLU A 293 ? 1.4731 1.7769 1.2536 0.0000 0.0000 0.0000 290 GLU A CB    
2223 C CG    . GLU A 293 ? 1.5313 1.8341 1.2773 0.0000 0.0000 0.0000 290 GLU A CG    
2224 C CD    . GLU A 293 ? 1.5642 1.8544 1.2890 0.0000 0.0000 0.0000 290 GLU A CD    
2225 O OE1   . GLU A 293 ? 1.5527 1.8349 1.2904 0.0000 0.0000 0.0000 290 GLU A OE1   
2226 O OE2   . GLU A 293 ? 1.6016 1.8889 1.2959 0.0000 0.0000 0.0000 290 GLU A OE2   
2227 N N     . GLU A 294 ? 1.4180 1.7148 1.2272 0.0000 0.0000 0.0000 291 GLU A N     
2228 C CA    . GLU A 294 ? 1.3861 1.6798 1.2184 0.0000 0.0000 0.0000 291 GLU A CA    
2229 C C     . GLU A 294 ? 1.3729 1.6735 1.2216 0.0000 0.0000 0.0000 291 GLU A C     
2230 O O     . GLU A 294 ? 1.3445 1.6518 1.2298 0.0000 0.0000 0.0000 291 GLU A O     
2231 C CB    . GLU A 294 ? 1.3941 1.6718 1.1963 0.0000 0.0000 0.0000 291 GLU A CB    
2232 C CG    . GLU A 294 ? 1.3774 1.6501 1.1989 0.0000 0.0000 0.0000 291 GLU A CG    
2233 C CD    . GLU A 294 ? 1.4117 1.6722 1.2067 0.0000 0.0000 0.0000 291 GLU A CD    
2234 O OE1   . GLU A 294 ? 1.4546 1.7087 1.2151 0.0000 0.0000 0.0000 291 GLU A OE1   
2235 O OE2   . GLU A 294 ? 1.4059 1.6626 1.2140 0.0000 0.0000 0.0000 291 GLU A OE2   
2236 N N     . LEU A 295 ? 1.3990 1.6958 1.2186 0.0000 0.0000 0.0000 292 LEU A N     
2237 C CA    . LEU A 295 ? 1.3926 1.6923 1.2223 0.0000 0.0000 0.0000 292 LEU A CA    
2238 C C     . LEU A 295 ? 1.3841 1.7033 1.2543 0.0000 0.0000 0.0000 292 LEU A C     
2239 O O     . LEU A 295 ? 1.3648 1.6874 1.2593 0.0000 0.0000 0.0000 292 LEU A O     
2240 C CB    . LEU A 295 ? 1.4266 1.7156 1.2132 0.0000 0.0000 0.0000 292 LEU A CB    
2241 C CG    . LEU A 295 ? 1.4230 1.6941 1.1882 0.0000 0.0000 0.0000 292 LEU A CG    
2242 C CD1   . LEU A 295 ? 1.4543 1.7118 1.1762 0.0000 0.0000 0.0000 292 LEU A CD1   
2243 C CD2   . LEU A 295 ? 1.3816 1.6555 1.1825 0.0000 0.0000 0.0000 292 LEU A CD2   
2244 N N     . SER A 296 ? 1.4042 1.7365 1.2827 0.0000 0.0000 0.0000 293 SER A N     
2245 C CA    . SER A 296 ? 1.3975 1.7516 1.3199 0.0000 0.0000 0.0000 293 SER A CA    
2246 C C     . SER A 296 ? 1.3682 1.7278 1.3313 0.0000 0.0000 0.0000 293 SER A C     
2247 O O     . SER A 296 ? 1.3521 1.7249 1.3548 0.0000 0.0000 0.0000 293 SER A O     
2248 C CB    . SER A 296 ? 1.4284 1.7964 1.3463 0.0000 0.0000 0.0000 293 SER A CB    
2249 O OG    . SER A 296 ? 1.4422 1.8087 1.3541 0.0000 0.0000 0.0000 293 SER A OG    
2250 N N     . LEU A 297 ? 1.3689 1.7170 1.3215 0.0000 0.0000 0.0000 294 LEU A N     
2251 C CA    . LEU A 297 ? 1.3443 1.6914 1.3292 0.0000 0.0000 0.0000 294 LEU A CA    
2252 C C     . LEU A 297 ? 1.3214 1.6622 1.3188 0.0000 0.0000 0.0000 294 LEU A C     
2253 O O     . LEU A 297 ? 1.2998 1.6463 1.3321 0.0000 0.0000 0.0000 294 LEU A O     
2254 C CB    . LEU A 297 ? 1.3484 1.6803 1.3156 0.0000 0.0000 0.0000 294 LEU A CB    
2255 C CG    . LEU A 297 ? 1.3216 1.6465 1.3155 0.0000 0.0000 0.0000 294 LEU A CG    
2256 C CD1   . LEU A 297 ? 1.3211 1.6576 1.3499 0.0000 0.0000 0.0000 294 LEU A CD1   
2257 C CD2   . LEU A 297 ? 1.3289 1.6350 1.3003 0.0000 0.0000 0.0000 294 LEU A CD2   
2258 N N     . LEU A 298 ? 1.3317 1.6597 1.2994 0.0000 0.0000 0.0000 295 LEU A N     
2259 C CA    . LEU A 298 ? 1.3181 1.6387 1.2933 0.0000 0.0000 0.0000 295 LEU A CA    
2260 C C     . LEU A 298 ? 1.3186 1.6523 1.3193 0.0000 0.0000 0.0000 295 LEU A C     
2261 O O     . LEU A 298 ? 1.3003 1.6339 1.3265 0.0000 0.0000 0.0000 295 LEU A O     
2262 C CB    . LEU A 298 ? 1.3266 1.6320 1.2652 0.0000 0.0000 0.0000 295 LEU A CB    
2263 C CG    . LEU A 298 ? 1.3024 1.6005 1.2436 0.0000 0.0000 0.0000 295 LEU A CG    
2264 C CD1   . LEU A 298 ? 1.2604 1.5507 1.2196 0.0000 0.0000 0.0000 295 LEU A CD1   
2265 C CD2   . LEU A 298 ? 1.3212 1.6065 1.2250 0.0000 0.0000 0.0000 295 LEU A CD2   
2266 N N     . GLN A 299 ? 1.3465 1.6907 1.3392 0.0000 0.0000 0.0000 296 GLN A N     
2267 C CA    . GLN A 299 ? 1.3544 1.7124 1.3712 0.0000 0.0000 0.0000 296 GLN A CA    
2268 C C     . GLN A 299 ? 1.3329 1.7092 1.3984 0.0000 0.0000 0.0000 296 GLN A C     
2269 O O     . GLN A 299 ? 1.3168 1.7013 1.4109 0.0000 0.0000 0.0000 296 GLN A O     
2270 C CB    . GLN A 299 ? 1.3901 1.7555 1.3870 0.0000 0.0000 0.0000 296 GLN A CB    
2271 C CG    . GLN A 299 ? 1.4238 1.7906 1.4235 0.0000 0.0000 0.0000 296 GLN A CG    
2272 C CD    . GLN A 299 ? 1.4864 1.8511 1.4519 0.0000 0.0000 0.0000 296 GLN A CD    
2273 O OE1   . GLN A 299 ? 1.5189 1.8659 1.4528 0.0000 0.0000 0.0000 296 GLN A OE1   
2274 N NE2   . GLN A 299 ? 1.5004 1.8817 1.4706 0.0000 0.0000 0.0000 296 GLN A NE2   
2275 N N     . GLU A 300 ? 1.3342 1.7154 1.4083 0.0000 0.0000 0.0000 297 GLU A N     
2276 C CA    . GLU A 300 ? 1.3221 1.7166 1.4400 0.0000 0.0000 0.0000 297 GLU A CA    
2277 C C     . GLU A 300 ? 1.2896 1.6694 1.4179 0.0000 0.0000 0.0000 297 GLU A C     
2278 O O     . GLU A 300 ? 1.2774 1.6643 1.4348 0.0000 0.0000 0.0000 297 GLU A O     
2279 C CB    . GLU A 300 ? 1.3392 1.7376 1.4585 0.0000 0.0000 0.0000 297 GLU A CB    
2280 C CG    . GLU A 300 ? 1.3623 1.7746 1.5280 0.0000 0.0000 0.0000 297 GLU A CG    
2281 C CD    . GLU A 300 ? 1.3984 1.7936 1.5744 0.0000 0.0000 0.0000 297 GLU A CD    
2282 O OE1   . GLU A 300 ? 1.4106 1.7829 1.5558 0.0000 0.0000 0.0000 297 GLU A OE1   
2283 O OE2   . GLU A 300 ? 1.4105 1.8150 1.6254 0.0000 0.0000 0.0000 297 GLU A OE2   
2284 N N     . ILE A 301 ? 1.2780 1.6371 1.3818 0.0000 0.0000 0.0000 298 ILE A N     
2285 C CA    . ILE A 301 ? 1.2531 1.5958 1.3621 0.0000 0.0000 0.0000 298 ILE A CA    
2286 C C     . ILE A 301 ? 1.2385 1.5795 1.3570 0.0000 0.0000 0.0000 298 ILE A C     
2287 O O     . ILE A 301 ? 1.2286 1.5674 1.3704 0.0000 0.0000 0.0000 298 ILE A O     
2288 C CB    . ILE A 301 ? 1.2539 1.5754 1.3292 0.0000 0.0000 0.0000 298 ILE A CB    
2289 C CG1   . ILE A 301 ? 1.2644 1.5825 1.3349 0.0000 0.0000 0.0000 298 ILE A CG1   
2290 C CG2   . ILE A 301 ? 1.2344 1.5390 1.3110 0.0000 0.0000 0.0000 298 ILE A CG2   
2291 C CD1   . ILE A 301 ? 1.2739 1.5761 1.3107 0.0000 0.0000 0.0000 298 ILE A CD1   
2292 N N     . ARG A 302 ? 1.2389 1.5786 1.3369 0.0000 0.0000 0.0000 299 ARG A N     
2293 C CA    . ARG A 302 ? 1.2246 1.5604 1.3271 0.0000 0.0000 0.0000 299 ARG A CA    
2294 C C     . ARG A 302 ? 1.2175 1.5699 1.3605 0.0000 0.0000 0.0000 299 ARG A C     
2295 O O     . ARG A 302 ? 1.2082 1.5531 1.3618 0.0000 0.0000 0.0000 299 ARG A O     
2296 C CB    . ARG A 302 ? 1.2392 1.5730 1.3151 0.0000 0.0000 0.0000 299 ARG A CB    
2297 C CG    . ARG A 302 ? 1.2355 1.5522 1.2721 0.0000 0.0000 0.0000 299 ARG A CG    
2298 C CD    . ARG A 302 ? 1.2422 1.5496 1.2574 0.0000 0.0000 0.0000 299 ARG A CD    
2299 N NE    . ARG A 302 ? 1.2548 1.5460 1.2339 0.0000 0.0000 0.0000 299 ARG A NE    
2300 C CZ    . ARG A 302 ? 1.2823 1.5703 1.2316 0.0000 0.0000 0.0000 299 ARG A CZ    
2301 N NH1   . ARG A 302 ? 1.3061 1.6056 1.2557 0.0000 0.0000 0.0000 299 ARG A NH1   
2302 N NH2   . ARG A 302 ? 1.2846 1.5577 1.2039 0.0000 0.0000 0.0000 299 ARG A NH2   
2303 N N     . THR A 303 ? 1.2224 1.5976 1.3885 0.0000 0.0000 0.0000 300 THR A N     
2304 C CA    . THR A 303 ? 1.2141 1.6100 1.4247 0.0000 0.0000 0.0000 300 THR A CA    
2305 C C     . THR A 303 ? 1.1989 1.5947 1.4375 0.0000 0.0000 0.0000 300 THR A C     
2306 O O     . THR A 303 ? 1.1936 1.5956 1.4625 0.0000 0.0000 0.0000 300 THR A O     
2307 C CB    . THR A 303 ? 1.2278 1.6512 1.4574 0.0000 0.0000 0.0000 300 THR A CB    
2308 O OG1   . THR A 303 ? 1.2357 1.6641 1.4645 0.0000 0.0000 0.0000 300 THR A OG1   
2309 C CG2   . THR A 303 ? 1.2455 1.6669 1.4451 0.0000 0.0000 0.0000 300 THR A CG2   
2310 N N     . SER A 304 ? 1.1945 1.5816 1.4216 0.0000 0.0000 0.0000 301 SER A N     
2311 C CA    . SER A 304 ? 1.1851 1.5680 1.4340 0.0000 0.0000 0.0000 301 SER A CA    
2312 C C     . SER A 304 ? 1.1692 1.5241 1.4015 0.0000 0.0000 0.0000 301 SER A C     
2313 O O     . SER A 304 ? 1.1658 1.5093 1.4045 0.0000 0.0000 0.0000 301 SER A O     
2314 C CB    . SER A 304 ? 1.1966 1.5800 1.4396 0.0000 0.0000 0.0000 301 SER A CB    
2315 O OG    . SER A 304 ? 1.2122 1.5718 1.4153 0.0000 0.0000 0.0000 301 SER A OG    
2316 N N     . LEU A 305 ? 1.1602 1.5026 1.3701 0.0000 0.0000 0.0000 302 LEU A N     
2317 C CA    . LEU A 305 ? 1.1495 1.4654 1.3412 0.0000 0.0000 0.0000 302 LEU A CA    
2318 C C     . LEU A 305 ? 1.1470 1.4585 1.3620 0.0000 0.0000 0.0000 302 LEU A C     
2319 O O     . LEU A 305 ? 1.1461 1.4745 1.3891 0.0000 0.0000 0.0000 302 LEU A O     
2320 C CB    . LEU A 305 ? 1.1455 1.4502 1.3098 0.0000 0.0000 0.0000 302 LEU A CB    
2321 C CG    . LEU A 305 ? 1.1369 1.4329 1.2682 0.0000 0.0000 0.0000 302 LEU A CG    
2322 C CD1   . LEU A 305 ? 1.1214 1.4011 1.2293 0.0000 0.0000 0.0000 302 LEU A CD1   
2323 C CD2   . LEU A 305 ? 1.1399 1.4239 1.2639 0.0000 0.0000 0.0000 302 LEU A CD2   
2324 N N     . TYR A 306 ? 1.1501 1.4376 1.3516 0.0000 0.0000 0.0000 303 TYR A N     
2325 C CA    . TYR A 306 ? 1.1574 1.4331 1.3712 0.0000 0.0000 0.0000 303 TYR A CA    
2326 C C     . TYR A 306 ? 1.1564 1.4306 1.3708 0.0000 0.0000 0.0000 303 TYR A C     
2327 O O     . TYR A 306 ? 1.1573 1.4189 1.3450 0.0000 0.0000 0.0000 303 TYR A O     
2328 C CB    . TYR A 306 ? 1.1654 1.4099 1.3532 0.0000 0.0000 0.0000 303 TYR A CB    
2329 C CG    . TYR A 306 ? 1.1876 1.4144 1.3777 0.0000 0.0000 0.0000 303 TYR A CG    
2330 C CD1   . TYR A 306 ? 1.2132 1.4432 1.4303 0.0000 0.0000 0.0000 303 TYR A CD1   
2331 C CD2   . TYR A 306 ? 1.1950 1.4017 1.3608 0.0000 0.0000 0.0000 303 TYR A CD2   
2332 C CE1   . TYR A 306 ? 1.2327 1.4451 1.4499 0.0000 0.0000 0.0000 303 TYR A CE1   
2333 C CE2   . TYR A 306 ? 1.2138 1.4023 1.3781 0.0000 0.0000 0.0000 303 TYR A CE2   
2334 C CZ    . TYR A 306 ? 1.2343 1.4253 1.4233 0.0000 0.0000 0.0000 303 TYR A CZ    
2335 O OH    . TYR A 306 ? 1.2599 1.4316 1.4460 0.0000 0.0000 0.0000 303 TYR A OH    
2336 N N     . HIS A 307 ? 1.1571 1.4432 1.4032 0.0000 0.0000 0.0000 304 HIS A N     
2337 C CA    . HIS A 307 ? 1.1583 1.4400 1.4050 0.0000 0.0000 0.0000 304 HIS A CA    
2338 C C     . HIS A 307 ? 1.1571 1.4279 1.4177 0.0000 0.0000 0.0000 304 HIS A C     
2339 O O     . HIS A 307 ? 1.1603 1.4494 1.4575 0.0000 0.0000 0.0000 304 HIS A O     
2340 C CB    . HIS A 307 ? 1.1626 1.4720 1.4320 0.0000 0.0000 0.0000 304 HIS A CB    
2341 C CG    . HIS A 307 ? 1.1911 1.4924 1.4566 0.0000 0.0000 0.0000 304 HIS A CG    
2342 N ND1   . HIS A 307 ? 1.2133 1.4945 1.4435 0.0000 0.0000 0.0000 304 HIS A ND1   
2343 C CD2   . HIS A 307 ? 1.2095 1.5176 1.5016 0.0000 0.0000 0.0000 304 HIS A CD2   
2344 C CE1   . HIS A 307 ? 1.2256 1.5005 1.4593 0.0000 0.0000 0.0000 304 HIS A CE1   
2345 N NE2   . HIS A 307 ? 1.2252 1.5161 1.4958 0.0000 0.0000 0.0000 304 HIS A NE2   
2346 N N     . PRO A 308 ? 1.1552 1.3962 1.3866 0.0000 0.0000 0.0000 305 PRO A N     
2347 C CA    . PRO A 308 ? 1.1627 1.3843 1.3941 0.0000 0.0000 0.0000 305 PRO A CA    
2348 C C     . PRO A 308 ? 1.1619 1.4027 1.4298 0.0000 0.0000 0.0000 305 PRO A C     
2349 O O     . PRO A 308 ? 1.1556 1.4168 1.4384 0.0000 0.0000 0.0000 305 PRO A O     
2350 C CB    . PRO A 308 ? 1.1682 1.3588 1.3578 0.0000 0.0000 0.0000 305 PRO A CB    
2351 C CG    . PRO A 308 ? 1.1562 1.3583 1.3378 0.0000 0.0000 0.0000 305 PRO A CG    
2352 C CD    . PRO A 308 ? 1.1509 1.3750 1.3454 0.0000 0.0000 0.0000 305 PRO A CD    
2353 N N     . SER A 309 ? 1.1691 1.4024 1.4511 0.0000 0.0000 0.0000 306 SER A N     
2354 C CA    . SER A 309 ? 1.1697 1.4177 1.4850 0.0000 0.0000 0.0000 306 SER A CA    
2355 C C     . SER A 309 ? 1.1808 1.3954 1.4669 0.0000 0.0000 0.0000 306 SER A C     
2356 O O     . SER A 309 ? 1.1948 1.3750 1.4385 0.0000 0.0000 0.0000 306 SER A O     
2357 C CB    . SER A 309 ? 1.1744 1.4455 1.5368 0.0000 0.0000 0.0000 306 SER A CB    
2358 O OG    . SER A 309 ? 1.1918 1.4430 1.5402 0.0000 0.0000 0.0000 306 SER A OG    
2359 N N     . THR A 310 ? 1.1774 1.4016 1.4855 0.0000 0.0000 0.0000 307 THR A N     
2360 C CA    . THR A 310 ? 1.1908 1.3827 1.4707 0.0000 0.0000 0.0000 307 THR A CA    
2361 C C     . THR A 310 ? 1.2101 1.3782 1.4801 0.0000 0.0000 0.0000 307 THR A C     
2362 O O     . THR A 310 ? 1.2099 1.3959 1.5134 0.0000 0.0000 0.0000 307 THR A O     
2363 C CB    . THR A 310 ? 1.1902 1.3978 1.4982 0.0000 0.0000 0.0000 307 THR A CB    
2364 O OG1   . THR A 310 ? 1.1922 1.4266 1.5511 0.0000 0.0000 0.0000 307 THR A OG1   
2365 C CG2   . THR A 310 ? 1.1671 1.3980 1.4863 0.0000 0.0000 0.0000 307 THR A CG2   
2366 N N     . PRO A 311 ? 1.2292 1.3554 1.4514 0.0000 0.0000 0.0000 308 PRO A N     
2367 C CA    . PRO A 311 ? 1.2556 1.3504 1.4563 0.0000 0.0000 0.0000 308 PRO A CA    
2368 C C     . PRO A 311 ? 1.2744 1.3701 1.4986 0.0000 0.0000 0.0000 308 PRO A C     
2369 O O     . PRO A 311 ? 1.2675 1.3806 1.5151 0.0000 0.0000 0.0000 308 PRO A O     
2370 C CB    . PRO A 311 ? 1.2730 1.3247 1.4124 0.0000 0.0000 0.0000 308 PRO A CB    
2371 C CG    . PRO A 311 ? 1.2644 1.3245 1.4043 0.0000 0.0000 0.0000 308 PRO A CG    
2372 C CD    . PRO A 311 ? 1.2308 1.3348 1.4134 0.0000 0.0000 0.0000 308 PRO A CD    
2373 N N     . PRO A 312 ? 1.6731 1.4923 1.3857 0.0000 0.0000 0.0000 309 PRO A N     
2374 C CA    . PRO A 312 ? 1.6604 1.4852 1.3878 0.0000 0.0000 0.0000 309 PRO A CA    
2375 C C     . PRO A 312 ? 1.5804 1.4561 1.3549 0.0000 0.0000 0.0000 309 PRO A C     
2376 O O     . PRO A 312 ? 1.5615 1.4249 1.3399 0.0000 0.0000 0.0000 309 PRO A O     
2377 C CB    . PRO A 312 ? 1.7554 1.4617 1.4247 0.0000 0.0000 0.0000 309 PRO A CB    
2378 C CG    . PRO A 312 ? 1.8352 1.4730 1.4524 0.0000 0.0000 0.0000 309 PRO A CG    
2379 C CD    . PRO A 312 ? 1.7751 1.4810 1.4214 0.0000 0.0000 0.0000 309 PRO A CD    
2380 N N     . ALA A 313 ? 1.5409 1.4777 1.3487 0.0000 0.0000 0.0000 310 ALA A N     
2381 C CA    . ALA A 313 ? 1.4825 1.4583 1.3288 0.0000 0.0000 0.0000 310 ALA A CA    
2382 C C     . ALA A 313 ? 1.5119 1.4193 1.3370 0.0000 0.0000 0.0000 310 ALA A C     
2383 O O     . ALA A 313 ? 1.5806 1.4258 1.3664 0.0000 0.0000 0.0000 310 ALA A O     
2384 C CB    . ALA A 313 ? 1.4504 1.5015 1.3255 0.0000 0.0000 0.0000 310 ALA A CB    
2385 N N     . SER A 314 ? 1.4706 1.3868 1.3179 0.0000 0.0000 0.0000 311 SER A N     
2386 C CA    . SER A 314 ? 1.4901 1.3574 1.3222 0.0000 0.0000 0.0000 311 SER A CA    
2387 C C     . SER A 314 ? 1.4780 1.3819 1.3253 0.0000 0.0000 0.0000 311 SER A C     
2388 O O     . SER A 314 ? 1.4299 1.4081 1.3111 0.0000 0.0000 0.0000 311 SER A O     
2389 C CB    . SER A 314 ? 1.4482 1.3268 1.3015 0.0000 0.0000 0.0000 311 SER A CB    
2390 O OG    . SER A 314 ? 1.3880 1.3189 1.2799 0.0000 0.0000 0.0000 311 SER A OG    
2391 N N     . SER A 315 ? 1.5263 1.3821 1.3452 0.0000 0.0000 0.0000 312 SER A N     
2392 C CA    . SER A 315 ? 1.5317 1.4274 1.3555 0.0000 0.0000 0.0000 312 SER A CA    
2393 C C     . SER A 315 ? 1.4588 1.4448 1.3315 0.0000 0.0000 0.0000 312 SER A C     
2394 O O     . SER A 315 ? 1.4491 1.5019 1.3347 0.0000 0.0000 0.0000 312 SER A O     
2395 C CB    . SER A 315 ? 1.5997 1.4238 1.3792 0.0000 0.0000 0.0000 312 SER A CB    
2396 O OG    . SER A 315 ? 1.5902 1.3958 1.3740 0.0000 0.0000 0.0000 312 SER A OG    
2397 N N     . ARG A 316 ? 1.4143 1.4042 1.3107 0.0000 0.0000 0.0000 313 ARG A N     
2398 C CA    . ARG A 316 ? 1.3593 1.4162 1.2943 0.0000 0.0000 0.0000 313 ARG A CA    
2399 C C     . ARG A 316 ? 1.3221 1.4005 1.2836 0.0000 0.0000 0.0000 313 ARG A C     
2400 O O     . ARG A 316 ? 1.2976 1.3712 1.2749 0.0000 0.0000 0.0000 313 ARG A O     
2401 C CB    . ARG A 316 ? 1.3537 1.3952 1.2896 0.0000 0.0000 0.0000 313 ARG A CB    
2402 C CG    . ARG A 316 ? 1.3983 1.4221 1.3060 0.0000 0.0000 0.0000 313 ARG A CG    
2403 C CD    . ARG A 316 ? 1.3650 1.4576 1.2935 0.0000 0.0000 0.0000 313 ARG A CD    
2404 N NE    . ARG A 316 ? 1.3856 1.4586 1.2872 0.0000 0.0000 0.0000 313 ARG A NE    
2405 C CZ    . ARG A 316 ? 1.3751 1.4343 1.2760 0.0000 0.0000 0.0000 313 ARG A CZ    
2406 N NH1   . ARG A 316 ? 1.3349 1.3970 1.2608 0.0000 0.0000 0.0000 313 ARG A NH1   
2407 N NH2   . ARG A 316 ? 1.4132 1.4571 1.2860 0.0000 0.0000 0.0000 313 ARG A NH2   
2408 N N     . SER A 317 ? 1.3247 1.4273 1.2886 0.0000 0.0000 0.0000 314 SER A N     
2409 C CA    . SER A 317 ? 1.2989 1.4219 1.2828 0.0000 0.0000 0.0000 314 SER A CA    
2410 C C     . SER A 317 ? 1.2759 1.4648 1.2826 0.0000 0.0000 0.0000 314 SER A C     
2411 O O     . SER A 317 ? 1.2801 1.5128 1.2886 0.0000 0.0000 0.0000 314 SER A O     
2412 C CB    . SER A 317 ? 1.3172 1.4285 1.2867 0.0000 0.0000 0.0000 314 SER A CB    
2413 O OG    . SER A 317 ? 1.3317 1.4885 1.3008 0.0000 0.0000 0.0000 314 SER A OG    
2414 N N     . TRP A 318 ? 1.2609 1.4597 1.2816 0.0000 0.0000 0.0000 315 TRP A N     
2415 C CA    . TRP A 318 ? 1.2528 1.5050 1.2878 0.0000 0.0000 0.0000 315 TRP A CA    
2416 C C     . TRP A 318 ? 1.2520 1.5219 1.2893 0.0000 0.0000 0.0000 315 TRP A C     
2417 O O     . TRP A 318 ? 1.2548 1.4945 1.2881 0.0000 0.0000 0.0000 315 TRP A O     
2418 C CB    . TRP A 318 ? 1.2473 1.4869 1.2923 0.0000 0.0000 0.0000 315 TRP A CB    
2419 C CG    . TRP A 318 ? 1.2512 1.4415 1.2977 0.0000 0.0000 0.0000 315 TRP A CG    
2420 C CD1   . TRP A 318 ? 1.2547 1.4005 1.2975 0.0000 0.0000 0.0000 315 TRP A CD1   
2421 C CD2   . TRP A 318 ? 1.2697 1.4537 1.3183 0.0000 0.0000 0.0000 315 TRP A CD2   
2422 N NE1   . TRP A 318 ? 1.2602 1.3817 1.3057 0.0000 0.0000 0.0000 315 TRP A NE1   
2423 C CE2   . TRP A 318 ? 1.2732 1.4097 1.3203 0.0000 0.0000 0.0000 315 TRP A CE2   
2424 C CE3   . TRP A 318 ? 1.2957 1.5100 1.3437 0.0000 0.0000 0.0000 315 TRP A CE3   
2425 C CZ2   . TRP A 318 ? 1.2994 1.4114 1.3430 0.0000 0.0000 0.0000 315 TRP A CZ2   
2426 C CZ3   . TRP A 318 ? 1.3262 1.5068 1.3679 0.0000 0.0000 0.0000 315 TRP A CZ3   
2427 C CH2   . TRP A 318 ? 1.3293 1.4561 1.3682 0.0000 0.0000 0.0000 315 TRP A CH2   
2428 N N     . SER A 319 ? 1.2493 1.5787 1.2922 0.0000 0.0000 0.0000 316 SER A N     
2429 C CA    . SER A 319 ? 1.2480 1.5993 1.2923 0.0000 0.0000 0.0000 316 SER A CA    
2430 C C     . SER A 319 ? 1.2547 1.6214 1.3028 0.0000 0.0000 0.0000 316 SER A C     
2431 O O     . SER A 319 ? 1.2569 1.6514 1.3076 0.0000 0.0000 0.0000 316 SER A O     
2432 C CB    . SER A 319 ? 1.2499 1.6564 1.2902 0.0000 0.0000 0.0000 316 SER A CB    
2433 O OG    . SER A 319 ? 1.2587 1.6279 1.2881 0.0000 0.0000 0.0000 316 SER A OG    
2434 N N     . PRO A 320 ? 1.2620 1.6093 1.3063 0.0000 0.0000 0.0000 317 PRO A N     
2435 C CA    . PRO A 320 ? 1.2813 1.6150 1.3190 0.0000 0.0000 0.0000 317 PRO A CA    
2436 C C     . PRO A 320 ? 1.2805 1.6889 1.3158 0.0000 0.0000 0.0000 317 PRO A C     
2437 O O     . PRO A 320 ? 1.2720 1.7261 1.3078 0.0000 0.0000 0.0000 317 PRO A O     
2438 C CB    . PRO A 320 ? 1.2986 1.5826 1.3287 0.0000 0.0000 0.0000 317 PRO A CB    
2439 C CG    . PRO A 320 ? 1.2738 1.5790 1.3095 0.0000 0.0000 0.0000 317 PRO A CG    
2440 C CD    . PRO A 320 ? 1.2573 1.6017 1.2989 0.0000 0.0000 0.0000 317 PRO A CD    
2441 N N     . VAL A 321 ? 1.2862 1.7144 1.3180 0.0000 0.0000 0.0000 318 VAL A N     
2442 C CA    . VAL A 321 ? 1.2897 1.7964 1.3162 0.0000 0.0000 0.0000 318 VAL A CA    
2443 C C     . VAL A 321 ? 1.3336 1.7860 1.3372 0.0000 0.0000 0.0000 318 VAL A C     
2444 O O     . VAL A 321 ? 1.3628 1.7288 1.3556 0.0000 0.0000 0.0000 318 VAL A O     
2445 C CB    . VAL A 321 ? 1.2788 1.8579 1.3128 0.0000 0.0000 0.0000 318 VAL A CB    
2446 C CG1   . VAL A 321 ? 1.3001 1.9772 1.3279 0.0000 0.0000 0.0000 318 VAL A CG1   
2447 C CG2   . VAL A 321 ? 1.2423 1.8593 1.2912 0.0000 0.0000 0.0000 318 VAL A CG2   
2448 N N     . VAL A 322 ? 1.3405 1.8383 1.3327 0.0000 0.0000 0.0000 319 VAL A N     
2449 C CA    . VAL A 322 ? 1.3946 1.8353 1.3557 0.0000 0.0000 0.0000 319 VAL A CA    
2450 C C     . VAL A 322 ? 1.4216 1.8390 1.3678 0.0000 0.0000 0.0000 319 VAL A C     
2451 O O     . VAL A 322 ? 1.3955 1.9017 1.3542 0.0000 0.0000 0.0000 319 VAL A O     
2452 C CB    . VAL A 322 ? 1.4132 1.9262 1.3628 0.0000 0.0000 0.0000 319 VAL A CB    
2453 C CG1   . VAL A 322 ? 1.4959 1.9268 1.4051 0.0000 0.0000 0.0000 319 VAL A CG1   
2454 C CG2   . VAL A 322 ? 1.3723 1.9280 1.3388 0.0000 0.0000 0.0000 319 VAL A CG2   
2455 N N     . GLY A 323 ? 1.4742 1.7749 1.3920 0.0000 0.0000 0.0000 320 GLY A N     
2456 C CA    . GLY A 323 ? 1.5093 1.7722 1.4071 0.0000 0.0000 0.0000 320 GLY A CA    
2457 C C     . GLY A 323 ? 1.4547 1.7234 1.3763 0.0000 0.0000 0.0000 320 GLY A C     
2458 O O     . GLY A 323 ? 1.4539 1.7735 1.3752 0.0000 0.0000 0.0000 320 GLY A O     
2459 N N     . GLN A 324 ? 1.4094 1.6325 1.3499 0.0000 0.0000 0.0000 321 GLN A N     
2460 C CA    . GLN A 324 ? 1.3591 1.5831 1.3209 0.0000 0.0000 0.0000 321 GLN A CA    
2461 C C     . GLN A 324 ? 1.3997 1.5036 1.3445 0.0000 0.0000 0.0000 321 GLN A C     
2462 O O     . GLN A 324 ? 1.4421 1.4629 1.3695 0.0000 0.0000 0.0000 321 GLN A O     
2463 C CB    . GLN A 324 ? 1.2878 1.5494 1.2790 0.0000 0.0000 0.0000 321 GLN A CB    
2464 C CG    . GLN A 324 ? 1.2403 1.5225 1.2517 0.0000 0.0000 0.0000 321 GLN A CG    
2465 C CD    . GLN A 324 ? 1.1986 1.5014 1.2284 0.0000 0.0000 0.0000 321 GLN A CD    
2466 O OE1   . GLN A 324 ? 1.1934 1.4845 1.2226 0.0000 0.0000 0.0000 321 GLN A OE1   
2467 N NE2   . GLN A 324 ? 1.1752 1.5069 1.2172 0.0000 0.0000 0.0000 321 GLN A NE2   
2468 N N     . LEU A 325 ? 1.3870 1.4878 1.3357 0.0000 0.0000 0.0000 322 LEU A N     
2469 C CA    . LEU A 325 ? 1.4153 1.4120 1.3508 0.0000 0.0000 0.0000 322 LEU A CA    
2470 C C     . LEU A 325 ? 1.3578 1.3420 1.3179 0.0000 0.0000 0.0000 322 LEU A C     
2471 O O     . LEU A 325 ? 1.3028 1.3475 1.2883 0.0000 0.0000 0.0000 322 LEU A O     
2472 C CB    . LEU A 325 ? 1.4340 1.4375 1.3629 0.0000 0.0000 0.0000 322 LEU A CB    
2473 C CG    . LEU A 325 ? 1.5297 1.4790 1.4163 0.0000 0.0000 0.0000 322 LEU A CG    
2474 C CD1   . LEU A 325 ? 1.5833 1.4909 1.4565 0.0000 0.0000 0.0000 322 LEU A CD1   
2475 C CD2   . LEU A 325 ? 1.5999 1.4347 1.4544 0.0000 0.0000 0.0000 322 LEU A CD2   
2476 N N     . VAL A 326 ? 1.3785 1.2840 1.3265 0.0000 0.0000 0.0000 323 VAL A N     
2477 C CA    . VAL A 326 ? 1.3209 1.2276 1.2882 0.0000 0.0000 0.0000 323 VAL A CA    
2478 C C     . VAL A 326 ? 1.3638 1.1773 1.3145 0.0000 0.0000 0.0000 323 VAL A C     
2479 O O     . VAL A 326 ? 1.4436 1.1827 1.3627 0.0000 0.0000 0.0000 323 VAL A O     
2480 C CB    . VAL A 326 ? 1.3029 1.2482 1.2736 0.0000 0.0000 0.0000 323 VAL A CB    
2481 C CG1   . VAL A 326 ? 1.2880 1.2213 1.2675 0.0000 0.0000 0.0000 323 VAL A CG1   
2482 C CG2   . VAL A 326 ? 1.2480 1.2919 1.2390 0.0000 0.0000 0.0000 323 VAL A CG2   
2483 N N     . GLN A 327 ? 1.3235 1.1385 1.2911 0.0000 0.0000 0.0000 324 GLN A N     
2484 C CA    . GLN A 327 ? 1.3692 1.1083 1.3217 0.0000 0.0000 0.0000 324 GLN A CA    
2485 C C     . GLN A 327 ? 1.3355 1.0947 1.3003 0.0000 0.0000 0.0000 324 GLN A C     
2486 O O     . GLN A 327 ? 1.2656 1.0908 1.2550 0.0000 0.0000 0.0000 324 GLN A O     
2487 C CB    . GLN A 327 ? 1.3795 1.0955 1.3337 0.0000 0.0000 0.0000 324 GLN A CB    
2488 C CG    . GLN A 327 ? 1.4229 1.1188 1.3602 0.0000 0.0000 0.0000 324 GLN A CG    
2489 C CD    . GLN A 327 ? 1.4390 1.1320 1.3820 0.0000 0.0000 0.0000 324 GLN A CD    
2490 O OE1   . GLN A 327 ? 1.4195 1.1765 1.3775 0.0000 0.0000 0.0000 324 GLN A OE1   
2491 N NE2   . GLN A 327 ? 1.4883 1.1167 1.4201 0.0000 0.0000 0.0000 324 GLN A NE2   
2492 N N     . GLU A 328 ? 1.3929 1.0930 1.3361 0.0000 0.0000 0.0000 325 GLU A N     
2493 C CA    . GLU A 328 ? 1.3759 1.1040 1.3265 0.0000 0.0000 0.0000 325 GLU A CA    
2494 C C     . GLU A 328 ? 1.3657 1.0898 1.3243 0.0000 0.0000 0.0000 325 GLU A C     
2495 O O     . GLU A 328 ? 1.4175 1.0762 1.3602 0.0000 0.0000 0.0000 325 GLU A O     
2496 C CB    . GLU A 328 ? 1.4559 1.1302 1.3758 0.0000 0.0000 0.0000 325 GLU A CB    
2497 C CG    . GLU A 328 ? 1.4466 1.1776 1.3750 0.0000 0.0000 0.0000 325 GLU A CG    
2498 C CD    . GLU A 328 ? 1.5458 1.2243 1.4403 0.0000 0.0000 0.0000 325 GLU A CD    
2499 O OE1   . GLU A 328 ? 1.6450 1.2188 1.5028 0.0000 0.0000 0.0000 325 GLU A OE1   
2500 O OE2   . GLU A 328 ? 1.5307 1.2733 1.4321 0.0000 0.0000 0.0000 325 GLU A OE2   
2501 N N     . ARG A 329 ? 1.3056 1.1017 1.2859 0.0000 0.0000 0.0000 326 ARG A N     
2502 C CA    . ARG A 329 ? 1.2946 1.1050 1.2830 0.0000 0.0000 0.0000 326 ARG A CA    
2503 C C     . ARG A 329 ? 1.3524 1.1213 1.3198 0.0000 0.0000 0.0000 326 ARG A C     
2504 O O     . ARG A 329 ? 1.3881 1.1473 1.3405 0.0000 0.0000 0.0000 326 ARG A O     
2505 C CB    . ARG A 329 ? 1.2270 1.1284 1.2387 0.0000 0.0000 0.0000 326 ARG A CB    
2506 C CG    . ARG A 329 ? 1.2633 1.1933 1.2815 0.0000 0.0000 0.0000 326 ARG A CG    
2507 C CD    . ARG A 329 ? 1.2626 1.2653 1.2985 0.0000 0.0000 0.0000 326 ARG A CD    
2508 N NE    . ARG A 329 ? 1.2854 1.3247 1.3260 0.0000 0.0000 0.0000 326 ARG A NE    
2509 C CZ    . ARG A 329 ? 1.2826 1.3292 1.3286 0.0000 0.0000 0.0000 326 ARG A CZ    
2510 N NH1   . ARG A 329 ? 1.2799 1.3076 1.3289 0.0000 0.0000 0.0000 326 ARG A NH1   
2511 N NH2   . ARG A 329 ? 1.2699 1.3434 1.3156 0.0000 0.0000 0.0000 326 ARG A NH2   
2512 N N     . VAL A 330 ? 1.3653 1.1113 1.3296 0.0000 0.0000 0.0000 327 VAL A N     
2513 C CA    . VAL A 330 ? 1.4313 1.1380 1.3732 0.0000 0.0000 0.0000 327 VAL A CA    
2514 C C     . VAL A 330 ? 1.3978 1.1982 1.3518 0.0000 0.0000 0.0000 327 VAL A C     
2515 O O     . VAL A 330 ? 1.3240 1.2173 1.3047 0.0000 0.0000 0.0000 327 VAL A O     
2516 C CB    . VAL A 330 ? 1.4647 1.1313 1.4001 0.0000 0.0000 0.0000 327 VAL A CB    
2517 C CG1   . VAL A 330 ? 1.5249 1.1863 1.4438 0.0000 0.0000 0.0000 327 VAL A CG1   
2518 C CG2   . VAL A 330 ? 1.5252 1.0813 1.4345 0.0000 0.0000 0.0000 327 VAL A CG2   
2519 N N     . ALA A 331 ? 1.4611 1.2356 1.3911 0.0000 0.0000 0.0000 328 ALA A N     
2520 C CA    . ALA A 331 ? 1.4397 1.3088 1.3764 0.0000 0.0000 0.0000 328 ALA A CA    
2521 C C     . ALA A 331 ? 1.3911 1.3416 1.3482 0.0000 0.0000 0.0000 328 ALA A C     
2522 O O     . ALA A 331 ? 1.3075 1.3441 1.2917 0.0000 0.0000 0.0000 328 ALA A O     
2523 C CB    . ALA A 331 ? 1.5480 1.3547 1.4474 0.0000 0.0000 0.0000 328 ALA A CB    
2524 N N     . ARG A 332 ? 1.4472 1.3667 1.3870 0.0000 0.0000 0.0000 329 ARG A N     
2525 C CA    . ARG A 332 ? 1.4085 1.4144 1.3658 0.0000 0.0000 0.0000 329 ARG A CA    
2526 C C     . ARG A 332 ? 1.4315 1.3573 1.3816 0.0000 0.0000 0.0000 329 ARG A C     
2527 O O     . ARG A 332 ? 1.5150 1.3882 1.4418 0.0000 0.0000 0.0000 329 ARG A O     
2528 C CB    . ARG A 332 ? 1.4543 1.5281 1.4011 0.0000 0.0000 0.0000 329 ARG A CB    
2529 N N     . PRO A 333 ? 1.3611 1.2796 1.3293 0.0000 0.0000 0.0000 330 PRO A N     
2530 C CA    . PRO A 333 ? 1.3797 1.2229 1.3405 0.0000 0.0000 0.0000 330 PRO A CA    
2531 C C     . PRO A 333 ? 1.4013 1.2774 1.3598 0.0000 0.0000 0.0000 330 PRO A C     
2532 O O     . PRO A 333 ? 1.3524 1.3479 1.3309 0.0000 0.0000 0.0000 330 PRO A O     
2533 C CB    . PRO A 333 ? 1.2893 1.1821 1.2782 0.0000 0.0000 0.0000 330 PRO A CB    
2534 C CG    . PRO A 333 ? 1.2432 1.1816 1.2433 0.0000 0.0000 0.0000 330 PRO A CG    
2535 C CD    . PRO A 333 ? 1.2660 1.2611 1.2613 0.0000 0.0000 0.0000 330 PRO A CD    
2536 N N     . ALA A 334 ? 1.4823 1.2559 1.4135 0.0000 0.0000 0.0000 331 ALA A N     
2537 C CA    . ALA A 334 ? 1.5130 1.3159 1.4411 0.0000 0.0000 0.0000 331 ALA A CA    
2538 C C     . ALA A 334 ? 1.4401 1.2994 1.3947 0.0000 0.0000 0.0000 331 ALA A C     
2539 O O     . ALA A 334 ? 1.3792 1.2351 1.3488 0.0000 0.0000 0.0000 331 ALA A O     
2540 C CB    . ALA A 334 ? 1.6479 1.3097 1.5306 0.0000 0.0000 0.0000 331 ALA A CB    
2541 N N     . SER A 335 ? 1.4493 1.3662 1.4080 0.0000 0.0000 0.0000 332 SER A N     
2542 C CA    . SER A 335 ? 1.3857 1.3684 1.3676 0.0000 0.0000 0.0000 332 SER A CA    
2543 C C     . SER A 335 ? 1.4159 1.2925 1.3848 0.0000 0.0000 0.0000 332 SER A C     
2544 O O     . SER A 335 ? 1.5132 1.2934 1.4522 0.0000 0.0000 0.0000 332 SER A O     
2545 C CB    . SER A 335 ? 1.3971 1.4753 1.3843 0.0000 0.0000 0.0000 332 SER A CB    
2546 O OG    . SER A 335 ? 1.3241 1.4935 1.3362 0.0000 0.0000 0.0000 332 SER A OG    
2547 N N     . LEU A 336 ? 1.3376 1.2328 1.3255 0.0000 0.0000 0.0000 333 LEU A N     
2548 C CA    . LEU A 336 ? 1.3477 1.1693 1.3273 0.0000 0.0000 0.0000 333 LEU A CA    
2549 C C     . LEU A 336 ? 1.4020 1.1033 1.3569 0.0000 0.0000 0.0000 333 LEU A C     
2550 O O     . LEU A 336 ? 1.4393 1.0747 1.3803 0.0000 0.0000 0.0000 333 LEU A O     
2551 C CB    . LEU A 336 ? 1.4050 1.2029 1.3707 0.0000 0.0000 0.0000 333 LEU A CB    
2552 C CG    . LEU A 336 ? 1.3479 1.2594 1.3349 0.0000 0.0000 0.0000 333 LEU A CG    
2553 C CD1   . LEU A 336 ? 1.4182 1.2799 1.3843 0.0000 0.0000 0.0000 333 LEU A CD1   
2554 C CD2   . LEU A 336 ? 1.2509 1.2296 1.2634 0.0000 0.0000 0.0000 333 LEU A CD2   
2555 N N     . ARG A 337 ? 1.4084 1.0877 1.3560 0.0000 0.0000 0.0000 334 ARG A N     
2556 C CA    . ARG A 337 ? 1.4601 1.0303 1.3811 0.0000 0.0000 0.0000 334 ARG A CA    
2557 C C     . ARG A 337 ? 1.3866 0.9966 1.3283 0.0000 0.0000 0.0000 334 ARG A C     
2558 O O     . ARG A 337 ? 1.3029 1.0112 1.2733 0.0000 0.0000 0.0000 334 ARG A O     
2559 C CB    . ARG A 337 ? 1.5554 1.0445 1.4408 0.0000 0.0000 0.0000 334 ARG A CB    
2560 C CG    . ARG A 337 ? 1.6395 1.0608 1.4945 0.0000 0.0000 0.0000 334 ARG A CG    
2561 C CD    . ARG A 337 ? 1.7676 1.0297 1.5672 0.0000 0.0000 0.0000 334 ARG A CD    
2562 N NE    . ARG A 337 ? 1.8851 1.0561 1.6456 0.0000 0.0000 0.0000 334 ARG A NE    
2563 C CZ    . ARG A 337 ? 1.9201 1.0347 1.6659 0.0000 0.0000 0.0000 334 ARG A CZ    
2564 N NH1   . ARG A 337 ? 1.8523 1.0034 1.6217 0.0000 0.0000 0.0000 334 ARG A NH1   
2565 N NH2   . ARG A 337 ? 2.0301 1.0562 1.7360 0.0000 0.0000 0.0000 334 ARG A NH2   
2566 N N     . PRO A 338 ? 1.4227 0.9588 1.3473 0.0000 0.0000 0.0000 335 PRO A N     
2567 C CA    . PRO A 338 ? 1.3588 0.9370 1.3024 0.0000 0.0000 0.0000 335 PRO A CA    
2568 C C     . PRO A 338 ? 1.3198 0.9558 1.2790 0.0000 0.0000 0.0000 335 PRO A C     
2569 O O     . PRO A 338 ? 1.3705 0.9754 1.3130 0.0000 0.0000 0.0000 335 PRO A O     
2570 C CB    . PRO A 338 ? 1.4263 0.9077 1.3389 0.0000 0.0000 0.0000 335 PRO A CB    
2571 C CG    . PRO A 338 ? 1.5099 0.9151 1.3953 0.0000 0.0000 0.0000 335 PRO A CG    
2572 C CD    . PRO A 338 ? 1.5327 0.9457 1.4165 0.0000 0.0000 0.0000 335 PRO A CD    
2573 N N     . ARG A 339 ? 1.2471 0.9641 1.2342 0.0000 0.0000 0.0000 336 ARG A N     
2574 C CA    . ARG A 339 ? 1.2135 0.9882 1.2137 0.0000 0.0000 0.0000 336 ARG A CA    
2575 C C     . ARG A 339 ? 1.2280 0.9706 1.2189 0.0000 0.0000 0.0000 336 ARG A C     
2576 O O     . ARG A 339 ? 1.1971 0.9825 1.1955 0.0000 0.0000 0.0000 336 ARG A O     
2577 C CB    . ARG A 339 ? 1.1382 0.9976 1.1635 0.0000 0.0000 0.0000 336 ARG A CB    
2578 C CG    . ARG A 339 ? 1.1396 1.0732 1.1758 0.0000 0.0000 0.0000 336 ARG A CG    
2579 C CD    . ARG A 339 ? 1.2298 1.1546 1.2594 0.0000 0.0000 0.0000 336 ARG A CD    
2580 N NE    . ARG A 339 ? 1.2240 1.2391 1.2651 0.0000 0.0000 0.0000 336 ARG A NE    
2581 C CZ    . ARG A 339 ? 1.2749 1.3113 1.3120 0.0000 0.0000 0.0000 336 ARG A CZ    
2582 N NH1   . ARG A 339 ? 1.3429 1.3018 1.3614 0.0000 0.0000 0.0000 336 ARG A NH1   
2583 N NH2   . ARG A 339 ? 1.2580 1.3941 1.3063 0.0000 0.0000 0.0000 336 ARG A NH2   
2584 N N     . TRP A 340 ? 1.2830 0.9567 1.2559 0.0000 0.0000 0.0000 337 TRP A N     
2585 C CA    . TRP A 340 ? 1.3080 0.9549 1.2691 0.0000 0.0000 0.0000 337 TRP A CA    
2586 C C     . TRP A 340 ? 1.4166 0.9571 1.3387 0.0000 0.0000 0.0000 337 TRP A C     
2587 O O     . TRP A 340 ? 1.4765 0.9560 1.3803 0.0000 0.0000 0.0000 337 TRP A O     
2588 C CB    . TRP A 340 ? 1.2545 0.9417 1.2305 0.0000 0.0000 0.0000 337 TRP A CB    
2589 C CG    . TRP A 340 ? 1.1849 0.9559 1.1895 0.0000 0.0000 0.0000 337 TRP A CG    
2590 C CD1   . TRP A 340 ? 1.1532 0.9600 1.1720 0.0000 0.0000 0.0000 337 TRP A CD1   
2591 C CD2   . TRP A 340 ? 1.1531 0.9766 1.1699 0.0000 0.0000 0.0000 337 TRP A CD2   
2592 N NE1   . TRP A 340 ? 1.0945 0.9632 1.1298 0.0000 0.0000 0.0000 337 TRP A NE1   
2593 C CE2   . TRP A 340 ? 1.0948 0.9733 1.1290 0.0000 0.0000 0.0000 337 TRP A CE2   
2594 C CE3   . TRP A 340 ? 1.1729 1.0006 1.1846 0.0000 0.0000 0.0000 337 TRP A CE3   
2595 C CZ2   . TRP A 340 ? 1.0667 0.9933 1.1097 0.0000 0.0000 0.0000 337 TRP A CZ2   
2596 C CZ3   . TRP A 340 ? 1.1166 1.0048 1.1420 0.0000 0.0000 0.0000 337 TRP A CZ3   
2597 C CH2   . TRP A 340 ? 1.0751 1.0068 1.1142 0.0000 0.0000 0.0000 337 TRP A CH2   
2598 N N     . HIS A 341 ? 1.4549 0.9703 1.3605 0.0000 0.0000 0.0000 338 HIS A N     
2599 C CA    . HIS A 341 ? 1.5696 0.9754 1.4300 0.0000 0.0000 0.0000 338 HIS A CA    
2600 C C     . HIS A 341 ? 1.5779 0.9758 1.4319 0.0000 0.0000 0.0000 338 HIS A C     
2601 O O     . HIS A 341 ? 1.4918 0.9788 1.3791 0.0000 0.0000 0.0000 338 HIS A O     
2602 C CB    . HIS A 341 ? 1.6004 0.9919 1.4440 0.0000 0.0000 0.0000 338 HIS A CB    
2603 C CG    . HIS A 341 ? 1.6231 1.0133 1.4619 0.0000 0.0000 0.0000 338 HIS A CG    
2604 N ND1   . HIS A 341 ? 1.7339 1.0262 1.5348 0.0000 0.0000 0.0000 338 HIS A ND1   
2605 C CD2   . HIS A 341 ? 1.5603 1.0406 1.4247 0.0000 0.0000 0.0000 338 HIS A CD2   
2606 C CE1   . HIS A 341 ? 1.7288 1.0608 1.5349 0.0000 0.0000 0.0000 338 HIS A CE1   
2607 N NE2   . HIS A 341 ? 1.6274 1.0773 1.4725 0.0000 0.0000 0.0000 338 HIS A NE2   
2608 N N     . LYS A 342 ? 1.6864 0.9804 1.4945 0.0000 0.0000 0.0000 339 LYS A N     
2609 C CA    . LYS A 342 ? 1.7054 0.9984 1.5016 0.0000 0.0000 0.0000 339 LYS A CA    
2610 C C     . LYS A 342 ? 1.6475 1.0260 1.4634 0.0000 0.0000 0.0000 339 LYS A C     
2611 O O     . LYS A 342 ? 1.6141 1.0283 1.4444 0.0000 0.0000 0.0000 339 LYS A O     
2612 C CB    . LYS A 342 ? 1.8445 1.0004 1.5786 0.0000 0.0000 0.0000 339 LYS A CB    
2613 N N     . PRO A 343 ? 1.6383 1.0620 1.4557 0.0000 0.0000 0.0000 340 PRO A N     
