data_3L73
# 
_entry.id   3L73 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3L73         
RCSB  RCSB056915   
WWPDB D_1000056915 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3L70 . unspecified 
PDB 3L71 . unspecified 
PDB 3L72 . unspecified 
PDB 3L74 . unspecified 
PDB 3L75 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3L73 
_pdbx_database_status.recvd_initial_deposition_date   2009-12-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, L.'   1 
'Berry, E.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Huang, L.'   1 ? 
primary 'Berry, E.A.' 2 ? 
# 
_cell.entry_id           3L73 
_cell.length_a           171.499 
_cell.length_b           182.934 
_cell.length_c           241.028 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3L73 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I'                                  
49503.840 2  1.10.2.2 ? ?                     ? 
2  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2'                                  
46683.809 2  1.10.2.2 ? ?                     ? 
3  polymer     nat 'CYTOCHROME B'                                                                                           
42622.977 2  1.10.2.2 ? ?                     ? 
4  polymer     nat 'MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN'                                                              
26973.744 2  1.10.2.2 ? ?                     ? 
5  polymer     nat 'CYTOCHROME B-C1 COMPLEX SUBUNIT 5, RIESKE IRONSULFUR PROTEIN, MITOCHONDRIAL'                            
21506.188 2  1.10.2.2 ? 'UNP RESIDUES 77-272' ? 
6  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14 KDA PROTEIN'                                          
13394.397 2  1.10.2.2 ? ?                     ? 
7  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE UBIQUINONE-BINDING PROTEIN QP-C'                         
9498.735  2  1.10.2.2 ? ?                     ? 
8  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11 KDA PROTEIN, COMPLEX III SUBUNIT VIII'                
9057.119  2  1.10.2.2 ? ?                     ? 
9  polymer     nat 'CYTOCHROME B-C1 COMPLEX SUBUNIT RIESKE, MITOCHONDRIAL'                                                  
4785.649  2  1.10.2.2 ? 'UNP RESIDUES 45-76'  ? 
10 polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 7.2 KDA PROTEIN'                                         
7005.963  2  1.10.2.2 ? ?                     ? 
11 non-polymer syn 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine                                                            
749.073   6  ?        ? ?                     ? 
12 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                                                        
616.487   4  ?        ? ?                     ? 
13 non-polymer syn '4-[7-(3,3-dimethylbut-1-yn-1-yl)naphthalen-1-yl]-5-methoxy-2-methyl-2,4-dihydro-3H-1,2,4-triazol-3-one' 
335.400   2  ?        ? ?                     ? 
14 non-polymer syn 'Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer'                                                       
863.343   2  ?        ? ?                     ? 
15 non-polymer syn GLYCEROL                                                                                                 92.094 
2  ?        ? ?                     ? 
16 non-polymer syn 'HEME C'                                                                                                 
618.503   2  ?        ? ?                     ? 
17 non-polymer syn CARDIOLIPIN                                                                                              
1464.043  4  ?        ? ?                     ? 
18 non-polymer man 'octyl beta-D-glucopyranoside'                                                                           
292.369   5  ?        ? ?                     ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                                                                             
175.820   2  ?        ? ?                     ? 
20 water       nat water                                                                                                    18.015 
19 ?        ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 
;UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CYTOCHROME B SUBUNIT, CYTOCHROME B-C1 COMPLEX SUBUNIT 3, COMPLEX III SUBUNIT 3, COMPLEX III SUBUNIT III
;
5 'UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, RIESKE IRON-SULFUR PROTEIN, RISP, COMPLEX III SUBUNIT 5' 
9 'UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, RIESKE IRON-SULFUR PROTEIN, RISP, COMPLEX III SUBUNIT 5' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
A,N ? 
2  'polypeptide(L)' no no 
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
B,O ? 
3  'polypeptide(L)' no no 
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
C,P ? 
4  'polypeptide(L)' no no 
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
D,Q ? 
5  'polypeptide(L)' no no 
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
E,R ? 
6  'polypeptide(L)' no no 
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
F,S ? 
7  'polypeptide(L)' no no 
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
G,T ? 
8  'polypeptide(L)' no no LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK 
LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK H,U ? 
9  'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)RPLLC
RESMSGRSARRDLVAGISLNAPASVRY
;
XXXXXXXXXXXXXXXRPLLCRESMSGRSARRDLVAGISLNAPASVRY I,V ? 
10 'polypeptide(L)' no no ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE 
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE J,W ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   ALA n 
1  2   ALA n 
1  3   THR n 
1  4   TYR n 
1  5   ALA n 
1  6   GLN n 
1  7   THR n 
1  8   LEU n 
1  9   GLN n 
1  10  ASN n 
1  11  ILE n 
1  12  PRO n 
1  13  GLU n 
1  14  THR n 
1  15  ASN n 
1  16  VAL n 
1  17  THR n 
1  18  THR n 
1  19  LEU n 
1  20  ASP n 
1  21  ASN n 
1  22  GLY n 
1  23  LEU n 
1  24  ARG n 
1  25  VAL n 
1  26  ALA n 
1  27  SER n 
1  28  GLU n 
1  29  GLU n 
1  30  SER n 
1  31  SER n 
1  32  GLN n 
1  33  PRO n 
1  34  THR n 
1  35  CYS n 
1  36  THR n 
1  37  VAL n 
1  38  GLY n 
1  39  VAL n 
1  40  TRP n 
1  41  ILE n 
1  42  GLY n 
1  43  ALA n 
1  44  GLY n 
1  45  SER n 
1  46  ARG n 
1  47  TYR n 
1  48  GLU n 
1  49  ASN n 
1  50  GLU n 
1  51  LYS n 
1  52  ASN n 
1  53  ASN n 
1  54  GLY n 
1  55  ALA n 
1  56  GLY n 
1  57  TYR n 
1  58  PHE n 
1  59  VAL n 
1  60  GLU n 
1  61  HIS n 
1  62  LEU n 
1  63  ALA n 
1  64  PHE n 
1  65  LYS n 
1  66  GLY n 
1  67  THR n 
1  68  LYS n 
1  69  LYS n 
1  70  ARG n 
1  71  PRO n 
1  72  CYS n 
1  73  ALA n 
1  74  ALA n 
1  75  PHE n 
1  76  GLU n 
1  77  LYS n 
1  78  GLU n 
1  79  VAL n 
1  80  GLU n 
1  81  SER n 
1  82  MET n 
1  83  GLY n 
1  84  ALA n 
1  85  HIS n 
1  86  PHE n 
1  87  ASN n 
1  88  GLY n 
1  89  TYR n 
1  90  THR n 
1  91  SER n 
1  92  ARG n 
1  93  GLU n 
1  94  GLN n 
1  95  THR n 
1  96  ALA n 
1  97  PHE n 
1  98  TYR n 
1  99  ILE n 
1  100 LYS n 
1  101 ALA n 
1  102 LEU n 
1  103 SER n 
1  104 LYS n 
1  105 ASP n 
1  106 MET n 
1  107 PRO n 
1  108 LYS n 
1  109 VAL n 
1  110 VAL n 
1  111 GLU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 ASP n 
1  116 VAL n 
1  117 VAL n 
1  118 GLN n 
1  119 ASN n 
1  120 CYS n 
1  121 ALA n 
1  122 LEU n 
1  123 GLU n 
1  124 GLU n 
1  125 SER n 
1  126 GLN n 
1  127 ILE n 
1  128 GLU n 
1  129 LYS n 
1  130 GLU n 
1  131 ARG n 
1  132 GLY n 
1  133 VAL n 
1  134 ILE n 
1  135 LEU n 
1  136 GLN n 
1  137 GLU n 
1  138 LEU n 
1  139 LYS n 
1  140 GLU n 
1  141 MET n 
1  142 ASP n 
1  143 ASN n 
1  144 ASP n 
1  145 MET n 
1  146 THR n 
1  147 ASN n 
1  148 VAL n 
1  149 THR n 
1  150 PHE n 
1  151 ASP n 
1  152 TYR n 
1  153 LEU n 
1  154 HIS n 
1  155 ALA n 
1  156 THR n 
1  157 ALA n 
1  158 PHE n 
1  159 GLN n 
1  160 GLY n 
1  161 THR n 
1  162 ALA n 
1  163 LEU n 
1  164 ALA n 
1  165 ARG n 
1  166 THR n 
1  167 VAL n 
1  168 GLU n 
1  169 GLY n 
1  170 THR n 
1  171 THR n 
1  172 GLU n 
1  173 ASN n 
1  174 ILE n 
1  175 LYS n 
1  176 HIS n 
1  177 LEU n 
1  178 THR n 
1  179 ARG n 
1  180 ALA n 
1  181 ASP n 
1  182 LEU n 
1  183 ALA n 
1  184 SER n 
1  185 TYR n 
1  186 ILE n 
1  187 ASP n 
1  188 THR n 
1  189 HIS n 
1  190 PHE n 
1  191 LYS n 
1  192 ALA n 
1  193 PRO n 
1  194 ARG n 
1  195 MET n 
1  196 VAL n 
1  197 LEU n 
1  198 ALA n 
1  199 ALA n 
1  200 ALA n 
1  201 GLY n 
1  202 GLY n 
1  203 ILE n 
1  204 SER n 
1  205 HIS n 
1  206 LYS n 
1  207 GLU n 
1  208 LEU n 
1  209 VAL n 
1  210 ASP n 
1  211 ALA n 
1  212 ALA n 
1  213 ARG n 
1  214 GLN n 
1  215 HIS n 
1  216 PHE n 
1  217 SER n 
1  218 GLY n 
1  219 VAL n 
1  220 SER n 
1  221 PHE n 
1  222 THR n 
1  223 TYR n 
1  224 LYS n 
1  225 GLU n 
1  226 ASP n 
1  227 ALA n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 LEU n 
1  232 PRO n 
1  233 ARG n 
1  234 CYS n 
1  235 ARG n 
1  236 PHE n 
1  237 THR n 
1  238 GLY n 
1  239 SER n 
1  240 GLU n 
1  241 ILE n 
1  242 ARG n 
1  243 ALA n 
1  244 ARG n 
1  245 ASP n 
1  246 ASP n 
1  247 ALA n 
1  248 LEU n 
1  249 PRO n 
1  250 VAL n 
1  251 ALA n 
1  252 HIS n 
1  253 VAL n 
1  254 ALA n 
1  255 LEU n 
1  256 ALA n 
1  257 VAL n 
1  258 GLU n 
1  259 GLY n 
1  260 PRO n 
1  261 GLY n 
1  262 TRP n 
1  263 ALA n 
1  264 ASP n 
1  265 PRO n 
1  266 ASP n 
1  267 ASN n 
1  268 VAL n 
1  269 VAL n 
1  270 LEU n 
1  271 HIS n 
1  272 VAL n 
1  273 ALA n 
1  274 ASN n 
1  275 ALA n 
1  276 ILE n 
1  277 ILE n 
1  278 GLY n 
1  279 ARG n 
1  280 TYR n 
1  281 ASP n 
1  282 ARG n 
1  283 THR n 
1  284 PHE n 
1  285 GLY n 
1  286 GLY n 
1  287 GLY n 
1  288 LYS n 
1  289 HIS n 
1  290 LEU n 
1  291 SER n 
1  292 SER n 
1  293 ARG n 
1  294 LEU n 
1  295 ALA n 
1  296 ALA n 
1  297 LEU n 
1  298 ALA n 
1  299 VAL n 
1  300 GLU n 
1  301 HIS n 
1  302 LYS n 
1  303 LEU n 
1  304 CYS n 
1  305 HIS n 
1  306 SER n 
1  307 PHE n 
1  308 GLN n 
1  309 THR n 
1  310 PHE n 
1  311 ASN n 
1  312 THR n 
1  313 SER n 
1  314 TYR n 
1  315 SER n 
1  316 ASP n 
1  317 THR n 
1  318 GLY n 
1  319 LEU n 
1  320 PHE n 
1  321 GLY n 
1  322 PHE n 
1  323 HIS n 
1  324 PHE n 
1  325 VAL n 
1  326 ALA n 
1  327 ASP n 
1  328 PRO n 
1  329 LEU n 
1  330 SER n 
1  331 ILE n 
1  332 ASP n 
1  333 ASP n 
1  334 MET n 
1  335 MET n 
1  336 PHE n 
1  337 CYS n 
1  338 ALA n 
1  339 GLN n 
1  340 GLY n 
1  341 GLU n 
1  342 TRP n 
1  343 MET n 
1  344 ARG n 
1  345 LEU n 
1  346 CYS n 
1  347 THR n 
1  348 SER n 
1  349 THR n 
1  350 THR n 
1  351 GLU n 
1  352 SER n 
1  353 GLU n 
1  354 VAL n 
1  355 LYS n 
1  356 ARG n 
1  357 ALA n 
1  358 LYS n 
1  359 ASN n 
1  360 HIS n 
1  361 LEU n 
1  362 ARG n 
1  363 SER n 
1  364 ALA n 
1  365 MET n 
1  366 VAL n 
1  367 ALA n 
1  368 GLN n 
1  369 LEU n 
1  370 ASP n 
1  371 GLY n 
1  372 THR n 
1  373 THR n 
1  374 PRO n 
1  375 VAL n 
1  376 CYS n 
1  377 GLU n 
1  378 THR n 
1  379 ILE n 
1  380 GLY n 
1  381 SER n 
1  382 HIS n 
1  383 LEU n 
1  384 LEU n 
1  385 ASN n 
1  386 TYR n 
1  387 GLY n 
1  388 ARG n 
1  389 ARG n 
1  390 ILE n 
1  391 SER n 
1  392 LEU n 
1  393 GLU n 
1  394 GLU n 
1  395 TRP n 
1  396 ASP n 
1  397 SER n 
1  398 ARG n 
1  399 ILE n 
1  400 SER n 
1  401 ALA n 
1  402 VAL n 
1  403 ASP n 
1  404 ALA n 
1  405 ARG n 
1  406 MET n 
1  407 VAL n 
1  408 ARG n 
1  409 ASP n 
1  410 VAL n 
1  411 CYS n 
1  412 SER n 
1  413 LYS n 
1  414 TYR n 
1  415 ILE n 
1  416 TYR n 
1  417 ASP n 
1  418 LYS n 
1  419 CYS n 
1  420 PRO n 
1  421 ALA n 
1  422 LEU n 
1  423 ALA n 
1  424 ALA n 
1  425 VAL n 
1  426 GLY n 
1  427 PRO n 
1  428 ILE n 
1  429 GLU n 
1  430 GLN n 
1  431 LEU n 
1  432 LEU n 
1  433 ASP n 
1  434 TYR n 
1  435 ASN n 
1  436 ARG n 
1  437 ILE n 
1  438 ARG n 
1  439 SER n 
1  440 GLY n 
1  441 MET n 
1  442 TYR n 
1  443 TRP n 
1  444 ILE n 
1  445 ARG n 
1  446 PHE n 
2  1   SER n 
2  2   LEU n 
2  3   LYS n 
2  4   VAL n 
2  5   ALA n 
2  6   PRO n 
2  7   LYS n 
2  8   VAL n 
2  9   ALA n 
2  10  VAL n 
2  11  SER n 
2  12  ALA n 
2  13  ALA n 
2  14  ALA n 
2  15  GLU n 
2  16  ARG n 
2  17  VAL n 
2  18  LYS n 
2  19  LEU n 
2  20  CYS n 
2  21  PRO n 
2  22  GLY n 
2  23  ALA n 
2  24  GLU n 
2  25  ASP n 
2  26  LEU n 
2  27  GLU n 
2  28  ILE n 
2  29  THR n 
2  30  LYS n 
2  31  LEU n 
2  32  PRO n 
2  33  ASN n 
2  34  GLY n 
2  35  LEU n 
2  36  ILE n 
2  37  ILE n 
2  38  ALA n 
2  39  SER n 
2  40  LEU n 
2  41  GLU n 
2  42  ASN n 
2  43  PHE n 
2  44  SER n 
2  45  PRO n 
2  46  ALA n 
2  47  SER n 
2  48  ARG n 
2  49  ILE n 
2  50  GLY n 
2  51  VAL n 
2  52  PHE n 
2  53  ILE n 
2  54  LYS n 
2  55  ALA n 
2  56  GLY n 
2  57  SER n 
2  58  ARG n 
2  59  TYR n 
2  60  GLU n 
2  61  THR n 
2  62  THR n 
2  63  ALA n 
2  64  ASN n 
2  65  LEU n 
2  66  GLY n 
2  67  THR n 
2  68  ALA n 
2  69  HIS n 
2  70  LEU n 
2  71  LEU n 
2  72  ARG n 
2  73  LEU n 
2  74  ALA n 
2  75  SER n 
2  76  PRO n 
2  77  LEU n 
2  78  THR n 
2  79  THR n 
2  80  LYS n 
2  81  GLY n 
2  82  ALA n 
2  83  SER n 
2  84  SER n 
2  85  PHE n 
2  86  ARG n 
2  87  ILE n 
2  88  THR n 
2  89  ARG n 
2  90  GLY n 
2  91  ILE n 
2  92  GLU n 
2  93  ALA n 
2  94  VAL n 
2  95  GLY n 
2  96  GLY n 
2  97  SER n 
2  98  LEU n 
2  99  SER n 
2  100 VAL n 
2  101 TYR n 
2  102 SER n 
2  103 THR n 
2  104 ARG n 
2  105 GLU n 
2  106 LYS n 
2  107 MET n 
2  108 THR n 
2  109 TYR n 
2  110 CYS n 
2  111 VAL n 
2  112 GLU n 
2  113 CYS n 
2  114 LEU n 
2  115 ARG n 
2  116 ASP n 
2  117 HIS n 
2  118 VAL n 
2  119 ASP n 
2  120 THR n 
2  121 VAL n 
2  122 MET n 
2  123 GLU n 
2  124 TYR n 
2  125 LEU n 
2  126 LEU n 
2  127 ASN n 
2  128 VAL n 
2  129 THR n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 GLU n 
2  134 PHE n 
2  135 ARG n 
2  136 PRO n 
2  137 TRP n 
2  138 GLU n 
2  139 VAL n 
2  140 THR n 
2  141 ASP n 
2  142 LEU n 
2  143 GLN n 
2  144 PRO n 
2  145 GLN n 
2  146 LEU n 
2  147 LYS n 
2  148 VAL n 
2  149 ASP n 
2  150 LYS n 
2  151 ALA n 
2  152 VAL n 
2  153 ALA n 
2  154 PHE n 
2  155 GLN n 
2  156 SER n 
2  157 PRO n 
2  158 GLN n 
2  159 VAL n 
2  160 GLY n 
2  161 VAL n 
2  162 LEU n 
2  163 GLU n 
2  164 ASN n 
2  165 LEU n 
2  166 HIS n 
2  167 ALA n 
2  168 ALA n 
2  169 ALA n 
2  170 TYR n 
2  171 LYS n 
2  172 THR n 
2  173 ALA n 
2  174 LEU n 
2  175 ALA n 
2  176 ASN n 
2  177 PRO n 
2  178 LEU n 
2  179 TYR n 
2  180 CYS n 
2  181 PRO n 
2  182 ASP n 
2  183 TYR n 
2  184 ARG n 
2  185 ILE n 
2  186 GLY n 
2  187 LYS n 
2  188 ILE n 
2  189 THR n 
2  190 SER n 
2  191 GLU n 
2  192 GLN n 
2  193 LEU n 
2  194 HIS n 
2  195 HIS n 
2  196 PHE n 
2  197 VAL n 
2  198 GLN n 
2  199 ASN n 
2  200 ASN n 
2  201 PHE n 
2  202 THR n 
2  203 SER n 
2  204 ALA n 
2  205 ARG n 
2  206 MET n 
2  207 ALA n 
2  208 LEU n 
2  209 VAL n 
2  210 GLY n 
2  211 ILE n 
2  212 GLY n 
2  213 VAL n 
2  214 LYS n 
2  215 HIS n 
2  216 SER n 
2  217 ASP n 
2  218 LEU n 
2  219 LYS n 
2  220 GLN n 
2  221 VAL n 
2  222 ALA n 
2  223 GLU n 
2  224 GLN n 
2  225 PHE n 
2  226 LEU n 
2  227 ASN n 
2  228 ILE n 
2  229 ARG n 
2  230 SER n 
2  231 GLY n 
2  232 ALA n 
2  233 GLY n 
2  234 THR n 
2  235 SER n 
2  236 SER n 
2  237 ALA n 
2  238 LYS n 
2  239 ALA n 
2  240 THR n 
2  241 TYR n 
2  242 TRP n 
2  243 GLY n 
2  244 GLY n 
2  245 GLU n 
2  246 ILE n 
2  247 ARG n 
2  248 GLU n 
2  249 GLN n 
2  250 ASN n 
2  251 GLY n 
2  252 HIS n 
2  253 SER n 
2  254 LEU n 
2  255 VAL n 
2  256 HIS n 
2  257 ALA n 
2  258 ALA n 
2  259 VAL n 
2  260 VAL n 
2  261 THR n 
2  262 GLU n 
2  263 GLY n 
2  264 ALA n 
2  265 ALA n 
2  266 VAL n 
2  267 GLY n 
2  268 SER n 
2  269 ALA n 
2  270 GLU n 
2  271 ALA n 
2  272 ASN n 
2  273 ALA n 
2  274 PHE n 
2  275 SER n 
2  276 VAL n 
2  277 LEU n 
2  278 GLN n 
2  279 HIS n 
2  280 VAL n 
2  281 LEU n 
2  282 GLY n 
2  283 ALA n 
2  284 GLY n 
2  285 PRO n 
2  286 LEU n 
2  287 ILE n 
2  288 LYS n 
2  289 ARG n 
2  290 GLY n 
2  291 SER n 
2  292 SER n 
2  293 VAL n 
2  294 THR n 
2  295 SER n 
2  296 LYS n 
2  297 LEU n 
2  298 TYR n 
2  299 GLN n 
2  300 GLY n 
2  301 VAL n 
2  302 ALA n 
2  303 LYS n 
2  304 ALA n 
2  305 THR n 
2  306 THR n 
2  307 GLN n 
2  308 PRO n 
2  309 PHE n 
2  310 ASP n 
2  311 ALA n 
2  312 SER n 
2  313 ALA n 
2  314 PHE n 
2  315 ASN n 
2  316 VAL n 
2  317 ASN n 
2  318 TYR n 
2  319 SER n 
2  320 ASP n 
2  321 SER n 
2  322 GLY n 
2  323 LEU n 
2  324 PHE n 
2  325 GLY n 
2  326 PHE n 
2  327 TYR n 
2  328 THR n 
2  329 ILE n 
2  330 SER n 
2  331 GLN n 
2  332 ALA n 
2  333 ALA n 
2  334 HIS n 
2  335 ALA n 
2  336 GLY n 
2  337 GLU n 
2  338 VAL n 
2  339 ILE n 
2  340 ARG n 
2  341 ALA n 
2  342 ALA n 
2  343 MET n 
2  344 ASN n 
2  345 GLN n 
2  346 LEU n 
2  347 LYS n 
2  348 ALA n 
2  349 ALA n 
2  350 ALA n 
2  351 GLN n 
2  352 GLY n 
2  353 GLY n 
2  354 VAL n 
2  355 THR n 
2  356 GLU n 
2  357 GLU n 
2  358 ASP n 
2  359 VAL n 
2  360 THR n 
2  361 LYS n 
2  362 ALA n 
2  363 LYS n 
2  364 ASN n 
2  365 GLN n 
2  366 LEU n 
2  367 LYS n 
2  368 ALA n 
2  369 THR n 
2  370 TYR n 
2  371 LEU n 
2  372 MET n 
2  373 SER n 
2  374 VAL n 
2  375 GLU n 
2  376 THR n 
2  377 ALA n 
2  378 GLN n 
2  379 GLY n 
2  380 LEU n 
2  381 LEU n 
2  382 ASN n 
2  383 GLU n 
2  384 ILE n 
2  385 GLY n 
2  386 SER n 
2  387 GLU n 
2  388 ALA n 
2  389 LEU n 
2  390 LEU n 
2  391 SER n 
2  392 GLY n 
2  393 THR n 
2  394 HIS n 
2  395 THR n 
2  396 ALA n 
2  397 PRO n 
2  398 SER n 
2  399 VAL n 
2  400 VAL n 
2  401 ALA n 
2  402 GLN n 
2  403 LYS n 
2  404 ILE n 
2  405 ASP n 
2  406 SER n 
2  407 VAL n 
2  408 THR n 
2  409 SER n 
2  410 ALA n 
2  411 ASP n 
2  412 VAL n 
2  413 VAL n 
2  414 ASN n 
2  415 ALA n 
2  416 ALA n 
2  417 LYS n 
2  418 LYS n 
2  419 PHE n 
2  420 VAL n 
2  421 SER n 
2  422 GLY n 
2  423 LYS n 
2  424 LYS n 
2  425 SER n 
2  426 MET n 
2  427 ALA n 
2  428 ALA n 
2  429 SER n 
2  430 GLY n 
2  431 ASP n 
2  432 LEU n 
2  433 GLY n 
2  434 SER n 
2  435 THR n 
2  436 PRO n 
2  437 PHE n 
2  438 LEU n 
2  439 ASP n 
2  440 GLU n 
2  441 LEU n 
3  1   MET n 
3  2   ALA n 
3  3   PRO n 
3  4   ASN n 
3  5   ILE n 
3  6   ARG n 
3  7   LYS n 
3  8   SER n 
3  9   HIS n 
3  10  PRO n 
3  11  LEU n 
3  12  LEU n 
3  13  LYS n 
3  14  MET n 
3  15  ILE n 
3  16  ASN n 
3  17  ASN n 
3  18  SER n 
3  19  LEU n 
3  20  ILE n 
3  21  ASP n 
3  22  LEU n 
3  23  PRO n 
3  24  ALA n 
3  25  PRO n 
3  26  SER n 
3  27  ASN n 
3  28  ILE n 
3  29  SER n 
3  30  ALA n 
3  31  TRP n 
3  32  TRP n 
3  33  ASN n 
3  34  PHE n 
3  35  GLY n 
3  36  SER n 
3  37  LEU n 
3  38  LEU n 
3  39  ALA n 
3  40  VAL n 
3  41  CYS n 
3  42  LEU n 
3  43  MET n 
3  44  THR n 
3  45  GLN n 
3  46  ILE n 
3  47  LEU n 
3  48  THR n 
3  49  GLY n 
3  50  LEU n 
3  51  LEU n 
3  52  LEU n 
3  53  ALA n 
3  54  MET n 
3  55  HIS n 
3  56  TYR n 
3  57  THR n 
3  58  ALA n 
3  59  ASP n 
3  60  THR n 
3  61  SER n 
3  62  LEU n 
3  63  ALA n 
3  64  PHE n 
3  65  SER n 
3  66  SER n 
3  67  VAL n 
3  68  ALA n 
3  69  HIS n 
3  70  THR n 
3  71  CYS n 
3  72  ARG n 
3  73  ASN n 
3  74  VAL n 
3  75  GLN n 
3  76  TYR n 
3  77  GLY n 
3  78  TRP n 
3  79  LEU n 
3  80  ILE n 
3  81  ARG n 
3  82  ASN n 
3  83  LEU n 
3  84  HIS n 
3  85  ALA n 
3  86  ASN n 
3  87  GLY n 
3  88  ALA n 
3  89  SER n 
3  90  PHE n 
3  91  PHE n 
3  92  PHE n 
3  93  ILE n 
3  94  CYS n 
3  95  ILE n 
3  96  PHE n 
3  97  LEU n 
3  98  HIS n 
3  99  ILE n 
3  100 GLY n 
3  101 ARG n 
3  102 GLY n 
3  103 LEU n 
3  104 TYR n 
3  105 TYR n 
3  106 GLY n 
3  107 SER n 
3  108 TYR n 
3  109 LEU n 
3  110 TYR n 
3  111 LYS n 
3  112 GLU n 
3  113 THR n 
3  114 TRP n 
3  115 ASN n 
3  116 THR n 
3  117 GLY n 
3  118 VAL n 
3  119 ILE n 
3  120 LEU n 
3  121 LEU n 
3  122 LEU n 
3  123 THR n 
3  124 LEU n 
3  125 MET n 
3  126 ALA n 
3  127 THR n 
3  128 ALA n 
3  129 PHE n 
3  130 VAL n 
3  131 GLY n 
3  132 TYR n 
3  133 VAL n 
3  134 LEU n 
3  135 PRO n 
3  136 TRP n 
3  137 GLY n 
3  138 GLN n 
3  139 MET n 
3  140 SER n 
3  141 PHE n 
3  142 TRP n 
3  143 GLY n 
3  144 ALA n 
3  145 THR n 
3  146 VAL n 
3  147 ILE n 
3  148 THR n 
3  149 ASN n 
3  150 LEU n 
3  151 PHE n 
3  152 SER n 
3  153 ALA n 
3  154 ILE n 
3  155 PRO n 
3  156 TYR n 
3  157 ILE n 
3  158 GLY n 
3  159 HIS n 
3  160 THR n 
3  161 LEU n 
3  162 VAL n 
3  163 GLU n 
3  164 TRP n 
3  165 ALA n 
3  166 TRP n 
3  167 GLY n 
3  168 GLY n 
3  169 PHE n 
3  170 SER n 
3  171 VAL n 
3  172 ASP n 
3  173 ASN n 
3  174 PRO n 
3  175 THR n 
3  176 LEU n 
3  177 THR n 
3  178 ARG n 
3  179 PHE n 
3  180 PHE n 
3  181 ALA n 
3  182 LEU n 
3  183 HIS n 
3  184 PHE n 
3  185 LEU n 
3  186 LEU n 
3  187 PRO n 
3  188 PHE n 
3  189 ALA n 
3  190 ILE n 
3  191 ALA n 
3  192 GLY n 
3  193 ILE n 
3  194 THR n 
3  195 ILE n 
3  196 ILE n 
3  197 HIS n 
3  198 LEU n 
3  199 THR n 
3  200 PHE n 
3  201 LEU n 
3  202 HIS n 
3  203 GLU n 
3  204 SER n 
3  205 GLY n 
3  206 SER n 
3  207 ASN n 
3  208 ASN n 
3  209 PRO n 
3  210 LEU n 
3  211 GLY n 
3  212 ILE n 
3  213 SER n 
3  214 SER n 
3  215 ASP n 
3  216 SER n 
3  217 ASP n 
3  218 LYS n 
3  219 ILE n 
3  220 PRO n 
3  221 PHE n 
3  222 HIS n 
3  223 PRO n 
3  224 TYR n 
3  225 TYR n 
3  226 SER n 
3  227 PHE n 
3  228 LYS n 
3  229 ASP n 
3  230 ILE n 
3  231 LEU n 
3  232 GLY n 
3  233 LEU n 
3  234 THR n 
3  235 LEU n 
3  236 MET n 
3  237 LEU n 
3  238 THR n 
3  239 PRO n 
3  240 PHE n 
3  241 LEU n 
3  242 THR n 
3  243 LEU n 
3  244 ALA n 
3  245 LEU n 
3  246 PHE n 
3  247 SER n 
3  248 PRO n 
3  249 ASN n 
3  250 LEU n 
3  251 LEU n 
3  252 GLY n 
3  253 ASP n 
3  254 PRO n 
3  255 GLU n 
3  256 ASN n 
3  257 PHE n 
3  258 THR n 
3  259 PRO n 
3  260 ALA n 
3  261 ASN n 
3  262 PRO n 
3  263 LEU n 
3  264 VAL n 
3  265 THR n 
3  266 PRO n 
3  267 PRO n 
3  268 HIS n 
3  269 ILE n 
3  270 LYS n 
3  271 PRO n 
3  272 GLU n 
3  273 TRP n 
3  274 TYR n 
3  275 PHE n 
3  276 LEU n 
3  277 PHE n 
3  278 ALA n 
3  279 TYR n 
3  280 ALA n 
3  281 ILE n 
3  282 LEU n 
3  283 ARG n 
3  284 SER n 
3  285 ILE n 
3  286 PRO n 
3  287 ASN n 
3  288 LYS n 
3  289 LEU n 
3  290 GLY n 
3  291 GLY n 
3  292 VAL n 
3  293 LEU n 
3  294 ALA n 
3  295 LEU n 
3  296 ALA n 
3  297 ALA n 
3  298 SER n 
3  299 VAL n 
3  300 LEU n 
3  301 ILE n 
3  302 LEU n 
3  303 PHE n 
3  304 LEU n 
3  305 ILE n 
3  306 PRO n 
3  307 PHE n 
3  308 LEU n 
3  309 HIS n 
3  310 LYS n 
3  311 SER n 
3  312 LYS n 
3  313 GLN n 
3  314 ARG n 
3  315 THR n 
3  316 MET n 
3  317 THR n 
3  318 PHE n 
3  319 ARG n 
3  320 PRO n 
3  321 LEU n 
3  322 SER n 
3  323 GLN n 
3  324 THR n 
3  325 LEU n 
3  326 PHE n 
3  327 TRP n 
3  328 LEU n 
3  329 LEU n 
3  330 VAL n 
3  331 ALA n 
3  332 ASN n 
3  333 LEU n 
3  334 LEU n 
3  335 ILE n 
3  336 LEU n 
3  337 THR n 
3  338 TRP n 
3  339 ILE n 
3  340 GLY n 
3  341 SER n 
3  342 GLN n 
3  343 PRO n 
3  344 VAL n 
3  345 GLU n 
3  346 HIS n 
3  347 PRO n 
3  348 PHE n 
3  349 ILE n 
3  350 ILE n 
3  351 ILE n 
3  352 GLY n 
3  353 GLN n 
3  354 MET n 
3  355 ALA n 
3  356 SER n 
3  357 LEU n 
3  358 SER n 
3  359 TYR n 
3  360 PHE n 
3  361 THR n 
3  362 ILE n 
3  363 LEU n 
3  364 LEU n 
3  365 ILE n 
3  366 LEU n 
3  367 PHE n 
3  368 PRO n 
3  369 THR n 
3  370 ILE n 
3  371 GLY n 
3  372 THR n 
3  373 LEU n 
3  374 GLU n 
3  375 ASN n 
3  376 LYS n 
3  377 MET n 
3  378 LEU n 
3  379 ASN n 
3  380 TYR n 
4  1   GLY n 
4  2   GLU n 
4  3   LEU n 
4  4   GLU n 
4  5   LEU n 
4  6   HIS n 
4  7   PRO n 
4  8   PRO n 
4  9   ALA n 
4  10  PHE n 
4  11  PRO n 
4  12  TRP n 
4  13  SER n 
4  14  HIS n 
4  15  GLY n 
4  16  GLY n 
4  17  PRO n 
4  18  LEU n 
4  19  SER n 
4  20  ALA n 
4  21  LEU n 
4  22  ASP n 
4  23  HIS n 
4  24  SER n 
4  25  SER n 
4  26  VAL n 
4  27  ARG n 
4  28  ARG n 
4  29  GLY n 
4  30  PHE n 
4  31  GLN n 
4  32  VAL n 
4  33  TYR n 
4  34  LYS n 
4  35  GLN n 
4  36  VAL n 
4  37  CYS n 
4  38  SER n 
4  39  ALA n 
4  40  CYS n 
4  41  HIS n 
4  42  SER n 
4  43  MET n 
4  44  ASP n 
4  45  TYR n 
4  46  VAL n 
4  47  ALA n 
4  48  PHE n 
4  49  ARG n 
4  50  ASN n 
4  51  LEU n 
4  52  ILE n 
4  53  GLY n 
4  54  VAL n 
4  55  THR n 
4  56  HIS n 
4  57  THR n 
4  58  GLU n 
4  59  ALA n 
4  60  GLU n 
4  61  ALA n 
4  62  LYS n 
4  63  ALA n 
4  64  LEU n 
4  65  ALA n 
4  66  GLU n 
4  67  GLU n 
4  68  VAL n 
4  69  GLU n 
4  70  VAL n 
4  71  GLN n 
4  72  ASP n 
4  73  GLY n 
4  74  PRO n 
4  75  ASP n 
4  76  GLU n 
4  77  ASN n 
4  78  GLY n 
4  79  GLU n 
4  80  LEU n 
4  81  PHE n 
4  82  MET n 
4  83  ARG n 
4  84  PRO n 
4  85  GLY n 
4  86  LYS n 
4  87  ILE n 
4  88  SER n 
4  89  ASP n 
4  90  TYR n 
4  91  PHE n 
4  92  PRO n 
4  93  LYS n 
4  94  PRO n 
4  95  TYR n 
4  96  PRO n 
4  97  ASN n 
4  98  PRO n 
4  99  GLU n 
4  100 ALA n 
4  101 ALA n 
4  102 ARG n 
4  103 ALA n 
4  104 ALA n 
4  105 ASN n 
4  106 ASN n 
4  107 GLY n 
4  108 ALA n 
4  109 LEU n 
4  110 PRO n 
4  111 PRO n 
4  112 ASP n 
4  113 LEU n 
4  114 SER n 
4  115 TYR n 
4  116 ILE n 
4  117 VAL n 
4  118 ASN n 
4  119 ALA n 
4  120 ARG n 
4  121 HIS n 
4  122 GLY n 
4  123 GLY n 
4  124 GLU n 
4  125 ASP n 
4  126 TYR n 
4  127 VAL n 
4  128 PHE n 
4  129 SER n 
4  130 LEU n 
4  131 LEU n 
4  132 THR n 
4  133 GLY n 
4  134 TYR n 
4  135 CYS n 
4  136 ASP n 
4  137 PRO n 
4  138 PRO n 
4  139 ALA n 
4  140 GLY n 
4  141 VAL n 
4  142 VAL n 
4  143 VAL n 
4  144 ARG n 
4  145 GLU n 
4  146 GLY n 
4  147 LEU n 
4  148 HIS n 
4  149 TYR n 
4  150 ASN n 
4  151 PRO n 
4  152 TYR n 
4  153 PHE n 
4  154 PRO n 
4  155 GLY n 
4  156 GLN n 
4  157 ALA n 
4  158 ILE n 
4  159 GLY n 
4  160 MET n 
4  161 ALA n 
4  162 PRO n 
4  163 PRO n 
4  164 ILE n 
4  165 TYR n 
4  166 ASN n 
4  167 GLU n 
4  168 ILE n 
4  169 LEU n 
4  170 GLU n 
4  171 TYR n 
4  172 ASP n 
4  173 ASP n 
4  174 GLY n 
4  175 THR n 
4  176 PRO n 
4  177 ALA n 
4  178 THR n 
4  179 MET n 
4  180 SER n 
4  181 GLN n 
4  182 ILE n 
4  183 ALA n 
4  184 LYS n 
4  185 ASP n 
4  186 VAL n 
4  187 CYS n 
4  188 THR n 
4  189 PHE n 
4  190 LEU n 
4  191 ARG n 
4  192 TRP n 
4  193 ALA n 
4  194 ALA n 
4  195 GLU n 
4  196 PRO n 
4  197 GLU n 
4  198 HIS n 
4  199 ASP n 
4  200 GLN n 
4  201 ARG n 
4  202 LYS n 
4  203 ARG n 
4  204 MET n 
4  205 GLY n 
4  206 LEU n 
4  207 LYS n 
4  208 MET n 
4  209 LEU n 
4  210 LEU n 
4  211 ILE n 
4  212 SER n 
4  213 ALA n 
4  214 LEU n 
4  215 LEU n 
4  216 THR n 
4  217 SER n 
4  218 LEU n 
4  219 LEU n 
4  220 TYR n 
4  221 TYR n 
4  222 MET n 
4  223 LYS n 
4  224 ARG n 
4  225 HIS n 
4  226 LYS n 
4  227 TRP n 
4  228 SER n 
4  229 VAL n 
4  230 LEU n 
4  231 LYS n 
4  232 SER n 
4  233 ARG n 
4  234 LYS n 
4  235 MET n 
4  236 ALA n 
4  237 TYR n 
4  238 ARG n 
4  239 PRO n 
4  240 PRO n 
4  241 LYS n 
5  1   VAL n 
5  2   HIS n 
5  3   ASN n 
5  4   ASP n 
5  5   VAL n 
5  6   THR n 
5  7   VAL n 
5  8   PRO n 
5  9   ASP n 
5  10  PHE n 
5  11  SER n 
5  12  ALA n 
5  13  TYR n 
5  14  ARG n 
5  15  ARG n 
5  16  GLU n 
5  17  ASP n 
5  18  VAL n 
5  19  MET n 
5  20  ASP n 
5  21  ALA n 
5  22  THR n 
5  23  THR n 
5  24  SER n 
5  25  SER n 
5  26  GLN n 
5  27  THR n 
5  28  SER n 
5  29  SER n 
5  30  GLU n 
5  31  ASP n 
5  32  ARG n 
5  33  LYS n 
5  34  GLY n 
5  35  PHE n 
5  36  SER n 
5  37  TYR n 
5  38  LEU n 
5  39  VAL n 
5  40  THR n 
5  41  ALA n 
5  42  THR n 
5  43  ALA n 
5  44  CYS n 
5  45  VAL n 
5  46  ALA n 
5  47  THR n 
5  48  ALA n 
5  49  TYR n 
5  50  ALA n 
5  51  ALA n 
5  52  LYS n 
5  53  ASN n 
5  54  VAL n 
5  55  VAL n 
5  56  THR n 
5  57  GLN n 
5  58  PHE n 
5  59  ILE n 
5  60  SER n 
5  61  SER n 
5  62  LEU n 
5  63  SER n 
5  64  ALA n 
5  65  SER n 
5  66  ALA n 
5  67  ASP n 
5  68  VAL n 
5  69  LEU n 
5  70  ALA n 
5  71  LEU n 
5  72  SER n 
5  73  LYS n 
5  74  ILE n 
5  75  GLU n 
5  76  ILE n 
5  77  LYS n 
5  78  LEU n 
5  79  SER n 
5  80  ASP n 
5  81  ILE n 
5  82  PRO n 
5  83  GLU n 
5  84  GLY n 
5  85  LYS n 
5  86  ASN n 
5  87  VAL n 
5  88  ALA n 
5  89  PHE n 
5  90  LYS n 
5  91  TRP n 
5  92  ARG n 
5  93  GLY n 
5  94  LYS n 
5  95  PRO n 
5  96  LEU n 
5  97  PHE n 
5  98  VAL n 
5  99  ARG n 
5  100 HIS n 
5  101 ARG n 
5  102 THR n 
5  103 GLN n 
5  104 ALA n 
5  105 GLU n 
5  106 ILE n 
5  107 ASN n 
5  108 GLN n 
5  109 GLU n 
5  110 ALA n 
5  111 GLU n 
5  112 VAL n 
5  113 ASP n 
5  114 VAL n 
5  115 SER n 
5  116 LYS n 
5  117 LEU n 
5  118 ARG n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 HIS n 
5  123 ASP n 
5  124 LEU n 
5  125 ASP n 
5  126 ARG n 
5  127 VAL n 
5  128 LYS n 
5  129 LYS n 
5  130 PRO n 
5  131 GLU n 
5  132 TRP n 
5  133 VAL n 
5  134 ILE n 
5  135 LEU n 
5  136 VAL n 
5  137 GLY n 
5  138 VAL n 
5  139 CYS n 
5  140 THR n 
5  141 HIS n 
5  142 LEU n 
5  143 GLY n 
5  144 CYS n 
5  145 VAL n 
5  146 PRO n 
5  147 ILE n 
5  148 ALA n 
5  149 ASN n 
5  150 SER n 
5  151 GLY n 
5  152 ASP n 
5  153 PHE n 
5  154 GLY n 
5  155 GLY n 
5  156 TYR n 
5  157 TYR n 
5  158 CYS n 
5  159 PRO n 
5  160 CYS n 
5  161 HIS n 
5  162 GLY n 
5  163 SER n 
5  164 HIS n 
5  165 TYR n 
5  166 ASP n 
5  167 ALA n 
5  168 SER n 
5  169 GLY n 
5  170 ARG n 
5  171 ILE n 
5  172 ARG n 
5  173 LYS n 
5  174 GLY n 
5  175 PRO n 
5  176 ALA n 
5  177 PRO n 
5  178 TYR n 
5  179 ASN n 
5  180 LEU n 
5  181 GLU n 
5  182 VAL n 
5  183 PRO n 
5  184 THR n 
5  185 TYR n 
5  186 GLN n 
5  187 PHE n 
5  188 VAL n 
5  189 GLY n 
5  190 ASP n 
5  191 ASP n 
5  192 LEU n 
5  193 VAL n 
5  194 VAL n 
5  195 VAL n 
5  196 GLY n 
6  1   ALA n 
6  2   ALA n 
6  3   ARG n 
6  4   ALA n 
6  5   THR n 
6  6   VAL n 
6  7   ALA n 
6  8   GLY n 
6  9   GLY n 
6  10  GLY n 
6  11  ARG n 
6  12  LEU n 
6  13  MET n 
6  14  ASP n 
6  15  ARG n 
6  16  ILE n 
6  17  ARG n 
6  18  LYS n 
6  19  TRP n 
6  20  TYR n 
6  21  TYR n 
6  22  ASN n 
6  23  ALA n 
6  24  ALA n 
6  25  GLY n 
6  26  PHE n 
6  27  ASN n 
6  28  LYS n 
6  29  TYR n 
6  30  GLY n 
6  31  LEU n 
6  32  MET n 
6  33  ARG n 
6  34  ASP n 
6  35  ASP n 
6  36  THR n 
6  37  LEU n 
6  38  TYR n 
6  39  GLU n 
6  40  ASP n 
6  41  ASP n 
6  42  ASP n 
6  43  VAL n 
6  44  LYS n 
6  45  GLU n 
6  46  ALA n 
6  47  LEU n 
6  48  LYS n 
6  49  ARG n 
6  50  LEU n 
6  51  PRO n 
6  52  GLU n 
6  53  ASP n 
6  54  LEU n 
6  55  TYR n 
6  56  ASN n 
6  57  GLU n 
6  58  ARG n 
6  59  MET n 
6  60  PHE n 
6  61  ARG n 
6  62  ILE n 
6  63  LYS n 
6  64  ARG n 
6  65  ALA n 
6  66  LEU n 
6  67  ASP n 
6  68  LEU n 
6  69  SER n 
6  70  LEU n 
6  71  LYS n 
6  72  HIS n 
6  73  ARG n 
6  74  ILE n 
6  75  LEU n 
6  76  PRO n 
6  77  LYS n 
6  78  GLU n 
6  79  GLN n 
6  80  TRP n 
6  81  VAL n 
6  82  LYS n 
6  83  TYR n 
6  84  GLU n 
6  85  GLU n 
6  86  ASP n 
6  87  LYS n 
6  88  PRO n 
6  89  TYR n 
6  90  LEU n 
6  91  GLU n 
6  92  PRO n 
6  93  TYR n 
6  94  LEU n 
6  95  LYS n 
6  96  GLU n 
6  97  VAL n 
6  98  ILE n 
6  99  ARG n 
6  100 GLU n 
6  101 ARG n 
6  102 LEU n 
6  103 GLU n 
6  104 ARG n 
6  105 GLU n 
6  106 ALA n 
6  107 TRP n 
6  108 ASN n 
6  109 LYS n 
6  110 LYS n 
7  1   GLY n 
7  2   ILE n 
7  3   HIS n 
7  4   PHE n 
7  5   GLY n 
7  6   ASN n 
7  7   LEU n 
7  8   ALA n 
7  9   ARG n 
7  10  VAL n 
7  11  ARG n 
7  12  HIS n 
7  13  ILE n 
7  14  ILE n 
7  15  THR n 
7  16  TYR n 
7  17  SER n 
7  18  LEU n 
7  19  SER n 
7  20  PRO n 
7  21  PHE n 
7  22  GLU n 
7  23  GLN n 
7  24  ARG n 
7  25  ALA n 
7  26  ILE n 
7  27  PRO n 
7  28  ASN n 
7  29  ILE n 
7  30  PHE n 
7  31  SER n 
7  32  ASP n 
7  33  ALA n 
7  34  LEU n 
7  35  PRO n 
7  36  ASN n 
7  37  VAL n 
7  38  TRP n 
7  39  ARG n 
7  40  ARG n 
7  41  PHE n 
7  42  SER n 
7  43  SER n 
7  44  GLN n 
7  45  VAL n 
7  46  PHE n 
7  47  LYS n 
7  48  VAL n 
7  49  ALA n 
7  50  PRO n 
7  51  PRO n 
7  52  PHE n 
7  53  LEU n 
7  54  GLY n 
7  55  ALA n 
7  56  TYR n 
7  57  LEU n 
7  58  LEU n 
7  59  TYR n 
7  60  SER n 
7  61  TRP n 
7  62  GLY n 
7  63  THR n 
7  64  GLN n 
7  65  GLU n 
7  66  PHE n 
7  67  GLU n 
7  68  ARG n 
7  69  LEU n 
7  70  LYS n 
7  71  ARG n 
7  72  LYS n 
7  73  ASN n 
7  74  PRO n 
7  75  ALA n 
7  76  ASP n 
7  77  TYR n 
7  78  GLU n 
7  79  ASN n 
7  80  ASP n 
7  81  GLN n 
8  1   LEU n 
8  2   ARG n 
8  3   GLY n 
8  4   SER n 
8  5   GLY n 
8  6   GLU n 
8  7   GLU n 
8  8   GLU n 
8  9   GLU n 
8  10  GLU n 
8  11  GLU n 
8  12  LEU n 
8  13  VAL n 
8  14  ASP n 
8  15  PRO n 
8  16  LEU n 
8  17  THR n 
8  18  THR n 
8  19  ILE n 
8  20  ARG n 
8  21  GLU n 
8  22  HIS n 
8  23  CYS n 
8  24  GLU n 
8  25  GLN n 
8  26  THR n 
8  27  GLU n 
8  28  LYS n 
8  29  CYS n 
8  30  VAL n 
8  31  LYS n 
8  32  ALA n 
8  33  ARG n 
8  34  GLU n 
8  35  ARG n 
8  36  LEU n 
8  37  GLU n 
8  38  LEU n 
8  39  CYS n 
8  40  ASP n 
8  41  ALA n 
8  42  ARG n 
8  43  VAL n 
8  44  SER n 
8  45  SER n 
8  46  ARG n 
8  47  SER n 
8  48  HIS n 
8  49  THR n 
8  50  GLU n 
8  51  GLU n 
8  52  GLN n 
8  53  CYS n 
8  54  THR n 
8  55  GLU n 
8  56  GLU n 
8  57  LEU n 
8  58  PHE n 
8  59  ASP n 
8  60  PHE n 
8  61  LEU n 
8  62  HIS n 
8  63  ALA n 
8  64  ARG n 
8  65  ASP n 
8  66  HIS n 
8  67  CYS n 
8  68  VAL n 
8  69  ALA n 
8  70  HIS n 
8  71  LYS n 
8  72  LEU n 
8  73  PHE n 
8  74  ASN n 
8  75  LYS n 
8  76  LEU n 
8  77  LYS n 
9  1   UNK n 
9  2   UNK n 
9  3   UNK n 
9  4   UNK n 
9  5   UNK n 
9  6   UNK n 
9  7   UNK n 
9  8   UNK n 
9  9   UNK n 
9  10  UNK n 
9  11  UNK n 
9  12  UNK n 
9  13  UNK n 
9  14  UNK n 
9  15  UNK n 
9  16  ARG n 
9  17  PRO n 
9  18  LEU n 
9  19  LEU n 
9  20  CYS n 
9  21  ARG n 
9  22  GLU n 
9  23  SER n 
9  24  MET n 
9  25  SER n 
9  26  GLY n 
9  27  ARG n 
9  28  SER n 
9  29  ALA n 
9  30  ARG n 
9  31  ARG n 
9  32  ASP n 
9  33  LEU n 
9  34  VAL n 
9  35  ALA n 
9  36  GLY n 
9  37  ILE n 
9  38  SER n 
9  39  LEU n 
9  40  ASN n 
9  41  ALA n 
9  42  PRO n 
9  43  ALA n 
9  44  SER n 
9  45  VAL n 
9  46  ARG n 
9  47  TYR n 
10 1   ALA n 
10 2   LEU n 
10 3   LEU n 
10 4   ARG n 
10 5   GLN n 
10 6   ALA n 
10 7   TYR n 
10 8   SER n 
10 9   ALA n 
10 10  LEU n 
10 11  PHE n 
10 12  ARG n 
10 13  ARG n 
10 14  THR n 
10 15  SER n 
10 16  THR n 
10 17  PHE n 
10 18  ALA n 
10 19  LEU n 
10 20  THR n 
10 21  VAL n 
10 22  VAL n 
10 23  LEU n 
10 24  GLY n 
10 25  ALA n 
10 26  VAL n 
10 27  LEU n 
10 28  PHE n 
10 29  GLU n 
10 30  ARG n 
10 31  ALA n 
10 32  PHE n 
10 33  ASP n 
10 34  GLN n 
10 35  GLY n 
10 36  ALA n 
10 37  ASP n 
10 38  ALA n 
10 39  ILE n 
10 40  PHE n 
10 41  GLU n 
10 42  HIS n 
10 43  LEU n 
10 44  ASN n 
10 45  GLU n 
10 46  GLY n 
10 47  LYS n 
10 48  LEU n 
10 49  TRP n 
10 50  LYS n 
10 51  HIS n 
10 52  ILE n 
10 53  LYS n 
10 54  HIS n 
10 55  LYS n 
10 56  TYR n 
10 57  GLU n 
10 58  ALA n 
10 59  SER n 
10 60  GLU n 
10 61  GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP D0VX31_CHICK D0VX31 1  
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
1  ? 
2  UNP D0VX29_CHICK D0VX29 2  
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
1  ? 
3  UNP CYB_CHICK    P18946 3  
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
1  ? 
4  UNP D0VX26_CHICK D0VX26 4  
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
1  ? 
5  UNP UCRI_CHICK   Q5ZLR5 5  
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
77 ? 
6  UNP D0VX30_CHICK D0VX30 6  
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
1  ? 
7  UNP D0VX32_CHICK D0VX32 7  
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
1  ? 
8  UNP D0VX28_CHICK D0VX28 8  LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK 1  ? 
9  UNP UCRI_CHICK   Q5ZLR5 9  RPLLCRESMSGRSARRDLVAGISLNAPASVRY 45 ? 
10 UNP D0VX27_CHICK D0VX27 10 ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3L73 A 1  ? 446 ? D0VX31 1  ? 446 ? 1  446 
2  2  3L73 B 1  ? 441 ? D0VX29 1  ? 441 ? -1 439 
3  3  3L73 C 1  ? 380 ? P18946 1  ? 380 ? 1  380 
4  4  3L73 D 1  ? 241 ? D0VX26 1  ? 241 ? 1  241 
5  5  3L73 E 1  ? 196 ? Q5ZLR5 77 ? 272 ? 1  196 
6  6  3L73 F 1  ? 110 ? D0VX30 1  ? 110 ? 1  110 
7  7  3L73 G 1  ? 81  ? D0VX32 1  ? 81  ? 1  81  
8  8  3L73 H 1  ? 77  ? D0VX28 1  ? 77  ? 2  78  
9  9  3L73 I 16 ? 47  ? Q5ZLR5 45 ? 76  ? 47 78  
10 10 3L73 J 1  ? 61  ? D0VX27 1  ? 61  ? 4  64  
11 1  3L73 N 1  ? 446 ? D0VX31 1  ? 446 ? 1  446 
12 2  3L73 O 1  ? 441 ? D0VX29 1  ? 441 ? -1 439 
13 3  3L73 P 1  ? 380 ? P18946 1  ? 380 ? 1  380 
14 4  3L73 Q 1  ? 241 ? D0VX26 1  ? 241 ? 1  241 
15 5  3L73 R 1  ? 196 ? Q5ZLR5 77 ? 272 ? 1  196 
16 6  3L73 S 1  ? 110 ? D0VX30 1  ? 110 ? 1  110 
17 7  3L73 T 1  ? 81  ? D0VX32 1  ? 81  ? 1  81  
18 8  3L73 U 1  ? 77  ? D0VX28 1  ? 77  ? 2  78  
19 9  3L73 V 16 ? 47  ? Q5ZLR5 45 ? 76  ? 47 78  
20 10 3L73 W 1  ? 61  ? D0VX27 1  ? 61  ? 4  64  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                                  
?                                                                                  'C3 H7 N O2'         89.093   
ARG 'L-peptide linking' y ARGININE                                                                                                 
?                                                                                  'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE                                                                                               
?                                                                                  'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                          
?                                                                                  'C4 H7 N O4'         133.103  
BOG D-saccharide        n 'octyl beta-D-glucopyranoside'                                                                           
?                                                                                  'C14 H28 O6'         292.369  
CDL non-polymer         . CARDIOLIPIN                                                                                              
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CYS 'L-peptide linking' y CYSTEINE                                                                                                 
?                                                                                  'C3 H7 N O2 S'       121.158  
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                                                                             
?                                                                                  'Fe2 S2'             175.820  
GLN 'L-peptide linking' y GLUTAMINE                                                                                                
?                                                                                  'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                          
?                                                                                  'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE                                                                                                  
?                                                                                  'C2 H5 N O2'         75.067   
GOL non-polymer         . GLYCEROL                                                                                                 
'GLYCERIN; PROPANE-1,2,3-TRIOL'                                                    'C3 H8 O3'           92.094   
HEC non-polymer         . 'HEME C'                                                                                                 
?                                                                                  'C34 H34 Fe N4 O4'   618.503  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                                                                        
HEME                                                                               'C34 H32 Fe N4 O4'   616.487  
HIS 'L-peptide linking' y HISTIDINE                                                                                                
?                                                                                  'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER                                                                                                    
?                                                                                  'H2 O'               18.015   
ILE 'L-peptide linking' y ISOLEUCINE                                                                                               
?                                                                                  'C6 H13 N O2'        131.173  
JZZ non-polymer         . '4-[7-(3,3-dimethylbut-1-yn-1-yl)naphthalen-1-yl]-5-methoxy-2-methyl-2,4-dihydro-3H-1,2,4-triazol-3-one' 
?                                                                                  'C20 H21 N3 O2'      335.400  
LEU 'L-peptide linking' y LEUCINE                                                                                                  
?                                                                                  'C6 H13 N O2'        131.173  
LYS 'L-peptide linking' y LYSINE                                                                                                   
?                                                                                  'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE                                                                                               
?                                                                                  'C5 H11 N O2 S'      149.211  
PEE non-polymer         . 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine                                                            
DOPE                                                                               'C41 H83 N O8 P 1'   749.073  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                            
?                                                                                  'C9 H11 N O2'        165.189  
PRO 'L-peptide linking' y PROLINE                                                                                                  
?                                                                                  'C5 H9 N O2'         115.130  
SER 'L-peptide linking' y SERINE                                                                                                   
?                                                                                  'C3 H7 N O3'         105.093  
THR 'L-peptide linking' y THREONINE                                                                                                
?                                                                                  'C4 H9 N O3'         119.119  
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                               
?                                                                                  'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE                                                                                                 
?                                                                                  'C9 H11 N O3'        181.189  
UNK 'L-peptide linking' . UNKNOWN                                                                                                  
?                                                                                  'C4 H9 N O2'         103.120  
UQ  non-polymer         . 'Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer'                                                       
?                                                                                  'C59 H90 O4'         863.343  
VAL 'L-peptide linking' y VALINE                                                                                                   
?                                                                                  'C5 H11 N O2'        117.146  
# 
_exptl.entry_id          3L73 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.02 
_exptl_crystal.density_percent_sol   69.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.77 
_exptl_crystal_grow.pdbx_details    
;FINAL CONCENTRATIONS BEFORE DIFFUSION: 50 MM CACODYLATE, 9.4 MM TRISHCL, 10 MM MGCL2, 50  G/L GLYCEROL, 30 G/L PEG 3350DA, 0.23 MM EDTA, 0.47 G/L UNDECYL MALTOSIDE, 31 MM OCTYL GLUCOSIDE, PH 6.77, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-08-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.00 1.0 
2 1.0  1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3L73 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.00 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   167200 
_reflns.number_all                   167200 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.08500 
_reflns.pdbx_netI_over_sigmaI        19.3800 
_reflns.B_iso_Wilson_estimate        80.8 
_reflns.pdbx_redundancy              4.300 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.072 
_reflns_shell.pdbx_redundancy        3.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8264 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3L73 
_refine.ls_number_reflns_obs                     145117 
_refine.ls_number_reflns_all                     145117 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3513358.57 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.97 
_refine.ls_d_res_high                            3.04 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.2597 
_refine.ls_R_factor_all                          0.2597 
_refine.ls_R_factor_R_work                       0.2590 
_refine.ls_R_factor_R_free                       0.293 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2854 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               86.5 
_refine.aniso_B[1][1]                            42.00 
_refine.aniso_B[2][2]                            -22.51 
_refine.aniso_B[3][3]                            -19.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.241878 
_refine.solvent_model_param_bsol                 21.5201 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3H1H' 
_refine.pdbx_method_to_determine_struct          'RIGID BODY REFINEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3L73 
_refine_analyze.Luzzati_coordinate_error_obs    0.48 
_refine_analyze.Luzzati_sigma_a_obs             0.75 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.57 
_refine_analyze.Luzzati_sigma_a_free            0.94 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31794 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         832 
_refine_hist.number_atoms_solvent             19 
_refine_hist.number_atoms_total               32645 
_refine_hist.d_res_high                       3.04 
_refine_hist.d_res_low                        24.97 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.92  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.25  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.20  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.66  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.73  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   7 
_refine_ls_shell.d_res_high                       3.04 
_refine_ls_shell.d_res_low                        3.20 
_refine_ls_shell.number_reflns_R_work             20157 
_refine_ls_shell.R_factor_R_work                  0.385 
_refine_ls_shell.percent_reflns_obs               99.8 
_refine_ls_shell.R_factor_R_free                  0.422 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            1.9 
_refine_ls_shell.number_reflns_R_free             384 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                20157 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param &_1_TOPOLOGY_INFILE_1 'X-RAY DIFFRACTION' 
2 hetero10.par      &_1_TOPOLOGY_INFILE_2 'X-RAY DIFFRACTION' 
3 prr.par           &_1_TOPOLOGY_INFILE_3 'X-RAY DIFFRACTION' 
4 water.param       &_1_TOPOLOGY_INFILE_4 'X-RAY DIFFRACTION' 
5 prosth3.par       &_1_TOPOLOGY_INFILE_5 'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3L73 
_struct.title                     'Cytochrome BC1 complex from chicken with triazolone inhibitor' 
_struct.pdbx_descriptor           
;MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I (E.C.1.10.2.2), MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2 (E.C.1.10.2.2), CYTOCHROME B (E.C.1.10.2.2), MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN (E.C.1.10.2.2), CYTOCHROME B-C1 COMPLEX SUBUNIT 5, RIESKE IRONSULFUR PROTEIN, MITOCHONDRIAL (E.C.1.10.2.2), MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14 KDA PROTEIN (E.C.1.10.2.2), MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE UBIQUINONE-BINDING PROTEIN QP-C (E.C.1.10.2.2), MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11 KDA PROTEIN, COMPLEX III SUBUNIT VIII (E.C.1.10.2.2), CYTOCHROME B-C1 COMPLEX SUBUNIT RIESKE, MITOCHONDRIAL (E.C.1.10.2.2), MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 7.2 KDA PROTEIN (E.C.1.10.2.2)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3L73 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL PROCESSING PROTEIN, UBIQUINONE, AZOXYSTROBIN OXIDOREDUCTASE, REDOX ENZYME RESPIRATORY CHAIN, ELECTRON TRANSPORT, HEME, INNER MEMBRANE, MEMBRANE, STROBILURINS BINDING, MITOCHONDRION, TRANSMEMBRANE, STIGMATELLIN, IRON, MITOCHONDRIAL INNER MEMBRANE, RESPIRATORY CHAIN, IRON-SULFUR, TRANSIT PEPTIDE, Metal-binding, Mitochondrion inner membrane, Transport, Disulfide bond, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 1  ? 
L  N N 2  ? 
M  N N 3  ? 
N  N N 4  ? 
O  N N 5  ? 
P  N N 6  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 11 ? 
V  N N 12 ? 
W  N N 12 ? 
X  N N 13 ? 
Y  N N 14 ? 
Z  N N 11 ? 
AA N N 15 ? 
BA N N 16 ? 
CA N N 17 ? 
DA N N 18 ? 
EA N N 18 ? 
FA N N 19 ? 
GA N N 11 ? 
HA N N 17 ? 
IA N N 12 ? 
JA N N 12 ? 
KA N N 18 ? 
LA N N 13 ? 
MA N N 14 ? 
NA N N 11 ? 
OA N N 11 ? 
PA N N 15 ? 
QA N N 16 ? 
RA N N 17 ? 
SA N N 18 ? 
TA N N 18 ? 
UA N N 19 ? 
VA N N 11 ? 
WA N N 17 ? 
XA N N 20 ? 
YA N N 20 ? 
ZA N N 20 ? 
AB N N 20 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The deposited coordinates (20 chains plus hetero groups) make up the asymmetric unit which is the biological assembly. One other subunit of the biological assembly (Subunit 11) is lost during purification or crystallization and is not present in the deposited structure.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   THR A 3   ? LEU A 8   ? THR A 3   LEU A 8   1 ? 6  
HELX_P HELX_P2   2   GLY A 44  ? GLU A 48  ? GLY A 44  GLU A 48  5 ? 5  
HELX_P HELX_P3   3   GLY A 54  ? HIS A 61  ? GLY A 54  HIS A 61  1 ? 8  
HELX_P HELX_P4   4   PRO A 71  ? SER A 81  ? PRO A 71  SER A 81  1 ? 11 
HELX_P HELX_P5   5   ASP A 105 ? CYS A 120 ? ASP A 105 CYS A 120 1 ? 16 
HELX_P HELX_P6   6   GLU A 123 ? ASP A 142 ? GLU A 123 ASP A 142 1 ? 20 
HELX_P HELX_P7   7   ASP A 144 ? PHE A 158 ? ASP A 144 PHE A 158 1 ? 15 
HELX_P HELX_P8   8   THR A 161 ? ARG A 165 ? THR A 161 ARG A 165 5 ? 5  
HELX_P HELX_P9   9   THR A 170 ? LEU A 177 ? THR A 170 LEU A 177 1 ? 8  
HELX_P HELX_P10  10  THR A 178 ? PHE A 190 ? THR A 178 PHE A 190 1 ? 13 
HELX_P HELX_P11  11  LYS A 191 ? PRO A 193 ? LYS A 191 PRO A 193 5 ? 3  
HELX_P HELX_P12  12  SER A 204 ? PHE A 216 ? SER A 204 PHE A 216 1 ? 13 
HELX_P HELX_P13  13  TYR A 223 ? ALA A 227 ? TYR A 223 ALA A 227 5 ? 5  
HELX_P HELX_P14  14  PRO A 265 ? GLY A 278 ? PRO A 265 GLY A 278 1 ? 14 
HELX_P HELX_P15  15  GLY A 286 ? LEU A 290 ? GLY A 286 LEU A 290 5 ? 5  
HELX_P HELX_P16  16  SER A 292 ? HIS A 301 ? SER A 292 HIS A 301 1 ? 10 
HELX_P HELX_P17  17  ASP A 327 ? LEU A 329 ? ASP A 327 LEU A 329 5 ? 3  
HELX_P HELX_P18  18  SER A 330 ? SER A 348 ? SER A 330 SER A 348 1 ? 19 
HELX_P HELX_P19  19  THR A 350 ? GLN A 368 ? THR A 350 GLN A 368 1 ? 19 
HELX_P HELX_P20  20  GLY A 371 ? GLY A 387 ? GLY A 371 GLY A 387 1 ? 17 
HELX_P HELX_P21  21  SER A 391 ? VAL A 402 ? SER A 391 VAL A 402 1 ? 12 
HELX_P HELX_P22  22  ASP A 403 ? ILE A 415 ? ASP A 403 ILE A 415 1 ? 13 
HELX_P HELX_P23  23  ASP A 433 ? SER A 439 ? ASP A 433 SER A 439 1 ? 7  
HELX_P HELX_P24  24  GLY A 440 ? TYR A 442 ? GLY A 440 TYR A 442 5 ? 3  
HELX_P HELX_P25  25  GLY B 56  ? GLU B 60  ? GLY B 54  GLU B 58  5 ? 5  
HELX_P HELX_P26  26  GLY B 66  ? ALA B 74  ? GLY B 64  ALA B 72  1 ? 9  
HELX_P HELX_P27  27  SER B 83  ? ALA B 93  ? SER B 81  ALA B 91  1 ? 11 
HELX_P HELX_P28  28  HIS B 117 ? ALA B 131 ? HIS B 115 ALA B 129 1 ? 15 
HELX_P HELX_P29  29  ARG B 135 ? GLN B 143 ? ARG B 133 GLN B 141 1 ? 9  
HELX_P HELX_P30  30  GLN B 143 ? PHE B 154 ? GLN B 141 PHE B 152 1 ? 12 
HELX_P HELX_P31  31  SER B 156 ? ALA B 169 ? SER B 154 ALA B 167 1 ? 14 
HELX_P HELX_P32  32  THR B 172 ? ASN B 176 ? THR B 170 ASN B 174 5 ? 5  
HELX_P HELX_P33  33  PRO B 181 ? ILE B 185 ? PRO B 179 ILE B 183 5 ? 5  
HELX_P HELX_P34  34  THR B 189 ? PHE B 201 ? THR B 187 PHE B 199 1 ? 13 
HELX_P HELX_P35  35  LYS B 214 ? PHE B 225 ? LYS B 212 PHE B 223 1 ? 12 
HELX_P HELX_P36  36  GLU B 270 ? GLY B 282 ? GLU B 268 GLY B 280 1 ? 13 
HELX_P HELX_P37  37  SER B 295 ? THR B 305 ? SER B 293 THR B 303 1 ? 11 
HELX_P HELX_P38  38  HIS B 334 ? GLN B 351 ? HIS B 332 GLN B 349 1 ? 18 
HELX_P HELX_P39  39  GLU B 357 ? SER B 373 ? GLU B 355 SER B 371 1 ? 17 
HELX_P HELX_P40  40  THR B 376 ? SER B 391 ? THR B 374 SER B 389 1 ? 16 
HELX_P HELX_P41  41  ALA B 396 ? SER B 406 ? ALA B 394 SER B 404 1 ? 11 
HELX_P HELX_P42  42  THR B 408 ? GLY B 422 ? THR B 406 GLY B 420 1 ? 15 
HELX_P HELX_P43  43  ASP B 431 ? THR B 435 ? ASP B 429 THR B 433 5 ? 5  
HELX_P HELX_P44  44  PHE B 437 ? LEU B 441 ? PHE B 435 LEU B 439 5 ? 5  
HELX_P HELX_P45  45  ASN C 4   ? HIS C 9   ? ASN C 4   HIS C 9   1 ? 6  
HELX_P HELX_P46  46  LEU C 11  ? ILE C 20  ? LEU C 11  ILE C 20  1 ? 10 
HELX_P HELX_P47  47  SER C 29  ? TRP C 32  ? SER C 29  TRP C 32  5 ? 4  
HELX_P HELX_P48  48  ASN C 33  ? MET C 54  ? ASN C 33  MET C 54  1 ? 22 
HELX_P HELX_P49  49  LEU C 62  ? ASN C 73  ? LEU C 62  ASN C 73  1 ? 12 
HELX_P HELX_P50  50  TYR C 76  ? TYR C 105 ? TYR C 76  TYR C 105 1 ? 30 
HELX_P HELX_P51  51  GLY C 106 ? LEU C 109 ? GLY C 106 LEU C 109 5 ? 4  
HELX_P HELX_P52  52  TYR C 110 ? LEU C 134 ? TYR C 110 LEU C 134 1 ? 25 
HELX_P HELX_P53  53  GLY C 137 ? ASN C 149 ? GLY C 137 ASN C 149 1 ? 13 
HELX_P HELX_P54  54  LEU C 150 ? ILE C 154 ? LEU C 150 ILE C 154 5 ? 5  
HELX_P HELX_P55  55  ILE C 157 ? GLY C 167 ? ILE C 157 GLY C 167 1 ? 11 
HELX_P HELX_P56  56  ASP C 172 ? GLY C 205 ? ASP C 172 GLY C 205 1 ? 34 
HELX_P HELX_P57  57  PHE C 221 ? SER C 247 ? PHE C 221 SER C 247 1 ? 27 
HELX_P HELX_P58  58  ASP C 253 ? THR C 258 ? ASP C 253 THR C 258 5 ? 6  
HELX_P HELX_P59  59  GLU C 272 ? ILE C 285 ? GLU C 272 ILE C 285 1 ? 14 
HELX_P HELX_P60  60  ASN C 287 ? ILE C 301 ? ASN C 287 ILE C 301 1 ? 15 
HELX_P HELX_P61  61  LEU C 302 ? HIS C 309 ? LEU C 302 HIS C 309 5 ? 8  
HELX_P HELX_P62  62  ARG C 319 ? SER C 341 ? ARG C 319 SER C 341 1 ? 23 
HELX_P HELX_P63  63  PRO C 347 ? ILE C 365 ? PRO C 347 ILE C 365 1 ? 19 
HELX_P HELX_P64  64  ILE C 365 ? LEU C 378 ? ILE C 365 LEU C 378 1 ? 14 
HELX_P HELX_P65  65  ASP D 22  ? VAL D 36  ? ASP D 22  VAL D 36  1 ? 15 
HELX_P HELX_P66  66  CYS D 37  ? CYS D 40  ? CYS D 37  CYS D 40  5 ? 4  
HELX_P HELX_P67  67  ALA D 47  ? ILE D 52  ? ALA D 47  ILE D 52  5 ? 6  
HELX_P HELX_P68  68  THR D 57  ? GLU D 67  ? THR D 57  GLU D 67  1 ? 11 
HELX_P HELX_P69  69  ASN D 97  ? ALA D 104 ? ASN D 97  ALA D 104 1 ? 8  
HELX_P HELX_P70  70  TYR D 115 ? ARG D 120 ? TYR D 115 ARG D 120 1 ? 6  
HELX_P HELX_P71  71  GLY D 123 ? THR D 132 ? GLY D 123 THR D 132 1 ? 10 
HELX_P HELX_P72  72  THR D 178 ? GLU D 195 ? THR D 178 GLU D 195 1 ? 18 
HELX_P HELX_P73  73  GLU D 197 ? SER D 232 ? GLU D 197 SER D 232 1 ? 36 
HELX_P HELX_P74  74  VAL E 1   ? VAL E 5   ? VAL E 1   VAL E 5   5 ? 5  
HELX_P HELX_P75  75  ARG E 15  ? MET E 19  ? ARG E 15  MET E 19  5 ? 5  
HELX_P HELX_P76  76  SER E 24  ? LEU E 62  ? SER E 24  LEU E 62  1 ? 39 
HELX_P HELX_P77  77  SER E 65  ? ALA E 70  ? SER E 65  ALA E 70  1 ? 6  
HELX_P HELX_P78  78  ARG F 11  ? GLY F 25  ? ARG F 11  GLY F 25  1 ? 15 
HELX_P HELX_P79  79  PHE F 26  ? GLY F 30  ? PHE F 26  GLY F 30  5 ? 5  
HELX_P HELX_P80  80  MET F 32  ? LEU F 37  ? MET F 32  LEU F 37  5 ? 6  
HELX_P HELX_P81  81  ASP F 40  ? LEU F 50  ? ASP F 40  LEU F 50  1 ? 11 
HELX_P HELX_P82  82  PRO F 51  ? HIS F 72  ? PRO F 51  HIS F 72  1 ? 22 
HELX_P HELX_P83  83  PRO F 76  ? TRP F 80  ? PRO F 76  TRP F 80  5 ? 5  
HELX_P HELX_P84  84  LYS F 82  ? ASP F 86  ? LYS F 82  ASP F 86  5 ? 5  
HELX_P HELX_P85  85  LEU F 90  ? ASN F 108 ? LEU F 90  ASN F 108 1 ? 19 
HELX_P HELX_P86  86  ASP G 32  ? LEU G 69  ? ASP G 32  LEU G 69  1 ? 38 
HELX_P HELX_P87  87  ASN G 73  ? TYR G 77  ? ASN G 73  TYR G 77  5 ? 5  
HELX_P HELX_P88  88  ASP H 14  ? GLN H 25  ? ASP H 15  GLN H 26  1 ? 12 
HELX_P HELX_P89  89  THR H 26  ? SER H 45  ? THR H 27  SER H 46  1 ? 20 
HELX_P HELX_P90  90  CYS H 53  ? LEU H 76  ? CYS H 54  LEU H 77  1 ? 24 
HELX_P HELX_P91  91  CYS I 20  ? SER I 25  ? CYS I 51  SER I 56  1 ? 6  
HELX_P HELX_P92  92  ALA J 1   ? LEU J 10  ? ALA J 4   LEU J 13  1 ? 10 
HELX_P HELX_P93  93  ARG J 13  ? LEU J 43  ? ARG J 16  LEU J 46  1 ? 31 
HELX_P HELX_P94  94  LEU J 48  ? LYS J 53  ? LEU J 51  LYS J 56  1 ? 6  
HELX_P HELX_P95  95  HIS J 54  ? TYR J 56  ? HIS J 57  TYR J 59  5 ? 3  
HELX_P HELX_P96  96  THR K 3   ? ASN K 10  ? THR N 3   ASN N 10  1 ? 8  
HELX_P HELX_P97  97  GLY K 54  ? HIS K 61  ? GLY N 54  HIS N 61  1 ? 8  
HELX_P HELX_P98  98  PRO K 71  ? SER K 81  ? PRO N 71  SER N 81  1 ? 11 
HELX_P HELX_P99  99  ASP K 105 ? CYS K 120 ? ASP N 105 CYS N 120 1 ? 16 
HELX_P HELX_P100 100 GLU K 123 ? ASP K 142 ? GLU N 123 ASP N 142 1 ? 20 
HELX_P HELX_P101 101 ASP K 144 ? PHE K 158 ? ASP N 144 PHE N 158 1 ? 15 
HELX_P HELX_P102 102 THR K 161 ? ARG K 165 ? THR N 161 ARG N 165 5 ? 5  
HELX_P HELX_P103 103 THR K 170 ? LEU K 177 ? THR N 170 LEU N 177 1 ? 8  
HELX_P HELX_P104 104 THR K 178 ? PHE K 190 ? THR N 178 PHE N 190 1 ? 13 
HELX_P HELX_P105 105 LYS K 191 ? PRO K 193 ? LYS N 191 PRO N 193 5 ? 3  
HELX_P HELX_P106 106 SER K 204 ? PHE K 216 ? SER N 204 PHE N 216 1 ? 13 
HELX_P HELX_P107 107 TYR K 223 ? ALA K 227 ? TYR N 223 ALA N 227 5 ? 5  
HELX_P HELX_P108 108 PRO K 265 ? GLY K 278 ? PRO N 265 GLY N 278 1 ? 14 
HELX_P HELX_P109 109 GLY K 286 ? LEU K 290 ? GLY N 286 LEU N 290 5 ? 5  
HELX_P HELX_P110 110 SER K 292 ? HIS K 301 ? SER N 292 HIS N 301 1 ? 10 
HELX_P HELX_P111 111 ASP K 327 ? LEU K 329 ? ASP N 327 LEU N 329 5 ? 3  
HELX_P HELX_P112 112 SER K 330 ? SER K 348 ? SER N 330 SER N 348 1 ? 19 
HELX_P HELX_P113 113 THR K 350 ? ALA K 367 ? THR N 350 ALA N 367 1 ? 18 
HELX_P HELX_P114 114 GLN K 368 ? ASP K 370 ? GLN N 368 ASP N 370 5 ? 3  
HELX_P HELX_P115 115 GLY K 371 ? GLY K 387 ? GLY N 371 GLY N 387 1 ? 17 
HELX_P HELX_P116 116 SER K 391 ? VAL K 402 ? SER N 391 VAL N 402 1 ? 12 
HELX_P HELX_P117 117 ASP K 403 ? ILE K 415 ? ASP N 403 ILE N 415 1 ? 13 
HELX_P HELX_P118 118 ASP K 433 ? GLY K 440 ? ASP N 433 GLY N 440 1 ? 8  
HELX_P HELX_P119 119 GLY L 56  ? GLU L 60  ? GLY O 54  GLU O 58  5 ? 5  
HELX_P HELX_P120 120 GLY L 66  ? ALA L 74  ? GLY O 64  ALA O 72  1 ? 9  
HELX_P HELX_P121 121 SER L 83  ? ALA L 93  ? SER O 81  ALA O 91  1 ? 11 
HELX_P HELX_P122 122 HIS L 117 ? ALA L 131 ? HIS O 115 ALA O 129 1 ? 15 
HELX_P HELX_P123 123 ARG L 135 ? GLN L 143 ? ARG O 133 GLN O 141 1 ? 9  
HELX_P HELX_P124 124 GLN L 143 ? PHE L 154 ? GLN O 141 PHE O 152 1 ? 12 
HELX_P HELX_P125 125 SER L 156 ? ALA L 169 ? SER O 154 ALA O 167 1 ? 14 
HELX_P HELX_P126 126 THR L 172 ? ASN L 176 ? THR O 170 ASN O 174 5 ? 5  
HELX_P HELX_P127 127 PRO L 181 ? ILE L 185 ? PRO O 179 ILE O 183 5 ? 5  
HELX_P HELX_P128 128 THR L 189 ? PHE L 201 ? THR O 187 PHE O 199 1 ? 13 
HELX_P HELX_P129 129 LYS L 214 ? GLN L 224 ? LYS O 212 GLN O 222 1 ? 11 
HELX_P HELX_P130 130 SER L 268 ? GLY L 282 ? SER O 266 GLY O 280 1 ? 15 
HELX_P HELX_P131 131 SER L 295 ? THR L 305 ? SER O 293 THR O 303 1 ? 11 
HELX_P HELX_P132 132 HIS L 334 ? GLN L 351 ? HIS O 332 GLN O 349 1 ? 18 
HELX_P HELX_P133 133 GLU L 357 ? SER L 373 ? GLU O 355 SER O 371 1 ? 17 
HELX_P HELX_P134 134 THR L 376 ? SER L 391 ? THR O 374 SER O 389 1 ? 16 
HELX_P HELX_P135 135 ALA L 396 ? SER L 406 ? ALA O 394 SER O 404 1 ? 11 
HELX_P HELX_P136 136 THR L 408 ? GLY L 422 ? THR O 406 GLY O 420 1 ? 15 
HELX_P HELX_P137 137 ASP L 431 ? THR L 435 ? ASP O 429 THR O 433 5 ? 5  
HELX_P HELX_P138 138 PHE L 437 ? LEU L 441 ? PHE O 435 LEU O 439 5 ? 5  
HELX_P HELX_P139 139 ASN M 4   ? HIS M 9   ? ASN P 4   HIS P 9   1 ? 6  
HELX_P HELX_P140 140 LEU M 11  ? ILE M 20  ? LEU P 11  ILE P 20  1 ? 10 
HELX_P HELX_P141 141 SER M 29  ? TRP M 32  ? SER P 29  TRP P 32  5 ? 4  
HELX_P HELX_P142 142 ASN M 33  ? MET M 54  ? ASN P 33  MET P 54  1 ? 22 
HELX_P HELX_P143 143 LEU M 62  ? VAL M 74  ? LEU P 62  VAL P 74  1 ? 13 
HELX_P HELX_P144 144 TYR M 76  ? TYR M 105 ? TYR P 76  TYR P 105 1 ? 30 
HELX_P HELX_P145 145 GLY M 106 ? LEU M 109 ? GLY P 106 LEU P 109 5 ? 4  
HELX_P HELX_P146 146 TYR M 110 ? LEU M 134 ? TYR P 110 LEU P 134 1 ? 25 
HELX_P HELX_P147 147 GLY M 137 ? ASN M 149 ? GLY P 137 ASN P 149 1 ? 13 
HELX_P HELX_P148 148 LEU M 150 ? ILE M 154 ? LEU P 150 ILE P 154 5 ? 5  
HELX_P HELX_P149 149 ILE M 157 ? GLY M 167 ? ILE P 157 GLY P 167 1 ? 11 
HELX_P HELX_P150 150 ASP M 172 ? GLY M 205 ? ASP P 172 GLY P 205 1 ? 34 
HELX_P HELX_P151 151 PHE M 221 ? SER M 247 ? PHE P 221 SER P 247 1 ? 27 
HELX_P HELX_P152 152 ASP M 253 ? THR M 258 ? ASP P 253 THR P 258 5 ? 6  
HELX_P HELX_P153 153 GLU M 272 ? ILE M 285 ? GLU P 272 ILE P 285 1 ? 14 
HELX_P HELX_P154 154 ASN M 287 ? ILE M 301 ? ASN P 287 ILE P 301 1 ? 15 
HELX_P HELX_P155 155 LEU M 302 ? HIS M 309 ? LEU P 302 HIS P 309 5 ? 8  
HELX_P HELX_P156 156 ARG M 319 ? SER M 341 ? ARG P 319 SER P 341 1 ? 23 
HELX_P HELX_P157 157 PRO M 347 ? ILE M 365 ? PRO P 347 ILE P 365 1 ? 19 
HELX_P HELX_P158 158 ILE M 365 ? MET M 377 ? ILE P 365 MET P 377 1 ? 13 
HELX_P HELX_P159 159 ASP N 22  ? VAL N 36  ? ASP Q 22  VAL Q 36  1 ? 15 
HELX_P HELX_P160 160 CYS N 37  ? CYS N 40  ? CYS Q 37  CYS Q 40  5 ? 4  
HELX_P HELX_P161 161 ALA N 47  ? ILE N 52  ? ALA Q 47  ILE Q 52  5 ? 6  
HELX_P HELX_P162 162 THR N 57  ? GLU N 67  ? THR Q 57  GLU Q 67  1 ? 11 
HELX_P HELX_P163 163 ASN N 97  ? ALA N 104 ? ASN Q 97  ALA Q 104 1 ? 8  
HELX_P HELX_P164 164 TYR N 115 ? ARG N 120 ? TYR Q 115 ARG Q 120 1 ? 6  
HELX_P HELX_P165 165 GLY N 123 ? THR N 132 ? GLY Q 123 THR Q 132 1 ? 10 
HELX_P HELX_P166 166 THR N 178 ? GLU N 195 ? THR Q 178 GLU Q 195 1 ? 18 
HELX_P HELX_P167 167 GLU N 197 ? SER N 232 ? GLU Q 197 SER Q 232 1 ? 36 
HELX_P HELX_P168 168 VAL O 1   ? VAL O 5   ? VAL R 1   VAL R 5   5 ? 5  
HELX_P HELX_P169 169 ARG O 15  ? MET O 19  ? ARG R 15  MET R 19  5 ? 5  
HELX_P HELX_P170 170 SER O 25  ? LEU O 62  ? SER R 25  LEU R 62  1 ? 38 
HELX_P HELX_P171 171 SER O 65  ? ALA O 70  ? SER R 65  ALA R 70  1 ? 6  
HELX_P HELX_P172 172 SER O 79  ? ILE O 81  ? SER R 79  ILE R 81  5 ? 3  
HELX_P HELX_P173 173 ALA O 104 ? GLU O 111 ? ALA R 104 GLU R 111 1 ? 8  
HELX_P HELX_P174 174 HIS O 122 ? VAL O 127 ? HIS R 122 VAL R 127 1 ? 6  
HELX_P HELX_P175 175 LEU P 12  ? GLY P 25  ? LEU S 12  GLY S 25  1 ? 14 
HELX_P HELX_P176 176 PHE P 26  ? GLY P 30  ? PHE S 26  GLY S 30  5 ? 5  
HELX_P HELX_P177 177 MET P 32  ? LEU P 37  ? MET S 32  LEU S 37  5 ? 6  
HELX_P HELX_P178 178 ASP P 40  ? LEU P 50  ? ASP S 40  LEU S 50  1 ? 11 
HELX_P HELX_P179 179 PRO P 51  ? HIS P 72  ? PRO S 51  HIS S 72  1 ? 22 
HELX_P HELX_P180 180 PRO P 76  ? TRP P 80  ? PRO S 76  TRP S 80  5 ? 5  
HELX_P HELX_P181 181 LYS P 82  ? ASP P 86  ? LYS S 82  ASP S 86  5 ? 5  
HELX_P HELX_P182 182 LEU P 90  ? LYS P 110 ? LEU S 90  LYS S 110 1 ? 21 
HELX_P HELX_P183 183 ASP Q 32  ? LEU Q 69  ? ASP T 32  LEU T 69  1 ? 38 
HELX_P HELX_P184 184 ASN Q 73  ? TYR Q 77  ? ASN T 73  TYR T 77  5 ? 5  
HELX_P HELX_P185 185 ASP R 14  ? GLN R 25  ? ASP U 15  GLN U 26  1 ? 12 
HELX_P HELX_P186 186 THR R 26  ? SER R 45  ? THR U 27  SER U 46  1 ? 20 
HELX_P HELX_P187 187 CYS R 53  ? LEU R 76  ? CYS U 54  LEU U 77  1 ? 24 
HELX_P HELX_P188 188 ALA T 1   ? LEU T 10  ? ALA W 4   LEU W 13  1 ? 10 
HELX_P HELX_P189 189 ARG T 13  ? LEU T 43  ? ARG W 16  LEU W 46  1 ? 31 
HELX_P HELX_P190 190 LEU T 48  ? LYS T 53  ? LEU W 51  LYS W 56  1 ? 6  
HELX_P HELX_P191 191 HIS T 54  ? TYR T 56  ? HIS W 57  TYR W 59  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? E CYS 144 SG  ? ? ? 1_555 E  CYS 160 SG  ? ? E CYS 144 E CYS 160 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2  disulf ? ? H CYS 23  SG  ? ? ? 1_555 H  CYS 67  SG  ? ? H CYS 24  H CYS 68  1_555 ? ? ? ? ? ? ? 2.063 ? ? 
disulf3  disulf ? ? H CYS 39  SG  ? ? ? 1_555 H  CYS 53  SG  ? ? H CYS 40  H CYS 54  1_555 ? ? ? ? ? ? ? 2.061 ? ? 
disulf4  disulf ? ? O CYS 144 SG  ? ? ? 1_555 O  CYS 160 SG  ? ? R CYS 144 R CYS 160 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf5  disulf ? ? R CYS 23  SG  ? ? ? 1_555 R  CYS 67  SG  ? ? U CYS 24  U CYS 68  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf6  disulf ? ? R CYS 39  SG  ? ? ? 1_555 R  CYS 53  SG  ? ? U CYS 40  U CYS 54  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc1  metalc ? ? C HIS 84  NE2 ? ? ? 1_555 V  HEM .   FE  ? ? C HIS 84  C HEM 501 1_555 ? ? ? ? ? ? ? 2.000 ? ? 
metalc2  metalc ? ? C HIS 98  NE2 ? ? ? 1_555 W  HEM .   FE  ? ? C HIS 98  C HEM 502 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
metalc3  metalc ? ? C HIS 183 NE2 ? ? ? 1_555 V  HEM .   FE  ? ? C HIS 183 C HEM 501 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc4  metalc ? ? C HIS 197 NE2 ? ? ? 1_555 W  HEM .   FE  ? ? C HIS 197 C HEM 502 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc5  metalc ? ? D HIS 41  NE2 ? ? ? 1_555 BA HEC .   FE  ? ? D HIS 41  D HEC 501 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc6  metalc ? ? D MET 160 SD  ? ? ? 1_555 BA HEC .   FE  ? ? D MET 160 D HEC 501 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc7  metalc ? ? E CYS 139 SG  ? ? ? 1_555 FA FES .   FE1 ? ? E CYS 139 E FES 501 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc8  metalc ? ? E HIS 141 ND1 ? ? ? 1_555 FA FES .   FE2 ? ? E HIS 141 E FES 501 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc9  metalc ? ? E CYS 158 SG  ? ? ? 1_555 FA FES .   FE1 ? ? E CYS 158 E FES 501 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc10 metalc ? ? E HIS 161 ND1 ? ? ? 1_555 FA FES .   FE2 ? ? E HIS 161 E FES 501 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc11 metalc ? ? M HIS 84  NE2 ? ? ? 1_555 IA HEM .   FE  ? ? P HIS 84  P HEM 501 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc12 metalc ? ? M HIS 98  NE2 ? ? ? 1_555 JA HEM .   FE  ? ? P HIS 98  P HEM 502 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc13 metalc ? ? M HIS 183 NE2 ? ? ? 1_555 IA HEM .   FE  ? ? P HIS 183 P HEM 501 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc14 metalc ? ? M HIS 197 NE2 ? ? ? 1_555 JA HEM .   FE  ? ? P HIS 197 P HEM 502 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
metalc15 metalc ? ? N HIS 41  NE2 ? ? ? 1_555 QA HEC .   FE  ? ? Q HIS 41  Q HEC 501 1_555 ? ? ? ? ? ? ? 2.003 ? ? 
metalc16 metalc ? ? N MET 160 SD  ? ? ? 1_555 QA HEC .   FE  ? ? Q MET 160 Q HEC 501 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc17 metalc ? ? O CYS 139 SG  ? ? ? 1_555 UA FES .   FE1 ? ? R CYS 139 R FES 501 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc18 metalc ? ? O HIS 141 ND1 ? ? ? 1_555 UA FES .   FE2 ? ? R HIS 141 R FES 501 1_555 ? ? ? ? ? ? ? 2.126 ? ? 
metalc19 metalc ? ? O CYS 158 SG  ? ? ? 1_555 UA FES .   FE1 ? ? R CYS 158 R FES 501 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc20 metalc ? ? O HIS 161 ND1 ? ? ? 1_555 UA FES .   FE2 ? ? R HIS 161 R FES 501 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 222 C . ? HIS 222 C PRO 223 C ? PRO 223 C 1 0.52  
2 HIS 346 C . ? HIS 346 C PRO 347 C ? PRO 347 C 1 -0.20 
3 GLY 73  D . ? GLY 73  D PRO 74  D ? PRO 74  D 1 0.10  
4 HIS 222 M . ? HIS 222 P PRO 223 M ? PRO 223 P 1 0.34  
5 HIS 346 M . ? HIS 346 P PRO 347 M ? PRO 347 P 1 0.02  
6 GLY 73  N . ? GLY 73  Q PRO 74  N ? PRO 74  Q 1 0.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 2 ? 
D ? 6 ? 
E ? 5 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 6 ? 
M ? 8 ? 
N ? 2 ? 
O ? 6 ? 
P ? 5 ? 
Q ? 2 ? 
R ? 2 ? 
S ? 2 ? 
T ? 3 ? 
U ? 3 ? 
V ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
L 5 6 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? parallel      
M 6 7 ? anti-parallel 
M 7 8 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
V 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 15  ? THR A 18  ? ASN A 15  THR A 18  
A 2 ARG A 24  ? GLU A 29  ? ARG A 24  GLU A 29  
A 3 MET A 195 ? GLY A 201 ? MET A 195 GLY A 201 
A 4 THR A 34  ? ILE A 41  ? THR A 34  ILE A 41  
A 5 THR A 95  ? LEU A 102 ? THR A 95  LEU A 102 
A 6 HIS A 85  ? THR A 90  ? HIS A 85  THR A 90  
B 1 ARG A 279 ? ASP A 281 ? ARG A 279 ASP A 281 
B 2 SER A 306 ? SER A 313 ? SER A 306 SER A 313 
B 3 GLY A 318 ? ALA A 326 ? GLY A 318 ALA A 326 
B 4 ALA A 251 ? GLU A 258 ? ALA A 251 GLU A 258 
B 5 ALA A 421 ? GLY A 426 ? ALA A 421 GLY A 426 
B 6 SER A 239 ? ASP A 245 ? SER A 239 ASP A 245 
B 7 ARG G 11  ? LEU G 18  ? ARG G 11  LEU G 18  
B 8 LYS D 234 ? TYR D 237 ? LYS D 234 TYR D 237 
C 1 ILE B 28  ? LYS B 30  ? ILE B 26  LYS B 28  
C 2 ILE B 36  ? ALA B 38  ? ILE B 34  ALA B 36  
D 1 MET B 206 ? ILE B 211 ? MET B 204 ILE B 209 
D 2 ALA B 46  ? ILE B 53  ? ALA B 44  ILE B 51  
D 3 MET B 107 ? LEU B 114 ? MET B 105 LEU B 112 
D 4 SER B 99  ? SER B 102 ? SER B 97  SER B 100 
D 5 VAL I 34  ? SER I 38  ? VAL I 65  SER I 69  
D 6 SER I 44  ? ARG I 46  ? SER I 75  ARG I 77  
E 1 GLU B 245 ? GLN B 249 ? GLU B 243 GLN B 247 
E 2 SER B 425 ? GLY B 430 ? SER B 423 GLY B 428 
E 3 LEU B 254 ? GLU B 262 ? LEU B 252 GLU B 260 
E 4 SER B 321 ? GLN B 331 ? SER B 319 GLN B 329 
E 5 PHE B 309 ? TYR B 318 ? PHE B 307 TYR B 316 
F 1 PRO C 23  ? PRO C 25  ? PRO C 23  PRO C 25  
F 2 LYS C 218 ? PRO C 220 ? LYS C 218 PRO C 220 
G 1 GLU D 69  ? ASP D 72  ? GLU D 69  ASP D 72  
G 2 PHE D 81  ? PRO D 84  ? PHE D 81  PRO D 84  
H 1 HIS D 148 ? TYR D 149 ? HIS D 148 TYR D 149 
H 2 ALA D 157 ? ILE D 158 ? ALA D 157 ILE D 158 
I 1 ILE E 74  ? ILE E 76  ? ILE E 74  ILE E 76  
I 2 VAL E 193 ? VAL E 195 ? VAL E 193 VAL E 195 
J 1 ASN E 86  ? TRP E 91  ? ASN E 86  TRP E 91  
J 2 LYS E 94  ? HIS E 100 ? LYS E 94  HIS E 100 
J 3 TRP E 132 ? VAL E 136 ? TRP E 132 VAL E 136 
K 1 TYR E 156 ? CYS E 158 ? TYR E 156 CYS E 158 
K 2 GLY E 162 ? TYR E 165 ? GLY E 162 TYR E 165 
L 1 ASN K 15  ? THR K 18  ? ASN N 15  THR N 18  
L 2 ARG K 24  ? GLU K 29  ? ARG N 24  GLU N 29  
L 3 MET K 195 ? GLY K 201 ? MET N 195 GLY N 201 
L 4 THR K 34  ? ILE K 41  ? THR N 34  ILE N 41  
L 5 THR K 95  ? LEU K 102 ? THR N 95  LEU N 102 
L 6 HIS K 85  ? THR K 90  ? HIS N 85  THR N 90  
M 1 ARG K 279 ? ASP K 281 ? ARG N 279 ASP N 281 
M 2 SER K 306 ? SER K 313 ? SER N 306 SER N 313 
M 3 GLY K 318 ? ALA K 326 ? GLY N 318 ALA N 326 
M 4 ALA K 251 ? GLU K 258 ? ALA N 251 GLU N 258 
M 5 ALA K 421 ? GLY K 426 ? ALA N 421 GLY N 426 
M 6 SER K 239 ? ASP K 245 ? SER N 239 ASP N 245 
M 7 ARG Q 11  ? LEU Q 18  ? ARG T 11  LEU T 18  
M 8 LYS N 234 ? TYR N 237 ? LYS Q 234 TYR Q 237 
N 1 ILE L 28  ? LYS L 30  ? ILE O 26  LYS O 28  
N 2 ILE L 36  ? ALA L 38  ? ILE O 34  ALA O 36  
O 1 MET L 206 ? ILE L 211 ? MET O 204 ILE O 209 
O 2 ALA L 46  ? ILE L 53  ? ALA O 44  ILE O 51  
O 3 MET L 107 ? LEU L 114 ? MET O 105 LEU O 112 
O 4 SER L 99  ? SER L 102 ? SER O 97  SER O 100 
O 5 ALA S 35  ? SER S 38  ? ALA V 66  SER V 69  
O 6 SER S 44  ? VAL S 45  ? SER V 75  VAL V 76  
P 1 GLU L 245 ? GLN L 249 ? GLU O 243 GLN O 247 
P 2 SER L 425 ? GLY L 430 ? SER O 423 GLY O 428 
P 3 LEU L 254 ? GLU L 262 ? LEU O 252 GLU O 260 
P 4 SER L 321 ? GLN L 331 ? SER O 319 GLN O 329 
P 5 PHE L 309 ? TYR L 318 ? PHE O 307 TYR O 316 
Q 1 PRO M 23  ? PRO M 25  ? PRO P 23  PRO P 25  
Q 2 LYS M 218 ? PRO M 220 ? LYS P 218 PRO P 220 
R 1 GLU N 69  ? ASP N 72  ? GLU Q 69  ASP Q 72  
R 2 PHE N 81  ? PRO N 84  ? PHE Q 81  PRO Q 84  
S 1 HIS N 148 ? TYR N 149 ? HIS Q 148 TYR Q 149 
S 2 ALA N 157 ? ILE N 158 ? ALA Q 157 ILE Q 158 
T 1 ILE O 74  ? LYS O 77  ? ILE R 74  LYS R 77  
T 2 LEU O 192 ? VAL O 195 ? LEU R 192 VAL R 195 
T 3 PHE O 187 ? VAL O 188 ? PHE R 187 VAL R 188 
U 1 ASN O 86  ? TRP O 91  ? ASN R 86  TRP R 91  
U 2 LYS O 94  ? HIS O 100 ? LYS R 94  HIS R 100 
U 3 TRP O 132 ? VAL O 136 ? TRP R 132 VAL R 136 
V 1 TYR O 156 ? CYS O 158 ? TYR R 156 CYS R 158 
V 2 GLY O 162 ? TYR O 165 ? GLY R 162 TYR R 165 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 17  ? N THR A 17  O VAL A 25  ? O VAL A 25  
A 2 3 N ALA A 26  ? N ALA A 26  O LEU A 197 ? O LEU A 197 
A 3 4 O ALA A 198 ? O ALA A 198 N GLY A 38  ? N GLY A 38  
A 4 5 N VAL A 37  ? N VAL A 37  O ILE A 99  ? O ILE A 99  
A 5 6 O TYR A 98  ? O TYR A 98  N ASN A 87  ? N ASN A 87  
B 1 2 N TYR A 280 ? N TYR A 280 O PHE A 307 ? O PHE A 307 
B 2 3 N THR A 312 ? N THR A 312 O LEU A 319 ? O LEU A 319 
B 3 4 O ALA A 326 ? O ALA A 326 N ALA A 251 ? N ALA A 251 
B 4 5 N HIS A 252 ? N HIS A 252 O VAL A 425 ? O VAL A 425 
B 5 6 O LEU A 422 ? O LEU A 422 N SER A 239 ? N SER A 239 
B 6 7 N GLU A 240 ? N GLU A 240 O SER G 17  ? O SER G 17  
B 7 8 O TYR G 16  ? O TYR G 16  N LYS D 234 ? N LYS D 234 
C 1 2 N THR B 29  ? N THR B 27  O ILE B 37  ? O ILE B 35  
D 1 2 O ALA B 207 ? O ALA B 205 N PHE B 52  ? N PHE B 50  
D 2 3 N VAL B 51  ? N VAL B 49  O TYR B 109 ? O TYR B 107 
D 3 4 O THR B 108 ? O THR B 106 N TYR B 101 ? N TYR B 99  
D 4 5 N SER B 102 ? N SER B 100 O ALA I 35  ? O ALA I 66  
D 5 6 N GLY I 36  ? N GLY I 67  O SER I 44  ? O SER I 75  
E 1 2 N GLU B 248 ? N GLU B 246 O ALA B 428 ? O ALA B 426 
E 2 3 O ALA B 427 ? O ALA B 425 N ALA B 258 ? N ALA B 256 
E 3 4 N ALA B 257 ? N ALA B 255 O THR B 328 ? O THR B 326 
E 4 5 O GLY B 325 ? O GLY B 323 N PHE B 314 ? N PHE B 312 
F 1 2 N ALA C 24  ? N ALA C 24  O ILE C 219 ? O ILE C 219 
G 1 2 N VAL D 70  ? N VAL D 70  O ARG D 83  ? O ARG D 83  
H 1 2 N HIS D 148 ? N HIS D 148 O ILE D 158 ? O ILE D 158 
I 1 2 N ILE E 76  ? N ILE E 76  O VAL E 193 ? O VAL E 193 
J 1 2 N PHE E 89  ? N PHE E 89  O LEU E 96  ? O LEU E 96  
J 2 3 N PHE E 97  ? N PHE E 97  O LEU E 135 ? O LEU E 135 
K 1 2 N TYR E 156 ? N TYR E 156 O TYR E 165 ? O TYR E 165 
L 1 2 N THR K 17  ? N THR N 17  O VAL K 25  ? O VAL N 25  
L 2 3 N ALA K 26  ? N ALA N 26  O LEU K 197 ? O LEU N 197 
L 3 4 O ALA K 200 ? O ALA N 200 N THR K 36  ? N THR N 36  
L 4 5 N VAL K 37  ? N VAL N 37  O ILE K 99  ? O ILE N 99  
L 5 6 O TYR K 98  ? O TYR N 98  N ASN K 87  ? N ASN N 87  
M 1 2 N TYR K 280 ? N TYR N 280 O PHE K 307 ? O PHE N 307 
M 2 3 N THR K 312 ? N THR N 312 O LEU K 319 ? O LEU N 319 
M 3 4 O ALA K 326 ? O ALA N 326 N ALA K 251 ? N ALA N 251 
M 4 5 N ALA K 256 ? N ALA N 256 O ALA K 421 ? O ALA N 421 
M 5 6 O LEU K 422 ? O LEU N 422 N SER K 239 ? N SER N 239 
M 6 7 N ARG K 244 ? N ARG N 244 O ILE Q 13  ? O ILE T 13  
M 7 8 O ILE Q 14  ? O ILE T 14  N ALA N 236 ? N ALA Q 236 
N 1 2 N THR L 29  ? N THR O 27  O ILE L 37  ? O ILE O 35  
O 1 2 O ALA L 207 ? O ALA O 205 N PHE L 52  ? N PHE O 50  
O 2 3 N SER L 47  ? N SER O 45  O CYS L 113 ? O CYS O 111 
O 3 4 O THR L 108 ? O THR O 106 N TYR L 101 ? N TYR O 99  
O 4 5 N SER L 102 ? N SER O 100 O ALA S 35  ? O ALA V 66  
O 5 6 N GLY S 36  ? N GLY V 67  O SER S 44  ? O SER V 75  
P 1 2 N GLU L 248 ? N GLU O 246 O ALA L 428 ? O ALA O 426 
P 2 3 O SER L 425 ? O SER O 423 N VAL L 260 ? N VAL O 258 
P 3 4 N ALA L 257 ? N ALA O 255 O THR L 328 ? O THR O 326 
P 4 5 O GLY L 325 ? O GLY O 323 N PHE L 314 ? N PHE O 312 
Q 1 2 N ALA M 24  ? N ALA P 24  O ILE M 219 ? O ILE P 219 
R 1 2 N VAL N 70  ? N VAL Q 70  O ARG N 83  ? O ARG Q 83  
S 1 2 N HIS N 148 ? N HIS Q 148 O ILE N 158 ? O ILE Q 158 
T 1 2 N ILE O 76  ? N ILE R 76  O VAL O 193 ? O VAL R 193 
T 2 3 O LEU O 192 ? O LEU R 192 N VAL O 188 ? N VAL R 188 
U 1 2 N PHE O 89  ? N PHE R 89  O LEU O 96  ? O LEU R 96  
U 2 3 N PHE O 97  ? N PHE R 97  O LEU O 135 ? O LEU R 135 
V 1 2 N TYR O 156 ? N TYR R 156 O TYR O 165 ? O TYR R 165 
# 
_database_PDB_matrix.entry_id          3L73 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3L73 
_atom_sites.fract_transf_matrix[1][1]   0.005831 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005466 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004149 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A  1  1   ? 91.887  83.631  57.917  1.00 114.63 ? 1    ALA A N     1 
ATOM   2     C  CA    . ALA A  1  1   ? 92.189  82.932  56.629  1.00 115.65 ? 1    ALA A CA    1 
ATOM   3     C  C     . ALA A  1  1   ? 91.647  83.723  55.430  1.00 116.27 ? 1    ALA A C     1 
ATOM   4     O  O     . ALA A  1  1   ? 91.949  84.913  55.259  1.00 116.55 ? 1    ALA A O     1 
ATOM   5     C  CB    . ALA A  1  1   ? 91.588  81.514  56.652  1.00 114.65 ? 1    ALA A CB    1 
ATOM   6     N  N     . ALA A  1  2   ? 90.856  83.055  54.594  1.00 116.34 ? 2    ALA A N     1 
ATOM   7     C  CA    . ALA A  1  2   ? 90.264  83.701  53.432  1.00 115.53 ? 2    ALA A CA    1 
ATOM   8     C  C     . ALA A  1  2   ? 89.102  84.577  53.906  1.00 115.57 ? 2    ALA A C     1 
ATOM   9     O  O     . ALA A  1  2   ? 88.503  84.327  54.965  1.00 114.88 ? 2    ALA A O     1 
ATOM   10    C  CB    . ALA A  1  2   ? 89.771  82.646  52.446  1.00 115.17 ? 2    ALA A CB    1 
ATOM   11    N  N     . THR A  1  3   ? 88.791  85.609  53.126  1.00 115.47 ? 3    THR A N     1 
ATOM   12    C  CA    . THR A  1  3   ? 87.703  86.515  53.478  1.00 115.04 ? 3    THR A CA    1 
ATOM   13    C  C     . THR A  1  3   ? 86.345  86.092  52.913  1.00 115.15 ? 3    THR A C     1 
ATOM   14    O  O     . THR A  1  3   ? 86.247  85.253  52.008  1.00 114.31 ? 3    THR A O     1 
ATOM   15    C  CB    . THR A  1  3   ? 87.977  87.982  53.009  1.00 114.06 ? 3    THR A CB    1 
ATOM   16    O  OG1   . THR A  1  3   ? 88.345  87.990  51.624  1.00 112.93 ? 3    THR A OG1   1 
ATOM   17    C  CG2   . THR A  1  3   ? 89.068  88.623  53.842  1.00 112.87 ? 3    THR A CG2   1 
ATOM   18    N  N     . TYR A  1  4   ? 85.304  86.687  53.490  1.00 115.30 ? 4    TYR A N     1 
ATOM   19    C  CA    . TYR A  1  4   ? 83.927  86.463  53.082  1.00 115.15 ? 4    TYR A CA    1 
ATOM   20    C  C     . TYR A  1  4   ? 83.872  86.851  51.609  1.00 114.60 ? 4    TYR A C     1 
ATOM   21    O  O     . TYR A  1  4   ? 83.273  86.158  50.792  1.00 114.06 ? 4    TYR A O     1 
ATOM   22    C  CB    . TYR A  1  4   ? 83.000  87.360  53.928  1.00 115.70 ? 4    TYR A CB    1 
ATOM   23    C  CG    . TYR A  1  4   ? 81.574  87.512  53.427  1.00 115.29 ? 4    TYR A CG    1 
ATOM   24    C  CD1   . TYR A  1  4   ? 80.679  86.443  53.453  1.00 115.15 ? 4    TYR A CD1   1 
ATOM   25    C  CD2   . TYR A  1  4   ? 81.130  88.727  52.911  1.00 114.79 ? 4    TYR A CD2   1 
ATOM   26    C  CE1   . TYR A  1  4   ? 79.379  86.581  52.974  1.00 114.38 ? 4    TYR A CE1   1 
ATOM   27    C  CE2   . TYR A  1  4   ? 79.837  88.873  52.431  1.00 114.80 ? 4    TYR A CE2   1 
ATOM   28    C  CZ    . TYR A  1  4   ? 78.967  87.798  52.464  1.00 114.40 ? 4    TYR A CZ    1 
ATOM   29    O  OH    . TYR A  1  4   ? 77.686  87.949  51.978  1.00 114.78 ? 4    TYR A OH    1 
ATOM   30    N  N     . ALA A  1  5   ? 84.528  87.959  51.282  1.00 114.56 ? 5    ALA A N     1 
ATOM   31    C  CA    . ALA A  1  5   ? 84.572  88.454  49.914  1.00 115.00 ? 5    ALA A CA    1 
ATOM   32    C  C     . ALA A  1  5   ? 85.041  87.370  48.948  1.00 115.77 ? 5    ALA A C     1 
ATOM   33    O  O     . ALA A  1  5   ? 84.420  87.143  47.906  1.00 115.81 ? 5    ALA A O     1 
ATOM   34    C  CB    . ALA A  1  5   ? 85.500  89.666  49.832  1.00 114.62 ? 5    ALA A CB    1 
ATOM   35    N  N     . GLN A  1  6   ? 86.129  86.693  49.305  1.00 116.55 ? 6    GLN A N     1 
ATOM   36    C  CA    . GLN A  1  6   ? 86.697  85.649  48.462  1.00 116.99 ? 6    GLN A CA    1 
ATOM   37    C  C     . GLN A  1  6   ? 85.930  84.328  48.463  1.00 116.38 ? 6    GLN A C     1 
ATOM   38    O  O     . GLN A  1  6   ? 85.652  83.780  47.392  1.00 115.84 ? 6    GLN A O     1 
ATOM   39    C  CB    . GLN A  1  6   ? 88.149  85.424  48.859  1.00 118.53 ? 6    GLN A CB    1 
ATOM   40    C  CG    . GLN A  1  6   ? 88.942  86.711  48.814  1.00 122.09 ? 6    GLN A CG    1 
ATOM   41    C  CD    . GLN A  1  6   ? 90.331  86.572  49.392  1.00 124.28 ? 6    GLN A CD    1 
ATOM   42    O  OE1   . GLN A  1  6   ? 90.502  86.143  50.539  1.00 126.17 ? 6    GLN A OE1   1 
ATOM   43    N  NE2   . GLN A  1  6   ? 91.336  86.945  48.607  1.00 124.33 ? 6    GLN A NE2   1 
ATOM   44    N  N     . THR A  1  7   ? 85.587  83.811  49.642  1.00 115.58 ? 7    THR A N     1 
ATOM   45    C  CA    . THR A  1  7   ? 84.838  82.559  49.707  1.00 115.11 ? 7    THR A CA    1 
ATOM   46    C  C     . THR A  1  7   ? 83.616  82.671  48.800  1.00 115.76 ? 7    THR A C     1 
ATOM   47    O  O     . THR A  1  7   ? 83.115  81.668  48.283  1.00 115.48 ? 7    THR A O     1 
ATOM   48    C  CB    . THR A  1  7   ? 84.362  82.245  51.140  1.00 114.33 ? 7    THR A CB    1 
ATOM   49    O  OG1   . THR A  1  7   ? 83.753  83.408  51.706  1.00 115.06 ? 7    THR A OG1   1 
ATOM   50    C  CG2   . THR A  1  7   ? 85.519  81.820  52.008  1.00 113.78 ? 7    THR A CG2   1 
ATOM   51    N  N     . LEU A  1  8   ? 83.154  83.907  48.605  1.00 116.42 ? 8    LEU A N     1 
ATOM   52    C  CA    . LEU A  1  8   ? 81.989  84.200  47.769  1.00 117.02 ? 8    LEU A CA    1 
ATOM   53    C  C     . LEU A  1  8   ? 82.257  84.104  46.279  1.00 117.55 ? 8    LEU A C     1 
ATOM   54    O  O     . LEU A  1  8   ? 81.336  83.883  45.493  1.00 118.29 ? 8    LEU A O     1 
ATOM   55    C  CB    . LEU A  1  8   ? 81.440  85.602  48.059  1.00 116.33 ? 8    LEU A CB    1 
ATOM   56    C  CG    . LEU A  1  8   ? 80.418  85.780  49.183  1.00 115.27 ? 8    LEU A CG    1 
ATOM   57    C  CD1   . LEU A  1  8   ? 79.855  87.196  49.119  1.00 114.05 ? 8    LEU A CD1   1 
ATOM   58    C  CD2   . LEU A  1  8   ? 79.302  84.752  49.035  1.00 114.69 ? 8    LEU A CD2   1 
ATOM   59    N  N     . GLN A  1  9   ? 83.509  84.292  45.887  1.00 117.70 ? 9    GLN A N     1 
ATOM   60    C  CA    . GLN A  1  9   ? 83.866  84.218  44.480  1.00 118.16 ? 9    GLN A CA    1 
ATOM   61    C  C     . GLN A  1  9   ? 84.187  82.786  44.077  1.00 118.25 ? 9    GLN A C     1 
ATOM   62    O  O     . GLN A  1  9   ? 83.761  82.315  43.019  1.00 117.63 ? 9    GLN A O     1 
ATOM   63    C  CB    . GLN A  1  9   ? 85.058  85.123  44.213  1.00 118.71 ? 9    GLN A CB    1 
ATOM   64    C  CG    . GLN A  1  9   ? 84.765  86.570  44.529  1.00 119.79 ? 9    GLN A CG    1 
ATOM   65    C  CD    . GLN A  1  9   ? 86.017  87.414  44.620  1.00 120.02 ? 9    GLN A CD    1 
ATOM   66    O  OE1   . GLN A  1  9   ? 86.811  87.270  45.554  1.00 119.34 ? 9    GLN A OE1   1 
ATOM   67    N  NE2   . GLN A  1  9   ? 86.205  88.301  43.646  1.00 120.99 ? 9    GLN A NE2   1 
ATOM   68    N  N     . ASN A  1  10  ? 84.927  82.089  44.932  1.00 118.80 ? 10   ASN A N     1 
ATOM   69    C  CA    . ASN A  1  10  ? 85.304  80.708  44.650  1.00 119.80 ? 10   ASN A CA    1 
ATOM   70    C  C     . ASN A  1  10  ? 84.151  79.719  44.684  1.00 119.06 ? 10   ASN A C     1 
ATOM   71    O  O     . ASN A  1  10  ? 84.374  78.502  44.685  1.00 119.26 ? 10   ASN A O     1 
ATOM   72    C  CB    . ASN A  1  10  ? 86.391  80.235  45.616  1.00 121.33 ? 10   ASN A CB    1 
ATOM   73    C  CG    . ASN A  1  10  ? 87.752  80.791  45.268  1.00 123.03 ? 10   ASN A CG    1 
ATOM   74    O  OD1   . ASN A  1  10  ? 87.970  82.006  45.324  1.00 123.75 ? 10   ASN A OD1   1 
ATOM   75    N  ND2   . ASN A  1  10  ? 88.679  79.905  44.896  1.00 123.54 ? 10   ASN A ND2   1 
ATOM   76    N  N     . ILE A  1  11  ? 82.924  80.226  44.723  1.00 117.49 ? 11   ILE A N     1 
ATOM   77    C  CA    . ILE A  1  11  ? 81.772  79.337  44.736  1.00 115.65 ? 11   ILE A CA    1 
ATOM   78    C  C     . ILE A  1  11  ? 81.518  78.858  43.303  1.00 113.51 ? 11   ILE A C     1 
ATOM   79    O  O     . ILE A  1  11  ? 81.293  79.663  42.389  1.00 112.30 ? 11   ILE A O     1 
ATOM   80    C  CB    . ILE A  1  11  ? 80.510  80.037  45.328  1.00 116.33 ? 11   ILE A CB    1 
ATOM   81    C  CG1   . ILE A  1  11  ? 80.763  80.396  46.802  1.00 116.07 ? 11   ILE A CG1   1 
ATOM   82    C  CG2   . ILE A  1  11  ? 79.285  79.122  45.203  1.00 116.03 ? 11   ILE A CG2   1 
ATOM   83    C  CD1   . ILE A  1  11  ? 79.576  81.038  47.511  1.00 116.20 ? 11   ILE A CD1   1 
ATOM   84    N  N     . PRO A  1  12  ? 81.580  77.530  43.090  1.00 111.73 ? 12   PRO A N     1 
ATOM   85    C  CA    . PRO A  1  12  ? 81.359  76.946  41.766  1.00 110.05 ? 12   PRO A CA    1 
ATOM   86    C  C     . PRO A  1  12  ? 80.161  77.564  41.083  1.00 108.64 ? 12   PRO A C     1 
ATOM   87    O  O     . PRO A  1  12  ? 79.128  77.770  41.706  1.00 109.28 ? 12   PRO A O     1 
ATOM   88    C  CB    . PRO A  1  12  ? 81.171  75.452  42.061  1.00 110.13 ? 12   PRO A CB    1 
ATOM   89    C  CG    . PRO A  1  12  ? 80.799  75.405  43.519  1.00 111.09 ? 12   PRO A CG    1 
ATOM   90    C  CD    . PRO A  1  12  ? 81.666  76.477  44.116  1.00 111.50 ? 12   PRO A CD    1 
ATOM   91    N  N     . GLU A  1  13  ? 80.307  77.866  39.802  1.00 107.17 ? 13   GLU A N     1 
ATOM   92    C  CA    . GLU A  1  13  ? 79.230  78.480  39.052  1.00 106.01 ? 13   GLU A CA    1 
ATOM   93    C  C     . GLU A  1  13  ? 78.088  77.532  38.718  1.00 104.93 ? 13   GLU A C     1 
ATOM   94    O  O     . GLU A  1  13  ? 78.225  76.308  38.796  1.00 103.51 ? 13   GLU A O     1 
ATOM   95    C  CB    . GLU A  1  13  ? 79.778  79.088  37.774  1.00 106.92 ? 13   GLU A CB    1 
ATOM   96    C  CG    . GLU A  1  13  ? 78.919  80.206  37.243  1.00 109.96 ? 13   GLU A CG    1 
ATOM   97    C  CD    . GLU A  1  13  ? 79.717  81.181  36.406  1.00 111.43 ? 13   GLU A CD    1 
ATOM   98    O  OE1   . GLU A  1  13  ? 80.109  80.814  35.274  1.00 112.86 ? 13   GLU A OE1   1 
ATOM   99    O  OE2   . GLU A  1  13  ? 79.961  82.310  36.890  1.00 111.23 ? 13   GLU A OE2   1 
ATOM   100   N  N     . THR A  1  14  ? 76.950  78.117  38.355  1.00 104.35 ? 14   THR A N     1 
ATOM   101   C  CA    . THR A  1  14  ? 75.774  77.337  38.010  1.00 103.59 ? 14   THR A CA    1 
ATOM   102   C  C     . THR A  1  14  ? 75.642  77.255  36.495  1.00 102.40 ? 14   THR A C     1 
ATOM   103   O  O     . THR A  1  14  ? 75.566  78.277  35.809  1.00 101.35 ? 14   THR A O     1 
ATOM   104   C  CB    . THR A  1  14  ? 74.490  77.958  38.612  1.00 103.87 ? 14   THR A CB    1 
ATOM   105   O  OG1   . THR A  1  14  ? 74.661  78.131  40.028  1.00 103.40 ? 14   THR A OG1   1 
ATOM   106   C  CG2   . THR A  1  14  ? 73.282  77.045  38.357  1.00 102.90 ? 14   THR A CG2   1 
ATOM   107   N  N     . ASN A  1  15  ? 75.631  76.025  35.989  1.00 101.50 ? 15   ASN A N     1 
ATOM   108   C  CA    . ASN A  1  15  ? 75.521  75.766  34.560  1.00 100.50 ? 15   ASN A CA    1 
ATOM   109   C  C     . ASN A  1  15  ? 74.077  75.641  34.152  1.00 98.47  ? 15   ASN A C     1 
ATOM   110   O  O     . ASN A  1  15  ? 73.278  75.016  34.845  1.00 97.55  ? 15   ASN A O     1 
ATOM   111   C  CB    . ASN A  1  15  ? 76.222  74.457  34.176  1.00 102.47 ? 15   ASN A CB    1 
ATOM   112   C  CG    . ASN A  1  15  ? 77.697  74.463  34.493  1.00 102.84 ? 15   ASN A CG    1 
ATOM   113   O  OD1   . ASN A  1  15  ? 78.442  75.339  34.032  1.00 101.14 ? 15   ASN A OD1   1 
ATOM   114   N  ND2   . ASN A  1  15  ? 78.135  73.474  35.284  1.00 103.34 ? 15   ASN A ND2   1 
ATOM   115   N  N     . VAL A  1  16  ? 73.759  76.218  33.005  1.00 96.97  ? 16   VAL A N     1 
ATOM   116   C  CA    . VAL A  1  16  ? 72.412  76.158  32.485  1.00 96.83  ? 16   VAL A CA    1 
ATOM   117   C  C     . VAL A  1  16  ? 72.473  75.909  30.994  1.00 96.41  ? 16   VAL A C     1 
ATOM   118   O  O     . VAL A  1  16  ? 73.096  76.673  30.256  1.00 96.79  ? 16   VAL A O     1 
ATOM   119   C  CB    . VAL A  1  16  ? 71.653  77.483  32.727  1.00 97.56  ? 16   VAL A CB    1 
ATOM   120   C  CG1   . VAL A  1  16  ? 70.216  77.365  32.218  1.00 96.56  ? 16   VAL A CG1   1 
ATOM   121   C  CG2   . VAL A  1  16  ? 71.677  77.837  34.210  1.00 98.25  ? 16   VAL A CG2   1 
ATOM   122   N  N     . THR A  1  17  ? 71.843  74.828  30.553  1.00 96.21  ? 17   THR A N     1 
ATOM   123   C  CA    . THR A  1  17  ? 71.800  74.517  29.131  1.00 96.33  ? 17   THR A CA    1 
ATOM   124   C  C     . THR A  1  17  ? 70.368  74.141  28.754  1.00 96.79  ? 17   THR A C     1 
ATOM   125   O  O     . THR A  1  17  ? 69.756  73.244  29.347  1.00 95.92  ? 17   THR A O     1 
ATOM   126   C  CB    . THR A  1  17  ? 72.773  73.360  28.739  1.00 95.89  ? 17   THR A CB    1 
ATOM   127   O  OG1   . THR A  1  17  ? 72.329  72.123  29.314  1.00 93.90  ? 17   THR A OG1   1 
ATOM   128   C  CG2   . THR A  1  17  ? 74.194  73.673  29.212  1.00 95.14  ? 17   THR A CG2   1 
ATOM   129   N  N     . THR A  1  18  ? 69.829  74.862  27.780  1.00 96.92  ? 18   THR A N     1 
ATOM   130   C  CA    . THR A  1  18  ? 68.475  74.617  27.311  1.00 96.65  ? 18   THR A CA    1 
ATOM   131   C  C     . THR A  1  18  ? 68.514  73.455  26.329  1.00 96.90  ? 18   THR A C     1 
ATOM   132   O  O     . THR A  1  18  ? 69.512  73.265  25.629  1.00 96.51  ? 18   THR A O     1 
ATOM   133   C  CB    . THR A  1  18  ? 67.920  75.855  26.569  1.00 96.51  ? 18   THR A CB    1 
ATOM   134   O  OG1   . THR A  1  18  ? 68.018  77.004  27.420  1.00 95.84  ? 18   THR A OG1   1 
ATOM   135   C  CG2   . THR A  1  18  ? 66.463  75.636  26.152  1.00 94.95  ? 18   THR A CG2   1 
ATOM   136   N  N     . LEU A  1  19  ? 67.443  72.667  26.292  1.00 96.68  ? 19   LEU A N     1 
ATOM   137   C  CA    . LEU A  1  19  ? 67.371  71.569  25.344  1.00 96.61  ? 19   LEU A CA    1 
ATOM   138   C  C     . LEU A  1  19  ? 66.698  72.123  24.103  1.00 97.86  ? 19   LEU A C     1 
ATOM   139   O  O     . LEU A  1  19  ? 66.656  73.341  23.898  1.00 97.45  ? 19   LEU A O     1 
ATOM   140   C  CB    . LEU A  1  19  ? 66.558  70.393  25.885  1.00 94.73  ? 19   LEU A CB    1 
ATOM   141   C  CG    . LEU A  1  19  ? 67.132  69.662  27.099  1.00 94.61  ? 19   LEU A CG    1 
ATOM   142   C  CD1   . LEU A  1  19  ? 66.496  68.279  27.222  1.00 94.01  ? 19   LEU A CD1   1 
ATOM   143   C  CD2   . LEU A  1  19  ? 68.627  69.534  26.953  1.00 94.90  ? 19   LEU A CD2   1 
ATOM   144   N  N     . ASP A  1  20  ? 66.167  71.235  23.276  1.00 99.53  ? 20   ASP A N     1 
ATOM   145   C  CA    . ASP A  1  20  ? 65.511  71.669  22.057  1.00 101.12 ? 20   ASP A CA    1 
ATOM   146   C  C     . ASP A  1  20  ? 64.018  71.789  22.283  1.00 100.91 ? 20   ASP A C     1 
ATOM   147   O  O     . ASP A  1  20  ? 63.355  72.637  21.688  1.00 101.09 ? 20   ASP A O     1 
ATOM   148   C  CB    . ASP A  1  20  ? 65.820  70.693  20.918  1.00 103.12 ? 20   ASP A CB    1 
ATOM   149   C  CG    . ASP A  1  20  ? 67.307  70.651  20.577  1.00 104.59 ? 20   ASP A CG    1 
ATOM   150   O  OD1   . ASP A  1  20  ? 67.905  71.735  20.391  1.00 105.09 ? 20   ASP A OD1   1 
ATOM   151   O  OD2   . ASP A  1  20  ? 67.878  69.538  20.493  1.00 105.69 ? 20   ASP A OD2   1 
ATOM   152   N  N     . ASN A  1  21  ? 63.489  70.945  23.155  1.00 100.60 ? 21   ASN A N     1 
ATOM   153   C  CA    . ASN A  1  21  ? 62.071  70.991  23.460  1.00 101.21 ? 21   ASN A CA    1 
ATOM   154   C  C     . ASN A  1  21  ? 61.758  72.145  24.418  1.00 101.01 ? 21   ASN A C     1 
ATOM   155   O  O     . ASN A  1  21  ? 60.623  72.278  24.891  1.00 101.95 ? 21   ASN A O     1 
ATOM   156   C  CB    . ASN A  1  21  ? 61.623  69.657  24.053  1.00 101.59 ? 21   ASN A CB    1 
ATOM   157   C  CG    . ASN A  1  21  ? 62.557  69.162  25.129  1.00 101.45 ? 21   ASN A CG    1 
ATOM   158   O  OD1   . ASN A  1  21  ? 63.742  69.501  25.143  1.00 101.65 ? 21   ASN A OD1   1 
ATOM   159   N  ND2   . ASN A  1  21  ? 62.035  68.340  26.027  1.00 101.56 ? 21   ASN A ND2   1 
ATOM   160   N  N     . GLY A  1  22  ? 62.770  72.970  24.700  1.00 99.48  ? 22   GLY A N     1 
ATOM   161   C  CA    . GLY A  1  22  ? 62.589  74.127  25.566  1.00 97.41  ? 22   GLY A CA    1 
ATOM   162   C  C     . GLY A  1  22  ? 62.968  73.981  27.030  1.00 96.22  ? 22   GLY A C     1 
ATOM   163   O  O     . GLY A  1  22  ? 63.118  74.985  27.741  1.00 95.52  ? 22   GLY A O     1 
ATOM   164   N  N     . LEU A  1  23  ? 63.119  72.742  27.488  1.00 95.21  ? 23   LEU A N     1 
ATOM   165   C  CA    . LEU A  1  23  ? 63.470  72.494  28.880  1.00 94.59  ? 23   LEU A CA    1 
ATOM   166   C  C     . LEU A  1  23  ? 64.854  73.031  29.207  1.00 94.38  ? 23   LEU A C     1 
ATOM   167   O  O     . LEU A  1  23  ? 65.762  72.990  28.377  1.00 94.23  ? 23   LEU A O     1 
ATOM   168   C  CB    . LEU A  1  23  ? 63.396  70.995  29.189  1.00 94.24  ? 23   LEU A CB    1 
ATOM   169   C  CG    . LEU A  1  23  ? 63.601  70.571  30.648  1.00 94.45  ? 23   LEU A CG    1 
ATOM   170   C  CD1   . LEU A  1  23  ? 62.917  69.232  30.880  1.00 94.16  ? 23   LEU A CD1   1 
ATOM   171   C  CD2   . LEU A  1  23  ? 65.086  70.493  30.980  1.00 93.41  ? 23   LEU A CD2   1 
ATOM   172   N  N     . ARG A  1  24  ? 65.002  73.549  30.422  1.00 94.97  ? 24   ARG A N     1 
ATOM   173   C  CA    . ARG A  1  24  ? 66.276  74.101  30.882  1.00 95.17  ? 24   ARG A CA    1 
ATOM   174   C  C     . ARG A  1  24  ? 66.890  73.224  31.970  1.00 94.32  ? 24   ARG A C     1 
ATOM   175   O  O     . ARG A  1  24  ? 66.233  72.861  32.946  1.00 94.12  ? 24   ARG A O     1 
ATOM   176   C  CB    . ARG A  1  24  ? 66.075  75.527  31.408  1.00 95.83  ? 24   ARG A CB    1 
ATOM   177   C  CG    . ARG A  1  24  ? 65.947  76.598  30.317  1.00 97.54  ? 24   ARG A CG    1 
ATOM   178   C  CD    . ARG A  1  24  ? 65.267  77.853  30.849  1.00 98.03  ? 24   ARG A CD    1 
ATOM   179   N  NE    . ARG A  1  24  ? 63.850  77.603  31.102  1.00 98.41  ? 24   ARG A NE    1 
ATOM   180   C  CZ    . ARG A  1  24  ? 63.060  78.400  31.813  1.00 96.99  ? 24   ARG A CZ    1 
ATOM   181   N  NH1   . ARG A  1  24  ? 63.547  79.509  32.356  1.00 95.27  ? 24   ARG A NH1   1 
ATOM   182   N  NH2   . ARG A  1  24  ? 61.781  78.084  31.974  1.00 96.58  ? 24   ARG A NH2   1 
ATOM   183   N  N     . VAL A  1  25  ? 68.156  72.874  31.792  1.00 93.33  ? 25   VAL A N     1 
ATOM   184   C  CA    . VAL A  1  25  ? 68.834  72.039  32.765  1.00 91.60  ? 25   VAL A CA    1 
ATOM   185   C  C     . VAL A  1  25  ? 69.934  72.840  33.430  1.00 91.00  ? 25   VAL A C     1 
ATOM   186   O  O     . VAL A  1  25  ? 70.757  73.462  32.754  1.00 90.26  ? 25   VAL A O     1 
ATOM   187   C  CB    . VAL A  1  25  ? 69.431  70.795  32.104  1.00 91.27  ? 25   VAL A CB    1 
ATOM   188   C  CG1   . VAL A  1  25  ? 70.208  70.000  33.123  1.00 90.50  ? 25   VAL A CG1   1 
ATOM   189   C  CG2   . VAL A  1  25  ? 68.321  69.946  31.504  1.00 90.62  ? 25   VAL A CG2   1 
ATOM   190   N  N     . ALA A  1  26  ? 69.934  72.826  34.760  1.00 90.40  ? 26   ALA A N     1 
ATOM   191   C  CA    . ALA A  1  26  ? 70.914  73.571  35.534  1.00 89.77  ? 26   ALA A CA    1 
ATOM   192   C  C     . ALA A  1  26  ? 71.346  72.831  36.783  1.00 89.56  ? 26   ALA A C     1 
ATOM   193   O  O     . ALA A  1  26  ? 70.616  71.983  37.305  1.00 87.98  ? 26   ALA A O     1 
ATOM   194   C  CB    . ALA A  1  26  ? 70.347  74.929  35.909  1.00 90.89  ? 26   ALA A CB    1 
ATOM   195   N  N     . SER A  1  27  ? 72.531  73.181  37.279  1.00 90.46  ? 27   SER A N     1 
ATOM   196   C  CA    . SER A  1  27  ? 73.067  72.519  38.460  1.00 91.73  ? 27   SER A CA    1 
ATOM   197   C  C     . SER A  1  27  ? 74.327  73.161  39.002  1.00 91.90  ? 27   SER A C     1 
ATOM   198   O  O     . SER A  1  27  ? 75.024  73.879  38.293  1.00 91.53  ? 27   SER A O     1 
ATOM   199   C  CB    . SER A  1  27  ? 73.408  71.077  38.114  1.00 93.11  ? 27   SER A CB    1 
ATOM   200   O  OG    . SER A  1  27  ? 74.496  71.057  37.197  1.00 93.95  ? 27   SER A OG    1 
ATOM   201   N  N     . GLU A  1  28  ? 74.614  72.881  40.267  1.00 93.16  ? 28   GLU A N     1 
ATOM   202   C  CA    . GLU A  1  28  ? 75.819  73.381  40.907  1.00 95.98  ? 28   GLU A CA    1 
ATOM   203   C  C     . GLU A  1  28  ? 76.532  72.175  41.466  1.00 97.17  ? 28   GLU A C     1 
ATOM   204   O  O     . GLU A  1  28  ? 76.036  71.521  42.392  1.00 96.36  ? 28   GLU A O     1 
ATOM   205   C  CB    . GLU A  1  28  ? 75.514  74.350  42.044  1.00 97.73  ? 28   GLU A CB    1 
ATOM   206   C  CG    . GLU A  1  28  ? 76.763  74.720  42.844  1.00 100.61 ? 28   GLU A CG    1 
ATOM   207   C  CD    . GLU A  1  28  ? 76.538  75.850  43.844  1.00 102.72 ? 28   GLU A CD    1 
ATOM   208   O  OE1   . GLU A  1  28  ? 76.311  77.006  43.410  1.00 103.46 ? 28   GLU A OE1   1 
ATOM   209   O  OE2   . GLU A  1  28  ? 76.595  75.578  45.067  1.00 103.64 ? 28   GLU A OE2   1 
ATOM   210   N  N     . GLU A  1  29  ? 77.704  71.900  40.895  1.00 98.97  ? 29   GLU A N     1 
ATOM   211   C  CA    . GLU A  1  29  ? 78.519  70.756  41.269  1.00 100.53 ? 29   GLU A CA    1 
ATOM   212   C  C     . GLU A  1  29  ? 79.413  70.988  42.469  1.00 100.99 ? 29   GLU A C     1 
ATOM   213   O  O     . GLU A  1  29  ? 80.237  71.902  42.487  1.00 100.15 ? 29   GLU A O     1 
ATOM   214   C  CB    . GLU A  1  29  ? 79.354  70.303  40.066  1.00 101.78 ? 29   GLU A CB    1 
ATOM   215   C  CG    . GLU A  1  29  ? 80.259  69.103  40.333  1.00 104.31 ? 29   GLU A CG    1 
ATOM   216   C  CD    . GLU A  1  29  ? 80.746  68.433  39.051  1.00 105.64 ? 29   GLU A CD    1 
ATOM   217   O  OE1   . GLU A  1  29  ? 81.016  69.154  38.060  1.00 106.00 ? 29   GLU A OE1   1 
ATOM   218   O  OE2   . GLU A  1  29  ? 80.868  67.185  39.042  1.00 106.32 ? 29   GLU A OE2   1 
ATOM   219   N  N     . SER A  1  30  ? 79.227  70.134  43.469  1.00 102.48 ? 30   SER A N     1 
ATOM   220   C  CA    . SER A  1  30  ? 79.987  70.186  44.709  1.00 104.74 ? 30   SER A CA    1 
ATOM   221   C  C     . SER A  1  30  ? 80.837  68.938  44.817  1.00 105.29 ? 30   SER A C     1 
ATOM   222   O  O     . SER A  1  30  ? 80.833  68.084  43.926  1.00 106.31 ? 30   SER A O     1 
ATOM   223   C  CB    . SER A  1  30  ? 79.052  70.238  45.924  1.00 106.49 ? 30   SER A CB    1 
ATOM   224   O  OG    . SER A  1  30  ? 78.443  68.975  46.178  1.00 107.64 ? 30   SER A OG    1 
ATOM   225   N  N     . SER A  1  31  ? 81.544  68.829  45.932  1.00 104.68 ? 31   SER A N     1 
ATOM   226   C  CA    . SER A  1  31  ? 82.402  67.694  46.179  1.00 104.14 ? 31   SER A CA    1 
ATOM   227   C  C     . SER A  1  31  ? 81.624  66.595  46.914  1.00 103.78 ? 31   SER A C     1 
ATOM   228   O  O     . SER A  1  31  ? 82.170  65.542  47.221  1.00 104.67 ? 31   SER A O     1 
ATOM   229   C  CB    . SER A  1  31  ? 83.591  68.164  47.016  1.00 104.02 ? 31   SER A CB    1 
ATOM   230   O  OG    . SER A  1  31  ? 84.579  67.161  47.125  1.00 105.75 ? 31   SER A OG    1 
ATOM   231   N  N     . GLN A  1  32  ? 80.338  66.835  47.165  1.00 103.10 ? 32   GLN A N     1 
ATOM   232   C  CA    . GLN A  1  32  ? 79.497  65.894  47.911  1.00 101.67 ? 32   GLN A CA    1 
ATOM   233   C  C     . GLN A  1  32  ? 79.000  64.603  47.261  1.00 98.74  ? 32   GLN A C     1 
ATOM   234   O  O     . GLN A  1  32  ? 78.515  64.593  46.134  1.00 98.19  ? 32   GLN A O     1 
ATOM   235   C  CB    . GLN A  1  32  ? 78.318  66.656  48.516  1.00 104.39 ? 32   GLN A CB    1 
ATOM   236   C  CG    . GLN A  1  32  ? 78.779  67.628  49.595  1.00 107.82 ? 32   GLN A CG    1 
ATOM   237   C  CD    . GLN A  1  32  ? 77.641  68.223  50.389  1.00 109.96 ? 32   GLN A CD    1 
ATOM   238   O  OE1   . GLN A  1  32  ? 76.923  69.101  49.901  1.00 111.36 ? 32   GLN A OE1   1 
ATOM   239   N  NE2   . GLN A  1  32  ? 77.459  67.741  51.624  1.00 110.46 ? 32   GLN A NE2   1 
ATOM   240   N  N     . PRO A  1  33  ? 79.096  63.492  48.010  1.00 96.59  ? 33   PRO A N     1 
ATOM   241   C  CA    . PRO A  1  33  ? 78.719  62.111  47.682  1.00 96.37  ? 33   PRO A CA    1 
ATOM   242   C  C     . PRO A  1  33  ? 77.216  61.914  47.520  1.00 96.98  ? 33   PRO A C     1 
ATOM   243   O  O     . PRO A  1  33  ? 76.742  60.984  46.850  1.00 97.02  ? 33   PRO A O     1 
ATOM   244   C  CB    . PRO A  1  33  ? 79.260  61.331  48.871  1.00 95.64  ? 33   PRO A CB    1 
ATOM   245   C  CG    . PRO A  1  33  ? 79.022  62.272  49.996  1.00 94.90  ? 33   PRO A CG    1 
ATOM   246   C  CD    . PRO A  1  33  ? 79.505  63.586  49.424  1.00 95.68  ? 33   PRO A CD    1 
ATOM   247   N  N     . THR A  1  34  ? 76.475  62.796  48.177  1.00 96.81  ? 34   THR A N     1 
ATOM   248   C  CA    . THR A  1  34  ? 75.029  62.784  48.153  1.00 93.89  ? 34   THR A CA    1 
ATOM   249   C  C     . THR A  1  34  ? 74.615  63.979  47.286  1.00 92.51  ? 34   THR A C     1 
ATOM   250   O  O     . THR A  1  34  ? 75.439  64.853  46.982  1.00 91.24  ? 34   THR A O     1 
ATOM   251   C  CB    . THR A  1  34  ? 74.481  62.883  49.607  1.00 93.28  ? 34   THR A CB    1 
ATOM   252   O  OG1   . THR A  1  34  ? 73.075  63.116  49.572  1.00 96.28  ? 34   THR A OG1   1 
ATOM   253   C  CG2   . THR A  1  34  ? 75.167  64.002  50.387  1.00 93.10  ? 34   THR A CG2   1 
ATOM   254   N  N     . CYS A  1  35  ? 73.357  64.004  46.859  1.00 91.53  ? 35   CYS A N     1 
ATOM   255   C  CA    . CYS A  1  35  ? 72.874  65.099  46.023  1.00 89.96  ? 35   CYS A CA    1 
ATOM   256   C  C     . CYS A  1  35  ? 71.350  65.211  46.025  1.00 90.13  ? 35   CYS A C     1 
ATOM   257   O  O     . CYS A  1  35  ? 70.642  64.428  46.672  1.00 89.19  ? 35   CYS A O     1 
ATOM   258   C  CB    . CYS A  1  35  ? 73.336  64.899  44.589  1.00 87.90  ? 35   CYS A CB    1 
ATOM   259   S  SG    . CYS A  1  35  ? 72.441  63.529  43.812  1.00 86.79  ? 35   CYS A SG    1 
ATOM   260   N  N     . THR A  1  36  ? 70.863  66.199  45.278  1.00 90.14  ? 36   THR A N     1 
ATOM   261   C  CA    . THR A  1  36  ? 69.434  66.455  45.140  1.00 89.57  ? 36   THR A CA    1 
ATOM   262   C  C     . THR A  1  36  ? 69.151  66.949  43.729  1.00 88.44  ? 36   THR A C     1 
ATOM   263   O  O     . THR A  1  36  ? 69.832  67.845  43.225  1.00 87.96  ? 36   THR A O     1 
ATOM   264   C  CB    . THR A  1  36  ? 68.940  67.560  46.107  1.00 90.22  ? 36   THR A CB    1 
ATOM   265   O  OG1   . THR A  1  36  ? 69.315  67.239  47.451  1.00 91.41  ? 36   THR A OG1   1 
ATOM   266   C  CG2   . THR A  1  36  ? 67.423  67.688  46.029  1.00 91.06  ? 36   THR A CG2   1 
ATOM   267   N  N     . VAL A  1  37  ? 68.157  66.354  43.084  1.00 87.31  ? 37   VAL A N     1 
ATOM   268   C  CA    . VAL A  1  37  ? 67.772  66.787  41.751  1.00 86.05  ? 37   VAL A CA    1 
ATOM   269   C  C     . VAL A  1  37  ? 66.261  66.667  41.629  1.00 85.35  ? 37   VAL A C     1 
ATOM   270   O  O     . VAL A  1  37  ? 65.637  65.751  42.182  1.00 83.16  ? 37   VAL A O     1 
ATOM   271   C  CB    . VAL A  1  37  ? 68.448  65.957  40.624  1.00 85.64  ? 37   VAL A CB    1 
ATOM   272   C  CG1   . VAL A  1  37  ? 69.929  65.877  40.870  1.00 85.34  ? 37   VAL A CG1   1 
ATOM   273   C  CG2   . VAL A  1  37  ? 67.835  64.568  40.532  1.00 86.30  ? 37   VAL A CG2   1 
ATOM   274   N  N     . GLY A  1  38  ? 65.681  67.625  40.920  1.00 85.03  ? 38   GLY A N     1 
ATOM   275   C  CA    . GLY A  1  38  ? 64.251  67.632  40.723  1.00 84.48  ? 38   GLY A CA    1 
ATOM   276   C  C     . GLY A  1  38  ? 63.853  68.619  39.647  1.00 84.61  ? 38   GLY A C     1 
ATOM   277   O  O     . GLY A  1  38  ? 64.692  69.325  39.064  1.00 82.92  ? 38   GLY A O     1 
ATOM   278   N  N     . VAL A  1  39  ? 62.553  68.657  39.386  1.00 85.47  ? 39   VAL A N     1 
ATOM   279   C  CA    . VAL A  1  39  ? 61.993  69.549  38.387  1.00 86.19  ? 39   VAL A CA    1 
ATOM   280   C  C     . VAL A  1  39  ? 61.057  70.606  39.003  1.00 85.75  ? 39   VAL A C     1 
ATOM   281   O  O     . VAL A  1  39  ? 60.049  70.280  39.635  1.00 85.91  ? 39   VAL A O     1 
ATOM   282   C  CB    . VAL A  1  39  ? 61.233  68.740  37.289  1.00 86.07  ? 39   VAL A CB    1 
ATOM   283   C  CG1   . VAL A  1  39  ? 60.204  67.819  37.923  1.00 85.81  ? 39   VAL A CG1   1 
ATOM   284   C  CG2   . VAL A  1  39  ? 60.549  69.692  36.320  1.00 86.89  ? 39   VAL A CG2   1 
ATOM   285   N  N     . TRP A  1  40  ? 61.425  71.872  38.825  1.00 84.87  ? 40   TRP A N     1 
ATOM   286   C  CA    . TRP A  1  40  ? 60.649  73.006  39.304  1.00 82.93  ? 40   TRP A CA    1 
ATOM   287   C  C     . TRP A  1  40  ? 59.781  73.465  38.138  1.00 80.96  ? 40   TRP A C     1 
ATOM   288   O  O     . TRP A  1  40  ? 60.292  73.868  37.094  1.00 81.01  ? 40   TRP A O     1 
ATOM   289   C  CB    . TRP A  1  40  ? 61.591  74.128  39.760  1.00 84.46  ? 40   TRP A CB    1 
ATOM   290   C  CG    . TRP A  1  40  ? 62.007  73.981  41.189  1.00 87.91  ? 40   TRP A CG    1 
ATOM   291   C  CD1   . TRP A  1  40  ? 61.477  74.636  42.262  1.00 89.73  ? 40   TRP A CD1   1 
ATOM   292   C  CD2   . TRP A  1  40  ? 62.943  73.035  41.725  1.00 89.69  ? 40   TRP A CD2   1 
ATOM   293   N  NE1   . TRP A  1  40  ? 62.014  74.154  43.434  1.00 90.10  ? 40   TRP A NE1   1 
ATOM   294   C  CE2   . TRP A  1  40  ? 62.916  73.169  43.134  1.00 90.21  ? 40   TRP A CE2   1 
ATOM   295   C  CE3   . TRP A  1  40  ? 63.798  72.083  41.155  1.00 90.23  ? 40   TRP A CE3   1 
ATOM   296   C  CZ2   . TRP A  1  40  ? 63.711  72.386  43.980  1.00 90.24  ? 40   TRP A CZ2   1 
ATOM   297   C  CZ3   . TRP A  1  40  ? 64.591  71.302  42.002  1.00 90.34  ? 40   TRP A CZ3   1 
ATOM   298   C  CH2   . TRP A  1  40  ? 64.538  71.460  43.398  1.00 89.66  ? 40   TRP A CH2   1 
ATOM   299   N  N     . ILE A  1  41  ? 58.468  73.387  38.315  1.00 78.68  ? 41   ILE A N     1 
ATOM   300   C  CA    . ILE A  1  41  ? 57.526  73.781  37.276  1.00 75.88  ? 41   ILE A CA    1 
ATOM   301   C  C     . ILE A  1  41  ? 56.825  75.111  37.548  1.00 75.38  ? 41   ILE A C     1 
ATOM   302   O  O     . ILE A  1  41  ? 56.478  75.426  38.686  1.00 75.05  ? 41   ILE A O     1 
ATOM   303   C  CB    . ILE A  1  41  ? 56.440  72.730  37.116  1.00 74.41  ? 41   ILE A CB    1 
ATOM   304   C  CG1   . ILE A  1  41  ? 57.069  71.346  37.127  1.00 74.73  ? 41   ILE A CG1   1 
ATOM   305   C  CG2   . ILE A  1  41  ? 55.681  72.958  35.826  1.00 72.98  ? 41   ILE A CG2   1 
ATOM   306   C  CD1   . ILE A  1  41  ? 56.055  70.223  36.986  1.00 76.16  ? 41   ILE A CD1   1 
ATOM   307   N  N     . GLY A  1  42  ? 56.614  75.883  36.491  1.00 74.70  ? 42   GLY A N     1 
ATOM   308   C  CA    . GLY A  1  42  ? 55.919  77.148  36.618  1.00 74.63  ? 42   GLY A CA    1 
ATOM   309   C  C     . GLY A  1  42  ? 54.413  76.928  36.517  1.00 75.52  ? 42   GLY A C     1 
ATOM   310   O  O     . GLY A  1  42  ? 53.761  77.414  35.584  1.00 75.87  ? 42   GLY A O     1 
ATOM   311   N  N     . ALA A  1  43  ? 53.867  76.173  37.471  1.00 75.39  ? 43   ALA A N     1 
ATOM   312   C  CA    . ALA A  1  43  ? 52.435  75.886  37.537  1.00 75.17  ? 43   ALA A CA    1 
ATOM   313   C  C     . ALA A  1  43  ? 51.933  75.994  38.987  1.00 75.77  ? 43   ALA A C     1 
ATOM   314   O  O     . ALA A  1  43  ? 52.708  75.871  39.940  1.00 76.21  ? 43   ALA A O     1 
ATOM   315   C  CB    . ALA A  1  43  ? 52.158  74.507  36.995  1.00 74.26  ? 43   ALA A CB    1 
ATOM   316   N  N     . GLY A  1  44  ? 50.636  76.232  39.153  1.00 75.78  ? 44   GLY A N     1 
ATOM   317   C  CA    . GLY A  1  44  ? 50.078  76.353  40.489  1.00 74.97  ? 44   GLY A CA    1 
ATOM   318   C  C     . GLY A  1  44  ? 48.609  76.729  40.465  1.00 73.98  ? 44   GLY A C     1 
ATOM   319   O  O     . GLY A  1  44  ? 48.000  76.786  39.396  1.00 74.61  ? 44   GLY A O     1 
ATOM   320   N  N     . SER A  1  45  ? 48.040  77.004  41.635  1.00 71.93  ? 45   SER A N     1 
ATOM   321   C  CA    . SER A  1  45  ? 46.634  77.354  41.712  1.00 69.06  ? 45   SER A CA    1 
ATOM   322   C  C     . SER A  1  45  ? 46.346  78.622  40.935  1.00 67.56  ? 45   SER A C     1 
ATOM   323   O  O     . SER A  1  45  ? 45.233  78.812  40.458  1.00 68.84  ? 45   SER A O     1 
ATOM   324   C  CB    . SER A  1  45  ? 46.188  77.511  43.166  1.00 68.41  ? 45   SER A CB    1 
ATOM   325   O  OG    . SER A  1  45  ? 46.833  78.604  43.779  1.00 68.76  ? 45   SER A OG    1 
ATOM   326   N  N     . ARG A  1  46  ? 47.332  79.493  40.780  1.00 65.97  ? 46   ARG A N     1 
ATOM   327   C  CA    . ARG A  1  46  ? 47.068  80.717  40.025  1.00 66.37  ? 46   ARG A CA    1 
ATOM   328   C  C     . ARG A  1  46  ? 46.714  80.375  38.584  1.00 67.56  ? 46   ARG A C     1 
ATOM   329   O  O     . ARG A  1  46  ? 45.925  81.075  37.946  1.00 68.53  ? 46   ARG A O     1 
ATOM   330   C  CB    . ARG A  1  46  ? 48.266  81.673  40.021  1.00 64.44  ? 46   ARG A CB    1 
ATOM   331   C  CG    . ARG A  1  46  ? 47.950  82.953  39.259  1.00 62.12  ? 46   ARG A CG    1 
ATOM   332   C  CD    . ARG A  1  46  ? 49.073  83.973  39.267  1.00 60.91  ? 46   ARG A CD    1 
ATOM   333   N  NE    . ARG A  1  46  ? 48.652  85.192  38.580  1.00 60.00  ? 46   ARG A NE    1 
ATOM   334   C  CZ    . ARG A  1  46  ? 49.404  86.281  38.439  1.00 59.30  ? 46   ARG A CZ    1 
ATOM   335   N  NH1   . ARG A  1  46  ? 50.634  86.298  38.943  1.00 57.41  ? 46   ARG A NH1   1 
ATOM   336   N  NH2   . ARG A  1  46  ? 48.912  87.357  37.815  1.00 57.02  ? 46   ARG A NH2   1 
ATOM   337   N  N     . TYR A  1  47  ? 47.310  79.298  38.077  1.00 68.27  ? 47   TYR A N     1 
ATOM   338   C  CA    . TYR A  1  47  ? 47.058  78.865  36.714  1.00 68.30  ? 47   TYR A CA    1 
ATOM   339   C  C     . TYR A  1  47  ? 45.739  78.132  36.620  1.00 69.81  ? 47   TYR A C     1 
ATOM   340   O  O     . TYR A  1  47  ? 45.255  77.858  35.524  1.00 70.73  ? 47   TYR A O     1 
ATOM   341   C  CB    . TYR A  1  47  ? 48.177  77.956  36.212  1.00 66.36  ? 47   TYR A CB    1 
ATOM   342   C  CG    . TYR A  1  47  ? 49.509  78.646  36.073  1.00 64.31  ? 47   TYR A CG    1 
ATOM   343   C  CD1   . TYR A  1  47  ? 50.335  78.826  37.176  1.00 63.09  ? 47   TYR A CD1   1 
ATOM   344   C  CD2   . TYR A  1  47  ? 49.921  79.162  34.847  1.00 62.74  ? 47   TYR A CD2   1 
ATOM   345   C  CE1   . TYR A  1  47  ? 51.538  79.510  37.065  1.00 63.67  ? 47   TYR A CE1   1 
ATOM   346   C  CE2   . TYR A  1  47  ? 51.124  79.848  34.722  1.00 62.09  ? 47   TYR A CE2   1 
ATOM   347   C  CZ    . TYR A  1  47  ? 51.930  80.026  35.838  1.00 63.18  ? 47   TYR A CZ    1 
ATOM   348   O  OH    . TYR A  1  47  ? 53.106  80.755  35.756  1.00 63.00  ? 47   TYR A OH    1 
ATOM   349   N  N     . GLU A  1  48  ? 45.150  77.810  37.761  1.00 71.28  ? 48   GLU A N     1 
ATOM   350   C  CA    . GLU A  1  48  ? 43.881  77.114  37.735  1.00 73.76  ? 48   GLU A CA    1 
ATOM   351   C  C     . GLU A  1  48  ? 42.766  78.094  37.389  1.00 75.52  ? 48   GLU A C     1 
ATOM   352   O  O     . GLU A  1  48  ? 42.982  79.306  37.307  1.00 75.06  ? 48   GLU A O     1 
ATOM   353   C  CB    . GLU A  1  48  ? 43.608  76.459  39.088  1.00 73.54  ? 48   GLU A CB    1 
ATOM   354   C  CG    . GLU A  1  48  ? 44.705  75.530  39.535  1.00 75.60  ? 48   GLU A CG    1 
ATOM   355   C  CD    . GLU A  1  48  ? 44.422  74.895  40.869  1.00 78.62  ? 48   GLU A CD    1 
ATOM   356   O  OE1   . GLU A  1  48  ? 44.004  75.622  41.795  1.00 80.01  ? 48   GLU A OE1   1 
ATOM   357   O  OE2   . GLU A  1  48  ? 44.630  73.669  41.001  1.00 81.45  ? 48   GLU A OE2   1 
ATOM   358   N  N     . ASN A  1  49  ? 41.579  77.548  37.164  1.00 78.00  ? 49   ASN A N     1 
ATOM   359   C  CA    . ASN A  1  49  ? 40.400  78.333  36.849  1.00 79.90  ? 49   ASN A CA    1 
ATOM   360   C  C     . ASN A  1  49  ? 39.401  77.991  37.945  1.00 80.86  ? 49   ASN A C     1 
ATOM   361   O  O     . ASN A  1  49  ? 39.706  77.209  38.845  1.00 80.04  ? 49   ASN A O     1 
ATOM   362   C  CB    . ASN A  1  49  ? 39.870  77.956  35.453  1.00 82.27  ? 49   ASN A CB    1 
ATOM   363   C  CG    . ASN A  1  49  ? 38.760  76.901  35.488  1.00 85.09  ? 49   ASN A CG    1 
ATOM   364   O  OD1   . ASN A  1  49  ? 38.908  75.826  36.080  1.00 86.14  ? 49   ASN A OD1   1 
ATOM   365   N  ND2   . ASN A  1  49  ? 37.642  77.208  34.829  1.00 86.83  ? 49   ASN A ND2   1 
ATOM   366   N  N     . GLU A  1  50  ? 38.211  78.564  37.877  1.00 83.63  ? 50   GLU A N     1 
ATOM   367   C  CA    . GLU A  1  50  ? 37.199  78.318  38.900  1.00 86.94  ? 50   GLU A CA    1 
ATOM   368   C  C     . GLU A  1  50  ? 36.717  76.859  39.020  1.00 85.36  ? 50   GLU A C     1 
ATOM   369   O  O     . GLU A  1  50  ? 36.238  76.439  40.080  1.00 84.55  ? 50   GLU A O     1 
ATOM   370   C  CB    . GLU A  1  50  ? 36.005  79.255  38.655  1.00 92.21  ? 50   GLU A CB    1 
ATOM   371   C  CG    . GLU A  1  50  ? 34.866  79.144  39.673  1.00 99.03  ? 50   GLU A CG    1 
ATOM   372   C  CD    . GLU A  1  50  ? 33.536  78.760  39.021  1.00 103.62 ? 50   GLU A CD    1 
ATOM   373   O  OE1   . GLU A  1  50  ? 33.141  79.444  38.042  1.00 105.78 ? 50   GLU A OE1   1 
ATOM   374   O  OE2   . GLU A  1  50  ? 32.889  77.785  39.487  1.00 105.08 ? 50   GLU A OE2   1 
ATOM   375   N  N     . LYS A  1  51  ? 36.864  76.083  37.952  1.00 83.92  ? 51   LYS A N     1 
ATOM   376   C  CA    . LYS A  1  51  ? 36.396  74.701  37.969  1.00 83.11  ? 51   LYS A CA    1 
ATOM   377   C  C     . LYS A  1  51  ? 37.437  73.608  38.166  1.00 81.02  ? 51   LYS A C     1 
ATOM   378   O  O     . LYS A  1  51  ? 37.085  72.459  38.427  1.00 80.27  ? 51   LYS A O     1 
ATOM   379   C  CB    . LYS A  1  51  ? 35.585  74.424  36.703  1.00 85.34  ? 51   LYS A CB    1 
ATOM   380   C  CG    . LYS A  1  51  ? 34.237  75.157  36.672  1.00 88.69  ? 51   LYS A CG    1 
ATOM   381   C  CD    . LYS A  1  51  ? 33.724  75.339  35.248  1.00 91.45  ? 51   LYS A CD    1 
ATOM   382   C  CE    . LYS A  1  51  ? 34.658  76.239  34.419  1.00 92.84  ? 51   LYS A CE    1 
ATOM   383   N  NZ    . LYS A  1  51  ? 34.359  76.190  32.951  1.00 92.74  ? 51   LYS A NZ    1 
ATOM   384   N  N     . ASN A  1  52  ? 38.712  73.943  38.036  1.00 79.07  ? 52   ASN A N     1 
ATOM   385   C  CA    . ASN A  1  52  ? 39.747  72.944  38.247  1.00 76.97  ? 52   ASN A CA    1 
ATOM   386   C  C     . ASN A  1  52  ? 40.610  73.309  39.462  1.00 76.68  ? 52   ASN A C     1 
ATOM   387   O  O     . ASN A  1  52  ? 41.632  72.670  39.720  1.00 77.59  ? 52   ASN A O     1 
ATOM   388   C  CB    . ASN A  1  52  ? 40.615  72.784  36.992  1.00 75.11  ? 52   ASN A CB    1 
ATOM   389   C  CG    . ASN A  1  52  ? 41.476  73.988  36.720  1.00 74.31  ? 52   ASN A CG    1 
ATOM   390   O  OD1   . ASN A  1  52  ? 41.456  74.953  37.476  1.00 74.86  ? 52   ASN A OD1   1 
ATOM   391   N  ND2   . ASN A  1  52  ? 42.247  73.938  35.635  1.00 74.10  ? 52   ASN A ND2   1 
ATOM   392   N  N     . ASN A  1  53  ? 40.183  74.331  40.208  1.00 75.02  ? 53   ASN A N     1 
ATOM   393   C  CA    . ASN A  1  53  ? 40.889  74.786  41.409  1.00 72.86  ? 53   ASN A CA    1 
ATOM   394   C  C     . ASN A  1  53  ? 41.192  73.597  42.316  1.00 71.70  ? 53   ASN A C     1 
ATOM   395   O  O     . ASN A  1  53  ? 40.273  72.949  42.829  1.00 71.00  ? 53   ASN A O     1 
ATOM   396   C  CB    . ASN A  1  53  ? 40.024  75.788  42.183  1.00 73.53  ? 53   ASN A CB    1 
ATOM   397   C  CG    . ASN A  1  53  ? 40.758  76.426  43.375  1.00 74.86  ? 53   ASN A CG    1 
ATOM   398   O  OD1   . ASN A  1  53  ? 40.128  76.855  44.356  1.00 74.53  ? 53   ASN A OD1   1 
ATOM   399   N  ND2   . ASN A  1  53  ? 42.086  76.511  43.282  1.00 73.84  ? 53   ASN A ND2   1 
ATOM   400   N  N     . GLY A  1  54  ? 42.480  73.317  42.504  1.00 69.91  ? 54   GLY A N     1 
ATOM   401   C  CA    . GLY A  1  54  ? 42.885  72.220  43.358  1.00 69.05  ? 54   GLY A CA    1 
ATOM   402   C  C     . GLY A  1  54  ? 43.350  70.996  42.606  1.00 68.62  ? 54   GLY A C     1 
ATOM   403   O  O     . GLY A  1  54  ? 43.712  69.988  43.211  1.00 68.27  ? 54   GLY A O     1 
ATOM   404   N  N     . ALA A  1  55  ? 43.319  71.065  41.282  1.00 69.40  ? 55   ALA A N     1 
ATOM   405   C  CA    . ALA A  1  55  ? 43.768  69.942  40.464  1.00 70.19  ? 55   ALA A CA    1 
ATOM   406   C  C     . ALA A  1  55  ? 45.288  69.787  40.666  1.00 70.62  ? 55   ALA A C     1 
ATOM   407   O  O     . ALA A  1  55  ? 45.788  68.699  40.965  1.00 69.13  ? 55   ALA A O     1 
ATOM   408   C  CB    . ALA A  1  55  ? 43.442  70.202  39.001  1.00 69.37  ? 55   ALA A CB    1 
ATOM   409   N  N     . GLY A  1  56  ? 46.016  70.887  40.520  1.00 70.77  ? 56   GLY A N     1 
ATOM   410   C  CA    . GLY A  1  56  ? 47.448  70.827  40.713  1.00 71.37  ? 56   GLY A CA    1 
ATOM   411   C  C     . GLY A  1  56  ? 47.817  70.214  42.053  1.00 71.85  ? 56   GLY A C     1 
ATOM   412   O  O     . GLY A  1  56  ? 48.922  69.699  42.221  1.00 74.57  ? 56   GLY A O     1 
ATOM   413   N  N     . TYR A  1  57  ? 46.908  70.284  43.018  1.00 70.93  ? 57   TYR A N     1 
ATOM   414   C  CA    . TYR A  1  57  ? 47.160  69.723  44.344  1.00 69.53  ? 57   TYR A CA    1 
ATOM   415   C  C     . TYR A  1  57  ? 46.784  68.252  44.300  1.00 69.44  ? 57   TYR A C     1 
ATOM   416   O  O     . TYR A  1  57  ? 47.497  67.398  44.815  1.00 70.53  ? 57   TYR A O     1 
ATOM   417   C  CB    . TYR A  1  57  ? 46.310  70.453  45.398  1.00 68.92  ? 57   TYR A CB    1 
ATOM   418   C  CG    . TYR A  1  57  ? 46.640  70.128  46.849  1.00 66.63  ? 57   TYR A CG    1 
ATOM   419   C  CD1   . TYR A  1  57  ? 47.903  70.408  47.378  1.00 66.41  ? 57   TYR A CD1   1 
ATOM   420   C  CD2   . TYR A  1  57  ? 45.684  69.569  47.696  1.00 65.16  ? 57   TYR A CD2   1 
ATOM   421   C  CE1   . TYR A  1  57  ? 48.208  70.142  48.708  1.00 64.79  ? 57   TYR A CE1   1 
ATOM   422   C  CE2   . TYR A  1  57  ? 45.975  69.299  49.032  1.00 64.18  ? 57   TYR A CE2   1 
ATOM   423   C  CZ    . TYR A  1  57  ? 47.238  69.590  49.531  1.00 65.11  ? 57   TYR A CZ    1 
ATOM   424   O  OH    . TYR A  1  57  ? 47.534  69.348  50.858  1.00 66.64  ? 57   TYR A OH    1 
ATOM   425   N  N     . PHE A  1  58  ? 45.651  67.969  43.671  1.00 69.86  ? 58   PHE A N     1 
ATOM   426   C  CA    . PHE A  1  58  ? 45.141  66.612  43.523  1.00 69.44  ? 58   PHE A CA    1 
ATOM   427   C  C     . PHE A  1  58  ? 46.193  65.791  42.768  1.00 70.51  ? 58   PHE A C     1 
ATOM   428   O  O     . PHE A  1  58  ? 46.301  64.579  42.946  1.00 70.23  ? 58   PHE A O     1 
ATOM   429   C  CB    . PHE A  1  58  ? 43.838  66.668  42.731  1.00 68.00  ? 58   PHE A CB    1 
ATOM   430   C  CG    . PHE A  1  58  ? 42.861  65.600  43.082  1.00 67.82  ? 58   PHE A CG    1 
ATOM   431   C  CD1   . PHE A  1  58  ? 41.525  65.919  43.299  1.00 69.00  ? 58   PHE A CD1   1 
ATOM   432   C  CD2   . PHE A  1  58  ? 43.255  64.282  43.191  1.00 68.67  ? 58   PHE A CD2   1 
ATOM   433   C  CE1   . PHE A  1  58  ? 40.585  64.937  43.622  1.00 69.11  ? 58   PHE A CE1   1 
ATOM   434   C  CE2   . PHE A  1  58  ? 42.322  63.286  43.515  1.00 70.28  ? 58   PHE A CE2   1 
ATOM   435   C  CZ    . PHE A  1  58  ? 40.982  63.620  43.733  1.00 68.98  ? 58   PHE A CZ    1 
ATOM   436   N  N     . VAL A  1  59  ? 46.963  66.472  41.921  1.00 71.58  ? 59   VAL A N     1 
ATOM   437   C  CA    . VAL A  1  59  ? 48.018  65.841  41.133  1.00 72.31  ? 59   VAL A CA    1 
ATOM   438   C  C     . VAL A  1  59  ? 49.214  65.539  42.023  1.00 73.15  ? 59   VAL A C     1 
ATOM   439   O  O     . VAL A  1  59  ? 49.798  64.468  41.942  1.00 75.00  ? 59   VAL A O     1 
ATOM   440   C  CB    . VAL A  1  59  ? 48.466  66.756  39.960  1.00 72.47  ? 59   VAL A CB    1 
ATOM   441   C  CG1   . VAL A  1  59  ? 49.870  66.390  39.490  1.00 70.89  ? 59   VAL A CG1   1 
ATOM   442   C  CG2   . VAL A  1  59  ? 47.480  66.629  38.811  1.00 71.74  ? 59   VAL A CG2   1 
ATOM   443   N  N     . GLU A  1  60  ? 49.581  66.489  42.867  1.00 73.43  ? 60   GLU A N     1 
ATOM   444   C  CA    . GLU A  1  60  ? 50.695  66.299  43.774  1.00 74.63  ? 60   GLU A CA    1 
ATOM   445   C  C     . GLU A  1  60  ? 50.466  65.043  44.616  1.00 74.13  ? 60   GLU A C     1 
ATOM   446   O  O     . GLU A  1  60  ? 51.415  64.388  45.048  1.00 74.96  ? 60   GLU A O     1 
ATOM   447   C  CB    . GLU A  1  60  ? 50.814  67.506  44.690  1.00 77.39  ? 60   GLU A CB    1 
ATOM   448   C  CG    . GLU A  1  60  ? 52.069  67.527  45.512  1.00 81.65  ? 60   GLU A CG    1 
ATOM   449   C  CD    . GLU A  1  60  ? 51.909  68.365  46.750  1.00 83.91  ? 60   GLU A CD    1 
ATOM   450   O  OE1   . GLU A  1  60  ? 51.279  67.869  47.707  1.00 84.25  ? 60   GLU A OE1   1 
ATOM   451   O  OE2   . GLU A  1  60  ? 52.398  69.518  46.763  1.00 87.05  ? 60   GLU A OE2   1 
ATOM   452   N  N     . HIS A  1  61  ? 49.199  64.715  44.844  1.00 73.21  ? 61   HIS A N     1 
ATOM   453   C  CA    . HIS A  1  61  ? 48.829  63.535  45.624  1.00 73.36  ? 61   HIS A CA    1 
ATOM   454   C  C     . HIS A  1  61  ? 48.959  62.215  44.865  1.00 73.90  ? 61   HIS A C     1 
ATOM   455   O  O     . HIS A  1  61  ? 49.051  61.161  45.476  1.00 74.57  ? 61   HIS A O     1 
ATOM   456   C  CB    . HIS A  1  61  ? 47.386  63.657  46.107  1.00 72.35  ? 61   HIS A CB    1 
ATOM   457   C  CG    . HIS A  1  61  ? 47.234  64.437  47.368  1.00 71.23  ? 61   HIS A CG    1 
ATOM   458   N  ND1   . HIS A  1  61  ? 46.902  63.847  48.569  1.00 71.55  ? 61   HIS A ND1   1 
ATOM   459   C  CD2   . HIS A  1  61  ? 47.379  65.757  47.625  1.00 70.44  ? 61   HIS A CD2   1 
ATOM   460   C  CE1   . HIS A  1  61  ? 46.848  64.771  49.511  1.00 70.29  ? 61   HIS A CE1   1 
ATOM   461   N  NE2   . HIS A  1  61  ? 47.133  65.938  48.963  1.00 70.33  ? 61   HIS A NE2   1 
ATOM   462   N  N     . LEU A  1  62  ? 48.938  62.271  43.538  1.00 73.96  ? 62   LEU A N     1 
ATOM   463   C  CA    . LEU A  1  62  ? 49.034  61.076  42.719  1.00 72.83  ? 62   LEU A CA    1 
ATOM   464   C  C     . LEU A  1  62  ? 50.407  60.950  42.098  1.00 74.39  ? 62   LEU A C     1 
ATOM   465   O  O     . LEU A  1  62  ? 50.827  59.862  41.716  1.00 74.45  ? 62   LEU A O     1 
ATOM   466   C  CB    . LEU A  1  62  ? 47.982  61.126  41.624  1.00 71.03  ? 62   LEU A CB    1 
ATOM   467   C  CG    . LEU A  1  62  ? 46.562  61.055  42.163  1.00 70.27  ? 62   LEU A CG    1 
ATOM   468   C  CD1   . LEU A  1  62  ? 45.591  61.232  41.038  1.00 70.53  ? 62   LEU A CD1   1 
ATOM   469   C  CD2   . LEU A  1  62  ? 46.338  59.716  42.838  1.00 70.25  ? 62   LEU A CD2   1 
ATOM   470   N  N     . ALA A  1  63  ? 51.104  62.073  41.999  1.00 76.35  ? 63   ALA A N     1 
ATOM   471   C  CA    . ALA A  1  63  ? 52.439  62.108  41.423  1.00 79.57  ? 63   ALA A CA    1 
ATOM   472   C  C     . ALA A  1  63  ? 53.310  60.948  41.905  1.00 81.86  ? 63   ALA A C     1 
ATOM   473   O  O     . ALA A  1  63  ? 54.145  60.432  41.160  1.00 83.09  ? 63   ALA A O     1 
ATOM   474   C  CB    . ALA A  1  63  ? 53.110  63.438  41.762  1.00 79.26  ? 63   ALA A CB    1 
ATOM   475   N  N     . PHE A  1  64  ? 53.102  60.526  43.145  1.00 84.06  ? 64   PHE A N     1 
ATOM   476   C  CA    . PHE A  1  64  ? 53.897  59.450  43.716  1.00 86.26  ? 64   PHE A CA    1 
ATOM   477   C  C     . PHE A  1  64  ? 53.206  58.097  43.791  1.00 86.95  ? 64   PHE A C     1 
ATOM   478   O  O     . PHE A  1  64  ? 53.817  57.112  44.183  1.00 87.20  ? 64   PHE A O     1 
ATOM   479   C  CB    . PHE A  1  64  ? 54.360  59.861  45.111  1.00 87.78  ? 64   PHE A CB    1 
ATOM   480   C  CG    . PHE A  1  64  ? 55.270  61.058  45.115  1.00 88.63  ? 64   PHE A CG    1 
ATOM   481   C  CD1   . PHE A  1  64  ? 55.099  62.077  46.051  1.00 90.43  ? 64   PHE A CD1   1 
ATOM   482   C  CD2   . PHE A  1  64  ? 56.291  61.170  44.182  1.00 87.88  ? 64   PHE A CD2   1 
ATOM   483   C  CE1   . PHE A  1  64  ? 55.937  63.200  46.059  1.00 90.60  ? 64   PHE A CE1   1 
ATOM   484   C  CE2   . PHE A  1  64  ? 57.123  62.273  44.180  1.00 89.14  ? 64   PHE A CE2   1 
ATOM   485   C  CZ    . PHE A  1  64  ? 56.951  63.296  45.121  1.00 90.37  ? 64   PHE A CZ    1 
ATOM   486   N  N     . LYS A  1  65  ? 51.934  58.040  43.425  1.00 88.45  ? 65   LYS A N     1 
ATOM   487   C  CA    . LYS A  1  65  ? 51.221  56.773  43.487  1.00 90.30  ? 65   LYS A CA    1 
ATOM   488   C  C     . LYS A  1  65  ? 51.413  55.935  42.221  1.00 91.08  ? 65   LYS A C     1 
ATOM   489   O  O     . LYS A  1  65  ? 50.507  55.199  41.797  1.00 90.21  ? 65   LYS A O     1 
ATOM   490   C  CB    . LYS A  1  65  ? 49.729  57.005  43.761  1.00 91.55  ? 65   LYS A CB    1 
ATOM   491   C  CG    . LYS A  1  65  ? 49.429  57.873  44.997  1.00 92.51  ? 65   LYS A CG    1 
ATOM   492   C  CD    . LYS A  1  65  ? 50.245  57.465  46.226  1.00 92.92  ? 65   LYS A CD    1 
ATOM   493   C  CE    . LYS A  1  65  ? 50.174  58.523  47.335  1.00 93.79  ? 65   LYS A CE    1 
ATOM   494   N  NZ    . LYS A  1  65  ? 51.400  58.551  48.201  1.00 93.12  ? 65   LYS A NZ    1 
ATOM   495   N  N     . GLY A  1  66  ? 52.599  56.075  41.621  1.00 91.46  ? 66   GLY A N     1 
ATOM   496   C  CA    . GLY A  1  66  ? 52.951  55.310  40.436  1.00 91.50  ? 66   GLY A CA    1 
ATOM   497   C  C     . GLY A  1  66  ? 52.672  55.858  39.048  1.00 91.83  ? 66   GLY A C     1 
ATOM   498   O  O     . GLY A  1  66  ? 51.715  56.604  38.828  1.00 91.01  ? 66   GLY A O     1 
ATOM   499   N  N     . THR A  1  67  ? 53.526  55.455  38.106  1.00 93.04  ? 67   THR A N     1 
ATOM   500   C  CA    . THR A  1  67  ? 53.429  55.852  36.704  1.00 94.83  ? 67   THR A CA    1 
ATOM   501   C  C     . THR A  1  67  ? 53.015  54.631  35.898  1.00 96.97  ? 67   THR A C     1 
ATOM   502   O  O     . THR A  1  67  ? 52.824  53.553  36.459  1.00 97.18  ? 67   THR A O     1 
ATOM   503   C  CB    . THR A  1  67  ? 54.780  56.321  36.144  1.00 94.46  ? 67   THR A CB    1 
ATOM   504   O  OG1   . THR A  1  67  ? 55.594  55.180  35.855  1.00 93.86  ? 67   THR A OG1   1 
ATOM   505   C  CG2   . THR A  1  67  ? 55.503  57.204  37.153  1.00 95.38  ? 67   THR A CG2   1 
ATOM   506   N  N     . LYS A  1  68  ? 52.896  54.790  34.581  1.00 99.72  ? 68   LYS A N     1 
ATOM   507   C  CA    . LYS A  1  68  ? 52.493  53.684  33.710  1.00 101.92 ? 68   LYS A CA    1 
ATOM   508   C  C     . LYS A  1  68  ? 53.592  52.645  33.521  1.00 102.60 ? 68   LYS A C     1 
ATOM   509   O  O     . LYS A  1  68  ? 53.337  51.440  33.601  1.00 102.94 ? 68   LYS A O     1 
ATOM   510   C  CB    . LYS A  1  68  ? 52.044  54.210  32.343  1.00 103.21 ? 68   LYS A CB    1 
ATOM   511   C  CG    . LYS A  1  68  ? 50.656  54.822  32.352  1.00 105.33 ? 68   LYS A CG    1 
ATOM   512   C  CD    . LYS A  1  68  ? 50.273  55.368  30.989  1.00 107.89 ? 68   LYS A CD    1 
ATOM   513   C  CE    . LYS A  1  68  ? 48.864  55.947  31.015  1.00 109.74 ? 68   LYS A CE    1 
ATOM   514   N  NZ    . LYS A  1  68  ? 48.430  56.435  29.673  1.00 112.11 ? 68   LYS A NZ    1 
ATOM   515   N  N     . LYS A  1  69  ? 54.815  53.103  33.276  1.00 102.77 ? 69   LYS A N     1 
ATOM   516   C  CA    . LYS A  1  69  ? 55.925  52.179  33.084  1.00 102.79 ? 69   LYS A CA    1 
ATOM   517   C  C     . LYS A  1  69  ? 56.139  51.307  34.335  1.00 102.12 ? 69   LYS A C     1 
ATOM   518   O  O     . LYS A  1  69  ? 56.712  50.219  34.247  1.00 102.59 ? 69   LYS A O     1 
ATOM   519   C  CB    . LYS A  1  69  ? 57.215  52.948  32.750  1.00 104.19 ? 69   LYS A CB    1 
ATOM   520   C  CG    . LYS A  1  69  ? 58.297  52.105  32.045  1.00 104.93 ? 69   LYS A CG    1 
ATOM   521   C  CD    . LYS A  1  69  ? 59.676  52.786  32.042  1.00 105.97 ? 69   LYS A CD    1 
ATOM   522   C  CE    . LYS A  1  69  ? 59.699  54.124  31.282  1.00 106.56 ? 69   LYS A CE    1 
ATOM   523   N  NZ    . LYS A  1  69  ? 60.972  54.914  31.495  1.00 104.79 ? 69   LYS A NZ    1 
ATOM   524   N  N     . ARG A  1  70  ? 55.675  51.776  35.494  1.00 100.68 ? 70   ARG A N     1 
