data_3L32
# 
_entry.id   3L32 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3L32         
RCSB  RCSB056770   
WWPDB D_1000056770 
# 
_pdbx_database_status.entry_id                        3L32 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-12-16 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ivanov, I.'      1 
'Crepin, T.'      2 
'Jamin, M.'       3 
'Ruigrok, R.W.H.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the dimerisation domain of the rabies virus phosphoprotein' 
_citation.journal_abbrev            J.Virol. 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JOVIAM 
_citation.country                   US 
_citation.journal_id_ISSN           1098-5514 
_citation.journal_id_CSD            0825 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20089657 
_citation.pdbx_database_id_DOI      10.1128/JVI.02557-09 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ivanov, I.'      1 
primary 'Crepin, T.'      2 
primary 'Jamin, M.'       3 
primary 'Ruigrok, R.W.H.' 4 
# 
_cell.entry_id           3L32 
_cell.length_a           43.290 
_cell.length_b           43.290 
_cell.length_c           192.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3L32 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Phosphoprotein 5343.142 2  ? ? 'UNP residues 90-133' ? 
2 water   nat water          18.015   51 ? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein P, Protein M1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF 
_entity_poly.pdbx_seq_one_letter_code_can   MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASN n 
1 3  LEU n 
1 4  LEU n 
1 5  PHE n 
1 6  GLN n 
1 7  SER n 
1 8  TYR n 
1 9  LEU n 
1 10 ASP n 
1 11 ASN n 
1 12 VAL n 
1 13 GLY n 
1 14 VAL n 
1 15 GLN n 
1 16 ILE n 
1 17 VAL n 
1 18 ARG n 
1 19 GLN n 
1 20 MET n 
1 21 ARG n 
1 22 SER n 
1 23 GLY n 
1 24 GLU n 
1 25 ARG n 
1 26 PHE n 
1 27 LEU n 
1 28 LYS n 
1 29 ILE n 
1 30 TRP n 
1 31 SER n 
1 32 GLN n 
1 33 THR n 
1 34 VAL n 
1 35 GLU n 
1 36 GLU n 
1 37 ILE n 
1 38 VAL n 
1 39 SER n 
1 40 TYR n 
1 41 VAL n 
1 42 THR n 
1 43 VAL n 
1 44 ASN n 
1 45 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 P 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    China/MRV 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rabies virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     445791 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PHOSP_RABVR 
_struct_ref.pdbx_db_accession          Q0GBY3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   NLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF 
_struct_ref.pdbx_align_begin           90 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3L32 A 2 ? 45 ? Q0GBY3 90 ? 133 ? 90 133 
2 1 3L32 B 2 ? 45 ? Q0GBY3 90 ? 133 ? 90 133 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3L32 MET A 1 ? UNP Q0GBY3 ? ? 'EXPRESSION TAG' 89 1 
2 3L32 MET B 1 ? UNP Q0GBY3 ? ? 'EXPRESSION TAG' 89 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3L32 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_percent_sol   41.56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '(NH4)2SO4, pH 6.5, vapor diffusion, hanging drop, temperature 298K' 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD           'ADSC QUANTUM 315r'        2009-07-28 ? 
2 'IMAGE PLATE' 'MAR scanner 345 mm plate' 2009-09-25 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 2 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.976 1.0 
2 1.771 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ESRF BEAMLINE ID14-4' ESRF ID14-4 ? 0.976 
2 SYNCHROTRON 'ESRF BEAMLINE BM14'   ESRF BM14   ? 1.771 
# 
_reflns.entry_id                     3L32 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.81 
_reflns.d_resolution_high            1.5 
_reflns.number_obs                   15278 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3L32 
_refine.ls_number_reflns_obs                     14377 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.81 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    99.07 
_refine.ls_R_factor_obs                          0.19796 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19647 
_refine.ls_R_factor_R_free                       0.22811 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  759 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.30 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.947 
_refine.B_iso_mean                               23.388 
_refine.aniso_B[1][1]                            -0.29 
_refine.aniso_B[2][2]                            -0.29 
_refine.aniso_B[3][3]                            0.58 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.081 
_refine.pdbx_overall_ESU_R_Free                  0.083 
_refine.overall_SU_ML                            0.049 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.307 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        760 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               811 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        25.81 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.032  0.022  ? 777  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.493  1.929  ? 1058 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.974  5.000  ? 97   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       40.955 24.000 ? 40   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.584 15.000 ? 143  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.722 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.173  0.200  ? 124  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.014  0.020  ? 580  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.755  1.500  ? 454  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.205  2.000  ? 750  'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.451  3.000  ? 323  'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.613  4.500  ? 303  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.500 
_refine_ls_shell.d_res_low                        1.539 
_refine_ls_shell.number_reflns_R_work             1059 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               99.91 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3L32 
_struct.title                     'Structure of the dimerisation domain of the rabies virus phosphoprotein' 
_struct.pdbx_descriptor           Phosphoprotein 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3L32 
_struct_keywords.text            'antiparallel alpha-helices, VIRAL PROTEIN, dimerisation domain, rabies virus, phosphoprotein' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 2  ? ARG A 21 ? ASN A 90  ARG A 109 1 ? 20 
HELX_P HELX_P2 2 ARG A 25 ? PHE A 45 ? ARG A 113 PHE A 133 1 ? 21 
HELX_P HELX_P3 3 ASN B 2  ? SER B 22 ? ASN B 90  SER B 110 1 ? 21 
HELX_P HELX_P4 4 ARG B 25 ? PHE B 45 ? ARG B 113 PHE B 133 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            89 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ASN 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ASN 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     90 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.16 
# 
_database_PDB_matrix.entry_id          3L32 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    3L32 
_atom_sites.fract_transf_matrix[1][1]   0.023100 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023100 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005208 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ASN A 1 2  ? 34.451 3.515   44.645 1.00 20.40 ? 90  ASN A N   1 
ATOM   2   C CA  . ASN A 1 2  ? 33.375 4.342   43.989 1.00 16.85 ? 90  ASN A CA  1 
ATOM   3   C C   . ASN A 1 2  ? 32.093 3.771   44.484 1.00 16.52 ? 90  ASN A C   1 
ATOM   4   O O   . ASN A 1 2  ? 31.631 2.766   43.976 1.00 16.43 ? 90  ASN A O   1 
ATOM   5   C CB  . ASN A 1 2  ? 33.460 4.170   42.467 1.00 18.48 ? 90  ASN A CB  1 
ATOM   6   C CG  . ASN A 1 2  ? 32.486 5.073   41.739 1.00 21.99 ? 90  ASN A CG  1 
ATOM   7   O OD1 . ASN A 1 2  ? 31.293 5.258   42.070 1.00 17.92 ? 90  ASN A OD1 1 
ATOM   8   N ND2 . ASN A 1 2  ? 33.030 5.804   40.771 1.00 27.42 ? 90  ASN A ND2 1 
ATOM   9   N N   . LEU A 1 3  ? 31.492 4.390   45.494 1.00 13.94 ? 91  LEU A N   1 
ATOM   10  C CA  . LEU A 1 3  ? 30.375 3.740   46.191 1.00 13.88 ? 91  LEU A CA  1 
ATOM   11  C C   . LEU A 1 3  ? 29.166 3.644   45.262 1.00 12.71 ? 91  LEU A C   1 
ATOM   12  O O   . LEU A 1 3  ? 28.497 2.610   45.264 1.00 14.03 ? 91  LEU A O   1 
ATOM   13  C CB  . LEU A 1 3  ? 30.077 4.597   47.460 1.00 13.14 ? 91  LEU A CB  1 
ATOM   14  C CG  . LEU A 1 3  ? 28.831 4.102   48.178 1.00 15.81 ? 91  LEU A CG  1 
ATOM   15  C CD1 . LEU A 1 3  ? 28.958 2.621   48.663 1.00 17.31 ? 91  LEU A CD1 1 
ATOM   16  C CD2 . LEU A 1 3  ? 28.616 5.144   49.366 1.00 16.52 ? 91  LEU A CD2 1 
ATOM   17  N N   . LEU A 1 4  ? 28.916 4.697   44.461 1.00 12.67 ? 92  LEU A N   1 
ATOM   18  C CA  . LEU A 1 4  ? 27.708 4.653   43.627 1.00 12.09 ? 92  LEU A CA  1 
ATOM   19  C C   . LEU A 1 4  ? 27.847 3.529   42.597 1.00 11.78 ? 92  LEU A C   1 
ATOM   20  O O   . LEU A 1 4  ? 26.890 2.769   42.375 1.00 12.51 ? 92  LEU A O   1 
ATOM   21  C CB  . LEU A 1 4  ? 27.455 5.966   42.954 1.00 11.73 ? 92  LEU A CB  1 
ATOM   22  C CG  . LEU A 1 4  ? 26.105 6.039   42.256 1.00 12.61 ? 92  LEU A CG  1 
ATOM   23  C CD1 . LEU A 1 4  ? 24.902 5.974   43.282 1.00 13.89 ? 92  LEU A CD1 1 
ATOM   24  C CD2 . LEU A 1 4  ? 26.056 7.362   41.458 1.00 13.41 ? 92  LEU A CD2 1 
ATOM   25  N N   . PHE A 1 5  ? 29.021 3.325   42.009 1.00 11.80 ? 93  PHE A N   1 
ATOM   26  C CA  . PHE A 1 5  ? 29.147 2.306   41.016 1.00 10.99 ? 93  PHE A CA  1 
ATOM   27  C C   . PHE A 1 5  ? 29.222 0.954   41.615 1.00 12.34 ? 93  PHE A C   1 
ATOM   28  O O   . PHE A 1 5  ? 28.673 -0.015  41.076 1.00 12.20 ? 93  PHE A O   1 
ATOM   29  C CB  . PHE A 1 5  ? 30.430 2.615   40.190 1.00 12.57 ? 93  PHE A CB  1 
ATOM   30  C CG  . PHE A 1 5  ? 30.617 1.761   38.909 1.00 11.79 ? 93  PHE A CG  1 
ATOM   31  C CD1 . PHE A 1 5  ? 29.556 1.226   38.206 1.00 13.38 ? 93  PHE A CD1 1 
ATOM   32  C CD2 . PHE A 1 5  ? 31.893 1.496   38.482 1.00 15.94 ? 93  PHE A CD2 1 
ATOM   33  C CE1 . PHE A 1 5  ? 29.802 0.459   36.989 1.00 13.98 ? 93  PHE A CE1 1 