2614 C CA    . PRO A 343 ? 1.5766 1.0953 1.4145 0.0000 0.0000 0.0000 340 PRO A CA    
2615 C C     . PRO A 343 ? 1.6360 1.1060 1.4429 0.0000 0.0000 0.0000 340 PRO A C     
2616 O O     . PRO A 343 ? 1.7488 1.1042 1.5073 0.0000 0.0000 0.0000 340 PRO A O     
2617 C CB    . PRO A 343 ? 1.5652 1.1425 1.4050 0.0000 0.0000 0.0000 340 PRO A CB    
2618 C CG    . PRO A 343 ? 1.5727 1.1327 1.4171 0.0000 0.0000 0.0000 340 PRO A CG    
2619 C CD    . PRO A 343 ? 1.6490 1.0838 1.4635 0.0000 0.0000 0.0000 340 PRO A CD    
2620 N N     . SER A 344 ? 1.5715 1.1235 1.4025 0.0000 0.0000 0.0000 341 SER A N     
2621 C CA    . SER A 344 ? 1.6254 1.1538 1.4302 0.0000 0.0000 0.0000 341 SER A CA    
2622 C C     . SER A 344 ? 1.5487 1.2002 1.3816 0.0000 0.0000 0.0000 341 SER A C     
2623 O O     . SER A 344 ? 1.4610 1.2055 1.3328 0.0000 0.0000 0.0000 341 SER A O     
2624 C CB    . SER A 344 ? 1.6477 1.1285 1.4456 0.0000 0.0000 0.0000 341 SER A CB    
2625 O OG    . SER A 344 ? 1.5723 1.1108 1.4113 0.0000 0.0000 0.0000 341 SER A OG    
2626 N N     . THR A 345 ? 1.5908 1.2417 1.4010 0.0000 0.0000 0.0000 342 THR A N     
2627 C CA    . THR A 345 ? 1.5375 1.3043 1.3669 0.0000 0.0000 0.0000 342 THR A CA    
2628 C C     . THR A 345 ? 1.4933 1.3178 1.3417 0.0000 0.0000 0.0000 342 THR A C     
2629 O O     . THR A 345 ? 1.5422 1.3075 1.3706 0.0000 0.0000 0.0000 342 THR A O     
2630 C CB    . THR A 345 ? 1.6176 1.3636 1.4057 0.0000 0.0000 0.0000 342 THR A CB    
2631 O OG1   . THR A 345 ? 1.6909 1.3489 1.4478 0.0000 0.0000 0.0000 342 THR A OG1   
2632 C CG2   . THR A 345 ? 1.5544 1.4400 1.3663 0.0000 0.0000 0.0000 342 THR A CG2   
2633 N N     . VAL A 346 ? 1.4103 1.3520 1.2950 0.0000 0.0000 0.0000 343 VAL A N     
2634 C CA    . VAL A 346 ? 1.3712 1.3810 1.2727 0.0000 0.0000 0.0000 343 VAL A CA    
2635 C C     . VAL A 346 ? 1.4314 1.4530 1.3048 0.0000 0.0000 0.0000 343 VAL A C     
2636 O O     . VAL A 346 ? 1.4416 1.5201 1.3099 0.0000 0.0000 0.0000 343 VAL A O     
2637 C CB    . VAL A 346 ? 1.2792 1.4017 1.2195 0.0000 0.0000 0.0000 343 VAL A CB    
2638 C CG1   . VAL A 346 ? 1.2458 1.4421 1.1966 0.0000 0.0000 0.0000 343 VAL A CG1   
2639 C CG2   . VAL A 346 ? 1.2278 1.3359 1.1914 0.0000 0.0000 0.0000 343 VAL A CG2   
2640 N N     . LEU A 347 ? 1.4774 1.4541 1.3314 0.0000 0.0000 0.0000 344 LEU A N     
2641 C CA    . LEU A 347 ? 1.5395 1.5246 1.3633 0.0000 0.0000 0.0000 344 LEU A CA    
2642 C C     . LEU A 347 ? 1.4765 1.5907 1.3282 0.0000 0.0000 0.0000 344 LEU A C     
2643 O O     . LEU A 347 ? 1.4738 1.6647 1.3258 0.0000 0.0000 0.0000 344 LEU A O     
2644 C CB    . LEU A 347 ? 1.6270 1.5046 1.4105 0.0000 0.0000 0.0000 344 LEU A CB    
2645 C CG    . LEU A 347 ? 1.7287 1.4599 1.4686 0.0000 0.0000 0.0000 344 LEU A CG    
2646 C CD1   . LEU A 347 ? 1.8367 1.4686 1.5283 0.0000 0.0000 0.0000 344 LEU A CD1   
2647 C CD2   . LEU A 347 ? 1.7813 1.4971 1.4962 0.0000 0.0000 0.0000 344 LEU A CD2   
2648 N N     . LYS A 348 ? 1.4350 1.5793 1.3087 0.0000 0.0000 0.0000 345 LYS A N     
2649 C CA    . LYS A 348 ? 1.3770 1.6397 1.2772 0.0000 0.0000 0.0000 345 LYS A CA    
2650 C C     . LYS A 348 ? 1.3071 1.5988 1.2427 0.0000 0.0000 0.0000 345 LYS A C     
2651 O O     . LYS A 348 ? 1.3112 1.5364 1.2490 0.0000 0.0000 0.0000 345 LYS A O     
2652 C CB    . LYS A 348 ? 1.4058 1.6854 1.2882 0.0000 0.0000 0.0000 345 LYS A CB    
2653 N N     . VAL A 349 ? 1.2560 1.6442 1.2153 0.0000 0.0000 0.0000 346 VAL A N     
2654 C CA    . VAL A 349 ? 1.2032 1.6135 1.1878 0.0000 0.0000 0.0000 346 VAL A CA    
2655 C C     . VAL A 349 ? 1.1886 1.6564 1.1777 0.0000 0.0000 0.0000 346 VAL A C     
2656 O O     . VAL A 349 ? 1.1715 1.7211 1.1680 0.0000 0.0000 0.0000 346 VAL A O     
2657 C CB    . VAL A 349 ? 1.1615 1.6234 1.1643 0.0000 0.0000 0.0000 346 VAL A CB    
2658 C CG1   . VAL A 349 ? 1.1168 1.5950 1.1359 0.0000 0.0000 0.0000 346 VAL A CG1   
2659 C CG2   . VAL A 349 ? 1.1779 1.5906 1.1784 0.0000 0.0000 0.0000 346 VAL A CG2   
2660 N N     . LEU A 350 ? 1.2026 1.6350 1.1863 0.0000 0.0000 0.0000 347 LEU A N     
2661 C CA    . LEU A 350 ? 1.1911 1.6833 1.1763 0.0000 0.0000 0.0000 347 LEU A CA    
2662 C C     . LEU A 350 ? 1.1457 1.6993 1.1490 0.0000 0.0000 0.0000 347 LEU A C     
2663 O O     . LEU A 350 ? 1.1369 1.7645 1.1414 0.0000 0.0000 0.0000 347 LEU A O     
2664 C CB    . LEU A 350 ? 1.2095 1.6608 1.1863 0.0000 0.0000 0.0000 347 LEU A CB    
2665 C CG    . LEU A 350 ? 1.2716 1.6475 1.2217 0.0000 0.0000 0.0000 347 LEU A CG    
2666 C CD1   . LEU A 350 ? 1.2949 1.6461 1.2367 0.0000 0.0000 0.0000 347 LEU A CD1   
2667 C CD2   . LEU A 350 ? 1.3063 1.7095 1.2364 0.0000 0.0000 0.0000 347 LEU A CD2   
2668 N N     . ASN A 351 ? 1.1282 1.6455 1.1413 0.0000 0.0000 0.0000 348 ASN A N     
2669 C CA    . ASN A 351 ? 1.1021 1.6518 1.1234 0.0000 0.0000 0.0000 348 ASN A CA    
2670 C C     . ASN A 351 ? 1.0973 1.5914 1.1237 0.0000 0.0000 0.0000 348 ASN A C     
2671 O O     . ASN A 351 ? 1.1114 1.5507 1.1373 0.0000 0.0000 0.0000 348 ASN A O     
2672 C CB    . ASN A 351 ? 1.0925 1.6658 1.1116 0.0000 0.0000 0.0000 348 ASN A CB    
2673 C CG    . ASN A 351 ? 1.0869 1.6105 1.1056 0.0000 0.0000 0.0000 348 ASN A CG    
2674 O OD1   . ASN A 351 ? 1.0784 1.5415 1.0997 0.0000 0.0000 0.0000 348 ASN A OD1   
2675 N ND2   . ASN A 351 ? 1.0836 1.6441 1.0988 0.0000 0.0000 0.0000 348 ASN A ND2   
2676 N N     . PRO A 352 ? 1.0872 1.5901 1.1147 0.0000 0.0000 0.0000 349 PRO A N     
2677 C CA    . PRO A 352 ? 1.0824 1.5376 1.1125 0.0000 0.0000 0.0000 349 PRO A CA    
2678 C C     . PRO A 352 ? 1.0830 1.4732 1.1130 0.0000 0.0000 0.0000 349 PRO A C     
2679 O O     . PRO A 352 ? 1.0833 1.4341 1.1147 0.0000 0.0000 0.0000 349 PRO A O     
2680 C CB    . PRO A 352 ? 1.0816 1.5472 1.1046 0.0000 0.0000 0.0000 349 PRO A CB    
2681 C CG    . PRO A 352 ? 1.0915 1.6164 1.1098 0.0000 0.0000 0.0000 349 PRO A CG    
2682 C CD    . PRO A 352 ? 1.0871 1.6273 1.1084 0.0000 0.0000 0.0000 349 PRO A CD    
2683 N N     . ARG A 353 ? 1.0857 1.4745 1.1136 0.0000 0.0000 0.0000 350 ARG A N     
2684 C CA    . ARG A 353 ? 1.0816 1.4262 1.1094 0.0000 0.0000 0.0000 350 ARG A CA    
2685 C C     . ARG A 353 ? 1.1003 1.4295 1.1269 0.0000 0.0000 0.0000 350 ARG A C     
2686 O O     . ARG A 353 ? 1.1044 1.4047 1.1311 0.0000 0.0000 0.0000 350 ARG A O     
2687 C CB    . ARG A 353 ? 1.0716 1.4303 1.0930 0.0000 0.0000 0.0000 350 ARG A CB    
2688 C CG    . ARG A 353 ? 1.0624 1.3846 1.0776 0.0000 0.0000 0.0000 350 ARG A CG    
2689 C CD    . ARG A 353 ? 1.0663 1.3883 1.0675 0.0000 0.0000 0.0000 350 ARG A CD    
2690 N NE    . ARG A 353 ? 1.0610 1.3753 1.0643 0.0000 0.0000 0.0000 350 ARG A NE    
2691 C CZ    . ARG A 353 ? 1.0484 1.3188 1.0547 0.0000 0.0000 0.0000 350 ARG A CZ    
2692 N NH1   . ARG A 353 ? 1.0325 1.2610 1.0404 0.0000 0.0000 0.0000 350 ARG A NH1   
2693 N NH2   . ARG A 353 ? 1.0323 1.3120 1.0400 0.0000 0.0000 0.0000 350 ARG A NH2   
2694 N N     . THR A 354 ? 1.1190 1.4668 1.1412 0.0000 0.0000 0.0000 351 THR A N     
2695 C CA    . THR A 354 ? 1.1558 1.4765 1.1682 0.0000 0.0000 0.0000 351 THR A CA    
2696 C C     . THR A 354 ? 1.1865 1.4770 1.1890 0.0000 0.0000 0.0000 351 THR A C     
2697 O O     . THR A 354 ? 1.1825 1.5157 1.1861 0.0000 0.0000 0.0000 351 THR A O     
2698 C CB    . THR A 354 ? 1.1642 1.5420 1.1711 0.0000 0.0000 0.0000 351 THR A CB    
2699 O OG1   . THR A 354 ? 1.1361 1.5640 1.1506 0.0000 0.0000 0.0000 351 THR A OG1   
2700 C CG2   . THR A 354 ? 1.2086 1.5540 1.2035 0.0000 0.0000 0.0000 351 THR A CG2   
2701 N N     . VAL A 355 ? 1.2230 1.4414 1.2128 0.0000 0.0000 0.0000 352 VAL A N     
2702 C CA    . VAL A 355 ? 1.2603 1.4359 1.2347 0.0000 0.0000 0.0000 352 VAL A CA    
2703 C C     . VAL A 355 ? 1.3355 1.4427 1.2810 0.0000 0.0000 0.0000 352 VAL A C     
2704 O O     . VAL A 355 ? 1.3508 1.4283 1.2923 0.0000 0.0000 0.0000 352 VAL A O     
2705 C CB    . VAL A 355 ? 1.2456 1.3831 1.2272 0.0000 0.0000 0.0000 352 VAL A CB    
2706 C CG1   . VAL A 355 ? 1.3021 1.3935 1.2635 0.0000 0.0000 0.0000 352 VAL A CG1   
2707 C CG2   . VAL A 355 ? 1.1893 1.3898 1.1919 0.0000 0.0000 0.0000 352 VAL A CG2   
2708 N N     . VAL A 356 ? 1.3915 1.4756 1.3131 0.0000 0.0000 0.0000 353 VAL A N     
2709 C CA    . VAL A 356 ? 1.4882 1.4762 1.3711 0.0000 0.0000 0.0000 353 VAL A CA    
2710 C C     . VAL A 356 ? 1.5339 1.4462 1.4014 0.0000 0.0000 0.0000 353 VAL A C     
2711 O O     . VAL A 356 ? 1.5141 1.4631 1.3872 0.0000 0.0000 0.0000 353 VAL A O     
2712 C CB    . VAL A 356 ? 1.5402 1.5379 1.3949 0.0000 0.0000 0.0000 353 VAL A CB    
2713 C CG1   . VAL A 356 ? 1.6501 1.5284 1.4564 0.0000 0.0000 0.0000 353 VAL A CG1   
2714 C CG2   . VAL A 356 ? 1.4957 1.5840 1.3670 0.0000 0.0000 0.0000 353 VAL A CG2   
2715 N N     . ILE A 357 ? 1.6000 1.4147 1.4476 0.0000 0.0000 0.0000 354 ILE A N     
2716 C CA    . ILE A 357 ? 1.6596 1.3967 1.4902 0.0000 0.0000 0.0000 354 ILE A CA    
2717 C C     . ILE A 357 ? 1.8040 1.4104 1.5798 0.0000 0.0000 0.0000 354 ILE A C     
2718 O O     . ILE A 357 ? 1.8543 1.4153 1.6113 0.0000 0.0000 0.0000 354 ILE A O     
2719 C CB    . ILE A 357 ? 1.6088 1.3392 1.4652 0.0000 0.0000 0.0000 354 ILE A CB    
2720 C CG1   . ILE A 357 ? 1.6219 1.3159 1.4743 0.0000 0.0000 0.0000 354 ILE A CG1   
2721 C CG2   . ILE A 357 ? 1.4997 1.3362 1.4008 0.0000 0.0000 0.0000 354 ILE A CG2   
2722 C CD1   . ILE A 357 ? 1.6221 1.2647 1.4780 0.0000 0.0000 0.0000 354 ILE A CD1   
2723 N N     . LEU A 358 ? 1.8847 1.4324 1.6316 0.0000 0.0000 0.0000 355 LEU A N     
2724 C CA    . LEU A 358 ? 2.0382 1.4378 1.7255 0.0000 0.0000 0.0000 355 LEU A CA    
2725 C C     . LEU A 358 ? 2.0615 1.3986 1.7529 0.0000 0.0000 0.0000 355 LEU A C     
2726 O O     . LEU A 358 ? 2.0369 1.3921 1.7415 0.0000 0.0000 0.0000 355 LEU A O     
2727 C CB    . LEU A 358 ? 2.1012 1.4747 1.7524 0.0000 0.0000 0.0000 355 LEU A CB    
2728 C CG    . LEU A 358 ? 2.2526 1.4602 1.8340 0.0000 0.0000 0.0000 355 LEU A CG    
2729 C CD1   . LEU A 358 ? 2.3604 1.4685 1.8934 0.0000 0.0000 0.0000 355 LEU A CD1   
2730 C CD2   . LEU A 358 ? 2.3051 1.5180 1.8577 0.0000 0.0000 0.0000 355 LEU A CD2   
2731 N N     . ASP A 359 ? 2.1185 1.3920 1.7981 0.0000 0.0000 0.0000 356 ASP A N     
2732 C CA    . ASP A 359 ? 2.1196 1.3643 1.8138 0.0000 0.0000 0.0000 356 ASP A CA    
2733 C C     . ASP A 359 ? 2.2579 1.3489 1.8969 0.0000 0.0000 0.0000 356 ASP A C     
2734 O O     . ASP A 359 ? 2.3379 1.3640 1.9386 0.0000 0.0000 0.0000 356 ASP A O     
2735 C CB    . ASP A 359 ? 2.0854 1.3693 1.8015 0.0000 0.0000 0.0000 356 ASP A CB    
2736 C CG    . ASP A 359 ? 2.2254 1.4143 1.8905 0.0000 0.0000 0.0000 356 ASP A CG    
2737 O OD1   . ASP A 359 ? 2.2368 1.4450 1.9119 0.0000 0.0000 0.0000 356 ASP A OD1   
2738 O OD2   . ASP A 359 ? 2.3411 1.4394 1.9537 0.0000 0.0000 0.0000 356 ASP A OD2   
2739 N N     . HIS A 360 ? 2.2926 1.3311 1.9261 0.0000 0.0000 0.0000 357 HIS A N     
2740 C CA    . HIS A 360 ? 2.4303 1.3147 2.0091 0.0000 0.0000 0.0000 357 HIS A CA    
2741 C C     . HIS A 360 ? 2.5701 1.3304 2.0862 0.0000 0.0000 0.0000 357 HIS A C     
2742 O O     . HIS A 360 ? 2.5735 1.3409 2.0953 0.0000 0.0000 0.0000 357 HIS A O     
2743 C CB    . HIS A 360 ? 2.3753 1.2893 1.9878 0.0000 0.0000 0.0000 357 HIS A CB    
2744 C CG    . HIS A 360 ? 2.2840 1.3120 1.9446 0.0000 0.0000 0.0000 357 HIS A CG    
2745 N ND1   . HIS A 360 ? 2.3288 1.3293 1.9795 0.0000 0.0000 0.0000 357 HIS A ND1   
2746 C CD2   . HIS A 360 ? 2.1613 1.3322 1.8756 0.0000 0.0000 0.0000 357 HIS A CD2   
2747 C CE1   . HIS A 360 ? 2.2282 1.3590 1.9262 0.0000 0.0000 0.0000 357 HIS A CE1   
2748 N NE2   . HIS A 360 ? 2.1364 1.3641 1.8714 0.0000 0.0000 0.0000 357 HIS A NE2   
2749 N N     . LEU A 361 ? 2.6891 1.3388 2.1424 0.0000 0.0000 0.0000 358 LEU A N     
2750 C CA    . LEU A 361 ? 2.6946 1.3444 2.1349 0.0000 0.0000 0.0000 358 LEU A CA    
2751 C C     . LEU A 361 ? 2.8587 1.3708 2.2173 0.0000 0.0000 0.0000 358 LEU A C     
2752 O O     . LEU A 361 ? 3.0241 1.3624 2.3108 0.0000 0.0000 0.0000 358 LEU A O     
2753 C CB    . LEU A 361 ? 2.7071 1.3196 2.1445 0.0000 0.0000 0.0000 358 LEU A CB    
2754 C CG    . LEU A 361 ? 2.6366 1.3394 2.0973 0.0000 0.0000 0.0000 358 LEU A CG    
2755 C CD1   . LEU A 361 ? 2.5171 1.3093 2.0325 0.0000 0.0000 0.0000 358 LEU A CD1   
2756 C CD2   . LEU A 361 ? 2.7860 1.3649 2.1709 0.0000 0.0000 0.0000 358 LEU A CD2   
2757 N N     . GLY A 362 ? 2.8204 1.4048 2.1855 0.0000 0.0000 0.0000 359 GLY A N     
2758 C CA    . GLY A 362 ? 2.6309 1.4096 2.0756 0.0000 0.0000 0.0000 359 GLY A CA    
2759 C C     . GLY A 362 ? 2.6169 1.4420 2.0615 0.0000 0.0000 0.0000 359 GLY A C     
2760 O O     . GLY A 362 ? 2.7249 1.4745 2.1125 0.0000 0.0000 0.0000 359 GLY A O     
2761 N N     . ASN A 363 ? 2.4813 1.4326 1.9871 0.0000 0.0000 0.0000 360 ASN A N     
2762 C CA    . ASN A 363 ? 2.4351 1.4680 1.9533 0.0000 0.0000 0.0000 360 ASN A CA    
2763 C C     . ASN A 363 ? 2.2551 1.4683 1.8467 0.0000 0.0000 0.0000 360 ASN A C     
2764 O O     . ASN A 363 ? 2.1533 1.4271 1.7916 0.0000 0.0000 0.0000 360 ASN A O     
2765 C CB    . ASN A 363 ? 2.4666 1.4791 1.9796 0.0000 0.0000 0.0000 360 ASN A CB    
2766 C CG    . ASN A 363 ? 2.5931 1.4453 2.0567 0.0000 0.0000 0.0000 360 ASN A CG    
2767 O OD1   . ASN A 363 ? 2.5506 1.3978 2.0378 0.0000 0.0000 0.0000 360 ASN A OD1   
2768 N ND2   . ASN A 363 ? 2.7463 1.4634 2.1376 0.0000 0.0000 0.0000 360 ASN A ND2   
2769 N N     . ASN A 364 ? 2.2156 1.5090 1.8129 0.0000 0.0000 0.0000 361 ASN A N     
2770 C CA    . ASN A 364 ? 2.0591 1.5156 1.7190 0.0000 0.0000 0.0000 361 ASN A CA    
2771 C C     . ASN A 364 ? 1.9714 1.5010 1.6724 0.0000 0.0000 0.0000 361 ASN A C     
2772 O O     . ASN A 364 ? 2.0170 1.5357 1.7011 0.0000 0.0000 0.0000 361 ASN A O     
2773 C CB    . ASN A 364 ? 2.0628 1.5854 1.7140 0.0000 0.0000 0.0000 361 ASN A CB    
2774 C CG    . ASN A 364 ? 2.1614 1.6112 1.7631 0.0000 0.0000 0.0000 361 ASN A CG    
2775 O OD1   . ASN A 364 ? 2.2446 1.5818 1.8118 0.0000 0.0000 0.0000 361 ASN A OD1   
2776 N ND2   . ASN A 364 ? 2.1665 1.6846 1.7621 0.0000 0.0000 0.0000 361 ASN A ND2   
2777 N N     . ARG A 365 ? 1.8482 1.4535 1.5994 0.0000 0.0000 0.0000 362 ARG A N     
2778 C CA    . ARG A 365 ? 1.7550 1.4386 1.5444 0.0000 0.0000 0.0000 362 ARG A CA    
2779 C C     . ARG A 365 ? 1.6334 1.4460 1.4674 0.0000 0.0000 0.0000 362 ARG A C     
2780 O O     . ARG A 365 ? 1.5883 1.4215 1.4368 0.0000 0.0000 0.0000 362 ARG A O     
2781 C CB    . ARG A 365 ? 1.7440 1.3846 1.5455 0.0000 0.0000 0.0000 362 ARG A CB    
2782 C CG    . ARG A 365 ? 1.8628 1.3771 1.6208 0.0000 0.0000 0.0000 362 ARG A CG    
2783 C CD    . ARG A 365 ? 1.8524 1.4006 1.6194 0.0000 0.0000 0.0000 362 ARG A CD    
2784 N NE    . ARG A 365 ? 1.7353 1.3511 1.5463 0.0000 0.0000 0.0000 362 ARG A NE    
2785 C CZ    . ARG A 365 ? 1.7013 1.3796 1.5296 0.0000 0.0000 0.0000 362 ARG A CZ    
2786 N NH1   . ARG A 365 ? 1.7472 1.4364 1.5550 0.0000 0.0000 0.0000 362 ARG A NH1   
2787 N NH2   . ARG A 365 ? 1.6325 1.3677 1.4961 0.0000 0.0000 0.0000 362 ARG A NH2   
2788 N N     . THR A 366 ? 1.5827 1.4842 1.4354 0.0000 0.0000 0.0000 363 THR A N     
2789 C CA    . THR A 366 ? 1.4787 1.4943 1.3710 0.0000 0.0000 0.0000 363 THR A CA    
2790 C C     . THR A 366 ? 1.4193 1.4604 1.3393 0.0000 0.0000 0.0000 363 THR A C     
2791 O O     . THR A 366 ? 1.4355 1.4779 1.3526 0.0000 0.0000 0.0000 363 THR A O     
2792 C CB    . THR A 366 ? 1.4632 1.5693 1.3575 0.0000 0.0000 0.0000 363 THR A CB    
2793 O OG1   . THR A 366 ? 1.5376 1.6149 1.4010 0.0000 0.0000 0.0000 363 THR A OG1   
2794 C CG2   . THR A 366 ? 1.3718 1.5784 1.2994 0.0000 0.0000 0.0000 363 THR A CG2   
2795 N N     . VAL A 367 ? 1.3543 1.4198 1.2986 0.0000 0.0000 0.0000 364 VAL A N     
2796 C CA    . VAL A 367 ? 1.3094 1.3760 1.2733 0.0000 0.0000 0.0000 364 VAL A CA    
2797 C C     . VAL A 367 ? 1.2371 1.3733 1.2260 0.0000 0.0000 0.0000 364 VAL A C     
2798 O O     . VAL A 367 ? 1.2208 1.3865 1.2127 0.0000 0.0000 0.0000 364 VAL A O     
2799 C CB    . VAL A 367 ? 1.3369 1.3168 1.2925 0.0000 0.0000 0.0000 364 VAL A CB    
2800 C CG1   . VAL A 367 ? 1.2898 1.2825 1.2674 0.0000 0.0000 0.0000 364 VAL A CG1   
2801 C CG2   . VAL A 367 ? 1.4214 1.3168 1.3475 0.0000 0.0000 0.0000 364 VAL A CG2   
2802 N N     . SER A 368 ? 1.2047 1.3649 1.2075 0.0000 0.0000 0.0000 365 SER A N     
2803 C CA    . SER A 368 ? 1.1568 1.3602 1.1743 0.0000 0.0000 0.0000 365 SER A CA    
2804 C C     . SER A 368 ? 1.1471 1.3047 1.1704 0.0000 0.0000 0.0000 365 SER A C     
2805 O O     . SER A 368 ? 1.1648 1.2755 1.1861 0.0000 0.0000 0.0000 365 SER A O     
2806 C CB    . SER A 368 ? 1.1339 1.3885 1.1568 0.0000 0.0000 0.0000 365 SER A CB    
2807 O OG    . SER A 368 ? 1.1105 1.4040 1.1373 0.0000 0.0000 0.0000 365 SER A OG    
2808 N N     . ILE A 369 ? 1.1260 1.3012 1.1550 0.0000 0.0000 0.0000 366 ILE A N     
2809 C CA    . ILE A 369 ? 1.1231 1.2675 1.1568 0.0000 0.0000 0.0000 366 ILE A CA    
2810 C C     . ILE A 369 ? 1.1163 1.2396 1.1531 0.0000 0.0000 0.0000 366 ILE A C     
2811 O O     . ILE A 369 ? 1.1207 1.2082 1.1593 0.0000 0.0000 0.0000 366 ILE A O     
2812 C CB    . ILE A 369 ? 1.1009 1.2751 1.1375 0.0000 0.0000 0.0000 366 ILE A CB    
2813 C CG1   . ILE A 369 ? 1.1078 1.3259 1.1426 0.0000 0.0000 0.0000 366 ILE A CG1   
2814 C CG2   . ILE A 369 ? 1.1060 1.2605 1.1457 0.0000 0.0000 0.0000 366 ILE A CG2   
2815 C CD1   . ILE A 369 ? 1.1057 1.3507 1.1402 0.0000 0.0000 0.0000 366 ILE A CD1   
2816 N N     . ASP A 370 ? 1.1079 1.2619 1.1440 0.0000 0.0000 0.0000 367 ASP A N     
2817 C CA    . ASP A 370 ? 1.1045 1.2523 1.1419 0.0000 0.0000 0.0000 367 ASP A CA    
2818 C C     . ASP A 370 ? 1.1207 1.2340 1.1596 0.0000 0.0000 0.0000 367 ASP A C     
2819 O O     . ASP A 370 ? 1.1155 1.2185 1.1567 0.0000 0.0000 0.0000 367 ASP A O     
2820 C CB    . ASP A 370 ? 1.1033 1.3037 1.1367 0.0000 0.0000 0.0000 367 ASP A CB    
2821 C CG    . ASP A 370 ? 1.1159 1.3303 1.1405 0.0000 0.0000 0.0000 367 ASP A CG    
2822 O OD1   . ASP A 370 ? 1.1470 1.3337 1.1703 0.0000 0.0000 0.0000 367 ASP A OD1   
2823 O OD2   . ASP A 370 ? 1.1327 1.3869 1.1487 0.0000 0.0000 0.0000 367 ASP A OD2   
2824 N N     . ASN A 371 ? 1.1454 1.2361 1.1788 0.0000 0.0000 0.0000 368 ASN A N     
2825 C CA    . ASN A 371 ? 1.1762 1.2165 1.2034 0.0000 0.0000 0.0000 368 ASN A CA    
2826 C C     . ASN A 371 ? 1.1944 1.1778 1.2161 0.0000 0.0000 0.0000 368 ASN A C     
2827 O O     . ASN A 371 ? 1.2441 1.1703 1.2526 0.0000 0.0000 0.0000 368 ASN A O     
2828 C CB    . ASN A 371 ? 1.2173 1.2592 1.2331 0.0000 0.0000 0.0000 368 ASN A CB    
2829 C CG    . ASN A 371 ? 1.2021 1.3120 1.2236 0.0000 0.0000 0.0000 368 ASN A CG    
2830 O OD1   . ASN A 371 ? 1.1721 1.3101 1.2028 0.0000 0.0000 0.0000 368 ASN A OD1   
2831 N ND2   . ASN A 371 ? 1.2440 1.3871 1.2578 0.0000 0.0000 0.0000 368 ASN A ND2   
2832 N N     . LEU A 372 ? 1.1613 1.1619 1.1900 0.0000 0.0000 0.0000 369 LEU A N     
2833 C CA    . LEU A 372 ? 1.1772 1.1470 1.2014 0.0000 0.0000 0.0000 369 LEU A CA    
2834 C C     . LEU A 372 ? 1.1439 1.1274 1.1785 0.0000 0.0000 0.0000 369 LEU A C     
2835 O O     . LEU A 372 ? 1.1095 1.1273 1.1519 0.0000 0.0000 0.0000 369 LEU A O     
2836 C CB    . LEU A 372 ? 1.1804 1.1723 1.1999 0.0000 0.0000 0.0000 369 LEU A CB    
2837 C CG    . LEU A 372 ? 1.2212 1.1935 1.2245 0.0000 0.0000 0.0000 369 LEU A CG    
2838 C CD1   . LEU A 372 ? 1.2209 1.2284 1.2208 0.0000 0.0000 0.0000 369 LEU A CD1   
2839 C CD2   . LEU A 372 ? 1.2752 1.1660 1.2568 0.0000 0.0000 0.0000 369 LEU A CD2   
2840 N N     . LYS A 373 ? 1.1627 1.1171 1.1930 0.0000 0.0000 0.0000 370 LYS A N     
2841 C CA    . LYS A 373 ? 1.1347 1.1151 1.1730 0.0000 0.0000 0.0000 370 LYS A CA    
2842 C C     . LYS A 373 ? 1.1563 1.1453 1.1883 0.0000 0.0000 0.0000 370 LYS A C     
2843 O O     . LYS A 373 ? 1.2071 1.1534 1.2237 0.0000 0.0000 0.0000 370 LYS A O     
2844 C CB    . LYS A 373 ? 1.1354 1.0942 1.1761 0.0000 0.0000 0.0000 370 LYS A CB    
2845 C CG    . LYS A 373 ? 1.1687 1.0747 1.1971 0.0000 0.0000 0.0000 370 LYS A CG    
2846 C CD    . LYS A 373 ? 1.1463 1.0608 1.1794 0.0000 0.0000 0.0000 370 LYS A CD    
2847 C CE    . LYS A 373 ? 1.1781 1.0356 1.2000 0.0000 0.0000 0.0000 370 LYS A CE    
2848 N NZ    . LYS A 373 ? 1.1621 1.0347 1.1870 0.0000 0.0000 0.0000 370 LYS A NZ    
2849 N N     . PRO A 374 ? 1.1286 1.1737 1.1686 0.0000 0.0000 0.0000 371 PRO A N     
2850 C CA    . PRO A 374 ? 1.1509 1.2250 1.1856 0.0000 0.0000 0.0000 371 PRO A CA    
2851 C C     . PRO A 374 ? 1.1806 1.2329 1.2101 0.0000 0.0000 0.0000 371 PRO A C     
2852 O O     . PRO A 374 ? 1.1643 1.2235 1.2025 0.0000 0.0000 0.0000 371 PRO A O     
2853 C CB    . PRO A 374 ? 1.1105 1.2612 1.1564 0.0000 0.0000 0.0000 371 PRO A CB    
2854 C CG    . PRO A 374 ? 1.0826 1.2257 1.1334 0.0000 0.0000 0.0000 371 PRO A CG    
2855 C CD    . PRO A 374 ? 1.0866 1.1711 1.1360 0.0000 0.0000 0.0000 371 PRO A CD    
2856 N N     . THR A 375 ? 1.2357 1.2586 1.2475 0.0000 0.0000 0.0000 372 THR A N     
2857 C CA    . THR A 375 ? 1.2684 1.2768 1.2725 0.0000 0.0000 0.0000 372 THR A CA    
2858 C C     . THR A 375 ? 1.2287 1.3332 1.2481 0.0000 0.0000 0.0000 372 THR A C     
2859 O O     . THR A 375 ? 1.2145 1.3897 1.2380 0.0000 0.0000 0.0000 372 THR A O     
2860 C CB    . THR A 375 ? 1.3470 1.3018 1.3212 0.0000 0.0000 0.0000 372 THR A CB    
2861 O OG1   . THR A 375 ? 1.4015 1.2562 1.3573 0.0000 0.0000 0.0000 372 THR A OG1   
2862 C CG2   . THR A 375 ? 1.3786 1.3332 1.3433 0.0000 0.0000 0.0000 372 THR A CG2   
2863 N N     . SER A 376 ? 1.2148 1.3270 1.2421 0.0000 0.0000 0.0000 373 SER A N     
2864 C CA    . SER A 376 ? 1.1834 1.3851 1.2229 0.0000 0.0000 0.0000 373 SER A CA    
2865 C C     . SER A 376 ? 1.2164 1.4562 1.2457 0.0000 0.0000 0.0000 373 SER A C     
2866 O O     . SER A 376 ? 1.2647 1.4406 1.2785 0.0000 0.0000 0.0000 373 SER A O     
2867 C CB    . SER A 376 ? 1.1561 1.3460 1.2049 0.0000 0.0000 0.0000 373 SER A CB    
2868 O OG    . SER A 376 ? 1.1918 1.3123 1.2326 0.0000 0.0000 0.0000 373 SER A OG    
2869 N N     . HIS A 377 ? 1.2004 1.5470 1.2359 0.0000 0.0000 0.0000 374 HIS A N     
2870 C CA    . HIS A 377 ? 1.2335 1.6448 1.2583 0.0000 0.0000 0.0000 374 HIS A CA    
2871 C C     . HIS A 377 ? 1.2807 1.6699 1.2843 0.0000 0.0000 0.0000 374 HIS A C     
2872 O O     . HIS A 377 ? 1.2612 1.6955 1.2681 0.0000 0.0000 0.0000 374 HIS A O     
2873 C CB    . HIS A 377 ? 1.2639 1.6521 1.2802 0.0000 0.0000 0.0000 374 HIS A CB    
2874 C CG    . HIS A 377 ? 1.2473 1.6193 1.2781 0.0000 0.0000 0.0000 374 HIS A CG    
2875 N ND1   . HIS A 377 ? 1.2201 1.6740 1.2680 0.0000 0.0000 0.0000 374 HIS A ND1   
2876 C CD2   . HIS A 377 ? 1.2637 1.5505 1.2904 0.0000 0.0000 0.0000 374 HIS A CD2   
2877 C CE1   . HIS A 377 ? 1.2071 1.6181 1.2594 0.0000 0.0000 0.0000 374 HIS A CE1   
2878 N NE2   . HIS A 377 ? 1.2250 1.5440 1.2671 0.0000 0.0000 0.0000 374 HIS A NE2   
2879 N N     . ASP B 119 ? 1.7875 2.0324 1.6823 0.0000 0.0000 0.0000 116 ASP B N     
2880 C CA    . ASP B 119 ? 1.7455 1.9739 1.6705 0.0000 0.0000 0.0000 116 ASP B CA    
2881 C C     . ASP B 119 ? 1.6970 1.9429 1.6454 0.0000 0.0000 0.0000 116 ASP B C     
2882 O O     . ASP B 119 ? 1.7045 1.9659 1.6585 0.0000 0.0000 0.0000 116 ASP B O     
2883 C CB    . ASP B 119 ? 1.7332 1.9716 1.6327 0.0000 0.0000 0.0000 116 ASP B CB    
2884 C CG    . ASP B 119 ? 1.7347 1.9439 1.6619 0.0000 0.0000 0.0000 116 ASP B CG    
2885 O OD1   . ASP B 119 ? 1.7227 1.9192 1.6870 0.0000 0.0000 0.0000 116 ASP B OD1   
2886 O OD2   . ASP B 119 ? 1.7621 1.9642 1.6742 0.0000 0.0000 0.0000 116 ASP B OD2   
2887 N N     . ARG B 120 ? 1.6474 1.8920 1.6099 0.0000 0.0000 0.0000 117 ARG B N     
2888 C CA    . ARG B 120 ? 1.5959 1.8581 1.5769 0.0000 0.0000 0.0000 117 ARG B CA    
2889 C C     . ARG B 120 ? 1.5662 1.8648 1.5168 0.0000 0.0000 0.0000 117 ARG B C     
2890 O O     . ARG B 120 ? 1.5626 1.8646 1.4897 0.0000 0.0000 0.0000 117 ARG B O     
2891 C CB    . ARG B 120 ? 1.5647 1.8077 1.5744 0.0000 0.0000 0.0000 117 ARG B CB    
2892 N N     . PRO B 121 ? 1.5457 1.8718 1.4990 0.0000 0.0000 0.0000 118 PRO B N     
2893 C CA    . PRO B 121 ? 1.5217 1.8827 1.4505 0.0000 0.0000 0.0000 118 PRO B CA    
2894 C C     . PRO B 121 ? 1.4767 1.8384 1.4053 0.0000 0.0000 0.0000 118 PRO B C     
2895 O O     . PRO B 121 ? 1.4566 1.8020 1.4104 0.0000 0.0000 0.0000 118 PRO B O     
2896 C CB    . PRO B 121 ? 1.5160 1.9014 1.4634 0.0000 0.0000 0.0000 118 PRO B CB    
2897 C CG    . PRO B 121 ? 1.5160 1.8778 1.5016 0.0000 0.0000 0.0000 118 PRO B CG    
2898 C CD    . PRO B 121 ? 1.5474 1.8733 1.5325 0.0000 0.0000 0.0000 118 PRO B CD    
2899 N N     . GLN B 122 ? 1.4599 1.8410 1.3600 0.0000 0.0000 0.0000 119 GLN B N     
2900 C CA    . GLN B 122 ? 1.4237 1.8023 1.3186 0.0000 0.0000 0.0000 119 GLN B CA    
2901 C C     . GLN B 122 ? 1.3774 1.7662 1.2916 0.0000 0.0000 0.0000 119 GLN B C     
2902 O O     . GLN B 122 ? 1.3752 1.7856 1.2972 0.0000 0.0000 0.0000 119 GLN B O     
2903 C CB    . GLN B 122 ? 1.4397 1.8348 1.2989 0.0000 0.0000 0.0000 119 GLN B CB    
2904 C CG    . GLN B 122 ? 1.4591 1.8410 1.3083 0.0000 0.0000 0.0000 119 GLN B CG    
2905 C CD    . GLN B 122 ? 1.5105 1.9092 1.3246 0.0000 0.0000 0.0000 119 GLN B CD    
2906 O OE1   . GLN B 122 ? 1.5490 1.9675 1.3426 0.0000 0.0000 0.0000 119 GLN B OE1   
2907 N NE2   . GLN B 122 ? 1.5035 1.8964 1.3104 0.0000 0.0000 0.0000 119 GLN B NE2   
2908 N N     . LYS B 123 ? 1.3392 1.7144 1.2607 0.0000 0.0000 0.0000 120 LYS B N     
2909 C CA    . LYS B 123 ? 1.2968 1.6766 1.2377 0.0000 0.0000 0.0000 120 LYS B CA    
2910 C C     . LYS B 123 ? 1.2659 1.6431 1.1960 0.0000 0.0000 0.0000 120 LYS B C     
2911 O O     . LYS B 123 ? 1.2707 1.6384 1.1842 0.0000 0.0000 0.0000 120 LYS B O     
2912 C CB    . LYS B 123 ? 1.2917 1.6553 1.2619 0.0000 0.0000 0.0000 120 LYS B CB    
2913 C CG    . LYS B 123 ? 1.3207 1.6827 1.3064 0.0000 0.0000 0.0000 120 LYS B CG    
2914 C CD    . LYS B 123 ? 1.3292 1.7114 1.3351 0.0000 0.0000 0.0000 120 LYS B CD    
2915 C CE    . LYS B 123 ? 1.3645 1.7427 1.3913 0.0000 0.0000 0.0000 120 LYS B CE    
2916 N NZ    . LYS B 123 ? 1.3878 1.7348 1.4319 0.0000 0.0000 0.0000 120 LYS B NZ    
2917 N N     . PRO B 124 ? 1.2337 1.6197 1.1742 0.0000 0.0000 0.0000 121 PRO B N     
2918 C CA    . PRO B 124 ? 1.2098 1.5906 1.1418 0.0000 0.0000 0.0000 121 PRO B CA    
2919 C C     . PRO B 124 ? 1.1932 1.5556 1.1311 0.0000 0.0000 0.0000 121 PRO B C     
2920 O O     . PRO B 124 ? 1.1897 1.5462 1.1474 0.0000 0.0000 0.0000 121 PRO B O     
2921 C CB    . PRO B 124 ? 1.1942 1.5865 1.1415 0.0000 0.0000 0.0000 121 PRO B CB    
2922 C CG    . PRO B 124 ? 1.2059 1.6165 1.1638 0.0000 0.0000 0.0000 121 PRO B CG    
2923 C CD    . PRO B 124 ? 1.2278 1.6300 1.1886 0.0000 0.0000 0.0000 121 PRO B CD    
2924 N N     . PHE B 125 ? 1.1817 1.5371 1.1042 0.0000 0.0000 0.0000 122 PHE B N     
2925 C CA    . PHE B 125 ? 1.1611 1.5039 1.0892 0.0000 0.0000 0.0000 122 PHE B CA    
2926 C C     . PHE B 125 ? 1.1703 1.5038 1.0984 0.0000 0.0000 0.0000 122 PHE B C     
2927 O O     . PHE B 125 ? 1.1668 1.4919 1.1024 0.0000 0.0000 0.0000 122 PHE B O     
2928 C CB    . PHE B 125 ? 1.1447 1.4866 1.0943 0.0000 0.0000 0.0000 122 PHE B CB    
2929 C CG    . PHE B 125 ? 1.1272 1.4783 1.0774 0.0000 0.0000 0.0000 122 PHE B CG    
2930 C CD1   . PHE B 125 ? 1.1082 1.4669 1.0768 0.0000 0.0000 0.0000 122 PHE B CD1   
2931 C CD2   . PHE B 125 ? 1.1301 1.4818 1.0641 0.0000 0.0000 0.0000 122 PHE B CD2   
2932 C CE1   . PHE B 125 ? 1.0978 1.4659 1.0683 0.0000 0.0000 0.0000 122 PHE B CE1   
2933 C CE2   . PHE B 125 ? 1.1203 1.4777 1.0570 0.0000 0.0000 0.0000 122 PHE B CE2   
2934 C CZ    . PHE B 125 ? 1.1029 1.4694 1.0577 0.0000 0.0000 0.0000 122 PHE B CZ    
2935 N N     . ASP B 126 ? 1.1798 1.5163 1.0997 0.0000 0.0000 0.0000 123 ASP B N     
2936 C CA    . ASP B 126 ? 1.1925 1.5192 1.1104 0.0000 0.0000 0.0000 123 ASP B CA    
2937 C C     . ASP B 126 ? 1.1895 1.5156 1.0892 0.0000 0.0000 0.0000 123 ASP B C     
2938 O O     . ASP B 126 ? 1.1964 1.5128 1.1021 0.0000 0.0000 0.0000 123 ASP B O     
2939 C CB    . ASP B 126 ? 1.2177 1.5502 1.1268 0.0000 0.0000 0.0000 123 ASP B CB    
2940 C CG    . ASP B 126 ? 1.2346 1.5601 1.1684 0.0000 0.0000 0.0000 123 ASP B CG    
2941 O OD1   . ASP B 126 ? 1.2293 1.5473 1.1867 0.0000 0.0000 0.0000 123 ASP B OD1   
2942 O OD2   . ASP B 126 ? 1.2658 1.5942 1.1946 0.0000 0.0000 0.0000 123 ASP B OD2   
2943 N N     . LYS B 127 ? 1.1781 1.5149 1.0580 0.0000 0.0000 0.0000 124 LYS B N     
2944 C CA    . LYS B 127 ? 1.1764 1.5153 1.0374 0.0000 0.0000 0.0000 124 LYS B CA    
2945 C C     . LYS B 127 ? 1.1644 1.5106 1.0126 0.0000 0.0000 0.0000 124 LYS B C     
2946 O O     . LYS B 127 ? 1.1646 1.5196 1.0077 0.0000 0.0000 0.0000 124 LYS B O     
2947 C CB    . LYS B 127 ? 1.2033 1.5475 1.0447 0.0000 0.0000 0.0000 124 LYS B CB    
2948 C CG    . LYS B 127 ? 1.2133 1.5619 1.0352 0.0000 0.0000 0.0000 124 LYS B CG    
2949 C CD    . LYS B 127 ? 1.2420 1.5977 1.0424 0.0000 0.0000 0.0000 124 LYS B CD    
2950 C CE    . LYS B 127 ? 1.2600 1.6025 1.0733 0.0000 0.0000 0.0000 124 LYS B CE    
2951 N NZ    . LYS B 127 ? 1.3072 1.6558 1.0972 0.0000 0.0000 0.0000 124 LYS B NZ    
2952 N N     . PHE B 128 ? 1.1517 1.4944 0.9979 0.0000 0.0000 0.0000 125 PHE B N     
2953 C CA    . PHE B 128 ? 1.1447 1.4891 0.9806 0.0000 0.0000 0.0000 125 PHE B CA    
2954 C C     . PHE B 128 ? 1.1578 1.5066 0.9746 0.0000 0.0000 0.0000 125 PHE B C     
2955 O O     . PHE B 128 ? 1.1623 1.5095 0.9823 0.0000 0.0000 0.0000 125 PHE B O     
2956 C CB    . PHE B 128 ? 1.1269 1.4635 0.9769 0.0000 0.0000 0.0000 125 PHE B CB    
2957 C CG    . PHE B 128 ? 1.1159 1.4507 0.9783 0.0000 0.0000 0.0000 125 PHE B CG    
2958 C CD1   . PHE B 128 ? 1.1235 1.4639 0.9908 0.0000 0.0000 0.0000 125 PHE B CD1   
2959 C CD2   . PHE B 128 ? 1.0948 1.4246 0.9640 0.0000 0.0000 0.0000 125 PHE B CD2   
2960 C CE1   . PHE B 128 ? 1.1086 1.4500 0.9892 0.0000 0.0000 0.0000 125 PHE B CE1   
2961 C CE2   . PHE B 128 ? 1.0913 1.4210 0.9705 0.0000 0.0000 0.0000 125 PHE B CE2   
2962 C CZ    . PHE B 128 ? 1.0955 1.4313 0.9815 0.0000 0.0000 0.0000 125 PHE B CZ    
2963 N N     . PHE B 129 ? 1.1646 1.5208 0.9633 0.0000 0.0000 0.0000 126 PHE B N     
2964 C CA    . PHE B 129 ? 1.1732 1.5351 0.9528 0.0000 0.0000 0.0000 126 PHE B CA    
2965 C C     . PHE B 129 ? 1.1654 1.5194 0.9468 0.0000 0.0000 0.0000 126 PHE B C     
2966 O O     . PHE B 129 ? 1.1614 1.5102 0.9465 0.0000 0.0000 0.0000 126 PHE B O     
2967 C CB    . PHE B 129 ? 1.1930 1.5699 0.9504 0.0000 0.0000 0.0000 126 PHE B CB    
2968 C CG    . PHE B 129 ? 1.2062 1.5914 0.9573 0.0000 0.0000 0.0000 126 PHE B CG    
2969 C CD1   . PHE B 129 ? 1.2263 1.6160 0.9646 0.0000 0.0000 0.0000 126 PHE B CD1   
2970 C CD2   . PHE B 129 ? 1.2039 1.5926 0.9628 0.0000 0.0000 0.0000 126 PHE B CD2   
2971 C CE1   . PHE B 129 ? 1.2402 1.6345 0.9721 0.0000 0.0000 0.0000 126 PHE B CE1   
2972 C CE2   . PHE B 129 ? 1.2138 1.6082 0.9671 0.0000 0.0000 0.0000 126 PHE B CE2   
2973 C CZ    . PHE B 129 ? 1.2327 1.6283 0.9717 0.0000 0.0000 0.0000 126 PHE B CZ    
2974 N N     . ILE B 130 ? 1.1656 1.5184 0.9465 0.0000 0.0000 0.0000 127 ILE B N     
2975 C CA    . ILE B 130 ? 1.1653 1.5098 0.9480 0.0000 0.0000 0.0000 127 ILE B CA    
2976 C C     . ILE B 130 ? 1.1874 1.5382 0.9551 0.0000 0.0000 0.0000 127 ILE B C     
2977 O O     . ILE B 130 ? 1.1985 1.5613 0.9583 0.0000 0.0000 0.0000 127 ILE B O     
2978 C CB    . ILE B 130 ? 1.1454 1.4828 0.9467 0.0000 0.0000 0.0000 127 ILE B CB    
2979 C CG1   . ILE B 130 ? 1.1389 1.4855 0.9467 0.0000 0.0000 0.0000 127 ILE B CG1   
2980 C CG2   . ILE B 130 ? 1.1349 1.4662 0.9501 0.0000 0.0000 0.0000 127 ILE B CG2   
2981 C CD1   . ILE B 130 ? 1.1258 1.4719 0.9491 0.0000 0.0000 0.0000 127 ILE B CD1   
2982 N N     . ASP B 131 ? 1.2001 1.5421 0.9648 0.0000 0.0000 0.0000 128 ASP B N     
2983 C CA    . ASP B 131 ? 1.2264 1.5729 0.9792 0.0000 0.0000 0.0000 128 ASP B CA    
2984 C C     . ASP B 131 ? 1.2335 1.5625 0.9926 0.0000 0.0000 0.0000 128 ASP B C     
2985 O O     . ASP B 131 ? 1.2269 1.5412 0.9953 0.0000 0.0000 0.0000 128 ASP B O     
2986 C CB    . ASP B 131 ? 1.2515 1.6123 0.9825 0.0000 0.0000 0.0000 128 ASP B CB    
2987 C CG    . ASP B 131 ? 1.2828 1.6566 0.9992 0.0000 0.0000 0.0000 128 ASP B CG    
2988 O OD1   . ASP B 131 ? 1.2962 1.6766 1.0177 0.0000 0.0000 0.0000 128 ASP B OD1   
2989 O OD2   . ASP B 131 ? 1.3073 1.6864 1.0084 0.0000 0.0000 0.0000 128 ASP B OD2   
2990 N N     . TYR B 132 ? 1.2523 1.5826 1.0072 0.0000 0.0000 0.0000 129 TYR B N     
2991 C CA    . TYR B 132 ? 1.2707 1.5821 1.0312 0.0000 0.0000 0.0000 129 TYR B CA    
2992 C C     . TYR B 132 ? 1.3004 1.6108 1.0483 0.0000 0.0000 0.0000 129 TYR B C     
2993 O O     . TYR B 132 ? 1.3146 1.6439 1.0472 0.0000 0.0000 0.0000 129 TYR B O     
2994 C CB    . TYR B 132 ? 1.2694 1.5824 1.0378 0.0000 0.0000 0.0000 129 TYR B CB    
2995 C CG    . TYR B 132 ? 1.2580 1.5635 1.0426 0.0000 0.0000 0.0000 129 TYR B CG    
2996 C CD1   . TYR B 132 ? 1.2483 1.5706 1.0415 0.0000 0.0000 0.0000 129 TYR B CD1   
2997 C CD2   . TYR B 132 ? 1.2771 1.5596 1.0687 0.0000 0.0000 0.0000 129 TYR B CD2   
2998 C CE1   . TYR B 132 ? 1.2441 1.5635 1.0514 0.0000 0.0000 0.0000 129 TYR B CE1   
2999 C CE2   . TYR B 132 ? 1.2736 1.5525 1.0764 0.0000 0.0000 0.0000 129 TYR B CE2   
3000 C CZ    . TYR B 132 ? 1.2556 1.5545 1.0656 0.0000 0.0000 0.0000 129 TYR B CZ    
3001 O OH    . TYR B 132 ? 1.2666 1.5655 1.0869 0.0000 0.0000 0.0000 129 TYR B OH    
3002 N N     . ILE B 133 ? 1.3147 1.6039 1.0696 0.0000 0.0000 0.0000 130 ILE B N     
3003 C CA    . ILE B 133 ? 1.3488 1.6306 1.0987 0.0000 0.0000 0.0000 130 ILE B CA    
3004 C C     . ILE B 133 ? 1.3694 1.6269 1.1309 0.0000 0.0000 0.0000 130 ILE B C     