ATOM   525   C  CA    . ARG A  1  70  ? 55.836  51.019  36.738  1.00 98.81  ? 70   ARG A CA    1 
ATOM   526   C  C     . ARG A  1  70  ? 54.857  51.451  37.832  1.00 98.25  ? 70   ARG A C     1 
ATOM   527   O  O     . ARG A  1  70  ? 55.047  52.477  38.481  1.00 97.03  ? 70   ARG A O     1 
ATOM   528   C  CB    . ARG A  1  70  ? 57.280  51.141  37.237  1.00 97.62  ? 70   ARG A CB    1 
ATOM   529   C  CG    . ARG A  1  70  ? 57.686  52.518  37.715  1.00 94.94  ? 70   ARG A CG    1 
ATOM   530   C  CD    . ARG A  1  70  ? 59.180  52.707  37.595  1.00 92.62  ? 70   ARG A CD    1 
ATOM   531   N  NE    . ARG A  1  70  ? 59.553  53.147  36.255  1.00 92.00  ? 70   ARG A NE    1 
ATOM   532   C  CZ    . ARG A  1  70  ? 60.792  53.473  35.892  1.00 92.54  ? 70   ARG A CZ    1 
ATOM   533   N  NH1   . ARG A  1  70  ? 61.784  53.402  36.766  1.00 92.97  ? 70   ARG A NH1   1 
ATOM   534   N  NH2   . ARG A  1  70  ? 61.041  53.889  34.658  1.00 92.51  ? 70   ARG A NH2   1 
ATOM   535   N  N     . PRO A  1  71  ? 53.802  50.647  38.058  1.00 98.88  ? 71   PRO A N     1 
ATOM   536   C  CA    . PRO A  1  71  ? 52.761  50.906  39.058  1.00 99.85  ? 71   PRO A CA    1 
ATOM   537   C  C     . PRO A  1  71  ? 53.241  51.176  40.487  1.00 100.45 ? 71   PRO A C     1 
ATOM   538   O  O     . PRO A  1  71  ? 54.433  51.074  40.785  1.00 100.80 ? 71   PRO A O     1 
ATOM   539   C  CB    . PRO A  1  71  ? 51.846  49.680  38.940  1.00 99.15  ? 71   PRO A CB    1 
ATOM   540   C  CG    . PRO A  1  71  ? 52.761  48.617  38.464  1.00 99.10  ? 71   PRO A CG    1 
ATOM   541   C  CD    . PRO A  1  71  ? 53.588  49.334  37.427  1.00 99.42  ? 71   PRO A CD    1 
ATOM   542   N  N     . CYS A  1  72  ? 52.285  51.532  41.348  1.00 100.85 ? 72   CYS A N     1 
ATOM   543   C  CA    . CYS A  1  72  ? 52.516  51.885  42.747  1.00 100.63 ? 72   CYS A CA    1 
ATOM   544   C  C     . CYS A  1  72  ? 53.609  51.103  43.469  1.00 99.98  ? 72   CYS A C     1 
ATOM   545   O  O     . CYS A  1  72  ? 54.721  51.608  43.647  1.00 100.07 ? 72   CYS A O     1 
ATOM   546   C  CB    . CYS A  1  72  ? 51.200  51.776  43.524  1.00 101.19 ? 72   CYS A CB    1 
ATOM   547   S  SG    . CYS A  1  72  ? 51.173  52.748  45.044  1.00 104.21 ? 72   CYS A SG    1 
ATOM   548   N  N     . ALA A  1  73  ? 53.282  49.883  43.894  1.00 98.94  ? 73   ALA A N     1 
ATOM   549   C  CA    . ALA A  1  73  ? 54.219  49.010  44.605  1.00 97.40  ? 73   ALA A CA    1 
ATOM   550   C  C     . ALA A  1  73  ? 55.641  49.102  44.052  1.00 96.28  ? 73   ALA A C     1 
ATOM   551   O  O     . ALA A  1  73  ? 56.595  49.384  44.782  1.00 95.46  ? 73   ALA A O     1 
ATOM   552   C  CB    . ALA A  1  73  ? 53.732  47.569  44.534  1.00 97.27  ? 73   ALA A CB    1 
ATOM   553   N  N     . ALA A  1  74  ? 55.766  48.858  42.753  1.00 95.29  ? 74   ALA A N     1 
ATOM   554   C  CA    . ALA A  1  74  ? 57.052  48.906  42.068  1.00 94.37  ? 74   ALA A CA    1 
ATOM   555   C  C     . ALA A  1  74  ? 57.771  50.232  42.273  1.00 93.75  ? 74   ALA A C     1 
ATOM   556   O  O     . ALA A  1  74  ? 58.913  50.273  42.737  1.00 92.86  ? 74   ALA A O     1 
ATOM   557   C  CB    . ALA A  1  74  ? 56.845  48.663  40.577  1.00 94.10  ? 74   ALA A CB    1 
ATOM   558   N  N     . PHE A  1  75  ? 57.093  51.314  41.908  1.00 93.62  ? 75   PHE A N     1 
ATOM   559   C  CA    . PHE A  1  75  ? 57.663  52.640  42.029  1.00 93.66  ? 75   PHE A CA    1 
ATOM   560   C  C     . PHE A  1  75  ? 58.232  52.881  43.419  1.00 93.83  ? 75   PHE A C     1 
ATOM   561   O  O     . PHE A  1  75  ? 59.430  53.121  43.572  1.00 94.19  ? 75   PHE A O     1 
ATOM   562   C  CB    . PHE A  1  75  ? 56.612  53.711  41.701  1.00 93.70  ? 75   PHE A CB    1 
ATOM   563   C  CG    . PHE A  1  75  ? 57.148  55.121  41.762  1.00 94.49  ? 75   PHE A CG    1 
ATOM   564   C  CD1   . PHE A  1  75  ? 58.091  55.561  40.843  1.00 95.43  ? 75   PHE A CD1   1 
ATOM   565   C  CD2   . PHE A  1  75  ? 56.754  55.992  42.773  1.00 94.32  ? 75   PHE A CD2   1 
ATOM   566   C  CE1   . PHE A  1  75  ? 58.637  56.846  40.933  1.00 95.03  ? 75   PHE A CE1   1 
ATOM   567   C  CE2   . PHE A  1  75  ? 57.294  57.274  42.868  1.00 93.04  ? 75   PHE A CE2   1 
ATOM   568   C  CZ    . PHE A  1  75  ? 58.237  57.697  41.946  1.00 93.81  ? 75   PHE A CZ    1 
ATOM   569   N  N     . GLU A  1  76  ? 57.379  52.804  44.433  1.00 94.04  ? 76   GLU A N     1 
ATOM   570   C  CA    . GLU A  1  76  ? 57.815  53.048  45.804  1.00 94.38  ? 76   GLU A CA    1 
ATOM   571   C  C     . GLU A  1  76  ? 59.013  52.186  46.185  1.00 94.17  ? 76   GLU A C     1 
ATOM   572   O  O     . GLU A  1  76  ? 60.074  52.691  46.573  1.00 93.25  ? 76   GLU A O     1 
ATOM   573   C  CB    . GLU A  1  76  ? 56.658  52.791  46.775  1.00 94.69  ? 76   GLU A CB    1 
ATOM   574   C  CG    . GLU A  1  76  ? 55.451  53.687  46.555  1.00 95.12  ? 76   GLU A CG    1 
ATOM   575   C  CD    . GLU A  1  76  ? 54.363  53.464  47.583  1.00 95.83  ? 76   GLU A CD    1 
ATOM   576   O  OE1   . GLU A  1  76  ? 53.717  52.393  47.562  1.00 94.96  ? 76   GLU A OE1   1 
ATOM   577   O  OE2   . GLU A  1  76  ? 54.161  54.367  48.417  1.00 97.33  ? 76   GLU A OE2   1 
ATOM   578   N  N     . LYS A  1  77  ? 58.827  50.877  46.065  1.00 94.45  ? 77   LYS A N     1 
ATOM   579   C  CA    . LYS A  1  77  ? 59.868  49.918  46.393  1.00 94.18  ? 77   LYS A CA    1 
ATOM   580   C  C     . LYS A  1  77  ? 61.175  50.244  45.682  1.00 93.41  ? 77   LYS A C     1 
ATOM   581   O  O     . LYS A  1  77  ? 62.238  50.163  46.281  1.00 93.32  ? 77   LYS A O     1 
ATOM   582   C  CB    . LYS A  1  77  ? 59.399  48.509  46.024  1.00 94.41  ? 77   LYS A CB    1 
ATOM   583   C  CG    . LYS A  1  77  ? 60.371  47.410  46.394  1.00 94.45  ? 77   LYS A CG    1 
ATOM   584   C  CD    . LYS A  1  77  ? 59.787  46.043  46.067  1.00 95.29  ? 77   LYS A CD    1 
ATOM   585   C  CE    . LYS A  1  77  ? 60.805  44.938  46.289  1.00 96.20  ? 77   LYS A CE    1 
ATOM   586   N  NZ    . LYS A  1  77  ? 60.257  43.610  45.905  1.00 96.93  ? 77   LYS A NZ    1 
ATOM   587   N  N     . GLU A  1  78  ? 61.101  50.615  44.409  1.00 93.00  ? 78   GLU A N     1 
ATOM   588   C  CA    . GLU A  1  78  ? 62.308  50.945  43.669  1.00 92.87  ? 78   GLU A CA    1 
ATOM   589   C  C     . GLU A  1  78  ? 63.027  52.152  44.263  1.00 93.96  ? 78   GLU A C     1 
ATOM   590   O  O     . GLU A  1  78  ? 64.257  52.182  44.322  1.00 94.00  ? 78   GLU A O     1 
ATOM   591   C  CB    . GLU A  1  78  ? 61.987  51.225  42.198  1.00 91.85  ? 78   GLU A CB    1 
ATOM   592   C  CG    . GLU A  1  78  ? 63.179  51.821  41.450  1.00 91.51  ? 78   GLU A CG    1 
ATOM   593   C  CD    . GLU A  1  78  ? 62.984  51.898  39.948  1.00 91.02  ? 78   GLU A CD    1 
ATOM   594   O  OE1   . GLU A  1  78  ? 63.941  52.329  39.257  1.00 89.99  ? 78   GLU A OE1   1 
ATOM   595   O  OE2   . GLU A  1  78  ? 61.887  51.527  39.467  1.00 89.93  ? 78   GLU A OE2   1 
ATOM   596   N  N     . VAL A  1  79  ? 62.258  53.145  44.705  1.00 95.58  ? 79   VAL A N     1 
ATOM   597   C  CA    . VAL A  1  79  ? 62.829  54.366  45.278  1.00 96.61  ? 79   VAL A CA    1 
ATOM   598   C  C     . VAL A  1  79  ? 63.374  54.138  46.675  1.00 96.87  ? 79   VAL A C     1 
ATOM   599   O  O     . VAL A  1  79  ? 64.499  54.532  46.997  1.00 96.08  ? 79   VAL A O     1 
ATOM   600   C  CB    . VAL A  1  79  ? 61.787  55.488  45.366  1.00 96.39  ? 79   VAL A CB    1 
ATOM   601   C  CG1   . VAL A  1  79  ? 62.472  56.784  45.798  1.00 97.12  ? 79   VAL A CG1   1 
ATOM   602   C  CG2   . VAL A  1  79  ? 61.085  55.655  44.025  1.00 96.16  ? 79   VAL A CG2   1 
ATOM   603   N  N     . GLU A  1  80  ? 62.552  53.517  47.510  1.00 97.57  ? 80   GLU A N     1 
ATOM   604   C  CA    . GLU A  1  80  ? 62.950  53.221  48.871  1.00 98.81  ? 80   GLU A CA    1 
ATOM   605   C  C     . GLU A  1  80  ? 64.256  52.432  48.846  1.00 99.30  ? 80   GLU A C     1 
ATOM   606   O  O     . GLU A  1  80  ? 65.275  52.861  49.391  1.00 99.43  ? 80   GLU A O     1 
ATOM   607   C  CB    . GLU A  1  80  ? 61.863  52.396  49.571  1.00 98.62  ? 80   GLU A CB    1 
ATOM   608   C  CG    . GLU A  1  80  ? 60.626  53.174  49.957  1.00 99.51  ? 80   GLU A CG    1 
ATOM   609   C  CD    . GLU A  1  80  ? 59.483  52.276  50.377  1.00 100.33 ? 80   GLU A CD    1 
ATOM   610   O  OE1   . GLU A  1  80  ? 59.672  51.451  51.290  1.00 100.80 ? 80   GLU A OE1   1 
ATOM   611   O  OE2   . GLU A  1  80  ? 58.388  52.396  49.795  1.00 101.45 ? 80   GLU A OE2   1 
ATOM   612   N  N     . SER A  1  81  ? 64.212  51.282  48.179  1.00 99.87  ? 81   SER A N     1 
ATOM   613   C  CA    . SER A  1  81  ? 65.352  50.378  48.084  1.00 99.56  ? 81   SER A CA    1 
ATOM   614   C  C     . SER A  1  81  ? 66.689  51.007  47.715  1.00 99.75  ? 81   SER A C     1 
ATOM   615   O  O     . SER A  1  81  ? 67.737  50.418  47.969  1.00 100.90 ? 81   SER A O     1 
ATOM   616   C  CB    . SER A  1  81  ? 65.027  49.241  47.115  1.00 98.36  ? 81   SER A CB    1 
ATOM   617   O  OG    . SER A  1  81  ? 64.622  49.759  45.867  1.00 97.99  ? 81   SER A OG    1 
ATOM   618   N  N     . MET A  1  82  ? 66.674  52.191  47.119  1.00 99.80  ? 82   MET A N     1 
ATOM   619   C  CA    . MET A  1  82  ? 67.933  52.832  46.764  1.00 100.11 ? 82   MET A CA    1 
ATOM   620   C  C     . MET A  1  82  ? 68.307  53.936  47.750  1.00 100.11 ? 82   MET A C     1 
ATOM   621   O  O     . MET A  1  82  ? 69.236  54.717  47.512  1.00 99.90  ? 82   MET A O     1 
ATOM   622   C  CB    . MET A  1  82  ? 67.864  53.375  45.341  1.00 100.63 ? 82   MET A CB    1 
ATOM   623   C  CG    . MET A  1  82  ? 66.687  54.266  45.058  1.00 101.09 ? 82   MET A CG    1 
ATOM   624   S  SD    . MET A  1  82  ? 66.605  54.588  43.298  1.00 103.93 ? 82   MET A SD    1 
ATOM   625   C  CE    . MET A  1  82  ? 68.196  55.426  43.032  1.00 100.90 ? 82   MET A CE    1 
ATOM   626   N  N     . GLY A  1  83  ? 67.574  53.972  48.864  1.00 100.12 ? 83   GLY A N     1 
ATOM   627   C  CA    . GLY A  1  83  ? 67.809  54.945  49.919  1.00 99.86  ? 83   GLY A CA    1 
ATOM   628   C  C     . GLY A  1  83  ? 67.516  56.385  49.555  1.00 100.09 ? 83   GLY A C     1 
ATOM   629   O  O     . GLY A  1  83  ? 67.901  57.296  50.293  1.00 99.70  ? 83   GLY A O     1 
ATOM   630   N  N     . ALA A  1  84  ? 66.824  56.590  48.433  1.00 100.29 ? 84   ALA A N     1 
ATOM   631   C  CA    . ALA A  1  84  ? 66.490  57.929  47.951  1.00 100.59 ? 84   ALA A CA    1 
ATOM   632   C  C     . ALA A  1  84  ? 65.210  58.498  48.561  1.00 101.02 ? 84   ALA A C     1 
ATOM   633   O  O     . ALA A  1  84  ? 64.279  57.758  48.880  1.00 101.41 ? 84   ALA A O     1 
ATOM   634   C  CB    . ALA A  1  84  ? 66.374  57.914  46.431  1.00 99.90  ? 84   ALA A CB    1 
ATOM   635   N  N     . HIS A  1  85  ? 65.173  59.823  48.711  1.00 100.89 ? 85   HIS A N     1 
ATOM   636   C  CA    . HIS A  1  85  ? 64.022  60.526  49.273  1.00 99.22  ? 85   HIS A CA    1 
ATOM   637   C  C     . HIS A  1  85  ? 63.257  61.278  48.209  1.00 97.55  ? 85   HIS A C     1 
ATOM   638   O  O     . HIS A  1  85  ? 63.819  62.148  47.530  1.00 96.01  ? 85   HIS A O     1 
ATOM   639   C  CB    . HIS A  1  85  ? 64.468  61.538  50.321  1.00 101.18 ? 85   HIS A CB    1 
ATOM   640   C  CG    . HIS A  1  85  ? 64.932  60.920  51.599  1.00 103.71 ? 85   HIS A CG    1 
ATOM   641   N  ND1   . HIS A  1  85  ? 65.563  61.644  52.588  1.00 104.79 ? 85   HIS A ND1   1 
ATOM   642   C  CD2   . HIS A  1  85  ? 64.854  59.648  52.054  1.00 104.69 ? 85   HIS A CD2   1 
ATOM   643   C  CE1   . HIS A  1  85  ? 65.856  60.842  53.597  1.00 105.74 ? 85   HIS A CE1   1 
ATOM   644   N  NE2   . HIS A  1  85  ? 65.437  59.626  53.298  1.00 105.49 ? 85   HIS A NE2   1 
ATOM   645   N  N     . PHE A  1  86  ? 61.977  60.948  48.068  1.00 96.12  ? 86   PHE A N     1 
ATOM   646   C  CA    . PHE A  1  86  ? 61.150  61.639  47.094  1.00 95.48  ? 86   PHE A CA    1 
ATOM   647   C  C     . PHE A  1  86  ? 60.159  62.553  47.805  1.00 94.12  ? 86   PHE A C     1 
ATOM   648   O  O     . PHE A  1  86  ? 59.408  62.118  48.681  1.00 93.59  ? 86   PHE A O     1 
ATOM   649   C  CB    . PHE A  1  86  ? 60.385  60.664  46.190  1.00 95.64  ? 86   PHE A CB    1 
ATOM   650   C  CG    . PHE A  1  86  ? 60.149  61.201  44.798  1.00 96.99  ? 86   PHE A CG    1 
ATOM   651   C  CD1   . PHE A  1  86  ? 60.254  62.571  44.535  1.00 98.42  ? 86   PHE A CD1   1 
ATOM   652   C  CD2   . PHE A  1  86  ? 59.829  60.349  43.749  1.00 98.06  ? 86   PHE A CD2   1 
ATOM   653   C  CE1   . PHE A  1  86  ? 60.043  63.086  43.244  1.00 99.10  ? 86   PHE A CE1   1 
ATOM   654   C  CE2   . PHE A  1  86  ? 59.614  60.853  42.452  1.00 99.20  ? 86   PHE A CE2   1 
ATOM   655   C  CZ    . PHE A  1  86  ? 59.722  62.225  42.203  1.00 99.09  ? 86   PHE A CZ    1 
ATOM   656   N  N     . ASN A  1  87  ? 60.181  63.827  47.418  1.00 92.30  ? 87   ASN A N     1 
ATOM   657   C  CA    . ASN A  1  87  ? 59.301  64.834  47.988  1.00 90.17  ? 87   ASN A CA    1 
ATOM   658   C  C     . ASN A  1  87  ? 59.019  65.917  46.946  1.00 88.27  ? 87   ASN A C     1 
ATOM   659   O  O     . ASN A  1  87  ? 59.629  65.952  45.873  1.00 88.82  ? 87   ASN A O     1 
ATOM   660   C  CB    . ASN A  1  87  ? 59.951  65.453  49.235  1.00 90.76  ? 87   ASN A CB    1 
ATOM   661   C  CG    . ASN A  1  87  ? 58.987  66.312  50.040  1.00 90.58  ? 87   ASN A CG    1 
ATOM   662   O  OD1   . ASN A  1  87  ? 58.039  65.812  50.656  1.00 89.07  ? 87   ASN A OD1   1 
ATOM   663   N  ND2   . ASN A  1  87  ? 59.225  67.616  50.036  1.00 91.50  ? 87   ASN A ND2   1 
ATOM   664   N  N     . GLY A  1  88  ? 58.084  66.798  47.275  1.00 85.92  ? 88   GLY A N     1 
ATOM   665   C  CA    . GLY A  1  88  ? 57.721  67.874  46.375  1.00 83.04  ? 88   GLY A CA    1 
ATOM   666   C  C     . GLY A  1  88  ? 56.600  68.721  46.946  1.00 80.26  ? 88   GLY A C     1 
ATOM   667   O  O     . GLY A  1  88  ? 56.083  68.433  48.027  1.00 79.37  ? 88   GLY A O     1 
ATOM   668   N  N     . TYR A  1  89  ? 56.216  69.761  46.216  1.00 78.08  ? 89   TYR A N     1 
ATOM   669   C  CA    . TYR A  1  89  ? 55.156  70.643  46.668  1.00 76.02  ? 89   TYR A CA    1 
ATOM   670   C  C     . TYR A  1  89  ? 54.443  71.375  45.534  1.00 76.64  ? 89   TYR A C     1 
ATOM   671   O  O     . TYR A  1  89  ? 54.701  71.135  44.349  1.00 77.31  ? 89   TYR A O     1 
ATOM   672   C  CB    . TYR A  1  89  ? 55.731  71.654  47.646  1.00 73.07  ? 89   TYR A CB    1 
ATOM   673   C  CG    . TYR A  1  89  ? 56.707  72.629  47.028  1.00 69.95  ? 89   TYR A CG    1 
ATOM   674   C  CD1   . TYR A  1  89  ? 56.263  73.645  46.182  1.00 67.86  ? 89   TYR A CD1   1 
ATOM   675   C  CD2   . TYR A  1  89  ? 58.068  72.552  47.311  1.00 67.61  ? 89   TYR A CD2   1 
ATOM   676   C  CE1   . TYR A  1  89  ? 57.138  74.551  45.644  1.00 67.23  ? 89   TYR A CE1   1 
ATOM   677   C  CE2   . TYR A  1  89  ? 58.954  73.456  46.774  1.00 66.74  ? 89   TYR A CE2   1 
ATOM   678   C  CZ    . TYR A  1  89  ? 58.483  74.456  45.940  1.00 67.25  ? 89   TYR A CZ    1 
ATOM   679   O  OH    . TYR A  1  89  ? 59.352  75.372  45.393  1.00 68.57  ? 89   TYR A OH    1 
ATOM   680   N  N     . THR A  1  90  ? 53.545  72.278  45.909  1.00 76.37  ? 90   THR A N     1 
ATOM   681   C  CA    . THR A  1  90  ? 52.798  73.037  44.926  1.00 75.83  ? 90   THR A CA    1 
ATOM   682   C  C     . THR A  1  90  ? 52.165  74.271  45.573  1.00 75.99  ? 90   THR A C     1 
ATOM   683   O  O     . THR A  1  90  ? 51.322  74.148  46.458  1.00 76.63  ? 90   THR A O     1 
ATOM   684   C  CB    . THR A  1  90  ? 51.716  72.129  44.245  1.00 75.11  ? 90   THR A CB    1 
ATOM   685   O  OG1   . THR A  1  90  ? 50.998  72.890  43.276  1.00 76.12  ? 90   THR A OG1   1 
ATOM   686   C  CG2   . THR A  1  90  ? 50.748  71.549  45.256  1.00 72.78  ? 90   THR A CG2   1 
ATOM   687   N  N     . SER A  1  91  ? 52.602  75.457  45.146  1.00 75.47  ? 91   SER A N     1 
ATOM   688   C  CA    . SER A  1  91  ? 52.074  76.726  45.660  1.00 74.25  ? 91   SER A CA    1 
ATOM   689   C  C     . SER A  1  91  ? 51.128  77.374  44.635  1.00 73.27  ? 91   SER A C     1 
ATOM   690   O  O     . SER A  1  91  ? 50.594  76.706  43.744  1.00 72.98  ? 91   SER A O     1 
ATOM   691   C  CB    . SER A  1  91  ? 53.217  77.703  45.952  1.00 75.71  ? 91   SER A CB    1 
ATOM   692   O  OG    . SER A  1  91  ? 53.525  78.510  44.810  1.00 76.41  ? 91   SER A OG    1 
ATOM   693   N  N     . ARG A  1  92  ? 50.935  78.684  44.761  1.00 71.50  ? 92   ARG A N     1 
ATOM   694   C  CA    . ARG A  1  92  ? 50.068  79.415  43.851  1.00 69.20  ? 92   ARG A CA    1 
ATOM   695   C  C     . ARG A  1  92  ? 50.681  79.576  42.457  1.00 68.49  ? 92   ARG A C     1 
ATOM   696   O  O     . ARG A  1  92  ? 49.982  79.444  41.450  1.00 68.77  ? 92   ARG A O     1 
ATOM   697   C  CB    . ARG A  1  92  ? 49.734  80.794  44.435  1.00 68.35  ? 92   ARG A CB    1 
ATOM   698   C  CG    . ARG A  1  92  ? 48.876  80.742  45.693  1.00 67.46  ? 92   ARG A CG    1 
ATOM   699   C  CD    . ARG A  1  92  ? 48.183  82.076  45.998  1.00 65.33  ? 92   ARG A CD    1 
ATOM   700   N  NE    . ARG A  1  92  ? 47.150  81.887  47.009  1.00 61.87  ? 92   ARG A NE    1 
ATOM   701   C  CZ    . ARG A  1  92  ? 47.398  81.696  48.300  1.00 61.88  ? 92   ARG A CZ    1 
ATOM   702   N  NH1   . ARG A  1  92  ? 48.643  81.690  48.742  1.00 61.74  ? 92   ARG A NH1   1 
ATOM   703   N  NH2   . ARG A  1  92  ? 46.405  81.464  49.145  1.00 63.25  ? 92   ARG A NH2   1 
ATOM   704   N  N     . GLU A  1  93  ? 51.980  79.857  42.398  1.00 66.60  ? 93   GLU A N     1 
ATOM   705   C  CA    . GLU A  1  93  ? 52.659  80.032  41.111  1.00 65.00  ? 93   GLU A CA    1 
ATOM   706   C  C     . GLU A  1  93  ? 53.865  79.111  40.873  1.00 64.69  ? 93   GLU A C     1 
ATOM   707   O  O     . GLU A  1  93  ? 54.710  79.433  40.048  1.00 64.24  ? 93   GLU A O     1 
ATOM   708   C  CB    . GLU A  1  93  ? 53.175  81.458  40.973  1.00 63.15  ? 93   GLU A CB    1 
ATOM   709   C  CG    . GLU A  1  93  ? 52.233  82.480  40.421  1.00 60.96  ? 93   GLU A CG    1 
ATOM   710   C  CD    . GLU A  1  93  ? 52.986  83.751  39.991  1.00 60.95  ? 93   GLU A CD    1 
ATOM   711   O  OE1   . GLU A  1  93  ? 54.078  84.039  40.546  1.00 60.26  ? 93   GLU A OE1   1 
ATOM   712   O  OE2   . GLU A  1  93  ? 52.482  84.465  39.103  1.00 60.14  ? 93   GLU A OE2   1 
ATOM   713   N  N     . GLN A  1  94  ? 53.966  77.980  41.563  1.00 64.11  ? 94   GLN A N     1 
ATOM   714   C  CA    . GLN A  1  94  ? 55.140  77.130  41.377  1.00 63.30  ? 94   GLN A CA    1 
ATOM   715   C  C     . GLN A  1  94  ? 55.003  75.755  41.995  1.00 64.91  ? 94   GLN A C     1 
ATOM   716   O  O     . GLN A  1  94  ? 54.681  75.636  43.173  1.00 67.09  ? 94   GLN A O     1 
ATOM   717   C  CB    . GLN A  1  94  ? 56.357  77.826  41.987  1.00 60.02  ? 94   GLN A CB    1 
ATOM   718   C  CG    . GLN A  1  94  ? 57.653  77.072  41.886  1.00 58.34  ? 94   GLN A CG    1 
ATOM   719   C  CD    . GLN A  1  94  ? 58.848  77.899  42.368  1.00 59.12  ? 94   GLN A CD    1 
ATOM   720   O  OE1   . GLN A  1  94  ? 59.006  79.073  41.997  1.00 57.44  ? 94   GLN A OE1   1 
ATOM   721   N  NE2   . GLN A  1  94  ? 59.703  77.282  43.188  1.00 56.06  ? 94   GLN A NE2   1 
ATOM   722   N  N     . THR A  1  95  ? 55.245  74.712  41.204  1.00 66.19  ? 95   THR A N     1 
ATOM   723   C  CA    . THR A  1  95  ? 55.176  73.338  41.712  1.00 66.94  ? 95   THR A CA    1 
ATOM   724   C  C     . THR A  1  95  ? 56.581  72.749  41.622  1.00 67.86  ? 95   THR A C     1 
ATOM   725   O  O     . THR A  1  95  ? 57.441  73.282  40.918  1.00 67.30  ? 95   THR A O     1 
ATOM   726   C  CB    . THR A  1  95  ? 54.226  72.431  40.885  1.00 66.19  ? 95   THR A CB    1 
ATOM   727   O  OG1   . THR A  1  95  ? 52.902  72.980  40.867  1.00 66.93  ? 95   THR A OG1   1 
ATOM   728   C  CG2   . THR A  1  95  ? 54.171  71.038  41.499  1.00 63.86  ? 95   THR A CG2   1 
ATOM   729   N  N     . ALA A  1  96  ? 56.821  71.662  42.343  1.00 69.06  ? 96   ALA A N     1 
ATOM   730   C  CA    . ALA A  1  96  ? 58.130  71.022  42.308  1.00 70.35  ? 96   ALA A CA    1 
ATOM   731   C  C     . ALA A  1  96  ? 58.132  69.597  42.877  1.00 71.51  ? 96   ALA A C     1 
ATOM   732   O  O     . ALA A  1  96  ? 57.458  69.295  43.863  1.00 71.05  ? 96   ALA A O     1 
ATOM   733   C  CB    . ALA A  1  96  ? 59.169  71.898  43.047  1.00 68.43  ? 96   ALA A CB    1 
ATOM   734   N  N     . PHE A  1  97  ? 58.871  68.717  42.208  1.00 73.39  ? 97   PHE A N     1 
ATOM   735   C  CA    . PHE A  1  97  ? 59.035  67.335  42.639  1.00 75.14  ? 97   PHE A CA    1 
ATOM   736   C  C     . PHE A  1  97  ? 60.541  67.106  42.588  1.00 77.12  ? 97   PHE A C     1 
ATOM   737   O  O     . PHE A  1  97  ? 61.164  67.285  41.541  1.00 77.38  ? 97   PHE A O     1 
ATOM   738   C  CB    . PHE A  1  97  ? 58.334  66.386  41.685  1.00 73.91  ? 97   PHE A CB    1 
ATOM   739   C  CG    . PHE A  1  97  ? 56.876  66.659  41.531  1.00 73.73  ? 97   PHE A CG    1 
ATOM   740   C  CD1   . PHE A  1  97  ? 56.406  67.448  40.488  1.00 72.18  ? 97   PHE A CD1   1 
ATOM   741   C  CD2   . PHE A  1  97  ? 55.962  66.109  42.427  1.00 74.20  ? 97   PHE A CD2   1 
ATOM   742   C  CE1   . PHE A  1  97  ? 55.043  67.680  40.337  1.00 71.48  ? 97   PHE A CE1   1 
ATOM   743   C  CE2   . PHE A  1  97  ? 54.594  66.335  42.288  1.00 73.33  ? 97   PHE A CE2   1 
ATOM   744   C  CZ    . PHE A  1  97  ? 54.135  67.122  41.240  1.00 72.95  ? 97   PHE A CZ    1 
ATOM   745   N  N     . TYR A  1  98  ? 61.138  66.734  43.711  1.00 78.99  ? 98   TYR A N     1 
ATOM   746   C  CA    . TYR A  1  98  ? 62.576  66.536  43.725  1.00 82.34  ? 98   TYR A CA    1 
ATOM   747   C  C     . TYR A  1  98  ? 62.975  65.322  44.540  1.00 82.79  ? 98   TYR A C     1 
ATOM   748   O  O     . TYR A  1  98  ? 62.195  64.836  45.361  1.00 81.75  ? 98   TYR A O     1 
ATOM   749   C  CB    . TYR A  1  98  ? 63.264  67.788  44.267  1.00 85.92  ? 98   TYR A CB    1 
ATOM   750   C  CG    . TYR A  1  98  ? 62.815  68.152  45.660  1.00 90.21  ? 98   TYR A CG    1 
ATOM   751   C  CD1   . TYR A  1  98  ? 63.391  67.552  46.777  1.00 91.80  ? 98   TYR A CD1   1 
ATOM   752   C  CD2   . TYR A  1  98  ? 61.774  69.059  45.862  1.00 90.67  ? 98   TYR A CD2   1 
ATOM   753   C  CE1   . TYR A  1  98  ? 62.940  67.842  48.058  1.00 93.09  ? 98   TYR A CE1   1 
ATOM   754   C  CE2   . TYR A  1  98  ? 61.314  69.355  47.138  1.00 91.22  ? 98   TYR A CE2   1 
ATOM   755   C  CZ    . TYR A  1  98  ? 61.899  68.742  48.231  1.00 92.48  ? 98   TYR A CZ    1 
ATOM   756   O  OH    . TYR A  1  98  ? 61.442  69.012  49.500  1.00 92.53  ? 98   TYR A OH    1 
ATOM   757   N  N     . ILE A  1  99  ? 64.197  64.840  44.303  1.00 83.73  ? 99   ILE A N     1 
ATOM   758   C  CA    . ILE A  1  99  ? 64.711  63.666  44.997  1.00 83.42  ? 99   ILE A CA    1 
ATOM   759   C  C     . ILE A  1  99  ? 66.103  63.849  45.578  1.00 83.70  ? 99   ILE A C     1 
ATOM   760   O  O     . ILE A  1  99  ? 66.955  64.546  45.018  1.00 82.59  ? 99   ILE A O     1 
ATOM   761   C  CB    . ILE A  1  99  ? 64.745  62.439  44.069  1.00 82.76  ? 99   ILE A CB    1 
ATOM   762   C  CG1   . ILE A  1  99  ? 63.343  62.148  43.544  1.00 82.83  ? 99   ILE A CG1   1 
ATOM   763   C  CG2   . ILE A  1  99  ? 65.248  61.230  44.825  1.00 83.62  ? 99   ILE A CG2   1 
ATOM   764   C  CD1   . ILE A  1  99  ? 63.250  60.892  42.714  1.00 82.94  ? 99   ILE A CD1   1 
ATOM   765   N  N     . LYS A  1  100 ? 66.307  63.210  46.722  1.00 84.39  ? 100  LYS A N     1 
ATOM   766   C  CA    . LYS A  1  100 ? 67.577  63.242  47.420  1.00 86.27  ? 100  LYS A CA    1 
ATOM   767   C  C     . LYS A  1  100 ? 68.157  61.833  47.384  1.00 88.09  ? 100  LYS A C     1 
ATOM   768   O  O     . LYS A  1  100 ? 67.569  60.903  47.947  1.00 87.68  ? 100  LYS A O     1 
ATOM   769   C  CB    . LYS A  1  100 ? 67.379  63.643  48.879  1.00 86.08  ? 100  LYS A CB    1 
ATOM   770   C  CG    . LYS A  1  100 ? 66.900  65.057  49.112  1.00 86.05  ? 100  LYS A CG    1 
ATOM   771   C  CD    . LYS A  1  100 ? 66.691  65.309  50.605  1.00 86.07  ? 100  LYS A CD    1 
ATOM   772   C  CE    . LYS A  1  100 ? 67.985  65.217  51.405  1.00 85.50  ? 100  LYS A CE    1 
ATOM   773   N  NZ    . LYS A  1  100 ? 68.950  66.298  51.059  1.00 86.52  ? 100  LYS A NZ    1 
ATOM   774   N  N     . ALA A  1  101 ? 69.308  61.678  46.730  1.00 89.95  ? 101  ALA A N     1 
ATOM   775   C  CA    . ALA A  1  101 ? 69.972  60.377  46.633  1.00 89.76  ? 101  ALA A CA    1 
ATOM   776   C  C     . ALA A  1  101 ? 71.470  60.556  46.515  1.00 89.77  ? 101  ALA A C     1 
ATOM   777   O  O     . ALA A  1  101 ? 71.986  61.664  46.655  1.00 89.05  ? 101  ALA A O     1 
ATOM   778   C  CB    . ALA A  1  101 ? 69.454  59.609  45.430  1.00 89.05  ? 101  ALA A CB    1 
ATOM   779   N  N     . LEU A  1  102 ? 72.161  59.451  46.255  1.00 90.88  ? 102  LEU A N     1 
ATOM   780   C  CA    . LEU A  1  102 ? 73.613  59.463  46.102  1.00 91.81  ? 102  LEU A CA    1 
ATOM   781   C  C     . LEU A  1  102 ? 73.957  59.958  44.693  1.00 92.08  ? 102  LEU A C     1 
ATOM   782   O  O     . LEU A  1  102 ? 73.281  59.599  43.723  1.00 92.06  ? 102  LEU A O     1 
ATOM   783   C  CB    . LEU A  1  102 ? 74.170  58.050  46.304  1.00 91.93  ? 102  LEU A CB    1 
ATOM   784   C  CG    . LEU A  1  102 ? 73.781  57.333  47.604  1.00 92.27  ? 102  LEU A CG    1 
ATOM   785   C  CD1   . LEU A  1  102 ? 74.133  55.846  47.527  1.00 90.89  ? 102  LEU A CD1   1 
ATOM   786   C  CD2   . LEU A  1  102 ? 74.484  58.010  48.776  1.00 91.78  ? 102  LEU A CD2   1 
ATOM   787   N  N     . SER A  1  103 ? 75.005  60.774  44.585  1.00 91.67  ? 103  SER A N     1 
ATOM   788   C  CA    . SER A  1  103 ? 75.434  61.321  43.297  1.00 91.22  ? 103  SER A CA    1 
ATOM   789   C  C     . SER A  1  103 ? 75.538  60.220  42.241  1.00 92.54  ? 103  SER A C     1 
ATOM   790   O  O     . SER A  1  103 ? 75.475  60.479  41.041  1.00 91.85  ? 103  SER A O     1 
ATOM   791   C  CB    . SER A  1  103 ? 76.784  62.017  43.463  1.00 89.85  ? 103  SER A CB    1 
ATOM   792   O  OG    . SER A  1  103 ? 76.730  63.003  44.482  1.00 87.36  ? 103  SER A OG    1 
ATOM   793   N  N     . LYS A  1  104 ? 75.700  58.990  42.719  1.00 94.94  ? 104  LYS A N     1 
ATOM   794   C  CA    . LYS A  1  104 ? 75.819  57.802  41.886  1.00 96.82  ? 104  LYS A CA    1 
ATOM   795   C  C     . LYS A  1  104 ? 74.546  57.558  41.085  1.00 97.62  ? 104  LYS A C     1 
ATOM   796   O  O     . LYS A  1  104 ? 74.592  57.341  39.873  1.00 97.93  ? 104  LYS A O     1 
ATOM   797   C  CB    . LYS A  1  104 ? 76.113  56.581  42.775  1.00 98.23  ? 104  LYS A CB    1 
ATOM   798   C  CG    . LYS A  1  104 ? 76.051  55.223  42.062  1.00 101.52 ? 104  LYS A CG    1 
ATOM   799   C  CD    . LYS A  1  104 ? 76.264  54.024  43.016  1.00 103.37 ? 104  LYS A CD    1 
ATOM   800   C  CE    . LYS A  1  104 ? 75.071  53.784  43.952  1.00 104.68 ? 104  LYS A CE    1 
ATOM   801   N  NZ    . LYS A  1  104 ? 75.254  52.609  44.864  1.00 104.67 ? 104  LYS A NZ    1 
ATOM   802   N  N     . ASP A  1  105 ? 73.408  57.601  41.768  1.00 98.63  ? 105  ASP A N     1 
ATOM   803   C  CA    . ASP A  1  105 ? 72.123  57.347  41.128  1.00 99.86  ? 105  ASP A CA    1 
ATOM   804   C  C     . ASP A  1  105 ? 71.576  58.528  40.332  1.00 99.10  ? 105  ASP A C     1 
ATOM   805   O  O     . ASP A  1  105 ? 70.499  58.435  39.743  1.00 98.64  ? 105  ASP A O     1 
ATOM   806   C  CB    . ASP A  1  105 ? 71.099  56.926  42.183  1.00 102.89 ? 105  ASP A CB    1 
ATOM   807   C  CG    . ASP A  1  105 ? 71.659  55.912  43.171  1.00 105.77 ? 105  ASP A CG    1 
ATOM   808   O  OD1   . ASP A  1  105 ? 72.330  54.958  42.713  1.00 106.57 ? 105  ASP A OD1   1 
ATOM   809   O  OD2   . ASP A  1  105 ? 71.422  56.066  44.397  1.00 107.41 ? 105  ASP A OD2   1 
ATOM   810   N  N     . MET A  1  106 ? 72.323  59.627  40.312  1.00 98.49  ? 106  MET A N     1 
ATOM   811   C  CA    . MET A  1  106 ? 71.917  60.834  39.599  1.00 98.21  ? 106  MET A CA    1 
ATOM   812   C  C     . MET A  1  106 ? 71.163  60.554  38.300  1.00 97.85  ? 106  MET A C     1 
ATOM   813   O  O     . MET A  1  106 ? 70.122  61.153  38.042  1.00 97.87  ? 106  MET A O     1 
ATOM   814   C  CB    . MET A  1  106 ? 73.142  61.703  39.333  1.00 99.40  ? 106  MET A CB    1 
ATOM   815   C  CG    . MET A  1  106 ? 72.881  62.914  38.479  1.00 100.67 ? 106  MET A CG    1 
ATOM   816   S  SD    . MET A  1  106 ? 73.261  62.572  36.771  1.00 104.14 ? 106  MET A SD    1 
ATOM   817   C  CE    . MET A  1  106 ? 71.676  62.682  36.033  1.00 103.68 ? 106  MET A CE    1 
ATOM   818   N  N     . PRO A  1  107 ? 71.679  59.647  37.459  1.00 97.55  ? 107  PRO A N     1 
ATOM   819   C  CA    . PRO A  1  107 ? 70.995  59.331  36.202  1.00 96.71  ? 107  PRO A CA    1 
ATOM   820   C  C     . PRO A  1  107 ? 69.686  58.551  36.385  1.00 95.63  ? 107  PRO A C     1 
ATOM   821   O  O     . PRO A  1  107 ? 68.678  58.872  35.759  1.00 95.06  ? 107  PRO A O     1 
ATOM   822   C  CB    . PRO A  1  107 ? 72.046  58.535  35.432  1.00 97.16  ? 107  PRO A CB    1 
ATOM   823   C  CG    . PRO A  1  107 ? 72.822  57.861  36.529  1.00 97.75  ? 107  PRO A CG    1 
ATOM   824   C  CD    . PRO A  1  107 ? 73.000  58.994  37.507  1.00 97.76  ? 107  PRO A CD    1 
ATOM   825   N  N     . LYS A  1  108 ? 69.704  57.524  37.234  1.00 95.22  ? 108  LYS A N     1 
ATOM   826   C  CA    . LYS A  1  108 ? 68.500  56.722  37.479  1.00 94.49  ? 108  LYS A CA    1 
ATOM   827   C  C     . LYS A  1  108 ? 67.434  57.606  38.113  1.00 93.38  ? 108  LYS A C     1 
ATOM   828   O  O     . LYS A  1  108 ? 66.232  57.394  37.925  1.00 93.51  ? 108  LYS A O     1 
ATOM   829   C  CB    . LYS A  1  108 ? 68.808  55.539  38.412  1.00 95.12  ? 108  LYS A CB    1 
ATOM   830   C  CG    . LYS A  1  108 ? 67.566  54.795  38.953  1.00 95.20  ? 108  LYS A CG    1 
ATOM   831   C  CD    . LYS A  1  108 ? 67.142  53.575  38.111  1.00 94.97  ? 108  LYS A CD    1 
ATOM   832   C  CE    . LYS A  1  108 ? 66.774  53.927  36.663  1.00 94.08  ? 108  LYS A CE    1 
ATOM   833   N  NZ    . LYS A  1  108 ? 66.276  52.739  35.894  1.00 91.74  ? 108  LYS A NZ    1 
ATOM   834   N  N     . VAL A  1  109 ? 67.881  58.595  38.877  1.00 90.92  ? 109  VAL A N     1 
ATOM   835   C  CA    . VAL A  1  109 ? 66.950  59.506  39.506  1.00 89.15  ? 109  VAL A CA    1 
ATOM   836   C  C     . VAL A  1  109 ? 66.237  60.220  38.364  1.00 87.97  ? 109  VAL A C     1 
ATOM   837   O  O     . VAL A  1  109 ? 65.020  60.107  38.205  1.00 87.24  ? 109  VAL A O     1 
ATOM   838   C  CB    . VAL A  1  109 ? 67.692  60.547  40.381  1.00 90.00  ? 109  VAL A CB    1 
ATOM   839   C  CG1   . VAL A  1  109 ? 66.697  61.458  41.087  1.00 90.24  ? 109  VAL A CG1   1 
ATOM   840   C  CG2   . VAL A  1  109 ? 68.551  59.842  41.403  1.00 90.27  ? 109  VAL A CG2   1 
ATOM   841   N  N     . VAL A  1  110 ? 67.018  60.924  37.549  1.00 86.17  ? 110  VAL A N     1 
ATOM   842   C  CA    . VAL A  1  110 ? 66.481  61.675  36.429  1.00 84.82  ? 110  VAL A CA    1 
ATOM   843   C  C     . VAL A  1  110 ? 65.436  60.926  35.644  1.00 85.36  ? 110  VAL A C     1 
ATOM   844   O  O     . VAL A  1  110 ? 64.478  61.525  35.166  1.00 85.56  ? 110  VAL A O     1 
ATOM   845   C  CB    . VAL A  1  110 ? 67.567  62.085  35.453  1.00 83.68  ? 110  VAL A CB    1 
ATOM   846   C  CG1   . VAL A  1  110 ? 66.950  62.879  34.328  1.00 83.43  ? 110  VAL A CG1   1 
ATOM   847   C  CG2   . VAL A  1  110 ? 68.616  62.912  36.160  1.00 83.52  ? 110  VAL A CG2   1 
ATOM   848   N  N     . GLU A  1  111 ? 65.621  59.620  35.495  1.00 86.74  ? 111  GLU A N     1 
ATOM   849   C  CA    . GLU A  1  111 ? 64.659  58.822  34.746  1.00 88.64  ? 111  GLU A CA    1 
ATOM   850   C  C     . GLU A  1  111 ? 63.344  58.770  35.510  1.00 88.76  ? 111  GLU A C     1 
ATOM   851   O  O     . GLU A  1  111 ? 62.256  58.859  34.922  1.00 89.52  ? 111  GLU A O     1 
ATOM   852   C  CB    . GLU A  1  111 ? 65.167  57.393  34.525  1.00 89.76  ? 111  GLU A CB    1 
ATOM   853   C  CG    . GLU A  1  111 ? 64.290  56.603  33.542  1.00 93.12  ? 111  GLU A CG    1 
ATOM   854   C  CD    . GLU A  1  111 ? 64.501  55.098  33.617  1.00 95.09  ? 111  GLU A CD    1 
ATOM   855   O  OE1   . GLU A  1  111 ? 65.671  54.658  33.628  1.00 96.66  ? 111  GLU A OE1   1 
ATOM   856   O  OE2   . GLU A  1  111 ? 63.496  54.352  33.657  1.00 95.70  ? 111  GLU A OE2   1 
ATOM   857   N  N     . LEU A  1  112 ? 63.452  58.614  36.827  1.00 87.65  ? 112  LEU A N     1 
ATOM   858   C  CA    . LEU A  1  112 ? 62.273  58.554  37.675  1.00 85.87  ? 112  LEU A CA    1 
ATOM   859   C  C     . LEU A  1  112 ? 61.503  59.870  37.601  1.00 84.90  ? 112  LEU A C     1 
ATOM   860   O  O     . LEU A  1  112 ? 60.283  59.872  37.412  1.00 84.62  ? 112  LEU A O     1 
ATOM   861   C  CB    . LEU A  1  112 ? 62.685  58.244  39.110  1.00 84.53  ? 112  LEU A CB    1 
ATOM   862   C  CG    . LEU A  1  112 ? 63.150  56.804  39.288  1.00 82.86  ? 112  LEU A CG    1 
ATOM   863   C  CD1   . LEU A  1  112 ? 63.701  56.620  40.693  1.00 82.69  ? 112  LEU A CD1   1 
ATOM   864   C  CD2   . LEU A  1  112 ? 61.979  55.864  39.017  1.00 80.46  ? 112  LEU A CD2   1 
ATOM   865   N  N     . LEU A  1  113 ? 62.220  60.983  37.745  1.00 83.14  ? 113  LEU A N     1 
ATOM   866   C  CA    . LEU A  1  113 ? 61.596  62.292  37.662  1.00 82.27  ? 113  LEU A CA    1 
ATOM   867   C  C     . LEU A  1  113 ? 60.784  62.321  36.374  1.00 82.55  ? 113  LEU A C     1 
ATOM   868   O  O     . LEU A  1  113 ? 59.552  62.303  36.391  1.00 82.38  ? 113  LEU A O     1 
ATOM   869   C  CB    . LEU A  1  113 ? 62.659  63.384  37.610  1.00 81.43  ? 113  LEU A CB    1 
ATOM   870   C  CG    . LEU A  1  113 ? 63.534  63.571  38.847  1.00 81.76  ? 113  LEU A CG    1 
ATOM   871   C  CD1   . LEU A  1  113 ? 64.597  64.627  38.545  1.00 81.41  ? 113  LEU A CD1   1 
ATOM   872   C  CD2   . LEU A  1  113 ? 62.670  63.980  40.045  1.00 81.09  ? 113  LEU A CD2   1 
ATOM   873   N  N     . ALA A  1  114 ? 61.498  62.352  35.257  1.00 82.59  ? 114  ALA A N     1 
ATOM   874   C  CA    . ALA A  1  114 ? 60.882  62.376  33.943  1.00 83.24  ? 114  ALA A CA    1 
ATOM   875   C  C     . ALA A  1  114 ? 59.688  61.438  33.859  1.00 83.88  ? 114  ALA A C     1 
ATOM   876   O  O     . ALA A  1  114 ? 58.692  61.738  33.210  1.00 84.25  ? 114  ALA A O     1 
ATOM   877   C  CB    . ALA A  1  114 ? 61.903  61.996  32.898  1.00 83.02  ? 114  ALA A CB    1 
ATOM   878   N  N     . ASP A  1  115 ? 59.787  60.295  34.516  1.00 85.23  ? 115  ASP A N     1 
ATOM   879   C  CA    . ASP A  1  115 ? 58.703  59.333  34.469  1.00 87.09  ? 115  ASP A CA    1 
ATOM   880   C  C     . ASP A  1  115 ? 57.467  59.831  35.221  1.00 87.33  ? 115  ASP A C     1 
ATOM   881   O  O     . ASP A  1  115 ? 56.333  59.515  34.850  1.00 86.63  ? 115  ASP A O     1 
ATOM   882   C  CB    . ASP A  1  115 ? 59.183  57.994  35.043  1.00 88.84  ? 115  ASP A CB    1 
ATOM   883   C  CG    . ASP A  1  115 ? 58.200  56.859  34.784  1.00 91.33  ? 115  ASP A CG    1 
ATOM   884   O  OD1   . ASP A  1  115 ? 57.786  56.676  33.620  1.00 93.47  ? 115  ASP A OD1   1 
ATOM   885   O  OD2   . ASP A  1  115 ? 57.840  56.139  35.739  1.00 91.88  ? 115  ASP A OD2   1 
ATOM   886   N  N     . VAL A  1  116 ? 57.688  60.627  36.261  1.00 87.50  ? 116  VAL A N     1 
ATOM   887   C  CA    . VAL A  1  116 ? 56.593  61.144  37.074  1.00 88.25  ? 116  VAL A CA    1 
ATOM   888   C  C     . VAL A  1  116 ? 55.846  62.300  36.437  1.00 87.97  ? 116  VAL A C     1 
ATOM   889   O  O     . VAL A  1  116 ? 54.615  62.275  36.337  1.00 87.53  ? 116  VAL A O     1 
ATOM   890   C  CB    . VAL A  1  116 ? 57.097  61.618  38.446  1.00 89.25  ? 116  VAL A CB    1 
ATOM   891   C  CG1   . VAL A  1  116 ? 55.917  61.906  39.348  1.00 90.20  ? 116  VAL A CG1   1 
ATOM   892   C  CG2   . VAL A  1  116 ? 58.012  60.566  39.066  1.00 90.26  ? 116  VAL A CG2   1 
ATOM   893   N  N     . VAL A  1  117 ? 56.594  63.319  36.026  1.00 88.17  ? 117  VAL A N     1 
ATOM   894   C  CA    . VAL A  1  117 ? 56.000  64.496  35.408  1.00 90.11  ? 117  VAL A CA    1 
ATOM   895   C  C     . VAL A  1  117 ? 55.363  64.154  34.066  1.00 91.74  ? 117  VAL A C     1 
ATOM   896   O  O     . VAL A  1  117 ? 54.322  64.699  33.713  1.00 92.75  ? 117  VAL A O     1 
ATOM   897   C  CB    . VAL A  1  117 ? 57.048  65.640  35.180  1.00 90.05  ? 117  VAL A CB    1 
ATOM   898   C  CG1   . VAL A  1  117 ? 57.765  65.979  36.465  1.00 90.61  ? 117  VAL A CG1   1 
ATOM   899   C  CG2   . VAL A  1  117 ? 58.050  65.242  34.134  1.00 91.32  ? 117  VAL A CG2   1 
ATOM   900   N  N     . GLN A  1  118 ? 55.982  63.235  33.329  1.00 93.68  ? 118  GLN A N     1 
ATOM   901   C  CA    . GLN A  1  118 ? 55.500  62.834  32.012  1.00 94.99  ? 118  GLN A CA    1 
ATOM   902   C  C     . GLN A  1  118 ? 54.528  61.668  31.974  1.00 95.95  ? 118  GLN A C     1 
ATOM   903   O  O     . GLN A  1  118 ? 53.612  61.670  31.154  1.00 96.44  ? 118  GLN A O     1 
ATOM   904   C  CB    . GLN A  1  118 ? 56.681  62.501  31.101  1.00 96.18  ? 118  GLN A CB    1 
ATOM   905   C  CG    . GLN A  1  118 ? 57.455  63.711  30.607  1.00 99.60  ? 118  GLN A CG    1 
ATOM   906   C  CD    . GLN A  1  118 ? 58.722  63.345  29.831  1.00 101.87 ? 118  GLN A CD    1 
ATOM   907   O  OE1   . GLN A  1  118 ? 59.288  64.182  29.113  1.00 103.45 ? 118  GLN A OE1   1 
ATOM   908   N  NE2   . GLN A  1  118 ? 59.179  62.101  29.982  1.00 102.70 ? 118  GLN A NE2   1 
ATOM   909   N  N     . ASN A  1  119 ? 54.711  60.682  32.853  1.00 97.10  ? 119  ASN A N     1 
ATOM   910   C  CA    . ASN A  1  119 ? 53.851  59.488  32.846  1.00 98.36  ? 119  ASN A CA    1 
ATOM   911   C  C     . ASN A  1  119 ? 52.966  59.174  34.045  1.00 97.22  ? 119  ASN A C     1 
ATOM   912   O  O     . ASN A  1  119 ? 52.744  58.003  34.340  1.00 96.87  ? 119  ASN A O     1 
ATOM   913   C  CB    . ASN A  1  119 ? 54.707  58.242  32.572  1.00 100.74 ? 119  ASN A CB    1 
ATOM   914   C  CG    . ASN A  1  119 ? 55.221  58.185  31.148  1.00 102.00 ? 119  ASN A CG    1 
ATOM   915   O  OD1   . ASN A  1  119 ? 54.461  57.908  30.207  1.00 101.90 ? 119  ASN A OD1   1 
ATOM   916   N  ND2   . ASN A  1  119 ? 56.516  58.459  30.977  1.00 101.90 ? 119  ASN A ND2   1 
ATOM   917   N  N     . CYS A  1  120 ? 52.436  60.178  34.728  1.00 96.96  ? 120  CYS A N     1 
ATOM   918   C  CA    . CYS A  1  120 ? 51.605  59.873  35.887  1.00 96.10  ? 120  CYS A CA    1 
ATOM   919   C  C     . CYS A  1  120 ? 50.509  58.859  35.558  1.00 93.69  ? 120  CYS A C     1 
ATOM   920   O  O     . CYS A  1  120 ? 49.759  59.037  34.605  1.00 92.23  ? 120  CYS A O     1 
ATOM   921   C  CB    . CYS A  1  120 ? 50.983  61.143  36.454  1.00 97.56  ? 120  CYS A CB    1 
ATOM   922   S  SG    . CYS A  1  120 ? 49.970  60.791  37.906  1.00 101.46 ? 120  CYS A SG    1 
ATOM   923   N  N     . ALA A  1  121 ? 50.424  57.799  36.359  1.00 92.82  ? 121  ALA A N     1 
ATOM   924   C  CA    . ALA A  1  121 ? 49.436  56.739  36.150  1.00 93.25  ? 121  ALA A CA    1 
ATOM   925   C  C     . ALA A  1  121 ? 47.988  57.212  36.195  1.00 93.71  ? 121  ALA A C     1 
ATOM   926   O  O     . ALA A  1  121 ? 47.193  56.871  35.326  1.00 93.55  ? 121  ALA A O     1 
ATOM   927   C  CB    . ALA A  1  121 ? 49.637  55.626  37.172  1.00 92.18  ? 121  ALA A CB    1 
ATOM   928   N  N     . LEU A  1  122 ? 47.645  57.991  37.214  1.00 94.39  ? 122  LEU A N     1 
ATOM   929   C  CA    . LEU A  1  122 ? 46.283  58.495  37.362  1.00 94.05  ? 122  LEU A CA    1 
ATOM   930   C  C     . LEU A  1  122 ? 45.305  57.334  37.386  1.00 94.20  ? 122  LEU A C     1 
ATOM   931   O  O     . LEU A  1  122 ? 44.307  57.331  36.668  1.00 94.48  ? 122  LEU A O     1 
ATOM   932   C  CB    . LEU A  1  122 ? 45.926  59.440  36.214  1.00 93.75  ? 122  LEU A CB    1 
ATOM   933   C  CG    . LEU A  1  122 ? 46.805  60.681  36.028  1.00 93.93  ? 122  LEU A CG    1 
ATOM   934   C  CD1   . LEU A  1  122 ? 46.287  61.480  34.853  1.00 93.45  ? 122  LEU A CD1   1 
ATOM   935   C  CD2   . LEU A  1  122 ? 46.799  61.537  37.285  1.00 93.63  ? 122  LEU A CD2   1 
ATOM   936   N  N     . GLU A  1  123 ? 45.607  56.346  38.215  1.00 94.42  ? 123  GLU A N     1 
ATOM   937   C  CA    . GLU A  1  123 ? 44.762  55.175  38.346  1.00 96.16  ? 123  GLU A CA    1 
ATOM   938   C  C     . GLU A  1  123 ? 43.388  55.573  38.876  1.00 95.87  ? 123  GLU A C     1 
ATOM   939   O  O     . GLU A  1  123 ? 43.278  56.119  39.965  1.00 95.62  ? 123  GLU A O     1 
ATOM   940   C  CB    . GLU A  1  123 ? 45.415  54.176  39.305  1.00 98.70  ? 123  GLU A CB    1 
ATOM   941   C  CG    . GLU A  1  123 ? 44.762  52.800  39.330  1.00 101.03 ? 123  GLU A CG    1 
ATOM   942   C  CD    . GLU A  1  123 ? 45.010  52.005  38.055  1.00 103.21 ? 123  GLU A CD    1 
ATOM   943   O  OE1   . GLU A  1  123 ? 44.446  50.893  37.941  1.00 105.06 ? 123  GLU A OE1   1 
ATOM   944   O  OE2   . GLU A  1  123 ? 45.767  52.480  37.171  1.00 103.65 ? 123  GLU A OE2   1 
ATOM   945   N  N     . GLU A  1  124 ? 42.345  55.286  38.105  1.00 96.17  ? 124  GLU A N     1 
ATOM   946   C  CA    . GLU A  1  124 ? 40.976  55.618  38.493  1.00 96.89  ? 124  GLU A CA    1 
ATOM   947   C  C     . GLU A  1  124 ? 40.633  55.195  39.923  1.00 95.93  ? 124  GLU A C     1 
ATOM   948   O  O     . GLU A  1  124 ? 39.815  55.833  40.588  1.00 95.86  ? 124  GLU A O     1 
ATOM   949   C  CB    . GLU A  1  124 ? 39.984  54.962  37.525  1.00 99.71  ? 124  GLU A CB    1 
ATOM   950   C  CG    . GLU A  1  124 ? 38.537  55.457  37.654  1.00 103.37 ? 124  GLU A CG    1 
ATOM   951   C  CD    . GLU A  1  124 ? 38.331  56.843  37.051  1.00 106.69 ? 124  GLU A CD    1 
ATOM   952   O  OE1   . GLU A  1  124 ? 38.603  57.006  35.836  1.00 108.22 ? 124  GLU A OE1   1 
ATOM   953   O  OE2   . GLU A  1  124 ? 37.898  57.767  37.787  1.00 107.87 ? 124  GLU A OE2   1 
ATOM   954   N  N     . SER A  1  125 ? 41.251  54.117  40.392  1.00 94.74  ? 125  SER A N     1 
ATOM   955   C  CA    . SER A  1  125 ? 40.987  53.623  41.742  1.00 93.75  ? 125  SER A CA    1 
ATOM   956   C  C     . SER A  1  125 ? 41.729  54.424  42.809  1.00 92.46  ? 125  SER A C     1 
ATOM   957   O  O     . SER A  1  125 ? 41.270  54.535  43.943  1.00 92.53  ? 125  SER A O     1 
ATOM   958   C  CB    . SER A  1  125 ? 41.364  52.135  41.850  1.00 94.25  ? 125  SER A CB    1 
ATOM   959   O  OG    . SER A  1  125 ? 42.740  51.908  41.581  1.00 94.69  ? 125  SER A OG    1 
ATOM   960   N  N     . GLN A  1  126 ? 42.878  54.977  42.432  1.00 90.85  ? 126  GLN A N     1 
ATOM   961   C  CA    . GLN A  1  126 ? 43.703  55.770  43.334  1.00 89.25  ? 126  GLN A CA    1 
ATOM   962   C  C     . GLN A  1  126 ? 43.028  57.110  43.597  1.00 88.29  ? 126  GLN A C     1 
ATOM   963   O  O     . GLN A  1  126 ? 43.009  57.611  44.717  1.00 88.76  ? 126  GLN A O     1 
ATOM   964   C  CB    . GLN A  1  126 ? 45.070  56.019  42.699  1.00 89.69  ? 126  GLN A CB    1 
ATOM   965   C  CG    . GLN A  1  126 ? 46.114  56.569  43.649  1.00 90.19  ? 126  GLN A CG    1 
ATOM   966   C  CD    . GLN A  1  126 ? 46.640  55.512  44.603  1.00 90.99  ? 126  GLN A CD    1 
ATOM   967   O  OE1   . GLN A  1  126 ? 47.112  54.450  44.176  1.00 91.17  ? 126  GLN A OE1   1 
ATOM   968   N  NE2   . GLN A  1  126 ? 46.567  55.796  45.901  1.00 90.98  ? 126  GLN A NE2   1 
ATOM   969   N  N     . ILE A  1  127 ? 42.473  57.688  42.546  1.00 86.52  ? 127  ILE A N     1 
ATOM   970   C  CA    . ILE A  1  127 ? 41.803  58.964  42.653  1.00 85.34  ? 127  ILE A CA    1 
ATOM   971   C  C     . ILE A  1  127 ? 40.687  58.977  43.685  1.00 85.87  ? 127  ILE A C     1 
ATOM   972   O  O     . ILE A  1  127 ? 40.491  59.973  44.359  1.00 87.00  ? 127  ILE A O     1 
ATOM   973   C  CB    . ILE A  1  127 ? 41.263  59.386  41.284  1.00 84.42  ? 127  ILE A CB    1 
ATOM   974   C  CG1   . ILE A  1  127 ? 42.452  59.726  40.384  1.00 84.12  ? 127  ILE A CG1   1 
ATOM   975   C  CG2   . ILE A  1  127 ? 40.309  60.568  41.417  1.00 82.95  ? 127  ILE A CG2   1 
ATOM   976   C  CD1   . ILE A  1  127 ? 42.097  59.990  38.950  1.00 83.53  ? 127  ILE A CD1   1 
ATOM   977   N  N     . GLU A  1  128 ? 39.957  57.883  43.829  1.00 86.60  ? 128  GLU A N     1 
ATOM   978   C  CA    . GLU A  1  128 ? 38.883  57.853  44.812  1.00 88.19  ? 128  GLU A CA    1 
ATOM   979   C  C     . GLU A  1  128 ? 39.403  57.716  46.238  1.00 89.56  ? 128  GLU A C     1 
ATOM   980   O  O     . GLU A  1  128 ? 38.636  57.747  47.202  1.00 90.63  ? 128  GLU A O     1 
ATOM   981   C  CB    . GLU A  1  128 ? 37.918  56.715  44.505  1.00 88.47  ? 128  GLU A CB    1 
ATOM   982   C  CG    . GLU A  1  128 ? 37.238  56.862  43.160  1.00 90.90  ? 128  GLU A CG    1 
ATOM   983   C  CD    . GLU A  1  128 ? 36.693  58.266  42.927  1.00 92.10  ? 128  GLU A CD    1 
ATOM   984   O  OE1   . GLU A  1  128 ? 35.955  58.773  43.804  1.00 92.60  ? 128  GLU A OE1   1 
ATOM   985   O  OE2   . GLU A  1  128 ? 37.002  58.859  41.866  1.00 92.58  ? 128  GLU A OE2   1 
ATOM   986   N  N     . LYS A  1  129 ? 40.714  57.571  46.380  1.00 90.62  ? 129  LYS A N     1 
ATOM   987   C  CA    . LYS A  1  129 ? 41.309  57.430  47.702  1.00 91.02  ? 129  LYS A CA    1 
ATOM   988   C  C     . LYS A  1  129 ? 41.935  58.754  48.131  1.00 89.70  ? 129  LYS A C     1 
ATOM   989   O  O     . LYS A  1  129 ? 41.735  59.199  49.261  1.00 90.45  ? 129  LYS A O     1 
ATOM   990   C  CB    . LYS A  1  129 ? 42.360  56.315  47.692  1.00 93.32  ? 129  LYS A CB    1 
ATOM   991   C  CG    . LYS A  1  129 ? 42.967  56.011  49.052  1.00 96.42  ? 129  LYS A CG    1 
ATOM   992   C  CD    . LYS A  1  129 ? 44.053  54.949  48.938  1.00 98.60  ? 129  LYS A CD    1 
ATOM   993   C  CE    . LYS A  1  129 ? 44.800  54.780  50.254  1.00 99.99  ? 129  LYS A CE    1 
ATOM   994   N  NZ    . LYS A  1  129 ? 45.925  53.806  50.127  1.00 100.65 ? 129  LYS A NZ    1 
ATOM   995   N  N     . GLU A  1  130 ? 42.685  59.380  47.224  1.00 86.97  ? 130  GLU A N     1 
ATOM   996   C  CA    . GLU A  1  130 ? 43.323  60.665  47.499  1.00 84.83  ? 130  GLU A CA    1 
ATOM   997   C  C     . GLU A  1  130 ? 42.264  61.762  47.689  1.00 82.97  ? 130  GLU A C     1 
ATOM   998   O  O     . GLU A  1  130 ? 42.520  62.802  48.291  1.00 82.33  ? 130  GLU A O     1 
ATOM   999   C  CB    . GLU A  1  130 ? 44.264  61.028  46.352  1.00 85.31  ? 130  GLU A CB    1 
ATOM   1000  C  CG    . GLU A  1  130 ? 45.319  59.970  46.088  1.00 87.14  ? 130  GLU A CG    1 
ATOM   1001  C  CD    . GLU A  1  130 ? 46.177  59.675  47.308  1.00 88.72  ? 130  GLU A CD    1 
ATOM   1002  O  OE1   . GLU A  1  130 ? 46.837  60.620  47.800  1.00 89.49  ? 130  GLU A OE1   1 
ATOM   1003  O  OE2   . GLU A  1  130 ? 46.193  58.504  47.770  1.00 88.31  ? 130  GLU A OE2   1 
ATOM   1004  N  N     . ARG A  1  131 ? 41.075  61.516  47.154  1.00 80.79  ? 131  ARG A N     1 
ATOM   1005  C  CA    . ARG A  1  131 ? 39.951  62.430  47.271  1.00 77.77  ? 131  ARG A CA    1 
ATOM   1006  C  C     . ARG A  1  131 ? 39.539  62.449  48.733  1.00 76.89  ? 131  ARG A C     1 
ATOM   1007  O  O     . ARG A  1  131 ? 39.312  63.507  49.307  1.00 76.21  ? 131  ARG A O     1 
ATOM   1008  C  CB    . ARG A  1  131 ? 38.807  61.921  46.398  1.00 78.55  ? 131  ARG A CB    1 
ATOM   1009  C  CG    . ARG A  1  131 ? 37.401  62.402  46.750  1.00 77.36  ? 131  ARG A CG    1 
ATOM   1010  C  CD    . ARG A  1  131 ? 36.483  62.107  45.580  1.00 75.64  ? 131  ARG A CD    1 
ATOM   1011  N  NE    . ARG A  1  131 ? 37.030  62.696  44.355  1.00 73.84  ? 131  ARG A NE    1 
ATOM   1012  C  CZ    . ARG A  1  131 ? 36.597  62.430  43.128  1.00 72.98  ? 131  ARG A CZ    1 
ATOM   1013  N  NH1   . ARG A  1  131 ? 35.603  61.578  42.938  1.00 72.39  ? 131  ARG A NH1   1 
ATOM   1014  N  NH2   . ARG A  1  131 ? 37.160  63.024  42.088  1.00 74.01  ? 131  ARG A NH2   1 
ATOM   1015  N  N     . GLY A  1  132 ? 39.442  61.264  49.326  1.00 76.30  ? 132  GLY A N     1 
ATOM   1016  C  CA    . GLY A  1  132 ? 39.079  61.165  50.725  1.00 75.54  ? 132  GLY A CA    1 
ATOM   1017  C  C     . GLY A  1  132 ? 40.183  61.728  51.603  1.00 74.67  ? 132  GLY A C     1 
ATOM   1018  O  O     . GLY A  1  132 ? 39.907  62.388  52.603  1.00 76.07  ? 132  GLY A O     1 
ATOM   1019  N  N     . VAL A  1  133 ? 41.434  61.467  51.224  1.00 73.23  ? 133  VAL A N     1 
ATOM   1020  C  CA    . VAL A  1  133 ? 42.605  61.945  51.966  1.00 70.87  ? 133  VAL A CA    1 
ATOM   1021  C  C     . VAL A  1  133 ? 42.731  63.458  51.911  1.00 69.67  ? 133  VAL A C     1 
ATOM   1022  O  O     . VAL A  1  133 ? 42.961  64.113  52.930  1.00 68.68  ? 133  VAL A O     1 
ATOM   1023  C  CB    . VAL A  1  133 ? 43.913  61.335  51.410  1.00 70.57  ? 133  VAL A CB    1 
ATOM   1024  C  CG1   . VAL A  1  133 ? 45.115  62.182  51.833  1.00 69.31  ? 133  VAL A CG1   1 
ATOM   1025  C  CG2   . VAL A  1  133 ? 44.070  59.906  51.911  1.00 70.42  ? 133  VAL A CG2   1 
ATOM   1026  N  N     . ILE A  1  134 ? 42.607  64.009  50.709  1.00 68.82  ? 134  ILE A N     1 
ATOM   1027  C  CA    . ILE A  1  134 ? 42.695  65.446  50.546  1.00 68.61  ? 134  ILE A CA    1 
ATOM   1028  C  C     . ILE A  1  134 ? 41.632  66.089  51.421  1.00 69.16  ? 134  ILE A C     1 
ATOM   1029  O  O     . ILE A  1  134 ? 41.926  67.019  52.165  1.00 70.11  ? 134  ILE A O     1 
ATOM   1030  C  CB    . ILE A  1  134 ? 42.489  65.856  49.085  1.00 68.58  ? 134  ILE A CB    1 
ATOM   1031  C  CG1   . ILE A  1  134 ? 43.715  65.454  48.262  1.00 69.41  ? 134  ILE A CG1   1 
ATOM   1032  C  CG2   . ILE A  1  134 ? 42.258  67.336  48.994  1.00 67.53  ? 134  ILE A CG2   1 
ATOM   1033  C  CD1   . ILE A  1  134 ? 43.717  65.986  46.838  1.00 70.33  ? 134  ILE A CD1   1 
ATOM   1034  N  N     . LEU A  1  135 ? 40.401  65.583  51.356  1.00 68.98  ? 135  LEU A N     1 
ATOM   1035  C  CA    . LEU A  1  135 ? 39.321  66.123  52.178  1.00 68.94  ? 135  LEU A CA    1 
ATOM   1036  C  C     . LEU A  1  135 ? 39.666  66.104  53.670  1.00 69.73  ? 135  LEU A C     1 
ATOM   1037  O  O     . LEU A  1  135 ? 39.126  66.879  54.456  1.00 69.98  ? 135  LEU A O     1 
ATOM   1038  C  CB    . LEU A  1  135 ? 38.027  65.348  51.945  1.00 67.97  ? 135  LEU A CB    1 
ATOM   1039  C  CG    . LEU A  1  135 ? 37.239  65.611  50.658  1.00 67.04  ? 135  LEU A CG    1 
ATOM   1040  C  CD1   . LEU A  1  135 ? 35.847  65.024  50.840  1.00 66.68  ? 135  LEU A CD1   1 
ATOM   1041  C  CD2   . LEU A  1  135 ? 37.130  67.097  50.364  1.00 64.97  ? 135  LEU A CD2   1 
ATOM   1042  N  N     . GLN A  1  136 ? 40.558  65.201  54.053  1.00 71.22  ? 136  GLN A N     1 
ATOM   1043  C  CA    . GLN A  1  136 ? 41.002  65.099  55.427  1.00 72.03  ? 136  GLN A CA    1 
ATOM   1044  C  C     . GLN A  1  136 ? 41.956  66.229  55.697  1.00 71.95  ? 136  GLN A C     1 
ATOM   1045  O  O     . GLN A  1  136 ? 41.756  67.013  56.612  1.00 72.81  ? 136  GLN A O     1 
ATOM   1046  C  CB    . GLN A  1  136 ? 41.730  63.788  55.658  1.00 75.26  ? 136  GLN A CB    1 
ATOM   1047  C  CG    . GLN A  1  136 ? 40.811  62.682  56.027  1.00 81.85  ? 136  GLN A CG    1 
ATOM   1048  C  CD    . GLN A  1  136 ? 39.866  63.121  57.121  1.00 87.35  ? 136  GLN A CD    1 
ATOM   1049  O  OE1   . GLN A  1  136 ? 40.302  63.507  58.216  1.00 89.97  ? 136  GLN A OE1   1 
ATOM   1050  N  NE2   . GLN A  1  136 ? 38.559  63.083  56.833  1.00 89.37  ? 136  GLN A NE2   1 
ATOM   1051  N  N     . GLU A  1  137 ? 43.001  66.316  54.889  1.00 70.98  ? 137  GLU A N     1 
ATOM   1052  C  CA    . GLU A  1  137 ? 43.997  67.355  55.067  1.00 71.47  ? 137  GLU A CA    1 
ATOM   1053  C  C     . GLU A  1  137 ? 43.366  68.743  55.103  1.00 71.14  ? 137  GLU A C     1 
ATOM   1054  O  O     . GLU A  1  137 ? 43.907  69.674  55.708  1.00 71.24  ? 137  GLU A O     1 
ATOM   1055  C  CB    . GLU A  1  137 ? 45.024  67.276  53.949  1.00 72.58  ? 137  GLU A CB    1 
ATOM   1056  C  CG    . GLU A  1  137 ? 45.465  65.873  53.655  1.00 75.50  ? 137  GLU A CG    1 
ATOM   1057  C  CD    . GLU A  1  137 ? 46.655  65.843  52.732  1.00 78.10  ? 137  GLU A CD    1 
ATOM   1058  O  OE1   . GLU A  1  137 ? 46.711  66.723  51.843  1.00 77.88  ? 137  GLU A OE1   1 
ATOM   1059  O  OE2   . GLU A  1  137 ? 47.516  64.941  52.891  1.00 79.20  ? 137  GLU A OE2   1 
ATOM   1060  N  N     . LEU A  1  138 ? 42.219  68.888  54.451  1.00 69.75  ? 138  LEU A N     1 
ATOM   1061  C  CA    . LEU A  1  138 ? 41.562  70.175  54.447  1.00 68.54  ? 138  LEU A CA    1 
ATOM   1062  C  C     . LEU A  1  138 ? 41.072  70.450  55.851  1.00 68.90  ? 138  LEU A C     1 
ATOM   1063  O  O     . LEU A  1  138 ? 41.304  71.535  56.376  1.00 68.67  ? 138  LEU A O     1 
ATOM   1064  C  CB    . LEU A  1  138 ? 40.381  70.201  53.472  1.00 66.84  ? 138  LEU A CB    1 
ATOM   1065  C  CG    . LEU A  1  138 ? 40.647  70.356  51.974  1.00 64.12  ? 138  LEU A CG    1 
ATOM   1066  C  CD1   . LEU A  1  138 ? 39.376  70.842  51.318  1.00 62.42  ? 138  LEU A CD1   1 
ATOM   1067  C  CD2   . LEU A  1  138 ? 41.758  71.345  51.719  1.00 63.22  ? 138  LEU A CD2   1 
ATOM   1068  N  N     . LYS A  1  139 ? 40.402  69.466  56.453  1.00 69.51  ? 139  LYS A N     1 
ATOM   1069  C  CA    . LYS A  1  139 ? 39.876  69.609  57.810  1.00 70.88  ? 139  LYS A CA    1 
ATOM   1070  C  C     . LYS A  1  139 ? 40.986  69.824  58.802  1.00 70.82  ? 139  LYS A C     1 
ATOM   1071  O  O     . LYS A  1  139 ? 40.782  70.491  59.806  1.00 70.98  ? 139  LYS A O     1 
ATOM   1072  C  CB    . LYS A  1  139 ? 39.051  68.390  58.235  1.00 73.23  ? 139  LYS A CB    1 
ATOM   1073  C  CG    . LYS A  1  139 ? 37.671  68.324  57.583  1.00 78.16  ? 139  LYS A CG    1 
ATOM   1074  C  CD    . LYS A  1  139 ? 36.929  67.020  57.904  1.00 81.20  ? 139  LYS A CD    1 
ATOM   1075  C  CE    . LYS A  1  139 ? 35.735  66.806  56.953  1.00 82.88  ? 139  LYS A CE    1 
ATOM   1076  N  NZ    . LYS A  1  139 ? 35.185  65.406  56.984  1.00 81.54  ? 139  LYS A NZ    1 
ATOM   1077  N  N     . GLU A  1  140 ? 42.155  69.248  58.536  1.00 71.91  ? 140  GLU A N     1 
ATOM   1078  C  CA    . GLU A  1  140 ? 43.290  69.436  59.430  1.00 72.75  ? 140  GLU A CA    1 
ATOM   1079  C  C     . GLU A  1  140 ? 43.763  70.864  59.235  1.00 71.09  ? 140  GLU A C     1 
ATOM   1080  O  O     . GLU A  1  140 ? 43.657  71.678  60.136  1.00 71.63  ? 140  GLU A O     1 
ATOM   1081  C  CB    . GLU A  1  140 ? 44.446  68.496  59.094  1.00 77.02  ? 140  GLU A CB    1 
ATOM   1082  C  CG    . GLU A  1  140 ? 44.184  66.998  59.251  1.00 82.91  ? 140  GLU A CG    1 
ATOM   1083  C  CD    . GLU A  1  140 ? 45.408  66.147  58.846  1.00 86.71  ? 140  GLU A CD    1 
ATOM   1084  O  OE1   . GLU A  1  140 ? 45.977  66.364  57.741  1.00 87.43  ? 140  GLU A OE1   1 
ATOM   1085  O  OE2   . GLU A  1  140 ? 45.801  65.259  59.633  1.00 88.54  ? 140  GLU A OE2   1 
ATOM   1086  N  N     . MET A  1  141 ? 44.264  71.171  58.044  1.00 69.76  ? 141  MET A N     1 
ATOM   1087  C  CA    . MET A  1  141 ? 44.763  72.513  57.749  1.00 70.08  ? 141  MET A CA    1 
ATOM   1088  C  C     . MET A  1  141 ? 43.824  73.631  58.179  1.00 69.36  ? 141  MET A C     1 
ATOM   1089  O  O     . MET A  1  141 ? 44.238  74.781  58.361  1.00 69.51  ? 141  MET A O     1 
ATOM   1090  C  CB    . MET A  1  141 ? 45.030  72.655  56.260  1.00 71.63  ? 141  MET A CB    1 
ATOM   1091  C  CG    . MET A  1  141 ? 45.902  71.574  55.723  1.00 74.71  ? 141  MET A CG    1 
ATOM   1092  S  SD    . MET A  1  141 ? 46.021  71.695  53.959  1.00 79.55  ? 141  MET A SD    1 
ATOM   1093  C  CE    . MET A  1  141 ? 47.742  72.351  53.792  1.00 78.80  ? 141  MET A CE    1 
ATOM   1094  N  N     . ASP A  1  142 ? 42.553  73.298  58.334  1.00 68.20  ? 142  ASP A N     1 
ATOM   1095  C  CA    . ASP A  1  142 ? 41.572  74.290  58.725  1.00 66.42  ? 142  ASP A CA    1 
ATOM   1096  C  C     . ASP A  1  142 ? 41.853  74.716  60.145  1.00 65.15  ? 142  ASP A C     1 
ATOM   1097  O  O     . ASP A  1  142 ? 41.489  75.806  60.553  1.00 66.03  ? 142  ASP A O     1 
ATOM   1098  C  CB    . ASP A  1  142 ? 40.168  73.700  58.609  1.00 66.94  ? 142  ASP A CB    1 
ATOM   1099  C  CG    . ASP A  1  142 ? 39.107  74.754  58.394  1.00 67.10  ? 142  ASP A CG    1 
ATOM   1100  O  OD1   . ASP A  1  142 ? 39.366  75.741  57.670  1.00 68.51  ? 142  ASP A OD1   1 
ATOM   1101  O  OD2   . ASP A  1  142 ? 38.001  74.585  58.940  1.00 68.42  ? 142  ASP A OD2   1 
ATOM   1102  N  N     . ASN A  1  143 ? 42.519  73.858  60.901  1.00 64.45  ? 143  ASN A N     1 
ATOM   1103  C  CA    . ASN A  1  143 ? 42.836  74.181  62.276  1.00 64.07  ? 143  ASN A CA    1 
ATOM   1104  C  C     . ASN A  1  143 ? 44.193  74.814  62.468  1.00 63.16  ? 143  ASN A C     1 
ATOM   1105  O  O     . ASN A  1  143 ? 44.683  74.892  63.574  1.00 63.97  ? 143  ASN A O     1 
ATOM   1106  C  CB    . ASN A  1  143 ? 42.702  72.944  63.159  1.00 65.71  ? 143  ASN A CB    1 
ATOM   1107  C  CG    . ASN A  1  143 ? 41.253  72.554  63.376  1.00 68.54  ? 143  ASN A CG    1 
ATOM   1108  O  OD1   . ASN A  1  143 ? 40.452  73.369  63.830  1.00 71.95  ? 143  ASN A OD1   1 
ATOM   1109  N  ND2   . ASN A  1  143 ? 40.904  71.313  63.052  1.00 67.98  ? 143  ASN A ND2   1 
ATOM   1110  N  N     . ASP A  1  144 ? 44.805  75.267  61.391  1.00 63.86  ? 144  ASP A N     1 
ATOM   1111  C  CA    . ASP A  1  144 ? 46.082  75.934  61.503  1.00 66.88  ? 144  ASP A CA    1 
ATOM   1112  C  C     . ASP A  1  144 ? 45.884  77.421  61.163  1.00 67.75  ? 144  ASP A C     1 
ATOM   1113  O  O     . ASP A  1  144 ? 46.095  77.860  60.020  1.00 67.73  ? 144  ASP A O     1 
ATOM   1114  C  CB    . ASP A  1  144 ? 47.103  75.281  60.577  1.00 70.39  ? 144  ASP A CB    1 
ATOM   1115  C  CG    . ASP A  1  144 ? 48.361  76.116  60.420  1.00 75.34  ? 144  ASP A CG    1 
ATOM   1116  O  OD1   . ASP A  1  144 ? 48.642  76.951  61.317  1.00 77.51  ? 144  ASP A OD1   1 
ATOM   1117  O  OD2   . ASP A  1  144 ? 49.073  75.934  59.403  1.00 77.93  ? 144  ASP A OD2   1 
ATOM   1118  N  N     . MET A  1  145 ? 45.460  78.172  62.180  1.00 67.71  ? 145  MET A N     1 
ATOM   1119  C  CA    . MET A  1  145 ? 45.181  79.604  62.094  1.00 68.40  ? 145  MET A CA    1 
ATOM   1120  C  C     . MET A  1  145 ? 46.101  80.414  61.198  1.00 67.77  ? 145  MET A C     1 
ATOM   1121  O  O     . MET A  1  145 ? 45.634  81.246  60.414  1.00 67.86  ? 145  MET A O     1 
ATOM   1122  C  CB    . MET A  1  145 ? 45.213  80.226  63.489  1.00 71.82  ? 145  MET A CB    1 
ATOM   1123  C  CG    . MET A  1  145 ? 44.259  79.600  64.459  1.00 77.13  ? 145  MET A CG    1 
ATOM   1124  S  SD    . MET A  1  145 ? 42.634  79.618  63.744  1.00 86.78  ? 145  MET A SD    1 
ATOM   1125  C  CE    . MET A  1  145 ? 42.462  77.881  63.120  1.00 84.76  ? 145  MET A CE    1 
ATOM   1126  N  N     . THR A  1  146 ? 47.405  80.185  61.327  1.00 66.54  ? 146  THR A N     1 
ATOM   1127  C  CA    . THR A  1  146 ? 48.391  80.922  60.546  1.00 64.25  ? 146  THR A CA    1 
ATOM   1128  C  C     . THR A  1  146 ? 48.156  80.802  59.055  1.00 64.07  ? 146  THR A C     1 
ATOM   1129  O  O     . THR A  1  146 ? 48.376  81.757  58.306  1.00 63.30  ? 146  THR A O     1 
ATOM   1130  C  CB    . THR A  1  146 ? 49.786  80.441  60.840  1.00 62.46  ? 146  THR A CB    1 
ATOM   1131  O  OG1   . THR A  1  146 ? 49.910  80.216  62.244  1.00 62.22  ? 146  THR A OG1   1 
ATOM   1132  C  CG2   . THR A  1  146 ? 50.787  81.489  60.421  1.00 60.54  ? 146  THR A CG2   1 
ATOM   1133  N  N     . ASN A  1  147 ? 47.717  79.629  58.611  1.00 63.59  ? 147  ASN A N     1 
ATOM   1134  C  CA    . ASN A  1  147 ? 47.455  79.470  57.198  1.00 63.86  ? 147  ASN A CA    1 
ATOM   1135  C  C     . ASN A  1  147 ? 46.045  79.891  56.861  1.00 60.70  ? 147  ASN A C     1 
ATOM   1136  O  O     . ASN A  1  147 ? 45.818  80.487  55.817  1.00 60.83  ? 147  ASN A O     1 
ATOM   1137  C  CB    . ASN A  1  147 ? 47.782  78.050  56.732  1.00 70.07  ? 147  ASN A CB    1 
ATOM   1138  C  CG    . ASN A  1  147 ? 49.303  77.846  56.544  1.00 75.33  ? 147  ASN A CG    1 
ATOM   1139  O  OD1   . ASN A  1  147 ? 49.965  78.612  55.807  1.00 75.15  ? 147  ASN A OD1   1 
ATOM   1140  N  ND2   . ASN A  1  147 ? 49.862  76.829  57.221  1.00 76.99  ? 147  ASN A ND2   1 
ATOM   1141  N  N     . VAL A  1  148 ? 45.088  79.614  57.733  1.00 57.28  ? 148  VAL A N     1 
ATOM   1142  C  CA    . VAL A  1  148 ? 43.742  80.095  57.460  1.00 53.96  ? 148  VAL A CA    1 
ATOM   1143  C  C     . VAL A  1  148 ? 43.850  81.610  57.258  1.00 53.64  ? 148  VAL A C     1 
ATOM   1144  O  O     . VAL A  1  148 ? 43.166  82.204  56.425  1.00 52.96  ? 148  VAL A O     1 
ATOM   1145  C  CB    . VAL A  1  148 ? 42.812  79.887  58.627  1.00 50.83  ? 148  VAL A CB    1 
ATOM   1146  C  CG1   . VAL A  1  148 ? 41.522  80.583  58.346  1.00 50.90  ? 148  VAL A CG1   1 
ATOM   1147  C  CG2   . VAL A  1  148 ? 42.578  78.424  58.847  1.00 51.36  ? 148  VAL A CG2   1 
ATOM   1148  N  N     . THR A  1  149 ? 44.733  82.228  58.030  1.00 53.58  ? 149  THR A N     1 
ATOM   1149  C  CA    . THR A  1  149 ? 44.934  83.667  57.961  1.00 53.96  ? 149  THR A CA    1 
ATOM   1150  C  C     . THR A  1  149 ? 45.570  84.181  56.685  1.00 54.52  ? 149  THR A C     1 
ATOM   1151  O  O     . THR A  1  149 ? 45.089  85.159  56.099  1.00 54.43  ? 149  THR A O     1 
ATOM   1152  C  CB    . THR A  1  149 ? 45.770  84.156  59.128  1.00 53.56  ? 149  THR A CB    1 
ATOM   1153  O  OG1   . THR A  1  149 ? 44.985  84.083  60.325  1.00 53.90  ? 149  THR A OG1   1 
ATOM   1154  C  CG2   . THR A  1  149 ? 46.223  85.590  58.889  1.00 52.08  ? 149  THR A CG2   1 
ATOM   1155  N  N     . PHE A  1  150 ? 46.661  83.548  56.267  1.00 54.66  ? 150  PHE A N     1 
ATOM   1156  C  CA    . PHE A  1  150 ? 47.319  83.972  55.046  1.00 54.72  ? 150  PHE A CA    1 
ATOM   1157  C  C     . PHE A  1  150 ? 46.451  83.694  53.840  1.00 54.35  ? 150  PHE A C     1 
ATOM   1158  O  O     . PHE A  1  150 ? 46.511  84.424  52.845  1.00 52.50  ? 150  PHE A O     1 
ATOM   1159  C  CB    . PHE A  1  150 ? 48.664  83.290  54.890  1.00 55.52  ? 150  PHE A CB    1 
ATOM   1160  C  CG    . PHE A  1  150 ? 49.791  84.050  55.508  1.00 56.95  ? 150  PHE A CG    1 
ATOM   1161  C  CD1   . PHE A  1  150 ? 50.083  83.908  56.863  1.00 58.15  ? 150  PHE A CD1   1 
ATOM   1162  C  CD2   . PHE A  1  150 ? 50.556  84.931  54.737  1.00 57.08  ? 150  PHE A CD2   1 
ATOM   1163  C  CE1   . PHE A  1  150 ? 51.127  84.629  57.458  1.00 58.19  ? 150  PHE A CE1   1 
ATOM   1164  C  CE2   . PHE A  1  150 ? 51.604  85.660  55.314  1.00 59.25  ? 150  PHE A CE2   1 
ATOM   1165  C  CZ    . PHE A  1  150 ? 51.888  85.507  56.684  1.00 58.93  ? 150  PHE A CZ    1 
ATOM   1166  N  N     . ASP A  1  151 ? 45.639  82.644  53.927  1.00 55.66  ? 151  ASP A N     1 
ATOM   1167  C  CA    . ASP A  1  151 ? 44.746  82.313  52.820  1.00 58.78  ? 151  ASP A CA    1 
ATOM   1168  C  C     . ASP A  1  151 ? 43.738  83.452  52.718  1.00 58.44  ? 151  ASP A C     1 
ATOM   1169  O  O     . ASP A  1  151 ? 43.496  83.998  51.636  1.00 59.65  ? 151  ASP A O     1 
ATOM   1170  C  CB    . ASP A  1  151 ? 44.012  80.973  53.048  1.00 61.22  ? 151  ASP A CB    1 
ATOM   1171  C  CG    . ASP A  1  151 ? 44.852  79.750  52.644  1.00 63.12  ? 151  ASP A CG    1 
ATOM   1172  O  OD1   . ASP A  1  151 ? 45.710  79.893  51.735  1.00 67.52  ? 151  ASP A OD1   1 
ATOM   1173  O  OD2   . ASP A  1  151 ? 44.645  78.647  53.214  1.00 60.85  ? 151  ASP A OD2   1 
ATOM   1174  N  N     . TYR A  1  152 ? 43.160  83.808  53.860  1.00 56.23  ? 152  TYR A N     1 
ATOM   1175  C  CA    . TYR A  1  152 ? 42.207  84.890  53.908  1.00 54.07  ? 152  TYR A CA    1 
ATOM   1176  C  C     . TYR A  1  152 ? 42.862  86.179  53.431  1.00 53.63  ? 152  TYR A C     1 
ATOM   1177  O  O     . TYR A  1  152 ? 42.234  86.976  52.735  1.00 53.68  ? 152  TYR A O     1 
ATOM   1178  C  CB    . TYR A  1  152 ? 41.709  85.070  55.328  1.00 52.40  ? 152  TYR A CB    1 
ATOM   1179  C  CG    . TYR A  1  152 ? 40.626  84.108  55.750  1.00 51.01  ? 152  TYR A CG    1 
ATOM   1180  C  CD1   . TYR A  1  152 ? 40.368  83.893  57.100  1.00 50.79  ? 152  TYR A CD1   1 
ATOM   1181  C  CD2   . TYR A  1  152 ? 39.835  83.445  54.818  1.00 50.33  ? 152  TYR A CD2   1 
ATOM   1182  C  CE1   . TYR A  1  152 ? 39.357  83.050  57.520  1.00 50.76  ? 152  TYR A CE1   1 
ATOM   1183  C  CE2   . TYR A  1  152 ? 38.807  82.592  55.234  1.00 50.98  ? 152  TYR A CE2   1 
ATOM   1184  C  CZ    . TYR A  1  152 ? 38.579  82.405  56.593  1.00 50.99  ? 152  TYR A CZ    1 
ATOM   1185  O  OH    . TYR A  1  152 ? 37.575  81.591  57.063  1.00 51.62  ? 152  TYR A OH    1 
ATOM   1186  N  N     . LEU A  1  153 ? 44.118  86.400  53.803  1.00 53.00  ? 153  LEU A N     1 
ATOM   1187  C  CA    . LEU A  1  153 ? 44.780  87.620  53.365  1.00 54.47  ? 153  LEU A CA    1 
ATOM   1188  C  C     . LEU A  1  153 ? 44.758  87.694  51.852  1.00 57.14  ? 153  LEU A C     1 
ATOM   1189  O  O     . LEU A  1  153 ? 44.481  88.749  51.291  1.00 58.72  ? 153  LEU A O     1 
ATOM   1190  C  CB    . LEU A  1  153 ? 46.224  87.692  53.847  1.00 52.58  ? 153  LEU A CB    1 
ATOM   1191  C  CG    . LEU A  1  153 ? 47.000  88.913  53.334  1.00 49.89  ? 153  LEU A CG    1 
ATOM   1192  C  CD1   . LEU A  1  153 ? 46.418  90.187  53.913  1.00 47.22  ? 153  LEU A CD1   1 
ATOM   1193  C  CD2   . LEU A  1  153 ? 48.467  88.792  53.722  1.00 49.03  ? 153  LEU A CD2   1 
ATOM   1194  N  N     . HIS A  1  154 ? 45.057  86.579  51.189  1.00 59.14  ? 154  HIS A N     1 
ATOM   1195  C  CA    . HIS A  1  154 ? 45.028  86.534  49.721  1.00 60.74  ? 154  HIS A CA    1 
ATOM   1196  C  C     . HIS A  1  154 ? 43.583  86.665  49.228  1.00 60.67  ? 154  HIS A C     1 
ATOM   1197  O  O     . HIS A  1  154 ? 43.267  87.487  48.358  1.00 60.15  ? 154  HIS A O     1 
ATOM   1198  C  CB    . HIS A  1  154 ? 45.600  85.210  49.201  1.00 61.97  ? 154  HIS A CB    1 
ATOM   1199  C  CG    . HIS A  1  154 ? 47.098  85.154  49.181  1.00 64.87  ? 154  HIS A CG    1 
ATOM   1200  N  ND1   . HIS A  1  154 ? 47.854  84.918  50.311  1.00 64.84  ? 154  HIS A ND1   1 
ATOM   1201  C  CD2   . HIS A  1  154 ? 47.982  85.298  48.164  1.00 65.46  ? 154  HIS A CD2   1 
ATOM   1202  C  CE1   . HIS A  1  154 ? 49.134  84.918  49.989  1.00 65.59  ? 154  HIS A CE1   1 
ATOM   1203  N  NE2   . HIS A  1  154 ? 49.240  85.146  48.692  1.00 65.64  ? 154  HIS A NE2   1 
ATOM   1204  N  N     . ALA A  1  155 ? 42.718  85.834  49.803  1.00 60.33  ? 155  ALA A N     1 
ATOM   1205  C  CA    . ALA A  1  155 ? 41.306  85.807  49.469  1.00 60.04  ? 155  ALA A CA    1 
ATOM   1206  C  C     . ALA A  1  155 ? 40.692  87.192  49.379  1.00 61.35  ? 155  ALA A C     1 
ATOM   1207  O  O     . ALA A  1  155 ? 39.588  87.340  48.844  1.00 63.58  ? 155  ALA A O     1 
ATOM   1208  C  CB    . ALA A  1  155 ? 40.547  84.979  50.493  1.00 58.34  ? 155  ALA A CB    1 
ATOM   1209  N  N     . THR A  1  156 ? 41.387  88.204  49.897  1.00 60.44  ? 156  THR A N     1 
ATOM   1210  C  CA    . THR A  1  156 ? 40.859  89.557  49.864  1.00 60.64  ? 156  THR A CA    1 
ATOM   1211  C  C     . THR A  1  156 ? 41.821  90.539  49.223  1.00 59.90  ? 156  THR A C     1 
ATOM   1212  O  O     . THR A  1  156 ? 41.417  91.363  48.413  1.00 59.95  ? 156  THR A O     1 
ATOM   1213  C  CB    . THR A  1  156 ? 40.480  90.044  51.300  1.00 63.23  ? 156  THR A CB    1 
ATOM   1214  O  OG1   . THR A  1  156 ? 39.795  91.311  51.229  1.00 64.56  ? 156  THR A OG1   1 
ATOM   1215  C  CG2   . THR A  1  156 ? 41.723  90.167  52.178  1.00 61.90  ? 156  THR A CG2   1 
ATOM   1216  N  N     . ALA A  1  157 ? 43.092  90.463  49.587  1.00 59.50  ? 157  ALA A N     1 
ATOM   1217  C  CA    . ALA A  1  157 ? 44.089  91.355  49.012  1.00 58.81  ? 157  ALA A CA    1 
ATOM   1218  C  C     . ALA A  1  157 ? 44.022  91.265  47.489  1.00 58.85  ? 157  ALA A C     1 
ATOM   1219  O  O     . ALA A  1  157 ? 44.322  92.239  46.785  1.00 59.88  ? 157  ALA A O     1 
ATOM   1220  C  CB    . ALA A  1  157 ? 45.469  90.960  49.482  1.00 59.94  ? 157  ALA A CB    1 
ATOM   1221  N  N     . PHE A  1  158 ? 43.645  90.085  46.990  1.00 57.22  ? 158  PHE A N     1 
ATOM   1222  C  CA    . PHE A  1  158 ? 43.523  89.841  45.555  1.00 55.15  ? 158  PHE A CA    1 
ATOM   1223  C  C     . PHE A  1  158 ? 42.131  89.356  45.233  1.00 56.10  ? 158  PHE A C     1 
ATOM   1224  O  O     . PHE A  1  158 ? 41.936  88.643  44.256  1.00 57.01  ? 158  PHE A O     1 
ATOM   1225  C  CB    . PHE A  1  158 ? 44.525  88.784  45.086  1.00 50.97  ? 158  PHE A CB    1 
ATOM   1226  C  CG    . PHE A  1  158 ? 45.941  89.197  45.245  1.00 47.43  ? 158  PHE A CG    1 
ATOM   1227  C  CD1   . PHE A  1  158 ? 46.763  88.555  46.164  1.00 48.35  ? 158  PHE A CD1   1 
ATOM   1228  C  CD2   . PHE A  1  158 ? 46.446  90.266  44.526  1.00 44.99  ? 158  PHE A CD2   1 
ATOM   1229  C  CE1   . PHE A  1  158 ? 48.087  88.983  46.373  1.00 47.31  ? 158  PHE A CE1   1 
ATOM   1230  C  CE2   . PHE A  1  158 ? 47.755  90.701  44.724  1.00 45.99  ? 158  PHE A CE2   1 
ATOM   1231  C  CZ    . PHE A  1  158 ? 48.581  90.059  45.652  1.00 45.41  ? 158  PHE A CZ    1 
ATOM   1232  N  N     . GLN A  1  159 ? 41.167  89.739  46.062  1.00 57.20  ? 159  GLN A N     1 
ATOM   1233  C  CA    . GLN A  1  159 ? 39.776  89.328  45.862  1.00 57.99  ? 159  GLN A CA    1 
ATOM   1234  C  C     . GLN A  1  159 ? 39.332  89.477  44.406  1.00 57.10  ? 159  GLN A C     1 
ATOM   1235  O  O     . GLN A  1  159 ? 39.704  90.448  43.725  1.00 54.60  ? 159  GLN A O     1 
ATOM   1236  C  CB    . GLN A  1  159 ? 38.839  90.160  46.745  1.00 58.10  ? 159  GLN A CB    1 
ATOM   1237  C  CG    . GLN A  1  159 ? 38.807  91.625  46.362  1.00 59.65  ? 159  GLN A CG    1 
ATOM   1238  C  CD    . GLN A  1  159 ? 37.827  92.418  47.198  1.00 60.79  ? 159  GLN A CD    1 
ATOM   1239  O  OE1   . GLN A  1  159 ? 36.926  93.069  46.666  1.00 62.02  ? 159  GLN A OE1   1 
ATOM   1240  N  NE2   . GLN A  1  159 ? 37.996  92.367  48.517  1.00 60.42  ? 159  GLN A NE2   1 
ATOM   1241  N  N     . GLY A  1  160 ? 38.544  88.504  43.949  1.00 55.68  ? 160  GLY A N     1 
ATOM   1242  C  CA    . GLY A  1  160 ? 38.024  88.530  42.598  1.00 56.97  ? 160  GLY A CA    1 
ATOM   1243  C  C     . GLY A  1  160 ? 38.982  88.139  41.491  1.00 58.62  ? 160  GLY A C     1 
ATOM   1244  O  O     . GLY A  1  160 ? 38.679  88.309  40.310  1.00 58.52  ? 160  GLY A O     1 
ATOM   1245  N  N     . THR A  1  161 ? 40.143  87.611  41.857  1.00 60.43  ? 161  THR A N     1 
ATOM   1246  C  CA    . THR A  1  161 ? 41.139  87.215  40.864  1.00 59.64  ? 161  THR A CA    1 
ATOM   1247  C  C     . THR A  1  161 ? 41.688  85.821  41.134  1.00 60.15  ? 161  THR A C     1 
ATOM   1248  O  O     . THR A  1  161 ? 41.259  85.133  42.057  1.00 59.10  ? 161  THR A O     1 
ATOM   1249  C  CB    . THR A  1  161 ? 42.329  88.163  40.868  1.00 58.87  ? 161  THR A CB    1 
ATOM   1250  O  OG1   . THR A  1  161 ? 43.105  87.901  42.038  1.00 57.07  ? 161  THR A OG1   1 
ATOM   1251  C  CG2   . THR A  1  161 ? 41.872  89.625  40.869  1.00 57.04  ? 161  THR A CG2   1 
ATOM   1252  N  N     . ALA A  1  162 ? 42.663  85.422  40.329  1.00 62.57  ? 162  ALA A N     1 
ATOM   1253  C  CA    . ALA A  1  162 ? 43.267  84.097  40.462  1.00 64.89  ? 162  ALA A CA    1 
ATOM   1254  C  C     . ALA A  1  162 ? 44.062  83.933  41.747  1.00 64.98  ? 162  ALA A C     1 
ATOM   1255  O  O     . ALA A  1  162 ? 43.941  82.911  42.420  1.00 66.45  ? 162  ALA A O     1 
ATOM   1256  C  CB    . ALA A  1  162 ? 44.158  83.805  39.262  1.00 67.52  ? 162  ALA A CB    1 
ATOM   1257  N  N     . LEU A  1  163 ? 44.884  84.921  42.086  1.00 63.12  ? 163  LEU A N     1 
ATOM   1258  C  CA    . LEU A  1  163 ? 45.664  84.830  43.304  1.00 62.22  ? 163  LEU A CA    1 
ATOM   1259  C  C     . LEU A  1  163 ? 44.787  84.770  44.553  1.00 62.77  ? 163  LEU A C     1 
ATOM   1260  O  O     . LEU A  1  163 ? 45.283  84.589  45.660  1.00 63.09  ? 163  LEU A O     1 
ATOM   1261  C  CB    . LEU A  1  163 ? 46.622  86.007  43.403  1.00 60.90  ? 163  LEU A CB    1 
ATOM   1262  C  CG    . LEU A  1  163 ? 47.940  85.816  42.658  1.00 59.93  ? 163  LEU A CG    1 
ATOM   1263  C  CD1   . LEU A  1  163 ? 48.843  87.021  42.892  1.00 59.59  ? 163  LEU A CD1   1 
ATOM   1264  C  CD2   . LEU A  1  163 ? 48.625  84.557  43.157  1.00 58.81  ? 163  LEU A CD2   1 
ATOM   1265  N  N     . ALA A  1  164 ? 43.480  84.903  44.377  1.00 63.16  ? 164  ALA A N     1 
ATOM   1266  C  CA    . ALA A  1  164 ? 42.576  84.868  45.514  1.00 63.53  ? 164  ALA A CA    1 
ATOM   1267  C  C     . ALA A  1  164 ? 42.280  83.452  45.979  1.00 64.29  ? 164  ALA A C     1 
ATOM   1268  O  O     . ALA A  1  164 ? 41.776  83.252  47.072  1.00 66.02  ? 164  ALA A O     1 
ATOM   1269  C  CB    . ALA A  1  164 ? 41.277  85.583  45.167  1.00 62.35  ? 164  ALA A CB    1 
ATOM   1270  N  N     . ARG A  1  165 ? 42.608  82.461  45.165  1.00 65.87  ? 165  ARG A N     1 
ATOM   1271  C  CA    . ARG A  1  165 ? 42.316  81.076  45.525  1.00 66.86  ? 165  ARG A CA    1 
ATOM   1272  C  C     . ARG A  1  165 ? 43.381  80.389  46.367  1.00 67.44  ? 165  ARG A C     1 
ATOM   1273  O  O     . ARG A  1  165 ? 44.570  80.730  46.279  1.00 68.48  ? 165  ARG A O     1 
ATOM   1274  C  CB    . ARG A  1  165 ? 42.082  80.242  44.261  1.00 68.00  ? 165  ARG A CB    1 
ATOM   1275  C  CG    . ARG A  1  165 ? 41.011  80.777  43.355  1.00 69.67  ? 165  ARG A CG    1 
ATOM   1276  C  CD    . ARG A  1  165 ? 40.656  79.771  42.289  1.00 73.20  ? 165  ARG A CD    1 
ATOM   1277  N  NE    . ARG A  1  165 ? 39.513  80.219  41.493  1.00 76.61  ? 165  ARG A NE    1 
ATOM   1278  C  CZ    . ARG A  1  165 ? 39.584  81.107  40.502  1.00 77.13  ? 165  ARG A CZ    1 
ATOM   1279  N  NH1   . ARG A  1  165 ? 40.759  81.642  40.172  1.00 77.58  ? 165  ARG A NH1   1 
ATOM   1280  N  NH2   . ARG A  1  165 ? 38.476  81.478  39.860  1.00 76.20  ? 165  ARG A NH2   1 
ATOM   1281  N  N     . THR A  1  166 ? 42.938  79.411  47.163  1.00 66.78  ? 166  THR A N     1 
ATOM   1282  C  CA    . THR A  1  166 ? 43.810  78.602  48.018  1.00 66.50  ? 166  THR A CA    1 
ATOM   1283  C  C     . THR A  1  166 ? 44.460  77.532  47.138  1.00 67.59  ? 166  THR A C     1 
ATOM   1284  O  O     . THR A  1  166 ? 43.891  77.145  46.110  1.00 69.29  ? 166  THR A O     1 
ATOM   1285  C  CB    . THR A  1  166 ? 43.009  77.865  49.101  1.00 66.37  ? 166  THR A CB    1 
ATOM   1286  O  OG1   . THR A  1  166 ? 41.934  77.135  48.491  1.00 65.62  ? 166  THR A OG1   1 
ATOM   1287  C  CG2   . THR A  1  166 ? 42.462  78.846  50.119  1.00 67.08  ? 166  THR A CG2   1 
ATOM   1288  N  N     . VAL A  1  167 ? 45.632  77.036  47.528  1.00 66.30  ? 167  VAL A N     1 
ATOM   1289  C  CA    . VAL A  1  167 ? 46.297  76.015  46.721  1.00 63.39  ? 167  VAL A CA    1 
ATOM   1290  C  C     . VAL A  1  167 ? 45.577  74.666  46.733  1.00 62.21  ? 167  VAL A C     1 
ATOM   1291  O  O     . VAL A  1  167 ? 45.542  73.957  45.733  1.00 61.23  ? 167  VAL A O     1 
ATOM   1292  C  CB    . VAL A  1  167 ? 47.742  75.836  47.175  1.00 62.01  ? 167  VAL A CB    1 
ATOM   1293  C  CG1   . VAL A  1  167 ? 48.379  74.687  46.451  1.00 62.94  ? 167  VAL A CG1   1 
ATOM   1294  C  CG2   . VAL A  1  167 ? 48.510  77.088  46.879  1.00 62.68  ? 167  VAL A CG2   1 
ATOM   1295  N  N     . GLU A  1  168 ? 44.991  74.320  47.865  1.00 62.50  ? 168  GLU A N     1 
ATOM   1296  C  CA    . GLU A  1  168 ? 44.278  73.063  47.987  1.00 64.72  ? 168  GLU A CA    1 
ATOM   1297  C  C     . GLU A  1  168 ? 42.921  73.094  47.290  1.00 64.82  ? 168  GLU A C     1 
ATOM   1298  O  O     . GLU A  1  168 ? 42.241  72.077  47.203  1.00 64.75  ? 168  GLU A O     1 
ATOM   1299  C  CB    . GLU A  1  168 ? 44.060  72.715  49.455  1.00 67.53  ? 168  GLU A CB    1 
ATOM   1300  C  CG    . GLU A  1  168 ? 45.322  72.605  50.299  1.00 72.94  ? 168  GLU A CG    1 
ATOM   1301  C  CD    . GLU A  1  168 ? 46.050  73.938  50.499  1.00 77.11  ? 168  GLU A CD    1 
ATOM   1302  O  OE1   . GLU A  1  168 ? 45.378  74.986  50.649  1.00 80.05  ? 168  GLU A OE1   1 
ATOM   1303  O  OE2   . GLU A  1  168 ? 47.303  73.935  50.533  1.00 79.63  ? 168  GLU A OE2   1 
ATOM   1304  N  N     . GLY A  1  169 ? 42.508  74.260  46.817  1.00 65.01  ? 169  GLY A N     1 
ATOM   1305  C  CA    . GLY A  1  169 ? 41.228  74.345  46.136  1.00 66.21  ? 169  GLY A CA    1 
ATOM   1306  C  C     . GLY A  1  169 ? 40.014  74.360  47.048  1.00 66.99  ? 169  GLY A C     1 
ATOM   1307  O  O     . GLY A  1  169 ? 40.134  74.551  48.252  1.00 67.63  ? 169  GLY A O     1 
ATOM   1308  N  N     . THR A  1  170 ? 38.842  74.140  46.461  1.00 67.58  ? 170  THR A N     1 
ATOM   1309  C  CA    . THR A  1  170 ? 37.569  74.137  47.170  1.00 67.91  ? 170  THR A CA    1 
ATOM   1310  C  C     . THR A  1  170 ? 37.123  72.742  47.516  1.00 66.35  ? 170  THR A C     1 
ATOM   1311  O  O     . THR A  1  170 ? 37.728  71.774  47.094  1.00 66.40  ? 170  THR A O     1 
ATOM   1312  C  CB    . THR A  1  170 ? 36.478  74.710  46.285  1.00 71.30  ? 170  THR A CB    1 
ATOM   1313  O  OG1   . THR A  1  170 ? 36.978  75.894  45.646  1.00 75.68  ? 170  THR A OG1   1 
ATOM   1314  C  CG2   . THR A  1  170 ? 35.214  75.033  47.112  1.00 73.80  ? 170  THR A CG2   1 
ATOM   1315  N  N     . THR A  1  171 ? 36.044  72.639  48.281  1.00 65.91  ? 171  THR A N     1 
ATOM   1316  C  CA    . THR A  1  171 ? 35.514  71.338  48.627  1.00 64.28  ? 171  THR A CA    1 
ATOM   1317  C  C     . THR A  1  171 ? 34.849  70.764  47.390  1.00 66.24  ? 171  THR A C     1 
ATOM   1318  O  O     . THR A  1  171 ? 35.119  69.637  47.005  1.00 67.36  ? 171  THR A O     1 
ATOM   1319  C  CB    . THR A  1  171 ? 34.475  71.412  49.726  1.00 61.25  ? 171  THR A CB    1 
ATOM   1320  O  OG1   . THR A  1  171 ? 35.118  71.587  50.991  1.00 59.82  ? 171  THR A OG1   1 
ATOM   1321  C  CG2   . THR A  1  171 ? 33.680  70.152  49.760  1.00 59.73  ? 171  THR A CG2   1 
ATOM   1322  N  N     . GLU A  1  172 ? 33.984  71.537  46.753  1.00 68.52  ? 172  GLU A N     1 
ATOM   1323  C  CA    . GLU A  1  172 ? 33.317  71.034  45.566  1.00 70.89  ? 172  GLU A CA    1 
ATOM   1324  C  C     . GLU A  1  172 ? 34.305  70.535  44.539  1.00 71.49  ? 172  GLU A C     1 
ATOM   1325  O  O     . GLU A  1  172 ? 34.229  69.384  44.112  1.00 72.23  ? 172  GLU A O     1 
ATOM   1326  C  CB    . GLU A  1  172 ? 32.422  72.105  44.960  1.00 73.32  ? 172  GLU A CB    1 
ATOM   1327  C  CG    . GLU A  1  172 ? 31.213  72.363  45.822  1.00 77.75  ? 172  GLU A CG    1 
ATOM   1328  C  CD    . GLU A  1  172 ? 30.529  71.067  46.221  1.00 80.41  ? 172  GLU A CD    1 
ATOM   1329  O  OE1   . GLU A  1  172 ? 30.017  70.365  45.318  1.00 81.77  ? 172  GLU A OE1   1 
ATOM   1330  O  OE2   . GLU A  1  172 ? 30.518  70.746  47.433  1.00 81.10  ? 172  GLU A OE2   1 
ATOM   1331  N  N     . ASN A  1  173 ? 35.236  71.392  44.141  1.00 71.83  ? 173  ASN A N     1 
ATOM   1332  C  CA    . ASN A  1  173 ? 36.236  70.991  43.165  1.00 71.76  ? 173  ASN A CA    1 
ATOM   1333  C  C     . ASN A  1  173 ? 36.846  69.619  43.507  1.00 71.71  ? 173  ASN A C     1 
ATOM   1334  O  O     . ASN A  1  173 ? 36.978  68.745  42.654  1.00 71.76  ? 173  ASN A O     1 
ATOM   1335  C  CB    . ASN A  1  173 ? 37.342  72.050  43.094  1.00 72.47  ? 173  ASN A CB    1 
ATOM   1336  C  CG    . ASN A  1  173 ? 36.968  73.217  42.220  1.00 73.36  ? 173  ASN A CG    1 
ATOM   1337  O  OD1   . ASN A  1  173 ? 35.829  73.664  42.228  1.00 75.47  ? 173  ASN A OD1   1 
ATOM   1338  N  ND2   . ASN A  1  173 ? 37.930  73.724  41.460  1.00 73.96  ? 173  ASN A ND2   1 
ATOM   1339  N  N     . ILE A  1  174 ? 37.203  69.424  44.765  1.00 71.42  ? 174  ILE A N     1 
ATOM   1340  C  CA    . ILE A  1  174 ? 37.823  68.179  45.158  1.00 71.13  ? 174  ILE A CA    1 
ATOM   1341  C  C     . ILE A  1  174 ? 36.876  67.006  45.139  1.00 70.90  ? 174  ILE A C     1 
ATOM   1342  O  O     . ILE A  1  174 ? 37.273  65.891  44.813  1.00 70.99  ? 174  ILE A O     1 
ATOM   1343  C  CB    . ILE A  1  174 ? 38.516  68.347  46.532  1.00 71.85  ? 174  ILE A CB    1 
ATOM   1344  C  CG1   . ILE A  1  174 ? 39.944  68.856  46.287  1.00 72.78  ? 174  ILE A CG1   1 
ATOM   1345  C  CG2   . ILE A  1  174 ? 38.505  67.044  47.318  1.00 71.58  ? 174  ILE A CG2   1 
ATOM   1346  C  CD1   . ILE A  1  174 ? 40.571  69.535  47.447  1.00 73.75  ? 174  ILE A CD1   1 
ATOM   1347  N  N     . LYS A  1  175 ? 35.616  67.258  45.459  1.00 71.40  ? 175  LYS A N     1 
ATOM   1348  C  CA    . LYS A  1  175 ? 34.621  66.196  45.464  1.00 72.28  ? 175  LYS A CA    1 
ATOM   1349  C  C     . LYS A  1  175 ? 34.238  65.746  44.059  1.00 72.75  ? 175  LYS A C     1 
ATOM   1350  O  O     . LYS A  1  175 ? 33.715  64.647  43.881  1.00 73.42  ? 175  LYS A O     1 
ATOM   1351  C  CB    . LYS A  1  175 ? 33.361  66.657  46.194  1.00 72.56  ? 175  LYS A CB    1 
ATOM   1352  C  CG    . LYS A  1  175 ? 33.536  66.814  47.692  1.00 74.85  ? 175  LYS A CG    1 
ATOM   1353  C  CD    . LYS A  1  175 ? 32.356  67.544  48.336  1.00 75.93  ? 175  LYS A CD    1 
ATOM   1354  C  CE    . LYS A  1  175 ? 31.040  66.811  48.166  1.00 75.76  ? 175  LYS A CE    1 
ATOM   1355  N  NZ    . LYS A  1  175 ? 29.934  67.569  48.814  1.00 76.72  ? 175  LYS A NZ    1 
ATOM   1356  N  N     . HIS A  1  176 ? 34.512  66.577  43.060  1.00 73.16  ? 176  HIS A N     1 
ATOM   1357  C  CA    . HIS A  1  176 ? 34.116  66.238  41.706  1.00 74.62  ? 176  HIS A CA    1 
ATOM   1358  C  C     . HIS A  1  176 ? 35.205  66.185  40.655  1.00 75.37  ? 176  HIS A C     1 
ATOM   1359  O  O     . HIS A  1  176 ? 34.978  65.640  39.580  1.00 75.11  ? 176  HIS A O     1 
ATOM   1360  C  CB    . HIS A  1  176 ? 33.025  67.201  41.238  1.00 76.63  ? 176  HIS A CB    1 
ATOM   1361  C  CG    . HIS A  1  176 ? 31.872  67.312  42.186  1.00 79.47  ? 176  HIS A CG    1 
ATOM   1362  N  ND1   . HIS A  1  176 ? 31.179  66.212  42.646  1.00 81.12  ? 176  HIS A ND1   1 
ATOM   1363  C  CD2   . HIS A  1  176 ? 31.314  68.388  42.792  1.00 80.69  ? 176  HIS A CD2   1 
ATOM   1364  C  CE1   . HIS A  1  176 ? 30.248  66.603  43.500  1.00 81.49  ? 176  HIS A CE1   1 
ATOM   1365  N  NE2   . HIS A  1  176 ? 30.309  67.918  43.606  1.00 82.92  ? 176  HIS A NE2   1 
ATOM   1366  N  N     . LEU A  1  177 ? 36.375  66.749  40.941  1.00 76.69  ? 177  LEU A N     1 
ATOM   1367  C  CA    . LEU A  1  177 ? 37.471  66.738  39.968  1.00 77.54  ? 177  LEU A CA    1 
ATOM   1368  C  C     . LEU A  1  177 ? 37.563  65.354  39.339  1.00 78.95  ? 177  LEU A C     1 
ATOM   1369  O  O     . LEU A  1  177 ? 37.333  64.348  40.011  1.00 78.95  ? 177  LEU A O     1 
ATOM   1370  C  CB    . LEU A  1  177 ? 38.802  67.120  40.637  1.00 76.39  ? 177  LEU A CB    1 
ATOM   1371  C  CG    . LEU A  1  177 ? 39.227  68.595  40.515  1.00 75.17  ? 177  LEU A CG    1 
ATOM   1372  C  CD1   . LEU A  1  177 ? 40.398  68.894  41.427  1.00 74.43  ? 177  LEU A CD1   1 
ATOM   1373  C  CD2   . LEU A  1  177 ? 39.597  68.904  39.080  1.00 73.44  ? 177  LEU A CD2   1 
ATOM   1374  N  N     . THR A  1  178 ? 37.896  65.304  38.050  1.00 80.76  ? 178  THR A N     1 
ATOM   1375  C  CA    . THR A  1  178 ? 37.969  64.031  37.326  1.00 81.88  ? 178  THR A CA    1 
ATOM   1376  C  C     . THR A  1  178 ? 39.337  63.608  36.794  1.00 82.08  ? 178  THR A C     1 
ATOM   1377  O  O     . THR A  1  178 ? 40.268  64.416  36.681  1.00 81.46  ? 178  THR A O     1 
ATOM   1378  C  CB    . THR A  1  178 ? 36.979  64.031  36.132  1.00 81.63  ? 178  THR A CB    1 
ATOM   1379  O  OG1   . THR A  1  178 ? 35.644  64.191  36.627  1.00 81.02  ? 178  THR A OG1   1 
ATOM   1380  C  CG2   . THR A  1  178 ? 37.082  62.728  35.333  1.00 82.95  ? 178  THR A CG2   1 
ATOM   1381  N  N     . ARG A  1  179 ? 39.427  62.317  36.474  1.00 82.72  ? 179  ARG A N     1 
ATOM   1382  C  CA    . ARG A  1  179 ? 40.628  61.706  35.921  1.00 83.58  ? 179  ARG A CA    1 
ATOM   1383  C  C     . ARG A  1  179 ? 40.969  62.567  34.701  1.00 83.69  ? 179  ARG A C     1 
ATOM   1384  O  O     . ARG A  1  179 ? 42.140  62.838  34.399  1.00 83.59  ? 179  ARG A O     1 
ATOM   1385  C  CB    . ARG A  1  179 ? 40.318  60.247  35.509  1.00 84.52  ? 179  ARG A CB    1 
ATOM   1386  C  CG    . ARG A  1  179 ? 41.528  59.278  35.467  1.00 85.54  ? 179  ARG A CG    1 
ATOM   1387  C  CD    . ARG A  1  179 ? 41.930  58.873  34.046  1.00 87.12  ? 179  ARG A CD    1 
ATOM   1388  N  NE    . ARG A  1  179 ? 43.352  58.542  33.952  1.00 88.83  ? 179  ARG A NE    1 
ATOM   1389  C  CZ    . ARG A  1  179 ? 44.083  58.697  32.846  1.00 91.04  ? 179  ARG A CZ    1 
ATOM   1390  N  NH1   . ARG A  1  179 ? 43.521  59.172  31.738  1.00 91.75  ? 179  ARG A NH1   1 
ATOM   1391  N  NH2   . ARG A  1  179 ? 45.384  58.409  32.846  1.00 91.18  ? 179  ARG A NH2   1 
ATOM   1392  N  N     . ALA A  1  180 ? 39.915  63.015  34.027  1.00 83.00  ? 180  ALA A N     1 
ATOM   1393  C  CA    . ALA A  1  180 ? 40.037  63.850  32.848  1.00 82.29  ? 180  ALA A CA    1 
ATOM   1394  C  C     . ALA A  1  180 ? 40.703  65.179  33.179  1.00 82.47  ? 180  ALA A C     1 
ATOM   1395  O  O     . ALA A  1  180 ? 41.699  65.564  32.563  1.00 81.45  ? 180  ALA A O     1 
ATOM   1396  C  CB    . ALA A  1  180 ? 38.662  64.094  32.271  1.00 82.90  ? 180  ALA A CB    1 
ATOM   1397  N  N     . ASP A  1  181 ? 40.135  65.873  34.159  1.00 83.26  ? 181  ASP A N     1 
ATOM   1398  C  CA    . ASP A  1  181 ? 40.631  67.179  34.584  1.00 83.90  ? 181  ASP A CA    1 
ATOM   1399  C  C     . ASP A  1  181 ? 42.066  67.103  35.066  1.00 82.73  ? 181  ASP A C     1 
ATOM   1400  O  O     . ASP A  1  181 ? 42.897  67.951  34.724  1.00 82.71  ? 181  ASP A O     1 
ATOM   1401  C  CB    . ASP A  1  181 ? 39.738  67.732  35.690  1.00 85.75  ? 181  ASP A CB    1 
ATOM   1402  C  CG    . ASP A  1  181 ? 38.266  67.660  35.329  1.00 88.22  ? 181  ASP A CG    1 
ATOM   1403  O  OD1   . ASP A  1  181 ? 37.728  66.533  35.238  1.00 89.45  ? 181  ASP A OD1   1 
ATOM   1404  O  OD2   . ASP A  1  181 ? 37.649  68.726  35.124  1.00 88.57  ? 181  ASP A OD2   1 
ATOM   1405  N  N     . LEU A  1  182 ? 42.352  66.086  35.870  1.00 80.99  ? 182  LEU A N     1 
ATOM   1406  C  CA    . LEU A  1  182 ? 43.698  65.902  36.377  1.00 79.60  ? 182  LEU A CA    1 
ATOM   1407  C  C     . LEU A  1  182 ? 44.576  65.687  35.153  1.00 78.98  ? 182  LEU A C     1 
ATOM   1408  O  O     . LEU A  1  182 ? 45.585  66.377  34.956  1.00 78.09  ? 182  LEU A O     1 
ATOM   1409  C  CB    . LEU A  1  182 ? 43.744  64.686  37.305  1.00 79.27  ? 182  LEU A CB    1 
ATOM   1410  C  CG    . LEU A  1  182 ? 42.863  64.799  38.556  1.00 78.85  ? 182  LEU A CG    1 
ATOM   1411  C  CD1   . LEU A  1  182 ? 42.928  63.540  39.381  1.00 78.12  ? 182  LEU A CD1   1 
ATOM   1412  C  CD2   . LEU A  1  182 ? 43.335  65.962  39.389  1.00 79.55  ? 182  LEU A CD2   1 
ATOM   1413  N  N     . ALA A  1  183 ? 44.161  64.737  34.321  1.00 78.10  ? 183  ALA A N     1 
ATOM   1414  C  CA    . ALA A  1  183 ? 44.879  64.425  33.100  1.00 78.07  ? 183  ALA A CA    1 
ATOM   1415  C  C     . ALA A  1  183 ? 45.152  65.729  32.361  1.00 79.11  ? 183  ALA A C     1 
ATOM   1416  O  O     . ALA A  1  183 ? 46.309  66.095  32.115  1.00 79.28  ? 183  ALA A O     1 
ATOM   1417  C  CB    . ALA A  1  183 ? 44.046  63.502  32.241  1.00 76.22  ? 183  ALA A CB    1 
ATOM   1418  N  N     . SER A  1  184 ? 44.074  66.438  32.033  1.00 79.48  ? 184  SER A N     1 
ATOM   1419  C  CA    . SER A  1  184 ? 44.175  67.698  31.321  1.00 79.44  ? 184  SER A CA    1 
ATOM   1420  C  C     . SER A  1  184 ? 45.203  68.627  31.943  1.00 80.54  ? 184  SER A C     1 
ATOM   1421  O  O     . SER A  1  184 ? 46.125  69.083  31.264  1.00 80.59  ? 184  SER A O     1 
ATOM   1422  C  CB    . SER A  1  184 ? 42.826  68.403  31.290  1.00 78.31  ? 184  SER A CB    1 
ATOM   1423  O  OG    . SER A  1  184 ? 42.964  69.663  30.655  1.00 78.00  ? 184  SER A OG    1 
ATOM   1424  N  N     . TYR A  1  185 ? 45.041  68.900  33.236  1.00 81.72  ? 185  TYR A N     1 
ATOM   1425  C  CA    . TYR A  1  185 ? 45.951  69.794  33.950  1.00 82.36  ? 185  TYR A CA    1 
ATOM   1426  C  C     . TYR A  1  185 ? 47.398  69.440  33.633  1.00 82.37  ? 185  TYR A C     1 
ATOM   1427  O  O     . TYR A  1  185 ? 48.183  70.299  33.205  1.00 82.97  ? 185  TYR A O     1 
ATOM   1428  C  CB    . TYR A  1  185 ? 45.706  69.714  35.467  1.00 82.58  ? 185  TYR A CB    1 
ATOM   1429  C  CG    . TYR A  1  185 ? 46.581  70.637  36.309  1.00 83.18  ? 185  TYR A CG    1 
ATOM   1430  C  CD1   . TYR A  1  185 ? 46.099  71.843  36.804  1.00 82.09  ? 185  TYR A CD1   1 
ATOM   1431  C  CD2   . TYR A  1  185 ? 47.904  70.297  36.599  1.00 85.21  ? 185  TYR A CD2   1 
ATOM   1432  C  CE1   . TYR A  1  185 ? 46.922  72.692  37.574  1.00 84.06  ? 185  TYR A CE1   1 
ATOM   1433  C  CE2   . TYR A  1  185 ? 48.737  71.138  37.361  1.00 85.14  ? 185  TYR A CE2   1 
ATOM   1434  C  CZ    . TYR A  1  185 ? 48.244  72.331  37.847  1.00 84.52  ? 185  TYR A CZ    1 
ATOM   1435  O  OH    . TYR A  1  185 ? 49.082  73.143  38.595  1.00 82.98  ? 185  TYR A OH    1 
ATOM   1436  N  N     . ILE A  1  186 ? 47.733  68.166  33.819  1.00 81.48  ? 186  ILE A N     1 
ATOM   1437  C  CA    . ILE A  1  186 ? 49.090  67.676  33.588  1.00 80.69  ? 186  ILE A CA    1 
ATOM   1438  C  C     . ILE A  1  186 ? 49.602  67.907  32.176  1.00 81.02  ? 186  ILE A C     1 
ATOM   1439  O  O     . ILE A  1  186 ? 50.738  68.360  31.976  1.00 79.51  ? 186  ILE A O     1 
ATOM   1440  C  CB    . ILE A  1  186 ? 49.176  66.187  33.888  1.00 79.10  ? 186  ILE A CB    1 
ATOM   1441  C  CG1   . ILE A  1  186 ? 48.487  65.894  35.223  1.00 78.84  ? 186  ILE A CG1   1 
ATOM   1442  C  CG2   . ILE A  1  186 ? 50.626  65.772  33.936  1.00 78.35  ? 186  ILE A CG2   1 
ATOM   1443  C  CD1   . ILE A  1  186 ? 48.388  64.431  35.580  1.00 77.20  ? 186  ILE A CD1   1 
ATOM   1444  N  N     . ASP A  1  187 ? 48.750  67.589  31.206  1.00 82.18  ? 187  ASP A N     1 
ATOM   1445  C  CA    . ASP A  1  187 ? 49.077  67.737  29.792  1.00 84.40  ? 187  ASP A CA    1 
ATOM   1446  C  C     . ASP A  1  187 ? 49.117  69.197  29.386  1.00 83.80  ? 187  ASP A C     1 
ATOM   1447  O  O     . ASP A  1  187 ? 49.817  69.560  28.446  1.00 83.83  ? 187  ASP A O     1 
ATOM   1448  C  CB    . ASP A  1  187 ? 48.042  67.011  28.927  1.00 88.78  ? 187  ASP A CB    1 
ATOM   1449  C  CG    . ASP A  1  187 ? 47.995  65.504  29.199  1.00 94.77  ? 187  ASP A CG    1 
ATOM   1450  O  OD1   . ASP A  1  187 ? 48.983  64.795  28.871  1.00 97.74  ? 187  ASP A OD1   1 
ATOM   1451  O  OD2   . ASP A  1  187 ? 46.969  65.025  29.745  1.00 97.17  ? 187  ASP A OD2   1 
ATOM   1452  N  N     . THR A  1  188 ? 48.363  70.027  30.105  1.00 82.32  ? 188  THR A N     1 
ATOM   1453  C  CA    . THR A  1  188 ? 48.288  71.455  29.823  1.00 79.21  ? 188  THR A CA    1 
ATOM   1454  C  C     . THR A  1  188 ? 49.429  72.253  30.435  1.00 78.94  ? 188  THR A C     1 
ATOM   1455  O  O     . THR A  1  188 ? 49.967  73.159  29.799  1.00 77.46  ? 188  THR A O     1 
ATOM   1456  C  CB    . THR A  1  188 ? 46.982  72.064  30.360  1.00 77.51  ? 188  THR A CB    1 
ATOM   1457  O  OG1   . THR A  1  188 ? 45.866  71.268  29.945  1.00 77.06  ? 188  THR A OG1   1 
ATOM   1458  C  CG2   . THR A  1  188 ? 46.811  73.478  29.837  1.00 74.94  ? 188  THR A CG2   1 
ATOM   1459  N  N     . HIS A  1  189 ? 49.806  71.909  31.665  1.00 79.09  ? 189  HIS A N     1 
ATOM   1460  C  CA    . HIS A  1  189 ? 50.842  72.658  32.359  1.00 79.61  ? 189  HIS A CA    1 
ATOM   1461  C  C     . HIS A  1  189 ? 52.232  72.059  32.455  1.00 81.42  ? 189  HIS A C     1 
ATOM   1462  O  O     . HIS A  1  189 ? 53.217  72.780  32.273  1.00 81.53  ? 189  HIS A O     1 
ATOM   1463  C  CB    . HIS A  1  189 ? 50.349  73.028  33.758  1.00 78.67  ? 189  HIS A CB    1 
ATOM   1464  C  CG    . HIS A  1  189 ? 49.118  73.881  33.751  1.00 78.73  ? 189  HIS A CG    1 
ATOM   1465  N  ND1   . HIS A  1  189 ? 49.101  75.156  33.229  1.00 78.33  ? 189  HIS A ND1   1 
ATOM   1466  C  CD2   . HIS A  1  189 ? 47.846  73.619  34.140  1.00 79.03  ? 189  HIS A CD2   1 
ATOM   1467  C  CE1   . HIS A  1  189 ? 47.872  75.642  33.291  1.00 77.69  ? 189  HIS A CE1   1 
ATOM   1468  N  NE2   . HIS A  1  189 ? 47.091  74.729  33.838  1.00 78.15  ? 189  HIS A NE2   1 
ATOM   1469  N  N     . PHE A  1  190 ? 52.340  70.766  32.744  1.00 83.48  ? 190  PHE A N     1 
ATOM   1470  C  CA    . PHE A  1  190 ? 53.668  70.152  32.860  1.00 86.04  ? 190  PHE A CA    1 
ATOM   1471  C  C     . PHE A  1  190 ? 54.345  70.020  31.501  1.00 87.70  ? 190  PHE A C     1 
ATOM   1472  O  O     . PHE A  1  190 ? 54.263  68.965  30.869  1.00 88.85  ? 190  PHE A O     1 
ATOM   1473  C  CB    . PHE A  1  190 ? 53.551  68.780  33.512  1.00 86.35  ? 190  PHE A CB    1 
ATOM   1474  C  CG    . PHE A  1  190 ? 53.085  68.828  34.938  1.00 86.96  ? 190  PHE A CG    1 
ATOM   1475  C  CD1   . PHE A  1  190 ? 52.571  67.688  35.552  1.00 87.53  ? 190  PHE A CD1   1 
ATOM   1476  C  CD2   . PHE A  1  190 ? 53.145  70.009  35.664  1.00 86.28  ? 190  PHE A CD2   1 
ATOM   1477  C  CE1   . PHE A  1  190 ? 52.120  67.721  36.867  1.00 87.22  ? 190  PHE A CE1   1 
ATOM   1478  C  CE2   . PHE A  1  190 ? 52.699  70.053  36.974  1.00 86.70  ? 190  PHE A CE2   1 
ATOM   1479  C  CZ    . PHE A  1  190 ? 52.182  68.903  37.579  1.00 87.20  ? 190  PHE A CZ    1 
ATOM   1480  N  N     . LYS A  1  191 ? 55.026  71.083  31.066  1.00 88.85  ? 191  LYS A N     1 
ATOM   1481  C  CA    . LYS A  1  191 ? 55.689  71.111  29.762  1.00 89.51  ? 191  LYS A CA    1 
ATOM   1482  C  C     . LYS A  1  191 ? 57.079  71.736  29.756  1.00 88.89  ? 191  LYS A C     1 
ATOM   1483  O  O     . LYS A  1  191 ? 57.303  72.788  30.339  1.00 88.94  ? 191  LYS A O     1 
ATOM   1484  C  CB    . LYS A  1  191 ? 54.802  71.845  28.763  1.00 91.69  ? 191  LYS A CB    1 
ATOM   1485  C  CG    . LYS A  1  191 ? 53.490  71.134  28.474  1.00 95.93  ? 191  LYS A CG    1 
ATOM   1486  C  CD    . LYS A  1  191 ? 52.693  71.897  27.421  1.00 100.60 ? 191  LYS A CD    1 
ATOM   1487  C  CE    . LYS A  1  191 ? 51.587  71.034  26.793  1.00 103.55 ? 191  LYS A CE    1 
ATOM   1488  N  NZ    . LYS A  1  191 ? 50.873  71.736  25.665  1.00 103.31 ? 191  LYS A NZ    1 
ATOM   1489  N  N     . ALA A  1  192 ? 57.995  71.086  29.048  1.00 88.91  ? 192  ALA A N     1 
ATOM   1490  C  CA    . ALA A  1  192 ? 59.396  71.506  28.938  1.00 89.11  ? 192  ALA A CA    1 
ATOM   1491  C  C     . ALA A  1  192 ? 59.755  72.989  29.010  1.00 88.50  ? 192  ALA A C     1 
ATOM   1492  O  O     . ALA A  1  192 ? 60.589  73.385  29.817  1.00 88.53  ? 192  ALA A O     1 
ATOM   1493  C  CB    . ALA A  1  192 ? 60.010  70.907  27.677  1.00 90.41  ? 192  ALA A CB    1 
ATOM   1494  N  N     . PRO A  1  193 ? 59.164  73.828  28.154  1.00 88.77  ? 193  PRO A N     1 
ATOM   1495  C  CA    . PRO A  1  193 ? 59.533  75.248  28.242  1.00 89.09  ? 193  PRO A CA    1 
ATOM   1496  C  C     . PRO A  1  193 ? 59.265  75.872  29.617  1.00 89.17  ? 193  PRO A C     1 
ATOM   1497  O  O     . PRO A  1  193 ? 59.997  76.771  30.062  1.00 88.74  ? 193  PRO A O     1 
ATOM   1498  C  CB    . PRO A  1  193 ? 58.712  75.890  27.121  1.00 89.26  ? 193  PRO A CB    1 
ATOM   1499  C  CG    . PRO A  1  193 ? 57.495  74.985  27.025  1.00 90.35  ? 193  PRO A CG    1 
ATOM   1500  C  CD    . PRO A  1  193 ? 58.108  73.607  27.149  1.00 89.70  ? 193  PRO A CD    1 
ATOM   1501  N  N     . ARG A  1  194 ? 58.221  75.366  30.280  1.00 89.15  ? 194  ARG A N     1 
ATOM   1502  C  CA    . ARG A  1  194 ? 57.797  75.825  31.611  1.00 88.06  ? 194  ARG A CA    1 
ATOM   1503  C  C     . ARG A  1  194 ? 58.427  75.014  32.758  1.00 86.63  ? 194  ARG A C     1 
ATOM   1504  O  O     . ARG A  1  194 ? 58.054  75.185  33.915  1.00 86.33  ? 194  ARG A O     1 
ATOM   1505  C  CB    . ARG A  1  194 ? 56.256  75.762  31.715  1.00 88.25  ? 194  ARG A CB    1 
ATOM   1506  C  CG    . ARG A  1  194 ? 55.531  76.884  30.974  1.00 88.47  ? 194  ARG A CG    1 
ATOM   1507  C  CD    . ARG A  1  194 ? 54.050  76.606  30.781  1.00 88.42  ? 194  ARG A CD    1 
ATOM   1508  N  NE    . ARG A  1  194 ? 53.342  76.424  32.040  1.00 89.34  ? 194  ARG A NE    1 
ATOM   1509  C  CZ    . ARG A  1  194 ? 52.038  76.183  32.123  1.00 89.38  ? 194  ARG A CZ    1 
ATOM   1510  N  NH1   . ARG A  1  194 ? 51.313  76.104  31.013  1.00 88.57  ? 194  ARG A NH1   1 
ATOM   1511  N  NH2   . ARG A  1  194 ? 51.467  76.001  33.310  1.00 88.70  ? 194  ARG A NH2   1 
ATOM   1512  N  N     . MET A  1  195 ? 59.379  74.138  32.436  1.00 85.93  ? 195  MET A N     1 
ATOM   1513  C  CA    . MET A  1  195 ? 60.047  73.304  33.442  1.00 83.65  ? 195  MET A CA    1 
ATOM   1514  C  C     . MET A  1  195 ? 61.547  73.539  33.536  1.00 81.82  ? 195  MET A C     1 
ATOM   1515  O  O     . MET A  1  195 ? 62.178  74.069  32.618  1.00 81.53  ? 195  MET A O     1 
ATOM   1516  C  CB    . MET A  1  195 ? 59.808  71.822  33.152  1.00 83.87  ? 195  MET A CB    1 
ATOM   1517  C  CG    . MET A  1  195 ? 58.348  71.460  33.058  1.00 85.91  ? 195  MET A CG    1 
ATOM   1518  S  SD    . MET A  1  195 ? 58.032  69.707  33.276  1.00 91.41  ? 195  MET A SD    1 
ATOM   1519  C  CE    . MET A  1  195 ? 57.531  69.208  31.645  1.00 90.55  ? 195  MET A CE    1 
ATOM   1520  N  N     . VAL A  1  196 ? 62.112  73.143  34.663  1.00 79.97  ? 196  VAL A N     1 
ATOM   1521  C  CA    . VAL A  1  196 ? 63.536  73.285  34.866  1.00 79.82  ? 196  VAL A CA    1 
ATOM   1522  C  C     . VAL A  1  196 ? 64.063  72.118  35.665  1.00 80.97  ? 196  VAL A C     1 
ATOM   1523  O  O     . VAL A  1  196 ? 63.542  71.793  36.732  1.00 80.10  ? 196  VAL A O     1 
ATOM   1524  C  CB    . VAL A  1  196 ? 63.874  74.567  35.605  1.00 79.05  ? 196  VAL A CB    1 
ATOM   1525  C  CG1   . VAL A  1  196 ? 65.361  74.614  35.928  1.00 78.51  ? 196  VAL A CG1   1 
ATOM   1526  C  CG2   . VAL A  1  196 ? 63.497  75.734  34.755  1.00 79.96  ? 196  VAL A CG2   1 
ATOM   1527  N  N     . LEU A  1  197 ? 65.091  71.469  35.130  1.00 82.23  ? 197  LEU A N     1 
ATOM   1528  C  CA    . LEU A  1  197 ? 65.694  70.344  35.822  1.00 82.74  ? 197  LEU A CA    1 
ATOM   1529  C  C     . LEU A  1  197 ? 66.863  70.919  36.606  1.00 83.19  ? 197  LEU A C     1 
ATOM   1530  O  O     . LEU A  1  197 ? 67.873  71.339  36.022  1.00 83.01  ? 197  LEU A O     1 
ATOM   1531  C  CB    . LEU A  1  197 ? 66.194  69.301  34.829  1.00 82.25  ? 197  LEU A CB    1 
ATOM   1532  C  CG    . LEU A  1  197 ? 66.544  67.949  35.456  1.00 81.03  ? 197  LEU A CG    1 
ATOM   1533  C  CD1   . LEU A  1  197 ? 65.274  67.180  35.781  1.00 78.72  ? 197  LEU A CD1   1 
ATOM   1534  C  CD2   . LEU A  1  197 ? 67.406  67.159  34.490  1.00 81.93  ? 197  LEU A CD2   1 
ATOM   1535  N  N     . ALA A  1  198 ? 66.707  70.970  37.926  1.00 82.76  ? 198  ALA A N     1 
ATOM   1536  C  CA    . ALA A  1  198 ? 67.752  71.509  38.776  1.00 82.50  ? 198  ALA A CA    1 
ATOM   1537  C  C     . ALA A  1  198 ? 68.408  70.384  39.537  1.00 83.04  ? 198  ALA A C     1 
ATOM   1538  O  O     . ALA A  1  198 ? 67.739  69.442  39.987  1.00 82.26  ? 198  ALA A O     1 
ATOM   1539  C  CB    . ALA A  1  198 ? 67.180  72.522  39.738  1.00 81.90  ? 198  ALA A CB    1 
ATOM   1540  N  N     . ALA A  1  199 ? 69.726  70.490  39.673  1.00 83.08  ? 199  ALA A N     1 
ATOM   1541  C  CA    . ALA A  1  199 ? 70.492  69.485  40.380  1.00 83.17  ? 199  ALA A CA    1 
ATOM   1542  C  C     . ALA A  1  199 ? 71.590  70.140  41.194  1.00 83.48  ? 199  ALA A C     1 
ATOM   1543  O  O     . ALA A  1  199 ? 72.180  71.135  40.777  1.00 82.44  ? 199  ALA A O     1 
ATOM   1544  C  CB    . ALA A  1  199 ? 71.087  68.508  39.390  1.00 82.85  ? 199  ALA A CB    1 
ATOM   1545  N  N     . ALA A  1  200 ? 71.853  69.577  42.366  1.00 85.17  ? 200  ALA A N     1 
ATOM   1546  C  CA    . ALA A  1  200 ? 72.899  70.093  43.234  1.00 87.78  ? 200  ALA A CA    1 
ATOM   1547  C  C     . ALA A  1  200 ? 73.556  68.962  44.029  1.00 89.51  ? 200  ALA A C     1 
ATOM   1548  O  O     . ALA A  1  200 ? 72.887  68.021  44.484  1.00 88.17  ? 200  ALA A O     1 
ATOM   1549  C  CB    . ALA A  1  200 ? 72.331  71.142  44.171  1.00 89.04  ? 200  ALA A CB    1 
ATOM   1550  N  N     . GLY A  1  201 ? 74.875  69.070  44.182  1.00 91.71  ? 201  GLY A N     1 
ATOM   1551  C  CA    . GLY A  1  201 ? 75.649  68.067  44.897  1.00 94.64  ? 201  GLY A CA    1 
ATOM   1552  C  C     . GLY A  1  201 ? 76.849  67.623  44.073  1.00 96.19  ? 201  GLY A C     1 
ATOM   1553  O  O     . GLY A  1  201 ? 77.504  68.445  43.426  1.00 95.98  ? 201  GLY A O     1 
ATOM   1554  N  N     . GLY A  1  202 ? 77.148  66.327  44.094  1.00 97.41  ? 202  GLY A N     1 
ATOM   1555  C  CA    . GLY A  1  202 ? 78.267  65.821  43.316  1.00 98.11  ? 202  GLY A CA    1 
ATOM   1556  C  C     . GLY A  1  202 ? 77.754  65.275  41.998  1.00 98.80  ? 202  GLY A C     1 
ATOM   1557  O  O     . GLY A  1  202 ? 77.454  64.090  41.880  1.00 98.02  ? 202  GLY A O     1 
ATOM   1558  N  N     . ILE A  1  203 ? 77.645  66.141  40.998  1.00 99.88  ? 203  ILE A N     1 
ATOM   1559  C  CA    . ILE A  1  203 ? 77.143  65.718  39.704  1.00 101.53 ? 203  ILE A CA    1 
ATOM   1560  C  C     . ILE A  1  203 ? 77.747  66.484  38.539  1.00 102.72 ? 203  ILE A C     1 
ATOM   1561  O  O     . ILE A  1  203 ? 77.946  67.698  38.607  1.00 102.34 ? 203  ILE A O     1 
ATOM   1562  C  CB    . ILE A  1  203 ? 75.614  65.875  39.645  1.00 102.09 ? 203  ILE A CB    1 
ATOM   1563  C  CG1   . ILE A  1  203 ? 74.967  64.951  40.669  1.00 102.36 ? 203  ILE A CG1   1 
ATOM   1564  C  CG2   . ILE A  1  203 ? 75.103  65.548  38.251  1.00 102.70 ? 203  ILE A CG2   1 
ATOM   1565  C  CD1   . ILE A  1  203 ? 73.482  65.115  40.759  1.00 103.04 ? 203  ILE A CD1   1 
ATOM   1566  N  N     . SER A  1  204 ? 78.029  65.759  37.461  1.00 104.25 ? 204  SER A N     1 
ATOM   1567  C  CA    . SER A  1  204 ? 78.590  66.360  36.255  1.00 105.74 ? 204  SER A CA    1 
ATOM   1568  C  C     . SER A  1  204 ? 77.459  66.986  35.449  1.00 105.30 ? 204  SER A C     1 
ATOM   1569  O  O     . SER A  1  204 ? 76.539  66.292  35.006  1.00 104.84 ? 204  SER A O     1 
ATOM   1570  C  CB    . SER A  1  204 ? 79.303  65.294  35.402  1.00 107.29 ? 204  SER A CB    1 
ATOM   1571  O  OG    . SER A  1  204 ? 79.738  65.819  34.151  1.00 108.31 ? 204  SER A OG    1 
ATOM   1572  N  N     . HIS A  1  205 ? 77.526  68.299  35.266  1.00 104.87 ? 205  HIS A N     1 
ATOM   1573  C  CA    . HIS A  1  205 ? 76.501  68.992  34.503  1.00 104.97 ? 205  HIS A CA    1 
ATOM   1574  C  C     . HIS A  1  205 ? 76.225  68.215  33.223  1.00 104.41 ? 205  HIS A C     1 
ATOM   1575  O  O     . HIS A  1  205 ? 75.080  67.947  32.860  1.00 103.14 ? 205  HIS A O     1 
ATOM   1576  C  CB    . HIS A  1  205 ? 76.978  70.404  34.156  1.00 105.88 ? 205  HIS A CB    1 
ATOM   1577  C  CG    . HIS A  1  205 ? 76.022  71.164  33.293  1.00 106.44 ? 205  HIS A CG    1 
ATOM   1578  N  ND1   . HIS A  1  205 ? 74.718  71.402  33.666  1.00 106.84 ? 205  HIS A ND1   1 
ATOM   1579  C  CD2   . HIS A  1  205 ? 76.174  71.728  32.071  1.00 106.57 ? 205  HIS A CD2   1 
ATOM   1580  C  CE1   . HIS A  1  205 ? 74.107  72.079  32.711  1.00 107.21 ? 205  HIS A CE1   1 
ATOM   1581  N  NE2   . HIS A  1  205 ? 74.968  72.290  31.731  1.00 106.20 ? 205  HIS A NE2   1 
ATOM   1582  N  N     . LYS A  1  206 ? 77.315  67.852  32.563  1.00 105.39 ? 206  LYS A N     1 
ATOM   1583  C  CA    . LYS A  1  206 ? 77.291  67.128  31.307  1.00 105.79 ? 206  LYS A CA    1 
ATOM   1584  C  C     . LYS A  1  206 ? 76.639  65.765  31.438  1.00 104.74 ? 206  LYS A C     1 
ATOM   1585  O  O     . LYS A  1  206 ? 75.888  65.360  30.561  1.00 104.01 ? 206  LYS A O     1 
ATOM   1586  C  CB    . LYS A  1  206 ? 78.726  67.021  30.782  1.00 107.74 ? 206  LYS A CB    1 
ATOM   1587  C  CG    . LYS A  1  206 ? 79.468  68.345  30.997  1.00 111.25 ? 206  LYS A CG    1 
ATOM   1588  C  CD    . LYS A  1  206 ? 80.819  68.474  30.298  1.00 113.57 ? 206  LYS A CD    1 
ATOM   1589  C  CE    . LYS A  1  206 ? 81.326  69.927  30.451  1.00 115.03 ? 206  LYS A CE    1 
ATOM   1590  N  NZ    . LYS A  1  206 ? 82.636  70.217  29.789  1.00 114.92 ? 206  LYS A NZ    1 
ATOM   1591  N  N     . GLU A  1  207 ? 76.911  65.055  32.527  1.00 104.25 ? 207  GLU A N     1 
ATOM   1592  C  CA    . GLU A  1  207 ? 76.297  63.743  32.716  1.00 104.94 ? 207  GLU A CA    1 
ATOM   1593  C  C     . GLU A  1  207 ? 74.793  63.930  32.889  1.00 104.51 ? 207  GLU A C     1 
ATOM   1594  O  O     . GLU A  1  207 ? 73.975  63.109  32.450  1.00 103.56 ? 207  GLU A O     1 
ATOM   1595  C  CB    . GLU A  1  207 ? 76.866  63.046  33.956  1.00 106.32 ? 207  GLU A CB    1 
ATOM   1596  C  CG    . GLU A  1  207 ? 78.253  62.453  33.769  1.00 107.87 ? 207  GLU A CG    1 
ATOM   1597  C  CD    . GLU A  1  207 ? 78.474  61.218  34.632  1.00 109.00 ? 207  GLU A CD    1 
ATOM   1598  O  OE1   . GLU A  1  207 ? 77.725  60.229  34.462  1.00 109.29 ? 207  GLU A OE1   1 
ATOM   1599  O  OE2   . GLU A  1  207 ? 79.393  61.235  35.479  1.00 109.49 ? 207  GLU A OE2   1 
ATOM   1600  N  N     . LEU A  1  208 ? 74.456  65.037  33.543  1.00 104.17 ? 208  LEU A N     1 
ATOM   1601  C  CA    . LEU A  1  208 ? 73.078  65.423  33.831  1.00 102.31 ? 208  LEU A CA    1 
ATOM   1602  C  C     . LEU A  1  208 ? 72.321  65.720  32.551  1.00 101.12 ? 208  LEU A C     1 
ATOM   1603  O  O     . LEU A  1  208 ? 71.330  65.066  32.234  1.00 100.84 ? 208  LEU A O     1 
ATOM   1604  C  CB    . LEU A  1  208 ? 73.075  66.665  34.723  1.00 101.30 ? 208  LEU A CB    1 
ATOM   1605  C  CG    . LEU A  1  208 ? 71.723  67.231  35.148  1.00 99.34  ? 208  LEU A CG    1 
ATOM   1606  C  CD1   . LEU A  1  208 ? 70.934  66.174  35.898  1.00 98.30  ? 208  LEU A CD1   1 
ATOM   1607  C  CD2   . LEU A  1  208 ? 71.950  68.458  36.015  1.00 98.38  ? 208  LEU A CD2   1 
ATOM   1608  N  N     . VAL A  1  209 ? 72.794  66.719  31.821  1.00 100.21 ? 209  VAL A N     1 
ATOM   1609  C  CA    . VAL A  1  209 ? 72.158  67.091  30.576  1.00 100.37 ? 209  VAL A CA    1 
ATOM   1610  C  C     . VAL A  1  209 ? 72.071  65.891  29.632  1.00 100.91 ? 209  VAL A C     1 
ATOM   1611  O  O     . VAL A  1  209 ? 71.140  65.795  28.833  1.00 100.43 ? 209  VAL A O     1 
ATOM   1612  C  CB    . VAL A  1  209 ? 72.915  68.255  29.895  1.00 99.94  ? 209  VAL A CB    1 
ATOM   1613  C  CG1   . VAL A  1  209 ? 74.392  67.923  29.764  1.00 100.88 ? 209  VAL A CG1   1 
ATOM   1614  C  CG2   . VAL A  1  209 ? 72.304  68.538  28.538  1.00 98.98  ? 209  VAL A CG2   1 
ATOM   1615  N  N     . ASP A  1  210 ? 73.031  64.973  29.726  1.00 102.14 ? 210  ASP A N     1 
ATOM   1616  C  CA    . ASP A  1  210 ? 73.020  63.785  28.867  1.00 103.41 ? 210  ASP A CA    1 
ATOM   1617  C  C     . ASP A  1  210 ? 71.821  62.936  29.228  1.00 102.51 ? 210  ASP A C     1 
ATOM   1618  O  O     . ASP A  1  210 ? 70.962  62.666  28.392  1.00 102.64 ? 210  ASP A O     1 
ATOM   1619  C  CB    . ASP A  1  210 ? 74.301  62.944  29.031  1.00 105.21 ? 210  ASP A CB    1 
ATOM   1620  C  CG    . ASP A  1  210 ? 75.437  63.409  28.121  1.00 106.66 ? 210  ASP A CG    1 
ATOM   1621  O  OD1   . ASP A  1  210 ? 75.182  63.628  26.912  1.00 107.45 ? 210  ASP A OD1   1 
ATOM   1622  O  OD2   . ASP A  1  210 ? 76.582  63.541  28.614  1.00 107.50 ? 210  ASP A OD2   1 
ATOM   1623  N  N     . ALA A  1  211 ? 71.775  62.520  30.485  1.00 101.90 ? 211  ALA A N     1 
ATOM   1624  C  CA    . ALA A  1  211 ? 70.675  61.711  30.980  1.00 101.70 ? 211  ALA A CA    1 
ATOM   1625  C  C     . ALA A  1  211 ? 69.360  62.450  30.736  1.00 101.44 ? 211  ALA A C     1 
ATOM   1626  O  O     . ALA A  1  211 ? 68.295  61.837  30.605  1.00 100.39 ? 211  ALA A O     1 
ATOM   1627  C  CB    . ALA A  1  211 ? 70.863  61.451  32.461  1.00 101.81 ? 211  ALA A CB    1 
ATOM   1628  N  N     . ALA A  1  212 ? 69.450  63.774  30.674  1.00 101.67 ? 212  ALA A N     1 
ATOM   1629  C  CA    . ALA A  1  212 ? 68.283  64.611  30.449  1.00 102.70 ? 212  ALA A CA    1 
ATOM   1630  C  C     . ALA A  1  212 ? 67.722  64.424  29.036  1.00 103.43 ? 212  ALA A C     1 
ATOM   1631  O  O     . ALA A  1  212 ? 66.538  64.105  28.868  1.00 103.65 ? 212  ALA A O     1 
ATOM   1632  C  CB    . ALA A  1  212 ? 68.647  66.069  30.683  1.00 103.32 ? 212  ALA A CB    1 
ATOM   1633  N  N     . ARG A  1  213 ? 68.581  64.630  28.035  1.00 103.27 ? 213  ARG A N     1 
ATOM   1634  C  CA    . ARG A  1  213 ? 68.216  64.494  26.622  1.00 102.47 ? 213  ARG A CA    1 
ATOM   1635  C  C     . ARG A  1  213 ? 67.511  63.189  26.368  1.00 102.42 ? 213  ARG A C     1 
ATOM   1636  O  O     . ARG A  1  213 ? 66.521  63.126  25.635  1.00 101.26 ? 213  ARG A O     1 
ATOM   1637  C  CB    . ARG A  1  213 ? 69.467  64.540  25.747  1.00 101.99 ? 213  ARG A CB    1 
ATOM   1638  C  CG    . ARG A  1  213 ? 69.750  65.890  25.144  1.00 102.33 ? 213  ARG A CG    1 
ATOM   1639  C  CD    . ARG A  1  213 ? 71.220  66.052  24.841  1.00 102.58 ? 213  ARG A CD    1 
ATOM   1640  N  NE    . ARG A  1  213 ? 71.511  67.409  24.396  1.00 103.71 ? 213  ARG A NE    1 
ATOM   1641  C  CZ    . ARG A  1  213 ? 72.730  67.936  24.364  1.00 104.43 ? 213  ARG A CZ    1 
ATOM   1642  N  NH1   . ARG A  1  213 ? 73.773  67.210  24.757  1.00 104.48 ? 213  ARG A NH1   1 
ATOM   1643  N  NH2   . ARG A  1  213 ? 72.904  69.183  23.937  1.00 103.77 ? 213  ARG A NH2   1 
ATOM   1644  N  N     . GLN A  1  214 ? 68.044  62.151  26.998  1.00 103.12 ? 214  GLN A N     1 
ATOM   1645  C  CA    . GLN A  1  214 ? 67.546  60.797  26.859  1.00 104.50 ? 214  GLN A CA    1 
ATOM   1646  C  C     . GLN A  1  214 ? 66.170  60.528  27.445  1.00 104.84 ? 214  GLN A C     1 
ATOM   1647  O  O     . GLN A  1  214 ? 65.439  59.698  26.907  1.00 103.86 ? 214  GLN A O     1 
ATOM   1648  C  CB    . GLN A  1  214 ? 68.558  59.824  27.470  1.00 106.17 ? 214  GLN A CB    1 
ATOM   1649  C  CG    . GLN A  1  214 ? 68.390  58.370  27.033  1.00 108.73 ? 214  GLN A CG    1 
ATOM   1650  C  CD    . GLN A  1  214 ? 69.496  57.467  27.560  1.00 110.33 ? 214  GLN A CD    1 
ATOM   1651  O  OE1   . GLN A  1  214 ? 69.586  57.207  28.761  1.00 111.15 ? 214  GLN A OE1   1 
ATOM   1652  N  NE2   . GLN A  1  214 ? 70.351  56.991  26.658  1.00 112.35 ? 214  GLN A NE2   1 
ATOM   1653  N  N     . HIS A  1  215 ? 65.805  61.215  28.529  1.00 105.98 ? 215  HIS A N     1 
ATOM   1654  C  CA    . HIS A  1  215 ? 64.503  60.966  29.152  1.00 107.10 ? 215  HIS A CA    1 
ATOM   1655  C  C     . HIS A  1  215 ? 63.402  62.000  28.943  1.00 107.98 ? 215  HIS A C     1 
ATOM   1656  O  O     . HIS A  1  215 ? 62.211  61.679  29.062  1.00 106.92 ? 215  HIS A O     1 
ATOM   1657  C  CB    . HIS A  1  215 ? 64.686  60.697  30.641  1.00 106.65 ? 215  HIS A CB    1 
ATOM   1658  C  CG    . HIS A  1  215 ? 65.483  59.464  30.926  1.00 105.73 ? 215  HIS A CG    1 
ATOM   1659  N  ND1   . HIS A  1  215 ? 66.839  59.494  31.164  1.00 105.13 ? 215  HIS A ND1   1 
ATOM   1660  C  CD2   . HIS A  1  215 ? 65.117  58.160  30.971  1.00 105.34 ? 215  HIS A CD2   1 
ATOM   1661  C  CE1   . HIS A  1  215 ? 67.277  58.260  31.346  1.00 105.57 ? 215  HIS A CE1   1 
ATOM   1662  N  NE2   . HIS A  1  215 ? 66.253  57.433  31.234  1.00 105.64 ? 215  HIS A NE2   1 
ATOM   1663  N  N     . PHE A  1  216 ? 63.796  63.233  28.644  1.00 109.28 ? 216  PHE A N     1 
ATOM   1664  C  CA    . PHE A  1  216 ? 62.837  64.297  28.373  1.00 110.85 ? 216  PHE A CA    1 
ATOM   1665  C  C     . PHE A  1  216 ? 62.829  64.427  26.860  1.00 112.77 ? 216  PHE A C     1 
ATOM   1666  O  O     . PHE A  1  216 ? 63.649  65.148  26.283  1.00 113.10 ? 216  PHE A O     1 
ATOM   1667  C  CB    . PHE A  1  216 ? 63.294  65.596  29.030  1.00 110.02 ? 216  PHE A CB    1 
ATOM   1668  C  CG    . PHE A  1  216 ? 63.205  65.573  30.528  1.00 108.82 ? 216  PHE A CG    1 
ATOM   1669  C  CD1   . PHE A  1  216 ? 64.290  65.949  31.308  1.00 108.13 ? 216  PHE A CD1   1 
ATOM   1670  C  CD2   . PHE A  1  216 ? 62.032  65.162  31.158  1.00 107.61 ? 216  PHE A CD2   1 
ATOM   1671  C  CE1   . PHE A  1  216 ? 64.209  65.912  32.689  1.00 107.93 ? 216  PHE A CE1   1 
ATOM   1672  C  CE2   . PHE A  1  216 ? 61.944  65.123  32.535  1.00 106.72 ? 216  PHE A CE2   1 
ATOM   1673  C  CZ    . PHE A  1  216 ? 63.033  65.496  33.304  1.00 107.67 ? 216  PHE A CZ    1 
ATOM   1674  N  N     . SER A  1  217 ? 61.909  63.703  26.223  1.00 115.22 ? 217  SER A N     1 
ATOM   1675  C  CA    . SER A  1  217 ? 61.808  63.686  24.762  1.00 117.55 ? 217  SER A CA    1 
ATOM   1676  C  C     . SER A  1  217 ? 60.791  64.647  24.146  1.00 118.94 ? 217  SER A C     1 
ATOM   1677  O  O     . SER A  1  217 ? 61.174  65.559  23.404  1.00 118.95 ? 217  SER A O     1 
ATOM   1678  C  CB    . SER A  1  217 ? 61.534  62.250  24.267  1.00 117.29 ? 217  SER A CB    1 
ATOM   1679  O  OG    . SER A  1  217 ? 60.455  61.637  24.955  1.00 116.88 ? 217  SER A OG    1 
ATOM   1680  N  N     . GLY A  1  218 ? 59.509  64.429  24.451  1.00 120.12 ? 218  GLY A N     1 
ATOM   1681  C  CA    . GLY A  1  218 ? 58.434  65.261  23.928  1.00 120.65 ? 218  GLY A CA    1 
ATOM   1682  C  C     . GLY A  1  218 ? 58.856  66.524  23.191  1.00 121.08 ? 218  GLY A C     1 
ATOM   1683  O  O     . GLY A  1  218 ? 59.027  67.582  23.813  1.00 121.34 ? 218  GLY A O     1 
ATOM   1684  N  N     . VAL A  1  219 ? 59.030  66.414  21.869  1.00 120.53 ? 219  VAL A N     1 
ATOM   1685  C  CA    . VAL A  1  219 ? 59.426  67.556  21.039  1.00 119.62 ? 219  VAL A CA    1 
ATOM   1686  C  C     . VAL A  1  219 ? 58.222  68.224  20.368  1.00 118.44 ? 219  VAL A C     1 
ATOM   1687  O  O     . VAL A  1  219 ? 57.457  67.589  19.633  1.00 118.29 ? 219  VAL A O     1 
ATOM   1688  C  CB    . VAL A  1  219 ? 60.455  67.152  19.951  1.00 119.79 ? 219  VAL A CB    1 
ATOM   1689  C  CG1   . VAL A  1  219 ? 60.774  68.360  19.070  1.00 119.97 ? 219  VAL A CG1   1 
ATOM   1690  C  CG2   . VAL A  1  219 ? 61.734  66.636  20.608  1.00 119.48 ? 219  VAL A CG2   1 
ATOM   1691  N  N     . SER A  1  220 ? 58.080  69.517  20.636  1.00 116.77 ? 220  SER A N     1 
ATOM   1692  C  CA    . SER A  1  220 ? 56.990  70.330  20.121  1.00 114.94 ? 220  SER A CA    1 
ATOM   1693  C  C     . SER A  1  220 ? 56.997  70.514  18.602  1.00 113.67 ? 220  SER A C     1 
ATOM   1694  O  O     . SER A  1  220 ? 58.053  70.600  17.975  1.00 112.98 ? 220  SER A O     1 
ATOM   1695  C  CB    . SER A  1  220 ? 57.008  71.693  20.833  1.00 115.06 ? 220  SER A CB    1 
ATOM   1696  O  OG    . SER A  1  220 ? 58.335  72.160  21.046  1.00 115.35 ? 220  SER A OG    1 
ATOM   1697  N  N     . PHE A  1  221 ? 55.799  70.568  18.026  1.00 112.27 ? 221  PHE A N     1 
ATOM   1698  C  CA    . PHE A  1  221 ? 55.623  70.744  16.591  1.00 111.22 ? 221  PHE A CA    1 
ATOM   1699  C  C     . PHE A  1  221 ? 55.254  72.182  16.247  1.00 110.99 ? 221  PHE A C     1 
ATOM   1700  O  O     . PHE A  1  221 ? 55.969  72.862  15.508  1.00 110.99 ? 221  PHE A O     1 
ATOM   1701  C  CB    . PHE A  1  221 ? 54.528  69.810  16.088  1.00 111.28 ? 221  PHE A CB    1 
ATOM   1702  C  CG    . PHE A  1  221 ? 54.905  68.361  16.129  1.00 112.29 ? 221  PHE A CG    1 
ATOM   1703  C  CD1   . PHE A  1  221 ? 54.157  67.449  16.869  1.00 112.56 ? 221  PHE A CD1   1 
ATOM   1704  C  CD2   . PHE A  1  221 ? 56.013  67.900  15.422  1.00 112.98 ? 221  PHE A CD2   1 
ATOM   1705  C  CE1   . PHE A  1  221 ? 54.505  66.096  16.907  1.00 111.99 ? 221  PHE A CE1   1 
ATOM   1706  C  CE2   . PHE A  1  221 ? 56.370  66.554  15.455  1.00 112.96 ? 221  PHE A CE2   1 
ATOM   1707  C  CZ    . PHE A  1  221 ? 55.610  65.650  16.201  1.00 112.10 ? 221  PHE A CZ    1 
ATOM   1708  N  N     . THR A  1  222 ? 54.124  72.631  16.782  1.00 110.46 ? 222  THR A N     1 
ATOM   1709  C  CA    . THR A  1  222 ? 53.639  73.985  16.550  1.00 109.82 ? 222  THR A CA    1 
ATOM   1710  C  C     . THR A  1  222 ? 54.362  74.978  17.466  1.00 110.51 ? 222  THR A C     1 
ATOM   1711  O  O     . THR A  1  222 ? 55.127  74.573  18.341  1.00 110.54 ? 222  THR A O     1 
ATOM   1712  C  CB    . THR A  1  222 ? 52.119  74.062  16.803  1.00 108.78 ? 222  THR A CB    1 
ATOM   1713  O  OG1   . THR A  1  222 ? 51.821  73.520  18.094  1.00 108.66 ? 222  THR A OG1   1 
ATOM   1714  C  CG2   . THR A  1  222 ? 51.367  73.269  15.756  1.00 107.79 ? 222  THR A CG2   1 
ATOM   1715  N  N     . TYR A  1  223 ? 54.128  76.274  17.254  1.00 111.17 ? 223  TYR A N     1 
ATOM   1716  C  CA    . TYR A  1  223 ? 54.745  77.329  18.063  1.00 110.99 ? 223  TYR A CA    1 
ATOM   1717  C  C     . TYR A  1  223 ? 54.041  77.393  19.426  1.00 110.41 ? 223  TYR A C     1 
ATOM   1718  O  O     . TYR A  1  223 ? 54.671  77.606  20.461  1.00 108.45 ? 223  TYR A O     1 
ATOM   1719  C  CB    . TYR A  1  223 ? 54.621  78.679  17.346  1.00 111.78 ? 223  TYR A CB    1 
ATOM   1720  C  CG    . TYR A  1  223 ? 53.188  79.170  17.203  1.00 113.49 ? 223  TYR A CG    1 
ATOM   1721  C  CD1   . TYR A  1  223 ? 52.799  80.404  17.734  1.00 114.44 ? 223  TYR A CD1   1 
ATOM   1722  C  CD2   . TYR A  1  223 ? 52.211  78.387  16.567  1.00 113.15 ? 223  TYR A CD2   1 
ATOM   1723  C  CE1   . TYR A  1  223 ? 51.473  80.851  17.644  1.00 115.10 ? 223  TYR A CE1   1 
ATOM   1724  C  CE2   . TYR A  1  223 ? 50.881  78.821  16.469  1.00 113.85 ? 223  TYR A CE2   1 
ATOM   1725  C  CZ    . TYR A  1  223 ? 50.519  80.057  17.012  1.00 115.14 ? 223  TYR A CZ    1 
ATOM   1726  O  OH    . TYR A  1  223 ? 49.215  80.511  16.939  1.00 115.34 ? 223  TYR A OH    1 
ATOM   1727  N  N     . LYS A  1  224 ? 52.726  77.201  19.409  1.00 110.95 ? 224  LYS A N     1 
ATOM   1728  C  CA    . LYS A  1  224 ? 51.938  77.223  20.626  1.00 112.08 ? 224  LYS A CA    1 
ATOM   1729  C  C     . LYS A  1  224 ? 52.576  76.363  21.708  1.00 113.27 ? 224  LYS A C     1 
ATOM   1730  O  O     . LYS A  1  224 ? 52.670  76.777  22.864  1.00 113.75 ? 224  LYS A O     1 
ATOM   1731  C  CB    . LYS A  1  224 ? 50.518  76.721  20.354  1.00 111.53 ? 224  LYS A CB    1 
ATOM   1732  C  CG    . LYS A  1  224 ? 49.606  77.748  19.721  1.00 112.30 ? 224  LYS A CG    1 
ATOM   1733  C  CD    . LYS A  1  224 ? 48.154  77.295  19.768  1.00 113.74 ? 224  LYS A CD    1 
ATOM   1734  C  CE    . LYS A  1  224 ? 47.211  78.422  19.354  1.00 115.13 ? 224  LYS A CE    1 
ATOM   1735  N  NZ    . LYS A  1  224 ? 45.766  78.056  19.472  1.00 115.02 ? 224  LYS A NZ    1 
ATOM   1736  N  N     . GLU A  1  225 ? 53.025  75.172  21.327  1.00 114.13 ? 225  GLU A N     1 
ATOM   1737  C  CA    . GLU A  1  225 ? 53.627  74.247  22.275  1.00 114.89 ? 225  GLU A CA    1 
ATOM   1738  C  C     . GLU A  1  225 ? 54.823  74.790  23.053  1.00 115.11 ? 225  GLU A C     1 
ATOM   1739  O  O     . GLU A  1  225 ? 54.920  74.570  24.265  1.00 115.17 ? 225  GLU A O     1 
ATOM   1740  C  CB    . GLU A  1  225 ? 54.003  72.942  21.568  1.00 115.42 ? 225  GLU A CB    1 
ATOM   1741  C  CG    . GLU A  1  225 ? 52.814  72.253  20.895  1.00 117.01 ? 225  GLU A CG    1 
ATOM   1742  C  CD    . GLU A  1  225 ? 53.057  70.769  20.606  1.00 118.48 ? 225  GLU A CD    1 
ATOM   1743  O  OE1   . GLU A  1  225 ? 53.995  70.437  19.850  1.00 119.20 ? 225  GLU A OE1   1 
ATOM   1744  O  OE2   . GLU A  1  225 ? 52.303  69.926  21.138  1.00 119.29 ? 225  GLU A OE2   1 
ATOM   1745  N  N     . ASP A  1  226 ? 55.738  75.493  22.391  1.00 115.41 ? 226  ASP A N     1 
ATOM   1746  C  CA    . ASP A  1  226 ? 56.879  76.019  23.134  1.00 116.43 ? 226  ASP A CA    1 
ATOM   1747  C  C     . ASP A  1  226 ? 56.849  77.527  23.378  1.00 115.64 ? 226  ASP A C     1 
ATOM   1748  O  O     . ASP A  1  226 ? 57.857  78.232  23.249  1.00 115.09 ? 226  ASP A O     1 
ATOM   1749  C  CB    . ASP A  1  226 ? 58.221  75.578  22.508  1.00 118.70 ? 226  ASP A CB    1 
ATOM   1750  C  CG    . ASP A  1  226 ? 58.314  75.870  21.031  1.00 120.29 ? 226  ASP A CG    1 
ATOM   1751  O  OD1   . ASP A  1  226 ? 57.448  75.369  20.284  1.00 122.80 ? 226  ASP A OD1   1 
ATOM   1752  O  OD2   . ASP A  1  226 ? 59.259  76.587  20.619  1.00 120.32 ? 226  ASP A OD2   1 
ATOM   1753  N  N     . ALA A  1  227 ? 55.661  77.995  23.745  1.00 115.00 ? 227  ALA A N     1 
ATOM   1754  C  CA    . ALA A  1  227 ? 55.410  79.387  24.094  1.00 113.56 ? 227  ALA A CA    1 
ATOM   1755  C  C     . ALA A  1  227 ? 54.936  79.370  25.550  1.00 112.74 ? 227  ALA A C     1 
ATOM   1756  O  O     . ALA A  1  227 ? 54.023  78.618  25.909  1.00 112.49 ? 227  ALA A O     1 
ATOM   1757  C  CB    . ALA A  1  227 ? 54.330  79.982  23.198  1.00 112.94 ? 227  ALA A CB    1 
ATOM   1758  N  N     . VAL A  1  228 ? 55.586  80.176  26.386  1.00 112.07 ? 228  VAL A N     1 
ATOM   1759  C  CA    . VAL A  1  228 ? 55.246  80.289  27.804  1.00 110.36 ? 228  VAL A CA    1 
ATOM   1760  C  C     . VAL A  1  228 ? 54.136  81.343  27.945  1.00 109.55 ? 228  VAL A C     1 
ATOM   1761  O  O     . VAL A  1  228 ? 54.359  82.535  27.698  1.00 109.44 ? 228  VAL A O     1 
ATOM   1762  C  CB    . VAL A  1  228 ? 56.492  80.696  28.635  1.00 109.76 ? 228  VAL A CB    1 
ATOM   1763  C  CG1   . VAL A  1  228 ? 57.261  81.814  27.922  1.00 109.48 ? 228  VAL A CG1   1 
ATOM   1764  C  CG2   . VAL A  1  228 ? 56.068  81.134  30.028  1.00 109.74 ? 228  VAL A CG2   1 
ATOM   1765  N  N     . PRO A  1  229 ? 52.924  80.907  28.346  1.00 108.12 ? 229  PRO A N     1 
ATOM   1766  C  CA    . PRO A  1  229 ? 51.762  81.783  28.518  1.00 106.59 ? 229  PRO A CA    1 
ATOM   1767  C  C     . PRO A  1  229 ? 51.919  82.872  29.574  1.00 104.90 ? 229  PRO A C     1 
ATOM   1768  O  O     . PRO A  1  229 ? 52.382  82.609  30.689  1.00 104.87 ? 229  PRO A O     1 
ATOM   1769  C  CB    . PRO A  1  229 ? 50.654  80.801  28.878  1.00 107.10 ? 229  PRO A CB    1 
ATOM   1770  C  CG    . PRO A  1  229 ? 51.389  79.804  29.717  1.00 107.23 ? 229  PRO A CG    1 
ATOM   1771  C  CD    . PRO A  1  229 ? 52.631  79.563  28.881  1.00 108.15 ? 229  PRO A CD    1 
ATOM   1772  N  N     . ILE A  1  230 ? 51.537  84.093  29.201  1.00 102.57 ? 230  ILE A N     1 
ATOM   1773  C  CA    . ILE A  1  230 ? 51.582  85.241  30.102  1.00 98.83  ? 230  ILE A CA    1 
ATOM   1774  C  C     . ILE A  1  230 ? 50.253  85.203  30.846  1.00 96.49  ? 230  ILE A C     1 
ATOM   1775  O  O     . ILE A  1  230 ? 49.195  85.007  30.236  1.00 96.49  ? 230  ILE A O     1 
ATOM   1776  C  CB    . ILE A  1  230 ? 51.677  86.569  29.328  1.00 99.02  ? 230  ILE A CB    1 
ATOM   1777  C  CG1   . ILE A  1  230 ? 52.991  86.621  28.546  1.00 100.09 ? 230  ILE A CG1   1 
ATOM   1778  C  CG2   . ILE A  1  230 ? 51.563  87.739  30.290  1.00 98.57  ? 230  ILE A CG2   1 
ATOM   1779  C  CD1   . ILE A  1  230 ? 53.165  87.879  27.697  1.00 100.07 ? 230  ILE A CD1   1 
ATOM   1780  N  N     . LEU A  1  231 ? 50.308  85.375  32.162  1.00 92.77  ? 231  LEU A N     1 
ATOM   1781  C  CA    . LEU A  1  231 ? 49.105  85.340  32.980  1.00 88.33  ? 231  LEU A CA    1 
ATOM   1782  C  C     . LEU A  1  231 ? 48.380  86.682  33.088  1.00 86.79  ? 231  LEU A C     1 
ATOM   1783  O  O     . LEU A  1  231 ? 49.005  87.751  33.058  1.00 86.97  ? 231  LEU A O     1 
ATOM   1784  C  CB    . LEU A  1  231 ? 49.460  84.843  34.377  1.00 85.36  ? 231  LEU A CB    1 
ATOM   1785  C  CG    . LEU A  1  231 ? 49.491  83.332  34.558  1.00 83.57  ? 231  LEU A CG    1 
ATOM   1786  C  CD1   . LEU A  1  231 ? 50.271  82.991  35.817  1.00 82.45  ? 231  LEU A CD1   1 
ATOM   1787  C  CD2   . LEU A  1  231 ? 48.068  82.796  34.611  1.00 81.85  ? 231  LEU A CD2   1 
ATOM   1788  N  N     . PRO A  1  232 ? 47.040  86.643  33.186  1.00 84.37  ? 232  PRO A N     1 
ATOM   1789  C  CA    . PRO A  1  232 ? 46.284  87.888  33.309  1.00 82.50  ? 232  PRO A CA    1 
ATOM   1790  C  C     . PRO A  1  232 ? 46.610  88.444  34.700  1.00 81.61  ? 232  PRO A C     1 
ATOM   1791  O  O     . PRO A  1  232 ? 46.683  87.694  35.688  1.00 82.00  ? 232  PRO A O     1 
ATOM   1792  C  CB    . PRO A  1  232 ? 44.837  87.425  33.174  1.00 81.66  ? 232  PRO A CB    1 
ATOM   1793  C  CG    . PRO A  1  232 ? 44.876  86.057  33.766  1.00 82.11  ? 232  PRO A CG    1 
ATOM   1794  C  CD    . PRO A  1  232 ? 46.138  85.479  33.180  1.00 83.38  ? 232  PRO A CD    1 
ATOM   1795  N  N     . ARG A  1  233 ? 46.828  89.750  34.773  1.00 79.62  ? 233  ARG A N     1 
ATOM   1796  C  CA    . ARG A  1  233 ? 47.179  90.393  36.027  1.00 77.89  ? 233  ARG A CA    1 
ATOM   1797  C  C     . ARG A  1  233 ? 46.101  90.386  37.115  1.00 76.21  ? 233  ARG A C     1 
ATOM   1798  O  O     . ARG A  1  233 ? 44.895  90.456  36.834  1.00 75.81  ? 233  ARG A O     1 
ATOM   1799  C  CB    . ARG A  1  233 ? 47.631  91.822  35.743  1.00 79.81  ? 233  ARG A CB    1 
ATOM   1800  C  CG    . ARG A  1  233 ? 47.685  92.702  36.957  1.00 82.76  ? 233  ARG A CG    1 
ATOM   1801  C  CD    . ARG A  1  233 ? 48.580  93.873  36.696  1.00 85.94  ? 233  ARG A CD    1 
ATOM   1802  N  NE    . ARG A  1  233 ? 49.966  93.560  37.019  1.00 88.96  ? 233  ARG A NE    1 
ATOM   1803  C  CZ    . ARG A  1  233 ? 51.000  94.302  36.640  1.00 90.70  ? 233  ARG A CZ    1 
ATOM   1804  N  NH1   . ARG A  1  233 ? 50.803  95.401  35.916  1.00 91.56  ? 233  ARG A NH1   1 
ATOM   1805  N  NH2   . ARG A  1  233 ? 52.230  93.954  36.995  1.00 92.00  ? 233  ARG A NH2   1 
ATOM   1806  N  N     . CYS A  1  234 ? 46.565  90.298  38.364  1.00 73.92  ? 234  CYS A N     1 
ATOM   1807  C  CA    . CYS A  1  234 ? 45.696  90.284  39.543  1.00 71.14  ? 234  CYS A CA    1 
ATOM   1808  C  C     . CYS A  1  234 ? 45.634  91.662  40.216  1.00 69.74  ? 234  CYS A C     1 
ATOM   1809  O  O     . CYS A  1  234 ? 46.668  92.270  40.517  1.00 70.93  ? 234  CYS A O     1 
ATOM   1810  C  CB    . CYS A  1  234 ? 46.195  89.245  40.554  1.00 70.28  ? 234  CYS A CB    1 
ATOM   1811  S  SG    . CYS A  1  234 ? 45.768  87.523  40.164  1.00 68.96  ? 234  CYS A SG    1 
ATOM   1812  N  N     . ARG A  1  235 ? 44.420  92.141  40.464  1.00 65.94  ? 235  ARG A N     1 
ATOM   1813  C  CA    . ARG A  1  235 ? 44.239  93.448  41.075  1.00 62.27  ? 235  ARG A CA    1 
ATOM   1814  C  C     . ARG A  1  235 ? 44.204  93.439  42.590  1.00 61.80  ? 235  ARG A C     1 
ATOM   1815  O  O     . ARG A  1  235 ? 43.400  92.726  43.208  1.00 61.69  ? 235  ARG A O     1 
ATOM   1816  C  CB    . ARG A  1  235 ? 42.948  94.080  40.567  1.00 60.66  ? 235  ARG A CB    1 
ATOM   1817  C  CG    . ARG A  1  235 ? 42.481  95.281  41.383  1.00 55.86  ? 235  ARG A CG    1 
ATOM   1818  C  CD    . ARG A  1  235 ? 40.995  95.468  41.257  1.00 51.27  ? 235  ARG A CD    1 
ATOM   1819  N  NE    . ARG A  1  235 ? 40.273  94.248  41.601  1.00 47.67  ? 235  ARG A NE    1 
ATOM   1820  C  CZ    . ARG A  1  235 ? 38.964  94.113  41.454  1.00 44.34  ? 235  ARG A CZ    1 
ATOM   1821  N  NH1   . ARG A  1  235 ? 38.267  95.125  40.981  1.00 45.48  ? 235  ARG A NH1   1 
ATOM   1822  N  NH2   . ARG A  1  235 ? 38.356  92.980  41.749  1.00 41.51  ? 235  ARG A NH2   1 
ATOM   1823  N  N     . PHE A  1  236 ? 45.064  94.266  43.184  1.00 60.03  ? 236  PHE A N     1 
ATOM   1824  C  CA    . PHE A  1  236 ? 45.127  94.395  44.638  1.00 56.51  ? 236  PHE A CA    1 
ATOM   1825  C  C     . PHE A  1  236 ? 44.026  95.321  45.178  1.00 57.30  ? 236  PHE A C     1 
ATOM   1826  O  O     . PHE A  1  236 ? 43.692  96.354  44.585  1.00 57.23  ? 236  PHE A O     1 
ATOM   1827  C  CB    . PHE A  1  236 ? 46.468  94.962  45.045  1.00 51.69  ? 236  PHE A CB    1 
ATOM   1828  C  CG    . PHE A  1  236 ? 46.664  95.020  46.512  1.00 47.00  ? 236  PHE A CG    1 