ATOM   34  C CE2 . PHE A 1 5  ? 32.117 0.770   37.289 1.00 14.31 ? 93  PHE A CE2 1 
ATOM   35  C CZ  . PHE A 1 5  ? 31.076 0.256   36.560 1.00 14.87 ? 93  PHE A CZ  1 
ATOM   36  N N   . GLN A 1 6  ? 29.945 0.797   42.744 1.00 11.98 ? 94  GLN A N   1 
ATOM   37  C CA  . GLN A 1 6  ? 29.976 -0.491  43.442 1.00 13.16 ? 94  GLN A CA  1 
ATOM   38  C C   . GLN A 1 6  ? 28.527 -0.876  43.839 1.00 12.45 ? 94  GLN A C   1 
ATOM   39  O O   . GLN A 1 6  ? 28.158 -2.069  43.626 1.00 14.35 ? 94  GLN A O   1 
ATOM   40  C CB  . GLN A 1 6  ? 30.779 -0.292  44.719 1.00 15.98 ? 94  GLN A CB  1 
ATOM   41  C CG  . GLN A 1 6  ? 30.938 -1.553  45.477 1.00 21.00 ? 94  GLN A CG  1 
ATOM   42  C CD  . GLN A 1 6  ? 31.603 -1.287  46.814 1.00 31.32 ? 94  GLN A CD  1 
ATOM   43  O OE1 . GLN A 1 6  ? 32.320 -0.309  46.964 1.00 36.19 ? 94  GLN A OE1 1 
ATOM   44  N NE2 . GLN A 1 6  ? 31.368 -2.159  47.783 1.00 36.87 ? 94  GLN A NE2 1 
ATOM   45  N N   . SER A 1 7  ? 27.723 0.084   44.300 1.00 12.26 ? 95  SER A N   1 
ATOM   46  C CA  A SER A 1 7  ? 26.367 -0.371  44.734 0.50 14.68 ? 95  SER A CA  1 
ATOM   47  C CA  B SER A 1 7  ? 26.332 -0.202  44.709 0.50 13.90 ? 95  SER A CA  1 
ATOM   48  C C   . SER A 1 7  ? 25.512 -0.704  43.508 1.00 13.42 ? 95  SER A C   1 
ATOM   49  O O   . SER A 1 7  ? 24.731 -1.690  43.579 1.00 13.67 ? 95  SER A O   1 
ATOM   50  C CB  A SER A 1 7  ? 25.697 0.621   45.658 0.50 16.87 ? 95  SER A CB  1 
ATOM   51  C CB  B SER A 1 7  ? 25.776 1.064   45.289 0.50 14.26 ? 95  SER A CB  1 
ATOM   52  O OG  A SER A 1 7  ? 25.714 1.877   45.052 0.50 19.98 ? 95  SER A OG  1 
ATOM   53  O OG  B SER A 1 7  ? 26.481 1.410   46.461 0.50 17.59 ? 95  SER A OG  1 
ATOM   54  N N   . TYR A 1 8  ? 25.716 -0.024  42.362 1.00 12.79 ? 96  TYR A N   1 
ATOM   55  C CA  . TYR A 1 8  ? 25.021 -0.382  41.180 1.00 11.76 ? 96  TYR A CA  1 
ATOM   56  C C   . TYR A 1 8  ? 25.403 -1.819  40.789 1.00 12.98 ? 96  TYR A C   1 
ATOM   57  O O   . TYR A 1 8  ? 24.544 -2.638  40.388 1.00 12.07 ? 96  TYR A O   1 
ATOM   58  C CB  . TYR A 1 8  ? 25.487 0.622   40.098 1.00 13.60 ? 96  TYR A CB  1 
ATOM   59  C CG  . TYR A 1 8  ? 24.769 0.448   38.760 1.00 12.55 ? 96  TYR A CG  1 
ATOM   60  C CD1 . TYR A 1 8  ? 23.518 1.087   38.500 1.00 12.79 ? 96  TYR A CD1 1 
ATOM   61  C CD2 . TYR A 1 8  ? 25.463 -0.218  37.739 1.00 13.19 ? 96  TYR A CD2 1 
ATOM   62  C CE1 . TYR A 1 8  ? 22.951 1.035   37.201 1.00 13.01 ? 96  TYR A CE1 1 
ATOM   63  C CE2 . TYR A 1 8  ? 24.859 -0.354  36.448 1.00 13.59 ? 96  TYR A CE2 1 
ATOM   64  C CZ  . TYR A 1 8  ? 23.673 0.338   36.220 1.00 13.83 ? 96  TYR A CZ  1 
ATOM   65  O OH  . TYR A 1 8  ? 23.006 0.346   35.004 1.00 16.33 ? 96  TYR A OH  1 
ATOM   66  N N   . LEU A 1 9  ? 26.705 -2.174  40.772 1.00 12.36 ? 97  LEU A N   1 
ATOM   67  C CA  . LEU A 1 9  ? 27.171 -3.482  40.384 1.00 12.47 ? 97  LEU A CA  1 
ATOM   68  C C   . LEU A 1 9  ? 26.685 -4.535  41.385 1.00 12.90 ? 97  LEU A C   1 
ATOM   69  O O   . LEU A 1 9  ? 26.454 -5.685  40.962 1.00 13.63 ? 97  LEU A O   1 
ATOM   70  C CB  . LEU A 1 9  ? 28.716 -3.561  40.230 1.00 11.49 ? 97  LEU A CB  1 
ATOM   71  C CG  . LEU A 1 9  ? 29.177 -2.754  39.039 1.00 12.87 ? 97  LEU A CG  1 
ATOM   72  C CD1 . LEU A 1 9  ? 30.759 -2.556  39.160 1.00 16.10 ? 97  LEU A CD1 1 
ATOM   73  C CD2 . LEU A 1 9  ? 28.828 -3.361  37.704 1.00 15.49 ? 97  LEU A CD2 1 
ATOM   74  N N   . ASP A 1 10 ? 26.537 -4.189  42.658 1.00 13.94 ? 98  ASP A N   1 
ATOM   75  C CA  . ASP A 1 10 ? 25.972 -5.184  43.609 1.00 13.28 ? 98  ASP A CA  1 
ATOM   76  C C   . ASP A 1 10 ? 24.538 -5.498  43.211 1.00 14.15 ? 98  ASP A C   1 
ATOM   77  O O   . ASP A 1 10 ? 24.120 -6.680  43.307 1.00 15.48 ? 98  ASP A O   1 
ATOM   78  C CB  . ASP A 1 10 ? 26.013 -4.574  45.018 1.00 13.88 ? 98  ASP A CB  1 
ATOM   79  C CG  . ASP A 1 10 ? 27.434 -4.536  45.623 1.00 19.86 ? 98  ASP A CG  1 
ATOM   80  O OD1 . ASP A 1 10 ? 28.340 -5.279  45.219 1.00 24.32 ? 98  ASP A OD1 1 
ATOM   81  O OD2 . ASP A 1 10 ? 27.470 -3.721  46.614 1.00 25.80 ? 98  ASP A OD2 1 
ATOM   82  N N   . ASN A 1 11 ? 23.814 -4.483  42.773 1.00 12.37 ? 99  ASN A N   1 
ATOM   83  C CA  . ASN A 1 11 ? 22.441 -4.701  42.261 1.00 12.37 ? 99  ASN A CA  1 
ATOM   84  C C   . ASN A 1 11 ? 22.482 -5.537  41.050 1.00 12.42 ? 99  ASN A C   1 
ATOM   85  O O   . ASN A 1 11 ? 21.683 -6.542  40.944 1.00 12.47 ? 99  ASN A O   1 
ATOM   86  C CB  . ASN A 1 11 ? 21.800 -3.363  41.991 1.00 11.00 ? 99  ASN A CB  1 
ATOM   87  C CG  . ASN A 1 11 ? 20.306 -3.460  41.662 1.00 12.86 ? 99  ASN A CG  1 
ATOM   88  O OD1 . ASN A 1 11 ? 19.949 -3.952  40.602 1.00 12.83 ? 99  ASN A OD1 1 
ATOM   89  N ND2 . ASN A 1 11 ? 19.482 -2.862  42.515 1.00 12.93 ? 99  ASN A ND2 1 
ATOM   90  N N   . VAL A 1 12 ? 23.370 -5.312  40.079 1.00 12.47 ? 100 VAL A N   1 
ATOM   91  C CA  . VAL A 1 12 ? 23.452 -6.184  38.902 1.00 12.85 ? 100 VAL A CA  1 
ATOM   92  C C   . VAL A 1 12 ? 23.750 -7.628  39.327 1.00 13.00 ? 100 VAL A C   1 
ATOM   93  O O   . VAL A 1 12 ? 23.185 -8.548  38.665 1.00 13.26 ? 100 VAL A O   1 
ATOM   94  C CB  . VAL A 1 12 ? 24.662 -5.612  38.036 1.00 12.36 ? 100 VAL A CB  1 
ATOM   95  C CG1 . VAL A 1 12 ? 25.006 -6.579  36.922 1.00 15.67 ? 100 VAL A CG1 1 
ATOM   96  C CG2 . VAL A 1 12 ? 24.239 -4.258  37.411 1.00 15.37 ? 100 VAL A CG2 1 
ATOM   97  N N   . GLY A 1 13 ? 24.583 -7.904  40.333 1.00 13.36 ? 101 GLY A N   1 
ATOM   98  C CA  . GLY A 1 13 ? 24.804 -9.319  40.710 1.00 14.04 ? 101 GLY A CA  1 
ATOM   99  C C   . GLY A 1 13 ? 23.513 -9.997  41.156 1.00 13.04 ? 101 GLY A C   1 
ATOM   100 O O   . GLY A 1 13 ? 23.334 -11.193 40.844 1.00 13.29 ? 101 GLY A O   1 
ATOM   101 N N   . VAL A 1 14 ? 22.687 -9.259  41.891 1.00 12.24 ? 102 VAL A N   1 
ATOM   102 C CA  . VAL A 1 14 ? 21.373 -9.909  42.358 1.00 13.41 ? 102 VAL A CA  1 
ATOM   103 C C   . VAL A 1 14 ? 20.510 -10.127 41.134 1.00 14.30 ? 102 VAL A C   1 
ATOM   104 O O   . VAL A 1 14 ? 19.880 -11.225 40.989 1.00 14.09 ? 102 VAL A O   1 
ATOM   105 C CB  . VAL A 1 14 ? 20.725 -9.084  43.357 1.00 12.33 ? 102 VAL A CB  1 
ATOM   106 C CG1 . VAL A 1 14 ? 19.348 -9.719  43.737 1.00 12.48 ? 102 VAL A CG1 1 
ATOM   107 C CG2 . VAL A 1 14 ? 21.562 -8.914  44.520 1.00 14.54 ? 102 VAL A CG2 1 
ATOM   108 N N   . GLN A 1 15 ? 20.486 -9.225  40.146 1.00 12.29 ? 103 GLN A N   1 
ATOM   109 C CA  . GLN A 1 15 ? 19.717 -9.462  38.955 1.00 11.68 ? 103 GLN A CA  1 
ATOM   110 C C   . GLN A 1 15 ? 20.173 -10.728 38.302 1.00 14.22 ? 103 GLN A C   1 
ATOM   111 O O   . GLN A 1 15 ? 19.336 -11.505 37.796 1.00 14.94 ? 103 GLN A O   1 
ATOM   112 C CB  . GLN A 1 15 ? 19.919 -8.318  37.946 1.00 12.73 ? 103 GLN A CB  1 
ATOM   113 C CG  . GLN A 1 15 ? 19.409 -6.903  38.477 1.00 12.30 ? 103 GLN A CG  1 
ATOM   114 C CD  . GLN A 1 15 ? 19.791 -5.850  37.488 1.00 14.87 ? 103 GLN A CD  1 
ATOM   115 O OE1 . GLN A 1 15 ? 20.397 -4.786  37.919 1.00 16.54 ? 103 GLN A OE1 1 
ATOM   116 N NE2 . GLN A 1 15 ? 19.598 -6.111  36.268 1.00 11.52 ? 103 GLN A NE2 1 
ATOM   117 N N   . ILE A 1 16 ? 21.492 -10.957 38.195 1.00 13.06 ? 104 ILE A N   1 
ATOM   118 C CA  . ILE A 1 16 ? 22.063 -12.096 37.503 1.00 15.64 ? 104 ILE A CA  1 
ATOM   119 C C   . ILE A 1 16 ? 21.639 -13.365 38.243 1.00 14.66 ? 104 ILE A C   1 
ATOM   120 O O   . ILE A 1 16 ? 21.227 -14.299 37.538 1.00 16.19 ? 104 ILE A O   1 
ATOM   121 C CB  . ILE A 1 16 ? 23.604 -11.943 37.385 1.00 14.08 ? 104 ILE A CB  1 
ATOM   122 C CG1 . ILE A 1 16 ? 23.892 -10.835 36.367 1.00 15.00 ? 104 ILE A CG1 1 
ATOM   123 C CG2 . ILE A 1 16 ? 24.200 -13.324 36.901 1.00 16.51 ? 104 ILE A CG2 1 
ATOM   124 C CD1 . ILE A 1 16 ? 25.408 -10.496 36.358 1.00 13.95 ? 104 ILE A CD1 1 
ATOM   125 N N   . VAL A 1 17 ? 21.823 -13.383 39.557 1.00 14.61 ? 105 VAL A N   1 
ATOM   126 C CA  . VAL A 1 17 ? 21.466 -14.640 40.410 1.00 16.42 ? 105 VAL A CA  1 
ATOM   127 C C   . VAL A 1 17 ? 20.034 -14.987 40.115 1.00 17.31 ? 105 VAL A C   1 
ATOM   128 O O   . VAL A 1 17 ? 19.708 -16.175 39.827 1.00 17.24 ? 105 VAL A O   1 
ATOM   129 C CB  . VAL A 1 17 ? 21.622 -14.320 41.959 1.00 18.84 ? 105 VAL A CB  1 
ATOM   130 C CG1 . VAL A 1 17 ? 20.939 -15.418 42.842 1.00 25.47 ? 105 VAL A CG1 1 
ATOM   131 C CG2 . VAL A 1 17 ? 23.113 -14.149 42.294 1.00 24.64 ? 105 VAL A CG2 1 
ATOM   132 N N   . ARG A 1 18 ? 19.165 -14.000 40.117 1.00 15.44 ? 106 ARG A N   1 
ATOM   133 C CA  . ARG A 1 18 ? 17.757 -14.317 39.982 1.00 14.38 ? 106 ARG A CA  1 
ATOM   134 C C   . ARG A 1 18 ? 17.509 -14.825 38.583 1.00 17.29 ? 106 ARG A C   1 
ATOM   135 O O   . ARG A 1 18 ? 16.734 -15.806 38.404 1.00 19.18 ? 106 ARG A O   1 
ATOM   136 C CB  . ARG A 1 18 ? 16.977 -13.059 40.312 1.00 16.40 ? 106 ARG A CB  1 
ATOM   137 C CG  . ARG A 1 18 ? 16.920 -12.760 41.732 1.00 17.14 ? 106 ARG A CG  1 
ATOM   138 C CD  . ARG A 1 18 ? 16.059 -11.501 41.903 1.00 19.95 ? 106 ARG A CD  1 
ATOM   139 N NE  . ARG A 1 18 ? 16.011 -11.200 43.319 1.00 22.01 ? 106 ARG A NE  1 
ATOM   140 C CZ  . ARG A 1 18 ? 15.273 -10.159 43.820 1.00 20.82 ? 106 ARG A CZ  1 
ATOM   141 N NH1 . ARG A 1 18 ? 14.586 -9.413  43.009 1.00 22.50 ? 106 ARG A NH1 1 
ATOM   142 N NH2 . ARG A 1 18 ? 15.212 -9.981  45.116 1.00 26.77 ? 106 ARG A NH2 1 
ATOM   143 N N   . GLN A 1 19 ? 18.080 -14.322 37.504 1.00 16.12 ? 107 GLN A N   1 
ATOM   144 C CA  . GLN A 1 19 ? 17.893 -14.936 36.198 1.00 16.46 ? 107 GLN A CA  1 
ATOM   145 C C   . GLN A 1 19 ? 18.532 -16.277 36.001 1.00 18.09 ? 107 GLN A C   1 
ATOM   146 O O   . GLN A 1 19 ? 17.994 -17.155 35.291 1.00 21.23 ? 107 GLN A O   1 
ATOM   147 C CB  . GLN A 1 19 ? 18.397 -13.932 35.069 1.00 22.16 ? 107 GLN A CB  1 
ATOM   148 C CG  . GLN A 1 19 ? 17.580 -12.588 35.095 1.00 22.58 ? 107 GLN A CG  1 
ATOM   149 C CD  . GLN A 1 19 ? 16.026 -12.914 35.025 1.00 29.24 ? 107 GLN A CD  1 
ATOM   150 O OE1 . GLN A 1 19 ? 15.609 -13.642 34.118 1.00 32.24 ? 107 GLN A OE1 1 
ATOM   151 N NE2 . GLN A 1 19 ? 15.230 -12.421 35.994 1.00 31.35 ? 107 GLN A NE2 1 
ATOM   152 N N   . MET A 1 20 ? 19.639 -16.551 36.689 1.00 18.55 ? 108 MET A N   1 
ATOM   153 C CA  . MET A 1 20 ? 20.301 -17.904 36.654 1.00 18.44 ? 108 MET A CA  1 
ATOM   154 C C   . MET A 1 20 ? 19.302 -18.947 37.225 1.00 20.14 ? 108 MET A C   1 
ATOM   155 O O   . MET A 1 20 ? 19.192 -20.074 36.715 1.00 20.13 ? 108 MET A O   1 