3005 O O     . ILE B 133 ? 1.3617 1.5994 1.1369 0.0000 0.0000 0.0000 130 ILE B O     
3006 C CB    . ILE B 133 ? 1.3535 1.6267 1.1082 0.0000 0.0000 0.0000 130 ILE B CB    
3007 C CG1   . ILE B 133 ? 1.3385 1.6391 1.0801 0.0000 0.0000 0.0000 130 ILE B CG1   
3008 C CG2   . ILE B 133 ? 1.3818 1.6407 1.1385 0.0000 0.0000 0.0000 130 ILE B CG2   
3009 C CD1   . ILE B 133 ? 1.3267 1.6239 1.0784 0.0000 0.0000 0.0000 130 ILE B CD1   
3010 N N     . GLY B 134 ? 1.4021 1.6622 1.1576 0.0000 0.0000 0.0000 131 GLY B N     
3011 C CA    . GLY B 134 ? 1.4320 1.6693 1.1990 0.0000 0.0000 0.0000 131 GLY B CA    
3012 C C     . GLY B 134 ? 1.4585 1.7124 1.2182 0.0000 0.0000 0.0000 131 GLY B C     
3013 O O     . GLY B 134 ? 1.4517 1.7360 1.1967 0.0000 0.0000 0.0000 131 GLY B O     
3014 N N     . PRO B 135 ? 1.4898 1.7238 1.2603 0.0000 0.0000 0.0000 132 PRO B N     
3015 C CA    . PRO B 135 ? 1.5100 1.7056 1.2976 0.0000 0.0000 0.0000 132 PRO B CA    
3016 C C     . PRO B 135 ? 1.5450 1.7157 1.3366 0.0000 0.0000 0.0000 132 PRO B C     
3017 O O     . PRO B 135 ? 1.5625 1.7448 1.3448 0.0000 0.0000 0.0000 132 PRO B O     
3018 C CB    . PRO B 135 ? 1.5264 1.7150 1.3226 0.0000 0.0000 0.0000 132 PRO B CB    
3019 C CG    . PRO B 135 ? 1.5168 1.7443 1.3020 0.0000 0.0000 0.0000 132 PRO B CG    
3020 C CD    . PRO B 135 ? 1.5085 1.7574 1.2753 0.0000 0.0000 0.0000 132 PRO B CD    
3021 N N     . LEU B 136 ? 1.5617 1.7002 1.3674 0.0000 0.0000 0.0000 133 LEU B N     
3022 C CA    . LEU B 136 ? 1.6009 1.7106 1.4175 0.0000 0.0000 0.0000 133 LEU B CA    
3023 C C     . LEU B 136 ? 1.6461 1.7132 1.4799 0.0000 0.0000 0.0000 133 LEU B C     
3024 O O     . LEU B 136 ? 1.6432 1.7050 1.4794 0.0000 0.0000 0.0000 133 LEU B O     
3025 C CB    . LEU B 136 ? 1.5785 1.6852 1.3996 0.0000 0.0000 0.0000 133 LEU B CB    
3026 C CG    . LEU B 136 ? 1.5338 1.6771 1.3412 0.0000 0.0000 0.0000 133 LEU B CG    
3027 C CD1   . LEU B 136 ? 1.5121 1.6481 1.3287 0.0000 0.0000 0.0000 133 LEU B CD1   
3028 C CD2   . LEU B 136 ? 1.5323 1.7074 1.3235 0.0000 0.0000 0.0000 133 LEU B CD2   
3029 N N     . PRO B 137 ? 1.6940 1.7310 1.5412 0.0000 0.0000 0.0000 134 PRO B N     
3030 C CA    . PRO B 137 ? 1.7364 1.7254 1.6029 0.0000 0.0000 0.0000 134 PRO B CA    
3031 C C     . PRO B 137 ? 1.7329 1.7069 1.6030 0.0000 0.0000 0.0000 134 PRO B C     
3032 O O     . PRO B 137 ? 1.7129 1.6981 1.5807 0.0000 0.0000 0.0000 134 PRO B O     
3033 C CB    . PRO B 137 ? 1.7665 1.7311 1.6486 0.0000 0.0000 0.0000 134 PRO B CB    
3034 C CG    . PRO B 137 ? 1.7602 1.7622 1.6287 0.0000 0.0000 0.0000 134 PRO B CG    
3035 C CD    . PRO B 137 ? 1.7116 1.7598 1.5567 0.0000 0.0000 0.0000 134 PRO B CD    
3036 N N     . PRO B 138 ? 1.7555 1.7075 1.6306 0.0000 0.0000 0.0000 135 PRO B N     
3037 C CA    . PRO B 138 ? 1.7510 1.6938 1.6254 0.0000 0.0000 0.0000 135 PRO B CA    
3038 C C     . PRO B 138 ? 1.7731 1.6848 1.6587 0.0000 0.0000 0.0000 135 PRO B C     
3039 O O     . PRO B 138 ? 1.8126 1.6857 1.7149 0.0000 0.0000 0.0000 135 PRO B O     
3040 C CB    . PRO B 138 ? 1.7768 1.6964 1.6568 0.0000 0.0000 0.0000 135 PRO B CB    
3041 C CG    . PRO B 138 ? 1.7825 1.7178 1.6619 0.0000 0.0000 0.0000 135 PRO B CG    
3042 C CD    . PRO B 138 ? 1.7839 1.7231 1.6644 0.0000 0.0000 0.0000 135 PRO B CD    
3043 N N     . SER B 139 ? 1.7528 1.6825 1.6313 0.0000 0.0000 0.0000 136 SER B N     
3044 C CA    . SER B 139 ? 1.7734 1.6776 1.6617 0.0000 0.0000 0.0000 136 SER B CA    
3045 C C     . SER B 139 ? 1.7645 1.6761 1.6419 0.0000 0.0000 0.0000 136 SER B C     
3046 O O     . SER B 139 ? 1.7280 1.6784 1.5919 0.0000 0.0000 0.0000 136 SER B O     
3047 C CB    . SER B 139 ? 1.7532 1.6770 1.6452 0.0000 0.0000 0.0000 136 SER B CB    
3048 O OG    . SER B 139 ? 1.7643 1.6638 1.6694 0.0000 0.0000 0.0000 136 SER B OG    
3049 N N     . GLN B 140 ? 1.8047 1.6786 1.6879 0.0000 0.0000 0.0000 137 GLN B N     
3050 C CA    . GLN B 140 ? 1.8061 1.6852 1.6769 0.0000 0.0000 0.0000 137 GLN B CA    
3051 C C     . GLN B 140 ? 1.7796 1.6920 1.6365 0.0000 0.0000 0.0000 137 GLN B C     
3052 O O     . GLN B 140 ? 1.7584 1.6968 1.6029 0.0000 0.0000 0.0000 137 GLN B O     
3053 C CB    . GLN B 140 ? 1.7828 1.6828 1.6490 0.0000 0.0000 0.0000 137 GLN B CB    
3054 C CG    . GLN B 140 ? 1.8204 1.7041 1.7034 0.0000 0.0000 0.0000 137 GLN B CG    
3055 C CD    . GLN B 140 ? 1.8953 1.7346 1.7894 0.0000 0.0000 0.0000 137 GLN B CD    
3056 O OE1   . GLN B 140 ? 1.9239 1.7546 1.8069 0.0000 0.0000 0.0000 137 GLN B OE1   
3057 N NE2   . GLN B 140 ? 1.9345 1.7467 1.8510 0.0000 0.0000 0.0000 137 GLN B NE2   
3058 N N     . GLY B 141 ? 1.7827 1.6962 1.6434 0.0000 0.0000 0.0000 138 GLY B N     
3059 C CA    . GLY B 141 ? 1.7552 1.7028 1.6073 0.0000 0.0000 0.0000 138 GLY B CA    
3060 C C     . GLY B 141 ? 1.7017 1.6979 1.5452 0.0000 0.0000 0.0000 138 GLY B C     
3061 O O     . GLY B 141 ? 1.6821 1.7104 1.5197 0.0000 0.0000 0.0000 138 GLY B O     
3062 N N     . TYR B 142 ? 1.6775 1.6798 1.5221 0.0000 0.0000 0.0000 139 TYR B N     
3063 C CA    . TYR B 142 ? 1.6277 1.6717 1.4648 0.0000 0.0000 0.0000 139 TYR B CA    
3064 C C     . TYR B 142 ? 1.6185 1.6707 1.4563 0.0000 0.0000 0.0000 139 TYR B C     
3065 O O     . TYR B 142 ? 1.6495 1.6740 1.4952 0.0000 0.0000 0.0000 139 TYR B O     
3066 C CB    . TYR B 142 ? 1.6126 1.6641 1.4484 0.0000 0.0000 0.0000 139 TYR B CB    
3067 C CG    . TYR B 142 ? 1.6189 1.6754 1.4503 0.0000 0.0000 0.0000 139 TYR B CG    
3068 C CD1   . TYR B 142 ? 1.5943 1.6862 1.4190 0.0000 0.0000 0.0000 139 TYR B CD1   
3069 C CD2   . TYR B 142 ? 1.6651 1.6904 1.4985 0.0000 0.0000 0.0000 139 TYR B CD2   
3070 C CE1   . TYR B 142 ? 1.5967 1.6958 1.4168 0.0000 0.0000 0.0000 139 TYR B CE1   
3071 C CE2   . TYR B 142 ? 1.6670 1.7001 1.4927 0.0000 0.0000 0.0000 139 TYR B CE2   
3072 C CZ    . TYR B 142 ? 1.6292 1.7007 1.4482 0.0000 0.0000 0.0000 139 TYR B CZ    
3073 O OH    . TYR B 142 ? 1.6322 1.7140 1.4432 0.0000 0.0000 0.0000 139 TYR B OH    
3074 N N     . LEU B 143 ? 1.5733 1.6633 1.4028 0.0000 0.0000 0.0000 140 LEU B N     
3075 C CA    . LEU B 143 ? 1.5610 1.6647 1.3870 0.0000 0.0000 0.0000 140 LEU B CA    
3076 C C     . LEU B 143 ? 1.5211 1.6575 1.3367 0.0000 0.0000 0.0000 140 LEU B C     
3077 O O     . LEU B 143 ? 1.5316 1.6763 1.3418 0.0000 0.0000 0.0000 140 LEU B O     
3078 C CB    . LEU B 143 ? 1.5655 1.6817 1.3924 0.0000 0.0000 0.0000 140 LEU B CB    
3079 C CG    . LEU B 143 ? 1.5942 1.6793 1.4313 0.0000 0.0000 0.0000 140 LEU B CG    
3080 C CD1   . LEU B 143 ? 1.5894 1.6979 1.4288 0.0000 0.0000 0.0000 140 LEU B CD1   
3081 C CD2   . LEU B 143 ? 1.6254 1.6856 1.4681 0.0000 0.0000 0.0000 140 LEU B CD2   
3082 N N     . TYR B 144 ? 1.4704 1.6253 1.2829 0.0000 0.0000 0.0000 141 TYR B N     
3083 C CA    . TYR B 144 ? 1.4298 1.6151 1.2331 0.0000 0.0000 0.0000 141 TYR B CA    
3084 C C     . TYR B 144 ? 1.3988 1.5843 1.2038 0.0000 0.0000 0.0000 141 TYR B C     
3085 O O     . TYR B 144 ? 1.3966 1.5668 1.2086 0.0000 0.0000 0.0000 141 TYR B O     
3086 C CB    . TYR B 144 ? 1.4105 1.6244 1.2109 0.0000 0.0000 0.0000 141 TYR B CB    
3087 C CG    . TYR B 144 ? 1.4287 1.6520 1.2277 0.0000 0.0000 0.0000 141 TYR B CG    
3088 C CD1   . TYR B 144 ? 1.4396 1.6853 1.2277 0.0000 0.0000 0.0000 141 TYR B CD1   
3089 C CD2   . TYR B 144 ? 1.4484 1.6599 1.2564 0.0000 0.0000 0.0000 141 TYR B CD2   
3090 C CE1   . TYR B 144 ? 1.4649 1.7220 1.2516 0.0000 0.0000 0.0000 141 TYR B CE1   
3091 C CE2   . TYR B 144 ? 1.4697 1.6921 1.2789 0.0000 0.0000 0.0000 141 TYR B CE2   
3092 C CZ    . TYR B 144 ? 1.4799 1.7255 1.2786 0.0000 0.0000 0.0000 141 TYR B CZ    
3093 O OH    . TYR B 144 ? 1.4950 1.7546 1.2945 0.0000 0.0000 0.0000 141 TYR B OH    
3094 N N     . VAL B 145 ? 1.3714 1.5757 1.1695 0.0000 0.0000 0.0000 142 VAL B N     
3095 C CA    . VAL B 145 ? 1.3370 1.5470 1.1382 0.0000 0.0000 0.0000 142 VAL B CA    
3096 C C     . VAL B 145 ? 1.3031 1.5420 1.0971 0.0000 0.0000 0.0000 142 VAL B C     
3097 O O     . VAL B 145 ? 1.3075 1.5641 1.0907 0.0000 0.0000 0.0000 142 VAL B O     
3098 C CB    . VAL B 145 ? 1.3509 1.5561 1.1545 0.0000 0.0000 0.0000 142 VAL B CB    
3099 C CG1   . VAL B 145 ? 1.3280 1.5423 1.1376 0.0000 0.0000 0.0000 142 VAL B CG1   
3100 C CG2   . VAL B 145 ? 1.3758 1.5489 1.1905 0.0000 0.0000 0.0000 142 VAL B CG2   
3101 N N     . LEU B 146 ? 1.2673 1.5104 1.0673 0.0000 0.0000 0.0000 143 LEU B N     
3102 C CA    . LEU B 146 ? 1.2349 1.5007 1.0327 0.0000 0.0000 0.0000 143 LEU B CA    
3103 C C     . LEU B 146 ? 1.2235 1.4944 1.0222 0.0000 0.0000 0.0000 143 LEU B C     
3104 O O     . LEU B 146 ? 1.2213 1.4818 1.0290 0.0000 0.0000 0.0000 143 LEU B O     
3105 C CB    . LEU B 146 ? 1.2154 1.4848 1.0219 0.0000 0.0000 0.0000 143 LEU B CB    
3106 C CG    . LEU B 146 ? 1.1896 1.4768 1.0000 0.0000 0.0000 0.0000 143 LEU B CG    
3107 C CD1   . LEU B 146 ? 1.1901 1.4941 0.9937 0.0000 0.0000 0.0000 143 LEU B CD1   
3108 C CD2   . LEU B 146 ? 1.1678 1.4581 0.9884 0.0000 0.0000 0.0000 143 LEU B CD2   
3109 N N     . VAL B 147 ? 1.2164 1.5051 1.0057 0.0000 0.0000 0.0000 144 VAL B N     
3110 C CA    . VAL B 147 ? 1.2104 1.5080 0.9996 0.0000 0.0000 0.0000 144 VAL B CA    
3111 C C     . VAL B 147 ? 1.1909 1.5025 0.9827 0.0000 0.0000 0.0000 144 VAL B C     
3112 O O     . VAL B 147 ? 1.1924 1.5154 0.9764 0.0000 0.0000 0.0000 144 VAL B O     
3113 C CB    . VAL B 147 ? 1.2306 1.5403 1.0052 0.0000 0.0000 0.0000 144 VAL B CB    
3114 C CG1   . VAL B 147 ? 1.2273 1.5532 1.0009 0.0000 0.0000 0.0000 144 VAL B CG1   
3115 C CG2   . VAL B 147 ? 1.2538 1.5477 1.0300 0.0000 0.0000 0.0000 144 VAL B CG2   
3116 N N     . VAL B 148 ? 1.1733 1.4833 0.9775 0.0000 0.0000 0.0000 145 VAL B N     
3117 C CA    . VAL B 148 ? 1.1520 1.4727 0.9618 0.0000 0.0000 0.0000 145 VAL B CA    
3118 C C     . VAL B 148 ? 1.1550 1.4863 0.9676 0.0000 0.0000 0.0000 145 VAL B C     
3119 O O     . VAL B 148 ? 1.1513 1.4786 0.9752 0.0000 0.0000 0.0000 145 VAL B O     
3120 C CB    . VAL B 148 ? 1.1323 1.4458 0.9567 0.0000 0.0000 0.0000 145 VAL B CB    
3121 C CG1   . VAL B 148 ? 1.1180 1.4409 0.9503 0.0000 0.0000 0.0000 145 VAL B CG1   
3122 C CG2   . VAL B 148 ? 1.1240 1.4306 0.9472 0.0000 0.0000 0.0000 145 VAL B CG2   
3123 N N     . VAL B 149 ? 1.1639 1.5101 0.9665 0.0000 0.0000 0.0000 146 VAL B N     
3124 C CA    . VAL B 149 ? 1.1697 1.5308 0.9747 0.0000 0.0000 0.0000 146 VAL B CA    
3125 C C     . VAL B 149 ? 1.1700 1.5352 0.9829 0.0000 0.0000 0.0000 146 VAL B C     
3126 O O     . VAL B 149 ? 1.1733 1.5369 0.9804 0.0000 0.0000 0.0000 146 VAL B O     
3127 C CB    . VAL B 149 ? 1.1863 1.5641 0.9714 0.0000 0.0000 0.0000 146 VAL B CB    
3128 C CG1   . VAL B 149 ? 1.1833 1.5796 0.9733 0.0000 0.0000 0.0000 146 VAL B CG1   
3129 C CG2   . VAL B 149 ? 1.1945 1.5666 0.9714 0.0000 0.0000 0.0000 146 VAL B CG2   
3130 N N     . ASP B 150 ? 1.1710 1.5413 0.9998 0.0000 0.0000 0.0000 147 ASP B N     
3131 C CA    . ASP B 150 ? 1.1757 1.5491 1.0140 0.0000 0.0000 0.0000 147 ASP B CA    
3132 C C     . ASP B 150 ? 1.1978 1.5874 1.0232 0.0000 0.0000 0.0000 147 ASP B C     
3133 O O     . ASP B 150 ? 1.2044 1.6110 1.0257 0.0000 0.0000 0.0000 147 ASP B O     
3134 C CB    . ASP B 150 ? 1.1630 1.5366 1.0245 0.0000 0.0000 0.0000 147 ASP B CB    
3135 C CG    . ASP B 150 ? 1.1766 1.5549 1.0496 0.0000 0.0000 0.0000 147 ASP B CG    
3136 O OD1   . ASP B 150 ? 1.1868 1.5551 1.0611 0.0000 0.0000 0.0000 147 ASP B OD1   
3137 O OD2   . ASP B 150 ? 1.1884 1.5808 1.0711 0.0000 0.0000 0.0000 147 ASP B OD2   
3138 N N     . GLY B 151 ? 1.2090 1.5939 1.0290 0.0000 0.0000 0.0000 148 GLY B N     
3139 C CA    . GLY B 151 ? 1.2345 1.6315 1.0376 0.0000 0.0000 0.0000 148 GLY B CA    
3140 C C     . GLY B 151 ? 1.2431 1.6577 1.0496 0.0000 0.0000 0.0000 148 GLY B C     
3141 O O     . GLY B 151 ? 1.2678 1.7014 1.0544 0.0000 0.0000 0.0000 148 GLY B O     
3142 N N     . MET B 152 ? 1.2295 1.6408 1.0614 0.0000 0.0000 0.0000 149 MET B N     
3143 C CA    . MET B 152 ? 1.2376 1.6670 1.0780 0.0000 0.0000 0.0000 149 MET B CA    
3144 C C     . MET B 152 ? 1.2293 1.6783 1.0768 0.0000 0.0000 0.0000 149 MET B C     
3145 O O     . MET B 152 ? 1.2446 1.7181 1.0837 0.0000 0.0000 0.0000 149 MET B O     
3146 C CB    . MET B 152 ? 1.2301 1.6479 1.0964 0.0000 0.0000 0.0000 149 MET B CB    
3147 C CG    . MET B 152 ? 1.2433 1.6787 1.1200 0.0000 0.0000 0.0000 149 MET B CG    
3148 S SD    . MET B 152 ? 1.2446 1.6962 1.1501 0.0000 0.0000 0.0000 149 MET B SD    
3149 C CE    . MET B 152 ? 1.2724 1.7625 1.1711 0.0000 0.0000 0.0000 149 MET B CE    
3150 N N     . THR B 153 ? 1.2090 1.6483 1.0720 0.0000 0.0000 0.0000 150 THR B N     
3151 C CA    . THR B 153 ? 1.2029 1.6573 1.0781 0.0000 0.0000 0.0000 150 THR B CA    
3152 C C     . THR B 153 ? 1.2160 1.6746 1.0742 0.0000 0.0000 0.0000 150 THR B C     
3153 O O     . THR B 153 ? 1.2264 1.7052 1.0901 0.0000 0.0000 0.0000 150 THR B O     
3154 C CB    . THR B 153 ? 1.1809 1.6218 1.0787 0.0000 0.0000 0.0000 150 THR B CB    
3155 O OG1   . THR B 153 ? 1.1647 1.5821 1.0523 0.0000 0.0000 0.0000 150 THR B OG1   
3156 C CG2   . THR B 153 ? 1.1721 1.6114 1.0900 0.0000 0.0000 0.0000 150 THR B CG2   
3157 N N     . GLY B 154 ? 1.2163 1.6570 1.0570 0.0000 0.0000 0.0000 151 GLY B N     
3158 C CA    . GLY B 154 ? 1.2244 1.6648 1.0518 0.0000 0.0000 0.0000 151 GLY B CA    
3159 C C     . GLY B 154 ? 1.2106 1.6336 1.0541 0.0000 0.0000 0.0000 151 GLY B C     
3160 O O     . GLY B 154 ? 1.2200 1.6398 1.0595 0.0000 0.0000 0.0000 151 GLY B O     
3161 N N     . PHE B 155 ? 1.1894 1.6005 1.0509 0.0000 0.0000 0.0000 152 PHE B N     
3162 C CA    . PHE B 155 ? 1.1750 1.5686 1.0486 0.0000 0.0000 0.0000 152 PHE B CA    
3163 C C     . PHE B 155 ? 1.1776 1.5500 1.0359 0.0000 0.0000 0.0000 152 PHE B C     
3164 O O     . PHE B 155 ? 1.1729 1.5406 1.0194 0.0000 0.0000 0.0000 152 PHE B O     
3165 C CB    . PHE B 155 ? 1.1553 1.5446 1.0478 0.0000 0.0000 0.0000 152 PHE B CB    
3166 C CG    . PHE B 155 ? 1.1456 1.5257 1.0528 0.0000 0.0000 0.0000 152 PHE B CG    
3167 C CD1   . PHE B 155 ? 1.1405 1.5357 1.0670 0.0000 0.0000 0.0000 152 PHE B CD1   
3168 C CD2   . PHE B 155 ? 1.1345 1.4925 1.0370 0.0000 0.0000 0.0000 152 PHE B CD2   
3169 C CE1   . PHE B 155 ? 1.1335 1.5192 1.0746 0.0000 0.0000 0.0000 152 PHE B CE1   
3170 C CE2   . PHE B 155 ? 1.1395 1.4876 1.0534 0.0000 0.0000 0.0000 152 PHE B CE2   
3171 C CZ    . PHE B 155 ? 1.1372 1.4981 1.0707 0.0000 0.0000 0.0000 152 PHE B CZ    
3172 N N     . THR B 156 ? 1.1838 1.5435 1.0451 0.0000 0.0000 0.0000 153 THR B N     
3173 C CA    . THR B 156 ? 1.1883 1.5293 1.0363 0.0000 0.0000 0.0000 153 THR B CA    
3174 C C     . THR B 156 ? 1.1809 1.4994 1.0374 0.0000 0.0000 0.0000 153 THR B C     
3175 O O     . THR B 156 ? 1.1803 1.4932 1.0515 0.0000 0.0000 0.0000 153 THR B O     
3176 C CB    . THR B 156 ? 1.2098 1.5533 1.0498 0.0000 0.0000 0.0000 153 THR B CB    
3177 O OG1   . THR B 156 ? 1.2218 1.5888 1.0475 0.0000 0.0000 0.0000 153 THR B OG1   
3178 C CG2   . THR B 156 ? 1.2192 1.5420 1.0482 0.0000 0.0000 0.0000 153 THR B CG2   
3179 N N     . TRP B 157 ? 1.1756 1.4831 1.0227 0.0000 0.0000 0.0000 154 TRP B N     
3180 C CA    . TRP B 157 ? 1.1775 1.4644 1.0270 0.0000 0.0000 0.0000 154 TRP B CA    
3181 C C     . TRP B 157 ? 1.1920 1.4663 1.0297 0.0000 0.0000 0.0000 154 TRP B C     
3182 O O     . TRP B 157 ? 1.1943 1.4777 1.0200 0.0000 0.0000 0.0000 154 TRP B O     
3183 C CB    . TRP B 157 ? 1.1629 1.4505 1.0140 0.0000 0.0000 0.0000 154 TRP B CB    
3184 C CG    . TRP B 157 ? 1.1560 1.4537 1.0204 0.0000 0.0000 0.0000 154 TRP B CG    
3185 C CD1   . TRP B 157 ? 1.1583 1.4510 1.0327 0.0000 0.0000 0.0000 154 TRP B CD1   
3186 C CD2   . TRP B 157 ? 1.1392 1.4540 1.0087 0.0000 0.0000 0.0000 154 TRP B CD2   
3187 N NE1   . TRP B 157 ? 1.1430 1.4507 1.0291 0.0000 0.0000 0.0000 154 TRP B NE1   
3188 C CE2   . TRP B 157 ? 1.1267 1.4467 1.0110 0.0000 0.0000 0.0000 154 TRP B CE2   
3189 C CE3   . TRP B 157 ? 1.1287 1.4543 0.9914 0.0000 0.0000 0.0000 154 TRP B CE3   
3190 C CZ2   . TRP B 157 ? 1.0997 1.4345 0.9943 0.0000 0.0000 0.0000 154 TRP B CZ2   
3191 C CZ3   . TRP B 157 ? 1.1157 1.4538 0.9876 0.0000 0.0000 0.0000 154 TRP B CZ3   
3192 C CH2   . TRP B 157 ? 1.1021 1.4443 0.9908 0.0000 0.0000 0.0000 154 TRP B CH2   
3193 N N     . LEU B 158 ? 1.2063 1.4594 1.0483 0.0000 0.0000 0.0000 155 LEU B N     
3194 C CA    . LEU B 158 ? 1.2270 1.4642 1.0613 0.0000 0.0000 0.0000 155 LEU B CA    
3195 C C     . LEU B 158 ? 1.2321 1.4512 1.0671 0.0000 0.0000 0.0000 155 LEU B C     
3196 O O     . LEU B 158 ? 1.2385 1.4454 1.0817 0.0000 0.0000 0.0000 155 LEU B O     
3197 C CB    . LEU B 158 ? 1.2495 1.4752 1.0898 0.0000 0.0000 0.0000 155 LEU B CB    
3198 C CG    . LEU B 158 ? 1.2630 1.5104 1.1011 0.0000 0.0000 0.0000 155 LEU B CG    
3199 C CD1   . LEU B 158 ? 1.2845 1.5214 1.1302 0.0000 0.0000 0.0000 155 LEU B CD1   
3200 C CD2   . LEU B 158 ? 1.2660 1.5321 1.0855 0.0000 0.0000 0.0000 155 LEU B CD2   
3201 N N     . TYR B 159 ? 1.2369 1.4568 1.0633 0.0000 0.0000 0.0000 156 TYR B N     
3202 C CA    . TYR B 159 ? 1.2484 1.4560 1.0746 0.0000 0.0000 0.0000 156 TYR B CA    
3203 C C     . TYR B 159 ? 1.2754 1.4690 1.0973 0.0000 0.0000 0.0000 156 TYR B C     
3204 O O     . TYR B 159 ? 1.2777 1.4840 1.0935 0.0000 0.0000 0.0000 156 TYR B O     
3205 C CB    . TYR B 159 ? 1.2273 1.4543 1.0522 0.0000 0.0000 0.0000 156 TYR B CB    
3206 C CG    . TYR B 159 ? 1.2161 1.4539 1.0473 0.0000 0.0000 0.0000 156 TYR B CG    
3207 C CD1   . TYR B 159 ? 1.2150 1.4468 1.0493 0.0000 0.0000 0.0000 156 TYR B CD1   
3208 C CD2   . TYR B 159 ? 1.2096 1.4641 1.0428 0.0000 0.0000 0.0000 156 TYR B CD2   
3209 C CE1   . TYR B 159 ? 1.2038 1.4473 1.0446 0.0000 0.0000 0.0000 156 TYR B CE1   
3210 C CE2   . TYR B 159 ? 1.1987 1.4628 1.0399 0.0000 0.0000 0.0000 156 TYR B CE2   
3211 C CZ    . TYR B 159 ? 1.1986 1.4576 1.0442 0.0000 0.0000 0.0000 156 TYR B CZ    
3212 O OH    . TYR B 159 ? 1.1982 1.4689 1.0525 0.0000 0.0000 0.0000 156 TYR B OH    
3213 N N     . PRO B 160 ? 1.3010 1.4680 1.1265 0.0000 0.0000 0.0000 157 PRO B N     
3214 C CA    . PRO B 160 ? 1.3263 1.4771 1.1501 0.0000 0.0000 0.0000 157 PRO B CA    
3215 C C     . PRO B 160 ? 1.3230 1.4843 1.1427 0.0000 0.0000 0.0000 157 PRO B C     
3216 O O     . PRO B 160 ? 1.3126 1.4782 1.1321 0.0000 0.0000 0.0000 157 PRO B O     
3217 C CB    . PRO B 160 ? 1.3537 1.4701 1.1851 0.0000 0.0000 0.0000 157 PRO B CB    
3218 C CG    . PRO B 160 ? 1.3413 1.4600 1.1768 0.0000 0.0000 0.0000 157 PRO B CG    
3219 C CD    . PRO B 160 ? 1.3066 1.4583 1.1377 0.0000 0.0000 0.0000 157 PRO B CD    
3220 N N     . THR B 161 ? 1.3365 1.5058 1.1537 0.0000 0.0000 0.0000 158 THR B N     
3221 C CA    . THR B 161 ? 1.3425 1.5254 1.1596 0.0000 0.0000 0.0000 158 THR B CA    
3222 C C     . THR B 161 ? 1.3777 1.5466 1.1967 0.0000 0.0000 0.0000 158 THR B C     
3223 O O     . THR B 161 ? 1.3984 1.5501 1.2177 0.0000 0.0000 0.0000 158 THR B O     
3224 C CB    . THR B 161 ? 1.3140 1.5317 1.1305 0.0000 0.0000 0.0000 158 THR B CB    
3225 O OG1   . THR B 161 ? 1.3185 1.5444 1.1318 0.0000 0.0000 0.0000 158 THR B OG1   
3226 C CG2   . THR B 161 ? 1.2899 1.5190 1.1058 0.0000 0.0000 0.0000 158 THR B CG2   
3227 N N     . LYS B 162 ? 1.3895 1.5676 1.2110 0.0000 0.0000 0.0000 159 LYS B N     
3228 C CA    . LYS B 162 ? 1.4262 1.5932 1.2518 0.0000 0.0000 0.0000 159 LYS B CA    
3229 C C     . LYS B 162 ? 1.4162 1.6117 1.2440 0.0000 0.0000 0.0000 159 LYS B C     
3230 O O     . LYS B 162 ? 1.4364 1.6267 1.2687 0.0000 0.0000 0.0000 159 LYS B O     
3231 C CB    . LYS B 162 ? 1.4440 1.6041 1.2717 0.0000 0.0000 0.0000 159 LYS B CB    
3232 C CG    . LYS B 162 ? 1.4919 1.6208 1.3160 0.0000 0.0000 0.0000 159 LYS B CG    
3233 C CD    . LYS B 162 ? 1.5677 1.6846 1.3910 0.0000 0.0000 0.0000 159 LYS B CD    
3234 C CE    . LYS B 162 ? 1.6128 1.7069 1.4293 0.0000 0.0000 0.0000 159 LYS B CE    
3235 N NZ    . LYS B 162 ? 1.6752 1.7380 1.4906 0.0000 0.0000 0.0000 159 LYS B NZ    
3236 N N     . ALA B 163 ? 1.3884 1.6133 1.2143 0.0000 0.0000 0.0000 160 ALA B N     
3237 C CA    . ALA B 163 ? 1.3762 1.6312 1.2045 0.0000 0.0000 0.0000 160 ALA B CA    
3238 C C     . ALA B 163 ? 1.3495 1.6263 1.1740 0.0000 0.0000 0.0000 160 ALA B C     
3239 O O     . ALA B 163 ? 1.3310 1.6093 1.1565 0.0000 0.0000 0.0000 160 ALA B O     
3240 C CB    . ALA B 163 ? 1.3735 1.6492 1.2135 0.0000 0.0000 0.0000 160 ALA B CB    
3241 N N     . PRO B 164 ? 1.3498 1.6438 1.1696 0.0000 0.0000 0.0000 161 PRO B N     
3242 C CA    . PRO B 164 ? 1.3310 1.6443 1.1471 0.0000 0.0000 0.0000 161 PRO B CA    
3243 C C     . PRO B 164 ? 1.3117 1.6518 1.1418 0.0000 0.0000 0.0000 161 PRO B C     
3244 O O     . PRO B 164 ? 1.3086 1.6709 1.1406 0.0000 0.0000 0.0000 161 PRO B O     
3245 C CB    . PRO B 164 ? 1.3451 1.6668 1.1490 0.0000 0.0000 0.0000 161 PRO B CB    
3246 C CG    . PRO B 164 ? 1.3607 1.6821 1.1693 0.0000 0.0000 0.0000 161 PRO B CG    
3247 C CD    . PRO B 164 ? 1.3693 1.6673 1.1872 0.0000 0.0000 0.0000 161 PRO B CD    
3248 N N     . SER B 165 ? 1.3014 1.6403 1.1414 0.0000 0.0000 0.0000 162 SER B N     
3249 C CA    . SER B 165 ? 1.2880 1.6535 1.1448 0.0000 0.0000 0.0000 162 SER B CA    
3250 C C     . SER B 165 ? 1.2697 1.6396 1.1312 0.0000 0.0000 0.0000 162 SER B C     
3251 O O     . SER B 165 ? 1.2720 1.6232 1.1254 0.0000 0.0000 0.0000 162 SER B O     
3252 C CB    . SER B 165 ? 1.2966 1.6626 1.1616 0.0000 0.0000 0.0000 162 SER B CB    
3253 O OG    . SER B 165 ? 1.3004 1.6445 1.1583 0.0000 0.0000 0.0000 162 SER B OG    
3254 N N     . THR B 166 ? 1.2539 1.6491 1.1310 0.0000 0.0000 0.0000 163 THR B N     
3255 C CA    . THR B 166 ? 1.2352 1.6371 1.1224 0.0000 0.0000 0.0000 163 THR B CA    
3256 C C     . THR B 166 ? 1.2330 1.6242 1.1168 0.0000 0.0000 0.0000 163 THR B C     
3257 O O     . THR B 166 ? 1.2239 1.6034 1.1025 0.0000 0.0000 0.0000 163 THR B O     
3258 C CB    . THR B 166 ? 1.2252 1.6575 1.1365 0.0000 0.0000 0.0000 163 THR B CB    
3259 O OG1   . THR B 166 ? 1.2377 1.6822 1.1526 0.0000 0.0000 0.0000 163 THR B OG1   
3260 C CG2   . THR B 166 ? 1.2053 1.6431 1.1294 0.0000 0.0000 0.0000 163 THR B CG2   
3261 N N     . SER B 167 ? 1.2411 1.6381 1.1277 0.0000 0.0000 0.0000 164 SER B N     
3262 C CA    . SER B 167 ? 1.2441 1.6331 1.1249 0.0000 0.0000 0.0000 164 SER B CA    
3263 C C     . SER B 167 ? 1.2472 1.6045 1.1105 0.0000 0.0000 0.0000 164 SER B C     
3264 O O     . SER B 167 ? 1.2431 1.5979 1.1046 0.0000 0.0000 0.0000 164 SER B O     
3265 C CB    . SER B 167 ? 1.2605 1.6537 1.1423 0.0000 0.0000 0.0000 164 SER B CB    
3266 O OG    . SER B 167 ? 1.2809 1.6521 1.1487 0.0000 0.0000 0.0000 164 SER B OG    
3267 N N     . ALA B 168 ? 1.2550 1.5902 1.1080 0.0000 0.0000 0.0000 165 ALA B N     
3268 C CA    . ALA B 168 ? 1.2545 1.5606 1.0949 0.0000 0.0000 0.0000 165 ALA B CA    
3269 C C     . ALA B 168 ? 1.2314 1.5380 1.0706 0.0000 0.0000 0.0000 165 ALA B C     
3270 O O     . ALA B 168 ? 1.2324 1.5244 1.0665 0.0000 0.0000 0.0000 165 ALA B O     
3271 C CB    . ALA B 168 ? 1.2792 1.5639 1.1127 0.0000 0.0000 0.0000 165 ALA B CB    
3272 N N     . THR B 169 ? 1.2073 1.5309 1.0520 0.0000 0.0000 0.0000 166 THR B N     
3273 C CA    . THR B 169 ? 1.1828 1.5083 1.0275 0.0000 0.0000 0.0000 166 THR B CA    
3274 C C     . THR B 169 ? 1.1674 1.4991 1.0203 0.0000 0.0000 0.0000 166 THR B C     
3275 O O     . THR B 169 ? 1.1649 1.4874 1.0149 0.0000 0.0000 0.0000 166 THR B O     
3276 C CB    . THR B 169 ? 1.1744 1.5166 1.0239 0.0000 0.0000 0.0000 166 THR B CB    
3277 O OG1   . THR B 169 ? 1.1788 1.5176 1.0181 0.0000 0.0000 0.0000 166 THR B OG1   
3278 C CG2   . THR B 169 ? 1.1620 1.5041 1.0114 0.0000 0.0000 0.0000 166 THR B CG2   
3279 N N     . VAL B 170 ? 1.1532 1.5030 1.0175 0.0000 0.0000 0.0000 167 VAL B N     
3280 C CA    . VAL B 170 ? 1.1343 1.4944 1.0071 0.0000 0.0000 0.0000 167 VAL B CA    
3281 C C     . VAL B 170 ? 1.1356 1.4819 0.9972 0.0000 0.0000 0.0000 167 VAL B C     
3282 O O     . VAL B 170 ? 1.1282 1.4722 0.9907 0.0000 0.0000 0.0000 167 VAL B O     
3283 C CB    . VAL B 170 ? 1.1288 1.5154 1.0173 0.0000 0.0000 0.0000 167 VAL B CB    
3284 C CG1   . VAL B 170 ? 1.1229 1.5210 1.0174 0.0000 0.0000 0.0000 167 VAL B CG1   
3285 C CG2   . VAL B 170 ? 1.1187 1.5195 1.0231 0.0000 0.0000 0.0000 167 VAL B CG2   
3286 N N     . LYS B 171 ? 1.1468 1.4832 0.9988 0.0000 0.0000 0.0000 168 LYS B N     
3287 C CA    . LYS B 171 ? 1.1583 1.4791 0.9990 0.0000 0.0000 0.0000 168 LYS B CA    
3288 C C     . LYS B 171 ? 1.1565 1.4590 0.9935 0.0000 0.0000 0.0000 168 LYS B C     
3289 O O     . LYS B 171 ? 1.1565 1.4581 0.9925 0.0000 0.0000 0.0000 168 LYS B O     
3290 C CB    . LYS B 171 ? 1.1765 1.4830 1.0083 0.0000 0.0000 0.0000 168 LYS B CB    
3291 N N     . SER B 172 ? 1.1543 1.4463 0.9901 0.0000 0.0000 0.0000 169 SER B N     
3292 C CA    . SER B 172 ? 1.1516 1.4305 0.9852 0.0000 0.0000 0.0000 169 SER B CA    
3293 C C     . SER B 172 ? 1.1303 1.4223 0.9713 0.0000 0.0000 0.0000 169 SER B C     
3294 O O     . SER B 172 ? 1.1337 1.4213 0.9758 0.0000 0.0000 0.0000 169 SER B O     
3295 C CB    . SER B 172 ? 1.1616 1.4321 0.9912 0.0000 0.0000 0.0000 169 SER B CB    
3296 O OG    . SER B 172 ? 1.1863 1.4371 1.0106 0.0000 0.0000 0.0000 169 SER B OG    
3297 N N     . LEU B 173 ? 1.1118 1.4195 0.9600 0.0000 0.0000 0.0000 170 LEU B N     
3298 C CA    . LEU B 173 ? 1.0939 1.4106 0.9513 0.0000 0.0000 0.0000 170 LEU B CA    
3299 C C     . LEU B 173 ? 1.0882 1.4134 0.9530 0.0000 0.0000 0.0000 170 LEU B C     
3300 O O     . LEU B 173 ? 1.0842 1.4111 0.9554 0.0000 0.0000 0.0000 170 LEU B O     
3301 C CB    . LEU B 173 ? 1.0851 1.4126 0.9494 0.0000 0.0000 0.0000 170 LEU B CB    
3302 C CG    . LEU B 173 ? 1.0845 1.4063 0.9387 0.0000 0.0000 0.0000 170 LEU B CG    
3303 C CD1   . LEU B 173 ? 1.0816 1.4142 0.9410 0.0000 0.0000 0.0000 170 LEU B CD1   
3304 C CD2   . LEU B 173 ? 1.0784 1.3917 0.9276 0.0000 0.0000 0.0000 170 LEU B CD2   
3305 N N     . ASN B 174 ? 1.0869 1.4191 0.9502 0.0000 0.0000 0.0000 171 ASN B N     
3306 C CA    . ASN B 174 ? 1.0855 1.4268 0.9502 0.0000 0.0000 0.0000 171 ASN B CA    
3307 C C     . ASN B 174 ? 1.0899 1.4190 0.9478 0.0000 0.0000 0.0000 171 ASN B C     
3308 O O     . ASN B 174 ? 1.0897 1.4264 0.9536 0.0000 0.0000 0.0000 171 ASN B O     
3309 C CB    . ASN B 174 ? 1.0964 1.4477 0.9555 0.0000 0.0000 0.0000 171 ASN B CB    
3310 C CG    . ASN B 174 ? 1.1014 1.4743 0.9740 0.0000 0.0000 0.0000 171 ASN B CG    
3311 O OD1   . ASN B 174 ? 1.1096 1.4903 0.9974 0.0000 0.0000 0.0000 171 ASN B OD1   
3312 N ND2   . ASN B 174 ? 1.1190 1.5017 0.9883 0.0000 0.0000 0.0000 171 ASN B ND2   
3313 N N     . VAL B 175 ? 1.0944 1.4049 0.9424 0.0000 0.0000 0.0000 172 VAL B N     
3314 C CA    . VAL B 175 ? 1.0910 1.3900 0.9369 0.0000 0.0000 0.0000 172 VAL B CA    
3315 C C     . VAL B 175 ? 1.0781 1.3823 0.9351 0.0000 0.0000 0.0000 172 VAL B C     
3316 O O     . VAL B 175 ? 1.0751 1.3872 0.9383 0.0000 0.0000 0.0000 172 VAL B O     
3317 C CB    . VAL B 175 ? 1.1069 1.3831 0.9452 0.0000 0.0000 0.0000 172 VAL B CB    
3318 C CG1   . VAL B 175 ? 1.1110 1.3780 0.9544 0.0000 0.0000 0.0000 172 VAL B CG1   
3319 C CG2   . VAL B 175 ? 1.1186 1.3870 0.9463 0.0000 0.0000 0.0000 172 VAL B CG2   
3320 N N     . LEU B 176 ? 1.0734 1.3752 0.9325 0.0000 0.0000 0.0000 173 LEU B N     
3321 C CA    . LEU B 176 ? 1.0690 1.3753 0.9365 0.0000 0.0000 0.0000 173 LEU B CA    
3322 C C     . LEU B 176 ? 1.0622 1.3822 0.9416 0.0000 0.0000 0.0000 173 LEU B C     
3323 O O     . LEU B 176 ? 1.0605 1.3851 0.9488 0.0000 0.0000 0.0000 173 LEU B O     
3324 C CB    . LEU B 176 ? 1.0717 1.3765 0.9359 0.0000 0.0000 0.0000 173 LEU B CB    
3325 C CG    . LEU B 176 ? 1.0576 1.3690 0.9277 0.0000 0.0000 0.0000 173 LEU B CG    
3326 C CD1   . LEU B 176 ? 1.0524 1.3642 0.9288 0.0000 0.0000 0.0000 173 LEU B CD1   
3327 C CD2   . LEU B 176 ? 1.0697 1.3796 0.9297 0.0000 0.0000 0.0000 173 LEU B CD2   
3328 N N     . THR B 177 ? 1.0595 1.3873 0.9417 0.0000 0.0000 0.0000 174 THR B N     
3329 C CA    . THR B 177 ? 1.0570 1.3964 0.9540 0.0000 0.0000 0.0000 174 THR B CA    
3330 C C     . THR B 177 ? 1.0648 1.4132 0.9645 0.0000 0.0000 0.0000 174 THR B C     
3331 O O     . THR B 177 ? 1.0644 1.4230 0.9771 0.0000 0.0000 0.0000 174 THR B O     
3332 C CB    . THR B 177 ? 1.0492 1.3952 0.9539 0.0000 0.0000 0.0000 174 THR B CB    
3333 O OG1   . THR B 177 ? 1.0576 1.4077 0.9545 0.0000 0.0000 0.0000 174 THR B OG1   
3334 C CG2   . THR B 177 ? 1.0448 1.3846 0.9491 0.0000 0.0000 0.0000 174 THR B CG2   
3335 N N     . SER B 178 ? 1.0814 1.4255 0.9690 0.0000 0.0000 0.0000 175 SER B N     
3336 C CA    . SER B 178 ? 1.0920 1.4447 0.9796 0.0000 0.0000 0.0000 175 SER B CA    
3337 C C     . SER B 178 ? 1.0909 1.4434 0.9891 0.0000 0.0000 0.0000 175 SER B C     
3338 O O     . SER B 178 ? 1.0934 1.4568 0.9975 0.0000 0.0000 0.0000 175 SER B O     
3339 C CB    . SER B 178 ? 1.1096 1.4556 0.9802 0.0000 0.0000 0.0000 175 SER B CB    
3340 O OG    . SER B 178 ? 1.1314 1.4793 0.9926 0.0000 0.0000 0.0000 175 SER B OG    
3341 N N     . ILE B 179 ? 1.0918 1.4348 0.9925 0.0000 0.0000 0.0000 176 ILE B N     
3342 C CA    . ILE B 179 ? 1.0947 1.4410 1.0069 0.0000 0.0000 0.0000 176 ILE B CA    
3343 C C     . ILE B 179 ? 1.0870 1.4389 1.0135 0.0000 0.0000 0.0000 176 ILE B C     
3344 O O     . ILE B 179 ? 1.0863 1.4477 1.0269 0.0000 0.0000 0.0000 176 ILE B O     
3345 C CB    . ILE B 179 ? 1.1048 1.4414 1.0128 0.0000 0.0000 0.0000 176 ILE B CB    
3346 C CG1   . ILE B 179 ? 1.1204 1.4499 1.0210 0.0000 0.0000 0.0000 176 ILE B CG1   
3347 C CG2   . ILE B 179 ? 1.0968 1.4420 1.0195 0.0000 0.0000 0.0000 176 ILE B CG2   
3348 C CD1   . ILE B 179 ? 1.1343 1.4526 1.0185 0.0000 0.0000 0.0000 176 ILE B CD1   
3349 N N     . ALA B 180 ? 1.0837 1.4292 1.0069 0.0000 0.0000 0.0000 177 ALA B N     
3350 C CA    . ALA B 180 ? 1.0829 1.4296 1.0185 0.0000 0.0000 0.0000 177 ALA B CA    
3351 C C     . ALA B 180 ? 1.0842 1.4258 1.0158 0.0000 0.0000 0.0000 177 ALA B C     
3352 O O     . ALA B 180 ? 1.0889 1.4263 1.0067 0.0000 0.0000 0.0000 177 ALA B O     
3353 C CB    . ALA B 180 ? 1.0854 1.4331 1.0240 0.0000 0.0000 0.0000 177 ALA B CB    
3354 N N     . ILE B 181 ? 1.0824 1.4238 1.0281 0.0000 0.0000 0.0000 178 ILE B N     
3355 C CA    . ILE B 181 ? 1.0842 1.4220 1.0301 0.0000 0.0000 0.0000 178 ILE B CA    
3356 C C     . ILE B 181 ? 1.0950 1.4269 1.0436 0.0000 0.0000 0.0000 178 ILE B C     
3357 O O     . ILE B 181 ? 1.1011 1.4314 1.0638 0.0000 0.0000 0.0000 178 ILE B O     
3358 C CB    . ILE B 181 ? 1.0803 1.4230 1.0429 0.0000 0.0000 0.0000 178 ILE B CB    
3359 C CG1   . ILE B 181 ? 1.0738 1.4266 1.0310 0.0000 0.0000 0.0000 178 ILE B CG1   
3360 C CG2   . ILE B 181 ? 1.0836 1.4249 1.0494 0.0000 0.0000 0.0000 178 ILE B CG2   
3361 C CD1   . ILE B 181 ? 1.0666 1.4302 1.0398 0.0000 0.0000 0.0000 178 ILE B CD1   
3362 N N     . PRO B 182 ? 1.1025 1.4319 1.0364 0.0000 0.0000 0.0000 179 PRO B N     
3363 C CA    . PRO B 182 ? 1.1143 1.4397 1.0465 0.0000 0.0000 0.0000 179 PRO B CA    
3364 C C     . PRO B 182 ? 1.1195 1.4392 1.0687 0.0000 0.0000 0.0000 179 PRO B C     
3365 O O     . PRO B 182 ? 1.1123 1.4341 1.0711 0.0000 0.0000 0.0000 179 PRO B O     
3366 C CB    . PRO B 182 ? 1.1214 1.4489 1.0306 0.0000 0.0000 0.0000 179 PRO B CB    
3367 C CG    . PRO B 182 ? 1.1125 1.4417 1.0190 0.0000 0.0000 0.0000 179 PRO B CG    
3368 C CD    . PRO B 182 ? 1.1016 1.4322 1.0186 0.0000 0.0000 0.0000 179 PRO B CD    
3369 N N     . LYS B 183 ? 1.1339 1.4468 1.0883 0.0000 0.0000 0.0000 180 LYS B N     
3370 C CA    . LYS B 183 ? 1.1451 1.4488 1.1158 0.0000 0.0000 0.0000 180 LYS B CA    
3371 C C     . LYS B 183 ? 1.1496 1.4563 1.1054 0.0000 0.0000 0.0000 180 LYS B C     
3372 O O     . LYS B 183 ? 1.1518 1.4576 1.1218 0.0000 0.0000 0.0000 180 LYS B O     
3373 C CB    . LYS B 183 ? 1.1627 1.4556 1.1419 0.0000 0.0000 0.0000 180 LYS B CB    
3374 C CG    . LYS B 183 ? 1.1817 1.4706 1.1837 0.0000 0.0000 0.0000 180 LYS B CG    
3375 C CD    . LYS B 183 ? 1.2476 1.5298 1.2524 0.0000 0.0000 0.0000 180 LYS B CD    
3376 C CE    . LYS B 183 ? 1.2728 1.5508 1.3045 0.0000 0.0000 0.0000 180 LYS B CE    
3377 N NZ    . LYS B 183 ? 1.3231 1.5902 1.3638 0.0000 0.0000 0.0000 180 LYS B NZ    
3378 N N     . VAL B 184 ? 1.1537 1.4666 1.0827 0.0000 0.0000 0.0000 181 VAL B N     
3379 C CA    . VAL B 184 ? 1.1601 1.4778 1.0723 0.0000 0.0000 0.0000 181 VAL B CA    
3380 C C     . VAL B 184 ? 1.1561 1.4836 1.0451 0.0000 0.0000 0.0000 181 VAL B C     
3381 O O     . VAL B 184 ? 1.1553 1.4853 1.0336 0.0000 0.0000 0.0000 181 VAL B O     
3382 C CB    . VAL B 184 ? 1.1818 1.4961 1.0828 0.0000 0.0000 0.0000 181 VAL B CB    
3383 C CG1   . VAL B 184 ? 1.1921 1.5152 1.0717 0.0000 0.0000 0.0000 181 VAL B CG1   
3384 C CG2   . VAL B 184 ? 1.1870 1.4871 1.1139 0.0000 0.0000 0.0000 181 VAL B CG2   
3385 N N     . ILE B 185 ? 1.1567 1.4897 1.0411 0.0000 0.0000 0.0000 182 ILE B N     
3386 C CA    . ILE B 185 ? 1.1602 1.5002 1.0227 0.0000 0.0000 0.0000 182 ILE B CA    
3387 C C     . ILE B 185 ? 1.1861 1.5331 1.0319 0.0000 0.0000 0.0000 182 ILE B C     
3388 O O     . ILE B 185 ? 1.1950 1.5439 1.0510 0.0000 0.0000 0.0000 182 ILE B O     
3389 C CB    . ILE B 185 ? 1.1422 1.4845 1.0122 0.0000 0.0000 0.0000 182 ILE B CB    
3390 C CG1   . ILE B 185 ? 1.1213 1.4588 1.0012 0.0000 0.0000 0.0000 182 ILE B CG1   
3391 C CG2   . ILE B 185 ? 1.1456 1.4923 0.9955 0.0000 0.0000 0.0000 182 ILE B CG2   
3392 C CD1   . ILE B 185 ? 1.0940 1.4348 0.9817 0.0000 0.0000 0.0000 182 ILE B CD1   
3393 N N     . HIS B 186 ? 1.2026 1.5552 1.0234 0.0000 0.0000 0.0000 183 HIS B N     
3394 C CA    . HIS B 186 ? 1.2307 1.5935 1.0304 0.0000 0.0000 0.0000 183 HIS B CA    
3395 C C     . HIS B 186 ? 1.2372 1.6065 1.0235 0.0000 0.0000 0.0000 183 HIS B C     
3396 O O     . HIS B 186 ? 1.2288 1.5938 1.0130 0.0000 0.0000 0.0000 183 HIS B O     