ATOM   1829  C  CD1   . PHE A  1  236 ? 46.995  93.877  47.217  1.00 46.08  ? 236  PHE A CD1   1 
ATOM   1830  C  CD2   . PHE A  1  236 ? 46.538  96.221  47.194  1.00 45.23  ? 236  PHE A CD2   1 
ATOM   1831  C  CE1   . PHE A  1  236 ? 47.205  93.929  48.585  1.00 45.58  ? 236  PHE A CE1   1 
ATOM   1832  C  CE2   . PHE A  1  236 ? 46.745  96.288  48.563  1.00 44.25  ? 236  PHE A CE2   1 
ATOM   1833  C  CZ    . PHE A  1  236 ? 47.082  95.141  49.263  1.00 45.09  ? 236  PHE A CZ    1 
ATOM   1834  N  N     . THR A  1  237 ? 43.476  94.965  46.324  1.00 57.40  ? 237  THR A N     1 
ATOM   1835  C  CA    . THR A  1  237 ? 42.432  95.777  46.914  1.00 57.22  ? 237  THR A CA    1 
ATOM   1836  C  C     . THR A  1  237 ? 42.675  96.040  48.388  1.00 57.27  ? 237  THR A C     1 
ATOM   1837  O  O     . THR A  1  237 ? 42.914  95.112  49.168  1.00 57.01  ? 237  THR A O     1 
ATOM   1838  C  CB    . THR A  1  237 ? 41.077  95.090  46.756  1.00 57.22  ? 237  THR A CB    1 
ATOM   1839  O  OG1   . THR A  1  237 ? 40.763  95.021  45.366  1.00 58.91  ? 237  THR A OG1   1 
ATOM   1840  C  CG2   . THR A  1  237 ? 39.988  95.847  47.506  1.00 57.26  ? 237  THR A CG2   1 
ATOM   1841  N  N     . GLY A  1  238 ? 42.636  97.312  48.765  1.00 57.24  ? 238  GLY A N     1 
ATOM   1842  C  CA    . GLY A  1  238 ? 42.797  97.636  50.169  1.00 57.82  ? 238  GLY A CA    1 
ATOM   1843  C  C     . GLY A  1  238 ? 41.480  97.199  50.790  1.00 58.48  ? 238  GLY A C     1 
ATOM   1844  O  O     . GLY A  1  238 ? 40.408  97.654  50.370  1.00 59.47  ? 238  GLY A O     1 
ATOM   1845  N  N     . SER A  1  239 ? 41.531  96.291  51.757  1.00 56.73  ? 239  SER A N     1 
ATOM   1846  C  CA    . SER A  1  239 ? 40.301  95.843  52.376  1.00 55.74  ? 239  SER A CA    1 
ATOM   1847  C  C     . SER A  1  239 ? 40.567  94.891  53.517  1.00 55.56  ? 239  SER A C     1 
ATOM   1848  O  O     . SER A  1  239 ? 41.704  94.539  53.784  1.00 56.07  ? 239  SER A O     1 
ATOM   1849  C  CB    . SER A  1  239 ? 39.410  95.177  51.333  1.00 55.42  ? 239  SER A CB    1 
ATOM   1850  O  OG    . SER A  1  239 ? 40.064  94.078  50.743  1.00 57.17  ? 239  SER A OG    1 
ATOM   1851  N  N     . GLU A  1  240 ? 39.516  94.477  54.206  1.00 55.82  ? 240  GLU A N     1 
ATOM   1852  C  CA    . GLU A  1  240 ? 39.696  93.570  55.315  1.00 57.17  ? 240  GLU A CA    1 
ATOM   1853  C  C     . GLU A  1  240 ? 38.674  92.461  55.271  1.00 56.54  ? 240  GLU A C     1 
ATOM   1854  O  O     . GLU A  1  240 ? 37.690  92.525  54.530  1.00 57.18  ? 240  GLU A O     1 
ATOM   1855  C  CB    . GLU A  1  240 ? 39.587  94.311  56.660  1.00 60.50  ? 240  GLU A CB    1 
ATOM   1856  C  CG    . GLU A  1  240 ? 38.241  94.996  56.909  1.00 65.66  ? 240  GLU A CG    1 
ATOM   1857  C  CD    . GLU A  1  240 ? 38.126  95.641  58.295  1.00 68.16  ? 240  GLU A CD    1 
ATOM   1858  O  OE1   . GLU A  1  240 ? 39.041  96.383  58.705  1.00 69.87  ? 240  GLU A OE1   1 
ATOM   1859  O  OE2   . GLU A  1  240 ? 37.103  95.423  58.974  1.00 70.85  ? 240  GLU A OE2   1 
ATOM   1860  N  N     . ILE A  1  241 ? 38.949  91.431  56.059  1.00 54.44  ? 241  ILE A N     1 
ATOM   1861  C  CA    . ILE A  1  241 ? 38.084  90.285  56.206  1.00 53.68  ? 241  ILE A CA    1 
ATOM   1862  C  C     . ILE A  1  241 ? 38.325  89.878  57.647  1.00 53.68  ? 241  ILE A C     1 
ATOM   1863  O  O     . ILE A  1  241 ? 39.474  89.708  58.069  1.00 52.86  ? 241  ILE A O     1 
ATOM   1864  C  CB    . ILE A  1  241 ? 38.478  89.155  55.279  1.00 54.57  ? 241  ILE A CB    1 
ATOM   1865  C  CG1   . ILE A  1  241 ? 37.727  87.890  55.685  1.00 53.94  ? 241  ILE A CG1   1 
ATOM   1866  C  CG2   . ILE A  1  241 ? 39.984  88.967  55.312  1.00 55.39  ? 241  ILE A CG2   1 
ATOM   1867  C  CD1   . ILE A  1  241 ? 38.009  86.722  54.812  1.00 55.21  ? 241  ILE A CD1   1 
ATOM   1868  N  N     . ARG A  1  242 ? 37.236  89.763  58.403  1.00 53.09  ? 242  ARG A N     1 
ATOM   1869  C  CA    . ARG A  1  242 ? 37.307  89.438  59.815  1.00 52.86  ? 242  ARG A CA    1 
ATOM   1870  C  C     . ARG A  1  242 ? 36.542  88.176  60.128  1.00 55.32  ? 242  ARG A C     1 
ATOM   1871  O  O     . ARG A  1  242 ? 35.312  88.172  60.096  1.00 58.31  ? 242  ARG A O     1 
ATOM   1872  C  CB    . ARG A  1  242 ? 36.720  90.579  60.638  1.00 50.09  ? 242  ARG A CB    1 
ATOM   1873  C  CG    . ARG A  1  242 ? 37.329  91.922  60.329  1.00 50.79  ? 242  ARG A CG    1 
ATOM   1874  C  CD    . ARG A  1  242 ? 37.066  92.973  61.406  1.00 50.68  ? 242  ARG A CD    1 
ATOM   1875  N  NE    . ARG A  1  242 ? 37.980  94.108  61.258  1.00 51.81  ? 242  ARG A NE    1 
ATOM   1876  C  CZ    . ARG A  1  242 ? 38.403  94.869  62.265  1.00 52.32  ? 242  ARG A CZ    1 
ATOM   1877  N  NH1   . ARG A  1  242 ? 37.988  94.622  63.509  1.00 50.93  ? 242  ARG A NH1   1 
ATOM   1878  N  NH2   . ARG A  1  242 ? 39.264  95.857  62.031  1.00 51.77  ? 242  ARG A NH2   1 
ATOM   1879  N  N     . ALA A  1  243 ? 37.263  87.104  60.428  1.00 55.23  ? 243  ALA A N     1 
ATOM   1880  C  CA    . ALA A  1  243 ? 36.624  85.849  60.768  1.00 56.02  ? 243  ALA A CA    1 
ATOM   1881  C  C     . ALA A  1  243 ? 36.740  85.771  62.274  1.00 58.46  ? 243  ALA A C     1 
ATOM   1882  O  O     . ALA A  1  243 ? 37.787  85.405  62.827  1.00 58.69  ? 243  ALA A O     1 
ATOM   1883  C  CB    . ALA A  1  243 ? 37.348  84.716  60.129  1.00 57.21  ? 243  ALA A CB    1 
ATOM   1884  N  N     . ARG A  1  244 ? 35.658  86.122  62.948  1.00 59.31  ? 244  ARG A N     1 
ATOM   1885  C  CA    . ARG A  1  244 ? 35.682  86.134  64.391  1.00 59.92  ? 244  ARG A CA    1 
ATOM   1886  C  C     . ARG A  1  244 ? 35.136  84.900  65.041  1.00 60.83  ? 244  ARG A C     1 
ATOM   1887  O  O     . ARG A  1  244 ? 34.141  84.339  64.603  1.00 61.74  ? 244  ARG A O     1 
ATOM   1888  C  CB    . ARG A  1  244 ? 34.930  87.342  64.914  1.00 59.94  ? 244  ARG A CB    1 
ATOM   1889  C  CG    . ARG A  1  244 ? 34.957  87.449  66.415  1.00 59.95  ? 244  ARG A CG    1 
ATOM   1890  C  CD    . ARG A  1  244 ? 34.465  88.804  66.859  1.00 59.82  ? 244  ARG A CD    1 
ATOM   1891  N  NE    . ARG A  1  244 ? 34.215  88.835  68.292  1.00 57.91  ? 244  ARG A NE    1 
ATOM   1892  C  CZ    . ARG A  1  244 ? 33.595  89.830  68.900  1.00 56.20  ? 244  ARG A CZ    1 
ATOM   1893  N  NH1   . ARG A  1  244 ? 33.172  90.864  68.190  1.00 56.43  ? 244  ARG A NH1   1 
ATOM   1894  N  NH2   . ARG A  1  244 ? 33.395  89.789  70.203  1.00 55.89  ? 244  ARG A NH2   1 
ATOM   1895  N  N     . ASP A  1  245 ? 35.812  84.495  66.107  1.00 61.96  ? 245  ASP A N     1 
ATOM   1896  C  CA    . ASP A  1  245 ? 35.449  83.328  66.892  1.00 62.77  ? 245  ASP A CA    1 
ATOM   1897  C  C     . ASP A  1  245 ? 36.073  83.553  68.246  1.00 62.41  ? 245  ASP A C     1 
ATOM   1898  O  O     . ASP A  1  245 ? 37.242  83.244  68.442  1.00 63.22  ? 245  ASP A O     1 
ATOM   1899  C  CB    . ASP A  1  245 ? 36.023  82.053  66.268  1.00 63.88  ? 245  ASP A CB    1 
ATOM   1900  C  CG    . ASP A  1  245 ? 35.649  80.810  67.049  1.00 67.06  ? 245  ASP A CG    1 
ATOM   1901  O  OD1   . ASP A  1  245 ? 34.695  80.886  67.855  1.00 68.86  ? 245  ASP A OD1   1 
ATOM   1902  O  OD2   . ASP A  1  245 ? 36.293  79.756  66.857  1.00 68.30  ? 245  ASP A OD2   1 
ATOM   1903  N  N     . ASP A  1  246 ? 35.311  84.106  69.178  1.00 61.86  ? 246  ASP A N     1 
ATOM   1904  C  CA    . ASP A  1  246 ? 35.873  84.366  70.488  1.00 63.36  ? 246  ASP A CA    1 
ATOM   1905  C  C     . ASP A  1  246 ? 36.266  83.081  71.227  1.00 63.83  ? 246  ASP A C     1 
ATOM   1906  O  O     . ASP A  1  246 ? 36.983  83.120  72.240  1.00 63.94  ? 246  ASP A O     1 
ATOM   1907  C  CB    . ASP A  1  246 ? 34.907  85.206  71.328  1.00 64.11  ? 246  ASP A CB    1 
ATOM   1908  C  CG    . ASP A  1  246 ? 34.804  86.647  70.835  1.00 67.29  ? 246  ASP A CG    1 
ATOM   1909  O  OD1   . ASP A  1  246 ? 35.804  87.197  70.315  1.00 68.25  ? 246  ASP A OD1   1 
ATOM   1910  O  OD2   . ASP A  1  246 ? 33.719  87.246  70.984  1.00 69.81  ? 246  ASP A OD2   1 
ATOM   1911  N  N     . ALA A  1  247 ? 35.828  81.940  70.696  1.00 63.11  ? 247  ALA A N     1 
ATOM   1912  C  CA    . ALA A  1  247 ? 36.129  80.653  71.312  1.00 61.44  ? 247  ALA A CA    1 
ATOM   1913  C  C     . ALA A  1  247 ? 37.572  80.207  71.097  1.00 60.61  ? 247  ALA A C     1 
ATOM   1914  O  O     . ALA A  1  247 ? 38.016  79.253  71.731  1.00 60.68  ? 247  ALA A O     1 
ATOM   1915  C  CB    . ALA A  1  247 ? 35.173  79.592  70.800  1.00 60.76  ? 247  ALA A CB    1 
ATOM   1916  N  N     . LEU A  1  248 ? 38.303  80.883  70.206  1.00 59.71  ? 248  LEU A N     1 
ATOM   1917  C  CA    . LEU A  1  248 ? 39.712  80.540  69.958  1.00 57.01  ? 248  LEU A CA    1 
ATOM   1918  C  C     . LEU A  1  248 ? 40.568  81.245  70.994  1.00 57.55  ? 248  LEU A C     1 
ATOM   1919  O  O     . LEU A  1  248 ? 40.332  82.416  71.312  1.00 56.71  ? 248  LEU A O     1 
ATOM   1920  C  CB    . LEU A  1  248 ? 40.182  80.970  68.564  1.00 53.19  ? 248  LEU A CB    1 
ATOM   1921  C  CG    . LEU A  1  248 ? 39.535  80.315  67.348  1.00 50.69  ? 248  LEU A CG    1 
ATOM   1922  C  CD1   . LEU A  1  248 ? 40.328  80.645  66.113  1.00 47.39  ? 248  LEU A CD1   1 
ATOM   1923  C  CD2   . LEU A  1  248 ? 39.469  78.822  67.548  1.00 49.80  ? 248  LEU A CD2   1 
ATOM   1924  N  N     . PRO A  1  249 ? 41.584  80.538  71.523  1.00 58.28  ? 249  PRO A N     1 
ATOM   1925  C  CA    . PRO A  1  249 ? 42.552  80.966  72.537  1.00 56.68  ? 249  PRO A CA    1 
ATOM   1926  C  C     . PRO A  1  249 ? 43.264  82.247  72.209  1.00 55.95  ? 249  PRO A C     1 
ATOM   1927  O  O     . PRO A  1  249 ? 43.329  83.144  73.041  1.00 56.39  ? 249  PRO A O     1 
ATOM   1928  C  CB    . PRO A  1  249 ? 43.511  79.794  72.614  1.00 56.28  ? 249  PRO A CB    1 
ATOM   1929  C  CG    . PRO A  1  249 ? 43.486  79.275  71.228  1.00 59.80  ? 249  PRO A CG    1 
ATOM   1930  C  CD    . PRO A  1  249 ? 42.012  79.258  70.934  1.00 59.48  ? 249  PRO A CD    1 
ATOM   1931  N  N     . VAL A  1  250 ? 43.821  82.336  71.012  1.00 55.98  ? 250  VAL A N     1 
ATOM   1932  C  CA    . VAL A  1  250 ? 44.502  83.567  70.644  1.00 58.00  ? 250  VAL A CA    1 
ATOM   1933  C  C     . VAL A  1  250 ? 44.046  84.052  69.279  1.00 57.95  ? 250  VAL A C     1 
ATOM   1934  O  O     . VAL A  1  250 ? 43.386  83.325  68.534  1.00 59.10  ? 250  VAL A O     1 
ATOM   1935  C  CB    . VAL A  1  250 ? 46.039  83.396  70.653  1.00 59.06  ? 250  VAL A CB    1 
ATOM   1936  C  CG1   . VAL A  1  250 ? 46.471  82.780  71.971  1.00 59.00  ? 250  VAL A CG1   1 
ATOM   1937  C  CG2   . VAL A  1  250 ? 46.496  82.545  69.481  1.00 58.85  ? 250  VAL A CG2   1 
ATOM   1938  N  N     . ALA A  1  251 ? 44.405  85.281  68.950  1.00 56.56  ? 251  ALA A N     1 
ATOM   1939  C  CA    . ALA A  1  251 ? 43.997  85.840  67.687  1.00 55.75  ? 251  ALA A CA    1 
ATOM   1940  C  C     . ALA A  1  251 ? 45.187  86.073  66.746  1.00 55.79  ? 251  ALA A C     1 
ATOM   1941  O  O     . ALA A  1  251 ? 46.315  86.347  67.186  1.00 53.41  ? 251  ALA A O     1 
ATOM   1942  C  CB    . ALA A  1  251 ? 43.227  87.145  67.943  1.00 54.90  ? 251  ALA A CB    1 
ATOM   1943  N  N     . HIS A  1  252 ? 44.917  85.939  65.448  1.00 55.73  ? 252  HIS A N     1 
ATOM   1944  C  CA    . HIS A  1  252 ? 45.922  86.141  64.414  1.00 55.28  ? 252  HIS A CA    1 
ATOM   1945  C  C     . HIS A  1  252 ? 45.522  87.319  63.544  1.00 54.94  ? 252  HIS A C     1 
ATOM   1946  O  O     . HIS A  1  252 ? 44.365  87.434  63.140  1.00 54.46  ? 252  HIS A O     1 
ATOM   1947  C  CB    . HIS A  1  252 ? 46.036  84.916  63.510  1.00 55.95  ? 252  HIS A CB    1 
ATOM   1948  C  CG    . HIS A  1  252 ? 46.725  83.742  64.139  1.00 57.63  ? 252  HIS A CG    1 
ATOM   1949  N  ND1   . HIS A  1  252 ? 47.871  83.184  63.612  1.00 57.24  ? 252  HIS A ND1   1 
ATOM   1950  C  CD2   . HIS A  1  252 ? 46.393  82.976  65.206  1.00 57.25  ? 252  HIS A CD2   1 
ATOM   1951  C  CE1   . HIS A  1  252 ? 48.211  82.126  64.324  1.00 55.47  ? 252  HIS A CE1   1 
ATOM   1952  N  NE2   . HIS A  1  252 ? 47.331  81.977  65.298  1.00 55.05  ? 252  HIS A NE2   1 
ATOM   1953  N  N     . VAL A  1  253 ? 46.485  88.184  63.249  1.00 54.24  ? 253  VAL A N     1 
ATOM   1954  C  CA    . VAL A  1  253 ? 46.241  89.340  62.402  1.00 53.82  ? 253  VAL A CA    1 
ATOM   1955  C  C     . VAL A  1  253 ? 47.392  89.457  61.416  1.00 54.74  ? 253  VAL A C     1 
ATOM   1956  O  O     . VAL A  1  253 ? 48.541  89.254  61.789  1.00 56.02  ? 253  VAL A O     1 
ATOM   1957  C  CB    . VAL A  1  253 ? 46.165  90.637  63.220  1.00 51.99  ? 253  VAL A CB    1 
ATOM   1958  C  CG1   . VAL A  1  253 ? 46.115  91.815  62.291  1.00 49.82  ? 253  VAL A CG1   1 
ATOM   1959  C  CG2   . VAL A  1  253 ? 44.930  90.632  64.097  1.00 51.69  ? 253  VAL A CG2   1 
ATOM   1960  N  N     . ALA A  1  254 ? 47.072  89.780  60.165  1.00 54.80  ? 254  ALA A N     1 
ATOM   1961  C  CA    . ALA A  1  254 ? 48.065  89.939  59.106  1.00 54.11  ? 254  ALA A CA    1 
ATOM   1962  C  C     . ALA A  1  254 ? 47.679  91.168  58.289  1.00 55.49  ? 254  ALA A C     1 
ATOM   1963  O  O     . ALA A  1  254 ? 46.520  91.298  57.876  1.00 57.47  ? 254  ALA A O     1 
ATOM   1964  C  CB    . ALA A  1  254 ? 48.064  88.728  58.232  1.00 53.24  ? 254  ALA A CB    1 
ATOM   1965  N  N     . LEU A  1  255 ? 48.640  92.060  58.048  1.00 54.93  ? 255  LEU A N     1 
ATOM   1966  C  CA    . LEU A  1  255 ? 48.392  93.292  57.295  1.00 55.06  ? 255  LEU A CA    1 
ATOM   1967  C  C     . LEU A  1  255 ? 49.436  93.465  56.197  1.00 57.38  ? 255  LEU A C     1 
ATOM   1968  O  O     . LEU A  1  255 ? 50.635  93.301  56.453  1.00 58.46  ? 255  LEU A O     1 
ATOM   1969  C  CB    . LEU A  1  255 ? 48.489  94.482  58.222  1.00 53.54  ? 255  LEU A CB    1 
ATOM   1970  C  CG    . LEU A  1  255 ? 48.021  95.808  57.640  1.00 53.14  ? 255  LEU A CG    1 
ATOM   1971  C  CD1   . LEU A  1  255 ? 46.509  95.950  57.937  1.00 53.17  ? 255  LEU A CD1   1 
ATOM   1972  C  CD2   . LEU A  1  255 ? 48.819  96.960  58.242  1.00 47.92  ? 255  LEU A CD2   1 
ATOM   1973  N  N     . ALA A  1  256 ? 49.006  93.836  54.991  1.00 57.73  ? 256  ALA A N     1 
ATOM   1974  C  CA    . ALA A  1  256 ? 49.968  93.974  53.909  1.00 58.99  ? 256  ALA A CA    1 
ATOM   1975  C  C     . ALA A  1  256 ? 49.624  94.947  52.798  1.00 59.90  ? 256  ALA A C     1 
ATOM   1976  O  O     . ALA A  1  256 ? 48.461  95.232  52.550  1.00 61.28  ? 256  ALA A O     1 
ATOM   1977  C  CB    . ALA A  1  256 ? 50.230  92.615  53.312  1.00 59.00  ? 256  ALA A CB    1 
ATOM   1978  N  N     . VAL A  1  257 ? 50.663  95.438  52.126  1.00 60.02  ? 257  VAL A N     1 
ATOM   1979  C  CA    . VAL A  1  257 ? 50.520  96.365  51.015  1.00 61.18  ? 257  VAL A CA    1 
ATOM   1980  C  C     . VAL A  1  257 ? 50.906  95.593  49.769  1.00 63.29  ? 257  VAL A C     1 
ATOM   1981  O  O     . VAL A  1  257 ? 51.413  94.481  49.889  1.00 63.34  ? 257  VAL A O     1 
ATOM   1982  C  CB    . VAL A  1  257 ? 51.467  97.545  51.172  1.00 60.02  ? 257  VAL A CB    1 
ATOM   1983  C  CG1   . VAL A  1  257 ? 51.048  98.388  52.347  1.00 60.70  ? 257  VAL A CG1   1 
ATOM   1984  C  CG2   . VAL A  1  257 ? 52.856  97.045  51.386  1.00 58.08  ? 257  VAL A CG2   1 
ATOM   1985  N  N     . GLU A  1  258 ? 50.688  96.159  48.579  1.00 65.76  ? 258  GLU A N     1 
ATOM   1986  C  CA    . GLU A  1  258 ? 51.046  95.429  47.357  1.00 67.02  ? 258  GLU A CA    1 
ATOM   1987  C  C     . GLU A  1  258 ? 52.538  95.485  47.063  1.00 67.59  ? 258  GLU A C     1 
ATOM   1988  O  O     . GLU A  1  258 ? 53.165  96.549  47.147  1.00 64.83  ? 258  GLU A O     1 
ATOM   1989  C  CB    . GLU A  1  258 ? 50.283  95.947  46.135  1.00 67.85  ? 258  GLU A CB    1 
ATOM   1990  C  CG    . GLU A  1  258 ? 50.280  94.940  44.988  1.00 70.45  ? 258  GLU A CG    1 
ATOM   1991  C  CD    . GLU A  1  258 ? 49.769  95.511  43.666  1.00 73.65  ? 258  GLU A CD    1 
ATOM   1992  O  OE1   . GLU A  1  258 ? 48.650  96.083  43.636  1.00 74.93  ? 258  GLU A OE1   1 
ATOM   1993  O  OE2   . GLU A  1  258 ? 50.494  95.375  42.647  1.00 74.65  ? 258  GLU A OE2   1 
ATOM   1994  N  N     . GLY A  1  259 ? 53.077  94.316  46.708  1.00 70.39  ? 259  GLY A N     1 
ATOM   1995  C  CA    . GLY A  1  259 ? 54.496  94.152  46.399  1.00 73.50  ? 259  GLY A CA    1 
ATOM   1996  C  C     . GLY A  1  259 ? 54.864  94.329  44.930  1.00 74.86  ? 259  GLY A C     1 
ATOM   1997  O  O     . GLY A  1  259 ? 53.993  94.246  44.055  1.00 75.59  ? 259  GLY A O     1 
ATOM   1998  N  N     . PRO A  1  260 ? 56.155  94.553  44.627  1.00 75.01  ? 260  PRO A N     1 
ATOM   1999  C  CA    . PRO A  1  260 ? 56.648  94.753  43.263  1.00 75.56  ? 260  PRO A CA    1 
ATOM   2000  C  C     . PRO A  1  260 ? 56.776  93.550  42.317  1.00 75.87  ? 260  PRO A C     1 
ATOM   2001  O  O     . PRO A  1  260 ? 56.703  93.726  41.094  1.00 77.25  ? 260  PRO A O     1 
ATOM   2002  C  CB    . PRO A  1  260 ? 57.979  95.457  43.493  1.00 75.59  ? 260  PRO A CB    1 
ATOM   2003  C  CG    . PRO A  1  260 ? 58.469  94.777  44.724  1.00 76.72  ? 260  PRO A CG    1 
ATOM   2004  C  CD    . PRO A  1  260 ? 57.236  94.773  45.601  1.00 75.64  ? 260  PRO A CD    1 
ATOM   2005  N  N     . GLY A  1  261 ? 56.963  92.344  42.842  1.00 74.79  ? 261  GLY A N     1 
ATOM   2006  C  CA    . GLY A  1  261 ? 57.103  91.209  41.940  1.00 74.07  ? 261  GLY A CA    1 
ATOM   2007  C  C     . GLY A  1  261 ? 58.567  90.870  41.681  1.00 73.63  ? 261  GLY A C     1 
ATOM   2008  O  O     . GLY A  1  261 ? 59.407  91.751  41.484  1.00 72.72  ? 261  GLY A O     1 
ATOM   2009  N  N     . TRP A  1  262 ? 58.860  89.573  41.675  1.00 72.93  ? 262  TRP A N     1 
ATOM   2010  C  CA    . TRP A  1  262 ? 60.207  89.024  41.496  1.00 71.15  ? 262  TRP A CA    1 
ATOM   2011  C  C     . TRP A  1  262 ? 61.279  89.877  40.849  1.00 71.90  ? 262  TRP A C     1 
ATOM   2012  O  O     . TRP A  1  262 ? 62.337  90.110  41.439  1.00 71.39  ? 262  TRP A O     1 
ATOM   2013  C  CB    . TRP A  1  262 ? 60.109  87.692  40.759  1.00 67.39  ? 262  TRP A CB    1 
ATOM   2014  C  CG    . TRP A  1  262 ? 59.596  86.594  41.642  1.00 64.73  ? 262  TRP A CG    1 
ATOM   2015  C  CD1   . TRP A  1  262 ? 58.519  85.779  41.415  1.00 64.83  ? 262  TRP A CD1   1 
ATOM   2016  C  CD2   . TRP A  1  262 ? 60.133  86.202  42.901  1.00 62.55  ? 262  TRP A CD2   1 
ATOM   2017  N  NE1   . TRP A  1  262 ? 58.355  84.904  42.462  1.00 62.94  ? 262  TRP A NE1   1 
ATOM   2018  C  CE2   . TRP A  1  262 ? 59.334  85.144  43.387  1.00 62.14  ? 262  TRP A CE2   1 
ATOM   2019  C  CE3   . TRP A  1  262 ? 61.213  86.642  43.668  1.00 63.05  ? 262  TRP A CE3   1 
ATOM   2020  C  CZ2   . TRP A  1  262 ? 59.584  84.521  44.604  1.00 63.52  ? 262  TRP A CZ2   1 
ATOM   2021  C  CZ3   . TRP A  1  262 ? 61.464  86.021  44.881  1.00 63.68  ? 262  TRP A CZ3   1 
ATOM   2022  C  CH2   . TRP A  1  262 ? 60.653  84.971  45.338  1.00 64.10  ? 262  TRP A CH2   1 
ATOM   2023  N  N     . ALA A  1  263 ? 60.988  90.342  39.642  1.00 72.77  ? 263  ALA A N     1 
ATOM   2024  C  CA    . ALA A  1  263 ? 61.911  91.140  38.844  1.00 74.03  ? 263  ALA A CA    1 
ATOM   2025  C  C     . ALA A  1  263 ? 62.423  92.486  39.388  1.00 76.02  ? 263  ALA A C     1 
ATOM   2026  O  O     . ALA A  1  263 ? 63.519  92.921  39.026  1.00 77.82  ? 263  ALA A O     1 
ATOM   2027  C  CB    . ALA A  1  263 ? 61.295  91.356  37.463  1.00 72.48  ? 263  ALA A CB    1 
ATOM   2028  N  N     . ASP A  1  264 ? 61.657  93.148  40.249  1.00 77.14  ? 264  ASP A N     1 
ATOM   2029  C  CA    . ASP A  1  264 ? 62.057  94.464  40.745  1.00 76.48  ? 264  ASP A CA    1 
ATOM   2030  C  C     . ASP A  1  264 ? 63.205  94.468  41.745  1.00 75.46  ? 264  ASP A C     1 
ATOM   2031  O  O     . ASP A  1  264 ? 63.176  93.768  42.745  1.00 74.11  ? 264  ASP A O     1 
ATOM   2032  C  CB    . ASP A  1  264 ? 60.845  95.184  41.352  1.00 77.16  ? 264  ASP A CB    1 
ATOM   2033  C  CG    . ASP A  1  264 ? 60.890  96.684  41.139  1.00 77.73  ? 264  ASP A CG    1 
ATOM   2034  O  OD1   . ASP A  1  264 ? 61.866  97.337  41.576  1.00 77.55  ? 264  ASP A OD1   1 
ATOM   2035  O  OD2   . ASP A  1  264 ? 59.936  97.205  40.526  1.00 78.06  ? 264  ASP A OD2   1 
ATOM   2036  N  N     . PRO A  1  265 ? 64.228  95.288  41.484  1.00 75.95  ? 265  PRO A N     1 
ATOM   2037  C  CA    . PRO A  1  265 ? 65.419  95.429  42.330  1.00 76.65  ? 265  PRO A CA    1 
ATOM   2038  C  C     . PRO A  1  265 ? 65.047  95.866  43.743  1.00 77.73  ? 265  PRO A C     1 
ATOM   2039  O  O     . PRO A  1  265 ? 65.732  95.550  44.720  1.00 78.47  ? 265  PRO A O     1 
ATOM   2040  C  CB    . PRO A  1  265 ? 66.224  96.515  41.623  1.00 76.30  ? 265  PRO A CB    1 
ATOM   2041  C  CG    . PRO A  1  265 ? 65.754  96.439  40.205  1.00 76.86  ? 265  PRO A CG    1 
ATOM   2042  C  CD    . PRO A  1  265 ? 64.289  96.205  40.332  1.00 76.56  ? 265  PRO A CD    1 
ATOM   2043  N  N     . ASP A  1  266 ? 63.956  96.613  43.839  1.00 77.86  ? 266  ASP A N     1 
ATOM   2044  C  CA    . ASP A  1  266 ? 63.504  97.116  45.119  1.00 77.52  ? 266  ASP A CA    1 
ATOM   2045  C  C     . ASP A  1  266 ? 63.329  95.995  46.138  1.00 76.14  ? 266  ASP A C     1 
ATOM   2046  O  O     . ASP A  1  266 ? 63.571  96.191  47.330  1.00 75.08  ? 266  ASP A O     1 
ATOM   2047  C  CB    . ASP A  1  266 ? 62.199  97.904  44.936  1.00 80.25  ? 266  ASP A CB    1 
ATOM   2048  C  CG    . ASP A  1  266 ? 62.399  99.209  44.138  1.00 83.09  ? 266  ASP A CG    1 
ATOM   2049  O  OD1   . ASP A  1  266 ? 63.539  99.738  44.121  1.00 84.17  ? 266  ASP A OD1   1 
ATOM   2050  O  OD2   . ASP A  1  266 ? 61.415  99.720  43.543  1.00 82.96  ? 266  ASP A OD2   1 
ATOM   2051  N  N     . ASN A  1  267 ? 62.932  94.815  45.669  1.00 74.61  ? 267  ASN A N     1 
ATOM   2052  C  CA    . ASN A  1  267 ? 62.731  93.686  46.567  1.00 73.51  ? 267  ASN A CA    1 
ATOM   2053  C  C     . ASN A  1  267 ? 63.910  93.471  47.498  1.00 73.22  ? 267  ASN A C     1 
ATOM   2054  O  O     . ASN A  1  267 ? 63.767  92.918  48.593  1.00 71.94  ? 267  ASN A O     1 
ATOM   2055  C  CB    . ASN A  1  267 ? 62.451  92.414  45.776  1.00 72.76  ? 267  ASN A CB    1 
ATOM   2056  C  CG    . ASN A  1  267 ? 60.979  92.237  45.476  1.00 72.86  ? 267  ASN A CG    1 
ATOM   2057  O  OD1   . ASN A  1  267 ? 60.169  92.140  46.385  1.00 73.04  ? 267  ASN A OD1   1 
ATOM   2058  N  ND2   . ASN A  1  267 ? 60.626  92.192  44.197  1.00 73.18  ? 267  ASN A ND2   1 
ATOM   2059  N  N     . VAL A  1  268 ? 65.083  93.915  47.069  1.00 74.32  ? 268  VAL A N     1 
ATOM   2060  C  CA    . VAL A  1  268 ? 66.262  93.760  47.913  1.00 75.09  ? 268  VAL A CA    1 
ATOM   2061  C  C     . VAL A  1  268 ? 66.079  94.701  49.114  1.00 74.32  ? 268  VAL A C     1 
ATOM   2062  O  O     . VAL A  1  268 ? 66.150  94.278  50.272  1.00 74.46  ? 268  VAL A O     1 
ATOM   2063  C  CB    . VAL A  1  268 ? 67.598  94.111  47.147  1.00 74.53  ? 268  VAL A CB    1 
ATOM   2064  C  CG1   . VAL A  1  268 ? 68.806  93.819  48.045  1.00 71.77  ? 268  VAL A CG1   1 
ATOM   2065  C  CG2   . VAL A  1  268 ? 67.691  93.313  45.850  1.00 71.97  ? 268  VAL A CG2   1 
ATOM   2066  N  N     . VAL A  1  269 ? 65.818  95.974  48.829  1.00 72.92  ? 269  VAL A N     1 
ATOM   2067  C  CA    . VAL A  1  269 ? 65.638  96.953  49.888  1.00 70.58  ? 269  VAL A CA    1 
ATOM   2068  C  C     . VAL A  1  269 ? 64.508  96.524  50.809  1.00 69.71  ? 269  VAL A C     1 
ATOM   2069  O  O     . VAL A  1  269 ? 64.638  96.610  52.026  1.00 68.76  ? 269  VAL A O     1 
ATOM   2070  C  CB    . VAL A  1  269 ? 65.318  98.344  49.323  1.00 70.41  ? 269  VAL A CB    1 
ATOM   2071  C  CG1   . VAL A  1  269 ? 65.283  99.350  50.455  1.00 69.96  ? 269  VAL A CG1   1 
ATOM   2072  C  CG2   . VAL A  1  269 ? 66.356  98.745  48.282  1.00 68.61  ? 269  VAL A CG2   1 
ATOM   2073  N  N     . LEU A  1  270 ? 63.403  96.052  50.229  1.00 68.71  ? 270  LEU A N     1 
ATOM   2074  C  CA    . LEU A  1  270 ? 62.262  95.611  51.032  1.00 67.31  ? 270  LEU A CA    1 
ATOM   2075  C  C     . LEU A  1  270 ? 62.703  94.577  52.053  1.00 67.67  ? 270  LEU A C     1 
ATOM   2076  O  O     . LEU A  1  270 ? 62.341  94.663  53.227  1.00 68.12  ? 270  LEU A O     1 
ATOM   2077  C  CB    . LEU A  1  270 ? 61.142  95.023  50.157  1.00 64.85  ? 270  LEU A CB    1 
ATOM   2078  C  CG    . LEU A  1  270 ? 60.389  95.976  49.216  1.00 62.13  ? 270  LEU A CG    1 
ATOM   2079  C  CD1   . LEU A  1  270 ? 59.146  95.299  48.715  1.00 60.22  ? 270  LEU A CD1   1 
ATOM   2080  C  CD2   . LEU A  1  270 ? 60.015  97.238  49.937  1.00 60.85  ? 270  LEU A CD2   1 
ATOM   2081  N  N     . HIS A  1  271 ? 63.493  93.602  51.612  1.00 68.77  ? 271  HIS A N     1 
ATOM   2082  C  CA    . HIS A  1  271 ? 63.986  92.559  52.518  1.00 68.75  ? 271  HIS A CA    1 
ATOM   2083  C  C     . HIS A  1  271 ? 64.915  93.112  53.603  1.00 67.36  ? 271  HIS A C     1 
ATOM   2084  O  O     . HIS A  1  271 ? 64.930  92.614  54.728  1.00 65.54  ? 271  HIS A O     1 
ATOM   2085  C  CB    . HIS A  1  271 ? 64.683  91.464  51.718  1.00 69.11  ? 271  HIS A CB    1 
ATOM   2086  C  CG    . HIS A  1  271 ? 63.734  90.506  51.081  1.00 71.63  ? 271  HIS A CG    1 
ATOM   2087  N  ND1   . HIS A  1  271 ? 63.796  90.173  49.746  1.00 73.27  ? 271  HIS A ND1   1 
ATOM   2088  C  CD2   . HIS A  1  271 ? 62.688  89.814  51.596  1.00 73.80  ? 271  HIS A CD2   1 
ATOM   2089  C  CE1   . HIS A  1  271 ? 62.827  89.317  49.462  1.00 74.41  ? 271  HIS A CE1   1 
ATOM   2090  N  NE2   . HIS A  1  271 ? 62.140  89.083  50.567  1.00 74.80  ? 271  HIS A NE2   1 
ATOM   2091  N  N     . VAL A  1  272 ? 65.680  94.141  53.250  1.00 66.64  ? 272  VAL A N     1 
ATOM   2092  C  CA    . VAL A  1  272 ? 66.586  94.797  54.183  1.00 67.67  ? 272  VAL A CA    1 
ATOM   2093  C  C     . VAL A  1  272 ? 65.727  95.458  55.251  1.00 68.75  ? 272  VAL A C     1 
ATOM   2094  O  O     . VAL A  1  272 ? 66.086  95.481  56.440  1.00 67.93  ? 272  VAL A O     1 
ATOM   2095  C  CB    . VAL A  1  272 ? 67.420  95.903  53.481  1.00 67.74  ? 272  VAL A CB    1 
ATOM   2096  C  CG1   . VAL A  1  272 ? 68.199  96.708  54.503  1.00 65.86  ? 272  VAL A CG1   1 
ATOM   2097  C  CG2   . VAL A  1  272 ? 68.361  95.276  52.476  1.00 68.36  ? 272  VAL A CG2   1 
ATOM   2098  N  N     . ALA A  1  273 ? 64.591  96.000  54.800  1.00 69.46  ? 273  ALA A N     1 
ATOM   2099  C  CA    . ALA A  1  273 ? 63.631  96.677  55.665  1.00 67.99  ? 273  ALA A CA    1 
ATOM   2100  C  C     . ALA A  1  273 ? 63.029  95.685  56.651  1.00 68.15  ? 273  ALA A C     1 
ATOM   2101  O  O     . ALA A  1  273 ? 62.995  95.947  57.852  1.00 68.51  ? 273  ALA A O     1 
ATOM   2102  C  CB    . ALA A  1  273 ? 62.535  97.314  54.834  1.00 67.04  ? 273  ALA A CB    1 
ATOM   2103  N  N     . ASN A  1  274 ? 62.549  94.548  56.156  1.00 67.43  ? 274  ASN A N     1 
ATOM   2104  C  CA    . ASN A  1  274 ? 61.980  93.559  57.054  1.00 68.57  ? 274  ASN A CA    1 
ATOM   2105  C  C     . ASN A  1  274 ? 63.052  93.089  58.026  1.00 70.10  ? 274  ASN A C     1 
ATOM   2106  O  O     . ASN A  1  274 ? 62.748  92.598  59.116  1.00 71.29  ? 274  ASN A O     1 
ATOM   2107  C  CB    . ASN A  1  274 ? 61.449  92.372  56.265  1.00 69.01  ? 274  ASN A CB    1 
ATOM   2108  C  CG    . ASN A  1  274 ? 60.094  92.635  55.669  1.00 69.74  ? 274  ASN A CG    1 
ATOM   2109  O  OD1   . ASN A  1  274 ? 59.677  91.961  54.725  1.00 70.73  ? 274  ASN A OD1   1 
ATOM   2110  N  ND2   . ASN A  1  274 ? 59.383  93.606  56.223  1.00 70.92  ? 274  ASN A ND2   1 
ATOM   2111  N  N     . ALA A  1  275 ? 64.313  93.243  57.628  1.00 70.59  ? 275  ALA A N     1 
ATOM   2112  C  CA    . ALA A  1  275 ? 65.427  92.825  58.470  1.00 69.36  ? 275  ALA A CA    1 
ATOM   2113  C  C     . ALA A  1  275 ? 65.508  93.716  59.681  1.00 68.55  ? 275  ALA A C     1 
ATOM   2114  O  O     . ALA A  1  275 ? 65.842  93.260  60.767  1.00 69.71  ? 275  ALA A O     1 
ATOM   2115  C  CB    . ALA A  1  275 ? 66.717  92.892  57.698  1.00 69.73  ? 275  ALA A CB    1 
ATOM   2116  N  N     . ILE A  1  276 ? 65.207  94.992  59.486  1.00 68.13  ? 276  ILE A N     1 
ATOM   2117  C  CA    . ILE A  1  276 ? 65.229  95.966  60.569  1.00 68.59  ? 276  ILE A CA    1 
ATOM   2118  C  C     . ILE A  1  276 ? 64.118  95.693  61.585  1.00 69.98  ? 276  ILE A C     1 
ATOM   2119  O  O     . ILE A  1  276 ? 64.350  95.749  62.797  1.00 71.07  ? 276  ILE A O     1 
ATOM   2120  C  CB    . ILE A  1  276 ? 65.065  97.385  60.025  1.00 67.07  ? 276  ILE A CB    1 
ATOM   2121  C  CG1   . ILE A  1  276 ? 66.129  97.652  58.968  1.00 66.39  ? 276  ILE A CG1   1 
ATOM   2122  C  CG2   . ILE A  1  276 ? 65.199  98.381  61.139  1.00 65.70  ? 276  ILE A CG2   1 
ATOM   2123  C  CD1   . ILE A  1  276 ? 66.150  99.073  58.470  1.00 67.61  ? 276  ILE A CD1   1 
ATOM   2124  N  N     . ILE A  1  277 ? 62.915  95.401  61.095  1.00 71.00  ? 277  ILE A N     1 
ATOM   2125  C  CA    . ILE A  1  277 ? 61.789  95.101  61.970  1.00 72.21  ? 277  ILE A CA    1 
ATOM   2126  C  C     . ILE A  1  277 ? 61.940  93.697  62.539  1.00 72.62  ? 277  ILE A C     1 
ATOM   2127  O  O     . ILE A  1  277 ? 61.645  93.458  63.707  1.00 73.48  ? 277  ILE A O     1 
ATOM   2128  C  CB    . ILE A  1  277 ? 60.461  95.192  61.217  1.00 73.10  ? 277  ILE A CB    1 
ATOM   2129  C  CG1   . ILE A  1  277 ? 60.255  96.630  60.750  1.00 74.33  ? 277  ILE A CG1   1 
ATOM   2130  C  CG2   . ILE A  1  277 ? 59.314  94.747  62.112  1.00 73.40  ? 277  ILE A CG2   1 
ATOM   2131  C  CD1   . ILE A  1  277 ? 58.962  96.851  60.037  1.00 75.16  ? 277  ILE A CD1   1 
ATOM   2132  N  N     . GLY A  1  278 ? 62.386  92.770  61.697  1.00 72.48  ? 278  GLY A N     1 
ATOM   2133  C  CA    . GLY A  1  278 ? 62.612  91.396  62.125  1.00 73.18  ? 278  GLY A CA    1 
ATOM   2134  C  C     . GLY A  1  278 ? 61.432  90.510  62.492  1.00 73.19  ? 278  GLY A C     1 
ATOM   2135  O  O     . GLY A  1  278 ? 60.387  90.504  61.837  1.00 73.69  ? 278  GLY A O     1 
ATOM   2136  N  N     . ARG A  1  279 ? 61.623  89.717  63.536  1.00 72.94  ? 279  ARG A N     1 
ATOM   2137  C  CA    . ARG A  1  279 ? 60.577  88.828  64.003  1.00 73.52  ? 279  ARG A CA    1 
ATOM   2138  C  C     . ARG A  1  279 ? 60.827  88.454  65.463  1.00 72.89  ? 279  ARG A C     1 
ATOM   2139  O  O     . ARG A  1  279 ? 61.950  88.569  65.960  1.00 73.81  ? 279  ARG A O     1 
ATOM   2140  C  CB    . ARG A  1  279 ? 60.518  87.584  63.130  1.00 75.40  ? 279  ARG A CB    1 
ATOM   2141  C  CG    . ARG A  1  279 ? 61.788  86.774  63.110  1.00 79.76  ? 279  ARG A CG    1 
ATOM   2142  C  CD    . ARG A  1  279 ? 61.575  85.498  62.323  1.00 84.28  ? 279  ARG A CD    1 
ATOM   2143  N  NE    . ARG A  1  279 ? 62.699  84.589  62.489  1.00 89.84  ? 279  ARG A NE    1 
ATOM   2144  C  CZ    . ARG A  1  279 ? 62.596  83.262  62.509  1.00 93.01  ? 279  ARG A CZ    1 
ATOM   2145  N  NH1   . ARG A  1  279 ? 61.407  82.675  62.373  1.00 93.28  ? 279  ARG A NH1   1 
ATOM   2146  N  NH2   . ARG A  1  279 ? 63.688  82.522  62.681  1.00 94.88  ? 279  ARG A NH2   1 
ATOM   2147  N  N     . TYR A  1  280 ? 59.777  88.028  66.152  1.00 70.82  ? 280  TYR A N     1 
ATOM   2148  C  CA    . TYR A  1  280 ? 59.897  87.671  67.548  1.00 69.92  ? 280  TYR A CA    1 
ATOM   2149  C  C     . TYR A  1  280 ? 59.043  86.467  67.830  1.00 69.93  ? 280  TYR A C     1 
ATOM   2150  O  O     . TYR A  1  280 ? 58.250  86.050  67.008  1.00 69.20  ? 280  TYR A O     1 
ATOM   2151  C  CB    . TYR A  1  280 ? 59.446  88.836  68.429  1.00 70.71  ? 280  TYR A CB    1 
ATOM   2152  C  CG    . TYR A  1  280 ? 59.349  88.512  69.908  1.00 72.58  ? 280  TYR A CG    1 
ATOM   2153  C  CD1   . TYR A  1  280 ? 60.486  88.423  70.704  1.00 73.25  ? 280  TYR A CD1   1 
ATOM   2154  C  CD2   . TYR A  1  280 ? 58.111  88.273  70.509  1.00 74.07  ? 280  TYR A CD2   1 
ATOM   2155  C  CE1   . TYR A  1  280 ? 60.393  88.103  72.060  1.00 74.39  ? 280  TYR A CE1   1 
ATOM   2156  C  CE2   . TYR A  1  280 ? 58.007  87.952  71.863  1.00 74.36  ? 280  TYR A CE2   1 
ATOM   2157  C  CZ    . TYR A  1  280 ? 59.150  87.868  72.629  1.00 75.12  ? 280  TYR A CZ    1 
ATOM   2158  O  OH    . TYR A  1  280 ? 59.050  87.537  73.958  1.00 76.69  ? 280  TYR A OH    1 
ATOM   2159  N  N     . ASP A  1  281 ? 59.218  85.910  69.011  1.00 71.96  ? 281  ASP A N     1 
ATOM   2160  C  CA    . ASP A  1  281 ? 58.465  84.754  69.436  1.00 74.66  ? 281  ASP A CA    1 
ATOM   2161  C  C     . ASP A  1  281 ? 58.968  84.445  70.854  1.00 76.28  ? 281  ASP A C     1 
ATOM   2162  O  O     . ASP A  1  281 ? 60.176  84.341  71.087  1.00 77.39  ? 281  ASP A O     1 
ATOM   2163  C  CB    . ASP A  1  281 ? 58.698  83.614  68.442  1.00 75.72  ? 281  ASP A CB    1 
ATOM   2164  C  CG    . ASP A  1  281 ? 59.033  82.317  69.114  1.00 79.16  ? 281  ASP A CG    1 
ATOM   2165  O  OD1   . ASP A  1  281 ? 58.238  81.876  69.969  1.00 80.90  ? 281  ASP A OD1   1 
ATOM   2166  O  OD2   . ASP A  1  281 ? 60.094  81.740  68.784  1.00 81.71  ? 281  ASP A OD2   1 
ATOM   2167  N  N     . ARG A  1  282 ? 58.029  84.349  71.796  1.00 77.10  ? 282  ARG A N     1 
ATOM   2168  C  CA    . ARG A  1  282 ? 58.309  84.096  73.211  1.00 76.88  ? 282  ARG A CA    1 
ATOM   2169  C  C     . ARG A  1  282 ? 59.520  83.253  73.616  1.00 75.87  ? 282  ARG A C     1 
ATOM   2170  O  O     . ARG A  1  282 ? 59.939  83.301  74.772  1.00 76.62  ? 282  ARG A O     1 
ATOM   2171  C  CB    . ARG A  1  282 ? 57.072  83.508  73.885  1.00 79.62  ? 282  ARG A CB    1 
ATOM   2172  C  CG    . ARG A  1  282 ? 56.051  84.545  74.306  1.00 84.40  ? 282  ARG A CG    1 
ATOM   2173  C  CD    . ARG A  1  282 ? 55.005  83.939  75.233  1.00 87.83  ? 282  ARG A CD    1 
ATOM   2174  N  NE    . ARG A  1  282 ? 54.340  82.799  74.610  1.00 91.40  ? 282  ARG A NE    1 
ATOM   2175  C  CZ    . ARG A  1  282 ? 53.519  81.975  75.255  1.00 93.73  ? 282  ARG A CZ    1 
ATOM   2176  N  NH1   . ARG A  1  282 ? 53.263  82.167  76.551  1.00 93.23  ? 282  ARG A NH1   1 
ATOM   2177  N  NH2   . ARG A  1  282 ? 52.955  80.958  74.607  1.00 94.49  ? 282  ARG A NH2   1 
ATOM   2178  N  N     . THR A  1  283 ? 60.088  82.475  72.705  1.00 73.20  ? 283  THR A N     1 
ATOM   2179  C  CA    . THR A  1  283 ? 61.238  81.674  73.083  1.00 69.88  ? 283  THR A CA    1 
ATOM   2180  C  C     . THR A  1  283 ? 62.573  82.372  72.815  1.00 68.02  ? 283  THR A C     1 
ATOM   2181  O  O     . THR A  1  283 ? 63.603  81.955  73.325  1.00 68.74  ? 283  THR A O     1 
ATOM   2182  C  CB    . THR A  1  283 ? 61.224  80.351  72.374  1.00 69.96  ? 283  THR A CB    1 
ATOM   2183  O  OG1   . THR A  1  283 ? 61.480  80.571  70.981  1.00 71.80  ? 283  THR A OG1   1 
ATOM   2184  C  CG2   . THR A  1  283 ? 59.879  79.662  72.588  1.00 66.10  ? 283  THR A CG2   1 
ATOM   2185  N  N     . PHE A  1  284 ? 62.565  83.421  72.006  1.00 64.66  ? 284  PHE A N     1 
ATOM   2186  C  CA    . PHE A  1  284 ? 63.792  84.160  71.759  1.00 63.62  ? 284  PHE A CA    1 
ATOM   2187  C  C     . PHE A  1  284 ? 64.369  84.531  73.117  1.00 66.14  ? 284  PHE A C     1 
ATOM   2188  O  O     . PHE A  1  284 ? 63.715  85.220  73.906  1.00 69.08  ? 284  PHE A O     1 
ATOM   2189  C  CB    . PHE A  1  284 ? 63.482  85.431  70.982  1.00 59.63  ? 284  PHE A CB    1 
ATOM   2190  C  CG    . PHE A  1  284 ? 63.159  85.189  69.546  1.00 54.63  ? 284  PHE A CG    1 
ATOM   2191  C  CD1   . PHE A  1  284 ? 62.365  84.104  69.177  1.00 50.97  ? 284  PHE A CD1   1 
ATOM   2192  C  CD2   . PHE A  1  284 ? 63.689  86.015  68.559  1.00 51.41  ? 284  PHE A CD2   1 
ATOM   2193  C  CE1   . PHE A  1  284 ? 62.109  83.836  67.859  1.00 48.46  ? 284  PHE A CE1   1 
ATOM   2194  C  CE2   . PHE A  1  284 ? 63.439  85.760  67.238  1.00 50.74  ? 284  PHE A CE2   1 
ATOM   2195  C  CZ    . PHE A  1  284 ? 62.645  84.661  66.881  1.00 51.02  ? 284  PHE A CZ    1 
ATOM   2196  N  N     . GLY A  1  285 ? 65.590  84.091  73.397  1.00 66.72  ? 285  GLY A N     1 
ATOM   2197  C  CA    . GLY A  1  285 ? 66.191  84.392  74.689  1.00 65.95  ? 285  GLY A CA    1 
ATOM   2198  C  C     . GLY A  1  285 ? 66.694  85.811  74.823  1.00 64.62  ? 285  GLY A C     1 
ATOM   2199  O  O     . GLY A  1  285 ? 66.747  86.355  75.918  1.00 63.03  ? 285  GLY A O     1 
ATOM   2200  N  N     . GLY A  1  286 ? 67.066  86.407  73.700  1.00 65.41  ? 286  GLY A N     1 
ATOM   2201  C  CA    . GLY A  1  286 ? 67.567  87.764  73.716  1.00 69.29  ? 286  GLY A CA    1 
ATOM   2202  C  C     . GLY A  1  286 ? 66.690  88.714  74.504  1.00 72.13  ? 286  GLY A C     1 
ATOM   2203  O  O     . GLY A  1  286 ? 67.185  89.722  75.020  1.00 74.57  ? 286  GLY A O     1 
ATOM   2204  N  N     . GLY A  1  287 ? 65.392  88.404  74.581  1.00 73.12  ? 287  GLY A N     1 
ATOM   2205  C  CA    . GLY A  1  287 ? 64.440  89.221  75.326  1.00 71.79  ? 287  GLY A CA    1 
ATOM   2206  C  C     . GLY A  1  287 ? 64.417  90.720  75.067  1.00 71.26  ? 287  GLY A C     1 
ATOM   2207  O  O     . GLY A  1  287 ? 64.565  91.186  73.939  1.00 70.25  ? 287  GLY A O     1 
ATOM   2208  N  N     . LYS A  1  288 ? 64.238  91.473  76.142  1.00 71.23  ? 288  LYS A N     1 
ATOM   2209  C  CA    . LYS A  1  288 ? 64.157  92.929  76.088  1.00 73.28  ? 288  LYS A CA    1 
ATOM   2210  C  C     . LYS A  1  288 ? 65.374  93.638  75.515  1.00 73.76  ? 288  LYS A C     1 
ATOM   2211  O  O     . LYS A  1  288 ? 65.433  94.878  75.485  1.00 73.30  ? 288  LYS A O     1 
ATOM   2212  C  CB    . LYS A  1  288 ? 63.933  93.461  77.489  1.00 75.73  ? 288  LYS A CB    1 
ATOM   2213  C  CG    . LYS A  1  288 ? 65.010  92.996  78.443  1.00 77.12  ? 288  LYS A CG    1 
ATOM   2214  C  CD    . LYS A  1  288 ? 64.884  93.666  79.785  1.00 79.66  ? 288  LYS A CD    1 
ATOM   2215  C  CE    . LYS A  1  288 ? 65.920  93.124  80.737  1.00 81.30  ? 288  LYS A CE    1 
ATOM   2216  N  NZ    . LYS A  1  288 ? 65.655  93.602  82.114  1.00 84.41  ? 288  LYS A NZ    1 
ATOM   2217  N  N     . HIS A  1  289 ? 66.353  92.865  75.074  1.00 74.55  ? 289  HIS A N     1 
ATOM   2218  C  CA    . HIS A  1  289 ? 67.571  93.455  74.543  1.00 74.67  ? 289  HIS A CA    1 
ATOM   2219  C  C     . HIS A  1  289 ? 67.709  93.258  73.051  1.00 75.56  ? 289  HIS A C     1 
ATOM   2220  O  O     . HIS A  1  289 ? 68.702  93.681  72.443  1.00 76.18  ? 289  HIS A O     1 
ATOM   2221  C  CB    . HIS A  1  289 ? 68.774  92.879  75.285  1.00 72.57  ? 289  HIS A CB    1 
ATOM   2222  C  CG    . HIS A  1  289 ? 68.849  93.320  76.711  1.00 71.18  ? 289  HIS A CG    1 
ATOM   2223  N  ND1   . HIS A  1  289 ? 68.891  92.433  77.766  1.00 69.60  ? 289  HIS A ND1   1 
ATOM   2224  C  CD2   . HIS A  1  289 ? 68.843  94.561  77.258  1.00 69.17  ? 289  HIS A CD2   1 
ATOM   2225  C  CE1   . HIS A  1  289 ? 68.906  93.109  78.902  1.00 69.95  ? 289  HIS A CE1   1 
ATOM   2226  N  NE2   . HIS A  1  289 ? 68.877  94.401  78.622  1.00 69.66  ? 289  HIS A NE2   1 
ATOM   2227  N  N     . LEU A  1  290 ? 66.707  92.616  72.461  1.00 75.12  ? 290  LEU A N     1 
ATOM   2228  C  CA    . LEU A  1  290 ? 66.727  92.394  71.036  1.00 75.28  ? 290  LEU A CA    1 
ATOM   2229  C  C     . LEU A  1  290 ? 66.878  93.760  70.374  1.00 76.97  ? 290  LEU A C     1 
ATOM   2230  O  O     . LEU A  1  290 ? 66.497  94.787  70.948  1.00 77.74  ? 290  LEU A O     1 
ATOM   2231  C  CB    . LEU A  1  290 ? 65.448  91.689  70.609  1.00 73.66  ? 290  LEU A CB    1 
ATOM   2232  C  CG    . LEU A  1  290 ? 65.349  90.279  71.205  1.00 72.38  ? 290  LEU A CG    1 
ATOM   2233  C  CD1   . LEU A  1  290 ? 64.028  89.650  70.868  1.00 73.38  ? 290  LEU A CD1   1 
ATOM   2234  C  CD2   . LEU A  1  290 ? 66.454  89.425  70.650  1.00 73.28  ? 290  LEU A CD2   1 
ATOM   2235  N  N     . SER A  1  291 ? 67.467  93.779  69.184  1.00 78.53  ? 291  SER A N     1 
ATOM   2236  C  CA    . SER A  1  291 ? 67.691  95.029  68.468  1.00 79.48  ? 291  SER A CA    1 
ATOM   2237  C  C     . SER A  1  291 ? 66.417  95.512  67.783  1.00 79.86  ? 291  SER A C     1 
ATOM   2238  O  O     . SER A  1  291 ? 66.248  96.715  67.544  1.00 80.02  ? 291  SER A O     1 
ATOM   2239  C  CB    . SER A  1  291 ? 68.814  94.843  67.449  1.00 80.48  ? 291  SER A CB    1 
ATOM   2240  O  OG    . SER A  1  291 ? 70.004  94.405  68.092  1.00 81.41  ? 291  SER A OG    1 
ATOM   2241  N  N     . SER A  1  292 ? 65.531  94.563  67.468  1.00 79.53  ? 292  SER A N     1 
ATOM   2242  C  CA    . SER A  1  292 ? 64.246  94.870  66.836  1.00 77.18  ? 292  SER A CA    1 
ATOM   2243  C  C     . SER A  1  292 ? 63.371  95.606  67.835  1.00 74.70  ? 292  SER A C     1 
ATOM   2244  O  O     . SER A  1  292 ? 62.931  95.033  68.839  1.00 72.07  ? 292  SER A O     1 
ATOM   2245  C  CB    . SER A  1  292 ? 63.536  93.590  66.410  1.00 78.49  ? 292  SER A CB    1 
ATOM   2246  O  OG    . SER A  1  292 ? 62.168  93.851  66.150  1.00 80.08  ? 292  SER A OG    1 
ATOM   2247  N  N     . ARG A  1  293 ? 63.118  96.877  67.551  1.00 72.90  ? 293  ARG A N     1 
ATOM   2248  C  CA    . ARG A  1  293 ? 62.310  97.705  68.430  1.00 71.89  ? 293  ARG A CA    1 
ATOM   2249  C  C     . ARG A  1  293 ? 60.960  97.077  68.738  1.00 69.67  ? 293  ARG A C     1 
ATOM   2250  O  O     . ARG A  1  293 ? 60.551  97.016  69.905  1.00 68.12  ? 293  ARG A O     1 
ATOM   2251  C  CB    . ARG A  1  293 ? 62.102  99.066  67.793  1.00 73.83  ? 293  ARG A CB    1 
ATOM   2252  C  CG    . ARG A  1  293 ? 63.381  99.724  67.359  1.00 78.34  ? 293  ARG A CG    1 
ATOM   2253  C  CD    . ARG A  1  293 ? 63.076  100.798 66.350  1.00 82.50  ? 293  ARG A CD    1 
ATOM   2254  N  NE    . ARG A  1  293 ? 62.032  101.683 66.855  1.00 85.69  ? 293  ARG A NE    1 
ATOM   2255  C  CZ    . ARG A  1  293 ? 62.212  102.572 67.824  1.00 87.78  ? 293  ARG A CZ    1 
ATOM   2256  N  NH1   . ARG A  1  293 ? 63.407  102.704 68.392  1.00 88.69  ? 293  ARG A NH1   1 
ATOM   2257  N  NH2   . ARG A  1  293 ? 61.191  103.315 68.235  1.00 88.58  ? 293  ARG A NH2   1 
ATOM   2258  N  N     . LEU A  1  294 ? 60.275  96.625  67.686  1.00 66.69  ? 294  LEU A N     1 
ATOM   2259  C  CA    . LEU A  1  294 ? 58.975  96.010  67.844  1.00 64.39  ? 294  LEU A CA    1 
ATOM   2260  C  C     . LEU A  1  294 ? 59.088  94.811  68.767  1.00 64.79  ? 294  LEU A C     1 
ATOM   2261  O  O     . LEU A  1  294 ? 58.196  94.565  69.592  1.00 65.53  ? 294  LEU A O     1 
ATOM   2262  C  CB    . LEU A  1  294 ? 58.415  95.592  66.491  1.00 63.48  ? 294  LEU A CB    1 
ATOM   2263  C  CG    . LEU A  1  294 ? 57.018  94.944  66.514  1.00 64.47  ? 294  LEU A CG    1 
ATOM   2264  C  CD1   . LEU A  1  294 ? 56.052  95.805  67.321  1.00 63.64  ? 294  LEU A CD1   1 
ATOM   2265  C  CD2   . LEU A  1  294 ? 56.496  94.755  65.091  1.00 63.41  ? 294  LEU A CD2   1 
ATOM   2266  N  N     . ALA A  1  295 ? 60.191  94.076  68.640  1.00 64.40  ? 295  ALA A N     1 
ATOM   2267  C  CA    . ALA A  1  295 ? 60.436  92.901  69.479  1.00 64.06  ? 295  ALA A CA    1 
ATOM   2268  C  C     . ALA A  1  295 ? 60.619  93.314  70.945  1.00 64.53  ? 295  ALA A C     1 
ATOM   2269  O  O     . ALA A  1  295 ? 60.083  92.678  71.859  1.00 63.12  ? 295  ALA A O     1 
ATOM   2270  C  CB    . ALA A  1  295 ? 61.655  92.165  68.989  1.00 63.36  ? 295  ALA A CB    1 
ATOM   2271  N  N     . ALA A  1  296 ? 61.385  94.383  71.162  1.00 65.27  ? 296  ALA A N     1 
ATOM   2272  C  CA    . ALA A  1  296 ? 61.613  94.894  72.508  1.00 65.12  ? 296  ALA A CA    1 
ATOM   2273  C  C     . ALA A  1  296 ? 60.263  95.266  73.125  1.00 65.27  ? 296  ALA A C     1 
ATOM   2274  O  O     . ALA A  1  296 ? 59.943  94.816  74.231  1.00 65.91  ? 296  ALA A O     1 
ATOM   2275  C  CB    . ALA A  1  296 ? 62.521  96.115  72.462  1.00 64.00  ? 296  ALA A CB    1 
ATOM   2276  N  N     . LEU A  1  297 ? 59.484  96.086  72.411  1.00 63.39  ? 297  LEU A N     1 
ATOM   2277  C  CA    . LEU A  1  297 ? 58.173  96.501  72.885  1.00 61.12  ? 297  LEU A CA    1 
ATOM   2278  C  C     . LEU A  1  297 ? 57.339  95.260  73.130  1.00 61.77  ? 297  LEU A C     1 
ATOM   2279  O  O     . LEU A  1  297 ? 56.714  95.105  74.187  1.00 62.86  ? 297  LEU A O     1 
ATOM   2280  C  CB    . LEU A  1  297 ? 57.483  97.380  71.852  1.00 59.67  ? 297  LEU A CB    1 
ATOM   2281  C  CG    . LEU A  1  297 ? 58.096  98.763  71.658  1.00 58.79  ? 297  LEU A CG    1 
ATOM   2282  C  CD1   . LEU A  1  297 ? 57.471  99.497  70.464  1.00 56.90  ? 297  LEU A CD1   1 
ATOM   2283  C  CD2   . LEU A  1  297 ? 57.882  99.532  72.938  1.00 58.40  ? 297  LEU A CD2   1 
ATOM   2284  N  N     . ALA A  1  298 ? 57.330  94.367  72.151  1.00 60.61  ? 298  ALA A N     1 
ATOM   2285  C  CA    . ALA A  1  298 ? 56.572  93.143  72.297  1.00 61.52  ? 298  ALA A CA    1 
ATOM   2286  C  C     . ALA A  1  298 ? 56.897  92.509  73.650  1.00 62.64  ? 298  ALA A C     1 
ATOM   2287  O  O     . ALA A  1  298 ? 56.014  92.074  74.378  1.00 62.40  ? 298  ALA A O     1 
ATOM   2288  C  CB    . ALA A  1  298 ? 56.916  92.201  71.179  1.00 59.71  ? 298  ALA A CB    1 
ATOM   2289  N  N     . VAL A  1  299 ? 58.181  92.480  73.982  1.00 65.68  ? 299  VAL A N     1 
ATOM   2290  C  CA    . VAL A  1  299 ? 58.666  91.900  75.242  1.00 67.36  ? 299  VAL A CA    1 
ATOM   2291  C  C     . VAL A  1  299 ? 58.218  92.736  76.455  1.00 68.45  ? 299  VAL A C     1 
ATOM   2292  O  O     . VAL A  1  299 ? 57.497  92.250  77.340  1.00 66.75  ? 299  VAL A O     1 
ATOM   2293  C  CB    . VAL A  1  299 ? 60.232  91.808  75.228  1.00 66.14  ? 299  VAL A CB    1 
ATOM   2294  C  CG1   . VAL A  1  299 ? 60.730  91.166  76.488  1.00 63.65  ? 299  VAL A CG1   1 
ATOM   2295  C  CG2   . VAL A  1  299 ? 60.703  91.009  74.022  1.00 66.37  ? 299  VAL A CG2   1 
ATOM   2296  N  N     . GLU A  1  300 ? 58.668  93.993  76.469  1.00 69.87  ? 300  GLU A N     1 
ATOM   2297  C  CA    . GLU A  1  300 ? 58.373  94.963  77.519  1.00 71.34  ? 300  GLU A CA    1 
ATOM   2298  C  C     . GLU A  1  300 ? 56.896  95.026  77.887  1.00 71.61  ? 300  GLU A C     1 
ATOM   2299  O  O     . GLU A  1  300 ? 56.550  94.968  79.062  1.00 72.95  ? 300  GLU A O     1 
ATOM   2300  C  CB    . GLU A  1  300 ? 58.868  96.347  77.079  1.00 72.74  ? 300  GLU A CB    1 
ATOM   2301  C  CG    . GLU A  1  300 ? 58.417  97.530  77.933  1.00 78.59  ? 300  GLU A CG    1 
ATOM   2302  C  CD    . GLU A  1  300 ? 58.958  98.893  77.409  1.00 83.96  ? 300  GLU A CD    1 
ATOM   2303  O  OE1   . GLU A  1  300 ? 59.073  99.061  76.167  1.00 86.26  ? 300  GLU A OE1   1 
ATOM   2304  O  OE2   . GLU A  1  300 ? 59.255  99.805  78.231  1.00 85.44  ? 300  GLU A OE2   1 
ATOM   2305  N  N     . HIS A  1  301 ? 56.024  95.124  76.891  1.00 70.53  ? 301  HIS A N     1 
ATOM   2306  C  CA    . HIS A  1  301 ? 54.601  95.222  77.158  1.00 69.30  ? 301  HIS A CA    1 
ATOM   2307  C  C     . HIS A  1  301 ? 53.790  93.965  76.928  1.00 70.77  ? 301  HIS A C     1 
ATOM   2308  O  O     . HIS A  1  301 ? 52.564  94.037  76.829  1.00 71.99  ? 301  HIS A O     1 
ATOM   2309  C  CB    . HIS A  1  301 ? 54.003  96.322  76.319  1.00 67.28  ? 301  HIS A CB    1 
ATOM   2310  C  CG    . HIS A  1  301 ? 54.666  97.641  76.508  1.00 67.71  ? 301  HIS A CG    1 
ATOM   2311  N  ND1   . HIS A  1  301 ? 54.618  98.331  77.699  1.00 68.06  ? 301  HIS A ND1   1 
ATOM   2312  C  CD2   . HIS A  1  301 ? 55.382  98.409  75.651  1.00 68.17  ? 301  HIS A CD2   1 
ATOM   2313  C  CE1   . HIS A  1  301 ? 55.275  99.471  77.566  1.00 68.84  ? 301  HIS A CE1   1 
ATOM   2314  N  NE2   . HIS A  1  301 ? 55.748  99.543  76.333  1.00 68.36  ? 301  HIS A NE2   1 
ATOM   2315  N  N     . LYS A  1  302 ? 54.453  92.817  76.847  1.00 71.90  ? 302  LYS A N     1 
ATOM   2316  C  CA    . LYS A  1  302 ? 53.753  91.549  76.618  1.00 71.26  ? 302  LYS A CA    1 
ATOM   2317  C  C     . LYS A  1  302 ? 52.728  91.748  75.503  1.00 69.41  ? 302  LYS A C     1 
ATOM   2318  O  O     . LYS A  1  302 ? 51.542  91.454  75.671  1.00 70.25  ? 302  LYS A O     1 
ATOM   2319  C  CB    . LYS A  1  302 ? 53.053  91.099  77.908  1.00 73.90  ? 302  LYS A CB    1 
ATOM   2320  C  CG    . LYS A  1  302 ? 53.978  90.968  79.128  1.00 77.64  ? 302  LYS A CG    1 
ATOM   2321  C  CD    . LYS A  1  302 ? 54.950  89.780  78.980  1.00 82.17  ? 302  LYS A CD    1 
ATOM   2322  C  CE    . LYS A  1  302 ? 56.054  89.785  80.047  1.00 83.11  ? 302  LYS A CE    1 
ATOM   2323  N  NZ    . LYS A  1  302 ? 56.947  90.995  79.964  1.00 82.88  ? 302  LYS A NZ    1 
ATOM   2324  N  N     . LEU A  1  303 ? 53.208  92.258  74.370  1.00 67.08  ? 303  LEU A N     1 
ATOM   2325  C  CA    . LEU A  1  303 ? 52.374  92.546  73.210  1.00 64.88  ? 303  LEU A CA    1 
ATOM   2326  C  C     . LEU A  1  303 ? 51.882  91.354  72.400  1.00 65.48  ? 303  LEU A C     1 
ATOM   2327  O  O     . LEU A  1  303 ? 50.781  91.385  71.862  1.00 65.37  ? 303  LEU A O     1 
ATOM   2328  C  CB    . LEU A  1  303 ? 53.107  93.512  72.281  1.00 60.90  ? 303  LEU A CB    1 
ATOM   2329  C  CG    . LEU A  1  303 ? 53.291  94.900  72.887  1.00 58.86  ? 303  LEU A CG    1 
ATOM   2330  C  CD1   . LEU A  1  303 ? 53.944  95.836  71.894  1.00 57.98  ? 303  LEU A CD1   1 
ATOM   2331  C  CD2   . LEU A  1  303 ? 51.934  95.445  73.279  1.00 59.37  ? 303  LEU A CD2   1 
ATOM   2332  N  N     . CYS A  1  304 ? 52.676  90.297  72.314  1.00 66.71  ? 304  CYS A N     1 
ATOM   2333  C  CA    . CYS A  1  304 ? 52.257  89.151  71.521  1.00 67.63  ? 304  CYS A CA    1 
ATOM   2334  C  C     . CYS A  1  304 ? 52.996  87.871  71.863  1.00 67.56  ? 304  CYS A C     1 
ATOM   2335  O  O     . CYS A  1  304 ? 53.899  87.863  72.696  1.00 69.09  ? 304  CYS A O     1 
ATOM   2336  C  CB    . CYS A  1  304 ? 52.488  89.455  70.047  1.00 68.23  ? 304  CYS A CB    1 
ATOM   2337  S  SG    . CYS A  1  304 ? 54.219  89.845  69.717  1.00 68.03  ? 304  CYS A SG    1 
ATOM   2338  N  N     . HIS A  1  305 ? 52.591  86.794  71.201  1.00 66.29  ? 305  HIS A N     1 
ATOM   2339  C  CA    . HIS A  1  305 ? 53.199  85.483  71.360  1.00 64.77  ? 305  HIS A CA    1 
ATOM   2340  C  C     . HIS A  1  305 ? 54.260  85.325  70.261  1.00 64.99  ? 305  HIS A C     1 
ATOM   2341  O  O     . HIS A  1  305 ? 55.169  84.490  70.374  1.00 64.75  ? 305  HIS A O     1 
ATOM   2342  C  CB    . HIS A  1  305 ? 52.152  84.391  71.162  1.00 63.81  ? 305  HIS A CB    1 
ATOM   2343  C  CG    . HIS A  1  305 ? 51.169  84.268  72.279  1.00 62.46  ? 305  HIS A CG    1 
ATOM   2344  N  ND1   . HIS A  1  305 ? 51.187  83.217  73.170  1.00 62.88  ? 305  HIS A ND1   1 
ATOM   2345  C  CD2   . HIS A  1  305 ? 50.119  85.042  72.634  1.00 62.73  ? 305  HIS A CD2   1 
ATOM   2346  C  CE1   . HIS A  1  305 ? 50.191  83.348  74.026  1.00 61.73  ? 305  HIS A CE1   1 
ATOM   2347  N  NE2   . HIS A  1  305 ? 49.526  84.447  73.722  1.00 62.64  ? 305  HIS A NE2   1 
ATOM   2348  N  N     . SER A  1  306 ? 54.118  86.121  69.197  1.00 63.68  ? 306  SER A N     1 
ATOM   2349  C  CA    . SER A  1  306 ? 55.024  86.066  68.054  1.00 63.25  ? 306  SER A CA    1 
ATOM   2350  C  C     . SER A  1  306 ? 54.602  87.009  66.940  1.00 62.96  ? 306  SER A C     1 
ATOM   2351  O  O     . SER A  1  306 ? 53.463  87.456  66.900  1.00 65.07  ? 306  SER A O     1 
ATOM   2352  C  CB    . SER A  1  306 ? 55.043  84.658  67.470  1.00 63.40  ? 306  SER A CB    1 
ATOM   2353  O  OG    . SER A  1  306 ? 53.818  84.384  66.811  1.00 62.08  ? 306  SER A OG    1 
ATOM   2354  N  N     . PHE A  1  307 ? 55.522  87.298  66.028  1.00 61.42  ? 307  PHE A N     1 
ATOM   2355  C  CA    . PHE A  1  307 ? 55.225  88.154  64.897  1.00 61.04  ? 307  PHE A CA    1 
ATOM   2356  C  C     . PHE A  1  307 ? 56.310  87.983  63.859  1.00 61.48  ? 307  PHE A C     1 
ATOM   2357  O  O     . PHE A  1  307 ? 57.442  87.672  64.192  1.00 61.39  ? 307  PHE A O     1 
ATOM   2358  C  CB    . PHE A  1  307 ? 55.088  89.620  65.330  1.00 60.17  ? 307  PHE A CB    1 
ATOM   2359  C  CG    . PHE A  1  307 ? 56.384  90.387  65.383  1.00 60.41  ? 307  PHE A CG    1 
ATOM   2360  C  CD1   . PHE A  1  307 ? 57.038  90.772  64.216  1.00 60.03  ? 307  PHE A CD1   1 
ATOM   2361  C  CD2   . PHE A  1  307 ? 56.916  90.793  66.601  1.00 61.08  ? 307  PHE A CD2   1 
ATOM   2362  C  CE1   . PHE A  1  307 ? 58.198  91.559  64.258  1.00 57.63  ? 307  PHE A CE1   1 
ATOM   2363  C  CE2   . PHE A  1  307 ? 58.073  91.578  66.652  1.00 59.68  ? 307  PHE A CE2   1 
ATOM   2364  C  CZ    . PHE A  1  307 ? 58.711  91.959  65.474  1.00 58.41  ? 307  PHE A CZ    1 
ATOM   2365  N  N     . GLN A  1  308 ? 55.952  88.182  62.595  1.00 62.87  ? 308  GLN A N     1 
ATOM   2366  C  CA    . GLN A  1  308 ? 56.880  88.025  61.490  1.00 63.41  ? 308  GLN A CA    1 
ATOM   2367  C  C     . GLN A  1  308 ? 56.597  88.999  60.370  1.00 64.34  ? 308  GLN A C     1 
ATOM   2368  O  O     . GLN A  1  308 ? 55.450  89.339  60.106  1.00 64.87  ? 308  GLN A O     1 
ATOM   2369  C  CB    . GLN A  1  308 ? 56.782  86.614  60.929  1.00 64.41  ? 308  GLN A CB    1 
ATOM   2370  C  CG    . GLN A  1  308 ? 55.354  86.188  60.580  1.00 66.55  ? 308  GLN A CG    1 
ATOM   2371  C  CD    . GLN A  1  308 ? 55.267  84.742  60.082  1.00 69.75  ? 308  GLN A CD    1 
ATOM   2372  O  OE1   . GLN A  1  308 ? 54.192  84.133  60.074  1.00 69.97  ? 308  GLN A OE1   1 
ATOM   2373  N  NE2   . GLN A  1  308 ? 56.404  84.189  59.658  1.00 72.83  ? 308  GLN A NE2   1 
ATOM   2374  N  N     . THR A  1  309 ? 57.663  89.451  59.721  1.00 65.00  ? 309  THR A N     1 
ATOM   2375  C  CA    . THR A  1  309 ? 57.557  90.354  58.587  1.00 64.71  ? 309  THR A CA    1 
ATOM   2376  C  C     . THR A  1  309 ? 57.683  89.411  57.403  1.00 64.48  ? 309  THR A C     1 
ATOM   2377  O  O     . THR A  1  309 ? 58.085  88.261  57.569  1.00 64.87  ? 309  THR A O     1 
ATOM   2378  C  CB    . THR A  1  309 ? 58.727  91.357  58.544  1.00 65.07  ? 309  THR A CB    1 
ATOM   2379  O  OG1   . THR A  1  309 ? 59.961  90.635  58.504  1.00 66.19  ? 309  THR A OG1   1 
ATOM   2380  C  CG2   . THR A  1  309 ? 58.719  92.260  59.769  1.00 64.38  ? 309  THR A CG2   1 
ATOM   2381  N  N     . PHE A  1  310 ? 57.330  89.868  56.214  1.00 64.65  ? 310  PHE A N     1 
ATOM   2382  C  CA    . PHE A  1  310 ? 57.447  89.007  55.051  1.00 65.62  ? 310  PHE A CA    1 
ATOM   2383  C  C     . PHE A  1  310 ? 57.363  89.804  53.777  1.00 65.19  ? 310  PHE A C     1 
ATOM   2384  O  O     . PHE A  1  310 ? 56.779  90.885  53.745  1.00 64.91  ? 310  PHE A O     1 
ATOM   2385  C  CB    . PHE A  1  310 ? 56.362  87.908  55.052  1.00 67.72  ? 310  PHE A CB    1 
ATOM   2386  C  CG    . PHE A  1  310 ? 54.937  88.431  55.011  1.00 70.14  ? 310  PHE A CG    1 
ATOM   2387  C  CD1   . PHE A  1  310 ? 54.151  88.437  56.157  1.00 70.04  ? 310  PHE A CD1   1 
ATOM   2388  C  CD2   . PHE A  1  310 ? 54.396  88.943  53.836  1.00 70.27  ? 310  PHE A CD2   1 
ATOM   2389  C  CE1   . PHE A  1  310 ? 52.855  88.945  56.136  1.00 69.80  ? 310  PHE A CE1   1 
ATOM   2390  C  CE2   . PHE A  1  310 ? 53.102  89.451  53.815  1.00 70.91  ? 310  PHE A CE2   1 
ATOM   2391  C  CZ    . PHE A  1  310 ? 52.332  89.452  54.971  1.00 70.04  ? 310  PHE A CZ    1 
ATOM   2392  N  N     . ASN A  1  311 ? 57.973  89.272  52.727  1.00 65.23  ? 311  ASN A N     1 
ATOM   2393  C  CA    . ASN A  1  311 ? 57.937  89.921  51.435  1.00 64.59  ? 311  ASN A CA    1 
ATOM   2394  C  C     . ASN A  1  311 ? 57.690  88.856  50.396  1.00 62.66  ? 311  ASN A C     1 
ATOM   2395  O  O     . ASN A  1  311 ? 58.578  88.496  49.634  1.00 63.75  ? 311  ASN A O     1 
ATOM   2396  C  CB    . ASN A  1  311 ? 59.242  90.646  51.141  1.00 67.64  ? 311  ASN A CB    1 
ATOM   2397  C  CG    . ASN A  1  311 ? 59.222  91.325  49.784  1.00 71.45  ? 311  ASN A CG    1 
ATOM   2398  O  OD1   . ASN A  1  311 ? 58.155  91.686  49.277  1.00 74.28  ? 311  ASN A OD1   1 
ATOM   2399  N  ND2   . ASN A  1  311 ? 60.397  91.510  49.188  1.00 73.13  ? 311  ASN A ND2   1 
ATOM   2400  N  N     . THR A  1  312 ? 56.471  88.339  50.392  1.00 60.66  ? 312  THR A N     1 
ATOM   2401  C  CA    . THR A  1  312 ? 56.086  87.303  49.458  1.00 59.83  ? 312  THR A CA    1 
ATOM   2402  C  C     . THR A  1  312 ? 55.938  87.850  48.057  1.00 61.08  ? 312  THR A C     1 
ATOM   2403  O  O     . THR A  1  312 ? 55.032  88.647  47.788  1.00 62.64  ? 312  THR A O     1 
ATOM   2404  C  CB    . THR A  1  312 ? 54.781  86.673  49.871  1.00 58.10  ? 312  THR A CB    1 
ATOM   2405  O  OG1   . THR A  1  312 ? 55.005  85.857  51.026  1.00 59.07  ? 312  THR A OG1   1 
ATOM   2406  C  CG2   . THR A  1  312 ? 54.216  85.836  48.737  1.00 58.14  ? 312  THR A CG2   1 
ATOM   2407  N  N     . SER A  1  313 ? 56.823  87.408  47.161  1.00 60.79  ? 313  SER A N     1 
ATOM   2408  C  CA    . SER A  1  313 ? 56.806  87.874  45.782  1.00 58.80  ? 313  SER A CA    1 
ATOM   2409  C  C     . SER A  1  313 ? 56.136  86.924  44.822  1.00 57.64  ? 313  SER A C     1 
ATOM   2410  O  O     . SER A  1  313 ? 55.961  85.754  45.122  1.00 56.34  ? 313  SER A O     1 
ATOM   2411  C  CB    . SER A  1  313 ? 58.230  88.165  45.312  1.00 57.25  ? 313  SER A CB    1 
ATOM   2412  O  OG    . SER A  1  313 ? 58.663  89.423  45.802  1.00 56.90  ? 313  SER A OG    1 
ATOM   2413  N  N     . TYR A  1  314 ? 55.732  87.467  43.680  1.00 57.94  ? 314  TYR A N     1 
ATOM   2414  C  CA    . TYR A  1  314 ? 55.107  86.707  42.605  1.00 59.53  ? 314  TYR A CA    1 
ATOM   2415  C  C     . TYR A  1  314 ? 55.597  87.307  41.280  1.00 60.36  ? 314  TYR A C     1 
ATOM   2416  O  O     . TYR A  1  314 ? 56.253  88.359  41.253  1.00 59.89  ? 314  TYR A O     1 
ATOM   2417  C  CB    . TYR A  1  314 ? 53.579  86.801  42.680  1.00 60.40  ? 314  TYR A CB    1 
ATOM   2418  C  CG    . TYR A  1  314 ? 52.948  86.015  43.806  1.00 61.16  ? 314  TYR A CG    1 
ATOM   2419  C  CD1   . TYR A  1  314 ? 51.871  86.532  44.516  1.00 63.07  ? 314  TYR A CD1   1 
ATOM   2420  C  CD2   . TYR A  1  314 ? 53.444  84.777  44.184  1.00 60.63  ? 314  TYR A CD2   1 
ATOM   2421  C  CE1   . TYR A  1  314 ? 51.308  85.839  45.591  1.00 63.82  ? 314  TYR A CE1   1 
ATOM   2422  C  CE2   . TYR A  1  314 ? 52.890  84.073  45.250  1.00 62.80  ? 314  TYR A CE2   1 
ATOM   2423  C  CZ    . TYR A  1  314 ? 51.824  84.610  45.959  1.00 63.69  ? 314  TYR A CZ    1 
ATOM   2424  O  OH    . TYR A  1  314 ? 51.313  83.938  47.059  1.00 63.33  ? 314  TYR A OH    1 
ATOM   2425  N  N     . SER A  1  315 ? 55.277  86.646  40.182  1.00 60.48  ? 315  SER A N     1 
ATOM   2426  C  CA    . SER A  1  315 ? 55.691  87.133  38.883  1.00 63.04  ? 315  SER A CA    1 
ATOM   2427  C  C     . SER A  1  315 ? 55.476  88.637  38.657  1.00 65.33  ? 315  SER A C     1 
ATOM   2428  O  O     . SER A  1  315 ? 56.437  89.389  38.451  1.00 66.89  ? 315  SER A O     1 
ATOM   2429  C  CB    . SER A  1  315 ? 54.951  86.357  37.808  1.00 62.15  ? 315  SER A CB    1 
ATOM   2430  O  OG    . SER A  1  315 ? 53.571  86.391  38.070  1.00 62.90  ? 315  SER A OG    1 
ATOM   2431  N  N     . ASP A  1  316 ? 54.212  89.060  38.703  1.00 67.37  ? 316  ASP A N     1 
ATOM   2432  C  CA    . ASP A  1  316 ? 53.812  90.450  38.462  1.00 68.28  ? 316  ASP A CA    1 
ATOM   2433  C  C     . ASP A  1  316 ? 53.391  91.276  39.700  1.00 68.78  ? 316  ASP A C     1 
ATOM   2434  O  O     . ASP A  1  316 ? 53.166  92.486  39.594  1.00 69.71  ? 316  ASP A O     1 
ATOM   2435  C  CB    . ASP A  1  316 ? 52.658  90.451  37.460  1.00 68.47  ? 316  ASP A CB    1 
ATOM   2436  C  CG    . ASP A  1  316 ? 51.458  89.697  37.982  1.00 70.64  ? 316  ASP A CG    1 
ATOM   2437  O  OD1   . ASP A  1  316 ? 51.593  88.491  38.248  1.00 70.78  ? 316  ASP A OD1   1 
ATOM   2438  O  OD2   . ASP A  1  316 ? 50.382  90.303  38.151  1.00 74.21  ? 316  ASP A OD2   1 
ATOM   2439  N  N     . THR A  1  317 ? 53.287  90.644  40.864  1.00 68.32  ? 317  THR A N     1 
ATOM   2440  C  CA    . THR A  1  317 ? 52.855  91.359  42.066  1.00 67.81  ? 317  THR A CA    1 
ATOM   2441  C  C     . THR A  1  317 ? 53.522  90.800  43.327  1.00 66.64  ? 317  THR A C     1 
ATOM   2442  O  O     . THR A  1  317 ? 54.642  90.293  43.255  1.00 67.52  ? 317  THR A O     1 
ATOM   2443  C  CB    . THR A  1  317 ? 51.299  91.278  42.204  1.00 68.81  ? 317  THR A CB    1 
ATOM   2444  O  OG1   . THR A  1  317 ? 50.859  92.131  43.269  1.00 70.23  ? 317  THR A OG1   1 
ATOM   2445  C  CG2   . THR A  1  317 ? 50.856  89.846  42.482  1.00 67.68  ? 317  THR A CG2   1 
ATOM   2446  N  N     . GLY A  1  318 ? 52.842  90.902  44.473  1.00 64.79  ? 318  GLY A N     1 
ATOM   2447  C  CA    . GLY A  1  318 ? 53.382  90.396  45.735  1.00 62.45  ? 318  GLY A CA    1 
ATOM   2448  C  C     . GLY A  1  318 ? 52.685  90.955  46.970  1.00 61.04  ? 318  GLY A C     1 
ATOM   2449  O  O     . GLY A  1  318 ? 51.781  91.779  46.841  1.00 63.35  ? 318  GLY A O     1 
ATOM   2450  N  N     . LEU A  1  319 ? 53.085  90.513  48.162  1.00 58.00  ? 319  LEU A N     1 
ATOM   2451  C  CA    . LEU A  1  319 ? 52.490  90.995  49.418  1.00 56.34  ? 319  LEU A CA    1 
ATOM   2452  C  C     . LEU A  1  319 ? 53.567  91.365  50.418  1.00 56.61  ? 319  LEU A C     1 
ATOM   2453  O  O     . LEU A  1  319 ? 54.377  90.534  50.789  1.00 59.85  ? 319  LEU A O     1 
ATOM   2454  C  CB    . LEU A  1  319 ? 51.604  89.928  50.054  1.00 54.00  ? 319  LEU A CB    1 
ATOM   2455  C  CG    . LEU A  1  319 ? 50.299  89.640  49.341  1.00 53.14  ? 319  LEU A CG    1 
ATOM   2456  C  CD1   . LEU A  1  319 ? 49.479  88.673  50.174  1.00 52.39  ? 319  LEU A CD1   1 
ATOM   2457  C  CD2   . LEU A  1  319 ? 49.553  90.942  49.127  1.00 51.28  ? 319  LEU A CD2   1 
ATOM   2458  N  N     . PHE A  1  320 ? 53.568  92.601  50.881  1.00 55.90  ? 320  PHE A N     1 
ATOM   2459  C  CA    . PHE A  1  320 ? 54.588  93.045  51.816  1.00 55.96  ? 320  PHE A CA    1 
ATOM   2460  C  C     . PHE A  1  320 ? 53.874  93.378  53.095  1.00 55.78  ? 320  PHE A C     1 
ATOM   2461  O  O     . PHE A  1  320 ? 53.006  94.243  53.101  1.00 56.28  ? 320  PHE A O     1 
ATOM   2462  C  CB    . PHE A  1  320 ? 55.276  94.294  51.248  1.00 58.33  ? 320  PHE A CB    1 
ATOM   2463  C  CG    . PHE A  1  320 ? 56.352  94.863  52.124  1.00 61.10  ? 320  PHE A CG    1 
ATOM   2464  C  CD1   . PHE A  1  320 ? 57.695  94.640  51.837  1.00 63.75  ? 320  PHE A CD1   1 
ATOM   2465  C  CD2   . PHE A  1  320 ? 56.027  95.602  53.251  1.00 61.87  ? 320  PHE A CD2   1 
ATOM   2466  C  CE1   . PHE A  1  320 ? 58.700  95.144  52.671  1.00 64.51  ? 320  PHE A CE1   1 
ATOM   2467  C  CE2   . PHE A  1  320 ? 57.025  96.108  54.087  1.00 63.79  ? 320  PHE A CE2   1 
ATOM   2468  C  CZ    . PHE A  1  320 ? 58.362  95.877  53.796  1.00 63.14  ? 320  PHE A CZ    1 
ATOM   2469  N  N     . GLY A  1  321 ? 54.217  92.702  54.181  1.00 55.77  ? 321  GLY A N     1 
ATOM   2470  C  CA    . GLY A  1  321 ? 53.537  93.007  55.421  1.00 57.21  ? 321  GLY A CA    1 
ATOM   2471  C  C     . GLY A  1  321 ? 54.017  92.284  56.661  1.00 57.44  ? 321  GLY A C     1 
ATOM   2472  O  O     . GLY A  1  321 ? 55.196  91.963  56.797  1.00 57.83  ? 321  GLY A O     1 
ATOM   2473  N  N     . PHE A  1  322 ? 53.091  92.067  57.589  1.00 56.43  ? 322  PHE A N     1 
ATOM   2474  C  CA    . PHE A  1  322 ? 53.410  91.383  58.824  1.00 55.55  ? 322  PHE A CA    1 
ATOM   2475  C  C     . PHE A  1  322 ? 52.206  90.601  59.371  1.00 55.89  ? 322  PHE A C     1 
ATOM   2476  O  O     . PHE A  1  322 ? 51.051  90.811  58.970  1.00 55.20  ? 322  PHE A O     1 
ATOM   2477  C  CB    . PHE A  1  322 ? 53.967  92.376  59.862  1.00 54.10  ? 322  PHE A CB    1 
ATOM   2478  C  CG    . PHE A  1  322 ? 53.024  93.490  60.228  1.00 53.80  ? 322  PHE A CG    1 
ATOM   2479  C  CD1   . PHE A  1  322 ? 51.973  93.278  61.127  1.00 53.71  ? 322  PHE A CD1   1 
ATOM   2480  C  CD2   . PHE A  1  322 ? 53.197  94.759  59.695  1.00 53.49  ? 322  PHE A CD2   1 
ATOM   2481  C  CE1   . PHE A  1  322 ? 51.109  94.313  61.491  1.00 50.98  ? 322  PHE A CE1   1 
ATOM   2482  C  CE2   . PHE A  1  322 ? 52.339  95.805  60.050  1.00 53.24  ? 322  PHE A CE2   1 
ATOM   2483  C  CZ    . PHE A  1  322 ? 51.292  95.576  60.953  1.00 52.05  ? 322  PHE A CZ    1 
ATOM   2484  N  N     . HIS A  1  323 ? 52.503  89.677  60.277  1.00 54.70  ? 323  HIS A N     1 
ATOM   2485  C  CA    . HIS A  1  323 ? 51.506  88.823  60.867  1.00 53.96  ? 323  HIS A CA    1 
ATOM   2486  C  C     . HIS A  1  323 ? 51.901  88.559  62.293  1.00 54.39  ? 323  HIS A C     1 
ATOM   2487  O  O     . HIS A  1  323 ? 53.011  88.145  62.554  1.00 56.73  ? 323  HIS A O     1 
ATOM   2488  C  CB    . HIS A  1  323 ? 51.442  87.509  60.088  1.00 53.87  ? 323  HIS A CB    1 
ATOM   2489  C  CG    . HIS A  1  323 ? 50.868  86.363  60.864  1.00 57.25  ? 323  HIS A CG    1 
ATOM   2490  N  ND1   . HIS A  1  323 ? 51.639  85.533  61.649  1.00 59.25  ? 323  HIS A ND1   1 
ATOM   2491  C  CD2   . HIS A  1  323 ? 49.599  85.895  60.963  1.00 59.43  ? 323  HIS A CD2   1 
ATOM   2492  C  CE1   . HIS A  1  323 ? 50.872  84.602  62.192  1.00 60.16  ? 323  HIS A CE1   1 
ATOM   2493  N  NE2   . HIS A  1  323 ? 49.628  84.799  61.793  1.00 58.92  ? 323  HIS A NE2   1 
ATOM   2494  N  N     . PHE A  1  324 ? 50.994  88.811  63.224  1.00 54.32  ? 324  PHE A N     1 
ATOM   2495  C  CA    . PHE A  1  324 ? 51.292  88.565  64.612  1.00 52.99  ? 324  PHE A CA    1 
ATOM   2496  C  C     . PHE A  1  324 ? 50.192  87.761  65.262  1.00 54.47  ? 324  PHE A C     1 
ATOM   2497  O  O     . PHE A  1  324 ? 49.063  87.708  64.772  1.00 54.41  ? 324  PHE A O     1 
ATOM   2498  C  CB    . PHE A  1  324 ? 51.514  89.879  65.345  1.00 52.40  ? 324  PHE A CB    1 
ATOM   2499  C  CG    . PHE A  1  324 ? 50.306  90.783  65.396  1.00 52.64  ? 324  PHE A CG    1 
ATOM   2500  C  CD1   . PHE A  1  324 ? 49.230  90.487  66.229  1.00 52.32  ? 324  PHE A CD1   1 
ATOM   2501  C  CD2   . PHE A  1  324 ? 50.282  91.978  64.674  1.00 52.03  ? 324  PHE A CD2   1 
ATOM   2502  C  CE1   . PHE A  1  324 ? 48.151  91.368  66.350  1.00 51.81  ? 324  PHE A CE1   1 
ATOM   2503  C  CE2   . PHE A  1  324 ? 49.208  92.866  64.785  1.00 53.01  ? 324  PHE A CE2   1 
ATOM   2504  C  CZ    . PHE A  1  324 ? 48.140  92.560  65.628  1.00 52.78  ? 324  PHE A CZ    1 
ATOM   2505  N  N     . VAL A  1  325 ? 50.550  87.122  66.368  1.00 56.02  ? 325  VAL A N     1 
ATOM   2506  C  CA    . VAL A  1  325 ? 49.644  86.286  67.147  1.00 57.52  ? 325  VAL A CA    1 
ATOM   2507  C  C     . VAL A  1  325 ? 49.600  86.854  68.563  1.00 58.82  ? 325  VAL A C     1 
ATOM   2508  O  O     . VAL A  1  325 ? 50.633  86.930  69.225  1.00 59.51  ? 325  VAL A O     1 
ATOM   2509  C  CB    . VAL A  1  325 ? 50.169  84.838  67.224  1.00 56.53  ? 325  VAL A CB    1 
ATOM   2510  C  CG1   . VAL A  1  325 ? 49.175  83.960  67.971  1.00 57.64  ? 325  VAL A CG1   1 
ATOM   2511  C  CG2   . VAL A  1  325 ? 50.427  84.305  65.825  1.00 55.26  ? 325  VAL A CG2   1 
ATOM   2512  N  N     . ALA A  1  326 ? 48.421  87.255  69.031  1.00 59.64  ? 326  ALA A N     1 
ATOM   2513  C  CA    . ALA A  1  326 ? 48.322  87.814  70.375  1.00 60.70  ? 326  ALA A CA    1 
ATOM   2514  C  C     . ALA A  1  326 ? 47.073  87.411  71.140  1.00 62.18  ? 326  ALA A C     1 
ATOM   2515  O  O     . ALA A  1  326 ? 46.185  86.745  70.607  1.00 63.00  ? 326  ALA A O     1 
ATOM   2516  C  CB    . ALA A  1  326 ? 48.408  89.309  70.309  1.00 59.85  ? 326  ALA A CB    1 
ATOM   2517  N  N     . ASP A  1  327 ? 47.029  87.807  72.405  1.00 63.00  ? 327  ASP A N     1 
ATOM   2518  C  CA    . ASP A  1  327 ? 45.888  87.514  73.250  1.00 64.74  ? 327  ASP A CA    1 
ATOM   2519  C  C     . ASP A  1  327 ? 44.852  88.561  72.925  1.00 62.91  ? 327  ASP A C     1 
ATOM   2520  O  O     . ASP A  1  327 ? 45.186  89.683  72.558  1.00 62.12  ? 327  ASP A O     1 
ATOM   2521  C  CB    . ASP A  1  327 ? 46.273  87.629  74.718  1.00 70.97  ? 327  ASP A CB    1 
ATOM   2522  C  CG    . ASP A  1  327 ? 47.522  86.833  75.052  1.00 76.80  ? 327  ASP A CG    1 
ATOM   2523  O  OD1   . ASP A  1  327 ? 47.405  85.601  75.282  1.00 78.82  ? 327  ASP A OD1   1 
ATOM   2524  O  OD2   . ASP A  1  327 ? 48.624  87.447  75.064  1.00 80.18  ? 327  ASP A OD2   1 
ATOM   2525  N  N     . PRO A  1  328 ? 43.574  88.215  73.071  1.00 61.71  ? 328  PRO A N     1 
ATOM   2526  C  CA    . PRO A  1  328 ? 42.519  89.166  72.771  1.00 61.51  ? 328  PRO A CA    1 
ATOM   2527  C  C     . PRO A  1  328 ? 42.737  90.596  73.248  1.00 62.34  ? 328  PRO A C     1 
ATOM   2528  O  O     . PRO A  1  328 ? 42.494  91.532  72.487  1.00 64.96  ? 328  PRO A O     1 
ATOM   2529  C  CB    . PRO A  1  328 ? 41.286  88.514  73.389  1.00 60.35  ? 328  PRO A CB    1 
ATOM   2530  C  CG    . PRO A  1  328 ? 41.848  87.627  74.422  1.00 60.59  ? 328  PRO A CG    1 
ATOM   2531  C  CD    . PRO A  1  328 ? 43.013  87.033  73.729  1.00 60.85  ? 328  PRO A CD    1 
ATOM   2532  N  N     . LEU A  1  329 ? 43.224  90.787  74.468  1.00 61.17  ? 329  LEU A N     1 
ATOM   2533  C  CA    . LEU A  1  329 ? 43.378  92.148  74.972  1.00 61.94  ? 329  LEU A CA    1 
ATOM   2534  C  C     . LEU A  1  329 ? 44.678  92.909  74.694  1.00 63.30  ? 329  LEU A C     1 
ATOM   2535  O  O     . LEU A  1  329 ? 44.912  93.990  75.244  1.00 64.51  ? 329  LEU A O     1 
ATOM   2536  C  CB    . LEU A  1  329 ? 43.052  92.162  76.466  1.00 61.10  ? 329  LEU A CB    1 
ATOM   2537  C  CG    . LEU A  1  329 ? 41.653  91.569  76.680  1.00 61.00  ? 329  LEU A CG    1 
ATOM   2538  C  CD1   . LEU A  1  329 ? 41.379  91.310  78.133  1.00 61.42  ? 329  LEU A CD1   1 
ATOM   2539  C  CD2   . LEU A  1  329 ? 40.632  92.512  76.118  1.00 61.16  ? 329  LEU A CD2   1 
ATOM   2540  N  N     . SER A  1  330 ? 45.533  92.376  73.841  1.00 63.46  ? 330  SER A N     1 
ATOM   2541  C  CA    . SER A  1  330 ? 46.743  93.112  73.540  1.00 64.10  ? 330  SER A CA    1 
ATOM   2542  C  C     . SER A  1  330 ? 46.823  93.341  72.035  1.00 63.86  ? 330  SER A C     1 
ATOM   2543  O  O     . SER A  1  330 ? 47.836  93.828  71.520  1.00 64.16  ? 330  SER A O     1 
ATOM   2544  C  CB    . SER A  1  330 ? 47.980  92.364  74.068  1.00 65.16  ? 330  SER A CB    1 
ATOM   2545  O  OG    . SER A  1  330 ? 48.086  91.045  73.554  1.00 68.17  ? 330  SER A OG    1 
ATOM   2546  N  N     . ILE A  1  331 ? 45.734  93.018  71.335  1.00 62.63  ? 331  ILE A N     1 
ATOM   2547  C  CA    . ILE A  1  331 ? 45.708  93.179  69.888  1.00 60.74  ? 331  ILE A CA    1 
ATOM   2548  C  C     . ILE A  1  331 ? 45.891  94.599  69.466  1.00 60.25  ? 331  ILE A C     1 
ATOM   2549  O  O     . ILE A  1  331 ? 46.662  94.864  68.563  1.00 60.55  ? 331  ILE A O     1 
ATOM   2550  C  CB    . ILE A  1  331 ? 44.405  92.750  69.236  1.00 59.67  ? 331  ILE A CB    1 
ATOM   2551  C  CG1   . ILE A  1  331 ? 44.082  91.303  69.550  1.00 60.56  ? 331  ILE A CG1   1 
ATOM   2552  C  CG2   . ILE A  1  331 ? 44.550  92.859  67.748  1.00 59.00  ? 331  ILE A CG2   1 
ATOM   2553  C  CD1   . ILE A  1  331 ? 42.796  90.836  68.890  1.00 61.84  ? 331  ILE A CD1   1 
ATOM   2554  N  N     . ASP A  1  332 ? 45.184  95.525  70.098  1.00 61.23  ? 332  ASP A N     1 
ATOM   2555  C  CA    . ASP A  1  332 ? 45.324  96.903  69.661  1.00 63.97  ? 332  ASP A CA    1 
ATOM   2556  C  C     . ASP A  1  332 ? 46.727  97.491  69.857  1.00 63.15  ? 332  ASP A C     1 
ATOM   2557  O  O     . ASP A  1  332 ? 47.322  98.020  68.915  1.00 61.88  ? 332  ASP A O     1 
ATOM   2558  C  CB    . ASP A  1  332 ? 44.260  97.813  70.304  1.00 65.92  ? 332  ASP A CB    1 
ATOM   2559  C  CG    . ASP A  1  332 ? 44.326  99.261  69.757  1.00 69.58  ? 332  ASP A CG    1 
ATOM   2560  O  OD1   . ASP A  1  332 ? 44.374  99.430  68.504  1.00 72.47  ? 332  ASP A OD1   1 
ATOM   2561  O  OD2   . ASP A  1  332 ? 44.339  100.230 70.564  1.00 68.18  ? 332  ASP A OD2   1 
ATOM   2562  N  N     . ASP A  1  333 ? 47.266  97.390  71.060  1.00 63.24  ? 333  ASP A N     1 
ATOM   2563  C  CA    . ASP A  1  333 ? 48.585  97.936  71.293  1.00 65.30  ? 333  ASP A CA    1 
ATOM   2564  C  C     . ASP A  1  333 ? 49.627  97.364  70.338  1.00 64.85  ? 333  ASP A C     1 
ATOM   2565  O  O     . ASP A  1  333 ? 50.495  98.094  69.865  1.00 65.21  ? 333  ASP A O     1 
ATOM   2566  C  CB    . ASP A  1  333 ? 49.005  97.672  72.729  1.00 70.40  ? 333  ASP A CB    1 
ATOM   2567  C  CG    . ASP A  1  333 ? 48.118  98.376  73.726  1.00 74.09  ? 333  ASP A CG    1 
ATOM   2568  O  OD1   . ASP A  1  333 ? 48.124  99.627  73.736  1.00 76.80  ? 333  ASP A OD1   1 
ATOM   2569  O  OD2   . ASP A  1  333 ? 47.412  97.676  74.489  1.00 77.31  ? 333  ASP A OD2   1 
ATOM   2570  N  N     . MET A  1  334 ? 49.552  96.064  70.055  1.00 62.87  ? 334  MET A N     1 
ATOM   2571  C  CA    . MET A  1  334 ? 50.505  95.431  69.148  1.00 60.53  ? 334  MET A CA    1 
ATOM   2572  C  C     . MET A  1  334 ? 50.414  96.070  67.772  1.00 60.03  ? 334  MET A C     1 
ATOM   2573  O  O     . MET A  1  334 ? 51.406  96.552  67.235  1.00 60.47  ? 334  MET A O     1 
ATOM   2574  C  CB    . MET A  1  334 ? 50.227  93.933  69.035  1.00 60.12  ? 334  MET A CB    1 
ATOM   2575  C  CG    . MET A  1  334 ? 51.116  93.185  68.032  1.00 61.62  ? 334  MET A CG    1 
ATOM   2576  S  SD    . MET A  1  334 ? 52.875  93.035  68.503  1.00 63.89  ? 334  MET A SD    1 
ATOM   2577  C  CE    . MET A  1  334 ? 53.695  93.361  66.993  1.00 63.22  ? 334  MET A CE    1 
ATOM   2578  N  N     . MET A  1  335 ? 49.212  96.079  67.211  1.00 60.43  ? 335  MET A N     1 
ATOM   2579  C  CA    . MET A  1  335 ? 48.967  96.650  65.887  1.00 60.25  ? 335  MET A CA    1 
ATOM   2580  C  C     . MET A  1  335 ? 49.473  98.084  65.838  1.00 59.65  ? 335  MET A C     1 
ATOM   2581  O  O     . MET A  1  335 ? 50.111  98.523  64.883  1.00 58.20  ? 335  MET A O     1 
ATOM   2582  C  CB    . MET A  1  335 ? 47.472  96.609  65.591  1.00 59.56  ? 335  MET A CB    1 
ATOM   2583  C  CG    . MET A  1  335 ? 47.050  97.367  64.358  1.00 61.02  ? 335  MET A CG    1 
ATOM   2584  S  SD    . MET A  1  335 ? 47.619  96.699  62.797  1.00 64.36  ? 335  MET A SD    1 
ATOM   2585  C  CE    . MET A  1  335 ? 46.479  95.352  62.569  1.00 61.79  ? 335  MET A CE    1 
ATOM   2586  N  N     . PHE A  1  336 ? 49.169  98.808  66.896  1.00 59.55  ? 336  PHE A N     1 
ATOM   2587  C  CA    . PHE A  1  336 ? 49.588  100.185 67.027  1.00 60.37  ? 336  PHE A CA    1 
ATOM   2588  C  C     . PHE A  1  336 ? 51.111  100.336 66.868  1.00 59.77  ? 336  PHE A C     1 
ATOM   2589  O  O     . PHE A  1  336 ? 51.593  101.138 66.068  1.00 58.28  ? 336  PHE A O     1 
ATOM   2590  C  CB    . PHE A  1  336 ? 49.168  100.692 68.407  1.00 62.38  ? 336  PHE A CB    1 
ATOM   2591  C  CG    . PHE A  1  336 ? 49.668  102.061 68.717  1.00 64.07  ? 336  PHE A CG    1 
ATOM   2592  C  CD1   . PHE A  1  336 ? 49.018  103.187 68.200  1.00 64.55  ? 336  PHE A CD1   1 
ATOM   2593  C  CD2   . PHE A  1  336 ? 50.816  102.234 69.492  1.00 64.62  ? 336  PHE A CD2   1 
ATOM   2594  C  CE1   . PHE A  1  336 ? 49.499  104.474 68.448  1.00 64.63  ? 336  PHE A CE1   1 
ATOM   2595  C  CE2   . PHE A  1  336 ? 51.310  103.512 69.746  1.00 65.06  ? 336  PHE A CE2   1 
ATOM   2596  C  CZ    . PHE A  1  336 ? 50.646  104.639 69.218  1.00 64.94  ? 336  PHE A CZ    1 
ATOM   2597  N  N     . CYS A  1  337 ? 51.853  99.563  67.658  1.00 59.27  ? 337  CYS A N     1 
ATOM   2598  C  CA    . CYS A  1  337 ? 53.307  99.589  67.650  1.00 58.49  ? 337  CYS A CA    1 
ATOM   2599  C  C     . CYS A  1  337 ? 53.878  99.136  66.323  1.00 57.37  ? 337  CYS A C     1 
ATOM   2600  O  O     . CYS A  1  337 ? 54.828  99.720  65.798  1.00 57.01  ? 337  CYS A O     1 
ATOM   2601  C  CB    . CYS A  1  337 ? 53.838  98.685  68.748  1.00 59.16  ? 337  CYS A CB    1 
ATOM   2602  S  SG    . CYS A  1  337 ? 53.398  99.223  70.403  1.00 66.22  ? 337  CYS A SG    1 
ATOM   2603  N  N     . ALA A  1  338 ? 53.301  98.072  65.794  1.00 56.02  ? 338  ALA A N     1 
ATOM   2604  C  CA    . ALA A  1  338 ? 53.743  97.537  64.530  1.00 55.62  ? 338  ALA A CA    1 
ATOM   2605  C  C     . ALA A  1  338 ? 53.675  98.622  63.462  1.00 56.54  ? 338  ALA A C     1 
ATOM   2606  O  O     . ALA A  1  338 ? 54.703  99.035  62.938  1.00 56.78  ? 338  ALA A O     1 
ATOM   2607  C  CB    . ALA A  1  338 ? 52.879  96.359  64.148  1.00 55.49  ? 338  ALA A CB    1 
ATOM   2608  N  N     . GLN A  1  339 ? 52.465  99.088  63.148  1.00 58.58  ? 339  GLN A N     1 
ATOM   2609  C  CA    . GLN A  1  339 ? 52.280  100.125 62.135  1.00 59.07  ? 339  GLN A CA    1 
ATOM   2610  C  C     . GLN A  1  339 ? 53.232  101.259 62.439  1.00 59.95  ? 339  GLN A C     1 
ATOM   2611  O  O     . GLN A  1  339 ? 53.726  101.936 61.539  1.00 60.27  ? 339  GLN A O     1 
ATOM   2612  C  CB    . GLN A  1  339 ? 50.853  100.674 62.145  1.00 60.20  ? 339  GLN A CB    1 
ATOM   2613  C  CG    . GLN A  1  339 ? 49.745  99.654  61.954  1.00 62.68  ? 339  GLN A CG    1 
ATOM   2614  C  CD    . GLN A  1  339 ? 48.429  100.312 61.555  1.00 63.98  ? 339  GLN A CD    1 
ATOM   2615  O  OE1   . GLN A  1  339 ? 48.228  100.672 60.396  1.00 62.84  ? 339  GLN A OE1   1 
ATOM   2616  N  NE2   . GLN A  1  339 ? 47.536  100.491 62.522  1.00 65.39  ? 339  GLN A NE2   1 
ATOM   2617  N  N     . GLY A  1  340 ? 53.483  101.467 63.724  1.00 61.16  ? 340  GLY A N     1 
ATOM   2618  C  CA    . GLY A  1  340 ? 54.391  102.521 64.125  1.00 62.87  ? 340  GLY A CA    1 
ATOM   2619  C  C     . GLY A  1  340 ? 55.750  102.301 63.507  1.00 64.20  ? 340  GLY A C     1 
ATOM   2620  O  O     . GLY A  1  340 ? 56.353  103.220 62.949  1.00 64.94  ? 340  GLY A O     1 
ATOM   2621  N  N     . GLU A  1  341 ? 56.230  101.067 63.592  1.00 65.01  ? 341  GLU A N     1 
ATOM   2622  C  CA    . GLU A  1  341 ? 57.526  100.738 63.040  1.00 65.83  ? 341  GLU A CA    1 
ATOM   2623  C  C     . GLU A  1  341 ? 57.590  100.937 61.533  1.00 66.44  ? 341  GLU A C     1 
ATOM   2624  O  O     . GLU A  1  341 ? 58.625  101.336 60.989  1.00 68.02  ? 341  GLU A O     1 
ATOM   2625  C  CB    . GLU A  1  341 ? 57.901  99.320  63.441  1.00 65.59  ? 341  GLU A CB    1 
ATOM   2626  C  CG    . GLU A  1  341 ? 58.205  99.222  64.933  1.00 68.35  ? 341  GLU A CG    1 
ATOM   2627  C  CD    . GLU A  1  341 ? 59.191  100.304 65.409  1.00 69.92  ? 341  GLU A CD    1 
ATOM   2628  O  OE1   . GLU A  1  341 ? 60.250  100.475 64.754  1.00 71.63  ? 341  GLU A OE1   1 
ATOM   2629  O  OE2   . GLU A  1  341 ? 58.912  100.978 66.433  1.00 69.43  ? 341  GLU A OE2   1 
ATOM   2630  N  N     . TRP A  1  342 ? 56.489  100.678 60.848  1.00 65.89  ? 342  TRP A N     1 
ATOM   2631  C  CA    . TRP A  1  342 ? 56.479  100.884 59.416  1.00 66.50  ? 342  TRP A CA    1 
ATOM   2632  C  C     . TRP A  1  342 ? 56.682  102.368 59.148  1.00 66.76  ? 342  TRP A C     1 
ATOM   2633  O  O     . TRP A  1  342 ? 57.444  102.756 58.267  1.00 66.39  ? 342  TRP A O     1 
ATOM   2634  C  CB    . TRP A  1  342 ? 55.147  100.453 58.834  1.00 68.00  ? 342  TRP A CB    1 
ATOM   2635  C  CG    . TRP A  1  342 ? 55.112  99.055  58.351  1.00 70.11  ? 342  TRP A CG    1 
ATOM   2636  C  CD1   . TRP A  1  342 ? 56.054  98.096  58.543  1.00 71.20  ? 342  TRP A CD1   1 
ATOM   2637  C  CD2   . TRP A  1  342 ? 54.062  98.444  57.598  1.00 71.12  ? 342  TRP A CD2   1 
ATOM   2638  N  NE1   . TRP A  1  342 ? 55.658  96.919  57.957  1.00 71.86  ? 342  TRP A NE1   1 
ATOM   2639  C  CE2   . TRP A  1  342 ? 54.436  97.108  57.370  1.00 71.54  ? 342  TRP A CE2   1 
ATOM   2640  C  CE3   . TRP A  1  342 ? 52.838  98.898  57.097  1.00 70.90  ? 342  TRP A CE3   1 
ATOM   2641  C  CZ2   . TRP A  1  342 ? 53.629  96.216  56.662  1.00 72.87  ? 342  TRP A CZ2   1 
ATOM   2642  C  CZ3   . TRP A  1  342 ? 52.039  98.016  56.399  1.00 72.07  ? 342  TRP A CZ3   1 
ATOM   2643  C  CH2   . TRP A  1  342 ? 52.438  96.684  56.186  1.00 72.12  ? 342  TRP A CH2   1 
ATOM   2644  N  N     . MET A  1  343 ? 55.994  103.204 59.915  1.00 66.76  ? 343  MET A N     1 
ATOM   2645  C  CA    . MET A  1  343 ? 56.117  104.637 59.717  1.00 67.99  ? 343  MET A CA    1 
ATOM   2646  C  C     . MET A  1  343 ? 57.535  105.096 59.966  1.00 68.50  ? 343  MET A C     1 
ATOM   2647  O  O     . MET A  1  343 ? 57.991  106.042 59.328  1.00 68.77  ? 343  MET A O     1 
ATOM   2648  C  CB    . MET A  1  343 ? 55.137  105.418 60.613  1.00 68.08  ? 343  MET A CB    1 
ATOM   2649  C  CG    . MET A  1  343 ? 53.666  105.313 60.183  1.00 65.02  ? 343  MET A CG    1 
ATOM   2650  S  SD    . MET A  1  343 ? 53.434  105.643 58.409  1.00 62.95  ? 343  MET A SD    1 
ATOM   2651  C  CE    . MET A  1  343 ? 53.333  103.973 57.769  1.00 61.15  ? 343  MET A CE    1 
ATOM   2652  N  N     . ARG A  1  344 ? 58.231  104.434 60.892  1.00 69.66  ? 344  ARG A N     1 
ATOM   2653  C  CA    . ARG A  1  344 ? 59.624  104.788 61.178  1.00 71.16  ? 344  ARG A CA    1 
ATOM   2654  C  C     . ARG A  1  344 ? 60.479  104.472 59.952  1.00 70.99  ? 344  ARG A C     1 
ATOM   2655  O  O     . ARG A  1  344 ? 61.337  105.263 59.561  1.00 70.94  ? 344  ARG A O     1 
ATOM   2656  C  CB    . ARG A  1  344 ? 60.154  104.016 62.382  1.00 72.64  ? 344  ARG A CB    1 
ATOM   2657  C  CG    . ARG A  1  344 ? 59.985  104.720 63.717  1.00 75.50  ? 344  ARG A CG    1 
ATOM   2658  C  CD    . ARG A  1  344 ? 60.840  104.043 64.805  1.00 80.79  ? 344  ARG A CD    1 
ATOM   2659  N  NE    . ARG A  1  344 ? 62.293  104.234 64.622  1.00 84.26  ? 344  ARG A NE    1 
ATOM   2660  C  CZ    . ARG A  1  344 ? 63.143  103.362 64.060  1.00 84.60  ? 344  ARG A CZ    1 
ATOM   2661  N  NH1   . ARG A  1  344 ? 62.733  102.177 63.594  1.00 82.95  ? 344  ARG A NH1   1 
ATOM   2662  N  NH2   . ARG A  1  344 ? 64.427  103.693 63.955  1.00 83.95  ? 344  ARG A NH2   1 
ATOM   2663  N  N     . LEU A  1  345 ? 60.223  103.319 59.344  1.00 70.73  ? 345  LEU A N     1 
ATOM   2664  C  CA    . LEU A  1  345 ? 60.937  102.894 58.142  1.00 71.26  ? 345  LEU A CA    1 
ATOM   2665  C  C     . LEU A  1  345 ? 60.892  103.943 57.040  1.00 70.85  ? 345  LEU A C     1 
ATOM   2666  O  O     . LEU A  1  345 ? 61.879  104.194 56.366  1.00 71.84  ? 345  LEU A O     1 
ATOM   2667  C  CB    . LEU A  1  345 ? 60.322  101.613 57.573  1.00 71.39  ? 345  LEU A CB    1 
ATOM   2668  C  CG    . LEU A  1  345 ? 60.566  100.325 58.337  1.00 71.67  ? 345  LEU A CG    1 
ATOM   2669  C  CD1   . LEU A  1  345 ? 59.824  99.175  57.686  1.00 69.96  ? 345  LEU A CD1   1 
ATOM   2670  C  CD2   . LEU A  1  345 ? 62.060  100.081 58.356  1.00 72.48  ? 345  LEU A CD2   1 
ATOM   2671  N  N     . CYS A  1  346 ? 59.729  104.541 56.842  1.00 70.87  ? 346  CYS A N     1 
ATOM   2672  C  CA    . CYS A  1  346 ? 59.562  105.531 55.794  1.00 70.95  ? 346  CYS A CA    1 
ATOM   2673  C  C     . CYS A  1  346 ? 60.136  106.889 56.162  1.00 71.42  ? 346  CYS A C     1 
ATOM   2674  O  O     . CYS A  1  346 ? 60.574  107.644 55.290  1.00 71.46  ? 346  CYS A O     1 
ATOM   2675  C  CB    . CYS A  1  346 ? 58.070  105.716 55.473  1.00 69.70  ? 346  CYS A CB    1 
ATOM   2676  S  SG    . CYS A  1  346 ? 57.111  104.204 55.250  1.00 69.56  ? 346  CYS A SG    1 
ATOM   2677  N  N     . THR A  1  347 ? 60.154  107.197 57.451  1.00 71.67  ? 347  THR A N     1 
ATOM   2678  C  CA    . THR A  1  347 ? 60.589  108.516 57.855  1.00 74.07  ? 347  THR A CA    1 
ATOM   2679  C  C     . THR A  1  347 ? 61.875  108.713 58.618  1.00 75.87  ? 347  THR A C     1 
ATOM   2680  O  O     . THR A  1  347 ? 62.456  109.794 58.543  1.00 75.97  ? 347  THR A O     1 
ATOM   2681  C  CB    . THR A  1  347 ? 59.493  109.219 58.682  1.00 74.45  ? 347  THR A CB    1 
ATOM   2682  O  OG1   . THR A  1  347 ? 59.274  108.499 59.899  1.00 74.57  ? 347  THR A OG1   1 
ATOM   2683  C  CG2   . THR A  1  347 ? 58.192  109.276 57.913  1.00 76.24  ? 347  THR A CG2   1 
ATOM   2684  N  N     . SER A  1  348 ? 62.336  107.709 59.349  1.00 77.61  ? 348  SER A N     1 
ATOM   2685  C  CA    . SER A  1  348 ? 63.530  107.939 60.135  1.00 80.15  ? 348  SER A CA    1 
ATOM   2686  C  C     . SER A  1  348 ? 64.489  106.778 60.335  1.00 82.08  ? 348  SER A C     1 
ATOM   2687  O  O     . SER A  1  348 ? 64.989  106.557 61.447  1.00 83.42  ? 348  SER A O     1 
ATOM   2688  C  CB    . SER A  1  348 ? 63.110  108.515 61.497  1.00 80.69  ? 348  SER A CB    1 
ATOM   2689  O  OG    . SER A  1  348 ? 62.147  107.696 62.147  1.00 81.40  ? 348  SER A OG    1 
ATOM   2690  N  N     . THR A  1  349 ? 64.771  106.046 59.265  1.00 83.27  ? 349  THR A N     1 
ATOM   2691  C  CA    . THR A  1  349 ? 65.687  104.926 59.382  1.00 84.75  ? 349  THR A CA    1 
ATOM   2692  C  C     . THR A  1  349 ? 67.096  105.461 59.625  1.00 86.33  ? 349  THR A C     1 
ATOM   2693  O  O     . THR A  1  349 ? 67.445  106.554 59.170  1.00 86.05  ? 349  THR A O     1 
ATOM   2694  C  CB    . THR A  1  349 ? 65.646  104.054 58.125  1.00 84.66  ? 349  THR A CB    1 
ATOM   2695  O  OG1   . THR A  1  349 ? 64.306  103.599 57.919  1.00 86.67  ? 349  THR A OG1   1 
ATOM   2696  C  CG2   . THR A  1  349 ? 66.532  102.832 58.286  1.00 84.89  ? 349  THR A CG2   1 
ATOM   2697  N  N     . THR A  1  350 ? 67.888  104.686 60.364  1.00 88.46  ? 350  THR A N     1 
ATOM   2698  C  CA    . THR A  1  350 ? 69.263  105.047 60.716  1.00 90.23  ? 350  THR A CA    1 
ATOM   2699  C  C     . THR A  1  350 ? 70.272  104.148 60.008  1.00 90.54  ? 350  THR A C     1 
ATOM   2700  O  O     . THR A  1  350 ? 70.014  102.961 59.806  1.00 90.64  ? 350  THR A O     1 
ATOM   2701  C  CB    . THR A  1  350 ? 69.506  104.878 62.235  1.00 91.13  ? 350  THR A CB    1 
ATOM   2702  O  OG1   . THR A  1  350 ? 68.381  105.390 62.958  1.00 91.78  ? 350  THR A OG1   1 
ATOM   2703  C  CG2   . THR A  1  350 ? 70.779  105.626 62.666  1.00 92.91  ? 350  THR A CG2   1 
ATOM   2704  N  N     . GLU A  1  351 ? 71.424  104.703 59.644  1.00 90.81  ? 351  GLU A N     1 
ATOM   2705  C  CA    . GLU A  1  351 ? 72.446  103.898 58.992  1.00 90.89  ? 351  GLU A CA    1 
ATOM   2706  C  C     . GLU A  1  351 ? 72.771  102.702 59.883  1.00 90.75  ? 351  GLU A C     1 
ATOM   2707  O  O     . GLU A  1  351 ? 72.986  101.597 59.394  1.00 90.40  ? 351  GLU A O     1 
ATOM   2708  C  CB    . GLU A  1  351 ? 73.701  104.725 58.754  1.00 91.04  ? 351  GLU A CB    1 
ATOM   2709  C  CG    . GLU A  1  351 ? 73.530  105.832 57.728  1.00 92.77  ? 351  GLU A CG    1 
ATOM   2710  C  CD    . GLU A  1  351 ? 73.164  105.310 56.345  1.00 94.42  ? 351  GLU A CD    1 
ATOM   2711  O  OE1   . GLU A  1  351 ? 73.434  104.116 56.068  1.00 95.07  ? 351  GLU A OE1   1 
ATOM   2712  O  OE2   . GLU A  1  351 ? 72.621  106.100 55.532  1.00 94.38  ? 351  GLU A OE2   1 
ATOM   2713  N  N     . SER A  1  352 ? 72.799  102.932 61.192  1.00 90.80  ? 352  SER A N     1 
ATOM   2714  C  CA    . SER A  1  352 ? 73.080  101.871 62.152  1.00 92.46  ? 352  SER A CA    1 
ATOM   2715  C  C     . SER A  1  352 ? 72.130  100.706 61.936  1.00 93.68  ? 352  SER A C     1 
ATOM   2716  O  O     . SER A  1  352 ? 72.553  99.550  61.920  1.00 95.17  ? 352  SER A O     1 
ATOM   2717  C  CB    . SER A  1  352 ? 72.902  102.381 63.576  1.00 92.55  ? 352  SER A CB    1 
ATOM   2718  O  OG    . SER A  1  352 ? 73.444  103.682 63.705  1.00 95.87  ? 352  SER A OG    1 
ATOM   2719  N  N     . GLU A  1  353 ? 70.844  101.024 61.780  1.00 94.57  ? 353  GLU A N     1 
ATOM   2720  C  CA    . GLU A  1  353 ? 69.793  100.027 61.567  1.00 94.13  ? 353  GLU A CA    1 
ATOM   2721  C  C     . GLU A  1  353 ? 69.964  99.244  60.263  1.00 93.10  ? 353  GLU A C     1 
ATOM   2722  O  O     . GLU A  1  353 ? 69.841  98.016  60.257  1.00 92.00  ? 353  GLU A O     1 
ATOM   2723  C  CB    . GLU A  1  353 ? 68.414  100.699 61.569  1.00 96.20  ? 353  GLU A CB    1 
ATOM   2724  C  CG    . GLU A  1  353 ? 68.013  101.341 62.893  1.00 98.71  ? 353  GLU A CG    1 
ATOM   2725  C  CD    . GLU A  1  353 ? 66.567  101.827 62.898  1.00 100.25 ? 353  GLU A CD    1 
ATOM   2726  O  OE1   . GLU A  1  353 ? 66.220  102.683 62.052  1.00 101.08 ? 353  GLU A OE1   1 
ATOM   2727  O  OE2   . GLU A  1  353 ? 65.777  101.355 63.750  1.00 100.82 ? 353  GLU A OE2   1 
ATOM   2728  N  N     . VAL A  1  354 ? 70.228  99.952  59.163  1.00 92.22  ? 354  VAL A N     1 
ATOM   2729  C  CA    . VAL A  1  354 ? 70.417  99.299  57.867  1.00 91.84  ? 354  VAL A CA    1 
ATOM   2730  C  C     . VAL A  1  354 ? 71.698  98.481  57.881  1.00 91.51  ? 354  VAL A C     1 
ATOM   2731  O  O     . VAL A  1  354 ? 71.732  97.353  57.390  1.00 91.42  ? 354  VAL A O     1 
ATOM   2732  C  CB    . VAL A  1  354 ? 70.505  100.317 56.706  1.00 91.60  ? 354  VAL A CB    1 
ATOM   2733  C  CG1   . VAL A  1  354 ? 69.225  101.130 56.633  1.00 93.03  ? 354  VAL A CG1   1 
ATOM   2734  C  CG2   . VAL A  1  354 ? 71.707  101.223 56.889  1.00 91.66  ? 354  VAL A CG2   1 
ATOM   2735  N  N     . LYS A  1  355 ? 72.748  99.058  58.456  1.00 91.10  ? 355  LYS A N     1 
ATOM   2736  C  CA    . LYS A  1  355 ? 74.037  98.394  58.552  1.00 90.19  ? 355  LYS A CA    1 
ATOM   2737  C  C     . LYS A  1  355 ? 73.838  97.006  59.148  1.00 88.99  ? 355  LYS A C     1 
ATOM   2738  O  O     . LYS A  1  355 ? 74.287  96.002  58.589  1.00 88.93  ? 355  LYS A O     1 
ATOM   2739  C  CB    . LYS A  1  355 ? 74.970  99.219  59.431  1.00 91.16  ? 355  LYS A CB    1 
ATOM   2740  C  CG    . LYS A  1  355 ? 76.439  98.919  59.225  1.00 94.25  ? 355  LYS A CG    1 
ATOM   2741  C  CD    . LYS A  1  355 ? 77.049  98.221  60.429  1.00 96.58  ? 355  LYS A CD    1 
ATOM   2742  C  CE    . LYS A  1  355 ? 78.572  98.143  60.294  1.00 98.55  ? 355  LYS A CE    1 
ATOM   2743  N  NZ    . LYS A  1  355 ? 79.215  99.495  60.110  1.00 98.98  ? 355  LYS A NZ    1 
ATOM   2744  N  N     . ARG A  1  356 ? 73.148  96.955  60.280  1.00 87.72  ? 356  ARG A N     1 
ATOM   2745  C  CA    . ARG A  1  356 ? 72.876  95.692  60.946  1.00 87.34  ? 356  ARG A CA    1 
ATOM   2746  C  C     . ARG A  1  356 ? 71.907  94.843  60.134  1.00 86.37  ? 356  ARG A C     1 
ATOM   2747  O  O     . ARG A  1  356 ? 72.108  93.641  59.960  1.00 85.93  ? 356  ARG A O     1 
ATOM   2748  C  CB    . ARG A  1  356 ? 72.271  95.939  62.323  1.00 89.44  ? 356  ARG A CB    1 
ATOM   2749  C  CG    . ARG A  1  356 ? 71.965  94.660  63.086  1.00 92.38  ? 356  ARG A CG    1 
ATOM   2750  C  CD    . ARG A  1  356 ? 71.102  94.926  64.307  1.00 95.31  ? 356  ARG A CD    1 
ATOM   2751  N  NE    . ARG A  1  356 ? 69.678  95.027  63.976  1.00 99.14  ? 356  ARG A NE    1 
ATOM   2752  C  CZ    . ARG A  1  356 ? 68.949  96.141  64.062  1.00 101.23 ? 356  ARG A CZ    1 
ATOM   2753  N  NH1   . ARG A  1  356 ? 69.496  97.288  64.469  1.00 100.71 ? 356  ARG A NH1   1 
ATOM   2754  N  NH2   . ARG A  1  356 ? 67.655  96.103  63.755  1.00 102.30 ? 356  ARG A NH2   1 
ATOM   2755  N  N     . ALA A  1  357 ? 70.843  95.474  59.652  1.00 85.46  ? 357  ALA A N     1 
ATOM   2756  C  CA    . ALA A  1  357 ? 69.838  94.778  58.864  1.00 84.40  ? 357  ALA A CA    1 
ATOM   2757  C  C     . ALA A  1  357 ? 70.465  94.032  57.686  1.00 83.51  ? 357  ALA A C     1 
ATOM   2758  O  O     . ALA A  1  357 ? 70.013  92.943  57.329  1.00 83.83  ? 357  ALA A O     1 
ATOM   2759  C  CB    . ALA A  1  357 ? 68.796  95.768  58.364  1.00 85.71  ? 357  ALA A CB    1 
ATOM   2760  N  N     . LYS A  1  358 ? 71.502  94.623  57.091  1.00 82.07  ? 358  LYS A N     1 
ATOM   2761  C  CA    . LYS A  1  358 ? 72.211  94.024  55.957  1.00 79.55  ? 358  LYS A CA    1 
ATOM   2762  C  C     . LYS A  1  358 ? 72.982  92.778  56.364  1.00 78.77  ? 358  LYS A C     1 
ATOM   2763  O  O     . LYS A  1  358 ? 72.975  91.782  55.649  1.00 77.00  ? 358  LYS A O     1 
ATOM   2764  C  CB    . LYS A  1  358 ? 73.165  95.043  55.344  1.00 78.55  ? 358  LYS A CB    1 
ATOM   2765  C  CG    . LYS A  1  358 ? 72.445  96.113  54.550  1.00 78.59  ? 358  LYS A CG    1 
ATOM   2766  C  CD    . LYS A  1  358 ? 73.226  97.421  54.474  1.00 77.75  ? 358  LYS A CD    1 
ATOM   2767  C  CE    . LYS A  1  358 ? 74.466  97.333  53.606  1.00 76.74  ? 358  LYS A CE    1 
ATOM   2768  N  NZ    . LYS A  1  358 ? 75.160  98.653  53.558  1.00 75.46  ? 358  LYS A NZ    1 
ATOM   2769  N  N     . ASN A  1  359 ? 73.649  92.833  57.514  1.00 79.39  ? 359  ASN A N     1 
ATOM   2770  C  CA    . ASN A  1  359 ? 74.398  91.672  57.993  1.00 80.26  ? 359  ASN A CA    1 
ATOM   2771  C  C     . ASN A  1  359 ? 73.449  90.530  58.270  1.00 80.71  ? 359  ASN A C     1 
ATOM   2772  O  O     . ASN A  1  359 ? 73.773  89.369  58.012  1.00 81.20  ? 359  ASN A O     1 
ATOM   2773  C  CB    . ASN A  1  359 ? 75.168  91.983  59.278  1.00 79.83  ? 359  ASN A CB    1 
ATOM   2774  C  CG    . ASN A  1  359 ? 76.237  93.016  59.070  1.00 79.10  ? 359  ASN A CG    1 
ATOM   2775  O  OD1   . ASN A  1  359 ? 76.791  93.142  57.975  1.00 78.39  ? 359  ASN A OD1   1 
ATOM   2776  N  ND2   . ASN A  1  359 ? 76.549  93.758  60.126  1.00 78.40  ? 359  ASN A ND2   1 
ATOM   2777  N  N     . HIS A  1  360 ? 72.280  90.857  58.814  1.00 81.49  ? 360  HIS A N     1 
ATOM   2778  C  CA    . HIS A  1  360 ? 71.292  89.832  59.099  1.00 82.14  ? 360  HIS A CA    1 
ATOM   2779  C  C     . HIS A  1  360 ? 70.873  89.210  57.771  1.00 81.23  ? 360  HIS A C     1 
ATOM   2780  O  O     . HIS A  1  360 ? 70.939  87.993  57.602  1.00 80.99  ? 360  HIS A O     1 
ATOM   2781  C  CB    . HIS A  1  360 ? 70.060  90.420  59.800  1.00 84.27  ? 360  HIS A CB    1 
ATOM   2782  C  CG    . HIS A  1  360 ? 68.960  89.421  60.003  1.00 87.04  ? 360  HIS A CG    1 
ATOM   2783  N  ND1   . HIS A  1  360 ? 69.022  88.425  60.956  1.00 87.53  ? 360  HIS A ND1   1 
ATOM   2784  C  CD2   . HIS A  1  360 ? 67.812  89.208  59.311  1.00 88.15  ? 360  HIS A CD2   1 
ATOM   2785  C  CE1   . HIS A  1  360 ? 67.965  87.639  60.841  1.00 88.27  ? 360  HIS A CE1   1 
ATOM   2786  N  NE2   . HIS A  1  360 ? 67.215  88.091  59.849  1.00 89.50  ? 360  HIS A NE2   1 
ATOM   2787  N  N     . LEU A  1  361 ? 70.456  90.058  56.831  1.00 80.04  ? 361  LEU A N     1 
ATOM   2788  C  CA    . LEU A  1  361 ? 70.017  89.606  55.520  1.00 79.12  ? 361  LEU A CA    1 
ATOM   2789  C  C     . LEU A  1  361 ? 71.045  88.754  54.794  1.00 79.99  ? 361  LEU A C     1 
ATOM   2790  O  O     . LEU A  1  361 ? 70.667  87.815  54.094  1.00 80.71  ? 361  LEU A O     1 
ATOM   2791  C  CB    . LEU A  1  361 ? 69.640  90.795  54.641  1.00 78.30  ? 361  LEU A CB    1 
ATOM   2792  C  CG    . LEU A  1  361 ? 69.227  90.421  53.213  1.00 78.07  ? 361  LEU A CG    1 
ATOM   2793  C  CD1   . LEU A  1  361 ? 68.021  89.492  53.243  1.00 78.68  ? 361  LEU A CD1   1 
ATOM   2794  C  CD2   . LEU A  1  361 ? 68.910  91.680  52.432  1.00 76.71  ? 361  LEU A CD2   1 
ATOM   2795  N  N     . ARG A  1  362 ? 72.335  89.078  54.937  1.00 80.58  ? 362  ARG A N     1 
ATOM   2796  C  CA    . ARG A  1  362 ? 73.392  88.291  54.289  1.00 79.68  ? 362  ARG A CA    1 
ATOM   2797  C  C     . ARG A  1  362 ? 73.379  86.890  54.862  1.00 79.95  ? 362  ARG A C     1 
ATOM   2798  O  O     . ARG A  1  362 ? 73.118  85.919  54.154  1.00 79.99  ? 362  ARG A O     1 
ATOM   2799  C  CB    . ARG A  1  362 ? 74.769  88.897  54.527  1.00 79.11  ? 362  ARG A CB    1 
ATOM   2800  C  CG    . ARG A  1  362 ? 74.985  90.222  53.841  1.00 80.00  ? 362  ARG A CG    1 
ATOM   2801  C  CD    . ARG A  1  362 ? 76.458  90.518  53.662  1.00 78.55  ? 362  ARG A CD    1 
ATOM   2802  N  NE    . ARG A  1  362 ? 76.667  91.883  53.202  1.00 79.18  ? 362  ARG A NE    1 
ATOM   2803  C  CZ    . ARG A  1  362 ? 76.653  92.953  53.997  1.00 80.25  ? 362  ARG A CZ    1 
ATOM   2804  N  NH1   . ARG A  1  362 ? 76.447  92.815  55.304  1.00 79.77  ? 362  ARG A NH1   1 
ATOM   2805  N  NH2   . ARG A  1  362 ? 76.833  94.168  53.481  1.00 80.90  ? 362  ARG A NH2   1 
ATOM   2806  N  N     . SER A  1  363 ? 73.645  86.787  56.157  1.00 80.42  ? 363  SER A N     1 
ATOM   2807  C  CA    . SER A  1  363 ? 73.644  85.489  56.815  1.00 82.58  ? 363  SER A CA    1 
ATOM   2808  C  C     . SER A  1  363 ? 72.391  84.696  56.417  1.00 83.66  ? 363  SER A C     1 
ATOM   2809  O  O     . SER A  1  363 ? 72.404  83.463  56.359  1.00 84.61  ? 363  SER A O     1 
ATOM   2810  C  CB    . SER A  1  363 ? 73.687  85.681  58.329  1.00 82.96  ? 363  SER A CB    1 
ATOM   2811  O  OG    . SER A  1  363 ? 74.786  86.501  58.696  1.00 84.44  ? 363  SER A OG    1 
ATOM   2812  N  N     . ALA A  1  364 ? 71.315  85.419  56.130  1.00 84.24  ? 364  ALA A N     1 
ATOM   2813  C  CA    . ALA A  1  364 ? 70.054  84.809  55.742  1.00 83.70  ? 364  ALA A CA    1 
ATOM   2814  C  C     . ALA A  1  364 ? 70.145  84.140  54.376  1.00 83.69  ? 364  ALA A C     1 
ATOM   2815  O  O     . ALA A  1  364 ? 69.807  82.964  54.234  1.00 82.27  ? 364  ALA A O     1 
ATOM   2816  C  CB    . ALA A  1  364 ? 68.946  85.867  55.736  1.00 83.04  ? 364  ALA A CB    1 
ATOM   2817  N  N     . MET A  1  365 ? 70.603  84.891  53.375  1.00 85.06  ? 365  MET A N     1 
ATOM   2818  C  CA    . MET A  1  365 ? 70.704  84.366  52.014  1.00 87.44  ? 365  MET A CA    1 
ATOM   2819  C  C     . MET A  1  365 ? 71.654  83.197  51.974  1.00 88.09  ? 365  MET A C     1 
ATOM   2820  O  O     . MET A  1  365 ? 71.443  82.236  51.231  1.00 88.47  ? 365  MET A O     1 
ATOM   2821  C  CB    . MET A  1  365 ? 71.189  85.442  51.045  1.00 88.76  ? 365  MET A CB    1 
ATOM   2822  C  CG    . MET A  1  365 ? 72.502  86.059  51.453  1.00 92.75  ? 365  MET A CG    1 
ATOM   2823  S  SD    . MET A  1  365 ? 73.242  87.123  50.199  1.00 98.43  ? 365  MET A SD    1 
ATOM   2824  C  CE    . MET A  1  365 ? 75.004  86.641  50.332  1.00 97.72  ? 365  MET A CE    1 
ATOM   2825  N  N     . VAL A  1  366 ? 72.708  83.291  52.780  1.00 88.74  ? 366  VAL A N     1 
ATOM   2826  C  CA    . VAL A  1  366 ? 73.710  82.241  52.852  1.00 88.14  ? 366  VAL A CA    1 
ATOM   2827  C  C     . VAL A  1  366 ? 73.058  81.007  53.443  1.00 88.69  ? 366  VAL A C     1 
ATOM   2828  O  O     . VAL A  1  366 ? 73.181  79.917  52.896  1.00 88.41  ? 366  VAL A O     1 
ATOM   2829  C  CB    . VAL A  1  366 ? 74.923  82.680  53.717  1.00 87.08  ? 366  VAL A CB    1 
ATOM   2830  C  CG1   . VAL A  1  366 ? 75.808  81.483  54.031  1.00 86.01  ? 366  VAL A CG1   1 
ATOM   2831  C  CG2   . VAL A  1  366 ? 75.729  83.751  52.969  1.00 85.09  ? 366  VAL A CG2   1 
ATOM   2832  N  N     . ALA A  1  367 ? 72.333  81.189  54.541  1.00 90.30  ? 367  ALA A N     1 
ATOM   2833  C  CA    . ALA A  1  367 ? 71.656  80.073  55.198  1.00 92.29  ? 367  ALA A CA    1 
ATOM   2834  C  C     . ALA A  1  367 ? 70.620  79.367  54.305  1.00 93.16  ? 367  ALA A C     1 
ATOM   2835  O  O     . ALA A  1  367 ? 70.115  78.298  54.662  1.00 92.45  ? 367  ALA A O     1 
ATOM   2836  C  CB    . ALA A  1  367 ? 70.996  80.553  56.489  1.00 92.11  ? 367  ALA A CB    1 
ATOM   2837  N  N     . GLN A  1  368 ? 70.307  79.958  53.152  1.00 94.23  ? 368  GLN A N     1 
ATOM   2838  C  CA    . GLN A  1  368 ? 69.342  79.363  52.224  1.00 94.96  ? 368  GLN A CA    1 
ATOM   2839  C  C     . GLN A  1  368 ? 70.027  78.404  51.242  1.00 95.00  ? 368  GLN A C     1 
ATOM   2840  O  O     . GLN A  1  368 ? 69.374  77.795  50.385  1.00 95.03  ? 368  GLN A O     1 
ATOM   2841  C  CB    . GLN A  1  368 ? 68.633  80.444  51.413  1.00 96.10  ? 368  GLN A CB    1 
ATOM   2842  C  CG    . GLN A  1  368 ? 67.970  81.537  52.212  1.00 97.06  ? 368  GLN A CG    1 
ATOM   2843  C  CD    . GLN A  1  368 ? 67.151  82.447  51.318  1.00 97.84  ? 368  GLN A CD    1 
ATOM   2844  O  OE1   . GLN A  1  368 ? 67.542  82.734  50.180  1.00 97.84  ? 368  GLN A OE1   1 
ATOM   2845  N  NE2   . GLN A  1  368 ? 66.015  82.916  51.827  1.00 97.52  ? 368  GLN A NE2   1 
ATOM   2846  N  N     . LEU A  1  369 ? 71.345  78.283  51.367  1.00 93.99  ? 369  LEU A N     1 
ATOM   2847  C  CA    . LEU A  1  369 ? 72.126  77.414  50.501  1.00 92.65  ? 369  LEU A CA    1 
ATOM   2848  C  C     . LEU A  1  369 ? 72.920  76.467  51.388  1.00 92.54  ? 369  LEU A C     1 
ATOM   2849  O  O     . LEU A  1  369 ? 74.079  76.158  51.139  1.00 93.51  ? 369  LEU A O     1 
ATOM   2850  C  CB    . LEU A  1  369 ? 73.057  78.274  49.667  1.00 91.84  ? 369  LEU A CB    1 
ATOM   2851  C  CG    . LEU A  1  369 ? 72.347  79.507  49.116  1.00 90.61  ? 369  LEU A CG    1 
ATOM   2852  C  CD1   . LEU A  1  369 ? 73.323  80.402  48.401  1.00 90.40  ? 369  LEU A CD1   1 
ATOM   2853  C  CD2   . LEU A  1  369 ? 71.256  79.060  48.179  1.00 91.81  ? 369  LEU A CD2   1 
ATOM   2854  N  N     . ASP A  1  370 ? 72.267  76.013  52.441  1.00 92.27  ? 370  ASP A N     1 
ATOM   2855  C  CA    . ASP A  1  370 ? 72.880  75.125  53.398  1.00 92.00  ? 370  ASP A CA    1 
ATOM   2856  C  C     . ASP A  1  370 ? 72.323  73.720  53.206  1.00 91.30  ? 370  ASP A C     1 
ATOM   2857  O  O     . ASP A  1  370 ? 71.457  73.255  53.961  1.00 91.17  ? 370  ASP A O     1 
ATOM   2858  C  CB    . ASP A  1  370 ? 72.600  75.655  54.804  1.00 94.09  ? 370  ASP A CB    1 
ATOM   2859  C  CG    . ASP A  1  370 ? 73.168  74.777  55.874  1.00 96.60  ? 370  ASP A CG    1 
ATOM   2860  O  OD1   . ASP A  1  370 ? 74.370  74.440  55.777  1.00 99.01  ? 370  ASP A OD1   1 
ATOM   2861  O  OD2   . ASP A  1  370 ? 72.413  74.427  56.809  1.00 98.25  ? 370  ASP A OD2   1 
ATOM   2862  N  N     . GLY A  1  371 ? 72.832  73.048  52.178  1.00 90.75  ? 371  GLY A N     1 
ATOM   2863  C  CA    . GLY A  1  371 ? 72.391  71.698  51.865  1.00 90.58  ? 371  GLY A CA    1 
ATOM   2864  C  C     . GLY A  1  371 ? 72.212  71.566  50.364  1.00 90.16  ? 371  GLY A C     1 
ATOM   2865  O  O     . GLY A  1  371 ? 72.288  72.562  49.645  1.00 90.49  ? 371  GLY A O     1 
ATOM   2866  N  N     . THR A  1  372 ? 71.975  70.355  49.876  1.00 89.31  ? 372  THR A N     1 
ATOM   2867  C  CA    . THR A  1  372 ? 71.808  70.188  48.442  1.00 88.54  ? 372  THR A CA    1 
ATOM   2868  C  C     . THR A  1  372 ? 70.396  70.523  48.011  1.00 87.29  ? 372  THR A C     1 
ATOM   2869  O  O     . THR A  1  372 ? 70.197  71.114  46.952  1.00 87.84  ? 372  THR A O     1 
ATOM   2870  C  CB    . THR A  1  372 ? 72.181  68.759  47.973  1.00 89.43  ? 372  THR A CB    1 
ATOM   2871  O  OG1   . THR A  1  372 ? 71.556  67.776  48.813  1.00 90.21  ? 372  THR A OG1   1 
ATOM   2872  C  CG2   . THR A  1  372 ? 73.693  68.585  48.010  1.00 89.52  ? 372  THR A CG2   1 
ATOM   2873  N  N     . THR A  1  373 ? 69.415  70.166  48.833  1.00 85.15  ? 373  THR A N     1 
ATOM   2874  C  CA    . THR A  1  373 ? 68.036  70.475  48.489  1.00 82.88  ? 373  THR A CA    1 
ATOM   2875  C  C     . THR A  1  373 ? 67.863  71.994  48.462  1.00 80.80  ? 373  THR A C     1 
ATOM   2876  O  O     . THR A  1  373 ? 67.411  72.559  47.466  1.00 78.23  ? 373  THR A O     1 
ATOM   2877  C  CB    . THR A  1  373 ? 67.055  69.851  49.493  1.00 83.70  ? 373  THR A CB    1 
ATOM   2878  O  OG1   . THR A  1  373 ? 67.376  68.466  49.666  1.00 85.15  ? 373  THR A OG1   1 
ATOM   2879  C  CG2   . THR A  1  373 ? 65.620  69.962  48.979  1.00 83.70  ? 373  THR A CG2   1 
ATOM   2880  N  N     . PRO A  1  374 ? 68.241  72.684  49.551  1.00 80.33  ? 374  PRO A N     1 
ATOM   2881  C  CA    . PRO A  1  374 ? 68.088  74.144  49.550  1.00 81.23  ? 374  PRO A CA    1 
ATOM   2882  C  C     . PRO A  1  374 ? 68.866  74.915  48.466  1.00 81.83  ? 374  PRO A C     1 
ATOM   2883  O  O     . PRO A  1  374 ? 68.535  76.066  48.156  1.00 82.32  ? 374  PRO A O     1 
ATOM   2884  C  CB    . PRO A  1  374 ? 68.473  74.546  50.983  1.00 79.02  ? 374  PRO A CB    1 
ATOM   2885  C  CG    . PRO A  1  374 ? 69.302  73.429  51.458  1.00 80.56  ? 374  PRO A CG    1 
ATOM   2886  C  CD    . PRO A  1  374 ? 68.643  72.205  50.881  1.00 80.44  ? 374  PRO A CD    1 
ATOM   2887  N  N     . VAL A  1  375 ? 69.886  74.297  47.883  1.00 82.19  ? 375  VAL A N     1 
ATOM   2888  C  CA    . VAL A  1  375 ? 70.638  74.968  46.831  1.00 82.33  ? 375  VAL A CA    1 
ATOM   2889  C  C     . VAL A  1  375 ? 69.946  74.658  45.521  1.00 81.95  ? 375  VAL A C     1 
ATOM   2890  O  O     . VAL A  1  375 ? 70.014  75.417  44.562  1.00 81.53  ? 375  VAL A O     1 
ATOM   2891  C  CB    . VAL A  1  375 ? 72.086  74.468  46.740  1.00 82.17  ? 375  VAL A CB    1 
ATOM   2892  C  CG1   . VAL A  1  375 ? 72.791  75.144  45.576  1.00 82.24  ? 375  VAL A CG1   1 
ATOM   2893  C  CG2   . VAL A  1  375 ? 72.818  74.778  48.030  1.00 83.28  ? 375  VAL A CG2   1 
ATOM   2894  N  N     . CYS A  1  376 ? 69.274  73.523  45.498  1.00 82.44  ? 376  CYS A N     1 
ATOM   2895  C  CA    . CYS A  1  376 ? 68.563  73.093  44.314  1.00 84.02  ? 376  CYS A CA    1 
ATOM   2896  C  C     . CYS A  1  376 ? 67.279  73.914  44.205  1.00 84.68  ? 376  CYS A C     1 
ATOM   2897  O  O     . CYS A  1  376 ? 66.874  74.317  43.107  1.00 85.14  ? 376  CYS A O     1 
ATOM   2898  C  CB    . CYS A  1  376 ? 68.247  71.608  44.437  1.00 84.71  ? 376  CYS A CB    1 
ATOM   2899  S  SG    . CYS A  1  376 ? 67.682  70.821  42.929  1.00 88.48  ? 376  CYS A SG    1 
ATOM   2900  N  N     . GLU A  1  377 ? 66.652  74.160  45.356  1.00 84.20  ? 377  GLU A N     1 
ATOM   2901  C  CA    . GLU A  1  377 ? 65.417  74.945  45.431  1.00 83.21  ? 377  GLU A CA    1 
ATOM   2902  C  C     . GLU A  1  377 ? 65.676  76.326  44.872  1.00 82.26  ? 377  GLU A C     1 
ATOM   2903  O  O     . GLU A  1  377 ? 64.839  76.892  44.181  1.00 82.19  ? 377  GLU A O     1 
ATOM   2904  C  CB    . GLU A  1  377 ? 64.952  75.076  46.891  1.00 84.06  ? 377  GLU A CB    1 
ATOM   2905  C  CG    . GLU A  1  377 ? 63.721  75.965  47.111  1.00 82.47  ? 377  GLU A CG    1 
ATOM   2906  C  CD    . GLU A  1  377 ? 62.452  75.409  46.468  1.00 81.24  ? 377  GLU A CD    1 
ATOM   2907  O  OE1   . GLU A  1  377 ? 62.073  74.255  46.783  1.00 79.91  ? 377  GLU A OE1   1 
ATOM   2908  O  OE2   . GLU A  1  377 ? 61.833  76.132  45.655  1.00 79.44  ? 377  GLU A OE2   1 
ATOM   2909  N  N     . THR A  1  378 ? 66.845  76.862  45.196  1.00 82.06  ? 378  THR A N     1 
ATOM   2910  C  CA    . THR A  1  378 ? 67.256  78.179  44.737  1.00 82.47  ? 378  THR A CA    1 
ATOM   2911  C  C     . THR A  1  378 ? 67.398  78.216  43.215  1.00 82.26  ? 378  THR A C     1 
ATOM   2912  O  O     . THR A  1  378 ? 66.857  79.104  42.537  1.00 82.50  ? 378  THR A O     1 
ATOM   2913  C  CB    . THR A  1  378 ? 68.594  78.563  45.384  1.00 82.24  ? 378  THR A CB    1 
ATOM   2914  O  OG1   . THR A  1  378 ? 68.408  78.686  46.797  1.00 83.18  ? 378  THR A OG1   1 
ATOM   2915  C  CG2   . THR A  1  378 ? 69.120  79.873  44.816  1.00 82.15  ? 378  THR A CG2   1 
ATOM   2916  N  N     . ILE A  1  379 ? 68.135  77.245  42.689  1.00 81.21  ? 379  ILE A N     1 
ATOM   2917  C  CA    . ILE A  1  379 ? 68.357  77.143  41.262  1.00 80.66  ? 379  ILE A CA    1 
ATOM   2918  C  C     . ILE A  1  379 ? 67.038  77.014  40.520  1.00 79.91  ? 379  ILE A C     1 
ATOM   2919  O  O     . ILE A  1  379 ? 66.739  77.832  39.643  1.00 79.07  ? 379  ILE A O     1 
ATOM   2920  C  CB    . ILE A  1  379 ? 69.271  75.948  40.956  1.00 81.50  ? 379  ILE A CB    1 
ATOM   2921  C  CG1   . ILE A  1  379 ? 70.685  76.282  41.444  1.00 82.82  ? 379  ILE A CG1   1 
ATOM   2922  C  CG2   . ILE A  1  379 ? 69.259  75.625  39.468  1.00 80.62  ? 379  ILE A CG2   1 
ATOM   2923  C  CD1   . ILE A  1  379 ? 71.703  75.194  41.231  1.00 83.22  ? 379  ILE A CD1   1 
ATOM   2924  N  N     . GLY A  1  380 ? 66.250  76.001  40.881  1.00 79.29  ? 380  GLY A N     1 
ATOM   2925  C  CA    . GLY A  1  380 ? 64.953  75.800  40.246  1.00 79.90  ? 380  GLY A CA    1 
ATOM   2926  C  C     . GLY A  1  380 ? 64.135  77.086  40.179  1.00 81.04  ? 380  GLY A C     1 
ATOM   2927  O  O     . GLY A  1  380 ? 63.553  77.423  39.137  1.00 81.87  ? 380  GLY A O     1 
ATOM   2928  N  N     . SER A  1  381 ? 64.109  77.813  41.299  1.00 80.79  ? 381  SER A N     1 
ATOM   2929  C  CA    . SER A  1  381 ? 63.388  79.072  41.424  1.00 78.18  ? 381  SER A CA    1 
ATOM   2930  C  C     . SER A  1  381 ? 64.023  80.210  40.653  1.00 77.52  ? 381  SER A C     1 
ATOM   2931  O  O     . SER A  1  381 ? 63.359  80.815  39.828  1.00 78.72  ? 381  SER A O     1 
ATOM   2932  C  CB    . SER A  1  381 ? 63.266  79.455  42.890  1.00 77.26  ? 381  SER A CB    1 
ATOM   2933  O  OG    . SER A  1  381 ? 62.435  78.519  43.545  1.00 78.47  ? 381  SER A OG    1 
ATOM   2934  N  N     . HIS A  1  382 ? 65.292  80.514  40.905  1.00 76.02  ? 382  HIS A N     1 
ATOM   2935  C  CA    . HIS A  1  382 ? 65.929  81.600  40.169  1.00 75.57  ? 382  HIS A CA    1 
ATOM   2936  C  C     . HIS A  1  382 ? 65.652  81.553  38.668  1.00 76.47  ? 382  HIS A C     1 
ATOM   2937  O  O     . HIS A  1  382 ? 65.200  82.538  38.079  1.00 76.06  ? 382  HIS A O     1 
ATOM   2938  C  CB    . HIS A  1  382 ? 67.429  81.580  40.365  1.00 74.40  ? 382  HIS A CB    1 
ATOM   2939  C  CG    . HIS A  1  382 ? 67.875  82.247  41.614  1.00 72.99  ? 382  HIS A CG    1 
ATOM   2940  N  ND1   . HIS A  1  382 ? 68.903  83.162  41.634  1.00 74.11  ? 382  HIS A ND1   1 
ATOM   2941  C  CD2   . HIS A  1  382 ? 67.462  82.109  42.894  1.00 72.71  ? 382  HIS A CD2   1 
ATOM   2942  C  CE1   . HIS A  1  382 ? 69.108  83.559  42.879  1.00 74.66  ? 382  HIS A CE1   1 
ATOM   2943  N  NE2   . HIS A  1  382 ? 68.247  82.935  43.663  1.00 73.56  ? 382  HIS A NE2   1 
ATOM   2944  N  N     . LEU A  1  383 ? 65.949  80.416  38.047  1.00 76.59  ? 383  LEU A N     1 
ATOM   2945  C  CA    . LEU A  1  383 ? 65.729  80.279  36.618  1.00 77.37  ? 383  LEU A CA    1 
ATOM   2946  C  C     . LEU A  1  383 ? 64.298  80.616  36.317  1.00 76.84  ? 383  LEU A C     1 
ATOM   2947  O  O     . LEU A  1  383 ? 64.002  81.533  35.555  1.00 77.38  ? 383  LEU A O     1 
ATOM   2948  C  CB    . LEU A  1  383 ? 66.010  78.849  36.157  1.00 79.54  ? 383  LEU A CB    1 
ATOM   2949  C  CG    . LEU A  1  383 ? 67.482  78.443  36.064  1.00 80.71  ? 383  LEU A CG    1 
ATOM   2950  C  CD1   . LEU A  1  383 ? 67.575  77.006  35.560  1.00 79.56  ? 383  LEU A CD1   1 
ATOM   2951  C  CD2   . LEU A  1  383 ? 68.227  79.412  35.136  1.00 79.85  ? 383  LEU A CD2   1 
ATOM   2952  N  N     . LEU A  1  384 ? 63.411  79.861  36.943  1.00 76.41  ? 384  LEU A N     1 
ATOM   2953  C  CA    . LEU A  1  384 ? 61.982  80.039  36.769  1.00 75.92  ? 384  LEU A CA    1 
ATOM   2954  C  C     . LEU A  1  384 ? 61.517  81.504  36.956  1.00 76.10  ? 384  LEU A C     1 
ATOM   2955  O  O     . LEU A  1  384 ? 60.693  81.993  36.183  1.00 76.90  ? 384  LEU A O     1 
ATOM   2956  C  CB    . LEU A  1  384 ? 61.268  79.092  37.740  1.00 73.88  ? 384  LEU A CB    1 
ATOM   2957  C  CG    . LEU A  1  384 ? 59.929  78.468  37.346  1.00 73.47  ? 384  LEU A CG    1 
ATOM   2958  C  CD1   . LEU A  1  384 ? 59.889  78.187  35.873  1.00 73.17  ? 384  LEU A CD1   1 
ATOM   2959  C  CD2   . LEU A  1  384 ? 59.727  77.180  38.126  1.00 72.97  ? 384  LEU A CD2   1 
ATOM   2960  N  N     . ASN A  1  385 ? 62.077  82.209  37.942  1.00 75.75  ? 385  ASN A N     1 
ATOM   2961  C  CA    . ASN A  1  385 ? 61.683  83.590  38.240  1.00 75.93  ? 385  ASN A CA    1 
ATOM   2962  C  C     . ASN A  1  385 ? 62.501  84.724  37.650  1.00 76.92  ? 385  ASN A C     1 
ATOM   2963  O  O     . ASN A  1  385 ? 61.931  85.690  37.150  1.00 77.02  ? 385  ASN A O     1 
ATOM   2964  C  CB    . ASN A  1  385 ? 61.605  83.800  39.755  1.00 75.50  ? 385  ASN A CB    1 
ATOM   2965  C  CG    . ASN A  1  385 ? 60.534  82.943  40.404  1.00 76.61  ? 385  ASN A CG    1 
ATOM   2966  O  OD1   . ASN A  1  385 ? 59.385  82.882  39.938  1.00 77.38  ? 385  ASN A OD1   1 
ATOM   2967  N  ND2   . ASN A  1  385 ? 60.897  82.278  41.490  1.00 76.61  ? 385  ASN A ND2   1 
ATOM   2968  N  N     . TYR A  1  386 ? 63.826  84.633  37.734  1.00 77.98  ? 386  TYR A N     1 
ATOM   2969  C  CA    . TYR A  1  386 ? 64.692  85.679  37.198  1.00 78.20  ? 386  TYR A CA    1 
ATOM   2970  C  C     . TYR A  1  386 ? 65.214  85.313  35.818  1.00 79.23  ? 386  TYR A C     1 
ATOM   2971  O  O     . TYR A  1  386 ? 65.858  86.133  35.166  1.00 79.68  ? 386  TYR A O     1 
ATOM   2972  C  CB    . TYR A  1  386 ? 65.886  85.910  38.110  1.00 77.59  ? 386  TYR A CB    1 
ATOM   2973  C  CG    . TYR A  1  386 ? 65.541  86.261  39.540  1.00 80.22  ? 386  TYR A CG    1 
ATOM   2974  C  CD1   . TYR A  1  386 ? 64.899  87.457  39.861  1.00 80.37  ? 386  TYR A CD1   1 
ATOM   2975  C  CD2   . TYR A  1  386 ? 65.908  85.416  40.588  1.00 81.32  ? 386  TYR A CD2   1 
ATOM   2976  C  CE1   . TYR A  1  386 ? 64.638  87.807  41.204  1.00 81.53  ? 386  TYR A CE1   1 
ATOM   2977  C  CE2   . TYR A  1  386 ? 65.652  85.754  41.931  1.00 81.10  ? 386  TYR A CE2   1 
ATOM   2978  C  CZ    . TYR A  1  386 ? 65.022  86.945  42.233  1.00 81.98  ? 386  TYR A CZ    1 
ATOM   2979  O  OH    . TYR A  1  386 ? 64.788  87.266  43.560  1.00 82.22  ? 386  TYR A OH    1 
ATOM   2980  N  N     . GLY A  1  387 ? 64.939  84.084  35.378  1.00 80.60  ? 387  GLY A N     1 
ATOM   2981  C  CA    . GLY A  1  387 ? 65.414  83.621  34.075  1.00 81.49  ? 387  GLY A CA    1 
ATOM   2982  C  C     . GLY A  1  387 ? 66.923  83.389  34.066  1.00 81.92  ? 387  GLY A C     1 
ATOM   2983  O  O     . GLY A  1  387 ? 67.583  83.500  33.029  1.00 81.07  ? 387  GLY A O     1 
ATOM   2984  N  N     . ARG A  1  388 ? 67.460  83.068  35.242  1.00 81.60  ? 388  ARG A N     1 
ATOM   2985  C  CA    . ARG A  1  388 ? 68.878  82.836  35.426  1.00 80.80  ? 388  ARG A CA    1 
ATOM   2986  C  C     . ARG A  1  388 ? 69.187  82.727  36.913  1.00 81.79  ? 388  ARG A C     1 
ATOM   2987  O  O     . ARG A  1  388 ? 68.327  82.949  37.762  1.00 82.35  ? 388  ARG A O     1 
ATOM   2988  C  CB    . ARG A  1  388 ? 69.682  83.995  34.849  1.00 79.75  ? 388  ARG A CB    1 
ATOM   2989  C  CG    . ARG A  1  388 ? 69.563  85.291  35.625  1.00 79.99  ? 388  ARG A CG    1 
ATOM   2990  C  CD    . ARG A  1  388 ? 70.544  86.311  35.075  1.00 81.82  ? 388  ARG A CD    1 
ATOM   2991  N  NE    . ARG A  1  388 ? 70.494  87.634  35.716  1.00 83.19  ? 388  ARG A NE    1 
ATOM   2992  C  CZ    . ARG A  1  388 ? 70.933  87.911  36.945  1.00 81.84  ? 388  ARG A CZ    1 
ATOM   2993  N  NH1   . ARG A  1  388 ? 70.844  89.144  37.425  1.00 80.93  ? 388  ARG A NH1   1 
ATOM   2994  N  NH2   . ARG A  1  388 ? 71.456  86.955  37.697  1.00 82.94  ? 388  ARG A NH2   1 
ATOM   2995  N  N     . ARG A  1  389 ? 70.430  82.393  37.226  1.00 82.86  ? 389  ARG A N     1 
ATOM   2996  C  CA    . ARG A  1  389 ? 70.844  82.275  38.611  1.00 82.84  ? 389  ARG A CA    1 
ATOM   2997  C  C     . ARG A  1  389 ? 71.509  83.555  39.058  1.00 83.28  ? 389  ARG A C     1 
ATOM   2998  O  O     . ARG A  1  389 ? 72.162  84.236  38.272  1.00 82.21  ? 389  ARG A O     1 
ATOM   2999  C  CB    . ARG A  1  389 ? 71.822  81.115  38.789  1.00 82.01  ? 389  ARG A CB    1 
ATOM   3000  C  CG    . ARG A  1  389 ? 72.476  81.047  40.164  1.00 80.90  ? 389  ARG A CG    1 
ATOM   3001  C  CD    . ARG A  1  389 ? 71.458  80.846  41.265  1.00 81.28  ? 389  ARG A CD    1 
ATOM   3002  N  NE    . ARG A  1  389 ? 72.075  80.784  42.589  1.00 83.80  ? 389  ARG A NE    1 
ATOM   3003  C  CZ    . ARG A  1  389 ? 72.703  79.715  43.080  1.00 85.04  ? 389  ARG A CZ    1 
ATOM   3004  N  NH1   . ARG A  1  389 ? 72.800  78.604  42.356  1.00 84.73  ? 389  ARG A NH1   1 
ATOM   3005  N  NH2   . ARG A  1  389 ? 73.230  79.752  44.300  1.00 84.48  ? 389  ARG A NH2   1 
ATOM   3006  N  N     . ILE A  1  390 ? 71.312  83.877  40.328  1.00 85.16  ? 390  ILE A N     1 
ATOM   3007  C  CA    . ILE A  1  390 ? 71.913  85.050  40.932  1.00 87.46  ? 390  ILE A CA    1 
ATOM   3008  C  C     . ILE A  1  390 ? 72.768  84.520  42.078  1.00 89.42  ? 390  ILE A C     1 
ATOM   3009  O  O     . ILE A  1  390 ? 72.260  83.924  43.043  1.00 88.76  ? 390  ILE A O     1 
ATOM   3010  C  CB    . ILE A  1  390 ? 70.850  86.041  41.463  1.00 86.92  ? 390  ILE A CB    1 
ATOM   3011  C  CG1   . ILE A  1  390 ? 69.907  86.444  40.317  1.00 86.61  ? 390  ILE A CG1   1 
ATOM   3012  C  CG2   . ILE A  1  390 ? 71.542  87.271  42.066  1.00 86.13  ? 390  ILE A CG2   1 
ATOM   3013  C  CD1   . ILE A  1  390 ? 68.876  87.503  40.682  1.00 85.58  ? 390  ILE A CD1   1 
ATOM   3014  N  N     . SER A  1  391 ? 74.077  84.721  41.936  1.00 91.48  ? 391  SER A N     1 
ATOM   3015  C  CA    . SER A  1  391 ? 75.066  84.261  42.909  1.00 92.14  ? 391  SER A CA    1 
ATOM   3016  C  C     . SER A  1  391 ? 75.063  85.091  44.171  1.00 91.49  ? 391  SER A C     1 
ATOM   3017  O  O     . SER A  1  391 ? 74.712  86.269  44.150  1.00 91.41  ? 391  SER A O     1 
ATOM   3018  C  CB    . SER A  1  391 ? 76.463  84.345  42.310  1.00 92.77  ? 391  SER A CB    1 
ATOM   3019  O  OG    . SER A  1  391 ? 76.872  85.706  42.229  1.00 93.18  ? 391  SER A OG    1 
ATOM   3020  N  N     . LEU A  1  392 ? 75.479  84.481  45.269  1.00 91.06  ? 392  LEU A N     1 
ATOM   3021  C  CA    . LEU A  1  392 ? 75.537  85.219  46.505  1.00 92.57  ? 392  LEU A CA    1 
ATOM   3022  C  C     . LEU A  1  392 ? 76.437  86.424  46.264  1.00 93.77  ? 392  LEU A C     1 
ATOM   3023  O  O     . LEU A  1  392 ? 76.200  87.510  46.801  1.00 93.84  ? 392  LEU A O     1 
ATOM   3024  C  CB    . LEU A  1  392 ? 76.102  84.345  47.625  1.00 93.33  ? 392  LEU A CB    1 
ATOM   3025  C  CG    . LEU A  1  392 ? 75.222  83.183  48.093  1.00 93.67  ? 392  LEU A CG    1 
ATOM   3026  C  CD1   . LEU A  1  392 ? 75.877  82.458  49.259  1.00 93.35  ? 392  LEU A CD1   1 
ATOM   3027  C  CD2   . LEU A  1  392 ? 73.870  83.724  48.522  1.00 95.20  ? 392  LEU A CD2   1 
ATOM   3028  N  N     . GLU A  1  393 ? 77.465  86.241  45.439  1.00 95.25  ? 393  GLU A N     1 
ATOM   3029  C  CA    . GLU A  1  393 ? 78.375  87.340  45.157  1.00 96.28  ? 393  GLU A CA    1 
ATOM   3030  C  C     . GLU A  1  393 ? 77.604  88.541  44.639  1.00 95.09  ? 393  GLU A C     1 
ATOM   3031  O  O     . GLU A  1  393 ? 77.961  89.687  44.934  1.00 95.04  ? 393  GLU A O     1 
ATOM   3032  C  CB    . GLU A  1  393 ? 79.444  86.942  44.133  1.00 99.64  ? 393  GLU A CB    1 
ATOM   3033  C  CG    . GLU A  1  393 ? 80.168  88.168  43.537  1.00 104.09 ? 393  GLU A CG    1 
ATOM   3034  C  CD    . GLU A  1  393 ? 81.550  87.867  42.970  1.00 105.82 ? 393  GLU A CD    1 
ATOM   3035  O  OE1   . GLU A  1  393 ? 81.666  86.955  42.119  1.00 106.42 ? 393  GLU A OE1   1 
ATOM   3036  O  OE2   . GLU A  1  393 ? 82.515  88.561  43.373  1.00 105.95 ? 393  GLU A OE2   1 
ATOM   3037  N  N     . GLU A  1  394 ? 76.551  88.275  43.866  1.00 93.28  ? 394  GLU A N     1 
ATOM   3038  C  CA    . GLU A  1  394 ? 75.728  89.351  43.313  1.00 90.69  ? 394  GLU A CA    1 
ATOM   3039  C  C     . GLU A  1  394 ? 74.824  89.931  44.394  1.00 88.35  ? 394  GLU A C     1 
ATOM   3040  O  O     . GLU A  1  394 ? 74.853  91.133  44.667  1.00 86.95  ? 394  GLU A O     1 
ATOM   3041  C  CB    . GLU A  1  394 ? 74.863  88.844  42.158  1.00 90.25  ? 394  GLU A CB    1 
ATOM   3042  C  CG    . GLU A  1  394 ? 74.316  89.978  41.311  1.00 90.74  ? 394  GLU A CG    1 
ATOM   3043  C  CD    . GLU A  1  394 ? 73.322  89.507  40.277  1.00 91.67  ? 394  GLU A CD    1 
ATOM   3044  O  OE1   . GLU A  1  394 ? 73.539  88.421  39.699  1.00 92.28  ? 394  GLU A OE1   1 
ATOM   3045  O  OE2   . GLU A  1  394 ? 72.331  90.228  40.035  1.00 91.47  ? 394  GLU A OE2   1 
ATOM   3046  N  N     . TRP A  1  395 ? 74.018  89.063  44.999  1.00 86.25  ? 395  TRP A N     1 
ATOM   3047  C  CA    . TRP A  1  395 ? 73.114  89.478  46.059  1.00 84.12  ? 395  TRP A CA    1 
ATOM   3048  C  C     . TRP A  1  395 ? 73.857  90.432  46.967  1.00 83.95  ? 395  TRP A C     1 
ATOM   3049  O  O     . TRP A  1  395 ? 73.382  91.530  47.267  1.00 84.37  ? 395  TRP A O     1 
ATOM   3050  C  CB    . TRP A  1  395 ? 72.633  88.265  46.868  1.00 80.17  ? 395  TRP A CB    1 
ATOM   3051  C  CG    . TRP A  1  395 ? 71.437  87.577  46.283  1.00 77.09  ? 395  TRP A CG    1 
ATOM   3052  C  CD1   . TRP A  1  395 ? 71.131  86.244  46.370  1.00 77.50  ? 395  TRP A CD1   1 
ATOM   3053  C  CD2   . TRP A  1  395 ? 70.370  88.186  45.544  1.00 75.34  ? 395  TRP A CD2   1 
ATOM   3054  N  NE1   . TRP A  1  395 ? 69.938  85.984  45.725  1.00 76.75  ? 395  TRP A NE1   1 
ATOM   3055  C  CE2   . TRP A  1  395 ? 69.450  87.158  45.212  1.00 75.93  ? 395  TRP A CE2   1 
ATOM   3056  C  CE3   . TRP A  1  395 ? 70.098  89.498  45.130  1.00 72.80  ? 395  TRP A CE3   1 
ATOM   3057  C  CZ2   . TRP A  1  395 ? 68.279  87.408  44.485  1.00 74.76  ? 395  TRP A CZ2   1 
ATOM   3058  C  CZ3   . TRP A  1  395 ? 68.939  89.744  44.408  1.00 72.66  ? 395  TRP A CZ3   1 
ATOM   3059  C  CH2   . TRP A  1  395 ? 68.042  88.703  44.092  1.00 73.52  ? 395  TRP A CH2   1 
ATOM   3060  N  N     . ASP A  1  396 ? 75.048  90.022  47.372  1.00 83.53  ? 396  ASP A N     1 
ATOM   3061  C  CA    . ASP A  1  396 ? 75.841  90.838  48.264  1.00 84.08  ? 396  ASP A CA    1 
ATOM   3062  C  C     . ASP A  1  396 ? 76.212  92.215  47.721  1.00 83.77  ? 396  ASP A C     1 
ATOM   3063  O  O     . ASP A  1  396 ? 76.300  93.185  48.482  1.00 81.99  ? 396  ASP A O     1 
ATOM   3064  C  CB    . ASP A  1  396 ? 77.102  90.092  48.672  1.00 85.36  ? 396  ASP A CB    1 
ATOM   3065  C  CG    . ASP A  1  396 ? 77.825  90.792  49.788  1.00 87.11  ? 396  ASP A CG    1 
ATOM   3066  O  OD1   . ASP A  1  396 ? 78.491  91.821  49.525  1.00 88.83  ? 396  ASP A OD1   1 
ATOM   3067  O  OD2   . ASP A  1  396 ? 77.702  90.323  50.937  1.00 87.09  ? 396  ASP A OD2   1 
ATOM   3068  N  N     . SER A  1  397 ? 76.440  92.301  46.414  1.00 84.16  ? 397  SER A N     1 
ATOM   3069  C  CA    . SER A  1  397 ? 76.789  93.578  45.799  1.00 84.77  ? 397  SER A CA    1 
ATOM   3070  C  C     . SER A  1  397 ? 75.620  94.550  45.909  1.00 85.12  ? 397  SER A C     1 
ATOM   3071  O  O     . SER A  1  397 ? 75.805  95.744  46.203  1.00 85.65  ? 397  SER A O     1 
ATOM   3072  C  CB    . SER A  1  397 ? 77.128  93.388  44.326  1.00 85.15  ? 397  SER A CB    1 
ATOM   3073  O  OG    . SER A  1  397 ? 77.211  94.653  43.685  1.00 86.47  ? 397  SER A OG    1 
ATOM   3074  N  N     . ARG A  1  398 ? 74.421  94.016  45.653  1.00 84.00  ? 398  ARG A N     1 
ATOM   3075  C  CA    . ARG A  1  398 ? 73.175  94.769  45.710  1.00 80.13  ? 398  ARG A CA    1 
ATOM   3076  C  C     . ARG A  1  398 ? 72.852  95.141  47.148  1.00 78.22  ? 398  ARG A C     1 
ATOM   3077  O  O     . ARG A  1  398 ? 72.551  96.296  47.435  1.00 78.28  ? 398  ARG A O     1 
ATOM   3078  C  CB    . ARG A  1  398 ? 72.046  93.930  45.129  1.00 79.74  ? 398  ARG A CB    1 
ATOM   3079  C  CG    . ARG A  1  398 ? 72.210  93.639  43.662  1.00 79.90  ? 398  ARG A CG    1 
ATOM   3080  C  CD    . ARG A  1  398 ? 71.141  92.679  43.181  1.00 81.57  ? 398  ARG A CD    1 
ATOM   3081  N  NE    . ARG A  1  398 ? 71.079  92.600  41.721  1.00 82.22  ? 398  ARG A NE    1 
ATOM   3082  C  CZ    . ARG A  1  398 ? 70.666  93.586  40.923  1.00 82.82  ? 398  ARG A CZ    1 
ATOM   3083  N  NH1   . ARG A  1  398 ? 70.264  94.751  41.428  1.00 82.63  ? 398  ARG A NH1   1 
ATOM   3084  N  NH2   . ARG A  1  398 ? 70.664  93.406  39.608  1.00 82.71  ? 398  ARG A NH2   1 
ATOM   3085  N  N     . ILE A  1  399 ? 72.920  94.159  48.045  1.00 75.13  ? 399  ILE A N     1 
ATOM   3086  C  CA    . ILE A  1  399 ? 72.640  94.381  49.454  1.00 73.26  ? 399  ILE A CA    1 
ATOM   3087  C  C     . ILE A  1  399 ? 73.539  95.437  50.071  1.00 75.79  ? 399  ILE A C     1 
ATOM   3088  O  O     . ILE A  1  399 ? 73.109  96.180  50.949  1.00 76.89  ? 399  ILE A O     1 
ATOM   3089  C  CB    . ILE A  1  399 ? 72.834  93.109  50.267  1.00 70.28  ? 399  ILE A CB    1 
ATOM   3090  C  CG1   . ILE A  1  399 ? 71.809  92.075  49.849  1.00 70.49  ? 399  ILE A CG1   1 
ATOM   3091  C  CG2   . ILE A  1  399 ? 72.718  93.403  51.747  1.00 67.85  ? 399  ILE A CG2   1 
ATOM   3092  C  CD1   . ILE A  1  399 ? 71.848  90.821  50.697  1.00 72.32  ? 399  ILE A CD1   1 
ATOM   3093  N  N     . SER A  1  400 ? 74.788  95.506  49.618  1.00 78.08  ? 400  SER A N     1 
ATOM   3094  C  CA    . SER A  1  400 ? 75.751  96.460  50.169  1.00 79.32  ? 400  SER A CA    1 
ATOM   3095  C  C     . SER A  1  400 ? 75.527  97.887  49.699  1.00 79.74  ? 400  SER A C     1 
ATOM   3096  O  O     . SER A  1  400 ? 75.978  98.841  50.336  1.00 78.94  ? 400  SER A O     1 
ATOM   3097  C  CB    . SER A  1  400 ? 77.163  96.009  49.822  1.00 80.20  ? 400  SER A CB    1 
ATOM   3098  O  OG    . SER A  1  400 ? 77.342  94.656  50.212  1.00 81.83  ? 400  SER A OG    1 
ATOM   3099  N  N     . ALA A  1  401 ? 74.817  98.030  48.587  1.00 81.39  ? 401  ALA A N     1 
ATOM   3100  C  CA    . ALA A  1  401 ? 74.517  99.349  48.026  1.00 83.66  ? 401  ALA A CA    1 
ATOM   3101  C  C     . ALA A  1  401 ? 73.364  100.058 48.766  1.00 84.54  ? 401  ALA A C     1 
ATOM   3102  O  O     . ALA A  1  401 ? 73.195  101.278 48.651  1.00 83.88  ? 401  ALA A O     1 
ATOM   3103  C  CB    . ALA A  1  401 ? 74.176  99.209  46.528  1.00 84.01  ? 401  ALA A CB    1 
ATOM   3104  N  N     . VAL A  1  402 ? 72.584  99.276  49.517  1.00 85.22  ? 402  VAL A N     1 
ATOM   3105  C  CA    . VAL A  1  402 ? 71.435  99.762  50.278  1.00 84.86  ? 402  VAL A CA    1 
ATOM   3106  C  C     . VAL A  1  402 ? 71.859  100.556 51.501  1.00 85.61  ? 402  VAL A C     1 
ATOM   3107  O  O     . VAL A  1  402 ? 72.710  100.114 52.265  1.00 85.48  ? 402  VAL A O     1 
ATOM   3108  C  CB    . VAL A  1  402 ? 70.559  98.592  50.762  1.00 84.10  ? 402  VAL A CB    1 
ATOM   3109  C  CG1   . VAL A  1  402 ? 69.315  99.122  51.436  1.00 84.83  ? 402  VAL A CG1   1 
ATOM   3110  C  CG2   . VAL A  1  402 ? 70.183  97.708  49.598  1.00 84.37  ? 402  VAL A CG2   1 
ATOM   3111  N  N     . ASP A  1  403 ? 71.247  101.724 51.684  1.00 86.58  ? 403  ASP A N     1 
ATOM   3112  C  CA    . ASP A  1  403 ? 71.545  102.595 52.815  1.00 87.27  ? 403  ASP A CA    1 
ATOM   3113  C  C     . ASP A  1  403 ? 70.257  103.210 53.350  1.00 88.00  ? 403  ASP A C     1 
ATOM   3114  O  O     . ASP A  1  403 ? 69.195  103.073 52.736  1.00 89.24  ? 403  ASP A O     1 
ATOM   3115  C  CB    . ASP A  1  403 ? 72.498  103.713 52.384  1.00 88.35  ? 403  ASP A CB    1 
ATOM   3116  C  CG    . ASP A  1  403 ? 71.814  104.792 51.540  1.00 89.93  ? 403  ASP A CG    1 
ATOM   3117  O  OD1   . ASP A  1  403 ? 71.394  104.520 50.389  1.00 89.79  ? 403  ASP A OD1   1 
ATOM   3118  O  OD2   . ASP A  1  403 ? 71.703  105.930 52.042  1.00 91.65  ? 403  ASP A OD2   1 
ATOM   3119  N  N     . ALA A  1  404 ? 70.353  103.895 54.487  1.00 87.82  ? 404  ALA A N     1 
ATOM   3120  C  CA    . ALA A  1  404 ? 69.190  104.537 55.096  1.00 87.60  ? 404  ALA A CA    1 
ATOM   3121  C  C     . ALA A  1  404 ? 68.383  105.289 54.051  1.00 87.48  ? 404  ALA A C     1 
ATOM   3122  O  O     . ALA A  1  404 ? 67.303  104.858 53.661  1.00 87.64  ? 404  ALA A O     1 
ATOM   3123  C  CB    . ALA A  1  404 ? 69.634  105.494 56.173  1.00 88.61  ? 404  ALA A CB    1 
ATOM   3124  N  N     . ARG A  1  405 ? 68.920  106.414 53.601  1.00 87.56  ? 405  ARG A N     1 
ATOM   3125  C  CA    . ARG A  1  405 ? 68.268  107.238 52.592  1.00 88.71  ? 405  ARG A CA    1 
ATOM   3126  C  C     . ARG A  1  405 ? 67.520  106.379 51.574  1.00 87.72  ? 405  ARG A C     1 
ATOM   3127  O  O     . ARG A  1  405 ? 66.408  106.710 51.177  1.00 88.20  ? 405  ARG A O     1 
ATOM   3128  C  CB    . ARG A  1  405 ? 69.320  108.096 51.879  1.00 91.58  ? 405  ARG A CB    1 
ATOM   3129  C  CG    . ARG A  1  405 ? 68.811  109.394 51.263  1.00 95.51  ? 405  ARG A CG    1 
ATOM   3130  C  CD    . ARG A  1  405 ? 68.177  109.195 49.899  1.00 100.44 ? 405  ARG A CD    1 
ATOM   3131  N  NE    . ARG A  1  405 ? 67.662  110.452 49.345  1.00 106.20 ? 405  ARG A NE    1 
ATOM   3132  C  CZ    . ARG A  1  405 ? 66.663  111.167 49.875  1.00 108.99 ? 405  ARG A CZ    1 