ATOM   156 C CB  . MET A 1 20 ? 21.631 -17.980 37.366 1.00 18.46 ? 108 MET A CB  1 
ATOM   157 C CG  . MET A 1 20 ? 22.698 -17.155 36.698 1.00 18.91 ? 108 MET A CG  1 
ATOM   158 S SD  . MET A 1 20 ? 24.230 -17.386 37.574 1.00 24.23 ? 108 MET A SD  1 
ATOM   159 C CE  . MET A 1 20 ? 24.605 -19.130 37.222 1.00 29.50 ? 108 MET A CE  1 
ATOM   160 N N   . ARG A 1 21 ? 18.577 -18.539 38.245 1.00 18.81 ? 109 ARG A N   1 
ATOM   161 C CA  . ARG A 1 21 ? 17.642 -19.475 38.916 1.00 21.34 ? 109 ARG A CA  1 
ATOM   162 C C   . ARG A 1 21 ? 16.440 -19.709 38.003 1.00 21.55 ? 109 ARG A C   1 
ATOM   163 O O   . ARG A 1 21 ? 15.647 -20.680 38.278 1.00 23.53 ? 109 ARG A O   1 
ATOM   164 C CB  . ARG A 1 21 ? 17.278 -18.846 40.271 1.00 20.96 ? 109 ARG A CB  1 
ATOM   165 C CG  . ARG A 1 21 ? 18.545 -18.934 41.135 1.00 25.13 ? 109 ARG A CG  1 
ATOM   166 C CD  . ARG A 1 21 ? 18.358 -18.326 42.505 1.00 31.19 ? 109 ARG A CD  1 
ATOM   167 N NE  . ARG A 1 21 ? 19.511 -18.706 43.320 1.00 33.02 ? 109 ARG A NE  1 
ATOM   168 C CZ  . ARG A 1 21 ? 19.880 -18.074 44.418 1.00 41.62 ? 109 ARG A CZ  1 
ATOM   169 N NH1 . ARG A 1 21 ? 19.117 -17.064 44.863 1.00 43.59 ? 109 ARG A NH1 1 
ATOM   170 N NH2 . ARG A 1 21 ? 20.985 -18.494 45.072 1.00 43.90 ? 109 ARG A NH2 1 
ATOM   171 N N   . SER A 1 22 ? 16.229 -18.961 36.934 1.00 20.84 ? 110 SER A N   1 
ATOM   172 C CA  . SER A 1 22 ? 15.126 -19.229 36.017 1.00 22.89 ? 110 SER A CA  1 
ATOM   173 C C   . SER A 1 22 ? 15.536 -20.233 34.954 1.00 24.28 ? 110 SER A C   1 
ATOM   174 O O   . SER A 1 22 ? 14.684 -20.580 34.108 1.00 25.45 ? 110 SER A O   1 
ATOM   175 C CB  . SER A 1 22 ? 14.692 -17.907 35.384 1.00 24.98 ? 110 SER A CB  1 
ATOM   176 O OG  . SER A 1 22 ? 15.591 -17.602 34.325 1.00 32.38 ? 110 SER A OG  1 
ATOM   177 N N   . GLY A 1 23 ? 16.801 -20.707 34.960 1.00 21.45 ? 111 GLY A N   1 
ATOM   178 C CA  . GLY A 1 23 ? 17.278 -21.667 33.948 1.00 24.28 ? 111 GLY A CA  1 
ATOM   179 C C   . GLY A 1 23 ? 17.867 -21.123 32.707 1.00 24.05 ? 111 GLY A C   1 
ATOM   180 O O   . GLY A 1 23 ? 18.214 -21.867 31.801 1.00 24.97 ? 111 GLY A O   1 
ATOM   181 N N   . GLU A 1 24 ? 18.095 -19.785 32.705 1.00 25.97 ? 112 GLU A N   1 
ATOM   182 C CA  . GLU A 1 24 ? 18.746 -19.208 31.556 1.00 23.37 ? 112 GLU A CA  1 
ATOM   183 C C   . GLU A 1 24 ? 20.294 -19.440 31.537 1.00 21.23 ? 112 GLU A C   1 
ATOM   184 O O   . GLU A 1 24 ? 20.916 -19.564 32.566 1.00 24.19 ? 112 GLU A O   1 
ATOM   185 C CB  . GLU A 1 24 ? 18.371 -17.702 31.523 1.00 25.47 ? 112 GLU A CB  1 
ATOM   186 C CG  . GLU A 1 24 ? 18.741 -17.125 30.167 1.00 31.04 ? 112 GLU A CG  1 
ATOM   187 C CD  . GLU A 1 24 ? 18.021 -17.860 29.022 1.00 40.80 ? 112 GLU A CD  1 
ATOM   188 O OE1 . GLU A 1 24 ? 16.860 -17.410 28.778 1.00 46.93 ? 112 GLU A OE1 1 
ATOM   189 O OE2 . GLU A 1 24 ? 18.607 -18.823 28.342 1.00 41.13 ? 112 GLU A OE2 1 
ATOM   190 N N   . ARG A 1 25 ? 20.882 -19.548 30.344 1.00 21.77 ? 113 ARG A N   1 
ATOM   191 C CA  . ARG A 1 25 ? 22.297 -19.734 30.142 1.00 21.02 ? 113 ARG A CA  1 
ATOM   192 C C   . ARG A 1 25 ? 23.031 -18.430 30.645 1.00 20.63 ? 113 ARG A C   1 
ATOM   193 O O   . ARG A 1 25 ? 22.573 -17.331 30.255 1.00 20.07 ? 113 ARG A O   1 
ATOM   194 C CB  . ARG A 1 25 ? 22.531 -19.839 28.675 1.00 24.23 ? 113 ARG A CB  1 
ATOM   195 C CG  . ARG A 1 25 ? 23.891 -20.226 28.303 1.00 30.60 ? 113 ARG A CG  1 
ATOM   196 C CD  . ARG A 1 25 ? 23.830 -20.456 26.829 1.00 40.99 ? 113 ARG A CD  1 
ATOM   197 N NE  . ARG A 1 25 ? 25.102 -20.921 26.314 1.00 51.82 ? 113 ARG A NE  1 
ATOM   198 C CZ  . ARG A 1 25 ? 25.958 -20.142 25.647 1.00 54.76 ? 113 ARG A CZ  1 
ATOM   199 N NH1 . ARG A 1 25 ? 25.646 -18.856 25.431 1.00 54.84 ? 113 ARG A NH1 1 
ATOM   200 N NH2 . ARG A 1 25 ? 27.103 -20.662 25.171 1.00 55.32 ? 113 ARG A NH2 1 
ATOM   201 N N   . PHE A 1 26 ? 24.116 -18.651 31.433 1.00 20.78 ? 114 PHE A N   1 
ATOM   202 C CA  . PHE A 1 26 ? 24.827 -17.495 32.007 1.00 18.26 ? 114 PHE A CA  1 
ATOM   203 C C   . PHE A 1 26 ? 25.252 -16.465 30.960 1.00 18.00 ? 114 PHE A C   1 
ATOM   204 O O   . PHE A 1 26 ? 24.928 -15.224 31.110 1.00 17.01 ? 114 PHE A O   1 
ATOM   205 C CB  . PHE A 1 26 ? 26.027 -17.899 32.849 1.00 20.21 ? 114 PHE A CB  1 
ATOM   206 C CG  . PHE A 1 26 ? 26.751 -16.696 33.383 1.00 17.48 ? 114 PHE A CG  1 
ATOM   207 C CD1 . PHE A 1 26 ? 26.300 -16.021 34.544 1.00 18.09 ? 114 PHE A CD1 1 
ATOM   208 C CD2 . PHE A 1 26 ? 27.846 -16.166 32.700 1.00 18.65 ? 114 PHE A CD2 1 
ATOM   209 C CE1 . PHE A 1 26 ? 26.956 -14.806 34.896 1.00 22.08 ? 114 PHE A CE1 1 
ATOM   210 C CE2 . PHE A 1 26 ? 28.503 -14.999 33.144 1.00 23.17 ? 114 PHE A CE2 1 
ATOM   211 C CZ  . PHE A 1 26 ? 28.018 -14.327 34.209 1.00 23.20 ? 114 PHE A CZ  1 
ATOM   212 N N   . LEU A 1 27 ? 25.810 -16.962 29.850 1.00 18.64 ? 115 LEU A N   1 
ATOM   213 C CA  . LEU A 1 27 ? 26.335 -15.974 28.903 1.00 20.21 ? 115 LEU A CA  1 
ATOM   214 C C   . LEU A 1 27 ? 25.243 -15.165 28.223 1.00 18.88 ? 115 LEU A C   1 
ATOM   215 O O   . LEU A 1 27 ? 25.462 -14.003 27.783 1.00 20.87 ? 115 LEU A O   1 
ATOM   216 C CB  . LEU A 1 27 ? 27.290 -16.620 27.905 1.00 20.86 ? 115 LEU A CB  1 
ATOM   217 C CG  . LEU A 1 27 ? 28.661 -16.905 28.489 1.00 22.97 ? 115 LEU A CG  1 
ATOM   218 C CD1 . LEU A 1 27 ? 29.444 -17.656 27.429 1.00 27.00 ? 115 LEU A CD1 1 
ATOM   219 C CD2 . LEU A 1 27 ? 29.415 -15.687 29.030 1.00 23.86 ? 115 LEU A CD2 1 
ATOM   220 N N   . LYS A 1 28 ? 24.036 -15.712 28.066 1.00 17.53 ? 116 LYS A N   1 
ATOM   221 C CA  . LYS A 1 28 ? 22.929 -14.919 27.605 1.00 17.67 ? 116 LYS A CA  1 
ATOM   222 C C   . LYS A 1 28 ? 22.487 -13.735 28.569 1.00 18.95 ? 116 LYS A C   1 
ATOM   223 O O   . LYS A 1 28 ? 22.236 -12.535 28.195 1.00 20.42 ? 116 LYS A O   1 
ATOM   224 C CB  . LYS A 1 28 ? 21.665 -15.806 27.305 1.00 20.95 ? 116 LYS A CB  1 
ATOM   225 C CG  . LYS A 1 28 ? 20.582 -15.108 26.647 1.00 27.90 ? 116 LYS A CG  1 
ATOM   226 C CD  . LYS A 1 28 ? 19.424 -14.727 27.608 1.00 42.79 ? 116 LYS A CD  1 
ATOM   227 C CE  . LYS A 1 28 ? 17.981 -14.925 27.007 1.00 46.05 ? 116 LYS A CE  1 
ATOM   228 N NZ  . LYS A 1 28 ? 17.655 -14.130 25.779 1.00 50.54 ? 116 LYS A NZ  1 
ATOM   229 N N   . ILE A 1 29 ? 22.389 -14.080 29.891 1.00 17.23 ? 117 ILE A N   1 
ATOM   230 C CA  . ILE A 1 29 ? 22.082 -13.103 30.877 1.00 17.22 ? 117 ILE A CA  1 
ATOM   231 C C   . ILE A 1 29 ? 23.202 -12.020 30.871 1.00 15.27 ? 117 ILE A C   1 
ATOM   232 O O   . ILE A 1 29 ? 22.856 -10.832 30.933 1.00 16.53 ? 117 ILE A O   1 
ATOM   233 C CB  . ILE A 1 29 ? 22.044 -13.785 32.282 1.00 17.36 ? 117 ILE A CB  1 
ATOM   234 C CG1 . ILE A 1 29 ? 20.872 -14.780 32.402 1.00 18.80 ? 117 ILE A CG1 1 
ATOM   235 C CG2 . ILE A 1 29 ? 21.784 -12.744 33.315 1.00 19.46 ? 117 ILE A CG2 1 
ATOM   236 C CD1 . ILE A 1 29 ? 21.159 -15.723 33.569 1.00 25.33 ? 117 ILE A CD1 1 
ATOM   237 N N   . TRP A 1 30 ? 24.428 -12.548 30.813 1.00 15.05 ? 118 TRP A N   1 
ATOM   238 C CA  . TRP A 1 30 ? 25.596 -11.611 30.846 1.00 13.54 ? 118 TRP A CA  1 
ATOM   239 C C   . TRP A 1 30 ? 25.511 -10.632 29.670 1.00 15.95 ? 118 TRP A C   1 
ATOM   240 O O   . TRP A 1 30 ? 25.681 -9.443  29.875 1.00 16.10 ? 118 TRP A O   1 
ATOM   241 C CB  . TRP A 1 30 ? 26.858 -12.392 30.758 1.00 14.10 ? 118 TRP A CB  1 
ATOM   242 C CG  . TRP A 1 30 ? 28.043 -11.463 30.891 1.00 13.75 ? 118 TRP A CG  1 
ATOM   243 C CD1 . TRP A 1 30 ? 28.967 -11.230 29.925 1.00 14.87 ? 118 TRP A CD1 1 
ATOM   244 C CD2 . TRP A 1 30 ? 28.421 -10.767 32.069 1.00 15.21 ? 118 TRP A CD2 1 
ATOM   245 N NE1 . TRP A 1 30 ? 29.898 -10.346 30.417 1.00 13.72 ? 118 TRP A NE1 1 
ATOM   246 C CE2 . TRP A 1 30 ? 29.583 -10.030 31.722 1.00 14.76 ? 118 TRP A CE2 1 
ATOM   247 C CE3 . TRP A 1 30 ? 27.843 -10.577 33.318 1.00 16.79 ? 118 TRP A CE3 1 
ATOM   248 C CZ2 . TRP A 1 30 ? 30.209 -9.170  32.603 1.00 15.68 ? 118 TRP A CZ2 1 
ATOM   249 C CZ3 . TRP A 1 30 ? 28.488 -9.679  34.223 1.00 17.17 ? 118 TRP A CZ3 1 
ATOM   250 C CH2 . TRP A 1 30 ? 29.673 -8.986  33.830 1.00 15.12 ? 118 TRP A CH2 1 
ATOM   251 N N   . SER A 1 31 ? 25.231 -11.101 28.479 1.00 17.83 ? 119 SER A N   1 
ATOM   252 C CA  . SER A 1 31 ? 25.196 -10.129 27.349 1.00 19.18 ? 119 SER A CA  1 
ATOM   253 C C   . SER A 1 31 ? 24.160 -9.079  27.551 1.00 21.16 ? 119 SER A C   1 
ATOM   254 O O   . SER A 1 31 ? 24.391 -7.915  27.232 1.00 24.70 ? 119 SER A O   1 
ATOM   255 C CB  . SER A 1 31 ? 25.015 -10.879 26.022 1.00 22.47 ? 119 SER A CB  1 
ATOM   256 O OG  . SER A 1 31 ? 23.734 -11.467 26.021 1.00 34.59 ? 119 SER A OG  1 
ATOM   257 N N   . GLN A 1 32 ? 23.018 -9.383  28.165 1.00 18.46 ? 120 GLN A N   1 
ATOM   258 C CA  . GLN A 1 32 ? 22.037 -8.331  28.500 1.00 20.38 ? 120 GLN A CA  1 
ATOM   259 C C   . GLN A 1 32 ? 22.429 -7.435  29.620 1.00 20.28 ? 120 GLN A C   1 
ATOM   260 O O   . GLN A 1 32 ? 22.205 -6.183  29.595 1.00 20.68 ? 120 GLN A O   1 
ATOM   261 C CB  . GLN A 1 32 ? 20.719 -9.017  28.906 1.00 22.00 ? 120 GLN A CB  1 
ATOM   262 C CG  . GLN A 1 32 ? 20.159 -9.871  27.794 1.00 24.82 ? 120 GLN A CG  1 
ATOM   263 C CD  . GLN A 1 32 ? 18.895 -10.609 28.255 1.00 29.92 ? 120 GLN A CD  1 
ATOM   264 O OE1 . GLN A 1 32 ? 18.721 -11.024 29.441 1.00 35.64 ? 120 GLN A OE1 1 
ATOM   265 N NE2 . GLN A 1 32 ? 17.990 -10.718 27.337 1.00 38.25 ? 120 GLN A NE2 1 
ATOM   266 N N   . THR A 1 33 ? 22.983 -7.970  30.676 1.00 18.67 ? 121 THR A N   1 
ATOM   267 C CA  . THR A 1 33 ? 23.405 -7.075  31.807 1.00 19.66 ? 121 THR A CA  1 
ATOM   268 C C   . THR A 1 33 ? 24.643 -6.230  31.462 1.00 19.26 ? 121 THR A C   1 
ATOM   269 O O   . THR A 1 33 ? 24.809 -5.064  32.031 1.00 20.15 ? 121 THR A O   1 
ATOM   270 C CB  . THR A 1 33 ? 23.731 -7.884  33.125 1.00 21.24 ? 121 THR A CB  1 
ATOM   271 O OG1 . THR A 1 33 ? 24.716 -8.936  32.871 1.00 21.21 ? 121 THR A OG1 1 
ATOM   272 C CG2 . THR A 1 33 ? 22.426 -8.421  33.725 1.00 23.42 ? 121 THR A CG2 1 
ATOM   273 N N   . VAL A 1 34 ? 25.498 -6.672  30.548 1.00 16.06 ? 122 VAL A N   1 
ATOM   274 C CA  A VAL A 1 34 ? 26.589 -5.842  30.039 0.50 17.81 ? 122 VAL A CA  1 
ATOM   275 C CA  B VAL A 1 34 ? 26.579 -5.810  30.191 0.50 18.75 ? 122 VAL A CA  1 
ATOM   276 C C   . VAL A 1 34 ? 26.032 -4.503  29.621 1.00 18.07 ? 122 VAL A C   1 