3397 C CB    . HIS B 186 ? 1.2498 1.6177 1.0295 0.0000 0.0000 0.0000 183 HIS B CB    
3398 C CG    . HIS B 186 ? 1.2706 1.6524 1.0227 0.0000 0.0000 0.0000 183 HIS B CG    
3399 N ND1   . HIS B 186 ? 1.2924 1.6773 1.0358 0.0000 0.0000 0.0000 183 HIS B ND1   
3400 C CD2   . HIS B 186 ? 1.2721 1.6659 1.0028 0.0000 0.0000 0.0000 183 HIS B CD2   
3401 C CE1   . HIS B 186 ? 1.3209 1.7218 1.0364 0.0000 0.0000 0.0000 183 HIS B CE1   
3402 N NE2   . HIS B 186 ? 1.3092 1.7162 1.0172 0.0000 0.0000 0.0000 183 HIS B NE2   
3403 N N     . SER B 187 ? 1.2565 1.6353 1.0357 0.0000 0.0000 0.0000 184 SER B N     
3404 C CA    . SER B 187 ? 1.2677 1.6525 1.0361 0.0000 0.0000 0.0000 184 SER B CA    
3405 C C     . SER B 187 ? 1.2934 1.6937 1.0470 0.0000 0.0000 0.0000 184 SER B C     
3406 O O     . SER B 187 ? 1.3030 1.7086 1.0591 0.0000 0.0000 0.0000 184 SER B O     
3407 C CB    . SER B 187 ? 1.2464 1.6253 1.0365 0.0000 0.0000 0.0000 184 SER B CB    
3408 O OG    . SER B 187 ? 1.2487 1.6360 1.0548 0.0000 0.0000 0.0000 184 SER B OG    
3409 N N     . ASP B 188 ? 1.3084 1.7154 1.0481 0.0000 0.0000 0.0000 185 ASP B N     
3410 C CA    . ASP B 188 ? 1.3341 1.7583 1.0620 0.0000 0.0000 0.0000 185 ASP B CA    
3411 C C     . ASP B 188 ? 1.3300 1.7579 1.0838 0.0000 0.0000 0.0000 185 ASP B C     
3412 O O     . ASP B 188 ? 1.3108 1.7284 1.0880 0.0000 0.0000 0.0000 185 ASP B O     
3413 C CB    . ASP B 188 ? 1.3483 1.7795 1.0533 0.0000 0.0000 0.0000 185 ASP B CB    
3414 C CG    . ASP B 188 ? 1.3264 1.7434 1.0434 0.0000 0.0000 0.0000 185 ASP B CG    
3415 O OD1   . ASP B 188 ? 1.3305 1.7459 1.0323 0.0000 0.0000 0.0000 185 ASP B OD1   
3416 O OD2   . ASP B 188 ? 1.2964 1.7042 1.0372 0.0000 0.0000 0.0000 185 ASP B OD2   
3417 N N     . GLN B 189 ? 1.3551 1.8007 1.1055 0.0000 0.0000 0.0000 186 GLN B N     
3418 C CA    . GLN B 189 ? 1.3525 1.8066 1.1316 0.0000 0.0000 0.0000 186 GLN B CA    
3419 C C     . GLN B 189 ? 1.3495 1.8073 1.1375 0.0000 0.0000 0.0000 186 GLN B C     
3420 O O     . GLN B 189 ? 1.3512 1.8259 1.1543 0.0000 0.0000 0.0000 186 GLN B O     
3421 C CB    . GLN B 189 ? 1.3723 1.8449 1.1498 0.0000 0.0000 0.0000 186 GLN B CB    
3422 C CG    . GLN B 189 ? 1.3898 1.8544 1.1678 0.0000 0.0000 0.0000 186 GLN B CG    
3423 C CD    . GLN B 189 ? 1.4162 1.8913 1.2170 0.0000 0.0000 0.0000 186 GLN B CD    
3424 O OE1   . GLN B 189 ? 1.4250 1.9181 1.2409 0.0000 0.0000 0.0000 186 GLN B OE1   
3425 N NE2   . GLN B 189 ? 1.4344 1.8982 1.2403 0.0000 0.0000 0.0000 186 GLN B NE2   
3426 N N     . GLY B 190 ? 1.3491 1.7907 1.1297 0.0000 0.0000 0.0000 187 GLY B N     
3427 C CA    . GLY B 190 ? 1.3518 1.7903 1.1405 0.0000 0.0000 0.0000 187 GLY B CA    
3428 C C     . GLY B 190 ? 1.3364 1.7796 1.1559 0.0000 0.0000 0.0000 187 GLY B C     
3429 O O     . GLY B 190 ? 1.3233 1.7632 1.1579 0.0000 0.0000 0.0000 187 GLY B O     
3430 N N     . ALA B 191 ? 1.3420 1.7945 1.1716 0.0000 0.0000 0.0000 188 ALA B N     
3431 C CA    . ALA B 191 ? 1.3283 1.7937 1.1878 0.0000 0.0000 0.0000 188 ALA B CA    
3432 C C     . ALA B 191 ? 1.3107 1.7618 1.1814 0.0000 0.0000 0.0000 188 ALA B C     
3433 O O     . ALA B 191 ? 1.2993 1.7628 1.1937 0.0000 0.0000 0.0000 188 ALA B O     
3434 C CB    . ALA B 191 ? 1.3344 1.8080 1.2003 0.0000 0.0000 0.0000 188 ALA B CB    
3435 N N     . ALA B 192 ? 1.3109 1.7378 1.1653 0.0000 0.0000 0.0000 189 ALA B N     
3436 C CA    . ALA B 192 ? 1.2952 1.7086 1.1572 0.0000 0.0000 0.0000 189 ALA B CA    
3437 C C     . ALA B 192 ? 1.2808 1.6950 1.1519 0.0000 0.0000 0.0000 189 ALA B C     
3438 O O     . ALA B 192 ? 1.2664 1.6819 1.1528 0.0000 0.0000 0.0000 189 ALA B O     
3439 C CB    . ALA B 192 ? 1.3030 1.6908 1.1471 0.0000 0.0000 0.0000 189 ALA B CB    
3440 N N     . PHE B 193 ? 1.2887 1.7025 1.1497 0.0000 0.0000 0.0000 190 PHE B N     
3441 C CA    . PHE B 193 ? 1.2825 1.6919 1.1508 0.0000 0.0000 0.0000 190 PHE B CA    
3442 C C     . PHE B 193 ? 1.2874 1.7133 1.1768 0.0000 0.0000 0.0000 190 PHE B C     
3443 O O     . PHE B 193 ? 1.2792 1.7021 1.1851 0.0000 0.0000 0.0000 190 PHE B O     
3444 C CB    . PHE B 193 ? 1.2911 1.6885 1.1362 0.0000 0.0000 0.0000 190 PHE B CB    
3445 C CG    . PHE B 193 ? 1.2789 1.6628 1.1047 0.0000 0.0000 0.0000 190 PHE B CG    
3446 C CD1   . PHE B 193 ? 1.2564 1.6275 1.0875 0.0000 0.0000 0.0000 190 PHE B CD1   
3447 C CD2   . PHE B 193 ? 1.2830 1.6677 1.0855 0.0000 0.0000 0.0000 190 PHE B CD2   
3448 C CE1   . PHE B 193 ? 1.2544 1.6111 1.0713 0.0000 0.0000 0.0000 190 PHE B CE1   
3449 C CE2   . PHE B 193 ? 1.2859 1.6582 1.0748 0.0000 0.0000 0.0000 190 PHE B CE2   
3450 C CZ    . PHE B 193 ? 1.2699 1.6268 1.0676 0.0000 0.0000 0.0000 190 PHE B CZ    
3451 N N     . THR B 194 ? 1.3031 1.7462 1.1940 0.0000 0.0000 0.0000 191 THR B N     
3452 C CA    . THR B 194 ? 1.3116 1.7724 1.2251 0.0000 0.0000 0.0000 191 THR B CA    
3453 C C     . THR B 194 ? 1.3001 1.7777 1.2471 0.0000 0.0000 0.0000 191 THR B C     
3454 O O     . THR B 194 ? 1.3037 1.7916 1.2776 0.0000 0.0000 0.0000 191 THR B O     
3455 C CB    . THR B 194 ? 1.3294 1.8058 1.2313 0.0000 0.0000 0.0000 191 THR B CB    
3456 O OG1   . THR B 194 ? 1.3341 1.8165 1.2249 0.0000 0.0000 0.0000 191 THR B OG1   
3457 C CG2   . THR B 194 ? 1.3465 1.8120 1.2194 0.0000 0.0000 0.0000 191 THR B CG2   
3458 N N     . SER B 195 ? 1.2929 1.7732 1.2392 0.0000 0.0000 0.0000 192 SER B N     
3459 C CA    . SER B 195 ? 1.2791 1.7791 1.2539 0.0000 0.0000 0.0000 192 SER B CA    
3460 C C     . SER B 195 ? 1.2650 1.7651 1.2628 0.0000 0.0000 0.0000 192 SER B C     
3461 O O     . SER B 195 ? 1.2638 1.7423 1.2517 0.0000 0.0000 0.0000 192 SER B O     
3462 C CB    . SER B 195 ? 1.2759 1.7704 1.2397 0.0000 0.0000 0.0000 192 SER B CB    
3463 O OG    . SER B 195 ? 1.2746 1.7510 1.2316 0.0000 0.0000 0.0000 192 SER B OG    
3464 N N     . SER B 196 ? 1.2522 1.7785 1.2824 0.0000 0.0000 0.0000 193 SER B N     
3465 C CA    . SER B 196 ? 1.2370 1.7677 1.2943 0.0000 0.0000 0.0000 193 SER B CA    
3466 C C     . SER B 196 ? 1.2163 1.7387 1.2659 0.0000 0.0000 0.0000 193 SER B C     
3467 O O     . SER B 196 ? 1.2106 1.7263 1.2719 0.0000 0.0000 0.0000 193 SER B O     
3468 C CB    . SER B 196 ? 1.2352 1.8004 1.3322 0.0000 0.0000 0.0000 193 SER B CB    
3469 O OG    . SER B 196 ? 1.2486 1.8363 1.3447 0.0000 0.0000 0.0000 193 SER B OG    
3470 N N     . THR B 197 ? 1.2058 1.7282 1.2362 0.0000 0.0000 0.0000 194 THR B N     
3471 C CA    . THR B 197 ? 1.1938 1.7062 1.2113 0.0000 0.0000 0.0000 194 THR B CA    
3472 C C     . THR B 197 ? 1.1894 1.6701 1.1858 0.0000 0.0000 0.0000 194 THR B C     
3473 O O     . THR B 197 ? 1.1831 1.6586 1.1833 0.0000 0.0000 0.0000 194 THR B O     
3474 C CB    . THR B 197 ? 1.1983 1.7122 1.1981 0.0000 0.0000 0.0000 194 THR B CB    
3475 O OG1   . THR B 197 ? 1.2046 1.7478 1.2226 0.0000 0.0000 0.0000 194 THR B OG1   
3476 C CG2   . THR B 197 ? 1.1914 1.7052 1.1850 0.0000 0.0000 0.0000 194 THR B CG2   
3477 N N     . PHE B 198 ? 1.1909 1.6534 1.1659 0.0000 0.0000 0.0000 195 PHE B N     
3478 C CA    . PHE B 198 ? 1.1861 1.6230 1.1431 0.0000 0.0000 0.0000 195 PHE B CA    
3479 C C     . PHE B 198 ? 1.1837 1.6198 1.1598 0.0000 0.0000 0.0000 195 PHE B C     
3480 O O     . PHE B 198 ? 1.1784 1.6027 1.1552 0.0000 0.0000 0.0000 195 PHE B O     
3481 C CB    . PHE B 198 ? 1.1974 1.6205 1.1295 0.0000 0.0000 0.0000 195 PHE B CB    
3482 C CG    . PHE B 198 ? 1.1932 1.5934 1.1060 0.0000 0.0000 0.0000 195 PHE B CG    
3483 C CD1   . PHE B 198 ? 1.1798 1.5673 1.0808 0.0000 0.0000 0.0000 195 PHE B CD1   
3484 C CD2   . PHE B 198 ? 1.1843 1.5774 1.0916 0.0000 0.0000 0.0000 195 PHE B CD2   
3485 C CE1   . PHE B 198 ? 1.1574 1.5280 1.0450 0.0000 0.0000 0.0000 195 PHE B CE1   
3486 C CE2   . PHE B 198 ? 1.1682 1.5450 1.0603 0.0000 0.0000 0.0000 195 PHE B CE2   
3487 C CZ    . PHE B 198 ? 1.1566 1.5233 1.0405 0.0000 0.0000 0.0000 195 PHE B CZ    
3488 N N     . ALA B 199 ? 1.1909 1.6397 1.1847 0.0000 0.0000 0.0000 196 ALA B N     
3489 C CA    . ALA B 199 ? 1.1985 1.6444 1.2148 0.0000 0.0000 0.0000 196 ALA B CA    
3490 C C     . ALA B 199 ? 1.1909 1.6405 1.2300 0.0000 0.0000 0.0000 196 ALA B C     
3491 O O     . ALA B 199 ? 1.1930 1.6270 1.2393 0.0000 0.0000 0.0000 196 ALA B O     
3492 C CB    . ALA B 199 ? 1.2088 1.6719 1.2460 0.0000 0.0000 0.0000 196 ALA B CB    
3493 N N     . GLU B 200 ? 1.1846 1.6560 1.2345 0.0000 0.0000 0.0000 197 GLU B N     
3494 C CA    . GLU B 200 ? 1.1764 1.6574 1.2448 0.0000 0.0000 0.0000 197 GLU B CA    
3495 C C     . GLU B 200 ? 1.1716 1.6355 1.2166 0.0000 0.0000 0.0000 197 GLU B C     
3496 O O     . GLU B 200 ? 1.1704 1.6276 1.2259 0.0000 0.0000 0.0000 197 GLU B O     
3497 C CB    . GLU B 200 ? 1.1692 1.6840 1.2544 0.0000 0.0000 0.0000 197 GLU B CB    
3498 N N     . TRP B 201 ? 1.1710 1.6277 1.1865 0.0000 0.0000 0.0000 198 TRP B N     
3499 C CA    . TRP B 201 ? 1.1691 1.6085 1.1620 0.0000 0.0000 0.0000 198 TRP B CA    
3500 C C     . TRP B 201 ? 1.1728 1.5922 1.1671 0.0000 0.0000 0.0000 198 TRP B C     
3501 O O     . TRP B 201 ? 1.1708 1.5858 1.1659 0.0000 0.0000 0.0000 198 TRP B O     
3502 C CB    . TRP B 201 ? 1.1730 1.6005 1.1372 0.0000 0.0000 0.0000 198 TRP B CB    
3503 C CG    . TRP B 201 ? 1.1662 1.5761 1.1102 0.0000 0.0000 0.0000 198 TRP B CG    
3504 C CD1   . TRP B 201 ? 1.1635 1.5764 1.0983 0.0000 0.0000 0.0000 198 TRP B CD1   
3505 C CD2   . TRP B 201 ? 1.1663 1.5554 1.0981 0.0000 0.0000 0.0000 198 TRP B CD2   
3506 N NE1   . TRP B 201 ? 1.1640 1.5584 1.0833 0.0000 0.0000 0.0000 198 TRP B NE1   
3507 C CE2   . TRP B 201 ? 1.1661 1.5470 1.0848 0.0000 0.0000 0.0000 198 TRP B CE2   
3508 C CE3   . TRP B 201 ? 1.1696 1.5485 1.1002 0.0000 0.0000 0.0000 198 TRP B CE3   
3509 C CZ2   . TRP B 201 ? 1.1659 1.5303 1.0740 0.0000 0.0000 0.0000 198 TRP B CZ2   
3510 C CZ3   . TRP B 201 ? 1.1703 1.5336 1.0878 0.0000 0.0000 0.0000 198 TRP B CZ3   
3511 C CH2   . TRP B 201 ? 1.1624 1.5194 1.0708 0.0000 0.0000 0.0000 198 TRP B CH2   
3512 N N     . ALA B 202 ? 1.1822 1.5911 1.1762 0.0000 0.0000 0.0000 199 ALA B N     
3513 C CA    . ALA B 202 ? 1.1922 1.5820 1.1847 0.0000 0.0000 0.0000 199 ALA B CA    
3514 C C     . ALA B 202 ? 1.1993 1.5890 1.2217 0.0000 0.0000 0.0000 199 ALA B C     
3515 O O     . ALA B 202 ? 1.2008 1.5782 1.2255 0.0000 0.0000 0.0000 199 ALA B O     
3516 C CB    . ALA B 202 ? 1.2028 1.5836 1.1821 0.0000 0.0000 0.0000 199 ALA B CB    
3517 N N     . LYS B 203 ? 1.2092 1.6133 1.2573 0.0000 0.0000 0.0000 200 LYS B N     
3518 C CA    . LYS B 203 ? 1.2221 1.6260 1.3040 0.0000 0.0000 0.0000 200 LYS B CA    
3519 C C     . LYS B 203 ? 1.2148 1.6262 1.3029 0.0000 0.0000 0.0000 200 LYS B C     
3520 O O     . LYS B 203 ? 1.2172 1.6173 1.3209 0.0000 0.0000 0.0000 200 LYS B O     
3521 C CB    . LYS B 203 ? 1.2282 1.6499 1.3401 0.0000 0.0000 0.0000 200 LYS B CB    
3522 C CG    . LYS B 203 ? 1.2568 1.6723 1.4076 0.0000 0.0000 0.0000 200 LYS B CG    
3523 C CD    . LYS B 203 ? 1.2933 1.7297 1.4791 0.0000 0.0000 0.0000 200 LYS B CD    
3524 C CE    . LYS B 203 ? 1.3297 1.7505 1.5541 0.0000 0.0000 0.0000 200 LYS B CE    
3525 N NZ    . LYS B 203 ? 1.3525 1.7875 1.6097 0.0000 0.0000 0.0000 200 LYS B NZ    
3526 N N     . GLU B 204 ? 1.2120 1.6423 1.2871 0.0000 0.0000 0.0000 201 GLU B N     
3527 C CA    . GLU B 204 ? 1.2157 1.6565 1.2887 0.0000 0.0000 0.0000 201 GLU B CA    
3528 C C     . GLU B 204 ? 1.2136 1.6340 1.2727 0.0000 0.0000 0.0000 201 GLU B C     
3529 O O     . GLU B 204 ? 1.2170 1.6382 1.2901 0.0000 0.0000 0.0000 201 GLU B O     
3530 C CB    . GLU B 204 ? 1.2158 1.6742 1.2669 0.0000 0.0000 0.0000 201 GLU B CB    
3531 C CG    . GLU B 204 ? 1.2526 1.7427 1.3219 0.0000 0.0000 0.0000 201 GLU B CG    
3532 C CD    . GLU B 204 ? 1.3034 1.8066 1.3495 0.0000 0.0000 0.0000 201 GLU B CD    
3533 O OE1   . GLU B 204 ? 1.3250 1.8115 1.3410 0.0000 0.0000 0.0000 201 GLU B OE1   
3534 O OE2   . GLU B 204 ? 1.3118 1.8424 1.3725 0.0000 0.0000 0.0000 201 GLU B OE2   
3535 N N     . ARG B 205 ? 1.2097 1.6138 1.2432 0.0000 0.0000 0.0000 202 ARG B N     
3536 C CA    . ARG B 205 ? 1.2057 1.5946 1.2266 0.0000 0.0000 0.0000 202 ARG B CA    
3537 C C     . ARG B 205 ? 1.2131 1.5836 1.2478 0.0000 0.0000 0.0000 202 ARG B C     
3538 O O     . ARG B 205 ? 1.2140 1.5735 1.2417 0.0000 0.0000 0.0000 202 ARG B O     
3539 C CB    . ARG B 205 ? 1.2036 1.5857 1.1936 0.0000 0.0000 0.0000 202 ARG B CB    
3540 C CG    . ARG B 205 ? 1.1969 1.5926 1.1736 0.0000 0.0000 0.0000 202 ARG B CG    
3541 C CD    . ARG B 205 ? 1.2056 1.5946 1.1580 0.0000 0.0000 0.0000 202 ARG B CD    
3542 N NE    . ARG B 205 ? 1.2062 1.6057 1.1455 0.0000 0.0000 0.0000 202 ARG B NE    
3543 C CZ    . ARG B 205 ? 1.2097 1.6266 1.1564 0.0000 0.0000 0.0000 202 ARG B CZ    
3544 N NH1   . ARG B 205 ? 1.2050 1.6316 1.1745 0.0000 0.0000 0.0000 202 ARG B NH1   
3545 N NH2   . ARG B 205 ? 1.2140 1.6392 1.1467 0.0000 0.0000 0.0000 202 ARG B NH2   
3546 N N     . GLY B 206 ? 1.2207 1.5883 1.2761 0.0000 0.0000 0.0000 203 GLY B N     
3547 C CA    . GLY B 206 ? 1.2341 1.5819 1.3029 0.0000 0.0000 0.0000 203 GLY B CA    
3548 C C     . GLY B 206 ? 1.2417 1.5763 1.2855 0.0000 0.0000 0.0000 203 GLY B C     
3549 O O     . GLY B 206 ? 1.2506 1.5706 1.2953 0.0000 0.0000 0.0000 203 GLY B O     
3550 N N     . ILE B 207 ? 1.2392 1.5807 1.2608 0.0000 0.0000 0.0000 204 ILE B N     
3551 C CA    . ILE B 207 ? 1.2473 1.5808 1.2441 0.0000 0.0000 0.0000 204 ILE B CA    
3552 C C     . ILE B 207 ? 1.2669 1.5990 1.2677 0.0000 0.0000 0.0000 204 ILE B C     
3553 O O     . ILE B 207 ? 1.2666 1.6109 1.2741 0.0000 0.0000 0.0000 204 ILE B O     
3554 C CB    . ILE B 207 ? 1.2365 1.5778 1.2067 0.0000 0.0000 0.0000 204 ILE B CB    
3555 C CG1   . ILE B 207 ? 1.2212 1.5636 1.1861 0.0000 0.0000 0.0000 204 ILE B CG1   
3556 C CG2   . ILE B 207 ? 1.2461 1.5821 1.1922 0.0000 0.0000 0.0000 204 ILE B CG2   
3557 C CD1   . ILE B 207 ? 1.2122 1.5593 1.1561 0.0000 0.0000 0.0000 204 ILE B CD1   
3558 N N     . HIS B 208 ? 1.2905 1.6097 1.2873 0.0000 0.0000 0.0000 205 HIS B N     
3559 C CA    . HIS B 208 ? 1.3186 1.6374 1.3122 0.0000 0.0000 0.0000 205 HIS B CA    
3560 C C     . HIS B 208 ? 1.3208 1.6494 1.2809 0.0000 0.0000 0.0000 205 HIS B C     
3561 O O     . HIS B 208 ? 1.3196 1.6472 1.2573 0.0000 0.0000 0.0000 205 HIS B O     
3562 C CB    . HIS B 208 ? 1.3466 1.6477 1.3466 0.0000 0.0000 0.0000 205 HIS B CB    
3563 C CG    . HIS B 208 ? 1.3898 1.6901 1.3868 0.0000 0.0000 0.0000 205 HIS B CG    
3564 N ND1   . HIS B 208 ? 1.4209 1.7230 1.3860 0.0000 0.0000 0.0000 205 HIS B ND1   
3565 C CD2   . HIS B 208 ? 1.4150 1.7152 1.4373 0.0000 0.0000 0.0000 205 HIS B CD2   
3566 C CE1   . HIS B 208 ? 1.4464 1.7490 1.4147 0.0000 0.0000 0.0000 205 HIS B CE1   
3567 N NE2   . HIS B 208 ? 1.4499 1.7507 1.4544 0.0000 0.0000 0.0000 205 HIS B NE2   
3568 N N     . LEU B 209 ? 1.3273 1.6668 1.2866 0.0000 0.0000 0.0000 206 LEU B N     
3569 C CA    . LEU B 209 ? 1.3319 1.6814 1.2617 0.0000 0.0000 0.0000 206 LEU B CA    
3570 C C     . LEU B 209 ? 1.3613 1.7098 1.2739 0.0000 0.0000 0.0000 206 LEU B C     
3571 O O     . LEU B 209 ? 1.3762 1.7220 1.3047 0.0000 0.0000 0.0000 206 LEU B O     
3572 C CB    . LEU B 209 ? 1.3202 1.6859 1.2573 0.0000 0.0000 0.0000 206 LEU B CB    
3573 C CG    . LEU B 209 ? 1.2902 1.6610 1.2328 0.0000 0.0000 0.0000 206 LEU B CG    
3574 C CD1   . LEU B 209 ? 1.2800 1.6683 1.2256 0.0000 0.0000 0.0000 206 LEU B CD1   
3575 C CD2   . LEU B 209 ? 1.2881 1.6506 1.2066 0.0000 0.0000 0.0000 206 LEU B CD2   
3576 N N     . GLU B 210 ? 1.3725 1.7245 1.2529 0.0000 0.0000 0.0000 207 GLU B N     
3577 C CA    . GLU B 210 ? 1.4038 1.7588 1.2607 0.0000 0.0000 0.0000 207 GLU B CA    
3578 C C     . GLU B 210 ? 1.4126 1.7836 1.2425 0.0000 0.0000 0.0000 207 GLU B C     
3579 O O     . GLU B 210 ? 1.4005 1.7744 1.2199 0.0000 0.0000 0.0000 207 GLU B O     
3580 C CB    . GLU B 210 ? 1.4120 1.7585 1.2549 0.0000 0.0000 0.0000 207 GLU B CB    
3581 C CG    . GLU B 210 ? 1.4517 1.8031 1.2682 0.0000 0.0000 0.0000 207 GLU B CG    
3582 C CD    . GLU B 210 ? 1.4745 1.8203 1.2801 0.0000 0.0000 0.0000 207 GLU B CD    
3583 O OE1   . GLU B 210 ? 1.4742 1.8043 1.3026 0.0000 0.0000 0.0000 207 GLU B OE1   
3584 O OE2   . GLU B 210 ? 1.4895 1.8484 1.2655 0.0000 0.0000 0.0000 207 GLU B OE2   
3585 N N     . PHE B 211 ? 1.4387 1.8195 1.2581 0.0000 0.0000 0.0000 208 PHE B N     
3586 C CA    . PHE B 211 ? 1.4519 1.8500 1.2481 0.0000 0.0000 0.0000 208 PHE B CA    
3587 C C     . PHE B 211 ? 1.4881 1.8955 1.2500 0.0000 0.0000 0.0000 208 PHE B C     
3588 O O     . PHE B 211 ? 1.5113 1.9165 1.2726 0.0000 0.0000 0.0000 208 PHE B O     
3589 C CB    . PHE B 211 ? 1.4482 1.8578 1.2644 0.0000 0.0000 0.0000 208 PHE B CB    
3590 C CG    . PHE B 211 ? 1.4240 1.8309 1.2706 0.0000 0.0000 0.0000 208 PHE B CG    
3591 C CD1   . PHE B 211 ? 1.4172 1.8290 1.2585 0.0000 0.0000 0.0000 208 PHE B CD1   
3592 C CD2   . PHE B 211 ? 1.4215 1.8213 1.3020 0.0000 0.0000 0.0000 208 PHE B CD2   
3593 C CE1   . PHE B 211 ? 1.3950 1.8063 1.2611 0.0000 0.0000 0.0000 208 PHE B CE1   
3594 C CE2   . PHE B 211 ? 1.4001 1.8020 1.3062 0.0000 0.0000 0.0000 208 PHE B CE2   
3595 C CZ    . PHE B 211 ? 1.3861 1.7946 1.2833 0.0000 0.0000 0.0000 208 PHE B CZ    
3596 N N     . SER B 212 ? 1.4984 1.9164 1.2319 0.0000 0.0000 0.0000 209 SER B N     
3597 C CA    . SER B 212 ? 1.5366 1.9713 1.2341 0.0000 0.0000 0.0000 209 SER B CA    
3598 C C     . SER B 212 ? 1.5556 2.0053 1.2527 0.0000 0.0000 0.0000 209 SER B C     
3599 O O     . SER B 212 ? 1.5344 1.9852 1.2556 0.0000 0.0000 0.0000 209 SER B O     
3600 C CB    . SER B 212 ? 1.5380 1.9815 1.2100 0.0000 0.0000 0.0000 209 SER B CB    
3601 O OG    . SER B 212 ? 1.5056 1.9474 1.1895 0.0000 0.0000 0.0000 209 SER B OG    
3602 N N     . THR B 213 ? 1.5986 2.0622 1.2694 0.0000 0.0000 0.0000 210 THR B N     
3603 C CA    . THR B 213 ? 1.6226 2.1048 1.2907 0.0000 0.0000 0.0000 210 THR B CA    
3604 C C     . THR B 213 ? 1.6276 2.1271 1.2772 0.0000 0.0000 0.0000 210 THR B C     
3605 O O     . THR B 213 ? 1.6270 2.1262 1.2564 0.0000 0.0000 0.0000 210 THR B O     
3606 C CB    . THR B 213 ? 1.6645 2.1576 1.3085 0.0000 0.0000 0.0000 210 THR B CB    
3607 O OG1   . THR B 213 ? 1.7001 2.2068 1.2990 0.0000 0.0000 0.0000 210 THR B OG1   
3608 C CG2   . THR B 213 ? 1.6688 2.1400 1.3346 0.0000 0.0000 0.0000 210 THR B CG2   
3609 N N     . PRO B 214 ? 1.6362 2.1506 1.2963 0.0000 0.0000 0.0000 211 PRO B N     
3610 C CA    . PRO B 214 ? 1.6445 2.1731 1.2908 0.0000 0.0000 0.0000 211 PRO B CA    
3611 C C     . PRO B 214 ? 1.6839 2.2290 1.2842 0.0000 0.0000 0.0000 211 PRO B C     
3612 O O     . PRO B 214 ? 1.7173 2.2780 1.2926 0.0000 0.0000 0.0000 211 PRO B O     
3613 C CB    . PRO B 214 ? 1.6481 2.1949 1.3121 0.0000 0.0000 0.0000 211 PRO B CB    
3614 C CG    . PRO B 214 ? 1.6239 2.1587 1.3266 0.0000 0.0000 0.0000 211 PRO B CG    
3615 C CD    . PRO B 214 ? 1.6336 2.1517 1.3254 0.0000 0.0000 0.0000 211 PRO B CD    
3616 N N     . TYR B 215 ? 1.6843 2.2259 1.2746 0.0000 0.0000 0.0000 212 TYR B N     
3617 C CA    . TYR B 215 ? 1.7219 2.2817 1.2725 0.0000 0.0000 0.0000 212 TYR B CA    
3618 C C     . TYR B 215 ? 1.7437 2.3069 1.2664 0.0000 0.0000 0.0000 212 TYR B C     
3619 O O     . TYR B 215 ? 1.7707 2.3503 1.2622 0.0000 0.0000 0.0000 212 TYR B O     
3620 C CB    . TYR B 215 ? 1.7548 2.3436 1.2852 0.0000 0.0000 0.0000 212 TYR B CB    
3621 C CG    . TYR B 215 ? 1.7520 2.3421 1.3126 0.0000 0.0000 0.0000 212 TYR B CG    
3622 C CD1   . TYR B 215 ? 1.7527 2.3389 1.3215 0.0000 0.0000 0.0000 212 TYR B CD1   
3623 C CD2   . TYR B 215 ? 1.7627 2.3590 1.3449 0.0000 0.0000 0.0000 212 TYR B CD2   
3624 C CE1   . TYR B 215 ? 1.7518 2.3429 1.3458 0.0000 0.0000 0.0000 212 TYR B CE1   
3625 C CE2   . TYR B 215 ? 1.7609 2.3638 1.3721 0.0000 0.0000 0.0000 212 TYR B CE2   
3626 C CZ    . TYR B 215 ? 1.7555 2.3565 1.3717 0.0000 0.0000 0.0000 212 TYR B CZ    
3627 O OH    . TYR B 215 ? 1.7553 2.3654 1.3992 0.0000 0.0000 0.0000 212 TYR B OH    
3628 N N     . HIS B 216 ? 1.7389 2.2880 1.2739 0.0000 0.0000 0.0000 213 HIS B N     
3629 C CA    . HIS B 216 ? 1.7566 2.3064 1.2704 0.0000 0.0000 0.0000 213 HIS B CA    
3630 C C     . HIS B 216 ? 1.7226 2.2455 1.2661 0.0000 0.0000 0.0000 213 HIS B C     
3631 O O     . HIS B 216 ? 1.7120 2.2188 1.2747 0.0000 0.0000 0.0000 213 HIS B O     
3632 C CB    . HIS B 216 ? 1.7889 2.3472 1.2852 0.0000 0.0000 0.0000 213 HIS B CB    
3633 N N     . PRO B 217 ? 1.7060 2.2239 1.2547 0.0000 0.0000 0.0000 214 PRO B N     
3634 C CA    . PRO B 217 ? 1.6731 2.1668 1.2522 0.0000 0.0000 0.0000 214 PRO B CA    
3635 C C     . PRO B 217 ? 1.6786 2.1705 1.2528 0.0000 0.0000 0.0000 214 PRO B C     
3636 O O     . PRO B 217 ? 1.6803 2.1780 1.2470 0.0000 0.0000 0.0000 214 PRO B O     
3637 C CB    . PRO B 217 ? 1.6612 2.1524 1.2440 0.0000 0.0000 0.0000 214 PRO B CB    
3638 C CG    . PRO B 217 ? 1.6855 2.1981 1.2432 0.0000 0.0000 0.0000 214 PRO B CG    
3639 C CD    . PRO B 217 ? 1.7190 2.2534 1.2465 0.0000 0.0000 0.0000 214 PRO B CD    
3640 N N     . GLN B 218 ? 1.6836 2.1673 1.2649 0.0000 0.0000 0.0000 215 GLN B N     
3641 C CA    . GLN B 218 ? 1.6861 2.1656 1.2677 0.0000 0.0000 0.0000 215 GLN B CA    
3642 C C     . GLN B 218 ? 1.6464 2.1046 1.2627 0.0000 0.0000 0.0000 215 GLN B C     
3643 O O     . GLN B 218 ? 1.6225 2.0615 1.2688 0.0000 0.0000 0.0000 215 GLN B O     
3644 C CB    . GLN B 218 ? 1.7088 2.1837 1.2871 0.0000 0.0000 0.0000 215 GLN B CB    
3645 N N     . SER B 219 ? 1.6384 2.1038 1.2499 0.0000 0.0000 0.0000 216 SER B N     
3646 C CA    . SER B 219 ? 1.6002 2.0509 1.2403 0.0000 0.0000 0.0000 216 SER B CA    
3647 C C     . SER B 219 ? 1.6108 2.0784 1.2383 0.0000 0.0000 0.0000 216 SER B C     
3648 O O     . SER B 219 ? 1.6461 2.1362 1.2425 0.0000 0.0000 0.0000 216 SER B O     
3649 C CB    . SER B 219 ? 1.5745 2.0172 1.2290 0.0000 0.0000 0.0000 216 SER B CB    
3650 O OG    . SER B 219 ? 1.5848 2.0446 1.2184 0.0000 0.0000 0.0000 216 SER B OG    
3651 N N     . SER B 220 ? 1.5807 2.0412 1.2318 0.0000 0.0000 0.0000 217 SER B N     
3652 C CA    . SER B 220 ? 1.5854 2.0633 1.2316 0.0000 0.0000 0.0000 217 SER B CA    
3653 C C     . SER B 220 ? 1.5957 2.1028 1.2197 0.0000 0.0000 0.0000 217 SER B C     
3654 O O     . SER B 220 ? 1.5883 2.0949 1.2133 0.0000 0.0000 0.0000 217 SER B O     
3655 C CB    . SER B 220 ? 1.5580 2.0222 1.2390 0.0000 0.0000 0.0000 217 SER B CB    
3656 O OG    . SER B 220 ? 1.5766 2.0610 1.2572 0.0000 0.0000 0.0000 217 SER B OG    
3657 N N     . GLY B 221 ? 1.6117 2.1442 1.2168 0.0000 0.0000 0.0000 218 GLY B N     
3658 C CA    . GLY B 221 ? 1.6147 2.1802 1.2011 0.0000 0.0000 0.0000 218 GLY B CA    
3659 C C     . GLY B 221 ? 1.5773 2.1395 1.1922 0.0000 0.0000 0.0000 218 GLY B C     
3660 O O     . GLY B 221 ? 1.5768 2.1444 1.1871 0.0000 0.0000 0.0000 218 GLY B O     
3661 N N     . LYS B 222 ? 1.5456 2.0970 1.1913 0.0000 0.0000 0.0000 219 LYS B N     
3662 C CA    . LYS B 222 ? 1.5100 2.0541 1.1871 0.0000 0.0000 0.0000 219 LYS B CA    
3663 C C     . LYS B 222 ? 1.4831 2.0002 1.1704 0.0000 0.0000 0.0000 219 LYS B C     
3664 O O     . LYS B 222 ? 1.4721 1.9889 1.1722 0.0000 0.0000 0.0000 219 LYS B O     
3665 C CB    . LYS B 222 ? 1.4900 2.0245 1.1971 0.0000 0.0000 0.0000 219 LYS B CB    
3666 C CG    . LYS B 222 ? 1.4589 1.9868 1.1995 0.0000 0.0000 0.0000 219 LYS B CG    
3667 C CD    . LYS B 222 ? 1.4426 1.9650 1.2095 0.0000 0.0000 0.0000 219 LYS B CD    
3668 C CE    . LYS B 222 ? 1.4225 1.9416 1.2218 0.0000 0.0000 0.0000 219 LYS B CE    
3669 N NZ    . LYS B 222 ? 1.4275 1.9800 1.2376 0.0000 0.0000 0.0000 219 LYS B NZ    
3670 N N     . VAL B 223 ? 1.4704 1.9654 1.1537 0.0000 0.0000 0.0000 220 VAL B N     
3671 C CA    . VAL B 223 ? 1.4485 1.9190 1.1420 0.0000 0.0000 0.0000 220 VAL B CA    
3672 C C     . VAL B 223 ? 1.4653 1.9438 1.1378 0.0000 0.0000 0.0000 220 VAL B C     
3673 O O     . VAL B 223 ? 1.4584 1.9250 1.1426 0.0000 0.0000 0.0000 220 VAL B O     
3674 C CB    . VAL B 223 ? 1.4345 1.8825 1.1353 0.0000 0.0000 0.0000 220 VAL B CB    
3675 C CG1   . VAL B 223 ? 1.4204 1.8510 1.1242 0.0000 0.0000 0.0000 220 VAL B CG1   
3676 C CG2   . VAL B 223 ? 1.4085 1.8433 1.1371 0.0000 0.0000 0.0000 220 VAL B CG2   
3677 N N     . GLU B 224 ? 1.4885 1.9867 1.1303 0.0000 0.0000 0.0000 221 GLU B N     
3678 C CA    . GLU B 224 ? 1.5029 2.0137 1.1214 0.0000 0.0000 0.0000 221 GLU B CA    
3679 C C     . GLU B 224 ? 1.5027 2.0232 1.1297 0.0000 0.0000 0.0000 221 GLU B C     
3680 O O     . GLU B 224 ? 1.4979 2.0055 1.1318 0.0000 0.0000 0.0000 221 GLU B O     
3681 C CB    . GLU B 224 ? 1.5327 2.0708 1.1143 0.0000 0.0000 0.0000 221 GLU B CB    
3682 N N     . ARG B 225 ? 1.5038 2.0462 1.1339 0.0000 0.0000 0.0000 222 ARG B N     
3683 C CA    . ARG B 225 ? 1.5062 2.0610 1.1504 0.0000 0.0000 0.0000 222 ARG B CA    
3684 C C     . ARG B 225 ? 1.4808 2.0031 1.1595 0.0000 0.0000 0.0000 222 ARG B C     
3685 O O     . ARG B 225 ? 1.4874 2.0000 1.1709 0.0000 0.0000 0.0000 222 ARG B O     
3686 C CB    . ARG B 225 ? 1.4704 2.0563 1.1174 0.0000 0.0000 0.0000 222 ARG B CB    
3687 N N     . LYS B 226 ? 1.4566 1.9612 1.1584 0.0000 0.0000 0.0000 223 LYS B N     
3688 C CA    . LYS B 226 ? 1.4366 1.9112 1.1678 0.0000 0.0000 0.0000 223 LYS B CA    
3689 C C     . LYS B 226 ? 1.4407 1.8902 1.1665 0.0000 0.0000 0.0000 223 LYS B C     
3690 O O     . LYS B 226 ? 1.4403 1.8723 1.1814 0.0000 0.0000 0.0000 223 LYS B O     
3691 C CB    . LYS B 226 ? 1.4061 1.8665 1.1577 0.0000 0.0000 0.0000 223 LYS B CB    
3692 C CG    . LYS B 226 ? 1.3838 1.8213 1.1647 0.0000 0.0000 0.0000 223 LYS B CG    
3693 C CD    . LYS B 226 ? 1.4013 1.8527 1.2006 0.0000 0.0000 0.0000 223 LYS B CD    
3694 C CE    . LYS B 226 ? 1.3958 1.8525 1.2224 0.0000 0.0000 0.0000 223 LYS B CE    
3695 N NZ    . LYS B 226 ? 1.3863 1.8126 1.2330 0.0000 0.0000 0.0000 223 LYS B NZ    
3696 N N     . ASN B 227 ? 1.4495 1.8978 1.1549 0.0000 0.0000 0.0000 224 ASN B N     
3697 C CA    . ASN B 227 ? 1.4564 1.8855 1.1570 0.0000 0.0000 0.0000 224 ASN B CA    
3698 C C     . ASN B 227 ? 1.4841 1.9203 1.1734 0.0000 0.0000 0.0000 224 ASN B C     
3699 O O     . ASN B 227 ? 1.4877 1.9026 1.1841 0.0000 0.0000 0.0000 224 ASN B O     
3700 C CB    . ASN B 227 ? 1.4546 1.8856 1.1391 0.0000 0.0000 0.0000 224 ASN B CB    
3701 C CG    . ASN B 227 ? 1.4406 1.8458 1.1394 0.0000 0.0000 0.0000 224 ASN B CG    
3702 O OD1   . ASN B 227 ? 1.4543 1.8498 1.1511 0.0000 0.0000 0.0000 224 ASN B OD1   
3703 N ND2   . ASN B 227 ? 1.4148 1.8102 1.1290 0.0000 0.0000 0.0000 224 ASN B ND2   
3704 N N     . SER B 228 ? 1.5064 1.9733 1.1787 0.0000 0.0000 0.0000 225 SER B N     
3705 C CA    . SER B 228 ? 1.5353 2.0133 1.1987 0.0000 0.0000 0.0000 225 SER B CA    
3706 C C     . SER B 228 ? 1.5352 1.9978 1.2289 0.0000 0.0000 0.0000 225 SER B C     
3707 O O     . SER B 228 ? 1.5479 1.9920 1.2492 0.0000 0.0000 0.0000 225 SER B O     
3708 C CB    . SER B 228 ? 1.5620 2.0821 1.1975 0.0000 0.0000 0.0000 225 SER B CB    
3709 O OG    . SER B 228 ? 1.5821 2.1169 1.2154 0.0000 0.0000 0.0000 225 SER B OG    
3710 N N     . ASP B 229 ? 1.5231 1.9924 1.2359 0.0000 0.0000 0.0000 226 ASP B N     
3711 C CA    . ASP B 229 ? 1.5243 1.9817 1.2692 0.0000 0.0000 0.0000 226 ASP B CA    
3712 C C     . ASP B 229 ? 1.5178 1.9319 1.2816 0.0000 0.0000 0.0000 226 ASP B C     
3713 O O     . ASP B 229 ? 1.5335 1.9328 1.3131 0.0000 0.0000 0.0000 226 ASP B O     
3714 C CB    . ASP B 229 ? 1.5069 1.9748 1.2717 0.0000 0.0000 0.0000 226 ASP B CB    
3715 C CG    . ASP B 229 ? 1.5241 2.0356 1.2738 0.0000 0.0000 0.0000 226 ASP B CG    
3716 O OD1   . ASP B 229 ? 1.5684 2.1046 1.2937 0.0000 0.0000 0.0000 226 ASP B OD1   
3717 O OD2   . ASP B 229 ? 1.5058 2.0281 1.2677 0.0000 0.0000 0.0000 226 ASP B OD2   
3718 N N     . ILE B 230 ? 1.4974 1.8921 1.2603 0.0000 0.0000 0.0000 227 ILE B N     
3719 C CA    . ILE B 230 ? 1.4902 1.8467 1.2671 0.0000 0.0000 0.0000 227 ILE B CA    
3720 C C     . ILE B 230 ? 1.5172 1.8603 1.2868 0.0000 0.0000 0.0000 227 ILE B C     
3721 O O     . ILE B 230 ? 1.5299 1.8476 1.3184 0.0000 0.0000 0.0000 227 ILE B O     
3722 C CB    . ILE B 230 ? 1.4634 1.8103 1.2353 0.0000 0.0000 0.0000 227 ILE B CB    
3723 C CG1   . ILE B 230 ? 1.4414 1.7987 1.2237 0.0000 0.0000 0.0000 227 ILE B CG1   
3724 C CG2   . ILE B 230 ? 1.4609 1.7729 1.2451 0.0000 0.0000 0.0000 227 ILE B CG2   
3725 C CD1   . ILE B 230 ? 1.4155 1.7714 1.1915 0.0000 0.0000 0.0000 227 ILE B CD1   
3726 N N     . LYS B 231 ? 1.5306 1.8904 1.2737 0.0000 0.0000 0.0000 228 LYS B N     
3727 C CA    . LYS B 231 ? 1.5589 1.9115 1.2929 0.0000 0.0000 0.0000 228 LYS B CA    
3728 C C     . LYS B 231 ? 1.5900 1.9438 1.3343 0.0000 0.0000 0.0000 228 LYS B C     
3729 O O     . LYS B 231 ? 1.6078 1.9331 1.3662 0.0000 0.0000 0.0000 228 LYS B O     
3730 C CB    . LYS B 231 ? 1.5634 1.9417 1.2658 0.0000 0.0000 0.0000 228 LYS B CB    
3731 N N     . ARG B 232 ? 1.5998 1.9858 1.3395 0.0000 0.0000 0.0000 229 ARG B N     
3732 C CA    . ARG B 232 ? 1.6298 2.0200 1.3849 0.0000 0.0000 0.0000 229 ARG B CA    
3733 C C     . ARG B 232 ? 1.6254 1.9789 1.4185 0.0000 0.0000 0.0000 229 ARG B C     
3734 O O     . ARG B 232 ? 1.6493 1.9755 1.4585 0.0000 0.0000 0.0000 229 ARG B O     
3735 C CB    . ARG B 232 ? 1.6384 2.0748 1.3849 0.0000 0.0000 0.0000 229 ARG B CB    
3736 C CG    . ARG B 232 ? 1.6810 2.1339 1.4326 0.0000 0.0000 0.0000 229 ARG B CG    
3737 C CD    . ARG B 232 ? 1.6923 2.1941 1.4413 0.0000 0.0000 0.0000 229 ARG B CD    
3738 N NE    . ARG B 232 ? 1.6796 2.1772 1.4693 0.0000 0.0000 0.0000 229 ARG B NE    
3739 C CZ    . ARG B 232 ? 1.6928 2.2069 1.5003 0.0000 0.0000 0.0000 229 ARG B CZ    
3740 N NH1   . ARG B 232 ? 1.7169 2.2537 1.5027 0.0000 0.0000 0.0000 229 ARG B NH1   
3741 N NH2   . ARG B 232 ? 1.6794 2.1892 1.5277 0.0000 0.0000 0.0000 229 ARG B NH2   
3742 N N     . LEU B 233 ? 1.5998 1.9513 1.4069 0.0000 0.0000 0.0000 230 LEU B N     
3743 C CA    . LEU B 233 ? 1.5970 1.9191 1.4389 0.0000 0.0000 0.0000 230 LEU B CA    
3744 C C     . LEU B 233 ? 1.6053 1.8804 1.4558 0.0000 0.0000 0.0000 230 LEU B C     
3745 O O     . LEU B 233 ? 1.6185 1.8637 1.4963 0.0000 0.0000 0.0000 230 LEU B O     
3746 C CB    . LEU B 233 ? 1.5641 1.8967 1.4153 0.0000 0.0000 0.0000 230 LEU B CB    
3747 C CG    . LEU B 233 ? 1.5573 1.8713 1.4440 0.0000 0.0000 0.0000 230 LEU B CG    
3748 C CD1   . LEU B 233 ? 1.5836 1.8952 1.4965 0.0000 0.0000 0.0000 230 LEU B CD1   
3749 C CD2   . LEU B 233 ? 1.5312 1.8717 1.4233 0.0000 0.0000 0.0000 230 LEU B CD2   
3750 N N     . LEU B 234 ? 1.6024 1.8718 1.4308 0.0000 0.0000 0.0000 231 LEU B N     
3751 C CA    . LEU B 234 ? 1.6161 1.8458 1.4502 0.0000 0.0000 0.0000 231 LEU B CA    
3752 C C     . LEU B 234 ? 1.6587 1.8724 1.4976 0.0000 0.0000 0.0000 231 LEU B C     
3753 O O     . LEU B 234 ? 1.6768 1.8532 1.5389 0.0000 0.0000 0.0000 231 LEU B O     
3754 C CB    . LEU B 234 ? 1.5941 1.8266 1.4073 0.0000 0.0000 0.0000 231 LEU B CB    
3755 C CG    . LEU B 234 ? 1.5606 1.7892 1.3776 0.0000 0.0000 0.0000 231 LEU B CG    
3756 C CD1   . LEU B 234 ? 1.5518 1.7804 1.3531 0.0000 0.0000 0.0000 231 LEU B CD1   
3757 C CD2   . LEU B 234 ? 1.5478 1.7433 1.3892 0.0000 0.0000 0.0000 231 LEU B CD2   
3758 N N     . THR B 235 ? 1.6809 1.9222 1.4983 0.0000 0.0000 0.0000 232 THR B N     
3759 C CA    . THR B 235 ? 1.7275 1.9573 1.5487 0.0000 0.0000 0.0000 232 THR B CA    
3760 C C     . THR B 235 ? 1.7586 1.9759 1.6100 0.0000 0.0000 0.0000 232 THR B C     
3761 O O     . THR B 235 ? 1.7895 1.9714 1.6610 0.0000 0.0000 0.0000 232 THR B O     
3762 C CB    . THR B 235 ? 1.7403 2.0103 1.5314 0.0000 0.0000 0.0000 232 THR B CB    
3763 O OG1   . THR B 235 ? 1.7152 2.0123 1.4787 0.0000 0.0000 0.0000 232 THR B OG1   
3764 C CG2   . THR B 235 ? 1.7686 2.0208 1.5573 0.0000 0.0000 0.0000 232 THR B CG2   
3765 N N     . LYS B 236 ? 1.7567 2.0033 1.6135 0.0000 0.0000 0.0000 233 LYS B N     
3766 C CA    . LYS B 236 ? 1.7871 2.0312 1.6753 0.0000 0.0000 0.0000 233 LYS B CA    
3767 C C     . LYS B 236 ? 1.8047 1.9957 1.7271 0.0000 0.0000 0.0000 233 LYS B C     
3768 O O     . LYS B 236 ? 1.8410 2.0023 1.7841 0.0000 0.0000 0.0000 233 LYS B O     
3769 C CB    . LYS B 236 ? 1.7650 2.0501 1.6558 0.0000 0.0000 0.0000 233 LYS B CB    
3770 N N     . LEU B 237 ? 1.7872 1.9653 1.7148 0.0000 0.0000 0.0000 234 LEU B N     
3771 C CA    . LEU B 237 ? 1.8084 1.9387 1.7654 0.0000 0.0000 0.0000 234 LEU B CA    
3772 C C     . LEU B 237 ? 1.8187 1.9078 1.7672 0.0000 0.0000 0.0000 234 LEU B C     
3773 O O     . LEU B 237 ? 1.8343 1.8810 1.8027 0.0000 0.0000 0.0000 234 LEU B O     
3774 C CB    . LEU B 237 ? 1.7843 1.9224 1.7548 0.0000 0.0000 0.0000 234 LEU B CB    
3775 C CG    . LEU B 237 ? 1.7868 1.9615 1.7765 0.0000 0.0000 0.0000 234 LEU B CG    
3776 C CD1   . LEU B 237 ? 1.7574 1.9438 1.7550 0.0000 0.0000 0.0000 234 LEU B CD1   
3777 C CD2   . LEU B 237 ? 1.8181 1.9769 1.8455 0.0000 0.0000 0.0000 234 LEU B CD2   
3778 N N     . LEU B 238 ? 1.8152 1.9186 1.7347 0.0000 0.0000 0.0000 235 LEU B N     
3779 C CA    . LEU B 238 ? 1.8295 1.8997 1.7430 0.0000 0.0000 0.0000 235 LEU B CA    
3780 C C     . LEU B 238 ? 1.8777 1.9148 1.8116 0.0000 0.0000 0.0000 235 LEU B C     
3781 O O     . LEU B 238 ? 1.8999 1.8901 1.8553 0.0000 0.0000 0.0000 235 LEU B O     
3782 C CB    . LEU B 238 ? 1.8102 1.9094 1.6904 0.0000 0.0000 0.0000 235 LEU B CB    
3783 C CG    . LEU B 238 ? 1.8187 1.8950 1.6911 0.0000 0.0000 0.0000 235 LEU B CG    
3784 C CD1   . LEU B 238 ? 1.7786 1.8815 1.6271 0.0000 0.0000 0.0000 235 LEU B CD1   
3785 C CD2   . LEU B 238 ? 1.8543 1.9285 1.7233 0.0000 0.0000 0.0000 235 LEU B CD2   
3786 N N     . VAL B 239 ? 1.8986 1.9599 1.8261 0.0000 0.0000 0.0000 236 VAL B N     
3787 C CA    . VAL B 239 ? 1.9481 1.9814 1.8972 0.0000 0.0000 0.0000 236 VAL B CA    
3788 C C     . VAL B 239 ? 1.9738 1.9693 1.9638 0.0000 0.0000 0.0000 236 VAL B C     