ATOM   3133  N  NH1   . ARG A  1  405 ? 66.048  110.760 50.986  1.00 110.30 ? 405  ARG A NH1   1 
ATOM   3134  N  NH2   . ARG A  1  405 ? 66.272  112.296 49.289  1.00 109.71 ? 405  ARG A NH2   1 
ATOM   3135  N  N     . MET A  1  406 ? 68.123  105.268 51.171  1.00 86.60  ? 406  MET A N     1 
ATOM   3136  C  CA    . MET A  1  406 ? 67.502  104.390 50.192  1.00 86.26  ? 406  MET A CA    1 
ATOM   3137  C  C     . MET A  1  406 ? 66.298  103.644 50.739  1.00 85.09  ? 406  MET A C     1 
ATOM   3138  O  O     . MET A  1  406 ? 65.238  103.624 50.115  1.00 85.26  ? 406  MET A O     1 
ATOM   3139  C  CB    . MET A  1  406 ? 68.522  103.391 49.660  1.00 87.79  ? 406  MET A CB    1 
ATOM   3140  C  CG    . MET A  1  406 ? 68.008  102.630 48.459  1.00 91.99  ? 406  MET A CG    1 
ATOM   3141  S  SD    . MET A  1  406 ? 69.309  102.061 47.355  1.00 94.67  ? 406  MET A SD    1 
ATOM   3142  C  CE    . MET A  1  406 ? 69.369  100.292 47.810  1.00 95.75  ? 406  MET A CE    1 
ATOM   3143  N  N     . VAL A  1  407 ? 66.465  103.029 51.904  1.00 83.87  ? 407  VAL A N     1 
ATOM   3144  C  CA    . VAL A  1  407 ? 65.382  102.281 52.545  1.00 82.14  ? 407  VAL A CA    1 
ATOM   3145  C  C     . VAL A  1  407 ? 64.160  103.164 52.738  1.00 80.34  ? 407  VAL A C     1 
ATOM   3146  O  O     . VAL A  1  407 ? 63.030  102.742 52.504  1.00 80.02  ? 407  VAL A O     1 
ATOM   3147  C  CB    . VAL A  1  407 ? 65.808  101.744 53.928  1.00 82.25  ? 407  VAL A CB    1 
ATOM   3148  C  CG1   . VAL A  1  407 ? 64.639  101.032 54.591  1.00 81.74  ? 407  VAL A CG1   1 
ATOM   3149  C  CG2   . VAL A  1  407 ? 66.993  100.806 53.777  1.00 82.03  ? 407  VAL A CG2   1 
ATOM   3150  N  N     . ARG A  1  408 ? 64.395  104.393 53.175  1.00 78.65  ? 408  ARG A N     1 
ATOM   3151  C  CA    . ARG A  1  408 ? 63.310  105.321 53.383  1.00 77.81  ? 408  ARG A CA    1 
ATOM   3152  C  C     . ARG A  1  408 ? 62.555  105.584 52.091  1.00 77.80  ? 408  ARG A C     1 
ATOM   3153  O  O     . ARG A  1  408 ? 61.331  105.520 52.064  1.00 79.15  ? 408  ARG A O     1 
ATOM   3154  C  CB    . ARG A  1  408 ? 63.833  106.630 53.948  1.00 76.94  ? 408  ARG A CB    1 
ATOM   3155  C  CG    . ARG A  1  408 ? 64.202  106.552 55.413  1.00 79.56  ? 408  ARG A CG    1 
ATOM   3156  C  CD    . ARG A  1  408 ? 64.214  107.945 56.019  1.00 83.50  ? 408  ARG A CD    1 
ATOM   3157  N  NE    . ARG A  1  408 ? 65.197  108.801 55.362  1.00 86.81  ? 408  ARG A NE    1 
ATOM   3158  C  CZ    . ARG A  1  408 ? 66.494  108.793 55.650  1.00 88.29  ? 408  ARG A CZ    1 
ATOM   3159  N  NH1   . ARG A  1  408 ? 66.951  107.974 56.596  1.00 88.97  ? 408  ARG A NH1   1 
ATOM   3160  N  NH2   . ARG A  1  408 ? 67.331  109.582 54.979  1.00 87.83  ? 408  ARG A NH2   1 
ATOM   3161  N  N     . ASP A  1  409 ? 63.269  105.865 51.011  1.00 77.23  ? 409  ASP A N     1 
ATOM   3162  C  CA    . ASP A  1  409 ? 62.597  106.137 49.750  1.00 76.83  ? 409  ASP A CA    1 
ATOM   3163  C  C     . ASP A  1  409 ? 61.755  104.965 49.266  1.00 75.63  ? 409  ASP A C     1 
ATOM   3164  O  O     . ASP A  1  409 ? 60.632  105.156 48.812  1.00 76.03  ? 409  ASP A O     1 
ATOM   3165  C  CB    . ASP A  1  409 ? 63.601  106.519 48.663  1.00 79.00  ? 409  ASP A CB    1 
ATOM   3166  C  CG    . ASP A  1  409 ? 64.315  107.837 48.948  1.00 81.35  ? 409  ASP A CG    1 
ATOM   3167  O  OD1   . ASP A  1  409 ? 63.738  108.723 49.628  1.00 81.08  ? 409  ASP A OD1   1 
ATOM   3168  O  OD2   . ASP A  1  409 ? 65.460  107.989 48.463  1.00 83.66  ? 409  ASP A OD2   1 
ATOM   3169  N  N     . VAL A  1  410 ? 62.298  103.756 49.357  1.00 73.85  ? 410  VAL A N     1 
ATOM   3170  C  CA    . VAL A  1  410 ? 61.575  102.569 48.916  1.00 72.71  ? 410  VAL A CA    1 
ATOM   3171  C  C     . VAL A  1  410 ? 60.323  102.309 49.749  1.00 72.41  ? 410  VAL A C     1 
ATOM   3172  O  O     . VAL A  1  410 ? 59.226  102.160 49.210  1.00 72.67  ? 410  VAL A O     1 
ATOM   3173  C  CB    . VAL A  1  410 ? 62.476  101.326 48.973  1.00 72.42  ? 410  VAL A CB    1 
ATOM   3174  C  CG1   . VAL A  1  410 ? 61.681  100.069 48.656  1.00 71.41  ? 410  VAL A CG1   1 
ATOM   3175  C  CG2   . VAL A  1  410 ? 63.604  101.488 47.990  1.00 72.46  ? 410  VAL A CG2   1 
ATOM   3176  N  N     . CYS A  1  411 ? 60.489  102.250 51.064  1.00 71.40  ? 411  CYS A N     1 
ATOM   3177  C  CA    . CYS A  1  411 ? 59.364  102.012 51.957  1.00 70.37  ? 411  CYS A CA    1 
ATOM   3178  C  C     . CYS A  1  411 ? 58.248  103.041 51.769  1.00 69.68  ? 411  CYS A C     1 
ATOM   3179  O  O     . CYS A  1  411 ? 57.074  102.688 51.716  1.00 69.72  ? 411  CYS A O     1 
ATOM   3180  C  CB    . CYS A  1  411 ? 59.855  102.018 53.399  1.00 70.30  ? 411  CYS A CB    1 
ATOM   3181  S  SG    . CYS A  1  411 ? 60.993  100.673 53.740  1.00 71.00  ? 411  CYS A SG    1 
ATOM   3182  N  N     . SER A  1  412 ? 58.616  104.311 51.673  1.00 68.62  ? 412  SER A N     1 
ATOM   3183  C  CA    . SER A  1  412 ? 57.636  105.364 51.467  1.00 69.23  ? 412  SER A CA    1 
ATOM   3184  C  C     . SER A  1  412 ? 56.850  105.043 50.205  1.00 69.94  ? 412  SER A C     1 
ATOM   3185  O  O     . SER A  1  412 ? 55.622  105.123 50.178  1.00 72.09  ? 412  SER A O     1 
ATOM   3186  C  CB    . SER A  1  412 ? 58.322  106.720 51.274  1.00 68.81  ? 412  SER A CB    1 
ATOM   3187  O  OG    . SER A  1  412 ? 59.076  107.096 52.407  1.00 70.52  ? 412  SER A OG    1 
ATOM   3188  N  N     . LYS A  1  413 ? 57.578  104.689 49.153  1.00 69.81  ? 413  LYS A N     1 
ATOM   3189  C  CA    . LYS A  1  413 ? 56.980  104.372 47.868  1.00 68.69  ? 413  LYS A CA    1 
ATOM   3190  C  C     . LYS A  1  413 ? 56.008  103.204 47.929  1.00 68.19  ? 413  LYS A C     1 
ATOM   3191  O  O     . LYS A  1  413 ? 55.001  103.205 47.221  1.00 69.49  ? 413  LYS A O     1 
ATOM   3192  C  CB    . LYS A  1  413 ? 58.070  104.078 46.845  1.00 68.57  ? 413  LYS A CB    1 
ATOM   3193  C  CG    . LYS A  1  413 ? 57.559  103.544 45.516  1.00 70.36  ? 413  LYS A CG    1 
ATOM   3194  C  CD    . LYS A  1  413 ? 58.723  103.241 44.581  1.00 74.68  ? 413  LYS A CD    1 
ATOM   3195  C  CE    . LYS A  1  413 ? 58.359  102.320 43.413  1.00 74.88  ? 413  LYS A CE    1 
ATOM   3196  N  NZ    . LYS A  1  413 ? 59.593  101.830 42.703  1.00 75.13  ? 413  LYS A NZ    1 
ATOM   3197  N  N     . TYR A  1  414 ? 56.285  102.218 48.776  1.00 66.62  ? 414  TYR A N     1 
ATOM   3198  C  CA    . TYR A  1  414 ? 55.400  101.059 48.864  1.00 66.28  ? 414  TYR A CA    1 
ATOM   3199  C  C     . TYR A  1  414 ? 54.433  101.007 50.040  1.00 65.06  ? 414  TYR A C     1 
ATOM   3200  O  O     . TYR A  1  414 ? 53.440  100.273 49.981  1.00 63.96  ? 414  TYR A O     1 
ATOM   3201  C  CB    . TYR A  1  414 ? 56.211  99.746  48.857  1.00 67.06  ? 414  TYR A CB    1 
ATOM   3202  C  CG    . TYR A  1  414 ? 56.792  99.379  47.515  1.00 67.85  ? 414  TYR A CG    1 
ATOM   3203  C  CD1   . TYR A  1  414 ? 57.979  99.957  47.069  1.00 69.18  ? 414  TYR A CD1   1 
ATOM   3204  C  CD2   . TYR A  1  414 ? 56.113  98.520  46.654  1.00 68.25  ? 414  TYR A CD2   1 
ATOM   3205  C  CE1   . TYR A  1  414 ? 58.473  99.700  45.798  1.00 69.65  ? 414  TYR A CE1   1 
ATOM   3206  C  CE2   . TYR A  1  414 ? 56.595  98.254  45.376  1.00 69.79  ? 414  TYR A CE2   1 
ATOM   3207  C  CZ    . TYR A  1  414 ? 57.774  98.851  44.953  1.00 70.86  ? 414  TYR A CZ    1 
ATOM   3208  O  OH    . TYR A  1  414 ? 58.241  98.621  43.677  1.00 72.48  ? 414  TYR A OH    1 
ATOM   3209  N  N     . ILE A  1  415 ? 54.707  101.773 51.092  1.00 64.17  ? 415  ILE A N     1 
ATOM   3210  C  CA    . ILE A  1  415 ? 53.862  101.740 52.287  1.00 64.38  ? 415  ILE A CA    1 
ATOM   3211  C  C     . ILE A  1  415 ? 53.081  103.001 52.632  1.00 64.92  ? 415  ILE A C     1 
ATOM   3212  O  O     . ILE A  1  415 ? 51.887  102.948 52.960  1.00 64.91  ? 415  ILE A O     1 
ATOM   3213  C  CB    . ILE A  1  415 ? 54.686  101.417 53.542  1.00 64.20  ? 415  ILE A CB    1 
ATOM   3214  C  CG1   . ILE A  1  415 ? 55.579  100.205 53.289  1.00 64.06  ? 415  ILE A CG1   1 
ATOM   3215  C  CG2   . ILE A  1  415 ? 53.749  101.191 54.722  1.00 63.71  ? 415  ILE A CG2   1 
ATOM   3216  C  CD1   . ILE A  1  415 ? 56.441  99.824  54.473  1.00 63.42  ? 415  ILE A CD1   1 
ATOM   3217  N  N     . TYR A  1  416 ? 53.762  104.137 52.572  1.00 64.90  ? 416  TYR A N     1 
ATOM   3218  C  CA    . TYR A  1  416 ? 53.144  105.390 52.950  1.00 63.88  ? 416  TYR A CA    1 
ATOM   3219  C  C     . TYR A  1  416 ? 51.806  105.725 52.320  1.00 63.87  ? 416  TYR A C     1 
ATOM   3220  O  O     . TYR A  1  416 ? 51.659  105.774 51.098  1.00 66.07  ? 416  TYR A O     1 
ATOM   3221  C  CB    . TYR A  1  416 ? 54.103  106.549 52.735  1.00 61.73  ? 416  TYR A CB    1 
ATOM   3222  C  CG    . TYR A  1  416 ? 53.765  107.683 53.659  1.00 62.38  ? 416  TYR A CG    1 
ATOM   3223  C  CD1   . TYR A  1  416 ? 54.086  107.619 55.018  1.00 62.07  ? 416  TYR A CD1   1 
ATOM   3224  C  CD2   . TYR A  1  416 ? 53.054  108.789 53.200  1.00 62.69  ? 416  TYR A CD2   1 
ATOM   3225  C  CE1   . TYR A  1  416 ? 53.704  108.622 55.897  1.00 61.05  ? 416  TYR A CE1   1 
ATOM   3226  C  CE2   . TYR A  1  416 ? 52.668  109.801 54.069  1.00 62.35  ? 416  TYR A CE2   1 
ATOM   3227  C  CZ    . TYR A  1  416 ? 52.996  109.708 55.417  1.00 62.72  ? 416  TYR A CZ    1 
ATOM   3228  O  OH    . TYR A  1  416 ? 52.597  110.704 56.285  1.00 67.05  ? 416  TYR A OH    1 
ATOM   3229  N  N     . ASP A  1  417 ? 50.838  105.968 53.190  1.00 61.94  ? 417  ASP A N     1 
ATOM   3230  C  CA    . ASP A  1  417 ? 49.492  106.326 52.800  1.00 62.47  ? 417  ASP A CA    1 
ATOM   3231  C  C     . ASP A  1  417 ? 48.774  105.323 51.891  1.00 61.80  ? 417  ASP A C     1 
ATOM   3232  O  O     . ASP A  1  417 ? 47.828  105.684 51.192  1.00 63.25  ? 417  ASP A O     1 
ATOM   3233  C  CB    . ASP A  1  417 ? 49.481  107.706 52.148  1.00 62.18  ? 417  ASP A CB    1 
ATOM   3234  C  CG    . ASP A  1  417 ? 48.079  108.299 52.072  1.00 63.75  ? 417  ASP A CG    1 
ATOM   3235  O  OD1   . ASP A  1  417 ? 47.879  109.266 51.316  1.00 65.83  ? 417  ASP A OD1   1 
ATOM   3236  O  OD2   . ASP A  1  417 ? 47.169  107.808 52.772  1.00 63.57  ? 417  ASP A OD2   1 
ATOM   3237  N  N     . LYS A  1  418 ? 49.200  104.068 51.902  1.00 60.16  ? 418  LYS A N     1 
ATOM   3238  C  CA    . LYS A  1  418 ? 48.537  103.065 51.076  1.00 59.91  ? 418  LYS A CA    1 
ATOM   3239  C  C     . LYS A  1  418 ? 47.338  102.505 51.813  1.00 58.45  ? 418  LYS A C     1 
ATOM   3240  O  O     . LYS A  1  418 ? 47.253  102.617 53.017  1.00 58.40  ? 418  LYS A O     1 
ATOM   3241  C  CB    . LYS A  1  418 ? 49.490  101.915 50.774  1.00 60.78  ? 418  LYS A CB    1 
ATOM   3242  C  CG    . LYS A  1  418 ? 50.643  102.295 49.877  1.00 62.76  ? 418  LYS A CG    1 
ATOM   3243  C  CD    . LYS A  1  418 ? 50.169  102.572 48.475  1.00 63.78  ? 418  LYS A CD    1 
ATOM   3244  C  CE    . LYS A  1  418 ? 51.325  102.892 47.566  1.00 65.04  ? 418  LYS A CE    1 
ATOM   3245  N  NZ    . LYS A  1  418 ? 50.828  102.970 46.171  1.00 67.63  ? 418  LYS A NZ    1 
ATOM   3246  N  N     . CYS A  1  419 ? 46.408  101.898 51.091  1.00 57.70  ? 419  CYS A N     1 
ATOM   3247  C  CA    . CYS A  1  419 ? 45.254  101.284 51.731  1.00 55.71  ? 419  CYS A CA    1 
ATOM   3248  C  C     . CYS A  1  419 ? 45.649  99.816  51.790  1.00 54.47  ? 419  CYS A C     1 
ATOM   3249  O  O     . CYS A  1  419 ? 45.691  99.138  50.770  1.00 55.74  ? 419  CYS A O     1 
ATOM   3250  C  CB    . CYS A  1  419 ? 44.001  101.442 50.872  1.00 55.67  ? 419  CYS A CB    1 
ATOM   3251  S  SG    . CYS A  1  419 ? 43.825  103.067 50.129  1.00 59.98  ? 419  CYS A SG    1 
ATOM   3252  N  N     . PRO A  1  420 ? 45.965  99.307  52.981  1.00 52.67  ? 420  PRO A N     1 
ATOM   3253  C  CA    . PRO A  1  420 ? 46.363  97.904  53.122  1.00 51.72  ? 420  PRO A CA    1 
ATOM   3254  C  C     . PRO A  1  420 ? 45.244  96.857  53.104  1.00 51.07  ? 420  PRO A C     1 
ATOM   3255  O  O     . PRO A  1  420 ? 44.057  97.174  53.094  1.00 51.46  ? 420  PRO A O     1 
ATOM   3256  C  CB    . PRO A  1  420 ? 47.120  97.904  54.439  1.00 51.04  ? 420  PRO A CB    1 
ATOM   3257  C  CG    . PRO A  1  420 ? 46.360  98.898  55.228  1.00 51.20  ? 420  PRO A CG    1 
ATOM   3258  C  CD    . PRO A  1  420 ? 46.135  100.029 54.251  1.00 51.73  ? 420  PRO A CD    1 
ATOM   3259  N  N     . ALA A  1  421 ? 45.649  95.599  53.076  1.00 49.45  ? 421  ALA A N     1 
ATOM   3260  C  CA    . ALA A  1  421 ? 44.713  94.504  53.084  1.00 49.30  ? 421  ALA A CA    1 
ATOM   3261  C  C     . ALA A  1  421 ? 44.913  93.884  54.456  1.00 51.70  ? 421  ALA A C     1 
ATOM   3262  O  O     . ALA A  1  421 ? 46.048  93.614  54.879  1.00 53.22  ? 421  ALA A O     1 
ATOM   3263  C  CB    . ALA A  1  421 ? 45.037  93.525  52.004  1.00 48.02  ? 421  ALA A CB    1 
ATOM   3264  N  N     . LEU A  1  422 ? 43.799  93.661  55.147  1.00 51.91  ? 422  LEU A N     1 
ATOM   3265  C  CA    . LEU A  1  422 ? 43.819  93.141  56.493  1.00 50.75  ? 422  LEU A CA    1 
ATOM   3266  C  C     . LEU A  1  422 ? 43.049  91.850  56.678  1.00 50.50  ? 422  LEU A C     1 
ATOM   3267  O  O     . LEU A  1  422 ? 41.908  91.730  56.233  1.00 52.75  ? 422  LEU A O     1 
ATOM   3268  C  CB    . LEU A  1  422 ? 43.241  94.202  57.420  1.00 51.38  ? 422  LEU A CB    1 
ATOM   3269  C  CG    . LEU A  1  422 ? 43.022  93.698  58.840  1.00 53.10  ? 422  LEU A CG    1 
ATOM   3270  C  CD1   . LEU A  1  422 ? 44.368  93.516  59.496  1.00 54.97  ? 422  LEU A CD1   1 
ATOM   3271  C  CD2   . LEU A  1  422 ? 42.178  94.678  59.629  1.00 55.10  ? 422  LEU A CD2   1 
ATOM   3272  N  N     . ALA A  1  423 ? 43.664  90.879  57.342  1.00 48.85  ? 423  ALA A N     1 
ATOM   3273  C  CA    . ALA A  1  423 ? 42.981  89.621  57.605  1.00 48.22  ? 423  ALA A CA    1 
ATOM   3274  C  C     . ALA A  1  423 ? 43.061  89.350  59.096  1.00 49.23  ? 423  ALA A C     1 
ATOM   3275  O  O     . ALA A  1  423 ? 44.150  89.383  59.686  1.00 49.08  ? 423  ALA A O     1 
ATOM   3276  C  CB    . ALA A  1  423 ? 43.623  88.515  56.848  1.00 48.81  ? 423  ALA A CB    1 
ATOM   3277  N  N     . ALA A  1  424 ? 41.909  89.106  59.717  1.00 48.60  ? 424  ALA A N     1 
ATOM   3278  C  CA    . ALA A  1  424 ? 41.888  88.858  61.145  1.00 48.30  ? 424  ALA A CA    1 
ATOM   3279  C  C     . ALA A  1  424 ? 41.033  87.670  61.497  1.00 49.29  ? 424  ALA A C     1 
ATOM   3280  O  O     . ALA A  1  424 ? 39.887  87.548  61.053  1.00 49.39  ? 424  ALA A O     1 
ATOM   3281  C  CB    . ALA A  1  424 ? 41.394  90.076  61.879  1.00 47.37  ? 424  ALA A CB    1 
ATOM   3282  N  N     . VAL A  1  425 ? 41.606  86.796  62.314  1.00 49.75  ? 425  VAL A N     1 
ATOM   3283  C  CA    . VAL A  1  425 ? 40.923  85.600  62.751  1.00 50.45  ? 425  VAL A CA    1 
ATOM   3284  C  C     . VAL A  1  425 ? 41.091  85.404  64.258  1.00 51.83  ? 425  VAL A C     1 
ATOM   3285  O  O     . VAL A  1  425 ? 42.180  85.638  64.815  1.00 50.16  ? 425  VAL A O     1 
ATOM   3286  C  CB    . VAL A  1  425 ? 41.481  84.363  62.025  1.00 51.06  ? 425  VAL A CB    1 
ATOM   3287  C  CG1   . VAL A  1  425 ? 40.640  83.134  62.363  1.00 50.36  ? 425  VAL A CG1   1 
ATOM   3288  C  CG2   . VAL A  1  425 ? 41.525  84.616  60.523  1.00 50.52  ? 425  VAL A CG2   1 
ATOM   3289  N  N     . GLY A  1  426 ? 40.000  84.970  64.898  1.00 52.56  ? 426  GLY A N     1 
ATOM   3290  C  CA    . GLY A  1  426 ? 40.010  84.705  66.324  1.00 52.94  ? 426  GLY A CA    1 
ATOM   3291  C  C     . GLY A  1  426 ? 39.174  85.692  67.083  1.00 53.73  ? 426  GLY A C     1 
ATOM   3292  O  O     . GLY A  1  426 ? 38.310  86.335  66.502  1.00 54.15  ? 426  GLY A O     1 
ATOM   3293  N  N     . PRO A  1  427 ? 39.413  85.834  68.394  1.00 55.46  ? 427  PRO A N     1 
ATOM   3294  C  CA    . PRO A  1  427 ? 38.729  86.735  69.334  1.00 56.68  ? 427  PRO A CA    1 
ATOM   3295  C  C     . PRO A  1  427 ? 39.236  88.151  69.090  1.00 58.08  ? 427  PRO A C     1 
ATOM   3296  O  O     . PRO A  1  427 ? 39.848  88.764  69.962  1.00 60.45  ? 427  PRO A O     1 
ATOM   3297  C  CB    . PRO A  1  427 ? 39.188  86.207  70.672  1.00 56.49  ? 427  PRO A CB    1 
ATOM   3298  C  CG    . PRO A  1  427 ? 40.617  85.871  70.368  1.00 56.61  ? 427  PRO A CG    1 
ATOM   3299  C  CD    . PRO A  1  427 ? 40.492  85.106  69.078  1.00 55.31  ? 427  PRO A CD    1 
ATOM   3300  N  N     . ILE A  1  428 ? 38.958  88.660  67.897  1.00 57.76  ? 428  ILE A N     1 
ATOM   3301  C  CA    . ILE A  1  428 ? 39.435  89.962  67.456  1.00 56.84  ? 428  ILE A CA    1 
ATOM   3302  C  C     . ILE A  1  428 ? 38.661  91.248  67.790  1.00 58.12  ? 428  ILE A C     1 
ATOM   3303  O  O     . ILE A  1  428 ? 38.913  92.302  67.187  1.00 57.29  ? 428  ILE A O     1 
ATOM   3304  C  CB    . ILE A  1  428 ? 39.634  89.886  65.954  1.00 55.37  ? 428  ILE A CB    1 
ATOM   3305  C  CG1   . ILE A  1  428 ? 38.343  89.388  65.292  1.00 53.42  ? 428  ILE A CG1   1 
ATOM   3306  C  CG2   . ILE A  1  428 ? 40.755  88.915  65.652  1.00 56.46  ? 428  ILE A CG2   1 
ATOM   3307  C  CD1   . ILE A  1  428 ? 38.412  89.298  63.799  1.00 49.83  ? 428  ILE A CD1   1 
ATOM   3308  N  N     . GLU A  1  429 ? 37.749  91.192  68.754  1.00 58.73  ? 429  GLU A N     1 
ATOM   3309  C  CA    . GLU A  1  429 ? 36.973  92.376  69.083  1.00 59.50  ? 429  GLU A CA    1 
ATOM   3310  C  C     . GLU A  1  429 ? 37.753  93.626  69.383  1.00 58.76  ? 429  GLU A C     1 
ATOM   3311  O  O     . GLU A  1  429 ? 37.287  94.706  69.061  1.00 59.18  ? 429  GLU A O     1 
ATOM   3312  C  CB    . GLU A  1  429 ? 36.065  92.113  70.263  1.00 63.78  ? 429  GLU A CB    1 
ATOM   3313  C  CG    . GLU A  1  429 ? 35.230  93.314  70.668  1.00 69.46  ? 429  GLU A CG    1 
ATOM   3314  C  CD    . GLU A  1  429 ? 34.185  92.953  71.722  1.00 74.32  ? 429  GLU A CD    1 
ATOM   3315  O  OE1   . GLU A  1  429 ? 34.546  92.913  72.924  1.00 75.94  ? 429  GLU A OE1   1 
ATOM   3316  O  OE2   . GLU A  1  429 ? 33.006  92.694  71.342  1.00 77.64  ? 429  GLU A OE2   1 
ATOM   3317  N  N     . GLN A  1  430 ? 38.923  93.495  70.009  1.00 59.49  ? 430  GLN A N     1 
ATOM   3318  C  CA    . GLN A  1  430 ? 39.724  94.672  70.370  1.00 58.63  ? 430  GLN A CA    1 
ATOM   3319  C  C     . GLN A  1  430 ? 40.464  95.338  69.214  1.00 57.04  ? 430  GLN A C     1 
ATOM   3320  O  O     . GLN A  1  430 ? 40.929  96.465  69.350  1.00 56.62  ? 430  GLN A O     1 
ATOM   3321  C  CB    . GLN A  1  430 ? 40.732  94.352  71.489  1.00 59.72  ? 430  GLN A CB    1 
ATOM   3322  C  CG    . GLN A  1  430 ? 41.199  95.630  72.238  1.00 63.59  ? 430  GLN A CG    1 
ATOM   3323  C  CD    . GLN A  1  430 ? 42.477  95.476  73.092  1.00 63.55  ? 430  GLN A CD    1 
ATOM   3324  O  OE1   . GLN A  1  430 ? 43.602  95.374  72.570  1.00 63.45  ? 430  GLN A OE1   1 
ATOM   3325  N  NE2   . GLN A  1  430 ? 42.299  95.484  74.412  1.00 63.61  ? 430  GLN A NE2   1 
ATOM   3326  N  N     . LEU A  1  431 ? 40.612  94.639  68.097  1.00 56.09  ? 431  LEU A N     1 
ATOM   3327  C  CA    . LEU A  1  431 ? 41.278  95.230  66.935  1.00 57.43  ? 431  LEU A CA    1 
ATOM   3328  C  C     . LEU A  1  431 ? 40.146  95.833  66.160  1.00 58.35  ? 431  LEU A C     1 
ATOM   3329  O  O     . LEU A  1  431 ? 39.228  95.096  65.795  1.00 61.61  ? 431  LEU A O     1 
ATOM   3330  C  CB    . LEU A  1  431 ? 41.921  94.160  66.030  1.00 55.11  ? 431  LEU A CB    1 
ATOM   3331  C  CG    . LEU A  1  431 ? 42.143  94.625  64.574  1.00 52.43  ? 431  LEU A CG    1 
ATOM   3332  C  CD1   . LEU A  1  431 ? 43.337  95.527  64.543  1.00 51.37  ? 431  LEU A CD1   1 
ATOM   3333  C  CD2   . LEU A  1  431 ? 42.352  93.471  63.624  1.00 50.34  ? 431  LEU A CD2   1 
ATOM   3334  N  N     . LEU A  1  432 ? 40.143  97.127  65.882  1.00 57.43  ? 432  LEU A N     1 
ATOM   3335  C  CA    . LEU A  1  432 ? 38.988  97.533  65.108  1.00 59.31  ? 432  LEU A CA    1 
ATOM   3336  C  C     . LEU A  1  432 ? 39.161  98.638  64.102  1.00 57.99  ? 432  LEU A C     1 
ATOM   3337  O  O     . LEU A  1  432 ? 40.210  99.222  63.985  1.00 58.16  ? 432  LEU A O     1 
ATOM   3338  C  CB    . LEU A  1  432 ? 37.749  97.806  66.026  1.00 61.02  ? 432  LEU A CB    1 
ATOM   3339  C  CG    . LEU A  1  432 ? 36.341  97.241  65.597  1.00 58.62  ? 432  LEU A CG    1 
ATOM   3340  C  CD1   . LEU A  1  432 ? 35.971  95.931  66.303  1.00 54.36  ? 432  LEU A CD1   1 
ATOM   3341  C  CD2   . LEU A  1  432 ? 35.286  98.263  65.924  1.00 58.24  ? 432  LEU A CD2   1 
ATOM   3342  N  N     . ASP A  1  433 ? 38.087  98.846  63.351  1.00 57.88  ? 433  ASP A N     1 
ATOM   3343  C  CA    . ASP A  1  433 ? 37.957  99.823  62.300  1.00 56.58  ? 433  ASP A CA    1 
ATOM   3344  C  C     . ASP A  1  433 ? 39.071  99.935  61.255  1.00 54.72  ? 433  ASP A C     1 
ATOM   3345  O  O     . ASP A  1  433 ? 40.190  100.344 61.555  1.00 53.02  ? 433  ASP A O     1 
ATOM   3346  C  CB    . ASP A  1  433 ? 37.699  101.173 62.906  1.00 59.75  ? 433  ASP A CB    1 
ATOM   3347  C  CG    . ASP A  1  433 ? 37.334  102.181 61.867  1.00 65.53  ? 433  ASP A CG    1 
ATOM   3348  O  OD1   . ASP A  1  433 ? 37.241  103.381 62.196  1.00 73.33  ? 433  ASP A OD1   1 
ATOM   3349  O  OD2   . ASP A  1  433 ? 37.132  101.777 60.706  1.00 66.56  ? 433  ASP A OD2   1 
ATOM   3350  N  N     . TYR A  1  434 ? 38.733  99.579  60.016  1.00 53.09  ? 434  TYR A N     1 
ATOM   3351  C  CA    . TYR A  1  434 ? 39.656  99.661  58.898  1.00 50.41  ? 434  TYR A CA    1 
ATOM   3352  C  C     . TYR A  1  434 ? 40.121  101.093 58.831  1.00 50.77  ? 434  TYR A C     1 
ATOM   3353  O  O     . TYR A  1  434 ? 41.278  101.364 58.546  1.00 51.11  ? 434  TYR A O     1 
ATOM   3354  C  CB    . TYR A  1  434 ? 38.956  99.327  57.591  1.00 49.68  ? 434  TYR A CB    1 
ATOM   3355  C  CG    . TYR A  1  434 ? 39.898  99.331  56.422  1.00 49.34  ? 434  TYR A CG    1 
ATOM   3356  C  CD1   . TYR A  1  434 ? 40.726  98.232  56.174  1.00 48.91  ? 434  TYR A CD1   1 
ATOM   3357  C  CD2   . TYR A  1  434 ? 40.051  100.469 55.627  1.00 48.35  ? 434  TYR A CD2   1 
ATOM   3358  C  CE1   . TYR A  1  434 ? 41.698  98.267  55.175  1.00 48.34  ? 434  TYR A CE1   1 
ATOM   3359  C  CE2   . TYR A  1  434 ? 41.021  100.516 54.624  1.00 49.09  ? 434  TYR A CE2   1 
ATOM   3360  C  CZ    . TYR A  1  434 ? 41.843  99.410  54.412  1.00 49.42  ? 434  TYR A CZ    1 
ATOM   3361  O  OH    . TYR A  1  434 ? 42.842  99.459  53.475  1.00 52.04  ? 434  TYR A OH    1 
ATOM   3362  N  N     . ASN A  1  435 ? 39.197  102.010 59.096  1.00 51.57  ? 435  ASN A N     1 
ATOM   3363  C  CA    . ASN A  1  435 ? 39.489  103.442 59.089  1.00 52.94  ? 435  ASN A CA    1 
ATOM   3364  C  C     . ASN A  1  435 ? 40.625  103.844 60.003  1.00 53.28  ? 435  ASN A C     1 
ATOM   3365  O  O     . ASN A  1  435 ? 41.498  104.612 59.618  1.00 53.53  ? 435  ASN A O     1 
ATOM   3366  C  CB    . ASN A  1  435 ? 38.255  104.241 59.477  1.00 51.82  ? 435  ASN A CB    1 
ATOM   3367  C  CG    . ASN A  1  435 ? 37.406  104.553 58.301  1.00 52.77  ? 435  ASN A CG    1 
ATOM   3368  O  OD1   . ASN A  1  435 ? 37.909  105.038 57.280  1.00 51.02  ? 435  ASN A OD1   1 
ATOM   3369  N  ND2   . ASN A  1  435 ? 36.110  104.279 58.413  1.00 53.44  ? 435  ASN A ND2   1 
ATOM   3370  N  N     . ARG A  1  436 ? 40.597  103.333 61.223  1.00 54.56  ? 436  ARG A N     1 
ATOM   3371  C  CA    . ARG A  1  436 ? 41.630  103.631 62.192  1.00 56.71  ? 436  ARG A CA    1 
ATOM   3372  C  C     . ARG A  1  436 ? 42.974  103.053 61.753  1.00 58.41  ? 436  ARG A C     1 
ATOM   3373  O  O     . ARG A  1  436 ? 44.033  103.681 61.950  1.00 59.18  ? 436  ARG A O     1 
ATOM   3374  C  CB    . ARG A  1  436 ? 41.224  103.078 63.551  1.00 55.63  ? 436  ARG A CB    1 
ATOM   3375  C  CG    . ARG A  1  436 ? 40.045  103.827 64.132  1.00 56.12  ? 436  ARG A CG    1 
ATOM   3376  C  CD    . ARG A  1  436 ? 40.387  105.294 64.350  1.00 55.40  ? 436  ARG A CD    1 
ATOM   3377  N  NE    . ARG A  1  436 ? 41.143  105.481 65.582  1.00 56.93  ? 436  ARG A NE    1 
ATOM   3378  C  CZ    . ARG A  1  436 ? 40.602  105.486 66.797  1.00 58.50  ? 436  ARG A CZ    1 
ATOM   3379  N  NH1   . ARG A  1  436 ? 39.290  105.321 66.947  1.00 60.02  ? 436  ARG A NH1   1 
ATOM   3380  N  NH2   . ARG A  1  436 ? 41.369  105.642 67.865  1.00 57.99  ? 436  ARG A NH2   1 
ATOM   3381  N  N     . ILE A  1  437 ? 42.927  101.864 61.149  1.00 58.01  ? 437  ILE A N     1 
ATOM   3382  C  CA    . ILE A  1  437 ? 44.133  101.203 60.667  1.00 57.05  ? 437  ILE A CA    1 
ATOM   3383  C  C     . ILE A  1  437 ? 44.696  101.948 59.462  1.00 55.61  ? 437  ILE A C     1 
ATOM   3384  O  O     . ILE A  1  437 ? 45.903  102.120 59.335  1.00 54.49  ? 437  ILE A O     1 
ATOM   3385  C  CB    . ILE A  1  437 ? 43.838  99.750  60.280  1.00 56.89  ? 437  ILE A CB    1 
ATOM   3386  C  CG1   . ILE A  1  437 ? 43.261  99.018  61.489  1.00 55.57  ? 437  ILE A CG1   1 
ATOM   3387  C  CG2   . ILE A  1  437 ? 45.115  99.058  59.839  1.00 58.06  ? 437  ILE A CG2   1 
ATOM   3388  C  CD1   . ILE A  1  437 ? 42.950  97.570  61.230  1.00 55.91  ? 437  ILE A CD1   1 
ATOM   3389  N  N     . ARG A  1  438 ? 43.806  102.406 58.595  1.00 54.80  ? 438  ARG A N     1 
ATOM   3390  C  CA    . ARG A  1  438 ? 44.214  103.131 57.405  1.00 56.53  ? 438  ARG A CA    1 
ATOM   3391  C  C     . ARG A  1  438 ? 44.929  104.415 57.793  1.00 57.70  ? 438  ARG A C     1 
ATOM   3392  O  O     . ARG A  1  438 ? 45.880  104.853 57.137  1.00 58.07  ? 438  ARG A O     1 
ATOM   3393  C  CB    . ARG A  1  438 ? 42.989  103.460 56.562  1.00 55.86  ? 438  ARG A CB    1 
ATOM   3394  C  CG    . ARG A  1  438 ? 43.264  104.306 55.340  1.00 54.73  ? 438  ARG A CG    1 
ATOM   3395  C  CD    . ARG A  1  438 ? 43.928  103.508 54.257  1.00 55.30  ? 438  ARG A CD    1 
ATOM   3396  N  NE    . ARG A  1  438 ? 44.222  104.326 53.078  1.00 55.78  ? 438  ARG A NE    1 
ATOM   3397  C  CZ    . ARG A  1  438 ? 45.029  105.386 53.080  1.00 55.82  ? 438  ARG A CZ    1 
ATOM   3398  N  NH1   . ARG A  1  438 ? 45.635  105.776 54.206  1.00 52.83  ? 438  ARG A NH1   1 
ATOM   3399  N  NH2   . ARG A  1  438 ? 45.245  106.048 51.945  1.00 57.29  ? 438  ARG A NH2   1 
ATOM   3400  N  N     . SER A  1  439 ? 44.462  105.014 58.874  1.00 59.09  ? 439  SER A N     1 
ATOM   3401  C  CA    . SER A  1  439 ? 45.038  106.259 59.356  1.00 61.02  ? 439  SER A CA    1 
ATOM   3402  C  C     . SER A  1  439 ? 46.381  106.023 60.021  1.00 61.03  ? 439  SER A C     1 
ATOM   3403  O  O     . SER A  1  439 ? 47.129  106.964 60.276  1.00 60.76  ? 439  SER A O     1 
ATOM   3404  C  CB    . SER A  1  439 ? 44.076  106.913 60.333  1.00 61.98  ? 439  SER A CB    1 
ATOM   3405  O  OG    . SER A  1  439 ? 42.792  106.991 59.739  1.00 63.90  ? 439  SER A OG    1 
ATOM   3406  N  N     . GLY A  1  440 ? 46.677  104.762 60.304  1.00 60.50  ? 440  GLY A N     1 
ATOM   3407  C  CA    . GLY A  1  440 ? 47.946  104.444 60.916  1.00 61.33  ? 440  GLY A CA    1 
ATOM   3408  C  C     . GLY A  1  440 ? 48.975  104.278 59.819  1.00 61.64  ? 440  GLY A C     1 
ATOM   3409  O  O     . GLY A  1  440 ? 50.120  103.895 60.065  1.00 62.98  ? 440  GLY A O     1 
ATOM   3410  N  N     . MET A  1  441 ? 48.557  104.567 58.596  1.00 60.60  ? 441  MET A N     1 
ATOM   3411  C  CA    . MET A  1  441 ? 49.431  104.445 57.453  1.00 60.01  ? 441  MET A CA    1 
ATOM   3412  C  C     . MET A  1  441 ? 50.125  105.756 57.108  1.00 62.33  ? 441  MET A C     1 
ATOM   3413  O  O     . MET A  1  441 ? 50.732  105.875 56.049  1.00 62.14  ? 441  MET A O     1 
ATOM   3414  C  CB    . MET A  1  441 ? 48.636  103.961 56.256  1.00 57.91  ? 441  MET A CB    1 
ATOM   3415  C  CG    . MET A  1  441 ? 48.010  102.615 56.440  1.00 55.93  ? 441  MET A CG    1 
ATOM   3416  S  SD    . MET A  1  441 ? 49.217  101.327 56.680  1.00 57.33  ? 441  MET A SD    1 
ATOM   3417  C  CE    . MET A  1  441 ? 49.724  100.938 54.985  1.00 55.37  ? 441  MET A CE    1 
ATOM   3418  N  N     . TYR A  1  442 ? 50.024  106.756 57.975  1.00 65.60  ? 442  TYR A N     1 
ATOM   3419  C  CA    . TYR A  1  442 ? 50.704  108.010 57.697  1.00 70.26  ? 442  TYR A CA    1 
ATOM   3420  C  C     . TYR A  1  442 ? 50.985  108.818 58.940  1.00 73.39  ? 442  TYR A C     1 
ATOM   3421  O  O     . TYR A  1  442 ? 50.340  108.646 59.970  1.00 71.14  ? 442  TYR A O     1 
ATOM   3422  C  CB    . TYR A  1  442 ? 49.954  108.845 56.664  1.00 70.48  ? 442  TYR A CB    1 
ATOM   3423  C  CG    . TYR A  1  442 ? 48.575  109.226 57.065  1.00 73.49  ? 442  TYR A CG    1 
ATOM   3424  C  CD1   . TYR A  1  442 ? 48.327  110.420 57.731  1.00 74.86  ? 442  TYR A CD1   1 
ATOM   3425  C  CD2   . TYR A  1  442 ? 47.503  108.378 56.792  1.00 75.91  ? 442  TYR A CD2   1 
ATOM   3426  C  CE1   . TYR A  1  442 ? 47.029  110.770 58.119  1.00 77.23  ? 442  TYR A CE1   1 
ATOM   3427  C  CE2   . TYR A  1  442 ? 46.209  108.707 57.175  1.00 77.80  ? 442  TYR A CE2   1 
ATOM   3428  C  CZ    . TYR A  1  442 ? 45.974  109.903 57.837  1.00 78.14  ? 442  TYR A CZ    1 
ATOM   3429  O  OH    . TYR A  1  442 ? 44.687  110.224 58.207  1.00 79.78  ? 442  TYR A OH    1 
ATOM   3430  N  N     . TRP A  1  443 ? 51.987  109.687 58.797  1.00 79.82  ? 443  TRP A N     1 
ATOM   3431  C  CA    . TRP A  1  443 ? 52.545  110.547 59.841  1.00 84.88  ? 443  TRP A CA    1 
ATOM   3432  C  C     . TRP A  1  443 ? 53.201  109.639 60.906  1.00 87.28  ? 443  TRP A C     1 
ATOM   3433  O  O     . TRP A  1  443 ? 52.498  108.961 61.678  1.00 88.64  ? 443  TRP A O     1 
ATOM   3434  C  CB    . TRP A  1  443 ? 51.478  111.461 60.455  1.00 88.73  ? 443  TRP A CB    1 
ATOM   3435  C  CG    . TRP A  1  443 ? 52.042  112.792 60.929  1.00 93.53  ? 443  TRP A CG    1 
ATOM   3436  C  CD1   . TRP A  1  443 ? 51.467  113.663 61.821  1.00 94.59  ? 443  TRP A CD1   1 
ATOM   3437  C  CD2   . TRP A  1  443 ? 53.303  113.381 60.552  1.00 95.66  ? 443  TRP A CD2   1 
ATOM   3438  N  NE1   . TRP A  1  443 ? 52.297  114.748 62.027  1.00 94.16  ? 443  TRP A NE1   1 
ATOM   3439  C  CE2   . TRP A  1  443 ? 53.425  114.599 61.264  1.00 95.02  ? 443  TRP A CE2   1 
ATOM   3440  C  CE3   . TRP A  1  443 ? 54.342  112.997 59.684  1.00 97.66  ? 443  TRP A CE3   1 
ATOM   3441  C  CZ2   . TRP A  1  443 ? 54.542  115.430 61.135  1.00 95.66  ? 443  TRP A CZ2   1 
ATOM   3442  C  CZ3   . TRP A  1  443 ? 55.456  113.828 59.556  1.00 97.53  ? 443  TRP A CZ3   1 
ATOM   3443  C  CH2   . TRP A  1  443 ? 55.542  115.029 60.280  1.00 97.41  ? 443  TRP A CH2   1 
ATOM   3444  N  N     . ILE A  1  444 ? 54.546  109.615 60.900  1.00 87.66  ? 444  ILE A N     1 
ATOM   3445  C  CA    . ILE A  1  444 ? 55.393  108.807 61.802  1.00 87.21  ? 444  ILE A CA    1 
ATOM   3446  C  C     . ILE A  1  444 ? 54.889  108.582 63.222  1.00 86.29  ? 444  ILE A C     1 
ATOM   3447  C  CB    . ILE A  1  444 ? 56.796  109.411 61.917  1.00 86.87  ? 444  ILE A CB    1 
ATOM   3448  N  N     . GLY B  2  22  ? 90.216  75.019  46.730  1.00 134.49 ? 20   GLY B N     1 
ATOM   3449  C  CA    . GLY B  2  22  ? 90.224  74.521  48.135  1.00 135.15 ? 20   GLY B CA    1 
ATOM   3450  C  C     . GLY B  2  22  ? 89.415  73.249  48.329  1.00 135.23 ? 20   GLY B C     1 
ATOM   3451  O  O     . GLY B  2  22  ? 88.370  73.061  47.704  1.00 134.91 ? 20   GLY B O     1 
ATOM   3452  N  N     . ALA B  2  23  ? 89.904  72.373  49.205  1.00 135.30 ? 21   ALA B N     1 
ATOM   3453  C  CA    . ALA B  2  23  ? 89.240  71.106  49.507  1.00 134.96 ? 21   ALA B CA    1 
ATOM   3454  C  C     . ALA B  2  23  ? 90.237  70.132  50.137  1.00 134.93 ? 21   ALA B C     1 
ATOM   3455  O  O     . ALA B  2  23  ? 90.872  69.349  49.424  1.00 134.42 ? 21   ALA B O     1 
ATOM   3456  N  N     . GLU B  2  24  ? 90.368  70.171  51.469  1.00 134.69 ? 22   GLU B N     1 
ATOM   3457  C  CA    . GLU B  2  24  ? 91.322  69.289  52.149  1.00 133.83 ? 22   GLU B CA    1 
ATOM   3458  C  C     . GLU B  2  24  ? 91.391  69.335  53.693  1.00 132.57 ? 22   GLU B C     1 
ATOM   3459  O  O     . GLU B  2  24  ? 91.172  70.382  54.315  1.00 131.94 ? 22   GLU B O     1 
ATOM   3460  C  CB    . GLU B  2  24  ? 92.717  69.589  51.613  1.00 134.52 ? 22   GLU B CB    1 
ATOM   3461  C  CG    . GLU B  2  24  ? 93.185  70.978  52.017  1.00 135.37 ? 22   GLU B CG    1 
ATOM   3462  C  CD    . GLU B  2  24  ? 94.155  71.585  51.032  1.00 136.10 ? 22   GLU B CD    1 
ATOM   3463  O  OE1   . GLU B  2  24  ? 93.770  71.752  49.851  1.00 136.27 ? 22   GLU B OE1   1 
ATOM   3464  O  OE2   . GLU B  2  24  ? 95.296  71.899  51.442  1.00 135.82 ? 22   GLU B OE2   1 
ATOM   3465  N  N     . ASP B  2  25  ? 91.725  68.172  54.267  1.00 130.80 ? 23   ASP B N     1 
ATOM   3466  C  CA    . ASP B  2  25  ? 91.933  67.916  55.705  1.00 128.35 ? 23   ASP B CA    1 
ATOM   3467  C  C     . ASP B  2  25  ? 90.793  68.002  56.717  1.00 126.22 ? 23   ASP B C     1 
ATOM   3468  O  O     . ASP B  2  25  ? 89.618  68.052  56.369  1.00 126.79 ? 23   ASP B O     1 
ATOM   3469  C  CB    . ASP B  2  25  ? 93.110  68.770  56.218  1.00 129.10 ? 23   ASP B CB    1 
ATOM   3470  C  CG    . ASP B  2  25  ? 92.678  70.136  56.741  1.00 129.67 ? 23   ASP B CG    1 
ATOM   3471  O  OD1   . ASP B  2  25  ? 92.097  70.198  57.848  1.00 129.39 ? 23   ASP B OD1   1 
ATOM   3472  O  OD2   . ASP B  2  25  ? 92.923  71.148  56.044  1.00 129.68 ? 23   ASP B OD2   1 
ATOM   3473  N  N     . LEU B  2  26  ? 91.197  67.988  57.984  1.00 123.09 ? 24   LEU B N     1 
ATOM   3474  C  CA    . LEU B  2  26  ? 90.341  68.065  59.163  1.00 120.84 ? 24   LEU B CA    1 
ATOM   3475  C  C     . LEU B  2  26  ? 91.245  67.840  60.371  1.00 119.93 ? 24   LEU B C     1 
ATOM   3476  O  O     . LEU B  2  26  ? 91.197  66.781  60.995  1.00 120.11 ? 24   LEU B O     1 
ATOM   3477  C  CB    . LEU B  2  26  ? 89.245  66.985  59.134  1.00 120.13 ? 24   LEU B CB    1 
ATOM   3478  C  CG    . LEU B  2  26  ? 88.497  66.614  60.431  1.00 118.38 ? 24   LEU B CG    1 
ATOM   3479  C  CD1   . LEU B  2  26  ? 87.976  67.846  61.152  1.00 118.25 ? 24   LEU B CD1   1 
ATOM   3480  C  CD2   . LEU B  2  26  ? 87.358  65.695  60.083  1.00 117.02 ? 24   LEU B CD2   1 
ATOM   3481  N  N     . GLU B  2  27  ? 92.073  68.830  60.696  1.00 118.43 ? 25   GLU B N     1 
ATOM   3482  C  CA    . GLU B  2  27  ? 92.989  68.718  61.833  1.00 117.44 ? 25   GLU B CA    1 
ATOM   3483  C  C     . GLU B  2  27  ? 92.274  68.567  63.181  1.00 115.72 ? 25   GLU B C     1 
ATOM   3484  O  O     . GLU B  2  27  ? 91.067  68.761  63.270  1.00 116.13 ? 25   GLU B O     1 
ATOM   3485  C  CB    . GLU B  2  27  ? 93.923  69.920  61.841  1.00 118.72 ? 25   GLU B CB    1 
ATOM   3486  C  CG    . GLU B  2  27  ? 94.796  69.949  60.605  1.00 120.93 ? 25   GLU B CG    1 
ATOM   3487  C  CD    . GLU B  2  27  ? 95.256  71.343  60.240  1.00 122.25 ? 25   GLU B CD    1 
ATOM   3488  O  OE1   . GLU B  2  27  ? 96.043  71.941  61.010  1.00 122.82 ? 25   GLU B OE1   1 
ATOM   3489  O  OE2   . GLU B  2  27  ? 94.821  71.837  59.175  1.00 122.59 ? 25   GLU B OE2   1 
ATOM   3490  N  N     . ILE B  2  28  ? 93.013  68.227  64.233  1.00 113.53 ? 26   ILE B N     1 
ATOM   3491  C  CA    . ILE B  2  28  ? 92.385  68.012  65.529  1.00 111.28 ? 26   ILE B CA    1 
ATOM   3492  C  C     . ILE B  2  28  ? 93.381  67.861  66.685  1.00 112.01 ? 26   ILE B C     1 
ATOM   3493  O  O     . ILE B  2  28  ? 93.689  66.748  67.108  1.00 113.28 ? 26   ILE B O     1 
ATOM   3494  C  CB    . ILE B  2  28  ? 91.460  66.758  65.441  1.00 109.00 ? 26   ILE B CB    1 
ATOM   3495  C  CG1   . ILE B  2  28  ? 90.996  66.309  66.817  1.00 107.60 ? 26   ILE B CG1   1 
ATOM   3496  C  CG2   . ILE B  2  28  ? 92.188  65.619  64.771  1.00 109.04 ? 26   ILE B CG2   1 
ATOM   3497  C  CD1   . ILE B  2  28  ? 90.209  65.020  66.760  1.00 107.08 ? 26   ILE B CD1   1 
ATOM   3498  N  N     . THR B  2  29  ? 93.877  68.988  67.193  1.00 111.98 ? 27   THR B N     1 
ATOM   3499  C  CA    . THR B  2  29  ? 94.829  69.012  68.314  1.00 112.12 ? 27   THR B CA    1 
ATOM   3500  C  C     . THR B  2  29  ? 94.174  68.495  69.606  1.00 112.87 ? 27   THR B C     1 
ATOM   3501  O  O     . THR B  2  29  ? 92.989  68.173  69.620  1.00 113.82 ? 27   THR B O     1 
ATOM   3502  C  CB    . THR B  2  29  ? 95.337  70.459  68.563  1.00 111.20 ? 27   THR B CB    1 
ATOM   3503  O  OG1   . THR B  2  29  ? 95.924  70.971  67.362  1.00 110.33 ? 27   THR B OG1   1 
ATOM   3504  C  CG2   . THR B  2  29  ? 96.375  70.493  69.677  1.00 110.74 ? 27   THR B CG2   1 
ATOM   3505  N  N     . LYS B  2  30  ? 94.944  68.391  70.683  1.00 113.28 ? 28   LYS B N     1 
ATOM   3506  C  CA    . LYS B  2  30  ? 94.378  67.947  71.949  1.00 114.12 ? 28   LYS B CA    1 
ATOM   3507  C  C     . LYS B  2  30  ? 95.125  68.517  73.159  1.00 115.35 ? 28   LYS B C     1 
ATOM   3508  O  O     . LYS B  2  30  ? 95.676  67.775  73.978  1.00 115.10 ? 28   LYS B O     1 
ATOM   3509  C  CB    . LYS B  2  30  ? 94.330  66.421  72.036  1.00 112.89 ? 28   LYS B CB    1 
ATOM   3510  C  CG    . LYS B  2  30  ? 93.562  65.956  73.266  1.00 112.59 ? 28   LYS B CG    1 
ATOM   3511  C  CD    . LYS B  2  30  ? 93.699  64.475  73.522  1.00 112.30 ? 28   LYS B CD    1 
ATOM   3512  C  CE    . LYS B  2  30  ? 92.986  64.085  74.808  1.00 111.60 ? 28   LYS B CE    1 
ATOM   3513  N  NZ    . LYS B  2  30  ? 93.213  62.654  75.150  1.00 110.46 ? 28   LYS B NZ    1 
ATOM   3514  N  N     . LEU B  2  31  ? 95.110  69.846  73.248  1.00 116.71 ? 29   LEU B N     1 
ATOM   3515  C  CA    . LEU B  2  31  ? 95.737  70.632  74.313  1.00 118.09 ? 29   LEU B CA    1 
ATOM   3516  C  C     . LEU B  2  31  ? 96.160  69.934  75.611  1.00 118.75 ? 29   LEU B C     1 
ATOM   3517  O  O     . LEU B  2  31  ? 95.700  68.830  75.934  1.00 118.28 ? 29   LEU B O     1 
ATOM   3518  C  CB    . LEU B  2  31  ? 94.826  71.812  74.685  1.00 118.38 ? 29   LEU B CB    1 
ATOM   3519  C  CG    . LEU B  2  31  ? 94.614  72.929  73.660  1.00 119.27 ? 29   LEU B CG    1 
ATOM   3520  C  CD1   . LEU B  2  31  ? 93.768  74.016  74.308  1.00 119.46 ? 29   LEU B CD1   1 
ATOM   3521  C  CD2   . LEU B  2  31  ? 95.952  73.505  73.190  1.00 119.31 ? 29   LEU B CD2   1 
ATOM   3522  N  N     . PRO B  2  32  ? 97.041  70.599  76.387  1.00 119.38 ? 30   PRO B N     1 
ATOM   3523  C  CA    . PRO B  2  32  ? 97.562  70.101  77.664  1.00 119.56 ? 30   PRO B CA    1 
ATOM   3524  C  C     . PRO B  2  32  ? 96.493  69.467  78.567  1.00 119.85 ? 30   PRO B C     1 
ATOM   3525  O  O     . PRO B  2  32  ? 96.489  68.249  78.801  1.00 119.28 ? 30   PRO B O     1 
ATOM   3526  C  CB    . PRO B  2  32  ? 98.164  71.359  78.288  1.00 119.72 ? 30   PRO B CB    1 
ATOM   3527  C  CG    . PRO B  2  32  ? 98.708  72.085  77.091  1.00 119.14 ? 30   PRO B CG    1 
ATOM   3528  C  CD    . PRO B  2  32  ? 97.595  71.939  76.086  1.00 119.22 ? 30   PRO B CD    1 
ATOM   3529  N  N     . ASN B  2  33  ? 95.589  70.317  79.055  1.00 120.11 ? 31   ASN B N     1 
ATOM   3530  C  CA    . ASN B  2  33  ? 94.500  69.932  79.960  1.00 119.82 ? 31   ASN B CA    1 
ATOM   3531  C  C     . ASN B  2  33  ? 93.444  68.920  79.474  1.00 119.31 ? 31   ASN B C     1 
ATOM   3532  O  O     . ASN B  2  33  ? 92.538  68.558  80.229  1.00 119.10 ? 31   ASN B O     1 
ATOM   3533  C  CB    . ASN B  2  33  ? 93.796  71.200  80.470  1.00 119.56 ? 31   ASN B CB    1 
ATOM   3534  C  CG    . ASN B  2  33  ? 93.503  72.208  79.361  1.00 119.95 ? 31   ASN B CG    1 
ATOM   3535  O  OD1   . ASN B  2  33  ? 92.938  73.273  79.618  1.00 119.83 ? 31   ASN B OD1   1 
ATOM   3536  N  ND2   . ASN B  2  33  ? 93.886  71.881  78.128  1.00 119.80 ? 31   ASN B ND2   1 
ATOM   3537  N  N     . GLY B  2  34  ? 93.558  68.459  78.233  1.00 118.70 ? 32   GLY B N     1 
ATOM   3538  C  CA    . GLY B  2  34  ? 92.596  67.498  77.719  1.00 117.56 ? 32   GLY B CA    1 
ATOM   3539  C  C     . GLY B  2  34  ? 91.533  68.124  76.840  1.00 116.91 ? 32   GLY B C     1 
ATOM   3540  O  O     . GLY B  2  34  ? 90.598  67.441  76.414  1.00 117.28 ? 32   GLY B O     1 
ATOM   3541  N  N     . LEU B  2  35  ? 91.678  69.420  76.567  1.00 115.67 ? 33   LEU B N     1 
ATOM   3542  C  CA    . LEU B  2  35  ? 90.724  70.147  75.734  1.00 114.27 ? 33   LEU B CA    1 
ATOM   3543  C  C     . LEU B  2  35  ? 90.917  69.829  74.260  1.00 112.62 ? 33   LEU B C     1 
ATOM   3544  O  O     . LEU B  2  35  ? 91.915  70.225  73.666  1.00 112.38 ? 33   LEU B O     1 
ATOM   3545  C  CB    . LEU B  2  35  ? 90.877  71.658  75.925  1.00 115.35 ? 33   LEU B CB    1 
ATOM   3546  C  CG    . LEU B  2  35  ? 89.949  72.496  75.033  1.00 115.92 ? 33   LEU B CG    1 
ATOM   3547  C  CD1   . LEU B  2  35  ? 88.512  72.363  75.544  1.00 115.45 ? 33   LEU B CD1   1 
ATOM   3548  C  CD2   . LEU B  2  35  ? 90.396  73.960  75.029  1.00 115.02 ? 33   LEU B CD2   1 
ATOM   3549  N  N     . ILE B  2  36  ? 89.952  69.137  73.666  1.00 110.66 ? 34   ILE B N     1 
ATOM   3550  C  CA    . ILE B  2  36  ? 90.050  68.780  72.259  1.00 108.48 ? 34   ILE B CA    1 
ATOM   3551  C  C     . ILE B  2  36  ? 89.596  69.900  71.326  1.00 107.50 ? 34   ILE B C     1 
ATOM   3552  O  O     . ILE B  2  36  ? 88.601  70.580  71.582  1.00 107.71 ? 34   ILE B O     1 
ATOM   3553  C  CB    . ILE B  2  36  ? 89.274  67.488  71.991  1.00 107.63 ? 34   ILE B CB    1 
ATOM   3554  C  CG1   . ILE B  2  36  ? 89.982  66.344  72.724  1.00 108.48 ? 34   ILE B CG1   1 
ATOM   3555  C  CG2   . ILE B  2  36  ? 89.183  67.225  70.499  1.00 106.24 ? 34   ILE B CG2   1 
ATOM   3556  C  CD1   . ILE B  2  36  ? 89.312  64.990  72.628  1.00 110.26 ? 34   ILE B CD1   1 
ATOM   3557  N  N     . ILE B  2  37  ? 90.349  70.084  70.245  1.00 105.72 ? 35   ILE B N     1 
ATOM   3558  C  CA    . ILE B  2  37  ? 90.080  71.127  69.259  1.00 104.39 ? 35   ILE B CA    1 
ATOM   3559  C  C     . ILE B  2  37  ? 89.973  70.578  67.834  1.00 104.03 ? 35   ILE B C     1 
ATOM   3560  O  O     . ILE B  2  37  ? 90.993  70.259  67.221  1.00 105.01 ? 35   ILE B O     1 
ATOM   3561  C  CB    . ILE B  2  37  ? 91.211  72.193  69.274  1.00 103.97 ? 35   ILE B CB    1 
ATOM   3562  C  CG1   . ILE B  2  37  ? 91.278  72.865  70.647  1.00 103.91 ? 35   ILE B CG1   1 
ATOM   3563  C  CG2   . ILE B  2  37  ? 91.000  73.222  68.163  1.00 102.11 ? 35   ILE B CG2   1 
ATOM   3564  C  CD1   . ILE B  2  37  ? 92.349  73.935  70.737  1.00 104.06 ? 35   ILE B CD1   1 
ATOM   3565  N  N     . ALA B  2  38  ? 88.751  70.475  67.304  1.00 102.76 ? 36   ALA B N     1 
ATOM   3566  C  CA    . ALA B  2  38  ? 88.538  69.986  65.933  1.00 100.83 ? 36   ALA B CA    1 
ATOM   3567  C  C     . ALA B  2  38  ? 88.486  71.180  64.984  1.00 99.60  ? 36   ALA B C     1 
ATOM   3568  O  O     . ALA B  2  38  ? 88.288  72.309  65.421  1.00 99.46  ? 36   ALA B O     1 
ATOM   3569  C  CB    . ALA B  2  38  ? 87.241  69.189  65.844  1.00 100.36 ? 36   ALA B CB    1 
ATOM   3570  N  N     . SER B  2  39  ? 88.667  70.940  63.692  1.00 98.60  ? 37   SER B N     1 
ATOM   3571  C  CA    . SER B  2  39  ? 88.646  72.035  62.727  1.00 98.82  ? 37   SER B CA    1 
ATOM   3572  C  C     . SER B  2  39  ? 88.603  71.574  61.274  1.00 100.21 ? 37   SER B C     1 
ATOM   3573  O  O     . SER B  2  39  ? 89.099  70.505  60.932  1.00 100.86 ? 37   SER B O     1 
ATOM   3574  C  CB    . SER B  2  39  ? 89.868  72.938  62.935  1.00 96.90  ? 37   SER B CB    1 
ATOM   3575  O  OG    . SER B  2  39  ? 90.056  73.807  61.832  1.00 93.53  ? 37   SER B OG    1 
ATOM   3576  N  N     . LEU B  2  40  ? 88.005  72.391  60.416  1.00 101.21 ? 38   LEU B N     1 
ATOM   3577  C  CA    . LEU B  2  40  ? 87.911  72.075  58.999  1.00 102.02 ? 38   LEU B CA    1 
ATOM   3578  C  C     . LEU B  2  40  ? 87.513  73.300  58.206  1.00 103.17 ? 38   LEU B C     1 
ATOM   3579  O  O     . LEU B  2  40  ? 86.514  73.935  58.494  1.00 104.27 ? 38   LEU B O     1 
ATOM   3580  C  CB    . LEU B  2  40  ? 86.901  70.953  58.760  1.00 100.52 ? 38   LEU B CB    1 
ATOM   3581  C  CG    . LEU B  2  40  ? 86.285  70.840  57.359  1.00 99.57  ? 38   LEU B CG    1 
ATOM   3582  C  CD1   . LEU B  2  40  ? 87.319  70.996  56.265  1.00 97.57  ? 38   LEU B CD1   1 
ATOM   3583  C  CD2   . LEU B  2  40  ? 85.597  69.489  57.259  1.00 99.53  ? 38   LEU B CD2   1 
ATOM   3584  N  N     . GLU B  2  41  ? 88.308  73.632  57.206  1.00 104.84 ? 39   GLU B N     1 
ATOM   3585  C  CA    . GLU B  2  41  ? 88.024  74.780  56.374  1.00 107.16 ? 39   GLU B CA    1 
ATOM   3586  C  C     . GLU B  2  41  ? 87.366  74.325  55.072  1.00 108.95 ? 39   GLU B C     1 
ATOM   3587  O  O     . GLU B  2  41  ? 87.981  73.623  54.274  1.00 109.63 ? 39   GLU B O     1 
ATOM   3588  C  CB    . GLU B  2  41  ? 89.323  75.520  56.083  1.00 107.69 ? 39   GLU B CB    1 
ATOM   3589  C  CG    . GLU B  2  41  ? 89.230  76.571  54.989  1.00 110.87 ? 39   GLU B CG    1 
ATOM   3590  C  CD    . GLU B  2  41  ? 88.410  77.780  55.390  1.00 112.64 ? 39   GLU B CD    1 
ATOM   3591  O  OE1   . GLU B  2  41  ? 87.162  77.677  55.416  1.00 113.51 ? 39   GLU B OE1   1 
ATOM   3592  O  OE2   . GLU B  2  41  ? 89.021  78.833  55.683  1.00 113.67 ? 39   GLU B OE2   1 
ATOM   3593  N  N     . ASN B  2  42  ? 86.107  74.704  54.866  1.00 110.74 ? 40   ASN B N     1 
ATOM   3594  C  CA    . ASN B  2  42  ? 85.397  74.345  53.640  1.00 111.72 ? 40   ASN B CA    1 
ATOM   3595  C  C     . ASN B  2  42  ? 85.101  75.618  52.867  1.00 112.27 ? 40   ASN B C     1 
ATOM   3596  O  O     . ASN B  2  42  ? 84.271  75.633  51.958  1.00 112.40 ? 40   ASN B O     1 
ATOM   3597  C  CB    . ASN B  2  42  ? 84.086  73.608  53.944  1.00 111.98 ? 40   ASN B CB    1 
ATOM   3598  C  CG    . ASN B  2  42  ? 83.183  74.377  54.890  1.00 112.36 ? 40   ASN B CG    1 
ATOM   3599  O  OD1   . ASN B  2  42  ? 83.385  75.571  55.133  1.00 111.54 ? 40   ASN B OD1   1 
ATOM   3600  N  ND2   . ASN B  2  42  ? 82.170  73.695  55.426  1.00 112.91 ? 40   ASN B ND2   1 
ATOM   3601  N  N     . PHE B  2  43  ? 85.794  76.684  53.251  1.00 113.01 ? 41   PHE B N     1 
ATOM   3602  C  CA    . PHE B  2  43  ? 85.651  77.989  52.622  1.00 114.59 ? 41   PHE B CA    1 
ATOM   3603  C  C     . PHE B  2  43  ? 84.220  78.467  52.420  1.00 114.62 ? 41   PHE B C     1 
ATOM   3604  O  O     . PHE B  2  43  ? 83.935  79.238  51.492  1.00 114.92 ? 41   PHE B O     1 
ATOM   3605  C  CB    . PHE B  2  43  ? 86.388  78.006  51.288  1.00 116.41 ? 41   PHE B CB    1 
ATOM   3606  C  CG    . PHE B  2  43  ? 87.851  77.765  51.424  1.00 119.06 ? 41   PHE B CG    1 
ATOM   3607  C  CD1   . PHE B  2  43  ? 88.359  76.469  51.370  1.00 120.08 ? 41   PHE B CD1   1 
ATOM   3608  C  CD2   . PHE B  2  43  ? 88.720  78.826  51.676  1.00 119.57 ? 41   PHE B CD2   1 
ATOM   3609  C  CE1   . PHE B  2  43  ? 89.712  76.227  51.569  1.00 120.76 ? 41   PHE B CE1   1 
ATOM   3610  C  CE2   . PHE B  2  43  ? 90.073  78.601  51.879  1.00 120.70 ? 41   PHE B CE2   1 
ATOM   3611  C  CZ    . PHE B  2  43  ? 90.573  77.295  51.825  1.00 121.47 ? 41   PHE B CZ    1 
ATOM   3612  N  N     . SER B  2  44  ? 83.322  78.006  53.291  1.00 113.80 ? 42   SER B N     1 
ATOM   3613  C  CA    . SER B  2  44  ? 81.921  78.413  53.232  1.00 111.12 ? 42   SER B CA    1 
ATOM   3614  C  C     . SER B  2  44  ? 81.899  79.883  53.607  1.00 108.80 ? 42   SER B C     1 
ATOM   3615  O  O     . SER B  2  44  ? 82.628  80.306  54.502  1.00 108.97 ? 42   SER B O     1 
ATOM   3616  C  CB    . SER B  2  44  ? 81.081  77.626  54.235  1.00 110.81 ? 42   SER B CB    1 
ATOM   3617  O  OG    . SER B  2  44  ? 79.751  78.097  54.235  1.00 111.16 ? 42   SER B OG    1 
ATOM   3618  N  N     . PRO B  2  45  ? 81.067  80.682  52.928  1.00 106.56 ? 43   PRO B N     1 
ATOM   3619  C  CA    . PRO B  2  45  ? 81.013  82.110  53.250  1.00 104.32 ? 43   PRO B CA    1 
ATOM   3620  C  C     . PRO B  2  45  ? 80.618  82.350  54.701  1.00 102.32 ? 43   PRO B C     1 
ATOM   3621  O  O     . PRO B  2  45  ? 80.559  83.492  55.160  1.00 101.83 ? 43   PRO B O     1 
ATOM   3622  C  CB    . PRO B  2  45  ? 79.989  82.648  52.252  1.00 104.25 ? 43   PRO B CB    1 
ATOM   3623  C  CG    . PRO B  2  45  ? 79.079  81.473  52.048  1.00 105.23 ? 43   PRO B CG    1 
ATOM   3624  C  CD    . PRO B  2  45  ? 80.039  80.321  51.936  1.00 105.80 ? 43   PRO B CD    1 
ATOM   3625  N  N     . ALA B  2  46  ? 80.380  81.265  55.428  1.00 100.48 ? 44   ALA B N     1 
ATOM   3626  C  CA    . ALA B  2  46  ? 79.984  81.372  56.822  1.00 99.21  ? 44   ALA B CA    1 
ATOM   3627  C  C     . ALA B  2  46  ? 80.658  80.366  57.740  1.00 98.20  ? 44   ALA B C     1 
ATOM   3628  O  O     . ALA B  2  46  ? 80.916  79.222  57.365  1.00 98.00  ? 44   ALA B O     1 
ATOM   3629  C  CB    . ALA B  2  46  ? 78.481  81.231  56.936  1.00 100.19 ? 44   ALA B CB    1 
ATOM   3630  N  N     . SER B  2  47  ? 80.926  80.813  58.958  1.00 96.88  ? 45   SER B N     1 
ATOM   3631  C  CA    . SER B  2  47  ? 81.551  79.983  59.969  1.00 95.64  ? 45   SER B CA    1 
ATOM   3632  C  C     . SER B  2  47  ? 80.463  79.497  60.908  1.00 95.26  ? 45   SER B C     1 
ATOM   3633  O  O     . SER B  2  47  ? 79.328  79.948  60.842  1.00 96.28  ? 45   SER B O     1 
ATOM   3634  C  CB    . SER B  2  47  ? 82.579  80.794  60.758  1.00 94.99  ? 45   SER B CB    1 
ATOM   3635  O  OG    . SER B  2  47  ? 83.502  81.425  59.888  1.00 95.44  ? 45   SER B OG    1 
ATOM   3636  N  N     . ARG B  2  48  ? 80.822  78.573  61.781  1.00 94.80  ? 46   ARG B N     1 
ATOM   3637  C  CA    . ARG B  2  48  ? 79.897  78.016  62.748  1.00 93.95  ? 46   ARG B CA    1 
ATOM   3638  C  C     . ARG B  2  48  ? 80.744  77.310  63.801  1.00 93.44  ? 46   ARG B C     1 
ATOM   3639  O  O     . ARG B  2  48  ? 81.032  76.118  63.692  1.00 93.78  ? 46   ARG B O     1 
ATOM   3640  C  CB    . ARG B  2  48  ? 78.930  77.036  62.065  1.00 94.78  ? 46   ARG B CB    1 
ATOM   3641  C  CG    . ARG B  2  48  ? 78.231  76.083  63.033  1.00 98.20  ? 46   ARG B CG    1 
ATOM   3642  C  CD    . ARG B  2  48  ? 76.701  76.133  62.983  1.00 100.12 ? 46   ARG B CD    1 
ATOM   3643  N  NE    . ARG B  2  48  ? 76.114  75.135  63.882  1.00 102.51 ? 46   ARG B NE    1 
ATOM   3644  C  CZ    . ARG B  2  48  ? 74.812  74.986  64.097  1.00 103.01 ? 46   ARG B CZ    1 
ATOM   3645  N  NH1   . ARG B  2  48  ? 73.950  75.782  63.477  1.00 104.00 ? 46   ARG B NH1   1 
ATOM   3646  N  NH2   . ARG B  2  48  ? 74.372  74.032  64.917  1.00 102.00 ? 46   ARG B NH2   1 
ATOM   3647  N  N     . ILE B  2  49  ? 81.157  78.064  64.813  1.00 92.06  ? 47   ILE B N     1 
ATOM   3648  C  CA    . ILE B  2  49  ? 81.981  77.535  65.897  1.00 90.81  ? 47   ILE B CA    1 
ATOM   3649  C  C     . ILE B  2  49  ? 81.111  76.961  67.017  1.00 90.13  ? 47   ILE B C     1 
ATOM   3650  O  O     . ILE B  2  49  ? 79.999  77.434  67.239  1.00 91.17  ? 47   ILE B O     1 
ATOM   3651  C  CB    . ILE B  2  49  ? 82.850  78.643  66.474  1.00 89.81  ? 47   ILE B CB    1 
ATOM   3652  C  CG1   . ILE B  2  49  ? 83.644  79.282  65.351  1.00 89.52  ? 47   ILE B CG1   1 
ATOM   3653  C  CG2   . ILE B  2  49  ? 83.791  78.091  67.514  1.00 89.71  ? 47   ILE B CG2   1 
ATOM   3654  C  CD1   . ILE B  2  49  ? 84.326  80.535  65.769  1.00 90.02  ? 47   ILE B CD1   1 
ATOM   3655  N  N     . GLY B  2  50  ? 81.615  75.951  67.723  1.00 88.38  ? 48   GLY B N     1 
ATOM   3656  C  CA    . GLY B  2  50  ? 80.839  75.359  68.802  1.00 86.05  ? 48   GLY B CA    1 
ATOM   3657  C  C     . GLY B  2  50  ? 81.619  74.800  69.984  1.00 84.19  ? 48   GLY B C     1 
ATOM   3658  O  O     . GLY B  2  50  ? 82.781  74.442  69.874  1.00 84.72  ? 48   GLY B O     1 
ATOM   3659  N  N     . VAL B  2  51  ? 80.969  74.731  71.133  1.00 81.96  ? 49   VAL B N     1 
ATOM   3660  C  CA    . VAL B  2  51  ? 81.591  74.196  72.327  1.00 79.67  ? 49   VAL B CA    1 
ATOM   3661  C  C     . VAL B  2  51  ? 80.736  73.028  72.784  1.00 80.64  ? 49   VAL B C     1 
ATOM   3662  O  O     . VAL B  2  51  ? 79.621  73.218  73.277  1.00 81.10  ? 49   VAL B O     1 
ATOM   3663  C  CB    . VAL B  2  51  ? 81.658  75.252  73.441  1.00 77.95  ? 49   VAL B CB    1 
ATOM   3664  C  CG1   . VAL B  2  51  ? 82.109  74.620  74.754  1.00 76.53  ? 49   VAL B CG1   1 
ATOM   3665  C  CG2   . VAL B  2  51  ? 82.600  76.348  73.030  1.00 76.60  ? 49   VAL B CG2   1 
ATOM   3666  N  N     . PHE B  2  52  ? 81.245  71.816  72.595  1.00 80.18  ? 50   PHE B N     1 
ATOM   3667  C  CA    . PHE B  2  52  ? 80.512  70.625  73.001  1.00 79.86  ? 50   PHE B CA    1 
ATOM   3668  C  C     . PHE B  2  52  ? 80.937  70.249  74.412  1.00 80.91  ? 50   PHE B C     1 
ATOM   3669  O  O     . PHE B  2  52  ? 82.092  70.429  74.777  1.00 83.14  ? 50   PHE B O     1 
ATOM   3670  C  CB    . PHE B  2  52  ? 80.792  69.498  72.023  1.00 77.22  ? 50   PHE B CB    1 
ATOM   3671  C  CG    . PHE B  2  52  ? 80.384  69.815  70.621  1.00 76.56  ? 50   PHE B CG    1 
ATOM   3672  C  CD1   . PHE B  2  52  ? 80.861  70.969  69.984  1.00 76.28  ? 50   PHE B CD1   1 
ATOM   3673  C  CD2   . PHE B  2  52  ? 79.527  68.960  69.928  1.00 76.04  ? 50   PHE B CD2   1 
ATOM   3674  C  CE1   . PHE B  2  52  ? 80.490  71.271  68.665  1.00 76.69  ? 50   PHE B CE1   1 
ATOM   3675  C  CE2   . PHE B  2  52  ? 79.145  69.242  68.610  1.00 76.54  ? 50   PHE B CE2   1 
ATOM   3676  C  CZ    . PHE B  2  52  ? 79.630  70.404  67.974  1.00 77.31  ? 50   PHE B CZ    1 
ATOM   3677  N  N     . ILE B  2  53  ? 80.011  69.739  75.212  1.00 81.12  ? 51   ILE B N     1 
ATOM   3678  C  CA    . ILE B  2  53  ? 80.340  69.395  76.580  1.00 82.21  ? 51   ILE B CA    1 
ATOM   3679  C  C     . ILE B  2  53  ? 79.593  68.170  77.076  1.00 85.06  ? 51   ILE B C     1 
ATOM   3680  O  O     . ILE B  2  53  ? 78.484  67.878  76.631  1.00 85.31  ? 51   ILE B O     1 
ATOM   3681  C  CB    . ILE B  2  53  ? 80.029  70.579  77.516  1.00 81.20  ? 51   ILE B CB    1 
ATOM   3682  C  CG1   . ILE B  2  53  ? 80.686  71.848  76.972  1.00 80.72  ? 51   ILE B CG1   1 
ATOM   3683  C  CG2   . ILE B  2  53  ? 80.533  70.286  78.931  1.00 81.26  ? 51   ILE B CG2   1 
ATOM   3684  C  CD1   . ILE B  2  53  ? 80.374  73.100  77.764  1.00 80.59  ? 51   ILE B CD1   1 
ATOM   3685  N  N     . LYS B  2  54  ? 80.219  67.443  77.992  1.00 88.19  ? 52   LYS B N     1 
ATOM   3686  C  CA    . LYS B  2  54  ? 79.601  66.264  78.573  1.00 91.34  ? 52   LYS B CA    1 
ATOM   3687  C  C     . LYS B  2  54  ? 78.850  66.761  79.796  1.00 91.72  ? 52   LYS B C     1 
ATOM   3688  O  O     . LYS B  2  54  ? 79.413  66.858  80.882  1.00 93.20  ? 52   LYS B O     1 
ATOM   3689  C  CB    . LYS B  2  54  ? 80.661  65.238  78.990  1.00 93.70  ? 52   LYS B CB    1 
ATOM   3690  C  CG    . LYS B  2  54  ? 81.565  64.792  77.849  1.00 97.43  ? 52   LYS B CG    1 
ATOM   3691  C  CD    . LYS B  2  54  ? 82.257  63.449  78.136  1.00 99.98  ? 52   LYS B CD    1 
ATOM   3692  C  CE    . LYS B  2  54  ? 83.137  63.009  76.950  1.00 101.58 ? 52   LYS B CE    1 
ATOM   3693  N  NZ    . LYS B  2  54  ? 83.774  61.668  77.121  1.00 101.21 ? 52   LYS B NZ    1 
ATOM   3694  N  N     . ALA B  2  55  ? 77.585  67.113  79.608  1.00 91.49  ? 53   ALA B N     1 
ATOM   3695  C  CA    . ALA B  2  55  ? 76.758  67.602  80.704  1.00 91.10  ? 53   ALA B CA    1 
ATOM   3696  C  C     . ALA B  2  55  ? 75.293  67.425  80.339  1.00 90.86  ? 53   ALA B C     1 
ATOM   3697  O  O     . ALA B  2  55  ? 74.946  67.372  79.162  1.00 91.25  ? 53   ALA B O     1 
ATOM   3698  C  CB    . ALA B  2  55  ? 77.061  69.060  80.964  1.00 90.71  ? 53   ALA B CB    1 
ATOM   3699  N  N     . GLY B  2  56  ? 74.428  67.325  81.337  1.00 90.44  ? 54   GLY B N     1 
ATOM   3700  C  CA    . GLY B  2  56  ? 73.025  67.158  81.025  1.00 91.65  ? 54   GLY B CA    1 
ATOM   3701  C  C     . GLY B  2  56  ? 72.231  66.642  82.195  1.00 92.42  ? 54   GLY B C     1 
ATOM   3702  O  O     . GLY B  2  56  ? 72.789  66.342  83.239  1.00 92.52  ? 54   GLY B O     1 
ATOM   3703  N  N     . SER B  2  57  ? 70.922  66.539  82.017  1.00 93.97  ? 55   SER B N     1 
ATOM   3704  C  CA    . SER B  2  57  ? 70.038  66.051  83.070  1.00 96.31  ? 55   SER B CA    1 
ATOM   3705  C  C     . SER B  2  57  ? 70.511  64.714  83.669  1.00 97.06  ? 55   SER B C     1 
ATOM   3706  O  O     . SER B  2  57  ? 69.944  64.216  84.649  1.00 96.23  ? 55   SER B O     1 
ATOM   3707  C  CB    . SER B  2  57  ? 68.619  65.889  82.512  1.00 96.97  ? 55   SER B CB    1 
ATOM   3708  O  OG    . SER B  2  57  ? 68.564  64.823  81.578  1.00 97.88  ? 55   SER B OG    1 
ATOM   3709  N  N     . ARG B  2  58  ? 71.552  64.144  83.069  1.00 98.21  ? 56   ARG B N     1 
ATOM   3710  C  CA    . ARG B  2  58  ? 72.120  62.869  83.502  1.00 99.07  ? 56   ARG B CA    1 
ATOM   3711  C  C     . ARG B  2  58  ? 72.901  63.000  84.808  1.00 99.42  ? 56   ARG B C     1 
ATOM   3712  O  O     . ARG B  2  58  ? 72.919  62.083  85.629  1.00 99.39  ? 56   ARG B O     1 
ATOM   3713  C  CB    . ARG B  2  58  ? 73.038  62.330  82.406  1.00 99.05  ? 56   ARG B CB    1 
ATOM   3714  C  CG    . ARG B  2  58  ? 73.724  61.037  82.743  1.00 100.30 ? 56   ARG B CG    1 
ATOM   3715  C  CD    . ARG B  2  58  ? 74.704  60.641  81.645  1.00 100.76 ? 56   ARG B CD    1 
ATOM   3716  N  NE    . ARG B  2  58  ? 75.336  59.351  81.913  1.00 100.92 ? 56   ARG B NE    1 
ATOM   3717  C  CZ    . ARG B  2  58  ? 74.665  58.219  82.089  1.00 101.25 ? 56   ARG B CZ    1 
ATOM   3718  N  NH1   . ARG B  2  58  ? 73.342  58.215  82.024  1.00 102.95 ? 56   ARG B NH1   1 
ATOM   3719  N  NH2   . ARG B  2  58  ? 75.309  57.092  82.331  1.00 101.57 ? 56   ARG B NH2   1 
ATOM   3720  N  N     . TYR B  2  59  ? 73.540  64.148  84.992  1.00 99.57  ? 57   TYR B N     1 
ATOM   3721  C  CA    . TYR B  2  59  ? 74.328  64.417  86.187  1.00 100.42 ? 57   TYR B CA    1 
ATOM   3722  C  C     . TYR B  2  59  ? 73.497  65.092  87.284  1.00 100.94 ? 57   TYR B C     1 
ATOM   3723  O  O     . TYR B  2  59  ? 74.019  65.522  88.320  1.00 100.38 ? 57   TYR B O     1 
ATOM   3724  C  CB    . TYR B  2  59  ? 75.512  65.296  85.813  1.00 101.29 ? 57   TYR B CB    1 
ATOM   3725  C  CG    . TYR B  2  59  ? 76.295  64.741  84.655  1.00 103.56 ? 57   TYR B CG    1 
ATOM   3726  C  CD1   . TYR B  2  59  ? 75.729  64.646  83.393  1.00 104.68 ? 57   TYR B CD1   1 
ATOM   3727  C  CD2   . TYR B  2  59  ? 77.605  64.296  84.821  1.00 105.39 ? 57   TYR B CD2   1 
ATOM   3728  C  CE1   . TYR B  2  59  ? 76.450  64.123  82.318  1.00 105.98 ? 57   TYR B CE1   1 
ATOM   3729  C  CE2   . TYR B  2  59  ? 78.335  63.768  83.753  1.00 104.85 ? 57   TYR B CE2   1 
ATOM   3730  C  CZ    . TYR B  2  59  ? 77.751  63.688  82.502  1.00 105.00 ? 57   TYR B CZ    1 
ATOM   3731  O  OH    . TYR B  2  59  ? 78.463  63.209  81.424  1.00 104.19 ? 57   TYR B OH    1 
ATOM   3732  N  N     . GLU B  2  60  ? 72.195  65.187  87.043  1.00 101.18 ? 58   GLU B N     1 
ATOM   3733  C  CA    . GLU B  2  60  ? 71.291  65.803  87.999  1.00 100.58 ? 58   GLU B CA    1 
ATOM   3734  C  C     . GLU B  2  60  ? 70.951  64.804  89.098  1.00 99.05  ? 58   GLU B C     1 
ATOM   3735  O  O     . GLU B  2  60  ? 70.879  63.598  88.859  1.00 98.14  ? 58   GLU B O     1 
ATOM   3736  C  CB    . GLU B  2  60  ? 70.004  66.263  87.291  1.00 101.95 ? 58   GLU B CB    1 
ATOM   3737  C  CG    . GLU B  2  60  ? 69.932  67.761  86.949  1.00 102.78 ? 58   GLU B CG    1 
ATOM   3738  C  CD    . GLU B  2  60  ? 68.740  68.106  86.052  1.00 104.18 ? 58   GLU B CD    1 
ATOM   3739  O  OE1   . GLU B  2  60  ? 67.670  67.466  86.192  1.00 104.15 ? 58   GLU B OE1   1 
ATOM   3740  O  OE2   . GLU B  2  60  ? 68.870  69.027  85.212  1.00 105.42 ? 58   GLU B OE2   1 
ATOM   3741  N  N     . THR B  2  61  ? 70.764  65.324  90.305  1.00 97.76  ? 59   THR B N     1 
ATOM   3742  C  CA    . THR B  2  61  ? 70.399  64.513  91.457  1.00 96.27  ? 59   THR B CA    1 
ATOM   3743  C  C     . THR B  2  61  ? 69.069  65.041  91.928  1.00 95.56  ? 59   THR B C     1 
ATOM   3744  O  O     . THR B  2  61  ? 68.766  66.223  91.749  1.00 95.49  ? 59   THR B O     1 
ATOM   3745  C  CB    . THR B  2  61  ? 71.361  64.686  92.622  1.00 96.13  ? 59   THR B CB    1 
ATOM   3746  O  OG1   . THR B  2  61  ? 72.698  64.433  92.180  1.00 95.94  ? 59   THR B OG1   1 
ATOM   3747  C  CG2   . THR B  2  61  ? 70.984  63.733  93.752  1.00 94.92  ? 59   THR B CG2   1 
ATOM   3748  N  N     . THR B  2  62  ? 68.287  64.174  92.555  1.00 94.66  ? 60   THR B N     1 
ATOM   3749  C  CA    . THR B  2  62  ? 66.975  64.561  93.051  1.00 93.62  ? 60   THR B CA    1 
ATOM   3750  C  C     . THR B  2  62  ? 67.020  65.947  93.719  1.00 92.65  ? 60   THR B C     1 
ATOM   3751  O  O     . THR B  2  62  ? 65.995  66.632  93.837  1.00 93.64  ? 60   THR B O     1 
ATOM   3752  C  CB    . THR B  2  62  ? 66.453  63.517  94.059  1.00 93.67  ? 60   THR B CB    1 
ATOM   3753  O  OG1   . THR B  2  62  ? 65.032  63.624  94.159  1.00 92.92  ? 60   THR B OG1   1 
ATOM   3754  C  CG2   . THR B  2  62  ? 67.080  63.737  95.442  1.00 94.92  ? 60   THR B CG2   1 
ATOM   3755  N  N     . ALA B  2  63  ? 68.215  66.363  94.132  1.00 89.95  ? 61   ALA B N     1 
ATOM   3756  C  CA    . ALA B  2  63  ? 68.392  67.646  94.794  1.00 86.96  ? 61   ALA B CA    1 
ATOM   3757  C  C     . ALA B  2  63  ? 68.524  68.862  93.875  1.00 84.81  ? 61   ALA B C     1 
ATOM   3758  O  O     . ALA B  2  63  ? 68.187  69.972  94.280  1.00 83.90  ? 61   ALA B O     1 
ATOM   3759  C  CB    . ALA B  2  63  ? 69.583  67.576  95.721  1.00 87.01  ? 61   ALA B CB    1 
ATOM   3760  N  N     . ASN B  2  64  ? 69.004  68.679  92.649  1.00 82.32  ? 62   ASN B N     1 
ATOM   3761  C  CA    . ASN B  2  64  ? 69.152  69.832  91.765  1.00 81.01  ? 62   ASN B CA    1 
ATOM   3762  C  C     . ASN B  2  64  ? 68.500  69.698  90.391  1.00 80.17  ? 62   ASN B C     1 
ATOM   3763  O  O     . ASN B  2  64  ? 68.860  70.417  89.447  1.00 79.18  ? 62   ASN B O     1 
ATOM   3764  C  CB    . ASN B  2  64  ? 70.636  70.196  91.614  1.00 81.18  ? 62   ASN B CB    1 
ATOM   3765  C  CG    . ASN B  2  64  ? 71.426  69.143  90.873  1.00 81.52  ? 62   ASN B CG    1 
ATOM   3766  O  OD1   . ASN B  2  64  ? 71.104  67.954  90.926  1.00 82.68  ? 62   ASN B OD1   1 
ATOM   3767  N  ND2   . ASN B  2  64  ? 72.486  69.572  90.190  1.00 81.68  ? 62   ASN B ND2   1 
ATOM   3768  N  N     . LEU B  2  65  ? 67.526  68.794  90.291  1.00 78.42  ? 63   LEU B N     1 
ATOM   3769  C  CA    . LEU B  2  65  ? 66.800  68.574  89.046  1.00 77.17  ? 63   LEU B CA    1 
ATOM   3770  C  C     . LEU B  2  65  ? 66.497  69.880  88.310  1.00 78.41  ? 63   LEU B C     1 
ATOM   3771  O  O     . LEU B  2  65  ? 66.313  70.933  88.924  1.00 79.32  ? 63   LEU B O     1 
ATOM   3772  C  CB    . LEU B  2  65  ? 65.498  67.846  89.338  1.00 73.76  ? 63   LEU B CB    1 
ATOM   3773  C  CG    . LEU B  2  65  ? 65.749  66.415  89.783  1.00 72.52  ? 63   LEU B CG    1 
ATOM   3774  C  CD1   . LEU B  2  65  ? 64.487  65.756  90.314  1.00 71.73  ? 63   LEU B CD1   1 
ATOM   3775  C  CD2   . LEU B  2  65  ? 66.294  65.666  88.597  1.00 71.89  ? 63   LEU B CD2   1 
ATOM   3776  N  N     . GLY B  2  66  ? 66.459  69.805  86.985  1.00 79.06  ? 64   GLY B N     1 
ATOM   3777  C  CA    . GLY B  2  66  ? 66.169  70.978  86.185  1.00 79.00  ? 64   GLY B CA    1 
ATOM   3778  C  C     . GLY B  2  66  ? 67.294  71.989  86.028  1.00 79.09  ? 64   GLY B C     1 
ATOM   3779  O  O     . GLY B  2  66  ? 67.290  72.771  85.068  1.00 80.25  ? 64   GLY B O     1 
ATOM   3780  N  N     . THR B  2  67  ? 68.256  71.992  86.945  1.00 78.06  ? 65   THR B N     1 
ATOM   3781  C  CA    . THR B  2  67  ? 69.357  72.947  86.850  1.00 77.87  ? 65   THR B CA    1 
ATOM   3782  C  C     . THR B  2  67  ? 70.087  72.885  85.492  1.00 78.15  ? 65   THR B C     1 
ATOM   3783  O  O     . THR B  2  67  ? 70.762  73.845  85.081  1.00 76.83  ? 65   THR B O     1 
ATOM   3784  C  CB    . THR B  2  67  ? 70.345  72.733  87.990  1.00 76.70  ? 65   THR B CB    1 
ATOM   3785  O  OG1   . THR B  2  67  ? 71.400  73.697  87.897  1.00 75.94  ? 65   THR B OG1   1 
ATOM   3786  C  CG2   . THR B  2  67  ? 70.906  71.347  87.919  1.00 78.18  ? 65   THR B CG2   1 
ATOM   3787  N  N     . ALA B  2  68  ? 69.939  71.760  84.795  1.00 78.70  ? 66   ALA B N     1 
ATOM   3788  C  CA    . ALA B  2  68  ? 70.546  71.591  83.479  1.00 80.32  ? 66   ALA B CA    1 
ATOM   3789  C  C     . ALA B  2  68  ? 69.741  72.426  82.482  1.00 81.58  ? 66   ALA B C     1 
ATOM   3790  O  O     . ALA B  2  68  ? 70.306  73.212  81.703  1.00 82.07  ? 66   ALA B O     1 
ATOM   3791  C  CB    . ALA B  2  68  ? 70.515  70.128  83.075  1.00 80.80  ? 66   ALA B CB    1 
ATOM   3792  N  N     . HIS B  2  69  ? 68.417  72.232  82.528  1.00 81.53  ? 67   HIS B N     1 
ATOM   3793  C  CA    . HIS B  2  69  ? 67.448  72.932  81.679  1.00 80.10  ? 67   HIS B CA    1 
ATOM   3794  C  C     . HIS B  2  69  ? 67.585  74.446  81.832  1.00 78.50  ? 67   HIS B C     1 
ATOM   3795  O  O     . HIS B  2  69  ? 67.746  75.165  80.841  1.00 77.65  ? 67   HIS B O     1 
ATOM   3796  C  CB    . HIS B  2  69  ? 66.029  72.499  82.074  1.00 82.01  ? 67   HIS B CB    1 
ATOM   3797  C  CG    . HIS B  2  69  ? 64.937  73.153  81.278  1.00 83.38  ? 67   HIS B CG    1 
ATOM   3798  N  ND1   . HIS B  2  69  ? 63.602  72.928  81.533  1.00 82.98  ? 67   HIS B ND1   1 
ATOM   3799  C  CD2   . HIS B  2  69  ? 64.980  74.007  80.226  1.00 84.14  ? 67   HIS B CD2   1 
ATOM   3800  C  CE1   . HIS B  2  69  ? 62.870  73.614  80.672  1.00 83.12  ? 67   HIS B CE1   1 
ATOM   3801  N  NE2   . HIS B  2  69  ? 63.681  74.277  79.868  1.00 82.34  ? 67   HIS B NE2   1 
ATOM   3802  N  N     . LEU B  2  70  ? 67.517  74.920  83.075  1.00 76.43  ? 68   LEU B N     1 
ATOM   3803  C  CA    . LEU B  2  70  ? 67.630  76.345  83.353  1.00 75.94  ? 68   LEU B CA    1 
ATOM   3804  C  C     . LEU B  2  70  ? 68.963  76.910  82.883  1.00 77.08  ? 68   LEU B C     1 
ATOM   3805  O  O     . LEU B  2  70  ? 69.046  78.068  82.455  1.00 77.23  ? 68   LEU B O     1 
ATOM   3806  C  CB    . LEU B  2  70  ? 67.472  76.614  84.847  1.00 73.72  ? 68   LEU B CB    1 
ATOM   3807  C  CG    . LEU B  2  70  ? 67.716  78.069  85.269  1.00 73.37  ? 68   LEU B CG    1 
ATOM   3808  C  CD1   . LEU B  2  70  ? 66.737  78.992  84.570  1.00 73.63  ? 68   LEU B CD1   1 
ATOM   3809  C  CD2   . LEU B  2  70  ? 67.580  78.198  86.778  1.00 72.77  ? 68   LEU B CD2   1 
ATOM   3810  N  N     . LEU B  2  71  ? 70.009  76.095  82.972  1.00 77.69  ? 69   LEU B N     1 
ATOM   3811  C  CA    . LEU B  2  71  ? 71.330  76.536  82.554  1.00 77.92  ? 69   LEU B CA    1 
ATOM   3812  C  C     . LEU B  2  71  ? 71.322  76.783  81.048  1.00 77.70  ? 69   LEU B C     1 
ATOM   3813  O  O     . LEU B  2  71  ? 72.039  77.651  80.530  1.00 77.61  ? 69   LEU B O     1 
ATOM   3814  C  CB    . LEU B  2  71  ? 72.381  75.483  82.923  1.00 77.70  ? 69   LEU B CB    1 
ATOM   3815  C  CG    . LEU B  2  71  ? 73.819  75.843  82.528  1.00 77.40  ? 69   LEU B CG    1 
ATOM   3816  C  CD1   . LEU B  2  71  ? 74.204  77.178  83.112  1.00 76.77  ? 69   LEU B CD1   1 
ATOM   3817  C  CD2   . LEU B  2  71  ? 74.759  74.776  83.014  1.00 77.59  ? 69   LEU B CD2   1 
ATOM   3818  N  N     . ARG B  2  72  ? 70.486  76.019  80.359  1.00 77.66  ? 70   ARG B N     1 
ATOM   3819  C  CA    . ARG B  2  72  ? 70.350  76.120  78.915  1.00 78.81  ? 70   ARG B CA    1 
ATOM   3820  C  C     . ARG B  2  72  ? 69.721  77.461  78.514  1.00 79.59  ? 70   ARG B C     1 
ATOM   3821  O  O     . ARG B  2  72  ? 70.197  78.137  77.595  1.00 80.02  ? 70   ARG B O     1 
ATOM   3822  C  CB    . ARG B  2  72  ? 69.497  74.952  78.427  1.00 79.29  ? 70   ARG B CB    1 
ATOM   3823  C  CG    . ARG B  2  72  ? 69.393  74.810  76.936  1.00 80.88  ? 70   ARG B CG    1 
ATOM   3824  C  CD    . ARG B  2  72  ? 68.868  73.414  76.579  1.00 83.88  ? 70   ARG B CD    1 
ATOM   3825  N  NE    . ARG B  2  72  ? 67.433  73.198  76.804  1.00 84.87  ? 70   ARG B NE    1 
ATOM   3826  C  CZ    . ARG B  2  72  ? 66.920  72.222  77.555  1.00 85.51  ? 70   ARG B CZ    1 
ATOM   3827  N  NH1   . ARG B  2  72  ? 67.714  71.362  78.182  1.00 85.72  ? 70   ARG B NH1   1 
ATOM   3828  N  NH2   . ARG B  2  72  ? 65.605  72.078  77.647  1.00 86.24  ? 70   ARG B NH2   1 
ATOM   3829  N  N     . LEU B  2  73  ? 68.661  77.853  79.218  1.00 79.03  ? 71   LEU B N     1 
ATOM   3830  C  CA    . LEU B  2  73  ? 67.972  79.101  78.924  1.00 78.31  ? 71   LEU B CA    1 
ATOM   3831  C  C     . LEU B  2  73  ? 68.747  80.299  79.424  1.00 78.45  ? 71   LEU B C     1 
ATOM   3832  O  O     . LEU B  2  73  ? 68.507  81.426  79.000  1.00 79.33  ? 71   LEU B O     1 
ATOM   3833  C  CB    . LEU B  2  73  ? 66.596  79.116  79.581  1.00 78.08  ? 71   LEU B CB    1 
ATOM   3834  C  CG    . LEU B  2  73  ? 65.644  77.957  79.282  1.00 78.81  ? 71   LEU B CG    1 
ATOM   3835  C  CD1   . LEU B  2  73  ? 64.286  78.227  79.939  1.00 78.34  ? 71   LEU B CD1   1 
ATOM   3836  C  CD2   . LEU B  2  73  ? 65.489  77.791  77.781  1.00 77.84  ? 71   LEU B CD2   1 
ATOM   3837  N  N     . ALA B  2  74  ? 69.677  80.053  80.333  1.00 78.35  ? 72   ALA B N     1 
ATOM   3838  C  CA    . ALA B  2  74  ? 70.464  81.126  80.916  1.00 77.79  ? 72   ALA B CA    1 
ATOM   3839  C  C     . ALA B  2  74  ? 71.604  81.651  80.041  1.00 77.55  ? 72   ALA B C     1 
ATOM   3840  O  O     . ALA B  2  74  ? 72.254  82.630  80.404  1.00 78.24  ? 72   ALA B O     1 
ATOM   3841  C  CB    . ALA B  2  74  ? 71.007  80.672  82.268  1.00 77.06  ? 72   ALA B CB    1 
ATOM   3842  N  N     . SER B  2  75  ? 71.852  81.028  78.894  1.00 76.35  ? 73   SER B N     1 
ATOM   3843  C  CA    . SER B  2  75  ? 72.940  81.483  78.036  1.00 76.64  ? 73   SER B CA    1 
ATOM   3844  C  C     . SER B  2  75  ? 73.094  82.999  77.833  1.00 77.22  ? 73   SER B C     1 
ATOM   3845  O  O     . SER B  2  75  ? 74.218  83.512  77.853  1.00 77.53  ? 73   SER B O     1 
ATOM   3846  C  CB    . SER B  2  75  ? 72.845  80.806  76.675  1.00 76.69  ? 73   SER B CB    1 
ATOM   3847  O  OG    . SER B  2  75  ? 71.506  80.763  76.234  1.00 80.62  ? 73   SER B OG    1 
ATOM   3848  N  N     . PRO B  2  76  ? 71.975  83.740  77.662  1.00 77.74  ? 74   PRO B N     1 
ATOM   3849  C  CA    . PRO B  2  76  ? 72.025  85.197  77.448  1.00 77.02  ? 74   PRO B CA    1 
ATOM   3850  C  C     . PRO B  2  76  ? 72.214  86.117  78.649  1.00 77.03  ? 74   PRO B C     1 
ATOM   3851  O  O     . PRO B  2  76  ? 72.266  87.340  78.471  1.00 75.49  ? 74   PRO B O     1 
ATOM   3852  C  CB    . PRO B  2  76  ? 70.714  85.475  76.726  1.00 76.73  ? 74   PRO B CB    1 
ATOM   3853  C  CG    . PRO B  2  76  ? 69.787  84.518  77.393  1.00 76.93  ? 74   PRO B CG    1 
ATOM   3854  C  CD    . PRO B  2  76  ? 70.596  83.242  77.487  1.00 77.44  ? 74   PRO B CD    1 
ATOM   3855  N  N     . LEU B  2  77  ? 72.309  85.539  79.852  1.00 78.15  ? 75   LEU B N     1 
ATOM   3856  C  CA    . LEU B  2  77  ? 72.506  86.303  81.099  1.00 79.43  ? 75   LEU B CA    1 
ATOM   3857  C  C     . LEU B  2  77  ? 73.935  86.856  81.185  1.00 81.02  ? 75   LEU B C     1 
ATOM   3858  O  O     . LEU B  2  77  ? 74.862  86.297  80.574  1.00 81.81  ? 75   LEU B O     1 
ATOM   3859  C  CB    . LEU B  2  77  ? 72.229  85.413  82.314  1.00 77.92  ? 75   LEU B CB    1 
ATOM   3860  C  CG    . LEU B  2  77  ? 70.809  84.858  82.424  1.00 77.77  ? 75   LEU B CG    1 
ATOM   3861  C  CD1   . LEU B  2  77  ? 70.708  83.829  83.535  1.00 77.35  ? 75   LEU B CD1   1 
ATOM   3862  C  CD2   . LEU B  2  77  ? 69.863  86.005  82.684  1.00 78.06  ? 75   LEU B CD2   1 
ATOM   3863  N  N     . THR B  2  78  ? 74.119  87.936  81.946  1.00 81.68  ? 76   THR B N     1 
ATOM   3864  C  CA    . THR B  2  78  ? 75.437  88.562  82.064  1.00 83.03  ? 76   THR B CA    1 
ATOM   3865  C  C     . THR B  2  78  ? 76.565  87.610  82.444  1.00 84.20  ? 76   THR B C     1 
ATOM   3866  O  O     . THR B  2  78  ? 76.383  86.668  83.229  1.00 83.25  ? 76   THR B O     1 
ATOM   3867  C  CB    . THR B  2  78  ? 75.459  89.732  83.083  1.00 82.99  ? 76   THR B CB    1 
ATOM   3868  O  OG1   . THR B  2  78  ? 75.090  89.254  84.383  1.00 82.16  ? 76   THR B OG1   1 
ATOM   3869  C  CG2   . THR B  2  78  ? 74.520  90.841  82.648  1.00 83.06  ? 76   THR B CG2   1 
ATOM   3870  N  N     . THR B  2  79  ? 77.733  87.892  81.863  1.00 85.27  ? 77   THR B N     1 
ATOM   3871  C  CA    . THR B  2  79  ? 78.963  87.133  82.070  1.00 84.64  ? 77   THR B CA    1 
ATOM   3872  C  C     . THR B  2  79  ? 80.011  88.133  82.532  1.00 86.46  ? 77   THR B C     1 
ATOM   3873  O  O     . THR B  2  79  ? 79.852  89.337  82.327  1.00 86.77  ? 77   THR B O     1 
ATOM   3874  C  CB    . THR B  2  79  ? 79.446  86.501  80.759  1.00 82.17  ? 77   THR B CB    1 
ATOM   3875  O  OG1   . THR B  2  79  ? 79.647  87.530  79.781  1.00 77.26  ? 77   THR B OG1   1 
ATOM   3876  C  CG2   . THR B  2  79  ? 78.418  85.516  80.241  1.00 82.54  ? 77   THR B CG2   1 
ATOM   3877  N  N     . LYS B  2  80  ? 81.082  87.641  83.146  1.00 87.91  ? 78   LYS B N     1 
ATOM   3878  C  CA    . LYS B  2  80  ? 82.143  88.520  83.633  1.00 88.91  ? 78   LYS B CA    1 
ATOM   3879  C  C     . LYS B  2  80  ? 82.734  89.416  82.537  1.00 88.38  ? 78   LYS B C     1 
ATOM   3880  O  O     . LYS B  2  80  ? 83.119  90.558  82.803  1.00 87.58  ? 78   LYS B O     1 
ATOM   3881  C  CB    . LYS B  2  80  ? 83.242  87.682  84.303  1.00 90.41  ? 78   LYS B CB    1 
ATOM   3882  C  CG    . LYS B  2  80  ? 82.762  86.955  85.560  1.00 92.39  ? 78   LYS B CG    1 
ATOM   3883  C  CD    . LYS B  2  80  ? 83.764  85.930  86.084  1.00 94.27  ? 78   LYS B CD    1 
ATOM   3884  C  CE    . LYS B  2  80  ? 83.159  85.109  87.226  1.00 95.71  ? 78   LYS B CE    1 
ATOM   3885  N  NZ    . LYS B  2  80  ? 83.976  83.915  87.601  1.00 96.82  ? 78   LYS B NZ    1 
ATOM   3886  N  N     . GLY B  2  81  ? 82.788  88.909  81.309  1.00 88.20  ? 79   GLY B N     1 
ATOM   3887  C  CA    . GLY B  2  81  ? 83.338  89.696  80.217  1.00 89.60  ? 79   GLY B CA    1 
ATOM   3888  C  C     . GLY B  2  81  ? 82.342  90.580  79.477  1.00 90.74  ? 79   GLY B C     1 
ATOM   3889  O  O     . GLY B  2  81  ? 82.661  91.713  79.098  1.00 90.73  ? 79   GLY B O     1 
ATOM   3890  N  N     . ALA B  2  82  ? 81.131  90.065  79.268  1.00 91.13  ? 80   ALA B N     1 
ATOM   3891  C  CA    . ALA B  2  82  ? 80.091  90.799  78.560  1.00 90.14  ? 80   ALA B CA    1 
ATOM   3892  C  C     . ALA B  2  82  ? 78.788  90.798  79.345  1.00 90.22  ? 80   ALA B C     1 
ATOM   3893  O  O     . ALA B  2  82  ? 78.516  89.887  80.132  1.00 90.27  ? 80   ALA B O     1 
ATOM   3894  C  CB    . ALA B  2  82  ? 79.866  90.184  77.182  1.00 89.31  ? 80   ALA B CB    1 
ATOM   3895  N  N     . SER B  2  83  ? 77.982  91.829  79.110  1.00 90.01  ? 81   SER B N     1 
ATOM   3896  C  CA    . SER B  2  83  ? 76.696  91.990  79.777  1.00 88.52  ? 81   SER B CA    1 
ATOM   3897  C  C     . SER B  2  83  ? 75.543  91.407  78.966  1.00 88.85  ? 81   SER B C     1 
ATOM   3898  O  O     . SER B  2  83  ? 75.625  91.253  77.741  1.00 88.74  ? 81   SER B O     1 
ATOM   3899  C  CB    . SER B  2  83  ? 76.431  93.475  80.026  1.00 87.53  ? 81   SER B CB    1 
ATOM   3900  O  OG    . SER B  2  83  ? 76.531  94.214  78.815  1.00 85.75  ? 81   SER B OG    1 
ATOM   3901  N  N     . SER B  2  84  ? 74.460  91.100  79.671  1.00 89.24  ? 82   SER B N     1 
ATOM   3902  C  CA    . SER B  2  84  ? 73.241  90.550  79.071  1.00 89.08  ? 82   SER B CA    1 
ATOM   3903  C  C     . SER B  2  84  ? 72.898  91.360  77.812  1.00 87.25  ? 82   SER B C     1 
ATOM   3904  O  O     . SER B  2  84  ? 72.473  90.823  76.778  1.00 85.21  ? 82   SER B O     1 
ATOM   3905  C  CB    . SER B  2  84  ? 72.102  90.645  80.100  1.00 89.95  ? 82   SER B CB    1 
ATOM   3906  O  OG    . SER B  2  84  ? 70.972  89.882  79.720  1.00 91.39  ? 82   SER B OG    1 
ATOM   3907  N  N     . PHE B  2  85  ? 73.104  92.664  77.931  1.00 85.59  ? 83   PHE B N     1 
ATOM   3908  C  CA    . PHE B  2  85  ? 72.848  93.591  76.854  1.00 84.47  ? 83   PHE B CA    1 
ATOM   3909  C  C     . PHE B  2  85  ? 73.827  93.384  75.707  1.00 84.39  ? 83   PHE B C     1 
ATOM   3910  O  O     . PHE B  2  85  ? 73.417  93.012  74.606  1.00 84.59  ? 83   PHE B O     1 
ATOM   3911  C  CB    . PHE B  2  85  ? 72.954  95.022  77.381  1.00 84.18  ? 83   PHE B CB    1 
ATOM   3912  C  CG    . PHE B  2  85  ? 72.684  96.079  76.347  1.00 84.71  ? 83   PHE B CG    1 
ATOM   3913  C  CD1   . PHE B  2  85  ? 71.427  96.217  75.777  1.00 85.80  ? 83   PHE B CD1   1 
ATOM   3914  C  CD2   . PHE B  2  85  ? 73.683  96.961  75.965  1.00 85.76  ? 83   PHE B CD2   1 
ATOM   3915  C  CE1   . PHE B  2  85  ? 71.171  97.224  74.842  1.00 86.22  ? 83   PHE B CE1   1 
ATOM   3916  C  CE2   . PHE B  2  85  ? 73.435  97.970  75.030  1.00 86.26  ? 83   PHE B CE2   1 
ATOM   3917  C  CZ    . PHE B  2  85  ? 72.180  98.101  74.472  1.00 85.50  ? 83   PHE B CZ    1 
ATOM   3918  N  N     . ARG B  2  86  ? 75.119  93.600  75.968  1.00 83.68  ? 84   ARG B N     1 
ATOM   3919  C  CA    . ARG B  2  86  ? 76.122  93.482  74.915  1.00 81.89  ? 84   ARG B CA    1 
ATOM   3920  C  C     . ARG B  2  86  ? 76.152  92.135  74.233  1.00 79.55  ? 84   ARG B C     1 
ATOM   3921  O  O     . ARG B  2  86  ? 76.428  92.052  73.044  1.00 78.51  ? 84   ARG B O     1 
ATOM   3922  C  CB    . ARG B  2  86  ? 77.522  93.835  75.428  1.00 84.31  ? 84   ARG B CB    1 
ATOM   3923  C  CG    . ARG B  2  86  ? 78.439  94.310  74.284  1.00 87.55  ? 84   ARG B CG    1 
ATOM   3924  C  CD    . ARG B  2  86  ? 79.821  94.805  74.720  1.00 88.66  ? 84   ARG B CD    1 
ATOM   3925  N  NE    . ARG B  2  86  ? 80.788  93.715  74.851  1.00 90.16  ? 84   ARG B NE    1 
ATOM   3926  C  CZ    . ARG B  2  86  ? 81.124  93.139  76.003  1.00 91.32  ? 84   ARG B CZ    1 
ATOM   3927  N  NH1   . ARG B  2  86  ? 80.576  93.542  77.154  1.00 90.87  ? 84   ARG B NH1   1 
ATOM   3928  N  NH2   . ARG B  2  86  ? 82.016  92.158  76.007  1.00 90.65  ? 84   ARG B NH2   1 
ATOM   3929  N  N     . ILE B  2  87  ? 75.858  91.075  74.969  1.00 78.51  ? 85   ILE B N     1 
ATOM   3930  C  CA    . ILE B  2  87  ? 75.854  89.760  74.351  1.00 78.96  ? 85   ILE B CA    1 
ATOM   3931  C  C     . ILE B  2  87  ? 74.868  89.731  73.176  1.00 79.68  ? 85   ILE B C     1 
ATOM   3932  O  O     . ILE B  2  87  ? 75.253  89.451  72.030  1.00 80.43  ? 85   ILE B O     1 
ATOM   3933  C  CB    . ILE B  2  87  ? 75.444  88.650  75.347  1.00 78.25  ? 85   ILE B CB    1 
ATOM   3934  C  CG1   . ILE B  2  87  ? 76.449  88.571  76.495  1.00 77.43  ? 85   ILE B CG1   1 
ATOM   3935  C  CG2   . ILE B  2  87  ? 75.354  87.315  74.619  1.00 78.03  ? 85   ILE B CG2   1 
ATOM   3936  C  CD1   . ILE B  2  87  ? 76.134  87.498  77.525  1.00 76.07  ? 85   ILE B CD1   1 
ATOM   3937  N  N     . THR B  2  88  ? 73.601  90.032  73.466  1.00 79.25  ? 86   THR B N     1 
ATOM   3938  C  CA    . THR B  2  88  ? 72.553  90.020  72.445  1.00 77.61  ? 86   THR B CA    1 
ATOM   3939  C  C     . THR B  2  88  ? 72.728  91.118  71.398  1.00 76.19  ? 86   THR B C     1 
ATOM   3940  O  O     . THR B  2  88  ? 72.605  90.866  70.202  1.00 74.60  ? 86   THR B O     1 
ATOM   3941  C  CB    . THR B  2  88  ? 71.148  90.148  73.078  1.00 77.60  ? 86   THR B CB    1 
ATOM   3942  O  OG1   . THR B  2  88  ? 70.975  89.126  74.072  1.00 77.83  ? 86   THR B OG1   1 
ATOM   3943  C  CG2   . THR B  2  88  ? 70.072  90.001  72.009  1.00 75.74  ? 86   THR B CG2   1 
ATOM   3944  N  N     . ARG B  2  89  ? 73.015  92.334  71.838  1.00 75.49  ? 87   ARG B N     1 
ATOM   3945  C  CA    . ARG B  2  89  ? 73.202  93.410  70.887  1.00 76.91  ? 87   ARG B CA    1 
ATOM   3946  C  C     . ARG B  2  89  ? 74.415  93.120  70.036  1.00 78.06  ? 87   ARG B C     1 
ATOM   3947  O  O     . ARG B  2  89  ? 74.334  93.128  68.809  1.00 78.53  ? 87   ARG B O     1 
ATOM   3948  C  CB    . ARG B  2  89  ? 73.396  94.743  71.600  1.00 77.22  ? 87   ARG B CB    1 
ATOM   3949  C  CG    . ARG B  2  89  ? 72.121  95.306  72.194  1.00 78.60  ? 87   ARG B CG    1 
ATOM   3950  C  CD    . ARG B  2  89  ? 71.010  95.424  71.141  1.00 78.21  ? 87   ARG B CD    1 
ATOM   3951  N  NE    . ARG B  2  89  ? 69.830  96.090  71.684  1.00 76.06  ? 87   ARG B NE    1 
ATOM   3952  C  CZ    . ARG B  2  89  ? 69.709  97.407  71.829  1.00 74.51  ? 87   ARG B CZ    1 
ATOM   3953  N  NH1   . ARG B  2  89  ? 70.688  98.224  71.466  1.00 71.81  ? 87   ARG B NH1   1 
ATOM   3954  N  NH2   . ARG B  2  89  ? 68.608  97.909  72.358  1.00 74.99  ? 87   ARG B NH2   1 
ATOM   3955  N  N     . GLY B  2  90  ? 75.535  92.858  70.706  1.00 79.00  ? 88   GLY B N     1 
ATOM   3956  C  CA    . GLY B  2  90  ? 76.789  92.572  70.028  1.00 79.26  ? 88   GLY B CA    1 
ATOM   3957  C  C     . GLY B  2  90  ? 76.720  91.490  68.969  1.00 79.50  ? 88   GLY B C     1 
ATOM   3958  O  O     . GLY B  2  90  ? 77.268  91.654  67.872  1.00 79.86  ? 88   GLY B O     1 
ATOM   3959  N  N     . ILE B  2  91  ? 76.061  90.381  69.287  1.00 78.55  ? 89   ILE B N     1 
ATOM   3960  C  CA    . ILE B  2  91  ? 75.940  89.297  68.323  1.00 79.29  ? 89   ILE B CA    1 
ATOM   3961  C  C     . ILE B  2  91  ? 75.067  89.692  67.131  1.00 81.12  ? 89   ILE B C     1 
ATOM   3962  O  O     . ILE B  2  91  ? 75.425  89.434  65.975  1.00 82.05  ? 89   ILE B O     1 
ATOM   3963  C  CB    . ILE B  2  91  ? 75.361  88.026  68.981  1.00 78.22  ? 89   ILE B CB    1 
ATOM   3964  C  CG1   . ILE B  2  91  ? 76.446  87.353  69.831  1.00 77.89  ? 89   ILE B CG1   1 
ATOM   3965  C  CG2   . ILE B  2  91  ? 74.807  87.081  67.909  1.00 77.51  ? 89   ILE B CG2   1 
ATOM   3966  C  CD1   . ILE B  2  91  ? 76.042  86.036  70.471  1.00 75.43  ? 89   ILE B CD1   1 
ATOM   3967  N  N     . GLU B  2  92  ? 73.928  90.323  67.417  1.00 82.23  ? 90   GLU B N     1 
ATOM   3968  C  CA    . GLU B  2  92  ? 72.992  90.748  66.378  1.00 81.35  ? 90   GLU B CA    1 
ATOM   3969  C  C     . GLU B  2  92  ? 73.571  91.829  65.482  1.00 79.87  ? 90   GLU B C     1 
ATOM   3970  O  O     . GLU B  2  92  ? 73.137  92.003  64.339  1.00 78.54  ? 90   GLU B O     1 
ATOM   3971  C  CB    . GLU B  2  92  ? 71.701  91.264  67.008  1.00 83.25  ? 90   GLU B CB    1 
ATOM   3972  C  CG    . GLU B  2  92  ? 70.901  90.216  67.746  1.00 86.58  ? 90   GLU B CG    1 
ATOM   3973  C  CD    . GLU B  2  92  ? 69.503  90.699  68.078  1.00 88.57  ? 90   GLU B CD    1 
ATOM   3974  O  OE1   . GLU B  2  92  ? 69.378  91.781  68.697  1.00 89.69  ? 90   GLU B OE1   1 
ATOM   3975  O  OE2   . GLU B  2  92  ? 68.532  89.995  67.720  1.00 90.15  ? 90   GLU B OE2   1 
ATOM   3976  N  N     . ALA B  2  93  ? 74.551  92.550  66.017  1.00 78.74  ? 91   ALA B N     1 
ATOM   3977  C  CA    . ALA B  2  93  ? 75.205  93.637  65.303  1.00 78.66  ? 91   ALA B CA    1 
ATOM   3978  C  C     . ALA B  2  93  ? 75.901  93.181  64.024  1.00 78.81  ? 91   ALA B C     1 
ATOM   3979  O  O     . ALA B  2  93  ? 76.124  93.975  63.108  1.00 77.64  ? 91   ALA B O     1 
ATOM   3980  C  CB    . ALA B  2  93  ? 76.208  94.319  66.221  1.00 78.00  ? 91   ALA B CB    1 
ATOM   3981  N  N     . VAL B  2  94  ? 76.237  91.898  63.966  1.00 79.89  ? 92   VAL B N     1 
ATOM   3982  C  CA    . VAL B  2  94  ? 76.932  91.336  62.814  1.00 80.13  ? 92   VAL B CA    1 
ATOM   3983  C  C     . VAL B  2  94  ? 76.114  90.247  62.142  1.00 80.45  ? 92   VAL B C     1 
ATOM   3984  O  O     . VAL B  2  94  ? 76.630  89.458  61.356  1.00 81.12  ? 92   VAL B O     1 
ATOM   3985  C  CB    . VAL B  2  94  ? 78.288  90.737  63.239  1.00 80.00  ? 92   VAL B CB    1 
ATOM   3986  C  CG1   . VAL B  2  94  ? 79.214  91.847  63.756  1.00 78.06  ? 92   VAL B CG1   1 
ATOM   3987  C  CG2   . VAL B  2  94  ? 78.065  89.671  64.312  1.00 78.60  ? 92   VAL B CG2   1 
ATOM   3988  N  N     . GLY B  2  95  ? 74.830  90.204  62.457  1.00 81.18  ? 93   GLY B N     1 
ATOM   3989  C  CA    . GLY B  2  95  ? 73.978  89.194  61.861  1.00 80.38  ? 93   GLY B CA    1 
ATOM   3990  C  C     . GLY B  2  95  ? 74.376  87.827  62.360  1.00 79.01  ? 93   GLY B C     1 
ATOM   3991  O  O     . GLY B  2  95  ? 74.325  86.849  61.623  1.00 78.31  ? 93   GLY B O     1 
ATOM   3992  N  N     . GLY B  2  96  ? 74.782  87.767  63.622  1.00 78.86  ? 94   GLY B N     1 
ATOM   3993  C  CA    . GLY B  2  96  ? 75.185  86.501  64.196  1.00 79.08  ? 94   GLY B CA    1 
ATOM   3994  C  C     . GLY B  2  96  ? 74.010  85.748  64.784  1.00 79.30  ? 94   GLY B C     1 
ATOM   3995  O  O     . GLY B  2  96  ? 72.862  86.153  64.621  1.00 79.37  ? 94   GLY B O     1 
ATOM   3996  N  N     . SER B  2  97  ? 74.304  84.636  65.450  1.00 78.89  ? 95   SER B N     1 
ATOM   3997  C  CA    . SER B  2  97  ? 73.290  83.819  66.095  1.00 78.20  ? 95   SER B CA    1 
ATOM   3998  C  C     . SER B  2  97  ? 73.962  83.200  67.311  1.00 78.20  ? 95   SER B C     1 
ATOM   3999  O  O     . SER B  2  97  ? 75.153  83.375  67.508  1.00 78.74  ? 95   SER B O     1 
ATOM   4000  C  CB    . SER B  2  97  ? 72.796  82.722  65.158  1.00 77.66  ? 95   SER B CB    1 
ATOM   4001  O  OG    . SER B  2  97  ? 73.693  81.638  65.164  1.00 78.95  ? 95   SER B OG    1 
ATOM   4002  N  N     . LEU B  2  98  ? 73.200  82.487  68.128  1.00 78.54  ? 96   LEU B N     1 
ATOM   4003  C  CA    . LEU B  2  98  ? 73.743  81.866  69.325  1.00 78.35  ? 96   LEU B CA    1 
ATOM   4004  C  C     . LEU B  2  98  ? 72.704  80.962  69.939  1.00 79.22  ? 96   LEU B C     1 
ATOM   4005  O  O     . LEU B  2  98  ? 71.658  81.423  70.370  1.00 81.70  ? 96   LEU B O     1 
ATOM   4006  C  CB    . LEU B  2  98  ? 74.154  82.928  70.339  1.00 77.67  ? 96   LEU B CB    1 
ATOM   4007  C  CG    . LEU B  2  98  ? 74.383  82.415  71.767  1.00 78.49  ? 96   LEU B CG    1 
ATOM   4008  C  CD1   . LEU B  2  98  ? 75.186  81.124  71.748  1.00 78.96  ? 96   LEU B CD1   1 
ATOM   4009  C  CD2   . LEU B  2  98  ? 75.104  83.483  72.578  1.00 79.17  ? 96   LEU B CD2   1 
ATOM   4010  N  N     . SER B  2  99  ? 73.004  79.674  69.998  1.00 79.76  ? 97   SER B N     1 
ATOM   4011  C  CA    . SER B  2  99  ? 72.064  78.710  70.540  1.00 80.08  ? 97   SER B CA    1 
ATOM   4012  C  C     . SER B  2  99  ? 72.698  77.646  71.439  1.00 80.36  ? 97   SER B C     1 
ATOM   4013  O  O     . SER B  2  99  ? 73.914  77.538  71.540  1.00 80.57  ? 97   SER B O     1 
ATOM   4014  C  CB    . SER B  2  99  ? 71.322  78.060  69.378  1.00 80.87  ? 97   SER B CB    1 
ATOM   4015  O  OG    . SER B  2  99  ? 72.052  78.249  68.172  1.00 80.57  ? 97   SER B OG    1 
ATOM   4016  N  N     . VAL B  2  100 ? 71.854  76.859  72.092  1.00 79.96  ? 98   VAL B N     1 
ATOM   4017  C  CA    . VAL B  2  100 ? 72.315  75.822  72.996  1.00 79.91  ? 98   VAL B CA    1 
ATOM   4018  C  C     . VAL B  2  100 ? 71.472  74.572  72.807  1.00 82.08  ? 98   VAL B C     1 
ATOM   4019  O  O     . VAL B  2  100 ? 70.319  74.530  73.230  1.00 83.05  ? 98   VAL B O     1 
ATOM   4020  C  CB    . VAL B  2  100 ? 72.194  76.295  74.465  1.00 78.58  ? 98   VAL B CB    1 
ATOM   4021  C  CG1   . VAL B  2  100 ? 72.440  75.146  75.425  1.00 78.44  ? 98   VAL B CG1   1 
ATOM   4022  C  CG2   . VAL B  2  100 ? 73.174  77.408  74.719  1.00 77.17  ? 98   VAL B CG2   1 
ATOM   4023  N  N     . TYR B  2  101 ? 72.038  73.557  72.160  1.00 83.62  ? 99   TYR B N     1 
ATOM   4024  C  CA    . TYR B  2  101 ? 71.318  72.307  71.949  1.00 85.07  ? 99   TYR B CA    1 
ATOM   4025  C  C     . TYR B  2  101 ? 71.833  71.323  72.978  1.00 85.19  ? 99   TYR B C     1 
ATOM   4026  O  O     . TYR B  2  101 ? 73.021  71.318  73.272  1.00 86.11  ? 99   TYR B O     1 
ATOM   4027  C  CB    . TYR B  2  101 ? 71.584  71.754  70.553  1.00 86.37  ? 99   TYR B CB    1 
ATOM   4028  C  CG    . TYR B  2  101 ? 71.397  72.758  69.447  1.00 88.67  ? 99   TYR B CG    1 
ATOM   4029  C  CD1   . TYR B  2  101 ? 72.380  73.711  69.179  1.00 89.16  ? 99   TYR B CD1   1 
ATOM   4030  C  CD2   . TYR B  2  101 ? 70.227  72.764  68.668  1.00 89.44  ? 99   TYR B CD2   1 
ATOM   4031  C  CE1   . TYR B  2  101 ? 72.212  74.657  68.154  1.00 91.02  ? 99   TYR B CE1   1 
ATOM   4032  C  CE2   . TYR B  2  101 ? 70.045  73.705  67.636  1.00 91.02  ? 99   TYR B CE2   1 
ATOM   4033  C  CZ    . TYR B  2  101 ? 71.042  74.653  67.383  1.00 91.33  ? 99   TYR B CZ    1 
ATOM   4034  O  OH    . TYR B  2  101 ? 70.874  75.592  66.375  1.00 90.11  ? 99   TYR B OH    1 
ATOM   4035  N  N     . SER B  2  102 ? 70.961  70.487  73.528  1.00 85.13  ? 100  SER B N     1 
ATOM   4036  C  CA    . SER B  2  102 ? 71.425  69.530  74.516  1.00 85.79  ? 100  SER B CA    1 
ATOM   4037  C  C     . SER B  2  102 ? 70.573  68.280  74.692  1.00 86.67  ? 100  SER B C     1 
ATOM   4038  O  O     . SER B  2  102 ? 69.349  68.330  74.636  1.00 86.86  ? 100  SER B O     1 
ATOM   4039  C  CB    . SER B  2  102 ? 71.601  70.224  75.867  1.00 85.24  ? 100  SER B CB    1 
ATOM   4040  O  OG    . SER B  2  102 ? 70.367  70.646  76.396  1.00 84.47  ? 100  SER B OG    1 
ATOM   4041  N  N     . THR B  2  103 ? 71.253  67.156  74.904  1.00 87.53  ? 101  THR B N     1 
ATOM   4042  C  CA    . THR B  2  103 ? 70.615  65.862  75.112  1.00 88.65  ? 101  THR B CA    1 
ATOM   4043  C  C     . THR B  2  103 ? 70.646  65.595  76.611  1.00 88.32  ? 101  THR B C     1 
ATOM   4044  O  O     . THR B  2  103 ? 70.935  66.494  77.396  1.00 88.54  ? 101  THR B O     1 
ATOM   4045  C  CB    . THR B  2  103 ? 71.401  64.751  74.417  1.00 89.72  ? 101  THR B CB    1 
ATOM   4046  O  OG1   . THR B  2  103 ? 72.630  64.533  75.125  1.00 90.80  ? 101  THR B OG1   1 
ATOM   4047  C  CG2   . THR B  2  103 ? 71.718  65.145  72.977  1.00 90.18  ? 101  THR B CG2   1 
ATOM   4048  N  N     . ARG B  2  104 ? 70.360  64.368  77.023  1.00 88.06  ? 102  ARG B N     1 
ATOM   4049  C  CA    . ARG B  2  104 ? 70.397  64.092  78.441  1.00 88.77  ? 102  ARG B CA    1 
ATOM   4050  C  C     . ARG B  2  104 ? 71.827  64.034  78.918  1.00 89.50  ? 102  ARG B C     1 
ATOM   4051  O  O     . ARG B  2  104 ? 72.071  64.079  80.117  1.00 90.16  ? 102  ARG B O     1 
ATOM   4052  C  CB    . ARG B  2  104 ? 69.716  62.774  78.759  1.00 89.28  ? 102  ARG B CB    1 
ATOM   4053  C  CG    . ARG B  2  104 ? 68.391  62.648  78.098  1.00 92.30  ? 102  ARG B CG    1 
ATOM   4054  C  CD    . ARG B  2  104 ? 67.439  61.829  78.904  1.00 93.93  ? 102  ARG B CD    1 
ATOM   4055  N  NE    . ARG B  2  104 ? 66.149  61.896  78.247  1.00 98.89  ? 102  ARG B NE    1 
ATOM   4056  C  CZ    . ARG B  2  104 ? 64.985  61.746  78.864  1.00 102.50 ? 102  ARG B CZ    1 
ATOM   4057  N  NH1   . ARG B  2  104 ? 64.946  61.514  80.171  1.00 104.29 ? 102  ARG B NH1   1 
ATOM   4058  N  NH2   . ARG B  2  104 ? 63.854  61.851  78.173  1.00 104.85 ? 102  ARG B NH2   1 
ATOM   4059  N  N     . GLU B  2  105 ? 72.781  63.956  77.992  1.00 90.34  ? 103  GLU B N     1 
ATOM   4060  C  CA    . GLU B  2  105 ? 74.177  63.847  78.397  1.00 90.97  ? 103  GLU B CA    1 
ATOM   4061  C  C     . GLU B  2  105 ? 75.199  64.685  77.655  1.00 91.79  ? 103  GLU B C     1 
ATOM   4062  O  O     . GLU B  2  105 ? 76.400  64.461  77.800  1.00 92.86  ? 103  GLU B O     1 
ATOM   4063  C  CB    . GLU B  2  105 ? 74.614  62.376  78.355  1.00 91.41  ? 103  GLU B CB    1 
ATOM   4064  C  CG    . GLU B  2  105 ? 74.672  61.762  76.964  1.00 91.92  ? 103  GLU B CG    1 
ATOM   4065  C  CD    . GLU B  2  105 ? 74.744  60.239  76.986  1.00 92.58  ? 103  GLU B CD    1 
ATOM   4066  O  OE1   . GLU B  2  105 ? 74.908  59.641  75.899  1.00 94.31  ? 103  GLU B OE1   1 
ATOM   4067  O  OE2   . GLU B  2  105 ? 74.627  59.638  78.080  1.00 92.18  ? 103  GLU B OE2   1 
ATOM   4068  N  N     . LYS B  2  106 ? 74.748  65.644  76.860  1.00 92.62  ? 104  LYS B N     1 
ATOM   4069  C  CA    . LYS B  2  106 ? 75.691  66.499  76.148  1.00 94.25  ? 104  LYS B CA    1 
ATOM   4070  C  C     . LYS B  2  106 ? 75.062  67.865  75.912  1.00 93.32  ? 104  LYS B C     1 
ATOM   4071  O  O     . LYS B  2  106 ? 73.868  67.966  75.671  1.00 94.56  ? 104  LYS B O     1 
ATOM   4072  C  CB    . LYS B  2  106 ? 76.125  65.847  74.815  1.00 96.70  ? 104  LYS B CB    1 
ATOM   4073  C  CG    . LYS B  2  106 ? 75.092  65.854  73.680  1.00 101.21 ? 104  LYS B CG    1 
ATOM   4074  C  CD    . LYS B  2  106 ? 75.050  67.208  72.927  1.00 105.38 ? 104  LYS B CD    1 
ATOM   4075  C  CE    . LYS B  2  106 ? 74.093  67.193  71.713  1.00 107.36 ? 104  LYS B CE    1 
ATOM   4076  N  NZ    . LYS B  2  106 ? 74.191  68.425  70.852  1.00 106.98 ? 104  LYS B NZ    1 
ATOM   4077  N  N     . MET B  2  107 ? 75.860  68.919  76.004  1.00 91.94  ? 105  MET B N     1 
ATOM   4078  C  CA    . MET B  2  107 ? 75.358  70.267  75.790  1.00 90.91  ? 105  MET B CA    1 
ATOM   4079  C  C     . MET B  2  107 ? 76.233  70.973  74.783  1.00 90.12  ? 105  MET B C     1 
ATOM   4080  O  O     . MET B  2  107 ? 77.441  71.004  74.932  1.00 91.49  ? 105  MET B O     1 
ATOM   4081  C  CB    . MET B  2  107 ? 75.369  71.061  77.094  1.00 91.99  ? 105  MET B CB    1 
ATOM   4082  C  CG    . MET B  2  107 ? 74.191  70.796  78.006  1.00 93.76  ? 105  MET B CG    1 
ATOM   4083  S  SD    . MET B  2  107 ? 74.313  71.729  79.557  1.00 97.03  ? 105  MET B SD    1 
ATOM   4084  C  CE    . MET B  2  107 ? 74.428  73.409  78.947  1.00 92.70  ? 105  MET B CE    1 
ATOM   4085  N  N     . THR B  2  108 ? 75.633  71.555  73.761  1.00 89.03  ? 106  THR B N     1 
ATOM   4086  C  CA    . THR B  2  108 ? 76.421  72.252  72.764  1.00 88.22  ? 106  THR B CA    1 
ATOM   4087  C  C     . THR B  2  108 ? 76.089  73.739  72.706  1.00 88.57  ? 106  THR B C     1 
ATOM   4088  O  O     . THR B  2  108 ? 74.926  74.132  72.627  1.00 89.02  ? 106  THR B O     1 
ATOM   4089  C  CB    . THR B  2  108 ? 76.198  71.659  71.370  1.00 88.05  ? 106  THR B CB    1 
ATOM   4090  O  OG1   . THR B  2  108 ? 76.216  70.228  71.447  1.00 87.62  ? 106  THR B OG1   1 
ATOM   4091  C  CG2   . THR B  2  108 ? 77.285  72.144  70.418  1.00 86.52  ? 106  THR B CG2   1 
ATOM   4092  N  N     . TYR B  2  109 ? 77.122  74.564  72.745  1.00 88.24  ? 107  TYR B N     1 
ATOM   4093  C  CA    . TYR B  2  109 ? 76.949  76.002  72.670  1.00 88.71  ? 107  TYR B CA    1 
ATOM   4094  C  C     . TYR B  2  109 ? 77.567  76.487  71.374  1.00 89.95  ? 107  TYR B C     1 
ATOM   4095  O  O     . TYR B  2  109 ? 78.780  76.633  71.298  1.00 90.55  ? 107  TYR B O     1 
ATOM   4096  C  CB    . TYR B  2  109 ? 77.672  76.700  73.819  1.00 87.65  ? 107  TYR B CB    1 
ATOM   4097  C  CG    . TYR B  2  109 ? 76.986  76.634  75.155  1.00 87.26  ? 107  TYR B CG    1 
ATOM   4098  C  CD1   . TYR B  2  109 ? 76.770  75.415  75.797  1.00 86.96  ? 107  TYR B CD1   1 
ATOM   4099  C  CD2   . TYR B  2  109 ? 76.576  77.802  75.795  1.00 87.20  ? 107  TYR B CD2   1 
ATOM   4100  C  CE1   . TYR B  2  109 ? 76.163  75.364  77.049  1.00 87.49  ? 107  TYR B CE1   1 
ATOM   4101  C  CE2   . TYR B  2  109 ? 75.970  77.766  77.042  1.00 87.78  ? 107  TYR B CE2   1 
ATOM   4102  C  CZ    . TYR B  2  109 ? 75.765  76.549  77.665  1.00 88.41  ? 107  TYR B CZ    1 
ATOM   4103  O  OH    . TYR B  2  109 ? 75.159  76.534  78.904  1.00 90.30  ? 107  TYR B OH    1 
ATOM   4104  N  N     . CYS B  2  110 ? 76.760  76.747  70.354  1.00 91.50  ? 108  CYS B N     1 
ATOM   4105  C  CA    . CYS B  2  110 ? 77.330  77.230  69.102  1.00 94.00  ? 108  CYS B CA    1 
ATOM   4106  C  C     . CYS B  2  110 ? 76.836  78.598  68.652  1.00 93.27  ? 108  CYS B C     1 
ATOM   4107  O  O     . CYS B  2  110 ? 75.844  79.115  69.148  1.00 93.48  ? 108  CYS B O     1 
ATOM   4108  C  CB    . CYS B  2  110 ? 77.133  76.201  67.980  1.00 95.98  ? 108  CYS B CB    1 
ATOM   4109  S  SG    . CYS B  2  110 ? 75.479  75.549  67.823  1.00 102.92 ? 108  CYS B SG    1 
ATOM   4110  N  N     . VAL B  2  111 ? 77.559  79.179  67.704  1.00 92.90  ? 109  VAL B N     1 
ATOM   4111  C  CA    . VAL B  2  111 ? 77.240  80.487  67.175  1.00 92.52  ? 109  VAL B CA    1 
ATOM   4112  C  C     . VAL B  2  111 ? 77.602  80.498  65.700  1.00 94.09  ? 109  VAL B C     1 
ATOM   4113  O  O     . VAL B  2  111 ? 78.614  79.917  65.318  1.00 95.36  ? 109  VAL B O     1 
ATOM   4114  C  CB    . VAL B  2  111 ? 78.071  81.574  67.896  1.00 91.53  ? 109  VAL B CB    1 
ATOM   4115  C  CG1   . VAL B  2  111 ? 77.953  81.391  69.393  1.00 90.46  ? 109  VAL B CG1   1 
ATOM   4116  C  CG2   . VAL B  2  111 ? 79.537  81.508  67.472  1.00 89.65  ? 109  VAL B CG2   1 
ATOM   4117  N  N     . GLU B  2  112 ? 76.774  81.131  64.870  1.00 95.06  ? 110  GLU B N     1 
ATOM   4118  C  CA    . GLU B  2  112 ? 77.062  81.231  63.438  1.00 95.90  ? 110  GLU B CA    1 
ATOM   4119  C  C     . GLU B  2  112 ? 77.298  82.690  63.114  1.00 95.98  ? 110  GLU B C     1 
ATOM   4120  O  O     . GLU B  2  112 ? 76.979  83.565  63.915  1.00 95.18  ? 110  GLU B O     1 
ATOM   4121  C  CB    . GLU B  2  112 ? 75.907  80.711  62.568  1.00 97.94  ? 110  GLU B CB    1 
ATOM   4122  C  CG    . GLU B  2  112 ? 75.740  79.189  62.555  1.00 101.54 ? 110  GLU B CG    1 
ATOM   4123  C  CD    . GLU B  2  112 ? 75.185  78.641  61.229  1.00 104.00 ? 110  GLU B CD    1 
ATOM   4124  O  OE1   . GLU B  2  112 ? 75.846  78.825  60.178  1.00 104.12 ? 110  GLU B OE1   1 
ATOM   4125  O  OE2   . GLU B  2  112 ? 74.095  78.017  61.237  1.00 105.61 ? 110  GLU B OE2   1 
ATOM   4126  N  N     . CYS B  2  113 ? 77.868  82.943  61.941  1.00 97.28  ? 111  CYS B N     1 
ATOM   4127  C  CA    . CYS B  2  113 ? 78.148  84.304  61.486  1.00 98.65  ? 111  CYS B CA    1 
ATOM   4128  C  C     . CYS B  2  113 ? 78.975  84.253  60.219  1.00 98.94  ? 111  CYS B C     1 
ATOM   4129  O  O     . CYS B  2  113 ? 79.487  83.204  59.847  1.00 98.42  ? 111  CYS B O     1 
ATOM   4130  C  CB    . CYS B  2  113 ? 78.914  85.109  62.555  1.00 99.03  ? 111  CYS B CB    1 
ATOM   4131  S  SG    . CYS B  2  113 ? 80.620  84.579  62.894  1.00 97.63  ? 111  CYS B SG    1 
ATOM   4132  N  N     . LEU B  2  114 ? 79.097  85.389  59.553  1.00 100.37 ? 112  LEU B N     1 
ATOM   4133  C  CA    . LEU B  2  114 ? 79.889  85.452  58.338  1.00 102.07 ? 112  LEU B CA    1 
ATOM   4134  C  C     . LEU B  2  114 ? 81.368  85.358  58.726  1.00 103.08 ? 112  LEU B C     1 
ATOM   4135  O  O     . LEU B  2  114 ? 81.761  85.764  59.825  1.00 102.86 ? 112  LEU B O     1 
ATOM   4136  C  CB    . LEU B  2  114 ? 79.592  86.757  57.608  1.00 102.42 ? 112  LEU B CB    1 
ATOM   4137  C  CG    . LEU B  2  114 ? 78.084  86.935  57.415  1.00 102.07 ? 112  LEU B CG    1 
ATOM   4138  C  CD1   . LEU B  2  114 ? 77.782  88.319  56.859  1.00 102.17 ? 112  LEU B CD1   1 
ATOM   4139  C  CD2   . LEU B  2  114 ? 77.565  85.831  56.494  1.00 100.55 ? 112  LEU B CD2   1 
ATOM   4140  N  N     . ARG B  2  115 ? 82.176  84.814  57.820  1.00 103.85 ? 113  ARG B N     1 
ATOM   4141  C  CA    . ARG B  2  115 ? 83.603  84.625  58.054  1.00 104.29 ? 113  ARG B CA    1 
ATOM   4142  C  C     . ARG B  2  115 ? 84.310  85.783  58.733  1.00 104.48 ? 113  ARG B C     1 
ATOM   4143  O  O     . ARG B  2  115 ? 85.155  85.574  59.604  1.00 104.85 ? 113  ARG B O     1 
ATOM   4144  C  CB    . ARG B  2  115 ? 84.324  84.358  56.740  1.00 104.58 ? 113  ARG B CB    1 
ATOM   4145  C  CG    . ARG B  2  115 ? 83.764  83.219  55.938  1.00 106.52 ? 113  ARG B CG    1 
ATOM   4146  C  CD    . ARG B  2  115 ? 84.630  82.974  54.719  1.00 107.16 ? 113  ARG B CD    1 
ATOM   4147  N  NE    . ARG B  2  115 ? 85.936  82.460  55.105  1.00 107.80 ? 113  ARG B NE    1 
ATOM   4148  C  CZ    . ARG B  2  115 ? 86.159  81.208  55.486  1.00 108.31 ? 113  ARG B CZ    1 
ATOM   4149  N  NH1   . ARG B  2  115 ? 85.166  80.329  55.523  1.00 107.60 ? 113  ARG B NH1   1 
ATOM   4150  N  NH2   . ARG B  2  115 ? 87.373  80.841  55.862  1.00 109.46 ? 113  ARG B NH2   1 
ATOM   4151  N  N     . ASP B  2  116 ? 83.971  87.003  58.338  1.00 103.75 ? 114  ASP B N     1 
ATOM   4152  C  CA    . ASP B  2  116 ? 84.638  88.173  58.884  1.00 103.94 ? 114  ASP B CA    1 
ATOM   4153  C  C     . ASP B  2  116 ? 84.240  88.625  60.273  1.00 104.23 ? 114  ASP B C     1 
ATOM   4154  O  O     . ASP B  2  116 ? 84.750  89.630  60.768  1.00 104.57 ? 114  ASP B O     1 
ATOM   4155  C  CB    . ASP B  2  116 ? 84.471  89.342  57.927  1.00 104.63 ? 114  ASP B CB    1 
ATOM   4156  C  CG    . ASP B  2  116 ? 84.869  88.989  56.517  1.00 105.95 ? 114  ASP B CG    1 
ATOM   4157  O  OD1   . ASP B  2  116 ? 85.941  88.370  56.340  1.00 107.73 ? 114  ASP B OD1   1 
ATOM   4158  O  OD2   . ASP B  2  116 ? 84.115  89.335  55.586  1.00 106.10 ? 114  ASP B OD2   1 
ATOM   4159  N  N     . HIS B  2  117 ? 83.346  87.898  60.921  1.00 104.34 ? 115  HIS B N     1 
ATOM   4160  C  CA    . HIS B  2  117 ? 82.913  88.325  62.239  1.00 103.81 ? 115  HIS B CA    1 
ATOM   4161  C  C     . HIS B  2  117 ? 83.174  87.273  63.287  1.00 103.48 ? 115  HIS B C     1 
ATOM   4162  O  O     . HIS B  2  117 ? 82.755  87.421  64.426  1.00 103.76 ? 115  HIS B O     1 
ATOM   4163  C  CB    . HIS B  2  117 ? 81.420  88.682  62.197  1.00 104.11 ? 115  HIS B CB    1 
ATOM   4164  C  CG    . HIS B  2  117 ? 81.079  89.742  61.188  1.00 103.81 ? 115  HIS B CG    1 
ATOM   4165  N  ND1   . HIS B  2  117 ? 81.627  91.007  61.223  1.00 103.33 ? 115  HIS B ND1   1 
ATOM   4166  C  CD2   . HIS B  2  117 ? 80.263  89.716  60.106  1.00 103.25 ? 115  HIS B CD2   1 
ATOM   4167  C  CE1   . HIS B  2  117 ? 81.165  91.713  60.205  1.00 103.27 ? 115  HIS B CE1   1 
ATOM   4168  N  NE2   . HIS B  2  117 ? 80.336  90.954  59.512  1.00 102.95 ? 115  HIS B NE2   1 
ATOM   4169  N  N     . VAL B  2  118 ? 83.879  86.216  62.907  1.00 103.62 ? 116  VAL B N     1 
ATOM   4170  C  CA    . VAL B  2  118 ? 84.170  85.135  63.840  1.00 103.86 ? 116  VAL B CA    1 
ATOM   4171  C  C     . VAL B  2  118 ? 84.729  85.661  65.156  1.00 104.62 ? 116  VAL B C     1 
ATOM   4172  O  O     . VAL B  2  118 ? 84.102  85.521  66.206  1.00 104.53 ? 116  VAL B O     1 
ATOM   4173  C  CB    . VAL B  2  118 ? 85.171  84.123  63.237  1.00 103.17 ? 116  VAL B CB    1 
ATOM   4174  C  CG1   . VAL B  2  118 ? 85.556  83.098  64.275  1.00 102.04 ? 116  VAL B CG1   1 
ATOM   4175  C  CG2   . VAL B  2  118 ? 84.550  83.423  62.042  1.00 103.58 ? 116  VAL B CG2   1 
ATOM   4176  N  N     . ASP B  2  119 ? 85.903  86.277  65.092  1.00 105.67 ? 117  ASP B N     1 
ATOM   4177  C  CA    . ASP B  2  119 ? 86.562  86.816  66.280  1.00 106.45 ? 117  ASP B CA    1 
ATOM   4178  C  C     . ASP B  2  119 ? 85.633  87.575  67.228  1.00 106.09 ? 117  ASP B C     1 
ATOM   4179  O  O     . ASP B  2  119 ? 85.773  87.476  68.452  1.00 105.79 ? 117  ASP B O     1 
ATOM   4180  C  CB    . ASP B  2  119 ? 87.737  87.716  65.863  1.00 107.75 ? 117  ASP B CB    1 
ATOM   4181  C  CG    . ASP B  2  119 ? 87.367  88.697  64.755  1.00 109.38 ? 117  ASP B CG    1 
ATOM   4182  O  OD1   . ASP B  2  119 ? 86.958  88.238  63.659  1.00 109.74 ? 117  ASP B OD1   1 
ATOM   4183  O  OD2   . ASP B  2  119 ? 87.492  89.924  64.982  1.00 109.43 ? 117  ASP B OD2   1 
ATOM   4184  N  N     . THR B  2  120 ? 84.685  88.321  66.661  1.00 105.90 ? 118  THR B N     1 
ATOM   4185  C  CA    . THR B  2  120 ? 83.734  89.112  67.449  1.00 105.04 ? 118  THR B CA    1 
ATOM   4186  C  C     . THR B  2  120 ? 82.715  88.236  68.193  1.00 104.45 ? 118  THR B C     1 
ATOM   4187  O  O     . THR B  2  120 ? 82.544  88.343  69.411  1.00 104.89 ? 118  THR B O     1 
ATOM   4188  C  CB    . THR B  2  120 ? 82.961  90.095  66.548  1.00 104.67 ? 118  THR B CB    1 
ATOM   4189  O  OG1   . THR B  2  120 ? 83.875  90.778  65.676  1.00 103.84 ? 118  THR B OG1   1 
ATOM   4190  C  CG2   . THR B  2  120 ? 82.226  91.113  67.399  1.00 105.33 ? 118  THR B CG2   1 
ATOM   4191  N  N     . VAL B  2  121 ? 82.041  87.376  67.440  1.00 103.40 ? 119  VAL B N     1 
ATOM   4192  C  CA    . VAL B  2  121 ? 81.043  86.462  67.981  1.00 102.12 ? 119  VAL B CA    1 
ATOM   4193  C  C     . VAL B  2  121 ? 81.675  85.497  68.978  1.00 101.24 ? 119  VAL B C     1 
ATOM   4194  O  O     . VAL B  2  121 ? 81.009  84.983  69.881  1.00 100.88 ? 119  VAL B O     1 
ATOM   4195  C  CB    . VAL B  2  121 ? 80.411  85.631  66.846  1.00 102.29 ? 119  VAL B CB    1 
ATOM   4196  C  CG1   . VAL B  2  121 ? 79.349  84.711  67.395  1.00 102.94 ? 119  VAL B CG1   1 
ATOM   4197  C  CG2   . VAL B  2  121 ? 79.826  86.553  65.802  1.00 102.82 ? 119  VAL B CG2   1 
ATOM   4198  N  N     . MET B  2  122 ? 82.970  85.256  68.811  1.00 100.16 ? 120  MET B N     1 
ATOM   4199  C  CA    . MET B  2  122 ? 83.678  84.327  69.678  1.00 98.56  ? 120  MET B CA    1 
ATOM   4200  C  C     . MET B  2  122 ? 83.721  84.773  71.134  1.00 96.12  ? 120  MET B C     1 
ATOM   4201  O  O     . MET B  2  122 ? 83.572  83.956  72.052  1.00 95.15  ? 120  MET B O     1 
ATOM   4202  C  CB    . MET B  2  122 ? 85.102  84.119  69.171  1.00 100.32 ? 120  MET B CB    1 
ATOM   4203  C  CG    . MET B  2  122 ? 85.744  82.868  69.743  1.00 103.26 ? 120  MET B CG    1 
ATOM   4204  S  SD    . MET B  2  122 ? 84.924  81.355  69.161  1.00 105.18 ? 120  MET B SD    1 
ATOM   4205  C  CE    . MET B  2  122 ? 86.223  80.692  68.114  1.00 105.01 ? 120  MET B CE    1 
ATOM   4206  N  N     . GLU B  2  123 ? 83.930  86.070  71.334  1.00 92.57  ? 121  GLU B N     1 
ATOM   4207  C  CA    . GLU B  2  123 ? 84.010  86.631  72.667  1.00 89.79  ? 121  GLU B CA    1 
ATOM   4208  C  C     . GLU B  2  123 ? 82.877  86.164  73.556  1.00 88.10  ? 121  GLU B C     1 
ATOM   4209  O  O     . GLU B  2  123 ? 83.092  85.614  74.643  1.00 87.39  ? 121  GLU B O     1 
ATOM   4210  C  CB    . GLU B  2  123 ? 83.993  88.148  72.590  1.00 90.11  ? 121  GLU B CB    1 
ATOM   4211  C  CG    . GLU B  2  123 ? 83.719  88.818  73.918  1.00 92.80  ? 121  GLU B CG    1 
ATOM   4212  C  CD    . GLU B  2  123 ? 83.924  90.319  73.860  1.00 96.01  ? 121  GLU B CD    1 
ATOM   4213  O  OE1   . GLU B  2  123 ? 83.724  90.907  72.765  1.00 95.61  ? 121  GLU B OE1   1 
ATOM   4214  O  OE2   . GLU B  2  123 ? 84.275  90.907  74.914  1.00 98.33  ? 121  GLU B OE2   1 
ATOM   4215  N  N     . TYR B  2  124 ? 81.659  86.388  73.078  1.00 86.26  ? 122  TYR B N     1 
ATOM   4216  C  CA    . TYR B  2  124 ? 80.464  86.024  73.827  1.00 82.36  ? 122  TYR B CA    1 
ATOM   4217  C  C     . TYR B  2  124 ? 80.395  84.509  74.020  1.00 83.07  ? 122  TYR B C     1 
ATOM   4218  O  O     . TYR B  2  124 ? 80.034  84.034  75.104  1.00 81.74  ? 122  TYR B O     1 
ATOM   4219  C  CB    . TYR B  2  124 ? 79.221  86.586  73.112  1.00 77.09  ? 122  TYR B CB    1 
ATOM   4220  C  CG    . TYR B  2  124 ? 79.374  88.056  72.728  1.00 71.13  ? 122  TYR B CG    1 
ATOM   4221  C  CD1   . TYR B  2  124 ? 79.641  88.428  71.403  1.00 68.37  ? 122  TYR B CD1   1 
ATOM   4222  C  CD2   . TYR B  2  124 ? 79.334  89.067  73.700  1.00 67.58  ? 122  TYR B CD2   1 
ATOM   4223  C  CE1   . TYR B  2  124 ? 79.870  89.763  71.053  1.00 65.72  ? 122  TYR B CE1   1 
ATOM   4224  C  CE2   . TYR B  2  124 ? 79.567  90.412  73.361  1.00 65.61  ? 122  TYR B CE2   1 
ATOM   4225  C  CZ    . TYR B  2  124 ? 79.835  90.748  72.030  1.00 65.90  ? 122  TYR B CZ    1 
ATOM   4226  O  OH    . TYR B  2  124 ? 80.081  92.057  71.662  1.00 64.30  ? 122  TYR B OH    1 
ATOM   4227  N  N     . LEU B  2  125 ? 80.764  83.752  72.984  1.00 83.93  ? 123  LEU B N     1 
ATOM   4228  C  CA    . LEU B  2  125 ? 80.760  82.297  73.093  1.00 85.07  ? 123  LEU B CA    1 
ATOM   4229  C  C     . LEU B  2  125 ? 81.644  81.885  74.270  1.00 87.40  ? 123  LEU B C     1 
ATOM   4230  O  O     . LEU B  2  125 ? 81.189  81.197  75.189  1.00 87.82  ? 123  LEU B O     1 
ATOM   4231  C  CB    . LEU B  2  125 ? 81.278  81.657  71.806  1.00 82.66  ? 123  LEU B CB    1 
ATOM   4232  C  CG    . LEU B  2  125 ? 81.409  80.129  71.854  1.00 81.69  ? 123  LEU B CG    1 
ATOM   4233  C  CD1   . LEU B  2  125 ? 80.188  79.501  72.517  1.00 80.75  ? 123  LEU B CD1   1 
ATOM   4234  C  CD2   . LEU B  2  125 ? 81.591  79.591  70.440  1.00 81.81  ? 123  LEU B CD2   1 
ATOM   4235  N  N     . LEU B  2  126 ? 82.905  82.317  74.232  1.00 89.54  ? 124  LEU B N     1 
ATOM   4236  C  CA    . LEU B  2  126 ? 83.878  82.026  75.286  1.00 90.42  ? 124  LEU B CA    1 
ATOM   4237  C  C     . LEU B  2  126 ? 83.280  82.428  76.629  1.00 89.61  ? 124  LEU B C     1 
ATOM   4238  O  O     . LEU B  2  126 ? 83.186  81.610  77.552  1.00 88.72  ? 124  LEU B O     1 
ATOM   4239  C  CB    . LEU B  2  126 ? 85.167  82.822  75.024  1.00 93.60  ? 124  LEU B CB    1 
ATOM   4240  C  CG    . LEU B  2  126 ? 86.349  82.942  76.014  1.00 96.25  ? 124  LEU B CG    1 
ATOM   4241  C  CD1   . LEU B  2  126 ? 87.389  83.841  75.349  1.00 97.20  ? 124  LEU B CD1   1 
ATOM   4242  C  CD2   . LEU B  2  126 ? 85.952  83.562  77.371  1.00 95.98  ? 124  LEU B CD2   1 
ATOM   4243  N  N     . ASN B  2  127 ? 82.880  83.698  76.712  1.00 88.52  ? 125  ASN B N     1 
ATOM   4244  C  CA    . ASN B  2  127 ? 82.286  84.292  77.911  1.00 87.49  ? 125  ASN B CA    1 
ATOM   4245  C  C     . ASN B  2  127 ? 81.102  83.509  78.488  1.00 87.43  ? 125  ASN B C     1 
ATOM   4246  O  O     . ASN B  2  127 ? 81.051  83.223  79.683  1.00 87.47  ? 125  ASN B O     1 
ATOM   4247  C  CB    . ASN B  2  127 ? 81.840  85.717  77.596  1.00 85.98  ? 125  ASN B CB    1 
ATOM   4248  C  CG    . ASN B  2  127 ? 82.792  86.763  78.140  1.00 85.09  ? 125  ASN B CG    1 
ATOM   4249  O  OD1   . ASN B  2  127 ? 82.936  86.909  79.357  1.00 84.64  ? 125  ASN B OD1   1 
ATOM   4250  N  ND2   . ASN B  2  127 ? 83.445  87.505  77.242  1.00 82.93  ? 125  ASN B ND2   1 
ATOM   4251  N  N     . VAL B  2  128 ? 80.146  83.169  77.636  1.00 86.79  ? 126  VAL B N     1 
ATOM   4252  C  CA    . VAL B  2  128 ? 78.982  82.431  78.081  1.00 86.60  ? 126  VAL B CA    1 
ATOM   4253  C  C     . VAL B  2  128 ? 79.308  81.104  78.759  1.00 87.47  ? 126  VAL B C     1 
ATOM   4254  O  O     . VAL B  2  128 ? 78.907  80.868  79.895  1.00 87.01  ? 126  VAL B O     1 
ATOM   4255  C  CB    . VAL B  2  128 ? 78.046  82.144  76.905  1.00 85.94  ? 126  VAL B CB    1 
ATOM   4256  C  CG1   . VAL B  2  128 ? 76.863  81.317  77.377  1.00 85.71  ? 126  VAL B CG1   1 
ATOM   4257  C  CG2   . VAL B  2  128 ? 77.582  83.446  76.295  1.00 85.32  ? 126  VAL B CG2   1 
ATOM   4258  N  N     . THR B  2  129 ? 80.044  80.249  78.050  1.00 89.14  ? 127  THR B N     1 
ATOM   4259  C  CA    . THR B  2  129 ? 80.418  78.908  78.517  1.00 89.84  ? 127  THR B CA    1 
ATOM   4260  C  C     . THR B  2  129 ? 81.456  78.792  79.641  1.00 91.09  ? 127  THR B C     1 
ATOM   4261  O  O     . THR B  2  129 ? 81.467  77.802  80.382  1.00 91.07  ? 127  THR B O     1 
ATOM   4262  C  CB    . THR B  2  129 ? 80.936  78.062  77.340  1.00 88.93  ? 127  THR B CB    1 
ATOM   4263  O  OG1   . THR B  2  129 ? 82.073  78.711  76.759  1.00 89.21  ? 127  THR B OG1   1 
ATOM   4264  C  CG2   . THR B  2  129 ? 79.871  77.913  76.278  1.00 88.47  ? 127  THR B CG2   1 
ATOM   4265  N  N     . THR B  2  130 ? 82.324  79.792  79.774  1.00 92.32  ? 128  THR B N     1 
ATOM   4266  C  CA    . THR B  2  130 ? 83.373  79.740  80.787  1.00 93.18  ? 128  THR B CA    1 
ATOM   4267  C  C     . THR B  2  130 ? 83.249  80.724  81.949  1.00 93.73  ? 128  THR B C     1 
ATOM   4268  O  O     . THR B  2  130 ? 83.653  80.409  83.076  1.00 93.92  ? 128  THR B O     1 
ATOM   4269  C  CB    . THR B  2  130 ? 84.762  79.958  80.139  1.00 93.59  ? 128  THR B CB    1 
ATOM   4270  O  OG1   . THR B  2  130 ? 84.879  81.316  79.688  1.00 93.07  ? 128  THR B OG1   1 
ATOM   4271  C  CG2   . THR B  2  130 ? 84.945  79.023  78.949  1.00 93.79  ? 128  THR B CG2   1 
ATOM   4272  N  N     . ALA B  2  131 ? 82.682  81.901  81.688  1.00 93.48  ? 129  ALA B N     1 
ATOM   4273  C  CA    . ALA B  2  131 ? 82.577  82.928  82.721  1.00 93.14  ? 129  ALA B CA    1 
ATOM   4274  C  C     . ALA B  2  131 ? 81.193  83.450  83.141  1.00 93.44  ? 129  ALA B C     1 
ATOM   4275  O  O     . ALA B  2  131 ? 81.031  84.654  83.356  1.00 93.95  ? 129  ALA B O     1 
ATOM   4276  C  CB    . ALA B  2  131 ? 83.460  84.109  82.320  1.00 92.41  ? 129  ALA B CB    1 
ATOM   4277  N  N     . PRO B  2  132 ? 80.180  82.570  83.275  1.00 93.25  ? 130  PRO B N     1 
ATOM   4278  C  CA    . PRO B  2  132 ? 78.870  83.097  83.683  1.00 92.78  ? 130  PRO B CA    1 
ATOM   4279  C  C     . PRO B  2  132 ? 78.901  83.719  85.082  1.00 92.36  ? 130  PRO B C     1 
ATOM   4280  O  O     . PRO B  2  132 ? 79.828  83.472  85.848  1.00 92.90  ? 130  PRO B O     1 
ATOM   4281  C  CB    . PRO B  2  132 ? 77.968  81.867  83.619  1.00 92.33  ? 130  PRO B CB    1 
ATOM   4282  C  CG    . PRO B  2  132 ? 78.891  80.757  83.941  1.00 92.50  ? 130  PRO B CG    1 
ATOM   4283  C  CD    . PRO B  2  132 ? 80.118  81.106  83.120  1.00 93.28  ? 130  PRO B CD    1 
ATOM   4284  N  N     . GLU B  2  133 ? 77.895  84.534  85.398  1.00 91.75  ? 131  GLU B N     1 
ATOM   4285  C  CA    . GLU B  2  133 ? 77.796  85.184  86.704  1.00 90.76  ? 131  GLU B CA    1 
ATOM   4286  C  C     . GLU B  2  133 ? 76.527  84.773  87.441  1.00 91.00  ? 131  GLU B C     1 
ATOM   4287  O  O     . GLU B  2  133 ? 76.465  84.847  88.675  1.00 91.61  ? 131  GLU B O     1 
ATOM   4288  C  CB    . GLU B  2  133 ? 77.822  86.703  86.558  1.00 89.48  ? 131  GLU B CB    1 
ATOM   4289  C  CG    . GLU B  2  133 ? 79.198  87.298  86.708  1.00 90.88  ? 131  GLU B CG    1 
ATOM   4290  C  CD    . GLU B  2  133 ? 79.193  88.818  86.700  1.00 92.64  ? 131  GLU B CD    1 
ATOM   4291  O  OE1   . GLU B  2  133 ? 78.394  89.415  87.451  1.00 93.79  ? 131  GLU B OE1   1 
ATOM   4292  O  OE2   . GLU B  2  133 ? 79.996  89.421  85.952  1.00 93.34  ? 131  GLU B OE2   1 
ATOM   4293  N  N     . PHE B  2  134 ? 75.521  84.338  86.682  1.00 90.06  ? 132  PHE B N     1 
ATOM   4294  C  CA    . PHE B  2  134 ? 74.250  83.903  87.252  1.00 88.66  ? 132  PHE B CA    1 
ATOM   4295  C  C     . PHE B  2  134 ? 73.810  84.807  88.391  1.00 87.12  ? 132  PHE B C     1 
ATOM   4296  O  O     . PHE B  2  134 ? 73.549  84.329  89.498  1.00 86.83  ? 132  PHE B O     1 
ATOM   4297  C  CB    . PHE B  2  134 ? 74.357  82.461  87.762  1.00 89.86  ? 132  PHE B CB    1 
ATOM   4298  C  CG    . PHE B  2  134 ? 74.688  81.461  86.688  1.00 92.08  ? 132  PHE B CG    1 
ATOM   4299  C  CD1   . PHE B  2  134 ? 75.279  80.244  87.016  1.00 92.21  ? 132  PHE B CD1   1 
ATOM   4300  C  CD2   . PHE B  2  134 ? 74.426  81.742  85.347  1.00 93.47  ? 132  PHE B CD2   1 
ATOM   4301  C  CE1   . PHE B  2  134 ? 75.611  79.326  86.029  1.00 93.38  ? 132  PHE B CE1   1 
ATOM   4302  C  CE2   . PHE B  2  134 ? 74.753  80.827  84.346  1.00 94.90  ? 132  PHE B CE2   1 
ATOM   4303  C  CZ    . PHE B  2  134 ? 75.348  79.618  84.689  1.00 94.88  ? 132  PHE B CZ    1 
ATOM   4304  N  N     . ARG B  2  135 ? 73.746  86.109  88.116  1.00 85.03  ? 133  ARG B N     1 
ATOM   4305  C  CA    . ARG B  2  135 ? 73.323  87.083  89.114  1.00 83.23  ? 133  ARG B CA    1 
ATOM   4306  C  C     . ARG B  2  135 ? 71.947  86.662  89.623  1.00 83.12  ? 133  ARG B C     1 
ATOM   4307  O  O     . ARG B  2  135 ? 71.045  86.355  88.832  1.00 82.61  ? 133  ARG B O     1 
ATOM   4308  C  CB    . ARG B  2  135 ? 73.267  88.471  88.495  1.00 81.77  ? 133  ARG B CB    1 
ATOM   4309  C  CG    . ARG B  2  135 ? 74.549  88.856  87.805  1.00 81.54  ? 133  ARG B CG    1 
ATOM   4310  C  CD    . ARG B  2  135 ? 74.520  90.303  87.382  1.00 83.17  ? 133  ARG B CD    1 
ATOM   4311  N  NE    . ARG B  2  135 ? 75.848  90.820  87.072  1.00 84.92  ? 133  ARG B NE    1 
ATOM   4312  C  CZ    . ARG B  2  135 ? 76.091  92.070  86.686  1.00 87.11  ? 133  ARG B CZ    1 
ATOM   4313  N  NH1   . ARG B  2  135 ? 75.093  92.935  86.557  1.00 88.28  ? 133  ARG B NH1   1 
ATOM   4314  N  NH2   . ARG B  2  135 ? 77.331  92.464  86.430  1.00 88.49  ? 133  ARG B NH2   1 
ATOM   4315  N  N     . PRO B  2  136 ? 71.769  86.639  90.954  1.00 82.59  ? 134  PRO B N     1 
ATOM   4316  C  CA    . PRO B  2  136 ? 70.519  86.249  91.610  1.00 82.70  ? 134  PRO B CA    1 
ATOM   4317  C  C     . PRO B  2  136 ? 69.258  86.775  90.938  1.00 82.69  ? 134  PRO B C     1 
ATOM   4318  O  O     . PRO B  2  136 ? 68.379  85.995  90.564  1.00 83.22  ? 134  PRO B O     1 
ATOM   4319  C  CB    . PRO B  2  136 ? 70.696  86.784  93.026  1.00 82.02  ? 134  PRO B CB    1 
ATOM   4320  C  CG    . PRO B  2  136 ? 72.124  86.644  93.233  1.00 81.59  ? 134  PRO B CG    1 
ATOM   4321  C  CD    . PRO B  2  136 ? 72.702  87.185  91.947  1.00 81.52  ? 134  PRO B CD    1 
ATOM   4322  N  N     . TRP B  2  137 ? 69.167  88.092  90.784  1.00 82.00  ? 135  TRP B N     1 
ATOM   4323  C  CA    . TRP B  2  137 ? 67.997  88.672  90.157  1.00 82.21  ? 135  TRP B CA    1 
ATOM   4324  C  C     . TRP B  2  137 ? 67.810  88.179  88.712  1.00 83.26  ? 135  TRP B C     1 
ATOM   4325  O  O     . TRP B  2  137 ? 66.763  87.613  88.396  1.00 84.41  ? 135  TRP B O     1 
ATOM   4326  C  CB    . TRP B  2  137 ? 68.073  90.192  90.227  1.00 81.14  ? 135  TRP B CB    1 
ATOM   4327  C  CG    . TRP B  2  137 ? 69.314  90.779  89.667  1.00 80.78  ? 135  TRP B CG    1 
ATOM   4328  C  CD1   . TRP B  2  137 ? 69.509  91.219  88.389  1.00 81.69  ? 135  TRP B CD1   1 
ATOM   4329  C  CD2   . TRP B  2  137 ? 70.521  91.057  90.375  1.00 80.61  ? 135  TRP B CD2   1 
ATOM   4330  N  NE1   . TRP B  2  137 ? 70.766  91.768  88.258  1.00 80.77  ? 135  TRP B NE1   1 
ATOM   4331  C  CE2   . TRP B  2  137 ? 71.407  91.680  89.466  1.00 80.75  ? 135  TRP B CE2   1 
ATOM   4332  C  CE3   . TRP B  2  137 ? 70.943  90.846  91.693  1.00 79.57  ? 135  TRP B CE3   1 
ATOM   4333  C  CZ2   . TRP B  2  137 ? 72.682  92.091  89.832  1.00 79.93  ? 135  TRP B CZ2   1 
ATOM   4334  C  CZ3   . TRP B  2  137 ? 72.210  91.258  92.055  1.00 78.01  ? 135  TRP B CZ3   1 
ATOM   4335  C  CH2   . TRP B  2  137 ? 73.064  91.875  91.129  1.00 78.54  ? 135  TRP B CH2   1 
ATOM   4336  N  N     . GLU B  2  138 ? 68.810  88.362  87.844  1.00 82.68  ? 136  GLU B N     1 
ATOM   4337  C  CA    . GLU B  2  138 ? 68.699  87.904  86.454  1.00 81.03  ? 136  GLU B CA    1 
ATOM   4338  C  C     . GLU B  2  138 ? 68.153  86.483  86.424  1.00 81.43  ? 136  GLU B C     1 
ATOM   4339  O  O     . GLU B  2  138 ? 67.313  86.136  85.593  1.00 81.01  ? 136  GLU B O     1 
ATOM   4340  C  CB    . GLU B  2  138 ? 70.059  87.932  85.757  1.00 78.95  ? 136  GLU B CB    1 
ATOM   4341  C  CG    . GLU B  2  138 ? 70.615  89.321  85.538  1.00 79.16  ? 136  GLU B CG    1 
ATOM   4342  C  CD    . GLU B  2  138 ? 71.770  89.352  84.541  1.00 81.41  ? 136  GLU B CD    1 
ATOM   4343  O  OE1   . GLU B  2  138 ? 72.262  90.471  84.240  1.00 79.45  ? 136  GLU B OE1   1 
ATOM   4344  O  OE2   . GLU B  2  138 ? 72.183  88.263  84.059  1.00 82.78  ? 136  GLU B OE2   1 
ATOM   4345  N  N     . VAL B  2  139 ? 68.643  85.674  87.354  1.00 82.43  ? 137  VAL B N     1 
ATOM   4346  C  CA    . VAL B  2  139 ? 68.244  84.282  87.482  1.00 83.63  ? 137  VAL B CA    1 
ATOM   4347  C  C     . VAL B  2  139 ? 66.811  84.144  87.981  1.00 84.88  ? 137  VAL B C     1 
ATOM   4348  O  O     . VAL B  2  139 ? 66.083  83.259  87.545  1.00 85.90  ? 137  VAL B O     1 
ATOM   4349  C  CB    . VAL B  2  139 ? 69.190  83.526  88.452  1.00 83.15  ? 137  VAL B CB    1 
ATOM   4350  C  CG1   . VAL B  2  139 ? 68.594  82.177  88.832  1.00 82.55  ? 137  VAL B CG1   1 
ATOM   4351  C  CG2   . VAL B  2  139 ? 70.550  83.343  87.806  1.00 80.94  ? 137  VAL B CG2   1 
ATOM   4352  N  N     . THR B  2  140 ? 66.399  85.006  88.901  1.00 86.11  ? 138  THR B N     1 
ATOM   4353  C  CA    . THR B  2  140 ? 65.036  84.914  89.407  1.00 87.97  ? 138  THR B CA    1 
ATOM   4354  C  C     . THR B  2  140 ? 64.048  85.302  88.311  1.00 88.12  ? 138  THR B C     1 
ATOM   4355  O  O     . THR B  2  140 ? 63.043  84.619  88.116  1.00 88.82  ? 138  THR B O     1 
ATOM   4356  C  CB    . THR B  2  140 ? 64.798  85.827  90.627  1.00 88.99  ? 138  THR B CB    1 
ATOM   4357  O  OG1   . THR B  2  140 ? 65.753  85.529  91.653  1.00 91.91  ? 138  THR B OG1   1 
ATOM   4358  C  CG2   . THR B  2  140 ? 63.417  85.586  91.190  1.00 88.82  ? 138  THR B CG2   1 
ATOM   4359  N  N     . ASP B  2  141 ? 64.345  86.386  87.591  1.00 88.06  ? 139  ASP B N     1 
ATOM   4360  C  CA    . ASP B  2  141 ? 63.484  86.869  86.504  1.00 88.13  ? 139  ASP B CA    1 
ATOM   4361  C  C     . ASP B  2  141 ? 63.355  85.865  85.353  1.00 87.70  ? 139  ASP B C     1 
ATOM   4362  O  O     . ASP B  2  141 ? 62.337  85.835  84.668  1.00 88.63  ? 139  ASP B O     1 
ATOM   4363  C  CB    . ASP B  2  141 ? 64.014  88.196  85.934  1.00 89.03  ? 139  ASP B CB    1 
ATOM   4364  C  CG    . ASP B  2  141 ? 64.156  89.289  86.998  1.00 92.16  ? 139  ASP B CG    1 
ATOM   4365  O  OD1   . ASP B  2  141 ? 63.282  89.377  87.892  1.00 94.94  ? 139  ASP B OD1   1 
ATOM   4366  O  OD2   . ASP B  2  141 ? 65.135  90.078  86.937  1.00 92.30  ? 139  ASP B OD2   1 
ATOM   4367  N  N     . LEU B  2  142 ? 64.387  85.047  85.157  1.00 86.04  ? 140  LEU B N     1 
ATOM   4368  C  CA    . LEU B  2  142 ? 64.427  84.059  84.088  1.00 83.14  ? 140  LEU B CA    1 
ATOM   4369  C  C     . LEU B  2  142 ? 63.634  82.779  84.316  1.00 81.84  ? 140  LEU B C     1 
ATOM   4370  O  O     . LEU B  2  142 ? 62.964  82.287  83.419  1.00 80.77  ? 140  LEU B O     1 
ATOM   4371  C  CB    . LEU B  2  142 ? 65.880  83.697  83.804  1.00 83.64  ? 140  LEU B CB    1 
ATOM   4372  C  CG    . LEU B  2  142 ? 66.116  82.568  82.798  1.00 84.89  ? 140  LEU B CG    1 
ATOM   4373  C  CD1   . LEU B  2  142 ? 65.422  82.902  81.491  1.00 85.28  ? 140  LEU B CD1   1 
ATOM   4374  C  CD2   . LEU B  2  142 ? 67.609  82.372  82.567  1.00 85.33  ? 140  LEU B CD2   1 
ATOM   4375  N  N     . GLN B  2  143 ? 63.706  82.237  85.517  1.00 81.70  ? 141  GLN B N     1 
ATOM   4376  C  CA    . GLN B  2  143 ? 63.016  80.991  85.814  1.00 82.62  ? 141  GLN B CA    1 
ATOM   4377  C  C     . GLN B  2  143 ? 61.574  80.838  85.342  1.00 82.34  ? 141  GLN B C     1 
ATOM   4378  O  O     . GLN B  2  143 ? 61.206  79.792  84.816  1.00 83.50  ? 141  GLN B O     1 
ATOM   4379  C  CB    . GLN B  2  143 ? 63.109  80.686  87.312  1.00 83.55  ? 141  GLN B CB    1 
ATOM   4380  C  CG    . GLN B  2  143 ? 64.540  80.418  87.755  1.00 83.95  ? 141  GLN B CG    1 
ATOM   4381  C  CD    . GLN B  2  143 ? 64.619  79.700  89.070  1.00 84.06  ? 141  GLN B CD    1 
ATOM   4382  O  OE1   . GLN B  2  143 ? 64.124  78.577  89.207  1.00 83.32  ? 141  GLN B OE1   1 
ATOM   4383  N  NE2   . GLN B  2  143 ? 65.246  80.341  90.054  1.00 85.05  ? 141  GLN B NE2   1 
ATOM   4384  N  N     . PRO B  2  144 ? 60.732  81.861  85.521  1.00 81.72  ? 142  PRO B N     1 
ATOM   4385  C  CA    . PRO B  2  144 ? 59.352  81.686  85.059  1.00 80.40  ? 142  PRO B CA    1 
ATOM   4386  C  C     . PRO B  2  144 ? 59.293  81.270  83.593  1.00 79.37  ? 142  PRO B C     1 
ATOM   4387  O  O     . PRO B  2  144 ? 58.272  80.782  83.115  1.00 80.05  ? 142  PRO B O     1 
ATOM   4388  C  CB    . PRO B  2  144 ? 58.733  83.052  85.311  1.00 80.94  ? 142  PRO B CB    1 
ATOM   4389  C  CG    . PRO B  2  144 ? 59.905  83.975  85.152  1.00 81.96  ? 142  PRO B CG    1 
ATOM   4390  C  CD    . PRO B  2  144 ? 60.976  83.254  85.921  1.00 82.00  ? 142  PRO B CD    1 
ATOM   4391  N  N     . GLN B  2  145 ? 60.402  81.458  82.889  1.00 77.91  ? 143  GLN B N     1 
ATOM   4392  C  CA    . GLN B  2  145 ? 60.490  81.087  81.484  1.00 77.09  ? 143  GLN B CA    1 
ATOM   4393  C  C     . GLN B  2  145 ? 60.426  79.568  81.292  1.00 75.84  ? 143  GLN B C     1 
ATOM   4394  O  O     . GLN B  2  145 ? 59.889  79.078  80.309  1.00 76.15  ? 143  GLN B O     1 
ATOM   4395  C  CB    . GLN B  2  145 ? 61.795  81.618  80.890  1.00 78.28  ? 143  GLN B CB    1 
ATOM   4396  C  CG    . GLN B  2  145 ? 61.983  81.313  79.414  1.00 81.45  ? 143  GLN B CG    1 
ATOM   4397  C  CD    . GLN B  2  145 ? 61.039  82.100  78.510  1.00 83.36  ? 143  GLN B CD    1 
ATOM   4398  O  OE1   . GLN B  2  145 ? 59.823  82.097  78.709  1.00 84.95  ? 143  GLN B OE1   1 
ATOM   4399  N  NE2   . GLN B  2  145 ? 61.599  82.768  77.503  1.00 83.55  ? 143  GLN B NE2   1 
ATOM   4400  N  N     . LEU B  2  146 ? 60.988  78.822  82.229  1.00 74.66  ? 144  LEU B N     1 
ATOM   4401  C  CA    . LEU B  2  146 ? 60.978  77.372  82.138  1.00 73.53  ? 144  LEU B CA    1 
ATOM   4402  C  C     . LEU B  2  146 ? 59.561  76.872  81.949  1.00 73.72  ? 144  LEU B C     1 
ATOM   4403  O  O     . LEU B  2  146 ? 59.322  75.886  81.259  1.00 74.45  ? 144  LEU B O     1 
ATOM   4404  C  CB    . LEU B  2  146 ? 61.559  76.751  83.412  1.00 72.95  ? 144  LEU B CB    1 
ATOM   4405  C  CG    . LEU B  2  146 ? 63.035  76.982  83.741  1.00 71.59  ? 144  LEU B CG    1 
ATOM   4406  C  CD1   . LEU B  2  146 ? 63.337  76.443  85.129  1.00 70.45  ? 144  LEU B CD1   1 
ATOM   4407  C  CD2   . LEU B  2  146 ? 63.898  76.305  82.693  1.00 70.08  ? 144  LEU B CD2   1 
ATOM   4408  N  N     . LYS B  2  147 ? 58.613  77.555  82.570  1.00 74.29  ? 145  LYS B N     1 
ATOM   4409  C  CA    . LYS B  2  147 ? 57.216  77.152  82.474  1.00 74.02  ? 145  LYS B CA    1 
ATOM   4410  C  C     . LYS B  2  147 ? 56.747  77.257  81.020  1.00 72.25  ? 145  LYS B C     1 
ATOM   4411  O  O     . LYS B  2  147 ? 56.078  76.362  80.510  1.00 71.24  ? 145  LYS B O     1 
ATOM   4412  C  CB    . LYS B  2  147 ? 56.373  78.043  83.392  1.00 76.42  ? 145  LYS B CB    1 
ATOM   4413  C  CG    . LYS B  2  147 ? 55.080  77.417  83.858  1.00 80.21  ? 145  LYS B CG    1 
ATOM   4414  C  CD    . LYS B  2  147 ? 54.427  78.297  84.914  1.00 84.59  ? 145  LYS B CD    1 
ATOM   4415  C  CE    . LYS B  2  147 ? 53.073  77.744  85.370  1.00 88.14  ? 145  LYS B CE    1 
ATOM   4416  N  NZ    . LYS B  2  147 ? 52.450  78.582  86.456  1.00 89.21  ? 145  LYS B NZ    1 
ATOM   4417  N  N     . VAL B  2  148 ? 57.115  78.358  80.369  1.00 70.28  ? 146  VAL B N     1 
ATOM   4418  C  CA    . VAL B  2  148 ? 56.773  78.623  78.977  1.00 69.28  ? 146  VAL B CA    1 
ATOM   4419  C  C     . VAL B  2  148 ? 57.504  77.651  78.069  1.00 69.70  ? 146  VAL B C     1 
ATOM   4420  O  O     . VAL B  2  148 ? 56.883  76.825  77.408  1.00 69.39  ? 146  VAL B O     1 
ATOM   4421  C  CB    . VAL B  2  148 ? 57.184  80.063  78.574  1.00 69.89  ? 146  VAL B CB    1 
ATOM   4422  C  CG1   . VAL B  2  148 ? 57.183  80.230  77.057  1.00 68.45  ? 146  VAL B CG1   1 
ATOM   4423  C  CG2   . VAL B  2  148 ? 56.239  81.054  79.200  1.00 70.16  ? 146  VAL B CG2   1 
ATOM   4424  N  N     . ASP B  2  149 ? 58.831  77.779  78.033  1.00 70.40  ? 147  ASP B N     1 
ATOM   4425  C  CA    . ASP B  2  149 ? 59.706  76.924  77.221  1.00 70.23  ? 147  ASP B CA    1 
ATOM   4426  C  C     . ASP B  2  149 ? 59.249  75.466  77.225  1.00 67.93  ? 147  ASP B C     1 
ATOM   4427  O  O     . ASP B  2  149 ? 59.158  74.814  76.182  1.00 67.04  ? 147  ASP B O     1 
ATOM   4428  C  CB    . ASP B  2  149 ? 61.134  76.989  77.761  1.00 72.53  ? 147  ASP B CB    1 
ATOM   4429  C  CG    . ASP B  2  149 ? 62.112  76.252  76.886  1.00 75.45  ? 147  ASP B CG    1 
ATOM   4430  O  OD1   . ASP B  2  149 ? 62.312  76.728  75.742  1.00 77.22  ? 147  ASP B OD1   1 
ATOM   4431  O  OD2   . ASP B  2  149 ? 62.666  75.210  77.335  1.00 76.32  ? 147  ASP B OD2   1 
ATOM   4432  N  N     . LYS B  2  150 ? 58.979  74.969  78.423  1.00 65.51  ? 148  LYS B N     1 
ATOM   4433  C  CA    . LYS B  2  150 ? 58.527  73.612  78.609  1.00 65.70  ? 148  LYS B CA    1 
ATOM   4434  C  C     . LYS B  2  150 ? 57.124  73.411  77.998  1.00 66.66  ? 148  LYS B C     1 
ATOM   4435  O  O     . LYS B  2  150 ? 56.814  72.341  77.472  1.00 66.62  ? 148  LYS B O     1 
ATOM   4436  C  CB    . LYS B  2  150 ? 58.544  73.283  80.114  1.00 64.31  ? 148  LYS B CB    1 