ATOM   277 O O   . VAL A 1 34 ? 26.695 -3.438  29.809 1.00 17.27 ? 122 VAL A O   1 
ATOM   278 C CB  A VAL A 1 34 ? 27.347 -6.454  28.847 0.50 16.77 ? 122 VAL A CB  1 
ATOM   279 C CB  B VAL A 1 34 ? 27.640 -6.439  29.289 0.50 16.96 ? 122 VAL A CB  1 
ATOM   280 C CG1 A VAL A 1 34 ? 28.279 -5.409  28.190 0.50 15.16 ? 122 VAL A CG1 1 
ATOM   281 C CG1 B VAL A 1 34 ? 28.366 -7.536  29.961 0.50 19.16 ? 122 VAL A CG1 1 
ATOM   282 C CG2 A VAL A 1 34 ? 28.234 -7.550  29.256 0.50 16.39 ? 122 VAL A CG2 1 
ATOM   283 C CG2 B VAL A 1 34 ? 27.049 -6.773  27.979 0.50 20.78 ? 122 VAL A CG2 1 
ATOM   284 N N   . GLU A 1 35 ? 24.867 -4.455  28.992 1.00 17.19 ? 123 GLU A N   1 
ATOM   285 C CA  . GLU A 1 35 ? 24.296 -3.207  28.519 1.00 17.71 ? 123 GLU A CA  1 
ATOM   286 C C   . GLU A 1 35 ? 24.037 -2.274  29.655 1.00 17.57 ? 123 GLU A C   1 
ATOM   287 O O   . GLU A 1 35 ? 24.190 -1.057  29.524 1.00 17.25 ? 123 GLU A O   1 
ATOM   288 C CB  . GLU A 1 35 ? 22.961 -3.388  27.829 1.00 20.13 ? 123 GLU A CB  1 
ATOM   289 C CG  . GLU A 1 35 ? 23.027 -4.266  26.553 1.00 31.20 ? 123 GLU A CG  1 
ATOM   290 C CD  . GLU A 1 35 ? 23.619 -3.495  25.353 1.00 48.58 ? 123 GLU A CD  1 
ATOM   291 O OE1 . GLU A 1 35 ? 24.474 -2.530  25.592 1.00 51.83 ? 123 GLU A OE1 1 
ATOM   292 O OE2 . GLU A 1 35 ? 23.220 -3.876  24.174 1.00 53.48 ? 123 GLU A OE2 1 
ATOM   293 N N   . GLU A 1 36 ? 23.653 -2.747  30.848 1.00 14.80 ? 124 GLU A N   1 
ATOM   294 C CA  . GLU A 1 36 ? 23.479 -1.854  31.962 1.00 15.82 ? 124 GLU A CA  1 
ATOM   295 C C   . GLU A 1 36 ? 24.774 -1.235  32.386 1.00 16.25 ? 124 GLU A C   1 
ATOM   296 O O   . GLU A 1 36 ? 24.817 -0.055  32.821 1.00 16.15 ? 124 GLU A O   1 
ATOM   297 C CB  . GLU A 1 36 ? 22.924 -2.607  33.194 1.00 15.76 ? 124 GLU A CB  1 
ATOM   298 C CG  . GLU A 1 36 ? 21.561 -3.124  33.049 1.00 15.85 ? 124 GLU A CG  1 
ATOM   299 C CD  . GLU A 1 36 ? 21.083 -3.819  34.270 1.00 16.80 ? 124 GLU A CD  1 
ATOM   300 O OE1 . GLU A 1 36 ? 21.458 -3.482  35.398 1.00 15.71 ? 124 GLU A OE1 1 
ATOM   301 O OE2 . GLU A 1 36 ? 20.170 -4.694  34.157 1.00 15.82 ? 124 GLU A OE2 1 
ATOM   302 N N   . ILE A 1 37 ? 25.837 -2.045  32.359 1.00 13.55 ? 125 ILE A N   1 
ATOM   303 C CA  . ILE A 1 37 ? 27.150 -1.575  32.858 1.00 13.64 ? 125 ILE A CA  1 
ATOM   304 C C   . ILE A 1 37 ? 27.691 -0.552  31.884 1.00 13.61 ? 125 ILE A C   1 
ATOM   305 O O   . ILE A 1 37 ? 28.214 0.521   32.316 1.00 14.05 ? 125 ILE A O   1 
ATOM   306 C CB  . ILE A 1 37 ? 28.125 -2.786  33.034 1.00 12.54 ? 125 ILE A CB  1 
ATOM   307 C CG1 . ILE A 1 37 ? 27.527 -3.737  34.105 1.00 12.65 ? 125 ILE A CG1 1 
ATOM   308 C CG2 . ILE A 1 37 ? 29.431 -2.227  33.495 1.00 15.04 ? 125 ILE A CG2 1 
ATOM   309 C CD1 . ILE A 1 37 ? 28.347 -5.020  34.204 1.00 13.80 ? 125 ILE A CD1 1 
ATOM   310 N N   . VAL A 1 38 ? 27.613 -0.857  30.564 1.00 13.56 ? 126 VAL A N   1 
ATOM   311 C CA  . VAL A 1 38 ? 28.114 0.129   29.590 1.00 14.24 ? 126 VAL A CA  1 
ATOM   312 C C   . VAL A 1 38 ? 27.292 1.379   29.674 1.00 15.21 ? 126 VAL A C   1 
ATOM   313 O O   . VAL A 1 38 ? 27.912 2.492   29.610 1.00 15.97 ? 126 VAL A O   1 
ATOM   314 C CB  . VAL A 1 38 ? 28.004 -0.477  28.211 1.00 15.12 ? 126 VAL A CB  1 
ATOM   315 C CG1 . VAL A 1 38 ? 28.262 0.647   27.164 1.00 20.20 ? 126 VAL A CG1 1 
ATOM   316 C CG2 . VAL A 1 38 ? 28.979 -1.572  27.996 1.00 15.41 ? 126 VAL A CG2 1 
ATOM   317 N N   . SER A 1 39 ? 26.022 1.325   29.898 1.00 14.48 ? 127 SER A N   1 
ATOM   318 C CA  . SER A 1 39 ? 25.214 2.529   30.000 1.00 15.10 ? 127 SER A CA  1 
ATOM   319 C C   . SER A 1 39 ? 25.604 3.340   31.218 1.00 16.19 ? 127 SER A C   1 
ATOM   320 O O   . SER A 1 39 ? 25.640 4.573   31.173 1.00 18.28 ? 127 SER A O   1 
ATOM   321 C CB  . SER A 1 39 ? 23.720 2.249   30.059 1.00 18.70 ? 127 SER A CB  1 
ATOM   322 O OG  . SER A 1 39 ? 23.308 1.770   28.789 1.00 25.00 ? 127 SER A OG  1 
ATOM   323 N N   . TYR A 1 40 ? 25.836 2.686   32.332 1.00 14.87 ? 128 TYR A N   1 
ATOM   324 C CA  . TYR A 1 40 ? 26.210 3.409   33.538 1.00 14.99 ? 128 TYR A CA  1 
ATOM   325 C C   . TYR A 1 40 ? 27.506 4.154   33.247 1.00 15.09 ? 128 TYR A C   1 
ATOM   326 O O   . TYR A 1 40 ? 27.665 5.349   33.645 1.00 15.42 ? 128 TYR A O   1 
ATOM   327 C CB  . TYR A 1 40 ? 26.449 2.392   34.702 1.00 13.92 ? 128 TYR A CB  1 
ATOM   328 C CG  . TYR A 1 40 ? 26.860 3.060   36.007 1.00 13.38 ? 128 TYR A CG  1 
ATOM   329 C CD1 . TYR A 1 40 ? 25.914 3.265   36.983 1.00 14.61 ? 128 TYR A CD1 1 
ATOM   330 C CD2 . TYR A 1 40 ? 28.137 3.582   36.221 1.00 14.30 ? 128 TYR A CD2 1 
ATOM   331 C CE1 . TYR A 1 40 ? 26.205 3.894   38.211 1.00 14.37 ? 128 TYR A CE1 1 
ATOM   332 C CE2 . TYR A 1 40 ? 28.482 4.238   37.432 1.00 15.31 ? 128 TYR A CE2 1 
ATOM   333 C CZ  . TYR A 1 40 ? 27.484 4.388   38.420 1.00 14.78 ? 128 TYR A CZ  1 
ATOM   334 O OH  . TYR A 1 40 ? 27.777 5.065   39.646 1.00 16.12 ? 128 TYR A OH  1 
ATOM   335 N N   . VAL A 1 41 ? 28.527 3.508   32.688 1.00 14.75 ? 129 VAL A N   1 
ATOM   336 C CA  . VAL A 1 41 ? 29.823 4.139   32.465 1.00 17.26 ? 129 VAL A CA  1 
ATOM   337 C C   . VAL A 1 41 ? 29.651 5.340   31.489 1.00 17.15 ? 129 VAL A C   1 
ATOM   338 O O   . VAL A 1 41 ? 30.304 6.377   31.673 1.00 19.78 ? 129 VAL A O   1 
ATOM   339 C CB  . VAL A 1 41 ? 30.877 3.077   32.064 1.00 17.21 ? 129 VAL A CB  1 
ATOM   340 C CG1 . VAL A 1 41 ? 32.138 3.779   31.747 1.00 19.89 ? 129 VAL A CG1 1 
ATOM   341 C CG2 . VAL A 1 41 ? 31.105 2.128   33.253 1.00 19.16 ? 129 VAL A CG2 1 
ATOM   342 N N   . THR A 1 42 ? 28.802 5.218   30.456 1.00 17.30 ? 130 THR A N   1 
ATOM   343 C CA  . THR A 1 42 ? 28.400 6.334   29.568 1.00 20.79 ? 130 THR A CA  1 
ATOM   344 C C   . THR A 1 42 ? 27.917 7.532   30.339 1.00 20.38 ? 130 THR A C   1 
ATOM   345 O O   . THR A 1 42 ? 28.303 8.687   30.040 1.00 24.08 ? 130 THR A O   1 
ATOM   346 C CB  . THR A 1 42 ? 27.374 5.876   28.532 1.00 21.43 ? 130 THR A CB  1 
ATOM   347 O OG1 . THR A 1 42 ? 28.004 4.873   27.747 1.00 24.39 ? 130 THR A OG1 1 
ATOM   348 C CG2 . THR A 1 42 ? 26.997 7.004   27.608 1.00 24.88 ? 130 THR A CG2 1 
ATOM   349 N N   . VAL A 1 43 ? 27.048 7.343   31.288 1.00 18.77 ? 131 VAL A N   1 
ATOM   350 C CA  . VAL A 1 43 ? 26.437 8.434   32.027 1.00 18.14 ? 131 VAL A CA  1 
ATOM   351 C C   . VAL A 1 43 ? 27.389 9.064   32.973 1.00 19.95 ? 131 VAL A C   1 
ATOM   352 O O   . VAL A 1 43 ? 27.375 10.333  33.076 1.00 22.56 ? 131 VAL A O   1 
ATOM   353 C CB  . VAL A 1 43 ? 25.239 7.866   32.889 1.00 18.58 ? 131 VAL A CB  1 
ATOM   354 C CG1 . VAL A 1 43 ? 24.662 8.939   33.890 1.00 19.98 ? 131 VAL A CG1 1 
ATOM   355 C CG2 . VAL A 1 43 ? 24.049 7.403   31.969 1.00 21.09 ? 131 VAL A CG2 1 
ATOM   356 N N   . ASN A 1 44 ? 28.191 8.262   33.677 1.00 18.03 ? 132 ASN A N   1 
ATOM   357 C CA  . ASN A 1 44 ? 28.945 8.679   34.850 1.00 19.27 ? 132 ASN A CA  1 
ATOM   358 C C   . ASN A 1 44 ? 30.430 8.966   34.639 1.00 22.00 ? 132 ASN A C   1 
ATOM   359 O O   . ASN A 1 44 ? 31.012 9.543   35.514 1.00 23.45 ? 132 ASN A O   1 
ATOM   360 C CB  . ASN A 1 44 ? 28.755 7.686   36.015 1.00 16.37 ? 132 ASN A CB  1 
ATOM   361 C CG  . ASN A 1 44 ? 27.330 7.654   36.428 1.00 19.39 ? 132 ASN A CG  1 
ATOM   362 O OD1 . ASN A 1 44 ? 26.932 8.441   37.326 1.00 20.66 ? 132 ASN A OD1 1 
ATOM   363 N ND2 . ASN A 1 44 ? 26.515 6.711   35.880 1.00 15.66 ? 132 ASN A ND2 1 
ATOM   364 N N   . PHE A 1 45 ? 31.026 8.448   33.560 1.00 21.89 ? 133 PHE A N   1 
ATOM   365 C CA  . PHE A 1 45 ? 32.466 8.595   33.271 1.00 25.79 ? 133 PHE A CA  1 
ATOM   366 C C   . PHE A 1 45 ? 32.589 9.016   31.847 1.00 29.15 ? 133 PHE A C   1 
ATOM   367 O O   . PHE A 1 45 ? 31.839 9.866   31.415 1.00 34.24 ? 133 PHE A O   1 
ATOM   368 C CB  . PHE A 1 45 ? 33.187 7.287   33.410 1.00 23.13 ? 133 PHE A CB  1 
ATOM   369 C CG  . PHE A 1 45 ? 33.191 6.759   34.749 1.00 24.61 ? 133 PHE A CG  1 
ATOM   370 C CD1 . PHE A 1 45 ? 34.265 7.014   35.606 1.00 25.77 ? 133 PHE A CD1 1 
ATOM   371 C CD2 . PHE A 1 45 ? 32.196 5.914   35.197 1.00 24.40 ? 133 PHE A CD2 1 
ATOM   372 C CE1 . PHE A 1 45 ? 34.288 6.470   36.883 1.00 26.99 ? 133 PHE A CE1 1 
ATOM   373 C CE2 . PHE A 1 45 ? 32.218 5.403   36.498 1.00 27.97 ? 133 PHE A CE2 1 
ATOM   374 C CZ  . PHE A 1 45 ? 33.227 5.663   37.306 1.00 26.06 ? 133 PHE A CZ  1 
ATOM   375 N N   . MET B 1 1  ? 32.570 5.191   21.606 1.00 46.98 ? 89  MET B N   1 
ATOM   376 C CA  . MET B 1 1  ? 32.809 3.692   21.346 1.00 46.41 ? 89  MET B CA  1 
ATOM   377 C C   . MET B 1 1  ? 31.719 2.942   22.173 1.00 45.68 ? 89  MET B C   1 
ATOM   378 O O   . MET B 1 1  ? 30.497 2.953   21.779 1.00 48.10 ? 89  MET B O   1 
ATOM   379 C CB  . MET B 1 1  ? 34.297 3.270   21.692 1.00 46.76 ? 89  MET B CB  1 
ATOM   380 C CG  . MET B 1 1  ? 35.163 2.421   20.686 1.00 42.94 ? 89  MET B CG  1 
ATOM   381 S SD  . MET B 1 1  ? 36.941 2.385   20.945 1.00 44.71 ? 89  MET B SD  1 
ATOM   382 C CE  . MET B 1 1  ? 37.740 1.464   19.672 1.00 41.29 ? 89  MET B CE  1 
ATOM   383 N N   . ASN B 1 2  ? 32.109 2.351   23.324 1.00 42.21 ? 90  ASN B N   1 
ATOM   384 C CA  . ASN B 1 2  ? 33.508 2.230   23.696 1.00 38.04 ? 90  ASN B CA  1 
ATOM   385 C C   . ASN B 1 2  ? 33.879 0.746   23.694 1.00 35.03 ? 90  ASN B C   1 
ATOM   386 O O   . ASN B 1 2  ? 33.522 -0.049  24.598 1.00 32.01 ? 90  ASN B O   1 
ATOM   387 C CB  . ASN B 1 2  ? 33.914 3.022   24.918 1.00 40.09 ? 90  ASN B CB  1 
ATOM   388 C CG  . ASN B 1 2  ? 34.955 2.345   25.762 1.00 41.34 ? 90  ASN B CG  1 
ATOM   389 O OD1 . ASN B 1 2  ? 36.047 1.905   25.346 1.00 39.05 ? 90  ASN B OD1 1 
ATOM   390 N ND2 . ASN B 1 2  ? 34.627 2.302   27.030 1.00 50.73 ? 90  ASN B ND2 1 
ATOM   391 N N   . LEU B 1 3  ? 34.612 0.421   22.637 1.00 31.40 ? 91  LEU B N   1 
ATOM   392 C CA  . LEU B 1 3  ? 34.812 -0.952  22.246 1.00 27.38 ? 91  LEU B CA  1 
ATOM   393 C C   . LEU B 1 3  ? 35.837 -1.677  23.132 1.00 24.89 ? 91  LEU B C   1 
ATOM   394 O O   . LEU B 1 3  ? 35.629 -2.905  23.369 1.00 21.70 ? 91  LEU B O   1 
ATOM   395 C CB  . LEU B 1 3  ? 35.111 -1.049  20.744 1.00 27.21 ? 91  LEU B CB  1 
ATOM   396 C CG  . LEU B 1 3  ? 33.899 -0.732  19.856 1.00 25.18 ? 91  LEU B CG  1 
ATOM   397 C CD1 . LEU B 1 3  ? 34.297 -0.781  18.429 1.00 28.71 ? 91  LEU B CD1 1 
ATOM   398 C CD2 . LEU B 1 3  ? 32.646 -1.534  20.126 1.00 27.84 ? 91  LEU B CD2 1 