3789 O O     . VAL B 239 ? 1.9564 1.9663 1.9573 0.0000 0.0000 0.0000 236 VAL B O     
3790 C CB    . VAL B 239 ? 1.9635 2.0387 1.8993 0.0000 0.0000 0.0000 236 VAL B CB    
3791 C CG1   . VAL B 239 ? 1.9579 2.0609 1.9099 0.0000 0.0000 0.0000 236 VAL B CG1   
3792 C CG2   . VAL B 239 ? 2.0073 2.0552 1.9539 0.0000 0.0000 0.0000 236 VAL B CG2   
3793 N N     . GLY B 240 ? 2.0158 1.9628 2.0301 0.0000 0.0000 0.0000 237 GLY B N     
3794 C CA    . GLY B 240 ? 2.0422 1.9451 2.0975 0.0000 0.0000 0.0000 237 GLY B CA    
3795 C C     . GLY B 240 ? 2.0366 1.8969 2.0966 0.0000 0.0000 0.0000 237 GLY B C     
3796 O O     . GLY B 240 ? 2.0740 1.8813 2.1636 0.0000 0.0000 0.0000 237 GLY B O     
3797 N N     . ARG B 241 ? 1.9926 1.8764 2.0237 0.0000 0.0000 0.0000 238 ARG B N     
3798 C CA    . ARG B 241 ? 1.9849 1.8366 2.0122 0.0000 0.0000 0.0000 238 ARG B CA    
3799 C C     . ARG B 241 ? 1.9460 1.8263 1.9363 0.0000 0.0000 0.0000 238 ARG B C     
3800 O O     . ARG B 241 ? 1.9088 1.8080 1.8851 0.0000 0.0000 0.0000 238 ARG B O     
3801 C CB    . ARG B 241 ? 1.9742 1.8210 2.0175 0.0000 0.0000 0.0000 238 ARG B CB    
3802 C CG    . ARG B 241 ? 1.9237 1.8222 1.9467 0.0000 0.0000 0.0000 238 ARG B CG    
3803 C CD    . ARG B 241 ? 1.9210 1.8294 1.9689 0.0000 0.0000 0.0000 238 ARG B CD    
3804 N NE    . ARG B 241 ? 1.9363 1.8741 1.9976 0.0000 0.0000 0.0000 238 ARG B NE    
3805 C CZ    . ARG B 241 ? 1.9242 1.8940 2.0011 0.0000 0.0000 0.0000 238 ARG B CZ    
3806 N NH1   . ARG B 241 ? 1.8958 1.8710 1.9776 0.0000 0.0000 0.0000 238 ARG B NH1   
3807 N NH2   . ARG B 241 ? 1.9335 1.9327 2.0212 0.0000 0.0000 0.0000 238 ARG B NH2   
3808 N N     . PRO B 242 ? 1.9543 1.8387 1.9309 0.0000 0.0000 0.0000 239 PRO B N     
3809 C CA    . PRO B 242 ? 1.9175 1.8364 1.8617 0.0000 0.0000 0.0000 239 PRO B CA    
3810 C C     . PRO B 242 ? 1.8990 1.8006 1.8362 0.0000 0.0000 0.0000 239 PRO B C     
3811 O O     . PRO B 242 ? 1.8656 1.7972 1.7800 0.0000 0.0000 0.0000 239 PRO B O     
3812 C CB    . PRO B 242 ? 1.9448 1.8615 1.8844 0.0000 0.0000 0.0000 239 PRO B CB    
3813 C CG    . PRO B 242 ? 1.9963 1.8582 1.9669 0.0000 0.0000 0.0000 239 PRO B CG    
3814 C CD    . PRO B 242 ? 2.0013 1.8533 1.9951 0.0000 0.0000 0.0000 239 PRO B CD    
3815 N N     . THR B 243 ? 1.9214 1.7757 1.8789 0.0000 0.0000 0.0000 240 THR B N     
3816 C CA    . THR B 243 ? 1.9124 1.7441 1.8648 0.0000 0.0000 0.0000 240 THR B CA    
3817 C C     . THR B 243 ? 1.8826 1.7194 1.8331 0.0000 0.0000 0.0000 240 THR B C     
3818 O O     . THR B 243 ? 1.8726 1.7048 1.8121 0.0000 0.0000 0.0000 240 THR B O     
3819 C CB    . THR B 243 ? 1.9669 1.7393 1.9403 0.0000 0.0000 0.0000 240 THR B CB    
3820 O OG1   . THR B 243 ? 1.9717 1.7235 1.9389 0.0000 0.0000 0.0000 240 THR B OG1   
3821 C CG2   . THR B 243 ? 1.9994 1.7367 2.0038 0.0000 0.0000 0.0000 240 THR B CG2   
3822 N N     . LYS B 244 ? 1.8659 1.7153 1.8277 0.0000 0.0000 0.0000 241 LYS B N     
3823 C CA    . LYS B 244 ? 1.8426 1.6945 1.8075 0.0000 0.0000 0.0000 241 LYS B CA    
3824 C C     . LYS B 244 ? 1.7918 1.6954 1.7457 0.0000 0.0000 0.0000 241 LYS B C     
3825 O O     . LYS B 244 ? 1.7834 1.6931 1.7503 0.0000 0.0000 0.0000 241 LYS B O     
3826 C CB    . LYS B 244 ? 1.8813 1.6923 1.8774 0.0000 0.0000 0.0000 241 LYS B CB    
3827 N N     . TRP B 245 ? 1.7566 1.6968 1.6879 0.0000 0.0000 0.0000 242 TRP B N     
3828 C CA    . TRP B 245 ? 1.7111 1.6990 1.6304 0.0000 0.0000 0.0000 242 TRP B CA    
3829 C C     . TRP B 245 ? 1.6767 1.6802 1.5845 0.0000 0.0000 0.0000 242 TRP B C     
3830 O O     . TRP B 245 ? 1.6458 1.6840 1.5472 0.0000 0.0000 0.0000 242 TRP B O     
3831 C CB    . TRP B 245 ? 1.6967 1.7161 1.5965 0.0000 0.0000 0.0000 242 TRP B CB    
3832 C CG    . TRP B 245 ? 1.6869 1.7033 1.5709 0.0000 0.0000 0.0000 242 TRP B CG    
3833 C CD1   . TRP B 245 ? 1.7197 1.7125 1.6059 0.0000 0.0000 0.0000 242 TRP B CD1   
3834 C CD2   . TRP B 245 ? 1.6434 1.6826 1.5102 0.0000 0.0000 0.0000 242 TRP B CD2   
3835 N NE1   . TRP B 245 ? 1.6986 1.7007 1.5703 0.0000 0.0000 0.0000 242 TRP B NE1   
3836 C CE2   . TRP B 245 ? 1.6510 1.6816 1.5111 0.0000 0.0000 0.0000 242 TRP B CE2   
3837 C CE3   . TRP B 245 ? 1.6027 1.6692 1.4616 0.0000 0.0000 0.0000 242 TRP B CE3   
3838 C CZ2   . TRP B 245 ? 1.6159 1.6665 1.4629 0.0000 0.0000 0.0000 242 TRP B CZ2   
3839 C CZ3   . TRP B 245 ? 1.5726 1.6557 1.4181 0.0000 0.0000 0.0000 242 TRP B CZ3   
3840 C CH2   . TRP B 245 ? 1.5752 1.6514 1.4155 0.0000 0.0000 0.0000 242 TRP B CH2   
3841 N N     . TYR B 246 ? 1.6839 1.6628 1.5887 0.0000 0.0000 0.0000 243 TYR B N     
3842 C CA    . TYR B 246 ? 1.6519 1.6457 1.5450 0.0000 0.0000 0.0000 243 TYR B CA    
3843 C C     . TYR B 246 ? 1.6387 1.6333 1.5444 0.0000 0.0000 0.0000 243 TYR B C     
3844 O O     . TYR B 246 ? 1.6065 1.6325 1.5067 0.0000 0.0000 0.0000 243 TYR B O     
3845 C CB    . TYR B 246 ? 1.6723 1.6414 1.5583 0.0000 0.0000 0.0000 243 TYR B CB    
3846 C CG    . TYR B 246 ? 1.6617 1.6467 1.5352 0.0000 0.0000 0.0000 243 TYR B CG    
3847 C CD1   . TYR B 246 ? 1.6500 1.6576 1.5075 0.0000 0.0000 0.0000 243 TYR B CD1   
3848 C CD2   . TYR B 246 ? 1.6761 1.6556 1.5553 0.0000 0.0000 0.0000 243 TYR B CD2   
3849 C CE1   . TYR B 246 ? 1.6399 1.6643 1.4871 0.0000 0.0000 0.0000 243 TYR B CE1   
3850 C CE2   . TYR B 246 ? 1.6656 1.6622 1.5321 0.0000 0.0000 0.0000 243 TYR B CE2   
3851 C CZ    . TYR B 246 ? 1.6466 1.6655 1.4971 0.0000 0.0000 0.0000 243 TYR B CZ    
3852 O OH    . TYR B 246 ? 1.6396 1.6773 1.4788 0.0000 0.0000 0.0000 243 TYR B OH    
3853 N N     . ASP B 247 ? 1.6628 1.6220 1.5875 0.0000 0.0000 0.0000 244 ASP B N     
3854 C CA    . ASP B 247 ? 1.6555 1.6123 1.5963 0.0000 0.0000 0.0000 244 ASP B CA    
3855 C C     . ASP B 247 ? 1.6201 1.6095 1.5732 0.0000 0.0000 0.0000 244 ASP B C     
3856 O O     . ASP B 247 ? 1.6087 1.6119 1.5728 0.0000 0.0000 0.0000 244 ASP B O     
3857 C CB    . ASP B 247 ? 1.7103 1.6187 1.6722 0.0000 0.0000 0.0000 244 ASP B CB    
3858 C CG    . ASP B 247 ? 1.7572 1.6295 1.7081 0.0000 0.0000 0.0000 244 ASP B CG    
3859 O OD1   . ASP B 247 ? 1.7837 1.6410 1.7282 0.0000 0.0000 0.0000 244 ASP B OD1   
3860 O OD2   . ASP B 247 ? 1.7925 1.6534 1.7406 0.0000 0.0000 0.0000 244 ASP B OD2   
3861 N N     . LEU B 248 ? 1.5973 1.6015 1.5478 0.0000 0.0000 0.0000 245 LEU B N     
3862 C CA    . LEU B 248 ? 1.5642 1.6026 1.5236 0.0000 0.0000 0.0000 245 LEU B CA    
3863 C C     . LEU B 248 ? 1.5108 1.5927 1.4519 0.0000 0.0000 0.0000 245 LEU B C     
3864 O O     . LEU B 248 ? 1.4959 1.6075 1.4455 0.0000 0.0000 0.0000 245 LEU B O     
3865 C CB    . LEU B 248 ? 1.5835 1.6209 1.5478 0.0000 0.0000 0.0000 245 LEU B CB    
3866 C CG    . LEU B 248 ? 1.6214 1.6243 1.6154 0.0000 0.0000 0.0000 245 LEU B CG    
3867 C CD1   . LEU B 248 ? 1.6361 1.6540 1.6348 0.0000 0.0000 0.0000 245 LEU B CD1   
3868 C CD2   . LEU B 248 ? 1.6084 1.6107 1.6291 0.0000 0.0000 0.0000 245 LEU B CD2   
3869 N N     . LEU B 249 ? 1.4770 1.5628 1.3954 0.0000 0.0000 0.0000 246 LEU B N     
3870 C CA    . LEU B 249 ? 1.4246 1.5472 1.3270 0.0000 0.0000 0.0000 246 LEU B CA    
3871 C C     . LEU B 249 ? 1.3931 1.5378 1.3054 0.0000 0.0000 0.0000 246 LEU B C     
3872 O O     . LEU B 249 ? 1.3760 1.5522 1.2851 0.0000 0.0000 0.0000 246 LEU B O     
3873 C CB    . LEU B 249 ? 1.4117 1.5329 1.2943 0.0000 0.0000 0.0000 246 LEU B CB    
3874 C CG    . LEU B 249 ? 1.4126 1.5322 1.2811 0.0000 0.0000 0.0000 246 LEU B CG    
3875 C CD1   . LEU B 249 ? 1.3994 1.5241 1.2541 0.0000 0.0000 0.0000 246 LEU B CD1   
3876 C CD2   . LEU B 249 ? 1.4002 1.5490 1.2605 0.0000 0.0000 0.0000 246 LEU B CD2   
3877 N N     . PRO B 250 ? 1.3870 1.5161 1.3108 0.0000 0.0000 0.0000 247 PRO B N     
3878 C CA    . PRO B 250 ? 1.3618 1.5133 1.2987 0.0000 0.0000 0.0000 247 PRO B CA    
3879 C C     . PRO B 250 ? 1.3555 1.5272 1.3115 0.0000 0.0000 0.0000 247 PRO B C     
3880 O O     . PRO B 250 ? 1.3325 1.5375 1.2896 0.0000 0.0000 0.0000 247 PRO B O     
3881 C CB    . PRO B 250 ? 1.3791 1.5047 1.3275 0.0000 0.0000 0.0000 247 PRO B CB    
3882 C CG    . PRO B 250 ? 1.3983 1.4959 1.3299 0.0000 0.0000 0.0000 247 PRO B CG    
3883 C CD    . PRO B 250 ? 1.4085 1.5020 1.3315 0.0000 0.0000 0.0000 247 PRO B CD    
3884 N N     . VAL B 251 ? 1.3759 1.5280 1.3481 0.0000 0.0000 0.0000 248 VAL B N     
3885 C CA    . VAL B 251 ? 1.3723 1.5449 1.3659 0.0000 0.0000 0.0000 248 VAL B CA    
3886 C C     . VAL B 251 ? 1.3506 1.5564 1.3280 0.0000 0.0000 0.0000 248 VAL B C     
3887 O O     . VAL B 251 ? 1.3420 1.5815 1.3293 0.0000 0.0000 0.0000 248 VAL B O     
3888 C CB    . VAL B 251 ? 1.4096 1.5524 1.4239 0.0000 0.0000 0.0000 248 VAL B CB    
3889 C CG1   . VAL B 251 ? 1.4106 1.5783 1.4540 0.0000 0.0000 0.0000 248 VAL B CG1   
3890 C CG2   . VAL B 251 ? 1.4322 1.5322 1.4571 0.0000 0.0000 0.0000 248 VAL B CG2   
3891 N N     . VAL B 252 ? 1.3419 1.5392 1.2945 0.0000 0.0000 0.0000 249 VAL B N     
3892 C CA    . VAL B 252 ? 1.3259 1.5527 1.2588 0.0000 0.0000 0.0000 249 VAL B CA    
3893 C C     . VAL B 252 ? 1.2919 1.5483 1.2151 0.0000 0.0000 0.0000 249 VAL B C     
3894 O O     . VAL B 252 ? 1.2860 1.5751 1.2105 0.0000 0.0000 0.0000 249 VAL B O     
3895 C CB    . VAL B 252 ? 1.3336 1.5443 1.2433 0.0000 0.0000 0.0000 249 VAL B CB    
3896 C CG1   . VAL B 252 ? 1.3200 1.5628 1.2062 0.0000 0.0000 0.0000 249 VAL B CG1   
3897 C CG2   . VAL B 252 ? 1.3626 1.5449 1.2830 0.0000 0.0000 0.0000 249 VAL B CG2   
3898 N N     . GLN B 253 ? 1.2718 1.5168 1.1862 0.0000 0.0000 0.0000 250 GLN B N     
3899 C CA    . GLN B 253 ? 1.2440 1.5118 1.1514 0.0000 0.0000 0.0000 250 GLN B CA    
3900 C C     . GLN B 253 ? 1.2318 1.5239 1.1600 0.0000 0.0000 0.0000 250 GLN B C     
3901 O O     . GLN B 253 ? 1.2195 1.5408 1.1439 0.0000 0.0000 0.0000 250 GLN B O     
3902 C CB    . GLN B 253 ? 1.2338 1.4842 1.1359 0.0000 0.0000 0.0000 250 GLN B CB    
3903 C CG    . GLN B 253 ? 1.2301 1.4937 1.1152 0.0000 0.0000 0.0000 250 GLN B CG    
3904 C CD    . GLN B 253 ? 1.2635 1.5143 1.1454 0.0000 0.0000 0.0000 250 GLN B CD    
3905 O OE1   . GLN B 253 ? 1.2992 1.5330 1.1704 0.0000 0.0000 0.0000 250 GLN B OE1   
3906 N NE2   . GLN B 253 ? 1.2624 1.5237 1.1540 0.0000 0.0000 0.0000 250 GLN B NE2   
3907 N N     . LEU B 254 ? 1.2377 1.5180 1.1889 0.0000 0.0000 0.0000 251 LEU B N     
3908 C CA    . LEU B 254 ? 1.2317 1.5356 1.2082 0.0000 0.0000 0.0000 251 LEU B CA    
3909 C C     . LEU B 254 ? 1.2413 1.5757 1.2247 0.0000 0.0000 0.0000 251 LEU B C     
3910 O O     . LEU B 254 ? 1.2269 1.5939 1.2196 0.0000 0.0000 0.0000 251 LEU B O     
3911 C CB    . LEU B 254 ? 1.2448 1.5275 1.2461 0.0000 0.0000 0.0000 251 LEU B CB    
3912 C CG    . LEU B 254 ? 1.2312 1.5030 1.2382 0.0000 0.0000 0.0000 251 LEU B CG    
3913 C CD1   . LEU B 254 ? 1.2437 1.4929 1.2747 0.0000 0.0000 0.0000 251 LEU B CD1   
3914 C CD2   . LEU B 254 ? 1.2032 1.5088 1.2196 0.0000 0.0000 0.0000 251 LEU B CD2   
3915 N N     . ALA B 255 ? 1.2704 1.5953 1.2497 0.0000 0.0000 0.0000 252 ALA B N     
3916 C CA    . ALA B 255 ? 1.2871 1.6419 1.2709 0.0000 0.0000 0.0000 252 ALA B CA    
3917 C C     . ALA B 255 ? 1.2804 1.6646 1.2380 0.0000 0.0000 0.0000 252 ALA B C     
3918 O O     . ALA B 255 ? 1.2739 1.6941 1.2380 0.0000 0.0000 0.0000 252 ALA B O     
3919 C CB    . ALA B 255 ? 1.3115 1.6465 1.2943 0.0000 0.0000 0.0000 252 ALA B CB    
3920 N N     . LEU B 256 ? 1.2884 1.6570 1.2175 0.0000 0.0000 0.0000 253 LEU B N     
3921 C CA    . LEU B 256 ? 1.2923 1.6829 1.1952 0.0000 0.0000 0.0000 253 LEU B CA    
3922 C C     . LEU B 256 ? 1.2802 1.6919 1.1897 0.0000 0.0000 0.0000 253 LEU B C     
3923 O O     . LEU B 256 ? 1.2848 1.7279 1.1881 0.0000 0.0000 0.0000 253 LEU B O     
3924 C CB    . LEU B 256 ? 1.2873 1.6544 1.1657 0.0000 0.0000 0.0000 253 LEU B CB    
3925 C CG    . LEU B 256 ? 1.3099 1.6588 1.1765 0.0000 0.0000 0.0000 253 LEU B CG    
3926 C CD1   . LEU B 256 ? 1.3051 1.6304 1.1566 0.0000 0.0000 0.0000 253 LEU B CD1   
3927 C CD2   . LEU B 256 ? 1.3310 1.7074 1.1786 0.0000 0.0000 0.0000 253 LEU B CD2   
3928 N N     . ASN B 257 ? 1.2755 1.6703 1.1970 0.0000 0.0000 0.0000 254 ASN B N     
3929 C CA    . ASN B 257 ? 1.2701 1.6807 1.1981 0.0000 0.0000 0.0000 254 ASN B CA    
3930 C C     . ASN B 257 ? 1.2827 1.7230 1.2371 0.0000 0.0000 0.0000 254 ASN B C     
3931 O O     . ASN B 257 ? 1.2716 1.7336 1.2301 0.0000 0.0000 0.0000 254 ASN B O     
3932 C CB    . ASN B 257 ? 1.2521 1.6382 1.1831 0.0000 0.0000 0.0000 254 ASN B CB    
3933 C CG    . ASN B 257 ? 1.2458 1.6132 1.1522 0.0000 0.0000 0.0000 254 ASN B CG    
3934 O OD1   . ASN B 257 ? 1.2472 1.6250 1.1356 0.0000 0.0000 0.0000 254 ASN B OD1   
3935 N ND2   . ASN B 257 ? 1.2259 1.5672 1.1315 0.0000 0.0000 0.0000 254 ASN B ND2   
3936 N N     . ASN B 258 ? 1.3157 1.7573 1.2901 0.0000 0.0000 0.0000 255 ASN B N     
3937 C CA    . ASN B 258 ? 1.3361 1.8103 1.3394 0.0000 0.0000 0.0000 255 ASN B CA    
3938 C C     . ASN B 258 ? 1.3697 1.8751 1.3712 0.0000 0.0000 0.0000 255 ASN B C     
3939 O O     . ASN B 258 ? 1.3804 1.9105 1.4100 0.0000 0.0000 0.0000 255 ASN B O     
3940 C CB    . ASN B 258 ? 1.3371 1.7970 1.3712 0.0000 0.0000 0.0000 255 ASN B CB    
3941 C CG    . ASN B 258 ? 1.3190 1.7786 1.3663 0.0000 0.0000 0.0000 255 ASN B CG    
3942 O OD1   . ASN B 258 ? 1.3119 1.8024 1.3721 0.0000 0.0000 0.0000 255 ASN B OD1   
3943 N ND2   . ASN B 258 ? 1.3266 1.7528 1.3700 0.0000 0.0000 0.0000 255 ASN B ND2   
3944 N N     . THR B 259 ? 1.3965 1.9039 1.3653 0.0000 0.0000 0.0000 256 THR B N     
3945 C CA    . THR B 259 ? 1.4369 1.9756 1.3969 0.0000 0.0000 0.0000 256 THR B CA    
3946 C C     . THR B 259 ? 1.4487 2.0226 1.3931 0.0000 0.0000 0.0000 256 THR B C     
3947 O O     . THR B 259 ? 1.4413 2.0046 1.3608 0.0000 0.0000 0.0000 256 THR B O     
3948 C CB    . THR B 259 ? 1.4549 1.9732 1.3891 0.0000 0.0000 0.0000 256 THR B CB    
3949 O OG1   . THR B 259 ? 1.4707 1.9670 1.4274 0.0000 0.0000 0.0000 256 THR B OG1   
3950 C CG2   . THR B 259 ? 1.4773 2.0312 1.3893 0.0000 0.0000 0.0000 256 THR B CG2   
3951 N N     . TYR B 260 ? 1.4765 2.0927 1.4378 0.0000 0.0000 0.0000 257 TYR B N     
3952 C CA    . TYR B 260 ? 1.5007 2.1553 1.4495 0.0000 0.0000 0.0000 257 TYR B CA    
3953 C C     . TYR B 260 ? 1.5239 2.1811 1.4275 0.0000 0.0000 0.0000 257 TYR B C     
3954 O O     . TYR B 260 ? 1.5485 2.2142 1.4357 0.0000 0.0000 0.0000 257 TYR B O     
3955 C CB    . TYR B 260 ? 1.5159 2.2201 1.4906 0.0000 0.0000 0.0000 257 TYR B CB    
3956 C CG    . TYR B 260 ? 1.5278 2.2404 1.5469 0.0000 0.0000 0.0000 257 TYR B CG    
3957 C CD1   . TYR B 260 ? 1.5387 2.2717 1.5671 0.0000 0.0000 0.0000 257 TYR B CD1   
3958 C CD2   . TYR B 260 ? 1.5524 2.2505 1.6053 0.0000 0.0000 0.0000 257 TYR B CD2   
3959 C CE1   . TYR B 260 ? 1.5392 2.2820 1.6090 0.0000 0.0000 0.0000 257 TYR B CE1   
3960 C CE2   . TYR B 260 ? 1.5504 2.2578 1.6443 0.0000 0.0000 0.0000 257 TYR B CE2   
3961 C CZ    . TYR B 260 ? 1.5424 2.2738 1.6440 0.0000 0.0000 0.0000 257 TYR B CZ    
3962 O OH    . TYR B 260 ? 1.5408 2.2845 1.6824 0.0000 0.0000 0.0000 257 TYR B OH    
3963 N N     . SER B 261 ? 1.5258 2.1752 1.4108 0.0000 0.0000 0.0000 258 SER B N     
3964 C CA    . SER B 261 ? 1.5533 2.2132 1.3975 0.0000 0.0000 0.0000 258 SER B CA    
3965 C C     . SER B 261 ? 1.5793 2.2913 1.4182 0.0000 0.0000 0.0000 258 SER B C     
3966 O O     . SER B 261 ? 1.5706 2.3045 1.4364 0.0000 0.0000 0.0000 258 SER B O     
3967 C CB    . SER B 261 ? 1.5404 2.1727 1.3704 0.0000 0.0000 0.0000 258 SER B CB    
3968 O OG    . SER B 261 ? 1.5599 2.1993 1.3509 0.0000 0.0000 0.0000 258 SER B OG    
3969 N N     . PRO B 262 ? 1.6113 2.3461 1.4155 0.0000 0.0000 0.0000 259 PRO B N     
3970 C CA    . PRO B 262 ? 1.6375 2.4256 1.4314 0.0000 0.0000 0.0000 259 PRO B CA    
3971 C C     . PRO B 262 ? 1.6361 2.4330 1.4271 0.0000 0.0000 0.0000 259 PRO B C     
3972 O O     . PRO B 262 ? 1.6448 2.4823 1.4509 0.0000 0.0000 0.0000 259 PRO B O     
3973 C CB    . PRO B 262 ? 1.6696 2.4696 1.4179 0.0000 0.0000 0.0000 259 PRO B CB    
3974 C CG    . PRO B 262 ? 1.6607 2.4208 1.4098 0.0000 0.0000 0.0000 259 PRO B CG    
3975 C CD    . PRO B 262 ? 1.6259 2.3406 1.3985 0.0000 0.0000 0.0000 259 PRO B CD    
3976 N N     . VAL B 263 ? 1.6263 2.3861 1.4008 0.0000 0.0000 0.0000 260 VAL B N     
3977 C CA    . VAL B 263 ? 1.6174 2.3722 1.3982 0.0000 0.0000 0.0000 260 VAL B CA    
3978 C C     . VAL B 263 ? 1.5793 2.3121 1.4044 0.0000 0.0000 0.0000 260 VAL B C     
3979 O O     . VAL B 263 ? 1.5547 2.2571 1.3929 0.0000 0.0000 0.0000 260 VAL B O     
3980 C CB    . VAL B 263 ? 1.6265 2.3495 1.3759 0.0000 0.0000 0.0000 260 VAL B CB    
3981 C CG1   . VAL B 263 ? 1.6329 2.3614 1.3835 0.0000 0.0000 0.0000 260 VAL B CG1   
3982 C CG2   . VAL B 263 ? 1.6536 2.3878 1.3579 0.0000 0.0000 0.0000 260 VAL B CG2   
3983 N N     . LEU B 264 ? 1.5720 2.3223 1.4190 0.0000 0.0000 0.0000 261 LEU B N     
3984 C CA    . LEU B 264 ? 1.5353 2.2703 1.4233 0.0000 0.0000 0.0000 261 LEU B CA    
3985 C C     . LEU B 264 ? 1.5136 2.2741 1.4383 0.0000 0.0000 0.0000 261 LEU B C     
3986 O O     . LEU B 264 ? 1.4951 2.2653 1.4553 0.0000 0.0000 0.0000 261 LEU B O     
3987 C CB    . LEU B 264 ? 1.5157 2.1983 1.4039 0.0000 0.0000 0.0000 261 LEU B CB    
3988 C CG    . LEU B 264 ? 1.5355 2.1887 1.3906 0.0000 0.0000 0.0000 261 LEU B CG    
3989 C CD1   . LEU B 264 ? 1.5209 2.1356 1.3662 0.0000 0.0000 0.0000 261 LEU B CD1   
3990 C CD2   . LEU B 264 ? 1.5417 2.1821 1.4075 0.0000 0.0000 0.0000 261 LEU B CD2   
3991 N N     . LYS B 265 ? 1.5134 2.2858 1.4308 0.0000 0.0000 0.0000 262 LYS B N     
3992 C CA    . LYS B 265 ? 1.4908 2.2740 1.4433 0.0000 0.0000 0.0000 262 LYS B CA    
3993 C C     . LYS B 265 ? 1.4491 2.1953 1.4297 0.0000 0.0000 0.0000 262 LYS B C     
3994 O O     . LYS B 265 ? 1.4349 2.1960 1.4544 0.0000 0.0000 0.0000 262 LYS B O     
3995 C CB    . LYS B 265 ? 1.5021 2.3429 1.4808 0.0000 0.0000 0.0000 262 LYS B CB    
3996 N N     . TYR B 266 ? 1.4232 2.1243 1.3828 0.0000 0.0000 0.0000 263 TYR B N     
3997 C CA    . TYR B 266 ? 1.3848 2.0495 1.3627 0.0000 0.0000 0.0000 263 TYR B CA    
3998 C C     . TYR B 266 ? 1.3697 1.9962 1.3310 0.0000 0.0000 0.0000 263 TYR B C     
3999 O O     . TYR B 266 ? 1.3839 1.9979 1.3123 0.0000 0.0000 0.0000 263 TYR B O     
4000 C CB    . TYR B 266 ? 1.3735 2.0208 1.3491 0.0000 0.0000 0.0000 263 TYR B CB    
4001 C CG    . TYR B 266 ? 1.3833 2.0604 1.3852 0.0000 0.0000 0.0000 263 TYR B CG    
4002 C CD1   . TYR B 266 ? 1.3870 2.0909 1.4266 0.0000 0.0000 0.0000 263 TYR B CD1   
4003 C CD2   . TYR B 266 ? 1.4039 2.0819 1.3958 0.0000 0.0000 0.0000 263 TYR B CD2   
4004 C CE1   . TYR B 266 ? 1.3868 2.1212 1.4532 0.0000 0.0000 0.0000 263 TYR B CE1   
4005 C CE2   . TYR B 266 ? 1.4101 2.1145 1.4281 0.0000 0.0000 0.0000 263 TYR B CE2   
4006 C CZ    . TYR B 266 ? 1.3979 2.1322 1.4531 0.0000 0.0000 0.0000 263 TYR B CZ    
4007 O OH    . TYR B 266 ? 1.3985 2.1619 1.4816 0.0000 0.0000 0.0000 263 TYR B OH    
4008 N N     . THR B 267 ? 1.3389 1.9478 1.3236 0.0000 0.0000 0.0000 264 THR B N     
4009 C CA    . THR B 267 ? 1.3217 1.8912 1.2937 0.0000 0.0000 0.0000 264 THR B CA    
4010 C C     . THR B 267 ? 1.2948 1.8360 1.2518 0.0000 0.0000 0.0000 264 THR B C     
4011 O O     . THR B 267 ? 1.2834 1.8297 1.2537 0.0000 0.0000 0.0000 264 THR B O     
4012 C CB    . THR B 267 ? 1.3185 1.8763 1.3200 0.0000 0.0000 0.0000 264 THR B CB    
4013 O OG1   . THR B 267 ? 1.3006 1.8572 1.3250 0.0000 0.0000 0.0000 264 THR B OG1   
4014 C CG2   . THR B 267 ? 1.3328 1.9220 1.3561 0.0000 0.0000 0.0000 264 THR B CG2   
4015 N N     . PRO B 268 ? 1.2834 1.7970 1.2146 0.0000 0.0000 0.0000 265 PRO B N     
4016 C CA    . PRO B 268 ? 1.2591 1.7460 1.1820 0.0000 0.0000 0.0000 265 PRO B CA    
4017 C C     . PRO B 268 ? 1.2304 1.7079 1.1788 0.0000 0.0000 0.0000 265 PRO B C     
4018 O O     . PRO B 268 ? 1.2207 1.6933 1.1728 0.0000 0.0000 0.0000 265 PRO B O     
4019 C CB    . PRO B 268 ? 1.2640 1.7247 1.1665 0.0000 0.0000 0.0000 265 PRO B CB    
4020 C CG    . PRO B 268 ? 1.2903 1.7677 1.1786 0.0000 0.0000 0.0000 265 PRO B CG    
4021 C CD    . PRO B 268 ? 1.3008 1.8116 1.2088 0.0000 0.0000 0.0000 265 PRO B CD    
4022 N N     . HIS B 269 ? 1.2156 1.6911 1.1819 0.0000 0.0000 0.0000 266 HIS B N     
4023 C CA    . HIS B 269 ? 1.1888 1.6593 1.1784 0.0000 0.0000 0.0000 266 HIS B CA    
4024 C C     . HIS B 269 ? 1.1726 1.6682 1.1811 0.0000 0.0000 0.0000 266 HIS B C     
4025 O O     . HIS B 269 ? 1.1608 1.6487 1.1752 0.0000 0.0000 0.0000 266 HIS B O     
4026 C CB    . HIS B 269 ? 1.1960 1.6670 1.2052 0.0000 0.0000 0.0000 266 HIS B CB    
4027 C CG    . HIS B 269 ? 1.1861 1.6541 1.2184 0.0000 0.0000 0.0000 266 HIS B CG    
4028 N ND1   . HIS B 269 ? 1.1737 1.6691 1.2308 0.0000 0.0000 0.0000 266 HIS B ND1   
4029 C CD2   . HIS B 269 ? 1.1875 1.6302 1.2211 0.0000 0.0000 0.0000 266 HIS B CD2   
4030 C CE1   . HIS B 269 ? 1.1762 1.6642 1.2484 0.0000 0.0000 0.0000 266 HIS B CE1   
4031 N NE2   . HIS B 269 ? 1.1900 1.6458 1.2470 0.0000 0.0000 0.0000 266 HIS B NE2   
4032 N N     . GLN B 270 ? 1.1728 1.7000 1.1910 0.0000 0.0000 0.0000 267 GLN B N     
4033 C CA    . GLN B 270 ? 1.1619 1.7158 1.2007 0.0000 0.0000 0.0000 267 GLN B CA    
4034 C C     . GLN B 270 ? 1.1505 1.6944 1.1756 0.0000 0.0000 0.0000 267 GLN B C     
4035 O O     . GLN B 270 ? 1.1375 1.6833 1.1796 0.0000 0.0000 0.0000 267 GLN B O     
4036 C CB    . GLN B 270 ? 1.1781 1.7709 1.2272 0.0000 0.0000 0.0000 267 GLN B CB    
4037 C CG    . GLN B 270 ? 1.1868 1.8004 1.2681 0.0000 0.0000 0.0000 267 GLN B CG    
4038 C CD    . GLN B 270 ? 1.2240 1.8727 1.3096 0.0000 0.0000 0.0000 267 GLN B CD    
4039 O OE1   . GLN B 270 ? 1.2394 1.9001 1.3017 0.0000 0.0000 0.0000 267 GLN B OE1   
4040 N NE2   . GLN B 270 ? 1.2458 1.9126 1.3616 0.0000 0.0000 0.0000 267 GLN B NE2   
4041 N N     . LEU B 271 ? 1.1540 1.6869 1.1501 0.0000 0.0000 0.0000 268 LEU B N     
4042 C CA    . LEU B 271 ? 1.1515 1.6723 1.1358 0.0000 0.0000 0.0000 268 LEU B CA    
4043 C C     . LEU B 271 ? 1.1305 1.6226 1.1175 0.0000 0.0000 0.0000 268 LEU B C     
4044 O O     . LEU B 271 ? 1.1270 1.6134 1.1206 0.0000 0.0000 0.0000 268 LEU B O     
4045 C CB    . LEU B 271 ? 1.1709 1.6862 1.1229 0.0000 0.0000 0.0000 268 LEU B CB    
4046 C CG    . LEU B 271 ? 1.2028 1.7499 1.1461 0.0000 0.0000 0.0000 268 LEU B CG    
4047 C CD1   . LEU B 271 ? 1.2291 1.7695 1.1366 0.0000 0.0000 0.0000 268 LEU B CD1   
4048 C CD2   . LEU B 271 ? 1.2157 1.7846 1.1771 0.0000 0.0000 0.0000 268 LEU B CD2   
4049 N N     . LEU B 272 ? 1.1155 1.5903 1.0980 0.0000 0.0000 0.0000 269 LEU B N     
4050 C CA    . LEU B 272 ? 1.0978 1.5496 1.0805 0.0000 0.0000 0.0000 269 LEU B CA    
4051 C C     . LEU B 272 ? 1.0880 1.5486 1.0966 0.0000 0.0000 0.0000 269 LEU B C     
4052 O O     . LEU B 272 ? 1.0805 1.5350 1.0961 0.0000 0.0000 0.0000 269 LEU B O     
4053 C CB    . LEU B 272 ? 1.0965 1.5278 1.0635 0.0000 0.0000 0.0000 269 LEU B CB    
4054 C CG    . LEU B 272 ? 1.0811 1.4904 1.0424 0.0000 0.0000 0.0000 269 LEU B CG    
4055 C CD1   . LEU B 272 ? 1.0687 1.4704 1.0219 0.0000 0.0000 0.0000 269 LEU B CD1   
4056 C CD2   . LEU B 272 ? 1.0665 1.4577 1.0126 0.0000 0.0000 0.0000 269 LEU B CD2   
4057 N N     . PHE B 273 ? 1.0904 1.5668 1.1149 0.0000 0.0000 0.0000 270 PHE B N     
4058 C CA    . PHE B 273 ? 1.0863 1.5725 1.1347 0.0000 0.0000 0.0000 270 PHE B CA    
4059 C C     . PHE B 273 ? 1.0938 1.6113 1.1696 0.0000 0.0000 0.0000 270 PHE B C     
4060 O O     . PHE B 273 ? 1.0879 1.6152 1.1842 0.0000 0.0000 0.0000 270 PHE B O     
4061 C CB    . PHE B 273 ? 1.0857 1.5667 1.1376 0.0000 0.0000 0.0000 270 PHE B CB    
4062 C CG    . PHE B 273 ? 1.0802 1.5310 1.1077 0.0000 0.0000 0.0000 270 PHE B CG    
4063 C CD1   . PHE B 273 ? 1.0865 1.5269 1.1014 0.0000 0.0000 0.0000 270 PHE B CD1   
4064 C CD2   . PHE B 273 ? 1.0717 1.5065 1.0898 0.0000 0.0000 0.0000 270 PHE B CD2   
4065 C CE1   . PHE B 273 ? 1.0919 1.5051 1.0860 0.0000 0.0000 0.0000 270 PHE B CE1   
4066 C CE2   . PHE B 273 ? 1.0789 1.4894 1.0757 0.0000 0.0000 0.0000 270 PHE B CE2   
4067 C CZ    . PHE B 273 ? 1.0829 1.4820 1.0680 0.0000 0.0000 0.0000 270 PHE B CZ    
4068 N N     . GLY B 274 ? 1.1126 1.6484 1.1884 0.0000 0.0000 0.0000 271 GLY B N     
4069 C CA    . GLY B 274 ? 1.1270 1.6960 1.2290 0.0000 0.0000 0.0000 271 GLY B CA    
4070 C C     . GLY B 274 ? 1.1345 1.7290 1.2667 0.0000 0.0000 0.0000 271 GLY B C     
4071 O O     . GLY B 274 ? 1.1280 1.7468 1.2878 0.0000 0.0000 0.0000 271 GLY B O     
4072 N N     . ILE B 275 ? 1.1499 1.7380 1.2784 0.0000 0.0000 0.0000 272 ILE B N     
4073 C CA    . ILE B 275 ? 1.1646 1.7730 1.3218 0.0000 0.0000 0.0000 272 ILE B CA    
4074 C C     . ILE B 275 ? 1.1863 1.7878 1.3348 0.0000 0.0000 0.0000 272 ILE B C     
4075 O O     . ILE B 275 ? 1.1941 1.7732 1.3127 0.0000 0.0000 0.0000 272 ILE B O     
4076 C CB    . ILE B 275 ? 1.1557 1.7515 1.3224 0.0000 0.0000 0.0000 272 ILE B CB    
4077 C CG1   . ILE B 275 ? 1.1579 1.7128 1.2936 0.0000 0.0000 0.0000 272 ILE B CG1   
4078 C CG2   . ILE B 275 ? 1.1520 1.7611 1.3334 0.0000 0.0000 0.0000 272 ILE B CG2   
4079 C CD1   . ILE B 275 ? 1.1753 1.7151 1.3100 0.0000 0.0000 0.0000 272 ILE B CD1   
4080 N N     . ASP B 276 ? 1.2049 1.8256 1.3816 0.0000 0.0000 0.0000 273 ASP B N     
4081 C CA    . ASP B 276 ? 1.2330 1.8463 1.4076 0.0000 0.0000 0.0000 273 ASP B CA    
4082 C C     . ASP B 276 ? 1.2388 1.8135 1.4051 0.0000 0.0000 0.0000 273 ASP B C     
4083 O O     . ASP B 276 ? 1.2372 1.8046 1.4141 0.0000 0.0000 0.0000 273 ASP B O     
4084 C CB    . ASP B 276 ? 1.2479 1.9014 1.4611 0.0000 0.0000 0.0000 273 ASP B CB    
4085 C CG    . ASP B 276 ? 1.2810 1.9735 1.4967 0.0000 0.0000 0.0000 273 ASP B CG    
4086 O OD1   . ASP B 276 ? 1.3157 1.9977 1.4981 0.0000 0.0000 0.0000 273 ASP B OD1   
4087 O OD2   . ASP B 276 ? 1.3070 2.0418 1.5579 0.0000 0.0000 0.0000 273 ASP B OD2   
4088 N N     . SER B 277 ? 1.2504 1.8011 1.3969 0.0000 0.0000 0.0000 274 SER B N     
4089 C CA    . SER B 277 ? 1.2578 1.7708 1.3975 0.0000 0.0000 0.0000 274 SER B CA    
4090 C C     . SER B 277 ? 1.2711 1.7930 1.4462 0.0000 0.0000 0.0000 274 SER B C     
4091 O O     . SER B 277 ? 1.2716 1.8284 1.4725 0.0000 0.0000 0.0000 274 SER B O     
4092 C CB    . SER B 277 ? 1.2682 1.7533 1.3777 0.0000 0.0000 0.0000 274 SER B CB    
4093 O OG    . SER B 277 ? 1.2821 1.7765 1.4044 0.0000 0.0000 0.0000 274 SER B OG    
4094 N N     . ASN B 278 ? 1.2839 1.7745 1.4604 0.0000 0.0000 0.0000 275 ASN B N     
4095 C CA    . ASN B 278 ? 1.3062 1.7970 1.5168 0.0000 0.0000 0.0000 275 ASN B CA    
4096 C C     . ASN B 278 ? 1.3341 1.7964 1.5403 0.0000 0.0000 0.0000 275 ASN B C     
4097 O O     . ASN B 278 ? 1.3565 1.8030 1.5862 0.0000 0.0000 0.0000 275 ASN B O     
4098 C CB    . ASN B 278 ? 1.3067 1.7811 1.5229 0.0000 0.0000 0.0000 275 ASN B CB    
4099 C CG    . ASN B 278 ? 1.2850 1.7712 1.4860 0.0000 0.0000 0.0000 275 ASN B CG    
4100 O OD1   . ASN B 278 ? 1.2686 1.7892 1.4931 0.0000 0.0000 0.0000 275 ASN B OD1   
4101 N ND2   . ASN B 278 ? 1.2813 1.7406 1.4448 0.0000 0.0000 0.0000 275 ASN B ND2   
4102 N N     . THR B 279 ? 1.3389 1.7939 1.5154 0.0000 0.0000 0.0000 276 THR B N     
4103 C CA    . THR B 279 ? 1.3683 1.8033 1.5393 0.0000 0.0000 0.0000 276 THR B CA    
4104 C C     . THR B 279 ? 1.3696 1.8342 1.5266 0.0000 0.0000 0.0000 276 THR B C     
4105 O O     . THR B 279 ? 1.3639 1.8172 1.4852 0.0000 0.0000 0.0000 276 THR B O     
4106 C CB    . THR B 279 ? 1.3765 1.7617 1.5159 0.0000 0.0000 0.0000 276 THR B CB    
4107 O OG1   . THR B 279 ? 1.3515 1.7358 1.4566 0.0000 0.0000 0.0000 276 THR B OG1   
4108 C CG2   . THR B 279 ? 1.3935 1.7467 1.5442 0.0000 0.0000 0.0000 276 THR B CG2   
4109 N N     . PRO B 280 ? 1.3790 1.8845 1.5642 0.0000 0.0000 0.0000 277 PRO B N     
4110 C CA    . PRO B 280 ? 1.3842 1.9209 1.5544 0.0000 0.0000 0.0000 277 PRO B CA    
4111 C C     . PRO B 280 ? 1.4150 1.9377 1.5773 0.0000 0.0000 0.0000 277 PRO B C     
4112 O O     . PRO B 280 ? 1.4311 1.9207 1.6074 0.0000 0.0000 0.0000 277 PRO B O     
4113 C CB    . PRO B 280 ? 1.3809 1.9707 1.5875 0.0000 0.0000 0.0000 277 PRO B CB    
4114 C CG    . PRO B 280 ? 1.3679 1.9534 1.6069 0.0000 0.0000 0.0000 277 PRO B CG    
4115 C CD    . PRO B 280 ? 1.3796 1.9113 1.6109 0.0000 0.0000 0.0000 277 PRO B CD    
4116 N N     . PHE B 281 ? 1.4270 1.9736 1.5658 0.0000 0.0000 0.0000 278 PHE B N     
4117 C CA    . PHE B 281 ? 1.4613 2.0043 1.5915 0.0000 0.0000 0.0000 278 PHE B CA    
4118 C C     . PHE B 281 ? 1.4715 2.0705 1.6040 0.0000 0.0000 0.0000 278 PHE B C     
4119 O O     . PHE B 281 ? 1.4993 2.1102 1.6358 0.0000 0.0000 0.0000 278 PHE B O     
4120 C CB    . PHE B 281 ? 1.4650 1.9744 1.5507 0.0000 0.0000 0.0000 278 PHE B CB    
4121 C CG    . PHE B 281 ? 1.4859 1.9398 1.5707 0.0000 0.0000 0.0000 278 PHE B CG    
4122 C CD1   . PHE B 281 ? 1.5212 1.9468 1.6069 0.0000 0.0000 0.0000 278 PHE B CD1   
4123 C CD2   . PHE B 281 ? 1.4762 1.9068 1.5582 0.0000 0.0000 0.0000 278 PHE B CD2   
4124 C CE1   . PHE B 281 ? 1.5362 1.9096 1.6205 0.0000 0.0000 0.0000 278 PHE B CE1   
4125 C CE2   . PHE B 281 ? 1.4765 1.8585 1.5549 0.0000 0.0000 0.0000 278 PHE B CE2   
4126 C CZ    . PHE B 281 ? 1.5069 1.8597 1.5866 0.0000 0.0000 0.0000 278 PHE B CZ    
4127 O "O5'" . DA  C 1   ? 1.8392 1.8373 1.8962 0.0000 0.0000 0.0000 1   DA  C "O5'" 
4128 C "C5'" . DA  C 1   ? 1.8618 1.8479 1.9119 0.0000 0.0000 0.0000 1   DA  C "C5'" 
4129 C "C4'" . DA  C 1   ? 1.8874 1.8246 1.8609 0.0000 0.0000 0.0000 1   DA  C "C4'" 
4130 O "O4'" . DA  C 1   ? 1.9328 1.8451 1.8888 0.0000 0.0000 0.0000 1   DA  C "O4'" 
4131 C "C3'" . DA  C 1   ? 1.8613 1.7913 1.8088 0.0000 0.0000 0.0000 1   DA  C "C3'" 
4132 O "O3'" . DA  C 1   ? 1.8534 1.7505 1.7458 0.0000 0.0000 0.0000 1   DA  C "O3'" 
4133 C "C2'" . DA  C 1   ? 1.8829 1.7963 1.8191 0.0000 0.0000 0.0000 1   DA  C "C2'" 
4134 C "C1'" . DA  C 1   ? 1.9390 1.8363 1.8717 0.0000 0.0000 0.0000 1   DA  C "C1'" 
4135 N N9    . DA  C 1   ? 1.9649 1.8738 1.9347 0.0000 0.0000 0.0000 1   DA  C N9    
4136 C C8    . DA  C 1   ? 1.9964 1.8783 1.9380 0.0000 0.0000 0.0000 1   DA  C C8    
4137 N N7    . DA  C 1   ? 2.0079 1.9042 1.9926 0.0000 0.0000 0.0000 1   DA  C N7    
4138 C C5    . DA  C 1   ? 1.9884 1.9285 2.0415 0.0000 0.0000 0.0000 1   DA  C C5    
4139 C C6    . DA  C 1   ? 1.9842 1.9613 2.1169 0.0000 0.0000 0.0000 1   DA  C C6    
4140 N N6    . DA  C 1   ? 1.9986 1.9726 2.1527 0.0000 0.0000 0.0000 1   DA  C N6    
4141 N N1    . DA  C 1   ? 1.9600 1.9752 2.1507 0.0000 0.0000 0.0000 1   DA  C N1    
4142 C C2    . DA  C 1   ? 1.9399 1.9518 2.1029 0.0000 0.0000 0.0000 1   DA  C C2    
4143 N N3    . DA  C 1   ? 1.9418 1.9206 2.0317 0.0000 0.0000 0.0000 1   DA  C N3    
4144 C C4    . DA  C 1   ? 1.9639 1.9099 2.0048 0.0000 0.0000 0.0000 1   DA  C C4    
4145 P P     . DT  C 2   ? 1.8121 1.7180 1.6987 0.0000 0.0000 0.0000 2   DT  C P     
4146 O OP1   . DT  C 2   ? 1.8201 1.7018 1.6720 0.0000 0.0000 0.0000 2   DT  C OP1   
4147 O OP2   . DT  C 2   ? 1.8117 1.7058 1.6802 0.0000 0.0000 0.0000 2   DT  C OP2   
4148 O "O5'" . DT  C 2   ? 1.7232 1.6760 1.6687 0.0000 0.0000 0.0000 2   DT  C "O5'" 
4149 C "C5'" . DT  C 2   ? 1.6281 1.5887 1.5844 0.0000 0.0000 0.0000 2   DT  C "C5'" 
4150 C "C4'" . DT  C 2   ? 1.5336 1.5341 1.5421 0.0000 0.0000 0.0000 2   DT  C "C4'" 
4151 O "O4'" . DT  C 2   ? 1.5272 1.5540 1.5846 0.0000 0.0000 0.0000 2   DT  C "O4'" 
4152 C "C3'" . DT  C 2   ? 1.4748 1.4870 1.4837 0.0000 0.0000 0.0000 2   DT  C "C3'" 
4153 O "O3'" . DT  C 2   ? 1.4005 1.4039 1.3920 0.0000 0.0000 0.0000 2   DT  C "O3'" 
4154 C "C2'" . DT  C 2   ? 1.4811 1.5313 1.5456 0.0000 0.0000 0.0000 2   DT  C "C2'" 
4155 C "C1'" . DT  C 2   ? 1.5176 1.5778 1.6160 0.0000 0.0000 0.0000 2   DT  C "C1'" 
4156 N N1    . DT  C 2   ? 1.5732 1.6440 1.6973 0.0000 0.0000 0.0000 2   DT  C N1    
4157 C C2    . DT  C 2   ? 1.6125 1.6967 1.7787 0.0000 0.0000 0.0000 2   DT  C C2    
4158 O O2    . DT  C 2   ? 1.6282 1.7165 1.8119 0.0000 0.0000 0.0000 2   DT  C O2    
4159 N N3    . DT  C 2   ? 1.6418 1.7317 1.8297 0.0000 0.0000 0.0000 2   DT  C N3    
4160 C C4    . DT  C 2   ? 1.6545 1.7316 1.8175 0.0000 0.0000 0.0000 2   DT  C C4    
4161 O O4    . DT  C 2   ? 1.6884 1.7650 1.8689 0.0000 0.0000 0.0000 2   DT  C O4    
4162 C C5    . DT  C 2   ? 1.6250 1.6869 1.7417 0.0000 0.0000 0.0000 2   DT  C C5    
4163 C C7    . DT  C 2   ? 1.6166 1.6583 1.6993 0.0000 0.0000 0.0000 2   DT  C C7    
4164 C C6    . DT  C 2   ? 1.5962 1.6587 1.7005 0.0000 0.0000 0.0000 2   DT  C C6    
4165 P P     . DT  C 3   ? 1.3091 1.3269 1.3088 0.0000 0.0000 0.0000 3   DT  C P     
4166 O OP1   . DT  C 3   ? 1.3136 1.3087 1.2862 0.0000 0.0000 0.0000 3   DT  C OP1   
4167 O OP2   . DT  C 3   ? 1.3052 1.3243 1.2969 0.0000 0.0000 0.0000 3   DT  C OP2   
4168 O "O5'" . DT  C 3   ? 1.2613 1.3144 1.3127 0.0000 0.0000 0.0000 3   DT  C "O5'" 
4169 C "C5'" . DT  C 3   ? 1.2447 1.3041 1.3111 0.0000 0.0000 0.0000 3   DT  C "C5'" 
4170 C "C4'" . DT  C 3   ? 1.2204 1.3158 1.3366 0.0000 0.0000 0.0000 3   DT  C "C4'" 
4171 O "O4'" . DT  C 3   ? 1.2294 1.3404 1.3700 0.0000 0.0000 0.0000 3   DT  C "O4'" 
4172 C "C3'" . DT  C 3   ? 1.1872 1.2897 1.2984 0.0000 0.0000 0.0000 3   DT  C "C3'" 
4173 O "O3'" . DT  C 3   ? 1.1361 1.2590 1.2810 0.0000 0.0000 0.0000 3   DT  C "O3'" 
4174 C "C2'" . DT  C 3   ? 1.1944 1.3059 1.3106 0.0000 0.0000 0.0000 3   DT  C "C2'" 
4175 C "C1'" . DT  C 3   ? 1.2290 1.3559 1.3816 0.0000 0.0000 0.0000 3   DT  C "C1'" 
4176 N N1    . DT  C 3   ? 1.2743 1.3956 1.4186 0.0000 0.0000 0.0000 3   DT  C N1    
4177 C C2    . DT  C 3   ? 1.2907 1.4337 1.4722 0.0000 0.0000 0.0000 3   DT  C C2    
4178 O O2    . DT  C 3   ? 1.2882 1.4591 1.5154 0.0000 0.0000 0.0000 3   DT  C O2    
4179 N N3    . DT  C 3   ? 1.3231 1.4492 1.4834 0.0000 0.0000 0.0000 3   DT  C N3    