ATOM   4437  C  CG    . LYS B  2  150 ? 57.986  71.912  80.459  1.00 66.31  ? 148  LYS B CG    1 
ATOM   4438  C  CD    . LYS B  2  150 ? 58.246  71.482  81.905  1.00 65.81  ? 148  LYS B CD    1 
ATOM   4439  C  CE    . LYS B  2  150 ? 57.482  70.186  82.227  1.00 65.61  ? 148  LYS B CE    1 
ATOM   4440  N  NZ    . LYS B  2  150 ? 57.902  69.551  83.500  1.00 65.90  ? 148  LYS B NZ    1 
ATOM   4441  N  N     . ALA B  2  151 ? 56.288  74.449  78.044  1.00 67.51  ? 149  ALA B N     1 
ATOM   4442  C  CA    . ALA B  2  151 ? 54.927  74.377  77.511  1.00 66.84  ? 149  ALA B CA    1 
ATOM   4443  C  C     . ALA B  2  151 ? 54.850  74.208  75.996  1.00 67.33  ? 149  ALA B C     1 
ATOM   4444  O  O     . ALA B  2  151 ? 53.985  73.480  75.509  1.00 68.51  ? 149  ALA B O     1 
ATOM   4445  C  CB    . ALA B  2  151 ? 54.139  75.601  77.932  1.00 65.33  ? 149  ALA B CB    1 
ATOM   4446  N  N     . VAL B  2  152 ? 55.728  74.872  75.246  1.00 67.04  ? 150  VAL B N     1 
ATOM   4447  C  CA    . VAL B  2  152 ? 55.688  74.722  73.796  1.00 68.59  ? 150  VAL B CA    1 
ATOM   4448  C  C     . VAL B  2  152 ? 56.232  73.345  73.410  1.00 70.53  ? 150  VAL B C     1 
ATOM   4449  O  O     . VAL B  2  152 ? 55.727  72.693  72.492  1.00 72.21  ? 150  VAL B O     1 
ATOM   4450  C  CB    . VAL B  2  152 ? 56.507  75.824  73.040  1.00 67.03  ? 150  VAL B CB    1 
ATOM   4451  C  CG1   . VAL B  2  152 ? 56.144  77.187  73.560  1.00 65.70  ? 150  VAL B CG1   1 
ATOM   4452  C  CG2   . VAL B  2  152 ? 57.999  75.574  73.159  1.00 67.54  ? 150  VAL B CG2   1 
ATOM   4453  N  N     . ALA B  2  153 ? 57.261  72.890  74.111  1.00 71.83  ? 151  ALA B N     1 
ATOM   4454  C  CA    . ALA B  2  153 ? 57.835  71.597  73.795  1.00 72.41  ? 151  ALA B CA    1 
ATOM   4455  C  C     . ALA B  2  153 ? 56.758  70.533  73.917  1.00 73.37  ? 151  ALA B C     1 
ATOM   4456  O  O     . ALA B  2  153 ? 56.501  69.786  72.968  1.00 73.79  ? 151  ALA B O     1 
ATOM   4457  C  CB    . ALA B  2  153 ? 58.979  71.298  74.725  1.00 71.88  ? 151  ALA B CB    1 
ATOM   4458  N  N     . PHE B  2  154 ? 56.107  70.487  75.075  1.00 74.57  ? 152  PHE B N     1 
ATOM   4459  C  CA    . PHE B  2  154 ? 55.065  69.497  75.329  1.00 76.31  ? 152  PHE B CA    1 
ATOM   4460  C  C     . PHE B  2  154 ? 53.823  69.617  74.457  1.00 77.45  ? 152  PHE B C     1 
ATOM   4461  O  O     . PHE B  2  154 ? 52.805  68.970  74.728  1.00 78.58  ? 152  PHE B O     1 
ATOM   4462  C  CB    . PHE B  2  154 ? 54.651  69.515  76.801  1.00 76.46  ? 152  PHE B CB    1 
ATOM   4463  C  CG    . PHE B  2  154 ? 55.559  68.711  77.700  1.00 77.84  ? 152  PHE B CG    1 
ATOM   4464  C  CD1   . PHE B  2  154 ? 56.924  69.018  77.791  1.00 78.14  ? 152  PHE B CD1   1 
ATOM   4465  C  CD2   . PHE B  2  154 ? 55.047  67.653  78.466  1.00 77.06  ? 152  PHE B CD2   1 
ATOM   4466  C  CE1   . PHE B  2  154 ? 57.764  68.288  78.628  1.00 77.92  ? 152  PHE B CE1   1 
ATOM   4467  C  CE2   . PHE B  2  154 ? 55.873  66.915  79.307  1.00 76.84  ? 152  PHE B CE2   1 
ATOM   4468  C  CZ    . PHE B  2  154 ? 57.235  67.231  79.390  1.00 79.29  ? 152  PHE B CZ    1 
ATOM   4469  N  N     . GLN B  2  155 ? 53.901  70.438  73.414  1.00 77.68  ? 153  GLN B N     1 
ATOM   4470  C  CA    . GLN B  2  155 ? 52.773  70.603  72.503  1.00 77.01  ? 153  GLN B CA    1 
ATOM   4471  C  C     . GLN B  2  155 ? 52.700  69.401  71.591  1.00 76.00  ? 153  GLN B C     1 
ATOM   4472  O  O     . GLN B  2  155 ? 51.657  69.124  70.988  1.00 75.68  ? 153  GLN B O     1 
ATOM   4473  C  CB    . GLN B  2  155 ? 52.941  71.850  71.654  1.00 77.68  ? 153  GLN B CB    1 
ATOM   4474  C  CG    . GLN B  2  155 ? 52.986  73.109  72.459  1.00 80.38  ? 153  GLN B CG    1 
ATOM   4475  C  CD    . GLN B  2  155 ? 52.340  74.246  71.734  1.00 82.23  ? 153  GLN B CD    1 
ATOM   4476  O  OE1   . GLN B  2  155 ? 51.117  74.263  71.564  1.00 85.10  ? 153  GLN B OE1   1 
ATOM   4477  N  NE2   . GLN B  2  155 ? 53.148  75.203  71.281  1.00 81.81  ? 153  GLN B NE2   1 
ATOM   4478  N  N     . SER B  2  156 ? 53.830  68.702  71.494  1.00 75.06  ? 154  SER B N     1 
ATOM   4479  C  CA    . SER B  2  156 ? 53.961  67.505  70.673  1.00 73.89  ? 154  SER B CA    1 
ATOM   4480  C  C     . SER B  2  156 ? 53.951  66.335  71.655  1.00 73.95  ? 154  SER B C     1 
ATOM   4481  O  O     . SER B  2  156 ? 54.853  66.213  72.478  1.00 74.90  ? 154  SER B O     1 
ATOM   4482  C  CB    . SER B  2  156 ? 55.286  67.567  69.913  1.00 72.77  ? 154  SER B CB    1 
ATOM   4483  O  OG    . SER B  2  156 ? 55.829  68.886  69.957  1.00 71.26  ? 154  SER B OG    1 
ATOM   4484  N  N     . PRO B  2  157 ? 52.924  65.467  71.596  1.00 73.21  ? 155  PRO B N     1 
ATOM   4485  C  CA    . PRO B  2  157 ? 52.880  64.339  72.530  1.00 74.02  ? 155  PRO B CA    1 
ATOM   4486  C  C     . PRO B  2  157 ? 54.167  63.529  72.406  1.00 75.38  ? 155  PRO B C     1 
ATOM   4487  O  O     . PRO B  2  157 ? 54.640  62.922  73.367  1.00 74.92  ? 155  PRO B O     1 
ATOM   4488  C  CB    . PRO B  2  157 ? 51.643  63.562  72.072  1.00 73.14  ? 155  PRO B CB    1 
ATOM   4489  C  CG    . PRO B  2  157 ? 50.799  64.594  71.429  1.00 72.08  ? 155  PRO B CG    1 
ATOM   4490  C  CD    . PRO B  2  157 ? 51.817  65.378  70.637  1.00 72.31  ? 155  PRO B CD    1 
ATOM   4491  N  N     . GLN B  2  158 ? 54.710  63.531  71.191  1.00 77.55  ? 156  GLN B N     1 
ATOM   4492  C  CA    . GLN B  2  158 ? 55.958  62.857  70.862  1.00 79.00  ? 156  GLN B CA    1 
ATOM   4493  C  C     . GLN B  2  158 ? 56.948  63.069  72.041  1.00 79.26  ? 156  GLN B C     1 
ATOM   4494  O  O     . GLN B  2  158 ? 57.568  62.121  72.531  1.00 78.21  ? 156  GLN B O     1 
ATOM   4495  C  CB    . GLN B  2  158 ? 56.500  63.454  69.530  1.00 79.70  ? 156  GLN B CB    1 
ATOM   4496  C  CG    . GLN B  2  158 ? 57.928  63.016  69.096  1.00 81.43  ? 156  GLN B CG    1 
ATOM   4497  C  CD    . GLN B  2  158 ? 58.767  64.118  68.377  1.00 81.15  ? 156  GLN B CD    1 
ATOM   4498  O  OE1   . GLN B  2  158 ? 58.354  64.679  67.355  1.00 79.91  ? 156  GLN B OE1   1 
ATOM   4499  N  NE2   . GLN B  2  158 ? 59.956  64.402  68.916  1.00 78.69  ? 156  GLN B NE2   1 
ATOM   4500  N  N     . VAL B  2  159 ? 57.054  64.309  72.518  1.00 79.81  ? 157  VAL B N     1 
ATOM   4501  C  CA    . VAL B  2  159 ? 57.970  64.646  73.609  1.00 81.52  ? 157  VAL B CA    1 
ATOM   4502  C  C     . VAL B  2  159 ? 57.527  64.178  75.010  1.00 83.47  ? 157  VAL B C     1 
ATOM   4503  O  O     . VAL B  2  159 ? 58.355  64.024  75.916  1.00 83.89  ? 157  VAL B O     1 
ATOM   4504  C  CB    . VAL B  2  159 ? 58.222  66.168  73.651  1.00 79.82  ? 157  VAL B CB    1 
ATOM   4505  C  CG1   . VAL B  2  159 ? 56.969  66.875  74.073  1.00 81.22  ? 157  VAL B CG1   1 
ATOM   4506  C  CG2   . VAL B  2  159 ? 59.349  66.493  74.607  1.00 79.49  ? 157  VAL B CG2   1 
ATOM   4507  N  N     . GLY B  2  160 ? 56.229  63.955  75.188  1.00 84.92  ? 158  GLY B N     1 
ATOM   4508  C  CA    . GLY B  2  160 ? 55.734  63.506  76.479  1.00 85.16  ? 158  GLY B CA    1 
ATOM   4509  C  C     . GLY B  2  160 ? 56.085  62.064  76.803  1.00 84.69  ? 158  GLY B C     1 
ATOM   4510  O  O     . GLY B  2  160 ? 56.592  61.771  77.882  1.00 84.79  ? 158  GLY B O     1 
ATOM   4511  N  N     . VAL B  2  161 ? 55.824  61.154  75.876  1.00 84.60  ? 159  VAL B N     1 
ATOM   4512  C  CA    . VAL B  2  161 ? 56.126  59.759  76.133  1.00 85.04  ? 159  VAL B CA    1 
ATOM   4513  C  C     . VAL B  2  161 ? 57.624  59.510  76.214  1.00 85.02  ? 159  VAL B C     1 
ATOM   4514  O  O     . VAL B  2  161 ? 58.063  58.622  76.942  1.00 84.96  ? 159  VAL B O     1 
ATOM   4515  C  CB    . VAL B  2  161 ? 55.522  58.828  75.062  1.00 85.20  ? 159  VAL B CB    1 
ATOM   4516  C  CG1   . VAL B  2  161 ? 54.010  58.959  75.046  1.00 85.04  ? 159  VAL B CG1   1 
ATOM   4517  C  CG2   . VAL B  2  161 ? 56.101  59.154  73.718  1.00 86.04  ? 159  VAL B CG2   1 
ATOM   4518  N  N     . LEU B  2  162 ? 58.420  60.282  75.481  1.00 85.10  ? 160  LEU B N     1 
ATOM   4519  C  CA    . LEU B  2  162 ? 59.861  60.068  75.550  1.00 85.65  ? 160  LEU B CA    1 
ATOM   4520  C  C     . LEU B  2  162 ? 60.402  60.385  76.942  1.00 86.33  ? 160  LEU B C     1 
ATOM   4521  O  O     . LEU B  2  162 ? 61.299  59.706  77.437  1.00 87.07  ? 160  LEU B O     1 
ATOM   4522  C  CB    . LEU B  2  162 ? 60.593  60.888  74.491  1.00 84.65  ? 160  LEU B CB    1 
ATOM   4523  C  CG    . LEU B  2  162 ? 60.406  60.424  73.040  1.00 84.24  ? 160  LEU B CG    1 
ATOM   4524  C  CD1   . LEU B  2  162 ? 61.601  60.914  72.234  1.00 84.60  ? 160  LEU B CD1   1 
ATOM   4525  C  CD2   . LEU B  2  162 ? 60.321  58.908  72.938  1.00 82.19  ? 160  LEU B CD2   1 
ATOM   4526  N  N     . GLU B  2  163 ? 59.850  61.411  77.578  1.00 87.10  ? 161  GLU B N     1 
ATOM   4527  C  CA    . GLU B  2  163 ? 60.259  61.774  78.927  1.00 87.04  ? 161  GLU B CA    1 
ATOM   4528  C  C     . GLU B  2  163 ? 59.937  60.621  79.856  1.00 86.92  ? 161  GLU B C     1 
ATOM   4529  O  O     . GLU B  2  163 ? 60.799  60.145  80.585  1.00 87.03  ? 161  GLU B O     1 
ATOM   4530  C  CB    . GLU B  2  163 ? 59.495  62.997  79.399  1.00 88.01  ? 161  GLU B CB    1 
ATOM   4531  C  CG    . GLU B  2  163 ? 59.970  64.283  78.795  1.00 90.46  ? 161  GLU B CG    1 
ATOM   4532  C  CD    . GLU B  2  163 ? 61.252  64.758  79.424  1.00 91.50  ? 161  GLU B CD    1 
ATOM   4533  O  OE1   . GLU B  2  163 ? 62.307  64.144  79.152  1.00 91.78  ? 161  GLU B OE1   1 
ATOM   4534  O  OE2   . GLU B  2  163 ? 61.191  65.743  80.201  1.00 92.73  ? 161  GLU B OE2   1 
ATOM   4535  N  N     . ASN B  2  164 ? 58.684  60.180  79.815  1.00 86.66  ? 162  ASN B N     1 
ATOM   4536  C  CA    . ASN B  2  164 ? 58.214  59.090  80.654  1.00 87.57  ? 162  ASN B CA    1 
ATOM   4537  C  C     . ASN B  2  164 ? 58.836  57.750  80.325  1.00 87.30  ? 162  ASN B C     1 
ATOM   4538  O  O     . ASN B  2  164 ? 58.772  56.822  81.134  1.00 87.72  ? 162  ASN B O     1 
ATOM   4539  C  CB    . ASN B  2  164 ? 56.700  58.969  80.553  1.00 89.76  ? 162  ASN B CB    1 
ATOM   4540  C  CG    . ASN B  2  164 ? 55.993  60.159  81.138  1.00 92.71  ? 162  ASN B CG    1 
ATOM   4541  O  OD1   . ASN B  2  164 ? 56.061  60.408  82.344  1.00 94.28  ? 162  ASN B OD1   1 
ATOM   4542  N  ND2   . ASN B  2  164 ? 55.316  60.919  80.286  1.00 95.63  ? 162  ASN B ND2   1 
ATOM   4543  N  N     . LEU B  2  165 ? 59.423  57.634  79.135  1.00 87.11  ? 163  LEU B N     1 
ATOM   4544  C  CA    . LEU B  2  165 ? 60.056  56.378  78.738  1.00 85.43  ? 163  LEU B CA    1 
ATOM   4545  C  C     . LEU B  2  165 ? 61.329  56.278  79.549  1.00 84.49  ? 163  LEU B C     1 
ATOM   4546  O  O     . LEU B  2  165 ? 61.480  55.384  80.384  1.00 83.28  ? 163  LEU B O     1 
ATOM   4547  C  CB    . LEU B  2  165 ? 60.390  56.369  77.247  1.00 84.84  ? 163  LEU B CB    1 
ATOM   4548  C  CG    . LEU B  2  165 ? 60.686  54.968  76.694  1.00 85.05  ? 163  LEU B CG    1 
ATOM   4549  C  CD1   . LEU B  2  165 ? 59.436  54.098  76.803  1.00 83.44  ? 163  LEU B CD1   1 
ATOM   4550  C  CD2   . LEU B  2  165 ? 61.145  55.060  75.243  1.00 85.13  ? 163  LEU B CD2   1 
ATOM   4551  N  N     . HIS B  2  166 ? 62.238  57.215  79.313  1.00 83.84  ? 164  HIS B N     1 
ATOM   4552  C  CA    . HIS B  2  166 ? 63.486  57.236  80.056  1.00 84.46  ? 164  HIS B CA    1 
ATOM   4553  C  C     . HIS B  2  166 ? 63.238  57.124  81.564  1.00 85.74  ? 164  HIS B C     1 
ATOM   4554  O  O     . HIS B  2  166 ? 64.160  56.866  82.333  1.00 86.99  ? 164  HIS B O     1 
ATOM   4555  C  CB    . HIS B  2  166 ? 64.251  58.522  79.772  1.00 82.26  ? 164  HIS B CB    1 
ATOM   4556  C  CG    . HIS B  2  166 ? 64.845  58.584  78.401  1.00 81.73  ? 164  HIS B CG    1 
ATOM   4557  N  ND1   . HIS B  2  166 ? 64.080  58.557  77.255  1.00 81.28  ? 164  HIS B ND1   1 
ATOM   4558  C  CD2   . HIS B  2  166 ? 66.130  58.716  77.991  1.00 81.35  ? 164  HIS B CD2   1 
ATOM   4559  C  CE1   . HIS B  2  166 ? 64.867  58.675  76.201  1.00 80.75  ? 164  HIS B CE1   1 
ATOM   4560  N  NE2   . HIS B  2  166 ? 66.116  58.772  76.620  1.00 80.50  ? 164  HIS B NE2   1 
ATOM   4561  N  N     . ALA B  2  167 ? 61.996  57.323  81.989  1.00 86.44  ? 165  ALA B N     1 
ATOM   4562  C  CA    . ALA B  2  167 ? 61.673  57.241  83.403  1.00 86.23  ? 165  ALA B CA    1 
ATOM   4563  C  C     . ALA B  2  167 ? 61.306  55.816  83.772  1.00 86.62  ? 165  ALA B C     1 
ATOM   4564  O  O     . ALA B  2  167 ? 61.442  55.422  84.926  1.00 87.38  ? 165  ALA B O     1 
ATOM   4565  C  CB    . ALA B  2  167 ? 60.525  58.178  83.736  1.00 85.89  ? 165  ALA B CB    1 
ATOM   4566  N  N     . ALA B  2  168 ? 60.836  55.044  82.798  1.00 86.89  ? 166  ALA B N     1 
ATOM   4567  C  CA    . ALA B  2  168 ? 60.454  53.657  83.051  1.00 88.14  ? 166  ALA B CA    1 
ATOM   4568  C  C     . ALA B  2  168 ? 61.600  52.752  82.626  1.00 88.70  ? 166  ALA B C     1 
ATOM   4569  O  O     . ALA B  2  168 ? 61.764  51.633  83.113  1.00 88.54  ? 166  ALA B O     1 
ATOM   4570  C  CB    . ALA B  2  168 ? 59.183  53.304  82.272  1.00 87.86  ? 166  ALA B CB    1 
ATOM   4571  N  N     . ALA B  2  169 ? 62.408  53.254  81.711  1.00 89.08  ? 167  ALA B N     1 
ATOM   4572  C  CA    . ALA B  2  169 ? 63.525  52.485  81.226  1.00 89.77  ? 167  ALA B CA    1 
ATOM   4573  C  C     . ALA B  2  169 ? 64.688  52.565  82.192  1.00 90.89  ? 167  ALA B C     1 
ATOM   4574  O  O     . ALA B  2  169 ? 65.635  51.788  82.080  1.00 93.12  ? 167  ALA B O     1 
ATOM   4575  C  CB    . ALA B  2  169 ? 63.946  52.993  79.879  1.00 89.20  ? 167  ALA B CB    1 
ATOM   4576  N  N     . TYR B  2  170 ? 64.643  53.502  83.134  1.00 90.30  ? 168  TYR B N     1 
ATOM   4577  C  CA    . TYR B  2  170 ? 65.747  53.620  84.077  1.00 90.17  ? 168  TYR B CA    1 
ATOM   4578  C  C     . TYR B  2  170 ? 65.365  53.875  85.532  1.00 91.38  ? 168  TYR B C     1 
ATOM   4579  O  O     . TYR B  2  170 ? 64.185  54.018  85.873  1.00 91.08  ? 168  TYR B O     1 
ATOM   4580  C  CB    . TYR B  2  170 ? 66.724  54.706  83.611  1.00 88.52  ? 168  TYR B CB    1 
ATOM   4581  C  CG    . TYR B  2  170 ? 67.351  54.419  82.266  1.00 88.25  ? 168  TYR B CG    1 
ATOM   4582  C  CD1   . TYR B  2  170 ? 66.613  54.530  81.096  1.00 87.78  ? 168  TYR B CD1   1 
ATOM   4583  C  CD2   . TYR B  2  170 ? 68.677  54.013  82.165  1.00 88.32  ? 168  TYR B CD2   1 
ATOM   4584  C  CE1   . TYR B  2  170 ? 67.176  54.244  79.861  1.00 87.91  ? 168  TYR B CE1   1 
ATOM   4585  C  CE2   . TYR B  2  170 ? 69.249  53.723  80.932  1.00 87.82  ? 168  TYR B CE2   1 
ATOM   4586  C  CZ    . TYR B  2  170 ? 68.491  53.842  79.784  1.00 87.69  ? 168  TYR B CZ    1 
ATOM   4587  O  OH    . TYR B  2  170 ? 69.038  53.572  78.551  1.00 87.53  ? 168  TYR B OH    1 
ATOM   4588  N  N     . LYS B  2  171 ? 66.390  53.897  86.385  1.00 92.92  ? 169  LYS B N     1 
ATOM   4589  C  CA    . LYS B  2  171 ? 66.238  54.151  87.818  1.00 93.04  ? 169  LYS B CA    1 
ATOM   4590  C  C     . LYS B  2  171 ? 67.063  55.377  88.177  1.00 93.55  ? 169  LYS B C     1 
ATOM   4591  O  O     . LYS B  2  171 ? 66.975  55.876  89.295  1.00 93.57  ? 169  LYS B O     1 
ATOM   4592  C  CB    . LYS B  2  171 ? 66.743  52.976  88.657  1.00 91.98  ? 169  LYS B CB    1 
ATOM   4593  C  CG    . LYS B  2  171 ? 65.889  51.727  88.616  1.00 92.02  ? 169  LYS B CG    1 
ATOM   4594  C  CD    . LYS B  2  171 ? 66.437  50.682  89.584  1.00 92.03  ? 169  LYS B CD    1 
ATOM   4595  C  CE    . LYS B  2  171 ? 65.594  49.407  89.593  1.00 93.34  ? 169  LYS B CE    1 
ATOM   4596  N  NZ    . LYS B  2  171 ? 66.001  48.429  90.648  1.00 92.86  ? 169  LYS B NZ    1 
ATOM   4597  N  N     . THR B  2  172 ? 67.857  55.861  87.226  1.00 94.19  ? 170  THR B N     1 
ATOM   4598  C  CA    . THR B  2  172 ? 68.706  57.021  87.472  1.00 95.84  ? 170  THR B CA    1 
ATOM   4599  C  C     . THR B  2  172 ? 69.289  57.656  86.213  1.00 95.89  ? 170  THR B C     1 
ATOM   4600  O  O     . THR B  2  172 ? 68.949  57.274  85.093  1.00 96.32  ? 170  THR B O     1 
ATOM   4601  C  CB    . THR B  2  172 ? 69.882  56.635  88.383  1.00 97.48  ? 170  THR B CB    1 
ATOM   4602  O  OG1   . THR B  2  172 ? 70.195  55.249  88.178  1.00 98.84  ? 170  THR B OG1   1 
ATOM   4603  C  CG2   . THR B  2  172 ? 69.543  56.887  89.849  1.00 98.29  ? 170  THR B CG2   1 
ATOM   4604  N  N     . ALA B  2  173 ? 70.171  58.633  86.433  1.00 95.63  ? 171  ALA B N     1 
ATOM   4605  C  CA    . ALA B  2  173 ? 70.875  59.372  85.382  1.00 95.17  ? 171  ALA B CA    1 
ATOM   4606  C  C     . ALA B  2  173 ? 70.068  59.644  84.111  1.00 93.88  ? 171  ALA B C     1 
ATOM   4607  O  O     . ALA B  2  173 ? 69.660  60.780  83.847  1.00 93.36  ? 171  ALA B O     1 
ATOM   4608  C  CB    . ALA B  2  173 ? 72.178  58.639  85.028  1.00 96.76  ? 171  ALA B CB    1 
ATOM   4609  N  N     . LEU B  2  174 ? 69.875  58.599  83.314  1.00 91.95  ? 172  LEU B N     1 
ATOM   4610  C  CA    . LEU B  2  174 ? 69.122  58.707  82.084  1.00 90.08  ? 172  LEU B CA    1 
ATOM   4611  C  C     . LEU B  2  174 ? 67.636  58.799  82.409  1.00 89.82  ? 172  LEU B C     1 
ATOM   4612  O  O     . LEU B  2  174 ? 66.838  59.262  81.595  1.00 90.02  ? 172  LEU B O     1 
ATOM   4613  C  CB    . LEU B  2  174 ? 69.404  57.499  81.188  1.00 87.59  ? 172  LEU B CB    1 
ATOM   4614  C  CG    . LEU B  2  174 ? 70.832  57.423  80.647  1.00 85.57  ? 172  LEU B CG    1 
ATOM   4615  C  CD1   . LEU B  2  174 ? 70.929  56.288  79.648  1.00 85.23  ? 172  LEU B CD1   1 
ATOM   4616  C  CD2   . LEU B  2  174 ? 71.213  58.729  79.985  1.00 83.61  ? 172  LEU B CD2   1 
ATOM   4617  N  N     . ALA B  2  175 ? 67.269  58.362  83.606  1.00 89.37  ? 173  ALA B N     1 
ATOM   4618  C  CA    . ALA B  2  175 ? 65.878  58.407  84.031  1.00 89.38  ? 173  ALA B CA    1 
ATOM   4619  C  C     . ALA B  2  175 ? 65.464  59.841  84.322  1.00 89.16  ? 173  ALA B C     1 
ATOM   4620  O  O     . ALA B  2  175 ? 64.271  60.134  84.470  1.00 89.19  ? 173  ALA B O     1 
ATOM   4621  C  CB    . ALA B  2  175 ? 65.681  57.547  85.270  1.00 89.72  ? 173  ALA B CB    1 
ATOM   4622  N  N     . ASN B  2  176 ? 66.457  60.726  84.411  1.00 88.57  ? 174  ASN B N     1 
ATOM   4623  C  CA    . ASN B  2  176 ? 66.212  62.138  84.682  1.00 88.08  ? 174  ASN B CA    1 
ATOM   4624  C  C     . ASN B  2  176 ? 65.622  62.824  83.457  1.00 88.05  ? 174  ASN B C     1 
ATOM   4625  O  O     . ASN B  2  176 ? 66.151  62.684  82.349  1.00 88.73  ? 174  ASN B O     1 
ATOM   4626  C  CB    . ASN B  2  176 ? 67.506  62.849  85.087  1.00 86.72  ? 174  ASN B CB    1 
ATOM   4627  C  CG    . ASN B  2  176 ? 67.890  62.583  86.525  1.00 85.61  ? 174  ASN B CG    1 
ATOM   4628  O  OD1   . ASN B  2  176 ? 67.110  62.025  87.299  1.00 83.15  ? 174  ASN B OD1   1 
ATOM   4629  N  ND2   . ASN B  2  176 ? 69.095  62.998  86.897  1.00 86.36  ? 174  ASN B ND2   1 
ATOM   4630  N  N     . PRO B  2  177 ? 64.518  63.581  83.648  1.00 87.30  ? 175  PRO B N     1 
ATOM   4631  C  CA    . PRO B  2  177 ? 63.801  64.319  82.601  1.00 85.21  ? 175  PRO B CA    1 
ATOM   4632  C  C     . PRO B  2  177 ? 64.647  65.429  81.982  1.00 83.69  ? 175  PRO B C     1 
ATOM   4633  O  O     . PRO B  2  177 ? 65.519  66.006  82.646  1.00 83.96  ? 175  PRO B O     1 
ATOM   4634  C  CB    . PRO B  2  177 ? 62.590  64.861  83.344  1.00 85.64  ? 175  PRO B CB    1 
ATOM   4635  C  CG    . PRO B  2  177 ? 63.152  65.138  84.692  1.00 86.12  ? 175  PRO B CG    1 
ATOM   4636  C  CD    . PRO B  2  177 ? 63.924  63.872  84.967  1.00 86.90  ? 175  PRO B CD    1 
ATOM   4637  N  N     . LEU B  2  178 ? 64.368  65.723  80.713  1.00 80.69  ? 176  LEU B N     1 
ATOM   4638  C  CA    . LEU B  2  178 ? 65.102  66.726  79.959  1.00 78.38  ? 176  LEU B CA    1 
ATOM   4639  C  C     . LEU B  2  178 ? 64.581  68.149  80.179  1.00 78.40  ? 176  LEU B C     1 
ATOM   4640  O  O     . LEU B  2  178 ? 65.300  69.127  79.950  1.00 79.74  ? 176  LEU B O     1 
ATOM   4641  C  CB    . LEU B  2  178 ? 65.058  66.344  78.481  1.00 76.83  ? 176  LEU B CB    1 
ATOM   4642  C  CG    . LEU B  2  178 ? 65.872  67.153  77.476  1.00 76.74  ? 176  LEU B CG    1 
ATOM   4643  C  CD1   . LEU B  2  178 ? 67.331  67.240  77.894  1.00 75.72  ? 176  LEU B CD1   1 
ATOM   4644  C  CD2   . LEU B  2  178 ? 65.734  66.493  76.117  1.00 76.51  ? 176  LEU B CD2   1 
ATOM   4645  N  N     . TYR B  2  179 ? 63.332  68.266  80.621  1.00 77.63  ? 177  TYR B N     1 
ATOM   4646  C  CA    . TYR B  2  179 ? 62.740  69.570  80.894  1.00 76.46  ? 177  TYR B CA    1 
ATOM   4647  C  C     . TYR B  2  179 ? 62.424  69.667  82.375  1.00 76.20  ? 177  TYR B C     1 
ATOM   4648  O  O     . TYR B  2  179 ? 61.732  68.813  82.932  1.00 74.51  ? 177  TYR B O     1 
ATOM   4649  C  CB    . TYR B  2  179 ? 61.460  69.781  80.082  1.00 76.75  ? 177  TYR B CB    1 
ATOM   4650  C  CG    . TYR B  2  179 ? 61.690  69.887  78.597  1.00 76.70  ? 177  TYR B CG    1 
ATOM   4651  C  CD1   . TYR B  2  179 ? 61.459  68.799  77.757  1.00 77.07  ? 177  TYR B CD1   1 
ATOM   4652  C  CD2   . TYR B  2  179 ? 62.185  71.061  78.033  1.00 77.63  ? 177  TYR B CD2   1 
ATOM   4653  C  CE1   . TYR B  2  179 ? 61.720  68.874  76.384  1.00 76.84  ? 177  TYR B CE1   1 
ATOM   4654  C  CE2   . TYR B  2  179 ? 62.451  71.151  76.654  1.00 77.66  ? 177  TYR B CE2   1 
ATOM   4655  C  CZ    . TYR B  2  179 ? 62.216  70.049  75.838  1.00 76.72  ? 177  TYR B CZ    1 
ATOM   4656  O  OH    . TYR B  2  179 ? 62.464  70.120  74.484  1.00 76.01  ? 177  TYR B OH    1 
ATOM   4657  N  N     . CYS B  2  180 ? 62.940  70.719  83.000  1.00 77.03  ? 178  CYS B N     1 
ATOM   4658  C  CA    . CYS B  2  180 ? 62.742  70.949  84.423  1.00 78.74  ? 178  CYS B CA    1 
ATOM   4659  C  C     . CYS B  2  180 ? 61.363  70.552  84.915  1.00 80.91  ? 178  CYS B C     1 
ATOM   4660  O  O     . CYS B  2  180 ? 60.347  71.035  84.410  1.00 80.58  ? 178  CYS B O     1 
ATOM   4661  C  CB    . CYS B  2  180 ? 62.976  72.419  84.774  1.00 77.65  ? 178  CYS B CB    1 
ATOM   4662  S  SG    . CYS B  2  180 ? 62.681  72.789  86.534  1.00 74.78  ? 178  CYS B SG    1 
ATOM   4663  N  N     . PRO B  2  181 ? 61.310  69.661  85.917  1.00 82.95  ? 179  PRO B N     1 
ATOM   4664  C  CA    . PRO B  2  181 ? 60.022  69.227  86.459  1.00 83.98  ? 179  PRO B CA    1 
ATOM   4665  C  C     . PRO B  2  181 ? 59.309  70.433  87.046  1.00 84.72  ? 179  PRO B C     1 
ATOM   4666  O  O     . PRO B  2  181 ? 59.941  71.400  87.478  1.00 84.31  ? 179  PRO B O     1 
ATOM   4667  C  CB    . PRO B  2  181 ? 60.410  68.184  87.506  1.00 84.01  ? 179  PRO B CB    1 
ATOM   4668  C  CG    . PRO B  2  181 ? 61.766  68.640  87.947  1.00 85.00  ? 179  PRO B CG    1 
ATOM   4669  C  CD    . PRO B  2  181 ? 62.428  69.043  86.650  1.00 83.87  ? 179  PRO B CD    1 
ATOM   4670  N  N     . ASP B  2  182 ? 57.986  70.364  87.041  1.00 86.71  ? 180  ASP B N     1 
ATOM   4671  C  CA    . ASP B  2  182 ? 57.143  71.446  87.527  1.00 87.79  ? 180  ASP B CA    1 
ATOM   4672  C  C     . ASP B  2  182 ? 57.475  71.987  88.919  1.00 86.84  ? 180  ASP B C     1 
ATOM   4673  O  O     . ASP B  2  182 ? 57.838  73.156  89.057  1.00 85.95  ? 180  ASP B O     1 
ATOM   4674  C  CB    . ASP B  2  182 ? 55.674  71.002  87.448  1.00 89.87  ? 180  ASP B CB    1 
ATOM   4675  C  CG    . ASP B  2  182 ? 55.128  71.034  86.018  1.00 91.11  ? 180  ASP B CG    1 
ATOM   4676  O  OD1   . ASP B  2  182 ? 55.928  70.963  85.055  1.00 91.49  ? 180  ASP B OD1   1 
ATOM   4677  O  OD2   . ASP B  2  182 ? 53.892  71.121  85.856  1.00 93.07  ? 180  ASP B OD2   1 
ATOM   4678  N  N     . TYR B  2  183 ? 57.364  71.139  89.939  1.00 86.66  ? 181  TYR B N     1 
ATOM   4679  C  CA    . TYR B  2  183 ? 57.632  71.554  91.319  1.00 86.12  ? 181  TYR B CA    1 
ATOM   4680  C  C     . TYR B  2  183 ? 58.948  72.315  91.536  1.00 83.20  ? 181  TYR B C     1 
ATOM   4681  O  O     . TYR B  2  183 ? 59.077  73.081  92.489  1.00 81.04  ? 181  TYR B O     1 
ATOM   4682  C  CB    . TYR B  2  183 ? 57.559  70.333  92.259  1.00 89.80  ? 181  TYR B CB    1 
ATOM   4683  C  CG    . TYR B  2  183 ? 58.825  69.488  92.371  1.00 94.45  ? 181  TYR B CG    1 
ATOM   4684  C  CD1   . TYR B  2  183 ? 59.932  69.942  93.093  1.00 97.07  ? 181  TYR B CD1   1 
ATOM   4685  C  CD2   . TYR B  2  183 ? 58.902  68.216  91.791  1.00 95.91  ? 181  TYR B CD2   1 
ATOM   4686  C  CE1   . TYR B  2  183 ? 61.084  69.153  93.242  1.00 98.48  ? 181  TYR B CE1   1 
ATOM   4687  C  CE2   . TYR B  2  183 ? 60.057  67.419  91.933  1.00 97.91  ? 181  TYR B CE2   1 
ATOM   4688  C  CZ    . TYR B  2  183 ? 61.142  67.900  92.662  1.00 98.66  ? 181  TYR B CZ    1 
ATOM   4689  O  OH    . TYR B  2  183 ? 62.287  67.145  92.813  1.00 99.09  ? 181  TYR B OH    1 
ATOM   4690  N  N     . ARG B  2  184 ? 59.917  72.122  90.652  1.00 80.93  ? 182  ARG B N     1 
ATOM   4691  C  CA    . ARG B  2  184 ? 61.186  72.802  90.817  1.00 79.79  ? 182  ARG B CA    1 
ATOM   4692  C  C     . ARG B  2  184 ? 61.345  74.128  90.092  1.00 80.36  ? 182  ARG B C     1 
ATOM   4693  O  O     . ARG B  2  184 ? 62.400  74.763  90.191  1.00 81.43  ? 182  ARG B O     1 
ATOM   4694  C  CB    . ARG B  2  184 ? 62.340  71.869  90.453  1.00 79.15  ? 182  ARG B CB    1 
ATOM   4695  C  CG    . ARG B  2  184 ? 62.782  70.993  91.628  1.00 78.16  ? 182  ARG B CG    1 
ATOM   4696  C  CD    . ARG B  2  184 ? 64.137  70.349  91.416  1.00 77.19  ? 182  ARG B CD    1 
ATOM   4697  N  NE    . ARG B  2  184 ? 65.213  71.332  91.241  1.00 74.88  ? 182  ARG B NE    1 
ATOM   4698  C  CZ    . ARG B  2  184 ? 65.695  72.119  92.202  1.00 72.96  ? 182  ARG B CZ    1 
ATOM   4699  N  NH1   . ARG B  2  184 ? 65.211  72.064  93.437  1.00 71.52  ? 182  ARG B NH1   1 
ATOM   4700  N  NH2   . ARG B  2  184 ? 66.673  72.962  91.921  1.00 71.85  ? 182  ARG B NH2   1 
ATOM   4701  N  N     . ILE B  2  185 ? 60.316  74.563  89.369  1.00 79.84  ? 183  ILE B N     1 
ATOM   4702  C  CA    . ILE B  2  185 ? 60.405  75.845  88.678  1.00 78.15  ? 183  ILE B CA    1 
ATOM   4703  C  C     . ILE B  2  185 ? 60.461  76.931  89.738  1.00 78.85  ? 183  ILE B C     1 
ATOM   4704  O  O     . ILE B  2  185 ? 59.615  76.988  90.635  1.00 78.36  ? 183  ILE B O     1 
ATOM   4705  C  CB    . ILE B  2  185 ? 59.185  76.129  87.797  1.00 77.46  ? 183  ILE B CB    1 
ATOM   4706  C  CG1   . ILE B  2  185 ? 59.009  75.026  86.757  1.00 76.99  ? 183  ILE B CG1   1 
ATOM   4707  C  CG2   . ILE B  2  185 ? 59.366  77.473  87.104  1.00 75.39  ? 183  ILE B CG2   1 
ATOM   4708  C  CD1   . ILE B  2  185 ? 60.014  75.082  85.654  1.00 77.12  ? 183  ILE B CD1   1 
ATOM   4709  N  N     . GLY B  2  186 ? 61.469  77.785  89.637  1.00 79.88  ? 184  GLY B N     1 
ATOM   4710  C  CA    . GLY B  2  186 ? 61.620  78.864  90.592  1.00 80.93  ? 184  GLY B CA    1 
ATOM   4711  C  C     . GLY B  2  186 ? 62.438  78.508  91.819  1.00 81.54  ? 184  GLY B C     1 
ATOM   4712  O  O     . GLY B  2  186 ? 62.835  79.401  92.572  1.00 81.24  ? 184  GLY B O     1 
ATOM   4713  N  N     . LYS B  2  187 ? 62.701  77.215  92.014  1.00 82.22  ? 185  LYS B N     1 
ATOM   4714  C  CA    . LYS B  2  187 ? 63.468  76.749  93.167  1.00 82.96  ? 185  LYS B CA    1 
ATOM   4715  C  C     . LYS B  2  187 ? 64.929  76.431  92.885  1.00 83.35  ? 185  LYS B C     1 
ATOM   4716  O  O     . LYS B  2  187 ? 65.652  75.943  93.756  1.00 83.41  ? 185  LYS B O     1 
ATOM   4717  C  CB    . LYS B  2  187 ? 62.780  75.542  93.790  1.00 82.93  ? 185  LYS B CB    1 
ATOM   4718  C  CG    . LYS B  2  187 ? 61.529  75.939  94.534  1.00 85.85  ? 185  LYS B CG    1 
ATOM   4719  C  CD    . LYS B  2  187 ? 60.670  74.747  94.914  1.00 88.76  ? 185  LYS B CD    1 
ATOM   4720  C  CE    . LYS B  2  187 ? 59.363  75.209  95.578  1.00 90.78  ? 185  LYS B CE    1 
ATOM   4721  N  NZ    . LYS B  2  187 ? 58.380  74.093  95.773  1.00 92.20  ? 185  LYS B NZ    1 
ATOM   4722  N  N     . ILE B  2  188 ? 65.369  76.707  91.668  1.00 83.79  ? 186  ILE B N     1 
ATOM   4723  C  CA    . ILE B  2  188 ? 66.758  76.481  91.310  1.00 84.63  ? 186  ILE B CA    1 
ATOM   4724  C  C     . ILE B  2  188 ? 67.510  77.709  91.824  1.00 85.57  ? 186  ILE B C     1 
ATOM   4725  O  O     . ILE B  2  188 ? 66.896  78.747  92.065  1.00 86.29  ? 186  ILE B O     1 
ATOM   4726  C  CB    . ILE B  2  188 ? 66.883  76.318  89.795  1.00 84.39  ? 186  ILE B CB    1 
ATOM   4727  C  CG1   . ILE B  2  188 ? 66.088  75.076  89.378  1.00 84.00  ? 186  ILE B CG1   1 
ATOM   4728  C  CG2   . ILE B  2  188 ? 68.339  76.227  89.387  1.00 83.67  ? 186  ILE B CG2   1 
ATOM   4729  C  CD1   . ILE B  2  188 ? 65.931  74.907  87.893  1.00 85.93  ? 186  ILE B CD1   1 
ATOM   4730  N  N     . THR B  2  189 ? 68.823  77.608  92.006  1.00 86.47  ? 187  THR B N     1 
ATOM   4731  C  CA    . THR B  2  189 ? 69.574  78.743  92.547  1.00 87.35  ? 187  THR B CA    1 
ATOM   4732  C  C     . THR B  2  189 ? 70.869  79.052  91.819  1.00 86.84  ? 187  THR B C     1 
ATOM   4733  O  O     . THR B  2  189 ? 71.407  78.204  91.117  1.00 86.56  ? 187  THR B O     1 
ATOM   4734  C  CB    . THR B  2  189 ? 69.950  78.496  94.007  1.00 88.40  ? 187  THR B CB    1 
ATOM   4735  O  OG1   . THR B  2  189 ? 71.100  77.635  94.052  1.00 91.17  ? 187  THR B OG1   1 
ATOM   4736  C  CG2   . THR B  2  189 ? 68.792  77.828  94.747  1.00 87.92  ? 187  THR B CG2   1 
ATOM   4737  N  N     . SER B  2  190 ? 71.371  80.269  92.013  1.00 86.95  ? 188  SER B N     1 
ATOM   4738  C  CA    . SER B  2  190 ? 72.620  80.685  91.395  1.00 88.81  ? 188  SER B CA    1 
ATOM   4739  C  C     . SER B  2  190 ? 73.726  79.731  91.818  1.00 91.15  ? 188  SER B C     1 
ATOM   4740  O  O     . SER B  2  190 ? 74.699  79.523  91.086  1.00 91.50  ? 188  SER B O     1 
ATOM   4741  C  CB    . SER B  2  190 ? 72.992  82.103  91.820  1.00 87.68  ? 188  SER B CB    1 
ATOM   4742  O  OG    . SER B  2  190 ? 72.210  83.054  91.138  1.00 87.48  ? 188  SER B OG    1 
ATOM   4743  N  N     . GLU B  2  191 ? 73.584  79.162  93.012  1.00 93.09  ? 189  GLU B N     1 
ATOM   4744  C  CA    . GLU B  2  191 ? 74.568  78.213  93.504  1.00 94.91  ? 189  GLU B CA    1 
ATOM   4745  C  C     . GLU B  2  191 ? 74.509  77.034  92.552  1.00 94.41  ? 189  GLU B C     1 
ATOM   4746  O  O     . GLU B  2  191 ? 75.409  76.837  91.729  1.00 94.98  ? 189  GLU B O     1 
ATOM   4747  C  CB    . GLU B  2  191 ? 74.229  77.737  94.923  1.00 97.46  ? 189  GLU B CB    1 
ATOM   4748  C  CG    . GLU B  2  191 ? 74.432  78.790  96.005  1.00 103.94 ? 189  GLU B CG    1 
ATOM   4749  C  CD    . GLU B  2  191 ? 73.333  79.860  96.027  1.00 107.56 ? 189  GLU B CD    1 
ATOM   4750  O  OE1   . GLU B  2  191 ? 73.022  80.429  94.956  1.00 109.61 ? 189  GLU B OE1   1 
ATOM   4751  O  OE2   . GLU B  2  191 ? 72.784  80.141  97.122  1.00 108.63 ? 189  GLU B OE2   1 
ATOM   4752  N  N     . GLN B  2  192 ? 73.419  76.279  92.650  1.00 92.71  ? 190  GLN B N     1 
ATOM   4753  C  CA    . GLN B  2  192 ? 73.220  75.099  91.822  1.00 91.19  ? 190  GLN B CA    1 
ATOM   4754  C  C     . GLN B  2  192 ? 73.751  75.256  90.409  1.00 89.81  ? 190  GLN B C     1 
ATOM   4755  O  O     . GLN B  2  192 ? 74.412  74.361  89.885  1.00 89.63  ? 190  GLN B O     1 
ATOM   4756  C  CB    . GLN B  2  192 ? 71.739  74.725  91.817  1.00 91.28  ? 190  GLN B CB    1 
ATOM   4757  C  CG    . GLN B  2  192 ? 71.266  74.317  93.199  1.00 92.01  ? 190  GLN B CG    1 
ATOM   4758  C  CD    . GLN B  2  192 ? 69.860  73.798  93.212  1.00 93.10  ? 190  GLN B CD    1 
ATOM   4759  O  OE1   . GLN B  2  192 ? 68.905  74.549  93.016  1.00 95.82  ? 190  GLN B OE1   1 
ATOM   4760  N  NE2   . GLN B  2  192 ? 69.717  72.498  93.438  1.00 94.07  ? 190  GLN B NE2   1 
ATOM   4761  N  N     . LEU B  2  193 ? 73.476  76.396  89.794  1.00 88.77  ? 191  LEU B N     1 
ATOM   4762  C  CA    . LEU B  2  193 ? 73.959  76.644  88.446  1.00 88.02  ? 191  LEU B CA    1 
ATOM   4763  C  C     . LEU B  2  193 ? 75.481  76.708  88.456  1.00 87.87  ? 191  LEU B C     1 
ATOM   4764  O  O     . LEU B  2  193 ? 76.141  76.009  87.685  1.00 87.40  ? 191  LEU B O     1 
ATOM   4765  C  CB    . LEU B  2  193 ? 73.374  77.952  87.904  1.00 87.22  ? 191  LEU B CB    1 
ATOM   4766  C  CG    . LEU B  2  193 ? 71.901  77.915  87.498  1.00 84.29  ? 191  LEU B CG    1 
ATOM   4767  C  CD1   . LEU B  2  193 ? 71.415  79.304  87.192  1.00 83.34  ? 191  LEU B CD1   1 
ATOM   4768  C  CD2   . LEU B  2  193 ? 71.745  77.016  86.296  1.00 83.92  ? 191  LEU B CD2   1 
ATOM   4769  N  N     . HIS B  2  194 ? 76.032  77.542  89.334  1.00 88.17  ? 192  HIS B N     1 
ATOM   4770  C  CA    . HIS B  2  194 ? 77.480  77.674  89.454  1.00 88.27  ? 192  HIS B CA    1 
ATOM   4771  C  C     . HIS B  2  194 ? 78.133  76.327  89.662  1.00 88.50  ? 192  HIS B C     1 
ATOM   4772  O  O     . HIS B  2  194 ? 78.977  75.919  88.869  1.00 89.16  ? 192  HIS B O     1 
ATOM   4773  C  CB    . HIS B  2  194 ? 77.841  78.582  90.617  1.00 87.20  ? 192  HIS B CB    1 
ATOM   4774  C  CG    . HIS B  2  194 ? 77.986  80.015  90.227  1.00 87.51  ? 192  HIS B CG    1 
ATOM   4775  N  ND1   . HIS B  2  194 ? 77.258  81.028  90.817  1.00 87.38  ? 192  HIS B ND1   1 
ATOM   4776  C  CD2   . HIS B  2  194 ? 78.779  80.609  89.304  1.00 87.40  ? 192  HIS B CD2   1 
ATOM   4777  C  CE1   . HIS B  2  194 ? 77.597  82.184  90.275  1.00 87.24  ? 192  HIS B CE1   1 
ATOM   4778  N  NE2   . HIS B  2  194 ? 78.519  81.957  89.353  1.00 87.40  ? 192  HIS B NE2   1 
ATOM   4779  N  N     . HIS B  2  195 ? 77.741  75.633  90.724  1.00 88.55  ? 193  HIS B N     1 
ATOM   4780  C  CA    . HIS B  2  195 ? 78.316  74.328  91.000  1.00 89.33  ? 193  HIS B CA    1 
ATOM   4781  C  C     . HIS B  2  195 ? 78.176  73.409  89.805  1.00 87.70  ? 193  HIS B C     1 
ATOM   4782  O  O     . HIS B  2  195 ? 79.146  72.776  89.416  1.00 87.89  ? 193  HIS B O     1 
ATOM   4783  C  CB    . HIS B  2  195 ? 77.679  73.698  92.240  1.00 93.54  ? 193  HIS B CB    1 
ATOM   4784  C  CG    . HIS B  2  195 ? 77.854  74.522  93.480  1.00 98.57  ? 193  HIS B CG    1 
ATOM   4785  N  ND1   . HIS B  2  195 ? 78.705  75.609  93.534  1.00 100.70 ? 193  HIS B ND1   1 
ATOM   4786  C  CD2   . HIS B  2  195 ? 77.271  74.438  94.701  1.00 100.43 ? 193  HIS B CD2   1 
ATOM   4787  C  CE1   . HIS B  2  195 ? 78.634  76.163  94.733  1.00 101.69 ? 193  HIS B CE1   1 
ATOM   4788  N  NE2   . HIS B  2  195 ? 77.772  75.472  95.461  1.00 102.56 ? 193  HIS B NE2   1 
ATOM   4789  N  N     . PHE B  2  196 ? 76.990  73.345  89.205  1.00 86.41  ? 194  PHE B N     1 
ATOM   4790  C  CA    . PHE B  2  196 ? 76.804  72.484  88.038  1.00 84.81  ? 194  PHE B CA    1 
ATOM   4791  C  C     . PHE B  2  196 ? 77.867  72.801  86.993  1.00 85.48  ? 194  PHE B C     1 
ATOM   4792  O  O     . PHE B  2  196 ? 78.520  71.908  86.466  1.00 85.55  ? 194  PHE B O     1 
ATOM   4793  C  CB    . PHE B  2  196 ? 75.426  72.676  87.405  1.00 80.39  ? 194  PHE B CB    1 
ATOM   4794  C  CG    . PHE B  2  196 ? 75.099  71.640  86.356  1.00 76.23  ? 194  PHE B CG    1 
ATOM   4795  C  CD1   . PHE B  2  196 ? 74.485  70.434  86.710  1.00 73.52  ? 194  PHE B CD1   1 
ATOM   4796  C  CD2   . PHE B  2  196 ? 75.442  71.850  85.018  1.00 74.42  ? 194  PHE B CD2   1 
ATOM   4797  C  CE1   . PHE B  2  196 ? 74.216  69.451  85.741  1.00 71.28  ? 194  PHE B CE1   1 
ATOM   4798  C  CE2   . PHE B  2  196 ? 75.180  70.877  84.040  1.00 72.14  ? 194  PHE B CE2   1 
ATOM   4799  C  CZ    . PHE B  2  196 ? 74.566  69.675  84.401  1.00 71.06  ? 194  PHE B CZ    1 
ATOM   4800  N  N     . VAL B  2  197 ? 78.036  74.081  86.698  1.00 86.86  ? 195  VAL B N     1 
ATOM   4801  C  CA    . VAL B  2  197 ? 79.025  74.510  85.722  1.00 88.91  ? 195  VAL B CA    1 
ATOM   4802  C  C     . VAL B  2  197 ? 80.459  74.187  86.143  1.00 90.20  ? 195  VAL B C     1 
ATOM   4803  O  O     . VAL B  2  197 ? 81.233  73.645  85.354  1.00 90.12  ? 195  VAL B O     1 
ATOM   4804  C  CB    . VAL B  2  197 ? 78.911  76.024  85.470  1.00 88.92  ? 195  VAL B CB    1 
ATOM   4805  C  CG1   . VAL B  2  197 ? 80.079  76.515  84.640  1.00 89.63  ? 195  VAL B CG1   1 
ATOM   4806  C  CG2   . VAL B  2  197 ? 77.617  76.311  84.753  1.00 90.16  ? 195  VAL B CG2   1 
ATOM   4807  N  N     . GLN B  2  198 ? 80.807  74.525  87.383  1.00 91.87  ? 196  GLN B N     1 
ATOM   4808  C  CA    . GLN B  2  198 ? 82.152  74.289  87.903  1.00 92.80  ? 196  GLN B CA    1 
ATOM   4809  C  C     . GLN B  2  198 ? 82.494  72.803  87.999  1.00 93.72  ? 196  GLN B C     1 
ATOM   4810  O  O     . GLN B  2  198 ? 83.667  72.437  87.951  1.00 94.65  ? 196  GLN B O     1 
ATOM   4811  C  CB    . GLN B  2  198 ? 82.305  74.919  89.287  1.00 92.72  ? 196  GLN B CB    1 
ATOM   4812  C  CG    . GLN B  2  198 ? 81.828  76.361  89.392  1.00 93.99  ? 196  GLN B CG    1 
ATOM   4813  C  CD    . GLN B  2  198 ? 81.970  76.932  90.806  1.00 95.39  ? 196  GLN B CD    1 
ATOM   4814  O  OE1   . GLN B  2  198 ? 81.710  76.243  91.806  1.00 96.15  ? 196  GLN B OE1   1 
ATOM   4815  N  NE2   . GLN B  2  198 ? 82.367  78.200  90.894  1.00 94.35  ? 196  GLN B NE2   1 
ATOM   4816  N  N     . ASN B  2  199 ? 81.476  71.954  88.133  1.00 93.84  ? 197  ASN B N     1 
ATOM   4817  C  CA    . ASN B  2  199 ? 81.682  70.510  88.249  1.00 94.15  ? 197  ASN B CA    1 
ATOM   4818  C  C     . ASN B  2  199 ? 81.567  69.724  86.942  1.00 93.59  ? 197  ASN B C     1 
ATOM   4819  O  O     . ASN B  2  199 ? 81.794  68.510  86.946  1.00 93.74  ? 197  ASN B O     1 
ATOM   4820  C  CB    . ASN B  2  199 ? 80.686  69.890  89.246  1.00 96.96  ? 197  ASN B CB    1 
ATOM   4821  C  CG    . ASN B  2  199 ? 80.886  70.379  90.672  1.00 100.00 ? 197  ASN B CG    1 
ATOM   4822  O  OD1   . ASN B  2  199 ? 82.012  70.455  91.153  1.00 103.38 ? 197  ASN B OD1   1 
ATOM   4823  N  ND2   . ASN B  2  199 ? 79.789  70.694  91.360  1.00 100.68 ? 197  ASN B ND2   1 
ATOM   4824  N  N     . ASN B  2  200 ? 81.216  70.383  85.836  1.00 92.22  ? 198  ASN B N     1 
ATOM   4825  C  CA    . ASN B  2  200 ? 81.049  69.664  84.568  1.00 91.51  ? 198  ASN B CA    1 
ATOM   4826  C  C     . ASN B  2  200 ? 81.690  70.336  83.372  1.00 91.86  ? 198  ASN B C     1 
ATOM   4827  O  O     . ASN B  2  200 ? 82.203  69.661  82.491  1.00 92.26  ? 198  ASN B O     1 
ATOM   4828  C  CB    . ASN B  2  200 ? 79.560  69.450  84.261  1.00 89.65  ? 198  ASN B CB    1 
ATOM   4829  C  CG    . ASN B  2  200 ? 78.865  68.588  85.294  1.00 89.21  ? 198  ASN B CG    1 
ATOM   4830  O  OD1   . ASN B  2  200 ? 78.910  67.366  85.224  1.00 90.17  ? 198  ASN B OD1   1 
ATOM   4831  N  ND2   . ASN B  2  200 ? 78.223  69.225  86.271  1.00 88.14  ? 198  ASN B ND2   1 
ATOM   4832  N  N     . PHE B  2  201 ? 81.639  71.660  83.327  1.00 93.17  ? 199  PHE B N     1 
ATOM   4833  C  CA    . PHE B  2  201 ? 82.217  72.401  82.206  1.00 95.35  ? 199  PHE B CA    1 
ATOM   4834  C  C     . PHE B  2  201 ? 83.723  72.493  82.406  1.00 95.91  ? 199  PHE B C     1 
ATOM   4835  O  O     . PHE B  2  201 ? 84.291  73.585  82.507  1.00 96.15  ? 199  PHE B O     1 
ATOM   4836  C  CB    . PHE B  2  201 ? 81.603  73.811  82.113  1.00 96.37  ? 199  PHE B CB    1 
ATOM   4837  C  CG    . PHE B  2  201 ? 80.189  73.838  81.558  1.00 97.30  ? 199  PHE B CG    1 
ATOM   4838  C  CD1   . PHE B  2  201 ? 79.362  72.715  81.632  1.00 97.25  ? 199  PHE B CD1   1 
ATOM   4839  C  CD2   . PHE B  2  201 ? 79.674  75.003  80.997  1.00 96.90  ? 199  PHE B CD2   1 
ATOM   4840  C  CE1   . PHE B  2  201 ? 78.052  72.753  81.162  1.00 96.04  ? 199  PHE B CE1   1 
ATOM   4841  C  CE2   . PHE B  2  201 ? 78.366  75.046  80.527  1.00 96.63  ? 199  PHE B CE2   1 
ATOM   4842  C  CZ    . PHE B  2  201 ? 77.555  73.917  80.611  1.00 96.46  ? 199  PHE B CZ    1 
ATOM   4843  N  N     . THR B  2  202 ? 84.353  71.322  82.457  1.00 96.27  ? 200  THR B N     1 
ATOM   4844  C  CA    . THR B  2  202 ? 85.789  71.185  82.665  1.00 95.42  ? 200  THR B CA    1 
ATOM   4845  C  C     . THR B  2  202 ? 86.486  70.740  81.386  1.00 95.78  ? 200  THR B C     1 
ATOM   4846  O  O     . THR B  2  202 ? 86.018  69.828  80.707  1.00 94.42  ? 200  THR B O     1 
ATOM   4847  C  CB    . THR B  2  202 ? 86.053  70.145  83.735  1.00 94.94  ? 200  THR B CB    1 
ATOM   4848  O  OG1   . THR B  2  202 ? 85.566  68.875  83.277  1.00 92.64  ? 200  THR B OG1   1 
ATOM   4849  C  CG2   . THR B  2  202 ? 85.340  70.530  85.028  1.00 93.87  ? 200  THR B CG2   1 
ATOM   4850  N  N     . SER B  2  203 ? 87.616  71.377  81.090  1.00 96.76  ? 201  SER B N     1 
ATOM   4851  C  CA    . SER B  2  203 ? 88.416  71.111  79.888  1.00 97.72  ? 201  SER B CA    1 
ATOM   4852  C  C     . SER B  2  203 ? 88.523  69.660  79.390  1.00 96.60  ? 201  SER B C     1 
ATOM   4853  O  O     . SER B  2  203 ? 88.628  69.423  78.189  1.00 95.09  ? 201  SER B O     1 
ATOM   4854  C  CB    . SER B  2  203 ? 89.829  71.664  80.086  1.00 99.19  ? 201  SER B CB    1 
ATOM   4855  O  OG    . SER B  2  203 ? 90.515  70.924  81.080  1.00 102.15 ? 201  SER B OG    1 
ATOM   4856  N  N     . ALA B  2  204 ? 88.510  68.696  80.302  1.00 96.68  ? 202  ALA B N     1 
ATOM   4857  C  CA    . ALA B  2  204 ? 88.618  67.291  79.912  1.00 97.52  ? 202  ALA B CA    1 
ATOM   4858  C  C     . ALA B  2  204 ? 87.276  66.669  79.489  1.00 98.31  ? 202  ALA B C     1 
ATOM   4859  O  O     . ALA B  2  204 ? 87.201  65.477  79.146  1.00 97.97  ? 202  ALA B O     1 
ATOM   4860  C  CB    . ALA B  2  204 ? 89.222  66.499  81.054  1.00 97.11  ? 202  ALA B CB    1 
ATOM   4861  N  N     . ARG B  2  205 ? 86.222  67.486  79.521  1.00 98.56  ? 203  ARG B N     1 
ATOM   4862  C  CA    . ARG B  2  205 ? 84.873  67.055  79.152  1.00 96.84  ? 203  ARG B CA    1 
ATOM   4863  C  C     . ARG B  2  205 ? 84.334  67.932  78.032  1.00 96.31  ? 203  ARG B C     1 
ATOM   4864  O  O     . ARG B  2  205 ? 83.249  67.685  77.513  1.00 96.53  ? 203  ARG B O     1 
ATOM   4865  C  CB    . ARG B  2  205 ? 83.940  67.165  80.353  1.00 96.23  ? 203  ARG B CB    1 
ATOM   4866  C  CG    . ARG B  2  205 ? 84.438  66.438  81.574  1.00 96.62  ? 203  ARG B CG    1 
ATOM   4867  C  CD    . ARG B  2  205 ? 83.535  66.667  82.770  1.00 96.62  ? 203  ARG B CD    1 
ATOM   4868  N  NE    . ARG B  2  205 ? 82.125  66.478  82.444  1.00 95.78  ? 203  ARG B NE    1 
ATOM   4869  C  CZ    . ARG B  2  205 ? 81.247  65.890  83.249  1.00 95.21  ? 203  ARG B CZ    1 
ATOM   4870  N  NH1   . ARG B  2  205 ? 81.628  65.425  84.427  1.00 94.94  ? 203  ARG B NH1   1 
ATOM   4871  N  NH2   . ARG B  2  205 ? 79.983  65.775  82.880  1.00 95.88  ? 203  ARG B NH2   1 
ATOM   4872  N  N     . MET B  2  206 ? 85.112  68.945  77.659  1.00 95.79  ? 204  MET B N     1 
ATOM   4873  C  CA    . MET B  2  206 ? 84.728  69.898  76.622  1.00 95.45  ? 204  MET B CA    1 
ATOM   4874  C  C     . MET B  2  206 ? 85.558  69.831  75.340  1.00 95.46  ? 204  MET B C     1 
ATOM   4875  O  O     . MET B  2  206 ? 86.753  69.525  75.370  1.00 96.91  ? 204  MET B O     1 
ATOM   4876  C  CB    . MET B  2  206 ? 84.830  71.313  77.180  1.00 95.92  ? 204  MET B CB    1 
ATOM   4877  C  CG    . MET B  2  206 ? 83.987  71.572  78.413  1.00 97.09  ? 204  MET B CG    1 
ATOM   4878  S  SD    . MET B  2  206 ? 84.434  73.134  79.182  1.00 97.83  ? 204  MET B SD    1 
ATOM   4879  C  CE    . MET B  2  206 ? 84.386  74.247  77.727  1.00 98.56  ? 204  MET B CE    1 
ATOM   4880  N  N     . ALA B  2  207 ? 84.922  70.152  74.219  1.00 94.26  ? 205  ALA B N     1 
ATOM   4881  C  CA    . ALA B  2  207 ? 85.590  70.149  72.923  1.00 93.07  ? 205  ALA B CA    1 
ATOM   4882  C  C     . ALA B  2  207 ? 85.216  71.416  72.169  1.00 92.38  ? 205  ALA B C     1 
ATOM   4883  O  O     . ALA B  2  207 ? 84.048  71.803  72.154  1.00 92.85  ? 205  ALA B O     1 
ATOM   4884  C  CB    . ALA B  2  207 ? 85.171  68.922  72.125  1.00 92.36  ? 205  ALA B CB    1 
ATOM   4885  N  N     . LEU B  2  208 ? 86.203  72.060  71.549  1.00 91.31  ? 206  LEU B N     1 
ATOM   4886  C  CA    . LEU B  2  208 ? 85.962  73.282  70.787  1.00 90.41  ? 206  LEU B CA    1 
ATOM   4887  C  C     . LEU B  2  208 ? 86.043  73.042  69.278  1.00 90.79  ? 206  LEU B C     1 
ATOM   4888  O  O     . LEU B  2  208 ? 87.080  73.297  68.669  1.00 91.22  ? 206  LEU B O     1 
ATOM   4889  C  CB    . LEU B  2  208 ? 86.973  74.365  71.177  1.00 89.31  ? 206  LEU B CB    1 
ATOM   4890  C  CG    . LEU B  2  208 ? 86.960  75.637  70.316  1.00 89.75  ? 206  LEU B CG    1 
ATOM   4891  C  CD1   . LEU B  2  208 ? 85.640  76.370  70.494  1.00 91.76  ? 206  LEU B CD1   1 
ATOM   4892  C  CD2   . LEU B  2  208 ? 88.099  76.548  70.706  1.00 89.25  ? 206  LEU B CD2   1 
ATOM   4893  N  N     . VAL B  2  209 ? 84.945  72.574  68.678  1.00 90.54  ? 207  VAL B N     1 
ATOM   4894  C  CA    . VAL B  2  209 ? 84.887  72.298  67.238  1.00 90.50  ? 207  VAL B CA    1 
ATOM   4895  C  C     . VAL B  2  209 ? 84.745  73.579  66.424  1.00 91.72  ? 207  VAL B C     1 
ATOM   4896  O  O     . VAL B  2  209 ? 84.490  74.638  66.989  1.00 91.80  ? 207  VAL B O     1 
ATOM   4897  C  CB    . VAL B  2  209 ? 83.703  71.397  66.910  1.00 89.82  ? 207  VAL B CB    1 
ATOM   4898  C  CG1   . VAL B  2  209 ? 83.917  70.729  65.562  1.00 90.33  ? 207  VAL B CG1   1 
ATOM   4899  C  CG2   . VAL B  2  209 ? 83.532  70.367  68.000  1.00 89.80  ? 207  VAL B CG2   1 
ATOM   4900  N  N     . GLY B  2  210 ? 84.899  73.502  65.103  1.00 93.47  ? 208  GLY B N     1 
ATOM   4901  C  CA    . GLY B  2  210 ? 84.774  74.723  64.317  1.00 96.44  ? 208  GLY B CA    1 
ATOM   4902  C  C     . GLY B  2  210 ? 84.883  74.727  62.796  1.00 98.01  ? 208  GLY B C     1 
ATOM   4903  O  O     . GLY B  2  210 ? 85.964  74.931  62.239  1.00 99.14  ? 208  GLY B O     1 
ATOM   4904  N  N     . ILE B  2  211 ? 83.754  74.536  62.119  1.00 98.45  ? 209  ILE B N     1 
ATOM   4905  C  CA    . ILE B  2  211 ? 83.707  74.549  60.660  1.00 98.56  ? 209  ILE B CA    1 
ATOM   4906  C  C     . ILE B  2  211 ? 83.895  75.987  60.153  1.00 99.12  ? 209  ILE B C     1 
ATOM   4907  O  O     . ILE B  2  211 ? 83.594  76.941  60.860  1.00 98.94  ? 209  ILE B O     1 
ATOM   4908  C  CB    . ILE B  2  211 ? 82.351  74.014  60.176  1.00 98.50  ? 209  ILE B CB    1 
ATOM   4909  C  CG1   . ILE B  2  211 ? 82.217  72.547  60.564  1.00 98.69  ? 209  ILE B CG1   1 
ATOM   4910  C  CG2   . ILE B  2  211 ? 82.205  74.192  58.677  1.00 98.37  ? 209  ILE B CG2   1 
ATOM   4911  C  CD1   . ILE B  2  211 ? 80.830  72.004  60.345  1.00 99.99  ? 209  ILE B CD1   1 
ATOM   4912  N  N     . GLY B  2  212 ? 84.407  76.137  58.938  1.00 100.23 ? 210  GLY B N     1 
ATOM   4913  C  CA    . GLY B  2  212 ? 84.598  77.461  58.377  1.00 102.63 ? 210  GLY B CA    1 
ATOM   4914  C  C     . GLY B  2  212 ? 85.759  78.280  58.911  1.00 104.75 ? 210  GLY B C     1 
ATOM   4915  O  O     . GLY B  2  212 ? 85.808  79.486  58.688  1.00 103.90 ? 210  GLY B O     1 
ATOM   4916  N  N     . VAL B  2  213 ? 86.692  77.644  59.612  1.00 107.90 ? 211  VAL B N     1 
ATOM   4917  C  CA    . VAL B  2  213 ? 87.857  78.356  60.149  1.00 111.22 ? 211  VAL B CA    1 
ATOM   4918  C  C     . VAL B  2  213 ? 89.156  77.547  60.040  1.00 114.13 ? 211  VAL B C     1 
ATOM   4919  O  O     . VAL B  2  213 ? 89.123  76.318  59.893  1.00 115.16 ? 211  VAL B O     1 
ATOM   4920  C  CB    . VAL B  2  213 ? 87.645  78.742  61.624  1.00 110.01 ? 211  VAL B CB    1 
ATOM   4921  C  CG1   . VAL B  2  213 ? 86.623  79.850  61.716  1.00 110.65 ? 211  VAL B CG1   1 
ATOM   4922  C  CG2   . VAL B  2  213 ? 87.188  77.533  62.417  1.00 108.56 ? 211  VAL B CG2   1 
ATOM   4923  N  N     . LYS B  2  214 ? 90.295  78.239  60.104  1.00 116.32 ? 212  LYS B N     1 
ATOM   4924  C  CA    . LYS B  2  214 ? 91.613  77.596  60.025  1.00 117.74 ? 212  LYS B CA    1 
ATOM   4925  C  C     . LYS B  2  214 ? 92.031  77.104  61.420  1.00 117.85 ? 212  LYS B C     1 
ATOM   4926  O  O     . LYS B  2  214 ? 91.896  77.831  62.414  1.00 116.80 ? 212  LYS B O     1 
ATOM   4927  C  CB    . LYS B  2  214 ? 92.654  78.581  59.478  1.00 118.79 ? 212  LYS B CB    1 
ATOM   4928  C  CG    . LYS B  2  214 ? 94.039  77.974  59.315  1.00 120.32 ? 212  LYS B CG    1 
ATOM   4929  C  CD    . LYS B  2  214 ? 95.088  79.029  58.991  1.00 121.35 ? 212  LYS B CD    1 
ATOM   4930  C  CE    . LYS B  2  214 ? 96.490  78.426  59.010  1.00 122.24 ? 212  LYS B CE    1 
ATOM   4931  N  NZ    . LYS B  2  214 ? 97.562  79.436  58.758  1.00 122.49 ? 212  LYS B NZ    1 
ATOM   4932  N  N     . HIS B  2  215 ? 92.552  75.877  61.478  1.00 118.03 ? 213  HIS B N     1 
ATOM   4933  C  CA    . HIS B  2  215 ? 92.942  75.252  62.744  1.00 118.37 ? 213  HIS B CA    1 
ATOM   4934  C  C     . HIS B  2  215 ? 93.845  76.047  63.695  1.00 118.63 ? 213  HIS B C     1 
ATOM   4935  O  O     . HIS B  2  215 ? 93.655  76.005  64.912  1.00 118.28 ? 213  HIS B O     1 
ATOM   4936  C  CB    . HIS B  2  215 ? 93.581  73.883  62.487  1.00 117.69 ? 213  HIS B CB    1 
ATOM   4937  C  CG    . HIS B  2  215 ? 93.592  72.991  63.692  1.00 117.18 ? 213  HIS B CG    1 
ATOM   4938  N  ND1   . HIS B  2  215 ? 92.590  72.085  63.958  1.00 117.15 ? 213  HIS B ND1   1 
ATOM   4939  C  CD2   . HIS B  2  215 ? 94.464  72.901  64.725  1.00 117.38 ? 213  HIS B CD2   1 
ATOM   4940  C  CE1   . HIS B  2  215 ? 92.843  71.473  65.102  1.00 117.11 ? 213  HIS B CE1   1 
ATOM   4941  N  NE2   . HIS B  2  215 ? 93.973  71.950  65.588  1.00 117.21 ? 213  HIS B NE2   1 
ATOM   4942  N  N     . SER B  2  216 ? 94.830  76.759  63.160  1.00 119.08 ? 214  SER B N     1 
ATOM   4943  C  CA    . SER B  2  216 ? 95.728  77.524  64.019  1.00 119.56 ? 214  SER B CA    1 
ATOM   4944  C  C     . SER B  2  216 ? 94.974  78.588  64.803  1.00 120.48 ? 214  SER B C     1 
ATOM   4945  O  O     . SER B  2  216 ? 95.253  78.816  65.982  1.00 119.69 ? 214  SER B O     1 
ATOM   4946  C  CB    . SER B  2  216 ? 96.824  78.192  63.188  1.00 119.35 ? 214  SER B CB    1 
ATOM   4947  O  OG    . SER B  2  216 ? 96.285  79.167  62.314  1.00 118.50 ? 214  SER B OG    1 
ATOM   4948  N  N     . ASP B  2  217 ? 94.017  79.230  64.133  1.00 122.32 ? 215  ASP B N     1 
ATOM   4949  C  CA    . ASP B  2  217 ? 93.199  80.295  64.719  1.00 123.45 ? 215  ASP B CA    1 
ATOM   4950  C  C     . ASP B  2  217 ? 92.271  79.788  65.811  1.00 124.58 ? 215  ASP B C     1 
ATOM   4951  O  O     . ASP B  2  217 ? 92.215  80.366  66.899  1.00 124.39 ? 215  ASP B O     1 
ATOM   4952  C  CB    . ASP B  2  217 ? 92.366  80.973  63.634  1.00 123.24 ? 215  ASP B CB    1 
ATOM   4953  C  CG    . ASP B  2  217 ? 93.217  81.548  62.517  1.00 123.54 ? 215  ASP B CG    1 
ATOM   4954  O  OD1   . ASP B  2  217 ? 94.073  82.415  62.806  1.00 123.29 ? 215  ASP B OD1   1 
ATOM   4955  O  OD2   . ASP B  2  217 ? 93.025  81.134  61.351  1.00 123.26 ? 215  ASP B OD2   1 
ATOM   4956  N  N     . LEU B  2  218 ? 91.532  78.720  65.509  1.00 125.76 ? 216  LEU B N     1 
ATOM   4957  C  CA    . LEU B  2  218 ? 90.615  78.129  66.475  1.00 127.45 ? 216  LEU B CA    1 
ATOM   4958  C  C     . LEU B  2  218 ? 91.410  77.615  67.668  1.00 129.97 ? 216  LEU B C     1 
ATOM   4959  O  O     . LEU B  2  218 ? 90.914  77.590  68.795  1.00 130.37 ? 216  LEU B O     1 
ATOM   4960  C  CB    . LEU B  2  218 ? 89.829  76.978  65.838  1.00 125.74 ? 216  LEU B CB    1 
ATOM   4961  C  CG    . LEU B  2  218 ? 88.899  76.194  66.773  1.00 124.70 ? 216  LEU B CG    1 
ATOM   4962  C  CD1   . LEU B  2  218 ? 87.972  77.141  67.497  1.00 123.84 ? 216  LEU B CD1   1 
ATOM   4963  C  CD2   . LEU B  2  218 ? 88.097  75.191  65.981  1.00 123.68 ? 216  LEU B CD2   1 
ATOM   4964  N  N     . LYS B  2  219 ? 92.651  77.210  67.410  1.00 133.03 ? 217  LYS B N     1 
ATOM   4965  C  CA    . LYS B  2  219 ? 93.539  76.702  68.451  1.00 135.43 ? 217  LYS B CA    1 
ATOM   4966  C  C     . LYS B  2  219 ? 93.979  77.830  69.376  1.00 136.93 ? 217  LYS B C     1 
ATOM   4967  O  O     . LYS B  2  219 ? 93.820  77.743  70.592  1.00 137.13 ? 217  LYS B O     1 
ATOM   4968  C  CB    . LYS B  2  219 ? 94.776  76.048  67.827  1.00 135.65 ? 217  LYS B CB    1 
ATOM   4969  C  CG    . LYS B  2  219 ? 95.792  75.564  68.854  1.00 136.55 ? 217  LYS B CG    1 
ATOM   4970  C  CD    . LYS B  2  219 ? 96.962  74.817  68.216  1.00 136.88 ? 217  LYS B CD    1 
ATOM   4971  C  CE    . LYS B  2  219 ? 97.887  74.231  69.288  1.00 137.10 ? 217  LYS B CE    1 
ATOM   4972  N  NZ    . LYS B  2  219 ? 98.973  73.376  68.730  1.00 136.12 ? 217  LYS B NZ    1 
ATOM   4973  N  N     . GLN B  2  220 ? 94.540  78.885  68.790  1.00 138.82 ? 218  GLN B N     1 
ATOM   4974  C  CA    . GLN B  2  220 ? 95.006  80.043  69.549  1.00 140.71 ? 218  GLN B CA    1 
ATOM   4975  C  C     . GLN B  2  220 ? 93.931  80.574  70.489  1.00 141.35 ? 218  GLN B C     1 
ATOM   4976  O  O     . GLN B  2  220 ? 94.221  81.017  71.603  1.00 140.88 ? 218  GLN B O     1 
ATOM   4977  C  CB    . GLN B  2  220 ? 95.430  81.154  68.597  1.00 141.38 ? 218  GLN B CB    1 
ATOM   4978  C  CG    . GLN B  2  220 ? 95.731  82.457  69.295  1.00 142.93 ? 218  GLN B CG    1 
ATOM   4979  C  CD    . GLN B  2  220 ? 96.262  83.497  68.345  1.00 144.08 ? 218  GLN B CD    1 
ATOM   4980  O  OE1   . GLN B  2  220 ? 95.608  83.849  67.360  1.00 144.74 ? 218  GLN B OE1   1 
ATOM   4981  N  NE2   . GLN B  2  220 ? 97.461  83.999  68.628  1.00 144.78 ? 218  GLN B NE2   1 
ATOM   4982  N  N     . VAL B  2  221 ? 92.691  80.539  70.014  1.00 142.55 ? 219  VAL B N     1 
ATOM   4983  C  CA    . VAL B  2  221 ? 91.550  80.992  70.793  1.00 143.53 ? 219  VAL B CA    1 
ATOM   4984  C  C     . VAL B  2  221 ? 91.436  80.119  72.040  1.00 144.17 ? 219  VAL B C     1 
ATOM   4985  O  O     . VAL B  2  221 ? 91.583  80.600  73.165  1.00 144.33 ? 219  VAL B O     1 
ATOM   4986  C  CB    . VAL B  2  221 ? 90.240  80.876  69.972  1.00 143.53 ? 219  VAL B CB    1 
ATOM   4987  C  CG1   . VAL B  2  221 ? 89.053  81.340  70.806  1.00 143.31 ? 219  VAL B CG1   1 
ATOM   4988  C  CG2   . VAL B  2  221 ? 90.349  81.704  68.698  1.00 143.46 ? 219  VAL B CG2   1 
ATOM   4989  N  N     . ALA B  2  222 ? 91.186  78.830  71.821  1.00 144.85 ? 220  ALA B N     1 
ATOM   4990  C  CA    . ALA B  2  222 ? 91.038  77.853  72.899  1.00 145.67 ? 220  ALA B CA    1 
ATOM   4991  C  C     . ALA B  2  222 ? 92.117  77.968  73.972  1.00 146.12 ? 220  ALA B C     1 
ATOM   4992  O  O     . ALA B  2  222 ? 91.872  77.683  75.148  1.00 146.16 ? 220  ALA B O     1 
ATOM   4993  C  CB    . ALA B  2  222 ? 91.041  76.444  72.319  1.00 145.82 ? 220  ALA B CB    1 
ATOM   4994  N  N     . GLU B  2  223 ? 93.305  78.395  73.556  1.00 146.60 ? 221  GLU B N     1 
ATOM   4995  C  CA    . GLU B  2  223 ? 94.445  78.540  74.454  1.00 146.90 ? 221  GLU B CA    1 
ATOM   4996  C  C     . GLU B  2  223 ? 94.379  79.726  75.412  1.00 147.23 ? 221  GLU B C     1 
ATOM   4997  O  O     . GLU B  2  223 ? 93.837  79.625  76.516  1.00 147.27 ? 221  GLU B O     1 
ATOM   4998  C  CB    . GLU B  2  223 ? 95.739  78.631  73.639  1.00 146.59 ? 221  GLU B CB    1 
ATOM   4999  C  CG    . GLU B  2  223 ? 96.294  77.293  73.182  1.00 145.89 ? 221  GLU B CG    1 
ATOM   5000  C  CD    . GLU B  2  223 ? 97.528  77.457  72.325  1.00 145.55 ? 221  GLU B CD    1 
ATOM   5001  O  OE1   . GLU B  2  223 ? 98.398  78.271  72.699  1.00 145.21 ? 221  GLU B OE1   1 
ATOM   5002  O  OE2   . GLU B  2  223 ? 97.633  76.774  71.285  1.00 145.55 ? 221  GLU B OE2   1 
ATOM   5003  N  N     . GLN B  2  224 ? 94.949  80.845  74.981  1.00 147.52 ? 222  GLN B N     1 
ATOM   5004  C  CA    . GLN B  2  224 ? 95.000  82.051  75.791  1.00 147.93 ? 222  GLN B CA    1 
ATOM   5005  C  C     . GLN B  2  224 ? 93.722  82.410  76.535  1.00 148.28 ? 222  GLN B C     1 
ATOM   5006  O  O     . GLN B  2  224 ? 93.766  83.146  77.524  1.00 148.00 ? 222  GLN B O     1 
ATOM   5007  C  CB    . GLN B  2  224 ? 95.423  83.238  74.926  1.00 147.79 ? 222  GLN B CB    1 
ATOM   5008  C  CG    . GLN B  2  224 ? 95.290  84.572  75.635  1.00 148.12 ? 222  GLN B CG    1 
ATOM   5009  C  CD    . GLN B  2  224 ? 95.879  85.708  74.843  1.00 148.72 ? 222  GLN B CD    1 
ATOM   5010  O  OE1   . GLN B  2  224 ? 95.673  85.808  73.631  1.00 149.11 ? 222  GLN B OE1   1 
ATOM   5011  N  NE2   . GLN B  2  224 ? 96.613  86.585  75.523  1.00 148.36 ? 222  GLN B NE2   1 
ATOM   5012  N  N     . PHE B  2  225 ? 92.587  81.888  76.082  1.00 148.98 ? 223  PHE B N     1 
ATOM   5013  C  CA    . PHE B  2  225 ? 91.332  82.237  76.724  1.00 149.75 ? 223  PHE B CA    1 
ATOM   5014  C  C     . PHE B  2  225 ? 90.609  81.216  77.581  1.00 149.94 ? 223  PHE B C     1 
ATOM   5015  O  O     . PHE B  2  225 ? 90.393  81.476  78.762  1.00 149.98 ? 223  PHE B O     1 
ATOM   5016  C  CB    . PHE B  2  225 ? 90.378  82.810  75.683  1.00 150.61 ? 223  PHE B CB    1 
ATOM   5017  C  CG    . PHE B  2  225 ? 90.849  84.109  75.105  1.00 152.19 ? 223  PHE B CG    1 
ATOM   5018  C  CD1   . PHE B  2  225 ? 91.667  84.132  73.977  1.00 152.52 ? 223  PHE B CD1   1 
ATOM   5019  C  CD2   . PHE B  2  225 ? 90.541  85.315  75.737  1.00 152.83 ? 223  PHE B CD2   1 
ATOM   5020  C  CE1   . PHE B  2  225 ? 92.176  85.336  73.486  1.00 153.11 ? 223  PHE B CE1   1 
ATOM   5021  C  CE2   . PHE B  2  225 ? 91.044  86.528  75.258  1.00 153.14 ? 223  PHE B CE2   1 
ATOM   5022  C  CZ    . PHE B  2  225 ? 91.865  86.538  74.131  1.00 153.30 ? 223  PHE B CZ    1 
ATOM   5023  N  N     . LEU B  2  226 ? 90.226  80.072  77.014  1.00 150.32 ? 224  LEU B N     1 
ATOM   5024  C  CA    . LEU B  2  226 ? 89.504  79.058  77.793  1.00 150.82 ? 224  LEU B CA    1 
ATOM   5025  C  C     . LEU B  2  226 ? 90.165  78.767  79.147  1.00 151.48 ? 224  LEU B C     1 
ATOM   5026  O  O     . LEU B  2  226 ? 91.055  77.915  79.255  1.00 151.40 ? 224  LEU B O     1 
ATOM   5027  C  CB    . LEU B  2  226 ? 89.338  77.761  76.987  1.00 150.04 ? 224  LEU B CB    1 
ATOM   5028  C  CG    . LEU B  2  226 ? 88.400  77.814  75.769  1.00 149.65 ? 224  LEU B CG    1 
ATOM   5029  C  CD1   . LEU B  2  226 ? 88.040  76.398  75.365  1.00 149.45 ? 224  LEU B CD1   1 
ATOM   5030  C  CD2   . LEU B  2  226 ? 87.123  78.584  76.086  1.00 149.13 ? 224  LEU B CD2   1 
ATOM   5031  N  N     . ASN B  2  227 ? 89.698  79.485  80.173  1.00 152.16 ? 225  ASN B N     1 
ATOM   5032  C  CA    . ASN B  2  227 ? 90.220  79.379  81.538  1.00 152.20 ? 225  ASN B CA    1 
ATOM   5033  C  C     . ASN B  2  227 ? 89.839  78.117  82.308  1.00 151.95 ? 225  ASN B C     1 
ATOM   5034  O  O     . ASN B  2  227 ? 90.663  77.211  82.402  1.00 151.88 ? 225  ASN B O     1 
ATOM   5035  C  CB    . ASN B  2  227 ? 89.826  80.623  82.347  1.00 152.29 ? 225  ASN B CB    1 
ATOM   5036  C  CG    . ASN B  2  227 ? 91.041  81.415  82.827  1.00 152.39 ? 225  ASN B CG    1 
ATOM   5037  O  OD1   . ASN B  2  227 ? 91.925  81.761  82.038  1.00 151.92 ? 225  ASN B OD1   1 
ATOM   5038  N  ND2   . ASN B  2  227 ? 91.084  81.708  84.125  1.00 151.99 ? 225  ASN B ND2   1 
ATOM   5039  N  N     . ILE B  2  228 ? 88.621  78.060  82.863  1.00 151.81 ? 226  ILE B N     1 
ATOM   5040  C  CA    . ILE B  2  228 ? 88.168  76.880  83.630  1.00 151.87 ? 226  ILE B CA    1 
ATOM   5041  C  C     . ILE B  2  228 ? 88.889  75.642  83.101  1.00 151.12 ? 226  ILE B C     1 
ATOM   5042  O  O     . ILE B  2  228 ? 88.436  74.985  82.153  1.00 151.18 ? 226  ILE B O     1 
ATOM   5043  C  CB    . ILE B  2  228 ? 86.629  76.632  83.512  1.00 152.58 ? 226  ILE B CB    1 
ATOM   5044  C  CG1   . ILE B  2  228 ? 85.839  77.858  83.993  1.00 152.50 ? 226  ILE B CG1   1 
ATOM   5045  C  CG2   . ILE B  2  228 ? 86.240  75.404  84.349  1.00 152.70 ? 226  ILE B CG2   1 
ATOM   5046  C  CD1   . ILE B  2  228 ? 84.322  77.709  83.856  1.00 151.61 ? 226  ILE B CD1   1 
ATOM   5047  N  N     . ARG B  2  229 ? 90.012  75.328  83.736  1.00 149.69 ? 227  ARG B N     1 
ATOM   5048  C  CA    . ARG B  2  229 ? 90.849  74.218  83.309  1.00 147.79 ? 227  ARG B CA    1 
ATOM   5049  C  C     . ARG B  2  229 ? 90.453  72.810  83.725  1.00 146.32 ? 227  ARG B C     1 
ATOM   5050  O  O     . ARG B  2  229 ? 89.363  72.556  84.259  1.00 145.84 ? 227  ARG B O     1 
ATOM   5051  C  CB    . ARG B  2  229 ? 92.304  74.473  83.735  1.00 147.09 ? 227  ARG B CB    1 
ATOM   5052  C  CG    . ARG B  2  229 ? 92.494  74.555  85.240  1.00 145.62 ? 227  ARG B CG    1 
ATOM   5053  C  CD    . ARG B  2  229 ? 93.918  74.895  85.617  1.00 143.67 ? 227  ARG B CD    1 
ATOM   5054  N  NE    . ARG B  2  229 ? 94.027  75.125  87.052  1.00 142.34 ? 227  ARG B NE    1 
ATOM   5055  C  CZ    . ARG B  2  229 ? 95.140  75.506  87.668  1.00 141.68 ? 227  ARG B CZ    1 
ATOM   5056  N  NH1   . ARG B  2  229 ? 96.249  75.702  86.971  1.00 140.94 ? 227  ARG B NH1   1 
ATOM   5057  N  NH2   . ARG B  2  229 ? 95.140  75.697  88.980  1.00 141.31 ? 227  ARG B NH2   1 
ATOM   5058  N  N     . SER B  2  230 ? 91.399  71.917  83.443  1.00 144.15 ? 228  SER B N     1 
ATOM   5059  C  CA    . SER B  2  230 ? 91.337  70.488  83.694  1.00 141.14 ? 228  SER B CA    1 
ATOM   5060  C  C     . SER B  2  230 ? 90.425  69.983  84.795  1.00 138.76 ? 228  SER B C     1 
ATOM   5061  O  O     . SER B  2  230 ? 90.017  70.715  85.703  1.00 138.54 ? 228  SER B O     1 
ATOM   5062  C  CB    . SER B  2  230 ? 92.759  69.965  83.920  1.00 141.22 ? 228  SER B CB    1 
ATOM   5063  O  OG    . SER B  2  230 ? 93.523  70.902  84.660  1.00 141.04 ? 228  SER B OG    1 
ATOM   5064  N  N     . GLY B  2  231 ? 90.125  68.698  84.688  1.00 135.82 ? 229  GLY B N     1 
ATOM   5065  C  CA    . GLY B  2  231 ? 89.267  68.050  85.646  1.00 132.67 ? 229  GLY B CA    1 
ATOM   5066  C  C     . GLY B  2  231 ? 88.322  67.152  84.892  1.00 130.85 ? 229  GLY B C     1 
ATOM   5067  O  O     . GLY B  2  231 ? 88.307  67.131  83.663  1.00 130.32 ? 229  GLY B O     1 
ATOM   5068  N  N     . ALA B  2  232 ? 87.542  66.394  85.643  1.00 129.53 ? 230  ALA B N     1 
ATOM   5069  C  CA    . ALA B  2  232 ? 86.563  65.489  85.081  1.00 128.45 ? 230  ALA B CA    1 
ATOM   5070  C  C     . ALA B  2  232 ? 85.367  65.621  86.007  1.00 128.16 ? 230  ALA B C     1 
ATOM   5071  O  O     . ALA B  2  232 ? 84.292  65.089  85.736  1.00 128.48 ? 230  ALA B O     1 
ATOM   5072  C  CB    . ALA B  2  232 ? 87.097  64.066  85.090  1.00 128.19 ? 230  ALA B CB    1 
ATOM   5073  N  N     . GLY B  2  233 ? 85.587  66.347  87.104  1.00 127.65 ? 231  GLY B N     1 
ATOM   5074  C  CA    . GLY B  2  233 ? 84.563  66.594  88.105  1.00 126.75 ? 231  GLY B CA    1 
ATOM   5075  C  C     . GLY B  2  233 ? 83.518  65.510  88.278  1.00 126.60 ? 231  GLY B C     1 
ATOM   5076  O  O     . GLY B  2  233 ? 83.758  64.339  87.978  1.00 126.84 ? 231  GLY B O     1 
ATOM   5077  N  N     . THR B  2  234 ? 82.350  65.907  88.774  1.00 126.11 ? 232  THR B N     1 
ATOM   5078  C  CA    . THR B  2  234 ? 81.246  64.981  88.995  1.00 125.76 ? 232  THR B CA    1 
ATOM   5079  C  C     . THR B  2  234 ? 81.170  63.919  87.903  1.00 125.71 ? 232  THR B C     1 
ATOM   5080  O  O     . THR B  2  234 ? 81.224  64.238  86.717  1.00 125.78 ? 232  THR B O     1 
ATOM   5081  C  CB    . THR B  2  234 ? 79.896  65.737  89.040  1.00 125.89 ? 232  THR B CB    1 
ATOM   5082  O  OG1   . THR B  2  234 ? 79.877  66.611  90.177  1.00 124.90 ? 232  THR B OG1   1 
ATOM   5083  C  CG2   . THR B  2  234 ? 78.720  64.754  89.118  1.00 125.30 ? 232  THR B CG2   1 
ATOM   5084  N  N     . SER B  2  235 ? 81.059  62.658  88.307  1.00 125.46 ? 233  SER B N     1 
ATOM   5085  C  CA    . SER B  2  235 ? 80.945  61.562  87.352  1.00 125.18 ? 233  SER B CA    1 
ATOM   5086  C  C     . SER B  2  235 ? 79.545  60.993  87.456  1.00 124.39 ? 233  SER B C     1 
ATOM   5087  O  O     . SER B  2  235 ? 79.059  60.714  88.554  1.00 124.01 ? 233  SER B O     1 
ATOM   5088  C  CB    . SER B  2  235 ? 81.960  60.464  87.655  1.00 126.12 ? 233  SER B CB    1 
ATOM   5089  O  OG    . SER B  2  235 ? 83.277  60.936  87.456  1.00 128.38 ? 233  SER B OG    1 
ATOM   5090  N  N     . SER B  2  236 ? 78.897  60.822  86.311  1.00 123.24 ? 234  SER B N     1 
ATOM   5091  C  CA    . SER B  2  236 ? 77.541  60.296  86.282  1.00 122.32 ? 234  SER B CA    1 
ATOM   5092  C  C     . SER B  2  236 ? 77.443  58.890  86.872  1.00 121.32 ? 234  SER B C     1 
ATOM   5093  O  O     . SER B  2  236 ? 78.320  58.053  86.663  1.00 121.41 ? 234  SER B O     1 
ATOM   5094  C  CB    . SER B  2  236 ? 77.021  60.286  84.841  1.00 122.56 ? 234  SER B CB    1 
ATOM   5095  O  OG    . SER B  2  236 ? 75.726  59.710  84.769  1.00 122.48 ? 234  SER B OG    1 
ATOM   5096  N  N     . ALA B  2  237 ? 76.377  58.634  87.619  1.00 120.03 ? 235  ALA B N     1 
ATOM   5097  C  CA    . ALA B  2  237 ? 76.174  57.316  88.197  1.00 119.91 ? 235  ALA B CA    1 
ATOM   5098  C  C     . ALA B  2  237 ? 75.828  56.362  87.050  1.00 119.81 ? 235  ALA B C     1 
ATOM   5099  O  O     . ALA B  2  237 ? 75.180  56.764  86.084  1.00 120.54 ? 235  ALA B O     1 
ATOM   5100  C  CB    . ALA B  2  237 ? 75.037  57.359  89.209  1.00 119.72 ? 235  ALA B CB    1 
ATOM   5101  N  N     . LYS B  2  238 ? 76.263  55.108  87.147  1.00 119.01 ? 236  LYS B N     1 
ATOM   5102  C  CA    . LYS B  2  238 ? 75.977  54.125  86.102  1.00 117.55 ? 236  LYS B CA    1 
ATOM   5103  C  C     . LYS B  2  238 ? 74.497  54.071  85.777  1.00 116.00 ? 236  LYS B C     1 
ATOM   5104  O  O     . LYS B  2  238 ? 73.645  54.272  86.644  1.00 115.12 ? 236  LYS B O     1 
ATOM   5105  C  CB    . LYS B  2  238 ? 76.441  52.726  86.519  1.00 118.28 ? 236  LYS B CB    1 
ATOM   5106  C  CG    . LYS B  2  238 ? 77.933  52.469  86.336  1.00 119.04 ? 236  LYS B CG    1 
ATOM   5107  C  CD    . LYS B  2  238 ? 78.317  52.413  84.861  1.00 119.28 ? 236  LYS B CD    1 
ATOM   5108  C  CE    . LYS B  2  238 ? 79.774  51.999  84.669  1.00 118.31 ? 236  LYS B CE    1 
ATOM   5109  N  NZ    . LYS B  2  238 ? 80.120  51.861  83.227  1.00 117.40 ? 236  LYS B NZ    1 
ATOM   5110  N  N     . ALA B  2  239 ? 74.203  53.787  84.517  1.00 114.60 ? 237  ALA B N     1 
ATOM   5111  C  CA    . ALA B  2  239 ? 72.831  53.704  84.058  1.00 113.27 ? 237  ALA B CA    1 
ATOM   5112  C  C     . ALA B  2  239 ? 72.209  52.349  84.381  1.00 112.18 ? 237  ALA B C     1 
ATOM   5113  O  O     . ALA B  2  239 ? 72.352  51.387  83.628  1.00 112.36 ? 237  ALA B O     1 
ATOM   5114  C  CB    . ALA B  2  239 ? 72.774  53.965  82.558  1.00 113.22 ? 237  ALA B CB    1 
ATOM   5115  N  N     . THR B  2  240 ? 71.524  52.273  85.512  1.00 111.04 ? 238  THR B N     1 
ATOM   5116  C  CA    . THR B  2  240 ? 70.860  51.037  85.902  1.00 110.83 ? 238  THR B CA    1 
ATOM   5117  C  C     . THR B  2  240 ? 69.631  50.931  85.009  1.00 110.34 ? 238  THR B C     1 
ATOM   5118  O  O     . THR B  2  240 ? 69.142  51.945  84.522  1.00 111.58 ? 238  THR B O     1 
ATOM   5119  C  CB    . THR B  2  240 ? 70.376  51.106  87.366  1.00 111.71 ? 238  THR B CB    1 
ATOM   5120  O  OG1   . THR B  2  240 ? 71.476  51.445  88.222  1.00 111.97 ? 238  THR B OG1   1 
ATOM   5121  C  CG2   . THR B  2  240 ? 69.760  49.768  87.800  1.00 111.15 ? 238  THR B CG2   1 
ATOM   5122  N  N     . TYR B  2  241 ? 69.129  49.722  84.786  1.00 109.03 ? 239  TYR B N     1 
ATOM   5123  C  CA    . TYR B  2  241 ? 67.935  49.554  83.963  1.00 107.55 ? 239  TYR B CA    1 
ATOM   5124  C  C     . TYR B  2  241 ? 66.789  49.102  84.867  1.00 106.53 ? 239  TYR B C     1 
ATOM   5125  O  O     . TYR B  2  241 ? 66.957  48.205  85.692  1.00 106.38 ? 239  TYR B O     1 
ATOM   5126  C  CB    . TYR B  2  241 ? 68.182  48.518  82.865  1.00 107.79 ? 239  TYR B CB    1 
ATOM   5127  C  CG    . TYR B  2  241 ? 67.032  48.345  81.895  1.00 108.87 ? 239  TYR B CG    1 
ATOM   5128  C  CD1   . TYR B  2  241 ? 67.139  48.760  80.567  1.00 108.86 ? 239  TYR B CD1   1 
ATOM   5129  C  CD2   . TYR B  2  241 ? 65.832  47.750  82.300  1.00 110.39 ? 239  TYR B CD2   1 
ATOM   5130  C  CE1   . TYR B  2  241 ? 66.075  48.584  79.656  1.00 109.18 ? 239  TYR B CE1   1 
ATOM   5131  C  CE2   . TYR B  2  241 ? 64.761  47.571  81.398  1.00 110.34 ? 239  TYR B CE2   1 
ATOM   5132  C  CZ    . TYR B  2  241 ? 64.891  47.989  80.082  1.00 109.51 ? 239  TYR B CZ    1 
ATOM   5133  O  OH    . TYR B  2  241 ? 63.843  47.809  79.206  1.00 107.97 ? 239  TYR B OH    1 
ATOM   5134  N  N     . TRP B  2  242 ? 65.627  49.728  84.720  1.00 105.49 ? 240  TRP B N     1 
ATOM   5135  C  CA    . TRP B  2  242 ? 64.477  49.370  85.540  1.00 104.56 ? 240  TRP B CA    1 
ATOM   5136  C  C     . TRP B  2  242 ? 63.481  48.475  84.805  1.00 103.85 ? 240  TRP B C     1 
ATOM   5137  O  O     . TRP B  2  242 ? 63.170  47.377  85.275  1.00 103.81 ? 240  TRP B O     1 
ATOM   5138  C  CB    . TRP B  2  242 ? 63.769  50.636  86.070  1.00 104.51 ? 240  TRP B CB    1 
ATOM   5139  C  CG    . TRP B  2  242 ? 62.455  50.366  86.798  1.00 104.71 ? 240  TRP B CG    1 
ATOM   5140  C  CD1   . TRP B  2  242 ? 62.077  49.205  87.430  1.00 105.41 ? 240  TRP B CD1   1 
ATOM   5141  C  CD2   . TRP B  2  242 ? 61.352  51.266  86.939  1.00 104.53 ? 240  TRP B CD2   1 
ATOM   5142  N  NE1   . TRP B  2  242 ? 60.807  49.329  87.943  1.00 104.34 ? 240  TRP B NE1   1 
ATOM   5143  C  CE2   . TRP B  2  242 ? 60.337  50.583  87.657  1.00 104.36 ? 240  TRP B CE2   1 
ATOM   5144  C  CE3   . TRP B  2  242 ? 61.118  52.584  86.526  1.00 104.85 ? 240  TRP B CE3   1 
ATOM   5145  C  CZ2   . TRP B  2  242 ? 59.110  51.172  87.969  1.00 104.03 ? 240  TRP B CZ2   1 
ATOM   5146  C  CZ3   . TRP B  2  242 ? 59.895  53.173  86.837  1.00 104.96 ? 240  TRP B CZ3   1 
ATOM   5147  C  CH2   . TRP B  2  242 ? 58.906  52.462  87.552  1.00 104.98 ? 240  TRP B CH2   1 
ATOM   5148  N  N     . GLY B  2  243 ? 62.987  48.929  83.656  1.00 102.52 ? 241  GLY B N     1 
ATOM   5149  C  CA    . GLY B  2  243 ? 62.019  48.130  82.926  1.00 101.08 ? 241  GLY B CA    1 
ATOM   5150  C  C     . GLY B  2  243 ? 60.635  48.316  83.525  1.00 100.11 ? 241  GLY B C     1 
ATOM   5151  O  O     . GLY B  2  243 ? 59.942  47.357  83.886  1.00 98.71  ? 241  GLY B O     1 
ATOM   5152  N  N     . GLY B  2  244 ? 60.240  49.579  83.635  1.00 99.60  ? 242  GLY B N     1 
ATOM   5153  C  CA    . GLY B  2  244 ? 58.944  49.906  84.185  1.00 98.27  ? 242  GLY B CA    1 
ATOM   5154  C  C     . GLY B  2  244 ? 57.962  50.247  83.092  1.00 97.32  ? 242  GLY B C     1 
ATOM   5155  O  O     . GLY B  2  244 ? 58.316  50.365  81.926  1.00 96.63  ? 242  GLY B O     1 
ATOM   5156  N  N     . GLU B  2  245 ? 56.711  50.404  83.483  1.00 97.61  ? 243  GLU B N     1 
ATOM   5157  C  CA    . GLU B  2  245 ? 55.651  50.732  82.553  1.00 97.95  ? 243  GLU B CA    1 
ATOM   5158  C  C     . GLU B  2  245 ? 54.870  51.923  83.123  1.00 97.38  ? 243  GLU B C     1 
ATOM   5159  O  O     . GLU B  2  245 ? 54.270  51.828  84.194  1.00 98.01  ? 243  GLU B O     1 
ATOM   5160  C  CB    . GLU B  2  245 ? 54.765  49.496  82.359  1.00 98.60  ? 243  GLU B CB    1 
ATOM   5161  C  CG    . GLU B  2  245 ? 53.351  49.786  81.902  1.00 101.63 ? 243  GLU B CG    1 
ATOM   5162  C  CD    . GLU B  2  245 ? 52.547  48.521  81.624  1.00 103.81 ? 243  GLU B CD    1 
ATOM   5163  O  OE1   . GLU B  2  245 ? 52.645  47.554  82.418  1.00 104.84 ? 243  GLU B OE1   1 
ATOM   5164  O  OE2   . GLU B  2  245 ? 51.804  48.502  80.613  1.00 104.45 ? 243  GLU B OE2   1 
ATOM   5165  N  N     . ILE B  2  246 ? 54.911  53.045  82.406  1.00 96.12  ? 244  ILE B N     1 
ATOM   5166  C  CA    . ILE B  2  246 ? 54.241  54.286  82.806  1.00 94.00  ? 244  ILE B CA    1 
ATOM   5167  C  C     . ILE B  2  246 ? 53.106  54.660  81.845  1.00 93.77  ? 244  ILE B C     1 
ATOM   5168  O  O     . ILE B  2  246 ? 53.337  54.916  80.669  1.00 93.79  ? 244  ILE B O     1 
ATOM   5169  C  CB    . ILE B  2  246 ? 55.250  55.452  82.830  1.00 92.39  ? 244  ILE B CB    1 
ATOM   5170  C  CG1   . ILE B  2  246 ? 56.327  55.187  83.884  1.00 89.20  ? 244  ILE B CG1   1 
ATOM   5171  C  CG2   . ILE B  2  246 ? 54.518  56.766  83.059  1.00 92.16  ? 244  ILE B CG2   1 
ATOM   5172  C  CD1   . ILE B  2  246 ? 57.478  56.150  83.820  1.00 86.07  ? 244  ILE B CD1   1 
ATOM   5173  N  N     . ARG B  2  247 ? 51.882  54.714  82.347  1.00 93.84  ? 245  ARG B N     1 
ATOM   5174  C  CA    . ARG B  2  247 ? 50.742  55.048  81.496  1.00 94.31  ? 245  ARG B CA    1 
ATOM   5175  C  C     . ARG B  2  247 ? 50.137  56.423  81.829  1.00 94.70  ? 245  ARG B C     1 
ATOM   5176  O  O     . ARG B  2  247 ? 50.044  56.801  83.003  1.00 95.41  ? 245  ARG B O     1 
ATOM   5177  C  CB    . ARG B  2  247 ? 49.665  53.968  81.635  1.00 93.58  ? 245  ARG B CB    1 
ATOM   5178  C  CG    . ARG B  2  247 ? 50.154  52.560  81.350  1.00 92.30  ? 245  ARG B CG    1 
ATOM   5179  C  CD    . ARG B  2  247 ? 49.145  51.522  81.823  1.00 92.06  ? 245  ARG B CD    1 
ATOM   5180  N  NE    . ARG B  2  247 ? 47.976  51.397  80.954  1.00 92.47  ? 245  ARG B NE    1 
ATOM   5181  C  CZ    . ARG B  2  247 ? 47.995  50.880  79.724  1.00 92.94  ? 245  ARG B CZ    1 
ATOM   5182  N  NH1   . ARG B  2  247 ? 49.131  50.433  79.193  1.00 92.56  ? 245  ARG B NH1   1 
ATOM   5183  N  NH2   . ARG B  2  247 ? 46.868  50.796  79.024  1.00 92.68  ? 245  ARG B NH2   1 
ATOM   5184  N  N     . GLU B  2  248 ? 49.718  57.157  80.794  1.00 94.17  ? 246  GLU B N     1 
ATOM   5185  C  CA    . GLU B  2  248 ? 49.120  58.488  80.967  1.00 92.72  ? 246  GLU B CA    1 
ATOM   5186  C  C     . GLU B  2  248 ? 47.779  58.661  80.252  1.00 91.27  ? 246  GLU B C     1 
ATOM   5187  O  O     . GLU B  2  248 ? 47.730  58.906  79.045  1.00 91.82  ? 246  GLU B O     1 
ATOM   5188  C  CB    . GLU B  2  248 ? 50.089  59.565  80.484  1.00 92.72  ? 246  GLU B CB    1 
ATOM   5189  C  CG    . GLU B  2  248 ? 49.490  60.949  80.456  1.00 95.07  ? 246  GLU B CG    1 
ATOM   5190  C  CD    . GLU B  2  248 ? 50.541  62.045  80.521  1.00 97.59  ? 246  GLU B CD    1 
ATOM   5191  O  OE1   . GLU B  2  248 ? 50.248  63.175  80.059  1.00 98.70  ? 246  GLU B OE1   1 
ATOM   5192  O  OE2   . GLU B  2  248 ? 51.651  61.782  81.047  1.00 97.23  ? 246  GLU B OE2   1 
ATOM   5193  N  N     . GLN B  2  249 ? 46.696  58.538  81.013  1.00 88.96  ? 247  GLN B N     1 
ATOM   5194  C  CA    . GLN B  2  249 ? 45.345  58.675  80.483  1.00 86.77  ? 247  GLN B CA    1 
ATOM   5195  C  C     . GLN B  2  249 ? 45.030  60.162  80.422  1.00 86.38  ? 247  GLN B C     1 
ATOM   5196  O  O     . GLN B  2  249 ? 44.930  60.814  81.461  1.00 86.06  ? 247  GLN B O     1 
ATOM   5197  C  CB    . GLN B  2  249 ? 44.365  57.965  81.421  1.00 86.88  ? 247  GLN B CB    1 
ATOM   5198  C  CG    . GLN B  2  249 ? 42.907  58.083  81.048  1.00 86.53  ? 247  GLN B CG    1 
ATOM   5199  C  CD    . GLN B  2  249 ? 42.604  57.437  79.722  1.00 88.07  ? 247  GLN B CD    1 
ATOM   5200  O  OE1   . GLN B  2  249 ? 42.863  56.252  79.528  1.00 88.50  ? 247  GLN B OE1   1 
ATOM   5201  N  NE2   . GLN B  2  249 ? 42.048  58.213  78.796  1.00 90.26  ? 247  GLN B NE2   1 
ATOM   5202  N  N     . ASN B  2  250 ? 44.872  60.707  79.218  1.00 85.51  ? 248  ASN B N     1 
ATOM   5203  C  CA    . ASN B  2  250 ? 44.590  62.132  79.096  1.00 84.34  ? 248  ASN B CA    1 
ATOM   5204  C  C     . ASN B  2  250 ? 43.499  62.517  78.103  1.00 85.54  ? 248  ASN B C     1 
ATOM   5205  O  O     . ASN B  2  250 ? 43.307  63.696  77.810  1.00 84.96  ? 248  ASN B O     1 
ATOM   5206  C  CB    . ASN B  2  250 ? 45.893  62.894  78.792  1.00 81.80  ? 248  ASN B CB    1 
ATOM   5207  C  CG    . ASN B  2  250 ? 46.476  62.560  77.432  1.00 78.63  ? 248  ASN B CG    1 
ATOM   5208  O  OD1   . ASN B  2  250 ? 47.641  62.854  77.157  1.00 75.52  ? 248  ASN B OD1   1 
ATOM   5209  N  ND2   . ASN B  2  250 ? 45.667  61.961  76.570  1.00 77.47  ? 248  ASN B ND2   1 
ATOM   5210  N  N     . GLY B  2  251 ? 42.782  61.532  77.580  1.00 87.66  ? 249  GLY B N     1 
ATOM   5211  C  CA    . GLY B  2  251 ? 41.708  61.842  76.651  1.00 92.95  ? 249  GLY B CA    1 
ATOM   5212  C  C     . GLY B  2  251 ? 41.996  61.950  75.155  1.00 96.05  ? 249  GLY B C     1 
ATOM   5213  O  O     . GLY B  2  251 ? 41.092  61.691  74.351  1.00 96.50  ? 249  GLY B O     1 
ATOM   5214  N  N     . HIS B  2  252 ? 43.218  62.348  74.780  1.00 98.66  ? 250  HIS B N     1 
ATOM   5215  C  CA    . HIS B  2  252 ? 43.628  62.471  73.369  1.00 100.79 ? 250  HIS B CA    1 
ATOM   5216  C  C     . HIS B  2  252 ? 43.068  61.350  72.496  1.00 101.19 ? 250  HIS B C     1 
ATOM   5217  O  O     . HIS B  2  252 ? 43.141  60.172  72.865  1.00 102.00 ? 250  HIS B O     1 
ATOM   5218  C  CB    . HIS B  2  252 ? 45.137  62.403  73.257  1.00 103.62 ? 250  HIS B CB    1 
ATOM   5219  C  CG    . HIS B  2  252 ? 45.773  63.677  72.823  1.00 108.61 ? 250  HIS B CG    1 
ATOM   5220  N  ND1   . HIS B  2  252 ? 45.835  64.790  73.634  1.00 110.48 ? 250  HIS B ND1   1 
ATOM   5221  C  CD2   . HIS B  2  252 ? 46.426  64.002  71.680  1.00 110.35 ? 250  HIS B CD2   1 
ATOM   5222  C  CE1   . HIS B  2  252 ? 46.505  65.745  73.012  1.00 112.21 ? 250  HIS B CE1   1 
ATOM   5223  N  NE2   . HIS B  2  252 ? 46.876  65.293  71.825  1.00 111.96 ? 250  HIS B NE2   1 
ATOM   5224  N  N     . SER B  2  253 ? 42.535  61.699  71.329  1.00 100.66 ? 251  SER B N     1 
ATOM   5225  C  CA    . SER B  2  253 ? 41.978  60.681  70.445  1.00 99.49  ? 251  SER B CA    1 
ATOM   5226  C  C     . SER B  2  253 ? 43.106  59.788  69.924  1.00 98.56  ? 251  SER B C     1 
ATOM   5227  O  O     . SER B  2  253 ? 42.874  58.650  69.509  1.00 99.52  ? 251  SER B O     1 
ATOM   5228  C  CB    . SER B  2  253 ? 41.261  61.330  69.268  1.00 99.70  ? 251  SER B CB    1 
ATOM   5229  O  OG    . SER B  2  253 ? 42.195  61.937  68.394  1.00 101.82 ? 251  SER B OG    1 
ATOM   5230  N  N     . LEU B  2  254 ? 44.332  60.302  69.955  1.00 96.25  ? 252  LEU B N     1 
ATOM   5231  C  CA    . LEU B  2  254 ? 45.471  59.534  69.479  1.00 92.76  ? 252  LEU B CA    1 
ATOM   5232  C  C     . LEU B  2  254 ? 46.384  59.038  70.584  1.00 91.50  ? 252  LEU B C     1 
ATOM   5233  O  O     . LEU B  2  254 ? 46.896  59.823  71.388  1.00 91.20  ? 252  LEU B O     1 
ATOM   5234  C  CB    . LEU B  2  254 ? 46.286  60.363  68.497  1.00 91.85  ? 252  LEU B CB    1 
ATOM   5235  C  CG    . LEU B  2  254 ? 45.543  60.754  67.227  1.00 91.03  ? 252  LEU B CG    1 
ATOM   5236  C  CD1   . LEU B  2  254 ? 46.534  61.344  66.241  1.00 90.73  ? 252  LEU B CD1   1 
ATOM   5237  C  CD2   . LEU B  2  254 ? 44.860  59.531  66.632  1.00 90.52  ? 252  LEU B CD2   1 
ATOM   5238  N  N     . VAL B  2  255 ? 46.592  57.724  70.600  1.00 89.57  ? 253  VAL B N     1 
ATOM   5239  C  CA    . VAL B  2  255 ? 47.456  57.075  71.579  1.00 87.69  ? 253  VAL B CA    1 
ATOM   5240  C  C     . VAL B  2  255 ? 48.872  56.884  71.055  1.00 86.62  ? 253  VAL B C     1 
ATOM   5241  O  O     . VAL B  2  255 ? 49.072  56.337  69.968  1.00 86.71  ? 253  VAL B O     1 
ATOM   5242  C  CB    . VAL B  2  255 ? 46.934  55.674  71.951  1.00 87.28  ? 253  VAL B CB    1 
ATOM   5243  C  CG1   . VAL B  2  255 ? 47.932  54.976  72.854  1.00 87.14  ? 253  VAL B CG1   1 
ATOM   5244  C  CG2   . VAL B  2  255 ? 45.591  55.778  72.635  1.00 88.59  ? 253  VAL B CG2   1 
ATOM   5245  N  N     . HIS B  2  256 ? 49.853  57.345  71.823  1.00 85.66  ? 254  HIS B N     1 
ATOM   5246  C  CA    . HIS B  2  256 ? 51.255  57.161  71.458  1.00 84.80  ? 254  HIS B CA    1 
ATOM   5247  C  C     . HIS B  2  256 ? 51.795  56.070  72.372  1.00 85.26  ? 254  HIS B C     1 
ATOM   5248  O  O     . HIS B  2  256 ? 51.508  56.062  73.567  1.00 85.81  ? 254  HIS B O     1 
ATOM   5249  C  CB    . HIS B  2  256 ? 52.072  58.436  71.657  1.00 81.83  ? 254  HIS B CB    1 
ATOM   5250  C  CG    . HIS B  2  256 ? 51.858  59.461  70.591  1.00 80.34  ? 254  HIS B CG    1 
ATOM   5251  N  ND1   . HIS B  2  256 ? 52.888  60.211  70.064  1.00 80.10  ? 254  HIS B ND1   1 
ATOM   5252  C  CD2   . HIS B  2  256 ? 50.735  59.866  69.954  1.00 79.92  ? 254  HIS B CD2   1 
ATOM   5253  C  CE1   . HIS B  2  256 ? 52.410  61.032  69.147  1.00 79.19  ? 254  HIS B CE1   1 
ATOM   5254  N  NE2   . HIS B  2  256 ? 51.105  60.843  69.061  1.00 79.71  ? 254  HIS B NE2   1 
ATOM   5255  N  N     . ALA B  2  257 ? 52.556  55.140  71.810  1.00 85.47  ? 255  ALA B N     1 
ATOM   5256  C  CA    . ALA B  2  257 ? 53.121  54.056  72.600  1.00 85.22  ? 255  ALA B CA    1 
ATOM   5257  C  C     . ALA B  2  257 ? 54.551  53.787  72.175  1.00 85.59  ? 255  ALA B C     1 
ATOM   5258  O  O     . ALA B  2  257 ? 54.907  53.919  70.999  1.00 85.61  ? 255  ALA B O     1 
ATOM   5259  C  CB    . ALA B  2  257 ? 52.288  52.799  72.449  1.00 85.00  ? 255  ALA B CB    1 
ATOM   5260  N  N     . ALA B  2  258 ? 55.371  53.422  73.150  1.00 85.42  ? 256  ALA B N     1 
ATOM   5261  C  CA    . ALA B  2  258 ? 56.767  53.128  72.893  1.00 85.34  ? 256  ALA B CA    1 
ATOM   5262  C  C     . ALA B  2  258 ? 57.202  51.983  73.795  1.00 85.31  ? 256  ALA B C     1 
ATOM   5263  O  O     . ALA B  2  258 ? 57.194  52.115  75.014  1.00 85.99  ? 256  ALA B O     1 
ATOM   5264  C  CB    . ALA B  2  258 ? 57.620  54.364  73.150  1.00 84.43  ? 256  ALA B CB    1 
ATOM   5265  N  N     . VAL B  2  259 ? 57.560  50.856  73.187  1.00 85.29  ? 257  VAL B N     1 
ATOM   5266  C  CA    . VAL B  2  259 ? 58.013  49.694  73.929  1.00 84.42  ? 257  VAL B CA    1 
ATOM   5267  C  C     . VAL B  2  259 ? 59.454  49.464  73.544  1.00 85.06  ? 257  VAL B C     1 
ATOM   5268  O  O     . VAL B  2  259 ? 59.759  49.356  72.360  1.00 85.25  ? 257  VAL B O     1 
ATOM   5269  C  CB    . VAL B  2  259 ? 57.196  48.458  73.568  1.00 83.27  ? 257  VAL B CB    1 
ATOM   5270  C  CG1   . VAL B  2  259 ? 57.773  47.258  74.254  1.00 83.44  ? 257  VAL B CG1   1 
ATOM   5271  C  CG2   . VAL B  2  259 ? 55.753  48.648  73.990  1.00 83.23  ? 257  VAL B CG2   1 
ATOM   5272  N  N     . VAL B  2  260 ? 60.343  49.412  74.528  1.00 86.31  ? 258  VAL B N     1 
ATOM   5273  C  CA    . VAL B  2  260 ? 61.749  49.191  74.227  1.00 89.44  ? 258  VAL B CA    1 
ATOM   5274  C  C     . VAL B  2  260 ? 62.450  48.230  75.178  1.00 91.87  ? 258  VAL B C     1 
ATOM   5275  O  O     . VAL B  2  260 ? 61.872  47.750  76.151  1.00 92.63  ? 258  VAL B O     1 
ATOM   5276  C  CB    . VAL B  2  260 ? 62.549  50.513  74.219  1.00 89.29  ? 258  VAL B CB    1 
ATOM   5277  C  CG1   . VAL B  2  260 ? 61.941  51.482  73.225  1.00 88.11  ? 258  VAL B CG1   1 
ATOM   5278  C  CG2   . VAL B  2  260 ? 62.596  51.103  75.619  1.00 89.04  ? 258  VAL B CG2   1 
ATOM   5279  N  N     . THR B  2  261 ? 63.711  47.952  74.866  1.00 94.25  ? 259  THR B N     1 
ATOM   5280  C  CA    . THR B  2  261 ? 64.551  47.068  75.660  1.00 96.21  ? 259  THR B CA    1 
ATOM   5281  C  C     . THR B  2  261 ? 65.934  47.691  75.649  1.00 97.46  ? 259  THR B C     1 
ATOM   5282  O  O     . THR B  2  261 ? 66.226  48.536  74.800  1.00 97.02  ? 259  THR B O     1 
ATOM   5283  C  CB    . THR B  2  261 ? 64.631  45.663  75.036  1.00 96.48  ? 259  THR B CB    1 
ATOM   5284  O  OG1   . THR B  2  261 ? 63.348  45.030  75.129  1.00 95.71  ? 259  THR B OG1   1 
ATOM   5285  C  CG2   . THR B  2  261 ? 65.688  44.810  75.752  1.00 96.83  ? 259  THR B CG2   1 
ATOM   5286  N  N     . GLU B  2  262 ? 66.785  47.294  76.586  1.00 98.87  ? 260  GLU B N     1 
ATOM   5287  C  CA    . GLU B  2  262 ? 68.117  47.855  76.618  1.00 100.98 ? 260  GLU B CA    1 
ATOM   5288  C  C     . GLU B  2  262 ? 68.809  47.425  75.343  1.00 101.33 ? 260  GLU B C     1 
ATOM   5289  O  O     . GLU B  2  262 ? 68.893  46.236  75.049  1.00 102.62 ? 260  GLU B O     1 
ATOM   5290  C  CB    . GLU B  2  262 ? 68.877  47.346  77.831  1.00 103.27 ? 260  GLU B CB    1 
ATOM   5291  C  CG    . GLU B  2  262 ? 70.158  48.114  78.110  1.00 107.81 ? 260  GLU B CG    1 
ATOM   5292  C  CD    . GLU B  2  262 ? 70.459  48.210  79.606  1.00 110.77 ? 260  GLU B CD    1 
ATOM   5293  O  OE1   . GLU B  2  262 ? 70.483  47.152  80.281  1.00 111.74 ? 260  GLU B OE1   1 
ATOM   5294  O  OE2   . GLU B  2  262 ? 70.670  49.343  80.106  1.00 112.09 ? 260  GLU B OE2   1 
ATOM   5295  N  N     . GLY B  2  263 ? 69.281  48.396  74.572  1.00 101.38 ? 261  GLY B N     1 
ATOM   5296  C  CA    . GLY B  2  263 ? 69.954  48.087  73.325  1.00 100.11 ? 261  GLY B CA    1 
ATOM   5297  C  C     . GLY B  2  263 ? 71.440  48.351  73.433  1.00 99.67  ? 261  GLY B C     1 
ATOM   5298  O  O     . GLY B  2  263 ? 72.039  48.144  74.488  1.00 99.79  ? 261  GLY B O     1 
ATOM   5299  N  N     . ALA B  2  264 ? 72.034  48.833  72.349  1.00 98.91  ? 262  ALA B N     1 
ATOM   5300  C  CA    . ALA B  2  264 ? 73.460  49.112  72.331  1.00 98.47  ? 262  ALA B CA    1 
ATOM   5301  C  C     . ALA B  2  264 ? 73.776  50.506  72.848  1.00 98.33  ? 262  ALA B C     1 
ATOM   5302  O  O     . ALA B  2  264 ? 72.903  51.370  72.919  1.00 97.86  ? 262  ALA B O     1 
ATOM   5303  C  CB    . ALA B  2  264 ? 74.000  48.948  70.914  1.00 98.28  ? 262  ALA B CB    1 
ATOM   5304  N  N     . ALA B  2  265 ? 75.041  50.708  73.212  1.00 98.77  ? 263  ALA B N     1 
ATOM   5305  C  CA    . ALA B  2  265 ? 75.524  51.987  73.710  1.00 98.68  ? 263  ALA B CA    1 
ATOM   5306  C  C     . ALA B  2  265 ? 76.449  52.588  72.660  1.00 99.41  ? 263  ALA B C     1 
ATOM   5307  O  O     . ALA B  2  265 ? 76.913  51.890  71.763  1.00 98.02  ? 263  ALA B O     1 
ATOM   5308  C  CB    . ALA B  2  265 ? 76.272  51.785  75.005  1.00 97.57  ? 263  ALA B CB    1 
ATOM   5309  N  N     . VAL B  2  266 ? 76.707  53.887  72.769  1.00 101.84 ? 264  VAL B N     1 
ATOM   5310  C  CA    . VAL B  2  266 ? 77.583  54.566  71.816  1.00 104.39 ? 264  VAL B CA    1 
ATOM   5311  C  C     . VAL B  2  266 ? 78.855  53.745  71.666  1.00 105.74 ? 264  VAL B C     1 
ATOM   5312  O  O     . VAL B  2  266 ? 79.313  53.134  72.633  1.00 106.30 ? 264  VAL B O     1 
ATOM   5313  C  CB    . VAL B  2  266 ? 77.997  55.977  72.305  1.00 104.56 ? 264  VAL B CB    1 
ATOM   5314  C  CG1   . VAL B  2  266 ? 78.757  56.700  71.192  1.00 103.79 ? 264  VAL B CG1   1 
ATOM   5315  C  CG2   . VAL B  2  266 ? 76.771  56.774  72.758  1.00 104.40 ? 264  VAL B CG2   1 
ATOM   5316  N  N     . GLY B  2  267 ? 79.420  53.734  70.461  1.00 106.88 ? 265  GLY B N     1 
ATOM   5317  C  CA    . GLY B  2  267 ? 80.641  52.981  70.220  1.00 108.24 ? 265  GLY B CA    1 
ATOM   5318  C  C     . GLY B  2  267 ? 80.580  51.475  70.475  1.00 109.31 ? 265  GLY B C     1 
ATOM   5319  O  O     . GLY B  2  267 ? 81.618  50.832  70.662  1.00 109.33 ? 265  GLY B O     1 
ATOM   5320  N  N     . SER B  2  268 ? 79.376  50.904  70.489  1.00 109.65 ? 266  SER B N     1 
ATOM   5321  C  CA    . SER B  2  268 ? 79.225  49.469  70.716  1.00 108.99 ? 266  SER B CA    1 
ATOM   5322  C  C     . SER B  2  268 ? 79.265  48.748  69.371  1.00 109.37 ? 266  SER B C     1 
ATOM   5323  O  O     . SER B  2  268 ? 78.867  49.296  68.341  1.00 108.58 ? 266  SER B O     1 
ATOM   5324  C  CB    . SER B  2  268 ? 77.903  49.170  71.443  1.00 108.21 ? 266  SER B CB    1 
ATOM   5325  O  OG    . SER B  2  268 ? 77.778  47.795  71.785  1.00 106.89 ? 266  SER B OG    1 
ATOM   5326  N  N     . ALA B  2  269 ? 79.763  47.519  69.389  1.00 110.64 ? 267  ALA B N     1 
ATOM   5327  C  CA    . ALA B  2  269 ? 79.862  46.715  68.179  1.00 112.03 ? 267  ALA B CA    1 
ATOM   5328  C  C     . ALA B  2  269 ? 78.470  46.281  67.763  1.00 112.68 ? 267  ALA B C     1 
ATOM   5329  O  O     . ALA B  2  269 ? 78.183  46.081  66.580  1.00 112.28 ? 267  ALA B O     1 
ATOM   5330  C  CB    . ALA B  2  269 ? 80.728  45.494  68.441  1.00 112.38 ? 267  ALA B CB    1 
ATOM   5331  N  N     . GLU B  2  270 ? 77.611  46.145  68.764  1.00 113.73 ? 268  GLU B N     1 
ATOM   5332  C  CA    . GLU B  2  270 ? 76.230  45.728  68.567  1.00 115.32 ? 268  GLU B CA    1 
ATOM   5333  C  C     . GLU B  2  270 ? 75.350  46.899  68.071  1.00 114.74 ? 268  GLU B C     1 
ATOM   5334  O  O     . GLU B  2  270 ? 74.222  46.691  67.605  1.00 114.71 ? 268  GLU B O     1 
ATOM   5335  C  CB    . GLU B  2  270 ? 75.708  45.166  69.898  1.00 117.48 ? 268  GLU B CB    1 
ATOM   5336  C  CG    . GLU B  2  270 ? 74.423  44.349  69.816  1.00 120.08 ? 268  GLU B CG    1 
ATOM   5337  C  CD    . GLU B  2  270 ? 74.073  43.685  71.150  1.00 121.37 ? 268  GLU B CD    1 
ATOM   5338  O  OE1   . GLU B  2  270 ? 74.044  44.400  72.184  1.00 120.89 ? 268  GLU B OE1   1 
ATOM   5339  O  OE2   . GLU B  2  270 ? 73.824  42.452  71.156  1.00 122.24 ? 268  GLU B OE2   1 
ATOM   5340  N  N     . ALA B  2  271 ? 75.883  48.121  68.166  1.00 113.29 ? 269  ALA B N     1 
ATOM   5341  C  CA    . ALA B  2  271 ? 75.182  49.340  67.743  1.00 110.90 ? 269  ALA B CA    1 
ATOM   5342  C  C     . ALA B  2  271 ? 74.812  49.311  66.264  1.00 109.13 ? 269  ALA B C     1 
ATOM   5343  O  O     . ALA B  2  271 ? 73.644  49.456  65.901  1.00 109.10 ? 269  ALA B O     1 
ATOM   5344  C  CB    . ALA B  2  271 ? 76.055  50.569  68.029  1.00 110.90 ? 269  ALA B CB    1 
ATOM   5345  N  N     . ASN B  2  272 ? 75.826  49.135  65.424  1.00 106.40 ? 270  ASN B N     1 
ATOM   5346  C  CA    . ASN B  2  272 ? 75.655  49.081  63.982  1.00 103.44 ? 270  ASN B CA    1 
ATOM   5347  C  C     . ASN B  2  272 ? 74.645  48.006  63.617  1.00 101.39 ? 270  ASN B C     1 
ATOM   5348  O  O     . ASN B  2  272 ? 73.974  48.094  62.597  1.00 101.09 ? 270  ASN B O     1 
ATOM   5349  C  CB    . ASN B  2  272 ? 76.995  48.765  63.328  1.00 104.38 ? 270  ASN B CB    1 
ATOM   5350  C  CG    . ASN B  2  272 ? 78.105  49.670  63.812  1.00 104.65 ? 270  ASN B CG    1 
ATOM   5351  O  OD1   . ASN B  2  272 ? 78.262  50.786  63.324  1.00 105.14 ? 270  ASN B OD1   1 
ATOM   5352  N  ND2   . ASN B  2  272 ? 78.872  49.198  64.791  1.00 104.00 ? 270  ASN B ND2   1 
ATOM   5353  N  N     . ALA B  2  273 ? 74.548  46.983  64.453  1.00 99.54  ? 271  ALA B N     1 
ATOM   5354  C  CA    . ALA B  2  273 ? 73.620  45.887  64.211  1.00 99.30  ? 271  ALA B CA    1 
ATOM   5355  C  C     . ALA B  2  273 ? 72.179  46.355  64.348  1.00 98.94  ? 271  ALA B C     1 
ATOM   5356  O  O     . ALA B  2  273 ? 71.331  46.067  63.500  1.00 98.58  ? 271  ALA B O     1 
ATOM   5357  C  CB    . ALA B  2  273 ? 73.893  44.755  65.191  1.00 100.19 ? 271  ALA B CB    1 
ATOM   5358  N  N     . PHE B  2  274 ? 71.910  47.070  65.436  1.00 98.98  ? 272  PHE B N     1 
ATOM   5359  C  CA    . PHE B  2  274 ? 70.578  47.601  65.715  1.00 97.84  ? 272  PHE B CA    1 
ATOM   5360  C  C     . PHE B  2  274 ? 70.167  48.660  64.698  1.00 97.00  ? 272  PHE B C     1 
ATOM   5361  O  O     . PHE B  2  274 ? 69.073  48.610  64.125  1.00 96.31  ? 272  PHE B O     1 
ATOM   5362  C  CB    . PHE B  2  274 ? 70.545  48.192  67.120  1.00 96.84  ? 272  PHE B CB    1 
ATOM   5363  C  CG    . PHE B  2  274 ? 70.305  47.175  68.183  1.00 97.14  ? 272  PHE B CG    1 
ATOM   5364  C  CD1   . PHE B  2  274 ? 71.290  46.871  69.114  1.00 97.38  ? 272  PHE B CD1   1 
ATOM   5365  C  CD2   . PHE B  2  274 ? 69.080  46.518  68.260  1.00 96.74  ? 272  PHE B CD2   1 
ATOM   5366  C  CE1   . PHE B  2  274 ? 71.054  45.924  70.117  1.00 97.67  ? 272  PHE B CE1   1 
ATOM   5367  C  CE2   . PHE B  2  274 ? 68.834  45.572  69.254  1.00 96.93  ? 272  PHE B CE2   1 
ATOM   5368  C  CZ    . PHE B  2  274 ? 69.822  45.273  70.185  1.00 97.03  ? 272  PHE B CZ    1 
ATOM   5369  N  N     . SER B  2  275 ? 71.056  49.624  64.488  1.00 95.76  ? 273  SER B N     1 
ATOM   5370  C  CA    . SER B  2  275 ? 70.814  50.686  63.535  1.00 94.07  ? 273  SER B CA    1 
ATOM   5371  C  C     . SER B  2  275 ? 70.302  50.040  62.256  1.00 93.87  ? 273  SER B C     1 
ATOM   5372  O  O     . SER B  2  275 ? 69.410  50.570  61.600  1.00 95.11  ? 273  SER B O     1 
ATOM   5373  C  CB    . SER B  2  275 ? 72.114  51.447  63.274  1.00 93.33  ? 273  SER B CB    1 
ATOM   5374  O  OG    . SER B  2  275 ? 72.711  51.844  64.503  1.00 91.99  ? 273  SER B OG    1 
ATOM   5375  N  N     . VAL B  2  276 ? 70.851  48.878  61.918  1.00 93.13  ? 274  VAL B N     1 
ATOM   5376  C  CA    . VAL B  2  276 ? 70.431  48.173  60.720  1.00 92.17  ? 274  VAL B CA    1 
ATOM   5377  C  C     . VAL B  2  276 ? 69.075  47.522  60.914  1.00 91.86  ? 274  VAL B C     1 
ATOM   5378  O  O     . VAL B  2  276 ? 68.214  47.625  60.048  1.00 91.26  ? 274  VAL B O     1 
ATOM   5379  C  CB    . VAL B  2  276 ? 71.451  47.106  60.303  1.00 91.84  ? 274  VAL B CB    1 
ATOM   5380  C  CG1   . VAL B  2  276 ? 70.891  46.274  59.172  1.00 91.15  ? 274  VAL B CG1   1 
ATOM   5381  C  CG2   . VAL B  2  276 ? 72.742  47.778  59.860  1.00 91.84  ? 274  VAL B CG2   1 
ATOM   5382  N  N     . LEU B  2  277 ? 68.879  46.845  62.040  1.00 92.85  ? 275  LEU B N     1 
ATOM   5383  C  CA    . LEU B  2  277 ? 67.585  46.218  62.294  1.00 94.20  ? 275  LEU B CA    1 
ATOM   5384  C  C     . LEU B  2  277 ? 66.534  47.317  62.322  1.00 95.69  ? 275  LEU B C     1 
ATOM   5385  O  O     . LEU B  2  277 ? 65.337  47.070  62.121  1.00 96.09  ? 275  LEU B O     1 
ATOM   5386  C  CB    . LEU B  2  277 ? 67.564  45.481  63.633  1.00 92.95  ? 275  LEU B CB    1 
ATOM   5387  C  CG    . LEU B  2  277 ? 66.131  45.110  64.045  1.00 92.62  ? 275  LEU B CG    1 
ATOM   5388  C  CD1   . LEU B  2  277 ? 65.531  44.141  63.045  1.00 91.69  ? 275  LEU B CD1   1 
ATOM   5389  C  CD2   . LEU B  2  277 ? 66.122  44.501  65.420  1.00 93.24  ? 275  LEU B CD2   1 
ATOM   5390  N  N     . GLN B  2  278 ? 66.992  48.536  62.586  1.00 96.53  ? 276  GLN B N     1 
ATOM   5391  C  CA    . GLN B  2  278 ? 66.105  49.687  62.624  1.00 96.79  ? 276  GLN B CA    1 
ATOM   5392  C  C     . GLN B  2  278 ? 65.535  49.857  61.218  1.00 96.55  ? 276  GLN B C     1 
ATOM   5393  O  O     . GLN B  2  278 ? 64.354  49.607  60.976  1.00 96.62  ? 276  GLN B O     1 
ATOM   5394  C  CB    . GLN B  2  278 ? 66.884  50.939  63.031  1.00 97.08  ? 276  GLN B CB    1 
ATOM   5395  C  CG    . GLN B  2  278 ? 66.013  52.140  63.340  1.00 97.73  ? 276  GLN B CG    1 
ATOM   5396  C  CD    . GLN B  2  278 ? 66.815  53.369  63.735  1.00 98.88  ? 276  GLN B CD    1 
ATOM   5397  O  OE1   . GLN B  2  278 ? 66.248  54.377  64.176  1.00 99.22  ? 276  GLN B OE1   1 
ATOM   5398  N  NE2   . GLN B  2  278 ? 68.138  53.298  63.575  1.00 98.86  ? 276  GLN B NE2   1 
ATOM   5399  N  N     . HIS B  2  279 ? 66.388  50.259  60.286  1.00 96.09  ? 277  HIS B N     1 
ATOM   5400  C  CA    . HIS B  2  279 ? 65.963  50.455  58.912  1.00 96.42  ? 277  HIS B CA    1 
ATOM   5401  C  C     . HIS B  2  279 ? 65.231  49.252  58.328  1.00 94.64  ? 277  HIS B C     1 
ATOM   5402  O  O     . HIS B  2  279 ? 64.373  49.392  57.465  1.00 93.52  ? 277  HIS B O     1 
ATOM   5403  C  CB    . HIS B  2  279 ? 67.176  50.815  58.061  1.00 99.74  ? 277  HIS B CB    1 
ATOM   5404  C  CG    . HIS B  2  279 ? 67.691  52.194  58.324  1.00 103.68 ? 277  HIS B CG    1 
ATOM   5405  N  ND1   . HIS B  2  279 ? 67.003  53.329  57.943  1.00 106.00 ? 277  HIS B ND1   1 
ATOM   5406  C  CD2   . HIS B  2  279 ? 68.800  52.627  58.970  1.00 105.05 ? 277  HIS B CD2   1 
ATOM   5407  C  CE1   . HIS B  2  279 ? 67.666  54.400  58.342  1.00 106.36 ? 277  HIS B CE1   1 
ATOM   5408  N  NE2   . HIS B  2  279 ? 68.760  54.002  58.968  1.00 106.73 ? 277  HIS B NE2   1 
ATOM   5409  N  N     . VAL B  2  280 ? 65.563  48.064  58.801  1.00 94.03  ? 278  VAL B N     1 
ATOM   5410  C  CA    . VAL B  2  280 ? 64.908  46.868  58.304  1.00 93.74  ? 278  VAL B CA    1 
ATOM   5411  C  C     . VAL B  2  280 ? 63.452  46.878  58.742  1.00 94.14  ? 278  VAL B C     1 
ATOM   5412  O  O     . VAL B  2  280 ? 62.549  46.649  57.937  1.00 93.99  ? 278  VAL B O     1 
ATOM   5413  C  CB    . VAL B  2  280 ? 65.594  45.597  58.840  1.00 93.39  ? 278  VAL B CB    1 
ATOM   5414  C  CG1   . VAL B  2  280 ? 64.767  44.365  58.483  1.00 93.17  ? 278  VAL B CG1   1 
ATOM   5415  C  CG2   . VAL B  2  280 ? 66.998  45.487  58.259  1.00 91.59  ? 278  VAL B CG2   1 
ATOM   5416  N  N     . LEU B  2  281 ? 63.230  47.140  60.026  1.00 94.70  ? 279  LEU B N     1 
ATOM   5417  C  CA    . LEU B  2  281 ? 61.877  47.185  60.572  1.00 94.99  ? 279  LEU B CA    1 
ATOM   5418  C  C     . LEU B  2  281 ? 61.170  48.410  60.015  1.00 95.02  ? 279  LEU B C     1 
ATOM   5419  O  O     . LEU B  2  281 ? 59.949  48.430  59.845  1.00 93.83  ? 279  LEU B O     1 
ATOM   5420  C  CB    . LEU B  2  281 ? 61.934  47.236  62.103  1.00 94.13  ? 279  LEU B CB    1 
ATOM   5421  C  CG    . LEU B  2  281 ? 62.141  45.871  62.768  1.00 93.70  ? 279  LEU B CG    1 
ATOM   5422  C  CD1   . LEU B  2  281 ? 62.727  46.041  64.154  1.00 93.57  ? 279  LEU B CD1   1 
ATOM   5423  C  CD2   . LEU B  2  281 ? 60.812  45.124  62.820  1.00 92.77  ? 279  LEU B CD2   1 
ATOM   5424  N  N     . GLY B  2  282 ? 61.970  49.426  59.718  1.00 96.19  ? 280  GLY B N     1 
ATOM   5425  C  CA    . GLY B  2  282 ? 61.448  50.660  59.166  1.00 97.97  ? 280  GLY B CA    1 
ATOM   5426  C  C     . GLY B  2  282 ? 61.490  51.821  60.141  1.00 98.63  ? 280  GLY B C     1 
ATOM   5427  O  O     . GLY B  2  282 ? 60.963  51.726  61.249  1.00 99.97  ? 280  GLY B O     1 
ATOM   5428  N  N     . ALA B  2  283 ? 62.119  52.920  59.741  1.00 98.60  ? 281  ALA B N     1 
ATOM   5429  C  CA    . ALA B  2  283 ? 62.188  54.089  60.602  1.00 98.66  ? 281  ALA B CA    1 
ATOM   5430  C  C     . ALA B  2  283 ? 62.166  55.376  59.780  1.00 99.25  ? 281  ALA B C     1 
ATOM   5431  O  O     . ALA B  2  283 ? 63.215  55.866  59.349  1.00 100.12 ? 281  ALA B O     1 
ATOM   5432  C  CB    . ALA B  2  283 ? 63.437  54.031  61.455  1.00 97.89  ? 281  ALA B CB    1 
ATOM   5433  N  N     . GLY B  2  284 ? 60.965  55.913  59.557  1.00 98.73  ? 282  GLY B N     1 
ATOM   5434  C  CA    . GLY B  2  284 ? 60.826  57.151  58.804  1.00 97.91  ? 282  GLY B CA    1 
ATOM   5435  C  C     . GLY B  2  284 ? 60.566  56.961  57.323  1.00 96.83  ? 282  GLY B C     1 
ATOM   5436  O  O     . GLY B  2  284 ? 61.278  56.193  56.679  1.00 97.62  ? 282  GLY B O     1 
ATOM   5437  N  N     . PRO B  2  285 ? 59.562  57.654  56.747  1.00 95.48  ? 283  PRO B N     1 
ATOM   5438  C  CA    . PRO B  2  285 ? 59.224  57.542  55.321  1.00 94.36  ? 283  PRO B CA    1 
ATOM   5439  C  C     . PRO B  2  285 ? 60.167  58.308  54.386  1.00 93.52  ? 283  PRO B C     1 
ATOM   5440  O  O     . PRO B  2  285 ? 60.762  59.320  54.771  1.00 91.70  ? 283  PRO B O     1 
ATOM   5441  C  CB    . PRO B  2  285 ? 57.793  58.066  55.277  1.00 94.30  ? 283  PRO B CB    1 
ATOM   5442  C  CG    . PRO B  2  285 ? 57.830  59.140  56.302  1.00 93.33  ? 283  PRO B CG    1 
ATOM   5443  C  CD    . PRO B  2  285 ? 58.581  58.503  57.446  1.00 93.76  ? 283  PRO B CD    1 
ATOM   5444  N  N     . LEU B  2  286 ? 60.298  57.818  53.155  1.00 93.18  ? 284  LEU B N     1 
ATOM   5445  C  CA    . LEU B  2  286 ? 61.181  58.452  52.184  1.00 93.20  ? 284  LEU B CA    1 
ATOM   5446  C  C     . LEU B  2  286 ? 60.382  59.017  51.023  1.00 92.73  ? 284  LEU B C     1 
ATOM   5447  O  O     . LEU B  2  286 ? 60.920  59.735  50.169  1.00 92.77  ? 284  LEU B O     1 
ATOM   5448  C  CB    . LEU B  2  286 ? 62.205  57.439  51.655  1.00 94.92  ? 284  LEU B CB    1 
ATOM   5449  C  CG    . LEU B  2  286 ? 62.966  56.552  52.656  1.00 95.96  ? 284  LEU B CG    1 
ATOM   5450  C  CD1   . LEU B  2  286 ? 64.174  55.938  51.970  1.00 96.20  ? 284  LEU B CD1   1 
ATOM   5451  C  CD2   . LEU B  2  286 ? 63.432  57.364  53.854  1.00 97.51  ? 284  LEU B CD2   1 
ATOM   5452  N  N     . ILE B  2  287 ? 59.093  58.686  51.002  1.00 91.69  ? 285  ILE B N     1 
ATOM   5453  C  CA    . ILE B  2  287 ? 58.183  59.149  49.956  1.00 90.64  ? 285  ILE B CA    1 
ATOM   5454  C  C     . ILE B  2  287 ? 56.999  59.910  50.558  1.00 90.14  ? 285  ILE B C     1 
ATOM   5455  O  O     . ILE B  2  287 ? 56.234  59.353  51.345  1.00 90.49  ? 285  ILE B O     1 
ATOM   5456  C  CB    . ILE B  2  287 ? 57.657  57.955  49.137  1.00 89.91  ? 285  ILE B CB    1 
ATOM   5457  C  CG1   . ILE B  2  287 ? 58.828  57.257  48.449  1.00 89.32  ? 285  ILE B CG1   1 
ATOM   5458  C  CG2   . ILE B  2  287 ? 56.654  58.423  48.106  1.00 89.75  ? 285  ILE B CG2   1 
ATOM   5459  C  CD1   . ILE B  2  287 ? 58.440  55.987  47.750  1.00 89.50  ? 285  ILE B CD1   1 
ATOM   5460  N  N     . LYS B  2  288 ? 56.855  61.180  50.178  1.00 89.34  ? 286  LYS B N     1 
ATOM   5461  C  CA    . LYS B  2  288 ? 55.776  62.044  50.676  1.00 89.32  ? 286  LYS B CA    1 
ATOM   5462  C  C     . LYS B  2  288 ? 54.371  61.442  50.533  1.00 89.65  ? 286  LYS B C     1 
ATOM   5463  O  O     . LYS B  2  288 ? 53.941  61.089  49.437  1.00 89.50  ? 286  LYS B O     1 
ATOM   5464  C  CB    . LYS B  2  288 ? 55.831  63.403  49.963  1.00 88.19  ? 286  LYS B CB    1 
ATOM   5465  C  CG    . LYS B  2  288 ? 54.776  64.396  50.426  1.00 87.80  ? 286  LYS B CG    1 
ATOM   5466  C  CD    . LYS B  2  288 ? 54.949  65.774  49.792  1.00 86.63  ? 286  LYS B CD    1 
ATOM   5467  C  CE    . LYS B  2  288 ? 53.864  66.728  50.274  1.00 85.56  ? 286  LYS B CE    1 
ATOM   5468  N  NZ    . LYS B  2  288 ? 54.022  68.093  49.728  1.00 84.84  ? 286  LYS B NZ    1 
ATOM   5469  N  N     . ARG B  2  289 ? 53.653  61.337  51.647  1.00 90.21  ? 287  ARG B N     1 
ATOM   5470  C  CA    . ARG B  2  289 ? 52.308  60.768  51.630  1.00 91.74  ? 287  ARG B CA    1 
ATOM   5471  C  C     . ARG B  2  289 ? 52.348  59.349  51.095  1.00 93.03  ? 287  ARG B C     1 
ATOM   5472  O  O     . ARG B  2  289 ? 51.319  58.774  50.720  1.00 93.31  ? 287  ARG B O     1 
ATOM   5473  C  CB    . ARG B  2  289 ? 51.368  61.584  50.738  1.00 91.22  ? 287  ARG B CB    1 
ATOM   5474  C  CG    . ARG B  2  289 ? 51.154  63.013  51.172  1.00 89.97  ? 287  ARG B CG    1 
ATOM   5475  C  CD    . ARG B  2  289 ? 49.799  63.531  50.719  1.00 87.87  ? 287  ARG B CD    1 
ATOM   5476  N  NE    . ARG B  2  289 ? 49.759  64.983  50.799  1.00 86.37  ? 287  ARG B NE    1 
ATOM   5477  C  CZ    . ARG B  2  289 ? 50.470  65.783  50.013  1.00 85.89  ? 287  ARG B CZ    1 
ATOM   5478  N  NH1   . ARG B  2  289 ? 51.262  65.270  49.089  1.00 85.74  ? 287  ARG B NH1   1 
ATOM   5479  N  NH2   . ARG B  2  289 ? 50.409  67.094  50.165  1.00 86.79  ? 287  ARG B NH2   1 
ATOM   5480  N  N     . GLY B  2  290 ? 53.537  58.778  51.051  1.00 94.27  ? 288  GLY B N     1 
ATOM   5481  C  CA    . GLY B  2  290 ? 53.645  57.438  50.530  1.00 96.03  ? 288  GLY B CA    1 
ATOM   5482  C  C     . GLY B  2  290 ? 53.605  56.360  51.584  1.00 97.03  ? 288  GLY B C     1 
ATOM   5483  O  O     . GLY B  2  290 ? 53.715  56.628  52.785  1.00 97.11  ? 288  GLY B O     1 
ATOM   5484  N  N     . SER B  2  291 ? 53.421  55.132  51.104  1.00 98.17  ? 289  SER B N     1 
ATOM   5485  C  CA    . SER B  2  291 ? 53.396  53.929  51.929  1.00 99.09  ? 289  SER B CA    1 
ATOM   5486  C  C     . SER B  2  291 ? 54.837  53.450  51.998  1.00 99.98  ? 289  SER B C     1 
ATOM   5487  O  O     . SER B  2  291 ? 55.631  53.729  51.092  1.00 101.37 ? 289  SER B O     1 
ATOM   5488  C  CB    . SER B  2  291 ? 52.541  52.838  51.270  1.00 98.65  ? 289  SER B CB    1 
ATOM   5489  O  OG    . SER B  2  291 ? 52.723  51.588  51.917  1.00 97.70  ? 289  SER B OG    1 
ATOM   5490  N  N     . SER B  2  292 ? 55.192  52.739  53.059  1.00 100.02 ? 290  SER B N     1 
ATOM   5491  C  CA    . SER B  2  292 ? 56.555  52.245  53.160  1.00 100.44 ? 290  SER B CA    1 
ATOM   5492  C  C     . SER B  2  292 ? 56.538  50.728  53.066  1.00 100.46 ? 290  SER B C     1 
ATOM   5493  O  O     . SER B  2  292 ? 56.155  50.039  54.011  1.00 100.19 ? 290  SER B O     1 
ATOM   5494  C  CB    . SER B  2  292 ? 57.199  52.707  54.473  1.00 100.86 ? 290  SER B CB    1 
ATOM   5495  O  OG    . SER B  2  292 ? 57.322  54.122  54.506  1.00 101.25 ? 290  SER B OG    1 
ATOM   5496  N  N     . VAL B  2  293 ? 56.934  50.214  51.905  1.00 100.84 ? 291  VAL B N     1 
ATOM   5497  C  CA    . VAL B  2  293 ? 56.965  48.772  51.674  1.00 101.02 ? 291  VAL B CA    1 
ATOM   5498  C  C     . VAL B  2  293 ? 58.245  48.185  52.281  1.00 101.63 ? 291  VAL B C     1 
ATOM   5499  O  O     . VAL B  2  293 ? 58.238  47.088  52.853  1.00 99.89  ? 291  VAL B O     1 
ATOM   5500  C  CB    . VAL B  2  293 ? 56.930  48.455  50.165  1.00 100.45 ? 291  VAL B CB    1 
ATOM   5501  C  CG1   . VAL B  2  293 ? 56.454  47.023  49.956  1.00 99.52  ? 291  VAL B CG1   1 
ATOM   5502  C  CG2   . VAL B  2  293 ? 56.037  49.451  49.438  1.00 98.59  ? 291  VAL B CG2   1 
ATOM   5503  N  N     . THR B  2  294 ? 59.334  48.943  52.149  1.00 102.78 ? 292  THR B N     1 
ATOM   5504  C  CA    . THR B  2  294 ? 60.647  48.572  52.676  1.00 104.36 ? 292  THR B CA    1 
ATOM   5505  C  C     . THR B  2  294 ? 60.656  48.594  54.206  1.00 105.34 ? 292  THR B C     1 
ATOM   5506  O  O     . THR B  2  294 ? 61.690  48.346  54.837  1.00 105.65 ? 292  THR B O     1 
ATOM   5507  C  CB    . THR B  2  294 ? 61.722  49.542  52.165  1.00 104.74 ? 292  THR B CB    1 
ATOM   5508  O  OG1   . THR B  2  294 ? 61.738  49.496  50.733  1.00 105.46 ? 292  THR B OG1   1 
ATOM   5509  C  CG2   . THR B  2  294 ? 63.106  49.180  52.721  1.00 104.79 ? 292  THR B CG2   1 
ATOM   5510  N  N     . SER B  2  295 ? 59.501  48.910  54.791  1.00 106.06 ? 293  SER B N     1 
ATOM   5511  C  CA    . SER B  2  295 ? 59.334  48.949  56.243  1.00 104.99 ? 293  SER B CA    1 
ATOM   5512  C  C     . SER B  2  295 ? 58.425  47.783  56.634  1.00 104.54 ? 293  SER B C     1 
ATOM   5513  O  O     . SER B  2  295 ? 57.207  47.799  56.397  1.00 103.16 ? 293  SER B O     1 
ATOM   5514  C  CB    . SER B  2  295 ? 58.715  50.280  56.686  1.00 104.62 ? 293  SER B CB    1 
ATOM   5515  O  OG    . SER B  2  295 ? 58.618  50.356  58.099  1.00 103.60 ? 293  SER B OG    1 
ATOM   5516  N  N     . LYS B  2  296 ? 59.042  46.761  57.214  1.00 104.14 ? 294  LYS B N     1 
ATOM   5517  C  CA    . LYS B  2  296 ? 58.322  45.573  57.629  1.00 103.88 ? 294  LYS B CA    1 
ATOM   5518  C  C     . LYS B  2  296 ? 57.348  45.936  58.731  1.00 102.75 ? 294  LYS B C     1 
ATOM   5519  O  O     . LYS B  2  296 ? 56.176  45.563  58.695  1.00 102.15 ? 294  LYS B O     1 
ATOM   5520  C  CB    . LYS B  2  296 ? 59.306  44.516  58.136  1.00 104.80 ? 294  LYS B CB    1 
ATOM   5521  C  CG    . LYS B  2  296 ? 60.359  44.119  57.113  1.00 106.09 ? 294  LYS B CG    1 
ATOM   5522  C  CD    . LYS B  2  296 ? 60.700  42.641  57.227  1.00 107.00 ? 294  LYS B CD    1 
ATOM   5523  C  CE    . LYS B  2  296 ? 61.530  42.180  56.042  1.00 107.89 ? 294  LYS B CE    1 
ATOM   5524  N  NZ    . LYS B  2  296 ? 61.702  40.696  56.021  1.00 108.70 ? 294  LYS B NZ    1 
ATOM   5525  N  N     . LEU B  2  297 ? 57.852  46.679  59.707  1.00 101.67 ? 295  LEU B N     1 
ATOM   5526  C  CA    . LEU B  2  297 ? 57.053  47.099  60.844  1.00 100.36 ? 295  LEU B CA    1 
ATOM   5527  C  C     . LEU B  2  297 ? 55.810  47.829  60.375  1.00 99.63  ? 295  LEU B C     1 
ATOM   5528  O  O     . LEU B  2  297 ? 54.696  47.502  60.786  1.00 98.44  ? 295  LEU B O     1 
ATOM   5529  C  CB    . LEU B  2  297 ? 57.889  47.996  61.746  1.00 100.02 ? 295  LEU B CB    1 
ATOM   5530  C  CG    . LEU B  2  297 ? 57.271  48.394  63.081  1.00 100.34 ? 295  LEU B CG    1 
ATOM   5531  C  CD1   . LEU B  2  297 ? 56.671  47.180  63.797  1.00 99.23  ? 295  LEU B CD1   1 
ATOM   5532  C  CD2   . LEU B  2  297 ? 58.358  49.064  63.914  1.00 100.50 ? 295  LEU B CD2   1 
ATOM   5533  N  N     . TYR B  2  298 ? 56.012  48.814  59.504  1.00 99.91  ? 296  TYR B N     1 
ATOM   5534  C  CA    . TYR B  2  298 ? 54.909  49.603  58.951  1.00 99.70  ? 296  TYR B CA    1 
ATOM   5535  C  C     . TYR B  2  298 ? 53.943  48.651  58.254  1.00 98.56  ? 296  TYR B C     1 
ATOM   5536  O  O     . TYR B  2  298 ? 52.795  48.481  58.672  1.00 96.26  ? 296  TYR B O     1 
ATOM   5537  C  CB    . TYR B  2  298 ? 55.444  50.627  57.931  1.00 101.11 ? 296  TYR B CB    1 
ATOM   5538  C  CG    . TYR B  2  298 ? 54.483  51.760  57.607  1.00 102.43 ? 296  TYR B CG    1 
ATOM   5539  C  CD1   . TYR B  2  298 ? 53.167  51.502  57.221  1.00 103.11 ? 296  TYR B CD1   1 
ATOM   5540  C  CD2   . TYR B  2  298 ? 54.884  53.093  57.727  1.00 103.35 ? 296  TYR B CD2   1 
ATOM   5541  C  CE1   . TYR B  2  298 ? 52.270  52.543  56.969  1.00 104.89 ? 296  TYR B CE1   1 
ATOM   5542  C  CE2   . TYR B  2  298 ? 53.995  54.144  57.477  1.00 104.88 ? 296  TYR B CE2   1 
ATOM   5543  C  CZ    . TYR B  2  298 ? 52.688  53.864  57.102  1.00 105.31 ? 296  TYR B CZ    1 
ATOM   5544  O  OH    . TYR B  2  298 ? 51.794  54.900  56.888  1.00 105.84 ? 296  TYR B OH    1 
ATOM   5545  N  N     . GLN B  2  299 ? 54.444  48.037  57.186  1.00 98.39  ? 297  GLN B N     1 
ATOM   5546  C  CA    . GLN B  2  299 ? 53.684  47.095  56.382  1.00 98.46  ? 297  GLN B CA    1 
ATOM   5547  C  C     . GLN B  2  299 ? 52.940  46.070  57.223  1.00 99.14  ? 297  GLN B C     1 
ATOM   5548  O  O     . GLN B  2  299 ? 51.833  45.651  56.877  1.00 98.66  ? 297  GLN B O     1 
ATOM   5549  C  CB    . GLN B  2  299 ? 54.618  46.372  55.415  1.00 98.19  ? 297  GLN B CB    1 
ATOM   5550  C  CG    . GLN B  2  299 ? 55.015  47.179  54.195  1.00 97.08  ? 297  GLN B CG    1 
ATOM   5551  C  CD    . GLN B  2  299 ? 53.816  47.633  53.395  1.00 95.56  ? 297  GLN B CD    1 
ATOM   5552  O  OE1   . GLN B  2  299 ? 52.762  46.997  53.419  1.00 94.52  ? 297  GLN B OE1   1 
ATOM   5553  N  NE2   . GLN B  2  299 ? 53.973  48.733  52.670  1.00 95.11  ? 297  GLN B NE2   1 
ATOM   5554  N  N     . GLY B  2  300 ? 53.557  45.655  58.322  1.00 100.31 ? 298  GLY B N     1 
ATOM   5555  C  CA    . GLY B  2  300 ? 52.923  44.677  59.183  1.00 101.24 ? 298  GLY B CA    1 
ATOM   5556  C  C     . GLY B  2  300 ? 51.692  45.260  59.846  1.00 101.57 ? 298  GLY B C     1 
ATOM   5557  O  O     . GLY B  2  300 ? 50.599  44.686  59.787  1.00 101.17 ? 298  GLY B O     1 
ATOM   5558  N  N     . VAL B  2  301 ? 51.876  46.416  60.475  1.00 101.81 ? 299  VAL B N     1 
ATOM   5559  C  CA    . VAL B  2  301 ? 50.790  47.089  61.167  1.00 102.22 ? 299  VAL B CA    1 
ATOM   5560  C  C     . VAL B  2  301 ? 49.703  47.500  60.178  1.00 103.16 ? 299  VAL B C     1 
ATOM   5561  O  O     . VAL B  2  301 ? 48.513  47.503  60.505  1.00 102.63 ? 299  VAL B O     1 
ATOM   5562  C  CB    . VAL B  2  301 ? 51.310  48.333  61.903  1.00 101.63 ? 299  VAL B CB    1 
ATOM   5563  C  CG1   . VAL B  2  301 ? 50.195  48.963  62.719  1.00 101.70 ? 299  VAL B CG1   1 
ATOM   5564  C  CG2   . VAL B  2  301 ? 52.472  47.949  62.796  1.00 101.50 ? 299  VAL B CG2   1 
ATOM   5565  N  N     . ALA B  2  302 ? 50.119  47.844  58.964  1.00 104.12 ? 300  ALA B N     1 
ATOM   5566  C  CA    . ALA B  2  302 ? 49.176  48.249  57.933  1.00 104.83 ? 300  ALA B CA    1 
ATOM   5567  C  C     . ALA B  2  302 ? 48.154  47.142  57.728  1.00 105.48 ? 300  ALA B C     1 
ATOM   5568  O  O     . ALA B  2  302 ? 46.949  47.387  57.726  1.00 104.76 ? 300  ALA B O     1 
ATOM   5569  C  CB    . ALA B  2  302 ? 49.918  48.539  56.627  1.00 105.00 ? 300  ALA B CB    1 
ATOM   5570  N  N     . LYS B  2  303 ? 48.646  45.918  57.566  1.00 107.31 ? 301  LYS B N     1 
ATOM   5571  C  CA    . LYS B  2  303 ? 47.775  44.770  57.358  1.00 110.10 ? 301  LYS B CA    1 
ATOM   5572  C  C     . LYS B  2  303 ? 46.861  44.560  58.568  1.00 111.44 ? 301  LYS B C     1 
ATOM   5573  O  O     . LYS B  2  303 ? 45.723  44.095  58.434  1.00 111.27 ? 301  LYS B O     1 
ATOM   5574  C  CB    . LYS B  2  303 ? 48.615  43.512  57.119  1.00 110.62 ? 301  LYS B CB    1 
ATOM   5575  C  CG    . LYS B  2  303 ? 49.671  43.656  56.025  1.00 112.69 ? 301  LYS B CG    1 
ATOM   5576  C  CD    . LYS B  2  303 ? 50.374  42.326  55.753  1.00 114.55 ? 301  LYS B CD    1 
ATOM   5577  C  CE    . LYS B  2  303 ? 51.571  42.484  54.810  1.00 115.65 ? 301  LYS B CE    1 
ATOM   5578  N  NZ    . LYS B  2  303 ? 51.211  42.945  53.432  1.00 115.96 ? 301  LYS B NZ    1 
ATOM   5579  N  N     . ALA B  2  304 ? 47.364  44.927  59.744  1.00 112.70 ? 302  ALA B N     1 
ATOM   5580  C  CA    . ALA B  2  304 ? 46.630  44.770  60.999  1.00 113.45 ? 302  ALA B CA    1 
ATOM   5581  C  C     . ALA B  2  304 ? 45.405  45.671  61.154  1.00 114.15 ? 302  ALA B C     1 
ATOM   5582  O  O     . ALA B  2  304 ? 44.293  45.178  61.343  1.00 114.08 ? 302  ALA B O     1 
ATOM   5583  C  CB    . ALA B  2  304 ? 47.577  44.977  62.171  1.00 113.82 ? 302  ALA B CB    1 
ATOM   5584  N  N     . THR B  2  305 ? 45.611  46.985  61.090  1.00 115.23 ? 303  THR B N     1 
ATOM   5585  C  CA    . THR B  2  305 ? 44.512  47.944  61.230  1.00 116.01 ? 303  THR B CA    1 
ATOM   5586  C  C     . THR B  2  305 ? 44.019  48.474  59.882  1.00 116.61 ? 303  THR B C     1 
ATOM   5587  O  O     . THR B  2  305 ? 44.588  48.166  58.829  1.00 116.89 ? 303  THR B O     1 
ATOM   5588  C  CB    . THR B  2  305 ? 44.926  49.157  62.102  1.00 116.48 ? 303  THR B CB    1 
ATOM   5589  O  OG1   . THR B  2  305 ? 43.796  50.023  62.294  1.00 116.18 ? 303  THR B OG1   1 
ATOM   5590  C  CG2   . THR B  2  305 ? 46.066  49.940  61.433  1.00 116.50 ? 303  THR B CG2   1 
ATOM   5591  N  N     . THR B  2  306 ? 42.963  49.283  59.927  1.00 117.14 ? 304  THR B N     1 
ATOM   5592  C  CA    . THR B  2  306 ? 42.375  49.862  58.718  1.00 117.07 ? 304  THR B CA    1 
ATOM   5593  C  C     . THR B  2  306 ? 42.457  51.386  58.727  1.00 116.37 ? 304  THR B C     1 
ATOM   5594  O  O     . THR B  2  306 ? 42.567  52.028  57.678  1.00 115.87 ? 304  THR B O     1 
ATOM   5595  C  CB    . THR B  2  306 ? 40.898  49.485  58.599  1.00 117.26 ? 304  THR B CB    1 
ATOM   5596  O  OG1   . THR B  2  306 ? 40.729  48.114  58.980  1.00 117.68 ? 304  THR B OG1   1 
ATOM   5597  C  CG2   . THR B  2  306 ? 40.418  49.683  57.161  1.00 117.06 ? 304  THR B CG2   1 
ATOM   5598  N  N     . GLN B  2  307 ? 42.399  51.953  59.926  1.00 115.48 ? 305  GLN B N     1 
ATOM   5599  C  CA    . GLN B  2  307 ? 42.445  53.394  60.103  1.00 114.33 ? 305  GLN B CA    1 
ATOM   5600  C  C     . GLN B  2  307 ? 43.873  53.907  60.163  1.00 112.59 ? 305  GLN B C     1 
ATOM   5601  O  O     . GLN B  2  307 ? 44.812  53.136  60.344  1.00 111.54 ? 305  GLN B O     1 
ATOM   5602  C  CB    . GLN B  2  307 ? 41.722  53.781  61.394  1.00 116.09 ? 305  GLN B CB    1 
ATOM   5603  C  CG    . GLN B  2  307 ? 40.318  53.198  61.538  1.00 116.71 ? 305  GLN B CG    1 
ATOM   5604  C  CD    . GLN B  2  307 ? 39.403  53.580  60.395  1.00 116.79 ? 305  GLN B CD    1 
ATOM   5605  O  OE1   . GLN B  2  307 ? 39.149  54.765  60.148  1.00 115.84 ? 305  GLN B OE1   1 
ATOM   5606  N  NE2   . GLN B  2  307 ? 38.901  52.574  59.685  1.00 116.99 ? 305  GLN B NE2   1 
ATOM   5607  N  N     . PRO B  2  308 ? 44.048  55.230  60.009  1.00 111.47 ? 306  PRO B N     1 
ATOM   5608  C  CA    . PRO B  2  308 ? 45.351  55.897  60.044  1.00 109.87 ? 306  PRO B CA    1 
ATOM   5609  C  C     . PRO B  2  308 ? 46.156  55.596  61.297  1.00 107.53 ? 306  PRO B C     1 
ATOM   5610  O  O     . PRO B  2  308 ? 45.601  55.371  62.378  1.00 106.75 ? 306  PRO B O     1 
ATOM   5611  C  CB    . PRO B  2  308 ? 44.981  57.370  59.922  1.00 110.70 ? 306  PRO B CB    1 
ATOM   5612  C  CG    . PRO B  2  308 ? 43.841  57.313  58.969  1.00 111.96 ? 306  PRO B CG    1 
ATOM   5613  C  CD    . PRO B  2  308 ? 43.012  56.170  59.547  1.00 112.02 ? 306  PRO B CD    1 
ATOM   5614  N  N     . PHE B  2  309 ? 47.475  55.611  61.127  1.00 104.98 ? 307  PHE B N     1 
ATOM   5615  C  CA    . PHE B  2  309 ? 48.408  55.317  62.202  1.00 102.56 ? 307  PHE B CA    1 
ATOM   5616  C  C     . PHE B  2  309 ? 49.824  55.567  61.706  1.00 99.96  ? 307  PHE B C     1 
ATOM   5617  O  O     . PHE B  2  309 ? 50.044  56.024  60.586  1.00 99.48  ? 307  PHE B O     1 
ATOM   5618  C  CB    . PHE B  2  309 ? 48.302  53.841  62.568  1.00 104.59 ? 307  PHE B CB    1 
ATOM   5619  C  CG    . PHE B  2  309 ? 48.929  52.930  61.545  1.00 107.23 ? 307  PHE B CG    1 
ATOM   5620  C  CD1   . PHE B  2  309 ? 50.256  52.518  61.675  1.00 108.18 ? 307  PHE B CD1   1 
ATOM   5621  C  CD2   . PHE B  2  309 ? 48.228  52.559  60.401  1.00 108.69 ? 307  PHE B CD2   1 
ATOM   5622  C  CE1   . PHE B  2  309 ? 50.876  51.755  60.680  1.00 108.19 ? 307  PHE B CE1   1 
ATOM   5623  C  CE2   . PHE B  2  309 ? 48.841  51.796  59.398  1.00 108.87 ? 307  PHE B CE2   1 
ATOM   5624  C  CZ    . PHE B  2  309 ? 50.168  51.396  59.541  1.00 108.44 ? 307  PHE B CZ    1 
ATOM   5625  N  N     . ASP B  2  310 ? 50.784  55.251  62.558  1.00 97.33  ? 308  ASP B N     1 
ATOM   5626  C  CA    . ASP B  2  310 ? 52.180  55.356  62.196  1.00 96.44  ? 308  ASP B CA    1 
ATOM   5627  C  C     . ASP B  2  310 ? 52.957  54.498  63.171  1.00 95.88  ? 308  ASP B C     1 
ATOM   5628  O  O     . ASP B  2  310 ? 52.621  54.439  64.353  1.00 96.37  ? 308  ASP B O     1 
ATOM   5629  C  CB    . ASP B  2  310 ? 52.682  56.799  62.244  1.00 96.47  ? 308  ASP B CB    1 
ATOM   5630  C  CG    . ASP B  2  310 ? 54.129  56.928  61.747  1.00 97.06  ? 308  ASP B CG    1 
ATOM   5631  O  OD1   . ASP B  2  310 ? 54.463  56.317  60.709  1.00 97.84  ? 308  ASP B OD1   1 
ATOM   5632  O  OD2   . ASP B  2  310 ? 54.938  57.640  62.381  1.00 97.43  ? 308  ASP B OD2   1 
ATOM   5633  N  N     . ALA B  2  311 ? 53.980  53.815  62.668  1.00 94.69  ? 309  ALA B N     1 
ATOM   5634  C  CA    . ALA B  2  311 ? 54.818  52.956  63.494  1.00 93.01  ? 309  ALA B CA    1 
ATOM   5635  C  C     . ALA B  2  311 ? 56.252  53.027  62.989  1.00 91.68  ? 309  ALA B C     1 
ATOM   5636  O  O     . ALA B  2  311 ? 56.487  53.089  61.789  1.00 91.84  ? 309  ALA B O     1 
ATOM   5637  C  CB    . ALA B  2  311 ? 54.310  51.528  63.439  1.00 91.84  ? 309  ALA B CB    1 
ATOM   5638  N  N     . SER B  2  312 ? 57.212  53.026  63.900  1.00 91.07  ? 310  SER B N     1 
ATOM   5639  C  CA    . SER B  2  312 ? 58.602  53.098  63.489  1.00 90.65  ? 310  SER B CA    1 
ATOM   5640  C  C     . SER B  2  312 ? 59.539  52.360  64.418  1.00 90.36  ? 310  SER B C     1 
ATOM   5641  O  O     . SER B  2  312 ? 59.169  51.933  65.511  1.00 90.18  ? 310  SER B O     1 
ATOM   5642  C  CB    . SER B  2  312 ? 59.050  54.554  63.396  1.00 90.78  ? 310  SER B CB    1 
ATOM   5643  O  OG    . SER B  2  312 ? 58.234  55.280  62.494  1.00 92.51  ? 310  SER B OG    1 
ATOM   5644  N  N     . ALA B  2  313 ? 60.772  52.216  63.960  1.00 90.23  ? 311  ALA B N     1 
ATOM   5645  C  CA    . ALA B  2  313 ? 61.788  51.555  64.741  1.00 89.45  ? 311  ALA B CA    1 
ATOM   5646  C  C     . ALA B  2  313 ? 62.426  52.648  65.565  1.00 89.30  ? 311  ALA B C     1 
ATOM   5647  O  O     . ALA B  2  313 ? 62.896  53.650  65.021  1.00 89.38  ? 311  ALA B O     1 
ATOM   5648  C  CB    . ALA B  2  313 ? 62.812  50.923  63.829  1.00 89.49  ? 311  ALA B CB    1 
ATOM   5649  N  N     . PHE B  2  314 ? 62.421  52.462  66.877  1.00 88.78  ? 312  PHE B N     1 
ATOM   5650  C  CA    . PHE B  2  314 ? 63.009  53.428  67.782  1.00 88.61  ? 312  PHE B CA    1 
ATOM   5651  C  C     . PHE B  2  314 ? 64.414  52.953  68.202  1.00 88.95  ? 312  PHE B C     1 
ATOM   5652  O  O     . PHE B  2  314 ? 64.608  51.779  68.537  1.00 87.57  ? 312  PHE B O     1 
ATOM   5653  C  CB    . PHE B  2  314 ? 62.089  53.587  68.993  1.00 88.57  ? 312  PHE B CB    1 
ATOM   5654  C  CG    . PHE B  2  314 ? 62.600  54.547  70.016  1.00 89.19  ? 312  PHE B CG    1 
ATOM   5655  C  CD1   . PHE B  2  314 ? 62.827  55.870  69.688  1.00 88.75  ? 312  PHE B CD1   1 
ATOM   5656  C  CD2   . PHE B  2  314 ? 62.874  54.121  71.313  1.00 90.81  ? 312  PHE B CD2   1 
ATOM   5657  C  CE1   . PHE B  2  314 ? 63.318  56.759  70.629  1.00 89.96  ? 312  PHE B CE1   1 
ATOM   5658  C  CE2   . PHE B  2  314 ? 63.367  55.006  72.265  1.00 91.79  ? 312  PHE B CE2   1 
ATOM   5659  C  CZ    . PHE B  2  314 ? 63.589  56.330  71.918  1.00 91.29  ? 312  PHE B CZ    1 
ATOM   5660  N  N     . ASN B  2  315 ? 65.395  53.852  68.170  1.00 89.10  ? 313  ASN B N     1 
ATOM   5661  C  CA    . ASN B  2  315 ? 66.750  53.475  68.552  1.00 90.22  ? 313  ASN B CA    1 
ATOM   5662  C  C     . ASN B  2  315 ? 67.609  54.625  69.052  1.00 90.71  ? 313  ASN B C     1 
ATOM   5663  O  O     . ASN B  2  315 ? 67.933  55.545  68.303  1.00 89.72  ? 313  ASN B O     1 
ATOM   5664  C  CB    . ASN B  2  315 ? 67.463  52.793  67.377  1.00 92.08  ? 313  ASN B CB    1 
ATOM   5665  C  CG    . ASN B  2  315 ? 68.921  52.423  67.694  1.00 93.34  ? 313  ASN B CG    1 
ATOM   5666  O  OD1   . ASN B  2  315 ? 69.199  51.587  68.565  1.00 93.40  ? 313  ASN B OD1   1 
ATOM   5667  N  ND2   . ASN B  2  315 ? 69.854  53.049  66.981  1.00 94.08  ? 313  ASN B ND2   1 
ATOM   5668  N  N     . VAL B  2  316 ? 67.998  54.533  70.323  1.00 92.91  ? 314  VAL B N     1 
ATOM   5669  C  CA    . VAL B  2  316 ? 68.836  55.537  70.985  1.00 94.46  ? 314  VAL B CA    1 
ATOM   5670  C  C     . VAL B  2  316 ? 70.133  54.909  71.486  1.00 95.87  ? 314  VAL B C     1 
ATOM   5671  O  O     . VAL B  2  316 ? 70.111  53.820  72.079  1.00 95.90  ? 314  VAL B O     1 
ATOM   5672  C  CB    . VAL B  2  316 ? 68.150  56.119  72.226  1.00 94.28  ? 314  VAL B CB    1 
ATOM   5673  C  CG1   . VAL B  2  316 ? 68.779  57.451  72.583  1.00 93.48  ? 314  VAL B CG1   1 
ATOM   5674  C  CG2   . VAL B  2  316 ? 66.667  56.236  71.997  1.00 94.56  ? 314  VAL B CG2   1 
ATOM   5675  N  N     . ASN B  2  317 ? 71.250  55.601  71.271  1.00 96.90  ? 315  ASN B N     1 
ATOM   5676  C  CA    . ASN B  2  317 ? 72.546  55.103  71.727  1.00 98.60  ? 315  ASN B CA    1 
ATOM   5677  C  C     . ASN B  2  317 ? 73.213  56.088  72.693  1.00 99.71  ? 315  ASN B C     1 
ATOM   5678  O  O     . ASN B  2  317 ? 73.628  57.175  72.292  1.00 99.77  ? 315  ASN B O     1 
ATOM   5679  C  CB    . ASN B  2  317 ? 73.465  54.826  70.527  1.00 98.43  ? 315  ASN B CB    1 
ATOM   5680  C  CG    . ASN B  2  317 ? 72.897  53.764  69.582  1.00 98.64  ? 315  ASN B CG    1 
ATOM   5681  O  OD1   . ASN B  2  317 ? 72.431  52.708  70.018  1.00 97.65  ? 315  ASN B OD1   1 
ATOM   5682  N  ND2   . ASN B  2  317 ? 72.943  54.041  68.281  1.00 97.98  ? 315  ASN B ND2   1 
ATOM   5683  N  N     . TYR B  2  318 ? 73.300  55.696  73.968  1.00 101.39 ? 316  TYR B N     1 
ATOM   5684  C  CA    . TYR B  2  318 ? 73.905  56.523  75.025  1.00 102.39 ? 316  TYR B CA    1 
ATOM   5685  C  C     . TYR B  2  318 ? 75.235  55.950  75.528  1.00 101.73 ? 316  TYR B C     1 
ATOM   5686  O  O     . TYR B  2  318 ? 75.436  54.734  75.541  1.00 102.14 ? 316  TYR B O     1 
ATOM   5687  C  CB    . TYR B  2  318 ? 72.958  56.655  76.234  1.00 104.29 ? 316  TYR B CB    1 
ATOM   5688  C  CG    . TYR B  2  318 ? 71.690  57.457  76.008  1.00 105.50 ? 316  TYR B CG    1 
ATOM   5689  C  CD1   . TYR B  2  318 ? 70.437  56.917  76.321  1.00 106.15 ? 316  TYR B CD1   1 
ATOM   5690  C  CD2   . TYR B  2  318 ? 71.742  58.753  75.502  1.00 105.77 ? 316  TYR B CD2   1 
ATOM   5691  C  CE1   . TYR B  2  318 ? 69.264  57.650  76.132  1.00 107.63 ? 316  TYR B CE1   1 
ATOM   5692  C  CE2   . TYR B  2  318 ? 70.581  59.497  75.311  1.00 107.71 ? 316  TYR B CE2   1 
ATOM   5693  C  CZ    . TYR B  2  318 ? 69.342  58.944  75.626  1.00 108.79 ? 316  TYR B CZ    1 
ATOM   5694  O  OH    . TYR B  2  318 ? 68.191  59.692  75.428  1.00 110.24 ? 316  TYR B OH    1 
ATOM   5695  N  N     . SER B  2  319 ? 76.120  56.846  75.960  1.00 100.63 ? 317  SER B N     1 
ATOM   5696  C  CA    . SER B  2  319 ? 77.442  56.507  76.488  1.00 99.12  ? 317  SER B CA    1 
ATOM   5697  C  C     . SER B  2  319 ? 77.537  55.134  77.157  1.00 97.72  ? 317  SER B C     1 
ATOM   5698  O  O     . SER B  2  319 ? 78.313  54.291  76.729  1.00 97.87  ? 317  SER B O     1 
ATOM   5699  C  CB    . SER B  2  319 ? 77.882  57.567  77.498  1.00 99.54  ? 317  SER B CB    1 
ATOM   5700  O  OG    . SER B  2  319 ? 77.100  57.488  78.683  1.00 100.78 ? 317  SER B OG    1 
ATOM   5701  N  N     . ASP B  2  320 ? 76.756  54.915  78.208  1.00 95.91  ? 318  ASP B N     1 
ATOM   5702  C  CA    . ASP B  2  320 ? 76.799  53.643  78.912  1.00 95.17  ? 318  ASP B CA    1 
ATOM   5703  C  C     . ASP B  2  320 ? 75.498  52.849  78.827  1.00 93.18  ? 318  ASP B C     1 
ATOM   5704  O  O     . ASP B  2  320 ? 75.129  52.131  79.762  1.00 92.69  ? 318  ASP B O     1 
ATOM   5705  C  CB    . ASP B  2  320 ? 77.163  53.865  80.389  1.00 98.68  ? 318  ASP B CB    1 
ATOM   5706  C  CG    . ASP B  2  320 ? 75.992  54.400  81.220  1.00 100.75 ? 318  ASP B CG    1 
ATOM   5707  O  OD1   . ASP B  2  320 ? 76.044  54.303  82.472  1.00 101.19 ? 318  ASP B OD1   1 
ATOM   5708  O  OD2   . ASP B  2  320 ? 75.023  54.919  80.623  1.00 102.78 ? 318  ASP B OD2   1 
ATOM   5709  N  N     . SER B  2  321 ? 74.796  52.979  77.713  1.00 90.69  ? 319  SER B N     1 
ATOM   5710  C  CA    . SER B  2  321 ? 73.555  52.246  77.543  1.00 89.02  ? 319  SER B CA    1 
ATOM   5711  C  C     . SER B  2  321 ? 72.791  52.717  76.320  1.00 87.27  ? 319  SER B C     1 
ATOM   5712  O  O     . SER B  2  321 ? 73.215  53.631  75.623  1.00 86.30  ? 319  SER B O     1 
ATOM   5713  C  CB    . SER B  2  321 ? 72.675  52.388  78.784  1.00 89.20  ? 319  SER B CB    1 
ATOM   5714  O  OG    . SER B  2  321 ? 71.524  51.575  78.667  1.00 90.50  ? 319  SER B OG    1 
ATOM   5715  N  N     . GLY B  2  322 ? 71.662  52.077  76.061  1.00 85.52  ? 320  GLY B N     1 
ATOM   5716  C  CA    . GLY B  2  322 ? 70.872  52.453  74.914  1.00 84.76  ? 320  GLY B CA    1 
ATOM   5717  C  C     . GLY B  2  322 ? 69.461  51.929  75.043  1.00 84.83  ? 320  GLY B C     1 
ATOM   5718  O  O     . GLY B  2  322 ? 69.142  51.201  75.999  1.00 83.84  ? 320  GLY B O     1 
ATOM   5719  N  N     . LEU B  2  323 ? 68.620  52.311  74.081  1.00 83.90  ? 321  LEU B N     1 
ATOM   5720  C  CA    . LEU B  2  323 ? 67.230  51.892  74.058  1.00 83.23  ? 321  LEU B CA    1 
ATOM   5721  C  C     . LEU B  2  323 ? 66.859  51.519  72.646  1.00 82.75  ? 321  LEU B C     1 
ATOM   5722  O  O     . LEU B  2  323 ? 67.296  52.175  71.700  1.00 82.40  ? 321  LEU B O     1 
ATOM   5723  C  CB    . LEU B  2  323 ? 66.318  53.018  74.543  1.00 83.80  ? 321  LEU B CB    1 
ATOM   5724  C  CG    . LEU B  2  323 ? 66.266  53.268  76.047  1.00 83.51  ? 321  LEU B CG    1 
ATOM   5725  C  CD1   . LEU B  2  323 ? 65.287  54.383  76.332  1.00 84.03  ? 321  LEU B CD1   1 
ATOM   5726  C  CD2   . LEU B  2  323 ? 65.839  51.996  76.759  1.00 83.57  ? 321  LEU B CD2   1 
ATOM   5727  N  N     . PHE B  2  324 ? 66.060  50.462  72.514  1.00 81.91  ? 322  PHE B N     1 
ATOM   5728  C  CA    . PHE B  2  324 ? 65.615  49.988  71.208  1.00 81.01  ? 322  PHE B CA    1 
ATOM   5729  C  C     . PHE B  2  324 ? 64.237  49.351  71.266  1.00 81.30  ? 322  PHE B C     1 
ATOM   5730  O  O     . PHE B  2  324 ? 63.893  48.642  72.215  1.00 80.91  ? 322  PHE B O     1 
ATOM   5731  C  CB    . PHE B  2  324 ? 66.593  48.968  70.635  1.00 79.57  ? 322  PHE B CB    1 
ATOM   5732  C  CG    . PHE B  2  324 ? 66.244  48.516  69.244  1.00 77.85  ? 322  PHE B CG    1 
ATOM   5733  C  CD1   . PHE B  2  324 ? 66.838  49.117  68.142  1.00 77.52  ? 322  PHE B CD1   1 
ATOM   5734  C  CD2   . PHE B  2  324 ? 65.303  47.505  69.037  1.00 77.09  ? 322  PHE B CD2   1 
ATOM   5735  C  CE1   . PHE B  2  324 ? 66.504  48.721  66.851  1.00 78.23  ? 322  PHE B CE1   1 
ATOM   5736  C  CE2   . PHE B  2  324 ? 64.959  47.100  67.750  1.00 76.50  ? 322  PHE B CE2   1 
ATOM   5737  C  CZ    . PHE B  2  324 ? 65.562  47.709  66.654  1.00 77.54  ? 322  PHE B CZ    1 
ATOM   5738  N  N     . GLY B  2  325 ? 63.468  49.595  70.213  1.00 81.66  ? 323  GLY B N     1 
ATOM   5739  C  CA    . GLY B  2  325 ? 62.125  49.064  70.117  1.00 81.45  ? 323  GLY B CA    1 
ATOM   5740  C  C     . GLY B  2  325 ? 61.352  49.818  69.055  1.00 81.40  ? 323  GLY B C     1 