ATOM   399 N N   . LEU B 1 4  ? 36.857 -1.006  23.721 1.00 25.18 ? 92  LEU B N   1 
ATOM   400 C CA  . LEU B 1 4  ? 37.834 -1.737  24.546 1.00 25.35 ? 92  LEU B CA  1 
ATOM   401 C C   . LEU B 1 4  ? 37.027 -2.153  25.794 1.00 21.96 ? 92  LEU B C   1 
ATOM   402 O O   . LEU B 1 4  ? 37.262 -3.230  26.258 1.00 20.95 ? 92  LEU B O   1 
ATOM   403 C CB  . LEU B 1 4  ? 39.065 -0.885  25.042 1.00 28.45 ? 92  LEU B CB  1 
ATOM   404 C CG  . LEU B 1 4  ? 38.591 0.418   25.772 1.00 37.42 ? 92  LEU B CG  1 
ATOM   405 C CD1 . LEU B 1 4  ? 39.298 0.809   27.224 1.00 42.06 ? 92  LEU B CD1 1 
ATOM   406 C CD2 . LEU B 1 4  ? 38.550 1.716   24.847 1.00 46.24 ? 92  LEU B CD2 1 
ATOM   407 N N   . PHE B 1 5  ? 36.149 -1.281  26.259 1.00 20.03 ? 93  PHE B N   1 
ATOM   408 C CA  . PHE B 1 5  ? 35.303 -1.624  27.494 1.00 18.89 ? 93  PHE B CA  1 
ATOM   409 C C   . PHE B 1 5  ? 34.324 -2.796  27.199 1.00 17.22 ? 93  PHE B C   1 
ATOM   410 O O   . PHE B 1 5  ? 34.218 -3.767  28.004 1.00 15.76 ? 93  PHE B O   1 
ATOM   411 C CB  . PHE B 1 5  ? 34.575 -0.420  28.038 1.00 18.32 ? 93  PHE B CB  1 
ATOM   412 C CG  . PHE B 1 5  ? 33.926 -0.663  29.354 1.00 16.93 ? 93  PHE B CG  1 
ATOM   413 C CD1 . PHE B 1 5  ? 34.661 -1.275  30.406 1.00 15.66 ? 93  PHE B CD1 1 
ATOM   414 C CD2 . PHE B 1 5  ? 32.624 -0.235  29.645 1.00 17.17 ? 93  PHE B CD2 1 
ATOM   415 C CE1 . PHE B 1 5  ? 34.062 -1.481  31.687 1.00 17.65 ? 93  PHE B CE1 1 
ATOM   416 C CE2 . PHE B 1 5  ? 32.041 -0.372  30.891 1.00 18.55 ? 93  PHE B CE2 1 
ATOM   417 C CZ  . PHE B 1 5  ? 32.712 -0.966  31.913 1.00 16.34 ? 93  PHE B CZ  1 
ATOM   418 N N   . GLN B 1 6  ? 33.701 -2.747  26.045 1.00 20.00 ? 94  GLN B N   1 
ATOM   419 C CA  . GLN B 1 6  ? 32.858 -3.909  25.589 1.00 17.56 ? 94  GLN B CA  1 
ATOM   420 C C   . GLN B 1 6  ? 33.699 -5.154  25.536 1.00 16.67 ? 94  GLN B C   1 
ATOM   421 O O   . GLN B 1 6  ? 33.256 -6.205  26.096 1.00 15.88 ? 94  GLN B O   1 
ATOM   422 C CB  . GLN B 1 6  ? 32.302 -3.620  24.189 1.00 19.34 ? 94  GLN B CB  1 
ATOM   423 C CG  . GLN B 1 6  ? 31.455 -4.743  23.669 1.00 19.88 ? 94  GLN B CG  1 
ATOM   424 C CD  . GLN B 1 6  ? 30.191 -4.932  24.353 1.00 26.26 ? 94  GLN B CD  1 
ATOM   425 O OE1 . GLN B 1 6  ? 29.456 -3.984  24.554 1.00 26.16 ? 94  GLN B OE1 1 
ATOM   426 N NE2 . GLN B 1 6  ? 29.863 -6.217  24.707 1.00 28.06 ? 94  GLN B NE2 1 
ATOM   427 N N   . SER B 1 7  ? 34.878 -5.112  24.957 1.00 16.04 ? 95  SER B N   1 
ATOM   428 C CA  A SER B 1 7  ? 35.740 -6.298  24.929 0.30 15.04 ? 95  SER B CA  1 
ATOM   429 C CA  B SER B 1 7  ? 35.646 -6.320  24.943 0.30 15.86 ? 95  SER B CA  1 
ATOM   430 C CA  C SER B 1 7  ? 35.762 -6.255  24.942 0.40 15.43 ? 95  SER B CA  1 
ATOM   431 C C   . SER B 1 7  ? 36.107 -6.778  26.324 1.00 16.51 ? 95  SER B C   1 
ATOM   432 O O   . SER B 1 7  ? 36.113 -7.982  26.607 1.00 16.26 ? 95  SER B O   1 
ATOM   433 C CB  A SER B 1 7  ? 37.044 -6.027  24.118 0.30 16.61 ? 95  SER B CB  1 
ATOM   434 C CB  B SER B 1 7  ? 36.817 -6.216  23.977 0.30 18.15 ? 95  SER B CB  1 
ATOM   435 C CB  C SER B 1 7  ? 37.118 -5.868  24.289 0.40 16.50 ? 95  SER B CB  1 
ATOM   436 O OG  A SER B 1 7  ? 36.710 -5.762  22.772 0.30 15.55 ? 95  SER B OG  1 
ATOM   437 O OG  B SER B 1 7  ? 36.901 -7.457  23.392 0.30 21.28 ? 95  SER B OG  1 
ATOM   438 O OG  C SER B 1 7  ? 37.822 -7.068  24.221 0.40 21.41 ? 95  SER B OG  1 
ATOM   439 N N   . TYR B 1 8  ? 36.427 -5.818  27.191 1.00 13.88 ? 96  TYR B N   1 
ATOM   440 C CA  . TYR B 1 8  ? 36.795 -6.204  28.513 1.00 15.24 ? 96  TYR B CA  1 
ATOM   441 C C   . TYR B 1 8  ? 35.579 -6.933  29.180 1.00 13.16 ? 96  TYR B C   1 
ATOM   442 O O   . TYR B 1 8  ? 35.786 -7.967  29.808 1.00 13.23 ? 96  TYR B O   1 
ATOM   443 C CB  . TYR B 1 8  ? 37.141 -4.923  29.315 1.00 14.07 ? 96  TYR B CB  1 
ATOM   444 C CG  . TYR B 1 8  ? 37.246 -5.165  30.805 1.00 12.97 ? 96  TYR B CG  1 
ATOM   445 C CD1 . TYR B 1 8  ? 38.269 -5.930  31.320 1.00 15.83 ? 96  TYR B CD1 1 
ATOM   446 C CD2 . TYR B 1 8  ? 36.285 -4.666  31.649 1.00 14.75 ? 96  TYR B CD2 1 
ATOM   447 C CE1 . TYR B 1 8  ? 38.343 -6.188  32.724 1.00 18.41 ? 96  TYR B CE1 1 
ATOM   448 C CE2 . TYR B 1 8  ? 36.355 -4.899  33.049 1.00 15.41 ? 96  TYR B CE2 1 
ATOM   449 C CZ  . TYR B 1 8  ? 37.321 -5.675  33.510 1.00 16.11 ? 96  TYR B CZ  1 
ATOM   450 O OH  . TYR B 1 8  ? 37.311 -5.879  34.928 1.00 20.79 ? 96  TYR B OH  1 
ATOM   451 N N   . LEU B 1 9  ? 34.411 -6.337  29.103 1.00 13.36 ? 97  LEU B N   1 
ATOM   452 C CA  . LEU B 1 9  ? 33.249 -7.009  29.736 1.00 13.00 ? 97  LEU B CA  1 
ATOM   453 C C   . LEU B 1 9  ? 32.852 -8.346  29.087 1.00 13.46 ? 97  LEU B C   1 
ATOM   454 O O   . LEU B 1 9  ? 32.503 -9.273  29.849 1.00 14.07 ? 97  LEU B O   1 
ATOM   455 C CB  . LEU B 1 9  ? 32.048 -6.103  29.757 1.00 13.52 ? 97  LEU B CB  1 
ATOM   456 C CG  . LEU B 1 9  ? 32.186 -4.780  30.628 1.00 15.59 ? 97  LEU B CG  1 
ATOM   457 C CD1 . LEU B 1 9  ? 30.995 -3.926  30.341 1.00 17.95 ? 97  LEU B CD1 1 
ATOM   458 C CD2 . LEU B 1 9  ? 32.328 -5.167  32.096 1.00 16.19 ? 97  LEU B CD2 1 
ATOM   459 N N   . ASP B 1 10 ? 33.078 -8.421  27.766 1.00 13.94 ? 98  ASP B N   1 
ATOM   460 C CA  . ASP B 1 10 ? 32.866 -9.793  27.183 1.00 15.64 ? 98  ASP B CA  1 
ATOM   461 C C   . ASP B 1 10 ? 33.809 -10.824 27.822 1.00 15.22 ? 98  ASP B C   1 
ATOM   462 O O   . ASP B 1 10 ? 33.404 -11.990 28.161 1.00 15.98 ? 98  ASP B O   1 
ATOM   463 C CB  . ASP B 1 10 ? 33.149 -9.719  25.682 1.00 16.91 ? 98  ASP B CB  1 
ATOM   464 C CG  . ASP B 1 10 ? 32.111 -8.990  24.910 1.00 21.86 ? 98  ASP B CG  1 
ATOM   465 O OD1 . ASP B 1 10 ? 30.938 -8.741  25.389 1.00 22.57 ? 98  ASP B OD1 1 
ATOM   466 O OD2 . ASP B 1 10 ? 32.547 -8.606  23.746 1.00 27.24 ? 98  ASP B OD2 1 
ATOM   467 N N   . ASN B 1 11 ? 35.067 -10.472 28.027 1.00 15.37 ? 99  ASN B N   1 
ATOM   468 C CA  . ASN B 1 11 ? 36.032 -11.370 28.625 1.00 15.85 ? 99  ASN B CA  1 
ATOM   469 C C   . ASN B 1 11 ? 35.705 -11.621 30.107 1.00 15.15 ? 99  ASN B C   1 
ATOM   470 O O   . ASN B 1 11 ? 35.887 -12.744 30.546 1.00 15.75 ? 99  ASN B O   1 
ATOM   471 C CB  . ASN B 1 11 ? 37.459 -10.872 28.482 1.00 19.54 ? 99  ASN B CB  1 
ATOM   472 C CG  . ASN B 1 11 ? 38.478 -11.951 28.946 1.00 29.83 ? 99  ASN B CG  1 
ATOM   473 O OD1 . ASN B 1 11 ? 38.550 -13.049 28.348 1.00 38.16 ? 99  ASN B OD1 1 
ATOM   474 N ND2 . ASN B 1 11 ? 39.185 -11.670 30.078 1.00 34.57 ? 99  ASN B ND2 1 
ATOM   475 N N   . VAL B 1 12 ? 35.222 -10.612 30.819 1.00 13.58 ? 100 VAL B N   1 
ATOM   476 C CA  . VAL B 1 12 ? 34.807 -10.861 32.198 1.00 12.71 ? 100 VAL B CA  1 
ATOM   477 C C   . VAL B 1 12 ? 33.753 -11.977 32.238 1.00 13.64 ? 100 VAL B C   1 
ATOM   478 O O   . VAL B 1 12 ? 33.865 -12.851 33.109 1.00 14.66 ? 100 VAL B O   1 
ATOM   479 C CB  . VAL B 1 12 ? 34.290 -9.594  32.814 1.00 13.33 ? 100 VAL B CB  1 
ATOM   480 C CG1 . VAL B 1 12 ? 33.650 -9.934  34.152 1.00 14.41 ? 100 VAL B CG1 1 
ATOM   481 C CG2 . VAL B 1 12 ? 35.472 -8.593  33.058 1.00 15.49 ? 100 VAL B CG2 1 
ATOM   482 N N   . GLY B 1 13 ? 32.768 -11.921 31.365 1.00 13.37 ? 101 GLY B N   1 
ATOM   483 C CA  . GLY B 1 13 ? 31.721 -12.974 31.410 1.00 13.00 ? 101 GLY B CA  1 
ATOM   484 C C   . GLY B 1 13 ? 32.310 -14.341 31.122 1.00 14.62 ? 101 GLY B C   1 
ATOM   485 O O   . GLY B 1 13 ? 31.908 -15.331 31.805 1.00 15.20 ? 101 GLY B O   1 
ATOM   486 N N   . VAL B 1 14 ? 33.191 -14.477 30.130 1.00 15.16 ? 102 VAL B N   1 
ATOM   487 C CA  . VAL B 1 14 ? 33.800 -15.764 29.883 1.00 17.60 ? 102 VAL B CA  1 
ATOM   488 C C   . VAL B 1 14 ? 34.598 -16.228 31.080 1.00 19.06 ? 102 VAL B C   1 
ATOM   489 O O   . VAL B 1 14 ? 34.542 -17.419 31.470 1.00 20.02 ? 102 VAL B O   1 
ATOM   490 C CB  . VAL B 1 14 ? 34.667 -15.700 28.576 1.00 18.72 ? 102 VAL B CB  1 
ATOM   491 C CG1 . VAL B 1 14 ? 35.469 -16.983 28.498 1.00 24.48 ? 102 VAL B CG1 1 
ATOM   492 C CG2 . VAL B 1 14 ? 33.732 -15.601 27.393 1.00 19.19 ? 102 VAL B CG2 1 
ATOM   493 N N   . GLN B 1 15 ? 35.288 -15.297 31.761 1.00 16.91 ? 103 GLN B N   1 
ATOM   494 C CA  . GLN B 1 15 ? 36.137 -15.664 32.928 1.00 18.59 ? 103 GLN B CA  1 
ATOM   495 C C   . GLN B 1 15 ? 35.226 -16.106 34.101 1.00 17.44 ? 103 GLN B C   1 
ATOM   496 O O   . GLN B 1 15 ? 35.527 -17.042 34.817 1.00 18.87 ? 103 GLN B O   1 
ATOM   497 C CB  . GLN B 1 15 ? 36.972 -14.504 33.421 1.00 18.82 ? 103 GLN B CB  1 
ATOM   498 C CG  . GLN B 1 15 ? 38.167 -14.068 32.426 1.00 29.17 ? 103 GLN B CG  1 
ATOM   499 C CD  . GLN B 1 15 ? 39.052 -12.805 32.984 1.00 42.75 ? 103 GLN B CD  1 
ATOM   500 O OE1 . GLN B 1 15 ? 38.578 -11.853 33.708 1.00 43.43 ? 103 GLN B OE1 1 
ATOM   501 N NE2 . GLN B 1 15 ? 40.351 -12.844 32.624 1.00 44.26 ? 103 GLN B NE2 1 
ATOM   502 N N   . ILE B 1 16 ? 34.068 -15.468 34.232 1.00 15.64 ? 104 ILE B N   1 
ATOM   503 C CA  . ILE B 1 16 ? 33.076 -15.894 35.245 1.00 14.83 ? 104 ILE B CA  1 
ATOM   504 C C   . ILE B 1 16 ? 32.610 -17.342 34.966 1.00 15.00 ? 104 ILE B C   1 
ATOM   505 O O   . ILE B 1 16 ? 32.641 -18.164 35.917 1.00 17.21 ? 104 ILE B O   1 
ATOM   506 C CB  . ILE B 1 16 ? 31.844 -14.954 35.352 1.00 14.49 ? 104 ILE B CB  1 
ATOM   507 C CG1 . ILE B 1 16 ? 32.310 -13.591 35.926 1.00 12.60 ? 104 ILE B CG1 1 
ATOM   508 C CG2 . ILE B 1 16 ? 30.743 -15.568 36.310 1.00 18.19 ? 104 ILE B CG2 1 
ATOM   509 C CD1 . ILE B 1 16 ? 31.313 -12.485 35.856 1.00 15.58 ? 104 ILE B CD1 1 
ATOM   510 N N   . VAL B 1 17 ? 32.283 -17.657 33.728 1.00 15.67 ? 105 VAL B N   1 
ATOM   511 C CA  . VAL B 1 17 ? 31.899 -19.037 33.404 1.00 17.81 ? 105 VAL B CA  1 
ATOM   512 C C   . VAL B 1 17 ? 32.996 -19.985 33.708 1.00 18.39 ? 105 VAL B C   1 
ATOM   513 O O   . VAL B 1 17 ? 32.728 -21.083 34.286 1.00 19.37 ? 105 VAL B O   1 
ATOM   514 C CB  . VAL B 1 17 ? 31.471 -19.154 31.954 1.00 16.72 ? 105 VAL B CB  1 
ATOM   515 C CG1 . VAL B 1 17 ? 31.045 -20.648 31.655 1.00 20.95 ? 105 VAL B CG1 1 
ATOM   516 C CG2 . VAL B 1 17 ? 30.245 -18.316 31.714 1.00 23.26 ? 105 VAL B CG2 1 
ATOM   517 N N   . ARG B 1 18 ? 34.254 -19.611 33.405 1.00 19.84 ? 106 ARG B N   1 
ATOM   518 C CA  . ARG B 1 18 ? 35.356 -20.520 33.709 1.00 21.75 ? 106 ARG B CA  1 
ATOM   519 C C   . ARG B 1 18 ? 35.417 -20.829 35.180 1.00 22.53 ? 106 ARG B C   1 
ATOM   520 O O   . ARG B 1 18 ? 35.661 -21.979 35.554 1.00 23.74 ? 106 ARG B O   1 