4180 C C4    . DT  C 3   ? 1.3452 1.4352 1.4518 0.0000 0.0000 0.0000 3   DT  C C4    
4181 O O4    . DT  C 3   ? 1.3846 1.4536 1.4681 0.0000 0.0000 0.0000 3   DT  C O4    
4182 C C5    . DT  C 3   ? 1.3327 1.4065 1.4094 0.0000 0.0000 0.0000 3   DT  C C5    
4183 C C7    . DT  C 3   ? 1.3553 1.3899 1.3773 0.0000 0.0000 0.0000 3   DT  C C7    
4184 C C6    . DT  C 3   ? 1.3039 1.3936 1.4001 0.0000 0.0000 0.0000 3   DT  C C6    
4185 P P     . DG  C 4   ? 1.1037 1.2104 1.2269 0.0000 0.0000 0.0000 4   DG  C P     
4186 O OP1   . DG  C 4   ? 1.0981 1.2282 1.2612 0.0000 0.0000 0.0000 4   DG  C OP1   
4187 O OP2   . DG  C 4   ? 1.1176 1.1909 1.2052 0.0000 0.0000 0.0000 4   DG  C OP2   
4188 O "O5'" . DG  C 4   ? 1.0900 1.1903 1.1870 0.0000 0.0000 0.0000 4   DG  C "O5'" 
4189 C "C5'" . DG  C 4   ? 1.0600 1.1833 1.1808 0.0000 0.0000 0.0000 4   DG  C "C5'" 
4190 C "C4'" . DG  C 4   ? 1.0545 1.1710 1.1532 0.0000 0.0000 0.0000 4   DG  C "C4'" 
4191 O "O4'" . DG  C 4   ? 1.0782 1.1738 1.1485 0.0000 0.0000 0.0000 4   DG  C "O4'" 
4192 C "C3'" . DG  C 4   ? 1.0364 1.1702 1.1516 0.0000 0.0000 0.0000 4   DG  C "C3'" 
4193 O "O3'" . DG  C 4   ? 1.0309 1.1580 1.1317 0.0000 0.0000 0.0000 4   DG  C "O3'" 
4194 C "C2'" . DG  C 4   ? 1.0407 1.1675 1.1436 0.0000 0.0000 0.0000 4   DG  C "C2'" 
4195 C "C1'" . DG  C 4   ? 1.0653 1.1671 1.1375 0.0000 0.0000 0.0000 4   DG  C "C1'" 
4196 N N9    . DG  C 4   ? 1.0721 1.1572 1.1269 0.0000 0.0000 0.0000 4   DG  C N9    
4197 C C8    . DG  C 4   ? 1.0754 1.1489 1.1231 0.0000 0.0000 0.0000 4   DG  C C8    
4198 N N7    . DG  C 4   ? 1.0864 1.1376 1.1099 0.0000 0.0000 0.0000 4   DG  C N7    
4199 C C5    . DG  C 4   ? 1.0816 1.1358 1.1052 0.0000 0.0000 0.0000 4   DG  C C5    
4200 C C6    . DG  C 4   ? 1.1016 1.1408 1.1128 0.0000 0.0000 0.0000 4   DG  C C6    
4201 O O6    . DG  C 4   ? 1.1383 1.1541 1.1289 0.0000 0.0000 0.0000 4   DG  C O6    
4202 N N1    . DG  C 4   ? 1.0955 1.1457 1.1206 0.0000 0.0000 0.0000 4   DG  C N1    
4203 C C2    . DG  C 4   ? 1.0875 1.1541 1.1257 0.0000 0.0000 0.0000 4   DG  C C2    
4204 N N2    . DG  C 4   ? 1.0936 1.1626 1.1399 0.0000 0.0000 0.0000 4   DG  C N2    
4205 N N3    . DG  C 4   ? 1.0758 1.1526 1.1192 0.0000 0.0000 0.0000 4   DG  C N3    
4206 C C4    . DG  C 4   ? 1.0731 1.1464 1.1137 0.0000 0.0000 0.0000 4   DG  C C4    
4207 P P     . DT  C 5   ? 1.0296 1.1640 1.1362 0.0000 0.0000 0.0000 5   DT  C P     
4208 O OP1   . DT  C 5   ? 1.0231 1.1400 1.1078 0.0000 0.0000 0.0000 5   DT  C OP1   
4209 O OP2   . DT  C 5   ? 1.0150 1.1716 1.1563 0.0000 0.0000 0.0000 5   DT  C OP2   
4210 O "O5'" . DT  C 5   ? 0.9948 1.1238 1.0889 0.0000 0.0000 0.0000 5   DT  C "O5'" 
4211 C "C5'" . DT  C 5   ? 1.0189 1.1303 1.0904 0.0000 0.0000 0.0000 5   DT  C "C5'" 
4212 C "C4'" . DT  C 5   ? 1.0232 1.1335 1.0938 0.0000 0.0000 0.0000 5   DT  C "C4'" 
4213 O "O4'" . DT  C 5   ? 1.0189 1.1293 1.0923 0.0000 0.0000 0.0000 5   DT  C "O4'" 
4214 C "C3'" . DT  C 5   ? 1.0216 1.1408 1.1006 0.0000 0.0000 0.0000 5   DT  C "C3'" 
4215 O "O3'" . DT  C 5   ? 1.0379 1.1431 1.1024 0.0000 0.0000 0.0000 5   DT  C "O3'" 
4216 C "C2'" . DT  C 5   ? 1.0033 1.1298 1.0920 0.0000 0.0000 0.0000 5   DT  C "C2'" 
4217 C "C1'" . DT  C 5   ? 0.9965 1.1133 1.0779 0.0000 0.0000 0.0000 5   DT  C "C1'" 
4218 N N1    . DT  C 5   ? 0.9726 1.0870 1.0531 0.0000 0.0000 0.0000 5   DT  C N1    
4219 C C2    . DT  C 5   ? 0.9660 1.0680 1.0380 0.0000 0.0000 0.0000 5   DT  C C2    
4220 O O2    . DT  C 5   ? 0.9718 1.0712 1.0467 0.0000 0.0000 0.0000 5   DT  C O2    
4221 N N3    . DT  C 5   ? 0.9703 1.0598 1.0303 0.0000 0.0000 0.0000 5   DT  C N3    
4222 C C4    . DT  C 5   ? 0.9724 1.0628 1.0327 0.0000 0.0000 0.0000 5   DT  C C4    
4223 O O4    . DT  C 5   ? 0.9673 1.0390 1.0110 0.0000 0.0000 0.0000 5   DT  C O4    
4224 C C5    . DT  C 5   ? 0.9758 1.0872 1.0572 0.0000 0.0000 0.0000 5   DT  C C5    
4225 C C7    . DT  C 5   ? 0.9820 1.1014 1.0789 0.0000 0.0000 0.0000 5   DT  C C7    
4226 C C6    . DT  C 5   ? 0.9741 1.0947 1.0617 0.0000 0.0000 0.0000 5   DT  C C6    
4227 P P     . DC  C 6   ? 1.0544 1.1561 1.1146 0.0000 0.0000 0.0000 6   DC  C P     
4228 O OP1   . DC  C 6   ? 1.0785 1.1556 1.1146 0.0000 0.0000 0.0000 6   DC  C OP1   
4229 O OP2   . DC  C 6   ? 1.0459 1.1584 1.1156 0.0000 0.0000 0.0000 6   DC  C OP2   
4230 O "O5'" . DC  C 6   ? 1.0420 1.1527 1.1160 0.0000 0.0000 0.0000 6   DC  C "O5'" 
4231 C "C5'" . DC  C 6   ? 1.0378 1.1430 1.1152 0.0000 0.0000 0.0000 6   DC  C "C5'" 
4232 C "C4'" . DC  C 6   ? 1.0210 1.1345 1.1128 0.0000 0.0000 0.0000 6   DC  C "C4'" 
4233 O "O4'" . DC  C 6   ? 1.0177 1.1381 1.1146 0.0000 0.0000 0.0000 6   DC  C "O4'" 
4234 C "C3'" . DC  C 6   ? 1.0130 1.1273 1.1018 0.0000 0.0000 0.0000 6   DC  C "C3'" 
4235 O "O3'" . DC  C 6   ? 1.0087 1.1215 1.1078 0.0000 0.0000 0.0000 6   DC  C "O3'" 
4236 C "C2'" . DC  C 6   ? 1.0108 1.1362 1.1053 0.0000 0.0000 0.0000 6   DC  C "C2'" 
4237 C "C1'" . DC  C 6   ? 1.0134 1.1390 1.1127 0.0000 0.0000 0.0000 6   DC  C "C1'" 
4238 N N1    . DC  C 6   ? 1.0218 1.1494 1.1192 0.0000 0.0000 0.0000 6   DC  C N1    
4239 C C2    . DC  C 6   ? 1.0389 1.1561 1.1300 0.0000 0.0000 0.0000 6   DC  C C2    
4240 O O2    . DC  C 6   ? 1.0454 1.1566 1.1392 0.0000 0.0000 0.0000 6   DC  C O2    
4241 N N3    . DC  C 6   ? 1.0542 1.1646 1.1360 0.0000 0.0000 0.0000 6   DC  C N3    
4242 C C4    . DC  C 6   ? 1.0466 1.1674 1.1364 0.0000 0.0000 0.0000 6   DC  C C4    
4243 N N4    . DC  C 6   ? 1.0434 1.1561 1.1273 0.0000 0.0000 0.0000 6   DC  C N4    
4244 C C5    . DC  C 6   ? 1.0466 1.1831 1.1505 0.0000 0.0000 0.0000 6   DC  C C5    
4245 C C6    . DC  C 6   ? 1.0354 1.1713 1.1372 0.0000 0.0000 0.0000 6   DC  C C6    
4246 P P     . DA  C 7   ? 1.0127 1.1151 1.1054 0.0000 0.0000 0.0000 7   DA  C P     
4247 O OP1   . DA  C 7   ? 1.0175 1.1023 1.0972 0.0000 0.0000 0.0000 7   DA  C OP1   
4248 O OP2   . DA  C 7   ? 0.9971 1.1006 1.0797 0.0000 0.0000 0.0000 7   DA  C OP2   
4249 O "O5'" . DA  C 7   ? 1.0120 1.1213 1.1298 0.0000 0.0000 0.0000 7   DA  C "O5'" 
4250 C "C5'" . DA  C 7   ? 1.0245 1.1345 1.1648 0.0000 0.0000 0.0000 7   DA  C "C5'" 
4251 C "C4'" . DA  C 7   ? 1.0280 1.1479 1.1938 0.0000 0.0000 0.0000 7   DA  C "C4'" 
4252 O "O4'" . DA  C 7   ? 1.0263 1.1481 1.1804 0.0000 0.0000 0.0000 7   DA  C "O4'" 
4253 C "C3'" . DA  C 7   ? 1.0268 1.1467 1.1991 0.0000 0.0000 0.0000 7   DA  C "C3'" 
4254 O "O3'" . DA  C 7   ? 1.0276 1.1539 1.2348 0.0000 0.0000 0.0000 7   DA  C "O3'" 
4255 C "C2'" . DA  C 7   ? 1.0197 1.1387 1.1702 0.0000 0.0000 0.0000 7   DA  C "C2'" 
4256 C "C1'" . DA  C 7   ? 1.0280 1.1484 1.1757 0.0000 0.0000 0.0000 7   DA  C "C1'" 
4257 N N9    . DA  C 7   ? 1.0262 1.1453 1.1513 0.0000 0.0000 0.0000 7   DA  C N9    
4258 C C8    . DA  C 7   ? 1.0381 1.1596 1.1521 0.0000 0.0000 0.0000 7   DA  C C8    
4259 N N7    . DA  C 7   ? 1.0565 1.1799 1.1612 0.0000 0.0000 0.0000 7   DA  C N7    
4260 C C5    . DA  C 7   ? 1.0423 1.1593 1.1442 0.0000 0.0000 0.0000 7   DA  C C5    
4261 C C6    . DA  C 7   ? 1.0474 1.1575 1.1368 0.0000 0.0000 0.0000 7   DA  C C6    
4262 N N6    . DA  C 7   ? 1.0565 1.1733 1.1458 0.0000 0.0000 0.0000 7   DA  C N6    
4263 N N1    . DA  C 7   ? 1.0435 1.1364 1.1210 0.0000 0.0000 0.0000 7   DA  C N1    
4264 C C2    . DA  C 7   ? 1.0553 1.1444 1.1416 0.0000 0.0000 0.0000 7   DA  C C2    
4265 N N3    . DA  C 7   ? 1.0435 1.1446 1.1522 0.0000 0.0000 0.0000 7   DA  C N3    
4266 C C4    . DA  C 7   ? 1.0330 1.1459 1.1453 0.0000 0.0000 0.0000 7   DA  C C4    
4267 P P     . DT  C 8   ? 1.0361 1.1630 1.2608 0.0000 0.0000 0.0000 8   DT  C P     
4268 O OP1   . DT  C 8   ? 1.0270 1.1632 1.3009 0.0000 0.0000 0.0000 8   DT  C OP1   
4269 O OP2   . DT  C 8   ? 1.0543 1.1715 1.2560 0.0000 0.0000 0.0000 8   DT  C OP2   
4270 O "O5'" . DT  C 8   ? 1.0423 1.1640 1.2456 0.0000 0.0000 0.0000 8   DT  C "O5'" 
4271 C "C5'" . DT  C 8   ? 1.0592 1.1775 1.2659 0.0000 0.0000 0.0000 8   DT  C "C5'" 
4272 C "C4'" . DT  C 8   ? 1.0739 1.1773 1.2505 0.0000 0.0000 0.0000 8   DT  C "C4'" 
4273 O "O4'" . DT  C 8   ? 1.0727 1.1715 1.2163 0.0000 0.0000 0.0000 8   DT  C "O4'" 
4274 C "C3'" . DT  C 8   ? 1.0911 1.1906 1.2632 0.0000 0.0000 0.0000 8   DT  C "C3'" 
4275 O "O3'" . DT  C 8   ? 1.1423 1.2320 1.3248 0.0000 0.0000 0.0000 8   DT  C "O3'" 
4276 C "C2'" . DT  C 8   ? 1.0781 1.1687 1.2116 0.0000 0.0000 0.0000 8   DT  C "C2'" 
4277 C "C1'" . DT  C 8   ? 1.0711 1.1593 1.1907 0.0000 0.0000 0.0000 8   DT  C "C1'" 
4278 N N1    . DT  C 8   ? 1.0476 1.1407 1.1505 0.0000 0.0000 0.0000 8   DT  C N1    
4279 C C2    . DT  C 8   ? 1.0508 1.1333 1.1316 0.0000 0.0000 0.0000 8   DT  C C2    
4280 O O2    . DT  C 8   ? 1.0619 1.1247 1.1260 0.0000 0.0000 0.0000 8   DT  C O2    
4281 N N3    . DT  C 8   ? 1.0429 1.1351 1.1209 0.0000 0.0000 0.0000 8   DT  C N3    
4282 C C4    . DT  C 8   ? 1.0328 1.1393 1.1210 0.0000 0.0000 0.0000 8   DT  C C4    
4283 O O4    . DT  C 8   ? 1.0348 1.1483 1.1225 0.0000 0.0000 0.0000 8   DT  C O4    
4284 C C5    . DT  C 8   ? 1.0221 1.1311 1.1216 0.0000 0.0000 0.0000 8   DT  C C5    
4285 C C7    . DT  C 8   ? 1.0226 1.1347 1.1215 0.0000 0.0000 0.0000 8   DT  C C7    
4286 C C6    . DT  C 8   ? 1.0246 1.1293 1.1345 0.0000 0.0000 0.0000 8   DT  C C6    
4287 P P     . DG  C 9   ? 1.1929 1.2764 1.3768 0.0000 0.0000 0.0000 9   DG  C P     
4288 O OP1   . DG  C 9   ? 1.1975 1.2821 1.4193 0.0000 0.0000 0.0000 9   DG  C OP1   
4289 O OP2   . DG  C 9   ? 1.1588 1.2492 1.3389 0.0000 0.0000 0.0000 9   DG  C OP2   
4290 O "O5'" . DG  C 9   ? 1.1887 1.2471 1.3240 0.0000 0.0000 0.0000 9   DG  C "O5'" 
4291 C "C5'" . DG  C 9   ? 1.1736 1.2079 1.2900 0.0000 0.0000 0.0000 9   DG  C "C5'" 
4292 C "C4'" . DG  C 9   ? 1.1742 1.1839 1.2430 0.0000 0.0000 0.0000 9   DG  C "C4'" 
4293 O "O4'" . DG  C 9   ? 1.1645 1.1856 1.2209 0.0000 0.0000 0.0000 9   DG  C "O4'" 
4294 C "C3'" . DG  C 9   ? 1.1679 1.1719 1.2336 0.0000 0.0000 0.0000 9   DG  C "C3'" 
4295 O "O3'" . DG  C 9   ? 1.1985 1.1684 1.2194 0.0000 0.0000 0.0000 9   DG  C "O3'" 
4296 C "C2'" . DG  C 9   ? 1.1513 1.1742 1.2188 0.0000 0.0000 0.0000 9   DG  C "C2'" 
4297 C "C1'" . DG  C 9   ? 1.1529 1.1769 1.2023 0.0000 0.0000 0.0000 9   DG  C "C1'" 
4298 N N9    . DG  C 9   ? 1.1169 1.1642 1.1793 0.0000 0.0000 0.0000 9   DG  C N9    
4299 C C8    . DG  C 9   ? 1.1072 1.1708 1.1927 0.0000 0.0000 0.0000 9   DG  C C8    
4300 N N7    . DG  C 9   ? 1.0887 1.1633 1.1731 0.0000 0.0000 0.0000 9   DG  C N7    
4301 C C5    . DG  C 9   ? 1.0770 1.1483 1.1451 0.0000 0.0000 0.0000 9   DG  C C5    
4302 C C6    . DG  C 9   ? 1.0605 1.1418 1.1269 0.0000 0.0000 0.0000 9   DG  C C6    
4303 O O6    . DG  C 9   ? 1.0502 1.1415 1.1232 0.0000 0.0000 0.0000 9   DG  C O6    
4304 N N1    . DG  C 9   ? 1.0622 1.1370 1.1169 0.0000 0.0000 0.0000 9   DG  C N1    
4305 C C2    . DG  C 9   ? 1.0817 1.1352 1.1180 0.0000 0.0000 0.0000 9   DG  C C2    
4306 N N2    . DG  C 9   ? 1.0894 1.1323 1.1113 0.0000 0.0000 0.0000 9   DG  C N2    
4307 N N3    . DG  C 9   ? 1.0928 1.1325 1.1241 0.0000 0.0000 0.0000 9   DG  C N3    
4308 C C4    . DG  C 9   ? 1.0899 1.1431 1.1425 0.0000 0.0000 0.0000 9   DG  C C4    
4309 P P     . DG  C 10  ? 1.2400 1.1730 1.2400 0.0000 0.0000 0.0000 10  DG  C P     
4310 O OP1   . DG  C 10  ? 1.2630 1.1867 1.2623 0.0000 0.0000 0.0000 10  DG  C OP1   
4311 O OP2   . DG  C 10  ? 1.2364 1.1750 1.2641 0.0000 0.0000 0.0000 10  DG  C OP2   
4312 O "O5'" . DG  C 10  ? 1.2699 1.1638 1.2093 0.0000 0.0000 0.0000 10  DG  C "O5'" 
4313 C "C5'" . DG  C 10  ? 1.2727 1.1745 1.2048 0.0000 0.0000 0.0000 10  DG  C "C5'" 
4314 C "C4'" . DG  C 10  ? 1.3056 1.1883 1.2003 0.0000 0.0000 0.0000 10  DG  C "C4'" 
4315 O "O4'" . DG  C 10  ? 1.2791 1.1981 1.2012 0.0000 0.0000 0.0000 10  DG  C "O4'" 
4316 C "C3'" . DG  C 10  ? 1.3451 1.2073 1.2104 0.0000 0.0000 0.0000 10  DG  C "C3'" 
4317 O "O3'" . DG  C 10  ? 1.4003 1.2297 1.2253 0.0000 0.0000 0.0000 10  DG  C "O3'" 
4318 C "C2'" . DG  C 10  ? 1.3029 1.2049 1.2009 0.0000 0.0000 0.0000 10  DG  C "C2'" 
4319 C "C1'" . DG  C 10  ? 1.2735 1.2015 1.1949 0.0000 0.0000 0.0000 10  DG  C "C1'" 
4320 N N9    . DG  C 10  ? 1.2344 1.2016 1.1935 0.0000 0.0000 0.0000 10  DG  C N9    
4321 C C8    . DG  C 10  ? 1.2166 1.2003 1.2000 0.0000 0.0000 0.0000 10  DG  C C8    
4322 N N7    . DG  C 10  ? 1.1860 1.1950 1.1904 0.0000 0.0000 0.0000 10  DG  C N7    
4323 C C5    . DG  C 10  ? 1.1740 1.1879 1.1733 0.0000 0.0000 0.0000 10  DG  C C5    
4324 C C6    . DG  C 10  ? 1.1472 1.1830 1.1625 0.0000 0.0000 0.0000 10  DG  C C6    
4325 O O6    . DG  C 10  ? 1.1416 1.1919 1.1709 0.0000 0.0000 0.0000 10  DG  C O6    
4326 N N1    . DG  C 10  ? 1.1416 1.1774 1.1538 0.0000 0.0000 0.0000 10  DG  C N1    
4327 C C2    . DG  C 10  ? 1.1725 1.1848 1.1626 0.0000 0.0000 0.0000 10  DG  C C2    
4328 N N2    . DG  C 10  ? 1.1849 1.1992 1.1779 0.0000 0.0000 0.0000 10  DG  C N2    
4329 N N3    . DG  C 10  ? 1.2040 1.1887 1.1691 0.0000 0.0000 0.0000 10  DG  C N3    
4330 C C4    . DG  C 10  ? 1.2046 1.1942 1.1787 0.0000 0.0000 0.0000 10  DG  C C4    
4331 P P     . DA  C 11  ? 1.4505 1.2456 1.2363 0.0000 0.0000 0.0000 11  DA  C P     
4332 O OP1   . DA  C 11  ? 1.5027 1.2393 1.2310 0.0000 0.0000 0.0000 11  DA  C OP1   
4333 O OP2   . DA  C 11  ? 1.4366 1.2376 1.2307 0.0000 0.0000 0.0000 11  DA  C OP2   
4334 O "O5'" . DA  C 11  ? 1.4138 1.2395 1.2247 0.0000 0.0000 0.0000 11  DA  C "O5'" 
4335 C "C5'" . DA  C 11  ? 1.4397 1.2595 1.2445 0.0000 0.0000 0.0000 11  DA  C "C5'" 
4336 C "C4'" . DA  C 11  ? 1.4353 1.2875 1.2740 0.0000 0.0000 0.0000 11  DA  C "C4'" 
4337 O "O4'" . DA  C 11  ? 1.3885 1.2900 1.2739 0.0000 0.0000 0.0000 11  DA  C "O4'" 
4338 C "C3'" . DA  C 11  ? 1.4634 1.3012 1.2911 0.0000 0.0000 0.0000 11  DA  C "C3'" 
4339 O "O3'" . DA  C 11  ? 1.4901 1.3163 1.3160 0.0000 0.0000 0.0000 11  DA  C "O3'" 
4340 C "C2'" . DA  C 11  ? 1.4215 1.2999 1.2874 0.0000 0.0000 0.0000 11  DA  C "C2'" 
4341 C "C1'" . DA  C 11  ? 1.3737 1.2920 1.2771 0.0000 0.0000 0.0000 11  DA  C "C1'" 
4342 N N9    . DA  C 11  ? 1.3450 1.2856 1.2666 0.0000 0.0000 0.0000 11  DA  C N9    
4343 C C8    . DA  C 11  ? 1.3587 1.2854 1.2661 0.0000 0.0000 0.0000 11  DA  C C8    
4344 N N7    . DA  C 11  ? 1.3330 1.2822 1.2628 0.0000 0.0000 0.0000 11  DA  C N7    
4345 C C5    . DA  C 11  ? 1.3056 1.2817 1.2595 0.0000 0.0000 0.0000 11  DA  C C5    
4346 C C6    . DA  C 11  ? 1.2828 1.2820 1.2581 0.0000 0.0000 0.0000 11  DA  C C6    
4347 N N6    . DA  C 11  ? 1.2854 1.2842 1.2619 0.0000 0.0000 0.0000 11  DA  C N6    
4348 N N1    . DA  C 11  ? 1.2676 1.2863 1.2617 0.0000 0.0000 0.0000 11  DA  C N1    
4349 C C2    . DA  C 11  ? 1.2718 1.2920 1.2713 0.0000 0.0000 0.0000 11  DA  C C2    
4350 N N3    . DA  C 11  ? 1.2921 1.2909 1.2731 0.0000 0.0000 0.0000 11  DA  C N3    
4351 C C4    . DA  C 11  ? 1.3127 1.2873 1.2668 0.0000 0.0000 0.0000 11  DA  C C4    
4352 P P     . DA  C 12  ? 1.4895 1.3440 1.3567 0.0000 0.0000 0.0000 12  DA  C P     
4353 O OP1   . DA  C 12  ? 1.5165 1.3545 1.3826 0.0000 0.0000 0.0000 12  DA  C OP1   
4354 O OP2   . DA  C 12  ? 1.4927 1.3378 1.3497 0.0000 0.0000 0.0000 12  DA  C OP2   
4355 O "O5'" . DA  C 12  ? 1.4421 1.3534 1.3643 0.0000 0.0000 0.0000 12  DA  C "O5'" 
4356 C "C5'" . DA  C 12  ? 1.4134 1.3580 1.3833 0.0000 0.0000 0.0000 12  DA  C "C5'" 
4357 C "C4'" . DA  C 12  ? 1.3757 1.3555 1.3853 0.0000 0.0000 0.0000 12  DA  C "C4'" 
4358 O "O4'" . DA  C 12  ? 1.3505 1.3382 1.3511 0.0000 0.0000 0.0000 12  DA  C "O4'" 
4359 C "C3'" . DA  C 12  ? 1.3918 1.3605 1.4042 0.0000 0.0000 0.0000 12  DA  C "C3'" 
4360 O "O3'" . DA  C 12  ? 1.3666 1.3705 1.4271 0.0000 0.0000 0.0000 12  DA  C "O3'" 
4361 C "C2'" . DA  C 12  ? 1.4031 1.3500 1.3759 0.0000 0.0000 0.0000 12  DA  C "C2'" 
4362 C "C1'" . DA  C 12  ? 1.3629 1.3399 1.3538 0.0000 0.0000 0.0000 12  DA  C "C1'" 
4363 N N9    . DA  C 12  ? 1.3645 1.3296 1.3279 0.0000 0.0000 0.0000 12  DA  C N9    
4364 C C8    . DA  C 12  ? 1.3918 1.3268 1.3181 0.0000 0.0000 0.0000 12  DA  C C8    
4365 N N7    . DA  C 12  ? 1.3855 1.3198 1.3035 0.0000 0.0000 0.0000 12  DA  C N7    
4366 C C5    . DA  C 12  ? 1.3593 1.3204 1.3034 0.0000 0.0000 0.0000 12  DA  C C5    
4367 C C6    . DA  C 12  ? 1.3458 1.3138 1.2918 0.0000 0.0000 0.0000 12  DA  C C6    
4368 N N6    . DA  C 12  ? 1.3548 1.3094 1.2853 0.0000 0.0000 0.0000 12  DA  C N6    
4369 N N1    . DA  C 12  ? 1.3325 1.3180 1.2963 0.0000 0.0000 0.0000 12  DA  C N1    
4370 C C2    . DA  C 12  ? 1.3287 1.3300 1.3157 0.0000 0.0000 0.0000 12  DA  C C2    
4371 N N3    . DA  C 12  ? 1.3315 1.3342 1.3288 0.0000 0.0000 0.0000 12  DA  C N3    
4372 C C4    . DA  C 12  ? 1.3483 1.3279 1.3192 0.0000 0.0000 0.0000 12  DA  C C4    
4373 P P     . DT  C 13  ? 1.3681 1.3843 1.4744 0.0000 0.0000 0.0000 13  DT  C P     
4374 O OP1   . DT  C 13  ? 1.3603 1.3923 1.4986 0.0000 0.0000 0.0000 13  DT  C OP1   
4375 O OP2   . DT  C 13  ? 1.4060 1.3885 1.4847 0.0000 0.0000 0.0000 13  DT  C OP2   
4376 O "O5'" . DT  C 13  ? 1.3760 1.4225 1.5186 0.0000 0.0000 0.0000 13  DT  C "O5'" 
4377 C "C5'" . DT  C 13  ? 1.3745 1.4406 1.5198 0.0000 0.0000 0.0000 13  DT  C "C5'" 
4378 C "C4'" . DT  C 13  ? 1.3856 1.4444 1.5112 0.0000 0.0000 0.0000 13  DT  C "C4'" 
4379 O "O4'" . DT  C 13  ? 1.3977 1.4302 1.4713 0.0000 0.0000 0.0000 13  DT  C "O4'" 
4380 C "C3'" . DT  C 13  ? 1.4068 1.4570 1.5427 0.0000 0.0000 0.0000 13  DT  C "C3'" 
4381 O "O3'" . DT  C 13  ? 1.4075 1.4694 1.5577 0.0000 0.0000 0.0000 13  DT  C "O3'" 
4382 C "C2'" . DT  C 13  ? 1.4327 1.4463 1.5127 0.0000 0.0000 0.0000 13  DT  C "C2'" 
4383 C "C1'" . DT  C 13  ? 1.4224 1.4358 1.4751 0.0000 0.0000 0.0000 13  DT  C "C1'" 
4384 N N1    . DT  C 13  ? 1.4519 1.4355 1.4561 0.0000 0.0000 0.0000 13  DT  C N1    
4385 C C2    . DT  C 13  ? 1.4574 1.4307 1.4363 0.0000 0.0000 0.0000 13  DT  C C2    
4386 O O2    . DT  C 13  ? 1.4589 1.4407 1.4449 0.0000 0.0000 0.0000 13  DT  C O2    
4387 N N3    . DT  C 13  ? 1.4673 1.4158 1.4105 0.0000 0.0000 0.0000 13  DT  C N3    
4388 C C4    . DT  C 13  ? 1.4783 1.4081 1.4034 0.0000 0.0000 0.0000 13  DT  C C4    
4389 O O4    . DT  C 13  ? 1.4925 1.3997 1.3874 0.0000 0.0000 0.0000 13  DT  C O4    
4390 C C5    . DT  C 13  ? 1.4788 1.4134 1.4217 0.0000 0.0000 0.0000 13  DT  C C5    
4391 C C7    . DT  C 13  ? 1.5001 1.4049 1.4146 0.0000 0.0000 0.0000 13  DT  C C7    
4392 C C6    . DT  C 13  ? 1.4690 1.4318 1.4532 0.0000 0.0000 0.0000 13  DT  C C6    
4393 P P     . DT  C 14  ? 1.4370 1.4982 1.6132 0.0000 0.0000 0.0000 14  DT  C P     
4394 O OP1   . DT  C 14  ? 1.4128 1.5070 1.6447 0.0000 0.0000 0.0000 14  DT  C OP1   
4395 O OP2   . DT  C 14  ? 1.4579 1.5018 1.6336 0.0000 0.0000 0.0000 14  DT  C OP2   
4396 O "O5'" . DT  C 14  ? 1.4507 1.4820 1.5716 0.0000 0.0000 0.0000 14  DT  C "O5'" 
4397 C "C5'" . DT  C 14  ? 1.4173 1.4523 1.5219 0.0000 0.0000 0.0000 14  DT  C "C5'" 
4398 C "C4'" . DT  C 14  ? 1.4153 1.4126 1.4618 0.0000 0.0000 0.0000 14  DT  C "C4'" 
4399 O "O4'" . DT  C 14  ? 1.4006 1.3817 1.4130 0.0000 0.0000 0.0000 14  DT  C "O4'" 
4400 C "C3'" . DT  C 14  ? 1.4442 1.4154 1.4795 0.0000 0.0000 0.0000 14  DT  C "C3'" 
4401 O "O3'" . DT  C 14  ? 1.4739 1.4219 1.4772 0.0000 0.0000 0.0000 14  DT  C "O3'" 
4402 C "C2'" . DT  C 14  ? 1.4575 1.4001 1.4542 0.0000 0.0000 0.0000 14  DT  C "C2'" 
4403 C "C1'" . DT  C 14  ? 1.4265 1.3713 1.4003 0.0000 0.0000 0.0000 14  DT  C "C1'" 
4404 N N1    . DT  C 14  ? 1.4214 1.3544 1.3771 0.0000 0.0000 0.0000 14  DT  C N1    
4405 C C2    . DT  C 14  ? 1.4310 1.3405 1.3446 0.0000 0.0000 0.0000 14  DT  C C2    
4406 O O2    . DT  C 14  ? 1.4564 1.3549 1.3489 0.0000 0.0000 0.0000 14  DT  C O2    
4407 N N3    . DT  C 14  ? 1.4318 1.3281 1.3285 0.0000 0.0000 0.0000 14  DT  C N3    
4408 C C4    . DT  C 14  ? 1.4313 1.3300 1.3411 0.0000 0.0000 0.0000 14  DT  C C4    
4409 O O4    . DT  C 14  ? 1.4401 1.3188 1.3250 0.0000 0.0000 0.0000 14  DT  C O4    
4410 C C5    . DT  C 14  ? 1.4254 1.3485 1.3802 0.0000 0.0000 0.0000 14  DT  C C5    
4411 C C7    . DT  C 14  ? 1.4346 1.3584 1.4073 0.0000 0.0000 0.0000 14  DT  C C7    
4412 C C6    . DT  C 14  ? 1.4164 1.3582 1.3959 0.0000 0.0000 0.0000 14  DT  C C6    
4413 P P     . DT  C 15  ? 1.5409 1.4409 1.5006 0.0000 0.0000 0.0000 15  DT  C P     
4414 O OP1   . DT  C 15  ? 1.5478 1.4555 1.5374 0.0000 0.0000 0.0000 15  DT  C OP1   
4415 O OP2   . DT  C 15  ? 1.5559 1.4342 1.4995 0.0000 0.0000 0.0000 15  DT  C OP2   
4416 O "O5'" . DT  C 15  ? 1.5573 1.4216 1.4515 0.0000 0.0000 0.0000 15  DT  C "O5'" 
4417 C "C5'" . DT  C 15  ? 1.5237 1.3965 1.4069 0.0000 0.0000 0.0000 15  DT  C "C5'" 
4418 C "C4'" . DT  C 15  ? 1.5582 1.3854 1.3806 0.0000 0.0000 0.0000 15  DT  C "C4'" 
4419 O "O4'" . DT  C 15  ? 1.5537 1.3854 1.3792 0.0000 0.0000 0.0000 15  DT  C "O4'" 
4420 C "C3'" . DT  C 15  ? 1.6218 1.3941 1.3920 0.0000 0.0000 0.0000 15  DT  C "C3'" 
4421 O "O3'" . DT  C 15  ? 1.6476 1.3815 1.3633 0.0000 0.0000 0.0000 15  DT  C "O3'" 
4422 C "C2'" . DT  C 15  ? 1.6319 1.3985 1.4058 0.0000 0.0000 0.0000 15  DT  C "C2'" 
4423 C "C1'" . DT  C 15  ? 1.5941 1.3835 1.3794 0.0000 0.0000 0.0000 15  DT  C "C1'" 
4424 N N1    . DT  C 15  ? 1.5798 1.3823 1.3858 0.0000 0.0000 0.0000 15  DT  C N1    
4425 C C2    . DT  C 15  ? 1.5766 1.3661 1.3587 0.0000 0.0000 0.0000 15  DT  C C2    
4426 O O2    . DT  C 15  ? 1.5836 1.3559 1.3366 0.0000 0.0000 0.0000 15  DT  C O2    
4427 N N3    . DT  C 15  ? 1.5700 1.3652 1.3645 0.0000 0.0000 0.0000 15  DT  C N3    
4428 C C4    . DT  C 15  ? 1.5620 1.3749 1.3925 0.0000 0.0000 0.0000 15  DT  C C4    
4429 O O4    . DT  C 15  ? 1.5597 1.3699 1.3933 0.0000 0.0000 0.0000 15  DT  C O4    
4430 C C5    . DT  C 15  ? 1.5589 1.3913 1.4239 0.0000 0.0000 0.0000 15  DT  C C5    
4431 C C7    . DT  C 15  ? 1.5494 1.4058 1.4666 0.0000 0.0000 0.0000 15  DT  C C7    
4432 C C6    . DT  C 15  ? 1.5682 1.3941 1.4181 0.0000 0.0000 0.0000 15  DT  C C6    
4433 P P     . DT  C 16  ? 1.7241 1.3852 1.3636 0.0000 0.0000 0.0000 16  DT  C P     
4434 O OP1   . DT  C 16  ? 1.7353 1.3772 1.3464 0.0000 0.0000 0.0000 16  DT  C OP1   
4435 O OP2   . DT  C 16  ? 1.7580 1.3990 1.3924 0.0000 0.0000 0.0000 16  DT  C OP2   
4436 O "O5'" . DT  C 16  ? 1.7398 1.3745 1.3460 0.0000 0.0000 0.0000 16  DT  C "O5'" 
4437 C "C5'" . DT  C 16  ? 1.7117 1.3711 1.3357 0.0000 0.0000 0.0000 16  DT  C "C5'" 
4438 C "C4'" . DT  C 16  ? 1.7178 1.3556 1.3190 0.0000 0.0000 0.0000 16  DT  C "C4'" 
4439 O "O4'" . DT  C 16  ? 1.6859 1.3554 1.3238 0.0000 0.0000 0.0000 16  DT  C "O4'" 
4440 C "C3'" . DT  C 16  ? 1.7843 1.3539 1.3168 0.0000 0.0000 0.0000 16  DT  C "C3'" 
4441 O "O3'" . DT  C 16  ? 1.8091 1.3534 1.3133 0.0000 0.0000 0.0000 16  DT  C "O3'" 
4442 C "C2'" . DT  C 16  ? 1.7872 1.3581 1.3280 0.0000 0.0000 0.0000 16  DT  C "C2'" 
4443 C "C1'" . DT  C 16  ? 1.7193 1.3481 1.3190 0.0000 0.0000 0.0000 16  DT  C "C1'" 
4444 N N1    . DT  C 16  ? 1.6858 1.3404 1.3215 0.0000 0.0000 0.0000 16  DT  C N1    
4445 C C2    . DT  C 16  ? 1.6618 1.3256 1.3063 0.0000 0.0000 0.0000 16  DT  C C2    
4446 O O2    . DT  C 16  ? 1.6555 1.3102 1.2840 0.0000 0.0000 0.0000 16  DT  C O2    
4447 N N3    . DT  C 16  ? 1.6547 1.3359 1.3281 0.0000 0.0000 0.0000 16  DT  C N3    
4448 C C4    . DT  C 16  ? 1.6627 1.3594 1.3675 0.0000 0.0000 0.0000 16  DT  C C4    
4449 O O4    . DT  C 16  ? 1.6529 1.3650 1.3878 0.0000 0.0000 0.0000 16  DT  C O4    
4450 C C5    . DT  C 16  ? 1.6794 1.3697 1.3791 0.0000 0.0000 0.0000 16  DT  C C5    
4451 C C7    . DT  C 16  ? 1.6879 1.3947 1.4261 0.0000 0.0000 0.0000 16  DT  C C7    
4452 C C6    . DT  C 16  ? 1.6896 1.3564 1.3505 0.0000 0.0000 0.0000 16  DT  C C6    
4453 P P     . DG  C 17  ? 1.8943 1.3599 1.3179 0.0000 0.0000 0.0000 17  DG  C P     
4454 O OP1   . DG  C 17  ? 1.8846 1.3471 1.3070 0.0000 0.0000 0.0000 17  DG  C OP1   
4455 O OP2   . DG  C 17  ? 1.9391 1.3601 1.3176 0.0000 0.0000 0.0000 17  DG  C OP2   
4456 O "O5'" . DG  C 17  ? 1.9179 1.3647 1.3246 0.0000 0.0000 0.0000 17  DG  C "O5'" 
4457 C "C5'" . DG  C 17  ? 1.8953 1.3630 1.3266 0.0000 0.0000 0.0000 17  DG  C "C5'" 
4458 C "C4'" . DG  C 17  ? 1.9276 1.3686 1.3329 0.0000 0.0000 0.0000 17  DG  C "C4'" 
4459 O "O4'" . DG  C 17  ? 1.8996 1.3693 1.3333 0.0000 0.0000 0.0000 17  DG  C "O4'" 
4460 C "C3'" . DG  C 17  ? 2.0162 1.3785 1.3411 0.0000 0.0000 0.0000 17  DG  C "C3'" 
4461 O "O3'" . DG  C 17  ? 2.0517 1.3902 1.3569 0.0000 0.0000 0.0000 17  DG  C "O3'" 
4462 C "C2'" . DG  C 17  ? 2.0280 1.3808 1.3427 0.0000 0.0000 0.0000 17  DG  C "C2'" 
4463 C "C1'" . DG  C 17  ? 1.9562 1.3768 1.3415 0.0000 0.0000 0.0000 17  DG  C "C1'" 
4464 N N9    . DG  C 17  ? 1.9301 1.3793 1.3493 0.0000 0.0000 0.0000 17  DG  C N9    
4465 C C8    . DG  C 17  ? 1.9402 1.3868 1.3600 0.0000 0.0000 0.0000 17  DG  C C8    
4466 N N7    . DG  C 17  ? 1.9118 1.3930 1.3773 0.0000 0.0000 0.0000 17  DG  C N7    
4467 C C5    . DG  C 17  ? 1.8827 1.3869 1.3733 0.0000 0.0000 0.0000 17  DG  C C5    
4468 C C6    . DG  C 17  ? 1.8530 1.3932 1.3926 0.0000 0.0000 0.0000 17  DG  C C6    
4469 O O6    . DG  C 17  ? 1.8501 1.4148 1.4296 0.0000 0.0000 0.0000 17  DG  C O6    
4470 N N1    . DG  C 17  ? 1.8384 1.3817 1.3783 0.0000 0.0000 0.0000 17  DG  C N1    
4471 C C2    . DG  C 17  ? 1.8494 1.3684 1.3530 0.0000 0.0000 0.0000 17  DG  C C2    
4472 N N2    . DG  C 17  ? 1.8370 1.3586 1.3432 0.0000 0.0000 0.0000 17  DG  C N2    
4473 N N3    . DG  C 17  ? 1.8756 1.3669 1.3429 0.0000 0.0000 0.0000 17  DG  C N3    
4474 C C4    . DG  C 17  ? 1.8929 1.3766 1.3532 0.0000 0.0000 0.0000 17  DG  C C4    
4475 P P     . DT  C 18  ? 2.1468 1.4005 1.3673 0.0000 0.0000 0.0000 18  DT  C P     
4476 O OP1   . DT  C 18  ? 2.1504 1.3998 1.3763 0.0000 0.0000 0.0000 18  DT  C OP1   
4477 O OP2   . DT  C 18  ? 2.2094 1.4063 1.3690 0.0000 0.0000 0.0000 18  DT  C OP2   
4478 O "O5'" . DT  C 18  ? 2.1442 1.3923 1.3564 0.0000 0.0000 0.0000 18  DT  C "O5'" 
4479 C "C5'" . DT  C 18  ? 2.0893 1.3717 1.3386 0.0000 0.0000 0.0000 18  DT  C "C5'" 
4480 C "C4'" . DT  C 18  ? 2.0842 1.3641 1.3307 0.0000 0.0000 0.0000 18  DT  C "C4'" 
4481 O "O4'" . DT  C 18  ? 2.0553 1.3727 1.3405 0.0000 0.0000 0.0000 18  DT  C "O4'" 
4482 C "C3'" . DT  C 18  ? 2.1565 1.3629 1.3295 0.0000 0.0000 0.0000 18  DT  C "C3'" 
4483 O "O3'" . DT  C 18  ? 2.1623 1.3341 1.3012 0.0000 0.0000 0.0000 18  DT  C "O3'" 
4484 C "C2'" . DT  C 18  ? 2.1540 1.3803 1.3531 0.0000 0.0000 0.0000 18  DT  C "C2'" 
4485 C "C1'" . DT  C 18  ? 2.0871 1.3918 1.3657 0.0000 0.0000 0.0000 18  DT  C "C1'" 
4486 N N1    . DT  C 18  ? 2.1015 1.4263 1.4080 0.0000 0.0000 0.0000 18  DT  C N1    
4487 C C2    . DT  C 18  ? 2.0842 1.4510 1.4441 0.0000 0.0000 0.0000 18  DT  C C2    
4488 O O2    . DT  C 18  ? 2.0795 1.4625 1.4568 0.0000 0.0000 0.0000 18  DT  C O2    
4489 N N3    . DT  C 18  ? 2.0870 1.4731 1.4789 0.0000 0.0000 0.0000 18  DT  C N3    
4490 C C4    . DT  C 18  ? 2.1234 1.4875 1.4935 0.0000 0.0000 0.0000 18  DT  C C4    
4491 O O4    . DT  C 18  ? 2.1289 1.5133 1.5345 0.0000 0.0000 0.0000 18  DT  C O4    
4492 C C5    . DT  C 18  ? 2.1610 1.4738 1.4643 0.0000 0.0000 0.0000 18  DT  C C5    
4493 C C7    . DT  C 18  ? 2.2009 1.4741 1.4628 0.0000 0.0000 0.0000 18  DT  C C7    
4494 C C6    . DT  C 18  ? 2.1513 1.4490 1.4294 0.0000 0.0000 0.0000 18  DT  C C6    
4495 P P     . DA  C 19  ? 2.2183 1.3199 1.2880 0.0000 0.0000 0.0000 19  DA  C P     
4496 O OP1   . DA  C 19  ? 2.2411 1.3154 1.2838 0.0000 0.0000 0.0000 19  DA  C OP1   
4497 O OP2   . DA  C 19  ? 2.2747 1.3194 1.2867 0.0000 0.0000 0.0000 19  DA  C OP2   
4498 O "O5'" . DA  C 19  ? 2.1981 1.3373 1.3116 0.0000 0.0000 0.0000 19  DA  C "O5'" 
4499 C "C5'" . DA  C 19  ? 2.2895 1.3821 1.3625 0.0000 0.0000 0.0000 19  DA  C "C5'" 
4500 C "C4'" . DA  C 19  ? 2.2807 1.4128 1.4053 0.0000 0.0000 0.0000 19  DA  C "C4'" 
4501 O "O4'" . DA  C 19  ? 2.2266 1.4255 1.4212 0.0000 0.0000 0.0000 19  DA  C "O4'" 
4502 C "C3'" . DA  C 19  ? 2.3486 1.4382 1.4452 0.0000 0.0000 0.0000 19  DA  C "C3'" 
4503 O "O3'" . DA  C 19  ? 2.3981 1.4395 1.4487 0.0000 0.0000 0.0000 19  DA  C "O3'" 
4504 C "C2'" . DA  C 19  ? 2.3078 1.4599 1.4842 0.0000 0.0000 0.0000 19  DA  C "C2'" 
4505 C "C1'" . DA  C 19  ? 2.2573 1.4707 1.4845 0.0000 0.0000 0.0000 19  DA  C "C1'" 
4506 N N9    . DA  C 19  ? 2.2910 1.5149 1.5315 0.0000 0.0000 0.0000 19  DA  C N9    
4507 C C8    . DA  C 19  ? 2.3421 1.5275 1.5323 0.0000 0.0000 0.0000 19  DA  C C8    
4508 N N7    . DA  C 19  ? 2.3458 1.5444 1.5545 0.0000 0.0000 0.0000 19  DA  C N7    
4509 C C5    . DA  C 19  ? 2.2994 1.5546 1.5833 0.0000 0.0000 0.0000 19  DA  C C5    
4510 C C6    . DA  C 19  ? 2.2686 1.5638 1.6092 0.0000 0.0000 0.0000 19  DA  C C6    
4511 N N6    . DA  C 19  ? 2.2757 1.5545 1.5971 0.0000 0.0000 0.0000 19  DA  C N6    
4512 N N1    . DA  C 19  ? 2.2273 1.5754 1.6425 0.0000 0.0000 0.0000 19  DA  C N1    
4513 C C2    . DA  C 19  ? 2.2166 1.5716 1.6411 0.0000 0.0000 0.0000 19  DA  C C2    
4514 N N3    . DA  C 19  ? 2.2369 1.5540 1.6069 0.0000 0.0000 0.0000 19  DA  C N3    
4515 C C4    . DA  C 19  ? 2.2745 1.5450 1.5783 0.0000 0.0000 0.0000 19  DA  C C4    
4516 O "O5'" . DT  D 1   ? 2.5487 1.9771 2.3352 0.0000 0.0000 0.0000 1   DT  D "O5'" 
4517 C "C5'" . DT  D 1   ? 2.4749 1.9759 2.3486 0.0000 0.0000 0.0000 1   DT  D "C5'" 
4518 C "C4'" . DT  D 1   ? 2.4226 1.9462 2.2674 0.0000 0.0000 0.0000 1   DT  D "C4'" 
4519 O "O4'" . DT  D 1   ? 2.4556 1.9414 2.2202 0.0000 0.0000 0.0000 1   DT  D "O4'" 
4520 C "C3'" . DT  D 1   ? 2.3481 1.9437 2.2815 0.0000 0.0000 0.0000 1   DT  D "C3'" 
4521 O "O3'" . DT  D 1   ? 2.2675 1.8951 2.2208 0.0000 0.0000 0.0000 1   DT  D "O3'" 
4522 C "C2'" . DT  D 1   ? 2.3602 1.9509 2.2567 0.0000 0.0000 0.0000 1   DT  D "C2'" 
4523 C "C1'" . DT  D 1   ? 2.4098 1.9421 2.1988 0.0000 0.0000 0.0000 1   DT  D "C1'" 
4524 N N1    . DT  D 1   ? 2.4377 1.9431 2.1605 0.0000 0.0000 0.0000 1   DT  D N1    
4525 C C2    . DT  D 1   ? 2.4863 1.9301 2.1132 0.0000 0.0000 0.0000 1   DT  D C2    
4526 O O2    . DT  D 1   ? 2.5117 1.9175 2.0969 0.0000 0.0000 0.0000 1   DT  D O2    
4527 N N3    . DT  D 1   ? 2.5016 1.9260 2.0806 0.0000 0.0000 0.0000 1   DT  D N3    
4528 C C4    . DT  D 1   ? 2.4740 1.9305 2.0849 0.0000 0.0000 0.0000 1   DT  D C4    
4529 O O4    . DT  D 1   ? 2.4923 1.9214 2.0504 0.0000 0.0000 0.0000 1   DT  D O4    
4530 C C5    . DT  D 1   ? 2.4259 1.9469 2.1352 0.0000 0.0000 0.0000 1   DT  D C5    
4531 C C7    . DT  D 1   ? 2.3898 1.9482 2.1400 0.0000 0.0000 0.0000 1   DT  D C7    
4532 C C6    . DT  D 1   ? 2.4109 1.9538 2.1723 0.0000 0.0000 0.0000 1   DT  D C6    
4533 P P     . DA  D 2   ? 2.2021 1.8349 2.1043 0.0000 0.0000 0.0000 2   DA  D P     
4534 O OP1   . DA  D 2   ? 2.1765 1.8348 2.1111 0.0000 0.0000 0.0000 2   DA  D OP1   
4535 O OP2   . DA  D 2   ? 2.1688 1.8254 2.0759 0.0000 0.0000 0.0000 2   DA  D OP2   
4536 O "O5'" . DA  D 2   ? 2.2109 1.7765 2.0098 0.0000 0.0000 0.0000 2   DA  D "O5'" 
4537 C "C5'" . DA  D 2   ? 2.1743 1.7095 1.9384 0.0000 0.0000 0.0000 2   DA  D "C5'" 
4538 C "C4'" . DA  D 2   ? 2.1153 1.6363 1.8170 0.0000 0.0000 0.0000 2   DA  D "C4'" 
4539 O "O4'" . DA  D 2   ? 2.1186 1.6224 1.7776 0.0000 0.0000 0.0000 2   DA  D "O4'" 
4540 C "C3'" . DA  D 2   ? 2.0282 1.5990 1.7698 0.0000 0.0000 0.0000 2   DA  D "C3'" 
4541 O "O3'" . DA  D 2   ? 1.9806 1.5362 1.7058 0.0000 0.0000 0.0000 2   DA  D "O3'" 
4542 C "C2'" . DA  D 2   ? 2.0186 1.5932 1.7256 0.0000 0.0000 0.0000 2   DA  D "C2'" 
4543 C "C1'" . DA  D 2   ? 2.0828 1.6081 1.7312 0.0000 0.0000 0.0000 2   DA  D "C1'" 
4544 N N9    . DA  D 2   ? 2.0949 1.6297 1.7455 0.0000 0.0000 0.0000 2   DA  D N9    
4545 C C8    . DA  D 2   ? 2.0880 1.6577 1.7961 0.0000 0.0000 0.0000 2   DA  D C8    
4546 N N7    . DA  D 2   ? 2.1000 1.6616 1.7857 0.0000 0.0000 0.0000 2   DA  D N7    
4547 C C5    . DA  D 2   ? 2.1247 1.6448 1.7369 0.0000 0.0000 0.0000 2   DA  D C5    
4548 C C6    . DA  D 2   ? 2.1450 1.6348 1.7023 0.0000 0.0000 0.0000 2   DA  D C6    
4549 N N6    . DA  D 2   ? 2.1564 1.6485 1.7172 0.0000 0.0000 0.0000 2   DA  D N6    
4550 N N1    . DA  D 2   ? 2.1600 1.6148 1.6595 0.0000 0.0000 0.0000 2   DA  D N1    
4551 C C2    . DA  D 2   ? 2.1641 1.6111 1.6553 0.0000 0.0000 0.0000 2   DA  D C2    
4552 N N3    . DA  D 2   ? 2.1484 1.6162 1.6791 0.0000 0.0000 0.0000 2   DA  D N3    
4553 C C4    . DA  D 2   ? 2.1259 1.6310 1.7183 0.0000 0.0000 0.0000 2   DA  D C4    
4554 P P     . DC  D 3   ? 1.9039 1.4696 1.6106 0.0000 0.0000 0.0000 3   DC  D P     
4555 O OP1   . DC  D 3   ? 1.9246 1.4628 1.6153 0.0000 0.0000 0.0000 3   DC  D OP1   
4556 O OP2   . DC  D 3   ? 1.8428 1.4633 1.6004 0.0000 0.0000 0.0000 3   DC  D OP2   
4557 O "O5'" . DC  D 3   ? 1.8953 1.4253 1.5296 0.0000 0.0000 0.0000 3   DC  D "O5'" 
4558 C "C5'" . DC  D 3   ? 1.8647 1.3786 1.4590 0.0000 0.0000 0.0000 3   DC  D "C5'" 
4559 C "C4'" . DC  D 3   ? 1.8292 1.3403 1.3934 0.0000 0.0000 0.0000 3   DC  D "C4'" 
4560 O "O4'" . DC  D 3   ? 1.8106 1.3419 1.3980 0.0000 0.0000 0.0000 3   DC  D "O4'" 
4561 C "C3'" . DC  D 3   ? 1.7771 1.3181 1.3549 0.0000 0.0000 0.0000 3   DC  D "C3'" 
4562 O "O3'" . DC  D 3   ? 1.7872 1.2910 1.3175 0.0000 0.0000 0.0000 3   DC  D "O3'" 
4563 C "C2'" . DC  D 3   ? 1.7577 1.3152 1.3376 0.0000 0.0000 0.0000 3   DC  D "C2'" 
4564 C "C1'" . DC  D 3   ? 1.7921 1.3335 1.3666 0.0000 0.0000 0.0000 3   DC  D "C1'" 
4565 N N1    . DC  D 3   ? 1.7690 1.3438 1.3805 0.0000 0.0000 0.0000 3   DC  D N1    
4566 C C2    . DC  D 3   ? 1.7807 1.3409 1.3633 0.0000 0.0000 0.0000 3   DC  D C2    
4567 O O2    . DC  D 3   ? 1.8183 1.3426 1.3512 0.0000 0.0000 0.0000 3   DC  D O2    
4568 N N3    . DC  D 3   ? 1.7584 1.3415 1.3675 0.0000 0.0000 0.0000 3   DC  D N3    
4569 C C4    . DC  D 3   ? 1.7284 1.3512 1.3956 0.0000 0.0000 0.0000 3   DC  D C4    
4570 N N4    . DC  D 3   ? 1.7216 1.3630 1.4111 0.0000 0.0000 0.0000 3   DC  D N4    
4571 C C5    . DC  D 3   ? 1.7185 1.3606 1.4225 0.0000 0.0000 0.0000 3   DC  D C5    