ATOM   5741  O  O     . GLY B  2  325 ? 61.914  50.340  68.096  1.00 80.60  ? 323  GLY B O     1 
ATOM   5742  N  N     . PHE B  2  326 ? 60.049  49.899  69.234  1.00 82.23  ? 324  PHE B N     1 
ATOM   5743  C  CA    . PHE B  2  326 ? 59.231  50.581  68.261  1.00 83.88  ? 324  PHE B CA    1 
ATOM   5744  C  C     . PHE B  2  326 ? 58.351  51.631  68.927  1.00 84.69  ? 324  PHE B C     1 
ATOM   5745  O  O     . PHE B  2  326 ? 58.118  51.573  70.136  1.00 84.85  ? 324  PHE B O     1 
ATOM   5746  C  CB    . PHE B  2  326 ? 58.374  49.546  67.546  1.00 84.78  ? 324  PHE B CB    1 
ATOM   5747  C  CG    . PHE B  2  326 ? 57.471  48.760  68.469  1.00 85.66  ? 324  PHE B CG    1 
ATOM   5748  C  CD1   . PHE B  2  326 ? 56.193  49.222  68.784  1.00 86.11  ? 324  PHE B CD1   1 
ATOM   5749  C  CD2   . PHE B  2  326 ? 57.882  47.547  68.997  1.00 85.17  ? 324  PHE B CD2   1 
ATOM   5750  C  CE1   . PHE B  2  326 ? 55.336  48.479  69.601  1.00 85.82  ? 324  PHE B CE1   1 
ATOM   5751  C  CE2   . PHE B  2  326 ? 57.034  46.803  69.814  1.00 85.56  ? 324  PHE B CE2   1 
ATOM   5752  C  CZ    . PHE B  2  326 ? 55.757  47.273  70.113  1.00 85.62  ? 324  PHE B CZ    1 
ATOM   5753  N  N     . TYR B  2  327 ? 57.866  52.581  68.128  1.00 84.75  ? 325  TYR B N     1 
ATOM   5754  C  CA    . TYR B  2  327 ? 56.990  53.650  68.603  1.00 84.11  ? 325  TYR B CA    1 
ATOM   5755  C  C     . TYR B  2  327 ? 55.753  53.693  67.698  1.00 83.14  ? 325  TYR B C     1 
ATOM   5756  O  O     . TYR B  2  327 ? 55.876  53.725  66.474  1.00 82.59  ? 325  TYR B O     1 
ATOM   5757  C  CB    . TYR B  2  327 ? 57.743  54.974  68.548  1.00 85.59  ? 325  TYR B CB    1 
ATOM   5758  C  CG    . TYR B  2  327 ? 57.020  56.143  69.164  1.00 88.28  ? 325  TYR B CG    1 
ATOM   5759  C  CD1   . TYR B  2  327 ? 57.701  57.038  69.976  1.00 88.66  ? 325  TYR B CD1   1 
ATOM   5760  C  CD2   . TYR B  2  327 ? 55.668  56.388  68.896  1.00 90.45  ? 325  TYR B CD2   1 
ATOM   5761  C  CE1   . TYR B  2  327 ? 57.070  58.155  70.506  1.00 90.26  ? 325  TYR B CE1   1 
ATOM   5762  C  CE2   . TYR B  2  327 ? 55.017  57.502  69.422  1.00 91.15  ? 325  TYR B CE2   1 
ATOM   5763  C  CZ    . TYR B  2  327 ? 55.729  58.387  70.228  1.00 91.51  ? 325  TYR B CZ    1 
ATOM   5764  O  OH    . TYR B  2  327 ? 55.114  59.507  70.745  1.00 92.15  ? 325  TYR B OH    1 
ATOM   5765  N  N     . THR B  2  328 ? 54.564  53.714  68.291  1.00 81.76  ? 326  THR B N     1 
ATOM   5766  C  CA    . THR B  2  328 ? 53.354  53.715  67.483  1.00 80.83  ? 326  THR B CA    1 
ATOM   5767  C  C     . THR B  2  328 ? 52.263  54.727  67.839  1.00 80.43  ? 326  THR B C     1 
ATOM   5768  O  O     . THR B  2  328 ? 51.876  54.856  68.994  1.00 80.25  ? 326  THR B O     1 
ATOM   5769  C  CB    . THR B  2  328 ? 52.711  52.343  67.523  1.00 80.72  ? 326  THR B CB    1 
ATOM   5770  O  OG1   . THR B  2  328 ? 52.057  52.167  68.785  1.00 81.02  ? 326  THR B OG1   1 
ATOM   5771  C  CG2   . THR B  2  328 ? 53.761  51.278  67.374  1.00 80.87  ? 326  THR B CG2   1 
ATOM   5772  N  N     . ILE B  2  329 ? 51.752  55.414  66.822  1.00 79.57  ? 327  ILE B N     1 
ATOM   5773  C  CA    . ILE B  2  329 ? 50.676  56.386  66.984  1.00 77.67  ? 327  ILE B CA    1 
ATOM   5774  C  C     . ILE B  2  329 ? 49.441  55.780  66.347  1.00 78.24  ? 327  ILE B C     1 
ATOM   5775  O  O     . ILE B  2  329 ? 49.527  55.273  65.233  1.00 78.50  ? 327  ILE B O     1 
ATOM   5776  C  CB    . ILE B  2  329 ? 50.979  57.663  66.234  1.00 75.67  ? 327  ILE B CB    1 
ATOM   5777  C  CG1   . ILE B  2  329 ? 52.384  58.140  66.575  1.00 74.43  ? 327  ILE B CG1   1 
ATOM   5778  C  CG2   . ILE B  2  329 ? 49.954  58.705  66.590  1.00 75.02  ? 327  ILE B CG2   1 
ATOM   5779  C  CD1   . ILE B  2  329 ? 52.792  59.361  65.822  1.00 72.56  ? 327  ILE B CD1   1 
ATOM   5780  N  N     . SER B  2  330 ? 48.297  55.839  67.022  1.00 79.15  ? 328  SER B N     1 
ATOM   5781  C  CA    . SER B  2  330 ? 47.075  55.254  66.458  1.00 81.08  ? 328  SER B CA    1 
ATOM   5782  C  C     . SER B  2  330 ? 45.775  55.650  67.153  1.00 82.67  ? 328  SER B C     1 
ATOM   5783  O  O     . SER B  2  330 ? 45.771  56.096  68.298  1.00 83.72  ? 328  SER B O     1 
ATOM   5784  C  CB    . SER B  2  330 ? 47.171  53.732  66.484  1.00 80.04  ? 328  SER B CB    1 
ATOM   5785  O  OG    . SER B  2  330 ? 47.103  53.264  67.816  1.00 79.21  ? 328  SER B OG    1 
ATOM   5786  N  N     . GLN B  2  331 ? 44.659  55.472  66.461  1.00 84.50  ? 329  GLN B N     1 
ATOM   5787  C  CA    . GLN B  2  331 ? 43.379  55.796  67.058  1.00 86.43  ? 329  GLN B CA    1 
ATOM   5788  C  C     . GLN B  2  331 ? 43.242  54.932  68.296  1.00 87.30  ? 329  GLN B C     1 
ATOM   5789  O  O     . GLN B  2  331 ? 43.582  53.754  68.276  1.00 86.74  ? 329  GLN B O     1 
ATOM   5790  C  CB    . GLN B  2  331 ? 42.245  55.512  66.077  1.00 87.99  ? 329  GLN B CB    1 
ATOM   5791  C  CG    . GLN B  2  331 ? 42.381  56.295  64.773  1.00 90.86  ? 329  GLN B CG    1 
ATOM   5792  C  CD    . GLN B  2  331 ? 41.132  56.247  63.904  1.00 92.14  ? 329  GLN B CD    1 
ATOM   5793  O  OE1   . GLN B  2  331 ? 41.088  56.853  62.826  1.00 91.75  ? 329  GLN B OE1   1 
ATOM   5794  N  NE2   . GLN B  2  331 ? 40.108  55.527  64.370  1.00 93.06  ? 329  GLN B NE2   1 
ATOM   5795  N  N     . ALA B  2  332 ? 42.754  55.533  69.374  1.00 89.72  ? 330  ALA B N     1 
ATOM   5796  C  CA    . ALA B  2  332 ? 42.587  54.844  70.648  1.00 91.88  ? 330  ALA B CA    1 
ATOM   5797  C  C     . ALA B  2  332 ? 42.026  53.433  70.531  1.00 93.58  ? 330  ALA B C     1 
ATOM   5798  O  O     . ALA B  2  332 ? 42.656  52.479  70.989  1.00 95.14  ? 330  ALA B O     1 
ATOM   5799  C  CB    . ALA B  2  332 ? 41.706  55.672  71.578  1.00 90.69  ? 330  ALA B CB    1 
ATOM   5800  N  N     . ALA B  2  333 ? 40.852  53.296  69.920  1.00 94.31  ? 331  ALA B N     1 
ATOM   5801  C  CA    . ALA B  2  333 ? 40.223  51.988  69.786  1.00 95.47  ? 331  ALA B CA    1 
ATOM   5802  C  C     . ALA B  2  333 ? 41.036  50.938  69.010  1.00 96.88  ? 331  ALA B C     1 
ATOM   5803  O  O     . ALA B  2  333 ? 40.706  49.749  69.048  1.00 97.06  ? 331  ALA B O     1 
ATOM   5804  C  CB    . ALA B  2  333 ? 38.857  52.150  69.167  1.00 93.91  ? 331  ALA B CB    1 
ATOM   5805  N  N     . HIS B  2  334 ? 42.101  51.361  68.327  1.00 97.97  ? 332  HIS B N     1 
ATOM   5806  C  CA    . HIS B  2  334 ? 42.917  50.427  67.549  1.00 98.65  ? 332  HIS B CA    1 
ATOM   5807  C  C     . HIS B  2  334 ? 44.360  50.283  67.996  1.00 99.17  ? 332  HIS B C     1 
ATOM   5808  O  O     . HIS B  2  334 ? 45.154  49.643  67.312  1.00 99.57  ? 332  HIS B O     1 
ATOM   5809  C  CB    . HIS B  2  334 ? 42.914  50.815  66.070  1.00 98.64  ? 332  HIS B CB    1 
ATOM   5810  C  CG    . HIS B  2  334 ? 41.554  50.825  65.455  1.00 99.65  ? 332  HIS B CG    1 
ATOM   5811  N  ND1   . HIS B  2  334 ? 40.655  49.792  65.619  1.00 100.06 ? 332  HIS B ND1   1 
ATOM   5812  C  CD2   . HIS B  2  334 ? 40.935  51.743  64.677  1.00 100.41 ? 332  HIS B CD2   1 
ATOM   5813  C  CE1   . HIS B  2  334 ? 39.541  50.074  64.970  1.00 100.64 ? 332  HIS B CE1   1 
ATOM   5814  N  NE2   . HIS B  2  334 ? 39.684  51.253  64.390  1.00 101.51 ? 332  HIS B NE2   1 
ATOM   5815  N  N     . ALA B  2  335 ? 44.716  50.877  69.128  1.00 99.79  ? 333  ALA B N     1 
ATOM   5816  C  CA    . ALA B  2  335 ? 46.093  50.771  69.612  1.00 100.07 ? 333  ALA B CA    1 
ATOM   5817  C  C     . ALA B  2  335 ? 46.387  49.325  70.005  1.00 99.98  ? 333  ALA B C     1 
ATOM   5818  O  O     . ALA B  2  335 ? 47.544  48.888  70.010  1.00 99.15  ? 333  ALA B O     1 
ATOM   5819  C  CB    . ALA B  2  335 ? 46.311  51.700  70.806  1.00 100.12 ? 333  ALA B CB    1 
ATOM   5820  N  N     . GLY B  2  336 ? 45.323  48.590  70.330  1.00 100.07 ? 334  GLY B N     1 
ATOM   5821  C  CA    . GLY B  2  336 ? 45.475  47.199  70.715  1.00 99.45  ? 334  GLY B CA    1 
ATOM   5822  C  C     . GLY B  2  336 ? 46.007  46.380  69.558  1.00 98.39  ? 334  GLY B C     1 
ATOM   5823  O  O     . GLY B  2  336 ? 47.121  45.853  69.609  1.00 97.72  ? 334  GLY B O     1 
ATOM   5824  N  N     . GLU B  2  337 ? 45.207  46.284  68.502  1.00 97.36  ? 335  GLU B N     1 
ATOM   5825  C  CA    . GLU B  2  337 ? 45.615  45.532  67.334  1.00 95.94  ? 335  GLU B CA    1 
ATOM   5826  C  C     . GLU B  2  337 ? 46.894  46.102  66.727  1.00 93.48  ? 335  GLU B C     1 
ATOM   5827  O  O     . GLU B  2  337 ? 47.720  45.358  66.212  1.00 93.91  ? 335  GLU B O     1 
ATOM   5828  C  CB    . GLU B  2  337 ? 44.485  45.498  66.295  1.00 97.32  ? 335  GLU B CB    1 
ATOM   5829  C  CG    . GLU B  2  337 ? 43.771  46.821  66.081  1.00 100.87 ? 335  GLU B CG    1 
ATOM   5830  C  CD    . GLU B  2  337 ? 42.854  46.814  64.856  1.00 103.37 ? 335  GLU B CD    1 
ATOM   5831  O  OE1   . GLU B  2  337 ? 43.356  46.600  63.726  1.00 105.13 ? 335  GLU B OE1   1 
ATOM   5832  O  OE2   . GLU B  2  337 ? 41.631  47.029  65.020  1.00 104.50 ? 335  GLU B OE2   1 
ATOM   5833  N  N     . VAL B  2  338 ? 47.079  47.411  66.809  1.00 90.75  ? 336  VAL B N     1 
ATOM   5834  C  CA    . VAL B  2  338 ? 48.267  48.006  66.230  1.00 89.57  ? 336  VAL B CA    1 
ATOM   5835  C  C     . VAL B  2  338 ? 49.555  47.684  66.954  1.00 89.70  ? 336  VAL B C     1 
ATOM   5836  O  O     . VAL B  2  338 ? 50.567  47.415  66.319  1.00 89.65  ? 336  VAL B O     1 
ATOM   5837  C  CB    . VAL B  2  338 ? 48.155  49.528  66.137  1.00 89.40  ? 336  VAL B CB    1 
ATOM   5838  C  CG1   . VAL B  2  338 ? 49.485  50.118  65.681  1.00 88.20  ? 336  VAL B CG1   1 
ATOM   5839  C  CG2   . VAL B  2  338 ? 47.063  49.903  65.162  1.00 89.15  ? 336  VAL B CG2   1 
ATOM   5840  N  N     . ILE B  2  339 ? 49.536  47.716  68.279  1.00 90.55  ? 337  ILE B N     1 
ATOM   5841  C  CA    . ILE B  2  339 ? 50.757  47.435  69.027  1.00 91.73  ? 337  ILE B CA    1 
ATOM   5842  C  C     . ILE B  2  339 ? 51.186  45.964  68.894  1.00 91.72  ? 337  ILE B C     1 
ATOM   5843  O  O     . ILE B  2  339 ? 52.376  45.667  68.711  1.00 91.40  ? 337  ILE B O     1 
ATOM   5844  C  CB    . ILE B  2  339 ? 50.589  47.833  70.517  1.00 91.96  ? 337  ILE B CB    1 
ATOM   5845  C  CG1   . ILE B  2  339 ? 50.411  49.348  70.623  1.00 90.91  ? 337  ILE B CG1   1 
ATOM   5846  C  CG2   . ILE B  2  339 ? 51.819  47.440  71.316  1.00 93.46  ? 337  ILE B CG2   1 
ATOM   5847  C  CD1   . ILE B  2  339 ? 50.225  49.835  72.027  1.00 90.15  ? 337  ILE B CD1   1 
ATOM   5848  N  N     . ARG B  2  340 ? 50.213  45.057  68.979  1.00 91.39  ? 338  ARG B N     1 
ATOM   5849  C  CA    . ARG B  2  340 ? 50.467  43.623  68.844  1.00 90.95  ? 338  ARG B CA    1 
ATOM   5850  C  C     . ARG B  2  340 ? 51.219  43.415  67.550  1.00 90.73  ? 338  ARG B C     1 
ATOM   5851  O  O     . ARG B  2  340 ? 52.299  42.839  67.528  1.00 90.78  ? 338  ARG B O     1 
ATOM   5852  C  CB    . ARG B  2  340 ? 49.157  42.861  68.737  1.00 91.62  ? 338  ARG B CB    1 
ATOM   5853  C  CG    . ARG B  2  340 ? 48.193  43.135  69.842  1.00 93.52  ? 338  ARG B CG    1 
ATOM   5854  C  CD    . ARG B  2  340 ? 48.448  42.211  71.006  1.00 96.78  ? 338  ARG B CD    1 
ATOM   5855  N  NE    . ARG B  2  340 ? 47.446  42.369  72.056  1.00 98.81  ? 338  ARG B NE    1 
ATOM   5856  C  CZ    . ARG B  2  340 ? 46.137  42.491  71.838  1.00 99.65  ? 338  ARG B CZ    1 
ATOM   5857  N  NH1   . ARG B  2  340 ? 45.645  42.478  70.599  1.00 97.71  ? 338  ARG B NH1   1 
ATOM   5858  N  NH2   . ARG B  2  340 ? 45.316  42.626  72.872  1.00 100.31 ? 338  ARG B NH2   1 
ATOM   5859  N  N     . ALA B  2  341 ? 50.607  43.885  66.468  1.00 90.95  ? 339  ALA B N     1 
ATOM   5860  C  CA    . ALA B  2  341 ? 51.171  43.772  65.140  1.00 91.08  ? 339  ALA B CA    1 
ATOM   5861  C  C     . ALA B  2  341 ? 52.633  44.171  65.162  1.00 91.39  ? 339  ALA B C     1 
ATOM   5862  O  O     . ALA B  2  341 ? 53.479  43.423  64.686  1.00 91.80  ? 339  ALA B O     1 
ATOM   5863  C  CB    . ALA B  2  341 ? 50.400  44.645  64.173  1.00 90.72  ? 339  ALA B CB    1 
ATOM   5864  N  N     . ALA B  2  342 ? 52.931  45.339  65.720  1.00 92.03  ? 340  ALA B N     1 
ATOM   5865  C  CA    . ALA B  2  342 ? 54.312  45.807  65.793  1.00 94.01  ? 340  ALA B CA    1 
ATOM   5866  C  C     . ALA B  2  342 ? 55.197  44.800  66.539  1.00 95.71  ? 340  ALA B C     1 
ATOM   5867  O  O     . ALA B  2  342 ? 56.400  44.694  66.269  1.00 96.23  ? 340  ALA B O     1 
ATOM   5868  C  CB    . ALA B  2  342 ? 54.365  47.155  66.477  1.00 93.82  ? 340  ALA B CB    1 
ATOM   5869  N  N     . MET B  2  343 ? 54.600  44.072  67.484  1.00 96.77  ? 341  MET B N     1 
ATOM   5870  C  CA    . MET B  2  343 ? 55.319  43.054  68.251  1.00 97.02  ? 341  MET B CA    1 
ATOM   5871  C  C     . MET B  2  343 ? 55.600  41.835  67.380  1.00 97.33  ? 341  MET B C     1 
ATOM   5872  O  O     . MET B  2  343 ? 56.757  41.502  67.130  1.00 96.74  ? 341  MET B O     1 
ATOM   5873  C  CB    . MET B  2  343 ? 54.503  42.624  69.473  1.00 97.31  ? 341  MET B CB    1 
ATOM   5874  C  CG    . MET B  2  343 ? 54.793  43.423  70.731  1.00 98.18  ? 341  MET B CG    1 
ATOM   5875  S  SD    . MET B  2  343 ? 56.246  42.827  71.637  1.00 99.36  ? 341  MET B SD    1 
ATOM   5876  C  CE    . MET B  2  343 ? 57.552  43.342  70.578  1.00 97.45  ? 341  MET B CE    1 
ATOM   5877  N  N     . ASN B  2  344 ? 54.536  41.180  66.918  1.00 97.72  ? 342  ASN B N     1 
ATOM   5878  C  CA    . ASN B  2  344 ? 54.672  39.999  66.073  1.00 98.61  ? 342  ASN B CA    1 
ATOM   5879  C  C     . ASN B  2  344 ? 55.722  40.199  65.004  1.00 98.09  ? 342  ASN B C     1 
ATOM   5880  O  O     . ASN B  2  344 ? 56.489  39.292  64.708  1.00 98.21  ? 342  ASN B O     1 
ATOM   5881  C  CB    . ASN B  2  344 ? 53.344  39.650  65.400  1.00 100.39 ? 342  ASN B CB    1 
ATOM   5882  C  CG    . ASN B  2  344 ? 52.249  39.380  66.398  1.00 103.03 ? 342  ASN B CG    1 
ATOM   5883  O  OD1   . ASN B  2  344 ? 52.497  38.801  67.456  1.00 104.28 ? 342  ASN B OD1   1 
ATOM   5884  N  ND2   . ASN B  2  344 ? 51.024  39.787  66.069  1.00 104.43 ? 342  ASN B ND2   1 
ATOM   5885  N  N     . GLN B  2  345 ? 55.751  41.391  64.424  1.00 97.90  ? 343  GLN B N     1 
ATOM   5886  C  CA    . GLN B  2  345 ? 56.709  41.699  63.379  1.00 98.23  ? 343  GLN B CA    1 
ATOM   5887  C  C     . GLN B  2  345 ? 58.133  41.795  63.905  1.00 98.91  ? 343  GLN B C     1 
ATOM   5888  O  O     . GLN B  2  345 ? 59.086  41.871  63.128  1.00 98.90  ? 343  GLN B O     1 
ATOM   5889  C  CB    . GLN B  2  345 ? 56.312  42.993  62.679  1.00 98.72  ? 343  GLN B CB    1 
ATOM   5890  C  CG    . GLN B  2  345 ? 55.396  42.789  61.487  1.00 99.02  ? 343  GLN B CG    1 
ATOM   5891  C  CD    . GLN B  2  345 ? 56.143  42.269  60.277  1.00 100.15 ? 343  GLN B CD    1 
ATOM   5892  O  OE1   . GLN B  2  345 ? 55.573  42.129  59.194  1.00 101.42 ? 343  GLN B OE1   1 
ATOM   5893  N  NE2   . GLN B  2  345 ? 57.430  41.981  60.452  1.00 100.14 ? 343  GLN B NE2   1 
ATOM   5894  N  N     . LEU B  2  346 ? 58.278  41.802  65.228  1.00 99.77  ? 344  LEU B N     1 
ATOM   5895  C  CA    . LEU B  2  346 ? 59.601  41.852  65.851  1.00 100.60 ? 344  LEU B CA    1 
ATOM   5896  C  C     . LEU B  2  346 ? 60.006  40.435  66.221  1.00 100.85 ? 344  LEU B C     1 
ATOM   5897  O  O     . LEU B  2  346 ? 61.179  40.074  66.150  1.00 100.44 ? 344  LEU B O     1 
ATOM   5898  C  CB    . LEU B  2  346 ? 59.591  42.737  67.098  1.00 100.19 ? 344  LEU B CB    1 
ATOM   5899  C  CG    . LEU B  2  346 ? 60.067  44.168  66.843  1.00 99.97  ? 344  LEU B CG    1 
ATOM   5900  C  CD1   . LEU B  2  346 ? 59.728  44.998  68.031  1.00 101.43 ? 344  LEU B CD1   1 
ATOM   5901  C  CD2   . LEU B  2  346 ? 61.560  44.208  66.580  1.00 98.56  ? 344  LEU B CD2   1 
ATOM   5902  N  N     . LYS B  2  347 ? 59.024  39.638  66.628  1.00 101.71 ? 345  LYS B N     1 
ATOM   5903  C  CA    . LYS B  2  347 ? 59.281  38.246  66.957  1.00 102.98 ? 345  LYS B CA    1 
ATOM   5904  C  C     . LYS B  2  347 ? 59.581  37.563  65.621  1.00 103.23 ? 345  LYS B C     1 
ATOM   5905  O  O     . LYS B  2  347 ? 60.590  36.873  65.473  1.00 104.07 ? 345  LYS B O     1 
ATOM   5906  C  CB    . LYS B  2  347 ? 58.054  37.607  67.631  1.00 103.55 ? 345  LYS B CB    1 
ATOM   5907  C  CG    . LYS B  2  347 ? 57.810  38.114  69.055  1.00 105.94 ? 345  LYS B CG    1 
ATOM   5908  C  CD    . LYS B  2  347 ? 56.662  37.395  69.778  1.00 107.24 ? 345  LYS B CD    1 
ATOM   5909  C  CE    . LYS B  2  347 ? 55.304  37.676  69.136  1.00 108.94 ? 345  LYS B CE    1 
ATOM   5910  N  NZ    . LYS B  2  347 ? 54.159  37.106  69.920  1.00 108.84 ? 345  LYS B NZ    1 
ATOM   5911  N  N     . ALA B  2  348 ? 58.712  37.787  64.639  1.00 102.53 ? 346  ALA B N     1 
ATOM   5912  C  CA    . ALA B  2  348 ? 58.877  37.204  63.316  1.00 101.17 ? 346  ALA B CA    1 
ATOM   5913  C  C     . ALA B  2  348 ? 60.246  37.524  62.728  1.00 100.84 ? 346  ALA B C     1 
ATOM   5914  O  O     . ALA B  2  348 ? 60.809  36.734  61.977  1.00 100.52 ? 346  ALA B O     1 
ATOM   5915  C  CB    . ALA B  2  348 ? 57.790  37.708  62.399  1.00 100.41 ? 346  ALA B CB    1 
ATOM   5916  N  N     . ALA B  2  349 ? 60.783  38.683  63.076  1.00 101.58 ? 347  ALA B N     1 
ATOM   5917  C  CA    . ALA B  2  349 ? 62.086  39.092  62.569  1.00 103.56 ? 347  ALA B CA    1 
ATOM   5918  C  C     . ALA B  2  349 ? 63.223  38.497  63.386  1.00 104.87 ? 347  ALA B C     1 
ATOM   5919  O  O     . ALA B  2  349 ? 64.343  38.364  62.899  1.00 104.91 ? 347  ALA B O     1 
ATOM   5920  C  CB    . ALA B  2  349 ? 62.189  40.606  62.575  1.00 103.46 ? 347  ALA B CB    1 
ATOM   5921  N  N     . ALA B  2  350 ? 62.930  38.153  64.637  1.00 106.85 ? 348  ALA B N     1 
ATOM   5922  C  CA    . ALA B  2  350 ? 63.925  37.571  65.536  1.00 108.18 ? 348  ALA B CA    1 
ATOM   5923  C  C     . ALA B  2  350 ? 64.077  36.075  65.248  1.00 109.32 ? 348  ALA B C     1 
ATOM   5924  O  O     . ALA B  2  350 ? 65.025  35.430  65.705  1.00 109.32 ? 348  ALA B O     1 
ATOM   5925  C  CB    . ALA B  2  350 ? 63.508  37.797  66.994  1.00 106.95 ? 348  ALA B CB    1 
ATOM   5926  N  N     . GLN B  2  351 ? 63.135  35.536  64.479  1.00 110.41 ? 349  GLN B N     1 
ATOM   5927  C  CA    . GLN B  2  351 ? 63.147  34.123  64.116  1.00 111.31 ? 349  GLN B CA    1 
ATOM   5928  C  C     . GLN B  2  351 ? 63.539  33.961  62.647  1.00 112.26 ? 349  GLN B C     1 
ATOM   5929  O  O     . GLN B  2  351 ? 62.863  33.266  61.885  1.00 112.19 ? 349  GLN B O     1 
ATOM   5930  C  CB    . GLN B  2  351 ? 61.765  33.507  64.345  1.00 110.73 ? 349  GLN B CB    1 
ATOM   5931  C  CG    . GLN B  2  351 ? 61.128  33.890  65.664  1.00 110.09 ? 349  GLN B CG    1 
ATOM   5932  C  CD    . GLN B  2  351 ? 59.734  33.329  65.805  1.00 110.35 ? 349  GLN B CD    1 
ATOM   5933  O  OE1   . GLN B  2  351 ? 58.962  33.314  64.844  1.00 110.38 ? 349  GLN B OE1   1 
ATOM   5934  N  NE2   . GLN B  2  351 ? 59.394  32.875  67.007  1.00 110.65 ? 349  GLN B NE2   1 
ATOM   5935  N  N     . GLY B  2  352 ? 64.625  34.623  62.254  1.00 113.26 ? 350  GLY B N     1 
ATOM   5936  C  CA    . GLY B  2  352 ? 65.107  34.536  60.884  1.00 114.36 ? 350  GLY B CA    1 
ATOM   5937  C  C     . GLY B  2  352 ? 64.215  35.098  59.784  1.00 115.22 ? 350  GLY B C     1 
ATOM   5938  O  O     . GLY B  2  352 ? 64.442  34.815  58.603  1.00 115.94 ? 350  GLY B O     1 
ATOM   5939  N  N     . GLY B  2  353 ? 63.209  35.890  60.151  1.00 115.34 ? 351  GLY B N     1 
ATOM   5940  C  CA    . GLY B  2  353 ? 62.323  36.467  59.153  1.00 114.54 ? 351  GLY B CA    1 
ATOM   5941  C  C     . GLY B  2  353 ? 62.961  37.654  58.458  1.00 114.07 ? 351  GLY B C     1 
ATOM   5942  O  O     . GLY B  2  353 ? 62.303  38.650  58.183  1.00 113.93 ? 351  GLY B O     1 
ATOM   5943  N  N     . VAL B  2  354 ? 64.251  37.537  58.169  1.00 114.31 ? 352  VAL B N     1 
ATOM   5944  C  CA    . VAL B  2  354 ? 65.003  38.602  57.516  1.00 115.30 ? 352  VAL B CA    1 
ATOM   5945  C  C     . VAL B  2  354 ? 65.766  38.093  56.283  1.00 116.31 ? 352  VAL B C     1 
ATOM   5946  O  O     . VAL B  2  354 ? 66.689  37.285  56.405  1.00 117.17 ? 352  VAL B O     1 
ATOM   5947  C  CB    . VAL B  2  354 ? 66.024  39.229  58.507  1.00 114.79 ? 352  VAL B CB    1 
ATOM   5948  C  CG1   . VAL B  2  354 ? 66.784  40.366  57.843  1.00 114.47 ? 352  VAL B CG1   1 
ATOM   5949  C  CG2   . VAL B  2  354 ? 65.307  39.719  59.748  1.00 114.65 ? 352  VAL B CG2   1 
ATOM   5950  N  N     . THR B  2  355 ? 65.377  38.564  55.099  1.00 116.37 ? 353  THR B N     1 
ATOM   5951  C  CA    . THR B  2  355 ? 66.042  38.177  53.855  1.00 115.83 ? 353  THR B CA    1 
ATOM   5952  C  C     . THR B  2  355 ? 67.466  38.714  53.883  1.00 115.92 ? 353  THR B C     1 
ATOM   5953  O  O     . THR B  2  355 ? 67.771  39.641  54.628  1.00 115.60 ? 353  THR B O     1 
ATOM   5954  C  CB    . THR B  2  355 ? 65.318  38.777  52.622  1.00 116.09 ? 353  THR B CB    1 
ATOM   5955  O  OG1   . THR B  2  355 ? 64.028  38.169  52.480  1.00 116.65 ? 353  THR B OG1   1 
ATOM   5956  C  CG2   . THR B  2  355 ? 66.124  38.557  51.350  1.00 115.25 ? 353  THR B CG2   1 
ATOM   5957  N  N     . GLU B  2  356 ? 68.341  38.130  53.077  1.00 116.89 ? 354  GLU B N     1 
ATOM   5958  C  CA    . GLU B  2  356 ? 69.718  38.596  53.025  1.00 118.39 ? 354  GLU B CA    1 
ATOM   5959  C  C     . GLU B  2  356 ? 69.741  39.920  52.258  1.00 118.38 ? 354  GLU B C     1 
ATOM   5960  O  O     . GLU B  2  356 ? 70.711  40.678  52.312  1.00 118.38 ? 354  GLU B O     1 
ATOM   5961  C  CB    . GLU B  2  356 ? 70.605  37.560  52.324  1.00 119.47 ? 354  GLU B CB    1 
ATOM   5962  C  CG    . GLU B  2  356 ? 72.099  37.860  52.420  1.00 121.56 ? 354  GLU B CG    1 
ATOM   5963  C  CD    . GLU B  2  356 ? 72.598  37.905  53.865  1.00 122.41 ? 354  GLU B CD    1 
ATOM   5964  O  OE1   . GLU B  2  356 ? 72.434  36.886  54.573  1.00 122.71 ? 354  GLU B OE1   1 
ATOM   5965  O  OE2   . GLU B  2  356 ? 73.151  38.950  54.290  1.00 122.16 ? 354  GLU B OE2   1 
ATOM   5966  N  N     . GLU B  2  357 ? 68.651  40.188  51.548  1.00 118.65 ? 355  GLU B N     1 
ATOM   5967  C  CA    . GLU B  2  357 ? 68.515  41.405  50.762  1.00 119.02 ? 355  GLU B CA    1 
ATOM   5968  C  C     . GLU B  2  357 ? 68.013  42.558  51.622  1.00 117.51 ? 355  GLU B C     1 
ATOM   5969  O  O     . GLU B  2  357 ? 68.436  43.702  51.447  1.00 117.84 ? 355  GLU B O     1 
ATOM   5970  C  CB    . GLU B  2  357 ? 67.538  41.173  49.613  1.00 121.41 ? 355  GLU B CB    1 
ATOM   5971  C  CG    . GLU B  2  357 ? 67.196  42.430  48.836  1.00 125.05 ? 355  GLU B CG    1 
ATOM   5972  C  CD    . GLU B  2  357 ? 65.860  42.316  48.121  1.00 127.51 ? 355  GLU B CD    1 
ATOM   5973  O  OE1   . GLU B  2  357 ? 64.842  42.053  48.804  1.00 128.28 ? 355  GLU B OE1   1 
ATOM   5974  O  OE2   . GLU B  2  357 ? 65.828  42.489  46.882  1.00 128.90 ? 355  GLU B OE2   1 
ATOM   5975  N  N     . ASP B  2  358 ? 67.097  42.257  52.538  1.00 115.01 ? 356  ASP B N     1 
ATOM   5976  C  CA    . ASP B  2  358 ? 66.559  43.281  53.416  1.00 112.19 ? 356  ASP B CA    1 
ATOM   5977  C  C     . ASP B  2  358 ? 67.728  43.902  54.132  1.00 110.62 ? 356  ASP B C     1 
ATOM   5978  O  O     . ASP B  2  358 ? 67.729  45.096  54.408  1.00 110.72 ? 356  ASP B O     1 
ATOM   5979  C  CB    . ASP B  2  358 ? 65.599  42.684  54.441  1.00 111.89 ? 356  ASP B CB    1 
ATOM   5980  C  CG    . ASP B  2  358 ? 64.412  42.005  53.797  1.00 111.59 ? 356  ASP B CG    1 
ATOM   5981  O  OD1   . ASP B  2  358 ? 63.933  42.508  52.760  1.00 112.12 ? 356  ASP B OD1   1 
ATOM   5982  O  OD2   . ASP B  2  358 ? 63.949  40.977  54.334  1.00 110.90 ? 356  ASP B OD2   1 
ATOM   5983  N  N     . VAL B  2  359 ? 68.725  43.076  54.426  1.00 109.36 ? 357  VAL B N     1 
ATOM   5984  C  CA    . VAL B  2  359 ? 69.926  43.537  55.109  1.00 109.21 ? 357  VAL B CA    1 
ATOM   5985  C  C     . VAL B  2  359 ? 70.732  44.432  54.180  1.00 108.92 ? 357  VAL B C     1 
ATOM   5986  O  O     . VAL B  2  359 ? 71.436  45.337  54.623  1.00 107.98 ? 357  VAL B O     1 
ATOM   5987  C  CB    . VAL B  2  359 ? 70.811  42.350  55.558  1.00 109.14 ? 357  VAL B CB    1 
ATOM   5988  C  CG1   . VAL B  2  359 ? 72.063  42.864  56.255  1.00 108.05 ? 357  VAL B CG1   1 
ATOM   5989  C  CG2   . VAL B  2  359 ? 70.023  41.440  56.495  1.00 109.32 ? 357  VAL B CG2   1 
ATOM   5990  N  N     . THR B  2  360 ? 70.617  44.172  52.884  1.00 109.77 ? 358  THR B N     1 
ATOM   5991  C  CA    . THR B  2  360 ? 71.327  44.950  51.879  1.00 110.59 ? 358  THR B CA    1 
ATOM   5992  C  C     . THR B  2  360 ? 70.651  46.315  51.715  1.00 110.84 ? 358  THR B C     1 
ATOM   5993  O  O     . THR B  2  360 ? 71.314  47.358  51.763  1.00 110.29 ? 358  THR B O     1 
ATOM   5994  C  CB    . THR B  2  360 ? 71.343  44.207  50.512  1.00 111.07 ? 358  THR B CB    1 
ATOM   5995  O  OG1   . THR B  2  360 ? 71.864  42.880  50.687  1.00 111.10 ? 358  THR B OG1   1 
ATOM   5996  C  CG2   . THR B  2  360 ? 72.216  44.951  49.511  1.00 111.24 ? 358  THR B CG2   1 
ATOM   5997  N  N     . LYS B  2  361 ? 69.331  46.300  51.529  1.00 111.17 ? 359  LYS B N     1 
ATOM   5998  C  CA    . LYS B  2  361 ? 68.556  47.528  51.368  1.00 111.28 ? 359  LYS B CA    1 
ATOM   5999  C  C     . LYS B  2  361 ? 68.826  48.482  52.522  1.00 111.44 ? 359  LYS B C     1 
ATOM   6000  O  O     . LYS B  2  361 ? 69.339  49.585  52.313  1.00 110.99 ? 359  LYS B O     1 
ATOM   6001  C  CB    . LYS B  2  361 ? 67.064  47.204  51.291  1.00 111.49 ? 359  LYS B CB    1 
ATOM   6002  C  CG    . LYS B  2  361 ? 66.730  46.319  50.113  1.00 113.14 ? 359  LYS B CG    1 
ATOM   6003  C  CD    . LYS B  2  361 ? 65.243  46.261  49.822  1.00 114.51 ? 359  LYS B CD    1 
ATOM   6004  C  CE    . LYS B  2  361 ? 65.010  45.617  48.454  1.00 115.27 ? 359  LYS B CE    1 
ATOM   6005  N  NZ    . LYS B  2  361 ? 63.590  45.635  48.005  1.00 116.74 ? 359  LYS B NZ    1 
ATOM   6006  N  N     . ALA B  2  362 ? 68.484  48.045  53.736  1.00 111.60 ? 360  ALA B N     1 
ATOM   6007  C  CA    . ALA B  2  362 ? 68.690  48.841  54.945  1.00 111.57 ? 360  ALA B CA    1 
ATOM   6008  C  C     . ALA B  2  362 ? 70.068  49.489  54.922  1.00 111.96 ? 360  ALA B C     1 
ATOM   6009  O  O     . ALA B  2  362 ? 70.185  50.715  54.979  1.00 112.25 ? 360  ALA B O     1 
ATOM   6010  C  CB    . ALA B  2  362 ? 68.546  47.963  56.184  1.00 110.80 ? 360  ALA B CB    1 
ATOM   6011  N  N     . LYS B  2  363 ? 71.104  48.658  54.826  1.00 112.36 ? 361  LYS B N     1 
ATOM   6012  C  CA    . LYS B  2  363 ? 72.485  49.130  54.790  1.00 112.51 ? 361  LYS B CA    1 
ATOM   6013  C  C     . LYS B  2  363 ? 72.674  50.329  53.865  1.00 112.21 ? 361  LYS B C     1 
ATOM   6014  O  O     . LYS B  2  363 ? 73.534  51.181  54.107  1.00 111.66 ? 361  LYS B O     1 
ATOM   6015  C  CB    . LYS B  2  363 ? 73.416  48.000  54.349  1.00 113.07 ? 361  LYS B CB    1 
ATOM   6016  C  CG    . LYS B  2  363 ? 73.614  46.899  55.379  1.00 113.85 ? 361  LYS B CG    1 
ATOM   6017  C  CD    . LYS B  2  363 ? 74.529  45.827  54.810  1.00 114.67 ? 361  LYS B CD    1 
ATOM   6018  C  CE    . LYS B  2  363 ? 74.836  44.729  55.807  1.00 114.68 ? 361  LYS B CE    1 
ATOM   6019  N  NZ    . LYS B  2  363 ? 75.693  43.697  55.156  1.00 114.39 ? 361  LYS B NZ    1 
ATOM   6020  N  N     . ASN B  2  364 ? 71.873  50.389  52.804  1.00 111.98 ? 362  ASN B N     1 
ATOM   6021  C  CA    . ASN B  2  364 ? 71.959  51.493  51.855  1.00 111.78 ? 362  ASN B CA    1 
ATOM   6022  C  C     . ASN B  2  364 ? 71.232  52.691  52.440  1.00 110.41 ? 362  ASN B C     1 
ATOM   6023  O  O     . ASN B  2  364 ? 71.789  53.790  52.524  1.00 110.57 ? 362  ASN B O     1 
ATOM   6024  C  CB    . ASN B  2  364 ? 71.310  51.119  50.520  1.00 113.69 ? 362  ASN B CB    1 
ATOM   6025  C  CG    . ASN B  2  364 ? 71.780  49.775  49.992  1.00 115.40 ? 362  ASN B CG    1 
ATOM   6026  O  OD1   . ASN B  2  364 ? 72.980  49.473  49.992  1.00 116.76 ? 362  ASN B OD1   1 
ATOM   6027  N  ND2   . ASN B  2  364 ? 70.836  48.964  49.523  1.00 114.99 ? 362  ASN B ND2   1 
ATOM   6028  N  N     . GLN B  2  365 ? 69.981  52.466  52.842  1.00 108.12 ? 363  GLN B N     1 
ATOM   6029  C  CA    . GLN B  2  365 ? 69.158  53.512  53.428  1.00 105.78 ? 363  GLN B CA    1 
ATOM   6030  C  C     . GLN B  2  365 ? 69.928  54.186  54.560  1.00 104.37 ? 363  GLN B C     1 
ATOM   6031  O  O     . GLN B  2  365 ? 69.859  55.405  54.730  1.00 104.07 ? 363  GLN B O     1 
ATOM   6032  C  CB    . GLN B  2  365 ? 67.847  52.917  53.952  1.00 105.25 ? 363  GLN B CB    1 
ATOM   6033  C  CG    . GLN B  2  365 ? 67.046  52.187  52.880  1.00 105.97 ? 363  GLN B CG    1 
ATOM   6034  C  CD    . GLN B  2  365 ? 65.705  51.653  53.375  1.00 106.94 ? 363  GLN B CD    1 
ATOM   6035  O  OE1   . GLN B  2  365 ? 65.631  50.947  54.382  1.00 108.02 ? 363  GLN B OE1   1 
ATOM   6036  N  NE2   . GLN B  2  365 ? 64.639  51.977  52.655  1.00 107.00 ? 363  GLN B NE2   1 
ATOM   6037  N  N     . LEU B  2  366 ? 70.681  53.385  55.312  1.00 102.76 ? 364  LEU B N     1 
ATOM   6038  C  CA    . LEU B  2  366 ? 71.468  53.880  56.437  1.00 101.54 ? 364  LEU B CA    1 
ATOM   6039  C  C     . LEU B  2  366 ? 72.671  54.723  56.000  1.00 101.01 ? 364  LEU B C     1 
ATOM   6040  O  O     . LEU B  2  366 ? 72.907  55.807  56.538  1.00 99.71  ? 364  LEU B O     1 
ATOM   6041  C  CB    . LEU B  2  366 ? 71.916  52.698  57.309  1.00 100.81 ? 364  LEU B CB    1 
ATOM   6042  C  CG    . LEU B  2  366 ? 72.576  52.942  58.676  1.00 101.23 ? 364  LEU B CG    1 
ATOM   6043  C  CD1   . LEU B  2  366 ? 71.882  54.066  59.432  1.00 101.18 ? 364  LEU B CD1   1 
ATOM   6044  C  CD2   . LEU B  2  366 ? 72.530  51.649  59.487  1.00 100.93 ? 364  LEU B CD2   1 
ATOM   6045  N  N     . LYS B  2  367 ? 73.427  54.231  55.023  1.00 101.38 ? 365  LYS B N     1 
ATOM   6046  C  CA    . LYS B  2  367 ? 74.587  54.966  54.513  1.00 101.82 ? 365  LYS B CA    1 
ATOM   6047  C  C     . LYS B  2  367 ? 74.153  56.282  53.856  1.00 100.59 ? 365  LYS B C     1 
ATOM   6048  O  O     . LYS B  2  367 ? 74.840  57.303  53.946  1.00 99.01  ? 365  LYS B O     1 
ATOM   6049  C  CB    . LYS B  2  367 ? 75.338  54.138  53.469  1.00 104.29 ? 365  LYS B CB    1 
ATOM   6050  C  CG    . LYS B  2  367 ? 75.905  52.804  53.930  1.00 106.93 ? 365  LYS B CG    1 
ATOM   6051  C  CD    . LYS B  2  367 ? 76.671  52.174  52.762  1.00 109.44 ? 365  LYS B CD    1 
ATOM   6052  C  CE    . LYS B  2  367 ? 77.105  50.742  53.036  1.00 111.24 ? 365  LYS B CE    1 
ATOM   6053  N  NZ    . LYS B  2  367 ? 77.929  50.188  51.914  1.00 112.03 ? 365  LYS B NZ    1 
ATOM   6054  N  N     . ALA B  2  368 ? 73.017  56.236  53.169  1.00 100.00 ? 366  ALA B N     1 
ATOM   6055  C  CA    . ALA B  2  368 ? 72.478  57.412  52.506  1.00 99.60  ? 366  ALA B CA    1 
ATOM   6056  C  C     . ALA B  2  368 ? 72.092  58.398  53.597  1.00 99.41  ? 366  ALA B C     1 
ATOM   6057  O  O     . ALA B  2  368 ? 72.618  59.511  53.668  1.00 98.53  ? 366  ALA B O     1 
ATOM   6058  C  CB    . ALA B  2  368 ? 71.253  57.032  51.681  1.00 99.47  ? 366  ALA B CB    1 
ATOM   6059  N  N     . THR B  2  369 ? 71.168  57.962  54.450  1.00 99.63  ? 367  THR B N     1 
ATOM   6060  C  CA    . THR B  2  369 ? 70.693  58.768  55.564  1.00 99.54  ? 367  THR B CA    1 
ATOM   6061  C  C     . THR B  2  369 ? 71.881  59.435  56.263  1.00 99.66  ? 367  THR B C     1 
ATOM   6062  O  O     . THR B  2  369 ? 71.893  60.650  56.445  1.00 99.86  ? 367  THR B O     1 
ATOM   6063  C  CB    . THR B  2  369 ? 69.882  57.887  56.559  1.00 99.16  ? 367  THR B CB    1 
ATOM   6064  O  OG1   . THR B  2  369 ? 68.525  57.773  56.096  1.00 97.93  ? 367  THR B OG1   1 
ATOM   6065  C  CG2   . THR B  2  369 ? 69.921  58.468  57.974  1.00 98.19  ? 367  THR B CG2   1 
ATOM   6066  N  N     . TYR B  2  370 ? 72.885  58.645  56.632  1.00 99.70  ? 368  TYR B N     1 
ATOM   6067  C  CA    . TYR B  2  370 ? 74.073  59.185  57.290  1.00 99.69  ? 368  TYR B CA    1 
ATOM   6068  C  C     . TYR B  2  370 ? 74.719  60.290  56.438  1.00 98.20  ? 368  TYR B C     1 
ATOM   6069  O  O     . TYR B  2  370 ? 74.954  61.402  56.911  1.00 97.01  ? 368  TYR B O     1 
ATOM   6070  C  CB    . TYR B  2  370 ? 75.091  58.056  57.556  1.00 101.75 ? 368  TYR B CB    1 
ATOM   6071  C  CG    . TYR B  2  370 ? 76.500  58.549  57.827  1.00 104.24 ? 368  TYR B CG    1 
ATOM   6072  C  CD1   . TYR B  2  370 ? 76.875  59.035  59.085  1.00 104.69 ? 368  TYR B CD1   1 
ATOM   6073  C  CD2   . TYR B  2  370 ? 77.437  58.614  56.792  1.00 105.88 ? 368  TYR B CD2   1 
ATOM   6074  C  CE1   . TYR B  2  370 ? 78.157  59.588  59.299  1.00 106.22 ? 368  TYR B CE1   1 
ATOM   6075  C  CE2   . TYR B  2  370 ? 78.714  59.163  56.988  1.00 107.17 ? 368  TYR B CE2   1 
ATOM   6076  C  CZ    . TYR B  2  370 ? 79.071  59.653  58.237  1.00 107.34 ? 368  TYR B CZ    1 
ATOM   6077  O  OH    . TYR B  2  370 ? 80.319  60.237  58.388  1.00 107.25 ? 368  TYR B OH    1 
ATOM   6078  N  N     . LEU B  2  371 ? 74.988  59.973  55.177  1.00 97.23  ? 369  LEU B N     1 
ATOM   6079  C  CA    . LEU B  2  371 ? 75.620  60.908  54.256  1.00 97.52  ? 369  LEU B CA    1 
ATOM   6080  C  C     . LEU B  2  371 ? 74.849  62.188  53.948  1.00 97.93  ? 369  LEU B C     1 
ATOM   6081  O  O     . LEU B  2  371 ? 75.449  63.238  53.670  1.00 97.45  ? 369  LEU B O     1 
ATOM   6082  C  CB    . LEU B  2  371 ? 75.943  60.186  52.954  1.00 98.04  ? 369  LEU B CB    1 
ATOM   6083  C  CG    . LEU B  2  371 ? 77.252  59.394  52.964  1.00 98.04  ? 369  LEU B CG    1 
ATOM   6084  C  CD1   . LEU B  2  371 ? 77.320  58.512  51.725  1.00 98.03  ? 369  LEU B CD1   1 
ATOM   6085  C  CD2   . LEU B  2  371 ? 78.444  60.364  53.021  1.00 97.12  ? 369  LEU B CD2   1 
ATOM   6086  N  N     . MET B  2  372 ? 73.522  62.099  53.972  1.00 98.59  ? 370  MET B N     1 
ATOM   6087  C  CA    . MET B  2  372 ? 72.681  63.267  53.714  1.00 98.34  ? 370  MET B CA    1 
ATOM   6088  C  C     . MET B  2  372 ? 72.706  64.137  54.969  1.00 98.98  ? 370  MET B C     1 
ATOM   6089  O  O     . MET B  2  372 ? 72.853  65.356  54.895  1.00 99.68  ? 370  MET B O     1 
ATOM   6090  C  CB    . MET B  2  372 ? 71.238  62.839  53.393  1.00 95.86  ? 370  MET B CB    1 
ATOM   6091  C  CG    . MET B  2  372 ? 71.120  61.943  52.166  1.00 94.79  ? 370  MET B CG    1 
ATOM   6092  S  SD    . MET B  2  372 ? 69.449  61.483  51.624  1.00 92.96  ? 370  MET B SD    1 
ATOM   6093  C  CE    . MET B  2  372 ? 69.055  60.136  52.772  1.00 93.51  ? 370  MET B CE    1 
ATOM   6094  N  N     . SER B  2  373 ? 72.595  63.482  56.120  1.00 99.39  ? 371  SER B N     1 
ATOM   6095  C  CA    . SER B  2  373 ? 72.590  64.140  57.419  1.00 100.05 ? 371  SER B CA    1 
ATOM   6096  C  C     . SER B  2  373 ? 73.781  65.032  57.699  1.00 100.28 ? 371  SER B C     1 
ATOM   6097  O  O     . SER B  2  373 ? 73.895  65.578  58.795  1.00 100.84 ? 371  SER B O     1 
ATOM   6098  C  CB    . SER B  2  373 ? 72.509  63.092  58.525  1.00 100.79 ? 371  SER B CB    1 
ATOM   6099  O  OG    . SER B  2  373 ? 71.323  62.328  58.404  1.00 103.27 ? 371  SER B OG    1 
ATOM   6100  N  N     . VAL B  2  374 ? 74.667  65.196  56.726  1.00 100.47 ? 372  VAL B N     1 
ATOM   6101  C  CA    . VAL B  2  374 ? 75.847  66.014  56.951  1.00 100.26 ? 372  VAL B CA    1 
ATOM   6102  C  C     . VAL B  2  374 ? 76.050  67.125  55.919  1.00 101.39 ? 372  VAL B C     1 
ATOM   6103  O  O     . VAL B  2  374 ? 77.138  67.698  55.821  1.00 102.34 ? 372  VAL B O     1 
ATOM   6104  C  CB    . VAL B  2  374 ? 77.097  65.119  57.012  1.00 98.60  ? 372  VAL B CB    1 
ATOM   6105  C  CG1   . VAL B  2  374 ? 78.268  65.901  57.531  1.00 98.07  ? 372  VAL B CG1   1 
ATOM   6106  C  CG2   . VAL B  2  374 ? 76.829  63.928  57.907  1.00 97.82  ? 372  VAL B CG2   1 
ATOM   6107  N  N     . GLU B  2  375 ? 75.002  67.436  55.156  1.00 101.97 ? 373  GLU B N     1 
ATOM   6108  C  CA    . GLU B  2  375 ? 75.063  68.495  54.142  1.00 102.26 ? 373  GLU B CA    1 
ATOM   6109  C  C     . GLU B  2  375 ? 74.900  69.846  54.860  1.00 102.67 ? 373  GLU B C     1 
ATOM   6110  O  O     . GLU B  2  375 ? 75.433  70.879  54.437  1.00 102.06 ? 373  GLU B O     1 
ATOM   6111  C  CB    . GLU B  2  375 ? 73.933  68.305  53.120  1.00 102.10 ? 373  GLU B CB    1 
ATOM   6112  C  CG    . GLU B  2  375 ? 73.899  66.925  52.446  1.00 103.49 ? 373  GLU B CG    1 
ATOM   6113  C  CD    . GLU B  2  375 ? 72.620  66.687  51.641  1.00 104.27 ? 373  GLU B CD    1 
ATOM   6114  O  OE1   . GLU B  2  375 ? 72.532  65.661  50.923  1.00 103.66 ? 373  GLU B OE1   1 
ATOM   6115  O  OE2   . GLU B  2  375 ? 71.697  67.526  51.734  1.00 105.91 ? 373  GLU B OE2   1 
ATOM   6116  N  N     . THR B  2  376 ? 74.161  69.795  55.968  1.00 103.11 ? 374  THR B N     1 
ATOM   6117  C  CA    . THR B  2  376 ? 73.854  70.937  56.832  1.00 102.88 ? 374  THR B CA    1 
ATOM   6118  C  C     . THR B  2  376 ? 75.086  71.439  57.573  1.00 103.64 ? 374  THR B C     1 
ATOM   6119  O  O     . THR B  2  376 ? 75.872  70.643  58.075  1.00 104.15 ? 374  THR B O     1 
ATOM   6120  C  CB    . THR B  2  376 ? 72.841  70.529  57.922  1.00 102.05 ? 374  THR B CB    1 
ATOM   6121  O  OG1   . THR B  2  376 ? 71.812  69.726  57.340  1.00 101.40 ? 374  THR B OG1   1 
ATOM   6122  C  CG2   . THR B  2  376 ? 72.229  71.751  58.584  1.00 101.60 ? 374  THR B CG2   1 
ATOM   6123  N  N     . ALA B  2  377 ? 75.248  72.752  57.662  1.00 104.50 ? 375  ALA B N     1 
ATOM   6124  C  CA    . ALA B  2  377 ? 76.373  73.312  58.403  1.00 105.66 ? 375  ALA B CA    1 
ATOM   6125  C  C     . ALA B  2  377 ? 76.229  72.735  59.801  1.00 106.68 ? 375  ALA B C     1 
ATOM   6126  O  O     . ALA B  2  377 ? 77.204  72.364  60.449  1.00 107.57 ? 375  ALA B O     1 
ATOM   6127  C  CB    . ALA B  2  377 ? 76.272  74.834  58.460  1.00 105.53 ? 375  ALA B CB    1 
ATOM   6128  N  N     . GLN B  2  378 ? 74.982  72.660  60.246  1.00 107.73 ? 376  GLN B N     1 
ATOM   6129  C  CA    . GLN B  2  378 ? 74.639  72.136  61.559  1.00 108.34 ? 376  GLN B CA    1 
ATOM   6130  C  C     . GLN B  2  378 ? 74.996  70.665  61.681  1.00 106.99 ? 376  GLN B C     1 
ATOM   6131  O  O     . GLN B  2  378 ? 75.799  70.290  62.531  1.00 106.94 ? 376  GLN B O     1 
ATOM   6132  C  CB    . GLN B  2  378 ? 73.145  72.307  61.791  1.00 111.11 ? 376  GLN B CB    1 
ATOM   6133  C  CG    . GLN B  2  378 ? 72.641  71.708  63.078  1.00 114.28 ? 376  GLN B CG    1 
ATOM   6134  C  CD    . GLN B  2  378 ? 71.153  71.455  63.024  1.00 116.41 ? 376  GLN B CD    1 
ATOM   6135  O  OE1   . GLN B  2  378 ? 70.685  70.584  62.272  1.00 116.70 ? 376  GLN B OE1   1 
ATOM   6136  N  NE2   . GLN B  2  378 ? 70.392  72.223  63.810  1.00 116.90 ? 376  GLN B NE2   1 
ATOM   6137  N  N     . GLY B  2  379 ? 74.381  69.842  60.832  1.00 105.75 ? 377  GLY B N     1 
ATOM   6138  C  CA    . GLY B  2  379 ? 74.632  68.406  60.843  1.00 104.22 ? 377  GLY B CA    1 
ATOM   6139  C  C     . GLY B  2  379 ? 76.099  68.002  60.769  1.00 102.72 ? 377  GLY B C     1 
ATOM   6140  O  O     . GLY B  2  379 ? 76.519  67.011  61.376  1.00 102.26 ? 377  GLY B O     1 
ATOM   6141  N  N     . LEU B  2  380 ? 76.883  68.765  60.017  1.00 101.00 ? 378  LEU B N     1 
ATOM   6142  C  CA    . LEU B  2  380 ? 78.304  68.491  59.881  1.00 99.10  ? 378  LEU B CA    1 
ATOM   6143  C  C     . LEU B  2  380 ? 78.999  68.728  61.210  1.00 97.82  ? 378  LEU B C     1 
ATOM   6144  O  O     . LEU B  2  380 ? 79.589  67.814  61.768  1.00 98.38  ? 378  LEU B O     1 
ATOM   6145  C  CB    . LEU B  2  380 ? 78.924  69.394  58.813  1.00 99.19  ? 378  LEU B CB    1 
ATOM   6146  C  CG    . LEU B  2  380 ? 80.428  69.243  58.566  1.00 98.81  ? 378  LEU B CG    1 
ATOM   6147  C  CD1   . LEU B  2  380 ? 80.709  67.875  57.988  1.00 97.47  ? 378  LEU B CD1   1 
ATOM   6148  C  CD2   . LEU B  2  380 ? 80.912  70.331  57.614  1.00 98.51  ? 378  LEU B CD2   1 
ATOM   6149  N  N     . LEU B  2  381 ? 78.925  69.955  61.717  1.00 96.48  ? 379  LEU B N     1 
ATOM   6150  C  CA    . LEU B  2  381 ? 79.565  70.294  62.986  1.00 96.16  ? 379  LEU B CA    1 
ATOM   6151  C  C     . LEU B  2  381 ? 79.155  69.333  64.083  1.00 95.79  ? 379  LEU B C     1 
ATOM   6152  O  O     . LEU B  2  381 ? 79.955  68.970  64.935  1.00 95.31  ? 379  LEU B O     1 
ATOM   6153  C  CB    . LEU B  2  381 ? 79.199  71.714  63.427  1.00 96.40  ? 379  LEU B CB    1 
ATOM   6154  C  CG    . LEU B  2  381 ? 79.889  72.205  64.708  1.00 96.35  ? 379  LEU B CG    1 
ATOM   6155  C  CD1   . LEU B  2  381 ? 81.286  72.701  64.379  1.00 96.95  ? 379  LEU B CD1   1 
ATOM   6156  C  CD2   . LEU B  2  381 ? 79.088  73.325  65.333  1.00 96.79  ? 379  LEU B CD2   1 
ATOM   6157  N  N     . ASN B  2  382 ? 77.895  68.937  64.077  1.00 96.39  ? 380  ASN B N     1 
ATOM   6158  C  CA    . ASN B  2  382 ? 77.415  68.014  65.085  1.00 97.86  ? 380  ASN B CA    1 
ATOM   6159  C  C     . ASN B  2  382 ? 78.207  66.724  64.982  1.00 98.92  ? 380  ASN B C     1 
ATOM   6160  O  O     . ASN B  2  382 ? 78.764  66.251  65.971  1.00 99.80  ? 380  ASN B O     1 
ATOM   6161  C  CB    . ASN B  2  382 ? 75.930  67.725  64.878  1.00 98.01  ? 380  ASN B CB    1 
ATOM   6162  C  CG    . ASN B  2  382 ? 75.417  66.636  65.798  1.00 97.85  ? 380  ASN B CG    1 
ATOM   6163  O  OD1   . ASN B  2  382 ? 75.358  66.813  67.018  1.00 98.40  ? 380  ASN B OD1   1 
ATOM   6164  N  ND2   . ASN B  2  382 ? 75.049  65.495  65.217  1.00 97.02  ? 380  ASN B ND2   1 
ATOM   6165  N  N     . GLU B  2  383 ? 78.252  66.162  63.775  1.00 99.93  ? 381  GLU B N     1 
ATOM   6166  C  CA    . GLU B  2  383 ? 78.976  64.916  63.501  1.00 100.07 ? 381  GLU B CA    1 
ATOM   6167  C  C     . GLU B  2  383 ? 80.439  64.990  63.976  1.00 98.58  ? 381  GLU B C     1 
ATOM   6168  O  O     . GLU B  2  383 ? 80.870  64.187  64.810  1.00 97.49  ? 381  GLU B O     1 
ATOM   6169  C  CB    . GLU B  2  383 ? 78.917  64.613  61.992  1.00 101.90 ? 381  GLU B CB    1 
ATOM   6170  C  CG    . GLU B  2  383 ? 79.512  63.267  61.579  1.00 103.88 ? 381  GLU B CG    1 
ATOM   6171  C  CD    . GLU B  2  383 ? 78.935  62.114  62.380  1.00 104.51 ? 381  GLU B CD    1 
ATOM   6172  O  OE1   . GLU B  2  383 ? 77.726  62.161  62.679  1.00 104.77 ? 381  GLU B OE1   1 
ATOM   6173  O  OE2   . GLU B  2  383 ? 79.683  61.164  62.705  1.00 104.86 ? 381  GLU B OE2   1 
ATOM   6174  N  N     . ILE B  2  384 ? 81.185  65.953  63.433  1.00 96.60  ? 382  ILE B N     1 
ATOM   6175  C  CA    . ILE B  2  384 ? 82.583  66.179  63.783  1.00 95.29  ? 382  ILE B CA    1 
ATOM   6176  C  C     . ILE B  2  384 ? 82.787  66.290  65.299  1.00 97.15  ? 382  ILE B C     1 
ATOM   6177  O  O     . ILE B  2  384 ? 83.583  65.551  65.889  1.00 98.54  ? 382  ILE B O     1 
ATOM   6178  C  CB    . ILE B  2  384 ? 83.101  67.479  63.126  1.00 92.44  ? 382  ILE B CB    1 
ATOM   6179  C  CG1   . ILE B  2  384 ? 83.124  67.308  61.613  1.00 90.71  ? 382  ILE B CG1   1 
ATOM   6180  C  CG2   . ILE B  2  384 ? 84.473  67.848  63.674  1.00 90.67  ? 382  ILE B CG2   1 
ATOM   6181  C  CD1   . ILE B  2  384 ? 83.612  68.525  60.867  1.00 90.12  ? 382  ILE B CD1   1 
ATOM   6182  N  N     . GLY B  2  385 ? 82.069  67.220  65.920  1.00 98.01  ? 383  GLY B N     1 
ATOM   6183  C  CA    . GLY B  2  385 ? 82.187  67.435  67.352  1.00 98.19  ? 383  GLY B CA    1 
ATOM   6184  C  C     . GLY B  2  385 ? 81.868  66.228  68.202  1.00 98.93  ? 383  GLY B C     1 
ATOM   6185  O  O     . GLY B  2  385 ? 82.570  65.965  69.173  1.00 98.42  ? 383  GLY B O     1 
ATOM   6186  N  N     . SER B  2  386 ? 80.811  65.502  67.846  1.00 100.47 ? 384  SER B N     1 
ATOM   6187  C  CA    . SER B  2  386 ? 80.407  64.312  68.594  1.00 102.47 ? 384  SER B CA    1 
ATOM   6188  C  C     . SER B  2  386 ? 81.584  63.377  68.811  1.00 103.96 ? 384  SER B C     1 
ATOM   6189  O  O     . SER B  2  386 ? 81.788  62.864  69.913  1.00 104.11 ? 384  SER B O     1 
ATOM   6190  C  CB    . SER B  2  386 ? 79.292  63.564  67.861  1.00 102.29 ? 384  SER B CB    1 
ATOM   6191  O  OG    . SER B  2  386 ? 78.063  64.250  67.996  1.00 101.51 ? 384  SER B OG    1 
ATOM   6192  N  N     . GLU B  2  387 ? 82.353  63.150  67.751  1.00 105.26 ? 385  GLU B N     1 
ATOM   6193  C  CA    . GLU B  2  387 ? 83.521  62.293  67.845  1.00 105.74 ? 385  GLU B CA    1 
ATOM   6194  C  C     . GLU B  2  387 ? 84.581  62.970  68.692  1.00 104.84 ? 385  GLU B C     1 
ATOM   6195  O  O     . GLU B  2  387 ? 84.954  62.463  69.745  1.00 104.84 ? 385  GLU B O     1 
ATOM   6196  C  CB    . GLU B  2  387 ? 84.095  62.007  66.466  1.00 107.71 ? 385  GLU B CB    1 
ATOM   6197  C  CG    . GLU B  2  387 ? 83.172  61.197  65.589  1.00 112.54 ? 385  GLU B CG    1 
ATOM   6198  C  CD    . GLU B  2  387 ? 83.892  60.590  64.400  1.00 115.18 ? 385  GLU B CD    1 
ATOM   6199  O  OE1   . GLU B  2  387 ? 84.801  59.755  64.632  1.00 116.74 ? 385  GLU B OE1   1 
ATOM   6200  O  OE2   . GLU B  2  387 ? 83.549  60.948  63.243  1.00 116.06 ? 385  GLU B OE2   1 
ATOM   6201  N  N     . ALA B  2  388 ? 85.058  64.122  68.234  1.00 103.35 ? 386  ALA B N     1 
ATOM   6202  C  CA    . ALA B  2  388 ? 86.084  64.858  68.957  1.00 102.71 ? 386  ALA B CA    1 
ATOM   6203  C  C     . ALA B  2  388 ? 85.859  64.963  70.475  1.00 102.74 ? 386  ALA B C     1 
ATOM   6204  O  O     . ALA B  2  388 ? 86.755  65.393  71.193  1.00 103.37 ? 386  ALA B O     1 
ATOM   6205  C  CB    . ALA B  2  388 ? 86.239  66.244  68.358  1.00 102.06 ? 386  ALA B CB    1 
ATOM   6206  N  N     . LEU B  2  389 ? 84.684  64.576  70.970  1.00 102.41 ? 387  LEU B N     1 
ATOM   6207  C  CA    . LEU B  2  389 ? 84.409  64.644  72.409  1.00 102.21 ? 387  LEU B CA    1 
ATOM   6208  C  C     . LEU B  2  389 ? 84.432  63.254  73.058  1.00 103.60 ? 387  LEU B C     1 
ATOM   6209  O  O     . LEU B  2  389 ? 85.155  63.024  74.024  1.00 103.45 ? 387  LEU B O     1 
ATOM   6210  C  CB    . LEU B  2  389 ? 83.047  65.307  72.664  1.00 100.16 ? 387  LEU B CB    1 
ATOM   6211  C  CG    . LEU B  2  389 ? 82.726  65.751  74.099  1.00 98.44  ? 387  LEU B CG    1 
ATOM   6212  C  CD1   . LEU B  2  389 ? 83.483  67.036  74.413  1.00 97.07  ? 387  LEU B CD1   1 
ATOM   6213  C  CD2   . LEU B  2  389 ? 81.231  65.981  74.262  1.00 96.45  ? 387  LEU B CD2   1 
ATOM   6214  N  N     . LEU B  2  390 ? 83.634  62.333  72.523  1.00 105.97 ? 388  LEU B N     1 
ATOM   6215  C  CA    . LEU B  2  390 ? 83.550  60.960  73.034  1.00 107.96 ? 388  LEU B CA    1 
ATOM   6216  C  C     . LEU B  2  390 ? 84.565  60.037  72.354  1.00 109.08 ? 388  LEU B C     1 
ATOM   6217  O  O     . LEU B  2  390 ? 84.336  58.831  72.234  1.00 109.71 ? 388  LEU B O     1 
ATOM   6218  C  CB    . LEU B  2  390 ? 82.135  60.395  72.811  1.00 108.22 ? 388  LEU B CB    1 
ATOM   6219  C  CG    . LEU B  2  390 ? 80.990  60.862  73.716  1.00 108.33 ? 388  LEU B CG    1 
ATOM   6220  C  CD1   . LEU B  2  390 ? 79.655  60.502  73.085  1.00 108.69 ? 388  LEU B CD1   1 
ATOM   6221  C  CD2   . LEU B  2  390 ? 81.132  60.223  75.094  1.00 108.00 ? 388  LEU B CD2   1 
ATOM   6222  N  N     . SER B  2  391 ? 85.682  60.606  71.909  1.00 109.88 ? 389  SER B N     1 
ATOM   6223  C  CA    . SER B  2  391 ? 86.728  59.845  71.226  1.00 110.43 ? 389  SER B CA    1 
ATOM   6224  C  C     . SER B  2  391 ? 88.014  60.656  71.201  1.00 110.84 ? 389  SER B C     1 
ATOM   6225  O  O     . SER B  2  391 ? 88.898  60.459  72.025  1.00 110.80 ? 389  SER B O     1 
ATOM   6226  C  CB    . SER B  2  391 ? 86.296  59.517  69.790  1.00 110.55 ? 389  SER B CB    1 
ATOM   6227  O  OG    . SER B  2  391 ? 87.377  59.043  69.004  1.00 110.28 ? 389  SER B OG    1 
ATOM   6228  N  N     . GLY B  2  392 ? 88.103  61.578  70.252  1.00 111.70 ? 390  GLY B N     1 
ATOM   6229  C  CA    . GLY B  2  392 ? 89.278  62.413  70.134  1.00 113.50 ? 390  GLY B CA    1 
ATOM   6230  C  C     . GLY B  2  392 ? 89.792  62.263  68.729  1.00 115.55 ? 390  GLY B C     1 
ATOM   6231  O  O     . GLY B  2  392 ? 90.875  62.733  68.396  1.00 116.27 ? 390  GLY B O     1 
ATOM   6232  N  N     . THR B  2  393 ? 88.991  61.611  67.896  1.00 117.55 ? 391  THR B N     1 
ATOM   6233  C  CA    . THR B  2  393 ? 89.364  61.363  66.513  1.00 120.48 ? 391  THR B CA    1 
ATOM   6234  C  C     . THR B  2  393 ? 88.182  61.473  65.558  1.00 121.53 ? 391  THR B C     1 
ATOM   6235  O  O     . THR B  2  393 ? 87.053  61.704  65.984  1.00 122.32 ? 391  THR B O     1 
ATOM   6236  C  CB    . THR B  2  393 ? 89.957  59.958  66.373  1.00 121.47 ? 391  THR B CB    1 
ATOM   6237  O  OG1   . THR B  2  393 ? 89.115  59.024  67.066  1.00 122.08 ? 391  THR B OG1   1 
ATOM   6238  C  CG2   . THR B  2  393 ? 91.365  59.908  66.950  1.00 122.09 ? 391  THR B CG2   1 
ATOM   6239  N  N     . HIS B  2  394 ? 88.456  61.291  64.267  1.00 122.48 ? 392  HIS B N     1 
ATOM   6240  C  CA    . HIS B  2  394 ? 87.427  61.360  63.234  1.00 123.39 ? 392  HIS B CA    1 
ATOM   6241  C  C     . HIS B  2  394 ? 87.427  60.146  62.311  1.00 122.98 ? 392  HIS B C     1 
ATOM   6242  O  O     . HIS B  2  394 ? 88.273  60.022  61.429  1.00 122.81 ? 392  HIS B O     1 
ATOM   6243  C  CB    . HIS B  2  394 ? 87.595  62.636  62.403  1.00 125.70 ? 392  HIS B CB    1 
ATOM   6244  C  CG    . HIS B  2  394 ? 86.708  62.695  61.193  1.00 128.51 ? 392  HIS B CG    1 
ATOM   6245  N  ND1   . HIS B  2  394 ? 87.032  62.080  60.001  1.00 129.22 ? 392  HIS B ND1   1 
ATOM   6246  C  CD2   . HIS B  2  394 ? 85.514  63.303  60.990  1.00 129.17 ? 392  HIS B CD2   1 
ATOM   6247  C  CE1   . HIS B  2  394 ? 86.078  62.310  59.114  1.00 129.40 ? 392  HIS B CE1   1 
ATOM   6248  N  NE2   . HIS B  2  394 ? 85.146  63.050  59.689  1.00 129.80 ? 392  HIS B NE2   1 
ATOM   6249  N  N     . THR B  2  395 ? 86.461  59.258  62.522  1.00 123.00 ? 393  THR B N     1 
ATOM   6250  C  CA    . THR B  2  395 ? 86.306  58.048  61.719  1.00 123.21 ? 393  THR B CA    1 
ATOM   6251  C  C     . THR B  2  395 ? 85.937  58.435  60.288  1.00 124.54 ? 393  THR B C     1 
ATOM   6252  O  O     . THR B  2  395 ? 84.836  58.922  60.047  1.00 125.10 ? 393  THR B O     1 
ATOM   6253  C  CB    . THR B  2  395 ? 85.172  57.143  62.285  1.00 122.06 ? 393  THR B CB    1 
ATOM   6254  O  OG1   . THR B  2  395 ? 85.506  56.708  63.610  1.00 120.58 ? 393  THR B OG1   1 
ATOM   6255  C  CG2   . THR B  2  395 ? 84.955  55.933  61.397  1.00 121.28 ? 393  THR B CG2   1 
ATOM   6256  N  N     . ALA B  2  396 ? 86.849  58.218  59.344  1.00 126.11 ? 394  ALA B N     1 
ATOM   6257  C  CA    . ALA B  2  396 ? 86.595  58.547  57.939  1.00 127.59 ? 394  ALA B CA    1 
ATOM   6258  C  C     . ALA B  2  396 ? 85.239  58.003  57.478  1.00 128.86 ? 394  ALA B C     1 
ATOM   6259  O  O     . ALA B  2  396 ? 84.781  56.955  57.949  1.00 128.92 ? 394  ALA B O     1 
ATOM   6260  C  CB    . ALA B  2  396 ? 87.702  57.985  57.063  1.00 127.52 ? 394  ALA B CB    1 
ATOM   6261  N  N     . PRO B  2  397 ? 84.580  58.707  56.540  1.00 129.74 ? 395  PRO B N     1 
ATOM   6262  C  CA    . PRO B  2  397 ? 83.272  58.264  56.042  1.00 129.92 ? 395  PRO B CA    1 
ATOM   6263  C  C     . PRO B  2  397 ? 83.296  56.869  55.421  1.00 130.05 ? 395  PRO B C     1 
ATOM   6264  O  O     . PRO B  2  397 ? 82.296  56.152  55.450  1.00 129.92 ? 395  PRO B O     1 
ATOM   6265  C  CB    . PRO B  2  397 ? 82.897  59.354  55.035  1.00 129.87 ? 395  PRO B CB    1 
ATOM   6266  C  CG    . PRO B  2  397 ? 84.232  59.816  54.528  1.00 130.15 ? 395  PRO B CG    1 
ATOM   6267  C  CD    . PRO B  2  397 ? 85.055  59.889  55.797  1.00 129.87 ? 395  PRO B CD    1 
ATOM   6268  N  N     . SER B  2  398 ? 84.442  56.492  54.864  1.00 130.38 ? 396  SER B N     1 
ATOM   6269  C  CA    . SER B  2  398 ? 84.593  55.183  54.237  1.00 130.39 ? 396  SER B CA    1 
ATOM   6270  C  C     . SER B  2  398 ? 84.710  54.100  55.301  1.00 130.07 ? 396  SER B C     1 
ATOM   6271  O  O     . SER B  2  398 ? 84.321  52.949  55.076  1.00 129.25 ? 396  SER B O     1 
ATOM   6272  C  CB    . SER B  2  398 ? 85.835  55.171  53.342  1.00 130.48 ? 396  SER B CB    1 
ATOM   6273  O  OG    . SER B  2  398 ? 87.002  55.464  54.092  1.00 131.44 ? 396  SER B OG    1 
ATOM   6274  N  N     . VAL B  2  399 ? 85.248  54.485  56.458  1.00 130.02 ? 397  VAL B N     1 
ATOM   6275  C  CA    . VAL B  2  399 ? 85.430  53.568  57.579  1.00 130.33 ? 397  VAL B CA    1 
ATOM   6276  C  C     . VAL B  2  399 ? 84.086  53.260  58.219  1.00 130.83 ? 397  VAL B C     1 
ATOM   6277  O  O     . VAL B  2  399 ? 83.804  52.112  58.570  1.00 131.03 ? 397  VAL B O     1 
ATOM   6278  C  CB    . VAL B  2  399 ? 86.363  54.166  58.666  1.00 129.93 ? 397  VAL B CB    1 
ATOM   6279  C  CG1   . VAL B  2  399 ? 86.531  53.173  59.812  1.00 128.95 ? 397  VAL B CG1   1 
ATOM   6280  C  CG2   . VAL B  2  399 ? 87.715  54.523  58.063  1.00 129.40 ? 397  VAL B CG2   1 
ATOM   6281  N  N     . VAL B  2  400 ? 83.262  54.292  58.374  1.00 131.04 ? 398  VAL B N     1 
ATOM   6282  C  CA    . VAL B  2  400 ? 81.946  54.118  58.970  1.00 130.95 ? 398  VAL B CA    1 
ATOM   6283  C  C     . VAL B  2  400 ? 81.093  53.281  58.021  1.00 130.47 ? 398  VAL B C     1 
ATOM   6284  O  O     . VAL B  2  400 ? 80.188  52.569  58.450  1.00 130.21 ? 398  VAL B O     1 
ATOM   6285  C  CB    . VAL B  2  400 ? 81.274  55.484  59.239  1.00 131.21 ? 398  VAL B CB    1 
ATOM   6286  C  CG1   . VAL B  2  400 ? 81.166  56.276  57.953  1.00 131.76 ? 398  VAL B CG1   1 
ATOM   6287  C  CG2   . VAL B  2  400 ? 79.906  55.274  59.862  1.00 131.36 ? 398  VAL B CG2   1 
ATOM   6288  N  N     . ALA B  2  401 ? 81.401  53.365  56.730  1.00 130.29 ? 399  ALA B N     1 
ATOM   6289  C  CA    . ALA B  2  401 ? 80.685  52.599  55.719  1.00 130.15 ? 399  ALA B CA    1 
ATOM   6290  C  C     . ALA B  2  401 ? 81.138  51.146  55.818  1.00 130.46 ? 399  ALA B C     1 
ATOM   6291  O  O     . ALA B  2  401 ? 80.331  50.225  55.743  1.00 129.13 ? 399  ALA B O     1 
ATOM   6292  C  CB    . ALA B  2  401 ? 80.988  53.151  54.337  1.00 130.17 ? 399  ALA B CB    1 
ATOM   6293  N  N     . GLN B  2  402 ? 82.442  50.950  55.990  1.00 131.73 ? 400  GLN B N     1 
ATOM   6294  C  CA    . GLN B  2  402 ? 83.016  49.608  56.111  1.00 132.58 ? 400  GLN B CA    1 
ATOM   6295  C  C     . GLN B  2  402 ? 82.477  48.891  57.345  1.00 132.16 ? 400  GLN B C     1 
ATOM   6296  O  O     . GLN B  2  402 ? 82.348  47.664  57.357  1.00 131.84 ? 400  GLN B O     1 
ATOM   6297  C  CB    . GLN B  2  402 ? 84.543  49.691  56.208  1.00 133.63 ? 400  GLN B CB    1 
ATOM   6298  C  CG    . GLN B  2  402 ? 85.213  48.382  56.614  1.00 135.33 ? 400  GLN B CG    1 
ATOM   6299  C  CD    . GLN B  2  402 ? 86.693  48.554  56.928  1.00 136.59 ? 400  GLN B CD    1 
ATOM   6300  O  OE1   . GLN B  2  402 ? 87.487  48.924  56.059  1.00 137.03 ? 400  GLN B OE1   1 
ATOM   6301  N  NE2   . GLN B  2  402 ? 87.069  48.288  58.178  1.00 136.19 ? 400  GLN B NE2   1 
ATOM   6302  N  N     . LYS B  2  403 ? 82.183  49.672  58.381  1.00 131.85 ? 401  LYS B N     1 
ATOM   6303  C  CA    . LYS B  2  403 ? 81.663  49.145  59.640  1.00 131.68 ? 401  LYS B CA    1 
ATOM   6304  C  C     . LYS B  2  403 ? 80.202  48.763  59.498  1.00 131.08 ? 401  LYS B C     1 
ATOM   6305  O  O     . LYS B  2  403 ? 79.739  47.790  60.095  1.00 130.87 ? 401  LYS B O     1 
ATOM   6306  C  CB    . LYS B  2  403 ? 81.776  50.194  60.755  1.00 132.46 ? 401  LYS B CB    1 
ATOM   6307  C  CG    . LYS B  2  403 ? 83.190  50.596  61.134  1.00 134.45 ? 401  LYS B CG    1 
ATOM   6308  C  CD    . LYS B  2  403 ? 83.936  49.458  61.813  1.00 135.78 ? 401  LYS B CD    1 
ATOM   6309  C  CE    . LYS B  2  403 ? 85.325  49.895  62.255  1.00 136.46 ? 401  LYS B CE    1 
ATOM   6310  N  NZ    . LYS B  2  403 ? 86.063  48.794  62.939  1.00 137.07 ? 401  LYS B NZ    1 
ATOM   6311  N  N     . ILE B  2  404 ? 79.475  49.535  58.699  1.00 130.33 ? 402  ILE B N     1 
ATOM   6312  C  CA    . ILE B  2  404 ? 78.052  49.294  58.526  1.00 129.23 ? 402  ILE B CA    1 
ATOM   6313  C  C     . ILE B  2  404 ? 77.719  48.038  57.714  1.00 127.67 ? 402  ILE B C     1 
ATOM   6314  O  O     . ILE B  2  404 ? 77.011  47.166  58.216  1.00 127.70 ? 402  ILE B O     1 
ATOM   6315  C  CB    . ILE B  2  404 ? 77.342  50.580  57.948  1.00 129.59 ? 402  ILE B CB    1 
ATOM   6316  C  CG1   . ILE B  2  404 ? 75.818  50.401  57.929  1.00 129.29 ? 402  ILE B CG1   1 
ATOM   6317  C  CG2   . ILE B  2  404 ? 77.883  50.918  56.570  1.00 130.57 ? 402  ILE B CG2   1 
ATOM   6318  C  CD1   . ILE B  2  404 ? 75.282  49.555  56.786  1.00 128.64 ? 402  ILE B CD1   1 
ATOM   6319  N  N     . ASP B  2  405 ? 78.227  47.914  56.488  1.00 125.75 ? 403  ASP B N     1 
ATOM   6320  C  CA    . ASP B  2  405 ? 77.912  46.727  55.690  1.00 123.59 ? 403  ASP B CA    1 
ATOM   6321  C  C     . ASP B  2  405 ? 78.555  45.460  56.238  1.00 121.24 ? 403  ASP B C     1 
ATOM   6322  O  O     . ASP B  2  405 ? 78.195  44.358  55.834  1.00 120.75 ? 403  ASP B O     1 
ATOM   6323  C  CB    . ASP B  2  405 ? 78.293  46.913  54.209  1.00 124.77 ? 403  ASP B CB    1 
ATOM   6324  C  CG    . ASP B  2  405 ? 79.613  47.630  54.027  1.00 126.43 ? 403  ASP B CG    1 
ATOM   6325  O  OD1   . ASP B  2  405 ? 80.540  47.378  54.829  1.00 128.34 ? 403  ASP B OD1   1 
ATOM   6326  O  OD2   . ASP B  2  405 ? 79.725  48.438  53.073  1.00 125.84 ? 403  ASP B OD2   1 
ATOM   6327  N  N     . SER B  2  406 ? 79.498  45.615  57.163  1.00 119.00 ? 404  SER B N     1 
ATOM   6328  C  CA    . SER B  2  406 ? 80.162  44.462  57.768  1.00 116.79 ? 404  SER B CA    1 
ATOM   6329  C  C     . SER B  2  406 ? 79.270  43.915  58.886  1.00 115.50 ? 404  SER B C     1 
ATOM   6330  O  O     . SER B  2  406 ? 79.729  43.643  60.000  1.00 114.27 ? 404  SER B O     1 
ATOM   6331  C  CB    . SER B  2  406 ? 81.522  44.872  58.339  1.00 116.35 ? 404  SER B CB    1 
ATOM   6332  O  OG    . SER B  2  406 ? 81.373  45.617  59.533  1.00 115.01 ? 404  SER B OG    1 
ATOM   6333  N  N     . VAL B  2  407 ? 77.987  43.764  58.570  1.00 114.50 ? 405  VAL B N     1 
ATOM   6334  C  CA    . VAL B  2  407 ? 76.995  43.273  59.522  1.00 113.50 ? 405  VAL B CA    1 
ATOM   6335  C  C     . VAL B  2  407 ? 76.217  42.106  58.923  1.00 113.19 ? 405  VAL B C     1 
ATOM   6336  O  O     . VAL B  2  407 ? 75.421  42.273  58.001  1.00 112.52 ? 405  VAL B O     1 
ATOM   6337  C  CB    . VAL B  2  407 ? 76.003  44.398  59.916  1.00 112.94 ? 405  VAL B CB    1 
ATOM   6338  C  CG1   . VAL B  2  407 ? 74.941  43.856  60.854  1.00 112.46 ? 405  VAL B CG1   1 
ATOM   6339  C  CG2   . VAL B  2  407 ? 76.754  45.546  60.575  1.00 112.06 ? 405  VAL B CG2   1 
ATOM   6340  N  N     . THR B  2  408 ? 76.448  40.921  59.473  1.00 113.55 ? 406  THR B N     1 
ATOM   6341  C  CA    . THR B  2  408 ? 75.808  39.697  59.004  1.00 113.36 ? 406  THR B CA    1 
ATOM   6342  C  C     . THR B  2  408 ? 74.302  39.726  59.107  1.00 112.12 ? 406  THR B C     1 
ATOM   6343  O  O     . THR B  2  408 ? 73.724  40.540  59.821  1.00 112.02 ? 406  THR B O     1 
ATOM   6344  C  CB    . THR B  2  408 ? 76.260  38.461  59.820  1.00 114.64 ? 406  THR B CB    1 
ATOM   6345  O  OG1   . THR B  2  408 ? 75.594  38.467  61.091  1.00 115.13 ? 406  THR B OG1   1 
ATOM   6346  C  CG2   . THR B  2  408 ? 77.774  38.476  60.048  1.00 115.54 ? 406  THR B CG2   1 
ATOM   6347  N  N     . SER B  2  409 ? 73.679  38.801  58.393  1.00 111.36 ? 407  SER B N     1 
ATOM   6348  C  CA    . SER B  2  409 ? 72.239  38.655  58.412  1.00 111.22 ? 407  SER B CA    1 
ATOM   6349  C  C     . SER B  2  409 ? 71.843  38.113  59.784  1.00 111.18 ? 407  SER B C     1 
ATOM   6350  O  O     . SER B  2  409 ? 70.675  38.137  60.168  1.00 111.05 ? 407  SER B O     1 
ATOM   6351  C  CB    . SER B  2  409 ? 71.816  37.669  57.329  1.00 111.18 ? 407  SER B CB    1 
ATOM   6352  O  OG    . SER B  2  409 ? 70.522  37.148  57.585  1.00 112.20 ? 407  SER B OG    1 
ATOM   6353  N  N     . ALA B  2  410 ? 72.833  37.619  60.518  1.00 111.48 ? 408  ALA B N     1 
ATOM   6354  C  CA    . ALA B  2  410 ? 72.605  37.055  61.844  1.00 111.15 ? 408  ALA B CA    1 
ATOM   6355  C  C     . ALA B  2  410 ? 72.558  38.142  62.904  1.00 110.71 ? 408  ALA B C     1 
ATOM   6356  O  O     . ALA B  2  410 ? 71.606  38.208  63.679  1.00 110.75 ? 408  ALA B O     1 
ATOM   6357  C  CB    . ALA B  2  410 ? 73.698  36.058  62.179  1.00 111.95 ? 408  ALA B CB    1 
ATOM   6358  N  N     . ASP B  2  411 ? 73.592  38.980  62.939  1.00 109.95 ? 409  ASP B N     1 
ATOM   6359  C  CA    . ASP B  2  411 ? 73.666  40.080  63.901  1.00 110.00 ? 409  ASP B CA    1 
ATOM   6360  C  C     . ASP B  2  411 ? 72.290  40.718  64.039  1.00 109.91 ? 409  ASP B C     1 
ATOM   6361  O  O     . ASP B  2  411 ? 71.837  41.041  65.144  1.00 109.82 ? 409  ASP B O     1 
ATOM   6362  C  CB    . ASP B  2  411 ? 74.650  41.149  63.420  1.00 109.65 ? 409  ASP B CB    1 
ATOM   6363  C  CG    . ASP B  2  411 ? 76.080  40.671  63.412  1.00 108.88 ? 409  ASP B CG    1 
ATOM   6364  O  OD1   . ASP B  2  411 ? 76.567  40.229  64.474  1.00 108.88 ? 409  ASP B OD1   1 
ATOM   6365  O  OD2   . ASP B  2  411 ? 76.720  40.750  62.345  1.00 108.29 ? 409  ASP B OD2   1 
ATOM   6366  N  N     . VAL B  2  412 ? 71.649  40.902  62.886  1.00 109.18 ? 410  VAL B N     1 
ATOM   6367  C  CA    . VAL B  2  412 ? 70.321  41.484  62.792  1.00 107.83 ? 410  VAL B CA    1 
ATOM   6368  C  C     . VAL B  2  412 ? 69.301  40.624  63.539  1.00 107.61 ? 410  VAL B C     1 
ATOM   6369  O  O     . VAL B  2  412 ? 68.710  41.074  64.522  1.00 107.97 ? 410  VAL B O     1 
ATOM   6370  C  CB    . VAL B  2  412 ? 69.916  41.633  61.308  1.00 107.32 ? 410  VAL B CB    1 
ATOM   6371  C  CG1   . VAL B  2  412 ? 68.440  41.970  61.190  1.00 106.92 ? 410  VAL B CG1   1 
ATOM   6372  C  CG2   . VAL B  2  412 ? 70.773  42.714  60.654  1.00 105.69 ? 410  VAL B CG2   1 
ATOM   6373  N  N     . VAL B  2  413 ? 69.106  39.388  63.090  1.00 106.89 ? 411  VAL B N     1 
ATOM   6374  C  CA    . VAL B  2  413 ? 68.149  38.503  63.746  1.00 107.00 ? 411  VAL B CA    1 
ATOM   6375  C  C     . VAL B  2  413 ? 68.414  38.394  65.247  1.00 107.83 ? 411  VAL B C     1 
ATOM   6376  O  O     . VAL B  2  413 ? 67.471  38.294  66.037  1.00 107.25 ? 411  VAL B O     1 
ATOM   6377  C  CB    . VAL B  2  413 ? 68.179  37.092  63.144  1.00 106.24 ? 411  VAL B CB    1 
ATOM   6378  C  CG1   . VAL B  2  413 ? 67.024  36.273  63.700  1.00 105.20 ? 411  VAL B CG1   1 
ATOM   6379  C  CG2   . VAL B  2  413 ? 68.105  37.169  61.631  1.00 106.18 ? 411  VAL B CG2   1 
ATOM   6380  N  N     . ASN B  2  414 ? 69.693  38.410  65.636  1.00 108.86 ? 412  ASN B N     1 
ATOM   6381  C  CA    . ASN B  2  414 ? 70.073  38.328  67.055  1.00 109.73 ? 412  ASN B CA    1 
ATOM   6382  C  C     . ASN B  2  414 ? 69.600  39.585  67.785  1.00 108.98 ? 412  ASN B C     1 
ATOM   6383  O  O     . ASN B  2  414 ? 69.040  39.504  68.884  1.00 109.43 ? 412  ASN B O     1 
ATOM   6384  C  CB    . ASN B  2  414 ? 71.601  38.204  67.236  1.00 111.68 ? 412  ASN B CB    1 
ATOM   6385  C  CG    . ASN B  2  414 ? 72.151  36.842  66.807  1.00 112.25 ? 412  ASN B CG    1 
ATOM   6386  O  OD1   . ASN B  2  414 ? 71.570  35.792  67.110  1.00 110.94 ? 412  ASN B OD1   1 
ATOM   6387  N  ND2   . ASN B  2  414 ? 73.292  36.860  66.115  1.00 112.04 ? 412  ASN B ND2   1 
ATOM   6388  N  N     . ALA B  2  415 ? 69.853  40.745  67.181  1.00 107.10 ? 413  ALA B N     1 
ATOM   6389  C  CA    . ALA B  2  415 ? 69.427  42.006  67.764  1.00 104.49 ? 413  ALA B CA    1 
ATOM   6390  C  C     . ALA B  2  415 ? 67.953  41.815  68.069  1.00 103.51 ? 413  ALA B C     1 
ATOM   6391  O  O     . ALA B  2  415 ? 67.517  41.970  69.209  1.00 103.12 ? 413  ALA B O     1 
ATOM   6392  C  CB    . ALA B  2  415 ? 69.620  43.133  66.769  1.00 103.80 ? 413  ALA B CB    1 
ATOM   6393  N  N     . ALA B  2  416 ? 67.201  41.437  67.040  1.00 102.54 ? 414  ALA B N     1 
ATOM   6394  C  CA    . ALA B  2  416 ? 65.771  41.202  67.169  1.00 102.69 ? 414  ALA B CA    1 
ATOM   6395  C  C     . ALA B  2  416 ? 65.476  40.320  68.378  1.00 103.29 ? 414  ALA B C     1 
ATOM   6396  O  O     . ALA B  2  416 ? 64.600  40.629  69.189  1.00 102.61 ? 414  ALA B O     1 
ATOM   6397  C  CB    . ALA B  2  416 ? 65.244  40.551  65.904  1.00 102.12 ? 414  ALA B CB    1 
ATOM   6398  N  N     . LYS B  2  417 ? 66.212  39.218  68.492  1.00 104.75 ? 415  LYS B N     1 
ATOM   6399  C  CA    . LYS B  2  417 ? 66.041  38.285  69.608  1.00 105.30 ? 415  LYS B CA    1 
ATOM   6400  C  C     . LYS B  2  417 ? 66.185  39.021  70.935  1.00 104.37 ? 415  LYS B C     1 
ATOM   6401  O  O     . LYS B  2  417 ? 65.263  39.041  71.758  1.00 103.83 ? 415  LYS B O     1 
ATOM   6402  C  CB    . LYS B  2  417 ? 67.100  37.174  69.566  1.00 107.24 ? 415  LYS B CB    1 
ATOM   6403  C  CG    . LYS B  2  417 ? 66.945  36.118  68.487  1.00 108.97 ? 415  LYS B CG    1 
ATOM   6404  C  CD    . LYS B  2  417 ? 68.064  35.084  68.632  1.00 111.79 ? 415  LYS B CD    1 
ATOM   6405  C  CE    . LYS B  2  417 ? 68.006  33.999  67.559  1.00 114.08 ? 415  LYS B CE    1 
ATOM   6406  N  NZ    . LYS B  2  417 ? 69.204  33.098  67.596  1.00 115.23 ? 415  LYS B NZ    1 
ATOM   6407  N  N     . LYS B  2  418 ? 67.363  39.615  71.125  1.00 103.15 ? 416  LYS B N     1 
ATOM   6408  C  CA    . LYS B  2  418 ? 67.690  40.348  72.337  1.00 101.93 ? 416  LYS B CA    1 
ATOM   6409  C  C     . LYS B  2  418 ? 66.503  41.180  72.805  1.00 101.16 ? 416  LYS B C     1 
ATOM   6410  O  O     . LYS B  2  418 ? 66.331  41.410  74.005  1.00 100.93 ? 416  LYS B O     1 
ATOM   6411  C  CB    . LYS B  2  418 ? 68.909  41.248  72.096  1.00 101.68 ? 416  LYS B CB    1 
ATOM   6412  C  CG    . LYS B  2  418 ? 69.425  41.881  73.372  1.00 102.79 ? 416  LYS B CG    1 
ATOM   6413  C  CD    . LYS B  2  418 ? 70.692  42.694  73.175  1.00 103.48 ? 416  LYS B CD    1 
ATOM   6414  C  CE    . LYS B  2  418 ? 71.166  43.255  74.521  1.00 103.80 ? 416  LYS B CE    1 
ATOM   6415  N  NZ    . LYS B  2  418 ? 72.354  44.146  74.425  1.00 103.06 ? 416  LYS B NZ    1 
ATOM   6416  N  N     . PHE B  2  419 ? 65.686  41.615  71.846  1.00 99.97  ? 417  PHE B N     1 
ATOM   6417  C  CA    . PHE B  2  419 ? 64.507  42.419  72.129  1.00 98.37  ? 417  PHE B CA    1 
ATOM   6418  C  C     . PHE B  2  419 ? 63.356  41.561  72.620  1.00 98.27  ? 417  PHE B C     1 
ATOM   6419  O  O     . PHE B  2  419 ? 62.738  41.874  73.634  1.00 98.20  ? 417  PHE B O     1 
ATOM   6420  C  CB    . PHE B  2  419 ? 64.049  43.173  70.878  1.00 97.21  ? 417  PHE B CB    1 
ATOM   6421  C  CG    . PHE B  2  419 ? 62.787  43.983  71.085  1.00 96.00  ? 417  PHE B CG    1 
ATOM   6422  C  CD1   . PHE B  2  419 ? 62.851  45.315  71.501  1.00 95.14  ? 417  PHE B CD1   1 
ATOM   6423  C  CD2   . PHE B  2  419 ? 61.535  43.394  70.915  1.00 94.33  ? 417  PHE B CD2   1 
ATOM   6424  C  CE1   . PHE B  2  419 ? 61.689  46.039  71.744  1.00 93.47  ? 417  PHE B CE1   1 
ATOM   6425  C  CE2   . PHE B  2  419 ? 60.375  44.105  71.158  1.00 92.87  ? 417  PHE B CE2   1 
ATOM   6426  C  CZ    . PHE B  2  419 ? 60.446  45.427  71.573  1.00 93.25  ? 417  PHE B CZ    1 
ATOM   6427  N  N     . VAL B  2  420 ? 63.063  40.486  71.896  1.00 98.74  ? 418  VAL B N     1 
ATOM   6428  C  CA    . VAL B  2  420 ? 61.955  39.607  72.264  1.00 100.35 ? 418  VAL B CA    1 
ATOM   6429  C  C     . VAL B  2  420 ? 62.210  38.889  73.575  1.00 102.31 ? 418  VAL B C     1 
ATOM   6430  O  O     . VAL B  2  420 ? 61.290  38.328  74.179  1.00 102.32 ? 418  VAL B O     1 
ATOM   6431  C  CB    . VAL B  2  420 ? 61.694  38.531  71.201  1.00 99.38  ? 418  VAL B CB    1 
ATOM   6432  C  CG1   . VAL B  2  420 ? 60.288  37.969  71.375  1.00 97.48  ? 418  VAL B CG1   1 
ATOM   6433  C  CG2   . VAL B  2  420 ? 61.905  39.106  69.808  1.00 99.28  ? 418  VAL B CG2   1 
ATOM   6434  N  N     . SER B  2  421 ? 63.467  38.911  74.006  1.00 104.54 ? 419  SER B N     1 
ATOM   6435  C  CA    . SER B  2  421 ? 63.874  38.257  75.247  1.00 106.41 ? 419  SER B CA    1 
ATOM   6436  C  C     . SER B  2  421 ? 63.985  39.234  76.430  1.00 107.19 ? 419  SER B C     1 
ATOM   6437  O  O     . SER B  2  421 ? 63.321  39.053  77.461  1.00 107.83 ? 419  SER B O     1 
ATOM   6438  C  CB    . SER B  2  421 ? 65.213  37.540  75.033  1.00 106.38 ? 419  SER B CB    1 
ATOM   6439  O  OG    . SER B  2  421 ? 66.210  38.447  74.589  1.00 106.67 ? 419  SER B OG    1 
ATOM   6440  N  N     . GLY B  2  422 ? 64.822  40.263  76.271  1.00 107.33 ? 420  GLY B N     1 
ATOM   6441  C  CA    . GLY B  2  422 ? 65.024  41.256  77.316  1.00 106.94 ? 420  GLY B CA    1 
ATOM   6442  C  C     . GLY B  2  422 ? 63.762  41.748  78.017  1.00 106.86 ? 420  GLY B C     1 
ATOM   6443  O  O     . GLY B  2  422 ? 62.634  41.523  77.550  1.00 106.86 ? 420  GLY B O     1 
ATOM   6444  N  N     . LYS B  2  423 ? 63.956  42.421  79.151  1.00 105.84 ? 421  LYS B N     1 
ATOM   6445  C  CA    . LYS B  2  423 ? 62.844  42.957  79.933  1.00 103.85 ? 421  LYS B CA    1 
ATOM   6446  C  C     . LYS B  2  423 ? 62.438  44.275  79.287  1.00 102.82 ? 421  LYS B C     1 
ATOM   6447  O  O     . LYS B  2  423 ? 63.265  45.185  79.136  1.00 102.85 ? 421  LYS B O     1 
ATOM   6448  C  CB    . LYS B  2  423 ? 63.284  43.187  81.384  1.00 104.03 ? 421  LYS B CB    1 
ATOM   6449  C  CG    . LYS B  2  423 ? 62.160  43.490  82.363  1.00 104.00 ? 421  LYS B CG    1 
ATOM   6450  C  CD    . LYS B  2  423 ? 62.717  43.830  83.748  1.00 105.00 ? 421  LYS B CD    1 
ATOM   6451  C  CE    . LYS B  2  423 ? 61.615  44.270  84.724  1.00 106.09 ? 421  LYS B CE    1 
ATOM   6452  N  NZ    . LYS B  2  423 ? 62.110  44.695  86.080  1.00 105.58 ? 421  LYS B NZ    1 
ATOM   6453  N  N     . LYS B  2  424 ? 61.169  44.367  78.894  1.00 100.81 ? 422  LYS B N     1 
ATOM   6454  C  CA    . LYS B  2  424 ? 60.662  45.569  78.241  1.00 98.43  ? 422  LYS B CA    1 
ATOM   6455  C  C     . LYS B  2  424 ? 60.098  46.617  79.192  1.00 97.30  ? 422  LYS B C     1 
ATOM   6456  O  O     . LYS B  2  424 ? 59.602  46.295  80.271  1.00 96.84  ? 422  LYS B O     1 
ATOM   6457  C  CB    . LYS B  2  424 ? 59.581  45.205  77.220  1.00 97.35  ? 422  LYS B CB    1 
ATOM   6458  C  CG    . LYS B  2  424 ? 60.071  44.428  76.015  1.00 95.63  ? 422  LYS B CG    1 
ATOM   6459  C  CD    . LYS B  2  424 ? 59.768  42.960  76.148  1.00 95.55  ? 422  LYS B CD    1 
ATOM   6460  C  CE    . LYS B  2  424 ? 60.013  42.240  74.836  1.00 95.40  ? 422  LYS B CE    1 
ATOM   6461  N  NZ    . LYS B  2  424 ? 59.588  40.810  74.900  1.00 95.27  ? 422  LYS B NZ    1 
ATOM   6462  N  N     . SER B  2  425 ? 60.206  47.877  78.773  1.00 96.61  ? 423  SER B N     1 
ATOM   6463  C  CA    . SER B  2  425 ? 59.686  49.029  79.512  1.00 95.49  ? 423  SER B CA    1 
ATOM   6464  C  C     . SER B  2  425 ? 58.827  49.798  78.505  1.00 94.04  ? 423  SER B C     1 
ATOM   6465  O  O     . SER B  2  425 ? 59.280  50.109  77.401  1.00 94.12  ? 423  SER B O     1 
ATOM   6466  C  CB    . SER B  2  425 ? 60.826  49.914  80.064  1.00 95.57  ? 423  SER B CB    1 
ATOM   6467  O  OG    . SER B  2  425 ? 61.719  50.340  79.056  1.00 95.60  ? 423  SER B OG    1 
ATOM   6468  N  N     . MET B  2  426 ? 57.586  50.090  78.890  1.00 92.42  ? 424  MET B N     1 
ATOM   6469  C  CA    . MET B  2  426 ? 56.636  50.770  78.009  1.00 90.80  ? 424  MET B CA    1 
ATOM   6470  C  C     . MET B  2  426 ? 56.086  52.115  78.513  1.00 90.36  ? 424  MET B C     1 
ATOM   6471  O  O     . MET B  2  426 ? 55.806  52.291  79.698  1.00 89.89  ? 424  MET B O     1 
ATOM   6472  C  CB    . MET B  2  426 ? 55.480  49.807  77.713  1.00 88.99  ? 424  MET B CB    1 
ATOM   6473  C  CG    . MET B  2  426 ? 54.349  50.370  76.894  1.00 87.25  ? 424  MET B CG    1 
ATOM   6474  S  SD    . MET B  2  426 ? 52.832  49.461  77.270  1.00 89.69  ? 424  MET B SD    1 
ATOM   6475  C  CE    . MET B  2  426 ? 52.516  48.611  75.756  1.00 87.96  ? 424  MET B CE    1 
ATOM   6476  N  N     . ALA B  2  427 ? 55.936  53.059  77.590  1.00 90.15  ? 425  ALA B N     1 
ATOM   6477  C  CA    . ALA B  2  427 ? 55.408  54.386  77.890  1.00 90.00  ? 425  ALA B CA    1 
ATOM   6478  C  C     . ALA B  2  427 ? 54.280  54.666  76.898  1.00 90.43  ? 425  ALA B C     1 
ATOM   6479  O  O     . ALA B  2  427 ? 54.474  54.548  75.693  1.00 91.27  ? 425  ALA B O     1 
ATOM   6480  C  CB    . ALA B  2  427 ? 56.504  55.427  77.747  1.00 88.52  ? 425  ALA B CB    1 
ATOM   6481  N  N     . ALA B  2  428 ? 53.103  55.025  77.397  1.00 91.06  ? 426  ALA B N     1 
ATOM   6482  C  CA    . ALA B  2  428 ? 51.969  55.301  76.515  1.00 92.22  ? 426  ALA B CA    1 
ATOM   6483  C  C     . ALA B  2  428 ? 51.070  56.415  77.055  1.00 93.07  ? 426  ALA B C     1 
ATOM   6484  O  O     . ALA B  2  428 ? 50.841  56.498  78.262  1.00 94.55  ? 426  ALA B O     1 
ATOM   6485  C  CB    . ALA B  2  428 ? 51.157  54.031  76.311  1.00 91.85  ? 426  ALA B CB    1 
ATOM   6486  N  N     . SER B  2  429 ? 50.553  57.260  76.161  1.00 92.50  ? 427  SER B N     1 
ATOM   6487  C  CA    . SER B  2  429 ? 49.687  58.365  76.571  1.00 91.06  ? 427  SER B CA    1 
ATOM   6488  C  C     . SER B  2  429 ? 48.575  58.729  75.584  1.00 89.57  ? 427  SER B C     1 
ATOM   6489  O  O     . SER B  2  429 ? 48.823  59.042  74.419  1.00 88.20  ? 427  SER B O     1 
ATOM   6490  C  CB    . SER B  2  429 ? 50.539  59.599  76.864  1.00 92.09  ? 427  SER B CB    1 
ATOM   6491  O  OG    . SER B  2  429 ? 51.312  59.967  75.736  1.00 94.60  ? 427  SER B OG    1 
ATOM   6492  N  N     . GLY B  2  430 ? 47.344  58.697  76.081  1.00 89.06  ? 428  GLY B N     1 
ATOM   6493  C  CA    . GLY B  2  430 ? 46.181  59.014  75.269  1.00 89.07  ? 428  GLY B CA    1 
ATOM   6494  C  C     . GLY B  2  430 ? 44.975  58.360  75.905  1.00 88.82  ? 428  GLY B C     1 
ATOM   6495  O  O     . GLY B  2  430 ? 44.973  58.158  77.121  1.00 88.32  ? 428  GLY B O     1 
ATOM   6496  N  N     . ASP B  2  431 ? 43.944  58.058  75.116  1.00 88.83  ? 429  ASP B N     1 
ATOM   6497  C  CA    . ASP B  2  431 ? 42.779  57.376  75.663  1.00 90.17  ? 429  ASP B CA    1 
ATOM   6498  C  C     . ASP B  2  431 ? 43.192  55.904  75.619  1.00 91.01  ? 429  ASP B C     1 
ATOM   6499  O  O     . ASP B  2  431 ? 42.887  55.174  74.669  1.00 91.91  ? 429  ASP B O     1 
ATOM   6500  C  CB    . ASP B  2  431 ? 41.540  57.613  74.805  1.00 91.08  ? 429  ASP B CB    1 
ATOM   6501  C  CG    . ASP B  2  431 ? 40.270  57.070  75.455  1.00 92.99  ? 429  ASP B CG    1 
ATOM   6502  O  OD1   . ASP B  2  431 ? 40.213  55.856  75.762  1.00 93.84  ? 429  ASP B OD1   1 
ATOM   6503  O  OD2   . ASP B  2  431 ? 39.322  57.857  75.663  1.00 94.39  ? 429  ASP B OD2   1 
ATOM   6504  N  N     . LEU B  2  432 ? 43.907  55.488  76.661  1.00 90.67  ? 430  LEU B N     1 
ATOM   6505  C  CA    . LEU B  2  432 ? 44.442  54.141  76.786  1.00 89.67  ? 430  LEU B CA    1 
ATOM   6506  C  C     . LEU B  2  432 ? 43.424  53.040  77.093  1.00 90.47  ? 430  LEU B C     1 
ATOM   6507  O  O     . LEU B  2  432 ? 43.803  51.894  77.342  1.00 90.96  ? 430  LEU B O     1 
ATOM   6508  C  CB    . LEU B  2  432 ? 45.539  54.153  77.854  1.00 87.41  ? 430  LEU B CB    1 
ATOM   6509  C  CG    . LEU B  2  432 ? 46.541  55.312  77.731  1.00 86.00  ? 430  LEU B CG    1 
ATOM   6510  C  CD1   . LEU B  2  432 ? 47.557  55.244  78.851  1.00 84.02  ? 430  LEU B CD1   1 
ATOM   6511  C  CD2   . LEU B  2  432 ? 47.237  55.265  76.384  1.00 84.94  ? 430  LEU B CD2   1 
ATOM   6512  N  N     . GLY B  2  433 ? 42.140  53.381  77.056  1.00 90.95  ? 431  GLY B N     1 
ATOM   6513  C  CA    . GLY B  2  433 ? 41.096  52.407  77.342  1.00 90.83  ? 431  GLY B CA    1 
ATOM   6514  C  C     . GLY B  2  433 ? 41.203  51.050  76.663  1.00 90.94  ? 431  GLY B C     1 
ATOM   6515  O  O     . GLY B  2  433 ? 40.778  50.042  77.227  1.00 89.59  ? 431  GLY B O     1 
ATOM   6516  N  N     . SER B  2  434 ? 41.763  51.021  75.454  1.00 92.04  ? 432  SER B N     1 
ATOM   6517  C  CA    . SER B  2  434 ? 41.912  49.780  74.685  1.00 91.95  ? 432  SER B CA    1 
ATOM   6518  C  C     . SER B  2  434 ? 43.375  49.483  74.381  1.00 92.22  ? 432  SER B C     1 
ATOM   6519  O  O     . SER B  2  434 ? 43.687  48.720  73.460  1.00 91.25  ? 432  SER B O     1 
ATOM   6520  C  CB    . SER B  2  434 ? 41.144  49.873  73.362  1.00 91.91  ? 432  SER B CB    1 
ATOM   6521  O  OG    . SER B  2  434 ? 39.751  50.028  73.567  1.00 91.92  ? 432  SER B OG    1 
ATOM   6522  N  N     . THR B  2  435 ? 44.265  50.101  75.151  1.00 92.57  ? 433  THR B N     1 
ATOM   6523  C  CA    . THR B  2  435 ? 45.698  49.908  74.987  1.00 92.44  ? 433  THR B CA    1 
ATOM   6524  C  C     . THR B  2  435 ? 46.159  48.812  75.934  1.00 92.70  ? 433  THR B C     1 
ATOM   6525  O  O     . THR B  2  435 ? 45.764  48.775  77.100  1.00 93.18  ? 433  THR B O     1 
ATOM   6526  C  CB    . THR B  2  435 ? 46.458  51.199  75.296  1.00 92.55  ? 433  THR B CB    1 
ATOM   6527  O  OG1   . THR B  2  435 ? 45.990  52.239  74.424  1.00 93.37  ? 433  THR B OG1   1 
ATOM   6528  C  CG2   . THR B  2  435 ? 47.959  50.997  75.107  1.00 92.32  ? 433  THR B CG2   1 
ATOM   6529  N  N     . PRO B  2  436 ? 46.999  47.895  75.443  1.00 92.76  ? 434  PRO B N     1 
ATOM   6530  C  CA    . PRO B  2  436 ? 47.497  46.795  76.270  1.00 92.59  ? 434  PRO B CA    1 
ATOM   6531  C  C     . PRO B  2  436 ? 48.619  47.143  77.245  1.00 92.07  ? 434  PRO B C     1 
ATOM   6532  O  O     . PRO B  2  436 ? 49.381  48.096  77.038  1.00 90.93  ? 434  PRO B O     1 
ATOM   6533  C  CB    . PRO B  2  436 ? 47.935  45.769  75.229  1.00 92.60  ? 434  PRO B CB    1 
ATOM   6534  C  CG    . PRO B  2  436 ? 48.487  46.646  74.150  1.00 92.97  ? 434  PRO B CG    1 
ATOM   6535  C  CD    . PRO B  2  436 ? 47.422  47.725  74.042  1.00 92.86  ? 434  PRO B CD    1 
ATOM   6536  N  N     . PHE B  2  437 ? 48.699  46.351  78.311  1.00 92.58  ? 435  PHE B N     1 
ATOM   6537  C  CA    . PHE B  2  437 ? 49.730  46.505  79.333  1.00 93.97  ? 435  PHE B CA    1 
ATOM   6538  C  C     . PHE B  2  437 ? 50.958  45.680  78.918  1.00 94.84  ? 435  PHE B C     1 
ATOM   6539  O  O     . PHE B  2  437 ? 50.827  44.612  78.312  1.00 96.05  ? 435  PHE B O     1 
ATOM   6540  C  CB    . PHE B  2  437 ? 49.243  45.996  80.698  1.00 93.08  ? 435  PHE B CB    1 
ATOM   6541  C  CG    . PHE B  2  437 ? 48.228  46.879  81.364  1.00 92.15  ? 435  PHE B CG    1 
ATOM   6542  C  CD1   . PHE B  2  437 ? 46.936  46.990  80.859  1.00 92.32  ? 435  PHE B CD1   1 
ATOM   6543  C  CD2   . PHE B  2  437 ? 48.551  47.564  82.528  1.00 91.23  ? 435  PHE B CD2   1 
ATOM   6544  C  CE1   . PHE B  2  437 ? 45.977  47.769  81.511  1.00 91.75  ? 435  PHE B CE1   1 
ATOM   6545  C  CE2   . PHE B  2  437 ? 47.600  48.342  83.183  1.00 91.23  ? 435  PHE B CE2   1 
ATOM   6546  C  CZ    . PHE B  2  437 ? 46.311  48.444  82.675  1.00 90.93  ? 435  PHE B CZ    1 
ATOM   6547  N  N     . LEU B  2  438 ? 52.143  46.175  79.263  1.00 93.90  ? 436  LEU B N     1 
ATOM   6548  C  CA    . LEU B  2  438 ? 53.395  45.510  78.944  1.00 92.59  ? 436  LEU B CA    1 
ATOM   6549  C  C     . LEU B  2  438 ? 53.348  43.987  79.118  1.00 93.47  ? 436  LEU B C     1 
ATOM   6550  O  O     . LEU B  2  438 ? 53.967  43.259  78.352  1.00 93.01  ? 436  LEU B O     1 
ATOM   6551  C  CB    . LEU B  2  438 ? 54.488  46.103  79.816  1.00 91.00  ? 436  LEU B CB    1 
ATOM   6552  C  CG    . LEU B  2  438 ? 55.930  45.779  79.482  1.00 90.04  ? 436  LEU B CG    1 
ATOM   6553  C  CD1   . LEU B  2  438 ? 56.227  46.118  78.042  1.00 90.14  ? 436  LEU B CD1   1 
ATOM   6554  C  CD2   . LEU B  2  438 ? 56.804  46.580  80.406  1.00 90.22  ? 436  LEU B CD2   1 
ATOM   6555  N  N     . ASP B  2  439 ? 52.610  43.502  80.112  1.00 95.11  ? 437  ASP B N     1 
ATOM   6556  C  CA    . ASP B  2  439 ? 52.524  42.065  80.340  1.00 97.77  ? 437  ASP B CA    1 
ATOM   6557  C  C     . ASP B  2  439 ? 51.470  41.338  79.498  1.00 99.60  ? 437  ASP B C     1 
ATOM   6558  O  O     . ASP B  2  439 ? 51.198  40.167  79.731  1.00 100.72 ? 437  ASP B O     1 
ATOM   6559  C  CB    . ASP B  2  439 ? 52.277  41.761  81.826  1.00 98.61  ? 437  ASP B CB    1 
ATOM   6560  C  CG    . ASP B  2  439 ? 50.835  42.019  82.260  1.00 100.35 ? 437  ASP B CG    1 
ATOM   6561  O  OD1   . ASP B  2  439 ? 49.890  41.486  81.629  1.00 98.36  ? 437  ASP B OD1   1 
ATOM   6562  O  OD2   . ASP B  2  439 ? 50.651  42.750  83.260  1.00 103.21 ? 437  ASP B OD2   1 
ATOM   6563  N  N     . GLU B  2  440 ? 50.861  42.015  78.533  1.00 101.13 ? 438  GLU B N     1 
ATOM   6564  C  CA    . GLU B  2  440 ? 49.864  41.355  77.694  1.00 102.24 ? 438  GLU B CA    1 
ATOM   6565  C  C     . GLU B  2  440 ? 50.411  41.241  76.283  1.00 103.72 ? 438  GLU B C     1 
ATOM   6566  O  O     . GLU B  2  440 ? 49.683  40.909  75.357  1.00 102.99 ? 438  GLU B O     1 
ATOM   6567  C  CB    . GLU B  2  440 ? 48.563  42.149  77.648  1.00 102.21 ? 438  GLU B CB    1 
ATOM   6568  C  CG    . GLU B  2  440 ? 48.000  42.544  78.992  1.00 103.44 ? 438  GLU B CG    1 
ATOM   6569  C  CD    . GLU B  2  440 ? 46.662  43.249  78.852  1.00 104.45 ? 438  GLU B CD    1 
ATOM   6570  O  OE1   . GLU B  2  440 ? 46.538  44.095  77.946  1.00 105.19 ? 438  GLU B OE1   1 
ATOM   6571  O  OE2   . GLU B  2  440 ? 45.736  42.968  79.643  1.00 105.23 ? 438  GLU B OE2   1 
ATOM   6572  N  N     . LEU B  2  441 ? 51.696  41.535  76.121  1.00 106.59 ? 439  LEU B N     1 
ATOM   6573  C  CA    . LEU B  2  441 ? 52.335  41.461  74.808  1.00 109.66 ? 439  LEU B CA    1 
ATOM   6574  C  C     . LEU B  2  441 ? 53.208  40.204  74.678  1.00 111.90 ? 439  LEU B C     1 
ATOM   6575  O  O     . LEU B  2  441 ? 54.420  40.351  74.372  1.00 113.66 ? 439  LEU B O     1 
ATOM   6576  C  CB    . LEU B  2  441 ? 53.200  42.704  74.566  1.00 108.93 ? 439  LEU B CB    1 
ATOM   6577  C  CG    . LEU B  2  441 ? 52.571  44.080  74.765  1.00 108.65 ? 439  LEU B CG    1 
ATOM   6578  C  CD1   . LEU B  2  441 ? 53.565  45.147  74.312  1.00 108.89 ? 439  LEU B CD1   1 
ATOM   6579  C  CD2   . LEU B  2  441 ? 51.270  44.176  73.980  1.00 108.43 ? 439  LEU B CD2   1 
ATOM   6580  O  OXT   . LEU B  2  441 ? 52.673  39.085  74.878  1.00 112.92 ? 439  LEU B OXT   1 
ATOM   6581  N  N     . MET C  3  1   ? 55.218  103.614 80.693  1.00 136.56 ? 1    MET C N     1 
ATOM   6582  C  CA    . MET C  3  1   ? 53.968  103.024 81.260  1.00 136.85 ? 1    MET C CA    1 
ATOM   6583  C  C     . MET C  3  1   ? 53.235  102.171 80.215  1.00 136.77 ? 1    MET C C     1 
ATOM   6584  O  O     . MET C  3  1   ? 53.376  100.942 80.191  1.00 136.93 ? 1    MET C O     1 
ATOM   6585  C  CB    . MET C  3  1   ? 53.047  104.143 81.767  1.00 136.95 ? 1    MET C CB    1 
ATOM   6586  N  N     . ALA C  3  2   ? 52.448  102.829 79.363  1.00 136.17 ? 2    ALA C N     1 
ATOM   6587  C  CA    . ALA C  3  2   ? 51.696  102.157 78.303  1.00 134.68 ? 2    ALA C CA    1 
ATOM   6588  C  C     . ALA C  3  2   ? 52.287  102.588 76.960  1.00 133.45 ? 2    ALA C C     1 
ATOM   6589  O  O     . ALA C  3  2   ? 52.849  103.682 76.848  1.00 133.53 ? 2    ALA C O     1 
ATOM   6590  C  CB    . ALA C  3  2   ? 50.211  102.543 78.380  1.00 134.61 ? 2    ALA C CB    1 
ATOM   6591  N  N     . PRO C  3  3   ? 52.176  101.736 75.925  1.00 131.84 ? 3    PRO C N     1 
ATOM   6592  C  CA    . PRO C  3  3   ? 52.732  102.116 74.622  1.00 130.76 ? 3    PRO C CA    1 
ATOM   6593  C  C     . PRO C  3  3   ? 52.385  103.540 74.149  1.00 129.90 ? 3    PRO C C     1 
ATOM   6594  O  O     . PRO C  3  3   ? 53.259  104.409 74.137  1.00 129.66 ? 3    PRO C O     1 
ATOM   6595  C  CB    . PRO C  3  3   ? 52.218  101.013 73.686  1.00 130.82 ? 3    PRO C CB    1 
ATOM   6596  C  CG    . PRO C  3  3   ? 51.039  100.416 74.420  1.00 130.97 ? 3    PRO C CG    1 
ATOM   6597  C  CD    . PRO C  3  3   ? 51.493  100.435 75.847  1.00 131.21 ? 3    PRO C CD    1 
ATOM   6598  N  N     . ASN C  3  4   ? 51.130  103.788 73.764  1.00 129.10 ? 4    ASN C N     1 
ATOM   6599  C  CA    . ASN C  3  4   ? 50.745  105.131 73.317  1.00 127.88 ? 4    ASN C CA    1 
ATOM   6600  C  C     . ASN C  3  4   ? 50.251  106.039 74.439  1.00 127.27 ? 4    ASN C C     1 
ATOM   6601  O  O     . ASN C  3  4   ? 49.452  105.643 75.291  1.00 127.63 ? 4    ASN C O     1 
ATOM   6602  C  CB    . ASN C  3  4   ? 49.717  105.094 72.160  1.00 127.68 ? 4    ASN C CB    1 
ATOM   6603  C  CG    . ASN C  3  4   ? 48.439  104.328 72.487  1.00 126.79 ? 4    ASN C CG    1 
ATOM   6604  O  OD1   . ASN C  3  4   ? 48.461  103.131 72.777  1.00 126.62 ? 4    ASN C OD1   1 
ATOM   6605  N  ND2   . ASN C  3  4   ? 47.312  105.020 72.404  1.00 126.21 ? 4    ASN C ND2   1 
ATOM   6606  N  N     . ILE C  3  5   ? 50.757  107.268 74.416  1.00 126.14 ? 5    ILE C N     1 
ATOM   6607  C  CA    . ILE C  3  5   ? 50.459  108.298 75.409  1.00 124.20 ? 5    ILE C CA    1 
ATOM   6608  C  C     . ILE C  3  5   ? 49.002  108.743 75.437  1.00 122.71 ? 5    ILE C C     1 
ATOM   6609  O  O     . ILE C  3  5   ? 48.634  109.623 76.207  1.00 122.84 ? 5    ILE C O     1 
ATOM   6610  C  CB    . ILE C  3  5   ? 51.356  109.541 75.167  1.00 124.08 ? 5    ILE C CB    1 
ATOM   6611  C  CG1   . ILE C  3  5   ? 52.788  109.090 74.843  1.00 124.74 ? 5    ILE C CG1   1 
ATOM   6612  C  CG2   . ILE C  3  5   ? 51.353  110.450 76.382  1.00 123.89 ? 5    ILE C CG2   1 
ATOM   6613  C  CD1   . ILE C  3  5   ? 53.383  108.062 75.815  1.00 125.03 ? 5    ILE C CD1   1 
ATOM   6614  N  N     . ARG C  3  6   ? 48.170  108.140 74.600  1.00 121.23 ? 6    ARG C N     1 
ATOM   6615  C  CA    . ARG C  3  6   ? 46.760  108.504 74.561  1.00 119.51 ? 6    ARG C CA    1 
ATOM   6616  C  C     . ARG C  3  6   ? 46.004  107.710 75.621  1.00 118.27 ? 6    ARG C C     1 
ATOM   6617  O  O     . ARG C  3  6   ? 44.896  108.074 76.009  1.00 118.09 ? 6    ARG C O     1 
ATOM   6618  C  CB    . ARG C  3  6   ? 46.181  108.209 73.176  1.00 119.78 ? 6    ARG C CB    1 
ATOM   6619  C  CG    . ARG C  3  6   ? 44.770  108.726 72.943  1.00 119.25 ? 6    ARG C CG    1 
ATOM   6620  C  CD    . ARG C  3  6   ? 44.070  107.892 71.874  1.00 119.36 ? 6    ARG C CD    1 
ATOM   6621  N  NE    . ARG C  3  6   ? 44.783  107.896 70.602  1.00 119.47 ? 6    ARG C NE    1 
ATOM   6622  C  CZ    . ARG C  3  6   ? 44.866  106.847 69.791  1.00 120.04 ? 6    ARG C CZ    1 
ATOM   6623  N  NH1   . ARG C  3  6   ? 44.279  105.701 70.122  1.00 119.33 ? 6    ARG C NH1   1 
ATOM   6624  N  NH2   . ARG C  3  6   ? 45.543  106.943 68.650  1.00 120.44 ? 6    ARG C NH2   1 
ATOM   6625  N  N     . LYS C  3  7   ? 46.617  106.629 76.095  1.00 117.15 ? 7    LYS C N     1 
ATOM   6626  C  CA    . LYS C  3  7   ? 46.002  105.768 77.103  1.00 116.18 ? 7    LYS C CA    1 
ATOM   6627  C  C     . LYS C  3  7   ? 46.609  105.896 78.502  1.00 115.60 ? 7    LYS C C     1 
ATOM   6628  O  O     . LYS C  3  7   ? 45.916  105.703 79.508  1.00 115.91 ? 7    LYS C O     1 
ATOM   6629  C  CB    . LYS C  3  7   ? 46.088  104.308 76.665  1.00 116.07 ? 7    LYS C CB    1 
ATOM   6630  C  CG    . LYS C  3  7   ? 45.300  103.971 75.413  1.00 115.70 ? 7    LYS C CG    1 
ATOM   6631  C  CD    . LYS C  3  7   ? 45.387  102.479 75.146  1.00 116.04 ? 7    LYS C CD    1 
ATOM   6632  C  CE    . LYS C  3  7   ? 44.666  102.079 73.878  1.00 116.44 ? 7    LYS C CE    1 
ATOM   6633  N  NZ    . LYS C  3  7   ? 44.794  100.611 73.665  1.00 115.73 ? 7    LYS C NZ    1 
ATOM   6634  N  N     . SER C  3  8   ? 47.903  106.207 78.564  1.00 114.32 ? 8    SER C N     1 
ATOM   6635  C  CA    . SER C  3  8   ? 48.603  106.352 79.838  1.00 112.37 ? 8    SER C CA    1 
ATOM   6636  C  C     . SER C  3  8   ? 48.356  107.696 80.541  1.00 111.46 ? 8    SER C C     1 
ATOM   6637  O  O     . SER C  3  8   ? 47.952  107.712 81.707  1.00 111.27 ? 8    SER C O     1 
ATOM   6638  C  CB    . SER C  3  8   ? 50.107  106.134 79.629  1.00 112.28 ? 8    SER C CB    1 
ATOM   6639  O  OG    . SER C  3  8   ? 50.603  106.927 78.564  1.00 110.64 ? 8    SER C OG    1 
ATOM   6640  N  N     . HIS C  3  9   ? 48.593  108.806 79.831  1.00 109.93 ? 9    HIS C N     1 
ATOM   6641  C  CA    . HIS C  3  9   ? 48.415  110.178 80.355  1.00 108.14 ? 9    HIS C CA    1 
ATOM   6642  C  C     . HIS C  3  9   ? 47.114  110.358 81.133  1.00 107.38 ? 9    HIS C C     1 
ATOM   6643  O  O     . HIS C  3  9   ? 46.038  110.058 80.620  1.00 108.85 ? 9    HIS C O     1 
ATOM   6644  C  CB    . HIS C  3  9   ? 48.439  111.194 79.206  1.00 106.59 ? 9    HIS C CB    1 
ATOM   6645  C  CG    . HIS C  3  9   ? 48.499  112.619 79.655  1.00 104.98 ? 9    HIS C CG    1 
ATOM   6646  N  ND1   . HIS C  3  9   ? 49.628  113.178 80.210  1.00 104.79 ? 9    HIS C ND1   1 
ATOM   6647  C  CD2   . HIS C  3  9   ? 47.574  113.604 79.621  1.00 105.60 ? 9    HIS C CD2   1 
ATOM   6648  C  CE1   . HIS C  3  9   ? 49.398  114.447 80.495  1.00 104.23 ? 9    HIS C CE1   1 
ATOM   6649  N  NE2   . HIS C  3  9   ? 48.158  114.730 80.146  1.00 105.19 ? 9    HIS C NE2   1 
ATOM   6650  N  N     . PRO C  3  10  ? 47.192  110.882 82.370  1.00 105.82 ? 10   PRO C N     1 
ATOM   6651  C  CA    . PRO C  3  10  ? 45.989  111.081 83.188  1.00 104.29 ? 10   PRO C CA    1 
ATOM   6652  C  C     . PRO C  3  10  ? 44.888  111.927 82.560  1.00 102.40 ? 10   PRO C C     1 
ATOM   6653  O  O     . PRO C  3  10  ? 43.723  111.761 82.911  1.00 101.94 ? 10   PRO C O     1 
ATOM   6654  C  CB    . PRO C  3  10  ? 46.539  111.694 84.473  1.00 104.48 ? 10   PRO C CB    1 
ATOM   6655  C  CG    . PRO C  3  10  ? 47.761  112.415 84.003  1.00 105.03 ? 10   PRO C CG    1 
ATOM   6656  C  CD    . PRO C  3  10  ? 48.376  111.439 83.043  1.00 105.27 ? 10   PRO C CD    1 
ATOM   6657  N  N     . LEU C  3  11  ? 45.250  112.820 81.637  1.00 100.20 ? 11   LEU C N     1 
ATOM   6658  C  CA    . LEU C  3  11  ? 44.268  113.678 80.976  1.00 97.95  ? 11   LEU C CA    1 
ATOM   6659  C  C     . LEU C  3  11  ? 43.834  113.187 79.594  1.00 97.79  ? 11   LEU C C     1 
ATOM   6660  O  O     . LEU C  3  11  ? 42.637  113.024 79.334  1.00 97.72  ? 11   LEU C O     1 
ATOM   6661  C  CB    . LEU C  3  11  ? 44.794  115.113 80.860  1.00 95.74  ? 11   LEU C CB    1 
ATOM   6662  C  CG    . LEU C  3  11  ? 44.770  115.992 82.115  1.00 94.21  ? 11   LEU C CG    1 
ATOM   6663  C  CD1   . LEU C  3  11  ? 45.115  117.416 81.736  1.00 92.54  ? 11   LEU C CD1   1 
ATOM   6664  C  CD2   . LEU C  3  11  ? 43.397  115.959 82.755  1.00 94.03  ? 11   LEU C CD2   1 
ATOM   6665  N  N     . LEU C  3  12  ? 44.798  112.963 78.704  1.00 97.20  ? 12   LEU C N     1 
ATOM   6666  C  CA    . LEU C  3  12  ? 44.474  112.500 77.362  1.00 96.39  ? 12   LEU C CA    1 
ATOM   6667  C  C     . LEU C  3  12  ? 43.624  111.263 77.477  1.00 96.02  ? 12   LEU C C     1 
ATOM   6668  O  O     . LEU C  3  12  ? 42.661  111.097 76.741  1.00 96.06  ? 12   LEU C O     1 
ATOM   6669  C  CB    . LEU C  3  12  ? 45.740  112.185 76.575  1.00 96.16  ? 12   LEU C CB    1 
ATOM   6670  C  CG    . LEU C  3  12  ? 46.655  113.380 76.324  1.00 95.76  ? 12   LEU C CG    1 
ATOM   6671  C  CD1   . LEU C  3  12  ? 47.814  112.925 75.476  1.00 95.41  ? 12   LEU C CD1   1 
ATOM   6672  C  CD2   . LEU C  3  12  ? 45.894  114.500 75.636  1.00 94.88  ? 12   LEU C CD2   1 
ATOM   6673  N  N     . LYS C  3  13  ? 43.993  110.400 78.415  1.00 96.26  ? 13   LYS C N     1 
ATOM   6674  C  CA    . LYS C  3  13  ? 43.261  109.166 78.671  1.00 96.97  ? 13   LYS C CA    1 
ATOM   6675  C  C     . LYS C  3  13  ? 41.772  109.464 78.830  1.00 97.57  ? 13   LYS C C     1 
ATOM   6676  O  O     . LYS C  3  13  ? 40.929  108.702 78.367  1.00 98.02  ? 13   LYS C O     1 
ATOM   6677  C  CB    . LYS C  3  13  ? 43.779  108.505 79.948  1.00 96.76  ? 13   LYS C CB    1 
ATOM   6678  C  CG    . LYS C  3  13  ? 42.893  107.392 80.467  1.00 98.41  ? 13   LYS C CG    1 
ATOM   6679  C  CD    . LYS C  3  13  ? 43.110  107.112 81.949  1.00 99.14  ? 13   LYS C CD    1 
ATOM   6680  C  CE    . LYS C  3  13  ? 44.430  106.416 82.213  1.00 100.31 ? 13   LYS C CE    1 
ATOM   6681  N  NZ    . LYS C  3  13  ? 44.553  106.055 83.650  1.00 101.02 ? 13   LYS C NZ    1 
ATOM   6682  N  N     . MET C  3  14  ? 41.454  110.574 79.490  1.00 98.41  ? 14   MET C N     1 
ATOM   6683  C  CA    . MET C  3  14  ? 40.065  110.961 79.710  1.00 98.70  ? 14   MET C CA    1 
ATOM   6684  C  C     . MET C  3  14  ? 39.445  111.430 78.402  1.00 97.53  ? 14   MET C C     1 
ATOM   6685  O  O     . MET C  3  14  ? 38.288  111.119 78.108  1.00 97.80  ? 14   MET C O     1 
ATOM   6686  C  CB    . MET C  3  14  ? 39.976  112.075 80.760  1.00 100.99 ? 14   MET C CB    1 
ATOM   6687  C  CG    . MET C  3  14  ? 40.541  111.685 82.121  1.00 103.51 ? 14   MET C CG    1 
ATOM   6688  S  SD    . MET C  3  14  ? 40.287  112.924 83.424  1.00 106.92 ? 14   MET C SD    1 
ATOM   6689  C  CE    . MET C  3  14  ? 39.737  111.848 84.836  1.00 105.71 ? 14   MET C CE    1 
ATOM   6690  N  N     . ILE C  3  15  ? 40.217  112.183 77.624  1.00 95.33  ? 15   ILE C N     1 
ATOM   6691  C  CA    . ILE C  3  15  ? 39.744  112.673 76.338  1.00 93.06  ? 15   ILE C CA    1 
ATOM   6692  C  C     . ILE C  3  15  ? 39.516  111.478 75.413  1.00 92.32  ? 15   ILE C C     1 
ATOM   6693  O  O     . ILE C  3  15  ? 38.541  111.420 74.671  1.00 92.39  ? 15   ILE C O     1 
ATOM   6694  C  CB    . ILE C  3  15  ? 40.773  113.610 75.701  1.00 91.52  ? 15   ILE C CB    1 
ATOM   6695  C  CG1   . ILE C  3  15  ? 40.989  114.813 76.605  1.00 91.23  ? 15   ILE C CG1   1 
ATOM   6696  C  CG2   . ILE C  3  15  ? 40.299  114.062 74.334  1.00 90.41  ? 15   ILE C CG2   1 
ATOM   6697  C  CD1   . ILE C  3  15  ? 41.999  115.786 76.059  1.00 91.97  ? 15   ILE C CD1   1 
ATOM   6698  N  N     . ASN C  3  16  ? 40.425  110.517 75.480  1.00 91.24  ? 16   ASN C N     1 
ATOM   6699  C  CA    . ASN C  3  16  ? 40.343  109.333 74.657  1.00 90.06  ? 16   ASN C CA    1 
ATOM   6700  C  C     . ASN C  3  16  ? 39.142  108.463 75.002  1.00 89.27  ? 16   ASN C C     1 
ATOM   6701  O  O     . ASN C  3  16  ? 38.379  108.077 74.125  1.00 90.26  ? 16   ASN C O     1 
ATOM   6702  C  CB    . ASN C  3  16  ? 41.633  108.518 74.801  1.00 91.00  ? 16   ASN C CB    1 
ATOM   6703  C  CG    . ASN C  3  16  ? 41.586  107.191 74.044  1.00 92.71  ? 16   ASN C CG    1 
ATOM   6704  O  OD1   . ASN C  3  16  ? 41.482  107.167 72.812  1.00 92.93  ? 16   ASN C OD1   1 
ATOM   6705  N  ND2   . ASN C  3  16  ? 41.664  106.079 74.783  1.00 92.04  ? 16   ASN C ND2   1 
ATOM   6706  N  N     . ASN C  3  17  ? 38.955  108.159 76.276  1.00 88.40  ? 17   ASN C N     1 
ATOM   6707  C  CA    . ASN C  3  17  ? 37.853  107.285 76.655  1.00 88.17  ? 17   ASN C CA    1 
ATOM   6708  C  C     . ASN C  3  17  ? 36.457  107.909 76.552  1.00 87.67  ? 17   ASN C C     1 
ATOM   6709  O  O     . ASN C  3  17  ? 35.478  107.326 77.038  1.00 87.56  ? 17   ASN C O     1 
ATOM   6710  C  CB    . ASN C  3  17  ? 38.064  106.735 78.078  1.00 88.66  ? 17   ASN C CB    1 
ATOM   6711  C  CG    . ASN C  3  17  ? 39.425  106.057 78.268  1.00 88.93  ? 17   ASN C CG    1 
ATOM   6712  O  OD1   . ASN C  3  17  ? 39.976  105.424 77.356  1.00 88.67  ? 17   ASN C OD1   1 
ATOM   6713  N  ND2   . ASN C  3  17  ? 39.960  106.175 79.474  1.00 88.39  ? 17   ASN C ND2   1 
ATOM   6714  N  N     . SER C  3  18  ? 36.355  109.076 75.916  1.00 86.20  ? 18   SER C N     1 
ATOM   6715  C  CA    . SER C  3  18  ? 35.056  109.740 75.778  1.00 84.35  ? 18   SER C CA    1 
ATOM   6716  C  C     . SER C  3  18  ? 34.861  110.484 74.457  1.00 82.59  ? 18   SER C C     1 
ATOM   6717  O  O     . SER C  3  18  ? 33.814  111.094 74.227  1.00 82.75  ? 18   SER C O     1 
ATOM   6718  C  CB    . SER C  3  18  ? 34.840  110.710 76.941  1.00 84.74  ? 18   SER C CB    1 
ATOM   6719  O  OG    . SER C  3  18  ? 35.812  111.737 76.937  1.00 85.94  ? 18   SER C OG    1 
ATOM   6720  N  N     . LEU C  3  19  ? 35.861  110.424 73.585  1.00 80.08  ? 19   LEU C N     1 
ATOM   6721  C  CA    . LEU C  3  19  ? 35.776  111.099 72.299  1.00 77.33  ? 19   LEU C CA    1 
ATOM   6722  C  C     . LEU C  3  19  ? 36.616  110.483 71.201  1.00 75.95  ? 19   LEU C C     1 
ATOM   6723  O  O     . LEU C  3  19  ? 36.694  111.041 70.118  1.00 77.06  ? 19   LEU C O     1 
ATOM   6724  C  CB    . LEU C  3  19  ? 36.202  112.553 72.437  1.00 76.06  ? 19   LEU C CB    1 
ATOM   6725  C  CG    . LEU C  3  19  ? 35.202  113.524 73.027  1.00 75.62  ? 19   LEU C CG    1 
ATOM   6726  C  CD1   . LEU C  3  19  ? 35.836  114.894 73.043  1.00 74.17  ? 19   LEU C CD1   1 
ATOM   6727  C  CD2   . LEU C  3  19  ? 33.918  113.520 72.198  1.00 75.44  ? 19   LEU C CD2   1 
ATOM   6728  N  N     . ILE C  3  20  ? 37.244  109.343 71.453  1.00 73.74  ? 20   ILE C N     1 
ATOM   6729  C  CA    . ILE C  3  20  ? 38.094  108.759 70.431  1.00 71.50  ? 20   ILE C CA    1 
ATOM   6730  C  C     . ILE C  3  20  ? 38.051  107.242 70.386  1.00 71.01  ? 20   ILE C C     1 
ATOM   6731  O  O     . ILE C  3  20  ? 37.784  106.660 69.333  1.00 71.95  ? 20   ILE C O     1 
ATOM   6732  C  CB    . ILE C  3  20  ? 39.553  109.239 70.621  1.00 69.86  ? 20   ILE C CB    1 
ATOM   6733  C  CG1   . ILE C  3  20  ? 39.606  110.760 70.438  1.00 69.10  ? 20   ILE C CG1   1 
ATOM   6734  C  CG2   . ILE C  3  20  ? 40.474  108.534 69.641  1.00 68.68  ? 20   ILE C CG2   1 
ATOM   6735  C  CD1   . ILE C  3  20  ? 40.921  111.403 70.781  1.00 69.92  ? 20   ILE C CD1   1 
ATOM   6736  N  N     . ASP C  3  21  ? 38.316  106.601 71.517  1.00 69.14  ? 21   ASP C N     1 
ATOM   6737  C  CA    . ASP C  3  21  ? 38.303  105.144 71.575  1.00 68.39  ? 21   ASP C CA    1 
ATOM   6738  C  C     . ASP C  3  21  ? 37.042  104.626 72.233  1.00 65.65  ? 21   ASP C C     1 
ATOM   6739  O  O     . ASP C  3  21  ? 36.920  103.432 72.516  1.00 64.44  ? 21   ASP C O     1 
ATOM   6740  C  CB    . ASP C  3  21  ? 39.527  104.629 72.333  1.00 72.74  ? 21   ASP C CB    1 
ATOM   6741  C  CG    . ASP C  3  21  ? 40.755  104.509 71.448  1.00 74.58  ? 21   ASP C CG    1 
ATOM   6742  O  OD1   . ASP C  3  21  ? 40.979  105.442 70.637  1.00 75.19  ? 21   ASP C OD1   1 
ATOM   6743  O  OD2   . ASP C  3  21  ? 41.487  103.491 71.577  1.00 73.58  ? 21   ASP C OD2   1 
ATOM   6744  N  N     . LEU C  3  22  ? 36.113  105.547 72.466  1.00 62.86  ? 22   LEU C N     1 
ATOM   6745  C  CA    . LEU C  3  22  ? 34.825  105.254 73.073  1.00 59.91  ? 22   LEU C CA    1 
ATOM   6746  C  C     . LEU C  3  22  ? 33.904  104.435 72.169  1.00 57.39  ? 22   LEU C C     1 
ATOM   6747  O  O     . LEU C  3  22  ? 33.674  104.781 71.021  1.00 56.00  ? 22   LEU C O     1 
ATOM   6748  C  CB    . LEU C  3  22  ? 34.144  106.559 73.413  1.00 62.07  ? 22   LEU C CB    1 
ATOM   6749  C  CG    . LEU C  3  22  ? 32.636  106.484 73.570  1.00 64.87  ? 22   LEU C CG    1 
ATOM   6750  C  CD1   . LEU C  3  22  ? 32.249  106.022 74.977  1.00 66.63  ? 22   LEU C CD1   1 
ATOM   6751  C  CD2   . LEU C  3  22  ? 32.096  107.865 73.286  1.00 66.90  ? 22   LEU C CD2   1 
ATOM   6752  N  N     . PRO C  3  23  ? 33.369  103.330 72.686  1.00 55.87  ? 23   PRO C N     1 
ATOM   6753  C  CA    . PRO C  3  23  ? 32.467  102.448 71.941  1.00 56.76  ? 23   PRO C CA    1 
ATOM   6754  C  C     . PRO C  3  23  ? 31.055  103.008 71.694  1.00 58.08  ? 23   PRO C C     1 
ATOM   6755  O  O     . PRO C  3  23  ? 30.307  103.328 72.633  1.00 60.17  ? 23   PRO C O     1 
ATOM   6756  C  CB    . PRO C  3  23  ? 32.444  101.186 72.804  1.00 56.07  ? 23   PRO C CB    1 
ATOM   6757  C  CG    . PRO C  3  23  ? 33.802  101.191 73.412  1.00 55.05  ? 23   PRO C CG    1 
ATOM   6758  C  CD    . PRO C  3  23  ? 33.936  102.621 73.840  1.00 54.97  ? 23   PRO C CD    1 
ATOM   6759  N  N     . ALA C  3  24  ? 30.686  103.115 70.423  1.00 57.06  ? 24   ALA C N     1 
ATOM   6760  C  CA    . ALA C  3  24  ? 29.373  103.633 70.053  1.00 56.25  ? 24   ALA C CA    1 
ATOM   6761  C  C     . ALA C  3  24  ? 28.630  102.684 69.131  1.00 56.01  ? 24   ALA C C     1 
ATOM   6762  O  O     . ALA C  3  24  ? 29.221  102.074 68.242  1.00 55.95  ? 24   ALA C O     1 
ATOM   6763  C  CB    . ALA C  3  24  ? 29.526  104.971 69.371  1.00 55.32  ? 24   ALA C CB    1 
ATOM   6764  N  N     . PRO C  3  25  ? 27.316  102.548 69.323  1.00 56.02  ? 25   PRO C N     1 
ATOM   6765  C  CA    . PRO C  3  25  ? 26.548  101.652 68.461  1.00 57.34  ? 25   PRO C CA    1 
ATOM   6766  C  C     . PRO C  3  25  ? 26.776  102.051 67.003  1.00 58.20  ? 25   PRO C C     1 
ATOM   6767  O  O     . PRO C  3  25  ? 26.894  103.235 66.681  1.00 60.86  ? 25   PRO C O     1 
ATOM   6768  C  CB    . PRO C  3  25  ? 25.115  101.896 68.910  1.00 58.22  ? 25   PRO C CB    1 
ATOM   6769  C  CG    . PRO C  3  25  ? 25.271  102.257 70.346  1.00 56.81  ? 25   PRO C CG    1 
ATOM   6770  C  CD    . PRO C  3  25  ? 26.441  103.202 70.305  1.00 56.18  ? 25   PRO C CD    1 
ATOM   6771  N  N     . SER C  3  26  ? 26.837  101.073 66.119  1.00 56.18  ? 26   SER C N     1 
ATOM   6772  C  CA    . SER C  3  26  ? 27.076  101.372 64.725  1.00 54.85  ? 26   SER C CA    1 
ATOM   6773  C  C     . SER C  3  26  ? 25.859  101.971 64.042  1.00 54.85  ? 26   SER C C     1 
ATOM   6774  O  O     . SER C  3  26  ? 25.962  102.545 62.959  1.00 55.33  ? 26   SER C O     1 
ATOM   6775  C  CB    . SER C  3  26  ? 27.473  100.089 64.007  1.00 54.79  ? 26   SER C CB    1 
ATOM   6776  O  OG    . SER C  3  26  ? 26.529  99.061  64.267  1.00 53.71  ? 26   SER C OG    1 
ATOM   6777  N  N     . ASN C  3  27  ? 24.705  101.867 64.683  1.00 54.58  ? 27   ASN C N     1 
ATOM   6778  C  CA    . ASN C  3  27  ? 23.487  102.332 64.047  1.00 54.65  ? 27   ASN C CA    1 
ATOM   6779  C  C     . ASN C  3  27  ? 22.761  103.523 64.631  1.00 55.88  ? 27   ASN C C     1 
ATOM   6780  O  O     . ASN C  3  27  ? 21.559  103.677 64.388  1.00 57.98  ? 27   ASN C O     1 
ATOM   6781  C  CB    . ASN C  3  27  ? 22.503  101.185 63.993  1.00 52.29  ? 27   ASN C CB    1 
ATOM   6782  C  CG    . ASN C  3  27  ? 22.046  100.789 65.356  1.00 52.64  ? 27   ASN C CG    1 
ATOM   6783  O  OD1   . ASN C  3  27  ? 22.867  100.513 66.245  1.00 51.51  ? 27   ASN C OD1   1 
ATOM   6784  N  ND2   . ASN C  3  27  ? 20.732  100.761 65.550  1.00 53.61  ? 27   ASN C ND2   1 
ATOM   6785  N  N     . ILE C  3  28  ? 23.433  104.372 65.394  1.00 56.17  ? 28   ILE C N     1 
ATOM   6786  C  CA    . ILE C  3  28  ? 22.694  105.501 65.928  1.00 56.55  ? 28   ILE C CA    1 
ATOM   6787  C  C     . ILE C  3  28  ? 22.468  106.489 64.803  1.00 56.69  ? 28   ILE C C     1 
ATOM   6788  O  O     . ILE C  3  28  ? 23.363  106.730 63.973  1.00 56.39  ? 28   ILE C O     1 
ATOM   6789  C  CB    . ILE C  3  28  ? 23.407  106.153 67.108  1.00 57.28  ? 28   ILE C CB    1 
ATOM   6790  C  CG1   . ILE C  3  28  ? 24.870  106.392 66.761  1.00 58.05  ? 28   ILE C CG1   1 
ATOM   6791  C  CG2   . ILE C  3  28  ? 23.265  105.263 68.338  1.00 57.08  ? 28   ILE C CG2   1 
ATOM   6792  C  CD1   . ILE C  3  28  ? 25.644  107.023 67.880  1.00 60.21  ? 28   ILE C CD1   1 
ATOM   6793  N  N     . SER C  3  29  ? 21.245  107.027 64.774  1.00 56.59  ? 29   SER C N     1 
ATOM   6794  C  CA    . SER C  3  29  ? 20.802  107.962 63.744  1.00 55.21  ? 29   SER C CA    1 
ATOM   6795  C  C     . SER C  3  29  ? 21.088  109.409 64.056  1.00 54.75  ? 29   SER C C     1 
ATOM   6796  O  O     . SER C  3  29  ? 21.883  109.731 64.946  1.00 56.20  ? 29   SER C O     1 
ATOM   6797  C  CB    . SER C  3  29  ? 19.308  107.802 63.498  1.00 54.72  ? 29   SER C CB    1 
ATOM   6798  O  OG    . SER C  3  29  ? 18.579  108.099 64.670  1.00 54.43  ? 29   SER C OG    1 
ATOM   6799  N  N     . ALA C  3  30  ? 20.445  110.284 63.294  1.00 53.04  ? 30   ALA C N     1 
ATOM   6800  C  CA    . ALA C  3  30  ? 20.630  111.706 63.471  1.00 51.71  ? 30   ALA C CA    1 
ATOM   6801  C  C     . ALA C  3  30  ? 20.064  112.152 64.813  1.00 52.20  ? 30   ALA C C     1 
ATOM   6802  O  O     . ALA C  3  30  ? 20.549  113.112 65.409  1.00 52.29  ? 30   ALA C O     1 
ATOM   6803  C  CB    . ALA C  3  30  ? 19.969  112.450 62.340  1.00 49.59  ? 30   ALA C CB    1 
ATOM   6804  N  N     . TRP C  3  31  ? 19.052  111.454 65.314  1.00 52.48  ? 31   TRP C N     1 
ATOM   6805  C  CA    . TRP C  3  31  ? 18.485  111.856 66.589  1.00 52.83  ? 31   TRP C CA    1 
ATOM   6806  C  C     . TRP C  3  31  ? 19.509  111.843 67.715  1.00 51.97  ? 31   TRP C C     1 
ATOM   6807  O  O     . TRP C  3  31  ? 19.286  112.410 68.775  1.00 53.39  ? 31   TRP C O     1 
ATOM   6808  C  CB    . TRP C  3  31  ? 17.281  110.985 66.940  1.00 53.36  ? 31   TRP C CB    1 
ATOM   6809  C  CG    . TRP C  3  31  ? 16.197  111.116 65.937  1.00 53.77  ? 31   TRP C CG    1 
ATOM   6810  C  CD1   . TRP C  3  31  ? 15.849  110.196 65.015  1.00 54.71  ? 31   TRP C CD1   1 
ATOM   6811  C  CD2   . TRP C  3  31  ? 15.401  112.279 65.669  1.00 54.95  ? 31   TRP C CD2   1 
ATOM   6812  N  NE1   . TRP C  3  31  ? 14.895  110.703 64.173  1.00 57.38  ? 31   TRP C NE1   1 
ATOM   6813  C  CE2   . TRP C  3  31  ? 14.599  111.983 64.550  1.00 56.25  ? 31   TRP C CE2   1 
ATOM   6814  C  CE3   . TRP C  3  31  ? 15.292  113.543 66.261  1.00 54.82  ? 31   TRP C CE3   1 
ATOM   6815  C  CZ2   . TRP C  3  31  ? 13.697  112.900 63.999  1.00 55.73  ? 31   TRP C CZ2   1 
ATOM   6816  C  CZ3   . TRP C  3  31  ? 14.398  114.461 65.716  1.00 55.63  ? 31   TRP C CZ3   1 
ATOM   6817  C  CH2   . TRP C  3  31  ? 13.610  114.130 64.592  1.00 55.54  ? 31   TRP C CH2   1 
ATOM   6818  N  N     . TRP C  3  32  ? 20.646  111.220 67.478  1.00 51.49  ? 32   TRP C N     1 
ATOM   6819  C  CA    . TRP C  3  32  ? 21.692  111.157 68.483  1.00 51.47  ? 32   TRP C CA    1 
ATOM   6820  C  C     . TRP C  3  32  ? 22.714  112.291 68.289  1.00 51.48  ? 32   TRP C C     1 
ATOM   6821  O  O     . TRP C  3  32  ? 23.772  112.307 68.919  1.00 53.42  ? 32   TRP C O     1 
ATOM   6822  C  CB    . TRP C  3  32  ? 22.379  109.786 68.407  1.00 51.07  ? 32   TRP C CB    1 
ATOM   6823  C  CG    . TRP C  3  32  ? 21.809  108.752 69.344  1.00 50.09  ? 32   TRP C CG    1 
ATOM   6824  C  CD1   . TRP C  3  32  ? 22.336  108.367 70.537  1.00 50.74  ? 32   TRP C CD1   1 
ATOM   6825  C  CD2   . TRP C  3  32  ? 20.590  108.010 69.189  1.00 49.93  ? 32   TRP C CD2   1 
ATOM   6826  N  NE1   . TRP C  3  32  ? 21.527  107.438 71.137  1.00 50.59  ? 32   TRP C NE1   1 
ATOM   6827  C  CE2   . TRP C  3  32  ? 20.446  107.201 70.332  1.00 49.87  ? 32   TRP C CE2   1 
ATOM   6828  C  CE3   . TRP C  3  32  ? 19.601  107.951 68.198  1.00 51.04  ? 32   TRP C CE3   1 
ATOM   6829  C  CZ2   . TRP C  3  32  ? 19.348  106.341 70.515  1.00 49.46  ? 32   TRP C CZ2   1 
ATOM   6830  C  CZ3   . TRP C  3  32  ? 18.501  107.086 68.384  1.00 48.49  ? 32   TRP C CZ3   1 
ATOM   6831  C  CH2   . TRP C  3  32  ? 18.391  106.301 69.530  1.00 47.04  ? 32   TRP C CH2   1 
ATOM   6832  N  N     . ASN C  3  33  ? 22.394  113.253 67.435  1.00 49.93  ? 33   ASN C N     1 
ATOM   6833  C  CA    . ASN C  3  33  ? 23.318  114.349 67.171  1.00 49.89  ? 33   ASN C CA    1 
ATOM   6834  C  C     . ASN C  3  33  ? 23.066  115.524 68.086  1.00 49.94  ? 33   ASN C C     1 
ATOM   6835  O  O     . ASN C  3  33  ? 23.921  116.385 68.263  1.00 52.42  ? 33   ASN C O     1 
ATOM   6836  C  CB    . ASN C  3  33  ? 23.184  114.834 65.716  1.00 50.81  ? 33   ASN C CB    1 
ATOM   6837  C  CG    . ASN C  3  33  ? 24.021  114.022 64.728  1.00 52.55  ? 33   ASN C CG    1 
ATOM   6838  O  OD1   . ASN C  3  33  ? 23.832  112.804 64.551  1.00 52.80  ? 33   ASN C OD1   1 
ATOM   6839  N  ND2   . ASN C  3  33  ? 24.954  114.703 64.072  1.00 51.97  ? 33   ASN C ND2   1 
ATOM   6840  N  N     . PHE C  3  34  ? 21.892  115.563 68.684  1.00 48.28  ? 34   PHE C N     1 
ATOM   6841  C  CA    . PHE C  3  34  ? 21.545  116.686 69.530  1.00 46.52  ? 34   PHE C CA    1 
ATOM   6842  C  C     . PHE C  3  34  ? 22.356  116.846 70.812  1.00 47.62  ? 34   PHE C C     1 
ATOM   6843  O  O     . PHE C  3  34  ? 22.455  117.962 71.344  1.00 48.62  ? 34   PHE C O     1 
ATOM   6844  C  CB    . PHE C  3  34  ? 20.029  116.647 69.777  1.00 42.08  ? 34   PHE C CB    1 
ATOM   6845  C  CG    . PHE C  3  34  ? 19.249  116.780 68.509  1.00 36.33  ? 34   PHE C CG    1 
ATOM   6846  C  CD1   . PHE C  3  34  ? 19.237  117.983 67.815  1.00 33.68  ? 34   PHE C CD1   1 
ATOM   6847  C  CD2   . PHE C  3  34  ? 18.683  115.676 67.911  1.00 35.43  ? 34   PHE C CD2   1 
ATOM   6848  C  CE1   . PHE C  3  34  ? 18.691  118.083 66.545  1.00 30.13  ? 34   PHE C CE1   1 
ATOM   6849  C  CE2   . PHE C  3  34  ? 18.133  115.776 66.628  1.00 33.94  ? 34   PHE C CE2   1 
ATOM   6850  C  CZ    . PHE C  3  34  ? 18.145  116.985 65.953  1.00 30.49  ? 34   PHE C CZ    1 
ATOM   6851  N  N     . GLY C  3  35  ? 22.952  115.753 71.293  1.00 47.68  ? 35   GLY C N     1 
ATOM   6852  C  CA    . GLY C  3  35  ? 23.772  115.828 72.496  1.00 47.23  ? 35   GLY C CA    1 
ATOM   6853  C  C     . GLY C  3  35  ? 24.940  116.785 72.270  1.00 47.67  ? 35   GLY C C     1 
ATOM   6854  O  O     . GLY C  3  35  ? 25.108  117.782 72.978  1.00 46.20  ? 35   GLY C O     1 
ATOM   6855  N  N     . SER C  3  36  ? 25.752  116.494 71.262  1.00 47.56  ? 36   SER C N     1 
ATOM   6856  C  CA    . SER C  3  36  ? 26.882  117.350 70.955  1.00 48.60  ? 36   SER C CA    1 
ATOM   6857  C  C     . SER C  3  36  ? 26.425  118.762 70.651  1.00 49.13  ? 36   SER C C     1 
ATOM   6858  O  O     . SER C  3  36  ? 27.053  119.722 71.100  1.00 49.11  ? 36   SER C O     1 
ATOM   6859  C  CB    . SER C  3  36  ? 27.668  116.795 69.774  1.00 48.38  ? 36   SER C CB    1 
ATOM   6860  O  OG    . SER C  3  36  ? 26.795  116.312 68.784  1.00 50.15  ? 36   SER C OG    1 
ATOM   6861  N  N     . LEU C  3  37  ? 25.339  118.903 69.887  1.00 49.62  ? 37   LEU C N     1 
ATOM   6862  C  CA    . LEU C  3  37  ? 24.828  120.244 69.570  1.00 47.99  ? 37   LEU C CA    1 
ATOM   6863  C  C     . LEU C  3  37  ? 24.532  120.979 70.869  1.00 45.80  ? 37   LEU C C     1 
ATOM   6864  O  O     . LEU C  3  37  ? 24.975  122.114 71.063  1.00 45.99  ? 37   LEU C O     1 
ATOM   6865  C  CB    . LEU C  3  37  ? 23.560  120.178 68.715  1.00 48.74  ? 37   LEU C CB    1 
ATOM   6866  C  CG    . LEU C  3  37  ? 23.759  119.707 67.271  1.00 50.95  ? 37   LEU C CG    1 
ATOM   6867  C  CD1   . LEU C  3  37  ? 22.424  119.725 66.561  1.00 51.37  ? 37   LEU C CD1   1 
ATOM   6868  C  CD2   . LEU C  3  37  ? 24.755  120.596 66.543  1.00 50.13  ? 37   LEU C CD2   1 
ATOM   6869  N  N     . LEU C  3  38  ? 23.795  120.328 71.763  1.00 42.35  ? 38   LEU C N     1 
ATOM   6870  C  CA    . LEU C  3  38  ? 23.483  120.941 73.037  1.00 38.83  ? 38   LEU C CA    1 
ATOM   6871  C  C     . LEU C  3  38  ? 24.760  121.427 73.662  1.00 37.24  ? 38   LEU C C     1 
ATOM   6872  O  O     . LEU C  3  38  ? 24.848  122.568 74.075  1.00 35.47  ? 38   LEU C O     1 
ATOM   6873  C  CB    . LEU C  3  38  ? 22.779  119.951 73.949  1.00 36.69  ? 38   LEU C CB    1 
ATOM   6874  C  CG    . LEU C  3  38  ? 21.342  119.816 73.467  1.00 35.36  ? 38   LEU C CG    1 
ATOM   6875  C  CD1   . LEU C  3  38  ? 20.627  118.759 74.232  1.00 36.05  ? 38   LEU C CD1   1 
ATOM   6876  C  CD2   . LEU C  3  38  ? 20.649  121.138 73.640  1.00 35.70  ? 38   LEU C CD2   1 
ATOM   6877  N  N     . ALA C  3  39  ? 25.763  120.561 73.702  1.00 39.07  ? 39   ALA C N     1 
ATOM   6878  C  CA    . ALA C  3  39  ? 27.063  120.922 74.272  1.00 38.89  ? 39   ALA C CA    1 
ATOM   6879  C  C     . ALA C  3  39  ? 27.657  122.118 73.532  1.00 39.27  ? 39   ALA C C     1 
ATOM   6880  O  O     . ALA C  3  39  ? 27.935  123.139 74.146  1.00 40.55  ? 39   ALA C O     1 
ATOM   6881  C  CB    . ALA C  3  39  ? 28.013  119.746 74.196  1.00 36.67  ? 39   ALA C CB    1 
ATOM   6882  N  N     . VAL C  3  40  ? 27.841  122.001 72.220  1.00 39.69  ? 40   VAL C N     1 
ATOM   6883  C  CA    . VAL C  3  40  ? 28.406  123.099 71.432  1.00 42.69  ? 40   VAL C CA    1 
ATOM   6884  C  C     . VAL C  3  40  ? 27.626  124.388 71.645  1.00 45.22  ? 40   VAL C C     1 
ATOM   6885  O  O     . VAL C  3  40  ? 28.178  125.467 71.839  1.00 44.99  ? 40   VAL C O     1 
ATOM   6886  C  CB    . VAL C  3  40  ? 28.364  122.778 69.960  1.00 41.36  ? 40   VAL C CB    1 
ATOM   6887  C  CG1   . VAL C  3  40  ? 28.873  123.952 69.159  1.00 38.93  ? 40   VAL C CG1   1 
ATOM   6888  C  CG2   . VAL C  3  40  ? 29.190  121.562 69.706  1.00 42.52  ? 40   VAL C CG2   1 
ATOM   6889  N  N     . CYS C  3  41  ? 26.318  124.242 71.587  1.00 47.68  ? 41   CYS C N     1 
ATOM   6890  C  CA    . CYS C  3  41  ? 25.394  125.332 71.798  1.00 49.25  ? 41   CYS C CA    1 
ATOM   6891  C  C     . CYS C  3  41  ? 25.762  126.067 73.116  1.00 47.37  ? 41   CYS C C     1 
ATOM   6892  O  O     . CYS C  3  41  ? 25.871  127.289 73.169  1.00 46.01  ? 41   CYS C O     1 
ATOM   6893  C  CB    . CYS C  3  41  ? 23.999  124.706 71.868  1.00 52.15  ? 41   CYS C CB    1 
ATOM   6894  S  SG    . CYS C  3  41  ? 22.657  125.796 71.587  1.00 60.09  ? 41   CYS C SG    1 
ATOM   6895  N  N     . LEU C  3  42  ? 25.965  125.291 74.172  1.00 45.98  ? 42   LEU C N     1 
ATOM   6896  C  CA    . LEU C  3  42  ? 26.316  125.809 75.481  1.00 45.46  ? 42   LEU C CA    1 
ATOM   6897  C  C     . LEU C  3  42  ? 27.612  126.591 75.483  1.00 48.36  ? 42   LEU C C     1 
ATOM   6898  O  O     . LEU C  3  42  ? 27.713  127.614 76.153  1.00 49.98  ? 42   LEU C O     1 
ATOM   6899  C  CB    . LEU C  3  42  ? 26.450  124.666 76.478  1.00 42.87  ? 42   LEU C CB    1 
ATOM   6900  C  CG    . LEU C  3  42  ? 26.889  125.112 77.864  1.00 41.86  ? 42   LEU C CG    1 
ATOM   6901  C  CD1   . LEU C  3  42  ? 25.792  125.929 78.448  1.00 43.21  ? 42   LEU C CD1   1 
ATOM   6902  C  CD2   . LEU C  3  42  ? 27.167  123.937 78.768  1.00 42.65  ? 42   LEU C CD2   1 
ATOM   6903  N  N     . MET C  3  43  ? 28.625  126.105 74.771  1.00 49.81  ? 43   MET C N     1 
ATOM   6904  C  CA    . MET C  3  43  ? 29.890  126.815 74.739  1.00 50.18  ? 43   MET C CA    1 
ATOM   6905  C  C     . MET C  3  43  ? 29.684  128.147 74.051  1.00 48.52  ? 43   MET C C     1 
ATOM   6906  O  O     . MET C  3  43  ? 30.165  129.173 74.499  1.00 49.33  ? 43   MET C O     1 
ATOM   6907  C  CB    . MET C  3  43  ? 30.931  125.991 74.014  1.00 55.84  ? 43   MET C CB    1 
ATOM   6908  C  CG    . MET C  3  43  ? 31.321  124.734 74.775  1.00 66.52  ? 43   MET C CG    1 
ATOM   6909  S  SD    . MET C  3  43  ? 32.542  123.675 73.878  1.00 80.19  ? 43   MET C SD    1 
ATOM   6910  C  CE    . MET C  3  43  ? 34.167  124.232 74.691  1.00 77.94  ? 43   MET C CE    1 
ATOM   6911  N  N     . THR C  3  44  ? 28.924  128.133 72.972  1.00 47.77  ? 44   THR C N     1 
ATOM   6912  C  CA    . THR C  3  44  ? 28.630  129.337 72.208  1.00 46.72  ? 44   THR C CA    1 
ATOM   6913  C  C     . THR C  3  44  ? 27.922  130.399 73.047  1.00 47.02  ? 44   THR C C     1 
ATOM   6914  O  O     . THR C  3  44  ? 28.246  131.584 72.969  1.00 46.09  ? 44   THR C O     1 
ATOM   6915  C  CB    . THR C  3  44  ? 27.733  128.985 71.042  1.00 47.11  ? 44   THR C CB    1 
ATOM   6916  O  OG1   . THR C  3  44  ? 28.238  127.801 70.435  1.00 48.40  ? 44   THR C OG1   1 
ATOM   6917  C  CG2   . THR C  3  44  ? 27.696  130.095 70.013  1.00 47.04  ? 44   THR C CG2   1 
ATOM   6918  N  N     . GLN C  3  45  ? 26.936  129.979 73.836  1.00 47.12  ? 45   GLN C N     1 
ATOM   6919  C  CA    . GLN C  3  45  ? 26.202  130.925 74.671  1.00 46.90  ? 45   GLN C CA    1 
ATOM   6920  C  C     . GLN C  3  45  ? 27.138  131.626 75.637  1.00 46.28  ? 45   GLN C C     1 
ATOM   6921  O  O     . GLN C  3  45  ? 27.138  132.861 75.739  1.00 47.08  ? 45   GLN C O     1 
ATOM   6922  C  CB    . GLN C  3  45  ? 25.086  130.228 75.461  1.00 45.73  ? 45   GLN C CB    1 
ATOM   6923  C  CG    . GLN C  3  45  ? 23.834  129.939 74.657  1.00 47.50  ? 45   GLN C CG    1 
ATOM   6924  C  CD    . GLN C  3  45  ? 23.381  131.124 73.806  1.00 48.29  ? 45   GLN C CD    1 
ATOM   6925  O  OE1   . GLN C  3  45  ? 23.960  131.405 72.743  1.00 50.32  ? 45   GLN C OE1   1 
ATOM   6926  N  NE2   . GLN C  3  45  ? 22.355  131.827 74.271  1.00 45.24  ? 45   GLN C NE2   1 
ATOM   6927  N  N     . ILE C  3  46  ? 27.927  130.821 76.346  1.00 45.02  ? 46   ILE C N     1 
ATOM   6928  C  CA    . ILE C  3  46  ? 28.895  131.313 77.316  1.00 42.84  ? 46   ILE C CA    1 
ATOM   6929  C  C     . ILE C  3  46  ? 29.872  132.264 76.649  1.00 42.31  ? 46   ILE C C     1 
ATOM   6930  O  O     . ILE C  3  46  ? 30.140  133.345 77.154  1.00 43.85  ? 46   ILE C O     1 
ATOM   6931  C  CB    . ILE C  3  46  ? 29.658  130.154 77.934  1.00 41.90  ? 46   ILE C CB    1 
ATOM   6932  C  CG1   . ILE C  3  46  ? 28.742  129.422 78.912  1.00 42.38  ? 46   ILE C CG1   1 
ATOM   6933  C  CG2   . ILE C  3  46  ? 30.903  130.649 78.599  1.00 39.23  ? 46   ILE C CG2   1 
ATOM   6934  C  CD1   . ILE C  3  46  ? 29.232  128.048 79.297  1.00 43.77  ? 46   ILE C CD1   1 
ATOM   6935  N  N     . LEU C  3  47  ? 30.390  131.876 75.498  1.00 40.19  ? 47   LEU C N     1 
ATOM   6936  C  CA    . LEU C  3  47  ? 31.317  132.732 74.808  1.00 39.37  ? 47   LEU C CA    1 
ATOM   6937  C  C     . LEU C  3  47  ? 30.685  134.069 74.413  1.00 38.91  ? 47   LEU C C     1 
ATOM   6938  O  O     . LEU C  3  47  ? 31.192  135.120 74.795  1.00 38.47  ? 47   LEU C O     1 
ATOM   6939  C  CB    . LEU C  3  47  ? 31.862  132.010 73.592  1.00 41.64  ? 47   LEU C CB    1 
ATOM   6940  C  CG    . LEU C  3  47  ? 32.962  132.800 72.886  1.00 44.28  ? 47   LEU C CG    1 
ATOM   6941  C  CD1   . LEU C  3  47  ? 34.079  133.157 73.865  1.00 43.76  ? 47   LEU C CD1   1 
ATOM   6942  C  CD2   . LEU C  3  47  ? 33.501  131.961 71.748  1.00 45.25  ? 47   LEU C CD2   1 
ATOM   6943  N  N     . THR C  3  48  ? 29.585  134.043 73.658  1.00 39.15  ? 48   THR C N     1 
ATOM   6944  C  CA    . THR C  3  48  ? 28.899  135.289 73.259  1.00 38.39  ? 48   THR C CA    1 
ATOM   6945  C  C     . THR C  3  48  ? 28.420  136.058 74.500  1.00 38.87  ? 48   THR C C     1 
ATOM   6946  O  O     . THR C  3  48  ? 28.542  137.283 74.586  1.00 36.82  ? 48   THR C O     1 
ATOM   6947  C  CB    . THR C  3  48  ? 27.663  135.011 72.352  1.00 37.87  ? 48   THR C CB    1 
ATOM   6948  O  OG1   . THR C  3  48  ? 26.701  134.202 73.048  1.00 38.61  ? 48   THR C OG1   1 
ATOM   6949  C  CG2   . THR C  3  48  ? 28.090  134.301 71.093  1.00 34.99  ? 48   THR C CG2   1 
ATOM   6950  N  N     . GLY C  3  49  ? 27.881  135.316 75.462  1.00 39.14  ? 49   GLY C N     1 
ATOM   6951  C  CA    . GLY C  3  49  ? 27.406  135.917 76.687  1.00 39.61  ? 49   GLY C CA    1 
ATOM   6952  C  C     . GLY C  3  49  ? 28.460  136.736 77.406  1.00 41.22  ? 49   GLY C C     1 
ATOM   6953  O  O     . GLY C  3  49  ? 28.164  137.825 77.884  1.00 41.15  ? 49   GLY C O     1 
ATOM   6954  N  N     . LEU C  3  50  ? 29.680  136.212 77.521  1.00 42.52  ? 50   LEU C N     1 
ATOM   6955  C  CA    . LEU C  3  50  ? 30.753  136.944 78.196  1.00 43.18  ? 50   LEU C CA    1 
ATOM   6956  C  C     . LEU C  3  50  ? 31.057  138.216 77.412  1.00 44.10  ? 50   LEU C C     1 
ATOM   6957  O  O     . LEU C  3  50  ? 31.152  139.317 77.977  1.00 43.43  ? 50   LEU C O     1 
ATOM   6958  C  CB    . LEU C  3  50  ? 32.022  136.099 78.292  1.00 42.70  ? 50   LEU C CB    1 
ATOM   6959  C  CG    . LEU C  3  50  ? 32.078  134.999 79.360  1.00 43.50  ? 50   LEU C CG    1 
ATOM   6960  C  CD1   . LEU C  3  50  ? 33.304  134.136 79.079  1.00 42.18  ? 50   LEU C CD1   1 
ATOM   6961  C  CD2   . LEU C  3  50  ? 32.136  135.576 80.772  1.00 38.96  ? 50   LEU C CD2   1 
ATOM   6962  N  N     . LEU C  3  51  ? 31.215  138.059 76.105  1.00 43.69  ? 51   LEU C N     1 
ATOM   6963  C  CA    . LEU C  3  51  ? 31.483  139.202 75.263  1.00 43.86  ? 51   LEU C CA    1 
ATOM   6964  C  C     . LEU C  3  51  ? 30.417  140.280 75.477  1.00 43.21  ? 51   LEU C C     1 
ATOM   6965  O  O     . LEU C  3  51  ? 30.732  141.466 75.433  1.00 43.84  ? 51   LEU C O     1 
ATOM   6966  C  CB    . LEU C  3  51  ? 31.547  138.768 73.791  1.00 46.37  ? 51   LEU C CB    1 
ATOM   6967  C  CG    . LEU C  3  51  ? 32.933  138.296 73.308  1.00 46.33  ? 51   LEU C CG    1 
ATOM   6968  C  CD1   . LEU C  3  51  ? 32.856  137.633 71.934  1.00 44.94  ? 51   LEU C CD1   1 
ATOM   6969  C  CD2   . LEU C  3  51  ? 33.855  139.512 73.248  1.00 45.93  ? 51   LEU C CD2   1 
ATOM   6970  N  N     . LEU C  3  52  ? 29.166  139.880 75.723  1.00 42.30  ? 52   LEU C N     1 
ATOM   6971  C  CA    . LEU C  3  52  ? 28.091  140.856 75.947  1.00 40.83  ? 52   LEU C CA    1 
ATOM   6972  C  C     . LEU C  3  52  ? 28.115  141.453 77.327  1.00 42.39  ? 52   LEU C C     1 
ATOM   6973  O  O     . LEU C  3  52  ? 27.763  142.617 77.509  1.00 43.18  ? 52   LEU C O     1 
ATOM   6974  C  CB    . LEU C  3  52  ? 26.720  140.244 75.792  1.00 37.23  ? 52   LEU C CB    1 
ATOM   6975  C  CG    . LEU C  3  52  ? 26.184  139.874 74.433  1.00 35.16  ? 52   LEU C CG    1 
ATOM   6976  C  CD1   . LEU C  3  52  ? 24.728  139.667 74.645  1.00 33.57  ? 52   LEU C CD1   1 
ATOM   6977  C  CD2   . LEU C  3  52  ? 26.423  140.938 73.395  1.00 34.61  ? 52   LEU C CD2   1 
ATOM   6978  N  N     . ALA C  3  53  ? 28.492  140.636 78.303  1.00 44.85  ? 53   ALA C N     1 
ATOM   6979  C  CA    . ALA C  3  53  ? 28.553  141.069 79.692  1.00 46.98  ? 53   ALA C CA    1 
ATOM   6980  C  C     . ALA C  3  53  ? 29.662  142.084 79.909  1.00 48.90  ? 53   ALA C C     1 
ATOM   6981  O  O     . ALA C  3  53  ? 29.679  142.787 80.910  1.00 50.15  ? 53   ALA C O     1 
ATOM   6982  C  CB    . ALA C  3  53  ? 28.756  139.870 80.599  1.00 45.81  ? 53   ALA C CB    1 
ATOM   6983  N  N     . MET C  3  54  ? 30.597  142.164 78.976  1.00 50.84  ? 54   MET C N     1 
ATOM   6984  C  CA    . MET C  3  54  ? 31.670  143.122 79.132  1.00 53.30  ? 54   MET C CA    1 
ATOM   6985  C  C     . MET C  3  54  ? 31.254  144.502 78.682  1.00 53.04  ? 54   MET C C     1 
ATOM   6986  O  O     . MET C  3  54  ? 32.088  145.420 78.633  1.00 56.99  ? 54   MET C O     1 
ATOM   6987  C  CB    . MET C  3  54  ? 32.888  142.692 78.343  1.00 54.97  ? 54   MET C CB    1 
ATOM   6988  C  CG    . MET C  3  54  ? 33.351  141.368 78.767  1.00 58.35  ? 54   MET C CG    1 
ATOM   6989  S  SD    . MET C  3  54  ? 34.796  140.963 77.871  1.00 65.34  ? 54   MET C SD    1 
ATOM   6990  C  CE    . MET C  3  54  ? 35.447  139.564 79.008  1.00 60.03  ? 54   MET C CE    1 
ATOM   6991  N  N     . HIS C  3  55  ? 29.980  144.663 78.353  1.00 48.92  ? 55   HIS C N     1 
ATOM   6992  C  CA    . HIS C  3  55  ? 29.512  145.957 77.913  1.00 46.95  ? 55   HIS C CA    1 
ATOM   6993  C  C     . HIS C  3  55  ? 28.158  146.291 78.513  1.00 47.74  ? 55   HIS C C     1 
ATOM   6994  O  O     . HIS C  3  55  ? 27.595  147.365 78.269  1.00 48.88  ? 55   HIS C O     1 
ATOM   6995  C  CB    . HIS C  3  55  ? 29.438  145.992 76.389  1.00 44.47  ? 55   HIS C CB    1 
ATOM   6996  C  CG    . HIS C  3  55  ? 30.772  145.934 75.714  1.00 44.81  ? 55   HIS C CG    1 
ATOM   6997  N  ND1   . HIS C  3  55  ? 31.261  144.787 75.126  1.00 44.88  ? 55   HIS C ND1   1 
ATOM   6998  C  CD2   . HIS C  3  55  ? 31.706  146.894 75.497  1.00 45.70  ? 55   HIS C CD2   1 
ATOM   6999  C  CE1   . HIS C  3  55  ? 32.433  145.045 74.567  1.00 46.48  ? 55   HIS C CE1   1 
ATOM   7000  N  NE2   . HIS C  3  55  ? 32.728  146.316 74.778  1.00 44.60  ? 55   HIS C NE2   1 
ATOM   7001  N  N     . TYR C  3  56  ? 27.642  145.374 79.316  1.00 47.44  ? 56   TYR C N     1 
ATOM   7002  C  CA    . TYR C  3  56  ? 26.335  145.551 79.929  1.00 47.47  ? 56   TYR C CA    1 
ATOM   7003  C  C     . TYR C  3  56  ? 26.447  146.257 81.254  1.00 47.81  ? 56   TYR C C     1 
ATOM   7004  O  O     . TYR C  3  56  ? 27.491  146.230 81.887  1.00 48.45  ? 56   TYR C O     1 
ATOM   7005  C  CB    . TYR C  3  56  ? 25.689  144.182 80.146  1.00 47.38  ? 56   TYR C CB    1 
ATOM   7006  C  CG    . TYR C  3  56  ? 24.357  144.197 80.862  1.00 46.48  ? 56   TYR C CG    1 
ATOM   7007  C  CD1   . TYR C  3  56  ? 23.199  144.617 80.212  1.00 47.34  ? 56   TYR C CD1   1 
ATOM   7008  C  CD2   . TYR C  3  56  ? 24.249  143.759 82.180  1.00 45.78  ? 56   TYR C CD2   1 
ATOM   7009  C  CE1   . TYR C  3  56  ? 21.958  144.597 80.853  1.00 46.78  ? 56   TYR C CE1   1 
ATOM   7010  C  CE2   . TYR C  3  56  ? 23.027  143.737 82.829  1.00 46.45  ? 56   TYR C CE2   1 
ATOM   7011  C  CZ    . TYR C  3  56  ? 21.879  144.159 82.160  1.00 47.05  ? 56   TYR C CZ    1 
ATOM   7012  O  OH    . TYR C  3  56  ? 20.661  144.149 82.804  1.00 45.85  ? 56   TYR C OH    1 
ATOM   7013  N  N     . THR C  3  57  ? 25.373  146.908 81.674  1.00 49.05  ? 57   THR C N     1 
ATOM   7014  C  CA    . THR C  3  57  ? 25.378  147.557 82.974  1.00 50.88  ? 57   THR C CA    1 
ATOM   7015  C  C     . THR C  3  57  ? 24.090  147.137 83.638  1.00 50.37  ? 57   THR C C     1 
ATOM   7016  O  O     . THR C  3  57  ? 23.024  147.384 83.116  1.00 51.80  ? 57   THR C O     1 
ATOM   7017  C  CB    . THR C  3  57  ? 25.425  149.090 82.891  1.00 51.01  ? 57   THR C CB    1 
ATOM   7018  O  OG1   . THR C  3  57  ? 26.683  149.513 82.346  1.00 54.82  ? 57   THR C OG1   1 
ATOM   7019  C  CG2   . THR C  3  57  ? 25.288  149.675 84.286  1.00 49.96  ? 57   THR C CG2   1 
ATOM   7020  N  N     . ALA C  3  58  ? 24.196  146.479 84.782  1.00 50.57  ? 58   ALA C N     1 
ATOM   7021  C  CA    . ALA C  3  58  ? 23.026  146.005 85.494  1.00 50.99  ? 58   ALA C CA    1 
ATOM   7022  C  C     . ALA C  3  58  ? 22.454  147.055 86.416  1.00 52.35  ? 58   ALA C C     1 
ATOM   7023  O  O     . ALA C  3  58  ? 22.658  147.031 87.637  1.00 53.52  ? 58   ALA C O     1 
ATOM   7024  C  CB    . ALA C  3  58  ? 23.366  144.754 86.279  1.00 50.10  ? 58   ALA C CB    1 
ATOM   7025  N  N     . ASP C  3  59  ? 21.738  147.995 85.829  1.00 53.21  ? 59   ASP C N     1 
ATOM   7026  C  CA    . ASP C  3  59  ? 21.114  149.022 86.619  1.00 54.65  ? 59   ASP C CA    1 
ATOM   7027  C  C     . ASP C  3  59  ? 19.936  149.470 85.820  1.00 53.53  ? 59   ASP C C     1 
ATOM   7028  O  O     . ASP C  3  59  ? 20.080  149.751 84.640  1.00 53.22  ? 59   ASP C O     1 
ATOM   7029  C  CB    . ASP C  3  59  ? 22.059  150.184 86.839  1.00 58.70  ? 59   ASP C CB    1 
ATOM   7030  C  CG    . ASP C  3  59  ? 21.482  151.207 87.786  1.00 63.13  ? 59   ASP C CG    1 
ATOM   7031  O  OD1   . ASP C  3  59  ? 21.564  150.997 89.031  1.00 64.52  ? 59   ASP C OD1   1 
ATOM   7032  O  OD2   . ASP C  3  59  ? 20.928  152.207 87.274  1.00 64.01  ? 59   ASP C OD2   1 
ATOM   7033  N  N     . THR C  3  60  ? 18.772  149.531 86.452  1.00 53.69  ? 60   THR C N     1 
ATOM   7034  C  CA    . THR C  3  60  ? 17.556  149.935 85.753  1.00 56.02  ? 60   THR C CA    1 
ATOM   7035  C  C     . THR C  3  60  ? 17.748  151.163 84.859  1.00 55.76  ? 60   THR C C     1 
ATOM   7036  O  O     . THR C  3  60  ? 17.309  151.177 83.707  1.00 56.64  ? 60   THR C O     1 
ATOM   7037  C  CB    . THR C  3  60  ? 16.393  150.200 86.742  1.00 57.55  ? 60   THR C CB    1 
ATOM   7038  O  OG1   . THR C  3  60  ? 16.727  151.280 87.625  1.00 60.09  ? 60   THR C OG1   1 
ATOM   7039  C  CG2   . THR C  3  60  ? 16.113  148.963 87.562  1.00 57.28  ? 60   THR C CG2   1 
ATOM   7040  N  N     . SER C  3  61  ? 18.433  152.175 85.372  1.00 55.13  ? 61   SER C N     1 
ATOM   7041  C  CA    . SER C  3  61  ? 18.665  153.392 84.607  1.00 55.16  ? 61   SER C CA    1 
ATOM   7042  C  C     . SER C  3  61  ? 19.671  153.264 83.466  1.00 53.28  ? 61   SER C C     1 
ATOM   7043  O  O     . SER C  3  61  ? 19.841  154.210 82.710  1.00 53.34  ? 61   SER C O     1 
ATOM   7044  C  CB    . SER C  3  61  ? 19.157  154.505 85.526  1.00 58.45  ? 61   SER C CB    1 