ATOM   521 C CB  . ARG B 1 18 ? 36.676 -19.999 33.228 1.00 23.04 ? 106 ARG B CB  1 
ATOM   522 C CG  . ARG B 1 18 ? 36.810 -20.109 31.801 1.00 28.85 ? 106 ARG B CG  1 
ATOM   523 C CD  . ARG B 1 18 ? 38.322 -20.012 31.339 1.00 38.38 ? 106 ARG B CD  1 
ATOM   524 N NE  . ARG B 1 18 ? 38.327 -20.177 29.874 1.00 45.12 ? 106 ARG B NE  1 
ATOM   525 C CZ  . ARG B 1 18 ? 38.441 -19.176 29.002 1.00 49.46 ? 106 ARG B CZ  1 
ATOM   526 N NH1 . ARG B 1 18 ? 38.657 -17.937 29.462 1.00 52.01 ? 106 ARG B NH1 1 
ATOM   527 N NH2 . ARG B 1 18 ? 38.396 -19.426 27.667 1.00 50.58 ? 106 ARG B NH2 1 
ATOM   528 N N   . GLN B 1 19 ? 35.207 -19.836 36.013 1.00 20.33 ? 107 GLN B N   1 
ATOM   529 C CA  . GLN B 1 19 ? 35.281 -20.024 37.434 1.00 21.01 ? 107 GLN B CA  1 
ATOM   530 C C   . GLN B 1 19 ? 34.120 -20.827 37.936 1.00 23.71 ? 107 GLN B C   1 
ATOM   531 O O   . GLN B 1 19 ? 34.323 -21.714 38.780 1.00 24.12 ? 107 GLN B O   1 
ATOM   532 C CB  . GLN B 1 19 ? 35.346 -18.709 38.112 1.00 24.37 ? 107 GLN B CB  1 
ATOM   533 C CG  . GLN B 1 19 ? 36.661 -18.035 37.768 1.00 27.29 ? 107 GLN B CG  1 
ATOM   534 C CD  . GLN B 1 19 ? 36.665 -16.610 38.259 1.00 34.18 ? 107 GLN B CD  1 
ATOM   535 O OE1 . GLN B 1 19 ? 36.396 -15.670 37.485 1.00 39.89 ? 107 GLN B OE1 1 
ATOM   536 N NE2 . GLN B 1 19 ? 36.865 -16.428 39.561 1.00 35.74 ? 107 GLN B NE2 1 
ATOM   537 N N   . MET B 1 20 ? 32.900 -20.584 37.463 1.00 22.06 ? 108 MET B N   1 
ATOM   538 C CA  . MET B 1 20 ? 31.692 -21.406 37.820 1.00 22.54 ? 108 MET B CA  1 
ATOM   539 C C   . MET B 1 20 ? 31.906 -22.847 37.399 1.00 24.86 ? 108 MET B C   1 
ATOM   540 O O   . MET B 1 20 ? 31.611 -23.781 38.252 1.00 26.94 ? 108 MET B O   1 
ATOM   541 C CB  . MET B 1 20 ? 30.493 -20.882 37.096 1.00 20.54 ? 108 MET B CB  1 
ATOM   542 C CG  . MET B 1 20 ? 30.114 -19.495 37.659 1.00 21.07 ? 108 MET B CG  1 
ATOM   543 S SD  . MET B 1 20 ? 28.622 -18.871 37.054 1.00 30.26 ? 108 MET B SD  1 
ATOM   544 C CE  . MET B 1 20 ? 28.698 -19.051 35.453 1.00 26.34 ? 108 MET B CE  1 
ATOM   545 N N   . ARG B 1 21 ? 32.454 -23.100 36.223 1.00 27.97 ? 109 ARG B N   1 
ATOM   546 C CA  . ARG B 1 21 ? 32.841 -24.486 35.807 1.00 32.27 ? 109 ARG B CA  1 
ATOM   547 C C   . ARG B 1 21 ? 33.796 -25.220 36.774 1.00 34.01 ? 109 ARG B C   1 
ATOM   548 O O   . ARG B 1 21 ? 33.719 -26.462 36.946 1.00 34.96 ? 109 ARG B O   1 
ATOM   549 C CB  . ARG B 1 21 ? 33.495 -24.429 34.439 1.00 33.06 ? 109 ARG B CB  1 
ATOM   550 C CG  . ARG B 1 21 ? 32.491 -24.482 33.372 1.00 36.87 ? 109 ARG B CG  1 
ATOM   551 C CD  . ARG B 1 21 ? 32.973 -23.531 32.373 1.00 43.14 ? 109 ARG B CD  1 
ATOM   552 N NE  . ARG B 1 21 ? 33.136 -24.104 31.054 1.00 48.57 ? 109 ARG B NE  1 
ATOM   553 C CZ  . ARG B 1 21 ? 34.304 -24.347 30.438 1.00 48.19 ? 109 ARG B CZ  1 
ATOM   554 N NH1 . ARG B 1 21 ? 35.514 -24.141 30.970 1.00 47.34 ? 109 ARG B NH1 1 
ATOM   555 N NH2 . ARG B 1 21 ? 34.233 -24.822 29.234 1.00 45.97 ? 109 ARG B NH2 1 
ATOM   556 N N   . SER B 1 22 ? 34.676 -24.448 37.408 1.00 36.09 ? 110 SER B N   1 
ATOM   557 C CA  . SER B 1 22 ? 35.659 -24.872 38.447 1.00 39.21 ? 110 SER B CA  1 
ATOM   558 C C   . SER B 1 22 ? 35.021 -25.242 39.717 1.00 39.27 ? 110 SER B C   1 
ATOM   559 O O   . SER B 1 22 ? 35.690 -25.731 40.614 1.00 41.99 ? 110 SER B O   1 
ATOM   560 C CB  . SER B 1 22 ? 36.564 -23.709 38.836 1.00 39.47 ? 110 SER B CB  1 
ATOM   561 O OG  . SER B 1 22 ? 37.661 -23.681 37.976 1.00 46.44 ? 110 SER B OG  1 
ATOM   562 N N   . GLY B 1 23 ? 33.735 -24.957 39.829 1.00 38.98 ? 111 GLY B N   1 
ATOM   563 C CA  . GLY B 1 23 ? 32.979 -25.158 41.047 1.00 37.70 ? 111 GLY B CA  1 
ATOM   564 C C   . GLY B 1 23 ? 32.886 -23.968 41.998 1.00 38.10 ? 111 GLY B C   1 
ATOM   565 O O   . GLY B 1 23 ? 32.360 -24.119 43.118 1.00 37.27 ? 111 GLY B O   1 
ATOM   566 N N   . GLU B 1 24 ? 33.342 -22.756 41.608 1.00 36.02 ? 112 GLU B N   1 
ATOM   567 C CA  . GLU B 1 24 ? 33.056 -21.581 42.483 1.00 35.47 ? 112 GLU B CA  1 
ATOM   568 C C   . GLU B 1 24 ? 31.602 -21.076 42.178 1.00 33.36 ? 112 GLU B C   1 
ATOM   569 O O   . GLU B 1 24 ? 31.136 -21.207 41.083 1.00 34.50 ? 112 GLU B O   1 
ATOM   570 C CB  . GLU B 1 24 ? 34.137 -20.496 42.352 1.00 36.61 ? 112 GLU B CB  1 
ATOM   571 C CG  . GLU B 1 24 ? 33.983 -19.421 43.454 1.00 44.36 ? 112 GLU B CG  1 
ATOM   572 C CD  . GLU B 1 24 ? 33.779 -20.052 44.862 1.00 55.51 ? 112 GLU B CD  1 
ATOM   573 O OE1 . GLU B 1 24 ? 34.753 -20.683 45.339 1.00 60.32 ? 112 GLU B OE1 1 
ATOM   574 O OE2 . GLU B 1 24 ? 32.682 -19.927 45.489 1.00 57.79 ? 112 GLU B OE2 1 
ATOM   575 N N   . ARG B 1 25 ? 30.875 -20.577 43.170 1.00 33.60 ? 113 ARG B N   1 
ATOM   576 C CA  . ARG B 1 25 ? 29.476 -20.198 43.010 1.00 34.29 ? 113 ARG B CA  1 
ATOM   577 C C   . ARG B 1 25 ? 29.456 -18.754 42.466 1.00 31.43 ? 113 ARG B C   1 
ATOM   578 O O   . ARG B 1 25 ? 30.296 -17.948 42.910 1.00 30.84 ? 113 ARG B O   1 
ATOM   579 C CB  . ARG B 1 25 ? 28.791 -20.171 44.406 1.00 35.12 ? 113 ARG B CB  1 
ATOM   580 C CG  . ARG B 1 25 ? 27.303 -20.647 44.427 1.00 42.92 ? 113 ARG B CG  1 
ATOM   581 C CD  . ARG B 1 25 ? 27.070 -22.011 43.726 1.00 44.99 ? 113 ARG B CD  1 
ATOM   582 N NE  . ARG B 1 25 ? 27.157 -23.147 44.627 1.00 51.33 ? 113 ARG B NE  1 
ATOM   583 C CZ  . ARG B 1 25 ? 26.261 -23.436 45.582 1.00 53.99 ? 113 ARG B CZ  1 
ATOM   584 N NH1 . ARG B 1 25 ? 25.206 -22.648 45.799 1.00 55.77 ? 113 ARG B NH1 1 
ATOM   585 N NH2 . ARG B 1 25 ? 26.425 -24.511 46.346 1.00 54.85 ? 113 ARG B NH2 1 
ATOM   586 N N   . PHE B 1 26 ? 28.522 -18.460 41.545 1.00 30.24 ? 114 PHE B N   1 
ATOM   587 C CA  . PHE B 1 26 ? 28.489 -17.145 40.930 1.00 28.70 ? 114 PHE B CA  1 
ATOM   588 C C   . PHE B 1 26 ? 28.584 -16.052 41.971 1.00 30.10 ? 114 PHE B C   1 
ATOM   589 O O   . PHE B 1 26 ? 29.340 -15.073 41.786 1.00 27.74 ? 114 PHE B O   1 
ATOM   590 C CB  . PHE B 1 26 ? 27.241 -16.919 40.051 1.00 27.46 ? 114 PHE B CB  1 
ATOM   591 C CG  . PHE B 1 26 ? 27.085 -15.497 39.672 1.00 24.35 ? 114 PHE B CG  1 
ATOM   592 C CD1 . PHE B 1 26 ? 27.810 -15.013 38.657 1.00 19.30 ? 114 PHE B CD1 1 
ATOM   593 C CD2 . PHE B 1 26 ? 26.241 -14.624 40.445 1.00 23.89 ? 114 PHE B CD2 1 
ATOM   594 C CE1 . PHE B 1 26 ? 27.825 -13.670 38.379 1.00 19.55 ? 114 PHE B CE1 1 
ATOM   595 C CE2 . PHE B 1 26 ? 26.162 -13.289 40.103 1.00 23.60 ? 114 PHE B CE2 1 
ATOM   596 C CZ  . PHE B 1 26 ? 26.967 -12.819 39.042 1.00 21.04 ? 114 PHE B CZ  1 
ATOM   597 N N   . LEU B 1 27 ? 27.787 -16.127 43.023 1.00 32.24 ? 115 LEU B N   1 
ATOM   598 C CA  . LEU B 1 27 ? 27.784 -15.078 44.034 1.00 35.01 ? 115 LEU B CA  1 
ATOM   599 C C   . LEU B 1 27 ? 29.146 -14.778 44.714 1.00 33.29 ? 115 LEU B C   1 
ATOM   600 O O   . LEU B 1 27 ? 29.510 -13.589 44.867 1.00 33.75 ? 115 LEU B O   1 
ATOM   601 C CB  . LEU B 1 27 ? 26.691 -15.360 45.080 1.00 35.18 ? 115 LEU B CB  1 
ATOM   602 C CG  . LEU B 1 27 ? 25.457 -14.451 45.115 1.00 42.26 ? 115 LEU B CG  1 
ATOM   603 C CD1 . LEU B 1 27 ? 25.533 -13.158 44.173 1.00 43.93 ? 115 LEU B CD1 1 
ATOM   604 C CD2 . LEU B 1 27 ? 24.133 -15.316 45.039 1.00 41.16 ? 115 LEU B CD2 1 
ATOM   605 N N   . LYS B 1 28 ? 29.974 -15.774 44.989 1.00 32.51 ? 116 LYS B N   1 
ATOM   606 C CA  . LYS B 1 28 ? 31.371 -15.521 45.508 1.00 29.35 ? 116 LYS B CA  1 
ATOM   607 C C   . LYS B 1 28 ? 32.348 -14.924 44.440 1.00 28.30 ? 116 LYS B C   1 
ATOM   608 O O   . LYS B 1 28 ? 33.111 -14.027 44.668 1.00 29.34 ? 116 LYS B O   1 
ATOM   609 C CB  . LYS B 1 28 ? 31.940 -16.834 45.997 1.00 32.19 ? 116 LYS B CB  1 
ATOM   610 C CG  . LYS B 1 28 ? 33.393 -16.752 46.456 1.00 38.12 ? 116 LYS B CG  1 
ATOM   611 C CD  . LYS B 1 28 ? 33.676 -17.599 47.738 1.00 45.71 ? 116 LYS B CD  1 
ATOM   612 C CE  . LYS B 1 28 ? 35.133 -18.170 47.766 1.00 50.65 ? 116 LYS B CE  1 
ATOM   613 N NZ  . LYS B 1 28 ? 35.466 -18.918 49.067 1.00 50.96 ? 116 LYS B NZ  1 
ATOM   614 N N   . ILE B 1 29 ? 32.247 -15.391 43.208 1.00 22.35 ? 117 ILE B N   1 
ATOM   615 C CA  A ILE B 1 29 ? 32.972 -14.824 42.069 0.60 20.44 ? 117 ILE B CA  1 
ATOM   616 C CA  B ILE B 1 29 ? 33.034 -14.818 42.105 0.40 19.56 ? 117 ILE B CA  1 
ATOM   617 C C   . ILE B 1 29 ? 32.621 -13.342 41.920 1.00 18.15 ? 117 ILE B C   1 
ATOM   618 O O   . ILE B 1 29 ? 33.466 -12.478 41.645 1.00 20.22 ? 117 ILE B O   1 
ATOM   619 C CB  A ILE B 1 29 ? 32.450 -15.596 40.802 0.60 18.21 ? 117 ILE B CB  1 
ATOM   620 C CB  B ILE B 1 29 ? 32.801 -15.654 40.778 0.40 18.46 ? 117 ILE B CB  1 
ATOM   621 C CG1 A ILE B 1 29 ? 32.897 -17.066 40.789 0.60 20.42 ? 117 ILE B CG1 1 
ATOM   622 C CG1 B ILE B 1 29 ? 33.411 -17.072 40.816 0.40 16.47 ? 117 ILE B CG1 1 
ATOM   623 C CG2 A ILE B 1 29 ? 32.925 -14.859 39.506 0.60 19.10 ? 117 ILE B CG2 1 
ATOM   624 C CG2 B ILE B 1 29 ? 33.490 -15.003 39.603 0.40 14.96 ? 117 ILE B CG2 1 
ATOM   625 C CD1 A ILE B 1 29 ? 31.960 -17.943 40.011 0.60 22.36 ? 117 ILE B CD1 1 
ATOM   626 C CD1 B ILE B 1 29 ? 32.625 -18.094 39.922 0.40 18.39 ? 117 ILE B CD1 1 
ATOM   627 N N   . TRP B 1 30 ? 31.354 -13.027 42.060 1.00 17.39 ? 118 TRP B N   1 
ATOM   628 C CA  . TRP B 1 30 ? 30.877 -11.655 41.777 1.00 15.91 ? 118 TRP B CA  1 
ATOM   629 C C   . TRP B 1 30 ? 31.479 -10.584 42.682 1.00 17.50 ? 118 TRP B C   1 
ATOM   630 O O   . TRP B 1 30 ? 31.781 -9.459  42.246 1.00 15.59 ? 118 TRP B O   1 
ATOM   631 C CB  . TRP B 1 30 ? 29.337 -11.579 41.796 1.00 17.64 ? 118 TRP B CB  1 
ATOM   632 C CG  . TRP B 1 30 ? 28.794 -10.241 41.304 1.00 17.25 ? 118 TRP B CG  1 
ATOM   633 C CD1 . TRP B 1 30 ? 28.164 -9.276  42.019 1.00 15.03 ? 118 TRP B CD1 1 
ATOM   634 C CD2 . TRP B 1 30 ? 28.908 -9.738  39.994 1.00 14.68 ? 118 TRP B CD2 1 
ATOM   635 N NE1 . TRP B 1 30 ? 27.833 -8.232  41.244 1.00 15.43 ? 118 TRP B NE1 1 
ATOM   636 C CE2 . TRP B 1 30 ? 28.315 -8.486  39.987 1.00 12.76 ? 118 TRP B CE2 1 
ATOM   637 C CE3 . TRP B 1 30 ? 29.453 -10.227 38.812 1.00 16.55 ? 118 TRP B CE3 1 
ATOM   638 C CZ2 . TRP B 1 30 ? 28.273 -7.708  38.834 1.00 13.54 ? 118 TRP B CZ2 1 
ATOM   639 C CZ3 . TRP B 1 30 ? 29.400 -9.446  37.634 1.00 17.43 ? 118 TRP B CZ3 1 
ATOM   640 C CH2 . TRP B 1 30 ? 28.819 -8.190  37.674 1.00 16.87 ? 118 TRP B CH2 1 
ATOM   641 N N   . SER B 1 31 ? 31.648 -10.864 43.979 1.00 18.79 ? 119 SER B N   1 
ATOM   642 C CA  . SER B 1 31 ? 32.295 -9.845  44.759 1.00 21.97 ? 119 SER B CA  1 