4572 C C6    . DC  D 3   ? 1.7412 1.3559 1.4125 0.0000 0.0000 0.0000 3   DC  D C6    
4573 P P     . DA  D 4   ? 1.7509 1.2659 1.2799 0.0000 0.0000 0.0000 4   DA  D P     
4574 O OP1   . DA  D 4   ? 1.7919 1.2557 1.2668 0.0000 0.0000 0.0000 4   DA  D OP1   
4575 O OP2   . DA  D 4   ? 1.7135 1.2716 1.2938 0.0000 0.0000 0.0000 4   DA  D OP2   
4576 O "O5'" . DA  D 4   ? 1.7191 1.2509 1.2501 0.0000 0.0000 0.0000 4   DA  D "O5'" 
4577 C "C5'" . DA  D 4   ? 1.7403 1.2464 1.2362 0.0000 0.0000 0.0000 4   DA  D "C5'" 
4578 C "C4'" . DA  D 4   ? 1.7104 1.2508 1.2342 0.0000 0.0000 0.0000 4   DA  D "C4'" 
4579 O "O4'" . DA  D 4   ? 1.6795 1.2477 1.2311 0.0000 0.0000 0.0000 4   DA  D "O4'" 
4580 C "C3'" . DA  D 4   ? 1.6891 1.2599 1.2427 0.0000 0.0000 0.0000 4   DA  D "C3'" 
4581 O "O3'" . DA  D 4   ? 1.7145 1.2795 1.2617 0.0000 0.0000 0.0000 4   DA  D "O3'" 
4582 C "C2'" . DA  D 4   ? 1.6190 1.2388 1.2219 0.0000 0.0000 0.0000 4   DA  D "C2'" 
4583 C "C1'" . DA  D 4   ? 1.6181 1.2332 1.2155 0.0000 0.0000 0.0000 4   DA  D "C1'" 
4584 N N9    . DA  D 4   ? 1.5973 1.2343 1.2226 0.0000 0.0000 0.0000 4   DA  D N9    
4585 C C8    . DA  D 4   ? 1.6012 1.2475 1.2466 0.0000 0.0000 0.0000 4   DA  D C8    
4586 N N7    . DA  D 4   ? 1.5857 1.2552 1.2639 0.0000 0.0000 0.0000 4   DA  D N7    
4587 C C5    . DA  D 4   ? 1.5717 1.2414 1.2419 0.0000 0.0000 0.0000 4   DA  D C5    
4588 C C6    . DA  D 4   ? 1.5589 1.2411 1.2458 0.0000 0.0000 0.0000 4   DA  D C6    
4589 N N6    . DA  D 4   ? 1.5478 1.2522 1.2737 0.0000 0.0000 0.0000 4   DA  D N6    
4590 N N1    . DA  D 4   ? 1.5660 1.2340 1.2281 0.0000 0.0000 0.0000 4   DA  D N1    
4591 C C2    . DA  D 4   ? 1.5758 1.2244 1.2079 0.0000 0.0000 0.0000 4   DA  D C2    
4592 N N3    . DA  D 4   ? 1.5803 1.2209 1.2021 0.0000 0.0000 0.0000 4   DA  D N3    
4593 C C4    . DA  D 4   ? 1.5840 1.2335 1.2218 0.0000 0.0000 0.0000 4   DA  D C4    
4594 P P     . DA  D 5   ? 1.6893 1.2945 1.2787 0.0000 0.0000 0.0000 5   DA  D P     
4595 O OP1   . DA  D 5   ? 1.7016 1.2865 1.2783 0.0000 0.0000 0.0000 5   DA  D OP1   
4596 O OP2   . DA  D 5   ? 1.6479 1.2878 1.2712 0.0000 0.0000 0.0000 5   DA  D OP2   
4597 O "O5'" . DA  D 5   ? 1.7099 1.3285 1.3099 0.0000 0.0000 0.0000 5   DA  D "O5'" 
4598 C "C5'" . DA  D 5   ? 1.7394 1.3642 1.3495 0.0000 0.0000 0.0000 5   DA  D "C5'" 
4599 C "C4'" . DA  D 5   ? 1.7204 1.3880 1.3723 0.0000 0.0000 0.0000 5   DA  D "C4'" 
4600 O "O4'" . DA  D 5   ? 1.7091 1.3872 1.3648 0.0000 0.0000 0.0000 5   DA  D "O4'" 
4601 C "C3'" . DA  D 5   ? 1.6991 1.4025 1.3912 0.0000 0.0000 0.0000 5   DA  D "C3'" 
4602 O "O3'" . DA  D 5   ? 1.7014 1.4369 1.4289 0.0000 0.0000 0.0000 5   DA  D "O3'" 
4603 C "C2'" . DA  D 5   ? 1.6761 1.3910 1.3726 0.0000 0.0000 0.0000 5   DA  D "C2'" 
4604 C "C1'" . DA  D 5   ? 1.6637 1.3816 1.3589 0.0000 0.0000 0.0000 5   DA  D "C1'" 
4605 N N9    . DA  D 5   ? 1.6475 1.3767 1.3530 0.0000 0.0000 0.0000 5   DA  D N9    
4606 C C8    . DA  D 5   ? 1.6457 1.3780 1.3573 0.0000 0.0000 0.0000 5   DA  D C8    
4607 N N7    . DA  D 5   ? 1.6292 1.3758 1.3601 0.0000 0.0000 0.0000 5   DA  D N7    
4608 C C5    . DA  D 5   ? 1.6241 1.3754 1.3579 0.0000 0.0000 0.0000 5   DA  D C5    
4609 C C6    . DA  D 5   ? 1.6129 1.3762 1.3647 0.0000 0.0000 0.0000 5   DA  D C6    
4610 N N6    . DA  D 5   ? 1.5925 1.3726 1.3739 0.0000 0.0000 0.0000 5   DA  D N6    
4611 N N1    . DA  D 5   ? 1.6312 1.3850 1.3693 0.0000 0.0000 0.0000 5   DA  D N1    
4612 C C2    . DA  D 5   ? 1.6440 1.3796 1.3557 0.0000 0.0000 0.0000 5   DA  D C2    
4613 N N3    . DA  D 5   ? 1.6450 1.3743 1.3480 0.0000 0.0000 0.0000 5   DA  D N3    
4614 C C4    . DA  D 5   ? 1.6400 1.3776 1.3540 0.0000 0.0000 0.0000 5   DA  D C4    
4615 P P     . DA  D 6   ? 1.7129 1.4559 1.4638 0.0000 0.0000 0.0000 6   DA  D P     
4616 O OP1   . DA  D 6   ? 1.7414 1.4458 1.4596 0.0000 0.0000 0.0000 6   DA  D OP1   
4617 O OP2   . DA  D 6   ? 1.6825 1.4510 1.4692 0.0000 0.0000 0.0000 6   DA  D OP2   
4618 O "O5'" . DA  D 6   ? 1.6655 1.4291 1.4342 0.0000 0.0000 0.0000 6   DA  D "O5'" 
4619 C "C5'" . DA  D 6   ? 1.6536 1.3885 1.3908 0.0000 0.0000 0.0000 6   DA  D "C5'" 
4620 C "C4'" . DA  D 6   ? 1.6066 1.3550 1.3468 0.0000 0.0000 0.0000 6   DA  D "C4'" 
4621 O "O4'" . DA  D 6   ? 1.5857 1.3427 1.3236 0.0000 0.0000 0.0000 6   DA  D "O4'" 
4622 C "C3'" . DA  D 6   ? 1.5461 1.3330 1.3312 0.0000 0.0000 0.0000 6   DA  D "C3'" 
4623 O "O3'" . DA  D 6   ? 1.5421 1.3127 1.3127 0.0000 0.0000 0.0000 6   DA  D "O3'" 
4624 C "C2'" . DA  D 6   ? 1.5121 1.3278 1.3153 0.0000 0.0000 0.0000 6   DA  D "C2'" 
4625 C "C1'" . DA  D 6   ? 1.5271 1.3193 1.2970 0.0000 0.0000 0.0000 6   DA  D "C1'" 
4626 N N9    . DA  D 6   ? 1.4910 1.3001 1.2748 0.0000 0.0000 0.0000 6   DA  D N9    
4627 C C8    . DA  D 6   ? 1.4733 1.2870 1.2646 0.0000 0.0000 0.0000 6   DA  D C8    
4628 N N7    . DA  D 6   ? 1.4569 1.2789 1.2542 0.0000 0.0000 0.0000 6   DA  D N7    
4629 C C5    . DA  D 6   ? 1.4528 1.2823 1.2557 0.0000 0.0000 0.0000 6   DA  D C5    
4630 C C6    . DA  D 6   ? 1.4414 1.2842 1.2608 0.0000 0.0000 0.0000 6   DA  D C6    
4631 N N6    . DA  D 6   ? 1.4394 1.2878 1.2686 0.0000 0.0000 0.0000 6   DA  D N6    
4632 N N1    . DA  D 6   ? 1.4436 1.2907 1.2691 0.0000 0.0000 0.0000 6   DA  D N1    
4633 C C2    . DA  D 6   ? 1.4560 1.2876 1.2615 0.0000 0.0000 0.0000 6   DA  D C2    
4634 N N3    . DA  D 6   ? 1.4745 1.2902 1.2603 0.0000 0.0000 0.0000 6   DA  D N3    
4635 C C4    . DA  D 6   ? 1.4726 1.2916 1.2632 0.0000 0.0000 0.0000 6   DA  D C4    
4636 P P     . DA  D 7   ? 1.5045 1.2991 1.3022 0.0000 0.0000 0.0000 7   DA  D P     
4637 O OP1   . DA  D 7   ? 1.5248 1.3031 1.3245 0.0000 0.0000 0.0000 7   DA  D OP1   
4638 O OP2   . DA  D 7   ? 1.4650 1.3046 1.3064 0.0000 0.0000 0.0000 7   DA  D OP2   
4639 O "O5'" . DA  D 7   ? 1.5246 1.2959 1.2833 0.0000 0.0000 0.0000 7   DA  D "O5'" 
4640 C "C5'" . DA  D 7   ? 1.5235 1.2947 1.2703 0.0000 0.0000 0.0000 7   DA  D "C5'" 
4641 C "C4'" . DA  D 7   ? 1.4959 1.2924 1.2618 0.0000 0.0000 0.0000 7   DA  D "C4'" 
4642 O "O4'" . DA  D 7   ? 1.4729 1.3002 1.2678 0.0000 0.0000 0.0000 7   DA  D "O4'" 
4643 C "C3'" . DA  D 7   ? 1.4550 1.2774 1.2503 0.0000 0.0000 0.0000 7   DA  D "C3'" 
4644 O "O3'" . DA  D 7   ? 1.4413 1.2564 1.2230 0.0000 0.0000 0.0000 7   DA  D "O3'" 
4645 C "C2'" . DA  D 7   ? 1.4181 1.2850 1.2596 0.0000 0.0000 0.0000 7   DA  D "C2'" 
4646 C "C1'" . DA  D 7   ? 1.4319 1.2991 1.2675 0.0000 0.0000 0.0000 7   DA  D "C1'" 
4647 N N9    . DA  D 7   ? 1.4206 1.3097 1.2798 0.0000 0.0000 0.0000 7   DA  D N9    
4648 C C8    . DA  D 7   ? 1.4120 1.3064 1.2821 0.0000 0.0000 0.0000 7   DA  D C8    
4649 N N7    . DA  D 7   ? 1.3962 1.3008 1.2760 0.0000 0.0000 0.0000 7   DA  D N7    
4650 C C5    . DA  D 7   ? 1.4023 1.3131 1.2844 0.0000 0.0000 0.0000 7   DA  D C5    
4651 C C6    . DA  D 7   ? 1.4018 1.3222 1.2951 0.0000 0.0000 0.0000 7   DA  D C6    
4652 N N6    . DA  D 7   ? 1.4022 1.3202 1.2947 0.0000 0.0000 0.0000 7   DA  D N6    
4653 N N1    . DA  D 7   ? 1.4041 1.3328 1.3089 0.0000 0.0000 0.0000 7   DA  D N1    
4654 C C2    . DA  D 7   ? 1.4081 1.3315 1.3063 0.0000 0.0000 0.0000 7   DA  D C2    
4655 N N3    . DA  D 7   ? 1.4169 1.3238 1.2937 0.0000 0.0000 0.0000 7   DA  D N3    
4656 C C4    . DA  D 7   ? 1.4136 1.3171 1.2862 0.0000 0.0000 0.0000 7   DA  D C4    
4657 P P     . DT  D 8   ? 1.3937 1.2306 1.1973 0.0000 0.0000 0.0000 8   DT  D P     
4658 O OP1   . DT  D 8   ? 1.4282 1.2236 1.1864 0.0000 0.0000 0.0000 8   DT  D OP1   
4659 O OP2   . DT  D 8   ? 1.3580 1.2192 1.1959 0.0000 0.0000 0.0000 8   DT  D OP2   
4660 O "O5'" . DT  D 8   ? 1.3562 1.2325 1.1953 0.0000 0.0000 0.0000 8   DT  D "O5'" 
4661 C "C5'" . DT  D 8   ? 1.3798 1.2473 1.2076 0.0000 0.0000 0.0000 8   DT  D "C5'" 
4662 C "C4'" . DT  D 8   ? 1.3537 1.2639 1.2270 0.0000 0.0000 0.0000 8   DT  D "C4'" 
4663 O "O4'" . DT  D 8   ? 1.3438 1.2713 1.2359 0.0000 0.0000 0.0000 8   DT  D "O4'" 
4664 C "C3'" . DT  D 8   ? 1.3251 1.2647 1.2271 0.0000 0.0000 0.0000 8   DT  D "C3'" 
4665 O "O3'" . DT  D 8   ? 1.3453 1.2846 1.2503 0.0000 0.0000 0.0000 8   DT  D "O3'" 
4666 C "C2'" . DT  D 8   ? 1.2848 1.2603 1.2248 0.0000 0.0000 0.0000 8   DT  D "C2'" 
4667 C "C1'" . DT  D 8   ? 1.2964 1.2604 1.2270 0.0000 0.0000 0.0000 8   DT  D "C1'" 
4668 N N1    . DT  D 8   ? 1.2749 1.2477 1.2150 0.0000 0.0000 0.0000 8   DT  D N1    
4669 C C2    . DT  D 8   ? 1.2621 1.2489 1.2192 0.0000 0.0000 0.0000 8   DT  D C2    
4670 O O2    . DT  D 8   ? 1.2636 1.2613 1.2363 0.0000 0.0000 0.0000 8   DT  D O2    
4671 N N3    . DT  D 8   ? 1.2594 1.2444 1.2151 0.0000 0.0000 0.0000 8   DT  D N3    
4672 C C4    . DT  D 8   ? 1.2597 1.2360 1.2081 0.0000 0.0000 0.0000 8   DT  D C4    
4673 O O4    . DT  D 8   ? 1.2546 1.2278 1.2035 0.0000 0.0000 0.0000 8   DT  D O4    
4674 C C5    . DT  D 8   ? 1.2677 1.2354 1.2079 0.0000 0.0000 0.0000 8   DT  D C5    
4675 C C7    . DT  D 8   ? 1.2838 1.2449 1.2262 0.0000 0.0000 0.0000 8   DT  D C7    
4676 C C6    . DT  D 8   ? 1.2722 1.2351 1.2034 0.0000 0.0000 0.0000 8   DT  D C6    
4677 P P     . DT  D 9   ? 1.3318 1.2945 1.2612 0.0000 0.0000 0.0000 9   DT  D P     
4678 O OP1   . DT  D 9   ? 1.3505 1.2941 1.2667 0.0000 0.0000 0.0000 9   DT  D OP1   
4679 O OP2   . DT  D 9   ? 1.3146 1.2784 1.2389 0.0000 0.0000 0.0000 9   DT  D OP2   
4680 O "O5'" . DT  D 9   ? 1.2981 1.3033 1.2768 0.0000 0.0000 0.0000 9   DT  D "O5'" 
4681 C "C5'" . DT  D 9   ? 1.3098 1.3209 1.3058 0.0000 0.0000 0.0000 9   DT  D "C5'" 
4682 C "C4'" . DT  D 9   ? 1.2833 1.3278 1.3193 0.0000 0.0000 0.0000 9   DT  D "C4'" 
4683 O "O4'" . DT  D 9   ? 1.2838 1.3246 1.3081 0.0000 0.0000 0.0000 9   DT  D "O4'" 
4684 C "C3'" . DT  D 9   ? 1.2601 1.3307 1.3227 0.0000 0.0000 0.0000 9   DT  D "C3'" 
4685 O "O3'" . DT  D 9   ? 1.2477 1.3425 1.3514 0.0000 0.0000 0.0000 9   DT  D "O3'" 
4686 C "C2'" . DT  D 9   ? 1.2392 1.3123 1.2926 0.0000 0.0000 0.0000 9   DT  D "C2'" 
4687 C "C1'" . DT  D 9   ? 1.2493 1.3119 1.2936 0.0000 0.0000 0.0000 9   DT  D "C1'" 
4688 N N1    . DT  D 9   ? 1.2432 1.2970 1.2706 0.0000 0.0000 0.0000 9   DT  D N1    
4689 C C2    . DT  D 9   ? 1.2410 1.2945 1.2700 0.0000 0.0000 0.0000 9   DT  D C2    
4690 O O2    . DT  D 9   ? 1.2422 1.3007 1.2834 0.0000 0.0000 0.0000 9   DT  D O2    
4691 N N3    . DT  D 9   ? 1.2424 1.2865 1.2582 0.0000 0.0000 0.0000 9   DT  D N3    
4692 C C4    . DT  D 9   ? 1.2435 1.2829 1.2529 0.0000 0.0000 0.0000 9   DT  D C4    
4693 O O4    . DT  D 9   ? 1.2539 1.2880 1.2612 0.0000 0.0000 0.0000 9   DT  D O4    
4694 C C5    . DT  D 9   ? 1.2424 1.2804 1.2481 0.0000 0.0000 0.0000 9   DT  D C5    
4695 C C7    . DT  D 9   ? 1.2494 1.2770 1.2459 0.0000 0.0000 0.0000 9   DT  D C7    
4696 C C6    . DT  D 9   ? 1.2432 1.2860 1.2540 0.0000 0.0000 0.0000 9   DT  D C6    
4697 P P     . DC  D 10  ? 1.2129 1.3362 1.3529 0.0000 0.0000 0.0000 10  DC  D P     
4698 O OP1   . DC  D 10  ? 1.2016 1.3409 1.3831 0.0000 0.0000 0.0000 10  DC  D OP1   
4699 O OP2   . DC  D 10  ? 1.2065 1.3250 1.3269 0.0000 0.0000 0.0000 10  DC  D OP2   
4700 O "O5'" . DC  D 10  ? 1.1922 1.3224 1.3377 0.0000 0.0000 0.0000 10  DC  D "O5'" 
4701 C "C5'" . DC  D 10  ? 1.1894 1.3188 1.3482 0.0000 0.0000 0.0000 10  DC  D "C5'" 
4702 C "C4'" . DC  D 10  ? 1.1751 1.3001 1.3254 0.0000 0.0000 0.0000 10  DC  D "C4'" 
4703 O "O4'" . DC  D 10  ? 1.1765 1.2828 1.2880 0.0000 0.0000 0.0000 10  DC  D "O4'" 
4704 C "C3'" . DC  D 10  ? 1.1580 1.2994 1.3279 0.0000 0.0000 0.0000 10  DC  D "C3'" 
4705 O "O3'" . DC  D 10  ? 1.1626 1.3027 1.3471 0.0000 0.0000 0.0000 10  DC  D "O3'" 
4706 C "C2'" . DC  D 10  ? 1.1560 1.2861 1.2935 0.0000 0.0000 0.0000 10  DC  D "C2'" 
4707 C "C1'" . DC  D 10  ? 1.1697 1.2769 1.2755 0.0000 0.0000 0.0000 10  DC  D "C1'" 
4708 N N1    . DC  D 10  ? 1.1723 1.2706 1.2548 0.0000 0.0000 0.0000 10  DC  D N1    
4709 C C2    . DC  D 10  ? 1.1838 1.2669 1.2456 0.0000 0.0000 0.0000 10  DC  D C2    
4710 O O2    . DC  D 10  ? 1.2036 1.2747 1.2568 0.0000 0.0000 0.0000 10  DC  D O2    
4711 N N3    . DC  D 10  ? 1.1785 1.2573 1.2305 0.0000 0.0000 0.0000 10  DC  D N3    
4712 C C4    . DC  D 10  ? 1.1675 1.2519 1.2228 0.0000 0.0000 0.0000 10  DC  D C4    
4713 N N4    . DC  D 10  ? 1.1660 1.2453 1.2155 0.0000 0.0000 0.0000 10  DC  D N4    
4714 C C5    . DC  D 10  ? 1.1751 1.2675 1.2398 0.0000 0.0000 0.0000 10  DC  D C5    
4715 C C6    . DC  D 10  ? 1.1719 1.2732 1.2533 0.0000 0.0000 0.0000 10  DC  D C6    
4716 P P     . DC  D 11  ? 1.1510 1.3012 1.3556 0.0000 0.0000 0.0000 11  DC  D P     
4717 O OP1   . DC  D 11  ? 1.1445 1.2920 1.3718 0.0000 0.0000 0.0000 11  DC  D OP1   
4718 O OP2   . DC  D 11  ? 1.1192 1.2932 1.3483 0.0000 0.0000 0.0000 11  DC  D OP2   
4719 O "O5'" . DC  D 11  ? 1.1427 1.2666 1.2981 0.0000 0.0000 0.0000 11  DC  D "O5'" 
4720 C "C5'" . DC  D 11  ? 1.1406 1.2369 1.2696 0.0000 0.0000 0.0000 11  DC  D "C5'" 
4721 C "C4'" . DC  D 11  ? 1.1333 1.2146 1.2287 0.0000 0.0000 0.0000 11  DC  D "C4'" 
4722 O "O4'" . DC  D 11  ? 1.1154 1.2010 1.2009 0.0000 0.0000 0.0000 11  DC  D "O4'" 
4723 C "C3'" . DC  D 11  ? 1.1290 1.2274 1.2422 0.0000 0.0000 0.0000 11  DC  D "C3'" 
4724 O "O3'" . DC  D 11  ? 1.1656 1.2364 1.2462 0.0000 0.0000 0.0000 11  DC  D "O3'" 
4725 C "C2'" . DC  D 11  ? 1.1026 1.2176 1.2192 0.0000 0.0000 0.0000 11  DC  D "C2'" 
4726 C "C1'" . DC  D 11  ? 1.1042 1.1979 1.1893 0.0000 0.0000 0.0000 11  DC  D "C1'" 
4727 N N1    . DC  D 11  ? 1.0780 1.1803 1.1625 0.0000 0.0000 0.0000 11  DC  D N1    
4728 C C2    . DC  D 11  ? 1.0768 1.1630 1.1394 0.0000 0.0000 0.0000 11  DC  D C2    
4729 O O2    . DC  D 11  ? 1.0748 1.1375 1.1146 0.0000 0.0000 0.0000 11  DC  D O2    
4730 N N3    . DC  D 11  ? 1.0721 1.1660 1.1390 0.0000 0.0000 0.0000 11  DC  D N3    
4731 C C4    . DC  D 11  ? 1.0560 1.1655 1.1372 0.0000 0.0000 0.0000 11  DC  D C4    
4732 N N4    . DC  D 11  ? 1.0502 1.1590 1.1285 0.0000 0.0000 0.0000 11  DC  D N4    
4733 C C5    . DC  D 11  ? 1.0557 1.1790 1.1548 0.0000 0.0000 0.0000 11  DC  D C5    
4734 C C6    . DC  D 11  ? 1.0647 1.1874 1.1700 0.0000 0.0000 0.0000 11  DC  D C6    
4735 P P     . DA  D 12  ? 1.2113 1.2660 1.2916 0.0000 0.0000 0.0000 12  DA  D P     
4736 O OP1   . DA  D 12  ? 1.2216 1.2781 1.3219 0.0000 0.0000 0.0000 12  DA  D OP1   
4737 O OP2   . DA  D 12  ? 1.1986 1.2720 1.3014 0.0000 0.0000 0.0000 12  DA  D OP2   
4738 O "O5'" . DA  D 12  ? 1.2609 1.2641 1.2796 0.0000 0.0000 0.0000 12  DA  D "O5'" 
4739 C "C5'" . DA  D 12  ? 1.2888 1.2626 1.2713 0.0000 0.0000 0.0000 12  DA  D "C5'" 
4740 C "C4'" . DA  D 12  ? 1.3138 1.2552 1.2513 0.0000 0.0000 0.0000 12  DA  D "C4'" 
4741 O "O4'" . DA  D 12  ? 1.2761 1.2447 1.2320 0.0000 0.0000 0.0000 12  DA  D "O4'" 
4742 C "C3'" . DA  D 12  ? 1.3434 1.2622 1.2573 0.0000 0.0000 0.0000 12  DA  D "C3'" 
4743 O "O3'" . DA  D 12  ? 1.4021 1.2757 1.2651 0.0000 0.0000 0.0000 12  DA  D "O3'" 
4744 C "C2'" . DA  D 12  ? 1.2902 1.2502 1.2398 0.0000 0.0000 0.0000 12  DA  D "C2'" 
4745 C "C1'" . DA  D 12  ? 1.2619 1.2387 1.2226 0.0000 0.0000 0.0000 12  DA  D "C1'" 
4746 N N9    . DA  D 12  ? 1.2123 1.2344 1.2161 0.0000 0.0000 0.0000 12  DA  D N9    
4747 C C8    . DA  D 12  ? 1.1973 1.2507 1.2364 0.0000 0.0000 0.0000 12  DA  D C8    
4748 N N7    . DA  D 12  ? 1.1784 1.2593 1.2412 0.0000 0.0000 0.0000 12  DA  D N7    
4749 C C5    . DA  D 12  ? 1.1614 1.2318 1.2085 0.0000 0.0000 0.0000 12  DA  D C5    
4750 C C6    . DA  D 12  ? 1.1339 1.2185 1.1926 0.0000 0.0000 0.0000 12  DA  D C6    
4751 N N6    . DA  D 12  ? 1.1002 1.2070 1.1794 0.0000 0.0000 0.0000 12  DA  D N6    
4752 N N1    . DA  D 12  ? 1.1460 1.2172 1.1935 0.0000 0.0000 0.0000 12  DA  D N1    
4753 C C2    . DA  D 12  ? 1.1808 1.2231 1.2020 0.0000 0.0000 0.0000 12  DA  D C2    
4754 N N3    . DA  D 12  ? 1.2034 1.2227 1.2010 0.0000 0.0000 0.0000 12  DA  D N3    
4755 C C4    . DA  D 12  ? 1.1886 1.2252 1.2029 0.0000 0.0000 0.0000 12  DA  D C4    
4756 P P     . DT  D 13  ? 1.4855 1.2992 1.2882 0.0000 0.0000 0.0000 13  DT  D P     
4757 O OP1   . DT  D 13  ? 1.5340 1.2914 1.2818 0.0000 0.0000 0.0000 13  DT  D OP1   
4758 O OP2   . DT  D 13  ? 1.4757 1.2899 1.2834 0.0000 0.0000 0.0000 13  DT  D OP2   
4759 O "O5'" . DT  D 13  ? 1.4476 1.2729 1.2572 0.0000 0.0000 0.0000 13  DT  D "O5'" 
4760 C "C5'" . DT  D 13  ? 1.3917 1.2379 1.2219 0.0000 0.0000 0.0000 13  DT  D "C5'" 
4761 C "C4'" . DT  D 13  ? 1.3532 1.2165 1.2035 0.0000 0.0000 0.0000 13  DT  D "C4'" 
4762 O "O4'" . DT  D 13  ? 1.2925 1.2134 1.1986 0.0000 0.0000 0.0000 13  DT  D "O4'" 
4763 C "C3'" . DT  D 13  ? 1.3710 1.2084 1.1969 0.0000 0.0000 0.0000 13  DT  D "C3'" 
4764 O "O3'" . DT  D 13  ? 1.3751 1.1922 1.1902 0.0000 0.0000 0.0000 13  DT  D "O3'" 
4765 C "C2'" . DT  D 13  ? 1.3236 1.2101 1.1954 0.0000 0.0000 0.0000 13  DT  D "C2'" 
4766 C "C1'" . DT  D 13  ? 1.2741 1.2060 1.1924 0.0000 0.0000 0.0000 13  DT  D "C1'" 
4767 N N1    . DT  D 13  ? 1.2324 1.2126 1.1946 0.0000 0.0000 0.0000 13  DT  D N1    
4768 C C2    . DT  D 13  ? 1.2126 1.2230 1.2080 0.0000 0.0000 0.0000 13  DT  D C2    
4769 O O2    . DT  D 13  ? 1.2253 1.2297 1.2239 0.0000 0.0000 0.0000 13  DT  D O2    
4770 N N3    . DT  D 13  ? 1.1782 1.2229 1.2031 0.0000 0.0000 0.0000 13  DT  D N3    
4771 C C4    . DT  D 13  ? 1.1621 1.2182 1.1939 0.0000 0.0000 0.0000 13  DT  D C4    
4772 O O4    . DT  D 13  ? 1.1379 1.2208 1.1945 0.0000 0.0000 0.0000 13  DT  D O4    
4773 C C5    . DT  D 13  ? 1.1798 1.2101 1.1869 0.0000 0.0000 0.0000 13  DT  D C5    
4774 C C7    . DT  D 13  ? 1.1745 1.2179 1.1976 0.0000 0.0000 0.0000 13  DT  D C7    
4775 C C6    . DT  D 13  ? 1.2202 1.2116 1.1901 0.0000 0.0000 0.0000 13  DT  D C6    
4776 P P     . DG  D 14  ? 1.4085 1.1771 1.1807 0.0000 0.0000 0.0000 14  DG  D P     
4777 O OP1   . DG  D 14  ? 1.4693 1.1813 1.1937 0.0000 0.0000 0.0000 14  DG  D OP1   
4778 O OP2   . DG  D 14  ? 1.4304 1.1827 1.1770 0.0000 0.0000 0.0000 14  DG  D OP2   
4779 O "O5'" . DG  D 14  ? 1.3464 1.1566 1.1705 0.0000 0.0000 0.0000 14  DG  D "O5'" 
4780 C "C5'" . DG  D 14  ? 1.2721 1.1412 1.1567 0.0000 0.0000 0.0000 14  DG  D "C5'" 
4781 C "C4'" . DG  D 14  ? 1.2440 1.1413 1.1702 0.0000 0.0000 0.0000 14  DG  D "C4'" 
4782 O "O4'" . DG  D 14  ? 1.2113 1.1561 1.1759 0.0000 0.0000 0.0000 14  DG  D "O4'" 
4783 C "C3'" . DG  D 14  ? 1.2741 1.1424 1.1772 0.0000 0.0000 0.0000 14  DG  D "C3'" 
4784 O "O3'" . DG  D 14  ? 1.2644 1.1453 1.2051 0.0000 0.0000 0.0000 14  DG  D "O3'" 
4785 C "C2'" . DG  D 14  ? 1.2499 1.1406 1.1601 0.0000 0.0000 0.0000 14  DG  D "C2'" 
4786 C "C1'" . DG  D 14  ? 1.2050 1.1483 1.1622 0.0000 0.0000 0.0000 14  DG  D "C1'" 
4787 N N9    . DG  D 14  ? 1.1904 1.1500 1.1472 0.0000 0.0000 0.0000 14  DG  D N9    
4788 C C8    . DG  D 14  ? 1.2086 1.1441 1.1327 0.0000 0.0000 0.0000 14  DG  D C8    
4789 N N7    . DG  D 14  ? 1.1718 1.1354 1.1170 0.0000 0.0000 0.0000 14  DG  D N7    
4790 C C5    . DG  D 14  ? 1.1318 1.1352 1.1172 0.0000 0.0000 0.0000 14  DG  D C5    
4791 C C6    . DG  D 14  ? 1.1003 1.1396 1.1169 0.0000 0.0000 0.0000 14  DG  D C6    
4792 O O6    . DG  D 14  ? 1.1016 1.1512 1.1258 0.0000 0.0000 0.0000 14  DG  D O6    
4793 N N1    . DG  D 14  ? 1.0701 1.1320 1.1115 0.0000 0.0000 0.0000 14  DG  D N1    
4794 C C2    . DG  D 14  ? 1.0717 1.1286 1.1180 0.0000 0.0000 0.0000 14  DG  D C2    
4795 N N2    . DG  D 14  ? 1.0569 1.1350 1.1289 0.0000 0.0000 0.0000 14  DG  D N2    
4796 N N3    . DG  D 14  ? 1.1011 1.1308 1.1285 0.0000 0.0000 0.0000 14  DG  D N3    
4797 C C4    . DG  D 14  ? 1.1377 1.1390 1.1305 0.0000 0.0000 0.0000 14  DG  D C4    
4798 P P     . DA  D 15  ? 1.2743 1.1404 1.2163 0.0000 0.0000 0.0000 15  DA  D P     
4799 O OP1   . DA  D 15  ? 1.2874 1.1511 1.2602 0.0000 0.0000 0.0000 15  DA  D OP1   
4800 O OP2   . DA  D 15  ? 1.3112 1.1312 1.1920 0.0000 0.0000 0.0000 15  DA  D OP2   
4801 O "O5'" . DA  D 15  ? 1.2237 1.1418 1.2134 0.0000 0.0000 0.0000 15  DA  D "O5'" 
4802 C "C5'" . DA  D 15  ? 1.1655 1.1220 1.2157 0.0000 0.0000 0.0000 15  DA  D "C5'" 
4803 C "C4'" . DA  D 15  ? 1.1092 1.0906 1.1797 0.0000 0.0000 0.0000 15  DA  D "C4'" 
4804 O "O4'" . DA  D 15  ? 1.0915 1.0843 1.1431 0.0000 0.0000 0.0000 15  DA  D "O4'" 
4805 C "C3'" . DA  D 15  ? 1.1184 1.0724 1.1670 0.0000 0.0000 0.0000 15  DA  D "C3'" 
4806 O "O3'" . DA  D 15  ? 1.0896 1.0689 1.1828 0.0000 0.0000 0.0000 15  DA  D "O3'" 
4807 C "C2'" . DA  D 15  ? 1.1286 1.0698 1.1326 0.0000 0.0000 0.0000 15  DA  D "C2'" 
4808 C "C1'" . DA  D 15  ? 1.0840 1.0636 1.1103 0.0000 0.0000 0.0000 15  DA  D "C1'" 
4809 N N9    . DA  D 15  ? 1.0630 1.0395 1.0616 0.0000 0.0000 0.0000 15  DA  D N9    
4810 C C8    . DA  D 15  ? 1.0922 1.0351 1.0467 0.0000 0.0000 0.0000 15  DA  D C8    
4811 N N7    . DA  D 15  ? 1.0678 1.0224 1.0190 0.0000 0.0000 0.0000 15  DA  D N7    
4812 C C5    . DA  D 15  ? 1.0338 1.0302 1.0251 0.0000 0.0000 0.0000 15  DA  D C5    
4813 C C6    . DA  D 15  ? 1.0159 1.0407 1.0255 0.0000 0.0000 0.0000 15  DA  D C6    
4814 N N6    . DA  D 15  ? 1.0196 1.0418 1.0195 0.0000 0.0000 0.0000 15  DA  D N6    
4815 N N1    . DA  D 15  ? 0.9989 1.0520 1.0379 0.0000 0.0000 0.0000 15  DA  D N1    
4816 C C2    . DA  D 15  ? 0.9889 1.0449 1.0431 0.0000 0.0000 0.0000 15  DA  D C2    
4817 N N3    . DA  D 15  ? 1.0046 1.0422 1.0549 0.0000 0.0000 0.0000 15  DA  D N3    
4818 C C4    . DA  D 15  ? 1.0281 1.0354 1.0445 0.0000 0.0000 0.0000 15  DA  D C4    
4819 P P     . DC  D 16  ? 1.1255 1.0861 1.2174 0.0000 0.0000 0.0000 16  DC  D P     
4820 O OP1   . DC  D 16  ? 1.1374 1.1045 1.2788 0.0000 0.0000 0.0000 16  DC  D OP1   
4821 O OP2   . DC  D 16  ? 1.1703 1.0876 1.2002 0.0000 0.0000 0.0000 16  DC  D OP2   
4822 O "O5'" . DC  D 16  ? 1.1072 1.0953 1.2187 0.0000 0.0000 0.0000 16  DC  D "O5'" 
4823 C "C5'" . DC  D 16  ? 1.0728 1.0969 1.2253 0.0000 0.0000 0.0000 16  DC  D "C5'" 
4824 C "C4'" . DC  D 16  ? 1.0717 1.1025 1.2103 0.0000 0.0000 0.0000 16  DC  D "C4'" 
4825 O "O4'" . DC  D 16  ? 1.0454 1.0800 1.1546 0.0000 0.0000 0.0000 16  DC  D "O4'" 
4826 C "C3'" . DC  D 16  ? 1.1123 1.1180 1.2229 0.0000 0.0000 0.0000 16  DC  D "C3'" 
4827 O "O3'" . DC  D 16  ? 1.1687 1.1784 1.3143 0.0000 0.0000 0.0000 16  DC  D "O3'" 
4828 C "C2'" . DC  D 16  ? 1.0708 1.0778 1.1494 0.0000 0.0000 0.0000 16  DC  D "C2'" 
4829 C "C1'" . DC  D 16  ? 1.0294 1.0543 1.1091 0.0000 0.0000 0.0000 16  DC  D "C1'" 
4830 N N1    . DC  D 16  ? 1.0160 1.0277 1.0612 0.0000 0.0000 0.0000 16  DC  D N1    
4831 C C2    . DC  D 16  ? 0.9836 1.0113 1.0243 0.0000 0.0000 0.0000 16  DC  D C2    
4832 O O2    . DC  D 16  ? 0.9529 1.0010 1.0104 0.0000 0.0000 0.0000 16  DC  D O2    
4833 N N3    . DC  D 16  ? 0.9752 0.9921 0.9920 0.0000 0.0000 0.0000 16  DC  D N3    
4834 C C4    . DC  D 16  ? 1.0027 0.9876 0.9910 0.0000 0.0000 0.0000 16  DC  D C4    
4835 N N4    . DC  D 16  ? 0.9961 0.9666 0.9594 0.0000 0.0000 0.0000 16  DC  D N4    
4836 C C5    . DC  D 16  ? 1.0303 0.9929 1.0142 0.0000 0.0000 0.0000 16  DC  D C5    
4837 C C6    . DC  D 16  ? 1.0306 1.0110 1.0485 0.0000 0.0000 0.0000 16  DC  D C6    
4838 P P     . DA  D 17  ? 1.2438 1.2254 1.3740 0.0000 0.0000 0.0000 17  DA  D P     
4839 O OP1   . DA  D 17  ? 1.2482 1.2195 1.3363 0.0000 0.0000 0.0000 17  DA  D OP1   
4840 O OP2   . DA  D 17  ? 1.2318 1.2230 1.4148 0.0000 0.0000 0.0000 17  DA  D OP2   
4841 O "O5'" . DA  D 17  ? 1.3149 1.2664 1.4192 0.0000 0.0000 0.0000 17  DA  D "O5'" 
4842 C "C5'" . DA  D 17  ? 1.4097 1.3287 1.4525 0.0000 0.0000 0.0000 17  DA  D "C5'" 
4843 C "C4'" . DA  D 17  ? 1.5044 1.3791 1.5146 0.0000 0.0000 0.0000 17  DA  D "C4'" 
4844 O "O4'" . DA  D 17  ? 1.5306 1.4106 1.5673 0.0000 0.0000 0.0000 17  DA  D "O4'" 
4845 C "C3'" . DA  D 17  ? 1.5594 1.3998 1.5038 0.0000 0.0000 0.0000 17  DA  D "C3'" 
4846 O "O3'" . DA  D 17  ? 1.6066 1.4145 1.5102 0.0000 0.0000 0.0000 17  DA  D "O3'" 
4847 C "C2'" . DA  D 17  ? 1.6059 1.4147 1.5310 0.0000 0.0000 0.0000 17  DA  D "C2'" 
4848 C "C1'" . DA  D 17  ? 1.5945 1.4339 1.5834 0.0000 0.0000 0.0000 17  DA  D "C1'" 
4849 N N9    . DA  D 17  ? 1.6081 1.4613 1.6055 0.0000 0.0000 0.0000 17  DA  D N9    
4850 C C8    . DA  D 17  ? 1.5860 1.4764 1.6104 0.0000 0.0000 0.0000 17  DA  D C8    
4851 N N7    . DA  D 17  ? 1.6033 1.4915 1.6231 0.0000 0.0000 0.0000 17  DA  D N7    
4852 C C5    . DA  D 17  ? 1.6404 1.4906 1.6317 0.0000 0.0000 0.0000 17  DA  D C5    
4853 C C6    . DA  D 17  ? 1.6611 1.4882 1.6319 0.0000 0.0000 0.0000 17  DA  D C6    
4854 N N6    . DA  D 17  ? 1.6469 1.4859 1.6225 0.0000 0.0000 0.0000 17  DA  D N6    
4855 N N1    . DA  D 17  ? 1.6998 1.4854 1.6395 0.0000 0.0000 0.0000 17  DA  D N1    
4856 C C2    . DA  D 17  ? 1.7194 1.4850 1.6464 0.0000 0.0000 0.0000 17  DA  D C2    
4857 N N3    . DA  D 17  ? 1.7010 1.4826 1.6424 0.0000 0.0000 0.0000 17  DA  D N3    
4858 C C4    . DA  D 17  ? 1.6532 1.4801 1.6294 0.0000 0.0000 0.0000 17  DA  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   ?   ?   ?   A . n 
A 1 12  ASP 12  9   ?   ?   ?   A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 ASN 227 224 224 ASN ASN A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1 343 PRO 343 340 340 PRO PRO A . n 
A 1 344 SER 344 341 341 SER SER A . n 
A 1 345 THR 345 342 342 THR THR A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 LYS 348 345 345 LYS LYS A . n 
A 1 349 VAL 349 346 346 VAL VAL A . n 
A 1 350 LEU 350 347 347 LEU LEU A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 PRO 352 349 349 PRO PRO A . n 
A 1 353 ARG 353 350 350 ARG ARG A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 VAL 356 353 353 VAL VAL A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 HIS 360 357 357 HIS HIS A . n 
A 1 361 LEU 361 358 358 LEU LEU A . n 
A 1 362 GLY 362 359 359 GLY GLY A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 ASN 364 361 361 ASN ASN A . n 
A 1 365 ARG 365 362 362 ARG ARG A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 VAL 367 364 364 VAL VAL A . n 
A 1 368 SER 368 365 365 SER SER A . n 
A 1 369 ILE 369 366 366 ILE ILE A . n 
A 1 370 ASP 370 367 367 ASP ASP A . n 
A 1 371 ASN 371 368 368 ASN ASN A . n 
A 1 372 LEU 372 369 369 LEU LEU A . n 
A 1 373 LYS 373 370 370 LYS LYS A . n 
A 1 374 PRO 374 371 371 PRO PRO A . n 
A 1 375 THR 375 372 372 THR THR A . n 
A 1 376 SER 376 373 373 SER SER A . n 
A 1 377 HIS 377 374 374 HIS HIS A . n 
A 1 378 GLN 378 375 ?   ?   ?   A . n 
A 1 379 ASN 379 376 ?   ?   ?   A . n 
A 1 380 GLY 380 377 ?   ?   ?   A . n 
A 1 381 THR 381 378 ?   ?   ?   A . n 
A 1 382 THR 382 379 ?   ?   ?   A . n 
A 1 383 ASN 383 380 ?   ?   ?   A . n 
A 1 384 ASP 384 381 ?   ?   ?   A . n 
A 1 385 THR 385 382 ?   ?   ?   A . n 
A 1 386 ALA 386 383 ?   ?   ?   A . n 
A 1 387 THR 387 384 ?   ?   ?   A . n 
A 1 388 MET 388 385 ?   ?   ?   A . n 
A 1 389 ASP 389 386 ?   ?   ?   A . n 
A 1 390 HIS 390 387 ?   ?   ?   A . n 
A 1 391 LEU 391 388 ?   ?   ?   A . n 
A 1 392 GLU 392 389 ?   ?   ?   A . n 
A 1 393 LYS 393 390 ?   ?   ?   A . n 
A 1 394 ASN 394 391 ?   ?   ?   A . n 
A 1 395 GLU 395 392 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   GLY 3   0   ?   ?   ?   B . n 
B 1 4   CYS 4   1   ?   ?   ?   B . n 
B 1 5   ASN 5   2   ?   ?   ?   B . n 
B 1 6   THR 6   3   ?   ?   ?   B . n 
B 1 7   LYS 7   4   ?   ?   ?   B . n 
B 1 8   LYS 8   5   ?   ?   ?   B . n 
B 1 9   PRO 9   6   ?   ?   ?   B . n 
B 1 10  ASN 10  7   ?   ?   ?   B . n 
B 1 11  LEU 11  8   ?   ?   ?   B . n 
B 1 12  ASP 12  9   ?   ?   ?   B . n 
B 1 13  ALA 13  10  ?   ?   ?   B . n 
B 1 14  GLU 14  11  ?   ?   ?   B . n 
B 1 15  LEU 15  12  ?   ?   ?   B . n 
B 1 16  ASP 16  13  ?   ?   ?   B . n 
B 1 17  GLN 17  14  ?   ?   ?   B . n 
B 1 18  LEU 18  15  ?   ?   ?   B . n 
B 1 19  LEU 19  16  ?   ?   ?   B . n 
B 1 20  GLN 20  17  ?   ?   ?   B . n 
B 1 21  GLY 21  18  ?   ?   ?   B . n 
B 1 22  HIS 22  19  ?   ?   ?   B . n 
B 1 23  TYR 23  20  ?   ?   ?   B . n 
B 1 24  ILE 24  21  ?   ?   ?   B . n 
B 1 25  LYS 25  22  ?   ?   ?   B . n 
B 1 26  GLY 26  23  ?   ?   ?   B . n 
B 1 27  TYR 27  24  ?   ?   ?   B . n 
B 1 28  PRO 28  25  ?   ?   ?   B . n 
B 1 29  LYS 29  26  ?   ?   ?   B . n 
B 1 30  GLN 30  27  ?   ?   ?   B . n 
B 1 31  TYR 31  28  ?   ?   ?   B . n 
B 1 32  THR 32  29  ?   ?   ?   B . n 
B 1 33  TYR 33  30  ?   ?   ?   B . n 
B 1 34  PHE 34  31  ?   ?   ?   B . n 
B 1 35  LEU 35  32  ?   ?   ?   B . n 
B 1 36  GLU 36  33  ?   ?   ?   B . n 
B 1 37  ASP 37  34  ?   ?   ?   B . n 
B 1 38  GLY 38  35  ?   ?   ?   B . n 
B 1 39  LYS 39  36  ?   ?   ?   B . n 
B 1 40  VAL 40  37  ?   ?   ?   B . n 
B 1 41  LYS 41  38  ?   ?   ?   B . n 
B 1 42  VAL 42  39  ?   ?   ?   B . n 
B 1 43  SER 43  40  ?   ?   ?   B . n 
B 1 44  ARG 44  41  ?   ?   ?   B . n 
B 1 45  PRO 45  42  ?   ?   ?   B . n 
B 1 46  GLU 46  43  ?   ?   ?   B . n 
B 1 47  GLY 47  44  ?   ?   ?   B . n 
B 1 48  VAL 48  45  ?   ?   ?   B . n 
B 1 49  LYS 49  46  ?   ?   ?   B . n 
B 1 50  ILE 50  47  ?   ?   ?   B . n 
B 1 51  ILE 51  48  ?   ?   ?   B . n 
B 1 52  PRO 52  49  ?   ?   ?   B . n 
B 1 53  PRO 53  50  ?   ?   ?   B . n 
B 1 54  GLN 54  51  ?   ?   ?   B . n 
B 1 55  SER 55  52  ?   ?   ?   B . n 
B 1 56  ASP 56  53  ?   ?   ?   B . n 
B 1 57  ARG 57  54  ?   ?   ?   B . n 
B 1 58  GLN 58  55  ?   ?   ?   B . n 
B 1 59  LYS 59  56  ?   ?   ?   B . n 
B 1 60  ILE 60  57  ?   ?   ?   B . n 
B 1 61  VAL 61  58  ?   ?   ?   B . n 
B 1 62  LEU 62  59  ?   ?   ?   B . n 
B 1 63  GLN 63  60  ?   ?   ?   B . n 
B 1 64  ALA 64  61  ?   ?   ?   B . n 
B 1 65  HIS 65  62  ?   ?   ?   B . n 
B 1 66  ASN 66  63  ?   ?   ?   B . n 
B 1 67  LEU 67  64  ?   ?   ?   B . n 
B 1 68  ALA 68  65  ?   ?   ?   B . n 
B 1 69  HIS 69  66  ?   ?   ?   B . n 
B 1 70  THR 70  67  ?   ?   ?   B . n 
B 1 71  GLY 71  68  ?   ?   ?   B . n 
B 1 72  ARG 72  69  ?   ?   ?   B . n 
B 1 73  GLU 73  70  ?   ?   ?   B . n 
B 1 74  ALA 74  71  ?   ?   ?   B . n 
B 1 75  THR 75  72  ?   ?   ?   B . n 
B 1 76  LEU 76  73  ?   ?   ?   B . n 
B 1 77  LEU 77  74  ?   ?   ?   B . n 
B 1 78  LYS 78  75  ?   ?   ?   B . n 
B 1 79  ILE 79  76  ?   ?   ?   B . n 
B 1 80  ALA 80  77  ?   ?   ?   B . n 
B 1 81  ASN 81  78  ?   ?   ?   B . n 
B 1 82  LEU 82  79  ?   ?   ?   B . n 
B 1 83  TYR 83  80  ?   ?   ?   B . n 
B 1 84  TRP 84  81  ?   ?   ?   B . n 
B 1 85  TRP 85  82  ?   ?   ?   B . n 
B 1 86  PRO 86  83  ?   ?   ?   B . n 
B 1 87  ASN 87  84  ?   ?   ?   B . n 
B 1 88  MET 88  85  ?   ?   ?   B . n 
B 1 89  ARG 89  86  ?   ?   ?   B . n 
B 1 90  LYS 90  87  ?   ?   ?   B . n 
B 1 91  ASP 91  88  ?   ?   ?   B . n 
B 1 92  VAL 92  89  ?   ?   ?   B . n 
B 1 93  VAL 93  90  ?   ?   ?   B . n 
B 1 94  LYS 94  91  ?   ?   ?   B . n 
B 1 95  GLN 95  92  ?   ?   ?   B . n 
B 1 96  LEU 96  93  ?   ?   ?   B . n 
B 1 97  GLY 97  94  ?   ?   ?   B . n 
B 1 98  ARG 98  95  ?   ?   ?   B . n 
B 1 99  CYS 99  96  ?   ?   ?   B . n 
B 1 100 GLN 100 97  ?   ?   ?   B . n 
B 1 101 GLN 101 98  ?   ?   ?   B . n 
B 1 102 CYS 102 99  ?   ?   ?   B . n 
B 1 103 LEU 103 100 ?   ?   ?   B . n 
B 1 104 ILE 104 101 ?   ?   ?   B . n 
B 1 105 THR 105 102 ?   ?   ?   B . n 
B 1 106 ASN 106 103 ?   ?   ?   B . n 
B 1 107 ALA 107 104 ?   ?   ?   B . n 
B 1 108 SER 108 105 ?   ?   ?   B . n 
B 1 109 ASN 109 106 ?   ?   ?   B . n 
B 1 110 LYS 110 107 ?   ?   ?   B . n 
B 1 111 ALA 111 108 ?   ?   ?   B . n 
B 1 112 SER 112 109 ?   ?   ?   B . n 
B 1 113 GLY 113 110 ?   ?   ?   B . n 
B 1 114 PRO 114 111 ?   ?   ?   B . n 
B 1 115 ILE 115 112 ?   ?   ?   B . n 
B 1 116 LEU 116 113 ?   ?   ?   B . n 
B 1 117 ARG 117 114 ?   ?   ?   B . n 
B 1 118 PRO 118 115 ?   ?   ?   B . n 
B 1 119 ASP 119 116 116 ASP ASP B . n 
B 1 120 ARG 120 117 117 ARG ARG B . n 
B 1 121 PRO 121 118 118 PRO PRO B . n 
B 1 122 GLN 122 119 119 GLN GLN B . n 
B 1 123 LYS 123 120 120 LYS LYS B . n 
B 1 124 PRO 124 121 121 PRO PRO B . n 
B 1 125 PHE 125 122 122 PHE PHE B . n 
B 1 126 ASP 126 123 123 ASP ASP B . n 
B 1 127 LYS 127 124 124 LYS LYS B . n 
B 1 128 PHE 128 125 125 PHE PHE B . n 
B 1 129 PHE 129 126 126 PHE PHE B . n 
B 1 130 ILE 130 127 127 ILE ILE B . n 
B 1 131 ASP 131 128 128 ASP ASP B . n 
B 1 132 TYR 132 129 129 TYR TYR B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 PRO 135 132 132 PRO PRO B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 PRO 137 134 134 PRO PRO B . n 
B 1 138 PRO 138 135 135 PRO PRO B . n 
B 1 139 SER 139 136 136 SER SER B . n 
B 1 140 GLN 140 137 137 GLN GLN B . n 
B 1 141 GLY 141 138 138 GLY GLY B . n 
B 1 142 TYR 142 139 139 TYR TYR B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 TYR 144 141 141 TYR TYR B . n 
B 1 145 VAL 145 142 142 VAL VAL B . n 
B 1 146 LEU 146 143 143 LEU LEU B . n 
B 1 147 VAL 147 144 144 VAL VAL B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 VAL 149 146 146 VAL VAL B . n 
B 1 150 ASP 150 147 147 ASP ASP B . n 
B 1 151 GLY 151 148 148 GLY GLY B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 THR 153 150 150 THR THR B . n 
B 1 154 GLY 154 151 151 GLY GLY B . n 
B 1 155 PHE 155 152 152 PHE PHE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 TRP 157 154 154 TRP TRP B . n 
B 1 158 LEU 158 155 155 LEU LEU B . n 
B 1 159 TYR 159 156 156 TYR TYR B . n 
B 1 160 PRO 160 157 157 PRO PRO B . n 
B 1 161 THR 161 158 158 THR THR B . n 
B 1 162 LYS 162 159 159 LYS LYS B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 PRO 164 161 161 PRO PRO B . n 
B 1 165 SER 165 162 162 SER SER B . n 
B 1 166 THR 166 163 163 THR THR B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ALA 168 165 165 ALA ALA B . n 
B 1 169 THR 169 166 166 THR THR B . n 
B 1 170 VAL 170 167 167 VAL VAL B . n 
B 1 171 LYS 171 168 168 LYS LYS B . n 
B 1 172 SER 172 169 169 SER SER B . n 
B 1 173 LEU 173 170 170 LEU LEU B . n 
B 1 174 ASN 174 171 171 ASN ASN B . n 
B 1 175 VAL 175 172 172 VAL VAL B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 THR 177 174 174 THR THR B . n 
B 1 178 SER 178 175 175 SER SER B . n 