ATOM   7045  O  OG    . SER C  3  61  ? 20.532  154.317 85.848  1.00 63.12  ? 61   SER C OG    1 
ATOM   7046  N  N     . LEU C  3  62  ? 20.344  152.125 83.337  1.00 51.11  ? 62   LEU C N     1 
ATOM   7047  C  CA    . LEU C  3  62  ? 21.327  151.977 82.273  1.00 49.07  ? 62   LEU C CA    1 
ATOM   7048  C  C     . LEU C  3  62  ? 21.264  150.672 81.473  1.00 49.92  ? 62   LEU C C     1 
ATOM   7049  O  O     . LEU C  3  62  ? 21.915  150.537 80.426  1.00 51.16  ? 62   LEU C O     1 
ATOM   7050  C  CB    . LEU C  3  62  ? 22.715  152.129 82.866  1.00 48.47  ? 62   LEU C CB    1 
ATOM   7051  C  CG    . LEU C  3  62  ? 22.949  153.414 83.642  1.00 47.98  ? 62   LEU C CG    1 
ATOM   7052  C  CD1   . LEU C  3  62  ? 24.277  153.354 84.340  1.00 48.04  ? 62   LEU C CD1   1 
ATOM   7053  C  CD2   . LEU C  3  62  ? 22.901  154.590 82.686  1.00 47.88  ? 62   LEU C CD2   1 
ATOM   7054  N  N     . ALA C  3  63  ? 20.484  149.712 81.956  1.00 48.58  ? 63   ALA C N     1 
ATOM   7055  C  CA    . ALA C  3  63  ? 20.360  148.425 81.284  1.00 46.11  ? 63   ALA C CA    1 
ATOM   7056  C  C     . ALA C  3  63  ? 19.978  148.541 79.823  1.00 45.16  ? 63   ALA C C     1 
ATOM   7057  O  O     . ALA C  3  63  ? 20.734  148.179 78.927  1.00 46.01  ? 63   ALA C O     1 
ATOM   7058  C  CB    . ALA C  3  63  ? 19.337  147.588 81.990  1.00 47.13  ? 63   ALA C CB    1 
ATOM   7059  N  N     . PHE C  3  64  ? 18.783  149.050 79.591  1.00 43.93  ? 64   PHE C N     1 
ATOM   7060  C  CA    . PHE C  3  64  ? 18.269  149.177 78.245  1.00 41.82  ? 64   PHE C CA    1 
ATOM   7061  C  C     . PHE C  3  64  ? 19.253  149.843 77.306  1.00 41.32  ? 64   PHE C C     1 
ATOM   7062  O  O     . PHE C  3  64  ? 19.491  149.365 76.193  1.00 40.94  ? 64   PHE C O     1 
ATOM   7063  C  CB    . PHE C  3  64  ? 16.957  149.969 78.275  1.00 42.08  ? 64   PHE C CB    1 
ATOM   7064  C  CG    . PHE C  3  64  ? 16.264  150.053 76.946  1.00 38.02  ? 64   PHE C CG    1 
ATOM   7065  C  CD1   . PHE C  3  64  ? 15.338  149.108 76.583  1.00 37.83  ? 64   PHE C CD1   1 
ATOM   7066  C  CD2   . PHE C  3  64  ? 16.577  151.058 76.043  1.00 36.56  ? 64   PHE C CD2   1 
ATOM   7067  C  CE1   . PHE C  3  64  ? 14.720  149.148 75.325  1.00 37.91  ? 64   PHE C CE1   1 
ATOM   7068  C  CE2   . PHE C  3  64  ? 15.972  151.101 74.804  1.00 36.94  ? 64   PHE C CE2   1 
ATOM   7069  C  CZ    . PHE C  3  64  ? 15.036  150.135 74.442  1.00 36.06  ? 64   PHE C CZ    1 
ATOM   7070  N  N     . SER C  3  65  ? 19.827  150.948 77.751  1.00 41.06  ? 65   SER C N     1 
ATOM   7071  C  CA    . SER C  3  65  ? 20.753  151.684 76.904  1.00 44.30  ? 65   SER C CA    1 
ATOM   7072  C  C     . SER C  3  65  ? 22.149  151.059 76.762  1.00 44.69  ? 65   SER C C     1 
ATOM   7073  O  O     . SER C  3  65  ? 22.865  151.319 75.770  1.00 45.45  ? 65   SER C O     1 
ATOM   7074  C  CB    . SER C  3  65  ? 20.887  153.114 77.412  1.00 45.07  ? 65   SER C CB    1 
ATOM   7075  O  OG    . SER C  3  65  ? 21.366  153.111 78.745  1.00 51.40  ? 65   SER C OG    1 
ATOM   7076  N  N     . SER C  3  66  ? 22.549  150.260 77.751  1.00 42.55  ? 66   SER C N     1 
ATOM   7077  C  CA    . SER C  3  66  ? 23.847  149.610 77.694  1.00 41.40  ? 66   SER C CA    1 
ATOM   7078  C  C     . SER C  3  66  ? 23.810  148.616 76.536  1.00 41.48  ? 66   SER C C     1 
ATOM   7079  O  O     . SER C  3  66  ? 24.764  148.499 75.742  1.00 42.02  ? 66   SER C O     1 
ATOM   7080  C  CB    . SER C  3  66  ? 24.138  148.893 79.011  1.00 41.28  ? 66   SER C CB    1 
ATOM   7081  O  OG    . SER C  3  66  ? 23.308  147.777 79.182  1.00 40.28  ? 66   SER C OG    1 
ATOM   7082  N  N     . VAL C  3  67  ? 22.684  147.924 76.447  1.00 39.28  ? 67   VAL C N     1 
ATOM   7083  C  CA    . VAL C  3  67  ? 22.449  146.955 75.407  1.00 38.18  ? 67   VAL C CA    1 
ATOM   7084  C  C     . VAL C  3  67  ? 22.419  147.690 74.076  1.00 39.31  ? 67   VAL C C     1 
ATOM   7085  O  O     . VAL C  3  67  ? 22.969  147.225 73.079  1.00 40.27  ? 67   VAL C O     1 
ATOM   7086  C  CB    . VAL C  3  67  ? 21.091  146.272 75.621  1.00 38.63  ? 67   VAL C CB    1 
ATOM   7087  C  CG1   . VAL C  3  67  ? 20.754  145.408 74.428  1.00 38.68  ? 67   VAL C CG1   1 
ATOM   7088  C  CG2   . VAL C  3  67  ? 21.104  145.443 76.903  1.00 35.84  ? 67   VAL C CG2   1 
ATOM   7089  N  N     . ALA C  3  68  ? 21.773  148.848 74.052  1.00 39.73  ? 68   ALA C N     1 
ATOM   7090  C  CA    . ALA C  3  68  ? 21.671  149.595 72.804  1.00 41.00  ? 68   ALA C CA    1 
ATOM   7091  C  C     . ALA C  3  68  ? 23.021  150.128 72.411  1.00 41.84  ? 68   ALA C C     1 
ATOM   7092  O  O     . ALA C  3  68  ? 23.346  150.186 71.224  1.00 41.59  ? 68   ALA C O     1 
ATOM   7093  C  CB    . ALA C  3  68  ? 20.674  150.739 72.942  1.00 40.36  ? 68   ALA C CB    1 
ATOM   7094  N  N     . HIS C  3  69  ? 23.803  150.528 73.412  1.00 42.54  ? 69   HIS C N     1 
ATOM   7095  C  CA    . HIS C  3  69  ? 25.121  151.061 73.150  1.00 43.72  ? 69   HIS C CA    1 
ATOM   7096  C  C     . HIS C  3  69  ? 25.952  149.918 72.582  1.00 42.07  ? 69   HIS C C     1 
ATOM   7097  O  O     . HIS C  3  69  ? 26.746  150.100 71.647  1.00 41.14  ? 69   HIS C O     1 
ATOM   7098  C  CB    . HIS C  3  69  ? 25.711  151.647 74.446  1.00 51.58  ? 69   HIS C CB    1 
ATOM   7099  C  CG    . HIS C  3  69  ? 27.221  151.600 74.530  1.00 60.64  ? 69   HIS C CG    1 
ATOM   7100  N  ND1   . HIS C  3  69  ? 27.909  150.564 75.142  1.00 62.46  ? 69   HIS C ND1   1 
ATOM   7101  C  CD2   . HIS C  3  69  ? 28.169  152.461 74.075  1.00 60.52  ? 69   HIS C CD2   1 
ATOM   7102  C  CE1   . HIS C  3  69  ? 29.210  150.791 75.055  1.00 62.94  ? 69   HIS C CE1   1 
ATOM   7103  N  NE2   . HIS C  3  69  ? 29.393  151.934 74.413  1.00 62.87  ? 69   HIS C NE2   1 
ATOM   7104  N  N     . THR C  3  70  ? 25.743  148.726 73.119  1.00 38.94  ? 70   THR C N     1 
ATOM   7105  C  CA    . THR C  3  70  ? 26.483  147.586 72.632  1.00 38.55  ? 70   THR C CA    1 
ATOM   7106  C  C     . THR C  3  70  ? 26.194  147.333 71.168  1.00 41.22  ? 70   THR C C     1 
ATOM   7107  O  O     . THR C  3  70  ? 27.100  147.045 70.409  1.00 44.39  ? 70   THR C O     1 
ATOM   7108  C  CB    . THR C  3  70  ? 26.130  146.323 73.381  1.00 36.25  ? 70   THR C CB    1 
ATOM   7109  O  OG1   . THR C  3  70  ? 26.311  146.537 74.774  1.00 37.67  ? 70   THR C OG1   1 
ATOM   7110  C  CG2   . THR C  3  70  ? 27.009  145.199 72.953  1.00 33.41  ? 70   THR C CG2   1 
ATOM   7111  N  N     . CYS C  3  71  ? 24.938  147.434 70.757  1.00 42.63  ? 71   CYS C N     1 
ATOM   7112  C  CA    . CYS C  3  71  ? 24.602  147.169 69.366  1.00 44.07  ? 71   CYS C CA    1 
ATOM   7113  C  C     . CYS C  3  71  ? 25.036  148.277 68.433  1.00 45.86  ? 71   CYS C C     1 
ATOM   7114  O  O     . CYS C  3  71  ? 25.526  148.022 67.324  1.00 46.95  ? 71   CYS C O     1 
ATOM   7115  C  CB    . CYS C  3  71  ? 23.110  146.953 69.238  1.00 45.18  ? 71   CYS C CB    1 
ATOM   7116  S  SG    . CYS C  3  71  ? 22.548  145.584 70.243  1.00 49.12  ? 71   CYS C SG    1 
ATOM   7117  N  N     . ARG C  3  72  ? 24.876  149.509 68.899  1.00 47.20  ? 72   ARG C N     1 
ATOM   7118  C  CA    . ARG C  3  72  ? 25.219  150.687 68.112  1.00 48.95  ? 72   ARG C CA    1 
ATOM   7119  C  C     . ARG C  3  72  ? 26.686  151.156 68.066  1.00 51.62  ? 72   ARG C C     1 
ATOM   7120  O  O     . ARG C  3  72  ? 27.101  151.778 67.071  1.00 52.75  ? 72   ARG C O     1 
ATOM   7121  C  CB    . ARG C  3  72  ? 24.359  151.854 68.571  1.00 46.44  ? 72   ARG C CB    1 
ATOM   7122  C  CG    . ARG C  3  72  ? 22.922  151.724 68.217  1.00 44.36  ? 72   ARG C CG    1 
ATOM   7123  C  CD    . ARG C  3  72  ? 22.162  152.904 68.746  1.00 44.44  ? 72   ARG C CD    1 
ATOM   7124  N  NE    . ARG C  3  72  ? 20.724  152.749 68.569  1.00 44.20  ? 72   ARG C NE    1 
ATOM   7125  C  CZ    . ARG C  3  72  ? 20.105  152.954 67.420  1.00 44.62  ? 72   ARG C CZ    1 
ATOM   7126  N  NH1   . ARG C  3  72  ? 20.821  153.328 66.365  1.00 46.18  ? 72   ARG C NH1   1 
ATOM   7127  N  NH2   . ARG C  3  72  ? 18.793  152.771 67.323  1.00 42.72  ? 72   ARG C NH2   1 
ATOM   7128  N  N     . ASN C  3  73  ? 27.466  150.888 69.117  1.00 52.31  ? 73   ASN C N     1 
ATOM   7129  C  CA    . ASN C  3  73  ? 28.853  151.346 69.134  1.00 51.86  ? 73   ASN C CA    1 
ATOM   7130  C  C     . ASN C  3  73  ? 29.911  150.274 69.159  1.00 51.92  ? 73   ASN C C     1 
ATOM   7131  O  O     . ASN C  3  73  ? 30.943  150.434 68.536  1.00 51.61  ? 73   ASN C O     1 
ATOM   7132  C  CB    . ASN C  3  73  ? 29.087  152.260 70.322  1.00 52.50  ? 73   ASN C CB    1 
ATOM   7133  C  CG    . ASN C  3  73  ? 28.130  153.409 70.350  1.00 55.38  ? 73   ASN C CG    1 
ATOM   7134  O  OD1   . ASN C  3  73  ? 27.855  154.033 69.319  1.00 56.90  ? 73   ASN C OD1   1 
ATOM   7135  N  ND2   . ASN C  3  73  ? 27.615  153.714 71.531  1.00 55.08  ? 73   ASN C ND2   1 
ATOM   7136  N  N     . VAL C  3  74  ? 29.671  149.195 69.895  1.00 51.65  ? 74   VAL C N     1 
ATOM   7137  C  CA    . VAL C  3  74  ? 30.651  148.120 69.996  1.00 51.34  ? 74   VAL C CA    1 
ATOM   7138  C  C     . VAL C  3  74  ? 30.850  147.382 68.673  1.00 52.72  ? 74   VAL C C     1 
ATOM   7139  O  O     . VAL C  3  74  ? 29.884  146.996 68.012  1.00 53.95  ? 74   VAL C O     1 
ATOM   7140  C  CB    . VAL C  3  74  ? 30.239  147.090 71.082  1.00 50.22  ? 74   VAL C CB    1 
ATOM   7141  C  CG1   . VAL C  3  74  ? 31.246  145.955 71.121  1.00 48.67  ? 74   VAL C CG1   1 
ATOM   7142  C  CG2   . VAL C  3  74  ? 30.118  147.770 72.441  1.00 45.18  ? 74   VAL C CG2   1 
ATOM   7143  N  N     . GLN C  3  75  ? 32.112  147.187 68.301  1.00 53.38  ? 75   GLN C N     1 
ATOM   7144  C  CA    . GLN C  3  75  ? 32.470  146.494 67.064  1.00 53.48  ? 75   GLN C CA    1 
ATOM   7145  C  C     . GLN C  3  75  ? 31.824  145.114 67.005  1.00 52.54  ? 75   GLN C C     1 
ATOM   7146  O  O     . GLN C  3  75  ? 32.236  144.203 67.715  1.00 52.43  ? 75   GLN C O     1 
ATOM   7147  C  CB    . GLN C  3  75  ? 33.984  146.349 66.996  1.00 56.01  ? 75   GLN C CB    1 
ATOM   7148  C  CG    . GLN C  3  75  ? 34.695  147.646 67.201  1.00 58.83  ? 75   GLN C CG    1 
ATOM   7149  C  CD    . GLN C  3  75  ? 34.158  148.689 66.259  1.00 63.02  ? 75   GLN C CD    1 
ATOM   7150  O  OE1   . GLN C  3  75  ? 33.599  148.343 65.213  1.00 65.00  ? 75   GLN C OE1   1 
ATOM   7151  N  NE2   . GLN C  3  75  ? 34.325  149.975 66.604  1.00 64.48  ? 75   GLN C NE2   1 
ATOM   7152  N  N     . TYR C  3  76  ? 30.823  144.968 66.146  1.00 51.31  ? 76   TYR C N     1 
ATOM   7153  C  CA    . TYR C  3  76  ? 30.081  143.718 65.998  1.00 49.92  ? 76   TYR C CA    1 
ATOM   7154  C  C     . TYR C  3  76  ? 29.200  143.394 67.202  1.00 47.86  ? 76   TYR C C     1 
ATOM   7155  O  O     . TYR C  3  76  ? 28.713  142.271 67.363  1.00 45.83  ? 76   TYR C O     1 
ATOM   7156  C  CB    . TYR C  3  76  ? 31.030  142.558 65.711  1.00 50.93  ? 76   TYR C CB    1 
ATOM   7157  C  CG    . TYR C  3  76  ? 31.756  142.742 64.420  1.00 51.77  ? 76   TYR C CG    1 
ATOM   7158  C  CD1   . TYR C  3  76  ? 33.029  143.279 64.395  1.00 52.35  ? 76   TYR C CD1   1 
ATOM   7159  C  CD2   . TYR C  3  76  ? 31.133  142.461 63.212  1.00 52.48  ? 76   TYR C CD2   1 
ATOM   7160  C  CE1   . TYR C  3  76  ? 33.662  143.537 63.205  1.00 52.91  ? 76   TYR C CE1   1 
ATOM   7161  C  CE2   . TYR C  3  76  ? 31.751  142.722 62.013  1.00 52.47  ? 76   TYR C CE2   1 
ATOM   7162  C  CZ    . TYR C  3  76  ? 33.019  143.265 62.014  1.00 53.44  ? 76   TYR C CZ    1 
ATOM   7163  O  OH    . TYR C  3  76  ? 33.639  143.576 60.821  1.00 56.79  ? 76   TYR C OH    1 
ATOM   7164  N  N     . GLY C  3  77  ? 28.995  144.387 68.049  1.00 47.03  ? 77   GLY C N     1 
ATOM   7165  C  CA    . GLY C  3  77  ? 28.150  144.163 69.196  1.00 49.59  ? 77   GLY C CA    1 
ATOM   7166  C  C     . GLY C  3  77  ? 26.803  143.675 68.704  1.00 50.69  ? 77   GLY C C     1 
ATOM   7167  O  O     . GLY C  3  77  ? 26.212  142.756 69.272  1.00 52.25  ? 77   GLY C O     1 
ATOM   7168  N  N     . TRP C  3  78  ? 26.316  144.280 67.628  1.00 49.69  ? 78   TRP C N     1 
ATOM   7169  C  CA    . TRP C  3  78  ? 25.027  143.891 67.083  1.00 48.66  ? 78   TRP C CA    1 
ATOM   7170  C  C     . TRP C  3  78  ? 24.962  142.418 66.677  1.00 48.38  ? 78   TRP C C     1 
ATOM   7171  O  O     . TRP C  3  78  ? 23.926  141.763 66.842  1.00 47.76  ? 78   TRP C O     1 
ATOM   7172  C  CB    . TRP C  3  78  ? 24.688  144.769 65.888  1.00 48.25  ? 78   TRP C CB    1 
ATOM   7173  C  CG    . TRP C  3  78  ? 25.571  144.574 64.717  1.00 45.77  ? 78   TRP C CG    1 
ATOM   7174  C  CD1   . TRP C  3  78  ? 26.670  145.304 64.381  1.00 47.15  ? 78   TRP C CD1   1 
ATOM   7175  C  CD2   . TRP C  3  78  ? 25.429  143.580 63.716  1.00 44.48  ? 78   TRP C CD2   1 
ATOM   7176  N  NE1   . TRP C  3  78  ? 27.226  144.821 63.216  1.00 43.66  ? 78   TRP C NE1   1 
ATOM   7177  C  CE2   . TRP C  3  78  ? 26.480  143.760 62.791  1.00 43.45  ? 78   TRP C CE2   1 
ATOM   7178  C  CE3   . TRP C  3  78  ? 24.516  142.548 63.509  1.00 44.50  ? 78   TRP C CE3   1 
ATOM   7179  C  CZ2   . TRP C  3  78  ? 26.638  142.954 61.686  1.00 44.54  ? 78   TRP C CZ2   1 
ATOM   7180  C  CZ3   . TRP C  3  78  ? 24.671  141.744 62.409  1.00 45.52  ? 78   TRP C CZ3   1 
ATOM   7181  C  CH2   . TRP C  3  78  ? 25.724  141.948 61.507  1.00 46.15  ? 78   TRP C CH2   1 
ATOM   7182  N  N     . LEU C  3  79  ? 26.079  141.913 66.151  1.00 48.49  ? 79   LEU C N     1 
ATOM   7183  C  CA    . LEU C  3  79  ? 26.200  140.522 65.710  1.00 45.96  ? 79   LEU C CA    1 
ATOM   7184  C  C     . LEU C  3  79  ? 26.231  139.612 66.921  1.00 45.61  ? 79   LEU C C     1 
ATOM   7185  O  O     . LEU C  3  79  ? 25.493  138.632 67.005  1.00 46.25  ? 79   LEU C O     1 
ATOM   7186  C  CB    . LEU C  3  79  ? 27.482  140.329 64.907  1.00 42.80  ? 79   LEU C CB    1 
ATOM   7187  C  CG    . LEU C  3  79  ? 27.798  138.872 64.595  1.00 42.72  ? 79   LEU C CG    1 
ATOM   7188  C  CD1   . LEU C  3  79  ? 26.583  138.193 64.032  1.00 41.28  ? 79   LEU C CD1   1 
ATOM   7189  C  CD2   . LEU C  3  79  ? 28.946  138.799 63.620  1.00 40.93  ? 79   LEU C CD2   1 
ATOM   7190  N  N     . ILE C  3  80  ? 27.107  139.939 67.858  1.00 44.85  ? 80   ILE C N     1 
ATOM   7191  C  CA    . ILE C  3  80  ? 27.233  139.159 69.073  1.00 44.40  ? 80   ILE C CA    1 
ATOM   7192  C  C     . ILE C  3  80  ? 25.884  139.106 69.790  1.00 44.79  ? 80   ILE C C     1 
ATOM   7193  O  O     . ILE C  3  80  ? 25.446  138.036 70.234  1.00 43.23  ? 80   ILE C O     1 
ATOM   7194  C  CB    . ILE C  3  80  ? 28.299  139.774 69.969  1.00 43.29  ? 80   ILE C CB    1 
ATOM   7195  C  CG1   . ILE C  3  80  ? 29.652  139.646 69.285  1.00 44.40  ? 80   ILE C CG1   1 
ATOM   7196  C  CG2   . ILE C  3  80  ? 28.336  139.080 71.308  1.00 42.54  ? 80   ILE C CG2   1 
ATOM   7197  C  CD1   . ILE C  3  80  ? 30.734  140.509 69.918  1.00 46.42  ? 80   ILE C CD1   1 
ATOM   7198  N  N     . ARG C  3  81  ? 25.215  140.256 69.866  1.00 45.32  ? 81   ARG C N     1 
ATOM   7199  C  CA    . ARG C  3  81  ? 23.912  140.335 70.517  1.00 45.73  ? 81   ARG C CA    1 
ATOM   7200  C  C     . ARG C  3  81  ? 22.942  139.406 69.801  1.00 46.18  ? 81   ARG C C     1 
ATOM   7201  O  O     . ARG C  3  81  ? 22.279  138.615 70.455  1.00 45.96  ? 81   ARG C O     1 
ATOM   7202  C  CB    . ARG C  3  81  ? 23.390  141.771 70.494  1.00 46.39  ? 81   ARG C CB    1 
ATOM   7203  C  CG    . ARG C  3  81  ? 22.386  142.112 71.591  1.00 45.90  ? 81   ARG C CG    1 
ATOM   7204  C  CD    . ARG C  3  81  ? 21.106  141.343 71.395  1.00 48.77  ? 81   ARG C CD    1 
ATOM   7205  N  NE    . ARG C  3  81  ? 20.047  141.704 72.346  1.00 49.28  ? 81   ARG C NE    1 
ATOM   7206  C  CZ    . ARG C  3  81  ? 19.365  142.845 72.332  1.00 45.17  ? 81   ARG C CZ    1 
ATOM   7207  N  NH1   . ARG C  3  81  ? 19.625  143.759 71.423  1.00 43.12  ? 81   ARG C NH1   1 
ATOM   7208  N  NH2   . ARG C  3  81  ? 18.405  143.052 73.217  1.00 43.05  ? 81   ARG C NH2   1 
ATOM   7209  N  N     . ASN C  3  82  ? 22.871  139.487 68.469  1.00 46.75  ? 82   ASN C N     1 
ATOM   7210  C  CA    . ASN C  3  82  ? 21.974  138.610 67.705  1.00 49.05  ? 82   ASN C CA    1 
ATOM   7211  C  C     . ASN C  3  82  ? 22.290  137.150 68.020  1.00 48.29  ? 82   ASN C C     1 
ATOM   7212  O  O     . ASN C  3  82  ? 21.441  136.405 68.519  1.00 48.70  ? 82   ASN C O     1 
ATOM   7213  C  CB    . ASN C  3  82  ? 22.086  138.860 66.179  1.00 52.04  ? 82   ASN C CB    1 
ATOM   7214  C  CG    . ASN C  3  82  ? 21.391  140.183 65.733  1.00 58.71  ? 82   ASN C CG    1 
ATOM   7215  O  OD1   . ASN C  3  82  ? 21.401  140.553 64.545  1.00 58.96  ? 82   ASN C OD1   1 
ATOM   7216  N  ND2   . ASN C  3  82  ? 20.785  140.892 66.696  1.00 59.22  ? 82   ASN C ND2   1 
ATOM   7217  N  N     . LEU C  3  83  ? 23.522  136.742 67.764  1.00 47.02  ? 83   LEU C N     1 
ATOM   7218  C  CA    . LEU C  3  83  ? 23.910  135.369 68.029  1.00 45.54  ? 83   LEU C CA    1 
ATOM   7219  C  C     . LEU C  3  83  ? 23.476  134.861 69.422  1.00 45.68  ? 83   LEU C C     1 
ATOM   7220  O  O     . LEU C  3  83  ? 22.880  133.784 69.546  1.00 42.86  ? 83   LEU C O     1 
ATOM   7221  C  CB    . LEU C  3  83  ? 25.422  135.237 67.852  1.00 44.64  ? 83   LEU C CB    1 
ATOM   7222  C  CG    . LEU C  3  83  ? 25.936  135.364 66.411  1.00 45.30  ? 83   LEU C CG    1 
ATOM   7223  C  CD1   . LEU C  3  83  ? 27.464  135.278 66.365  1.00 43.36  ? 83   LEU C CD1   1 
ATOM   7224  C  CD2   . LEU C  3  83  ? 25.316  134.262 65.565  1.00 42.43  ? 83   LEU C CD2   1 
ATOM   7225  N  N     . HIS C  3  84  ? 23.752  135.645 70.465  1.00 45.21  ? 84   HIS C N     1 
ATOM   7226  C  CA    . HIS C  3  84  ? 23.404  135.235 71.825  1.00 43.65  ? 84   HIS C CA    1 
ATOM   7227  C  C     . HIS C  3  84  ? 21.886  135.070 71.959  1.00 43.58  ? 84   HIS C C     1 
ATOM   7228  O  O     . HIS C  3  84  ? 21.402  134.028 72.407  1.00 44.78  ? 84   HIS C O     1 
ATOM   7229  C  CB    . HIS C  3  84  ? 23.923  136.263 72.861  1.00 40.90  ? 84   HIS C CB    1 
ATOM   7230  C  CG    . HIS C  3  84  ? 23.883  135.778 74.285  1.00 39.94  ? 84   HIS C CG    1 
ATOM   7231  N  ND1   . HIS C  3  84  ? 24.690  134.763 74.743  1.00 41.05  ? 84   HIS C ND1   1 
ATOM   7232  C  CD2   . HIS C  3  84  ? 23.144  136.177 75.354  1.00 39.51  ? 84   HIS C CD2   1 
ATOM   7233  C  CE1   . HIS C  3  84  ? 24.455  134.558 76.029  1.00 40.56  ? 84   HIS C CE1   1 
ATOM   7234  N  NE2   . HIS C  3  84  ? 23.520  135.403 76.428  1.00 39.00  ? 84   HIS C NE2   1 
ATOM   7235  N  N     . ALA C  3  85  ? 21.133  136.083 71.548  1.00 42.27  ? 85   ALA C N     1 
ATOM   7236  C  CA    . ALA C  3  85  ? 19.684  136.028 71.674  1.00 40.30  ? 85   ALA C CA    1 
ATOM   7237  C  C     . ALA C  3  85  ? 19.086  134.893 70.879  1.00 40.34  ? 85   ALA C C     1 
ATOM   7238  O  O     . ALA C  3  85  ? 18.249  134.148 71.394  1.00 40.34  ? 85   ALA C O     1 
ATOM   7239  C  CB    . ALA C  3  85  ? 19.079  137.331 71.260  1.00 38.77  ? 85   ALA C CB    1 
ATOM   7240  N  N     . ASN C  3  86  ? 19.505  134.742 69.629  1.00 40.67  ? 86   ASN C N     1 
ATOM   7241  C  CA    . ASN C  3  86  ? 18.971  133.645 68.830  1.00 43.81  ? 86   ASN C CA    1 
ATOM   7242  C  C     . ASN C  3  86  ? 19.538  132.296 69.278  1.00 44.93  ? 86   ASN C C     1 
ATOM   7243  O  O     . ASN C  3  86  ? 18.857  131.256 69.182  1.00 44.37  ? 86   ASN C O     1 
ATOM   7244  C  CB    . ASN C  3  86  ? 19.239  133.867 67.340  1.00 46.72  ? 86   ASN C CB    1 
ATOM   7245  C  CG    . ASN C  3  86  ? 18.271  134.865 66.717  1.00 50.75  ? 86   ASN C CG    1 
ATOM   7246  O  OD1   . ASN C  3  86  ? 18.590  136.050 66.555  1.00 51.67  ? 86   ASN C OD1   1 
ATOM   7247  N  ND2   . ASN C  3  86  ? 17.069  134.390 66.382  1.00 53.36  ? 86   ASN C ND2   1 
ATOM   7248  N  N     . GLY C  3  87  ? 20.778  132.325 69.777  1.00 44.76  ? 87   GLY C N     1 
ATOM   7249  C  CA    . GLY C  3  87  ? 21.417  131.115 70.269  1.00 43.93  ? 87   GLY C CA    1 
ATOM   7250  C  C     . GLY C  3  87  ? 20.549  130.431 71.313  1.00 43.95  ? 87   GLY C C     1 
ATOM   7251  O  O     . GLY C  3  87  ? 20.514  129.203 71.403  1.00 43.80  ? 87   GLY C O     1 
ATOM   7252  N  N     . ALA C  3  88  ? 19.837  131.234 72.097  1.00 43.73  ? 88   ALA C N     1 
ATOM   7253  C  CA    . ALA C  3  88  ? 18.938  130.706 73.107  1.00 43.97  ? 88   ALA C CA    1 
ATOM   7254  C  C     . ALA C  3  88  ? 17.909  129.772 72.465  1.00 45.20  ? 88   ALA C C     1 
ATOM   7255  O  O     . ALA C  3  88  ? 17.703  128.649 72.944  1.00 47.29  ? 88   ALA C O     1 
ATOM   7256  C  CB    . ALA C  3  88  ? 18.232  131.831 73.809  1.00 43.45  ? 88   ALA C CB    1 
ATOM   7257  N  N     . SER C  3  89  ? 17.267  130.216 71.383  1.00 43.28  ? 89   SER C N     1 
ATOM   7258  C  CA    . SER C  3  89  ? 16.273  129.371 70.739  1.00 43.53  ? 89   SER C CA    1 
ATOM   7259  C  C     . SER C  3  89  ? 16.844  128.082 70.181  1.00 44.99  ? 89   SER C C     1 
ATOM   7260  O  O     . SER C  3  89  ? 16.244  127.010 70.331  1.00 45.69  ? 89   SER C O     1 
ATOM   7261  C  CB    . SER C  3  89  ? 15.569  130.129 69.642  1.00 42.32  ? 89   SER C CB    1 
ATOM   7262  O  OG    . SER C  3  89  ? 14.670  131.045 70.224  1.00 45.84  ? 89   SER C OG    1 
ATOM   7263  N  N     . PHE C  3  90  ? 17.999  128.185 69.532  1.00 45.10  ? 90   PHE C N     1 
ATOM   7264  C  CA    . PHE C  3  90  ? 18.655  127.018 68.967  1.00 43.45  ? 90   PHE C CA    1 
ATOM   7265  C  C     . PHE C  3  90  ? 18.804  126.053 70.135  1.00 41.14  ? 90   PHE C C     1 
ATOM   7266  O  O     . PHE C  3  90  ? 18.510  124.857 70.016  1.00 41.42  ? 90   PHE C O     1 
ATOM   7267  C  CB    . PHE C  3  90  ? 20.032  127.417 68.406  1.00 48.12  ? 90   PHE C CB    1 
ATOM   7268  C  CG    . PHE C  3  90  ? 20.797  126.283 67.723  1.00 54.68  ? 90   PHE C CG    1 
ATOM   7269  C  CD1   . PHE C  3  90  ? 20.686  126.066 66.336  1.00 56.93  ? 90   PHE C CD1   1 
ATOM   7270  C  CD2   . PHE C  3  90  ? 21.642  125.427 68.463  1.00 55.37  ? 90   PHE C CD2   1 
ATOM   7271  C  CE1   . PHE C  3  90  ? 21.415  125.001 65.690  1.00 57.37  ? 90   PHE C CE1   1 
ATOM   7272  C  CE2   . PHE C  3  90  ? 22.360  124.376 67.828  1.00 57.03  ? 90   PHE C CE2   1 
ATOM   7273  C  CZ    . PHE C  3  90  ? 22.244  124.165 66.436  1.00 55.77  ? 90   PHE C CZ    1 
ATOM   7274  N  N     . PHE C  3  91  ? 19.216  126.586 71.281  1.00 36.96  ? 91   PHE C N     1 
ATOM   7275  C  CA    . PHE C  3  91  ? 19.432  125.759 72.460  1.00 36.15  ? 91   PHE C CA    1 
ATOM   7276  C  C     . PHE C  3  91  ? 18.196  124.980 72.841  1.00 36.55  ? 91   PHE C C     1 
ATOM   7277  O  O     . PHE C  3  91  ? 18.280  123.766 73.047  1.00 36.39  ? 91   PHE C O     1 
ATOM   7278  C  CB    . PHE C  3  91  ? 19.897  126.607 73.635  1.00 36.85  ? 91   PHE C CB    1 
ATOM   7279  C  CG    . PHE C  3  91  ? 20.857  125.896 74.584  1.00 38.15  ? 91   PHE C CG    1 
ATOM   7280  C  CD1   . PHE C  3  91  ? 20.506  124.702 75.204  1.00 39.33  ? 91   PHE C CD1   1 
ATOM   7281  C  CD2   . PHE C  3  91  ? 22.031  126.509 74.987  1.00 37.46  ? 91   PHE C CD2   1 
ATOM   7282  C  CE1   . PHE C  3  91  ? 21.298  124.151 76.217  1.00 35.27  ? 91   PHE C CE1   1 
ATOM   7283  C  CE2   . PHE C  3  91  ? 22.809  125.958 75.994  1.00 36.40  ? 91   PHE C CE2   1 
ATOM   7284  C  CZ    . PHE C  3  91  ? 22.432  124.782 76.605  1.00 35.18  ? 91   PHE C CZ    1 
ATOM   7285  N  N     . PHE C  3  92  ? 17.049  125.659 72.938  1.00 37.38  ? 92   PHE C N     1 
ATOM   7286  C  CA    . PHE C  3  92  ? 15.774  124.978 73.266  1.00 36.10  ? 92   PHE C CA    1 
ATOM   7287  C  C     . PHE C  3  92  ? 15.271  124.029 72.158  1.00 36.12  ? 92   PHE C C     1 
ATOM   7288  O  O     . PHE C  3  92  ? 14.788  122.923 72.449  1.00 34.09  ? 92   PHE C O     1 
ATOM   7289  C  CB    . PHE C  3  92  ? 14.693  125.992 73.599  1.00 34.36  ? 92   PHE C CB    1 
ATOM   7290  C  CG    . PHE C  3  92  ? 14.770  126.492 74.999  1.00 32.93  ? 92   PHE C CG    1 
ATOM   7291  C  CD1   . PHE C  3  92  ? 15.393  127.700 75.291  1.00 32.94  ? 92   PHE C CD1   1 
ATOM   7292  C  CD2   . PHE C  3  92  ? 14.244  125.738 76.035  1.00 30.86  ? 92   PHE C CD2   1 
ATOM   7293  C  CE1   . PHE C  3  92  ? 15.488  128.151 76.601  1.00 31.47  ? 92   PHE C CE1   1 
ATOM   7294  C  CE2   . PHE C  3  92  ? 14.333  126.176 77.343  1.00 28.98  ? 92   PHE C CE2   1 
ATOM   7295  C  CZ    . PHE C  3  92  ? 14.954  127.379 77.631  1.00 31.12  ? 92   PHE C CZ    1 
ATOM   7296  N  N     . ILE C  3  93  ? 15.373  124.461 70.900  1.00 34.66  ? 93   ILE C N     1 
ATOM   7297  C  CA    . ILE C  3  93  ? 14.985  123.597 69.811  1.00 36.43  ? 93   ILE C CA    1 
ATOM   7298  C  C     . ILE C  3  93  ? 15.771  122.312 70.020  1.00 37.97  ? 93   ILE C C     1 
ATOM   7299  O  O     . ILE C  3  93  ? 15.215  121.217 70.057  1.00 40.12  ? 93   ILE C O     1 
ATOM   7300  C  CB    . ILE C  3  93  ? 15.399  124.155 68.454  1.00 37.76  ? 93   ILE C CB    1 
ATOM   7301  C  CG1   . ILE C  3  93  ? 14.510  125.345 68.092  1.00 41.38  ? 93   ILE C CG1   1 
ATOM   7302  C  CG2   . ILE C  3  93  ? 15.308  123.061 67.399  1.00 35.48  ? 93   ILE C CG2   1 
ATOM   7303  C  CD1   . ILE C  3  93  ? 14.817  126.016 66.727  1.00 40.10  ? 93   ILE C CD1   1 
ATOM   7304  N  N     . CYS C  3  94  ? 17.081  122.443 70.163  1.00 37.45  ? 94   CYS C N     1 
ATOM   7305  C  CA    . CYS C  3  94  ? 17.886  121.261 70.369  1.00 36.90  ? 94   CYS C CA    1 
ATOM   7306  C  C     . CYS C  3  94  ? 17.474  120.457 71.589  1.00 36.18  ? 94   CYS C C     1 
ATOM   7307  O  O     . CYS C  3  94  ? 17.352  119.244 71.527  1.00 36.72  ? 94   CYS C O     1 
ATOM   7308  C  CB    . CYS C  3  94  ? 19.349  121.640 70.452  1.00 36.41  ? 94   CYS C CB    1 
ATOM   7309  S  SG    . CYS C  3  94  ? 19.991  121.968 68.813  1.00 43.07  ? 94   CYS C SG    1 
ATOM   7310  N  N     . ILE C  3  95  ? 17.226  121.113 72.700  1.00 35.33  ? 95   ILE C N     1 
ATOM   7311  C  CA    . ILE C  3  95  ? 16.858  120.352 73.863  1.00 36.46  ? 95   ILE C CA    1 
ATOM   7312  C  C     . ILE C  3  95  ? 15.534  119.617 73.708  1.00 38.16  ? 95   ILE C C     1 
ATOM   7313  O  O     . ILE C  3  95  ? 15.357  118.537 74.281  1.00 38.96  ? 95   ILE C O     1 
ATOM   7314  C  CB    . ILE C  3  95  ? 16.784  121.231 75.085  1.00 37.71  ? 95   ILE C CB    1 
ATOM   7315  C  CG1   . ILE C  3  95  ? 17.055  120.375 76.314  1.00 37.47  ? 95   ILE C CG1   1 
ATOM   7316  C  CG2   . ILE C  3  95  ? 15.397  121.915 75.168  1.00 36.38  ? 95   ILE C CG2   1 
ATOM   7317  C  CD1   . ILE C  3  95  ? 17.430  121.181 77.530  1.00 40.05  ? 95   ILE C CD1   1 
ATOM   7318  N  N     . PHE C  3  96  ? 14.589  120.178 72.954  1.00 37.79  ? 96   PHE C N     1 
ATOM   7319  C  CA    . PHE C  3  96  ? 13.312  119.477 72.788  1.00 38.05  ? 96   PHE C CA    1 
ATOM   7320  C  C     . PHE C  3  96  ? 13.470  118.237 71.899  1.00 38.92  ? 96   PHE C C     1 
ATOM   7321  O  O     . PHE C  3  96  ? 12.869  117.191 72.174  1.00 39.28  ? 96   PHE C O     1 
ATOM   7322  C  CB    . PHE C  3  96  ? 12.229  120.402 72.230  1.00 37.70  ? 96   PHE C CB    1 
ATOM   7323  C  CG    . PHE C  3  96  ? 11.866  121.540 73.151  1.00 37.02  ? 96   PHE C CG    1 
ATOM   7324  C  CD1   . PHE C  3  96  ? 11.785  121.345 74.527  1.00 36.08  ? 96   PHE C CD1   1 
ATOM   7325  C  CD2   . PHE C  3  96  ? 11.623  122.814 72.642  1.00 35.89  ? 96   PHE C CD2   1 
ATOM   7326  C  CE1   . PHE C  3  96  ? 11.472  122.412 75.390  1.00 36.78  ? 96   PHE C CE1   1 
ATOM   7327  C  CE2   . PHE C  3  96  ? 11.310  123.874 73.488  1.00 37.00  ? 96   PHE C CE2   1 
ATOM   7328  C  CZ    . PHE C  3  96  ? 11.236  123.673 74.873  1.00 36.26  ? 96   PHE C CZ    1 
ATOM   7329  N  N     . LEU C  3  97  ? 14.268  118.339 70.838  1.00 37.22  ? 97   LEU C N     1 
ATOM   7330  C  CA    . LEU C  3  97  ? 14.508  117.163 70.018  1.00 37.42  ? 97   LEU C CA    1 
ATOM   7331  C  C     . LEU C  3  97  ? 15.304  116.138 70.856  1.00 38.24  ? 97   LEU C C     1 
ATOM   7332  O  O     . LEU C  3  97  ? 15.054  114.943 70.767  1.00 39.14  ? 97   LEU C O     1 
ATOM   7333  C  CB    . LEU C  3  97  ? 15.284  117.532 68.759  1.00 37.77  ? 97   LEU C CB    1 
ATOM   7334  C  CG    . LEU C  3  97  ? 14.567  118.602 67.929  1.00 42.29  ? 97   LEU C CG    1 
ATOM   7335  C  CD1   . LEU C  3  97  ? 15.325  118.887 66.653  1.00 39.63  ? 97   LEU C CD1   1 
ATOM   7336  C  CD2   . LEU C  3  97  ? 13.146  118.131 67.606  1.00 43.00  ? 97   LEU C CD2   1 
ATOM   7337  N  N     . HIS C  3  98  ? 16.242  116.601 71.689  1.00 37.89  ? 98   HIS C N     1 
ATOM   7338  C  CA    . HIS C  3  98  ? 17.048  115.702 72.522  1.00 36.40  ? 98   HIS C CA    1 
ATOM   7339  C  C     . HIS C  3  98  ? 16.086  114.935 73.428  1.00 35.95  ? 98   HIS C C     1 
ATOM   7340  O  O     . HIS C  3  98  ? 16.129  113.697 73.500  1.00 35.72  ? 98   HIS C O     1 
ATOM   7341  C  CB    . HIS C  3  98  ? 18.074  116.518 73.336  1.00 35.47  ? 98   HIS C CB    1 
ATOM   7342  C  CG    . HIS C  3  98  ? 19.092  115.695 74.083  1.00 36.71  ? 98   HIS C CG    1 
ATOM   7343  N  ND1   . HIS C  3  98  ? 20.089  114.979 73.456  1.00 37.70  ? 98   HIS C ND1   1 
ATOM   7344  C  CD2   . HIS C  3  98  ? 19.338  115.577 75.414  1.00 36.66  ? 98   HIS C CD2   1 
ATOM   7345  C  CE1   . HIS C  3  98  ? 20.908  114.469 74.365  1.00 37.24  ? 98   HIS C CE1   1 
ATOM   7346  N  NE2   . HIS C  3  98  ? 20.478  114.818 75.566  1.00 36.58  ? 98   HIS C NE2   1 
ATOM   7347  N  N     . ILE C  3  99  ? 15.193  115.663 74.091  1.00 35.55  ? 99   ILE C N     1 
ATOM   7348  C  CA    . ILE C  3  99  ? 14.218  115.024 74.974  1.00 35.86  ? 99   ILE C CA    1 
ATOM   7349  C  C     . ILE C  3  99  ? 13.317  114.072 74.189  1.00 37.18  ? 99   ILE C C     1 
ATOM   7350  O  O     . ILE C  3  99  ? 13.135  112.918 74.572  1.00 38.61  ? 99   ILE C O     1 
ATOM   7351  C  CB    . ILE C  3  99  ? 13.354  116.073 75.706  1.00 34.37  ? 99   ILE C CB    1 
ATOM   7352  C  CG1   . ILE C  3  99  ? 14.231  116.796 76.735  1.00 34.56  ? 99   ILE C CG1   1 
ATOM   7353  C  CG2   . ILE C  3  99  ? 12.143  115.402 76.387  1.00 30.10  ? 99   ILE C CG2   1 
ATOM   7354  C  CD1   . ILE C  3  99  ? 13.627  118.035 77.369  1.00 34.81  ? 99   ILE C CD1   1 
ATOM   7355  N  N     . GLY C  3  100 ? 12.773  114.541 73.075  1.00 36.09  ? 100  GLY C N     1 
ATOM   7356  C  CA    . GLY C  3  100 ? 11.903  113.687 72.293  1.00 36.80  ? 100  GLY C CA    1 
ATOM   7357  C  C     . GLY C  3  100 ? 12.548  112.358 72.004  1.00 36.07  ? 100  GLY C C     1 
ATOM   7358  O  O     . GLY C  3  100 ? 12.010  111.315 72.364  1.00 37.59  ? 100  GLY C O     1 
ATOM   7359  N  N     . ARG C  3  101 ? 13.698  112.419 71.346  1.00 36.05  ? 101  ARG C N     1 
ATOM   7360  C  CA    . ARG C  3  101 ? 14.483  111.254 70.983  1.00 35.71  ? 101  ARG C CA    1 
ATOM   7361  C  C     . ARG C  3  101 ? 14.541  110.286 72.149  1.00 36.29  ? 101  ARG C C     1 
ATOM   7362  O  O     . ARG C  3  101 ? 14.376  109.077 71.987  1.00 34.92  ? 101  ARG C O     1 
ATOM   7363  C  CB    . ARG C  3  101 ? 15.901  111.686 70.619  1.00 35.80  ? 101  ARG C CB    1 
ATOM   7364  C  CG    . ARG C  3  101 ? 16.891  110.558 70.331  1.00 37.90  ? 101  ARG C CG    1 
ATOM   7365  C  CD    . ARG C  3  101 ? 17.337  109.796 71.603  1.00 41.93  ? 101  ARG C CD    1 
ATOM   7366  N  NE    . ARG C  3  101 ? 17.989  110.639 72.603  1.00 44.08  ? 101  ARG C NE    1 
ATOM   7367  C  CZ    . ARG C  3  101 ? 19.284  110.926 72.607  1.00 46.22  ? 101  ARG C CZ    1 
ATOM   7368  N  NH1   . ARG C  3  101 ? 20.086  110.431 71.671  1.00 48.01  ? 101  ARG C NH1   1 
ATOM   7369  N  NH2   . ARG C  3  101 ? 19.773  111.732 73.530  1.00 47.35  ? 101  ARG C NH2   1 
ATOM   7370  N  N     . GLY C  3  102 ? 14.784  110.810 73.337  1.00 36.54  ? 102  GLY C N     1 
ATOM   7371  C  CA    . GLY C  3  102 ? 14.878  109.917 74.477  1.00 39.56  ? 102  GLY C CA    1 
ATOM   7372  C  C     . GLY C  3  102 ? 13.587  109.219 74.872  1.00 40.62  ? 102  GLY C C     1 
ATOM   7373  O  O     . GLY C  3  102 ? 13.579  108.074 75.342  1.00 40.50  ? 102  GLY C O     1 
ATOM   7374  N  N     . LEU C  3  103 ? 12.481  109.921 74.694  1.00 41.23  ? 103  LEU C N     1 
ATOM   7375  C  CA    . LEU C  3  103 ? 11.199  109.371 75.043  1.00 42.61  ? 103  LEU C CA    1 
ATOM   7376  C  C     . LEU C  3  103 ? 10.806  108.294 74.045  1.00 42.38  ? 103  LEU C C     1 
ATOM   7377  O  O     . LEU C  3  103 ? 10.377  107.203 74.420  1.00 42.14  ? 103  LEU C O     1 
ATOM   7378  C  CB    . LEU C  3  103 ? 10.185  110.494 75.063  1.00 46.81  ? 103  LEU C CB    1 
ATOM   7379  C  CG    . LEU C  3  103 ? 8.748   110.092 75.357  1.00 51.36  ? 103  LEU C CG    1 
ATOM   7380  C  CD1   . LEU C  3  103 ? 8.699   109.127 76.535  1.00 52.04  ? 103  LEU C CD1   1 
ATOM   7381  C  CD2   . LEU C  3  103 ? 7.954   111.361 75.633  1.00 51.80  ? 103  LEU C CD2   1 
ATOM   7382  N  N     . TYR C  3  104 ? 10.986  108.598 72.766  1.00 41.67  ? 104  TYR C N     1 
ATOM   7383  C  CA    . TYR C  3  104 ? 10.665  107.661 71.696  1.00 40.82  ? 104  TYR C CA    1 
ATOM   7384  C  C     . TYR C  3  104 ? 11.537  106.419 71.645  1.00 40.07  ? 104  TYR C C     1 
ATOM   7385  O  O     . TYR C  3  104 ? 11.112  105.416 71.098  1.00 41.50  ? 104  TYR C O     1 
ATOM   7386  C  CB    . TYR C  3  104 ? 10.769  108.352 70.348  1.00 41.55  ? 104  TYR C CB    1 
ATOM   7387  C  CG    . TYR C  3  104 ? 10.284  107.518 69.171  1.00 44.35  ? 104  TYR C CG    1 
ATOM   7388  C  CD1   . TYR C  3  104 ? 8.937   107.547 68.776  1.00 44.41  ? 104  TYR C CD1   1 
ATOM   7389  C  CD2   . TYR C  3  104 ? 11.177  106.747 68.417  1.00 44.08  ? 104  TYR C CD2   1 
ATOM   7390  C  CE1   . TYR C  3  104 ? 8.488   106.843 67.661  1.00 44.96  ? 104  TYR C CE1   1 
ATOM   7391  C  CE2   . TYR C  3  104 ? 10.743  106.040 67.298  1.00 46.21  ? 104  TYR C CE2   1 
ATOM   7392  C  CZ    . TYR C  3  104 ? 9.389   106.091 66.917  1.00 47.14  ? 104  TYR C CZ    1 
ATOM   7393  O  OH    . TYR C  3  104 ? 8.942   105.405 65.794  1.00 45.02  ? 104  TYR C OH    1 
ATOM   7394  N  N     . TYR C  3  105 ? 12.761  106.481 72.172  1.00 40.56  ? 105  TYR C N     1 
ATOM   7395  C  CA    . TYR C  3  105 ? 13.659  105.320 72.141  1.00 39.94  ? 105  TYR C CA    1 
ATOM   7396  C  C     . TYR C  3  105 ? 14.008  104.764 73.515  1.00 41.52  ? 105  TYR C C     1 
ATOM   7397  O  O     . TYR C  3  105 ? 14.968  103.998 73.686  1.00 39.93  ? 105  TYR C O     1 
ATOM   7398  C  CB    . TYR C  3  105 ? 14.933  105.639 71.389  1.00 37.96  ? 105  TYR C CB    1 
ATOM   7399  C  CG    . TYR C  3  105 ? 14.727  105.902 69.918  1.00 37.90  ? 105  TYR C CG    1 
ATOM   7400  C  CD1   . TYR C  3  105 ? 14.632  107.195 69.434  1.00 38.06  ? 105  TYR C CD1   1 
ATOM   7401  C  CD2   . TYR C  3  105 ? 14.675  104.860 69.005  1.00 37.79  ? 105  TYR C CD2   1 
ATOM   7402  C  CE1   . TYR C  3  105 ? 14.502  107.447 68.080  1.00 39.49  ? 105  TYR C CE1   1 
ATOM   7403  C  CE2   . TYR C  3  105 ? 14.541  105.099 67.648  1.00 38.27  ? 105  TYR C CE2   1 
ATOM   7404  C  CZ    . TYR C  3  105 ? 14.462  106.394 67.185  1.00 39.94  ? 105  TYR C CZ    1 
ATOM   7405  O  OH    . TYR C  3  105 ? 14.416  106.642 65.822  1.00 42.10  ? 105  TYR C OH    1 
ATOM   7406  N  N     . GLY C  3  106 ? 13.197  105.161 74.490  1.00 42.91  ? 106  GLY C N     1 
ATOM   7407  C  CA    . GLY C  3  106 ? 13.347  104.687 75.852  1.00 43.75  ? 106  GLY C CA    1 
ATOM   7408  C  C     . GLY C  3  106 ? 14.708  104.850 76.454  1.00 43.79  ? 106  GLY C C     1 
ATOM   7409  O  O     . GLY C  3  106 ? 15.152  103.993 77.205  1.00 44.44  ? 106  GLY C O     1 
ATOM   7410  N  N     . SER C  3  107 ? 15.361  105.955 76.125  1.00 43.96  ? 107  SER C N     1 
ATOM   7411  C  CA    . SER C  3  107 ? 16.684  106.244 76.640  1.00 43.39  ? 107  SER C CA    1 
ATOM   7412  C  C     . SER C  3  107 ? 16.598  106.440 78.134  1.00 43.14  ? 107  SER C C     1 
ATOM   7413  O  O     . SER C  3  107 ? 17.530  106.134 78.869  1.00 43.14  ? 107  SER C O     1 
ATOM   7414  C  CB    . SER C  3  107 ? 17.208  107.503 75.981  1.00 42.53  ? 107  SER C CB    1 
ATOM   7415  O  OG    . SER C  3  107 ? 17.075  107.377 74.578  1.00 46.22  ? 107  SER C OG    1 
ATOM   7416  N  N     . TYR C  3  108 ? 15.449  106.944 78.569  1.00 44.70  ? 108  TYR C N     1 
ATOM   7417  C  CA    . TYR C  3  108 ? 15.175  107.221 79.974  1.00 44.41  ? 108  TYR C CA    1 
ATOM   7418  C  C     . TYR C  3  108 ? 15.333  105.987 80.813  1.00 43.56  ? 108  TYR C C     1 
ATOM   7419  O  O     . TYR C  3  108 ? 15.303  106.072 82.024  1.00 44.80  ? 108  TYR C O     1 
ATOM   7420  C  CB    . TYR C  3  108 ? 13.753  107.778 80.153  1.00 45.59  ? 108  TYR C CB    1 
ATOM   7421  C  CG    . TYR C  3  108 ? 12.697  106.908 79.526  1.00 45.01  ? 108  TYR C CG    1 
ATOM   7422  C  CD1   . TYR C  3  108 ? 12.300  105.728 80.132  1.00 45.54  ? 108  TYR C CD1   1 
ATOM   7423  C  CD2   . TYR C  3  108 ? 12.157  107.233 78.277  1.00 44.56  ? 108  TYR C CD2   1 
ATOM   7424  C  CE1   . TYR C  3  108 ? 11.399  104.880 79.515  1.00 47.31  ? 108  TYR C CE1   1 
ATOM   7425  C  CE2   . TYR C  3  108 ? 11.258  106.409 77.656  1.00 45.73  ? 108  TYR C CE2   1 
ATOM   7426  C  CZ    . TYR C  3  108 ? 10.880  105.225 78.278  1.00 47.36  ? 108  TYR C CZ    1 
ATOM   7427  O  OH    . TYR C  3  108 ? 9.986   104.375 77.663  1.00 50.35  ? 108  TYR C OH    1 
ATOM   7428  N  N     . LEU C  3  109 ? 15.480  104.826 80.196  1.00 44.59  ? 109  LEU C N     1 
ATOM   7429  C  CA    . LEU C  3  109 ? 15.663  103.639 81.016  1.00 44.80  ? 109  LEU C CA    1 
ATOM   7430  C  C     . LEU C  3  109 ? 17.046  103.726 81.622  1.00 44.96  ? 109  LEU C C     1 
ATOM   7431  O  O     . LEU C  3  109 ? 17.421  102.898 82.429  1.00 48.84  ? 109  LEU C O     1 
ATOM   7432  C  CB    . LEU C  3  109 ? 15.469  102.344 80.215  1.00 43.55  ? 109  LEU C CB    1 
ATOM   7433  C  CG    . LEU C  3  109 ? 13.982  102.053 79.924  1.00 41.17  ? 109  LEU C CG    1 
ATOM   7434  C  CD1   . LEU C  3  109 ? 13.778  100.622 79.464  1.00 39.84  ? 109  LEU C CD1   1 
ATOM   7435  C  CD2   . LEU C  3  109 ? 13.189  102.271 81.183  1.00 39.19  ? 109  LEU C CD2   1 
ATOM   7436  N  N     . TYR C  3  110 ? 17.791  104.753 81.225  1.00 43.74  ? 110  TYR C N     1 
ATOM   7437  C  CA    . TYR C  3  110 ? 19.107  105.034 81.768  1.00 43.37  ? 110  TYR C CA    1 
ATOM   7438  C  C     . TYR C  3  110 ? 18.840  106.090 82.842  1.00 47.39  ? 110  TYR C C     1 
ATOM   7439  O  O     . TYR C  3  110 ? 19.350  107.211 82.768  1.00 49.50  ? 110  TYR C O     1 
ATOM   7440  C  CB    . TYR C  3  110 ? 19.990  105.659 80.718  1.00 39.24  ? 110  TYR C CB    1 
ATOM   7441  C  CG    . TYR C  3  110 ? 20.527  104.708 79.704  1.00 39.70  ? 110  TYR C CG    1 
ATOM   7442  C  CD1   . TYR C  3  110 ? 20.677  103.349 79.992  1.00 38.44  ? 110  TYR C CD1   1 
ATOM   7443  C  CD2   . TYR C  3  110 ? 20.962  105.177 78.469  1.00 39.81  ? 110  TYR C CD2   1 
ATOM   7444  C  CE1   . TYR C  3  110 ? 21.249  102.485 79.067  1.00 41.21  ? 110  TYR C CE1   1 
ATOM   7445  C  CE2   . TYR C  3  110 ? 21.542  104.330 77.540  1.00 43.01  ? 110  TYR C CE2   1 
ATOM   7446  C  CZ    . TYR C  3  110 ? 21.683  102.985 77.838  1.00 44.36  ? 110  TYR C CZ    1 
ATOM   7447  O  OH    . TYR C  3  110 ? 22.248  102.152 76.893  1.00 48.18  ? 110  TYR C OH    1 
ATOM   7448  N  N     . LYS C  3  111 ? 18.044  105.722 83.841  1.00 50.12  ? 111  LYS C N     1 
ATOM   7449  C  CA    . LYS C  3  111 ? 17.634  106.622 84.903  1.00 50.94  ? 111  LYS C CA    1 
ATOM   7450  C  C     . LYS C  3  111 ? 18.500  107.787 85.343  1.00 50.67  ? 111  LYS C C     1 
ATOM   7451  O  O     . LYS C  3  111 ? 18.019  108.910 85.323  1.00 50.08  ? 111  LYS C O     1 
ATOM   7452  C  CB    . LYS C  3  111 ? 17.212  105.804 86.109  1.00 55.03  ? 111  LYS C CB    1 
ATOM   7453  C  CG    . LYS C  3  111 ? 15.872  105.117 85.895  1.00 59.11  ? 111  LYS C CG    1 
ATOM   7454  C  CD    . LYS C  3  111 ? 15.465  104.275 87.104  1.00 65.67  ? 111  LYS C CD    1 
ATOM   7455  C  CE    . LYS C  3  111 ? 14.196  103.435 86.820  1.00 69.72  ? 111  LYS C CE    1 
ATOM   7456  N  NZ    . LYS C  3  111 ? 14.331  102.484 85.649  1.00 72.09  ? 111  LYS C NZ    1 
ATOM   7457  N  N     . GLU C  3  112 ? 19.751  107.571 85.742  1.00 52.47  ? 112  GLU C N     1 
ATOM   7458  C  CA    . GLU C  3  112 ? 20.553  108.725 86.179  1.00 53.99  ? 112  GLU C CA    1 
ATOM   7459  C  C     . GLU C  3  112 ? 20.878  109.654 85.033  1.00 52.54  ? 112  GLU C C     1 
ATOM   7460  O  O     . GLU C  3  112 ? 20.874  110.880 85.202  1.00 52.27  ? 112  GLU C O     1 
ATOM   7461  C  CB    . GLU C  3  112 ? 21.857  108.317 86.846  1.00 57.67  ? 112  GLU C CB    1 
ATOM   7462  C  CG    . GLU C  3  112 ? 21.694  107.314 87.948  1.00 68.28  ? 112  GLU C CG    1 
ATOM   7463  C  CD    . GLU C  3  112 ? 22.059  105.912 87.476  1.00 75.34  ? 112  GLU C CD    1 
ATOM   7464  O  OE1   . GLU C  3  112 ? 21.530  105.480 86.411  1.00 78.43  ? 112  GLU C OE1   1 
ATOM   7465  O  OE2   . GLU C  3  112 ? 22.879  105.251 88.169  1.00 78.61  ? 112  GLU C OE2   1 
ATOM   7466  N  N     . THR C  3  113 ? 21.185  109.096 83.868  1.00 50.02  ? 113  THR C N     1 
ATOM   7467  C  CA    . THR C  3  113 ? 21.462  109.974 82.751  1.00 48.25  ? 113  THR C CA    1 
ATOM   7468  C  C     . THR C  3  113 ? 20.190  110.784 82.513  1.00 47.86  ? 113  THR C C     1 
ATOM   7469  O  O     . THR C  3  113 ? 20.256  111.990 82.286  1.00 50.40  ? 113  THR C O     1 
ATOM   7470  C  CB    . THR C  3  113 ? 21.806  109.210 81.487  1.00 47.23  ? 113  THR C CB    1 
ATOM   7471  O  OG1   . THR C  3  113 ? 22.920  108.358 81.742  1.00 48.76  ? 113  THR C OG1   1 
ATOM   7472  C  CG2   . THR C  3  113 ? 22.182  110.164 80.391  1.00 46.39  ? 113  THR C CG2   1 
ATOM   7473  N  N     . TRP C  3  114 ? 19.035  110.127 82.588  1.00 44.04  ? 114  TRP C N     1 
ATOM   7474  C  CA    . TRP C  3  114 ? 17.764  110.797 82.381  1.00 40.39  ? 114  TRP C CA    1 
ATOM   7475  C  C     . TRP C  3  114 ? 17.556  111.884 83.408  1.00 39.52  ? 114  TRP C C     1 
ATOM   7476  O  O     . TRP C  3  114 ? 17.388  113.039 83.051  1.00 39.72  ? 114  TRP C O     1 
ATOM   7477  C  CB    . TRP C  3  114 ? 16.619  109.788 82.449  1.00 42.01  ? 114  TRP C CB    1 
ATOM   7478  C  CG    . TRP C  3  114 ? 15.272  110.372 82.191  1.00 43.36  ? 114  TRP C CG    1 
ATOM   7479  C  CD1   . TRP C  3  114 ? 14.322  110.682 83.115  1.00 43.80  ? 114  TRP C CD1   1 
ATOM   7480  C  CD2   . TRP C  3  114 ? 14.733  110.756 80.919  1.00 44.77  ? 114  TRP C CD2   1 
ATOM   7481  N  NE1   . TRP C  3  114 ? 13.221  111.239 82.503  1.00 45.24  ? 114  TRP C NE1   1 
ATOM   7482  C  CE2   . TRP C  3  114 ? 13.446  111.295 81.154  1.00 44.61  ? 114  TRP C CE2   1 
ATOM   7483  C  CE3   . TRP C  3  114 ? 15.209  110.698 79.605  1.00 44.09  ? 114  TRP C CE3   1 
ATOM   7484  C  CZ2   . TRP C  3  114 ? 12.634  111.772 80.125  1.00 41.99  ? 114  TRP C CZ2   1 
ATOM   7485  C  CZ3   . TRP C  3  114 ? 14.400  111.173 78.588  1.00 43.15  ? 114  TRP C CZ3   1 
ATOM   7486  C  CH2   . TRP C  3  114 ? 13.126  111.703 78.856  1.00 41.35  ? 114  TRP C CH2   1 
ATOM   7487  N  N     . ASN C  3  115 ? 17.593  111.532 84.689  1.00 39.82  ? 115  ASN C N     1 
ATOM   7488  C  CA    . ASN C  3  115 ? 17.374  112.532 85.731  1.00 39.89  ? 115  ASN C CA    1 
ATOM   7489  C  C     . ASN C  3  115 ? 18.346  113.711 85.665  1.00 39.62  ? 115  ASN C C     1 
ATOM   7490  O  O     . ASN C  3  115 ? 17.921  114.862 85.796  1.00 40.79  ? 115  ASN C O     1 
ATOM   7491  C  CB    . ASN C  3  115 ? 17.410  111.902 87.121  1.00 41.09  ? 115  ASN C CB    1 
ATOM   7492  C  CG    . ASN C  3  115 ? 16.336  110.832 87.325  1.00 44.29  ? 115  ASN C CG    1 
ATOM   7493  O  OD1   . ASN C  3  115 ? 15.149  111.039 87.047  1.00 48.33  ? 115  ASN C OD1   1 
ATOM   7494  N  ND2   . ASN C  3  115 ? 16.752  109.683 87.837  1.00 43.64  ? 115  ASN C ND2   1 
ATOM   7495  N  N     . THR C  3  116 ? 19.639  113.469 85.472  1.00 38.56  ? 116  THR C N     1 
ATOM   7496  C  CA    . THR C  3  116 ? 20.521  114.627 85.378  1.00 39.36  ? 116  THR C CA    1 
ATOM   7497  C  C     . THR C  3  116 ? 19.973  115.483 84.220  1.00 40.22  ? 116  THR C C     1 
ATOM   7498  O  O     . THR C  3  116 ? 19.950  116.720 84.279  1.00 40.52  ? 116  THR C O     1 
ATOM   7499  C  CB    . THR C  3  116 ? 22.017  114.247 85.118  1.00 37.78  ? 116  THR C CB    1 
ATOM   7500  O  OG1   . THR C  3  116 ? 22.126  113.401 83.970  1.00 40.38  ? 116  THR C OG1   1 
ATOM   7501  C  CG2   . THR C  3  116 ? 22.596  113.551 86.318  1.00 34.12  ? 116  THR C CG2   1 
ATOM   7502  N  N     . GLY C  3  117 ? 19.480  114.812 83.188  1.00 40.12  ? 117  GLY C N     1 
ATOM   7503  C  CA    . GLY C  3  117 ? 18.932  115.527 82.051  1.00 40.62  ? 117  GLY C CA    1 
ATOM   7504  C  C     . GLY C  3  117 ? 17.794  116.462 82.432  1.00 40.73  ? 117  GLY C C     1 
ATOM   7505  O  O     . GLY C  3  117 ? 17.740  117.623 82.002  1.00 41.27  ? 117  GLY C O     1 
ATOM   7506  N  N     . VAL C  3  118 ? 16.866  115.978 83.240  1.00 38.32  ? 118  VAL C N     1 
ATOM   7507  C  CA    . VAL C  3  118 ? 15.779  116.848 83.633  1.00 37.88  ? 118  VAL C CA    1 
ATOM   7508  C  C     . VAL C  3  118 ? 16.355  118.058 84.381  1.00 39.33  ? 118  VAL C C     1 
ATOM   7509  O  O     . VAL C  3  118 ? 15.880  119.188 84.224  1.00 40.90  ? 118  VAL C O     1 
ATOM   7510  C  CB    . VAL C  3  118 ? 14.778  116.114 84.517  1.00 35.84  ? 118  VAL C CB    1 
ATOM   7511  C  CG1   . VAL C  3  118 ? 13.568  116.972 84.753  1.00 32.28  ? 118  VAL C CG1   1 
ATOM   7512  C  CG2   . VAL C  3  118 ? 14.380  114.823 83.851  1.00 37.35  ? 118  VAL C CG2   1 
ATOM   7513  N  N     . ILE C  3  119 ? 17.393  117.842 85.179  1.00 38.31  ? 119  ILE C N     1 
ATOM   7514  C  CA    . ILE C  3  119 ? 17.974  118.965 85.910  1.00 37.56  ? 119  ILE C CA    1 
ATOM   7515  C  C     . ILE C  3  119 ? 18.602  119.971 84.935  1.00 36.40  ? 119  ILE C C     1 
ATOM   7516  O  O     . ILE C  3  119 ? 18.589  121.189 85.160  1.00 33.95  ? 119  ILE C O     1 
ATOM   7517  C  CB    . ILE C  3  119 ? 19.039  118.476 86.925  1.00 37.63  ? 119  ILE C CB    1 
ATOM   7518  C  CG1   . ILE C  3  119 ? 18.361  117.796 88.105  1.00 37.35  ? 119  ILE C CG1   1 
ATOM   7519  C  CG2   . ILE C  3  119 ? 19.855  119.642 87.450  1.00 35.19  ? 119  ILE C CG2   1 
ATOM   7520  C  CD1   . ILE C  3  119 ? 19.339  117.429 89.175  1.00 36.71  ? 119  ILE C CD1   1 
ATOM   7521  N  N     . LEU C  3  120 ? 19.150  119.454 83.845  1.00 34.95  ? 120  LEU C N     1 
ATOM   7522  C  CA    . LEU C  3  120 ? 19.769  120.315 82.865  1.00 35.28  ? 120  LEU C CA    1 
ATOM   7523  C  C     . LEU C  3  120 ? 18.730  121.218 82.259  1.00 35.09  ? 120  LEU C C     1 
ATOM   7524  O  O     . LEU C  3  120 ? 18.960  122.412 82.099  1.00 34.41  ? 120  LEU C O     1 
ATOM   7525  C  CB    . LEU C  3  120 ? 20.453  119.474 81.796  1.00 36.45  ? 120  LEU C CB    1 
ATOM   7526  C  CG    . LEU C  3  120 ? 21.840  119.103 82.296  1.00 37.66  ? 120  LEU C CG    1 
ATOM   7527  C  CD1   . LEU C  3  120 ? 22.497  118.158 81.352  1.00 42.17  ? 120  LEU C CD1   1 
ATOM   7528  C  CD2   . LEU C  3  120 ? 22.663  120.365 82.413  1.00 38.23  ? 120  LEU C CD2   1 
ATOM   7529  N  N     . LEU C  3  121 ? 17.574  120.635 81.944  1.00 36.63  ? 121  LEU C N     1 
ATOM   7530  C  CA    . LEU C  3  121 ? 16.438  121.361 81.367  1.00 34.83  ? 121  LEU C CA    1 
ATOM   7531  C  C     . LEU C  3  121 ? 15.986  122.449 82.321  1.00 33.89  ? 121  LEU C C     1 
ATOM   7532  O  O     . LEU C  3  121 ? 15.872  123.613 81.945  1.00 32.88  ? 121  LEU C O     1 
ATOM   7533  C  CB    . LEU C  3  121 ? 15.264  120.412 81.123  1.00 34.60  ? 121  LEU C CB    1 
ATOM   7534  C  CG    . LEU C  3  121 ? 13.961  121.106 80.698  1.00 34.19  ? 121  LEU C CG    1 
ATOM   7535  C  CD1   . LEU C  3  121 ? 14.175  121.899 79.399  1.00 31.82  ? 121  LEU C CD1   1 
ATOM   7536  C  CD2   . LEU C  3  121 ? 12.886  120.061 80.497  1.00 29.89  ? 121  LEU C CD2   1 
ATOM   7537  N  N     . LEU C  3  122 ? 15.718  122.062 83.559  1.00 32.83  ? 122  LEU C N     1 
ATOM   7538  C  CA    . LEU C  3  122 ? 15.316  123.044 84.543  1.00 35.76  ? 122  LEU C CA    1 
ATOM   7539  C  C     . LEU C  3  122 ? 16.351  124.174 84.669  1.00 36.26  ? 122  LEU C C     1 
ATOM   7540  O  O     . LEU C  3  122 ? 16.005  125.353 84.577  1.00 36.62  ? 122  LEU C O     1 
ATOM   7541  C  CB    . LEU C  3  122 ? 15.089  122.380 85.900  1.00 36.56  ? 122  LEU C CB    1 
ATOM   7542  C  CG    . LEU C  3  122 ? 13.935  121.363 85.951  1.00 38.32  ? 122  LEU C CG    1 
ATOM   7543  C  CD1   . LEU C  3  122 ? 13.785  120.832 87.363  1.00 38.00  ? 122  LEU C CD1   1 
ATOM   7544  C  CD2   . LEU C  3  122 ? 12.642  122.011 85.496  1.00 33.71  ? 122  LEU C CD2   1 
ATOM   7545  N  N     . THR C  3  123 ? 17.623  123.840 84.848  1.00 36.14  ? 123  THR C N     1 
ATOM   7546  C  CA    . THR C  3  123 ? 18.599  124.908 84.983  1.00 36.09  ? 123  THR C CA    1 
ATOM   7547  C  C     . THR C  3  123 ? 18.563  125.819 83.766  1.00 35.67  ? 123  THR C C     1 
ATOM   7548  O  O     . THR C  3  123 ? 18.560  127.051 83.899  1.00 34.22  ? 123  THR C O     1 
ATOM   7549  C  CB    . THR C  3  123 ? 20.021  124.360 85.174  1.00 38.29  ? 123  THR C CB    1 
ATOM   7550  O  OG1   . THR C  3  123 ? 20.050  123.497 86.319  1.00 38.11  ? 123  THR C OG1   1 
ATOM   7551  C  CG2   . THR C  3  123 ? 21.011  125.512 85.402  1.00 37.75  ? 123  THR C CG2   1 
ATOM   7552  N  N     . LEU C  3  124 ? 18.516  125.214 82.580  1.00 35.16  ? 124  LEU C N     1 
ATOM   7553  C  CA    . LEU C  3  124 ? 18.483  125.988 81.335  1.00 35.18  ? 124  LEU C CA    1 
ATOM   7554  C  C     . LEU C  3  124 ? 17.323  126.977 81.324  1.00 37.14  ? 124  LEU C C     1 
ATOM   7555  O  O     . LEU C  3  124 ? 17.516  128.169 81.007  1.00 36.32  ? 124  LEU C O     1 
ATOM   7556  C  CB    . LEU C  3  124 ? 18.370  125.063 80.133  1.00 31.55  ? 124  LEU C CB    1 
ATOM   7557  C  CG    . LEU C  3  124 ? 18.007  125.752 78.818  1.00 29.69  ? 124  LEU C CG    1 
ATOM   7558  C  CD1   . LEU C  3  124 ? 18.975  126.864 78.514  1.00 31.04  ? 124  LEU C CD1   1 
ATOM   7559  C  CD2   . LEU C  3  124 ? 18.013  124.734 77.695  1.00 30.31  ? 124  LEU C CD2   1 
ATOM   7560  N  N     . MET C  3  125 ? 16.128  126.476 81.672  1.00 37.39  ? 125  MET C N     1 
ATOM   7561  C  CA    . MET C  3  125 ? 14.931  127.304 81.724  1.00 37.62  ? 125  MET C CA    1 
ATOM   7562  C  C     . MET C  3  125 ? 15.167  128.511 82.607  1.00 37.83  ? 125  MET C C     1 
ATOM   7563  O  O     . MET C  3  125 ? 14.970  129.643 82.164  1.00 39.30  ? 125  MET C O     1 
ATOM   7564  C  CB    . MET C  3  125 ? 13.757  126.502 82.238  1.00 39.18  ? 125  MET C CB    1 
ATOM   7565  C  CG    . MET C  3  125 ? 13.302  125.435 81.243  1.00 44.48  ? 125  MET C CG    1 
ATOM   7566  S  SD    . MET C  3  125 ? 11.945  124.377 81.836  1.00 48.22  ? 125  MET C SD    1 
ATOM   7567  C  CE    . MET C  3  125 ? 10.522  125.458 81.516  1.00 47.40  ? 125  MET C CE    1 
ATOM   7568  N  N     . ALA C  3  126 ? 15.617  128.287 83.841  1.00 36.61  ? 126  ALA C N     1 
ATOM   7569  C  CA    . ALA C  3  126 ? 15.907  129.404 84.749  1.00 36.25  ? 126  ALA C CA    1 
ATOM   7570  C  C     . ALA C  3  126 ? 16.916  130.350 84.109  1.00 37.69  ? 126  ALA C C     1 
ATOM   7571  O  O     . ALA C  3  126 ? 16.734  131.571 84.117  1.00 37.48  ? 126  ALA C O     1 
ATOM   7572  C  CB    . ALA C  3  126 ? 16.460  128.903 86.046  1.00 32.89  ? 126  ALA C CB    1 
ATOM   7573  N  N     . THR C  3  127 ? 17.977  129.788 83.539  1.00 38.70  ? 127  THR C N     1 
ATOM   7574  C  CA    . THR C  3  127 ? 18.993  130.621 82.913  1.00 39.46  ? 127  THR C CA    1 
ATOM   7575  C  C     . THR C  3  127 ? 18.372  131.608 81.906  1.00 38.87  ? 127  THR C C     1 
ATOM   7576  O  O     . THR C  3  127 ? 18.584  132.827 81.997  1.00 37.84  ? 127  THR C O     1 
ATOM   7577  C  CB    . THR C  3  127 ? 20.090  129.751 82.209  1.00 40.10  ? 127  THR C CB    1 
ATOM   7578  O  OG1   . THR C  3  127 ? 20.739  128.921 83.182  1.00 39.60  ? 127  THR C OG1   1 
ATOM   7579  C  CG2   . THR C  3  127 ? 21.136  130.635 81.535  1.00 35.38  ? 127  THR C CG2   1 
ATOM   7580  N  N     . ALA C  3  128 ? 17.586  131.101 80.964  1.00 37.78  ? 128  ALA C N     1 
ATOM   7581  C  CA    . ALA C  3  128 ? 17.005  131.995 79.972  1.00 39.08  ? 128  ALA C CA    1 
ATOM   7582  C  C     . ALA C  3  128 ? 16.065  132.996 80.618  1.00 41.26  ? 128  ALA C C     1 
ATOM   7583  O  O     . ALA C  3  128 ? 16.077  134.176 80.279  1.00 41.07  ? 128  ALA C O     1 
ATOM   7584  C  CB    . ALA C  3  128 ? 16.271  131.202 78.909  1.00 38.71  ? 128  ALA C CB    1 
ATOM   7585  N  N     . PHE C  3  129 ? 15.259  132.532 81.568  1.00 42.79  ? 129  PHE C N     1 
ATOM   7586  C  CA    . PHE C  3  129 ? 14.309  133.416 82.217  1.00 43.17  ? 129  PHE C CA    1 
ATOM   7587  C  C     . PHE C  3  129 ? 14.962  134.636 82.838  1.00 43.32  ? 129  PHE C C     1 
ATOM   7588  O  O     . PHE C  3  129 ? 14.412  135.723 82.774  1.00 43.52  ? 129  PHE C O     1 
ATOM   7589  C  CB    . PHE C  3  129 ? 13.541  132.690 83.297  1.00 44.88  ? 129  PHE C CB    1 
ATOM   7590  C  CG    . PHE C  3  129 ? 12.459  133.526 83.907  1.00 47.23  ? 129  PHE C CG    1 
ATOM   7591  C  CD1   . PHE C  3  129 ? 11.196  133.588 83.316  1.00 46.61  ? 129  PHE C CD1   1 
ATOM   7592  C  CD2   . PHE C  3  129 ? 12.707  134.275 85.055  1.00 46.76  ? 129  PHE C CD2   1 
ATOM   7593  C  CE1   . PHE C  3  129 ? 10.209  134.368 83.853  1.00 45.95  ? 129  PHE C CE1   1 
ATOM   7594  C  CE2   . PHE C  3  129 ? 11.722  135.065 85.603  1.00 45.57  ? 129  PHE C CE2   1 
ATOM   7595  C  CZ    . PHE C  3  129 ? 10.472  135.112 85.003  1.00 47.57  ? 129  PHE C CZ    1 
ATOM   7596  N  N     . VAL C  3  130 ? 16.118  134.457 83.468  1.00 43.85  ? 130  VAL C N     1 
ATOM   7597  C  CA    . VAL C  3  130 ? 16.818  135.592 84.071  1.00 44.05  ? 130  VAL C CA    1 
ATOM   7598  C  C     . VAL C  3  130 ? 17.566  136.395 82.999  1.00 44.56  ? 130  VAL C C     1 
ATOM   7599  O  O     . VAL C  3  130 ? 17.669  137.628 83.078  1.00 44.02  ? 130  VAL C O     1 
ATOM   7600  C  CB    . VAL C  3  130 ? 17.824  135.137 85.136  1.00 43.71  ? 130  VAL C CB    1 
ATOM   7601  C  CG1   . VAL C  3  130 ? 17.110  134.315 86.159  1.00 42.17  ? 130  VAL C CG1   1 
ATOM   7602  C  CG2   . VAL C  3  130 ? 18.974  134.355 84.494  1.00 41.31  ? 130  VAL C CG2   1 
ATOM   7603  N  N     . GLY C  3  131 ? 18.077  135.699 81.992  1.00 43.81  ? 131  GLY C N     1 
ATOM   7604  C  CA    . GLY C  3  131 ? 18.781  136.397 80.939  1.00 45.87  ? 131  GLY C CA    1 
ATOM   7605  C  C     . GLY C  3  131 ? 17.872  137.366 80.221  1.00 46.60  ? 131  GLY C C     1 
ATOM   7606  O  O     . GLY C  3  131 ? 18.248  138.499 79.925  1.00 47.36  ? 131  GLY C O     1 
ATOM   7607  N  N     . TYR C  3  132 ? 16.653  136.912 79.963  1.00 47.11  ? 132  TYR C N     1 
ATOM   7608  C  CA    . TYR C  3  132 ? 15.665  137.708 79.264  1.00 45.87  ? 132  TYR C CA    1 
ATOM   7609  C  C     . TYR C  3  132 ? 15.376  139.006 79.994  1.00 45.14  ? 132  TYR C C     1 
ATOM   7610  O  O     . TYR C  3  132 ? 15.143  140.034 79.367  1.00 46.44  ? 132  TYR C O     1 
ATOM   7611  C  CB    . TYR C  3  132 ? 14.373  136.914 79.111  1.00 46.70  ? 132  TYR C CB    1 
ATOM   7612  C  CG    . TYR C  3  132 ? 13.398  137.530 78.143  1.00 49.21  ? 132  TYR C CG    1 
ATOM   7613  C  CD1   . TYR C  3  132 ? 13.740  137.724 76.806  1.00 50.98  ? 132  TYR C CD1   1 
ATOM   7614  C  CD2   . TYR C  3  132 ? 12.134  137.924 78.559  1.00 49.82  ? 132  TYR C CD2   1 
ATOM   7615  C  CE1   . TYR C  3  132 ? 12.839  138.295 75.910  1.00 52.19  ? 132  TYR C CE1   1 
ATOM   7616  C  CE2   . TYR C  3  132 ? 11.229  138.494 77.671  1.00 50.95  ? 132  TYR C CE2   1 
ATOM   7617  C  CZ    . TYR C  3  132 ? 11.584  138.674 76.354  1.00 51.44  ? 132  TYR C CZ    1 
ATOM   7618  O  OH    . TYR C  3  132 ? 10.673  139.211 75.477  1.00 54.62  ? 132  TYR C OH    1 
ATOM   7619  N  N     . VAL C  3  133 ? 15.392  138.981 81.317  1.00 42.40  ? 133  VAL C N     1 
ATOM   7620  C  CA    . VAL C  3  133 ? 15.091  140.204 82.041  1.00 41.76  ? 133  VAL C CA    1 
ATOM   7621  C  C     . VAL C  3  133 ? 16.155  141.289 81.862  1.00 41.32  ? 133  VAL C C     1 
ATOM   7622  O  O     . VAL C  3  133 ? 15.847  142.474 81.904  1.00 42.16  ? 133  VAL C O     1 
ATOM   7623  C  CB    . VAL C  3  133 ? 14.875  139.918 83.565  1.00 41.29  ? 133  VAL C CB    1 
ATOM   7624  C  CG1   . VAL C  3  133 ? 14.554  141.181 84.309  1.00 40.28  ? 133  VAL C CG1   1 
ATOM   7625  C  CG2   . VAL C  3  133 ? 13.724  138.973 83.754  1.00 41.27  ? 133  VAL C CG2   1 
ATOM   7626  N  N     . LEU C  3  134 ? 17.395  140.899 81.620  1.00 40.20  ? 134  LEU C N     1 
ATOM   7627  C  CA    . LEU C  3  134 ? 18.473  141.885 81.514  1.00 40.85  ? 134  LEU C CA    1 
ATOM   7628  C  C     . LEU C  3  134 ? 18.346  143.125 80.632  1.00 40.87  ? 134  LEU C C     1 
ATOM   7629  O  O     . LEU C  3  134 ? 18.712  144.197 81.058  1.00 41.48  ? 134  LEU C O     1 
ATOM   7630  C  CB    . LEU C  3  134 ? 19.796  141.184 81.191  1.00 40.16  ? 134  LEU C CB    1 
ATOM   7631  C  CG    . LEU C  3  134 ? 20.140  140.114 82.225  1.00 38.98  ? 134  LEU C CG    1 
ATOM   7632  C  CD1   . LEU C  3  134 ? 21.377  139.388 81.809  1.00 38.86  ? 134  LEU C CD1   1 
ATOM   7633  C  CD2   . LEU C  3  134 ? 20.322  140.750 83.583  1.00 37.45  ? 134  LEU C CD2   1 
ATOM   7634  N  N     . PRO C  3  135 ? 17.856  143.004 79.390  1.00 42.10  ? 135  PRO C N     1 
ATOM   7635  C  CA    . PRO C  3  135 ? 17.742  144.207 78.555  1.00 42.55  ? 135  PRO C CA    1 
ATOM   7636  C  C     . PRO C  3  135 ? 16.742  145.206 79.102  1.00 43.03  ? 135  PRO C C     1 
ATOM   7637  O  O     . PRO C  3  135 ? 16.701  146.350 78.682  1.00 43.42  ? 135  PRO C O     1 
ATOM   7638  C  CB    . PRO C  3  135 ? 17.341  143.658 77.197  1.00 42.40  ? 135  PRO C CB    1 
ATOM   7639  C  CG    . PRO C  3  135 ? 16.575  142.458 77.556  1.00 44.59  ? 135  PRO C CG    1 
ATOM   7640  C  CD    . PRO C  3  135 ? 17.409  141.823 78.646  1.00 43.77  ? 135  PRO C CD    1 
ATOM   7641  N  N     . TRP C  3  136 ? 15.916  144.759 80.031  1.00 44.74  ? 136  TRP C N     1 
ATOM   7642  C  CA    . TRP C  3  136 ? 14.970  145.645 80.690  1.00 44.76  ? 136  TRP C CA    1 
ATOM   7643  C  C     . TRP C  3  136 ? 13.998  146.381 79.773  1.00 44.93  ? 136  TRP C C     1 
ATOM   7644  O  O     . TRP C  3  136 ? 13.811  147.603 79.884  1.00 43.74  ? 136  TRP C O     1 
ATOM   7645  C  CB    . TRP C  3  136 ? 15.756  146.644 81.535  1.00 43.86  ? 136  TRP C CB    1 
ATOM   7646  C  CG    . TRP C  3  136 ? 15.036  147.151 82.722  1.00 44.37  ? 136  TRP C CG    1 
ATOM   7647  C  CD1   . TRP C  3  136 ? 14.721  148.438 82.984  1.00 46.21  ? 136  TRP C CD1   1 
ATOM   7648  C  CD2   . TRP C  3  136 ? 14.565  146.388 83.838  1.00 46.27  ? 136  TRP C CD2   1 
ATOM   7649  N  NE1   . TRP C  3  136 ? 14.081  148.540 84.199  1.00 46.29  ? 136  TRP C NE1   1 
ATOM   7650  C  CE2   . TRP C  3  136 ? 13.968  147.294 84.743  1.00 45.81  ? 136  TRP C CE2   1 
ATOM   7651  C  CE3   . TRP C  3  136 ? 14.592  145.028 84.167  1.00 48.16  ? 136  TRP C CE3   1 
ATOM   7652  C  CZ2   . TRP C  3  136 ? 13.400  146.890 85.949  1.00 46.34  ? 136  TRP C CZ2   1 
ATOM   7653  C  CZ3   . TRP C  3  136 ? 14.026  144.626 85.381  1.00 48.47  ? 136  TRP C CZ3   1 
ATOM   7654  C  CH2   . TRP C  3  136 ? 13.436  145.559 86.252  1.00 47.22  ? 136  TRP C CH2   1 
ATOM   7655  N  N     . GLY C  3  137 ? 13.394  145.625 78.863  1.00 45.24  ? 137  GLY C N     1 
ATOM   7656  C  CA    . GLY C  3  137 ? 12.386  146.183 77.981  1.00 46.48  ? 137  GLY C CA    1 
ATOM   7657  C  C     . GLY C  3  137 ? 11.013  145.910 78.612  1.00 46.96  ? 137  GLY C C     1 
ATOM   7658  O  O     . GLY C  3  137 ? 10.922  145.320 79.696  1.00 45.95  ? 137  GLY C O     1 
ATOM   7659  N  N     . GLN C  3  138 ? 9.939   146.320 77.945  1.00 47.26  ? 138  GLN C N     1 
ATOM   7660  C  CA    . GLN C  3  138 ? 8.599   146.118 78.483  1.00 47.62  ? 138  GLN C CA    1 
ATOM   7661  C  C     . GLN C  3  138 ? 8.290   144.668 78.802  1.00 47.24  ? 138  GLN C C     1 
ATOM   7662  O  O     . GLN C  3  138 ? 7.743   144.371 79.864  1.00 46.27  ? 138  GLN C O     1 
ATOM   7663  C  CB    . GLN C  3  138 ? 7.540   146.657 77.518  1.00 48.71  ? 138  GLN C CB    1 
ATOM   7664  C  CG    . GLN C  3  138 ? 7.141   148.082 77.796  1.00 50.19  ? 138  GLN C CG    1 
ATOM   7665  C  CD    . GLN C  3  138 ? 6.472   148.230 79.145  1.00 53.99  ? 138  GLN C CD    1 
ATOM   7666  O  OE1   . GLN C  3  138 ? 7.081   147.970 80.192  1.00 53.39  ? 138  GLN C OE1   1 
ATOM   7667  N  NE2   . GLN C  3  138 ? 5.205   148.645 79.130  1.00 54.56  ? 138  GLN C NE2   1 
ATOM   7668  N  N     . MET C  3  139 ? 8.636   143.762 77.893  1.00 46.47  ? 139  MET C N     1 
ATOM   7669  C  CA    . MET C  3  139 ? 8.349   142.363 78.136  1.00 46.46  ? 139  MET C CA    1 
ATOM   7670  C  C     . MET C  3  139 ? 9.313   141.806 79.146  1.00 47.41  ? 139  MET C C     1 
ATOM   7671  O  O     . MET C  3  139 ? 8.980   140.891 79.876  1.00 48.75  ? 139  MET C O     1 
ATOM   7672  C  CB    . MET C  3  139 ? 8.408   141.546 76.852  1.00 45.98  ? 139  MET C CB    1 
ATOM   7673  C  CG    . MET C  3  139 ? 7.462   140.346 76.875  1.00 50.26  ? 139  MET C CG    1 
ATOM   7674  S  SD    . MET C  3  139 ? 5.684   140.730 77.367  1.00 53.45  ? 139  MET C SD    1 
ATOM   7675  C  CE    . MET C  3  139 ? 4.968   141.179 75.771  1.00 47.11  ? 139  MET C CE    1 
ATOM   7676  N  N     . SER C  3  140 ? 10.512  142.360 79.210  1.00 48.75  ? 140  SER C N     1 
ATOM   7677  C  CA    . SER C  3  140 ? 11.481  141.867 80.178  1.00 49.42  ? 140  SER C CA    1 
ATOM   7678  C  C     . SER C  3  140 ? 10.875  142.074 81.553  1.00 49.72  ? 140  SER C C     1 
ATOM   7679  O  O     . SER C  3  140 ? 10.785  141.166 82.366  1.00 50.27  ? 140  SER C O     1 
ATOM   7680  C  CB    . SER C  3  140 ? 12.797  142.655 80.101  1.00 50.83  ? 140  SER C CB    1 
ATOM   7681  O  OG    . SER C  3  140 ? 13.469  142.479 78.863  1.00 52.67  ? 140  SER C OG    1 
ATOM   7682  N  N     . PHE C  3  141 ? 10.440  143.293 81.802  1.00 50.48  ? 141  PHE C N     1 
ATOM   7683  C  CA    . PHE C  3  141 ? 9.876   143.630 83.090  1.00 50.22  ? 141  PHE C CA    1 
ATOM   7684  C  C     . PHE C  3  141 ? 8.611   142.866 83.412  1.00 49.62  ? 141  PHE C C     1 
ATOM   7685  O  O     . PHE C  3  141 ? 8.533   142.193 84.428  1.00 50.63  ? 141  PHE C O     1 
ATOM   7686  C  CB    . PHE C  3  141 ? 9.589   145.126 83.156  1.00 51.62  ? 141  PHE C CB    1 
ATOM   7687  C  CG    . PHE C  3  141 ? 8.956   145.555 84.439  1.00 53.11  ? 141  PHE C CG    1 
ATOM   7688  C  CD1   . PHE C  3  141 ? 9.729   145.729 85.586  1.00 53.71  ? 141  PHE C CD1   1 
ATOM   7689  C  CD2   . PHE C  3  141 ? 7.577   145.729 84.520  1.00 53.12  ? 141  PHE C CD2   1 
ATOM   7690  C  CE1   . PHE C  3  141 ? 9.138   146.064 86.799  1.00 52.88  ? 141  PHE C CE1   1 
ATOM   7691  C  CE2   . PHE C  3  141 ? 6.978   146.063 85.725  1.00 53.42  ? 141  PHE C CE2   1 
ATOM   7692  C  CZ    . PHE C  3  141 ? 7.762   146.229 86.869  1.00 53.85  ? 141  PHE C CZ    1 
ATOM   7693  N  N     . TRP C  3  142 ? 7.614   142.964 82.549  1.00 49.27  ? 142  TRP C N     1 
ATOM   7694  C  CA    . TRP C  3  142 ? 6.350   142.288 82.812  1.00 49.05  ? 142  TRP C CA    1 
ATOM   7695  C  C     . TRP C  3  142 ? 6.393   140.761 82.896  1.00 47.58  ? 142  TRP C C     1 
ATOM   7696  O  O     . TRP C  3  142 ? 5.627   140.171 83.642  1.00 48.00  ? 142  TRP C O     1 
ATOM   7697  C  CB    . TRP C  3  142 ? 5.295   142.779 81.817  1.00 49.70  ? 142  TRP C CB    1 
ATOM   7698  C  CG    . TRP C  3  142 ? 4.959   144.238 82.086  1.00 50.39  ? 142  TRP C CG    1 
ATOM   7699  C  CD1   . TRP C  3  142 ? 5.488   145.346 81.468  1.00 51.17  ? 142  TRP C CD1   1 
ATOM   7700  C  CD2   . TRP C  3  142 ? 4.128   144.731 83.132  1.00 49.51  ? 142  TRP C CD2   1 
ATOM   7701  N  NE1   . TRP C  3  142 ? 5.038   146.492 82.075  1.00 49.52  ? 142  TRP C NE1   1 
ATOM   7702  C  CE2   . TRP C  3  142 ? 4.202   146.141 83.100  1.00 49.89  ? 142  TRP C CE2   1 
ATOM   7703  C  CE3   . TRP C  3  142 ? 3.331   144.116 84.102  1.00 48.39  ? 142  TRP C CE3   1 
ATOM   7704  C  CZ2   . TRP C  3  142 ? 3.510   146.942 84.002  1.00 51.19  ? 142  TRP C CZ2   1 
ATOM   7705  C  CZ3   . TRP C  3  142 ? 2.650   144.908 84.997  1.00 49.02  ? 142  TRP C CZ3   1 
ATOM   7706  C  CH2   . TRP C  3  142 ? 2.741   146.308 84.944  1.00 50.42  ? 142  TRP C CH2   1 
ATOM   7707  N  N     . GLY C  3  143 ? 7.280   140.115 82.153  1.00 46.05  ? 143  GLY C N     1 
ATOM   7708  C  CA    . GLY C  3  143 ? 7.376   138.675 82.271  1.00 43.95  ? 143  GLY C CA    1 
ATOM   7709  C  C     . GLY C  3  143 ? 7.905   138.411 83.677  1.00 44.54  ? 143  GLY C C     1 
ATOM   7710  O  O     . GLY C  3  143 ? 7.374   137.585 84.447  1.00 42.58  ? 143  GLY C O     1 
ATOM   7711  N  N     . ALA C  3  144 ? 8.971   139.130 84.016  1.00 43.96  ? 144  ALA C N     1 
ATOM   7712  C  CA    . ALA C  3  144 ? 9.581   139.014 85.323  1.00 44.30  ? 144  ALA C CA    1 
ATOM   7713  C  C     . ALA C  3  144 ? 8.497   139.172 86.388  1.00 46.05  ? 144  ALA C C     1 
ATOM   7714  O  O     . ALA C  3  144 ? 8.391   138.360 87.307  1.00 46.69  ? 144  ALA C O     1 
ATOM   7715  C  CB    . ALA C  3  144 ? 10.638  140.075 85.487  1.00 42.56  ? 144  ALA C CB    1 
ATOM   7716  N  N     . THR C  3  145 ? 7.677   140.212 86.244  1.00 48.39  ? 145  THR C N     1 
ATOM   7717  C  CA    . THR C  3  145 ? 6.584   140.505 87.190  1.00 50.29  ? 145  THR C CA    1 
ATOM   7718  C  C     . THR C  3  145 ? 5.511   139.421 87.279  1.00 48.94  ? 145  THR C C     1 
ATOM   7719  O  O     . THR C  3  145 ? 5.226   138.885 88.344  1.00 48.30  ? 145  THR C O     1 
ATOM   7720  C  CB    . THR C  3  145 ? 5.869   141.817 86.832  1.00 51.02  ? 145  THR C CB    1 
ATOM   7721  O  OG1   . THR C  3  145 ? 6.811   142.895 86.842  1.00 53.36  ? 145  THR C OG1   1 
ATOM   7722  C  CG2   . THR C  3  145 ? 4.797   142.112 87.849  1.00 51.29  ? 145  THR C CG2   1 
ATOM   7723  N  N     . VAL C  3  146 ? 4.899   139.134 86.149  1.00 48.65  ? 146  VAL C N     1 
ATOM   7724  C  CA    . VAL C  3  146 ? 3.879   138.114 86.073  1.00 50.18  ? 146  VAL C CA    1 
ATOM   7725  C  C     . VAL C  3  146 ? 4.282   136.785 86.710  1.00 51.48  ? 146  VAL C C     1 
ATOM   7726  O  O     . VAL C  3  146 ? 3.563   136.252 87.552  1.00 50.52  ? 146  VAL C O     1 
ATOM   7727  C  CB    . VAL C  3  146 ? 3.525   137.849 84.600  1.00 49.84  ? 146  VAL C CB    1 
ATOM   7728  C  CG1   . VAL C  3  146 ? 3.049   136.414 84.408  1.00 50.00  ? 146  VAL C CG1   1 
ATOM   7729  C  CG2   . VAL C  3  146 ? 2.473   138.822 84.158  1.00 49.13  ? 146  VAL C CG2   1 
ATOM   7730  N  N     . ILE C  3  147 ? 5.432   136.255 86.303  1.00 53.21  ? 147  ILE C N     1 
ATOM   7731  C  CA    . ILE C  3  147 ? 5.870   134.958 86.787  1.00 54.70  ? 147  ILE C CA    1 
ATOM   7732  C  C     . ILE C  3  147 ? 6.391   134.875 88.201  1.00 55.90  ? 147  ILE C C     1 
ATOM   7733  O  O     . ILE C  3  147 ? 6.160   133.878 88.873  1.00 56.44  ? 147  ILE C O     1 
ATOM   7734  C  CB    . ILE C  3  147 ? 6.910   134.363 85.853  1.00 55.33  ? 147  ILE C CB    1 
ATOM   7735  C  CG1   . ILE C  3  147 ? 6.330   134.257 84.443  1.00 55.72  ? 147  ILE C CG1   1 
ATOM   7736  C  CG2   . ILE C  3  147 ? 7.291   132.984 86.322  1.00 55.77  ? 147  ILE C CG2   1 
ATOM   7737  C  CD1   . ILE C  3  147 ? 5.139   133.323 84.343  1.00 56.38  ? 147  ILE C CD1   1 
ATOM   7738  N  N     . THR C  3  148 ? 7.103   135.894 88.664  1.00 57.90  ? 148  THR C N     1 
ATOM   7739  C  CA    . THR C  3  148 ? 7.609   135.856 90.035  1.00 60.07  ? 148  THR C CA    1 
ATOM   7740  C  C     . THR C  3  148 ? 6.480   136.142 91.032  1.00 61.50  ? 148  THR C C     1 
ATOM   7741  O  O     . THR C  3  148 ? 6.581   135.800 92.196  1.00 62.34  ? 148  THR C O     1 
ATOM   7742  C  CB    . THR C  3  148 ? 8.754   136.871 90.265  1.00 59.29  ? 148  THR C CB    1 
ATOM   7743  O  OG1   . THR C  3  148 ? 8.298   138.188 89.936  1.00 60.60  ? 148  THR C OG1   1 
ATOM   7744  C  CG2   . THR C  3  148 ? 9.959   136.522 89.417  1.00 56.58  ? 148  THR C CG2   1 
ATOM   7745  N  N     . ASN C  3  149 ? 5.403   136.766 90.576  1.00 63.30  ? 149  ASN C N     1 
ATOM   7746  C  CA    . ASN C  3  149 ? 4.293   137.051 91.464  1.00 66.42  ? 149  ASN C CA    1 
ATOM   7747  C  C     . ASN C  3  149 ? 3.545   135.776 91.798  1.00 68.22  ? 149  ASN C C     1 
ATOM   7748  O  O     . ASN C  3  149 ? 2.792   135.717 92.760  1.00 69.32  ? 149  ASN C O     1 
ATOM   7749  C  CB    . ASN C  3  149 ? 3.314   138.015 90.809  1.00 70.04  ? 149  ASN C CB    1 
ATOM   7750  C  CG    . ASN C  3  149 ? 3.031   139.240 91.671  1.00 74.51  ? 149  ASN C CG    1 
ATOM   7751  O  OD1   . ASN C  3  149 ? 2.834   139.129 92.896  1.00 74.47  ? 149  ASN C OD1   1 
ATOM   7752  N  ND2   . ASN C  3  149 ? 3.001   140.425 91.033  1.00 75.09  ? 149  ASN C ND2   1 
ATOM   7753  N  N     . LEU C  3  150 ? 3.742   134.742 90.999  1.00 70.12  ? 150  LEU C N     1 
ATOM   7754  C  CA    . LEU C  3  150 ? 3.034   133.505 91.246  1.00 72.08  ? 150  LEU C CA    1 
ATOM   7755  C  C     . LEU C  3  150 ? 3.352   132.908 92.598  1.00 74.37  ? 150  LEU C C     1 
ATOM   7756  O  O     . LEU C  3  150 ? 2.473   132.381 93.261  1.00 75.47  ? 150  LEU C O     1 
ATOM   7757  C  CB    . LEU C  3  150 ? 3.338   132.491 90.146  1.00 70.86  ? 150  LEU C CB    1 
ATOM   7758  C  CG    . LEU C  3  150 ? 2.872   132.925 88.757  1.00 70.20  ? 150  LEU C CG    1 
ATOM   7759  C  CD1   . LEU C  3  150 ? 3.035   131.778 87.770  1.00 70.58  ? 150  LEU C CD1   1 
ATOM   7760  C  CD2   . LEU C  3  150 ? 1.412   133.357 88.831  1.00 70.64  ? 150  LEU C CD2   1 
ATOM   7761  N  N     . PHE C  3  151 ? 4.604   133.006 93.020  1.00 76.86  ? 151  PHE C N     1 
ATOM   7762  C  CA    . PHE C  3  151 ? 5.009   132.423 94.290  1.00 79.85  ? 151  PHE C CA    1 
ATOM   7763  C  C     . PHE C  3  151 ? 4.240   132.970 95.472  1.00 80.15  ? 151  PHE C C     1 
ATOM   7764  O  O     . PHE C  3  151 ? 4.190   132.340 96.518  1.00 80.55  ? 151  PHE C O     1 
ATOM   7765  C  CB    . PHE C  3  151 ? 6.522   132.602 94.485  1.00 83.46  ? 151  PHE C CB    1 
ATOM   7766  C  CG    . PHE C  3  151 ? 7.340   132.016 93.362  1.00 89.55  ? 151  PHE C CG    1 
ATOM   7767  C  CD1   . PHE C  3  151 ? 8.595   132.549 93.028  1.00 89.95  ? 151  PHE C CD1   1 
ATOM   7768  C  CD2   . PHE C  3  151 ? 6.816   130.957 92.586  1.00 91.96  ? 151  PHE C CD2   1 
ATOM   7769  C  CE1   . PHE C  3  151 ? 9.320   132.041 91.928  1.00 92.09  ? 151  PHE C CE1   1 
ATOM   7770  C  CE2   . PHE C  3  151 ? 7.524   130.435 91.484  1.00 93.28  ? 151  PHE C CE2   1 
ATOM   7771  C  CZ    . PHE C  3  151 ? 8.781   130.980 91.149  1.00 93.35  ? 151  PHE C CZ    1 
ATOM   7772  N  N     . SER C  3  152 ? 3.620   134.130 95.312  1.00 81.31  ? 152  SER C N     1 
ATOM   7773  C  CA    . SER C  3  152 ? 2.855   134.712 96.409  1.00 83.19  ? 152  SER C CA    1 
ATOM   7774  C  C     . SER C  3  152 ? 1.598   133.884 96.638  1.00 85.13  ? 152  SER C C     1 
ATOM   7775  O  O     . SER C  3  152 ? 0.852   134.117 97.590  1.00 84.66  ? 152  SER C O     1 
ATOM   7776  C  CB    . SER C  3  152 ? 2.467   136.151 96.082  1.00 83.12  ? 152  SER C CB    1 
ATOM   7777  O  OG    . SER C  3  152 ? 1.584   136.184 94.980  1.00 83.34  ? 152  SER C OG    1 
ATOM   7778  N  N     . ALA C  3  153 ? 1.378   132.915 95.751  1.00 88.34  ? 153  ALA C N     1 
ATOM   7779  C  CA    . ALA C  3  153 ? 0.225   132.006 95.806  1.00 90.78  ? 153  ALA C CA    1 
ATOM   7780  C  C     . ALA C  3  153 ? 0.477   130.779 96.688  1.00 92.54  ? 153  ALA C C     1 
ATOM   7781  O  O     . ALA C  3  153 ? -0.431  129.989 96.941  1.00 92.13  ? 153  ALA C O     1 
ATOM   7782  C  CB    . ALA C  3  153 ? -0.146  131.552 94.401  1.00 90.38  ? 153  ALA C CB    1 
ATOM   7783  N  N     . ILE C  3  154 ? 1.718   130.606 97.126  1.00 95.22  ? 154  ILE C N     1 
ATOM   7784  C  CA    . ILE C  3  154 ? 2.055   129.499 98.000  1.00 97.91  ? 154  ILE C CA    1 
ATOM   7785  C  C     . ILE C  3  154 ? 1.528   129.937 99.357  1.00 101.72 ? 154  ILE C C     1 
ATOM   7786  O  O     . ILE C  3  154 ? 1.619   131.109 99.715  1.00 102.06 ? 154  ILE C O     1 
ATOM   7787  C  CB    . ILE C  3  154 ? 3.573   129.283 98.051  1.00 96.60  ? 154  ILE C CB    1 
ATOM   7788  C  CG1   . ILE C  3  154 ? 4.060   128.780 96.692  1.00 95.73  ? 154  ILE C CG1   1 
ATOM   7789  C  CG2   . ILE C  3  154 ? 3.924   128.285 99.136  1.00 96.49  ? 154  ILE C CG2   1 
ATOM   7790  C  CD1   . ILE C  3  154 ? 5.522   129.051 96.433  1.00 96.42  ? 154  ILE C CD1   1 
ATOM   7791  N  N     . PRO C  3  155 ? 0.949   129.005 100.126 1.00 105.96 ? 155  PRO C N     1 
ATOM   7792  C  CA    . PRO C  3  155 ? 0.382   129.279 101.460 1.00 108.93 ? 155  PRO C CA    1 
ATOM   7793  C  C     . PRO C  3  155 ? 1.335   129.728 102.587 1.00 111.05 ? 155  PRO C C     1 
ATOM   7794  O  O     . PRO C  3  155 ? 2.390   129.114 102.814 1.00 111.17 ? 155  PRO C O     1 
ATOM   7795  C  CB    . PRO C  3  155 ? -0.318  127.960 101.818 1.00 109.02 ? 155  PRO C CB    1 
ATOM   7796  C  CG    . PRO C  3  155 ? -0.585  127.310 100.472 1.00 108.69 ? 155  PRO C CG    1 
ATOM   7797  C  CD    . PRO C  3  155 ? 0.672   127.618 99.710  1.00 106.94 ? 155  PRO C CD    1 
ATOM   7798  N  N     . TYR C  3  156 ? 0.941   130.797 103.288 1.00 112.82 ? 156  TYR C N     1 
ATOM   7799  C  CA    . TYR C  3  156 ? 1.697   131.332 104.433 1.00 114.64 ? 156  TYR C CA    1 
ATOM   7800  C  C     . TYR C  3  156 ? 3.095   131.905 104.112 1.00 114.07 ? 156  TYR C C     1 
ATOM   7801  O  O     . TYR C  3  156 ? 3.385   133.068 104.398 1.00 113.84 ? 156  TYR C O     1 
ATOM   7802  C  CB    . TYR C  3  156 ? 1.849   130.234 105.505 1.00 117.81 ? 156  TYR C CB    1 
ATOM   7803  C  CG    . TYR C  3  156 ? 0.610   129.377 105.769 1.00 120.47 ? 156  TYR C CG    1 
ATOM   7804  C  CD1   . TYR C  3  156 ? 0.744   128.049 106.204 1.00 121.67 ? 156  TYR C CD1   1 
ATOM   7805  C  CD2   . TYR C  3  156 ? -0.686  129.877 105.571 1.00 121.12 ? 156  TYR C CD2   1 
ATOM   7806  C  CE1   . TYR C  3  156 ? -0.376  127.237 106.428 1.00 122.21 ? 156  TYR C CE1   1 
ATOM   7807  C  CE2   . TYR C  3  156 ? -1.815  129.070 105.794 1.00 121.38 ? 156  TYR C CE2   1 
ATOM   7808  C  CZ    . TYR C  3  156 ? -1.648  127.753 106.219 1.00 121.95 ? 156  TYR C CZ    1 
ATOM   7809  O  OH    . TYR C  3  156 ? -2.742  126.940 106.413 1.00 121.33 ? 156  TYR C OH    1 
ATOM   7810  N  N     . ILE C  3  157 ? 3.952   131.065 103.539 1.00 113.09 ? 157  ILE C N     1 
ATOM   7811  C  CA    . ILE C  3  157 ? 5.318   131.427 103.169 1.00 112.18 ? 157  ILE C CA    1 
ATOM   7812  C  C     . ILE C  3  157 ? 5.388   132.102 101.797 1.00 112.34 ? 157  ILE C C     1 
ATOM   7813  O  O     . ILE C  3  157 ? 6.475   132.328 101.248 1.00 112.71 ? 157  ILE C O     1 
ATOM   7814  C  CB    . ILE C  3  157 ? 6.184   130.168 103.119 1.00 111.64 ? 157  ILE C CB    1 
ATOM   7815  C  CG1   . ILE C  3  157 ? 5.483   129.099 102.265 1.00 111.49 ? 157  ILE C CG1   1 
ATOM   7816  C  CG2   . ILE C  3  157 ? 6.426   129.664 104.522 1.00 111.55 ? 157  ILE C CG2   1 
ATOM   7817  C  CD1   . ILE C  3  157 ? 6.252   127.792 102.106 1.00 111.37 ? 157  ILE C CD1   1 
ATOM   7818  N  N     . GLY C  3  158 ? 4.220   132.431 101.256 1.00 112.09 ? 158  GLY C N     1 
ATOM   7819  C  CA    . GLY C  3  158 ? 4.144   133.034 99.939  1.00 111.00 ? 158  GLY C CA    1 
ATOM   7820  C  C     . GLY C  3  158 ? 4.671   134.439 99.781  1.00 109.99 ? 158  GLY C C     1 
ATOM   7821  O  O     . GLY C  3  158 ? 5.769   134.646 99.267  1.00 109.19 ? 158  GLY C O     1 
ATOM   7822  N  N     . HIS C  3  159 ? 3.879   135.407 100.219 1.00 109.61 ? 159  HIS C N     1 
ATOM   7823  C  CA    . HIS C  3  159 ? 4.259   136.803 100.099 1.00 109.62 ? 159  HIS C CA    1 
ATOM   7824  C  C     . HIS C  3  159 ? 5.674   137.111 100.549 1.00 108.04 ? 159  HIS C C     1 
ATOM   7825  O  O     . HIS C  3  159 ? 6.220   138.163 100.217 1.00 107.74 ? 159  HIS C O     1 
ATOM   7826  C  CB    . HIS C  3  159 ? 3.250   137.673 100.844 1.00 112.33 ? 159  HIS C CB    1 
ATOM   7827  C  CG    . HIS C  3  159 ? 1.987   137.902 100.072 1.00 115.15 ? 159  HIS C CG    1 
ATOM   7828  N  ND1   . HIS C  3  159 ? 1.803   138.997 99.251  1.00 115.68 ? 159  HIS C ND1   1 
ATOM   7829  C  CD2   . HIS C  3  159 ? 0.879   137.133 99.929  1.00 115.85 ? 159  HIS C CD2   1 
ATOM   7830  C  CE1   . HIS C  3  159 ? 0.638   138.893 98.636  1.00 116.11 ? 159  HIS C CE1   1 
ATOM   7831  N  NE2   . HIS C  3  159 ? 0.058   137.771 99.029  1.00 116.76 ? 159  HIS C NE2   1 
ATOM   7832  N  N     . THR C  3  160 ? 6.277   136.190 101.289 1.00 106.51 ? 160  THR C N     1 
ATOM   7833  C  CA    . THR C  3  160 ? 7.643   136.389 101.748 1.00 104.64 ? 160  THR C CA    1 
ATOM   7834  C  C     . THR C  3  160 ? 8.640   135.889 100.712 1.00 101.97 ? 160  THR C C     1 
ATOM   7835  O  O     . THR C  3  160 ? 9.430   136.677 100.196 1.00 101.04 ? 160  THR C O     1 
ATOM   7836  C  CB    . THR C  3  160 ? 7.893   135.694 103.118 1.00 106.26 ? 160  THR C CB    1 
ATOM   7837  O  OG1   . THR C  3  160 ? 7.321   136.492 104.169 1.00 105.98 ? 160  THR C OG1   1 
ATOM   7838  C  CG2   . THR C  3  160 ? 9.397   135.516 103.380 1.00 107.16 ? 160  THR C CG2   1 
ATOM   7839  N  N     . LEU C  3  161 ? 8.605   134.595 100.396 1.00 99.58  ? 161  LEU C N     1 
ATOM   7840  C  CA    . LEU C  3  161 ? 9.535   134.060 99.409  1.00 98.12  ? 161  LEU C CA    1 
ATOM   7841  C  C     . LEU C  3  161 ? 9.624   135.005 98.206  1.00 95.54  ? 161  LEU C C     1 
ATOM   7842  O  O     . LEU C  3  161 ? 10.670  135.111 97.569  1.00 95.63  ? 161  LEU C O     1 
ATOM   7843  C  CB    . LEU C  3  161 ? 9.108   132.654 98.949  1.00 100.34 ? 161  LEU C CB    1 
ATOM   7844  C  CG    . LEU C  3  161 ? 9.679   132.145 97.598  1.00 102.86 ? 161  LEU C CG    1 
ATOM   7845  C  CD1   . LEU C  3  161 ? 11.202  131.967 97.653  1.00 101.07 ? 161  LEU C CD1   1 
ATOM   7846  C  CD2   . LEU C  3  161 ? 8.997   130.827 97.230  1.00 103.17 ? 161  LEU C CD2   1 
ATOM   7847  N  N     . VAL C  3  162 ? 8.530   135.704 97.918  1.00 92.22  ? 162  VAL C N     1 
ATOM   7848  C  CA    . VAL C  3  162 ? 8.479   136.631 96.794  1.00 88.82  ? 162  VAL C CA    1 
ATOM   7849  C  C     . VAL C  3  162 ? 9.263   137.903 97.044  1.00 87.94  ? 162  VAL C C     1 
ATOM   7850  O  O     . VAL C  3  162 ? 10.120  138.272 96.241  1.00 87.69  ? 162  VAL C O     1 
ATOM   7851  C  CB    . VAL C  3  162 ? 7.025   137.009 96.453  1.00 87.91  ? 162  VAL C CB    1 
ATOM   7852  C  CG1   . VAL C  3  162 ? 6.994   138.157 95.485  1.00 86.97  ? 162  VAL C CG1   1 
ATOM   7853  C  CG2   . VAL C  3  162 ? 6.324   135.825 95.837  1.00 88.77  ? 162  VAL C CG2   1 
ATOM   7854  N  N     . GLU C  3  163 ? 8.965   138.576 98.155  1.00 87.50  ? 163  GLU C N     1 
ATOM   7855  C  CA    . GLU C  3  163 ? 9.646   139.828 98.506  1.00 87.03  ? 163  GLU C CA    1 
ATOM   7856  C  C     . GLU C  3  163 ? 11.107  139.607 98.832  1.00 84.43  ? 163  GLU C C     1 
ATOM   7857  O  O     . GLU C  3  163 ? 11.869  140.553 98.999  1.00 83.76  ? 163  GLU C O     1 
ATOM   7858  C  CB    . GLU C  3  163 ? 8.974   140.508 99.696  1.00 90.21  ? 163  GLU C CB    1 
ATOM   7859  C  CG    . GLU C  3  163 ? 7.575   141.032 99.402  1.00 95.64  ? 163  GLU C CG    1 
ATOM   7860  C  CD    . GLU C  3  163 ? 7.079   142.037 100.444 1.00 98.70  ? 163  GLU C CD    1 
ATOM   7861  O  OE1   . GLU C  3  163 ? 5.912   142.478 100.320 1.00 99.74  ? 163  GLU C OE1   1 
ATOM   7862  O  OE2   . GLU C  3  163 ? 7.850   142.389 101.374 1.00 99.26  ? 163  GLU C OE2   1 
ATOM   7863  N  N     . TRP C  3  164 ? 11.481  138.345 98.937  1.00 81.89  ? 164  TRP C N     1 
ATOM   7864  C  CA    . TRP C  3  164 ? 12.846  137.994 99.223  1.00 79.25  ? 164  TRP C CA    1 
ATOM   7865  C  C     . TRP C  3  164 ? 13.551  137.917 97.876  1.00 77.19  ? 164  TRP C C     1 
ATOM   7866  O  O     . TRP C  3  164 ? 14.647  138.440 97.707  1.00 77.92  ? 164  TRP C O     1 
ATOM   7867  C  CB    . TRP C  3  164 ? 12.893  136.650 99.949  1.00 80.55  ? 164  TRP C CB    1 
ATOM   7868  C  CG    . TRP C  3  164 ? 14.253  136.271 100.373 1.00 81.21  ? 164  TRP C CG    1 
ATOM   7869  C  CD1   . TRP C  3  164 ? 15.036  136.908 101.292 1.00 81.61  ? 164  TRP C CD1   1 
ATOM   7870  C  CD2   . TRP C  3  164 ? 15.047  135.230 99.819  1.00 81.67  ? 164  TRP C CD2   1 
ATOM   7871  N  NE1   . TRP C  3  164 ? 16.278  136.332 101.334 1.00 82.56  ? 164  TRP C NE1   1 
ATOM   7872  C  CE2   . TRP C  3  164 ? 16.312  135.297 100.436 1.00 82.52  ? 164  TRP C CE2   1 
ATOM   7873  C  CE3   . TRP C  3  164 ? 14.814  134.247 98.855  1.00 82.37  ? 164  TRP C CE3   1 
ATOM   7874  C  CZ2   . TRP C  3  164 ? 17.345  134.418 100.119 1.00 82.90  ? 164  TRP C CZ2   1 
ATOM   7875  C  CZ3   . TRP C  3  164 ? 15.840  133.372 98.538  1.00 83.42  ? 164  TRP C CZ3   1 
ATOM   7876  C  CH2   . TRP C  3  164 ? 17.090  133.463 99.168  1.00 83.93  ? 164  TRP C CH2   1 
ATOM   7877  N  N     . ALA C  3  165 ? 12.895  137.291 96.910  1.00 74.41  ? 165  ALA C N     1 
ATOM   7878  C  CA    . ALA C  3  165 ? 13.445  137.139 95.570  1.00 72.05  ? 165  ALA C CA    1 
ATOM   7879  C  C     . ALA C  3  165 ? 13.630  138.466 94.848  1.00 70.92  ? 165  ALA C C     1 
ATOM   7880  O  O     . ALA C  3  165 ? 14.614  138.661 94.139  1.00 69.74  ? 165  ALA C O     1 
ATOM   7881  C  CB    . ALA C  3  165 ? 12.543  136.254 94.753  1.00 73.86  ? 165  ALA C CB    1 
ATOM   7882  N  N     . TRP C  3  166 ? 12.666  139.368 95.008  1.00 69.64  ? 166  TRP C N     1 
ATOM   7883  C  CA    . TRP C  3  166 ? 12.734  140.682 94.369  1.00 67.61  ? 166  TRP C CA    1 
ATOM   7884  C  C     . TRP C  3  166 ? 13.739  141.611 95.044  1.00 66.38  ? 166  TRP C C     1 
ATOM   7885  O  O     . TRP C  3  166 ? 14.305  142.503 94.404  1.00 65.27  ? 166  TRP C O     1 
ATOM   7886  C  CB    . TRP C  3  166 ? 11.384  141.382 94.432  1.00 66.30  ? 166  TRP C CB    1 
ATOM   7887  C  CG    . TRP C  3  166 ? 10.350  140.834 93.570  1.00 64.85  ? 166  TRP C CG    1 
ATOM   7888  C  CD1   . TRP C  3  166 ? 10.527  140.171 92.400  1.00 65.58  ? 166  TRP C CD1   1 
ATOM   7889  C  CD2   . TRP C  3  166 ? 8.941   140.986 93.743  1.00 65.40  ? 166  TRP C CD2   1 
ATOM   7890  N  NE1   . TRP C  3  166 ? 9.311   139.897 91.824  1.00 66.77  ? 166  TRP C NE1   1 
ATOM   7891  C  CE2   . TRP C  3  166 ? 8.317   140.388 92.632  1.00 66.49  ? 166  TRP C CE2   1 
ATOM   7892  C  CE3   . TRP C  3  166 ? 8.142   141.573 94.733  1.00 64.73  ? 166  TRP C CE3   1 
ATOM   7893  C  CZ2   . TRP C  3  166 ? 6.922   140.359 92.479  1.00 65.74  ? 166  TRP C CZ2   1 
ATOM   7894  C  CZ3   . TRP C  3  166 ? 6.761   141.544 94.583  1.00 63.76  ? 166  TRP C CZ3   1 
ATOM   7895  C  CH2   . TRP C  3  166 ? 6.166   140.940 93.463  1.00 64.11  ? 166  TRP C CH2   1 
ATOM   7896  N  N     . GLY C  3  167 ? 13.919  141.407 96.349  1.00 64.62  ? 167  GLY C N     1 
ATOM   7897  C  CA    . GLY C  3  167 ? 14.806  142.249 97.126  1.00 62.37  ? 167  GLY C CA    1 
ATOM   7898  C  C     . GLY C  3  167 ? 14.071  143.537 97.484  1.00 60.53  ? 167  GLY C C     1 
ATOM   7899  O  O     . GLY C  3  167 ? 14.675  144.590 97.693  1.00 60.56  ? 167  GLY C O     1 
ATOM   7900  N  N     . GLY C  3  168 ? 12.753  143.450 97.561  1.00 58.99  ? 168  GLY C N     1 
ATOM   7901  C  CA    . GLY C  3  168 ? 11.957  144.618 97.862  1.00 57.15  ? 168  GLY C CA    1 
ATOM   7902  C  C     . GLY C  3  168 ? 10.494  144.338 97.619  1.00 57.22  ? 168  GLY C C     1 
ATOM   7903  O  O     . GLY C  3  168 ? 10.021  143.237 97.868  1.00 57.20  ? 168  GLY C O     1 
ATOM   7904  N  N     . PHE C  3  169 ? 9.772   145.313 97.094  1.00 58.47  ? 169  PHE C N     1 
ATOM   7905  C  CA    . PHE C  3  169 ? 8.345   145.123 96.893  1.00 62.27  ? 169  PHE C CA    1 
ATOM   7906  C  C     . PHE C  3  169 ? 7.846   144.933 95.467  1.00 62.56  ? 169  PHE C C     1 
ATOM   7907  O  O     . PHE C  3  169 ? 6.671   144.644 95.239  1.00 62.47  ? 169  PHE C O     1 
ATOM   7908  C  CB    . PHE C  3  169 ? 7.616   146.286 97.541  1.00 66.08  ? 169  PHE C CB    1 
ATOM   7909  C  CG    . PHE C  3  169 ? 7.997   146.492 98.972  1.00 70.51  ? 169  PHE C CG    1 
ATOM   7910  C  CD1   . PHE C  3  169 ? 8.703   147.629 99.361  1.00 71.14  ? 169  PHE C CD1   1 
ATOM   7911  C  CD2   . PHE C  3  169 ? 7.685   145.518 99.931  1.00 72.79  ? 169  PHE C CD2   1 
ATOM   7912  C  CE1   . PHE C  3  169 ? 9.101   147.799 100.684 1.00 72.76  ? 169  PHE C CE1   1 
ATOM   7913  C  CE2   . PHE C  3  169 ? 8.076   145.672 101.260 1.00 74.58  ? 169  PHE C CE2   1 
ATOM   7914  C  CZ    . PHE C  3  169 ? 8.788   146.818 101.637 1.00 75.45  ? 169  PHE C CZ    1 
ATOM   7915  N  N     . SER C  3  170 ? 8.739   145.094 94.506  1.00 62.41  ? 170  SER C N     1 
ATOM   7916  C  CA    . SER C  3  170 ? 8.386   144.940 93.106  1.00 61.70  ? 170  SER C CA    1 
ATOM   7917  C  C     . SER C  3  170 ? 9.669   144.671 92.344  1.00 61.00  ? 170  SER C C     1 
ATOM   7918  O  O     . SER C  3  170 ? 10.774  144.876 92.863  1.00 61.39  ? 170  SER C O     1 
ATOM   7919  C  CB    . SER C  3  170 ? 7.746   146.218 92.573  1.00 61.59  ? 170  SER C CB    1 
ATOM   7920  O  OG    . SER C  3  170 ? 8.634   147.312 92.729  1.00 62.22  ? 170  SER C OG    1 
ATOM   7921  N  N     . VAL C  3  171 ? 9.532   144.200 91.114  1.00 58.62  ? 171  VAL C N     1 
ATOM   7922  C  CA    . VAL C  3  171 ? 10.708  143.939 90.331  1.00 55.83  ? 171  VAL C CA    1 
ATOM   7923  C  C     . VAL C  3  171 ? 11.363  145.284 90.146  1.00 54.92  ? 171  VAL C C     1 
ATOM   7924  O  O     . VAL C  3  171 ? 10.840  146.139 89.446  1.00 56.09  ? 171  VAL C O     1 
ATOM   7925  C  CB    . VAL C  3  171 ? 10.328  143.378 88.991  1.00 56.78  ? 171  VAL C CB    1 
ATOM   7926  C  CG1   . VAL C  3  171 ? 11.564  143.217 88.125  1.00 54.29  ? 171  VAL C CG1   1 
ATOM   7927  C  CG2   . VAL C  3  171 ? 9.609   142.050 89.196  1.00 58.40  ? 171  VAL C CG2   1 
ATOM   7928  N  N     . ASP C  3  172 ? 12.494  145.498 90.794  1.00 53.23  ? 172  ASP C N     1 
ATOM   7929  C  CA    . ASP C  3  172 ? 13.163  146.775 90.644  1.00 51.26  ? 172  ASP C CA    1 
ATOM   7930  C  C     . ASP C  3  172 ? 14.652  146.537 90.559  1.00 48.81  ? 172  ASP C C     1 
ATOM   7931  O  O     . ASP C  3  172 ? 15.079  145.401 90.403  1.00 48.00  ? 172  ASP C O     1 
ATOM   7932  C  CB    . ASP C  3  172 ? 12.848  147.694 91.814  1.00 54.74  ? 172  ASP C CB    1 
ATOM   7933  C  CG    . ASP C  3  172 ? 12.975  149.171 91.455  1.00 58.62  ? 172  ASP C CG    1 
ATOM   7934  O  OD1   . ASP C  3  172 ? 13.746  149.534 90.531  1.00 61.27  ? 172  ASP C OD1   1 
ATOM   7935  O  OD2   . ASP C  3  172 ? 12.295  149.983 92.116  1.00 62.34  ? 172  ASP C OD2   1 
ATOM   7936  N  N     . ASN C  3  173 ? 15.438  147.599 90.691  1.00 47.07  ? 173  ASN C N     1 
ATOM   7937  C  CA    . ASN C  3  173 ? 16.871  147.481 90.569  1.00 48.35  ? 173  ASN C CA    1 
ATOM   7938  C  C     . ASN C  3  173 ? 17.494  146.344 91.356  1.00 49.57  ? 173  ASN C C     1 
ATOM   7939  O  O     . ASN C  3  173 ? 18.369  145.633 90.845  1.00 50.49  ? 173  ASN C O     1 
ATOM   7940  C  CB    . ASN C  3  173 ? 17.565  148.779 90.933  1.00 50.34  ? 173  ASN C CB    1 
ATOM   7941  C  CG    . ASN C  3  173 ? 18.956  148.864 90.323  1.00 53.72  ? 173  ASN C CG    1 
ATOM   7942  O  OD1   . ASN C  3  173 ? 19.109  149.214 89.152  1.00 56.08  ? 173  ASN C OD1   1 
ATOM   7943  N  ND2   . ASN C  3  173 ? 19.973  148.510 91.100  1.00 55.48  ? 173  ASN C ND2   1 
ATOM   7944  N  N     . PRO C  3  174 ? 17.069  146.149 92.610  1.00 48.74  ? 174  PRO C N     1 
ATOM   7945  C  CA    . PRO C  3  174 ? 17.646  145.062 93.393  1.00 48.71  ? 174  PRO C CA    1 
ATOM   7946  C  C     . PRO C  3  174 ? 17.418  143.675 92.795  1.00 48.70  ? 174  PRO C C     1 
ATOM   7947  O  O     . PRO C  3  174 ? 18.132  142.720 93.120  1.00 49.48  ? 174  PRO C O     1 
ATOM   7948  C  CB    . PRO C  3  174 ? 16.981  145.242 94.758  1.00 49.57  ? 174  PRO C CB    1 
ATOM   7949  C  CG    . PRO C  3  174 ? 15.701  145.923 94.439  1.00 49.61  ? 174  PRO C CG    1 
ATOM   7950  C  CD    . PRO C  3  174 ? 16.158  146.942 93.445  1.00 49.27  ? 174  PRO C CD    1 
ATOM   7951  N  N     . THR C  3  175 ? 16.422  143.574 91.925  1.00 48.24  ? 175  THR C N     1 
ATOM   7952  C  CA    . THR C  3  175 ? 16.077  142.316 91.281  1.00 48.50  ? 175  THR C CA    1 
ATOM   7953  C  C     . THR C  3  175 ? 16.955  142.160 90.047  1.00 48.84  ? 175  THR C C     1 
ATOM   7954  O  O     . THR C  3  175 ? 17.493  141.080 89.753  1.00 49.81  ? 175  THR C O     1 
ATOM   7955  C  CB    . THR C  3  175 ? 14.592  142.327 90.846  1.00 48.30  ? 175  THR C CB    1 
ATOM   7956  O  OG1   . THR C  3  175 ? 13.806  142.923 91.879  1.00 49.86  ? 175  THR C OG1   1 
ATOM   7957  C  CG2   . THR C  3  175 ? 14.083  140.922 90.603  1.00 46.84  ? 175  THR C CG2   1 
ATOM   7958  N  N     . LEU C  3  176 ? 17.100  143.255 89.321  1.00 47.98  ? 176  LEU C N     1 
ATOM   7959  C  CA    . LEU C  3  176 ? 17.894  143.242 88.116  1.00 47.76  ? 176  LEU C CA    1 
ATOM   7960  C  C     . LEU C  3  176 ? 19.300  142.822 88.459  1.00 48.46  ? 176  LEU C C     1 
ATOM   7961  O  O     . LEU C  3  176 ? 19.838  141.918 87.839  1.00 50.52  ? 176  LEU C O     1 
ATOM   7962  C  CB    . LEU C  3  176 ? 17.914  144.626 87.475  1.00 46.89  ? 176  LEU C CB    1 
ATOM   7963  C  CG    . LEU C  3  176 ? 18.641  144.802 86.151  1.00 45.32  ? 176  LEU C CG    1 
ATOM   7964  C  CD1   . LEU C  3  176 ? 17.959  143.968 85.094  1.00 46.45  ? 176  LEU C CD1   1 
ATOM   7965  C  CD2   . LEU C  3  176 ? 18.618  146.264 85.753  1.00 44.73  ? 176  LEU C CD2   1 
ATOM   7966  N  N     . THR C  3  177 ? 19.892  143.449 89.463  1.00 47.76  ? 177  THR C N     1 
ATOM   7967  C  CA    . THR C  3  177 ? 21.257  143.111 89.800  1.00 49.46  ? 177  THR C CA    1 
ATOM   7968  C  C     . THR C  3  177 ? 21.481  141.669 90.197  1.00 50.08  ? 177  THR C C     1 
ATOM   7969  O  O     . THR C  3  177 ? 22.511  141.078 89.842  1.00 51.28  ? 177  THR C O     1 
ATOM   7970  C  CB    . THR C  3  177 ? 21.819  144.018 90.901  1.00 50.80  ? 177  THR C CB    1 
ATOM   7971  O  OG1   . THR C  3  177 ? 20.867  144.145 91.959  1.00 53.36  ? 177  THR C OG1   1 
ATOM   7972  C  CG2   . THR C  3  177 ? 22.141  145.388 90.335  1.00 52.05  ? 177  THR C CG2   1 
ATOM   7973  N  N     . ARG C  3  178 ? 20.539  141.084 90.923  1.00 49.93  ? 178  ARG C N     1 
ATOM   7974  C  CA    . ARG C  3  178 ? 20.727  139.699 91.321  1.00 50.30  ? 178  ARG C CA    1 
ATOM   7975  C  C     . ARG C  3  178 ? 20.441  138.774 90.152  1.00 49.90  ? 178  ARG C C     1 
ATOM   7976  O  O     . ARG C  3  178 ? 20.977  137.666 90.093  1.00 51.42  ? 178  ARG C O     1 
ATOM   7977  C  CB    . ARG C  3  178 ? 19.858  139.338 92.530  1.00 50.63  ? 178  ARG C CB    1 
ATOM   7978  C  CG    . ARG C  3  178 ? 18.366  139.460 92.310  1.00 53.10  ? 178  ARG C CG    1 
ATOM   7979  C  CD    . ARG C  3  178 ? 17.631  139.270 93.627  1.00 56.08  ? 178  ARG C CD    1 
ATOM   7980  N  NE    . ARG C  3  178 ? 18.056  140.244 94.633  1.00 56.80  ? 178  ARG C NE    1 
ATOM   7981  C  CZ    . ARG C  3  178 ? 17.556  140.318 95.864  1.00 56.79  ? 178  ARG C CZ    1 
ATOM   7982  N  NH1   . ARG C  3  178 ? 16.603  139.472 96.251  1.00 52.44  ? 178  ARG C NH1   1 
ATOM   7983  N  NH2   . ARG C  3  178 ? 18.014  141.245 96.702  1.00 57.91  ? 178  ARG C NH2   1 
ATOM   7984  N  N     . PHE C  3  179 ? 19.608  139.212 89.209  1.00 48.64  ? 179  PHE C N     1 
ATOM   7985  C  CA    . PHE C  3  179 ? 19.332  138.366 88.054  1.00 47.65  ? 179  PHE C CA    1 
ATOM   7986  C  C     . PHE C  3  179 ? 20.564  138.269 87.154  1.00 47.13  ? 179  PHE C C     1 
ATOM   7987  O  O     . PHE C  3  179 ? 20.884  137.194 86.638  1.00 46.41  ? 179  PHE C O     1 
ATOM   7988  C  CB    . PHE C  3  179 ? 18.129  138.889 87.290  1.00 46.67  ? 179  PHE C CB    1 
ATOM   7989  C  CG    . PHE C  3  179 ? 16.816  138.352 87.796  1.00 47.77  ? 179  PHE C CG    1 
ATOM   7990  C  CD1   . PHE C  3  179 ? 16.710  137.813 89.076  1.00 48.65  ? 179  PHE C CD1   1 
ATOM   7991  C  CD2   . PHE C  3  179 ? 15.676  138.394 87.001  1.00 47.14  ? 179  PHE C CD2   1 
ATOM   7992  C  CE1   . PHE C  3  179 ? 15.484  137.318 89.552  1.00 48.19  ? 179  PHE C CE1   1 
ATOM   7993  C  CE2   . PHE C  3  179 ? 14.462  137.909 87.469  1.00 46.51  ? 179  PHE C CE2   1 
ATOM   7994  C  CZ    . PHE C  3  179 ? 14.367  137.369 88.746  1.00 46.12  ? 179  PHE C CZ    1 
ATOM   7995  N  N     . PHE C  3  180 ? 21.265  139.388 86.977  1.00 46.79  ? 180  PHE C N     1 
ATOM   7996  C  CA    . PHE C  3  180 ? 22.483  139.393 86.176  1.00 46.15  ? 180  PHE C CA    1 
ATOM   7997  C  C     . PHE C  3  180 ? 23.457  138.380 86.794  1.00 45.61  ? 180  PHE C C     1 
ATOM   7998  O  O     . PHE C  3  180 ? 24.007  137.538 86.094  1.00 45.07  ? 180  PHE C O     1 
ATOM   7999  C  CB    . PHE C  3  180 ? 23.116  140.789 86.173  1.00 47.18  ? 180  PHE C CB    1 
ATOM   8000  C  CG    . PHE C  3  180 ? 24.390  140.891 85.351  1.00 49.62  ? 180  PHE C CG    1 
ATOM   8001  C  CD1   . PHE C  3  180 ? 25.513  141.530 85.858  1.00 50.32  ? 180  PHE C CD1   1 
ATOM   8002  C  CD2   . PHE C  3  180 ? 24.467  140.354 84.082  1.00 49.62  ? 180  PHE C CD2   1 
ATOM   8003  C  CE1   . PHE C  3  180 ? 26.677  141.623 85.116  1.00 48.09  ? 180  PHE C CE1   1 
ATOM   8004  C  CE2   . PHE C  3  180 ? 25.642  140.449 83.337  1.00 48.70  ? 180  PHE C CE2   1 
ATOM   8005  C  CZ    . PHE C  3  180 ? 26.735  141.080 83.856  1.00 48.04  ? 180  PHE C CZ    1 
ATOM   8006  N  N     . ALA C  3  181 ? 23.662  138.453 88.108  1.00 44.76  ? 181  ALA C N     1 
ATOM   8007  C  CA    . ALA C  3  181 ? 24.570  137.525 88.785  1.00 44.69  ? 181  ALA C CA    1 
ATOM   8008  C  C     . ALA C  3  181 ? 24.156  136.087 88.493  1.00 45.73  ? 181  ALA C C     1 
ATOM   8009  O  O     . ALA C  3  181 ? 24.970  135.241 88.107  1.00 47.81  ? 181  ALA C O     1 
ATOM   8010  C  CB    . ALA C  3  181 ? 24.550  137.761 90.276  1.00 41.80  ? 181  ALA C CB    1 
ATOM   8011  N  N     . LEU C  3  182 ? 22.882  135.804 88.701  1.00 44.24  ? 182  LEU C N     1 
ATOM   8012  C  CA    . LEU C  3  182 ? 22.373  134.479 88.455  1.00 41.91  ? 182  LEU C CA    1 
ATOM   8013  C  C     . LEU C  3  182 ? 22.562  134.045 87.011  1.00 40.63  ? 182  LEU C C     1 
ATOM   8014  O  O     . LEU C  3  182 ? 22.926  132.898 86.744  1.00 37.79  ? 182  LEU C O     1 
ATOM   8015  C  CB    . LEU C  3  182 ? 20.901  134.452 88.789  1.00 44.17  ? 182  LEU C CB    1 
ATOM   8016  C  CG    . LEU C  3  182 ? 20.606  134.000 90.193  1.00 44.95  ? 182  LEU C CG    1 
ATOM   8017  C  CD1   . LEU C  3  182 ? 19.091  133.988 90.380  1.00 44.27  ? 182  LEU C CD1   1 
ATOM   8018  C  CD2   . LEU C  3  182 ? 21.221  132.620 90.395  1.00 43.66  ? 182  LEU C CD2   1 
ATOM   8019  N  N     . HIS C  3  183 ? 22.295  134.959 86.081  1.00 39.66  ? 183  HIS C N     1 
ATOM   8020  C  CA    . HIS C  3  183 ? 22.415  134.630 84.673  1.00 39.49  ? 183  HIS C CA    1 
ATOM   8021  C  C     . HIS C  3  183 ? 23.870  134.319 84.330  1.00 40.60  ? 183  HIS C C     1 
ATOM   8022  O  O     . HIS C  3  183 ? 24.149  133.475 83.496  1.00 42.05  ? 183  HIS C O     1 
ATOM   8023  C  CB    . HIS C  3  183 ? 21.882  135.764 83.801  1.00 36.85  ? 183  HIS C CB    1 
ATOM   8024  C  CG    . HIS C  3  183 ? 21.841  135.423 82.349  1.00 37.71  ? 183  HIS C CG    1 
ATOM   8025  N  ND1   . HIS C  3  183 ? 21.082  134.382 81.864  1.00 38.51  ? 183  HIS C ND1   1 
ATOM   8026  C  CD2   . HIS C  3  183 ? 22.492  135.945 81.276  1.00 38.48  ? 183  HIS C CD2   1 
ATOM   8027  C  CE1   . HIS C  3  183 ? 21.271  134.277 80.557  1.00 40.13  ? 183  HIS C CE1   1 
ATOM   8028  N  NE2   . HIS C  3  183 ? 22.123  135.213 80.172  1.00 38.74  ? 183  HIS C NE2   1 
ATOM   8029  N  N     . PHE C  3  184 ? 24.802  134.988 84.988  1.00 41.76  ? 184  PHE C N     1 
ATOM   8030  C  CA    . PHE C  3  184 ? 26.227  134.755 84.750  1.00 42.22  ? 184  PHE C CA    1 
ATOM   8031  C  C     . PHE C  3  184 ? 26.623  133.382 85.346  1.00 42.62  ? 184  PHE C C     1 
ATOM   8032  O  O     . PHE C  3  184 ? 27.399  132.633 84.762  1.00 43.43  ? 184  PHE C O     1 
ATOM   8033  C  CB    . PHE C  3  184 ? 27.019  135.877 85.433  1.00 41.91  ? 184  PHE C CB    1 
ATOM   8034  C  CG    . PHE C  3  184 ? 28.417  136.070 84.910  1.00 41.87  ? 184  PHE C CG    1 
ATOM   8035  C  CD1   . PHE C  3  184 ? 28.837  137.329 84.492  1.00 41.98  ? 184  PHE C CD1   1 
ATOM   8036  C  CD2   . PHE C  3  184 ? 29.324  135.033 84.885  1.00 40.98  ? 184  PHE C CD2   1 
ATOM   8037  C  CE1   . PHE C  3  184 ? 30.125  137.548 84.064  1.00 38.41  ? 184  PHE C CE1   1 
ATOM   8038  C  CE2   . PHE C  3  184 ? 30.619  135.250 84.456  1.00 41.20  ? 184  PHE C CE2   1 
ATOM   8039  C  CZ    . PHE C  3  184 ? 31.014  136.508 84.046  1.00 40.73  ? 184  PHE C CZ    1 
ATOM   8040  N  N     . LEU C  3  185 ? 26.060  133.053 86.501  1.00 41.91  ? 185  LEU C N     1 
ATOM   8041  C  CA    . LEU C  3  185 ? 26.381  131.816 87.199  1.00 41.15  ? 185  LEU C CA    1 
ATOM   8042  C  C     . LEU C  3  185 ? 25.805  130.497 86.666  1.00 41.74  ? 185  LEU C C     1 
ATOM   8043  O  O     . LEU C  3  185 ? 26.548  129.553 86.445  1.00 43.96  ? 185  LEU C O     1 
ATOM   8044  C  CB    . LEU C  3  185 ? 25.998  131.975 88.671  1.00 40.15  ? 185  LEU C CB    1 
ATOM   8045  C  CG    . LEU C  3  185 ? 26.110  130.749 89.572  1.00 39.51  ? 185  LEU C CG    1 
ATOM   8046  C  CD1   . LEU C  3  185 ? 27.541  130.231 89.559  1.00 39.88  ? 185  LEU C CD1   1 
ATOM   8047  C  CD2   . LEU C  3  185 ? 25.707  131.131 90.982  1.00 38.62  ? 185  LEU C CD2   1 
ATOM   8048  N  N     . LEU C  3  186 ? 24.498  130.418 86.455  1.00 39.97  ? 186  LEU C N     1 
ATOM   8049  C  CA    . LEU C  3  186 ? 23.894  129.176 86.001  1.00 39.09  ? 186  LEU C CA    1 
ATOM   8050  C  C     . LEU C  3  186 ? 24.497  128.430 84.811  1.00 39.38  ? 186  LEU C C     1 
ATOM   8051  O  O     . LEU C  3  186 ? 24.543  127.200 84.798  1.00 39.29  ? 186  LEU C O     1 
ATOM   8052  C  CB    . LEU C  3  186 ? 22.418  129.407 85.754  1.00 41.00  ? 186  LEU C CB    1 
ATOM   8053  C  CG    . LEU C  3  186 ? 21.751  129.851 87.045  1.00 42.53  ? 186  LEU C CG    1 
ATOM   8054  C  CD1   . LEU C  3  186 ? 20.255  130.075 86.817  1.00 43.49  ? 186  LEU C CD1   1 
ATOM   8055  C  CD2   . LEU C  3  186 ? 21.978  128.783 88.087  1.00 43.81  ? 186  LEU C CD2   1 
ATOM   8056  N  N     . PRO C  3  187 ? 24.932  129.149 83.777  1.00 39.44  ? 187  PRO C N     1 
ATOM   8057  C  CA    . PRO C  3  187 ? 25.509  128.408 82.651  1.00 39.34  ? 187  PRO C CA    1 
ATOM   8058  C  C     . PRO C  3  187 ? 26.671  127.517 83.100  1.00 39.66  ? 187  PRO C C     1 
ATOM   8059  O  O     . PRO C  3  187 ? 26.862  126.402 82.596  1.00 40.15  ? 187  PRO C O     1 
ATOM   8060  C  CB    . PRO C  3  187 ? 25.949  129.514 81.707  1.00 40.53  ? 187  PRO C CB    1 
ATOM   8061  C  CG    . PRO C  3  187 ? 24.876  130.544 81.919  1.00 41.24  ? 187  PRO C CG    1 
ATOM   8062  C  CD    . PRO C  3  187 ? 24.714  130.563 83.434  1.00 39.00  ? 187  PRO C CD    1 
ATOM   8063  N  N     . PHE C  3  188 ? 27.455  128.001 84.049  1.00 38.49  ? 188  PHE C N     1 
ATOM   8064  C  CA    . PHE C  3  188 ? 28.546  127.184 84.526  1.00 39.73  ? 188  PHE C CA    1 
ATOM   8065  C  C     . PHE C  3  188 ? 28.009  125.951 85.243  1.00 38.77  ? 188  PHE C C     1 
ATOM   8066  O  O     . PHE C  3  188 ? 28.501  124.842 85.041  1.00 38.52  ? 188  PHE C O     1 
ATOM   8067  C  CB    . PHE C  3  188 ? 29.447  128.021 85.396  1.00 43.41  ? 188  PHE C CB    1 
ATOM   8068  C  CG    . PHE C  3  188 ? 30.029  129.177 84.659  1.00 49.10  ? 188  PHE C CG    1 
ATOM   8069  C  CD1   . PHE C  3  188 ? 29.668  130.487 84.969  1.00 52.48  ? 188  PHE C CD1   1 
ATOM   8070  C  CD2   . PHE C  3  188 ? 30.889  128.956 83.585  1.00 50.89  ? 188  PHE C CD2   1 
ATOM   8071  C  CE1   . PHE C  3  188 ? 30.158  131.565 84.202  1.00 53.58  ? 188  PHE C CE1   1 
ATOM   8072  C  CE2   . PHE C  3  188 ? 31.386  130.027 82.810  1.00 51.97  ? 188  PHE C CE2   1 
ATOM   8073  C  CZ    . PHE C  3  188 ? 31.021  131.328 83.117  1.00 51.47  ? 188  PHE C CZ    1 
ATOM   8074  N  N     . ALA C  3  189 ? 26.974  126.124 86.052  1.00 37.43  ? 189  ALA C N     1 
ATOM   8075  C  CA    . ALA C  3  189 ? 26.374  124.971 86.723  1.00 35.97  ? 189  ALA C CA    1 
ATOM   8076  C  C     . ALA C  3  189 ? 25.935  124.013 85.633  1.00 35.81  ? 189  ALA C C     1 
ATOM   8077  O  O     . ALA C  3  189 ? 26.043  122.797 85.777  1.00 36.71  ? 189  ALA C O     1 
ATOM   8078  C  CB    . ALA C  3  189 ? 25.152  125.381 87.545  1.00 33.77  ? 189  ALA C CB    1 
ATOM   8079  N  N     . ILE C  3  190 ? 25.426  124.563 84.536  1.00 34.76  ? 190  ILE C N     1 
ATOM   8080  C  CA    . ILE C  3  190 ? 24.969  123.709 83.467  1.00 34.08  ? 190  ILE C CA    1 
ATOM   8081  C  C     . ILE C  3  190 ? 26.121  122.890 82.940  1.00 33.70  ? 190  ILE C C     1 
ATOM   8082  O  O     . ILE C  3  190 ? 26.015  121.651 82.869  1.00 33.70  ? 190  ILE C O     1 
ATOM   8083  C  CB    . ILE C  3  190 ? 24.329  124.505 82.340  1.00 34.42  ? 190  ILE C CB    1 
ATOM   8084  C  CG1   . ILE C  3  190 ? 23.053  125.189 82.860  1.00 33.41  ? 190  ILE C CG1   1 
ATOM   8085  C  CG2   . ILE C  3  190 ? 24.029  123.575 81.177  1.00 31.87  ? 190  ILE C CG2   1 
ATOM   8086  C  CD1   . ILE C  3  190 ? 22.273  125.979 81.789  1.00 33.50  ? 190  ILE C CD1   1 
ATOM   8087  N  N     . ALA C  3  191 ? 27.221  123.564 82.594  1.00 31.86  ? 191  ALA C N     1 
ATOM   8088  C  CA    . ALA C  3  191 ? 28.413  122.866 82.100  1.00 30.01  ? 191  ALA C CA    1 
ATOM   8089  C  C     . ALA C  3  191 ? 28.832  121.790 83.108  1.00 29.63  ? 191  ALA C C     1 
ATOM   8090  O  O     . ALA C  3  191 ? 29.066  120.635 82.756  1.00 27.94  ? 191  ALA C O     1 
ATOM   8091  C  CB    . ALA C  3  191 ? 29.522  123.825 81.922  1.00 30.16  ? 191  ALA C CB    1 
ATOM   8092  N  N     . GLY C  3  192 ? 28.931  122.172 84.371  1.00 28.84  ? 192  GLY C N     1 
ATOM   8093  C  CA    . GLY C  3  192 ? 29.280  121.190 85.374  1.00 30.53  ? 192  GLY C CA    1 
ATOM   8094  C  C     . GLY C  3  192 ? 28.354  119.982 85.323  1.00 33.84  ? 192  GLY C C     1 
ATOM   8095  O  O     . GLY C  3  192 ? 28.799  118.856 85.076  1.00 34.10  ? 192  GLY C O     1 
ATOM   8096  N  N     . ILE C  3  193 ? 27.060  120.208 85.552  1.00 36.37  ? 193  ILE C N     1 
ATOM   8097  C  CA    . ILE C  3  193 ? 26.080  119.131 85.524  1.00 38.68  ? 193  ILE C CA    1 
ATOM   8098  C  C     . ILE C  3  193 ? 26.124  118.323 84.221  1.00 40.37  ? 193  ILE C C     1 
ATOM   8099  O  O     . ILE C  3  193 ? 25.805  117.124 84.222  1.00 39.99  ? 193  ILE C O     1 
ATOM   8100  C  CB    . ILE C  3  193 ? 24.668  119.674 85.739  1.00 40.61  ? 193  ILE C CB    1 
ATOM   8101  C  CG1   . ILE C  3  193 ? 24.609  120.373 87.079  1.00 39.55  ? 193  ILE C CG1   1 
ATOM   8102  C  CG2   . ILE C  3  193 ? 23.629  118.544 85.746  1.00 38.74  ? 193  ILE C CG2   1 
ATOM   8103  C  CD1   . ILE C  3  193 ? 23.223  120.807 87.396  1.00 43.31  ? 193  ILE C CD1   1 
ATOM   8104  N  N     . THR C  3  194 ? 26.496  118.959 83.110  1.00 39.85  ? 194  THR C N     1 
ATOM   8105  C  CA    . THR C  3  194 ? 26.621  118.208 81.864  1.00 41.53  ? 194  THR C CA    1 
ATOM   8106  C  C     . THR C  3  194 ? 27.741  117.152 82.013  1.00 43.98  ? 194  THR C C     1 
ATOM   8107  O  O     . THR C  3  194 ? 27.621  116.034 81.510  1.00 45.02  ? 194  THR C O     1 
ATOM   8108  C  CB    . THR C  3  194 ? 26.974  119.120 80.708  1.00 40.29  ? 194  THR C CB    1 
ATOM   8109  O  OG1   . THR C  3  194 ? 25.948  120.096 80.585  1.00 43.62  ? 194  THR C OG1   1 
ATOM   8110  C  CG2   . THR C  3  194 ? 27.095  118.347 79.405  1.00 35.74  ? 194  THR C CG2   1 
ATOM   8111  N  N     . ILE C  3  195 ? 28.826  117.493 82.704  1.00 44.60  ? 195  ILE C N     1 
ATOM   8112  C  CA    . ILE C  3  195 ? 29.891  116.520 82.870  1.00 44.92  ? 195  ILE C CA    1 
ATOM   8113  C  C     . ILE C  3  195 ? 29.311  115.317 83.593  1.00 44.85  ? 195  ILE C C     1 
ATOM   8114  O  O     . ILE C  3  195 ? 29.611  114.178 83.236  1.00 44.62  ? 195  ILE C O     1 
ATOM   8115  C  CB    . ILE C  3  195 ? 31.070  117.048 83.697  1.00 46.42  ? 195  ILE C CB    1 
ATOM   8116  C  CG1   . ILE C  3  195 ? 31.519  118.434 83.217  1.00 46.71  ? 195  ILE C CG1   1 
ATOM   8117  C  CG2   . ILE C  3  195 ? 32.228  116.109 83.520  1.00 44.54  ? 195  ILE C CG2   1 
ATOM   8118  C  CD1   . ILE C  3  195 ? 32.102  118.432 81.834  1.00 46.39  ? 195  ILE C CD1   1 
ATOM   8119  N  N     . ILE C  3  196 ? 28.488  115.564 84.613  1.00 44.31  ? 196  ILE C N     1 
ATOM   8120  C  CA    . ILE C  3  196 ? 27.840  114.458 85.351  1.00 44.40  ? 196  ILE C CA    1 
ATOM   8121  C  C     . ILE C  3  196 ? 26.924  113.655 84.389  1.00 44.03  ? 196  ILE C C     1 
ATOM   8122  O  O     . ILE C  3  196 ? 26.932  112.422 84.388  1.00 42.63  ? 196  ILE C O     1 
ATOM   8123  C  CB    . ILE C  3  196 ? 26.943  114.981 86.527  1.00 44.01  ? 196  ILE C CB    1 
ATOM   8124  C  CG1   . ILE C  3  196 ? 27.755  115.864 87.476  1.00 43.76  ? 196  ILE C CG1   1 
ATOM   8125  C  CG2   . ILE C  3  196 ? 26.322  113.814 87.277  1.00 40.69  ? 196  ILE C CG2   1 
ATOM   8126  C  CD1   . ILE C  3  196 ? 28.958  115.178 88.074  1.00 43.72  ? 196  ILE C CD1   1 
ATOM   8127  N  N     . HIS C  3  197 ? 26.137  114.373 83.584  1.00 42.62  ? 197  HIS C N     1 
ATOM   8128  C  CA    . HIS C  3  197 ? 25.221  113.755 82.627  1.00 42.30  ? 197  HIS C CA    1 
ATOM   8129  C  C     . HIS C  3  197 ? 26.012  112.732 81.803  1.00 41.94  ? 197  HIS C C     1 
ATOM   8130  O  O     . HIS C  3  197 ? 25.680  111.546 81.800  1.00 42.76  ? 197  HIS C O     1 
ATOM   8131  C  CB    . HIS C  3  197 ? 24.591  114.852 81.741  1.00 40.78  ? 197  HIS C CB    1 
ATOM   8132  C  CG    . HIS C  3  197 ? 23.476  114.394 80.839  1.00 39.69  ? 197  HIS C CG    1 
ATOM   8133  N  ND1   . HIS C  3  197 ? 22.292  113.863 81.307  1.00 37.43  ? 197  HIS C ND1   1 
ATOM   8134  C  CD2   . HIS C  3  197 ? 23.324  114.507 79.492  1.00 40.55  ? 197  HIS C CD2   1 
ATOM   8135  C  CE1   . HIS C  3  197 ? 21.460  113.681 80.291  1.00 37.76  ? 197  HIS C CE1   1 
ATOM   8136  N  NE2   . HIS C  3  197 ? 22.057  114.066 79.174  1.00 38.16  ? 197  HIS C NE2   1 
ATOM   8137  N  N     . LEU C  3  198 ? 27.075  113.170 81.137  1.00 41.64  ? 198  LEU C N     1 
ATOM   8138  C  CA    . LEU C  3  198 ? 27.875  112.246 80.323  1.00 42.07  ? 198  LEU C CA    1 
ATOM   8139  C  C     . LEU C  3  198 ? 28.589  111.153 81.118  1.00 43.51  ? 198  LEU C C     1 
ATOM   8140  O  O     . LEU C  3  198 ? 28.898  110.091 80.579  1.00 42.73  ? 198  LEU C O     1 
ATOM   8141  C  CB    . LEU C  3  198 ? 28.913  113.001 79.515  1.00 39.39  ? 198  LEU C CB    1 
ATOM   8142  C  CG    . LEU C  3  198 ? 28.350  113.931 78.466  1.00 39.29  ? 198  LEU C CG    1 
ATOM   8143  C  CD1   . LEU C  3  198 ? 29.448  114.689 77.751  1.00 36.93  ? 198  LEU C CD1   1 
ATOM   8144  C  CD2   . LEU C  3  198 ? 27.592  113.088 77.501  1.00 42.18  ? 198  LEU C CD2   1 
ATOM   8145  N  N     . THR C  3  199 ? 28.866  111.407 82.390  1.00 43.78  ? 199  THR C N     1 
ATOM   8146  C  CA    . THR C  3  199 ? 29.541  110.398 83.183  1.00 45.76  ? 199  THR C CA    1 
ATOM   8147  C  C     . THR C  3  199 ? 28.627  109.216 83.413  1.00 45.60  ? 199  THR C C     1 
ATOM   8148  O  O     . THR C  3  199 ? 29.018  108.077 83.197  1.00 46.98  ? 199  THR C O     1 
ATOM   8149  C  CB    . THR C  3  199 ? 30.014  110.962 84.526  1.00 48.02  ? 199  THR C CB    1 
ATOM   8150  O  OG1   . THR C  3  199 ? 31.228  111.692 84.312  1.00 50.89  ? 199  THR C OG1   1 
ATOM   8151  C  CG2   . THR C  3  199 ? 30.259  109.841 85.531  1.00 48.23  ? 199  THR C CG2   1 
ATOM   8152  N  N     . PHE C  3  200 ? 27.414  109.477 83.874  1.00 45.16  ? 200  PHE C N     1 
ATOM   8153  C  CA    . PHE C  3  200 ? 26.472  108.394 84.071  1.00 43.53  ? 200  PHE C CA    1 
ATOM   8154  C  C     . PHE C  3  200 ? 26.276  107.727 82.712  1.00 45.01  ? 200  PHE C C     1 
ATOM   8155  O  O     . PHE C  3  200 ? 26.298  106.508 82.592  1.00 45.34  ? 200  PHE C O     1 
ATOM   8156  C  CB    . PHE C  3  200 ? 25.139  108.938 84.550  1.00 40.67  ? 200  PHE C CB    1 
ATOM   8157  C  CG    . PHE C  3  200 ? 25.079  109.189 86.010  1.00 37.69  ? 200  PHE C CG    1 
ATOM   8158  C  CD1   . PHE C  3  200 ? 25.081  108.136 86.905  1.00 38.84  ? 200  PHE C CD1   1 
ATOM   8159  C  CD2   . PHE C  3  200 ? 24.976  110.477 86.496  1.00 38.14  ? 200  PHE C CD2   1 
ATOM   8160  C  CE1   . PHE C  3  200 ? 24.976  108.359 88.265  1.00 37.71  ? 200  PHE C CE1   1 
ATOM   8161  C  CE2   . PHE C  3  200 ? 24.873  110.716 87.858  1.00 36.75  ? 200  PHE C CE2   1 
ATOM   8162  C  CZ    . PHE C  3  200 ? 24.872  109.655 88.740  1.00 37.60  ? 200  PHE C CZ    1 
ATOM   8163  N  N     . LEU C  3  201 ? 26.081  108.528 81.676  1.00 46.09  ? 201  LEU C N     1 
ATOM   8164  C  CA    . LEU C  3  201 ? 25.877  107.941 80.376  1.00 48.31  ? 201  LEU C CA    1 
ATOM   8165  C  C     . LEU C  3  201 ? 26.949  106.920 80.045  1.00 49.78  ? 201  LEU C C     1 
ATOM   8166  O  O     . LEU C  3  201 ? 26.631  105.815 79.656  1.00 52.22  ? 201  LEU C O     1 
ATOM   8167  C  CB    . LEU C  3  201 ? 25.864  108.998 79.281  1.00 48.84  ? 201  LEU C CB    1 
ATOM   8168  C  CG    . LEU C  3  201 ? 25.764  108.306 77.916  1.00 49.35  ? 201  LEU C CG    1 
ATOM   8169  C  CD1   . LEU C  3  201 ? 24.373  107.675 77.821  1.00 48.59  ? 201  LEU C CD1   1 
ATOM   8170  C  CD2   . LEU C  3  201 ? 26.012  109.273 76.764  1.00 47.64  ? 201  LEU C CD2   1 
ATOM   8171  N  N     . HIS C  3  202 ? 28.217  107.273 80.204  1.00 50.61  ? 202  HIS C N     1 
ATOM   8172  C  CA    . HIS C  3  202 ? 29.281  106.338 79.859  1.00 52.62  ? 202  HIS C CA    1 
ATOM   8173  C  C     . HIS C  3  202 ? 29.325  105.023 80.616  1.00 53.59  ? 202  HIS C C     1 
ATOM   8174  O  O     . HIS C  3  202 ? 30.083  104.135 80.249  1.00 53.86  ? 202  HIS C O     1 
ATOM   8175  C  CB    . HIS C  3  202 ? 30.636  107.027 79.957  1.00 54.26  ? 202  HIS C CB    1 
ATOM   8176  C  CG    . HIS C  3  202 ? 30.838  108.090 78.918  1.00 58.23  ? 202  HIS C CG    1 
ATOM   8177  N  ND1   . HIS C  3  202 ? 31.912  108.954 78.929  1.00 58.86  ? 202  HIS C ND1   1 
ATOM   8178  C  CD2   . HIS C  3  202 ? 30.091  108.434 77.841  1.00 59.05  ? 202  HIS C CD2   1 
ATOM   8179  C  CE1   . HIS C  3  202 ? 31.817  109.786 77.906  1.00 59.06  ? 202  HIS C CE1   1 
ATOM   8180  N  NE2   . HIS C  3  202 ? 30.722  109.491 77.231  1.00 59.00  ? 202  HIS C NE2   1 
ATOM   8181  N  N     . GLU C  3  203 ? 28.524  104.889 81.666  1.00 55.23  ? 203  GLU C N     1 
ATOM   8182  C  CA    . GLU C  3  203 ? 28.481  103.649 82.441  1.00 57.20  ? 203  GLU C CA    1 
ATOM   8183  C  C     . GLU C  3  203 ? 27.863  102.567 81.588  1.00 57.26  ? 203  GLU C C     1 
ATOM   8184  O  O     . GLU C  3  203 ? 28.310  101.429 81.577  1.00 57.90  ? 203  GLU C O     1 
ATOM   8185  C  CB    . GLU C  3  203 ? 27.624  103.818 83.693  1.00 60.37  ? 203  GLU C CB    1 
ATOM   8186  C  CG    . GLU C  3  203 ? 28.226  104.732 84.739  1.00 67.69  ? 203  GLU C CG    1 
ATOM   8187  C  CD    . GLU C  3  203 ? 29.472  104.138 85.371  1.00 71.29  ? 203  GLU C CD    1 
ATOM   8188  O  OE1   . GLU C  3  203 ? 29.335  103.141 86.125  1.00 74.43  ? 203  GLU C OE1   1 
ATOM   8189  O  OE2   . GLU C  3  203 ? 30.581  104.664 85.107  1.00 71.56  ? 203  GLU C OE2   1 
ATOM   8190  N  N     . SER C  3  204 ? 26.818  102.945 80.867  1.00 59.09  ? 204  SER C N     1 
ATOM   8191  C  CA    . SER C  3  204 ? 26.081  102.030 79.990  1.00 59.65  ? 204  SER C CA    1 
ATOM   8192  C  C     . SER C  3  204 ? 26.486  102.125 78.522  1.00 58.96  ? 204  SER C C     1 
ATOM   8193  O  O     . SER C  3  204 ? 26.512  101.120 77.810  1.00 60.28  ? 204  SER C O     1 
ATOM   8194  C  CB    . SER C  3  204 ? 24.575  102.310 80.095  1.00 59.30  ? 204  SER C CB    1 
ATOM   8195  O  OG    . SER C  3  204 ? 24.260  103.623 79.662  1.00 57.70  ? 204  SER C OG    1 
ATOM   8196  N  N     . GLY C  3  205 ? 26.807  103.335 78.080  1.00 57.50  ? 205  GLY C N     1 
ATOM   8197  C  CA    . GLY C  3  205 ? 27.167  103.531 76.698  1.00 57.37  ? 205  GLY C CA    1 
ATOM   8198  C  C     . GLY C  3  205 ? 25.855  103.929 76.065  1.00 58.56  ? 205  GLY C C     1 
ATOM   8199  O  O     . GLY C  3  205 ? 24.810  103.868 76.737  1.00 58.21  ? 205  GLY C O     1 
ATOM   8200  N  N     . SER C  3  206 ? 25.884  104.325 74.792  1.00 58.12  ? 206  SER C N     1 
ATOM   8201  C  CA    . SER C  3  206 ? 24.658  104.755 74.127  1.00 56.97  ? 206  SER C CA    1 
ATOM   8202  C  C     . SER C  3  206 ? 23.663  103.671 73.804  1.00 55.46  ? 206  SER C C     1 
ATOM   8203  O  O     . SER C  3  206 ? 23.996  102.512 73.610  1.00 57.73  ? 206  SER C O     1 
ATOM   8204  C  CB    . SER C  3  206 ? 24.976  105.489 72.839  1.00 56.66  ? 206  SER C CB    1 
ATOM   8205  O  OG    . SER C  3  206 ? 25.710  106.658 73.109  1.00 61.01  ? 206  SER C OG    1 
ATOM   8206  N  N     . ASN C  3  207 ? 22.414  104.076 73.754  1.00 53.82  ? 207  ASN C N     1 
ATOM   8207  C  CA    . ASN C  3  207 ? 21.333  103.189 73.397  1.00 52.06  ? 207  ASN C CA    1 
ATOM   8208  C  C     . ASN C  3  207 ? 21.319  103.326 71.867  1.00 50.71  ? 207  ASN C C     1 
ATOM   8209  O  O     . ASN C  3  207 ? 22.058  104.151 71.320  1.00 50.19  ? 207  ASN C O     1 
ATOM   8210  C  CB    . ASN C  3  207 ? 20.048  103.740 73.995  1.00 53.46  ? 207  ASN C CB    1 
ATOM   8211  C  CG    . ASN C  3  207 ? 18.866  102.892 73.702  1.00 52.85  ? 207  ASN C CG    1 
ATOM   8212  O  OD1   . ASN C  3  207 ? 17.724  103.351 73.795  1.00 54.24  ? 207  ASN C OD1   1 
ATOM   8213  N  ND2   . ASN C  3  207 ? 19.114  101.639 73.358  1.00 51.43  ? 207  ASN C ND2   1 
ATOM   8214  N  N     . ASN C  3  208 ? 20.513  102.536 71.165  1.00 48.05  ? 208  ASN C N     1 
ATOM   8215  C  CA    . ASN C  3  208 ? 20.460  102.664 69.707  1.00 45.75  ? 208  ASN C CA    1 
ATOM   8216  C  C     . ASN C  3  208 ? 19.011  102.512 69.254  1.00 44.63  ? 208  ASN C C     1 
ATOM   8217  O  O     . ASN C  3  208 ? 18.209  101.951 69.965  1.00 45.39  ? 208  ASN C O     1 
ATOM   8218  C  CB    . ASN C  3  208 ? 21.354  101.628 69.042  1.00 44.50  ? 208  ASN C CB    1 
ATOM   8219  C  CG    . ASN C  3  208 ? 20.766  100.252 69.078  1.00 45.05  ? 208  ASN C CG    1 
ATOM   8220  O  OD1   . ASN C  3  208 ? 19.976  99.884  68.212  1.00 46.43  ? 208  ASN C OD1   1 
ATOM   8221  N  ND2   . ASN C  3  208 ? 21.137  99.477  70.088  1.00 44.35  ? 208  ASN C ND2   1 
ATOM   8222  N  N     . PRO C  3  209 ? 18.666  103.002 68.057  1.00 43.86  ? 209  PRO C N     1 
ATOM   8223  C  CA    . PRO C  3  209 ? 17.299  102.918 67.553  1.00 43.26  ? 209  PRO C CA    1 
ATOM   8224  C  C     . PRO C  3  209 ? 16.541  101.593 67.503  1.00 43.90  ? 209  PRO C C     1 
ATOM   8225  O  O     . PRO C  3  209 ? 15.330  101.601 67.372  1.00 46.16  ? 209  PRO C O     1 
ATOM   8226  C  CB    . PRO C  3  209 ? 17.394  103.608 66.193  1.00 43.82  ? 209  PRO C CB    1 
ATOM   8227  C  CG    . PRO C  3  209 ? 18.831  103.425 65.791  1.00 42.52  ? 209  PRO C CG    1 
ATOM   8228  C  CD    . PRO C  3  209 ? 19.546  103.656 67.069  1.00 44.75  ? 209  PRO C CD    1 
ATOM   8229  N  N     . LEU C  3  210 ? 17.204  100.453 67.595  1.00 43.46  ? 210  LEU C N     1 
ATOM   8230  C  CA    . LEU C  3  210 ? 16.445  99.207  67.572  1.00 43.18  ? 210  LEU C CA    1 
ATOM   8231  C  C     . LEU C  3  210 ? 16.244  98.732  69.003  1.00 42.97  ? 210  LEU C C     1 
ATOM   8232  O  O     . LEU C  3  210 ? 15.519  97.775  69.246  1.00 44.06  ? 210  LEU C O     1 
ATOM   8233  C  CB    . LEU C  3  210 ? 17.166  98.113  66.778  1.00 45.06  ? 210  LEU C CB    1 
ATOM   8234  C  CG    . LEU C  3  210 ? 17.424  98.273  65.281  1.00 46.15  ? 210  LEU C CG    1 
ATOM   8235  C  CD1   . LEU C  3  210 ? 18.142  97.034  64.736  1.00 46.95  ? 210  LEU C CD1   1 
ATOM   8236  C  CD2   . LEU C  3  210 ? 16.117  98.456  64.577  1.00 47.60  ? 210  LEU C CD2   1 
ATOM   8237  N  N     . GLY C  3  211 ? 16.908  99.391  69.944  1.00 42.47  ? 211  GLY C N     1 
ATOM   8238  C  CA    . GLY C  3  211 ? 16.778  99.037  71.350  1.00 45.69  ? 211  GLY C CA    1 
ATOM   8239  C  C     . GLY C  3  211 ? 17.158  97.618  71.764  1.00 49.00  ? 211  GLY C C     1 
ATOM   8240  O  O     . GLY C  3  211 ? 16.532  97.026  72.664  1.00 50.77  ? 211  GLY C O     1 
ATOM   8241  N  N     . ILE C  3  212 ? 18.165  97.054  71.103  1.00 49.05  ? 212  ILE C N     1 
ATOM   8242  C  CA    . ILE C  3  212 ? 18.639  95.721  71.424  1.00 48.34  ? 212  ILE C CA    1 
ATOM   8243  C  C     . ILE C  3  212 ? 20.128  95.889  71.582  1.00 50.39  ? 212  ILE C C     1 
ATOM   8244  O  O     . ILE C  3  212 ? 20.724  96.743  70.942  1.00 50.64  ? 212  ILE C O     1 
ATOM   8245  C  CB    . ILE C  3  212 ? 18.363  94.718  70.290  1.00 48.74  ? 212  ILE C CB    1 
ATOM   8246  C  CG1   . ILE C  3  212 ? 18.954  95.238  68.984  1.00 47.28  ? 212  ILE C CG1   1 
ATOM   8247  C  CG2   . ILE C  3  212 ? 16.844  94.467  70.136  1.00 48.94  ? 212  ILE C CG2   1 
ATOM   8248  C  CD1   . ILE C  3  212 ? 18.859  94.241  67.867  1.00 45.76  ? 212  ILE C CD1   1 
ATOM   8249  N  N     . SER C  3  213 ? 20.733  95.080  72.434  1.00 53.36  ? 213  SER C N     1 
ATOM   8250  C  CA    . SER C  3  213 ? 22.173  95.167  72.692  1.00 56.90  ? 213  SER C CA    1 
ATOM   8251  C  C     . SER C  3  213 ? 23.049  95.357  71.448  1.00 56.67  ? 213  SER C C     1 
ATOM   8252  O  O     . SER C  3  213 ? 22.993  94.567  70.514  1.00 56.98  ? 213  SER C O     1 
ATOM   8253  C  CB    . SER C  3  213 ? 22.612  93.912  73.456  1.00 59.90  ? 213  SER C CB    1 
ATOM   8254  O  OG    . SER C  3  213 ? 24.015  93.872  73.636  1.00 65.96  ? 213  SER C OG    1 
ATOM   8255  N  N     . SER C  3  214 ? 23.876  96.395  71.445  1.00 56.90  ? 214  SER C N     1 
ATOM   8256  C  CA    . SER C  3  214 ? 24.740  96.645  70.294  1.00 59.49  ? 214  SER C CA    1 
ATOM   8257  C  C     . SER C  3  214 ? 26.217  96.303  70.518  1.00 60.46  ? 214  SER C C     1 
ATOM   8258  O  O     . SER C  3  214 ? 27.091  96.842  69.851  1.00 58.89  ? 214  SER C O     1 
ATOM   8259  C  CB    . SER C  3  214 ? 24.599  98.109  69.822  1.00 60.15  ? 214  SER C CB    1 
ATOM   8260  O  OG    . SER C  3  214 ? 24.606  99.050  70.892  1.00 61.65  ? 214  SER C OG    1 
ATOM   8261  N  N     . ASP C  3  215 ? 26.486  95.389  71.444  1.00 63.27  ? 215  ASP C N     1 
ATOM   8262  C  CA    . ASP C  3  215 ? 27.860  94.987  71.763  1.00 65.70  ? 215  ASP C CA    1 
ATOM   8263  C  C     . ASP C  3  215 ? 28.456  94.186  70.613  1.00 65.95  ? 215  ASP C C     1 
ATOM   8264  O  O     . ASP C  3  215 ? 29.688  94.130  70.408  1.00 66.02  ? 215  ASP C O     1 
ATOM   8265  C  CB    . ASP C  3  215 ? 27.872  94.127  73.035  1.00 67.31  ? 215  ASP C CB    1 
ATOM   8266  C  CG    . ASP C  3  215 ? 27.599  94.933  74.302  1.00 70.05  ? 215  ASP C CG    1 
ATOM   8267  O  OD1   . ASP C  3  215 ? 27.442  94.300  75.375  1.00 70.92  ? 215  ASP C OD1   1 
ATOM   8268  O  OD2   . ASP C  3  215 ? 27.555  96.187  74.227  1.00 70.48  ? 215  ASP C OD2   1 
ATOM   8269  N  N     . SER C  3  216 ? 27.552  93.557  69.871  1.00 64.58  ? 216  SER C N     1 
ATOM   8270  C  CA    . SER C  3  216 ? 27.910  92.720  68.736  1.00 62.60  ? 216  SER C CA    1 
ATOM   8271  C  C     . SER C  3  216 ? 28.419  93.528  67.569  1.00 61.66  ? 216  SER C C     1 
ATOM   8272  O  O     . SER C  3  216 ? 28.960  92.963  66.621  1.00 60.91  ? 216  SER C O     1 
ATOM   8273  C  CB    . SER C  3  216 ? 26.687  91.929  68.300  1.00 61.47  ? 216  SER C CB    1 
ATOM   8274  O  OG    . SER C  3  216 ? 25.511  92.625  68.684  1.00 63.16  ? 216  SER C OG    1 
ATOM   8275  N  N     . ASP C  3  217 ? 28.250  94.847  67.648  1.00 61.37  ? 217  ASP C N     1 
ATOM   8276  C  CA    . ASP C  3  217 ? 28.647  95.738  66.562  1.00 61.44  ? 217  ASP C CA    1 
ATOM   8277  C  C     . ASP C  3  217 ? 28.949  97.151  67.045  1.00 59.98  ? 217  ASP C C     1 
ATOM   8278  O  O     . ASP C  3  217 ? 28.102  98.034  66.915  1.00 59.76  ? 217  ASP C O     1 
ATOM   8279  C  CB    . ASP C  3  217 ? 27.514  95.799  65.523  1.00 64.24  ? 217  ASP C CB    1 
ATOM   8280  C  CG    . ASP C  3  217 ? 27.990  96.272  64.163  1.00 67.82  ? 217  ASP C CG    1 
ATOM   8281  O  OD1   . ASP C  3  217 ? 27.140  96.381  63.244  1.00 67.74  ? 217  ASP C OD1   1 
ATOM   8282  O  OD2   . ASP C  3  217 ? 29.218  96.524  64.023  1.00 69.75  ? 217  ASP C OD2   1 
ATOM   8283  N  N     . LYS C  3  218 ? 30.143  97.379  67.589  1.00 58.05  ? 218  LYS C N     1 
ATOM   8284  C  CA    . LYS C  3  218 ? 30.483  98.712  68.068  1.00 56.79  ? 218  LYS C CA    1 
ATOM   8285  C  C     . LYS C  3  218 ? 31.627  99.328  67.292  1.00 56.08  ? 218  LYS C C     1 
ATOM   8286  O  O     . LYS C  3  218 ? 32.522  98.623  66.858  1.00 59.26  ? 218  LYS C O     1 
ATOM   8287  C  CB    . LYS C  3  218 ? 30.797  98.677  69.557  1.00 57.03  ? 218  LYS C CB    1 
ATOM   8288  C  CG    . LYS C  3  218 ? 29.538  98.528  70.431  1.00 59.34  ? 218  LYS C CG    1 
ATOM   8289  C  CD    . LYS C  3  218 ? 29.666  99.240  71.794  1.00 58.83  ? 218  LYS C CD    1 
ATOM   8290  C  CE    . LYS C  3  218 ? 28.493  98.925  72.726  1.00 57.43  ? 218  LYS C CE    1 
ATOM   8291  N  NZ    . LYS C  3  218 ? 27.238  99.532  72.268  1.00 55.22  ? 218  LYS C NZ    1 
ATOM   8292  N  N     . ILE C  3  219 ? 31.577  100.642 67.095  1.00 53.00  ? 219  ILE C N     1 
ATOM   8293  C  CA    . ILE C  3  219 ? 32.597  101.353 66.330  1.00 50.98  ? 219  ILE C CA    1 
ATOM   8294  C  C     . ILE C  3  219 ? 33.171  102.504 67.154  1.00 49.97  ? 219  ILE C C     1 
ATOM   8295  O  O     . ILE C  3  219 ? 32.481  103.078 67.996  1.00 49.91  ? 219  ILE C O     1 
ATOM   8296  C  CB    . ILE C  3  219 ? 32.008  101.918 64.984  1.00 50.43  ? 219  ILE C CB    1 
ATOM   8297  C  CG1   . ILE C  3  219 ? 30.801  102.818 65.259  1.00 50.11  ? 219  ILE C CG1   1 
ATOM   8298  C  CG2   . ILE C  3  219 ? 31.543  100.783 64.094  1.00 47.04  ? 219  ILE C CG2   1 
ATOM   8299  C  CD1   . ILE C  3  219 ? 30.188  103.404 64.020  1.00 49.67  ? 219  ILE C CD1   1 
ATOM   8300  N  N     . PRO C  3  220 ? 34.445  102.859 66.924  1.00 48.39  ? 220  PRO C N     1 
ATOM   8301  C  CA    . PRO C  3  220 ? 35.029  103.953 67.698  1.00 47.63  ? 220  PRO C CA    1 
ATOM   8302  C  C     . PRO C  3  220 ? 34.387  105.306 67.365  1.00 46.61  ? 220  PRO C C     1 
ATOM   8303  O  O     . PRO C  3  220 ? 34.116  105.594 66.205  1.00 46.51  ? 220  PRO C O     1 
ATOM   8304  C  CB    . PRO C  3  220 ? 36.512  103.878 67.325  1.00 46.80  ? 220  PRO C CB    1 
ATOM   8305  C  CG    . PRO C  3  220 ? 36.462  103.435 65.904  1.00 46.99  ? 220  PRO C CG    1 
ATOM   8306  C  CD    . PRO C  3  220 ? 35.417  102.326 65.955  1.00 48.67  ? 220  PRO C CD    1 
ATOM   8307  N  N     . PHE C  3  221 ? 34.145  106.118 68.395  1.00 45.58  ? 221  PHE C N     1 
ATOM   8308  C  CA    . PHE C  3  221 ? 33.548  107.433 68.244  1.00 45.91  ? 221  PHE C CA    1 
ATOM   8309  C  C     . PHE C  3  221 ? 34.193  108.182 67.096  1.00 47.30  ? 221  PHE C C     1 
ATOM   8310  O  O     . PHE C  3  221 ? 33.505  108.745 66.252  1.00 46.58  ? 221  PHE C O     1 
ATOM   8311  C  CB    . PHE C  3  221 ? 33.715  108.231 69.530  1.00 47.50  ? 221  PHE C CB    1 
ATOM   8312  C  CG    . PHE C  3  221 ? 33.063  109.577 69.487  1.00 49.47  ? 221  PHE C CG    1 
ATOM   8313  C  CD1   . PHE C  3  221 ? 31.688  109.707 69.679  1.00 50.06  ? 221  PHE C CD1   1 
ATOM   8314  C  CD2   . PHE C  3  221 ? 33.813  110.716 69.195  1.00 50.21  ? 221  PHE C CD2   1 
ATOM   8315  C  CE1   . PHE C  3  221 ? 31.068  110.961 69.576  1.00 50.96  ? 221  PHE C CE1   1 
ATOM   8316  C  CE2   . PHE C  3  221 ? 33.209  111.976 69.090  1.00 50.11  ? 221  PHE C CE2   1 
ATOM   8317  C  CZ    . PHE C  3  221 ? 31.834  112.100 69.279  1.00 50.67  ? 221  PHE C CZ    1 
ATOM   8318  N  N     . HIS C  3  222 ? 35.524  108.216 67.089  1.00 50.75  ? 222  HIS C N     1 
ATOM   8319  C  CA    . HIS C  3  222 ? 36.282  108.864 66.015  1.00 51.78  ? 222  HIS C CA    1 
ATOM   8320  C  C     . HIS C  3  222 ? 36.768  107.758 65.076  1.00 51.56  ? 222  HIS C C     1 
ATOM   8321  O  O     . HIS C  3  222 ? 37.313  106.745 65.540  1.00 52.66  ? 222  HIS C O     1 
ATOM   8322  C  CB    . HIS C  3  222 ? 37.500  109.595 66.566  1.00 53.67  ? 222  HIS C CB    1 
ATOM   8323  C  CG    . HIS C  3  222 ? 38.384  110.153 65.495  1.00 56.62  ? 222  HIS C CG    1 
ATOM   8324  N  ND1   . HIS C  3  222 ? 38.066  111.294 64.788  1.00 57.22  ? 222  HIS C ND1   1 
ATOM   8325  C  CD2   . HIS C  3  222 ? 39.534  109.684 64.953  1.00 57.56  ? 222  HIS C CD2   1 
ATOM   8326  C  CE1   . HIS C  3  222 ? 38.980  111.501 63.855  1.00 57.09  ? 222  HIS C CE1   1 
ATOM   8327  N  NE2   . HIS C  3  222 ? 39.881  110.538 63.933  1.00 57.88  ? 222  HIS C NE2   1 
ATOM   8328  N  N     . PRO C  3  223 ? 36.651  107.960 63.750  1.00 50.39  ? 223  PRO C N     1 
ATOM   8329  C  CA    . PRO C  3  223 ? 36.117  109.129 63.054  1.00 50.32  ? 223  PRO C CA    1 
ATOM   8330  C  C     . PRO C  3  223 ? 34.631  109.108 62.768  1.00 50.88  ? 223  PRO C C     1 
ATOM   8331  O  O     . PRO C  3  223 ? 34.062  110.132 62.388  1.00 51.53  ? 223  PRO C O     1 
ATOM   8332  C  CB    . PRO C  3  223 ? 36.913  109.130 61.759  1.00 49.72  ? 223  PRO C CB    1 
ATOM   8333  C  CG    . PRO C  3  223 ? 36.935  107.679 61.420  1.00 48.73  ? 223  PRO C CG    1 
ATOM   8334  C  CD    . PRO C  3  223 ? 37.149  106.973 62.770  1.00 49.61  ? 223  PRO C CD    1 
ATOM   8335  N  N     . TYR C  3  224 ? 34.004  107.950 62.935  1.00 50.86  ? 224  TYR C N     1 
ATOM   8336  C  CA    . TYR C  3  224 ? 32.583  107.809 62.652  1.00 50.88  ? 224  TYR C CA    1 
ATOM   8337  C  C     . TYR C  3  224 ? 31.687  108.916 63.179  1.00 51.35  ? 224  TYR C C     1 
ATOM   8338  O  O     . TYR C  3  224 ? 31.076  109.656 62.392  1.00 49.61  ? 224  TYR C O     1 
ATOM   8339  C  CB    . TYR C  3  224 ? 32.113  106.451 63.140  1.00 51.57  ? 224  TYR C CB    1 
ATOM   8340  C  CG    . TYR C  3  224 ? 32.769  105.359 62.334  1.00 53.26  ? 224  TYR C CG    1 
ATOM   8341  C  CD1   . TYR C  3  224 ? 33.443  104.300 62.956  1.00 52.94  ? 224  TYR C CD1   1 
ATOM   8342  C  CD2   . TYR C  3  224 ? 32.779  105.421 60.938  1.00 51.51  ? 224  TYR C CD2   1 
ATOM   8343  C  CE1   . TYR C  3  224 ? 34.112  103.338 62.198  1.00 52.39  ? 224  TYR C CE1   1 
ATOM   8344  C  CE2   . TYR C  3  224 ? 33.447  104.466 60.180  1.00 51.70  ? 224  TYR C CE2   1 
ATOM   8345  C  CZ    . TYR C  3  224 ? 34.109  103.433 60.809  1.00 51.68  ? 224  TYR C CZ    1 
ATOM   8346  O  OH    . TYR C  3  224 ? 34.758  102.496 60.041  1.00 53.93  ? 224  TYR C OH    1 
ATOM   8347  N  N     . TYR C  3  225 ? 31.620  109.050 64.499  1.00 50.96  ? 225  TYR C N     1 