ATOM   643 C C   . SER B 1 31 ? 33.708 -9.400  44.271 1.00 21.13 ? 119 SER B C   1 
ATOM   644 O O   . SER B 1 31 ? 33.963 -8.168  44.282 1.00 23.12 ? 119 SER B O   1 
ATOM   645 C CB  . SER B 1 31 ? 32.420 -10.363 46.210 1.00 26.69 ? 119 SER B CB  1 
ATOM   646 O OG  . SER B 1 31 ? 32.865 -11.709 46.243 1.00 35.74 ? 119 SER B OG  1 
ATOM   647 N N   . GLN B 1 32 ? 34.527 -10.351 43.827 1.00 21.23 ? 120 GLN B N   1 
ATOM   648 C CA  . GLN B 1 32 ? 35.820 -10.125 43.260 1.00 21.79 ? 120 GLN B CA  1 
ATOM   649 C C   . GLN B 1 32 ? 35.627 -9.350  41.931 1.00 20.72 ? 120 GLN B C   1 
ATOM   650 O O   . GLN B 1 32 ? 36.376 -8.362  41.626 1.00 22.98 ? 120 GLN B O   1 
ATOM   651 C CB  . GLN B 1 32 ? 36.602 -11.397 42.973 1.00 26.47 ? 120 GLN B CB  1 
ATOM   652 C CG  . GLN B 1 32 ? 37.972 -11.216 42.256 1.00 35.25 ? 120 GLN B CG  1 
ATOM   653 C CD  . GLN B 1 32 ? 39.034 -10.414 43.052 1.00 47.99 ? 120 GLN B CD  1 
ATOM   654 O OE1 . GLN B 1 32 ? 39.413 -10.779 44.211 1.00 51.26 ? 120 GLN B OE1 1 
ATOM   655 N NE2 . GLN B 1 32 ? 39.541 -9.310  42.421 1.00 48.31 ? 120 GLN B NE2 1 
ATOM   656 N N   . THR B 1 33 ? 34.610 -9.740  41.163 1.00 17.59 ? 121 THR B N   1 
ATOM   657 C CA  . THR B 1 33 ? 34.424 -9.110  39.888 1.00 16.97 ? 121 THR B CA  1 
ATOM   658 C C   . THR B 1 33 ? 34.036 -7.692  40.005 1.00 17.06 ? 121 THR B C   1 
ATOM   659 O O   . THR B 1 33 ? 34.486 -6.803  39.208 1.00 15.22 ? 121 THR B O   1 
ATOM   660 C CB  . THR B 1 33 ? 33.325 -9.864  39.146 1.00 16.94 ? 121 THR B CB  1 
ATOM   661 O OG1 . THR B 1 33 ? 33.768 -11.214 38.999 1.00 19.75 ? 121 THR B OG1 1 
ATOM   662 C CG2 . THR B 1 33 ? 33.182 -9.292  37.683 1.00 19.59 ? 121 THR B CG2 1 
ATOM   663 N N   . VAL B 1 34 ? 33.206 -7.333  40.995 1.00 16.81 ? 122 VAL B N   1 
ATOM   664 C CA  . VAL B 1 34 ? 32.812 -5.976  41.158 1.00 14.61 ? 122 VAL B CA  1 
ATOM   665 C C   . VAL B 1 34 ? 34.051 -5.114  41.393 1.00 14.95 ? 122 VAL B C   1 
ATOM   666 O O   . VAL B 1 34 ? 34.165 -4.049  40.754 1.00 14.79 ? 122 VAL B O   1 
ATOM   667 C CB  . VAL B 1 34 ? 31.885 -5.883  42.355 1.00 15.28 ? 122 VAL B CB  1 
ATOM   668 C CG1 . VAL B 1 34 ? 31.665 -4.403  42.685 1.00 15.57 ? 122 VAL B CG1 1 
ATOM   669 C CG2 . VAL B 1 34 ? 30.509 -6.450  41.966 1.00 16.68 ? 122 VAL B CG2 1 
ATOM   670 N N   . GLU B 1 35 ? 34.963 -5.562  42.258 1.00 15.96 ? 123 GLU B N   1 
ATOM   671 C CA  . GLU B 1 35 ? 36.141 -4.763  42.501 1.00 17.62 ? 123 GLU B CA  1 
ATOM   672 C C   . GLU B 1 35 ? 36.989 -4.631  41.218 1.00 15.54 ? 123 GLU B C   1 
ATOM   673 O O   . GLU B 1 35 ? 37.534 -3.528  40.960 1.00 17.07 ? 123 GLU B O   1 
ATOM   674 C CB  . GLU B 1 35 ? 36.944 -5.424  43.598 1.00 21.34 ? 123 GLU B CB  1 
ATOM   675 C CG  . GLU B 1 35 ? 38.073 -4.572  44.093 1.00 32.89 ? 123 GLU B CG  1 
ATOM   676 C CD  . GLU B 1 35 ? 39.339 -5.422  44.175 1.00 48.58 ? 123 GLU B CD  1 
ATOM   677 O OE1 . GLU B 1 35 ? 39.300 -6.515  44.837 1.00 51.01 ? 123 GLU B OE1 1 
ATOM   678 O OE2 . GLU B 1 35 ? 40.357 -5.001  43.530 1.00 57.63 ? 123 GLU B OE2 1 
ATOM   679 N N   . GLU B 1 36 ? 37.079 -5.692  40.414 1.00 16.22 ? 124 GLU B N   1 
ATOM   680 C CA  . GLU B 1 36 ? 37.878 -5.633  39.164 1.00 15.01 ? 124 GLU B CA  1 
ATOM   681 C C   . GLU B 1 36 ? 37.245 -4.658  38.226 1.00 14.46 ? 124 GLU B C   1 
ATOM   682 O O   . GLU B 1 36 ? 37.972 -3.842  37.545 1.00 14.65 ? 124 GLU B O   1 
ATOM   683 C CB  . GLU B 1 36 ? 37.921 -6.996  38.510 1.00 16.85 ? 124 GLU B CB  1 
ATOM   684 C CG  . GLU B 1 36 ? 38.838 -7.927  39.372 1.00 21.70 ? 124 GLU B CG  1 
ATOM   685 C CD  . GLU B 1 36 ? 38.922 -9.322  38.890 1.00 33.91 ? 124 GLU B CD  1 
ATOM   686 O OE1 . GLU B 1 36 ? 38.492 -9.582  37.735 1.00 39.58 ? 124 GLU B OE1 1 
ATOM   687 O OE2 . GLU B 1 36 ? 39.431 -10.182 39.674 1.00 40.62 ? 124 GLU B OE2 1 
ATOM   688 N N   . ILE B 1 37 ? 35.912 -4.691  38.037 1.00 12.93 ? 125 ILE B N   1 
ATOM   689 C CA  . ILE B 1 37 ? 35.296 -3.776  37.093 1.00 13.24 ? 125 ILE B CA  1 
ATOM   690 C C   . ILE B 1 37 ? 35.406 -2.326  37.552 1.00 13.16 ? 125 ILE B C   1 
ATOM   691 O O   . ILE B 1 37 ? 35.736 -1.400  36.764 1.00 13.87 ? 125 ILE B O   1 
ATOM   692 C CB  . ILE B 1 37 ? 33.752 -4.083  36.916 1.00 12.10 ? 125 ILE B CB  1 
ATOM   693 C CG1 . ILE B 1 37 ? 33.679 -5.476  36.212 1.00 12.85 ? 125 ILE B CG1 1 
ATOM   694 C CG2 . ILE B 1 37 ? 33.057 -2.978  36.110 1.00 13.24 ? 125 ILE B CG2 1 
ATOM   695 C CD1 . ILE B 1 37 ? 32.195 -6.009  36.139 1.00 15.39 ? 125 ILE B CD1 1 
ATOM   696 N N   . VAL B 1 38 ? 35.185 -2.057  38.868 1.00 14.03 ? 126 VAL B N   1 
ATOM   697 C CA  . VAL B 1 38 ? 35.402 -0.703  39.328 1.00 14.85 ? 126 VAL B CA  1 
ATOM   698 C C   . VAL B 1 38 ? 36.885 -0.214  39.165 1.00 14.40 ? 126 VAL B C   1 
ATOM   699 O O   . VAL B 1 38 ? 37.063 0.926   38.655 1.00 17.50 ? 126 VAL B O   1 
ATOM   700 C CB  . VAL B 1 38 ? 35.013 -0.650  40.851 1.00 15.29 ? 126 VAL B CB  1 
ATOM   701 C CG1 . VAL B 1 38 ? 35.424 0.727   41.427 1.00 18.95 ? 126 VAL B CG1 1 
ATOM   702 C CG2 . VAL B 1 38 ? 33.473 -0.775  41.051 1.00 16.03 ? 126 VAL B CG2 1 
ATOM   703 N N   . SER B 1 39 ? 37.818 -1.098  39.388 1.00 15.23 ? 127 SER B N   1 
ATOM   704 C CA  . SER B 1 39 ? 39.244 -0.679  39.132 1.00 15.96 ? 127 SER B CA  1 
ATOM   705 C C   . SER B 1 39 ? 39.483 -0.449  37.704 1.00 17.30 ? 127 SER B C   1 
ATOM   706 O O   . SER B 1 39 ? 40.145 0.571   37.329 1.00 17.96 ? 127 SER B O   1 
ATOM   707 C CB  . SER B 1 39 ? 40.161 -1.776  39.593 1.00 19.08 ? 127 SER B CB  1 
ATOM   708 O OG  . SER B 1 39 ? 40.118 -1.857  41.024 1.00 23.71 ? 127 SER B OG  1 
ATOM   709 N N   . TYR B 1 40 ? 38.994 -1.296  36.805 1.00 13.67 ? 128 TYR B N   1 
ATOM   710 C CA  . TYR B 1 40 ? 39.201 -1.043  35.397 1.00 13.67 ? 128 TYR B CA  1 
ATOM   711 C C   . TYR B 1 40 ? 38.684 0.287   34.953 1.00 15.59 ? 128 TYR B C   1 
ATOM   712 O O   . TYR B 1 40 ? 39.360 1.050   34.214 1.00 16.62 ? 128 TYR B O   1 
ATOM   713 C CB  . TYR B 1 40 ? 38.512 -2.199  34.570 1.00 15.11 ? 128 TYR B CB  1 
ATOM   714 C CG  . TYR B 1 40 ? 38.681 -2.041  33.045 1.00 11.94 ? 128 TYR B CG  1 
ATOM   715 C CD1 . TYR B 1 40 ? 39.678 -2.853  32.443 1.00 14.05 ? 128 TYR B CD1 1 
ATOM   716 C CD2 . TYR B 1 40 ? 37.935 -1.198  32.322 1.00 15.20 ? 128 TYR B CD2 1 
ATOM   717 C CE1 . TYR B 1 40 ? 39.855 -2.680  30.997 1.00 16.67 ? 128 TYR B CE1 1 
ATOM   718 C CE2 . TYR B 1 40 ? 38.129 -1.035  30.950 1.00 16.52 ? 128 TYR B CE2 1 
ATOM   719 C CZ  . TYR B 1 40 ? 39.059 -1.818  30.378 1.00 17.29 ? 128 TYR B CZ  1 
ATOM   720 O OH  . TYR B 1 40 ? 39.225 -1.636  28.971 1.00 24.02 ? 128 TYR B OH  1 
ATOM   721 N N   . VAL B 1 41 ? 37.438 0.638   35.348 1.00 14.81 ? 129 VAL B N   1 
ATOM   722 C CA  . VAL B 1 41 ? 36.879 1.869   34.916 1.00 15.88 ? 129 VAL B CA  1 
ATOM   723 C C   . VAL B 1 41 ? 37.608 3.054   35.589 1.00 18.24 ? 129 VAL B C   1 
ATOM   724 O O   . VAL B 1 41 ? 37.853 4.091   34.869 1.00 19.67 ? 129 VAL B O   1 
ATOM   725 C CB  . VAL B 1 41 ? 35.352 1.866   35.251 1.00 17.19 ? 129 VAL B CB  1 
ATOM   726 C CG1 . VAL B 1 41 ? 34.730 3.185   35.036 1.00 20.85 ? 129 VAL B CG1 1 
ATOM   727 C CG2 . VAL B 1 41 ? 34.684 0.834   34.392 1.00 18.17 ? 129 VAL B CG2 1 
ATOM   728 N N   . THR B 1 42 ? 37.975 2.947   36.869 1.00 17.15 ? 130 THR B N   1 
ATOM   729 C CA  . THR B 1 42 ? 38.714 4.036   37.581 1.00 19.85 ? 130 THR B CA  1 
ATOM   730 C C   . THR B 1 42 ? 39.983 4.368   36.926 1.00 21.29 ? 130 THR B C   1 
ATOM   731 O O   . THR B 1 42 ? 40.293 5.581   36.790 1.00 24.06 ? 130 THR B O   1 
ATOM   732 C CB  . THR B 1 42 ? 38.972 3.607   39.003 1.00 22.62 ? 130 THR B CB  1 
ATOM   733 O OG1 . THR B 1 42 ? 37.696 3.536   39.603 1.00 25.59 ? 130 THR B OG1 1 
ATOM   734 C CG2 . THR B 1 42 ? 39.879 4.682   39.757 1.00 26.18 ? 130 THR B CG2 1 
ATOM   735 N N   . VAL B 1 43 ? 40.697 3.352   36.459 1.00 19.63 ? 131 VAL B N   1 
ATOM   736 C CA  . VAL B 1 43 ? 42.003 3.525   35.766 1.00 19.19 ? 131 VAL B CA  1 
ATOM   737 C C   . VAL B 1 43 ? 41.848 3.991   34.358 1.00 21.97 ? 131 VAL B C   1 
ATOM   738 O O   . VAL B 1 43 ? 42.639 4.863   33.918 1.00 23.51 ? 131 VAL B O   1 
ATOM   739 C CB  . VAL B 1 43 ? 42.771 2.224   35.751 1.00 21.88 ? 131 VAL B CB  1 
ATOM   740 C CG1 . VAL B 1 43 ? 43.887 2.227   34.793 1.00 24.56 ? 131 VAL B CG1 1 
ATOM   741 C CG2 . VAL B 1 43 ? 43.240 1.947   37.170 1.00 19.42 ? 131 VAL B CG2 1 
ATOM   742 N N   . ASN B 1 44 ? 40.912 3.433   33.603 1.00 19.21 ? 132 ASN B N   1 
ATOM   743 C CA  . ASN B 1 44 ? 40.845 3.632   32.159 1.00 20.37 ? 132 ASN B CA  1 
ATOM   744 C C   . ASN B 1 44 ? 39.917 4.769   31.747 1.00 22.83 ? 132 ASN B C   1 
ATOM   745 O O   . ASN B 1 44 ? 40.036 5.248   30.620 1.00 27.29 ? 132 ASN B O   1 
ATOM   746 C CB  . ASN B 1 44 ? 40.510 2.310   31.460 1.00 19.13 ? 132 ASN B CB  1 
ATOM   747 C CG  . ASN B 1 44 ? 41.631 1.306   31.580 1.00 20.54 ? 132 ASN B CG  1 
ATOM   748 O OD1 . ASN B 1 44 ? 41.435 0.117   31.910 1.00 19.32 ? 132 ASN B OD1 1 
ATOM   749 N ND2 . ASN B 1 44 ? 42.850 1.736   31.307 1.00 17.50 ? 132 ASN B ND2 1 
ATOM   750 N N   . PHE B 1 45 ? 39.042 5.239   32.636 1.00 24.37 ? 133 PHE B N   1 
ATOM   751 C CA  . PHE B 1 45 ? 38.136 6.370   32.332 1.00 26.38 ? 133 PHE B CA  1 
ATOM   752 C C   . PHE B 1 45 ? 38.267 7.432   33.437 1.00 27.97 ? 133 PHE B C   1 
ATOM   753 O O   . PHE B 1 45 ? 39.423 7.847   33.746 1.00 33.69 ? 133 PHE B O   1 
ATOM   754 C CB  . PHE B 1 45 ? 36.664 5.913   32.349 1.00 26.96 ? 133 PHE B CB  1 
ATOM   755 C CG  . PHE B 1 45 ? 36.290 4.919   31.307 1.00 30.15 ? 133 PHE B CG  1 
ATOM   756 C CD1 . PHE B 1 45 ? 36.489 3.570   31.488 1.00 28.06 ? 133 PHE B CD1 1 
ATOM   757 C CD2 . PHE B 1 45 ? 35.583 5.338   30.188 1.00 34.11 ? 133 PHE B CD2 1 
ATOM   758 C CE1 . PHE B 1 45 ? 36.066 2.636   30.560 1.00 27.56 ? 133 PHE B CE1 1 
ATOM   759 C CE2 . PHE B 1 45 ? 35.130 4.389   29.201 1.00 38.58 ? 133 PHE B CE2 1 
ATOM   760 C CZ  . PHE B 1 45 ? 35.376 3.008   29.428 1.00 35.91 ? 133 PHE B CZ  1 
HETATM 761 O O   . HOH C 2 .  ? 26.714 -19.710 29.918 1.00 28.98 ? 2   HOH A O   1 
HETATM 762 O O   . HOH C 2 .  ? 26.637 10.806  37.714 1.00 32.25 ? 3   HOH A O   1 
HETATM 763 O O   . HOH C 2 .  ? 22.983 -2.037  45.612 1.00 31.32 ? 6   HOH A O   1 