B 1 179 ILE 179 176 176 ILE ILE B . n 
B 1 180 ALA 180 177 177 ALA ALA B . n 
B 1 181 ILE 181 178 178 ILE ILE B . n 
B 1 182 PRO 182 179 179 PRO PRO B . n 
B 1 183 LYS 183 180 180 LYS LYS B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 HIS 186 183 183 HIS HIS B . n 
B 1 187 SER 187 184 184 SER SER B . n 
B 1 188 ASP 188 185 185 ASP ASP B . n 
B 1 189 GLN 189 186 186 GLN GLN B . n 
B 1 190 GLY 190 187 187 GLY GLY B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 THR 194 191 191 THR THR B . n 
B 1 195 SER 195 192 192 SER SER B . n 
B 1 196 SER 196 193 193 SER SER B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 PHE 198 195 195 PHE PHE B . n 
B 1 199 ALA 199 196 196 ALA ALA B . n 
B 1 200 GLU 200 197 197 GLU GLU B . n 
B 1 201 TRP 201 198 198 TRP TRP B . n 
B 1 202 ALA 202 199 199 ALA ALA B . n 
B 1 203 LYS 203 200 200 LYS LYS B . n 
B 1 204 GLU 204 201 201 GLU GLU B . n 
B 1 205 ARG 205 202 202 ARG ARG B . n 
B 1 206 GLY 206 203 203 GLY GLY B . n 
B 1 207 ILE 207 204 204 ILE ILE B . n 
B 1 208 HIS 208 205 205 HIS HIS B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLU 210 207 207 GLU GLU B . n 
B 1 211 PHE 211 208 208 PHE PHE B . n 
B 1 212 SER 212 209 209 SER SER B . n 
B 1 213 THR 213 210 210 THR THR B . n 
B 1 214 PRO 214 211 211 PRO PRO B . n 
B 1 215 TYR 215 212 212 TYR TYR B . n 
B 1 216 HIS 216 213 213 HIS HIS B . n 
B 1 217 PRO 217 214 214 PRO PRO B . n 
B 1 218 GLN 218 215 215 GLN GLN B . n 
B 1 219 SER 219 216 216 SER SER B . n 
B 1 220 SER 220 217 217 SER SER B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 LYS 222 219 219 LYS LYS B . n 
B 1 223 VAL 223 220 220 VAL VAL B . n 
B 1 224 GLU 224 221 221 GLU GLU B . n 
B 1 225 ARG 225 222 222 ARG ARG B . n 
B 1 226 LYS 226 223 223 LYS LYS B . n 
B 1 227 ASN 227 224 224 ASN ASN B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 ILE 230 227 227 ILE ILE B . n 
B 1 231 LYS 231 228 228 LYS LYS B . n 
B 1 232 ARG 232 229 229 ARG ARG B . n 
B 1 233 LEU 233 230 230 LEU LEU B . n 
B 1 234 LEU 234 231 231 LEU LEU B . n 
B 1 235 THR 235 232 232 THR THR B . n 
B 1 236 LYS 236 233 233 LYS LYS B . n 
B 1 237 LEU 237 234 234 LEU LEU B . n 
B 1 238 LEU 238 235 235 LEU LEU B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 GLY 240 237 237 GLY GLY B . n 
B 1 241 ARG 241 238 238 ARG ARG B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 THR 243 240 240 THR THR B . n 
B 1 244 LYS 244 241 241 LYS LYS B . n 
B 1 245 TRP 245 242 242 TRP TRP B . n 
B 1 246 TYR 246 243 243 TYR TYR B . n 
B 1 247 ASP 247 244 244 ASP ASP B . n 
B 1 248 LEU 248 245 245 LEU LEU B . n 
B 1 249 LEU 249 246 246 LEU LEU B . n 
B 1 250 PRO 250 247 247 PRO PRO B . n 
B 1 251 VAL 251 248 248 VAL VAL B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 ASN 257 254 254 ASN ASN B . n 
B 1 258 ASN 258 255 255 ASN ASN B . n 
B 1 259 THR 259 256 256 THR THR B . n 
B 1 260 TYR 260 257 257 TYR TYR B . n 
B 1 261 SER 261 258 258 SER SER B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 VAL 263 260 260 VAL VAL B . n 
B 1 264 LEU 264 261 261 LEU LEU B . n 
B 1 265 LYS 265 262 262 LYS LYS B . n 
B 1 266 TYR 266 263 263 TYR TYR B . n 
B 1 267 THR 267 264 264 THR THR B . n 
B 1 268 PRO 268 265 265 PRO PRO B . n 
B 1 269 HIS 269 266 266 HIS HIS B . n 
B 1 270 GLN 270 267 267 GLN GLN B . n 
B 1 271 LEU 271 268 268 LEU LEU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 PHE 273 270 270 PHE PHE B . n 
B 1 274 GLY 274 271 271 GLY GLY B . n 
B 1 275 ILE 275 272 272 ILE ILE B . n 
B 1 276 ASP 276 273 273 ASP ASP B . n 
B 1 277 SER 277 274 274 SER SER B . n 
B 1 278 ASN 278 275 275 ASN ASN B . n 
B 1 279 THR 279 276 276 THR THR B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 PHE 281 278 278 PHE PHE B . n 
B 1 282 ALA 282 279 ?   ?   ?   B . n 
B 1 283 ASN 283 280 ?   ?   ?   B . n 
B 1 284 GLN 284 281 ?   ?   ?   B . n 
B 1 285 ASP 285 282 ?   ?   ?   B . n 
B 1 286 THR 286 283 ?   ?   ?   B . n 
B 1 287 LEU 287 284 ?   ?   ?   B . n 
B 1 288 ASP 288 285 ?   ?   ?   B . n 
B 1 289 LEU 289 286 ?   ?   ?   B . n 
B 1 290 THR 290 287 ?   ?   ?   B . n 
B 1 291 ARG 291 288 ?   ?   ?   B . n 
B 1 292 GLU 292 289 ?   ?   ?   B . n 
B 1 293 GLU 293 290 ?   ?   ?   B . n 
B 1 294 GLU 294 291 ?   ?   ?   B . n 
B 1 295 LEU 295 292 ?   ?   ?   B . n 
B 1 296 SER 296 293 ?   ?   ?   B . n 
B 1 297 LEU 297 294 ?   ?   ?   B . n 
B 1 298 LEU 298 295 ?   ?   ?   B . n 
B 1 299 GLN 299 296 ?   ?   ?   B . n 
B 1 300 GLU 300 297 ?   ?   ?   B . n 
B 1 301 ILE 301 298 ?   ?   ?   B . n 
B 1 302 ARG 302 299 ?   ?   ?   B . n 
B 1 303 THR 303 300 ?   ?   ?   B . n 
B 1 304 SER 304 301 ?   ?   ?   B . n 
B 1 305 LEU 305 302 ?   ?   ?   B . n 
B 1 306 TYR 306 303 ?   ?   ?   B . n 
B 1 307 HIS 307 304 ?   ?   ?   B . n 
B 1 308 PRO 308 305 ?   ?   ?   B . n 
B 1 309 SER 309 306 ?   ?   ?   B . n 
B 1 310 THR 310 307 ?   ?   ?   B . n 
B 1 311 PRO 311 308 ?   ?   ?   B . n 
B 1 312 PRO 312 309 ?   ?   ?   B . n 
B 1 313 ALA 313 310 ?   ?   ?   B . n 
B 1 314 SER 314 311 ?   ?   ?   B . n 
B 1 315 SER 315 312 ?   ?   ?   B . n 
B 1 316 ARG 316 313 ?   ?   ?   B . n 
B 1 317 SER 317 314 ?   ?   ?   B . n 
B 1 318 TRP 318 315 ?   ?   ?   B . n 
B 1 319 SER 319 316 ?   ?   ?   B . n 
B 1 320 PRO 320 317 ?   ?   ?   B . n 
B 1 321 VAL 321 318 ?   ?   ?   B . n 
B 1 322 VAL 322 319 ?   ?   ?   B . n 
B 1 323 GLY 323 320 ?   ?   ?   B . n 
B 1 324 GLN 324 321 ?   ?   ?   B . n 
B 1 325 LEU 325 322 ?   ?   ?   B . n 
B 1 326 VAL 326 323 ?   ?   ?   B . n 
B 1 327 GLN 327 324 ?   ?   ?   B . n 
B 1 328 GLU 328 325 ?   ?   ?   B . n 
B 1 329 ARG 329 326 ?   ?   ?   B . n 
B 1 330 VAL 330 327 ?   ?   ?   B . n 
B 1 331 ALA 331 328 ?   ?   ?   B . n 
B 1 332 ARG 332 329 ?   ?   ?   B . n 
B 1 333 PRO 333 330 ?   ?   ?   B . n 
B 1 334 ALA 334 331 ?   ?   ?   B . n 
B 1 335 SER 335 332 ?   ?   ?   B . n 
B 1 336 LEU 336 333 ?   ?   ?   B . n 
B 1 337 ARG 337 334 ?   ?   ?   B . n 
B 1 338 PRO 338 335 ?   ?   ?   B . n 
B 1 339 ARG 339 336 ?   ?   ?   B . n 
B 1 340 TRP 340 337 ?   ?   ?   B . n 
B 1 341 HIS 341 338 ?   ?   ?   B . n 
B 1 342 LYS 342 339 ?   ?   ?   B . n 
B 1 343 PRO 343 340 ?   ?   ?   B . n 
B 1 344 SER 344 341 ?   ?   ?   B . n 
B 1 345 THR 345 342 ?   ?   ?   B . n 
B 1 346 VAL 346 343 ?   ?   ?   B . n 
B 1 347 LEU 347 344 ?   ?   ?   B . n 
B 1 348 LYS 348 345 ?   ?   ?   B . n 
B 1 349 VAL 349 346 ?   ?   ?   B . n 
B 1 350 LEU 350 347 ?   ?   ?   B . n 
B 1 351 ASN 351 348 ?   ?   ?   B . n 
B 1 352 PRO 352 349 ?   ?   ?   B . n 
B 1 353 ARG 353 350 ?   ?   ?   B . n 
B 1 354 THR 354 351 ?   ?   ?   B . n 
B 1 355 VAL 355 352 ?   ?   ?   B . n 
B 1 356 VAL 356 353 ?   ?   ?   B . n 
B 1 357 ILE 357 354 ?   ?   ?   B . n 
B 1 358 LEU 358 355 ?   ?   ?   B . n 
B 1 359 ASP 359 356 ?   ?   ?   B . n 
B 1 360 HIS 360 357 ?   ?   ?   B . n 
B 1 361 LEU 361 358 ?   ?   ?   B . n 
B 1 362 GLY 362 359 ?   ?   ?   B . n 
B 1 363 ASN 363 360 ?   ?   ?   B . n 
B 1 364 ASN 364 361 ?   ?   ?   B . n 
B 1 365 ARG 365 362 ?   ?   ?   B . n 
B 1 366 THR 366 363 ?   ?   ?   B . n 
B 1 367 VAL 367 364 ?   ?   ?   B . n 
B 1 368 SER 368 365 ?   ?   ?   B . n 
B 1 369 ILE 369 366 ?   ?   ?   B . n 
B 1 370 ASP 370 367 ?   ?   ?   B . n 
B 1 371 ASN 371 368 ?   ?   ?   B . n 
B 1 372 LEU 372 369 ?   ?   ?   B . n 
B 1 373 LYS 373 370 ?   ?   ?   B . n 
B 1 374 PRO 374 371 ?   ?   ?   B . n 
B 1 375 THR 375 372 ?   ?   ?   B . n 
B 1 376 SER 376 373 ?   ?   ?   B . n 
B 1 377 HIS 377 374 ?   ?   ?   B . n 
B 1 378 GLN 378 375 ?   ?   ?   B . n 
B 1 379 ASN 379 376 ?   ?   ?   B . n 
B 1 380 GLY 380 377 ?   ?   ?   B . n 
B 1 381 THR 381 378 ?   ?   ?   B . n 
B 1 382 THR 382 379 ?   ?   ?   B . n 
B 1 383 ASN 383 380 ?   ?   ?   B . n 
B 1 384 ASP 384 381 ?   ?   ?   B . n 
B 1 385 THR 385 382 ?   ?   ?   B . n 
B 1 386 ALA 386 383 ?   ?   ?   B . n 
B 1 387 THR 387 384 ?   ?   ?   B . n 
B 1 388 MET 388 385 ?   ?   ?   B . n 
B 1 389 ASP 389 386 ?   ?   ?   B . n 
B 1 390 HIS 390 387 ?   ?   ?   B . n 
B 1 391 LEU 391 388 ?   ?   ?   B . n 
B 1 392 GLU 392 389 ?   ?   ?   B . n 
B 1 393 LYS 393 390 ?   ?   ?   B . n 
B 1 394 ASN 394 391 ?   ?   ?   B . n 
B 1 395 GLU 395 392 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  A   C . n 
C 2 2   DT  2   2   2   DT  T   C . n 
C 2 3   DT  3   3   3   DT  T   C . n 
C 2 4   DG  4   4   4   DG  G   C . n 
C 2 5   DT  5   5   5   DT  T   C . n 
C 2 6   DC  6   6   6   DC  C   C . n 
C 2 7   DA  7   7   7   DA  A   C . n 
C 2 8   DT  8   8   8   DT  T   C . n 
C 2 9   DG  9   9   9   DG  G   C . n 
C 2 10  DG  10  10  10  DG  G   C . n 
C 2 11  DA  11  11  11  DA  A   C . n 
C 2 12  DA  12  12  12  DA  A   C . n 
C 2 13  DT  13  13  13  DT  T   C . n 
C 2 14  DT  14  14  14  DT  T   C . n 
C 2 15  DT  15  15  15  DT  T   C . n 
C 2 16  DT  16  16  16  DT  T   C . n 
C 2 17  DG  17  17  17  DG  G   C . n 
C 2 18  DT  18  18  18  DT  T   C . n 
C 2 19  DA  19  19  19  DA  A   C . n 
D 3 1   DT  1   1   1   DT  T   D . n 
D 3 2   DA  2   2   2   DA  A   D . n 
D 3 3   DC  3   3   3   DC  C   D . n 
D 3 4   DA  4   4   4   DA  A   D . n 
D 3 5   DA  5   5   5   DA  A   D . n 
D 3 6   DA  6   6   6   DA  A   D . n 
D 3 7   DA  7   7   7   DA  A   D . n 
D 3 8   DT  8   8   8   DT  T   D . n 
D 3 9   DT  9   9   9   DT  T   D . n 
D 3 10  DC  10  10  10  DC  C   D . n 
D 3 11  DC  11  11  11  DC  C   D . n 
D 3 12  DA  12  12  12  DA  A   D . n 
D 3 13  DT  13  13  13  DT  T   D . n 
D 3 14  DG  14  14  14  DG  G   D . n 
D 3 15  DA  15  15  15  DA  A   D . n 
D 3 16  DC  16  16  16  DC  C   D . n 
D 3 17  DA  17  17  17  DA  A   D . n 
# 
_struct_site_keywords.site_id   1 
_struct_site_keywords.text      'INTERCALATION, MINOR GROOVE BINDER' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 23150 ? 
1 MORE         -124  ? 
1 'SSA (A^2)'  53880 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -62.6150000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OAG ? I RLT .   ? A RLT 397 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 138.6 ? 
2  OAG ? I RLT .   ? A RLT 397 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 80.4  ? 
3  OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 65.1  ? 
4  OAG ? I RLT .   ? A RLT 397 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OAH ? I RLT .   ? A RLT 397 ? 1_555 74.6  ? 
5  OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OAH ? I RLT .   ? A RLT 397 ? 1_555 78.2  ? 
6  OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OAH ? I RLT .   ? A RLT 397 ? 1_555 81.4  ? 
7  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 118.5 ? 
8  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 117.9 ? 
9  ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 99.3  ? 
10 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 108.6 ? 
11 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 103.0 ? 
12 SG  ? A CYS 99  ? A CYS 96  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 108.1 ? 
13 OAH ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OAE ? I RLT .   ? A RLT 397 ? 1_555 87.8  ? 
14 OAH ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 87.8  ? 
15 OAE ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 173.5 ? 
16 OAH ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 149.9 ? 
17 OAE ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 79.8  ? 
18 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 101.8 ? 
19 OAH ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 93.8  ? 
20 OAE ? I RLT .   ? A RLT 397 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 68.1  ? 
21 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 107.4 ? 
22 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MN ? G MN . ? A MN 395 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 56.1  ? 
23 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MN ? N MN . ? B MN 393 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 68.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -67.8420 27.0170 -55.7960 0.3026 0.3414 0.3122 -0.1004 -0.0615 -0.0606 4.0202 1.0034 5.3215 0.6630 
3.0680  1.3986  0.2040  -0.0939 -0.1871 -0.2145 -0.3743 0.2550  0.1800  -0.6665 0.1703 
'X-RAY DIFFRACTION' 2 ? refined -35.2130 38.8700 -5.2950  0.1836 0.3122 0.1216 -0.0568 0.0969  0.0587  1.1059 2.5892 1.6034 0.1692 
0.2043  0.4813  -0.1592 -0.3521 -0.1092 0.1288  0.0281  0.1387  0.2875  -0.0835 0.1311 
'X-RAY DIFFRACTION' 3 ? refined -54.2870 27.6810 -27.5350 0.4599 0.3925 0.4604 -0.2472 0.1345  0.0676  4.5856 0.1582 9.4075 0.6130 
-1.7984 0.4017  -0.4436 -0.5720 -0.8848 0.0889  -0.1626 -0.0367 1.3379  -0.3577 0.6062 
'X-RAY DIFFRACTION' 4 ? refined -24.6010 37.0440 15.4440  0.2537 0.5740 0.0578 0.0179  0.1120  0.0522  3.5133 1.7709 2.0652 
-0.6482 0.5991  -0.6755 -0.1656 -0.5702 -0.2205 0.3046  0.1166  0.1533  0.2421  -0.1076 0.0491 
'X-RAY DIFFRACTION' 5 ? refined -42.8200 61.1910 -15.4880 0.2039 0.2818 0.2540 -0.0994 0.0221  -0.0045 0.0415 5.7226 1.7416 0.4010 
0.1116  -0.2404 0.0036  -0.0440 0.0198  0.0307  -0.0652 0.2866  -0.3338 -0.1928 0.0616 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 10  ? ? A 111 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 112 ? ? A 308 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 309 ? ? A 374 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 B 116 ? ? B 278 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 C 1   ? ? C 19  ? ? ? ? 
'X-RAY DIFFRACTION' 6 5 D 1   ? ? D 17  ? ? ? ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .       ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 
2 SCALA       3.3.9   2008/10/21      other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
3 REFMAC      .       ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.005   'June 11, 2008' package PDB                  help@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 ADSC        Quantum ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 PHASER      .       ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" C DT 2  ? ? "O3'" C DT 2  ? ? P     C DT 3  ? ? 128.35 119.70 8.65  1.20 Y 
2  1 "O4'" C DT 3  ? ? "C1'" C DT 3  ? ? N1    C DT 3  ? ? 113.66 108.30 5.36  0.30 N 
3  1 "O4'" C DG 4  ? ? "C1'" C DG 4  ? ? N9    C DG 4  ? ? 111.98 108.30 3.68  0.30 N 
4  1 "O5'" C DG 9  ? ? "C5'" C DG 9  ? ? "C4'" C DG 9  ? ? 103.48 109.40 -5.92 0.80 N 
5  1 "C3'" C DA 12 ? ? "C2'" C DA 12 ? ? "C1'" C DA 12 ? ? 97.16  102.40 -5.24 0.80 N 
6  1 "O4'" C DT 18 ? ? "C4'" C DT 18 ? ? "C3'" C DT 18 ? ? 101.98 104.50 -2.52 0.40 N 
7  1 "C1'" C DT 18 ? ? "O4'" C DT 18 ? ? "C4'" C DT 18 ? ? 103.49 110.10 -6.61 1.00 N 
8  1 "O4'" D DT 1  ? ? "C1'" D DT 1  ? ? "C2'" D DT 1  ? ? 101.05 105.90 -4.85 0.80 N 
9  1 "O4'" D DT 1  ? ? "C1'" D DT 1  ? ? N1    D DT 1  ? ? 117.93 108.30 9.63  0.30 N 
10 1 "C3'" D DA 5  ? ? "C2'" D DA 5  ? ? "C1'" D DA 5  ? ? 95.82  102.40 -6.58 0.80 N 
11 1 "O4'" D DA 5  ? ? "C1'" D DA 5  ? ? N9    D DA 5  ? ? 112.58 108.30 4.28  0.30 N 
12 1 N3    D DT 8  ? ? C4    D DT 8  ? ? O4    D DT 8  ? ? 123.73 119.90 3.83  0.60 N 
13 1 "O4'" D DC 10 ? ? "C1'" D DC 10 ? ? N1    D DC 10 ? ? 103.77 108.00 -4.23 0.70 N 
14 1 "O4'" D DC 11 ? ? "C1'" D DC 11 ? ? N1    D DC 11 ? ? 114.06 108.30 5.76  0.30 N 
15 1 "O4'" D DA 12 ? ? "C1'" D DA 12 ? ? N9    D DA 12 ? ? 103.21 108.00 -4.79 0.70 N 
16 1 "O4'" D DT 13 ? ? "C1'" D DT 13 ? ? N1    D DT 13 ? ? 103.64 108.00 -4.36 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 24  ? ? 30.98   66.92   
2  1 GLN A 27  ? ? 107.19  -27.40  
3  1 GLN A 51  ? ? -29.56  -48.95  
4  1 PRO A 118 ? ? -48.84  152.31  
5  1 SER A 192 ? ? -48.01  151.34  
6  1 HIS A 213 ? ? -154.43 76.51   
7  1 SER A 217 ? ? -72.90  22.16   
8  1 THR A 240 ? ? -66.66  73.12   
9  1 LYS A 241 ? ? -101.84 77.73   
10 1 SER A 274 ? ? -73.73  -163.09 
11 1 ASP A 282 ? ? -38.23  -34.46  
12 1 ALA A 328 ? ? -48.46  -91.80  
13 1 PRO A 349 ? ? -61.83  1.13    
14 1 ASP A 356 ? ? -93.83  -139.50 
15 1 LEU A 358 ? ? -175.26 101.47  
16 1 PHE B 122 ? ? 85.73   -0.62   
17 1 GLN B 186 ? ? -83.77  33.12   
18 1 SER B 192 ? ? -48.66  151.53  
19 1 TYR B 212 ? ? 72.69   -9.61   
20 1 HIS B 213 ? ? -116.11 79.60   
21 1 LEU B 261 ? ? 83.57   -27.48  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 22  ? CG  ? A LYS 25  CG  
2  1 Y 1 A LYS 22  ? CD  ? A LYS 25  CD  
3  1 Y 1 A LYS 22  ? CE  ? A LYS 25  CE  
4  1 Y 1 A LYS 22  ? NZ  ? A LYS 25  NZ  
5  1 Y 1 A LYS 26  ? CG  ? A LYS 29  CG  
6  1 Y 1 A LYS 26  ? CD  ? A LYS 29  CD  
7  1 Y 1 A LYS 26  ? CE  ? A LYS 29  CE  
8  1 Y 1 A LYS 26  ? NZ  ? A LYS 29  NZ  
9  1 Y 1 A GLU 43  ? CG  ? A GLU 46  CG  
10 1 Y 1 A GLU 43  ? CD  ? A GLU 46  CD  
11 1 Y 1 A GLU 43  ? OE1 ? A GLU 46  OE1 
12 1 Y 1 A GLU 43  ? OE2 ? A GLU 46  OE2 
13 1 Y 1 A LYS 87  ? CG  ? A LYS 90  CG  
14 1 Y 1 A LYS 87  ? CD  ? A LYS 90  CD  
15 1 Y 1 A LYS 87  ? CE  ? A LYS 90  CE  
16 1 Y 1 A LYS 87  ? NZ  ? A LYS 90  NZ  
17 1 Y 1 A LYS 91  ? CG  ? A LYS 94  CG  
18 1 Y 1 A LYS 91  ? CD  ? A LYS 94  CD  
19 1 Y 1 A LYS 91  ? CE  ? A LYS 94  CE  
20 1 Y 1 A LYS 91  ? NZ  ? A LYS 94  NZ  
21 1 Y 1 A ARG 329 ? CG  ? A ARG 332 CG  
22 1 Y 1 A ARG 329 ? CD  ? A ARG 332 CD  
23 1 Y 1 A ARG 329 ? NE  ? A ARG 332 NE  
24 1 Y 1 A ARG 329 ? CZ  ? A ARG 332 CZ  
25 1 Y 1 A ARG 329 ? NH1 ? A ARG 332 NH1 
26 1 Y 1 A ARG 329 ? NH2 ? A ARG 332 NH2 
27 1 Y 1 A LYS 339 ? CG  ? A LYS 342 CG  
28 1 Y 1 A LYS 339 ? CD  ? A LYS 342 CD  
29 1 Y 1 A LYS 339 ? CE  ? A LYS 342 CE  
30 1 Y 1 A LYS 339 ? NZ  ? A LYS 342 NZ  
31 1 Y 1 A LYS 345 ? CG  ? A LYS 348 CG  
32 1 Y 1 A LYS 345 ? CD  ? A LYS 348 CD  
33 1 Y 1 A LYS 345 ? CE  ? A LYS 348 CE  
34 1 Y 1 A LYS 345 ? NZ  ? A LYS 348 NZ  
35 1 Y 1 B ARG 117 ? CG  ? B ARG 120 CG  
36 1 Y 1 B ARG 117 ? CD  ? B ARG 120 CD  
37 1 Y 1 B ARG 117 ? NE  ? B ARG 120 NE  
38 1 Y 1 B ARG 117 ? CZ  ? B ARG 120 CZ  
39 1 Y 1 B ARG 117 ? NH1 ? B ARG 120 NH1 
40 1 Y 1 B ARG 117 ? NH2 ? B ARG 120 NH2 
41 1 Y 1 B LYS 168 ? CG  ? B LYS 171 CG  
42 1 Y 1 B LYS 168 ? CD  ? B LYS 171 CD  
43 1 Y 1 B LYS 168 ? CE  ? B LYS 171 CE  
44 1 Y 1 B LYS 168 ? NZ  ? B LYS 171 NZ  
45 1 Y 1 B GLU 197 ? CG  ? B GLU 200 CG  
46 1 Y 1 B GLU 197 ? CD  ? B GLU 200 CD  
47 1 Y 1 B GLU 197 ? OE1 ? B GLU 200 OE1 
48 1 Y 1 B GLU 197 ? OE2 ? B GLU 200 OE2 
49 1 Y 1 B HIS 213 ? CG  ? B HIS 216 CG  
50 1 Y 1 B HIS 213 ? ND1 ? B HIS 216 ND1 
51 1 Y 1 B HIS 213 ? CD2 ? B HIS 216 CD2 
52 1 Y 1 B HIS 213 ? CE1 ? B HIS 216 CE1 
53 1 Y 1 B HIS 213 ? NE2 ? B HIS 216 NE2 
54 1 Y 1 B GLN 215 ? CG  ? B GLN 218 CG  
55 1 Y 1 B GLN 215 ? CD  ? B GLN 218 CD  
56 1 Y 1 B GLN 215 ? OE1 ? B GLN 218 OE1 
57 1 Y 1 B GLN 215 ? NE2 ? B GLN 218 NE2 
58 1 Y 1 B GLU 221 ? CG  ? B GLU 224 CG  
59 1 Y 1 B GLU 221 ? CD  ? B GLU 224 CD  
60 1 Y 1 B GLU 221 ? OE1 ? B GLU 224 OE1 
61 1 Y 1 B GLU 221 ? OE2 ? B GLU 224 OE2 
62 1 Y 1 B ARG 222 ? CG  ? B ARG 225 CG  
63 1 Y 1 B ARG 222 ? CD  ? B ARG 225 CD  
64 1 Y 1 B ARG 222 ? NE  ? B ARG 225 NE  
65 1 Y 1 B ARG 222 ? CZ  ? B ARG 225 CZ  
66 1 Y 1 B ARG 222 ? NH1 ? B ARG 225 NH1 
67 1 Y 1 B ARG 222 ? NH2 ? B ARG 225 NH2 
68 1 Y 1 B LYS 228 ? CG  ? B LYS 231 CG  
69 1 Y 1 B LYS 228 ? CD  ? B LYS 231 CD  
70 1 Y 1 B LYS 228 ? CE  ? B LYS 231 CE  
71 1 Y 1 B LYS 228 ? NZ  ? B LYS 231 NZ  
72 1 Y 1 B LYS 233 ? CG  ? B LYS 236 CG  
73 1 Y 1 B LYS 233 ? CD  ? B LYS 236 CD  
74 1 Y 1 B LYS 233 ? CE  ? B LYS 236 CE  
75 1 Y 1 B LYS 233 ? NZ  ? B LYS 236 NZ  
76 1 Y 1 B LYS 241 ? CG  ? B LYS 244 CG  
77 1 Y 1 B LYS 241 ? CD  ? B LYS 244 CD  
78 1 Y 1 B LYS 241 ? CE  ? B LYS 244 CE  
79 1 Y 1 B LYS 241 ? NZ  ? B LYS 244 NZ  
80 1 Y 1 B LYS 262 ? CG  ? B LYS 265 CG  
81 1 Y 1 B LYS 262 ? CD  ? B LYS 265 CD  
82 1 Y 1 B LYS 262 ? CE  ? B LYS 265 CE  
83 1 Y 1 B LYS 262 ? NZ  ? B LYS 265 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -2  ? A GLY 1   
2   1 Y 1 A PRO -1  ? A PRO 2   
3   1 Y 1 A GLY 0   ? A GLY 3   
4   1 Y 1 A CYS 1   ? A CYS 4   
5   1 Y 1 A ASN 2   ? A ASN 5   
6   1 Y 1 A THR 3   ? A THR 6   
7   1 Y 1 A LYS 4   ? A LYS 7   
8   1 Y 1 A LYS 5   ? A LYS 8   
9   1 Y 1 A PRO 6   ? A PRO 9   
10  1 Y 1 A ASN 7   ? A ASN 10  
11  1 Y 1 A LEU 8   ? A LEU 11  
12  1 Y 1 A ASP 9   ? A ASP 12  
13  1 Y 1 A GLN 375 ? A GLN 378 
14  1 Y 1 A ASN 376 ? A ASN 379 
15  1 Y 1 A GLY 377 ? A GLY 380 
16  1 Y 1 A THR 378 ? A THR 381 
17  1 Y 1 A THR 379 ? A THR 382 
18  1 Y 1 A ASN 380 ? A ASN 383 
19  1 Y 1 A ASP 381 ? A ASP 384 
20  1 Y 1 A THR 382 ? A THR 385 
21  1 Y 1 A ALA 383 ? A ALA 386 
22  1 Y 1 A THR 384 ? A THR 387 
23  1 Y 1 A MET 385 ? A MET 388 
24  1 Y 1 A ASP 386 ? A ASP 389 
25  1 Y 1 A HIS 387 ? A HIS 390 
26  1 Y 1 A LEU 388 ? A LEU 391 
27  1 Y 1 A GLU 389 ? A GLU 392 
28  1 Y 1 A LYS 390 ? A LYS 393 
29  1 Y 1 A ASN 391 ? A ASN 394 
30  1 Y 1 A GLU 392 ? A GLU 395 
31  1 Y 1 B GLY -2  ? B GLY 1   
32  1 Y 1 B PRO -1  ? B PRO 2   
33  1 Y 1 B GLY 0   ? B GLY 3   
34  1 Y 1 B CYS 1   ? B CYS 4   
35  1 Y 1 B ASN 2   ? B ASN 5   
36  1 Y 1 B THR 3   ? B THR 6   
37  1 Y 1 B LYS 4   ? B LYS 7   
38  1 Y 1 B LYS 5   ? B LYS 8   
39  1 Y 1 B PRO 6   ? B PRO 9   
40  1 Y 1 B ASN 7   ? B ASN 10  
41  1 Y 1 B LEU 8   ? B LEU 11  
42  1 Y 1 B ASP 9   ? B ASP 12  
43  1 Y 1 B ALA 10  ? B ALA 13  
44  1 Y 1 B GLU 11  ? B GLU 14  
45  1 Y 1 B LEU 12  ? B LEU 15  
46  1 Y 1 B ASP 13  ? B ASP 16  
47  1 Y 1 B GLN 14  ? B GLN 17  
48  1 Y 1 B LEU 15  ? B LEU 18  
49  1 Y 1 B LEU 16  ? B LEU 19  
50  1 Y 1 B GLN 17  ? B GLN 20  
51  1 Y 1 B GLY 18  ? B GLY 21  
52  1 Y 1 B HIS 19  ? B HIS 22  
53  1 Y 1 B TYR 20  ? B TYR 23  
54  1 Y 1 B ILE 21  ? B ILE 24  
55  1 Y 1 B LYS 22  ? B LYS 25  
56  1 Y 1 B GLY 23  ? B GLY 26  
57  1 Y 1 B TYR 24  ? B TYR 27  
58  1 Y 1 B PRO 25  ? B PRO 28  
59  1 Y 1 B LYS 26  ? B LYS 29  
60  1 Y 1 B GLN 27  ? B GLN 30  
61  1 Y 1 B TYR 28  ? B TYR 31  
62  1 Y 1 B THR 29  ? B THR 32  
63  1 Y 1 B TYR 30  ? B TYR 33  
64  1 Y 1 B PHE 31  ? B PHE 34  
65  1 Y 1 B LEU 32  ? B LEU 35  
66  1 Y 1 B GLU 33  ? B GLU 36  
67  1 Y 1 B ASP 34  ? B ASP 37  
68  1 Y 1 B GLY 35  ? B GLY 38  
69  1 Y 1 B LYS 36  ? B LYS 39  
70  1 Y 1 B VAL 37  ? B VAL 40  
71  1 Y 1 B LYS 38  ? B LYS 41  
72  1 Y 1 B VAL 39  ? B VAL 42  
73  1 Y 1 B SER 40  ? B SER 43  
74  1 Y 1 B ARG 41  ? B ARG 44  
75  1 Y 1 B PRO 42  ? B PRO 45  
76  1 Y 1 B GLU 43  ? B GLU 46  
77  1 Y 1 B GLY 44  ? B GLY 47  
78  1 Y 1 B VAL 45  ? B VAL 48  
79  1 Y 1 B LYS 46  ? B LYS 49  
80  1 Y 1 B ILE 47  ? B ILE 50  
81  1 Y 1 B ILE 48  ? B ILE 51  
82  1 Y 1 B PRO 49  ? B PRO 52  
83  1 Y 1 B PRO 50  ? B PRO 53  
84  1 Y 1 B GLN 51  ? B GLN 54  
85  1 Y 1 B SER 52  ? B SER 55  
86  1 Y 1 B ASP 53  ? B ASP 56  
87  1 Y 1 B ARG 54  ? B ARG 57  
88  1 Y 1 B GLN 55  ? B GLN 58  
89  1 Y 1 B LYS 56  ? B LYS 59  
90  1 Y 1 B ILE 57  ? B ILE 60  
91  1 Y 1 B VAL 58  ? B VAL 61  
92  1 Y 1 B LEU 59  ? B LEU 62  
93  1 Y 1 B GLN 60  ? B GLN 63  
94  1 Y 1 B ALA 61  ? B ALA 64  
95  1 Y 1 B HIS 62  ? B HIS 65  
96  1 Y 1 B ASN 63  ? B ASN 66  
97  1 Y 1 B LEU 64  ? B LEU 67  
98  1 Y 1 B ALA 65  ? B ALA 68  
99  1 Y 1 B HIS 66  ? B HIS 69  
100 1 Y 1 B THR 67  ? B THR 70  
101 1 Y 1 B GLY 68  ? B GLY 71  
102 1 Y 1 B ARG 69  ? B ARG 72  
103 1 Y 1 B GLU 70  ? B GLU 73  
104 1 Y 1 B ALA 71  ? B ALA 74  
105 1 Y 1 B THR 72  ? B THR 75  
106 1 Y 1 B LEU 73  ? B LEU 76  
107 1 Y 1 B LEU 74  ? B LEU 77  
108 1 Y 1 B LYS 75  ? B LYS 78  
109 1 Y 1 B ILE 76  ? B ILE 79  
110 1 Y 1 B ALA 77  ? B ALA 80  
111 1 Y 1 B ASN 78  ? B ASN 81  
112 1 Y 1 B LEU 79  ? B LEU 82  
113 1 Y 1 B TYR 80  ? B TYR 83  
114 1 Y 1 B TRP 81  ? B TRP 84  
115 1 Y 1 B TRP 82  ? B TRP 85  
116 1 Y 1 B PRO 83  ? B PRO 86  
117 1 Y 1 B ASN 84  ? B ASN 87  
118 1 Y 1 B MET 85  ? B MET 88  
119 1 Y 1 B ARG 86  ? B ARG 89  
120 1 Y 1 B LYS 87  ? B LYS 90  
121 1 Y 1 B ASP 88  ? B ASP 91  
122 1 Y 1 B VAL 89  ? B VAL 92  
123 1 Y 1 B VAL 90  ? B VAL 93  
124 1 Y 1 B LYS 91  ? B LYS 94  
125 1 Y 1 B GLN 92  ? B GLN 95  
126 1 Y 1 B LEU 93  ? B LEU 96  
127 1 Y 1 B GLY 94  ? B GLY 97  
128 1 Y 1 B ARG 95  ? B ARG 98  
129 1 Y 1 B CYS 96  ? B CYS 99  
130 1 Y 1 B GLN 97  ? B GLN 100 
131 1 Y 1 B GLN 98  ? B GLN 101 
132 1 Y 1 B CYS 99  ? B CYS 102 
133 1 Y 1 B LEU 100 ? B LEU 103 
134 1 Y 1 B ILE 101 ? B ILE 104 
135 1 Y 1 B THR 102 ? B THR 105 
136 1 Y 1 B ASN 103 ? B ASN 106 
137 1 Y 1 B ALA 104 ? B ALA 107 
138 1 Y 1 B SER 105 ? B SER 108 
139 1 Y 1 B ASN 106 ? B ASN 109 
140 1 Y 1 B LYS 107 ? B LYS 110 
141 1 Y 1 B ALA 108 ? B ALA 111 
142 1 Y 1 B SER 109 ? B SER 112 
143 1 Y 1 B GLY 110 ? B GLY 113 
144 1 Y 1 B PRO 111 ? B PRO 114 
145 1 Y 1 B ILE 112 ? B ILE 115 
146 1 Y 1 B LEU 113 ? B LEU 116 
147 1 Y 1 B ARG 114 ? B ARG 117 
148 1 Y 1 B PRO 115 ? B PRO 118 
149 1 Y 1 B ALA 279 ? B ALA 282 
150 1 Y 1 B ASN 280 ? B ASN 283 
151 1 Y 1 B GLN 281 ? B GLN 284 
152 1 Y 1 B ASP 282 ? B ASP 285 
153 1 Y 1 B THR 283 ? B THR 286 
154 1 Y 1 B LEU 284 ? B LEU 287 
155 1 Y 1 B ASP 285 ? B ASP 288 
156 1 Y 1 B LEU 286 ? B LEU 289 
157 1 Y 1 B THR 287 ? B THR 290 
158 1 Y 1 B ARG 288 ? B ARG 291 
159 1 Y 1 B GLU 289 ? B GLU 292 
160 1 Y 1 B GLU 290 ? B GLU 293 
161 1 Y 1 B GLU 291 ? B GLU 294 
162 1 Y 1 B LEU 292 ? B LEU 295 
163 1 Y 1 B SER 293 ? B SER 296 
164 1 Y 1 B LEU 294 ? B LEU 297 
165 1 Y 1 B LEU 295 ? B LEU 298 
166 1 Y 1 B GLN 296 ? B GLN 299 
167 1 Y 1 B GLU 297 ? B GLU 300 
168 1 Y 1 B ILE 298 ? B ILE 301 
169 1 Y 1 B ARG 299 ? B ARG 302 
170 1 Y 1 B THR 300 ? B THR 303 
171 1 Y 1 B SER 301 ? B SER 304 
172 1 Y 1 B LEU 302 ? B LEU 305 
173 1 Y 1 B TYR 303 ? B TYR 306 
174 1 Y 1 B HIS 304 ? B HIS 307 
175 1 Y 1 B PRO 305 ? B PRO 308 
176 1 Y 1 B SER 306 ? B SER 309 
177 1 Y 1 B THR 307 ? B THR 310 
178 1 Y 1 B PRO 308 ? B PRO 311 
179 1 Y 1 B PRO 309 ? B PRO 312 
180 1 Y 1 B ALA 310 ? B ALA 313 
181 1 Y 1 B SER 311 ? B SER 314 
182 1 Y 1 B SER 312 ? B SER 315 
183 1 Y 1 B ARG 313 ? B ARG 316 
184 1 Y 1 B SER 314 ? B SER 317 
185 1 Y 1 B TRP 315 ? B TRP 318 
186 1 Y 1 B SER 316 ? B SER 319 
187 1 Y 1 B PRO 317 ? B PRO 320 
188 1 Y 1 B VAL 318 ? B VAL 321 
189 1 Y 1 B VAL 319 ? B VAL 322 
190 1 Y 1 B GLY 320 ? B GLY 323 
191 1 Y 1 B GLN 321 ? B GLN 324 
192 1 Y 1 B LEU 322 ? B LEU 325 
193 1 Y 1 B VAL 323 ? B VAL 326 
194 1 Y 1 B GLN 324 ? B GLN 327 
195 1 Y 1 B GLU 325 ? B GLU 328 
196 1 Y 1 B ARG 326 ? B ARG 329 
197 1 Y 1 B VAL 327 ? B VAL 330 
198 1 Y 1 B ALA 328 ? B ALA 331 
199 1 Y 1 B ARG 329 ? B ARG 332 
200 1 Y 1 B PRO 330 ? B PRO 333 
201 1 Y 1 B ALA 331 ? B ALA 334 
202 1 Y 1 B SER 332 ? B SER 335 
203 1 Y 1 B LEU 333 ? B LEU 336 
204 1 Y 1 B ARG 334 ? B ARG 337 
205 1 Y 1 B PRO 335 ? B PRO 338 
206 1 Y 1 B ARG 336 ? B ARG 339 
207 1 Y 1 B TRP 337 ? B TRP 340 
208 1 Y 1 B HIS 338 ? B HIS 341 
209 1 Y 1 B LYS 339 ? B LYS 342 
210 1 Y 1 B PRO 340 ? B PRO 343 
211 1 Y 1 B SER 341 ? B SER 344 
212 1 Y 1 B THR 342 ? B THR 345 
213 1 Y 1 B VAL 343 ? B VAL 346 
214 1 Y 1 B LEU 344 ? B LEU 347 
215 1 Y 1 B LYS 345 ? B LYS 348 
216 1 Y 1 B VAL 346 ? B VAL 349 
217 1 Y 1 B LEU 347 ? B LEU 350 
218 1 Y 1 B ASN 348 ? B ASN 351 
219 1 Y 1 B PRO 349 ? B PRO 352 
220 1 Y 1 B ARG 350 ? B ARG 353 
221 1 Y 1 B THR 351 ? B THR 354 
222 1 Y 1 B VAL 352 ? B VAL 355 
223 1 Y 1 B VAL 353 ? B VAL 356 
224 1 Y 1 B ILE 354 ? B ILE 357 
225 1 Y 1 B LEU 355 ? B LEU 358 
226 1 Y 1 B ASP 356 ? B ASP 359 
227 1 Y 1 B HIS 357 ? B HIS 360 
228 1 Y 1 B LEU 358 ? B LEU 361 
229 1 Y 1 B GLY 359 ? B GLY 362 
230 1 Y 1 B ASN 360 ? B ASN 363 
231 1 Y 1 B ASN 361 ? B ASN 364 
232 1 Y 1 B ARG 362 ? B ARG 365 
233 1 Y 1 B THR 363 ? B THR 366 
234 1 Y 1 B VAL 364 ? B VAL 367 
235 1 Y 1 B SER 365 ? B SER 368 
236 1 Y 1 B ILE 366 ? B ILE 369 
237 1 Y 1 B ASP 367 ? B ASP 370 
238 1 Y 1 B ASN 368 ? B ASN 371 
239 1 Y 1 B LEU 369 ? B LEU 372 
240 1 Y 1 B LYS 370 ? B LYS 373 
241 1 Y 1 B PRO 371 ? B PRO 374 
242 1 Y 1 B THR 372 ? B THR 375 
243 1 Y 1 B SER 373 ? B SER 376 
244 1 Y 1 B HIS 374 ? B HIS 377 
245 1 Y 1 B GLN 375 ? B GLN 378 
246 1 Y 1 B ASN 376 ? B ASN 379 
247 1 Y 1 B GLY 377 ? B GLY 380 
248 1 Y 1 B THR 378 ? B THR 381 
249 1 Y 1 B THR 379 ? B THR 382 
250 1 Y 1 B ASN 380 ? B ASN 383 
251 1 Y 1 B ASP 381 ? B ASP 384 
252 1 Y 1 B THR 382 ? B THR 385 
253 1 Y 1 B ALA 383 ? B ALA 386 
254 1 Y 1 B THR 384 ? B THR 387 
255 1 Y 1 B MET 385 ? B MET 388 
256 1 Y 1 B ASP 386 ? B ASP 389 
257 1 Y 1 B HIS 387 ? B HIS 390 
258 1 Y 1 B LEU 388 ? B LEU 391 
259 1 Y 1 B GLU 389 ? B GLU 392 
260 1 Y 1 B LYS 390 ? B LYS 393 
261 1 Y 1 B ASN 391 ? B ASN 394 
262 1 Y 1 B GLU 392 ? B GLU 395 
# 
_ndb_struct_conf_na.entry_id   3L2V 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 16 1_555 -0.167 -0.013 -0.182 -30.245 -15.126 -6.483 1  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DT 5  1_555 D DA 15 1_555 0.548  -0.247 0.296  -22.542 0.766   -2.996 2  C_DT5:DA15_D  C 5  ? D 15 ? 20 1 
1 C DC 6  1_555 D DG 14 1_555 0.027  -0.095 -0.410 7.117   5.735   5.001  3  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 C DA 7  1_555 D DT 13 1_555 0.653  -0.017 -0.032 -4.858  -3.424  -4.802 4  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 C DT 8  1_555 D DA 12 1_555 -0.051 -0.162 -0.215 -3.647  -8.361  1.676  5  C_DT8:DA12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 0.316  -0.022 -0.140 7.382   2.166   2.935  6  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.722 -0.080 0.546  26.657  -4.900  -2.272 7  C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DA 11 1_555 D DT 9  1_555 0.152  -0.121 0.298  5.884   -20.440 2.112  8  C_DA11:DT9_D  C 11 ? D 9  ? 20 1 
1 C DA 12 1_555 D DT 8  1_555 -0.074 -0.153 0.429  -0.748  -10.426 1.185  9  C_DA12:DT8_D  C 12 ? D 8  ? 20 1 
1 C DT 13 1_555 D DA 7  1_555 0.081  -0.056 0.401  -9.235  -21.705 -4.930 10 C_DT13:DA7_D  C 13 ? D 7  ? 20 1 
1 C DT 14 1_555 D DA 6  1_555 -0.220 -0.105 -0.177 -8.117  -21.403 -0.493 11 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 -0.236 -0.086 -0.248 -17.565 -16.667 -9.918 12 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DT 16 1_555 D DA 4  1_555 -0.342 0.104  -0.321 -8.909  -10.169 2.755  13 C_DT16:DA4_D  C 16 ? D 4  ? 20 1 
1 C DG 17 1_555 D DC 3  1_555 -0.126 -0.026 -0.188 -1.070  -17.124 5.213  14 C_DG17:DC3_D  C 17 ? D 3  ? 19 1 
1 C DT 18 1_555 D DA 2  1_555 -0.223 -0.177 -0.184 6.174   -12.858 4.963  15 C_DT18:DA2_D  C 18 ? D 2  ? 20 1 
1 C DA 19 1_555 D DT 1  1_555 0.909  0.230  -1.330 -8.670  -23.291 22.053 16 C_DA19:DT1_D  C 19 ? D 1  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 16 1_555 C DT 5  1_555 D DA 15 1_555 0.738  -0.023 3.266 -2.627 4.700  40.378 -0.549 -1.348 3.192 6.772  
3.786   40.720 1  CC_DG4DT5:DA15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DT 5  1_555 D DA 15 1_555 C DC 6  1_555 D DG 14 1_555 0.757  0.567  2.721 5.110  4.231  23.094 0.173  -0.381 2.875 10.298 
-12.439 24.016 2  CC_DT5DC6:DG14DA15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DC 6  1_555 D DG 14 1_555 C DA 7  1_555 D DT 13 1_555 -1.580 1.262  3.696 -6.833 11.211 43.618 0.430  1.311  4.075 14.696 
8.957   45.459 3  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT 8  1_555 D DA 12 1_555 0.346  -0.658 3.201 2.719  2.215  26.930 -1.947 -0.069 3.157 4.731  
-5.806  27.153 4  CC_DA7DT8:DA12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG 9  1_555 D DC 11 1_555 0.914  2.003  3.207 3.833  8.104  39.414 1.941  -0.869 3.602 11.831 
-5.596  40.381 5  CC_DT8DG9:DC11DA12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 -0.863 0.324  2.810 -5.642 1.508  25.796 0.352  0.551  2.942 3.324  
12.436  26.438 6  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DA 11 1_555 D DT 9  1_555 0.042  -0.141 3.717 3.576  2.378  45.967 -0.411 0.294  3.698 3.037  
-4.567  46.157 7  CC_DG10DA11:DT9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DA 11 1_555 D DT 9  1_555 C DA 12 1_555 D DT 8  1_555 -0.071 -0.381 3.301 -4.546 -0.345 34.311 -0.587 -0.589 3.286 -0.582 
7.664   34.604 8  CC_DA11DA12:DT8DT9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DA 12 1_555 D DT 8  1_555 C DT 13 1_555 D DA 7  1_555 -0.635 -0.700 3.389 -0.278 -3.907 35.814 -0.550 0.986  3.448 -6.331 
0.450   36.020 9  CC_DA12DT13:DA7DT8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DT 13 1_555 D DA 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.214 -0.349 3.163 2.153  -4.408 35.799 0.041  0.640  3.164 -7.129 
-3.482  36.123 10 CC_DT13DT14:DA6DA7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 -0.190 0.113  3.568 1.186  -4.454 41.901 0.657  0.397  3.532 -6.206 
-1.652  42.143 11 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DT 16 1_555 D DA 4  1_555 0.249  -0.195 2.890 -0.799 -1.373 30.248 -0.128 -0.619 2.888 -2.630 
1.530   30.289 12 CC_DT15DT16:DA4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DT 16 1_555 D DA 4  1_555 C DG 17 1_555 D DC 3  1_555 0.160  1.694  3.376 -3.059 16.734 39.688 0.428  -0.562 3.745 23.389 
4.275   43.045 13 CC_DT16DG17:DC3DA4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DG 17 1_555 D DC 3  1_555 C DT 18 1_555 D DA 2  1_555 0.447  -0.242 3.375 -1.724 -3.722 27.834 0.403  -1.336 3.345 -7.683 
3.558   28.129 14 CC_DG17DT18:DA2DC3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DT 18 1_555 D DA 2  1_555 C DA 19 1_555 D DT 1  1_555 0.789  -0.301 3.466 10.830 19.375 36.908 -2.500 0.088  3.063 27.746 
-15.510 42.869 15 CC_DT18DA19:DT1DA2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 'MANGANESE (II) ION' MN  
6 'AMMONIUM ION' NH4 
7 
;N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-dihydropyrimidine-4-carboxamide
;
RLT 
8 GLYCEROL GOL 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1 393 1   ZN  ZN  A . 
F 5 MN  1 394 2   MN  MN  A . 
G 5 MN  1 395 3   MN  MN  A . 
H 6 NH4 1 396 5   NH4 NH4 A . 
I 7 RLT 1 397 1   RLT RLT A . 
J 8 GOL 1 801 801 GOL GOL A . 
K 8 GOL 1 802 802 GOL GOL A . 
L 8 GOL 1 803 803 GOL GOL A . 
M 8 GOL 1 804 804 GOL GOL A . 
N 5 MN  1 393 4   MN  MN  B . 
#