ATOM   8348  C  CA    . TYR C  3  225 ? 30.783  110.085 65.079  1.00 51.74  ? 225  TYR C CA    1 
ATOM   8349  C  C     . TYR C  3  225 ? 31.390  111.481 65.183  1.00 52.84  ? 225  TYR C C     1 
ATOM   8350  O  O     . TYR C  3  225 ? 30.663  112.483 65.232  1.00 54.41  ? 225  TYR C O     1 
ATOM   8351  C  CB    . TYR C  3  225 ? 30.254  109.599 66.415  1.00 49.99  ? 225  TYR C CB    1 
ATOM   8352  C  CG    . TYR C  3  225 ? 29.354  108.446 66.170  1.00 49.04  ? 225  TYR C CG    1 
ATOM   8353  C  CD1   . TYR C  3  225 ? 29.721  107.160 66.539  1.00 50.32  ? 225  TYR C CD1   1 
ATOM   8354  C  CD2   . TYR C  3  225 ? 28.170  108.624 65.455  1.00 47.90  ? 225  TYR C CD2   1 
ATOM   8355  C  CE1   . TYR C  3  225 ? 28.919  106.066 66.192  1.00 52.10  ? 225  TYR C CE1   1 
ATOM   8356  C  CE2   . TYR C  3  225 ? 27.370  107.554 65.101  1.00 47.25  ? 225  TYR C CE2   1 
ATOM   8357  C  CZ    . TYR C  3  225 ? 27.739  106.280 65.468  1.00 49.61  ? 225  TYR C CZ    1 
ATOM   8358  O  OH    . TYR C  3  225 ? 26.926  105.226 65.130  1.00 48.95  ? 225  TYR C OH    1 
ATOM   8359  N  N     . SER C  3  226 ? 32.710  111.578 65.211  1.00 52.25  ? 226  SER C N     1 
ATOM   8360  C  CA    . SER C  3  226 ? 33.278  112.899 65.258  1.00 51.51  ? 226  SER C CA    1 
ATOM   8361  C  C     . SER C  3  226 ? 32.834  113.570 63.949  1.00 51.42  ? 226  SER C C     1 
ATOM   8362  O  O     . SER C  3  226 ? 32.397  114.720 63.943  1.00 50.87  ? 226  SER C O     1 
ATOM   8363  C  CB    . SER C  3  226 ? 34.801  112.821 65.379  1.00 52.09  ? 226  SER C CB    1 
ATOM   8364  O  OG    . SER C  3  226 ? 35.360  111.958 64.417  1.00 53.99  ? 226  SER C OG    1 
ATOM   8365  N  N     . PHE C  3  227 ? 32.899  112.837 62.843  1.00 51.92  ? 227  PHE C N     1 
ATOM   8366  C  CA    . PHE C  3  227 ? 32.485  113.398 61.561  1.00 53.06  ? 227  PHE C CA    1 
ATOM   8367  C  C     . PHE C  3  227 ? 30.987  113.594 61.462  1.00 53.19  ? 227  PHE C C     1 
ATOM   8368  O  O     . PHE C  3  227 ? 30.523  114.636 60.999  1.00 53.00  ? 227  PHE C O     1 
ATOM   8369  C  CB    . PHE C  3  227 ? 32.941  112.513 60.418  1.00 54.51  ? 227  PHE C CB    1 
ATOM   8370  C  CG    . PHE C  3  227 ? 34.379  112.675 60.083  1.00 59.02  ? 227  PHE C CG    1 
ATOM   8371  C  CD1   . PHE C  3  227 ? 34.766  113.339 58.924  1.00 60.27  ? 227  PHE C CD1   1 
ATOM   8372  C  CD2   . PHE C  3  227 ? 35.364  112.193 60.941  1.00 61.01  ? 227  PHE C CD2   1 
ATOM   8373  C  CE1   . PHE C  3  227 ? 36.124  113.526 58.620  1.00 60.74  ? 227  PHE C CE1   1 
ATOM   8374  C  CE2   . PHE C  3  227 ? 36.720  112.373 60.646  1.00 62.43  ? 227  PHE C CE2   1 
ATOM   8375  C  CZ    . PHE C  3  227 ? 37.101  113.045 59.477  1.00 60.68  ? 227  PHE C CZ    1 
ATOM   8376  N  N     . LYS C  3  228 ? 30.225  112.596 61.895  1.00 53.53  ? 228  LYS C N     1 
ATOM   8377  C  CA    . LYS C  3  228 ? 28.771  112.695 61.834  1.00 54.29  ? 228  LYS C CA    1 
ATOM   8378  C  C     . LYS C  3  228 ? 28.263  113.906 62.616  1.00 55.00  ? 228  LYS C C     1 
ATOM   8379  O  O     . LYS C  3  228 ? 27.370  114.610 62.157  1.00 55.76  ? 228  LYS C O     1 
ATOM   8380  C  CB    . LYS C  3  228 ? 28.117  111.426 62.372  1.00 54.13  ? 228  LYS C CB    1 
ATOM   8381  C  CG    . LYS C  3  228 ? 26.651  111.288 62.005  1.00 55.16  ? 228  LYS C CG    1 
ATOM   8382  C  CD    . LYS C  3  228 ? 26.019  110.167 62.819  1.00 60.32  ? 228  LYS C CD    1 
ATOM   8383  C  CE    . LYS C  3  228 ? 24.531  109.972 62.550  1.00 61.21  ? 228  LYS C CE    1 
ATOM   8384  N  NZ    . LYS C  3  228 ? 24.275  109.258 61.263  1.00 63.80  ? 228  LYS C NZ    1 
ATOM   8385  N  N     . ASP C  3  229 ? 28.833  114.162 63.788  1.00 54.91  ? 229  ASP C N     1 
ATOM   8386  C  CA    . ASP C  3  229 ? 28.414  115.312 64.579  1.00 56.31  ? 229  ASP C CA    1 
ATOM   8387  C  C     . ASP C  3  229 ? 28.796  116.663 63.953  1.00 56.65  ? 229  ASP C C     1 
ATOM   8388  O  O     . ASP C  3  229 ? 28.007  117.611 63.980  1.00 56.54  ? 229  ASP C O     1 
ATOM   8389  C  CB    . ASP C  3  229 ? 28.997  115.219 65.981  1.00 57.81  ? 229  ASP C CB    1 
ATOM   8390  C  CG    . ASP C  3  229 ? 28.419  114.072 66.757  1.00 61.17  ? 229  ASP C CG    1 
ATOM   8391  O  OD1   . ASP C  3  229 ? 28.734  113.936 67.970  1.00 62.14  ? 229  ASP C OD1   1 
ATOM   8392  O  OD2   . ASP C  3  229 ? 27.643  113.303 66.135  1.00 61.92  ? 229  ASP C OD2   1 
ATOM   8393  N  N     . ILE C  3  230 ? 30.002  116.755 63.396  1.00 55.78  ? 230  ILE C N     1 
ATOM   8394  C  CA    . ILE C  3  230 ? 30.446  117.997 62.778  1.00 53.43  ? 230  ILE C CA    1 
ATOM   8395  C  C     . ILE C  3  230 ? 29.540  118.322 61.624  1.00 51.60  ? 230  ILE C C     1 
ATOM   8396  O  O     . ILE C  3  230 ? 29.247  119.485 61.365  1.00 50.51  ? 230  ILE C O     1 
ATOM   8397  C  CB    . ILE C  3  230 ? 31.889  117.883 62.284  1.00 54.49  ? 230  ILE C CB    1 
ATOM   8398  C  CG1   . ILE C  3  230 ? 32.824  118.131 63.458  1.00 53.48  ? 230  ILE C CG1   1 
ATOM   8399  C  CG2   . ILE C  3  230 ? 32.151  118.867 61.144  1.00 53.30  ? 230  ILE C CG2   1 
ATOM   8400  C  CD1   . ILE C  3  230 ? 34.248  117.915 63.117  1.00 59.84  ? 230  ILE C CD1   1 
ATOM   8401  N  N     . LEU C  3  231 ? 29.108  117.283 60.926  1.00 50.71  ? 231  LEU C N     1 
ATOM   8402  C  CA    . LEU C  3  231 ? 28.199  117.464 59.808  1.00 51.69  ? 231  LEU C CA    1 
ATOM   8403  C  C     . LEU C  3  231 ? 26.857  117.954 60.371  1.00 51.53  ? 231  LEU C C     1 
ATOM   8404  O  O     . LEU C  3  231 ? 26.209  118.846 59.811  1.00 49.83  ? 231  LEU C O     1 
ATOM   8405  C  CB    . LEU C  3  231 ? 27.992  116.140 59.074  1.00 50.98  ? 231  LEU C CB    1 
ATOM   8406  C  CG    . LEU C  3  231 ? 26.961  116.280 57.949  1.00 51.64  ? 231  LEU C CG    1 
ATOM   8407  C  CD1   . LEU C  3  231 ? 27.478  117.253 56.927  1.00 50.52  ? 231  LEU C CD1   1 
ATOM   8408  C  CD2   . LEU C  3  231 ? 26.690  114.950 57.303  1.00 51.91  ? 231  LEU C CD2   1 
ATOM   8409  N  N     . GLY C  3  232 ? 26.457  117.349 61.485  1.00 51.14  ? 232  GLY C N     1 
ATOM   8410  C  CA    . GLY C  3  232 ? 25.221  117.721 62.133  1.00 51.99  ? 232  GLY C CA    1 
ATOM   8411  C  C     . GLY C  3  232 ? 25.290  119.164 62.573  1.00 53.98  ? 232  GLY C C     1 
ATOM   8412  O  O     . GLY C  3  232 ? 24.308  119.891 62.468  1.00 55.41  ? 232  GLY C O     1 
ATOM   8413  N  N     . LEU C  3  233 ? 26.451  119.584 63.071  1.00 55.70  ? 233  LEU C N     1 
ATOM   8414  C  CA    . LEU C  3  233 ? 26.654  120.959 63.518  1.00 55.62  ? 233  LEU C CA    1 
ATOM   8415  C  C     . LEU C  3  233 ? 26.443  121.928 62.364  1.00 56.13  ? 233  LEU C C     1 
ATOM   8416  O  O     . LEU C  3  233 ? 25.688  122.877 62.497  1.00 57.85  ? 233  LEU C O     1 
ATOM   8417  C  CB    . LEU C  3  233 ? 28.066  121.142 64.072  1.00 56.41  ? 233  LEU C CB    1 
ATOM   8418  C  CG    . LEU C  3  233 ? 28.468  122.542 64.546  1.00 56.33  ? 233  LEU C CG    1 
ATOM   8419  C  CD1   . LEU C  3  233 ? 27.710  122.858 65.804  1.00 55.84  ? 233  LEU C CD1   1 
ATOM   8420  C  CD2   . LEU C  3  233 ? 29.968  122.616 64.816  1.00 54.18  ? 233  LEU C CD2   1 
ATOM   8421  N  N     . THR C  3  234 ? 27.099  121.702 61.230  1.00 56.80  ? 234  THR C N     1 
ATOM   8422  C  CA    . THR C  3  234 ? 26.928  122.604 60.076  1.00 58.05  ? 234  THR C CA    1 
ATOM   8423  C  C     . THR C  3  234 ? 25.506  122.596 59.523  1.00 56.68  ? 234  THR C C     1 
ATOM   8424  O  O     . THR C  3  234 ? 25.014  123.614 59.039  1.00 56.19  ? 234  THR C O     1 
ATOM   8425  C  CB    . THR C  3  234 ? 27.861  122.254 58.895  1.00 58.20  ? 234  THR C CB    1 
ATOM   8426  O  OG1   . THR C  3  234 ? 27.437  121.019 58.309  1.00 62.16  ? 234  THR C OG1   1 
ATOM   8427  C  CG2   . THR C  3  234 ? 29.296  122.145 59.363  1.00 57.68  ? 234  THR C CG2   1 
ATOM   8428  N  N     . LEU C  3  235 ? 24.855  121.443 59.572  1.00 55.67  ? 235  LEU C N     1 
ATOM   8429  C  CA    . LEU C  3  235 ? 23.505  121.372 59.084  1.00 56.25  ? 235  LEU C CA    1 
ATOM   8430  C  C     . LEU C  3  235 ? 22.540  122.196 59.936  1.00 58.20  ? 235  LEU C C     1 
ATOM   8431  O  O     . LEU C  3  235 ? 21.624  122.815 59.405  1.00 59.27  ? 235  LEU C O     1 
ATOM   8432  C  CB    . LEU C  3  235 ? 23.058  119.926 58.999  1.00 54.61  ? 235  LEU C CB    1 
ATOM   8433  C  CG    . LEU C  3  235 ? 23.713  119.223 57.813  1.00 54.62  ? 235  LEU C CG    1 
ATOM   8434  C  CD1   . LEU C  3  235 ? 23.221  117.791 57.733  1.00 54.06  ? 235  LEU C CD1   1 
ATOM   8435  C  CD2   . LEU C  3  235 ? 23.380  119.964 56.529  1.00 51.92  ? 235  LEU C CD2   1 
ATOM   8436  N  N     . MET C  3  236 ? 22.727  122.230 61.247  1.00 59.87  ? 236  MET C N     1 
ATOM   8437  C  CA    . MET C  3  236 ? 21.828  123.040 62.059  1.00 63.18  ? 236  MET C CA    1 
ATOM   8438  C  C     . MET C  3  236 ? 22.256  124.495 62.026  1.00 64.45  ? 236  MET C C     1 
ATOM   8439  O  O     . MET C  3  236 ? 21.433  125.406 61.957  1.00 65.83  ? 236  MET C O     1 
ATOM   8440  C  CB    . MET C  3  236 ? 21.795  122.543 63.494  1.00 65.23  ? 236  MET C CB    1 
ATOM   8441  C  CG    . MET C  3  236 ? 21.002  121.235 63.651  1.00 71.07  ? 236  MET C CG    1 
ATOM   8442  S  SD    . MET C  3  236 ? 19.258  121.330 63.112  1.00 74.15  ? 236  MET C SD    1 
ATOM   8443  C  CE    . MET C  3  236 ? 18.523  122.345 64.422  1.00 68.04  ? 236  MET C CE    1 
ATOM   8444  N  N     . LEU C  3  237 ? 23.560  124.706 62.049  1.00 64.65  ? 237  LEU C N     1 
ATOM   8445  C  CA    . LEU C  3  237 ? 24.124  126.039 62.023  1.00 63.59  ? 237  LEU C CA    1 
ATOM   8446  C  C     . LEU C  3  237 ? 23.590  126.891 60.870  1.00 62.62  ? 237  LEU C C     1 
ATOM   8447  O  O     . LEU C  3  237 ? 23.443  128.102 61.010  1.00 62.31  ? 237  LEU C O     1 
ATOM   8448  C  CB    . LEU C  3  237 ? 25.641  125.927 61.924  1.00 65.08  ? 237  LEU C CB    1 
ATOM   8449  C  CG    . LEU C  3  237 ? 26.482  126.979 62.633  1.00 65.72  ? 237  LEU C CG    1 
ATOM   8450  C  CD1   . LEU C  3  237 ? 26.065  127.080 64.101  1.00 65.91  ? 237  LEU C CD1   1 
ATOM   8451  C  CD2   . LEU C  3  237 ? 27.945  126.589 62.502  1.00 65.06  ? 237  LEU C CD2   1 
ATOM   8452  N  N     . THR C  3  238 ? 23.295  126.275 59.732  1.00 61.93  ? 238  THR C N     1 
ATOM   8453  C  CA    . THR C  3  238 ? 22.794  127.052 58.600  1.00 63.26  ? 238  THR C CA    1 
ATOM   8454  C  C     . THR C  3  238 ? 21.458  127.779 58.866  1.00 63.86  ? 238  THR C C     1 
ATOM   8455  O  O     . THR C  3  238 ? 21.365  128.992 58.674  1.00 65.74  ? 238  THR C O     1 
ATOM   8456  C  CB    . THR C  3  238 ? 22.660  126.195 57.328  1.00 63.53  ? 238  THR C CB    1 
ATOM   8457  O  OG1   . THR C  3  238 ? 23.935  125.625 56.981  1.00 61.44  ? 238  THR C OG1   1 
ATOM   8458  C  CG2   . THR C  3  238 ? 22.175  127.065 56.182  1.00 63.75  ? 238  THR C CG2   1 
ATOM   8459  N  N     . PRO C  3  239 ? 20.405  127.057 59.283  1.00 62.61  ? 239  PRO C N     1 
ATOM   8460  C  CA    . PRO C  3  239 ? 19.139  127.749 59.550  1.00 61.42  ? 239  PRO C CA    1 
ATOM   8461  C  C     . PRO C  3  239 ? 19.335  128.817 60.626  1.00 61.63  ? 239  PRO C C     1 
ATOM   8462  O  O     . PRO C  3  239 ? 18.790  129.912 60.538  1.00 61.47  ? 239  PRO C O     1 
ATOM   8463  C  CB    . PRO C  3  239 ? 18.239  126.629 60.016  1.00 60.62  ? 239  PRO C CB    1 
ATOM   8464  C  CG    . PRO C  3  239 ? 18.711  125.504 59.179  1.00 61.99  ? 239  PRO C CG    1 
ATOM   8465  C  CD    . PRO C  3  239 ? 20.205  125.602 59.279  1.00 61.43  ? 239  PRO C CD    1 
ATOM   8466  N  N     . PHE C  3  240 ? 20.120  128.484 61.644  1.00 62.26  ? 240  PHE C N     1 
ATOM   8467  C  CA    . PHE C  3  240 ? 20.429  129.407 62.742  1.00 63.33  ? 240  PHE C CA    1 
ATOM   8468  C  C     . PHE C  3  240 ? 20.896  130.748 62.188  1.00 62.48  ? 240  PHE C C     1 
ATOM   8469  O  O     . PHE C  3  240 ? 20.209  131.758 62.324  1.00 63.38  ? 240  PHE C O     1 
ATOM   8470  C  CB    . PHE C  3  240 ? 21.546  128.804 63.616  1.00 66.49  ? 240  PHE C CB    1 
ATOM   8471  C  CG    . PHE C  3  240 ? 22.006  129.681 64.775  1.00 67.54  ? 240  PHE C CG    1 
ATOM   8472  C  CD1   . PHE C  3  240 ? 23.326  129.606 65.229  1.00 67.90  ? 240  PHE C CD1   1 
ATOM   8473  C  CD2   . PHE C  3  240 ? 21.136  130.533 65.434  1.00 69.40  ? 240  PHE C CD2   1 
ATOM   8474  C  CE1   . PHE C  3  240 ? 23.771  130.362 66.314  1.00 66.62  ? 240  PHE C CE1   1 
ATOM   8475  C  CE2   . PHE C  3  240 ? 21.581  131.295 66.529  1.00 70.22  ? 240  PHE C CE2   1 
ATOM   8476  C  CZ    . PHE C  3  240 ? 22.902  131.204 66.960  1.00 67.87  ? 240  PHE C CZ    1 
ATOM   8477  N  N     . LEU C  3  241 ? 22.067  130.741 61.558  1.00 60.05  ? 241  LEU C N     1 
ATOM   8478  C  CA    . LEU C  3  241 ? 22.647  131.947 61.001  1.00 58.44  ? 241  LEU C CA    1 
ATOM   8479  C  C     . LEU C  3  241 ? 21.753  132.658 60.013  1.00 58.51  ? 241  LEU C C     1 
ATOM   8480  O  O     . LEU C  3  241 ? 21.744  133.891 59.969  1.00 57.72  ? 241  LEU C O     1 
ATOM   8481  C  CB    . LEU C  3  241 ? 23.966  131.622 60.327  1.00 57.62  ? 241  LEU C CB    1 
ATOM   8482  C  CG    . LEU C  3  241 ? 24.988  131.026 61.276  1.00 55.05  ? 241  LEU C CG    1 
ATOM   8483  C  CD1   . LEU C  3  241 ? 26.348  131.042 60.615  1.00 55.61  ? 241  LEU C CD1   1 
ATOM   8484  C  CD2   . LEU C  3  241 ? 25.012  131.833 62.549  1.00 52.86  ? 241  LEU C CD2   1 
ATOM   8485  N  N     . THR C  3  242 ? 21.023  131.879 59.212  1.00 58.61  ? 242  THR C N     1 
ATOM   8486  C  CA    . THR C  3  242 ? 20.092  132.420 58.216  1.00 58.86  ? 242  THR C CA    1 
ATOM   8487  C  C     . THR C  3  242 ? 19.022  133.236 58.908  1.00 59.83  ? 242  THR C C     1 
ATOM   8488  O  O     . THR C  3  242 ? 18.623  134.292 58.434  1.00 59.36  ? 242  THR C O     1 
ATOM   8489  C  CB    . THR C  3  242 ? 19.404  131.317 57.441  1.00 58.35  ? 242  THR C CB    1 
ATOM   8490  O  OG1   . THR C  3  242 ? 20.336  130.729 56.529  1.00 61.50  ? 242  THR C OG1   1 
ATOM   8491  C  CG2   . THR C  3  242 ? 18.235  131.858 56.683  1.00 56.77  ? 242  THR C CG2   1 
ATOM   8492  N  N     . LEU C  3  243 ? 18.564  132.729 60.042  1.00 61.57  ? 243  LEU C N     1 
ATOM   8493  C  CA    . LEU C  3  243 ? 17.568  133.413 60.840  1.00 62.83  ? 243  LEU C CA    1 
ATOM   8494  C  C     . LEU C  3  243 ? 18.185  134.640 61.525  1.00 62.81  ? 243  LEU C C     1 
ATOM   8495  O  O     . LEU C  3  243 ? 17.700  135.753 61.385  1.00 63.84  ? 243  LEU C O     1 
ATOM   8496  C  CB    . LEU C  3  243 ? 17.025  132.465 61.900  1.00 64.57  ? 243  LEU C CB    1 
ATOM   8497  C  CG    . LEU C  3  243 ? 16.008  133.137 62.814  1.00 66.84  ? 243  LEU C CG    1 
ATOM   8498  C  CD1   . LEU C  3  243 ? 14.790  133.476 61.960  1.00 66.78  ? 243  LEU C CD1   1 
ATOM   8499  C  CD2   . LEU C  3  243 ? 15.647  132.239 64.004  1.00 66.09  ? 243  LEU C CD2   1 
ATOM   8500  N  N     . ALA C  3  244 ? 19.265  134.432 62.263  1.00 63.21  ? 244  ALA C N     1 
ATOM   8501  C  CA    . ALA C  3  244 ? 19.926  135.522 62.978  1.00 63.77  ? 244  ALA C CA    1 
ATOM   8502  C  C     . ALA C  3  244 ? 20.556  136.580 62.078  1.00 63.49  ? 244  ALA C C     1 
ATOM   8503  O  O     . ALA C  3  244 ? 21.001  137.626 62.557  1.00 64.58  ? 244  ALA C O     1 
ATOM   8504  C  CB    . ALA C  3  244 ? 20.997  134.955 63.927  1.00 64.50  ? 244  ALA C CB    1 
ATOM   8505  N  N     . LEU C  3  245 ? 20.626  136.316 60.784  1.00 61.52  ? 245  LEU C N     1 
ATOM   8506  C  CA    . LEU C  3  245 ? 21.219  137.299 59.908  1.00 60.30  ? 245  LEU C CA    1 
ATOM   8507  C  C     . LEU C  3  245 ? 20.214  137.909 58.958  1.00 61.46  ? 245  LEU C C     1 
ATOM   8508  O  O     . LEU C  3  245 ? 20.343  139.070 58.581  1.00 61.62  ? 245  LEU C O     1 
ATOM   8509  C  CB    . LEU C  3  245 ? 22.366  136.694 59.111  1.00 59.07  ? 245  LEU C CB    1 
ATOM   8510  C  CG    . LEU C  3  245 ? 23.696  136.577 59.836  1.00 58.57  ? 245  LEU C CG    1 
ATOM   8511  C  CD1   . LEU C  3  245 ? 24.779  136.423 58.798  1.00 59.08  ? 245  LEU C CD1   1 
ATOM   8512  C  CD2   . LEU C  3  245 ? 23.968  137.816 60.666  1.00 57.36  ? 245  LEU C CD2   1 
ATOM   8513  N  N     . PHE C  3  246 ? 19.205  137.143 58.562  1.00 61.56  ? 246  PHE C N     1 
ATOM   8514  C  CA    . PHE C  3  246 ? 18.236  137.693 57.641  1.00 61.16  ? 246  PHE C CA    1 
ATOM   8515  C  C     . PHE C  3  246 ? 16.955  138.160 58.291  1.00 63.13  ? 246  PHE C C     1 
ATOM   8516  O  O     . PHE C  3  246 ? 16.397  139.162 57.872  1.00 66.35  ? 246  PHE C O     1 
ATOM   8517  C  CB    . PHE C  3  246 ? 17.958  136.702 56.525  1.00 58.47  ? 246  PHE C CB    1 
ATOM   8518  C  CG    . PHE C  3  246 ? 19.098  136.565 55.555  1.00 57.03  ? 246  PHE C CG    1 
ATOM   8519  C  CD1   . PHE C  3  246 ? 19.720  135.338 55.348  1.00 54.46  ? 246  PHE C CD1   1 
ATOM   8520  C  CD2   . PHE C  3  246 ? 19.539  137.664 54.828  1.00 55.90  ? 246  PHE C CD2   1 
ATOM   8521  C  CE1   . PHE C  3  246 ? 20.759  135.210 54.433  1.00 53.79  ? 246  PHE C CE1   1 
ATOM   8522  C  CE2   . PHE C  3  246 ? 20.584  137.538 53.907  1.00 55.30  ? 246  PHE C CE2   1 
ATOM   8523  C  CZ    . PHE C  3  246 ? 21.191  136.308 53.711  1.00 52.68  ? 246  PHE C CZ    1 
ATOM   8524  N  N     . SER C  3  247 ? 16.497  137.469 59.324  1.00 63.61  ? 247  SER C N     1 
ATOM   8525  C  CA    . SER C  3  247 ? 15.270  137.862 60.009  1.00 64.61  ? 247  SER C CA    1 
ATOM   8526  C  C     . SER C  3  247 ? 15.553  137.852 61.509  1.00 64.95  ? 247  SER C C     1 
ATOM   8527  O  O     . SER C  3  247 ? 14.978  137.073 62.267  1.00 66.70  ? 247  SER C O     1 
ATOM   8528  C  CB    . SER C  3  247 ? 14.160  136.876 59.668  1.00 64.63  ? 247  SER C CB    1 
ATOM   8529  O  OG    . SER C  3  247 ? 12.963  137.256 60.315  1.00 68.72  ? 247  SER C OG    1 
ATOM   8530  N  N     . PRO C  3  248 ? 16.436  138.743 61.954  1.00 64.23  ? 248  PRO C N     1 
ATOM   8531  C  CA    . PRO C  3  248 ? 16.906  138.942 63.330  1.00 64.21  ? 248  PRO C CA    1 
ATOM   8532  C  C     . PRO C  3  248 ? 15.872  139.003 64.443  1.00 64.92  ? 248  PRO C C     1 
ATOM   8533  O  O     . PRO C  3  248 ? 16.138  138.560 65.569  1.00 64.45  ? 248  PRO C O     1 
ATOM   8534  C  CB    . PRO C  3  248 ? 17.691  140.247 63.254  1.00 63.63  ? 248  PRO C CB    1 
ATOM   8535  C  CG    . PRO C  3  248 ? 18.063  140.359 61.813  1.00 66.04  ? 248  PRO C CG    1 
ATOM   8536  C  CD    . PRO C  3  248 ? 16.847  139.862 61.098  1.00 64.72  ? 248  PRO C CD    1 
ATOM   8537  N  N     . ASN C  3  249 ? 14.698  139.553 64.147  1.00 65.79  ? 249  ASN C N     1 
ATOM   8538  C  CA    . ASN C  3  249 ? 13.693  139.701 65.189  1.00 64.91  ? 249  ASN C CA    1 
ATOM   8539  C  C     . ASN C  3  249 ? 12.460  138.871 64.985  1.00 63.75  ? 249  ASN C C     1 
ATOM   8540  O  O     . ASN C  3  249 ? 11.472  139.077 65.677  1.00 66.01  ? 249  ASN C O     1 
ATOM   8541  C  CB    . ASN C  3  249 ? 13.288  141.165 65.308  1.00 66.13  ? 249  ASN C CB    1 
ATOM   8542  C  CG    . ASN C  3  249 ? 14.490  142.095 65.458  1.00 68.67  ? 249  ASN C CG    1 
ATOM   8543  O  OD1   . ASN C  3  249 ? 15.257  142.004 66.433  1.00 67.08  ? 249  ASN C OD1   1 
ATOM   8544  N  ND2   . ASN C  3  249 ? 14.662  143.002 64.483  1.00 69.35  ? 249  ASN C ND2   1 
ATOM   8545  N  N     . LEU C  3  250 ? 12.505  137.933 64.050  1.00 60.62  ? 250  LEU C N     1 
ATOM   8546  C  CA    . LEU C  3  250 ? 11.345  137.098 63.786  1.00 58.44  ? 250  LEU C CA    1 
ATOM   8547  C  C     . LEU C  3  250 ? 10.691  136.567 65.059  1.00 57.80  ? 250  LEU C C     1 
ATOM   8548  O  O     . LEU C  3  250 ? 9.524   136.820 65.336  1.00 57.73  ? 250  LEU C O     1 
ATOM   8549  C  CB    . LEU C  3  250 ? 11.735  135.917 62.913  1.00 57.60  ? 250  LEU C CB    1 
ATOM   8550  C  CG    . LEU C  3  250 ? 10.593  135.211 62.193  1.00 56.18  ? 250  LEU C CG    1 
ATOM   8551  C  CD1   . LEU C  3  250 ? 10.191  136.023 60.971  1.00 54.74  ? 250  LEU C CD1   1 
ATOM   8552  C  CD2   . LEU C  3  250 ? 11.035  133.840 61.764  1.00 55.85  ? 250  LEU C CD2   1 
ATOM   8553  N  N     . LEU C  3  251 ? 11.464  135.842 65.845  1.00 58.05  ? 251  LEU C N     1 
ATOM   8554  C  CA    . LEU C  3  251 ? 10.954  135.233 67.060  1.00 58.13  ? 251  LEU C CA    1 
ATOM   8555  C  C     . LEU C  3  251 ? 10.771  136.134 68.273  1.00 57.67  ? 251  LEU C C     1 
ATOM   8556  O  O     . LEU C  3  251 ? 10.314  135.665 69.317  1.00 59.19  ? 251  LEU C O     1 
ATOM   8557  C  CB    . LEU C  3  251 ? 11.868  134.079 67.452  1.00 59.46  ? 251  LEU C CB    1 
ATOM   8558  C  CG    . LEU C  3  251 ? 12.034  132.997 66.384  1.00 61.80  ? 251  LEU C CG    1 
ATOM   8559  C  CD1   . LEU C  3  251 ? 13.218  132.074 66.737  1.00 61.97  ? 251  LEU C CD1   1 
ATOM   8560  C  CD2   . LEU C  3  251 ? 10.725  132.224 66.263  1.00 60.34  ? 251  LEU C CD2   1 
ATOM   8561  N  N     . GLY C  3  252 ? 11.102  137.413 68.159  1.00 56.19  ? 252  GLY C N     1 
ATOM   8562  C  CA    . GLY C  3  252 ? 10.991  138.267 69.328  1.00 56.01  ? 252  GLY C CA    1 
ATOM   8563  C  C     . GLY C  3  252 ? 9.921   139.328 69.382  1.00 55.99  ? 252  GLY C C     1 
ATOM   8564  O  O     . GLY C  3  252 ? 9.548   139.921 68.364  1.00 57.62  ? 252  GLY C O     1 
ATOM   8565  N  N     . ASP C  3  253 ? 9.454   139.591 70.598  1.00 55.75  ? 253  ASP C N     1 
ATOM   8566  C  CA    . ASP C  3  253 ? 8.409   140.584 70.826  1.00 55.82  ? 253  ASP C CA    1 
ATOM   8567  C  C     . ASP C  3  253 ? 8.900   142.006 70.599  1.00 54.93  ? 253  ASP C C     1 
ATOM   8568  O  O     . ASP C  3  253 ? 9.957   142.403 71.103  1.00 55.99  ? 253  ASP C O     1 
ATOM   8569  C  CB    . ASP C  3  253 ? 7.874   140.477 72.252  1.00 58.47  ? 253  ASP C CB    1 
ATOM   8570  C  CG    . ASP C  3  253 ? 6.469   141.034 72.386  1.00 61.79  ? 253  ASP C CG    1 
ATOM   8571  O  OD1   . ASP C  3  253 ? 6.217   142.145 71.863  1.00 63.63  ? 253  ASP C OD1   1 
ATOM   8572  O  OD2   . ASP C  3  253 ? 5.616   140.362 73.018  1.00 64.20  ? 253  ASP C OD2   1 
ATOM   8573  N  N     . PRO C  3  254 ? 8.143   142.797 69.823  1.00 53.06  ? 254  PRO C N     1 
ATOM   8574  C  CA    . PRO C  3  254 ? 8.531   144.182 69.553  1.00 51.41  ? 254  PRO C CA    1 
ATOM   8575  C  C     . PRO C  3  254 ? 8.392   145.034 70.797  1.00 50.32  ? 254  PRO C C     1 
ATOM   8576  O  O     . PRO C  3  254 ? 9.040   146.062 70.940  1.00 52.03  ? 254  PRO C O     1 
ATOM   8577  C  CB    . PRO C  3  254 ? 7.572   144.594 68.450  1.00 50.34  ? 254  PRO C CB    1 
ATOM   8578  C  CG    . PRO C  3  254 ? 6.399   143.732 68.686  1.00 50.26  ? 254  PRO C CG    1 
ATOM   8579  C  CD    . PRO C  3  254 ? 7.001   142.412 68.984  1.00 51.03  ? 254  PRO C CD    1 
ATOM   8580  N  N     . GLU C  3  255 ? 7.543   144.578 71.703  1.00 49.45  ? 255  GLU C N     1 
ATOM   8581  C  CA    . GLU C  3  255 ? 7.289   145.270 72.951  1.00 48.21  ? 255  GLU C CA    1 
ATOM   8582  C  C     . GLU C  3  255 ? 8.595   145.417 73.736  1.00 46.22  ? 255  GLU C C     1 
ATOM   8583  O  O     . GLU C  3  255 ? 8.716   146.260 74.629  1.00 45.43  ? 255  GLU C O     1 
ATOM   8584  C  CB    . GLU C  3  255 ? 6.252   144.475 73.758  1.00 49.67  ? 255  GLU C CB    1 
ATOM   8585  C  CG    . GLU C  3  255 ? 5.569   145.255 74.880  1.00 56.36  ? 255  GLU C CG    1 
ATOM   8586  C  CD    . GLU C  3  255 ? 4.492   146.224 74.386  1.00 59.72  ? 255  GLU C CD    1 
ATOM   8587  O  OE1   . GLU C  3  255 ? 3.402   145.740 73.994  1.00 61.57  ? 255  GLU C OE1   1 
ATOM   8588  O  OE2   . GLU C  3  255 ? 4.733   147.464 74.390  1.00 62.61  ? 255  GLU C OE2   1 
ATOM   8589  N  N     . ASN C  3  256 ? 9.592   144.617 73.385  1.00 45.55  ? 256  ASN C N     1 
ATOM   8590  C  CA    . ASN C  3  256 ? 10.845  144.692 74.106  1.00 45.44  ? 256  ASN C CA    1 
ATOM   8591  C  C     . ASN C  3  256 ? 11.827  145.701 73.561  1.00 46.20  ? 256  ASN C C     1 
ATOM   8592  O  O     . ASN C  3  256 ? 13.010  145.674 73.907  1.00 46.32  ? 256  ASN C O     1 
ATOM   8593  C  CB    . ASN C  3  256 ? 11.490  143.329 74.200  1.00 45.99  ? 256  ASN C CB    1 
ATOM   8594  C  CG    . ASN C  3  256 ? 11.856  142.975 75.625  1.00 48.83  ? 256  ASN C CG    1 
ATOM   8595  O  OD1   . ASN C  3  256 ? 11.276  143.513 76.580  1.00 48.84  ? 256  ASN C OD1   1 
ATOM   8596  N  ND2   . ASN C  3  256 ? 12.811  142.054 75.785  1.00 51.12  ? 256  ASN C ND2   1 
ATOM   8597  N  N     . PHE C  3  257 ? 11.321  146.592 72.710  1.00 46.01  ? 257  PHE C N     1 
ATOM   8598  C  CA    . PHE C  3  257 ? 12.103  147.680 72.145  1.00 45.21  ? 257  PHE C CA    1 
ATOM   8599  C  C     . PHE C  3  257 ? 11.615  148.966 72.778  1.00 46.20  ? 257  PHE C C     1 
ATOM   8600  O  O     . PHE C  3  257 ? 11.817  150.062 72.255  1.00 45.73  ? 257  PHE C O     1 
ATOM   8601  C  CB    . PHE C  3  257 ? 11.901  147.766 70.662  1.00 45.02  ? 257  PHE C CB    1 
ATOM   8602  C  CG    . PHE C  3  257 ? 12.797  146.876 69.900  1.00 46.85  ? 257  PHE C CG    1 
ATOM   8603  C  CD1   . PHE C  3  257 ? 12.517  145.535 69.777  1.00 46.59  ? 257  PHE C CD1   1 
ATOM   8604  C  CD2   . PHE C  3  257 ? 13.933  147.387 69.281  1.00 48.17  ? 257  PHE C CD2   1 
ATOM   8605  C  CE1   . PHE C  3  257 ? 13.351  144.718 69.046  1.00 47.46  ? 257  PHE C CE1   1 
ATOM   8606  C  CE2   . PHE C  3  257 ? 14.772  146.571 68.546  1.00 46.94  ? 257  PHE C CE2   1 
ATOM   8607  C  CZ    . PHE C  3  257 ? 14.482  145.240 68.429  1.00 45.92  ? 257  PHE C CZ    1 
ATOM   8608  N  N     . THR C  3  258 ? 10.949  148.800 73.913  1.00 47.13  ? 258  THR C N     1 
ATOM   8609  C  CA    . THR C  3  258 ? 10.402  149.901 74.665  1.00 47.84  ? 258  THR C CA    1 
ATOM   8610  C  C     . THR C  3  258 ? 10.873  149.730 76.081  1.00 49.33  ? 258  THR C C     1 
ATOM   8611  O  O     . THR C  3  258 ? 10.640  148.689 76.687  1.00 52.50  ? 258  THR C O     1 
ATOM   8612  C  CB    . THR C  3  258 ? 8.895   149.843 74.670  1.00 46.40  ? 258  THR C CB    1 
ATOM   8613  O  OG1   . THR C  3  258 ? 8.410   150.019 73.340  1.00 51.41  ? 258  THR C OG1   1 
ATOM   8614  C  CG2   . THR C  3  258 ? 8.347   150.927 75.525  1.00 47.21  ? 258  THR C CG2   1 
ATOM   8615  N  N     . PRO C  3  259 ? 11.555  150.737 76.632  1.00 48.77  ? 259  PRO C N     1 
ATOM   8616  C  CA    . PRO C  3  259 ? 12.032  150.622 78.009  1.00 49.60  ? 259  PRO C CA    1 
ATOM   8617  C  C     . PRO C  3  259 ? 10.906  150.304 79.005  1.00 51.29  ? 259  PRO C C     1 
ATOM   8618  O  O     . PRO C  3  259 ? 9.817   150.884 78.963  1.00 50.99  ? 259  PRO C O     1 
ATOM   8619  C  CB    . PRO C  3  259 ? 12.676  151.976 78.249  1.00 49.58  ? 259  PRO C CB    1 
ATOM   8620  C  CG    . PRO C  3  259 ? 13.222  152.314 76.903  1.00 48.29  ? 259  PRO C CG    1 
ATOM   8621  C  CD    . PRO C  3  259 ? 12.091  151.943 75.987  1.00 48.29  ? 259  PRO C CD    1 
ATOM   8622  N  N     . ALA C  3  260 ? 11.184  149.365 79.901  1.00 53.72  ? 260  ALA C N     1 
ATOM   8623  C  CA    . ALA C  3  260 ? 10.213  148.947 80.897  1.00 53.99  ? 260  ALA C CA    1 
ATOM   8624  C  C     . ALA C  3  260 ? 9.530   150.149 81.529  1.00 54.00  ? 260  ALA C C     1 
ATOM   8625  O  O     . ALA C  3  260 ? 10.148  151.177 81.757  1.00 53.50  ? 260  ALA C O     1 
ATOM   8626  C  CB    . ALA C  3  260 ? 10.902  148.099 81.972  1.00 51.72  ? 260  ALA C CB    1 
ATOM   8627  N  N     . ASN C  3  261 ? 8.238   150.003 81.785  1.00 55.27  ? 261  ASN C N     1 
ATOM   8628  C  CA    . ASN C  3  261 ? 7.433   151.037 82.410  1.00 55.06  ? 261  ASN C CA    1 
ATOM   8629  C  C     . ASN C  3  261 ? 6.412   150.344 83.307  1.00 53.74  ? 261  ASN C C     1 
ATOM   8630  O  O     . ASN C  3  261 ? 5.459   149.730 82.826  1.00 51.99  ? 261  ASN C O     1 
ATOM   8631  C  CB    . ASN C  3  261 ? 6.714   151.860 81.350  1.00 57.52  ? 261  ASN C CB    1 
ATOM   8632  C  CG    . ASN C  3  261 ? 5.736   152.831 81.956  1.00 59.51  ? 261  ASN C CG    1 
ATOM   8633  O  OD1   . ASN C  3  261 ? 5.575   152.887 83.185  1.00 58.68  ? 261  ASN C OD1   1 
ATOM   8634  N  ND2   . ASN C  3  261 ? 5.075   153.607 81.107  1.00 58.83  ? 261  ASN C ND2   1 
ATOM   8635  N  N     . PRO C  3  262 ? 6.609   150.437 84.624  1.00 52.78  ? 262  PRO C N     1 
ATOM   8636  C  CA    . PRO C  3  262 ? 5.760   149.843 85.655  1.00 54.09  ? 262  PRO C CA    1 
ATOM   8637  C  C     . PRO C  3  262 ? 4.329   150.341 85.617  1.00 56.22  ? 262  PRO C C     1 
ATOM   8638  O  O     . PRO C  3  262 ? 3.448   149.720 86.200  1.00 57.59  ? 262  PRO C O     1 
ATOM   8639  C  CB    . PRO C  3  262 ? 6.443   150.264 86.953  1.00 52.79  ? 262  PRO C CB    1 
ATOM   8640  C  CG    . PRO C  3  262 ? 7.830   150.461 86.562  1.00 52.45  ? 262  PRO C CG    1 
ATOM   8641  C  CD    . PRO C  3  262 ? 7.712   151.171 85.247  1.00 52.20  ? 262  PRO C CD    1 
ATOM   8642  N  N     . LEU C  3  263 ? 4.103   151.467 84.941  1.00 57.52  ? 263  LEU C N     1 
ATOM   8643  C  CA    . LEU C  3  263 ? 2.778   152.080 84.869  1.00 57.00  ? 263  LEU C CA    1 
ATOM   8644  C  C     . LEU C  3  263 ? 2.105   151.899 83.535  1.00 56.47  ? 263  LEU C C     1 
ATOM   8645  O  O     . LEU C  3  263 ? 1.346   152.754 83.108  1.00 57.01  ? 263  LEU C O     1 
ATOM   8646  C  CB    . LEU C  3  263 ? 2.879   153.578 85.149  1.00 58.83  ? 263  LEU C CB    1 
ATOM   8647  C  CG    . LEU C  3  263 ? 3.588   153.972 86.442  1.00 59.67  ? 263  LEU C CG    1 
ATOM   8648  C  CD1   . LEU C  3  263 ? 3.782   155.477 86.512  1.00 59.55  ? 263  LEU C CD1   1 
ATOM   8649  C  CD2   . LEU C  3  263 ? 2.767   153.469 87.607  1.00 61.88  ? 263  LEU C CD2   1 
ATOM   8650  N  N     . VAL C  3  264 ? 2.393   150.801 82.864  1.00 55.96  ? 264  VAL C N     1 
ATOM   8651  C  CA    . VAL C  3  264 ? 1.772   150.535 81.581  1.00 55.73  ? 264  VAL C CA    1 
ATOM   8652  C  C     . VAL C  3  264 ? 1.861   149.058 81.292  1.00 56.19  ? 264  VAL C C     1 
ATOM   8653  O  O     . VAL C  3  264 ? 2.922   148.539 80.942  1.00 57.63  ? 264  VAL C O     1 
ATOM   8654  C  CB    . VAL C  3  264 ? 2.460   151.286 80.453  1.00 54.49  ? 264  VAL C CB    1 
ATOM   8655  C  CG1   . VAL C  3  264 ? 1.930   150.813 79.126  1.00 55.34  ? 264  VAL C CG1   1 
ATOM   8656  C  CG2   . VAL C  3  264 ? 2.207   152.744 80.591  1.00 55.22  ? 264  VAL C CG2   1 
ATOM   8657  N  N     . THR C  3  265 ? 0.746   148.371 81.447  1.00 55.78  ? 265  THR C N     1 
ATOM   8658  C  CA    . THR C  3  265 ? 0.755   146.960 81.182  1.00 56.52  ? 265  THR C CA    1 
ATOM   8659  C  C     . THR C  3  265 ? 0.579   146.669 79.696  1.00 57.43  ? 265  THR C C     1 
ATOM   8660  O  O     . THR C  3  265 ? -0.310  147.221 79.029  1.00 57.52  ? 265  THR C O     1 
ATOM   8661  C  CB    . THR C  3  265 ? -0.328  146.285 81.951  1.00 55.97  ? 265  THR C CB    1 
ATOM   8662  O  OG1   . THR C  3  265 ? -0.216  146.675 83.324  1.00 57.28  ? 265  THR C OG1   1 
ATOM   8663  C  CG2   . THR C  3  265 ? -0.195  144.780 81.822  1.00 56.96  ? 265  THR C CG2   1 
ATOM   8664  N  N     . PRO C  3  266 ? 1.467   145.834 79.136  1.00 57.63  ? 266  PRO C N     1 
ATOM   8665  C  CA    . PRO C  3  266 ? 1.287   145.552 77.717  1.00 58.09  ? 266  PRO C CA    1 
ATOM   8666  C  C     . PRO C  3  266 ? -0.032  144.807 77.528  1.00 59.91  ? 266  PRO C C     1 
ATOM   8667  O  O     . PRO C  3  266 ? -0.513  144.122 78.436  1.00 59.91  ? 266  PRO C O     1 
ATOM   8668  C  CB    . PRO C  3  266 ? 2.512   144.713 77.392  1.00 57.38  ? 266  PRO C CB    1 
ATOM   8669  C  CG    . PRO C  3  266 ? 3.561   145.341 78.283  1.00 56.08  ? 266  PRO C CG    1 
ATOM   8670  C  CD    . PRO C  3  266 ? 2.813   145.434 79.585  1.00 55.57  ? 266  PRO C CD    1 
ATOM   8671  N  N     . PRO C  3  267 ? -0.643  144.939 76.347  1.00 61.90  ? 267  PRO C N     1 
ATOM   8672  C  CA    . PRO C  3  267 ? -1.915  144.275 76.050  1.00 63.27  ? 267  PRO C CA    1 
ATOM   8673  C  C     . PRO C  3  267 ? -1.802  142.751 76.103  1.00 65.19  ? 267  PRO C C     1 
ATOM   8674  O  O     . PRO C  3  267 ? -2.627  142.069 76.714  1.00 65.82  ? 267  PRO C O     1 
ATOM   8675  C  CB    . PRO C  3  267 ? -2.240  144.768 74.644  1.00 62.86  ? 267  PRO C CB    1 
ATOM   8676  C  CG    . PRO C  3  267 ? -1.500  146.067 74.538  1.00 62.39  ? 267  PRO C CG    1 
ATOM   8677  C  CD    . PRO C  3  267 ? -0.191  145.731 75.192  1.00 63.57  ? 267  PRO C CD    1 
ATOM   8678  N  N     . HIS C  3  268 ? -0.770  142.216 75.458  1.00 67.11  ? 268  HIS C N     1 
ATOM   8679  C  CA    . HIS C  3  268 ? -0.579  140.776 75.442  1.00 67.45  ? 268  HIS C CA    1 
ATOM   8680  C  C     . HIS C  3  268 ? 0.763   140.382 76.000  1.00 65.32  ? 268  HIS C C     1 
ATOM   8681  O  O     . HIS C  3  268 ? 1.787   140.512 75.313  1.00 67.05  ? 268  HIS C O     1 
ATOM   8682  C  CB    . HIS C  3  268 ? -0.735  140.257 74.020  1.00 71.03  ? 268  HIS C CB    1 
ATOM   8683  C  CG    . HIS C  3  268 ? -2.017  140.687 73.381  1.00 76.60  ? 268  HIS C CG    1 
ATOM   8684  N  ND1   . HIS C  3  268 ? -2.071  141.320 72.153  1.00 77.30  ? 268  HIS C ND1   1 
ATOM   8685  C  CD2   . HIS C  3  268 ? -3.294  140.623 73.829  1.00 78.20  ? 268  HIS C CD2   1 
ATOM   8686  C  CE1   . HIS C  3  268 ? -3.324  141.629 71.875  1.00 77.12  ? 268  HIS C CE1   1 
ATOM   8687  N  NE2   . HIS C  3  268 ? -4.086  141.217 72.876  1.00 79.38  ? 268  HIS C NE2   1 
ATOM   8688  N  N     . ILE C  3  269 ? 0.734   139.920 77.255  1.00 61.01  ? 269  ILE C N     1 
ATOM   8689  C  CA    . ILE C  3  269 ? 1.914   139.457 77.980  1.00 57.31  ? 269  ILE C CA    1 
ATOM   8690  C  C     . ILE C  3  269 ? 2.134   137.963 77.713  1.00 56.23  ? 269  ILE C C     1 
ATOM   8691  O  O     . ILE C  3  269 ? 1.656   137.110 78.459  1.00 57.19  ? 269  ILE C O     1 
ATOM   8692  C  CB    . ILE C  3  269 ? 1.754   139.698 79.502  1.00 54.71  ? 269  ILE C CB    1 
ATOM   8693  C  CG1   . ILE C  3  269 ? 1.898   141.181 79.793  1.00 54.01  ? 269  ILE C CG1   1 
ATOM   8694  C  CG2   . ILE C  3  269 ? 2.799   138.942 80.292  1.00 54.32  ? 269  ILE C CG2   1 
ATOM   8695  C  CD1   . ILE C  3  269 ? 2.011   141.505 81.262  1.00 53.59  ? 269  ILE C CD1   1 
ATOM   8696  N  N     . LYS C  3  270 ? 2.844   137.651 76.637  1.00 53.28  ? 270  LYS C N     1 
ATOM   8697  C  CA    . LYS C  3  270 ? 3.107   136.269 76.303  1.00 53.26  ? 270  LYS C CA    1 
ATOM   8698  C  C     . LYS C  3  270 ? 4.618   136.036 76.304  1.00 53.36  ? 270  LYS C C     1 
ATOM   8699  O  O     . LYS C  3  270 ? 5.393   136.950 76.043  1.00 55.17  ? 270  LYS C O     1 
ATOM   8700  C  CB    . LYS C  3  270 ? 2.514   135.942 74.933  1.00 53.79  ? 270  LYS C CB    1 
ATOM   8701  C  CG    . LYS C  3  270 ? 3.175   136.662 73.780  1.00 53.41  ? 270  LYS C CG    1 
ATOM   8702  C  CD    . LYS C  3  270 ? 2.553   136.240 72.467  1.00 57.60  ? 270  LYS C CD    1 
ATOM   8703  C  CE    . LYS C  3  270 ? 3.500   136.448 71.287  1.00 62.78  ? 270  LYS C CE    1 
ATOM   8704  N  NZ    . LYS C  3  270 ? 4.742   135.594 71.448  1.00 68.28  ? 270  LYS C NZ    1 
ATOM   8705  N  N     . PRO C  3  271 ? 5.055   134.807 76.603  1.00 51.58  ? 271  PRO C N     1 
ATOM   8706  C  CA    . PRO C  3  271 ? 6.469   134.443 76.645  1.00 49.97  ? 271  PRO C CA    1 
ATOM   8707  C  C     . PRO C  3  271 ? 7.093   134.170 75.288  1.00 49.52  ? 271  PRO C C     1 
ATOM   8708  O  O     . PRO C  3  271 ? 6.451   134.308 74.243  1.00 50.38  ? 271  PRO C O     1 
ATOM   8709  C  CB    . PRO C  3  271 ? 6.458   133.196 77.502  1.00 50.32  ? 271  PRO C CB    1 
ATOM   8710  C  CG    . PRO C  3  271 ? 5.217   132.544 77.057  1.00 52.08  ? 271  PRO C CG    1 
ATOM   8711  C  CD    . PRO C  3  271 ? 4.228   133.682 77.060  1.00 51.62  ? 271  PRO C CD    1 
ATOM   8712  N  N     . GLU C  3  272 ? 8.368   133.798 75.320  1.00 48.45  ? 272  GLU C N     1 
ATOM   8713  C  CA    . GLU C  3  272 ? 9.106   133.442 74.118  1.00 47.47  ? 272  GLU C CA    1 
ATOM   8714  C  C     . GLU C  3  272 ? 8.537   132.091 73.702  1.00 46.68  ? 272  GLU C C     1 
ATOM   8715  O  O     . GLU C  3  272 ? 8.072   131.321 74.545  1.00 47.23  ? 272  GLU C O     1 
ATOM   8716  C  CB    . GLU C  3  272 ? 10.571  133.304 74.452  1.00 49.10  ? 272  GLU C CB    1 
ATOM   8717  C  CG    . GLU C  3  272 ? 11.225  134.604 74.759  1.00 53.41  ? 272  GLU C CG    1 
ATOM   8718  C  CD    . GLU C  3  272 ? 11.264  135.482 73.540  1.00 58.34  ? 272  GLU C CD    1 
ATOM   8719  O  OE1   . GLU C  3  272 ? 11.905  135.071 72.542  1.00 57.89  ? 272  GLU C OE1   1 
ATOM   8720  O  OE2   . GLU C  3  272 ? 10.642  136.575 73.581  1.00 61.71  ? 272  GLU C OE2   1 
ATOM   8721  N  N     . TRP C  3  273 ? 8.580   131.770 72.421  1.00 44.84  ? 273  TRP C N     1 
ATOM   8722  C  CA    . TRP C  3  273 ? 7.982   130.516 72.000  1.00 43.31  ? 273  TRP C CA    1 
ATOM   8723  C  C     . TRP C  3  273 ? 8.243   129.344 72.929  1.00 44.12  ? 273  TRP C C     1 
ATOM   8724  O  O     . TRP C  3  273 ? 7.294   128.683 73.372  1.00 45.14  ? 273  TRP C O     1 
ATOM   8725  C  CB    . TRP C  3  273 ? 8.410   130.159 70.583  1.00 41.75  ? 273  TRP C CB    1 
ATOM   8726  C  CG    . TRP C  3  273 ? 9.835   129.818 70.426  1.00 43.31  ? 273  TRP C CG    1 
ATOM   8727  C  CD1   . TRP C  3  273 ? 10.862  130.669 70.132  1.00 43.92  ? 273  TRP C CD1   1 
ATOM   8728  C  CD2   . TRP C  3  273 ? 10.401  128.516 70.496  1.00 42.89  ? 273  TRP C CD2   1 
ATOM   8729  N  NE1   . TRP C  3  273 ? 12.035  129.968 70.005  1.00 43.03  ? 273  TRP C NE1   1 
ATOM   8730  C  CE2   . TRP C  3  273 ? 11.776  128.641 70.223  1.00 44.23  ? 273  TRP C CE2   1 
ATOM   8731  C  CE3   . TRP C  3  273 ? 9.876   127.249 70.759  1.00 43.60  ? 273  TRP C CE3   1 
ATOM   8732  C  CZ2   . TRP C  3  273 ? 12.636  127.541 70.204  1.00 46.72  ? 273  TRP C CZ2   1 
ATOM   8733  C  CZ3   . TRP C  3  273 ? 10.727  126.152 70.740  1.00 44.87  ? 273  TRP C CZ3   1 
ATOM   8734  C  CH2   . TRP C  3  273 ? 12.091  126.303 70.463  1.00 45.33  ? 273  TRP C CH2   1 
ATOM   8735  N  N     . TYR C  3  274 ? 9.516   129.106 73.253  1.00 43.90  ? 274  TYR C N     1 
ATOM   8736  C  CA    . TYR C  3  274 ? 9.889   127.981 74.108  1.00 43.35  ? 274  TYR C CA    1 
ATOM   8737  C  C     . TYR C  3  274 ? 9.265   127.871 75.504  1.00 43.26  ? 274  TYR C C     1 
ATOM   8738  O  O     . TYR C  3  274 ? 9.534   126.906 76.220  1.00 44.31  ? 274  TYR C O     1 
ATOM   8739  C  CB    . TYR C  3  274 ? 11.411  127.867 74.211  1.00 41.31  ? 274  TYR C CB    1 
ATOM   8740  C  CG    . TYR C  3  274 ? 12.137  129.123 74.608  1.00 41.35  ? 274  TYR C CG    1 
ATOM   8741  C  CD1   . TYR C  3  274 ? 12.167  129.565 75.942  1.00 40.67  ? 274  TYR C CD1   1 
ATOM   8742  C  CD2   . TYR C  3  274 ? 12.884  129.830 73.658  1.00 41.72  ? 274  TYR C CD2   1 
ATOM   8743  C  CE1   . TYR C  3  274 ? 12.948  130.687 76.326  1.00 39.86  ? 274  TYR C CE1   1 
ATOM   8744  C  CE2   . TYR C  3  274 ? 13.658  130.942 74.019  1.00 40.72  ? 274  TYR C CE2   1 
ATOM   8745  C  CZ    . TYR C  3  274 ? 13.689  131.363 75.349  1.00 40.41  ? 274  TYR C CZ    1 
ATOM   8746  O  OH    . TYR C  3  274 ? 14.463  132.448 75.667  1.00 38.72  ? 274  TYR C OH    1 
ATOM   8747  N  N     . PHE C  3  275 ? 8.431   128.829 75.895  1.00 41.51  ? 275  PHE C N     1 
ATOM   8748  C  CA    . PHE C  3  275 ? 7.779   128.749 77.193  1.00 40.84  ? 275  PHE C CA    1 
ATOM   8749  C  C     . PHE C  3  275 ? 6.283   128.747 77.020  1.00 41.74  ? 275  PHE C C     1 
ATOM   8750  O  O     . PHE C  3  275 ? 5.544   128.485 77.982  1.00 41.08  ? 275  PHE C O     1 
ATOM   8751  C  CB    . PHE C  3  275 ? 8.137   129.932 78.066  1.00 41.10  ? 275  PHE C CB    1 
ATOM   8752  C  CG    . PHE C  3  275 ? 9.471   129.828 78.706  1.00 42.59  ? 275  PHE C CG    1 
ATOM   8753  C  CD1   . PHE C  3  275 ? 9.989   130.898 79.419  1.00 43.18  ? 275  PHE C CD1   1 
ATOM   8754  C  CD2   . PHE C  3  275 ? 10.223  128.672 78.596  1.00 44.30  ? 275  PHE C CD2   1 
ATOM   8755  C  CE1   . PHE C  3  275 ? 11.235  130.817 80.011  1.00 43.77  ? 275  PHE C CE1   1 
ATOM   8756  C  CE2   . PHE C  3  275 ? 11.475  128.585 79.187  1.00 44.89  ? 275  PHE C CE2   1 
ATOM   8757  C  CZ    . PHE C  3  275 ? 11.978  129.664 79.894  1.00 44.49  ? 275  PHE C CZ    1 
ATOM   8758  N  N     . LEU C  3  276 ? 5.846   129.061 75.796  1.00 41.69  ? 276  LEU C N     1 
ATOM   8759  C  CA    . LEU C  3  276 ? 4.427   129.125 75.464  1.00 40.71  ? 276  LEU C CA    1 
ATOM   8760  C  C     . LEU C  3  276 ? 3.652   127.956 76.029  1.00 42.27  ? 276  LEU C C     1 
ATOM   8761  O  O     . LEU C  3  276 ? 2.808   128.141 76.897  1.00 43.67  ? 276  LEU C O     1 
ATOM   8762  C  CB    . LEU C  3  276 ? 4.244   129.205 73.955  1.00 38.06  ? 276  LEU C CB    1 
ATOM   8763  C  CG    . LEU C  3  276 ? 4.642   130.561 73.345  1.00 34.88  ? 276  LEU C CG    1 
ATOM   8764  C  CD1   . LEU C  3  276 ? 4.440   130.555 71.851  1.00 29.95  ? 276  LEU C CD1   1 
ATOM   8765  C  CD2   . LEU C  3  276 ? 3.810   131.660 73.967  1.00 33.90  ? 276  LEU C CD2   1 
ATOM   8766  N  N     . PHE C  3  277 ? 3.963   126.750 75.572  1.00 44.11  ? 277  PHE C N     1 
ATOM   8767  C  CA    . PHE C  3  277 ? 3.277   125.553 76.060  1.00 45.07  ? 277  PHE C CA    1 
ATOM   8768  C  C     . PHE C  3  277 ? 3.063   125.549 77.566  1.00 44.73  ? 277  PHE C C     1 
ATOM   8769  O  O     . PHE C  3  277 ? 2.000   125.179 78.037  1.00 46.69  ? 277  PHE C O     1 
ATOM   8770  C  CB    . PHE C  3  277 ? 4.054   124.294 75.665  1.00 47.83  ? 277  PHE C CB    1 
ATOM   8771  C  CG    . PHE C  3  277 ? 5.108   123.883 76.661  1.00 52.33  ? 277  PHE C CG    1 
ATOM   8772  C  CD1   . PHE C  3  277 ? 4.800   123.015 77.699  1.00 53.47  ? 277  PHE C CD1   1 
ATOM   8773  C  CD2   . PHE C  3  277 ? 6.408   124.379 76.575  1.00 54.68  ? 277  PHE C CD2   1 
ATOM   8774  C  CE1   . PHE C  3  277 ? 5.773   122.651 78.639  1.00 54.21  ? 277  PHE C CE1   1 
ATOM   8775  C  CE2   . PHE C  3  277 ? 7.381   124.018 77.512  1.00 53.88  ? 277  PHE C CE2   1 
ATOM   8776  C  CZ    . PHE C  3  277 ? 7.060   123.154 78.541  1.00 53.86  ? 277  PHE C CZ    1 
ATOM   8777  N  N     . ALA C  3  278 ? 4.065   125.953 78.333  1.00 44.24  ? 278  ALA C N     1 
ATOM   8778  C  CA    . ALA C  3  278 ? 3.919   125.944 79.786  1.00 45.24  ? 278  ALA C CA    1 
ATOM   8779  C  C     . ALA C  3  278 ? 2.992   127.055 80.260  1.00 44.66  ? 278  ALA C C     1 
ATOM   8780  O  O     . ALA C  3  278 ? 2.257   126.913 81.243  1.00 43.89  ? 278  ALA C O     1 
ATOM   8781  C  CB    . ALA C  3  278 ? 5.290   126.091 80.453  1.00 45.41  ? 278  ALA C CB    1 
ATOM   8782  N  N     . TYR C  3  279 ? 3.052   128.176 79.563  1.00 43.23  ? 279  TYR C N     1 
ATOM   8783  C  CA    . TYR C  3  279 ? 2.230   129.299 79.922  1.00 43.50  ? 279  TYR C CA    1 
ATOM   8784  C  C     . TYR C  3  279 ? 0.781   128.908 79.676  1.00 45.07  ? 279  TYR C C     1 
ATOM   8785  O  O     . TYR C  3  279 ? -0.130  129.360 80.372  1.00 45.96  ? 279  TYR C O     1 
ATOM   8786  C  CB    . TYR C  3  279 ? 2.610   130.497 79.071  1.00 42.65  ? 279  TYR C CB    1 
ATOM   8787  C  CG    . TYR C  3  279 ? 1.996   131.790 79.541  1.00 43.05  ? 279  TYR C CG    1 
ATOM   8788  C  CD1   . TYR C  3  279 ? 2.051   132.170 80.884  1.00 42.48  ? 279  TYR C CD1   1 
ATOM   8789  C  CD2   . TYR C  3  279 ? 1.401   132.659 78.635  1.00 43.09  ? 279  TYR C CD2   1 
ATOM   8790  C  CE1   . TYR C  3  279 ? 1.534   133.382 81.297  1.00 42.63  ? 279  TYR C CE1   1 
ATOM   8791  C  CE2   . TYR C  3  279 ? 0.886   133.865 79.031  1.00 42.34  ? 279  TYR C CE2   1 
ATOM   8792  C  CZ    . TYR C  3  279 ? 0.955   134.223 80.354  1.00 44.01  ? 279  TYR C CZ    1 
ATOM   8793  O  OH    . TYR C  3  279 ? 0.453   135.452 80.705  1.00 49.90  ? 279  TYR C OH    1 
ATOM   8794  N  N     . ALA C  3  280 ? 0.574   128.050 78.682  1.00 44.68  ? 280  ALA C N     1 
ATOM   8795  C  CA    . ALA C  3  280 ? -0.758  127.591 78.346  1.00 43.83  ? 280  ALA C CA    1 
ATOM   8796  C  C     . ALA C  3  280 ? -1.277  126.745 79.495  1.00 45.83  ? 280  ALA C C     1 
ATOM   8797  O  O     . ALA C  3  280 ? -2.348  127.009 80.043  1.00 48.24  ? 280  ALA C O     1 
ATOM   8798  C  CB    . ALA C  3  280 ? -0.717  126.792 77.081  1.00 39.33  ? 280  ALA C CB    1 
ATOM   8799  N  N     . ILE C  3  281 ? -0.513  125.732 79.872  1.00 47.27  ? 281  ILE C N     1 
ATOM   8800  C  CA    . ILE C  3  281 ? -0.927  124.870 80.961  1.00 49.42  ? 281  ILE C CA    1 
ATOM   8801  C  C     . ILE C  3  281 ? -1.185  125.704 82.191  1.00 50.77  ? 281  ILE C C     1 
ATOM   8802  O  O     . ILE C  3  281 ? -2.116  125.436 82.928  1.00 51.60  ? 281  ILE C O     1 
ATOM   8803  C  CB    . ILE C  3  281 ? 0.144   123.795 81.251  1.00 50.64  ? 281  ILE C CB    1 
ATOM   8804  C  CG1   . ILE C  3  281 ? 0.129   122.776 80.111  1.00 52.37  ? 281  ILE C CG1   1 
ATOM   8805  C  CG2   . ILE C  3  281 ? -0.115  123.096 82.588  1.00 49.77  ? 281  ILE C CG2   1 
ATOM   8806  C  CD1   . ILE C  3  281 ? 1.230   121.766 80.172  1.00 54.35  ? 281  ILE C CD1   1 
ATOM   8807  N  N     . LEU C  3  282 ? -0.377  126.734 82.404  1.00 52.90  ? 282  LEU C N     1 
ATOM   8808  C  CA    . LEU C  3  282 ? -0.554  127.576 83.579  1.00 54.92  ? 282  LEU C CA    1 
ATOM   8809  C  C     . LEU C  3  282 ? -1.945  128.164 83.663  1.00 56.77  ? 282  LEU C C     1 
ATOM   8810  O  O     . LEU C  3  282 ? -2.624  128.051 84.686  1.00 56.15  ? 282  LEU C O     1 
ATOM   8811  C  CB    . LEU C  3  282 ? 0.443   128.729 83.585  1.00 53.88  ? 282  LEU C CB    1 
ATOM   8812  C  CG    . LEU C  3  282 ? 0.204   129.730 84.731  1.00 52.86  ? 282  LEU C CG    1 
ATOM   8813  C  CD1   . LEU C  3  282 ? 0.491   129.077 86.071  1.00 52.78  ? 282  LEU C CD1   1 
ATOM   8814  C  CD2   . LEU C  3  282 ? 1.095   130.927 84.571  1.00 53.21  ? 282  LEU C CD2   1 
ATOM   8815  N  N     . ARG C  3  283 ? -2.352  128.805 82.577  1.00 59.45  ? 283  ARG C N     1 
ATOM   8816  C  CA    . ARG C  3  283 ? -3.646  129.456 82.511  1.00 63.78  ? 283  ARG C CA    1 
ATOM   8817  C  C     . ARG C  3  283 ? -4.817  128.491 82.359  1.00 66.20  ? 283  ARG C C     1 
ATOM   8818  O  O     . ARG C  3  283 ? -5.984  128.893 82.428  1.00 67.71  ? 283  ARG C O     1 
ATOM   8819  C  CB    . ARG C  3  283 ? -3.647  130.457 81.362  1.00 64.74  ? 283  ARG C CB    1 
ATOM   8820  C  CG    . ARG C  3  283 ? -2.463  131.393 81.410  1.00 68.37  ? 283  ARG C CG    1 
ATOM   8821  C  CD    . ARG C  3  283 ? -2.624  132.618 80.511  1.00 70.77  ? 283  ARG C CD    1 
ATOM   8822  N  NE    . ARG C  3  283 ? -2.679  132.285 79.087  1.00 72.90  ? 283  ARG C NE    1 
ATOM   8823  C  CZ    . ARG C  3  283 ? -2.649  133.194 78.115  1.00 73.39  ? 283  ARG C CZ    1 
ATOM   8824  N  NH1   . ARG C  3  283 ? -2.560  134.488 78.422  1.00 74.53  ? 283  ARG C NH1   1 
ATOM   8825  N  NH2   . ARG C  3  283 ? -2.713  132.814 76.845  1.00 71.37  ? 283  ARG C NH2   1 
ATOM   8826  N  N     . SER C  3  284 ? -4.513  127.217 82.153  1.00 67.60  ? 284  SER C N     1 
ATOM   8827  C  CA    . SER C  3  284 ? -5.568  126.231 81.988  1.00 68.67  ? 284  SER C CA    1 
ATOM   8828  C  C     . SER C  3  284 ? -6.338  126.017 83.278  1.00 68.58  ? 284  SER C C     1 
ATOM   8829  O  O     . SER C  3  284 ? -7.515  125.711 83.248  1.00 69.55  ? 284  SER C O     1 
ATOM   8830  C  CB    . SER C  3  284 ? -4.986  124.898 81.519  1.00 69.45  ? 284  SER C CB    1 
ATOM   8831  O  OG    . SER C  3  284 ? -4.221  124.283 82.541  1.00 68.25  ? 284  SER C OG    1 
ATOM   8832  N  N     . ILE C  3  285 ? -5.674  126.171 84.412  1.00 68.77  ? 285  ILE C N     1 
ATOM   8833  C  CA    . ILE C  3  285 ? -6.336  125.982 85.688  1.00 70.64  ? 285  ILE C CA    1 
ATOM   8834  C  C     . ILE C  3  285 ? -6.583  127.324 86.333  1.00 73.74  ? 285  ILE C C     1 
ATOM   8835  O  O     . ILE C  3  285 ? -5.681  127.884 86.960  1.00 73.74  ? 285  ILE C O     1 
ATOM   8836  C  CB    . ILE C  3  285 ? -5.472  125.185 86.675  1.00 70.52  ? 285  ILE C CB    1 
ATOM   8837  C  CG1   . ILE C  3  285 ? -5.054  123.855 86.063  1.00 72.54  ? 285  ILE C CG1   1 
ATOM   8838  C  CG2   . ILE C  3  285 ? -6.224  124.957 87.960  1.00 69.18  ? 285  ILE C CG2   1 
ATOM   8839  C  CD1   . ILE C  3  285 ? -6.197  122.918 85.756  1.00 75.61  ? 285  ILE C CD1   1 
ATOM   8840  N  N     . PRO C  3  286 ? -7.803  127.875 86.187  1.00 76.74  ? 286  PRO C N     1 
ATOM   8841  C  CA    . PRO C  3  286 ? -8.081  129.175 86.813  1.00 77.91  ? 286  PRO C CA    1 
ATOM   8842  C  C     . PRO C  3  286 ? -8.062  128.941 88.334  1.00 79.18  ? 286  PRO C C     1 
ATOM   8843  O  O     . PRO C  3  286 ? -8.887  128.180 88.862  1.00 79.40  ? 286  PRO C O     1 
ATOM   8844  C  CB    . PRO C  3  286 ? -9.470  129.510 86.288  1.00 77.17  ? 286  PRO C CB    1 
ATOM   8845  C  CG    . PRO C  3  286 ? -10.121 128.143 86.242  1.00 77.20  ? 286  PRO C CG    1 
ATOM   8846  C  CD    . PRO C  3  286 ? -9.032  127.292 85.615  1.00 77.11  ? 286  PRO C CD    1 
ATOM   8847  N  N     . ASN C  3  287 ? -7.116  129.586 89.016  1.00 78.63  ? 287  ASN C N     1 
ATOM   8848  C  CA    . ASN C  3  287 ? -6.928  129.447 90.457  1.00 79.44  ? 287  ASN C CA    1 
ATOM   8849  C  C     . ASN C  3  287 ? -5.440  129.560 90.615  1.00 80.15  ? 287  ASN C C     1 
ATOM   8850  O  O     . ASN C  3  287 ? -4.725  128.587 90.395  1.00 81.93  ? 287  ASN C O     1 
ATOM   8851  C  CB    . ASN C  3  287 ? -7.357  128.064 90.957  1.00 80.34  ? 287  ASN C CB    1 
ATOM   8852  C  CG    . ASN C  3  287 ? -6.872  127.776 92.368  1.00 82.31  ? 287  ASN C CG    1 
ATOM   8853  O  OD1   . ASN C  3  287 ? -5.673  127.821 92.650  1.00 84.48  ? 287  ASN C OD1   1 
ATOM   8854  N  ND2   . ASN C  3  287 ? -7.803  127.474 93.263  1.00 83.60  ? 287  ASN C ND2   1 
ATOM   8855  N  N     . LYS C  3  288 ? -4.969  130.733 91.008  1.00 80.61  ? 288  LYS C N     1 
ATOM   8856  C  CA    . LYS C  3  288 ? -3.538  130.952 91.139  1.00 80.24  ? 288  LYS C CA    1 
ATOM   8857  C  C     . LYS C  3  288 ? -2.744  129.720 91.605  1.00 77.81  ? 288  LYS C C     1 
ATOM   8858  O  O     . LYS C  3  288 ? -1.775  129.342 90.953  1.00 77.20  ? 288  LYS C O     1 
ATOM   8859  C  CB    . LYS C  3  288 ? -3.274  132.165 92.050  1.00 83.57  ? 288  LYS C CB    1 
ATOM   8860  C  CG    . LYS C  3  288 ? -1.969  132.922 91.709  1.00 88.22  ? 288  LYS C CG    1 
ATOM   8861  C  CD    . LYS C  3  288 ? -1.852  134.312 92.382  1.00 90.39  ? 288  LYS C CD    1 
ATOM   8862  C  CE    . LYS C  3  288 ? -0.596  135.071 91.899  1.00 91.16  ? 288  LYS C CE    1 
ATOM   8863  N  NZ    . LYS C  3  288 ? -0.616  136.539 92.212  1.00 91.97  ? 288  LYS C NZ    1 
ATOM   8864  N  N     . LEU C  3  289 ? -3.164  129.065 92.686  1.00 75.40  ? 289  LEU C N     1 
ATOM   8865  C  CA    . LEU C  3  289 ? -2.412  127.909 93.179  1.00 73.56  ? 289  LEU C CA    1 
ATOM   8866  C  C     . LEU C  3  289 ? -2.445  126.646 92.337  1.00 71.71  ? 289  LEU C C     1 
ATOM   8867  O  O     . LEU C  3  289 ? -1.416  125.985 92.163  1.00 72.70  ? 289  LEU C O     1 
ATOM   8868  C  CB    . LEU C  3  289 ? -2.829  127.546 94.603  1.00 74.08  ? 289  LEU C CB    1 
ATOM   8869  C  CG    . LEU C  3  289 ? -1.912  126.474 95.219  1.00 75.45  ? 289  LEU C CG    1 
ATOM   8870  C  CD1   . LEU C  3  289 ? -0.443  126.809 94.948  1.00 76.09  ? 289  LEU C CD1   1 
ATOM   8871  C  CD2   . LEU C  3  289 ? -2.153  126.385 96.716  1.00 75.53  ? 289  LEU C CD2   1 
ATOM   8872  N  N     . GLY C  3  290 ? -3.617  126.289 91.833  1.00 68.99  ? 290  GLY C N     1 
ATOM   8873  C  CA    . GLY C  3  290 ? -3.708  125.098 91.013  1.00 65.26  ? 290  GLY C CA    1 
ATOM   8874  C  C     . GLY C  3  290 ? -2.871  125.260 89.762  1.00 63.39  ? 290  GLY C C     1 
ATOM   8875  O  O     . GLY C  3  290 ? -2.099  124.383 89.395  1.00 62.46  ? 290  GLY C O     1 
ATOM   8876  N  N     . GLY C  3  291 ? -3.026  126.400 89.104  1.00 62.16  ? 291  GLY C N     1 
ATOM   8877  C  CA    . GLY C  3  291 ? -2.266  126.656 87.897  1.00 61.94  ? 291  GLY C CA    1 
ATOM   8878  C  C     . GLY C  3  291 ? -0.772  126.497 88.120  1.00 61.46  ? 291  GLY C C     1 
ATOM   8879  O  O     . GLY C  3  291 ? -0.056  125.967 87.266  1.00 62.67  ? 291  GLY C O     1 
ATOM   8880  N  N     . VAL C  3  292 ? -0.288  126.964 89.264  1.00 59.47  ? 292  VAL C N     1 
ATOM   8881  C  CA    . VAL C  3  292 ? 1.118   126.840 89.557  1.00 57.13  ? 292  VAL C CA    1 
ATOM   8882  C  C     . VAL C  3  292 ? 1.446   125.363 89.582  1.00 57.60  ? 292  VAL C C     1 
ATOM   8883  O  O     . VAL C  3  292 ? 2.244   124.893 88.779  1.00 59.60  ? 292  VAL C O     1 
ATOM   8884  C  CB    . VAL C  3  292 ? 1.462   127.465 90.885  1.00 56.24  ? 292  VAL C CB    1 
ATOM   8885  C  CG1   . VAL C  3  292 ? 2.824   126.999 91.331  1.00 56.15  ? 292  VAL C CG1   1 
ATOM   8886  C  CG2   . VAL C  3  292 ? 1.453   128.976 90.745  1.00 55.62  ? 292  VAL C CG2   1 
ATOM   8887  N  N     . LEU C  3  293 ? 0.824   124.615 90.480  1.00 56.07  ? 293  LEU C N     1 
ATOM   8888  C  CA    . LEU C  3  293 ? 1.094   123.183 90.523  1.00 56.52  ? 293  LEU C CA    1 
ATOM   8889  C  C     . LEU C  3  293 ? 1.056   122.567 89.113  1.00 56.28  ? 293  LEU C C     1 
ATOM   8890  O  O     . LEU C  3  293 ? 1.958   121.830 88.724  1.00 57.97  ? 293  LEU C O     1 
ATOM   8891  C  CB    . LEU C  3  293 ? 0.074   122.480 91.416  1.00 56.35  ? 293  LEU C CB    1 
ATOM   8892  C  CG    . LEU C  3  293 ? 0.054   122.981 92.858  1.00 58.03  ? 293  LEU C CG    1 
ATOM   8893  C  CD1   . LEU C  3  293 ? -1.193  122.484 93.540  1.00 57.95  ? 293  LEU C CD1   1 
ATOM   8894  C  CD2   . LEU C  3  293 ? 1.298   122.515 93.595  1.00 56.30  ? 293  LEU C CD2   1 
ATOM   8895  N  N     . ALA C  3  294 ? 0.020   122.870 88.341  1.00 54.69  ? 294  ALA C N     1 
ATOM   8896  C  CA    . ALA C  3  294 ? -0.089  122.319 86.999  1.00 53.51  ? 294  ALA C CA    1 
ATOM   8897  C  C     . ALA C  3  294 ? 1.176   122.624 86.187  1.00 52.07  ? 294  ALA C C     1 
ATOM   8898  O  O     . ALA C  3  294 ? 1.662   121.779 85.432  1.00 49.83  ? 294  ALA C O     1 
ATOM   8899  C  CB    . ALA C  3  294 ? -1.344  122.886 86.299  1.00 53.40  ? 294  ALA C CB    1 
ATOM   8900  N  N     . LEU C  3  295 ? 1.696   123.838 86.354  1.00 50.48  ? 295  LEU C N     1 
ATOM   8901  C  CA    . LEU C  3  295 ? 2.896   124.250 85.652  1.00 51.29  ? 295  LEU C CA    1 
ATOM   8902  C  C     . LEU C  3  295 ? 4.060   123.402 86.130  1.00 52.40  ? 295  LEU C C     1 
ATOM   8903  O  O     . LEU C  3  295 ? 4.775   122.812 85.328  1.00 53.65  ? 295  LEU C O     1 
ATOM   8904  C  CB    . LEU C  3  295 ? 3.199   125.721 85.916  1.00 50.55  ? 295  LEU C CB    1 
ATOM   8905  C  CG    . LEU C  3  295 ? 4.526   126.281 85.379  1.00 49.15  ? 295  LEU C CG    1 
ATOM   8906  C  CD1   . LEU C  3  295 ? 4.733   125.946 83.898  1.00 48.85  ? 295  LEU C CD1   1 
ATOM   8907  C  CD2   . LEU C  3  295 ? 4.502   127.774 85.572  1.00 47.86  ? 295  LEU C CD2   1 
ATOM   8908  N  N     . ALA C  3  296 ? 4.259   123.362 87.441  1.00 52.21  ? 296  ALA C N     1 
ATOM   8909  C  CA    . ALA C  3  296 ? 5.319   122.568 88.015  1.00 51.92  ? 296  ALA C CA    1 
ATOM   8910  C  C     . ALA C  3  296 ? 5.210   121.177 87.399  1.00 53.70  ? 296  ALA C C     1 
ATOM   8911  O  O     . ALA C  3  296 ? 6.078   120.739 86.658  1.00 54.75  ? 296  ALA C O     1 
ATOM   8912  C  CB    . ALA C  3  296 ? 5.132   122.490 89.493  1.00 52.89  ? 296  ALA C CB    1 
ATOM   8913  N  N     . ALA C  3  297 ? 4.118   120.493 87.692  1.00 55.18  ? 297  ALA C N     1 
ATOM   8914  C  CA    . ALA C  3  297 ? 3.884   119.159 87.167  1.00 56.98  ? 297  ALA C CA    1 
ATOM   8915  C  C     . ALA C  3  297 ? 4.188   118.986 85.668  1.00 58.26  ? 297  ALA C C     1 
ATOM   8916  O  O     . ALA C  3  297 ? 4.700   117.943 85.245  1.00 58.31  ? 297  ALA C O     1 
ATOM   8917  C  CB    . ALA C  3  297 ? 2.446   118.769 87.434  1.00 57.03  ? 297  ALA C CB    1 
ATOM   8918  N  N     . SER C  3  298 ? 3.869   119.991 84.861  1.00 58.47  ? 298  SER C N     1 
ATOM   8919  C  CA    . SER C  3  298 ? 4.102   119.876 83.422  1.00 58.75  ? 298  SER C CA    1 
ATOM   8920  C  C     . SER C  3  298 ? 5.522   119.486 83.067  1.00 58.64  ? 298  SER C C     1 
ATOM   8921  O  O     . SER C  3  298 ? 5.730   118.664 82.186  1.00 60.70  ? 298  SER C O     1 
ATOM   8922  C  CB    . SER C  3  298 ? 3.771   121.179 82.703  1.00 59.33  ? 298  SER C CB    1 
ATOM   8923  O  OG    . SER C  3  298 ? 4.755   122.155 82.971  1.00 61.38  ? 298  SER C OG    1 
ATOM   8924  N  N     . VAL C  3  299 ? 6.503   120.082 83.734  1.00 56.49  ? 299  VAL C N     1 
ATOM   8925  C  CA    . VAL C  3  299 ? 7.887   119.764 83.449  1.00 54.29  ? 299  VAL C CA    1 
ATOM   8926  C  C     . VAL C  3  299 ? 8.382   118.669 84.388  1.00 53.58  ? 299  VAL C C     1 
ATOM   8927  O  O     . VAL C  3  299 ? 9.122   117.772 83.982  1.00 53.58  ? 299  VAL C O     1 
ATOM   8928  C  CB    . VAL C  3  299 ? 8.757   121.005 83.588  1.00 54.84  ? 299  VAL C CB    1 
ATOM   8929  C  CG1   . VAL C  3  299 ? 10.217  120.638 83.406  1.00 56.62  ? 299  VAL C CG1   1 
ATOM   8930  C  CG2   . VAL C  3  299 ? 8.343   122.030 82.551  1.00 55.10  ? 299  VAL C CG2   1 
ATOM   8931  N  N     . LEU C  3  300 ? 7.971   118.725 85.646  1.00 52.16  ? 300  LEU C N     1 
ATOM   8932  C  CA    . LEU C  3  300 ? 8.391   117.699 86.586  1.00 51.91  ? 300  LEU C CA    1 
ATOM   8933  C  C     . LEU C  3  300 ? 7.886   116.315 86.175  1.00 51.98  ? 300  LEU C C     1 
ATOM   8934  O  O     . LEU C  3  300 ? 8.477   115.310 86.537  1.00 52.94  ? 300  LEU C O     1 
ATOM   8935  C  CB    . LEU C  3  300 ? 7.905   118.034 87.999  1.00 51.00  ? 300  LEU C CB    1 
ATOM   8936  C  CG    . LEU C  3  300 ? 8.487   119.338 88.569  1.00 52.66  ? 300  LEU C CG    1 
ATOM   8937  C  CD1   . LEU C  3  300 ? 8.221   119.431 90.071  1.00 48.60  ? 300  LEU C CD1   1 
ATOM   8938  C  CD2   . LEU C  3  300 ? 9.987   119.390 88.284  1.00 51.25  ? 300  LEU C CD2   1 
ATOM   8939  N  N     . ILE C  3  301 ? 6.804   116.264 85.402  1.00 51.93  ? 301  ILE C N     1 
ATOM   8940  C  CA    . ILE C  3  301 ? 6.218   114.994 84.960  1.00 50.15  ? 301  ILE C CA    1 
ATOM   8941  C  C     . ILE C  3  301 ? 7.287   114.074 84.384  1.00 48.45  ? 301  ILE C C     1 
ATOM   8942  O  O     . ILE C  3  301 ? 7.179   112.849 84.473  1.00 45.79  ? 301  ILE C O     1 
ATOM   8943  C  CB    . ILE C  3  301 ? 5.129   115.246 83.892  1.00 51.18  ? 301  ILE C CB    1 
ATOM   8944  C  CG1   . ILE C  3  301 ? 4.319   113.978 83.645  1.00 51.96  ? 301  ILE C CG1   1 
ATOM   8945  C  CG2   . ILE C  3  301 ? 5.769   115.684 82.597  1.00 51.58  ? 301  ILE C CG2   1 
ATOM   8946  C  CD1   . ILE C  3  301 ? 3.568   113.518 84.851  1.00 54.54  ? 301  ILE C CD1   1 
ATOM   8947  N  N     . LEU C  3  302 ? 8.312   114.698 83.800  1.00 47.80  ? 302  LEU C N     1 
ATOM   8948  C  CA    . LEU C  3  302 ? 9.463   114.027 83.190  1.00 47.70  ? 302  LEU C CA    1 
ATOM   8949  C  C     . LEU C  3  302 ? 10.215  113.051 84.102  1.00 47.11  ? 302  LEU C C     1 
ATOM   8950  O  O     . LEU C  3  302 ? 10.812  112.092 83.624  1.00 46.03  ? 302  LEU C O     1 
ATOM   8951  C  CB    . LEU C  3  302 ? 10.445  115.071 82.696  1.00 48.26  ? 302  LEU C CB    1 
ATOM   8952  C  CG    . LEU C  3  302 ? 10.084  115.815 81.418  1.00 49.20  ? 302  LEU C CG    1 
ATOM   8953  C  CD1   . LEU C  3  302 ? 10.830  117.116 81.410  1.00 52.50  ? 302  LEU C CD1   1 
ATOM   8954  C  CD2   . LEU C  3  302 ? 10.464  115.024 80.201  1.00 48.32  ? 302  LEU C CD2   1 
ATOM   8955  N  N     . PHE C  3  303 ? 10.205  113.316 85.404  1.00 46.76  ? 303  PHE C N     1 
ATOM   8956  C  CA    . PHE C  3  303 ? 10.861  112.449 86.368  1.00 47.57  ? 303  PHE C CA    1 
ATOM   8957  C  C     . PHE C  3  303 ? 10.128  111.111 86.518  1.00 50.27  ? 303  PHE C C     1 
ATOM   8958  O  O     . PHE C  3  303 ? 10.721  110.135 86.978  1.00 52.91  ? 303  PHE C O     1 
ATOM   8959  C  CB    . PHE C  3  303 ? 10.943  113.125 87.744  1.00 44.33  ? 303  PHE C CB    1 
ATOM   8960  C  CG    . PHE C  3  303 ? 12.083  114.093 87.894  1.00 43.18  ? 303  PHE C CG    1 
ATOM   8961  C  CD1   . PHE C  3  303 ? 11.860  115.370 88.394  1.00 42.72  ? 303  PHE C CD1   1 
ATOM   8962  C  CD2   . PHE C  3  303 ? 13.384  113.723 87.564  1.00 44.35  ? 303  PHE C CD2   1 
ATOM   8963  C  CE1   . PHE C  3  303 ? 12.918  116.268 88.564  1.00 44.58  ? 303  PHE C CE1   1 
ATOM   8964  C  CE2   . PHE C  3  303 ? 14.455  114.609 87.728  1.00 43.94  ? 303  PHE C CE2   1 
ATOM   8965  C  CZ    . PHE C  3  303 ? 14.226  115.888 88.230  1.00 43.94  ? 303  PHE C CZ    1 
ATOM   8966  N  N     . LEU C  3  304 ? 8.855   111.053 86.132  1.00 51.33  ? 304  LEU C N     1 
ATOM   8967  C  CA    . LEU C  3  304 ? 8.093   109.813 86.262  1.00 53.42  ? 304  LEU C CA    1 
ATOM   8968  C  C     . LEU C  3  304 ? 8.132   108.883 85.055  1.00 55.03  ? 304  LEU C C     1 
ATOM   8969  O  O     . LEU C  3  304 ? 7.797   107.700 85.173  1.00 56.34  ? 304  LEU C O     1 
ATOM   8970  C  CB    . LEU C  3  304 ? 6.623   110.102 86.555  1.00 55.28  ? 304  LEU C CB    1 
ATOM   8971  C  CG    . LEU C  3  304 ? 6.192   110.847 87.817  1.00 58.72  ? 304  LEU C CG    1 
ATOM   8972  C  CD1   . LEU C  3  304 ? 4.666   110.758 87.904  1.00 57.59  ? 304  LEU C CD1   1 
ATOM   8973  C  CD2   . LEU C  3  304 ? 6.851   110.247 89.069  1.00 58.25  ? 304  LEU C CD2   1 
ATOM   8974  N  N     . ILE C  3  305 ? 8.533   109.393 83.897  1.00 54.77  ? 305  ILE C N     1 
ATOM   8975  C  CA    . ILE C  3  305 ? 8.540   108.561 82.706  1.00 54.44  ? 305  ILE C CA    1 
ATOM   8976  C  C     . ILE C  3  305 ? 9.171   107.195 82.911  1.00 55.56  ? 305  ILE C C     1 
ATOM   8977  O  O     . ILE C  3  305 ? 8.552   106.186 82.595  1.00 56.40  ? 305  ILE C O     1 
ATOM   8978  C  CB    . ILE C  3  305 ? 9.237   109.244 81.533  1.00 54.51  ? 305  ILE C CB    1 
ATOM   8979  C  CG1   . ILE C  3  305 ? 8.508   110.536 81.159  1.00 56.33  ? 305  ILE C CG1   1 
ATOM   8980  C  CG2   . ILE C  3  305 ? 9.231   108.328 80.345  1.00 55.01  ? 305  ILE C CG2   1 
ATOM   8981  C  CD1   . ILE C  3  305 ? 7.047   110.346 80.762  1.00 55.68  ? 305  ILE C CD1   1 
ATOM   8982  N  N     . PRO C  3  306 ? 10.408  107.136 83.444  1.00 56.61  ? 306  PRO C N     1 
ATOM   8983  C  CA    . PRO C  3  306 ? 11.099  105.856 83.678  1.00 56.28  ? 306  PRO C CA    1 
ATOM   8984  C  C     . PRO C  3  306 ? 10.248  104.817 84.410  1.00 57.10  ? 306  PRO C C     1 
ATOM   8985  O  O     . PRO C  3  306 ? 10.364  103.614 84.183  1.00 57.07  ? 306  PRO C O     1 
ATOM   8986  C  CB    . PRO C  3  306 ? 12.311  106.262 84.507  1.00 55.87  ? 306  PRO C CB    1 
ATOM   8987  C  CG    . PRO C  3  306 ? 12.601  107.642 84.013  1.00 56.99  ? 306  PRO C CG    1 
ATOM   8988  C  CD    . PRO C  3  306 ? 11.231  108.268 83.913  1.00 55.89  ? 306  PRO C CD    1 
ATOM   8989  N  N     . PHE C  3  307 ? 9.380   105.280 85.291  1.00 57.67  ? 307  PHE C N     1 
ATOM   8990  C  CA    . PHE C  3  307 ? 8.559   104.355 86.032  1.00 59.08  ? 307  PHE C CA    1 
ATOM   8991  C  C     . PHE C  3  307 ? 7.238   104.049 85.362  1.00 58.27  ? 307  PHE C C     1 
ATOM   8992  O  O     . PHE C  3  307 ? 6.470   103.256 85.869  1.00 59.81  ? 307  PHE C O     1 
ATOM   8993  C  CB    . PHE C  3  307 ? 8.326   104.905 87.428  1.00 62.31  ? 307  PHE C CB    1 
ATOM   8994  C  CG    . PHE C  3  307 ? 9.601   105.253 88.151  1.00 68.01  ? 307  PHE C CG    1 
ATOM   8995  C  CD1   . PHE C  3  307 ? 10.562  104.269 88.421  1.00 70.92  ? 307  PHE C CD1   1 
ATOM   8996  C  CD2   . PHE C  3  307 ? 9.858   106.562 88.551  1.00 68.95  ? 307  PHE C CD2   1 
ATOM   8997  C  CE1   . PHE C  3  307 ? 11.766  104.587 89.080  1.00 70.52  ? 307  PHE C CE1   1 
ATOM   8998  C  CE2   . PHE C  3  307 ? 11.051  106.886 89.207  1.00 70.37  ? 307  PHE C CE2   1 
ATOM   8999  C  CZ    . PHE C  3  307 ? 12.006  105.896 89.470  1.00 70.69  ? 307  PHE C CZ    1 
ATOM   9000  N  N     . LEU C  3  308 ? 6.965   104.665 84.222  1.00 56.87  ? 308  LEU C N     1 
ATOM   9001  C  CA    . LEU C  3  308 ? 5.706   104.416 83.526  1.00 55.58  ? 308  LEU C CA    1 
ATOM   9002  C  C     . LEU C  3  308 ? 5.914   103.599 82.268  1.00 55.92  ? 308  LEU C C     1 
ATOM   9003  O  O     . LEU C  3  308 ? 5.072   103.620 81.360  1.00 57.53  ? 308  LEU C O     1 
ATOM   9004  C  CB    . LEU C  3  308 ? 5.024   105.729 83.149  1.00 53.62  ? 308  LEU C CB    1 
ATOM   9005  C  CG    . LEU C  3  308 ? 4.681   106.640 84.315  1.00 51.25  ? 308  LEU C CG    1 
ATOM   9006  C  CD1   . LEU C  3  308 ? 3.973   107.879 83.806  1.00 48.45  ? 308  LEU C CD1   1 
ATOM   9007  C  CD2   . LEU C  3  308 ? 3.828   105.857 85.288  1.00 48.28  ? 308  LEU C CD2   1 
ATOM   9008  N  N     . HIS C  3  309 ? 7.035   102.890 82.208  1.00 54.37  ? 309  HIS C N     1 
ATOM   9009  C  CA    . HIS C  3  309 ? 7.340   102.066 81.045  1.00 52.86  ? 309  HIS C CA    1 
ATOM   9010  C  C     . HIS C  3  309 ? 6.814   100.659 81.297  1.00 52.79  ? 309  HIS C C     1 
ATOM   9011  O  O     . HIS C  3  309 ? 7.228   99.993  82.234  1.00 53.53  ? 309  HIS C O     1 
ATOM   9012  C  CB    . HIS C  3  309 ? 8.839   102.040 80.809  1.00 51.50  ? 309  HIS C CB    1 
ATOM   9013  C  CG    . HIS C  3  309 ? 9.253   101.175 79.666  1.00 51.20  ? 309  HIS C CG    1 
ATOM   9014  N  ND1   . HIS C  3  309 ? 9.542   101.682 78.421  1.00 49.65  ? 309  HIS C ND1   1 
ATOM   9015  C  CD2   . HIS C  3  309 ? 9.415   99.832  79.576  1.00 52.23  ? 309  HIS C CD2   1 
ATOM   9016  C  CE1   . HIS C  3  309 ? 9.864   100.688 77.609  1.00 50.65  ? 309  HIS C CE1   1 
ATOM   9017  N  NE2   . HIS C  3  309 ? 9.795   99.555  78.283  1.00 50.91  ? 309  HIS C NE2   1 
ATOM   9018  N  N     . LYS C  3  310 ? 5.891   100.210 80.461  1.00 53.07  ? 310  LYS C N     1 
ATOM   9019  C  CA    . LYS C  3  310 ? 5.315   98.897  80.646  1.00 53.03  ? 310  LYS C CA    1 
ATOM   9020  C  C     . LYS C  3  310 ? 5.732   97.937  79.574  1.00 53.81  ? 310  LYS C C     1 
ATOM   9021  O  O     . LYS C  3  310 ? 5.727   96.735  79.808  1.00 54.99  ? 310  LYS C O     1 
ATOM   9022  C  CB    . LYS C  3  310 ? 3.790   98.984  80.684  1.00 53.71  ? 310  LYS C CB    1 
ATOM   9023  C  CG    . LYS C  3  310 ? 3.270   99.822  81.824  1.00 54.97  ? 310  LYS C CG    1 
ATOM   9024  C  CD    . LYS C  3  310 ? 3.708   99.221  83.143  1.00 58.50  ? 310  LYS C CD    1 
ATOM   9025  C  CE    . LYS C  3  310 ? 3.423   100.151 84.322  1.00 62.61  ? 310  LYS C CE    1 
ATOM   9026  N  NZ    . LYS C  3  310 ? 3.902   99.616  85.639  1.00 62.86  ? 310  LYS C NZ    1 
ATOM   9027  N  N     . SER C  3  311 ? 6.103   98.449  78.403  1.00 54.18  ? 311  SER C N     1 
ATOM   9028  C  CA    . SER C  3  311 ? 6.507   97.569  77.304  1.00 53.72  ? 311  SER C CA    1 
ATOM   9029  C  C     . SER C  3  311 ? 7.623   96.573  77.615  1.00 52.75  ? 311  SER C C     1 
ATOM   9030  O  O     . SER C  3  311 ? 8.440   96.780  78.503  1.00 52.50  ? 311  SER C O     1 
ATOM   9031  C  CB    . SER C  3  311 ? 6.921   98.373  76.086  1.00 53.09  ? 311  SER C CB    1 
ATOM   9032  O  OG    . SER C  3  311 ? 7.191   97.463  75.027  1.00 56.17  ? 311  SER C OG    1 
ATOM   9033  N  N     . LYS C  3  312 ? 7.656   95.489  76.857  1.00 52.50  ? 312  LYS C N     1 
ATOM   9034  C  CA    . LYS C  3  312 ? 8.666   94.471  77.051  1.00 53.32  ? 312  LYS C CA    1 
ATOM   9035  C  C     . LYS C  3  312 ? 9.858   94.773  76.139  1.00 52.98  ? 312  LYS C C     1 
ATOM   9036  O  O     . LYS C  3  312 ? 10.921  94.140  76.214  1.00 52.36  ? 312  LYS C O     1 
ATOM   9037  C  CB    . LYS C  3  312 ? 8.059   93.109  76.740  1.00 55.21  ? 312  LYS C CB    1 
ATOM   9038  C  CG    . LYS C  3  312 ? 7.114   92.625  77.811  1.00 57.52  ? 312  LYS C CG    1 
ATOM   9039  C  CD    . LYS C  3  312 ? 7.647   91.343  78.456  1.00 63.26  ? 312  LYS C CD    1 
ATOM   9040  C  CE    . LYS C  3  312 ? 6.848   90.953  79.704  1.00 67.64  ? 312  LYS C CE    1 
ATOM   9041  N  NZ    . LYS C  3  312 ? 6.896   92.029  80.765  1.00 69.26  ? 312  LYS C NZ    1 
ATOM   9042  N  N     . GLN C  3  313 ? 9.653   95.765  75.285  1.00 51.87  ? 313  GLN C N     1 
ATOM   9043  C  CA    . GLN C  3  313 ? 10.650  96.223  74.339  1.00 50.01  ? 313  GLN C CA    1 
ATOM   9044  C  C     . GLN C  3  313 ? 11.023  97.645  74.764  1.00 50.65  ? 313  GLN C C     1 
ATOM   9045  O  O     . GLN C  3  313 ? 10.229  98.348  75.389  1.00 50.95  ? 313  GLN C O     1 
ATOM   9046  C  CB    . GLN C  3  313 ? 10.054  96.188  72.940  1.00 47.38  ? 313  GLN C CB    1 
ATOM   9047  C  CG    . GLN C  3  313 ? 9.633   94.803  72.551  1.00 48.74  ? 313  GLN C CG    1 
ATOM   9048  C  CD    . GLN C  3  313 ? 8.917   94.745  71.222  1.00 52.79  ? 313  GLN C CD    1 
ATOM   9049  O  OE1   . GLN C  3  313 ? 7.871   95.382  71.027  1.00 57.98  ? 313  GLN C OE1   1 
ATOM   9050  N  NE2   . GLN C  3  313 ? 9.468   93.971  70.294  1.00 52.79  ? 313  GLN C NE2   1 
ATOM   9051  N  N     . ARG C  3  314 ? 12.233  98.071  74.430  1.00 51.27  ? 314  ARG C N     1 
ATOM   9052  C  CA    . ARG C  3  314 ? 12.705  99.384  74.843  1.00 49.61  ? 314  ARG C CA    1 
ATOM   9053  C  C     . ARG C  3  314 ? 12.189  100.562 74.058  1.00 50.01  ? 314  ARG C C     1 
ATOM   9054  O  O     . ARG C  3  314 ? 11.614  101.485 74.627  1.00 50.00  ? 314  ARG C O     1 
ATOM   9055  C  CB    . ARG C  3  314 ? 14.220  99.406  74.814  1.00 48.60  ? 314  ARG C CB    1 
ATOM   9056  C  CG    . ARG C  3  314 ? 14.779  100.674 75.346  1.00 49.87  ? 314  ARG C CG    1 
ATOM   9057  C  CD    . ARG C  3  314 ? 16.244  100.531 75.647  1.00 51.73  ? 314  ARG C CD    1 
ATOM   9058  N  NE    . ARG C  3  314 ? 16.718  101.668 76.427  1.00 52.97  ? 314  ARG C NE    1 
ATOM   9059  C  CZ    . ARG C  3  314 ? 17.963  101.818 76.862  1.00 52.88  ? 314  ARG C CZ    1 
ATOM   9060  N  NH1   . ARG C  3  314 ? 18.879  100.896 76.594  1.00 53.36  ? 314  ARG C NH1   1 
ATOM   9061  N  NH2   . ARG C  3  314 ? 18.285  102.888 77.575  1.00 51.69  ? 314  ARG C NH2   1 
ATOM   9062  N  N     . THR C  3  315 ? 12.416  100.528 72.751  1.00 50.14  ? 315  THR C N     1 
ATOM   9063  C  CA    . THR C  3  315 ? 12.007  101.597 71.845  1.00 50.33  ? 315  THR C CA    1 
ATOM   9064  C  C     . THR C  3  315 ? 10.582  101.476 71.320  1.00 50.20  ? 315  THR C C     1 
ATOM   9065  O  O     . THR C  3  315 ? 9.881   100.497 71.576  1.00 51.70  ? 315  THR C O     1 
ATOM   9066  C  CB    . THR C  3  315 ? 12.919  101.615 70.629  1.00 50.74  ? 315  THR C CB    1 
ATOM   9067  O  OG1   . THR C  3  315 ? 12.896  100.322 70.016  1.00 48.81  ? 315  THR C OG1   1 
ATOM   9068  C  CG2   . THR C  3  315 ? 14.336  101.944 71.044  1.00 51.34  ? 315  THR C CG2   1 
ATOM   9069  N  N     . MET C  3  316 ? 10.157  102.476 70.565  1.00 48.51  ? 316  MET C N     1 
ATOM   9070  C  CA    . MET C  3  316 ? 8.825   102.434 69.969  1.00 48.07  ? 316  MET C CA    1 
ATOM   9071  C  C     . MET C  3  316 ? 8.954   101.994 68.498  1.00 49.35  ? 316  MET C C     1 
ATOM   9072  O  O     . MET C  3  316 ? 7.986   102.043 67.737  1.00 49.81  ? 316  MET C O     1 
ATOM   9073  C  CB    . MET C  3  316 ? 8.153   103.819 70.038  1.00 43.30  ? 316  MET C CB    1 
ATOM   9074  C  CG    . MET C  3  316 ? 7.480   104.141 71.347  1.00 37.94  ? 316  MET C CG    1 
ATOM   9075  S  SD    . MET C  3  316 ? 7.192   105.921 71.499  1.00 42.45  ? 316  MET C SD    1 
ATOM   9076  C  CE    . MET C  3  316 ? 6.752   106.088 73.237  1.00 37.02  ? 316  MET C CE    1 
ATOM   9077  N  N     . THR C  3  317 ? 10.144  101.559 68.097  1.00 49.26  ? 317  THR C N     1 
ATOM   9078  C  CA    . THR C  3  317 ? 10.327  101.188 66.710  1.00 49.50  ? 317  THR C CA    1 
ATOM   9079  C  C     . THR C  3  317 ? 9.347   100.156 66.245  1.00 50.61  ? 317  THR C C     1 
ATOM   9080  O  O     . THR C  3  317 ? 8.785   100.281 65.162  1.00 53.88  ? 317  THR C O     1 
ATOM   9081  C  CB    . THR C  3  317 ? 11.705  100.640 66.436  1.00 48.37  ? 317  THR C CB    1 
ATOM   9082  O  OG1   . THR C  3  317 ? 12.680  101.589 66.851  1.00 50.10  ? 317  THR C OG1   1 
ATOM   9083  C  CG2   . THR C  3  317 ? 11.878  100.396 64.967  1.00 48.40  ? 317  THR C CG2   1 
ATOM   9084  N  N     . PHE C  3  318 ? 9.138   99.134  67.057  1.00 50.55  ? 318  PHE C N     1 
ATOM   9085  C  CA    . PHE C  3  318 ? 8.238   98.056  66.677  1.00 51.24  ? 318  PHE C CA    1 
ATOM   9086  C  C     . PHE C  3  318 ? 6.943   98.105  67.489  1.00 53.41  ? 318  PHE C C     1 
ATOM   9087  O  O     . PHE C  3  318 ? 6.376   97.056  67.836  1.00 53.80  ? 318  PHE C O     1 
ATOM   9088  C  CB    . PHE C  3  318 ? 8.941   96.709  66.900  1.00 48.55  ? 318  PHE C CB    1 
ATOM   9089  C  CG    . PHE C  3  318 ? 10.329  96.635  66.324  1.00 44.21  ? 318  PHE C CG    1 
ATOM   9090  C  CD1   . PHE C  3  318 ? 11.392  96.155  67.093  1.00 43.82  ? 318  PHE C CD1   1 
ATOM   9091  C  CD2   . PHE C  3  318 ? 10.586  97.050  65.033  1.00 42.85  ? 318  PHE C CD2   1 
ATOM   9092  C  CE1   . PHE C  3  318 ? 12.701  96.092  66.581  1.00 40.90  ? 318  PHE C CE1   1 
ATOM   9093  C  CE2   . PHE C  3  318 ? 11.896  96.991  64.513  1.00 43.49  ? 318  PHE C CE2   1 
ATOM   9094  C  CZ    . PHE C  3  318 ? 12.950  96.510  65.294  1.00 41.41  ? 318  PHE C CZ    1 
ATOM   9095  N  N     . ARG C  3  319 ? 6.488   99.319  67.800  1.00 55.23  ? 319  ARG C N     1 
ATOM   9096  C  CA    . ARG C  3  319 ? 5.264   99.518  68.591  1.00 58.14  ? 319  ARG C CA    1 
ATOM   9097  C  C     . ARG C  3  319 ? 4.400   100.605 67.957  1.00 60.34  ? 319  ARG C C     1 
ATOM   9098  O  O     . ARG C  3  319 ? 4.305   101.730 68.475  1.00 61.02  ? 319  ARG C O     1 
ATOM   9099  C  CB    . ARG C  3  319 ? 5.606   99.931  70.029  1.00 57.47  ? 319  ARG C CB    1 
ATOM   9100  C  CG    . ARG C  3  319 ? 6.305   98.870  70.835  1.00 59.10  ? 319  ARG C CG    1 
ATOM   9101  C  CD    . ARG C  3  319 ? 6.144   99.162  72.302  1.00 61.47  ? 319  ARG C CD    1 
ATOM   9102  N  NE    . ARG C  3  319 ? 7.017   100.232 72.767  1.00 64.32  ? 319  ARG C NE    1 
ATOM   9103  C  CZ    . ARG C  3  319 ? 6.665   101.133 73.680  1.00 66.03  ? 319  ARG C CZ    1 
ATOM   9104  N  NH1   . ARG C  3  319 ? 5.452   101.102 74.215  1.00 67.50  ? 319  ARG C NH1   1 
ATOM   9105  N  NH2   . ARG C  3  319 ? 7.534   102.049 74.085  1.00 68.02  ? 319  ARG C NH2   1 
ATOM   9106  N  N     . PRO C  3  320 ? 3.727   100.269 66.845  1.00 60.98  ? 320  PRO C N     1 
ATOM   9107  C  CA    . PRO C  3  320 ? 2.859   101.165 66.079  1.00 60.37  ? 320  PRO C CA    1 
ATOM   9108  C  C     . PRO C  3  320 ? 1.782   101.916 66.864  1.00 60.45  ? 320  PRO C C     1 
ATOM   9109  O  O     . PRO C  3  320 ? 1.497   103.085 66.547  1.00 61.98  ? 320  PRO C O     1 
ATOM   9110  C  CB    . PRO C  3  320 ? 2.294   100.249 65.011  1.00 61.04  ? 320  PRO C CB    1 
ATOM   9111  C  CG    . PRO C  3  320 ? 2.192   98.945  65.736  1.00 61.43  ? 320  PRO C CG    1 
ATOM   9112  C  CD    . PRO C  3  320 ? 3.509   98.870  66.442  1.00 60.92  ? 320  PRO C CD    1 
ATOM   9113  N  N     . LEU C  3  321 ? 1.172   101.281 67.869  1.00 58.50  ? 321  LEU C N     1 
ATOM   9114  C  CA    . LEU C  3  321 ? 0.167   102.007 68.651  1.00 56.68  ? 321  LEU C CA    1 
ATOM   9115  C  C     . LEU C  3  321 ? 0.865   103.113 69.435  1.00 55.85  ? 321  LEU C C     1 
ATOM   9116  O  O     . LEU C  3  321 ? 0.406   104.253 69.453  1.00 55.37  ? 321  LEU C O     1 
ATOM   9117  C  CB    . LEU C  3  321 ? -0.584  101.090 69.614  1.00 56.07  ? 321  LEU C CB    1 
ATOM   9118  C  CG    . LEU C  3  321 ? -1.375  99.952  68.963  1.00 56.06  ? 321  LEU C CG    1 
ATOM   9119  C  CD1   . LEU C  3  321 ? -2.284  99.322  70.017  1.00 53.62  ? 321  LEU C CD1   1 
ATOM   9120  C  CD2   . LEU C  3  321 ? -2.187  100.475 67.787  1.00 52.31  ? 321  LEU C CD2   1 
ATOM   9121  N  N     . SER C  3  322 ? 1.992   102.781 70.058  1.00 54.61  ? 322  SER C N     1 
ATOM   9122  C  CA    . SER C  3  322 ? 2.752   103.768 70.818  1.00 54.18  ? 322  SER C CA    1 
ATOM   9123  C  C     . SER C  3  322 ? 3.214   104.915 69.914  1.00 52.55  ? 322  SER C C     1 
ATOM   9124  O  O     . SER C  3  322 ? 3.270   106.073 70.318  1.00 50.72  ? 322  SER C O     1 
ATOM   9125  C  CB    . SER C  3  322 ? 3.969   103.105 71.475  1.00 55.96  ? 322  SER C CB    1 
ATOM   9126  O  OG    . SER C  3  322 ? 3.582   102.158 72.464  1.00 57.61  ? 322  SER C OG    1 
ATOM   9127  N  N     . GLN C  3  323 ? 3.541   104.581 68.678  1.00 52.11  ? 323  GLN C N     1 
ATOM   9128  C  CA    . GLN C  3  323 ? 4.002   105.579 67.733  1.00 52.31  ? 323  GLN C CA    1 
ATOM   9129  C  C     . GLN C  3  323 ? 2.988   106.655 67.425  1.00 52.44  ? 323  GLN C C     1 
ATOM   9130  O  O     . GLN C  3  323 ? 3.344   107.823 67.327  1.00 53.79  ? 323  GLN C O     1 
ATOM   9131  C  CB    . GLN C  3  323 ? 4.427   104.919 66.433  1.00 52.13  ? 323  GLN C CB    1 
ATOM   9132  C  CG    . GLN C  3  323 ? 5.687   104.133 66.547  1.00 53.37  ? 323  GLN C CG    1 
ATOM   9133  C  CD    . GLN C  3  323 ? 6.018   103.483 65.250  1.00 55.62  ? 323  GLN C CD    1 
ATOM   9134  O  OE1   . GLN C  3  323 ? 5.982   104.131 64.204  1.00 59.43  ? 323  GLN C OE1   1 
ATOM   9135  N  NE2   . GLN C  3  323 ? 6.341   102.196 65.290  1.00 55.97  ? 323  GLN C NE2   1 
ATOM   9136  N  N     . THR C  3  324 ? 1.726   106.294 67.239  1.00 51.97  ? 324  THR C N     1 
ATOM   9137  C  CA    . THR C  3  324 ? 0.766   107.349 66.954  1.00 50.56  ? 324  THR C CA    1 
ATOM   9138  C  C     . THR C  3  324 ? 0.543   108.096 68.258  1.00 47.34  ? 324  THR C C     1 
ATOM   9139  O  O     . THR C  3  324 ? 0.505   109.321 68.289  1.00 45.87  ? 324  THR C O     1 
ATOM   9140  C  CB    . THR C  3  324 ? -0.577  106.792 66.399  1.00 52.82  ? 324  THR C CB    1 
ATOM   9141  O  OG1   . THR C  3  324 ? -1.101  105.823 67.310  1.00 54.32  ? 324  THR C OG1   1 
ATOM   9142  C  CG2   . THR C  3  324 ? -0.365  106.142 65.014  1.00 53.35  ? 324  THR C CG2   1 
ATOM   9143  N  N     . LEU C  3  325 ? 0.430   107.358 69.351  1.00 45.06  ? 325  LEU C N     1 
ATOM   9144  C  CA    . LEU C  3  325 ? 0.229   108.022 70.620  1.00 45.30  ? 325  LEU C CA    1 
ATOM   9145  C  C     . LEU C  3  325 ? 1.358   109.037 70.806  1.00 45.94  ? 325  LEU C C     1 
ATOM   9146  O  O     . LEU C  3  325 ? 1.120   110.177 71.195  1.00 47.93  ? 325  LEU C O     1 
ATOM   9147  C  CB    . LEU C  3  325 ? 0.206   107.001 71.752  1.00 43.53  ? 325  LEU C CB    1 
ATOM   9148  C  CG    . LEU C  3  325 ? -0.444  107.488 73.041  1.00 43.07  ? 325  LEU C CG    1 
ATOM   9149  C  CD1   . LEU C  3  325 ? -1.746  108.173 72.695  1.00 43.07  ? 325  LEU C CD1   1 
ATOM   9150  C  CD2   . LEU C  3  325 ? -0.682  106.315 73.998  1.00 43.67  ? 325  LEU C CD2   1 
ATOM   9151  N  N     . PHE C  3  326 ? 2.584   108.630 70.494  1.00 45.73  ? 326  PHE C N     1 
ATOM   9152  C  CA    . PHE C  3  326 ? 3.737   109.516 70.596  1.00 43.89  ? 326  PHE C CA    1 
ATOM   9153  C  C     . PHE C  3  326 ? 3.568   110.785 69.750  1.00 44.55  ? 326  PHE C C     1 
ATOM   9154  O  O     . PHE C  3  326 ? 3.801   111.883 70.245  1.00 44.76  ? 326  PHE C O     1 
ATOM   9155  C  CB    . PHE C  3  326 ? 5.006   108.788 70.154  1.00 42.13  ? 326  PHE C CB    1 
ATOM   9156  C  CG    . PHE C  3  326 ? 6.234   109.666 70.140  1.00 39.49  ? 326  PHE C CG    1 
ATOM   9157  C  CD1   . PHE C  3  326 ? 6.952   109.890 71.305  1.00 37.27  ? 326  PHE C CD1   1 
ATOM   9158  C  CD2   . PHE C  3  326 ? 6.639   110.309 68.968  1.00 37.63  ? 326  PHE C CD2   1 
ATOM   9159  C  CE1   . PHE C  3  326 ? 8.047   110.738 71.310  1.00 35.78  ? 326  PHE C CE1   1 
ATOM   9160  C  CE2   . PHE C  3  326 ? 7.728   111.154 68.967  1.00 36.15  ? 326  PHE C CE2   1 
ATOM   9161  C  CZ    . PHE C  3  326 ? 8.434   111.369 70.149  1.00 35.51  ? 326  PHE C CZ    1 
ATOM   9162  N  N     . TRP C  3  327 ? 3.193   110.641 68.476  1.00 46.08  ? 327  TRP C N     1 
ATOM   9163  C  CA    . TRP C  3  327 ? 2.989   111.808 67.599  1.00 48.32  ? 327  TRP C CA    1 
ATOM   9164  C  C     . TRP C  3  327 ? 1.733   112.604 67.974  1.00 50.82  ? 327  TRP C C     1 
ATOM   9165  O  O     . TRP C  3  327 ? 1.611   113.790 67.639  1.00 51.34  ? 327  TRP C O     1 
ATOM   9166  C  CB    . TRP C  3  327 ? 2.891   111.394 66.140  1.00 46.82  ? 327  TRP C CB    1 
ATOM   9167  C  CG    . TRP C  3  327 ? 4.158   110.884 65.636  1.00 49.68  ? 327  TRP C CG    1 
ATOM   9168  C  CD1   . TRP C  3  327 ? 4.439   109.604 65.253  1.00 50.50  ? 327  TRP C CD1   1 
ATOM   9169  C  CD2   . TRP C  3  327 ? 5.375   111.616 65.515  1.00 50.81  ? 327  TRP C CD2   1 
ATOM   9170  N  NE1   . TRP C  3  327 ? 5.765   109.494 64.903  1.00 50.98  ? 327  TRP C NE1   1 
ATOM   9171  C  CE2   . TRP C  3  327 ? 6.363   110.717 65.057  1.00 50.08  ? 327  TRP C CE2   1 
ATOM   9172  C  CE3   . TRP C  3  327 ? 5.730   112.946 65.752  1.00 51.66  ? 327  TRP C CE3   1 
ATOM   9173  C  CZ2   . TRP C  3  327 ? 7.681   111.105 64.834  1.00 48.55  ? 327  TRP C CZ2   1 
ATOM   9174  C  CZ3   . TRP C  3  327 ? 7.043   113.329 65.527  1.00 52.04  ? 327  TRP C CZ3   1 
ATOM   9175  C  CH2   . TRP C  3  327 ? 8.002   112.407 65.072  1.00 49.71  ? 327  TRP C CH2   1 
ATOM   9176  N  N     . LEU C  3  328 ? 0.792   111.953 68.651  1.00 51.03  ? 328  LEU C N     1 
ATOM   9177  C  CA    . LEU C  3  328 ? -0.399  112.648 69.086  1.00 50.80  ? 328  LEU C CA    1 
ATOM   9178  C  C     . LEU C  3  328 ? 0.100   113.637 70.113  1.00 50.63  ? 328  LEU C C     1 
ATOM   9179  O  O     . LEU C  3  328 ? -0.202  114.816 70.051  1.00 52.97  ? 328  LEU C O     1 
ATOM   9180  C  CB    . LEU C  3  328 ? -1.352  111.697 69.762  1.00 53.85  ? 328  LEU C CB    1 
ATOM   9181  C  CG    . LEU C  3  328 ? -2.768  111.861 69.255  1.00 55.57  ? 328  LEU C CG    1 
ATOM   9182  C  CD1   . LEU C  3  328 ? -2.861  111.245 67.854  1.00 55.11  ? 328  LEU C CD1   1 
ATOM   9183  C  CD2   . LEU C  3  328 ? -3.706  111.169 70.213  1.00 57.47  ? 328  LEU C CD2   1 
ATOM   9184  N  N     . LEU C  3  329 ? 0.874   113.138 71.065  1.00 49.28  ? 329  LEU C N     1 
ATOM   9185  C  CA    . LEU C  3  329 ? 1.464   113.965 72.114  1.00 46.89  ? 329  LEU C CA    1 
ATOM   9186  C  C     . LEU C  3  329 ? 2.258   115.142 71.540  1.00 45.74  ? 329  LEU C C     1 
ATOM   9187  O  O     . LEU C  3  329 ? 2.142   116.269 72.013  1.00 46.32  ? 329  LEU C O     1 
ATOM   9188  C  CB    . LEU C  3  329 ? 2.410   113.119 72.954  1.00 47.54  ? 329  LEU C CB    1 
ATOM   9189  C  CG    . LEU C  3  329 ? 3.146   113.920 74.011  1.00 46.81  ? 329  LEU C CG    1 
ATOM   9190  C  CD1   . LEU C  3  329 ? 2.107   114.417 74.999  1.00 47.33  ? 329  LEU C CD1   1 
ATOM   9191  C  CD2   . LEU C  3  329 ? 4.205   113.077 74.692  1.00 44.88  ? 329  LEU C CD2   1 
ATOM   9192  N  N     . VAL C  3  330 ? 3.092   114.875 70.542  1.00 43.49  ? 330  VAL C N     1 
ATOM   9193  C  CA    . VAL C  3  330 ? 3.868   115.942 69.935  1.00 43.74  ? 330  VAL C CA    1 
ATOM   9194  C  C     . VAL C  3  330 ? 2.898   117.008 69.446  1.00 44.67  ? 330  VAL C C     1 
ATOM   9195  O  O     . VAL C  3  330 ? 3.065   118.190 69.744  1.00 45.59  ? 330  VAL C O     1 
ATOM   9196  C  CB    . VAL C  3  330 ? 4.675   115.437 68.743  1.00 42.95  ? 330  VAL C CB    1 
ATOM   9197  C  CG1   . VAL C  3  330 ? 5.590   116.533 68.236  1.00 38.91  ? 330  VAL C CG1   1 
ATOM   9198  C  CG2   . VAL C  3  330 ? 5.445   114.205 69.143  1.00 41.58  ? 330  VAL C CG2   1 
ATOM   9199  N  N     . ALA C  3  331 ? 1.880   116.580 68.698  1.00 44.04  ? 331  ALA C N     1 
ATOM   9200  C  CA    . ALA C  3  331 ? 0.870   117.495 68.186  1.00 41.61  ? 331  ALA C CA    1 
ATOM   9201  C  C     . ALA C  3  331 ? 0.208   118.205 69.363  1.00 41.77  ? 331  ALA C C     1 
ATOM   9202  O  O     . ALA C  3  331 ? -0.052  119.410 69.306  1.00 43.40  ? 331  ALA C O     1 
ATOM   9203  C  CB    . ALA C  3  331 ? -0.149  116.740 67.402  1.00 39.88  ? 331  ALA C CB    1 
ATOM   9204  N  N     . ASN C  3  332 ? -0.053  117.458 70.432  1.00 41.11  ? 332  ASN C N     1 
ATOM   9205  C  CA    . ASN C  3  332 ? -0.672  118.007 71.636  1.00 40.37  ? 332  ASN C CA    1 
ATOM   9206  C  C     . ASN C  3  332 ? 0.123   119.240 72.055  1.00 39.59  ? 332  ASN C C     1 
ATOM   9207  O  O     . ASN C  3  332 ? -0.448  120.301 72.310  1.00 38.99  ? 332  ASN C O     1 
ATOM   9208  C  CB    . ASN C  3  332 ? -0.650  116.961 72.750  1.00 42.33  ? 332  ASN C CB    1 
ATOM   9209  C  CG    . ASN C  3  332 ? -1.650  117.253 73.855  1.00 46.04  ? 332  ASN C CG    1 
ATOM   9210  O  OD1   . ASN C  3  332 ? -1.865  118.404 74.229  1.00 46.55  ? 332  ASN C OD1   1 
ATOM   9211  N  ND2   . ASN C  3  332 ? -2.253  116.197 74.404  1.00 49.30  ? 332  ASN C ND2   1 
ATOM   9212  N  N     . LEU C  3  333 ? 1.446   119.096 72.090  1.00 39.71  ? 333  LEU C N     1 
ATOM   9213  C  CA    . LEU C  3  333 ? 2.348   120.185 72.474  1.00 41.42  ? 333  LEU C CA    1 
ATOM   9214  C  C     . LEU C  3  333 ? 2.320   121.390 71.524  1.00 41.25  ? 333  LEU C C     1 
ATOM   9215  O  O     . LEU C  3  333 ? 2.414   122.534 71.967  1.00 40.01  ? 333  LEU C O     1 
ATOM   9216  C  CB    . LEU C  3  333 ? 3.777   119.652 72.602  1.00 43.66  ? 333  LEU C CB    1 
ATOM   9217  C  CG    . LEU C  3  333 ? 3.993   118.687 73.779  1.00 45.85  ? 333  LEU C CG    1 
ATOM   9218  C  CD1   . LEU C  3  333 ? 5.345   118.024 73.708  1.00 42.21  ? 333  LEU C CD1   1 
ATOM   9219  C  CD2   . LEU C  3  333 ? 3.849   119.454 75.084  1.00 46.61  ? 333  LEU C CD2   1 
ATOM   9220  N  N     . LEU C  3  334 ? 2.214   121.148 70.223  1.00 41.26  ? 334  LEU C N     1 
ATOM   9221  C  CA    . LEU C  3  334 ? 2.119   122.262 69.286  1.00 43.05  ? 334  LEU C CA    1 
ATOM   9222  C  C     . LEU C  3  334 ? 0.886   123.065 69.631  1.00 42.72  ? 334  LEU C C     1 
ATOM   9223  O  O     . LEU C  3  334 ? 0.917   124.286 69.661  1.00 43.25  ? 334  LEU C O     1 
ATOM   9224  C  CB    . LEU C  3  334 ? 1.974   121.785 67.849  1.00 44.73  ? 334  LEU C CB    1 
ATOM   9225  C  CG    . LEU C  3  334 ? 3.294   121.542 67.134  1.00 48.13  ? 334  LEU C CG    1 
ATOM   9226  C  CD1   . LEU C  3  334 ? 3.015   121.031 65.716  1.00 46.75  ? 334  LEU C CD1   1 
ATOM   9227  C  CD2   . LEU C  3  334 ? 4.087   122.850 67.107  1.00 49.72  ? 334  LEU C CD2   1 
ATOM   9228  N  N     . ILE C  3  335 ? -0.210  122.377 69.900  1.00 42.10  ? 335  ILE C N     1 
ATOM   9229  C  CA    . ILE C  3  335 ? -1.422  123.083 70.233  1.00 42.65  ? 335  ILE C CA    1 
ATOM   9230  C  C     . ILE C  3  335 ? -1.280  123.903 71.509  1.00 41.57  ? 335  ILE C C     1 
ATOM   9231  O  O     . ILE C  3  335 ? -1.699  125.068 71.562  1.00 40.35  ? 335  ILE C O     1 
ATOM   9232  C  CB    . ILE C  3  335 ? -2.586  122.115 70.354  1.00 44.74  ? 335  ILE C CB    1 
ATOM   9233  C  CG1   . ILE C  3  335 ? -2.862  121.499 68.978  1.00 44.78  ? 335  ILE C CG1   1 
ATOM   9234  C  CG2   . ILE C  3  335 ? -3.816  122.849 70.892  1.00 44.57  ? 335  ILE C CG2   1 
ATOM   9235  C  CD1   . ILE C  3  335 ? -3.815  120.324 69.025  1.00 46.48  ? 335  ILE C CD1   1 
ATOM   9236  N  N     . LEU C  3  336 ? -0.702  123.307 72.542  1.00 40.69  ? 336  LEU C N     1 
ATOM   9237  C  CA    . LEU C  3  336 ? -0.523  124.052 73.773  1.00 40.13  ? 336  LEU C CA    1 
ATOM   9238  C  C     . LEU C  3  336 ? 0.335   125.284 73.455  1.00 41.21  ? 336  LEU C C     1 
ATOM   9239  O  O     . LEU C  3  336 ? 0.077   126.391 73.950  1.00 42.75  ? 336  LEU C O     1 
ATOM   9240  C  CB    . LEU C  3  336 ? 0.128   123.171 74.833  1.00 38.49  ? 336  LEU C CB    1 
ATOM   9241  C  CG    . LEU C  3  336 ? -0.838  122.227 75.557  1.00 38.54  ? 336  LEU C CG    1 
ATOM   9242  C  CD1   . LEU C  3  336 ? -0.104  121.310 76.502  1.00 39.57  ? 336  LEU C CD1   1 
ATOM   9243  C  CD2   . LEU C  3  336 ? -1.816  123.053 76.360  1.00 38.55  ? 336  LEU C CD2   1 
ATOM   9244  N  N     . THR C  3  337 ? 1.337   125.103 72.599  1.00 40.03  ? 337  THR C N     1 
ATOM   9245  C  CA    . THR C  3  337 ? 2.212   126.209 72.216  1.00 39.28  ? 337  THR C CA    1 
ATOM   9246  C  C     . THR C  3  337 ? 1.401   127.324 71.585  1.00 39.40  ? 337  THR C C     1 
ATOM   9247  O  O     . THR C  3  337 ? 1.573   128.492 71.912  1.00 38.29  ? 337  THR C O     1 
ATOM   9248  C  CB    . THR C  3  337 ? 3.258   125.733 71.222  1.00 38.85  ? 337  THR C CB    1 
ATOM   9249  O  OG1   . THR C  3  337 ? 4.044   124.725 71.851  1.00 40.94  ? 337  THR C OG1   1 
ATOM   9250  C  CG2   . THR C  3  337 ? 4.159   126.863 70.783  1.00 36.48  ? 337  THR C CG2   1 
ATOM   9251  N  N     . TRP C  3  338 ? 0.522   126.939 70.664  1.00 40.95  ? 338  TRP C N     1 
ATOM   9252  C  CA    . TRP C  3  338 ? -0.360  127.869 69.975  1.00 41.93  ? 338  TRP C CA    1 
ATOM   9253  C  C     . TRP C  3  338 ? -1.280  128.545 70.993  1.00 42.97  ? 338  TRP C C     1 
ATOM   9254  O  O     . TRP C  3  338 ? -1.384  129.774 71.016  1.00 43.03  ? 338  TRP C O     1 
ATOM   9255  C  CB    . TRP C  3  338 ? -1.180  127.120 68.940  1.00 42.82  ? 338  TRP C CB    1 
ATOM   9256  C  CG    . TRP C  3  338 ? -2.285  127.903 68.362  1.00 47.08  ? 338  TRP C CG    1 
ATOM   9257  C  CD1   . TRP C  3  338 ? -2.204  129.128 67.776  1.00 48.80  ? 338  TRP C CD1   1 
ATOM   9258  C  CD2   . TRP C  3  338 ? -3.657  127.525 68.314  1.00 50.48  ? 338  TRP C CD2   1 
ATOM   9259  N  NE1   . TRP C  3  338 ? -3.447  129.546 67.366  1.00 50.45  ? 338  TRP C NE1   1 
ATOM   9260  C  CE2   . TRP C  3  338 ? -4.360  128.580 67.686  1.00 52.21  ? 338  TRP C CE2   1 
ATOM   9261  C  CE3   . TRP C  3  338 ? -4.367  126.398 68.742  1.00 52.81  ? 338  TRP C CE3   1 
ATOM   9262  C  CZ2   . TRP C  3  338 ? -5.741  128.541 67.478  1.00 53.66  ? 338  TRP C CZ2   1 
ATOM   9263  C  CZ3   . TRP C  3  338 ? -5.747  126.357 68.533  1.00 54.43  ? 338  TRP C CZ3   1 
ATOM   9264  C  CH2   . TRP C  3  338 ? -6.416  127.425 67.906  1.00 54.83  ? 338  TRP C CH2   1 
ATOM   9265  N  N     . ILE C  3  339 ? -1.939  127.755 71.840  1.00 41.52  ? 339  ILE C N     1 
ATOM   9266  C  CA    . ILE C  3  339 ? -2.792  128.344 72.848  1.00 42.27  ? 339  ILE C CA    1 
ATOM   9267  C  C     . ILE C  3  339 ? -2.018  129.332 73.709  1.00 43.53  ? 339  ILE C C     1 
ATOM   9268  O  O     . ILE C  3  339 ? -2.541  130.389 74.051  1.00 46.43  ? 339  ILE C O     1 
ATOM   9269  C  CB    . ILE C  3  339 ? -3.403  127.291 73.766  1.00 43.32  ? 339  ILE C CB    1 
ATOM   9270  C  CG1   . ILE C  3  339 ? -4.421  126.489 72.973  1.00 45.52  ? 339  ILE C CG1   1 
ATOM   9271  C  CG2   . ILE C  3  339 ? -4.051  127.952 75.008  1.00 40.94  ? 339  ILE C CG2   1 
ATOM   9272  C  CD1   . ILE C  3  339 ? -5.524  127.339 72.365  1.00 45.71  ? 339  ILE C CD1   1 
ATOM   9273  N  N     . GLY C  3  340 ? -0.784  129.001 74.069  1.00 42.62  ? 340  GLY C N     1 
ATOM   9274  C  CA    . GLY C  3  340 ? -0.004  129.913 74.888  1.00 43.01  ? 340  GLY C CA    1 
ATOM   9275  C  C     . GLY C  3  340 ? 0.202   131.297 74.287  1.00 43.76  ? 340  GLY C C     1 
ATOM   9276  O  O     . GLY C  3  340 ? 0.442   132.270 75.011  1.00 43.81  ? 340  GLY C O     1 
ATOM   9277  N  N     . SER C  3  341 ? 0.099   131.396 72.965  1.00 44.70  ? 341  SER C N     1 
ATOM   9278  C  CA    . SER C  3  341 ? 0.278   132.674 72.270  1.00 47.47  ? 341  SER C CA    1 
ATOM   9279  C  C     . SER C  3  341 ? -1.009  133.489 72.044  1.00 49.33  ? 341  SER C C     1 
ATOM   9280  O  O     . SER C  3  341 ? -0.962  134.595 71.501  1.00 48.72  ? 341  SER C O     1 
ATOM   9281  C  CB    . SER C  3  341 ? 0.924   132.436 70.906  1.00 46.57  ? 341  SER C CB    1 
ATOM   9282  O  OG    . SER C  3  341 ? -0.003  131.859 70.004  1.00 44.05  ? 341  SER C OG    1 
ATOM   9283  N  N     . GLN C  3  342 ? -2.152  132.935 72.431  1.00 51.14  ? 342  GLN C N     1 
ATOM   9284  C  CA    . GLN C  3  342 ? -3.421  133.614 72.246  1.00 52.86  ? 342  GLN C CA    1 
ATOM   9285  C  C     . GLN C  3  342 ? -3.966  134.206 73.528  1.00 56.14  ? 342  GLN C C     1 
ATOM   9286  O  O     . GLN C  3  342 ? -3.536  133.853 74.630  1.00 58.31  ? 342  GLN C O     1 
ATOM   9287  C  CB    . GLN C  3  342 ? -4.432  132.645 71.670  1.00 50.13  ? 342  GLN C CB    1 
ATOM   9288  C  CG    . GLN C  3  342 ? -4.021  132.140 70.331  1.00 51.18  ? 342  GLN C CG    1 
ATOM   9289  C  CD    . GLN C  3  342 ? -3.809  133.261 69.356  1.00 53.42  ? 342  GLN C CD    1 
ATOM   9290  O  OE1   . GLN C  3  342 ? -2.853  133.255 68.584  1.00 55.43  ? 342  GLN C OE1   1 
ATOM   9291  N  NE2   . GLN C  3  342 ? -4.708  134.241 69.377  1.00 56.23  ? 342  GLN C NE2   1 
ATOM   9292  N  N     . PRO C  3  343 ? -4.918  135.139 73.406  1.00 57.59  ? 343  PRO C N     1 
ATOM   9293  C  CA    . PRO C  3  343 ? -5.505  135.759 74.598  1.00 57.81  ? 343  PRO C CA    1 
ATOM   9294  C  C     . PRO C  3  343 ? -6.317  134.739 75.383  1.00 58.36  ? 343  PRO C C     1 
ATOM   9295  O  O     . PRO C  3  343 ? -6.499  133.606 74.932  1.00 58.41  ? 343  PRO C O     1 
ATOM   9296  C  CB    . PRO C  3  343 ? -6.363  136.878 74.014  1.00 57.50  ? 343  PRO C CB    1 
ATOM   9297  C  CG    . PRO C  3  343 ? -6.756  136.337 72.661  1.00 58.24  ? 343  PRO C CG    1 
ATOM   9298  C  CD    . PRO C  3  343 ? -5.473  135.718 72.171  1.00 57.65  ? 343  PRO C CD    1 
ATOM   9299  N  N     . VAL C  3  344 ? -6.790  135.127 76.559  1.00 59.58  ? 344  VAL C N     1 
ATOM   9300  C  CA    . VAL C  3  344 ? -7.583  134.207 77.355  1.00 62.53  ? 344  VAL C CA    1 
ATOM   9301  C  C     . VAL C  3  344 ? -9.056  134.471 77.079  1.00 63.14  ? 344  VAL C C     1 
ATOM   9302  O  O     . VAL C  3  344 ? -9.735  135.172 77.820  1.00 63.03  ? 344  VAL C O     1 
ATOM   9303  C  CB    . VAL C  3  344 ? -7.307  134.361 78.862  1.00 64.22  ? 344  VAL C CB    1 
ATOM   9304  C  CG1   . VAL C  3  344 ? -7.742  133.103 79.594  1.00 65.17  ? 344  VAL C CG1   1 
ATOM   9305  C  CG2   . VAL C  3  344 ? -5.836  134.609 79.101  1.00 66.25  ? 344  VAL C CG2   1 
ATOM   9306  N  N     . GLU C  3  345 ? -9.537  133.894 75.990  1.00 64.50  ? 345  GLU C N     1 
ATOM   9307  C  CA    . GLU C  3  345 ? -10.910 134.054 75.576  1.00 66.22  ? 345  GLU C CA    1 
ATOM   9308  C  C     . GLU C  3  345 ? -11.374 132.833 74.827  1.00 66.39  ? 345  GLU C C     1 
ATOM   9309  O  O     . GLU C  3  345 ? -10.565 132.030 74.363  1.00 67.62  ? 345  GLU C O     1 
ATOM   9310  C  CB    . GLU C  3  345 ? -11.025 135.235 74.642  1.00 68.78  ? 345  GLU C CB    1 
ATOM   9311  C  CG    . GLU C  3  345 ? -10.678 136.546 75.276  1.00 74.10  ? 345  GLU C CG    1 
ATOM   9312  C  CD    . GLU C  3  345 ? -10.658 137.662 74.254  1.00 77.91  ? 345  GLU C CD    1 
ATOM   9313  O  OE1   . GLU C  3  345 ? -11.269 137.468 73.170  1.00 79.08  ? 345  GLU C OE1   1 
ATOM   9314  O  OE2   . GLU C  3  345 ? -10.042 138.724 74.537  1.00 78.95  ? 345  GLU C OE2   1 
ATOM   9315  N  N     . HIS C  3  346 ? -12.685 132.694 74.700  1.00 65.52  ? 346  HIS C N     1 
ATOM   9316  C  CA    . HIS C  3  346 ? -13.229 131.571 73.960  1.00 63.81  ? 346  HIS C CA    1 
ATOM   9317  C  C     . HIS C  3  346 ? -12.769 131.828 72.520  1.00 60.43  ? 346  HIS C C     1 
ATOM   9318  O  O     . HIS C  3  346 ? -12.618 132.983 72.127  1.00 61.25  ? 346  HIS C O     1 
ATOM   9319  C  CB    . HIS C  3  346 ? -14.760 131.575 74.054  1.00 65.10  ? 346  HIS C CB    1 
ATOM   9320  C  CG    . HIS C  3  346 ? -15.406 130.475 73.272  1.00 67.97  ? 346  HIS C CG    1 
ATOM   9321  N  ND1   . HIS C  3  346 ? -15.426 129.167 73.709  1.00 68.49  ? 346  HIS C ND1   1 
ATOM   9322  C  CD2   . HIS C  3  346 ? -15.973 130.471 72.039  1.00 67.82  ? 346  HIS C CD2   1 
ATOM   9323  C  CE1   . HIS C  3  346 ? -15.975 128.405 72.778  1.00 68.54  ? 346  HIS C CE1   1 
ATOM   9324  N  NE2   . HIS C  3  346 ? -16.314 129.170 71.754  1.00 68.65  ? 346  HIS C NE2   1 
ATOM   9325  N  N     . PRO C  3  347 ? -12.505 130.771 71.730  1.00 57.31  ? 347  PRO C N     1 
ATOM   9326  C  CA    . PRO C  3  347 ? -12.584 129.340 72.032  1.00 56.57  ? 347  PRO C CA    1 
ATOM   9327  C  C     . PRO C  3  347 ? -11.303 128.826 72.692  1.00 56.31  ? 347  PRO C C     1 
ATOM   9328  O  O     . PRO C  3  347 ? -11.283 127.731 73.270  1.00 57.42  ? 347  PRO C O     1 
ATOM   9329  C  CB    . PRO C  3  347 ? -12.813 128.724 70.659  1.00 54.90  ? 347  PRO C CB    1 
ATOM   9330  C  CG    . PRO C  3  347 ? -11.958 129.583 69.808  1.00 55.64  ? 347  PRO C CG    1 
ATOM   9331  C  CD    . PRO C  3  347 ? -12.285 130.972 70.287  1.00 55.74  ? 347  PRO C CD    1 
ATOM   9332  N  N     . PHE C  3  348 ? -10.247 129.636 72.599  1.00 54.19  ? 348  PHE C N     1 
ATOM   9333  C  CA    . PHE C  3  348 ? -8.931  129.328 73.152  1.00 51.27  ? 348  PHE C CA    1 
ATOM   9334  C  C     . PHE C  3  348 ? -8.958  128.794 74.587  1.00 52.90  ? 348  PHE C C     1 
ATOM   9335  O  O     . PHE C  3  348 ? -8.182  127.887 74.930  1.00 54.91  ? 348  PHE C O     1 
ATOM   9336  C  CB    . PHE C  3  348 ? -8.063  130.570 73.114  1.00 46.52  ? 348  PHE C CB    1 
ATOM   9337  C  CG    . PHE C  3  348 ? -7.945  131.172 71.765  1.00 43.72  ? 348  PHE C CG    1 
ATOM   9338  C  CD1   . PHE C  3  348 ? -7.779  132.539 71.618  1.00 44.18  ? 348  PHE C CD1   1 
ATOM   9339  C  CD2   . PHE C  3  348 ? -7.974  130.381 70.635  1.00 43.88  ? 348  PHE C CD2   1 
ATOM   9340  C  CE1   . PHE C  3  348 ? -7.642  133.111 70.352  1.00 43.56  ? 348  PHE C CE1   1 
ATOM   9341  C  CE2   . PHE C  3  348 ? -7.837  130.944 69.366  1.00 44.20  ? 348  PHE C CE2   1 
ATOM   9342  C  CZ    . PHE C  3  348 ? -7.670  132.314 69.227  1.00 42.67  ? 348  PHE C CZ    1 
ATOM   9343  N  N     . ILE C  3  349 ? -9.837  129.343 75.426  1.00 50.28  ? 349  ILE C N     1 
ATOM   9344  C  CA    . ILE C  3  349 ? -9.909  128.899 76.809  1.00 48.77  ? 349  ILE C CA    1 
ATOM   9345  C  C     . ILE C  3  349 ? -10.255 127.429 76.951  1.00 48.66  ? 349  ILE C C     1 
ATOM   9346  O  O     . ILE C  3  349 ? -9.611  126.698 77.689  1.00 48.63  ? 349  ILE C O     1 
ATOM   9347  C  CB    . ILE C  3  349 ? -10.936 129.716 77.611  1.00 48.65  ? 349  ILE C CB    1 
ATOM   9348  C  CG1   . ILE C  3  349 ? -10.583 131.209 77.524  1.00 49.27  ? 349  ILE C CG1   1 
ATOM   9349  C  CG2   . ILE C  3  349 ? -10.963 129.242 79.065  1.00 46.31  ? 349  ILE C CG2   1 
ATOM   9350  C  CD1   . ILE C  3  349 ? -11.238 132.091 78.574  1.00 46.98  ? 349  ILE C CD1   1 
ATOM   9351  N  N     . ILE C  3  350 ? -11.271 126.986 76.237  1.00 49.26  ? 350  ILE C N     1 
ATOM   9352  C  CA    . ILE C  3  350 ? -11.673 125.595 76.350  1.00 49.85  ? 350  ILE C CA    1 
ATOM   9353  C  C     . ILE C  3  350 ? -10.634 124.683 75.694  1.00 48.98  ? 350  ILE C C     1 
ATOM   9354  O  O     . ILE C  3  350 ? -10.210 123.675 76.286  1.00 47.57  ? 350  ILE C O     1 
ATOM   9355  C  CB    . ILE C  3  350 ? -13.107 125.375 75.729  1.00 50.56  ? 350  ILE C CB    1 
ATOM   9356  C  CG1   . ILE C  3  350 ? -13.639 123.994 76.099  1.00 49.90  ? 350  ILE C CG1   1 
ATOM   9357  C  CG2   . ILE C  3  350 ? -13.062 125.511 74.218  1.00 50.13  ? 350  ILE C CG2   1 
ATOM   9358  C  CD1   . ILE C  3  350 ? -13.698 123.759 77.596  1.00 52.90  ? 350  ILE C CD1   1 
ATOM   9359  N  N     . ILE C  3  351 ? -10.222 125.041 74.479  1.00 48.11  ? 351  ILE C N     1 
ATOM   9360  C  CA    . ILE C  3  351 ? -9.225  124.250 73.770  1.00 48.27  ? 351  ILE C CA    1 
ATOM   9361  C  C     . ILE C  3  351 ? -8.005  124.087 74.673  1.00 50.23  ? 351  ILE C C     1 
ATOM   9362  O  O     . ILE C  3  351 ? -7.370  123.033 74.681  1.00 50.84  ? 351  ILE C O     1 
ATOM   9363  C  CB    . ILE C  3  351 ? -8.782  124.927 72.480  1.00 45.62  ? 351  ILE C CB    1 
ATOM   9364  C  CG1   . ILE C  3  351 ? -9.961  125.038 71.534  1.00 44.06  ? 351  ILE C CG1   1 
ATOM   9365  C  CG2   . ILE C  3  351 ? -7.683  124.132 71.830  1.00 44.01  ? 351  ILE C CG2   1 
ATOM   9366  C  CD1   . ILE C  3  351 ? -9.630  125.798 70.291  1.00 45.88  ? 351  ILE C CD1   1 
ATOM   9367  N  N     . GLY C  3  352 ? -7.694  125.138 75.436  1.00 50.30  ? 352  GLY C N     1 
ATOM   9368  C  CA    . GLY C  3  352 ? -6.562  125.109 76.340  1.00 49.31  ? 352  GLY C CA    1 
ATOM   9369  C  C     . GLY C  3  352 ? -6.665  124.015 77.377  1.00 50.30  ? 352  GLY C C     1 
ATOM   9370  O  O     . GLY C  3  352 ? -5.742  123.225 77.557  1.00 51.12  ? 352  GLY C O     1 
ATOM   9371  N  N     . GLN C  3  353 ? -7.793  123.948 78.059  1.00 51.97  ? 353  GLN C N     1 
ATOM   9372  C  CA    . GLN C  3  353 ? -7.962  122.939 79.081  1.00 54.64  ? 353  GLN C CA    1 
ATOM   9373  C  C     . GLN C  3  353 ? -8.013  121.546 78.490  1.00 55.31  ? 353  GLN C C     1 
ATOM   9374  O  O     . GLN C  3  353 ? -7.690  120.563 79.153  1.00 56.52  ? 353  GLN C O     1 
ATOM   9375  C  CB    . GLN C  3  353 ? -9.228  123.220 79.849  1.00 57.62  ? 353  GLN C CB    1 
ATOM   9376  C  CG    . GLN C  3  353 ? -9.195  124.566 80.508  1.00 62.55  ? 353  GLN C CG    1 
ATOM   9377  C  CD    . GLN C  3  353 ? -10.574 125.122 80.702  1.00 63.99  ? 353  GLN C CD    1 
ATOM   9378  O  OE1   . GLN C  3  353 ? -11.365 125.176 79.755  1.00 66.83  ? 353  GLN C OE1   1 
ATOM   9379  N  NE2   . GLN C  3  353 ? -10.876 125.550 81.921  1.00 63.78  ? 353  GLN C NE2   1 
ATOM   9380  N  N     . MET C  3  354 ? -8.431  121.444 77.244  1.00 54.97  ? 354  MET C N     1 
ATOM   9381  C  CA    . MET C  3  354 ? -8.477  120.135 76.641  1.00 56.55  ? 354  MET C CA    1 
ATOM   9382  C  C     . MET C  3  354 ? -7.061  119.652 76.423  1.00 55.56  ? 354  MET C C     1 
ATOM   9383  O  O     . MET C  3  354 ? -6.682  118.584 76.907  1.00 56.52  ? 354  MET C O     1 
ATOM   9384  C  CB    . MET C  3  354 ? -9.241  120.191 75.325  1.00 62.55  ? 354  MET C CB    1 
ATOM   9385  C  CG    . MET C  3  354 ? -10.704 120.550 75.525  1.00 67.59  ? 354  MET C CG    1 
ATOM   9386  S  SD    . MET C  3  354 ? -11.489 119.356 76.661  1.00 76.20  ? 354  MET C SD    1 
ATOM   9387  C  CE    . MET C  3  354 ? -11.535 120.256 78.304  1.00 71.16  ? 354  MET C CE    1 
ATOM   9388  N  N     . ALA C  3  355 ? -6.273  120.450 75.713  1.00 53.86  ? 355  ALA C N     1 
ATOM   9389  C  CA    . ALA C  3  355 ? -4.886  120.110 75.438  1.00 52.66  ? 355  ALA C CA    1 
ATOM   9390  C  C     . ALA C  3  355 ? -4.129  119.840 76.727  1.00 52.69  ? 355  ALA C C     1 
ATOM   9391  O  O     . ALA C  3  355 ? -3.299  118.936 76.778  1.00 52.89  ? 355  ALA C O     1 
ATOM   9392  C  CB    . ALA C  3  355 ? -4.226  121.224 74.690  1.00 53.36  ? 355  ALA C CB    1 
ATOM   9393  N  N     . SER C  3  356 ? -4.403  120.628 77.762  1.00 51.52  ? 356  SER C N     1 
ATOM   9394  C  CA    . SER C  3  356 ? -3.743  120.425 79.042  1.00 52.92  ? 356  SER C CA    1 
ATOM   9395  C  C     . SER C  3  356 ? -4.154  119.104 79.648  1.00 53.64  ? 356  SER C C     1 
ATOM   9396  O  O     . SER C  3  356 ? -3.347  118.388 80.234  1.00 55.28  ? 356  SER C O     1 
ATOM   9397  C  CB    . SER C  3  356 ? -4.106  121.521 80.028  1.00 53.36  ? 356  SER C CB    1 
ATOM   9398  O  OG    . SER C  3  356 ? -3.322  122.672 79.817  1.00 57.42  ? 356  SER C OG    1 
ATOM   9399  N  N     . LEU C  3  357 ? -5.430  118.785 79.520  1.00 53.85  ? 357  LEU C N     1 
ATOM   9400  C  CA    . LEU C  3  357 ? -5.949  117.552 80.075  1.00 53.16  ? 357  LEU C CA    1 
ATOM   9401  C  C     . LEU C  3  357 ? -5.386  116.349 79.335  1.00 52.74  ? 357  LEU C C     1 
ATOM   9402  O  O     . LEU C  3  357 ? -4.913  115.387 79.943  1.00 50.53  ? 357  LEU C O     1 
ATOM   9403  C  CB    . LEU C  3  357 ? -7.466  117.561 79.979  1.00 53.73  ? 357  LEU C CB    1 
ATOM   9404  C  CG    . LEU C  3  357 ? -8.165  116.553 80.877  1.00 54.35  ? 357  LEU C CG    1 
ATOM   9405  C  CD1   . LEU C  3  357 ? -7.622  116.619 82.304  1.00 53.59  ? 357  LEU C CD1   1 
ATOM   9406  C  CD2   . LEU C  3  357 ? -9.626  116.882 80.860  1.00 54.65  ? 357  LEU C CD2   1 
ATOM   9407  N  N     . SER C  3  358 ? -5.439  116.414 78.011  1.00 52.49  ? 358  SER C N     1 
ATOM   9408  C  CA    . SER C  3  358 ? -4.937  115.328 77.189  1.00 53.41  ? 358  SER C CA    1 
ATOM   9409  C  C     . SER C  3  358 ? -3.464  115.130 77.435  1.00 53.77  ? 358  SER C C     1 
ATOM   9410  O  O     . SER C  3  358 ? -2.988  114.006 77.424  1.00 57.11  ? 358  SER C O     1 
ATOM   9411  C  CB    . SER C  3  358 ? -5.143  115.630 75.717  1.00 52.42  ? 358  SER C CB    1 
ATOM   9412  O  OG    . SER C  3  358 ? -4.554  116.872 75.410  1.00 56.74  ? 358  SER C OG    1 
ATOM   9413  N  N     . TYR C  3  359 ? -2.736  116.223 77.634  1.00 52.29  ? 359  TYR C N     1 
ATOM   9414  C  CA    . TYR C  3  359 ? -1.305  116.137 77.883  1.00 51.21  ? 359  TYR C CA    1 
ATOM   9415  C  C     . TYR C  3  359 ? -0.999  115.138 79.008  1.00 51.85  ? 359  TYR C C     1 
ATOM   9416  O  O     . TYR C  3  359 ? -0.308  114.131 78.791  1.00 51.78  ? 359  TYR C O     1 
ATOM   9417  C  CB    . TYR C  3  359 ? -0.750  117.517 78.252  1.00 50.80  ? 359  TYR C CB    1 
ATOM   9418  C  CG    . TYR C  3  359 ? 0.721   117.523 78.593  1.00 49.65  ? 359  TYR C CG    1 
ATOM   9419  C  CD1   . TYR C  3  359 ? 1.682   117.360 77.598  1.00 48.99  ? 359  TYR C CD1   1 
ATOM   9420  C  CD2   . TYR C  3  359 ? 1.148   117.630 79.928  1.00 50.49  ? 359  TYR C CD2   1 
ATOM   9421  C  CE1   . TYR C  3  359 ? 3.031   117.296 77.912  1.00 50.73  ? 359  TYR C CE1   1 
ATOM   9422  C  CE2   . TYR C  3  359 ? 2.499   117.568 80.261  1.00 51.17  ? 359  TYR C CE2   1 
ATOM   9423  C  CZ    . TYR C  3  359 ? 3.434   117.397 79.244  1.00 52.03  ? 359  TYR C CZ    1 
ATOM   9424  O  OH    . TYR C  3  359 ? 4.770   117.308 79.548  1.00 52.59  ? 359  TYR C OH    1 
ATOM   9425  N  N     . PHE C  3  360 ? -1.528  115.397 80.202  1.00 50.97  ? 360  PHE C N     1 
ATOM   9426  C  CA    . PHE C  3  360 ? -1.264  114.515 81.329  1.00 51.00  ? 360  PHE C CA    1 
ATOM   9427  C  C     . PHE C  3  360 ? -1.827  113.115 81.179  1.00 51.51  ? 360  PHE C C     1 
ATOM   9428  O  O     . PHE C  3  360 ? -1.276  112.142 81.698  1.00 52.09  ? 360  PHE C O     1 
ATOM   9429  C  CB    . PHE C  3  360 ? -1.763  115.148 82.622  1.00 49.66  ? 360  PHE C CB    1 
ATOM   9430  C  CG    . PHE C  3  360 ? -0.964  116.335 83.041  1.00 49.95  ? 360  PHE C CG    1 
ATOM   9431  C  CD1   . PHE C  3  360 ? -1.440  117.617 82.839  1.00 50.97  ? 360  PHE C CD1   1 
ATOM   9432  C  CD2   . PHE C  3  360 ? 0.301   116.174 83.574  1.00 49.72  ? 360  PHE C CD2   1 
ATOM   9433  C  CE1   . PHE C  3  360 ? -0.657  118.727 83.162  1.00 51.08  ? 360  PHE C CE1   1 
ATOM   9434  C  CE2   . PHE C  3  360 ? 1.081   117.276 83.894  1.00 50.78  ? 360  PHE C CE2   1 
ATOM   9435  C  CZ    . PHE C  3  360 ? 0.602   118.551 83.688  1.00 49.74  ? 360  PHE C CZ    1 
ATOM   9436  N  N     . THR C  3  361 ? -2.922  113.002 80.456  1.00 52.09  ? 361  THR C N     1 
ATOM   9437  C  CA    . THR C  3  361 ? -3.531  111.707 80.270  1.00 52.37  ? 361  THR C CA    1 
ATOM   9438  C  C     . THR C  3  361 ? -2.626  110.832 79.436  1.00 52.78  ? 361  THR C C     1 
ATOM   9439  O  O     . THR C  3  361 ? -2.280  109.714 79.826  1.00 53.58  ? 361  THR C O     1 
ATOM   9440  C  CB    . THR C  3  361 ? -4.837  111.859 79.570  1.00 51.67  ? 361  THR C CB    1 
ATOM   9441  O  OG1   . THR C  3  361 ? -5.500  113.008 80.096  1.00 51.22  ? 361  THR C OG1   1 
ATOM   9442  C  CG2   . THR C  3  361 ? -5.677  110.633 79.793  1.00 51.66  ? 361  THR C CG2   1 
ATOM   9443  N  N     . ILE C  3  362 ? -2.236  111.357 78.285  1.00 52.31  ? 362  ILE C N     1 
ATOM   9444  C  CA    . ILE C  3  362 ? -1.370  110.632 77.384  1.00 52.54  ? 362  ILE C CA    1 
ATOM   9445  C  C     . ILE C  3  362 ? -0.145  110.046 78.068  1.00 52.65  ? 362  ILE C C     1 
ATOM   9446  O  O     . ILE C  3  362 ? 0.231   108.915 77.782  1.00 54.39  ? 362  ILE C O     1 
ATOM   9447  C  CB    . ILE C  3  362 ? -0.893  111.514 76.242  1.00 52.46  ? 362  ILE C CB    1 
ATOM   9448  C  CG1   . ILE C  3  362 ? -2.077  111.859 75.350  1.00 50.83  ? 362  ILE C CG1   1 
ATOM   9449  C  CG2   . ILE C  3  362 ? 0.214   110.798 75.464  1.00 53.59  ? 362  ILE C CG2   1 
ATOM   9450  C  CD1   . ILE C  3  362 ? -1.688  112.275 73.974  1.00 54.45  ? 362  ILE C CD1   1 
ATOM   9451  N  N     . LEU C  3  363 ? 0.479   110.803 78.966  1.00 51.01  ? 363  LEU C N     1 
ATOM   9452  C  CA    . LEU C  3  363 ? 1.669   110.308 79.651  1.00 49.17  ? 363  LEU C CA    1 
ATOM   9453  C  C     . LEU C  3  363 ? 1.391   109.500 80.905  1.00 49.28  ? 363  LEU C C     1 
ATOM   9454  O  O     . LEU C  3  363 ? 2.099   108.537 81.180  1.00 49.83  ? 363  LEU C O     1 
ATOM   9455  C  CB    . LEU C  3  363 ? 2.592   111.453 80.042  1.00 47.24  ? 363  LEU C CB    1 
ATOM   9456  C  CG    . LEU C  3  363 ? 3.276   112.292 78.968  1.00 47.12  ? 363  LEU C CG    1 
ATOM   9457  C  CD1   . LEU C  3  363 ? 3.834   113.512 79.698  1.00 48.21  ? 363  LEU C CD1   1 
ATOM   9458  C  CD2   . LEU C  3  363 ? 4.371   111.544 78.202  1.00 42.50  ? 363  LEU C CD2   1 
ATOM   9459  N  N     . LEU C  3  364 ? 0.390   109.894 81.685  1.00 49.13  ? 364  LEU C N     1 
ATOM   9460  C  CA    . LEU C  3  364 ? 0.096   109.173 82.924  1.00 48.57  ? 364  LEU C CA    1 
ATOM   9461  C  C     . LEU C  3  364 ? -0.747  107.919 82.738  1.00 48.91  ? 364  LEU C C     1 
ATOM   9462  O  O     . LEU C  3  364 ? -0.513  106.895 83.386  1.00 48.30  ? 364  LEU C O     1 
ATOM   9463  C  CB    . LEU C  3  364 ? -0.605  110.088 83.934  1.00 45.48  ? 364  LEU C CB    1 
ATOM   9464  C  CG    . LEU C  3  364 ? 0.216   111.219 84.555  1.00 44.34  ? 364  LEU C CG    1 
ATOM   9465  C  CD1   . LEU C  3  364 ? -0.676  112.008 85.495  1.00 43.35  ? 364  LEU C CD1   1 
ATOM   9466  C  CD2   . LEU C  3  364 ? 1.409   110.669 85.312  1.00 41.93  ? 364  LEU C CD2   1 
ATOM   9467  N  N     . ILE C  3  365 ? -1.709  107.983 81.828  1.00 48.53  ? 365  ILE C N     1 
ATOM   9468  C  CA    . ILE C  3  365 ? -2.600  106.859 81.635  1.00 46.61  ? 365  ILE C CA    1 
ATOM   9469  C  C     . ILE C  3  365 ? -2.493  106.079 80.347  1.00 48.12  ? 365  ILE C C     1 
ATOM   9470  O  O     . ILE C  3  365 ? -2.429  104.856 80.379  1.00 48.78  ? 365  ILE C O     1 
ATOM   9471  C  CB    . ILE C  3  365 ? -4.036  107.323 81.776  1.00 45.02  ? 365  ILE C CB    1 
ATOM   9472  C  CG1   . ILE C  3  365 ? -4.290  107.678 83.237  1.00 43.58  ? 365  ILE C CG1   1 
ATOM   9473  C  CG2   . ILE C  3  365 ? -4.982  106.265 81.207  1.00 43.48  ? 365  ILE C CG2   1 
ATOM   9474  C  CD1   . ILE C  3  365 ? -5.410  108.649 83.435  1.00 45.19  ? 365  ILE C CD1   1 
ATOM   9475  N  N     . LEU C  3  366 ? -2.494  106.761 79.210  1.00 48.50  ? 366  LEU C N     1 
ATOM   9476  C  CA    . LEU C  3  366 ? -2.443  106.029 77.960  1.00 49.17  ? 366  LEU C CA    1 
ATOM   9477  C  C     . LEU C  3  366 ? -1.151  105.299 77.702  1.00 49.44  ? 366  LEU C C     1 
ATOM   9478  O  O     . LEU C  3  366 ? -1.150  104.074 77.584  1.00 50.28  ? 366  LEU C O     1 
ATOM   9479  C  CB    . LEU C  3  366 ? -2.778  106.937 76.778  1.00 49.17  ? 366  LEU C CB    1 
ATOM   9480  C  CG    . LEU C  3  366 ? -4.210  107.482 76.783  1.00 48.06  ? 366  LEU C CG    1 
ATOM   9481  C  CD1   . LEU C  3  366 ? -4.602  107.836 75.356  1.00 45.44  ? 366  LEU C CD1   1 
ATOM   9482  C  CD2   . LEU C  3  366 ? -5.168  106.439 77.352  1.00 44.95  ? 366  LEU C CD2   1 
ATOM   9483  N  N     . PHE C  3  367 ? -0.046  106.022 77.630  1.00 49.51  ? 367  PHE C N     1 
ATOM   9484  C  CA    . PHE C  3  367 ? 1.206   105.350 77.361  1.00 50.45  ? 367  PHE C CA    1 
ATOM   9485  C  C     . PHE C  3  367 ? 1.402   104.063 78.143  1.00 50.94  ? 367  PHE C C     1 
ATOM   9486  O  O     . PHE C  3  367 ? 1.670   103.008 77.557  1.00 52.74  ? 367  PHE C O     1 
ATOM   9487  C  CB    . PHE C  3  367 ? 2.386   106.298 77.561  1.00 49.94  ? 367  PHE C CB    1 
ATOM   9488  C  CG    . PHE C  3  367 ? 2.831   106.936 76.282  1.00 51.27  ? 367  PHE C CG    1 
ATOM   9489  C  CD1   . PHE C  3  367 ? 2.983   108.309 76.179  1.00 51.24  ? 367  PHE C CD1   1 
ATOM   9490  C  CD2   . PHE C  3  367 ? 3.005   106.153 75.142  1.00 51.33  ? 367  PHE C CD2   1 
ATOM   9491  C  CE1   . PHE C  3  367 ? 3.285   108.892 74.959  1.00 52.72  ? 367  PHE C CE1   1 
ATOM   9492  C  CE2   . PHE C  3  367 ? 3.311   106.726 73.912  1.00 52.13  ? 367  PHE C CE2   1 
ATOM   9493  C  CZ    . PHE C  3  367 ? 3.448   108.098 73.817  1.00 53.22  ? 367  PHE C CZ    1 
ATOM   9494  N  N     . PRO C  3  368 ? 1.244   104.107 79.467  1.00 49.35  ? 368  PRO C N     1 
ATOM   9495  C  CA    . PRO C  3  368 ? 1.444   102.843 80.181  1.00 49.12  ? 368  PRO C CA    1 
ATOM   9496  C  C     . PRO C  3  368 ? 0.397   101.780 79.818  1.00 48.90  ? 368  PRO C C     1 
ATOM   9497  O  O     . PRO C  3  368 ? 0.681   100.582 79.754  1.00 47.90  ? 368  PRO C O     1 
ATOM   9498  C  CB    . PRO C  3  368 ? 1.409   103.270 81.657  1.00 47.52  ? 368  PRO C CB    1 
ATOM   9499  C  CG    . PRO C  3  368 ? 0.566   104.492 81.648  1.00 47.26  ? 368  PRO C CG    1 
ATOM   9500  C  CD    . PRO C  3  368 ? 0.952   105.216 80.387  1.00 48.05  ? 368  PRO C CD    1 
ATOM   9501  N  N     . THR C  3  369 ? -0.811  102.233 79.547  1.00 49.50  ? 369  THR C N     1 
ATOM   9502  C  CA    . THR C  3  369 ? -1.880  101.322 79.217  1.00 51.35  ? 369  THR C CA    1 
ATOM   9503  C  C     . THR C  3  369 ? -1.709  100.690 77.850  1.00 53.06  ? 369  THR C C     1 
ATOM   9504  O  O     . THR C  3  369 ? -1.758  99.470  77.722  1.00 54.67  ? 369  THR C O     1 
ATOM   9505  C  CB    . THR C  3  369 ? -3.217  102.044 79.304  1.00 50.98  ? 369  THR C CB    1 
ATOM   9506  O  OG1   . THR C  3  369 ? -3.484  102.334 80.681  1.00 51.30  ? 369  THR C OG1   1 
ATOM   9507  C  CG2   . THR C  3  369 ? -4.333  101.212 78.710  1.00 47.28  ? 369  THR C CG2   1 
ATOM   9508  N  N     . ILE C  3  370 ? -1.519  101.504 76.823  1.00 53.12  ? 370  ILE C N     1 
ATOM   9509  C  CA    . ILE C  3  370 ? -1.342  100.949 75.497  1.00 55.04  ? 370  ILE C CA    1 
ATOM   9510  C  C     . ILE C  3  370 ? -0.154  99.993  75.538  1.00 55.36  ? 370  ILE C C     1 
ATOM   9511  O  O     . ILE C  3  370 ? -0.179  98.923  74.918  1.00 55.80  ? 370  ILE C O     1 
ATOM   9512  C  CB    . ILE C  3  370 ? -1.065  102.055 74.466  1.00 57.35  ? 370  ILE C CB    1 
ATOM   9513  C  CG1   . ILE C  3  370 ? -2.260  103.006 74.417  1.00 60.11  ? 370  ILE C CG1   1 
ATOM   9514  C  CG2   . ILE C  3  370 ? -0.798  101.453 73.072  1.00 57.44  ? 370  ILE C CG2   1 
ATOM   9515  C  CD1   . ILE C  3  370 ? -3.521  102.382 73.875  1.00 60.70  ? 370  ILE C CD1   1 
ATOM   9516  N  N     . GLY C  3  371 ? 0.877   100.371 76.290  1.00 54.78  ? 371  GLY C N     1 
ATOM   9517  C  CA    . GLY C  3  371 ? 2.070   99.545  76.381  1.00 54.97  ? 371  GLY C CA    1 
ATOM   9518  C  C     . GLY C  3  371 ? 1.804   98.122  76.832  1.00 55.56  ? 371  GLY C C     1 
ATOM   9519  O  O     . GLY C  3  371 ? 2.352   97.159  76.282  1.00 55.63  ? 371  GLY C O     1 
ATOM   9520  N  N     . THR C  3  372 ? 0.971   97.996  77.858  1.00 55.32  ? 372  THR C N     1 
ATOM   9521  C  CA    . THR C  3  372 ? 0.592   96.696  78.394  1.00 54.14  ? 372  THR C CA    1 
ATOM   9522  C  C     . THR C  3  372 ? -0.185  95.922  77.332  1.00 53.65  ? 372  THR C C     1 
ATOM   9523  O  O     . THR C  3  372 ? 0.118   94.765  77.024  1.00 52.59  ? 372  THR C O     1 
ATOM   9524  C  CB    . THR C  3  372 ? -0.298  96.863  79.631  1.00 54.27  ? 372  THR C CB    1 
ATOM   9525  O  OG1   . THR C  3  372 ? 0.509   97.177  80.775  1.00 54.81  ? 372  THR C OG1   1 
ATOM   9526  C  CG2   . THR C  3  372 ? -1.085  95.603  79.884  1.00 55.89  ? 372  THR C CG2   1 
ATOM   9527  N  N     . LEU C  3  373 ? -1.202  96.578  76.787  1.00 53.69  ? 373  LEU C N     1 
ATOM   9528  C  CA    . LEU C  3  373 ? -2.038  95.989  75.755  1.00 53.19  ? 373  LEU C CA    1 
ATOM   9529  C  C     . LEU C  3  373 ? -1.152  95.497  74.616  1.00 53.18  ? 373  LEU C C     1 
ATOM   9530  O  O     . LEU C  3  373 ? -1.319  94.388  74.119  1.00 53.99  ? 373  LEU C O     1 
ATOM   9531  C  CB    . LEU C  3  373 ? -3.029  97.030  75.244  1.00 52.46  ? 373  LEU C CB    1 
ATOM   9532  C  CG    . LEU C  3  373 ? -3.682  96.691  73.914  1.00 52.40  ? 373  LEU C CG    1 
ATOM   9533  C  CD1   . LEU C  3  373 ? -4.670  95.581  74.130  1.00 52.87  ? 373  LEU C CD1   1 
ATOM   9534  C  CD2   . LEU C  3  373 ? -4.357  97.917  73.336  1.00 52.65  ? 373  LEU C CD2   1 
ATOM   9535  N  N     . GLU C  3  374 ? -0.208  96.321  74.196  1.00 52.34  ? 374  GLU C N     1 
ATOM   9536  C  CA    . GLU C  3  374 ? 0.683   95.905  73.134  1.00 54.03  ? 374  GLU C CA    1 
ATOM   9537  C  C     . GLU C  3  374 ? 1.429   94.626  73.536  1.00 55.28  ? 374  GLU C C     1 
ATOM   9538  O  O     . GLU C  3  374 ? 1.615   93.722  72.722  1.00 55.82  ? 374  GLU C O     1 
ATOM   9539  C  CB    . GLU C  3  374 ? 1.675   97.021  72.827  1.00 54.84  ? 374  GLU C CB    1 
ATOM   9540  C  CG    . GLU C  3  374 ? 1.311   97.839  71.610  1.00 57.72  ? 374  GLU C CG    1 
ATOM   9541  C  CD    . GLU C  3  374 ? 2.136   99.104  71.494  1.00 60.41  ? 374  GLU C CD    1 
ATOM   9542  O  OE1   . GLU C  3  374 ? 2.223   99.640  70.349  1.00 59.46  ? 374  GLU C OE1   1 
ATOM   9543  O  OE2   . GLU C  3  374 ? 2.681   99.548  72.549  1.00 60.78  ? 374  GLU C OE2   1 
ATOM   9544  N  N     . ASN C  3  375 ? 1.853   94.541  74.794  1.00 55.93  ? 375  ASN C N     1 
ATOM   9545  C  CA    . ASN C  3  375 ? 2.576   93.362  75.239  1.00 56.28  ? 375  ASN C CA    1 
ATOM   9546  C  C     . ASN C  3  375 ? 1.747   92.127  75.022  1.00 59.22  ? 375  ASN C C     1 
ATOM   9547  O  O     . ASN C  3  375 ? 2.287   91.082  74.663  1.00 61.67  ? 375  ASN C O     1 
ATOM   9548  C  CB    . ASN C  3  375 ? 2.934   93.440  76.718  1.00 54.52  ? 375  ASN C CB    1 
ATOM   9549  C  CG    . ASN C  3  375 ? 4.176   94.242  76.978  1.00 51.42  ? 375  ASN C CG    1 
ATOM   9550  O  OD1   . ASN C  3  375 ? 5.048   94.350  76.124  1.00 54.09  ? 375  ASN C OD1   1 
ATOM   9551  N  ND2   . ASN C  3  375 ? 4.276   94.792  78.170  1.00 48.57  ? 375  ASN C ND2   1 
ATOM   9552  N  N     . LYS C  3  376 ? 0.439   92.237  75.249  1.00 60.78  ? 376  LYS C N     1 
ATOM   9553  C  CA    . LYS C  3  376 ? -0.429  91.087  75.073  1.00 61.52  ? 376  LYS C CA    1 
ATOM   9554  C  C     . LYS C  3  376 ? -0.539  90.710  73.621  1.00 61.20  ? 376  LYS C C     1 
ATOM   9555  O  O     . LYS C  3  376 ? -0.597  89.533  73.303  1.00 63.42  ? 376  LYS C O     1 
ATOM   9556  C  CB    . LYS C  3  376 ? -1.809  91.346  75.657  1.00 63.67  ? 376  LYS C CB    1 
ATOM   9557  C  CG    . LYS C  3  376 ? -1.792  91.526  77.169  1.00 68.52  ? 376  LYS C CG    1 
ATOM   9558  C  CD    . LYS C  3  376 ? -3.173  91.932  77.689  1.00 74.50  ? 376  LYS C CD    1 
ATOM   9559  C  CE    . LYS C  3  376 ? -3.132  92.448  79.144  1.00 77.71  ? 376  LYS C CE    1 
ATOM   9560  N  NZ    . LYS C  3  376 ? -2.709  91.418  80.154  1.00 79.68  ? 376  LYS C NZ    1 
ATOM   9561  N  N     . MET C  3  377 ? -0.531  91.681  72.724  1.00 60.56  ? 377  MET C N     1 
ATOM   9562  C  CA    . MET C  3  377 ? -0.633  91.338  71.317  1.00 63.17  ? 377  MET C CA    1 
ATOM   9563  C  C     . MET C  3  377 ? 0.584   90.641  70.710  1.00 65.35  ? 377  MET C C     1 
ATOM   9564  O  O     . MET C  3  377 ? 0.559   90.205  69.554  1.00 65.67  ? 377  MET C O     1 
ATOM   9565  C  CB    . MET C  3  377 ? -1.004  92.565  70.518  1.00 62.94  ? 377  MET C CB    1 
ATOM   9566  C  CG    . MET C  3  377 ? -2.463  92.849  70.618  1.00 64.12  ? 377  MET C CG    1 
ATOM   9567  S  SD    . MET C  3  377 ? -2.743  94.575  70.419  1.00 72.10  ? 377  MET C SD    1 
ATOM   9568  C  CE    . MET C  3  377 ? -2.201  94.827  68.737  1.00 69.31  ? 377  MET C CE    1 
ATOM   9569  N  N     . LEU C  3  378 ? 1.651   90.523  71.487  1.00 67.75  ? 378  LEU C N     1 
ATOM   9570  C  CA    . LEU C  3  378 ? 2.846   89.829  71.018  1.00 70.46  ? 378  LEU C CA    1 
ATOM   9571  C  C     . LEU C  3  378 ? 2.805   88.468  71.675  1.00 72.71  ? 378  LEU C C     1 
ATOM   9572  O  O     . LEU C  3  378 ? 3.698   87.650  71.485  1.00 72.56  ? 378  LEU C O     1 
ATOM   9573  C  CB    . LEU C  3  378 ? 4.106   90.562  71.456  1.00 69.26  ? 378  LEU C CB    1 
ATOM   9574  C  CG    . LEU C  3  378 ? 4.480   91.794  70.652  1.00 68.83  ? 378  LEU C CG    1 
ATOM   9575  C  CD1   . LEU C  3  378 ? 5.457   92.656  71.445  1.00 69.81  ? 378  LEU C CD1   1 
ATOM   9576  C  CD2   . LEU C  3  378 ? 5.076   91.353  69.332  1.00 68.41  ? 378  LEU C CD2   1 
ATOM   9577  N  N     . ASN C  3  379 ? 1.749   88.256  72.454  1.00 75.69  ? 379  ASN C N     1 
ATOM   9578  C  CA    . ASN C  3  379 ? 1.522   87.023  73.183  1.00 81.15  ? 379  ASN C CA    1 
ATOM   9579  C  C     . ASN C  3  379 ? 2.537   86.916  74.324  1.00 83.96  ? 379  ASN C C     1 
ATOM   9580  O  O     . ASN C  3  379 ? 3.184   85.882  74.529  1.00 85.18  ? 379  ASN C O     1 
ATOM   9581  C  CB    . ASN C  3  379 ? 1.609   85.827  72.230  1.00 83.45  ? 379  ASN C CB    1 
ATOM   9582  C  CG    . ASN C  3  379 ? 1.084   84.542  72.848  1.00 87.02  ? 379  ASN C CG    1 
ATOM   9583  O  OD1   . ASN C  3  379 ? -0.059  84.476  73.327  1.00 87.56  ? 379  ASN C OD1   1 
ATOM   9584  N  ND2   . ASN C  3  379 ? 1.921   83.505  72.839  1.00 89.83  ? 379  ASN C ND2   1 
ATOM   9585  N  N     . TYR C  3  380 ? 2.654   88.015  75.067  1.00 86.30  ? 380  TYR C N     1 
ATOM   9586  C  CA    . TYR C  3  380 ? 3.561   88.136  76.211  1.00 88.51  ? 380  TYR C CA    1 
ATOM   9587  C  C     . TYR C  3  380 ? 2.773   88.545  77.453  1.00 90.66  ? 380  TYR C C     1 
ATOM   9588  O  O     . TYR C  3  380 ? 1.535   88.724  77.339  1.00 91.07  ? 380  TYR C O     1 
ATOM   9589  C  CB    . TYR C  3  380 ? 4.622   89.209  75.942  1.00 86.84  ? 380  TYR C CB    1 
ATOM   9590  C  CG    . TYR C  3  380 ? 5.867   88.722  75.265  1.00 84.46  ? 380  TYR C CG    1 
ATOM   9591  C  CD1   . TYR C  3  380 ? 6.477   89.483  74.268  1.00 83.56  ? 380  TYR C CD1   1 
ATOM   9592  C  CD2   . TYR C  3  380 ? 6.462   87.522  75.646  1.00 84.33  ? 380  TYR C CD2   1 
ATOM   9593  C  CE1   . TYR C  3  380 ? 7.646   89.064  73.665  1.00 83.92  ? 380  TYR C CE1   1 
ATOM   9594  C  CE2   . TYR C  3  380 ? 7.637   87.089  75.050  1.00 85.30  ? 380  TYR C CE2   1 
ATOM   9595  C  CZ    . TYR C  3  380 ? 8.225   87.868  74.057  1.00 85.36  ? 380  TYR C CZ    1 
ATOM   9596  O  OH    . TYR C  3  380 ? 9.396   87.460  73.459  1.00 86.96  ? 380  TYR C OH    1 
ATOM   9597  O  OXT   . TYR C  3  380 ? 3.419   88.703  78.520  1.00 93.85  ? 380  TYR C OXT   1 
ATOM   9598  N  N     . GLY D  4  1   ? -14.826 145.936 69.313  1.00 104.91 ? 1    GLY D N     1 
ATOM   9599  C  CA    . GLY D  4  1   ? -13.940 146.482 70.386  1.00 105.71 ? 1    GLY D CA    1 
ATOM   9600  C  C     . GLY D  4  1   ? -12.504 146.015 70.222  1.00 105.46 ? 1    GLY D C     1 
ATOM   9601  O  O     . GLY D  4  1   ? -11.554 146.778 70.454  1.00 105.83 ? 1    GLY D O     1 
ATOM   9602  N  N     . GLU D  4  2   ? -12.363 144.747 69.832  1.00 104.68 ? 2    GLU D N     1 
ATOM   9603  C  CA    . GLU D  4  2   ? -11.067 144.098 69.597  1.00 102.49 ? 2    GLU D CA    1 
ATOM   9604  C  C     . GLU D  4  2   ? -10.777 144.158 68.100  1.00 100.20 ? 2    GLU D C     1 
ATOM   9605  O  O     . GLU D  4  2   ? -9.925  143.418 67.601  1.00 99.88  ? 2    GLU D O     1 
ATOM   9606  C  CB    . GLU D  4  2   ? -11.114 142.622 69.999  1.00 103.67 ? 2    GLU D CB    1 
ATOM   9607  C  CG    . GLU D  4  2   ? -11.543 142.332 71.421  1.00 105.49 ? 2    GLU D CG    1 
ATOM   9608  C  CD    . GLU D  4  2   ? -12.070 140.915 71.557  1.00 106.93 ? 2    GLU D CD    1 
ATOM   9609  O  OE1   . GLU D  4  2   ? -11.425 139.987 71.017  1.00 107.10 ? 2    GLU D OE1   1 
ATOM   9610  O  OE2   . GLU D  4  2   ? -13.128 140.729 72.201  1.00 107.73 ? 2    GLU D OE2   1 
ATOM   9611  N  N     . LEU D  4  3   ? -11.510 145.018 67.393  1.00 96.79  ? 3    LEU D N     1 
ATOM   9612  C  CA    . LEU D  4  3   ? -11.348 145.180 65.953  1.00 92.97  ? 3    LEU D CA    1 
ATOM   9613  C  C     . LEU D  4  3   ? -10.159 146.064 65.610  1.00 90.32  ? 3    LEU D C     1 
ATOM   9614  O  O     . LEU D  4  3   ? -9.959  147.116 66.223  1.00 90.11  ? 3    LEU D O     1 
ATOM   9615  C  CB    . LEU D  4  3   ? -12.612 145.791 65.348  1.00 93.18  ? 3    LEU D CB    1 
ATOM   9616  C  CG    . LEU D  4  3   ? -13.812 144.875 65.125  1.00 93.06  ? 3    LEU D CG    1 
ATOM   9617  C  CD1   . LEU D  4  3   ? -14.940 145.659 64.485  1.00 93.11  ? 3    LEU D CD1   1 
ATOM   9618  C  CD2   . LEU D  4  3   ? -13.407 143.727 64.215  1.00 94.28  ? 3    LEU D CD2   1 
ATOM   9619  N  N     . GLU D  4  4   ? -9.364  145.636 64.637  1.00 86.72  ? 4    GLU D N     1 
ATOM   9620  C  CA    . GLU D  4  4   ? -8.222  146.429 64.224  1.00 84.79  ? 4    GLU D CA    1 
ATOM   9621  C  C     . GLU D  4  4   ? -7.854  146.154 62.779  1.00 81.00  ? 4    GLU D C     1 
ATOM   9622  O  O     . GLU D  4  4   ? -7.944  145.033 62.305  1.00 80.77  ? 4    GLU D O     1 
ATOM   9623  C  CB    . GLU D  4  4   ? -7.021  146.184 65.151  1.00 87.76  ? 4    GLU D CB    1 
ATOM   9624  C  CG    . GLU D  4  4   ? -6.653  144.718 65.364  1.00 93.00  ? 4    GLU D CG    1 
ATOM   9625  C  CD    . GLU D  4  4   ? -5.550  144.519 66.420  1.00 96.74  ? 4    GLU D CD    1 
ATOM   9626  O  OE1   . GLU D  4  4   ? -5.358  143.351 66.851  1.00 97.93  ? 4    GLU D OE1   1 
ATOM   9627  O  OE2   . GLU D  4  4   ? -4.882  145.516 66.812  1.00 97.25  ? 4    GLU D OE2   1 
ATOM   9628  N  N     . LEU D  4  5   ? -7.463  147.206 62.076  1.00 76.85  ? 5    LEU D N     1 
ATOM   9629  C  CA    . LEU D  4  5   ? -7.075  147.104 60.681  1.00 71.88  ? 5    LEU D CA    1 
ATOM   9630  C  C     . LEU D  4  5   ? -5.551  146.906 60.586  1.00 70.07  ? 5    LEU D C     1 
ATOM   9631  O  O     . LEU D  4  5   ? -4.762  147.659 61.177  1.00 69.60  ? 5    LEU D O     1 
ATOM   9632  C  CB    . LEU D  4  5   ? -7.504  148.378 59.945  1.00 68.44  ? 5    LEU D CB    1 
ATOM   9633  C  CG    . LEU D  4  5   ? -7.306  148.383 58.439  1.00 65.44  ? 5    LEU D CG    1 
ATOM   9634  C  CD1   . LEU D  4  5   ? -8.295  147.443 57.827  1.00 64.81  ? 5    LEU D CD1   1 
ATOM   9635  C  CD2   . LEU D  4  5   ? -7.478  149.777 57.887  1.00 65.91  ? 5    LEU D CD2   1 
ATOM   9636  N  N     . HIS D  4  6   ? -5.139  145.887 59.844  1.00 67.98  ? 6    HIS D N     1 
ATOM   9637  C  CA    . HIS D  4  6   ? -3.718  145.598 59.690  1.00 66.11  ? 6    HIS D CA    1 
ATOM   9638  C  C     . HIS D  4  6   ? -3.154  146.193 58.410  1.00 62.50  ? 6    HIS D C     1 
ATOM   9639  O  O     . HIS D  4  6   ? -3.734  146.069 57.336  1.00 63.30  ? 6    HIS D O     1 
ATOM   9640  C  CB    . HIS D  4  6   ? -3.495  144.080 59.741  1.00 69.26  ? 6    HIS D CB    1 
ATOM   9641  C  CG    . HIS D  4  6   ? -3.913  143.455 61.042  1.00 70.87  ? 6    HIS D CG    1 
ATOM   9642  N  ND1   . HIS D  4  6   ? -4.440  142.184 61.124  1.00 72.24  ? 6    HIS D ND1   1 
ATOM   9643  C  CD2   . HIS D  4  6   ? -3.915  143.946 62.306  1.00 71.13  ? 6    HIS D CD2   1 
ATOM   9644  C  CE1   . HIS D  4  6   ? -4.757  141.921 62.380  1.00 72.51  ? 6    HIS D CE1   1 
ATOM   9645  N  NE2   . HIS D  4  6   ? -4.449  142.974 63.117  1.00 72.37  ? 6    HIS D NE2   1 
ATOM   9646  N  N     . PRO D  4  7   ? -1.998  146.846 58.506  1.00 60.17  ? 7    PRO D N     1 
ATOM   9647  C  CA    . PRO D  4  7   ? -1.425  147.446 57.303  1.00 59.16  ? 7    PRO D CA    1 
ATOM   9648  C  C     . PRO D  4  7   ? -1.105  146.447 56.223  1.00 58.22  ? 7    PRO D C     1 
ATOM   9649  O  O     . PRO D  4  7   ? -1.039  145.257 56.465  1.00 58.24  ? 7    PRO D O     1 
ATOM   9650  C  CB    . PRO D  4  7   ? -0.174  148.150 57.825  1.00 58.42  ? 7    PRO D CB    1 
ATOM   9651  C  CG    . PRO D  4  7   ? 0.241   147.284 58.964  1.00 58.35  ? 7    PRO D CG    1 
ATOM   9652  C