HETATM 764 O O   . HOH C 2 .  ? 34.463 10.199  30.241 1.00 54.07 ? 10  HOH A O   1 
HETATM 765 O O   . HOH C 2 .  ? 26.609 -3.972  25.307 1.00 42.35 ? 12  HOH A O   1 
HETATM 766 O O   . HOH C 2 .  ? 17.607 -14.382 31.075 1.00 49.20 ? 13  HOH A O   1 
HETATM 767 O O   . HOH C 2 .  ? 17.877 -9.144  24.931 1.00 39.38 ? 14  HOH A O   1 
HETATM 768 O O   . HOH C 2 .  ? 26.435 -6.703  25.301 1.00 39.84 ? 16  HOH A O   1 
HETATM 769 O O   . HOH C 2 .  ? 14.147 -16.650 39.195 1.00 49.35 ? 18  HOH A O   1 
HETATM 770 O O   . HOH C 2 .  ? 28.137 -7.905  45.129 1.00 40.66 ? 19  HOH A O   1 
HETATM 771 O O   . HOH C 2 .  ? 19.631 -5.527  28.470 1.00 39.14 ? 21  HOH A O   1 
HETATM 772 O O   . HOH C 2 .  ? 29.965 6.493   39.811 1.00 19.46 ? 22  HOH A O   1 
HETATM 773 O O   . HOH C 2 .  ? 30.216 7.321   44.448 1.00 19.82 ? 23  HOH A O   1 
HETATM 774 O O   . HOH C 2 .  ? 25.445 -8.609  44.746 1.00 32.27 ? 26  HOH A O   1 
HETATM 775 O O   . HOH C 2 .  ? 27.721 -1.294  48.655 1.00 42.54 ? 28  HOH A O   1 
HETATM 776 O O   . HOH C 2 .  ? 30.589 -5.129  46.284 1.00 38.40 ? 29  HOH A O   1 
HETATM 777 O O   . HOH C 2 .  ? 32.877 6.547   46.693 1.00 30.09 ? 30  HOH A O   1 
HETATM 778 O O   . HOH C 2 .  ? 34.323 0.584   44.896 1.00 33.77 ? 31  HOH A O   1 
HETATM 779 O O   . HOH C 2 .  ? 23.036 -19.633 34.117 1.00 33.81 ? 32  HOH A O   1 
HETATM 780 O O   . HOH C 2 .  ? 20.836 -1.453  44.703 1.00 34.78 ? 35  HOH A O   1 
HETATM 781 O O   . HOH C 2 .  ? 17.205 -16.083 44.087 1.00 47.93 ? 37  HOH A O   1 
HETATM 782 O O   . HOH C 2 .  ? 29.598 -20.353 24.164 1.00 46.58 ? 38  HOH A O   1 
HETATM 783 O O   . HOH C 2 .  ? 24.772 -2.631  47.784 0.50 34.41 ? 39  HOH A O   1 
HETATM 784 O O   . HOH C 2 .  ? 28.969 9.068   39.724 1.00 41.25 ? 42  HOH A O   1 
HETATM 785 O O   . HOH C 2 .  ? 23.296 -7.340  24.348 1.00 51.91 ? 44  HOH A O   1 
HETATM 786 O O   . HOH C 2 .  ? 23.242 3.675   26.682 1.00 42.76 ? 45  HOH A O   1 
HETATM 787 O O   . HOH C 2 .  ? 16.998 -12.342 30.977 1.00 47.64 ? 46  HOH A O   1 
HETATM 788 O O   . HOH C 2 .  ? 13.912 -19.468 31.516 1.00 43.83 ? 47  HOH A O   1 
HETATM 789 O O   . HOH C 2 .  ? 32.518 6.935   29.207 1.00 44.11 ? 48  HOH A O   1 
HETATM 790 O O   . HOH C 2 .  ? 15.454 -13.901 46.576 1.00 36.73 ? 49  HOH A O   1 
HETATM 791 O O   . HOH C 2 .  ? 34.441 0.947   49.853 1.00 36.52 ? 51  HOH A O   1 
HETATM 792 O O   . HOH D 2 .  ? 35.077 -8.950  22.663 1.00 26.36 ? 1   HOH B O   1 
HETATM 793 O O   . HOH D 2 .  ? 30.995 -8.671  21.299 1.00 31.62 ? 4   HOH B O   1 
HETATM 794 O O   . HOH D 2 .  ? 38.601 -8.296  35.593 1.00 32.28 ? 5   HOH B O   1 
HETATM 795 O O   . HOH D 2 .  ? 38.193 7.686   36.516 1.00 43.41 ? 7   HOH B O   1 
HETATM 796 O O   . HOH D 2 .  ? 39.847 -4.812  26.337 1.00 33.47 ? 8   HOH B O   1 
HETATM 797 O O   . HOH D 2 .  ? 29.024 -10.920 45.854 1.00 45.93 ? 9   HOH B O   1 
HETATM 798 O O   . HOH D 2 .  ? 29.893 -23.641 40.251 1.00 56.42 ? 11  HOH B O   1 
HETATM 799 O O   . HOH D 2 .  ? 35.991 -12.440 37.749 1.00 47.23 ? 15  HOH B O   1 
HETATM 800 O O   . HOH D 2 .  ? 31.355 -0.031  25.742 1.00 35.83 ? 17  HOH B O   1 
HETATM 801 O O   . HOH D 2 .  ? 39.084 -17.200 26.456 1.00 46.82 ? 20  HOH B O   1 
HETATM 802 O O   . HOH D 2 .  ? 26.932 -20.654 40.420 1.00 28.31 ? 24  HOH B O   1 
HETATM 803 O O   . HOH D 2 .  ? 40.663 -4.506  37.064 1.00 27.38 ? 25  HOH B O   1 
HETATM 804 O O   . HOH D 2 .  ? 25.456 -18.019 43.133 1.00 35.80 ? 27  HOH B O   1 
HETATM 805 O O   . HOH D 2 .  ? 39.144 -16.404 32.011 1.00 47.13 ? 33  HOH B O   1 
HETATM 806 O O   . HOH D 2 .  ? 38.719 10.537  34.407 1.00 39.22 ? 34  HOH B O   1 
HETATM 807 O O   . HOH D 2 .  ? 24.146 -20.381 40.853 1.00 36.52 ? 36  HOH B O   1 
HETATM 808 O O   . HOH D 2 .  ? 42.035 -5.235  38.994 1.00 41.55 ? 40  HOH B O   1 
HETATM 809 O O   . HOH D 2 .  ? 45.026 5.992   35.167 1.00 41.05 ? 41  HOH B O   1 
HETATM 810 O O   . HOH D 2 .  ? 41.059 -3.402  28.101 1.00 41.79 ? 43  HOH B O   1 
HETATM 811 O O   . HOH D 2 .  ? 35.873 -29.015 40.927 1.00 48.02 ? 50  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  89  ?   ?   ?   A . n 
A 1 2  ASN 2  90  90  ASN ASN A . n 
A 1 3  LEU 3  91  91  LEU LEU A . n 
A 1 4  LEU 4  92  92  LEU LEU A . n 
A 1 5  PHE 5  93  93  PHE PHE A . n 
A 1 6  GLN 6  94  94  GLN GLN A . n 
A 1 7  SER 7  95  95  SER SER A . n 
A 1 8  TYR 8  96  96  TYR TYR A . n 
A 1 9  LEU 9  97  97  LEU LEU A . n 
A 1 10 ASP 10 98  98  ASP ASP A . n 
A 1 11 ASN 11 99  99  ASN ASN A . n 
A 1 12 VAL 12 100 100 VAL VAL A . n 
A 1 13 GLY 13 101 101 GLY GLY A . n 
A 1 14 VAL 14 102 102 VAL VAL A . n 
A 1 15 GLN 15 103 103 GLN GLN A . n 
A 1 16 ILE 16 104 104 ILE ILE A . n 
A 1 17 VAL 17 105 105 VAL VAL A . n 
A 1 18 ARG 18 106 106 ARG ARG A . n 
A 1 19 GLN 19 107 107 GLN GLN A . n 
A 1 20 MET 20 108 108 MET MET A . n 
A 1 21 ARG 21 109 109 ARG ARG A . n 
A 1 22 SER 22 110 110 SER SER A . n 
A 1 23 GLY 23 111 111 GLY GLY A . n 
A 1 24 GLU 24 112 112 GLU GLU A . n 
A 1 25 ARG 25 113 113 ARG ARG A . n 
A 1 26 PHE 26 114 114 PHE PHE A . n 
A 1 27 LEU 27 115 115 LEU LEU A . n 
A 1 28 LYS 28 116 116 LYS LYS A . n 
A 1 29 ILE 29 117 117 ILE ILE A . n 
A 1 30 TRP 30 118 118 TRP TRP A . n 
A 1 31 SER 31 119 119 SER SER A . n 
A 1 32 GLN 32 120 120 GLN GLN A . n 
A 1 33 THR 33 121 121 THR THR A . n 
A 1 34 VAL 34 122 122 VAL VAL A . n 
A 1 35 GLU 35 123 123 GLU GLU A . n 
A 1 36 GLU 36 124 124 GLU GLU A . n 
A 1 37 ILE 37 125 125 ILE ILE A . n 
A 1 38 VAL 38 126 126 VAL VAL A . n 
A 1 39 SER 39 127 127 SER SER A . n 
A 1 40 TYR 40 128 128 TYR TYR A . n 
A 1 41 VAL 41 129 129 VAL VAL A . n 
A 1 42 THR 42 130 130 THR THR A . n 
A 1 43 VAL 43 131 131 VAL VAL A . n 
A 1 44 ASN 44 132 132 ASN ASN A . n 
A 1 45 PHE 45 133 133 PHE PHE A . n 
B 1 1  MET 1  89  89  MET MET B . n 
B 1 2  ASN 2  90  90  ASN ASN B . n 
B 1 3  LEU 3  91  91  LEU LEU B . n 
B 1 4  LEU 4  92  92  LEU LEU B . n 
B 1 5  PHE 5  93  93  PHE PHE B . n 
B 1 6  GLN 6  94  94  GLN GLN B . n 
B 1 7  SER 7  95  95  SER SER B . n 
B 1 8  TYR 8  96  96  TYR TYR B . n 
B 1 9  LEU 9  97  97  LEU LEU B . n 
B 1 10 ASP 10 98  98  ASP ASP B . n 
B 1 11 ASN 11 99  99  ASN ASN B . n 
B 1 12 VAL 12 100 100 VAL VAL B . n 
B 1 13 GLY 13 101 101 GLY GLY B . n 
B 1 14 VAL 14 102 102 VAL VAL B . n 
B 1 15 GLN 15 103 103 GLN GLN B . n 
B 1 16 ILE 16 104 104 ILE ILE B . n 
B 1 17 VAL 17 105 105 VAL VAL B . n 
B 1 18 ARG 18 106 106 ARG ARG B . n 
B 1 19 GLN 19 107 107 GLN GLN B . n 
B 1 20 MET 20 108 108 MET MET B . n 
B 1 21 ARG 21 109 109 ARG ARG B . n 
B 1 22 SER 22 110 110 SER SER B . n 
B 1 23 GLY 23 111 111 GLY GLY B . n 
B 1 24 GLU 24 112 112 GLU GLU B . n 
B 1 25 ARG 25 113 113 ARG ARG B . n 
B 1 26 PHE 26 114 114 PHE PHE B . n 
B 1 27 LEU 27 115 115 LEU LEU B . n 
B 1 28 LYS 28 116 116 LYS LYS B . n 
B 1 29 ILE 29 117 117 ILE ILE B . n 
B 1 30 TRP 30 118 118 TRP TRP B . n 
B 1 31 SER 31 119 119 SER SER B . n 
B 1 32 GLN 32 120 120 GLN GLN B . n 
B 1 33 THR 33 121 121 THR THR B . n 
B 1 34 VAL 34 122 122 VAL VAL B . n 
B 1 35 GLU 35 123 123 GLU GLU B . n 
B 1 36 GLU 36 124 124 GLU GLU B . n 
B 1 37 ILE 37 125 125 ILE ILE B . n 
B 1 38 VAL 38 126 126 VAL VAL B . n 
B 1 39 SER 39 127 127 SER SER B . n 
B 1 40 TYR 40 128 128 TYR TYR B . n 
B 1 41 VAL 41 129 129 VAL VAL B . n 
B 1 42 THR 42 130 130 THR THR B . n 
B 1 43 VAL 43 131 131 VAL VAL B . n 
B 1 44 ASN 44 132 132 ASN ASN B . n 
B 1 45 PHE 45 133 133 PHE PHE B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1570 ? 
1 MORE         -21  ? 
1 'SSA (A^2)'  5670 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-16 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 REFMAC      5.5.0102 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
2 PDB_EXTRACT 3.005    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 XSCALE      .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    13 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    46 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A TYR 96  ? ? CG  A TYR 96  ? ? CD2 A TYR 96  ? ? 117.31 121.00 -3.69 0.60 N 
2 1 CB A ASP 98  ? ? CG  A ASP 98  ? ? OD2 A ASP 98  ? ? 110.11 118.30 -8.19 0.90 N 
3 1 CG B MET 89  ? ? SD  B MET 89  ? ? CE  B MET 89  ? ? 110.78 100.20 10.58 1.60 N 
4 1 CB B ASP 98  ? ? CG  B ASP 98  ? ? OD2 B ASP 98  ? ? 112.07 118.30 -6.23 0.90 N 
5 1 NE B ARG 109 ? ? CZ  B ARG 109 ? ? NH1 B ARG 109 ? ? 125.21 120.30 4.91  0.50 N 
6 1 NE B ARG 109 ? ? CZ  B ARG 109 ? ? NH2 B ARG 109 ? ? 116.41 120.30 -3.89 0.50 N 
7 1 CB B TYR 128 ? ? CG  B TYR 128 ? ? CD1 B TYR 128 ? ? 115.95 121.00 -5.05 0.60 N 
8 1 CG B TYR 128 ? ? CD1 B TYR 128 ? ? CE1 B TYR 128 ? ? 115.80 121.30 -5.50 0.80 N 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      89 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  2  2  HOH HOH A . 
C 2 HOH 2  3  3  HOH HOH A . 
C 2 HOH 3  6  6  HOH HOH A . 
C 2 HOH 4  10 10 HOH HOH A . 
C 2 HOH 5  12 12 HOH HOH A . 
C 2 HOH 6  13 13 HOH HOH A . 
C 2 HOH 7  14 14 HOH HOH A . 
C 2 HOH 8  16 16 HOH HOH A . 
C 2 HOH 9  18 18 HOH HOH A . 
C 2 HOH 10 19 19 HOH HOH A . 
C 2 HOH 11 21 21 HOH HOH A . 
C 2 HOH 12 22 22 HOH HOH A . 
C 2 HOH 13 23 23 HOH HOH A . 
C 2 HOH 14 26 26 HOH HOH A . 
C 2 HOH 15 28 28 HOH HOH A . 
C 2 HOH 16 29 29 HOH HOH A . 
C 2 HOH 17 30 30 HOH HOH A . 
C 2 HOH 18 31 31 HOH HOH A . 
C 2 HOH 19 32 32 HOH HOH A . 
C 2 HOH 20 35 35 HOH HOH A . 
C 2 HOH 21 37 37 HOH HOH A . 
C 2 HOH 22 38 38 HOH HOH A . 
C 2 HOH 23 39 39 HOH HOH A . 
C 2 HOH 24 42 42 HOH HOH A . 
C 2 HOH 25 44 44 HOH HOH A . 
C 2 HOH 26 45 45 HOH HOH A . 
C 2 HOH 27 46 46 HOH HOH A . 
C 2 HOH 28 47 47 HOH HOH A . 
C 2 HOH 29 48 48 HOH HOH A . 
C 2 HOH 30 49 49 HOH HOH A . 
C 2 HOH 31 51 51 HOH HOH A . 
D 2 HOH 1  1  1  HOH HOH B . 
D 2 HOH 2  4  4  HOH HOH B . 
D 2 HOH 3  5  5  HOH HOH B . 
D 2 HOH 4  7  7  HOH HOH B . 
D 2 HOH 5  8  8  HOH HOH B . 
D 2 HOH 6  9  9  HOH HOH B . 
D 2 HOH 7  11 11 HOH HOH B . 
D 2 HOH 8  15 15 HOH HOH B . 
D 2 HOH 9  17 17 HOH HOH B . 
D 2 HOH 10 20 20 HOH HOH B . 
D 2 HOH 11 24 24 HOH HOH B . 
D 2 HOH 12 25 25 HOH HOH B . 
D 2 HOH 13 27 27 HOH HOH B . 
D 2 HOH 14 33 33 HOH HOH B . 
D 2 HOH 15 34 34 HOH HOH B . 
D 2 HOH 16 36 36 HOH HOH B . 
D 2 HOH 17 40 40 HOH HOH B . 
D 2 HOH 18 41 41 HOH HOH B . 
D 2 HOH 19 43 43 HOH HOH B . 
D 2 HOH 20 50 50 HOH HOH B . 
#