data_3LJA
# 
_entry.id   3LJA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LJA         
NDB   NA0439       
RCSB  RCSB057346   
WWPDB D_1000057346 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1KX5 
_pdbx_database_related.details        'molecular replacement starting model' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3LJA 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, B.'      1 
'Davey, C.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            398 
_citation.page_first                633 
_citation.page_last                 640 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20350553 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.03.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, B.'      1 
primary 'Davey, C.A.' 2 
# 
_cell.entry_id           3LJA 
_cell.length_a           106.348 
_cell.length_b           109.785 
_cell.length_c           182.424 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LJA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'       15303.930 2  ? ? ? ? 
2 polymer     man 'Histone H4'         11263.231 2  ? ? ? ? 
3 polymer     man 'Histone H2A'        13978.241 2  ? ? ? ? 
4 polymer     man 'Histone H2B 1.1'    13524.752 2  ? ? ? ? 
5 polymer     syn '147mer DNA'         45368.051 1  ? ? ? ? 
6 polymer     syn '147mer DNA'         45359.035 1  ? ? ? ? 
7 non-polymer syn 'SULFATE ION'        96.063    3  ? ? ? ? 
8 non-polymer syn 'MANGANESE (II) ION' 54.938    45 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DA)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGAATCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DT)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGATTCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DG  n 
5 73  DA  n 
5 74  DA  n 
5 75  DT  n 
5 76  DC  n 
5 77  DC  n 
5 78  DA  n 
5 79  DG  n 
5 80  DC  n 
5 81  DT  n 
5 82  DG  n 
5 83  DA  n 
5 84  DA  n 
5 85  DC  n 
5 86  DA  n 
5 87  DT  n 
5 88  DG  n 
5 89  DC  n 
5 90  DC  n 
5 91  DT  n 
5 92  DT  n 
5 93  DT  n 
5 94  DT  n 
5 95  DG  n 
5 96  DA  n 
5 97  DT  n 
5 98  DG  n 
5 99  DG  n 
5 100 DA  n 
5 101 DG  n 
5 102 DC  n 
5 103 DA  n 
5 104 DG  n 
5 105 DT  n 
5 106 DT  n 
5 107 DT  n 
5 108 DC  n 
5 109 DC  n 
5 110 DA  n 
5 111 DA  n 
5 112 DA  n 
5 113 DT  n 
5 114 DA  n 
5 115 DC  n 
5 116 DA  n 
5 117 DC  n 
5 118 DT  n 
5 119 DT  n 
5 120 DT  n 
5 121 DT  n 
5 122 DG  n 
5 123 DG  n 
5 124 DT  n 
5 125 DA  n 
5 126 DG  n 
5 127 DT  n 
5 128 DA  n 
5 129 DT  n 
5 130 DC  n 
5 131 DT  n 
5 132 DG  n 
5 133 DC  n 
5 134 DA  n 
5 135 DG  n 
5 136 DG  n 
5 137 DT  n 
5 138 DG  n 
5 139 DG  n 
5 140 DA  n 
5 141 DT  n 
5 142 DA  n 
5 143 DT  n 
5 144 DT  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DG  n 
6 73  DA  n 
6 74  DT  n 
6 75  DT  n 
6 76  DC  n 
6 77  DC  n 
6 78  DA  n 
6 79  DG  n 
6 80  DC  n 
6 81  DT  n 
6 82  DG  n 
6 83  DA  n 
6 84  DA  n 
6 85  DC  n 
6 86  DA  n 
6 87  DT  n 
6 88  DG  n 
6 89  DC  n 
6 90  DC  n 
6 91  DT  n 
6 92  DT  n 
6 93  DT  n 
6 94  DT  n 
6 95  DG  n 
6 96  DA  n 
6 97  DT  n 
6 98  DG  n 
6 99  DG  n 
6 100 DA  n 
6 101 DG  n 
6 102 DC  n 
6 103 DA  n 
6 104 DG  n 
6 105 DT  n 
6 106 DT  n 
6 107 DT  n 
6 108 DC  n 
6 109 DC  n 
6 110 DA  n 
6 111 DA  n 
6 112 DA  n 
6 113 DT  n 
6 114 DA  n 
6 115 DC  n 
6 116 DA  n 
6 117 DC  n 
6 118 DT  n 
6 119 DT  n 
6 120 DT  n 
6 121 DT  n 
6 122 DG  n 
6 123 DG  n 
6 124 DT  n 
6 125 DA  n 
6 126 DG  n 
6 127 DT  n 
6 128 DA  n 
6 129 DT  n 
6 130 DC  n 
6 131 DT  n 
6 132 DG  n 
6 133 DC  n 
6 134 DA  n 
6 135 DG  n 
6 136 DG  n 
6 137 DT  n 
6 138 DG  n 
6 139 DG  n 
6 140 DA  n 
6 141 DT  n 
6 142 DA  n 
6 143 DT  n 
6 144 DT  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'African clawed frog' ? ?         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'African clawed frog' ? ?         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'African clawed frog' ? LOC494591 ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'African clawed frog' ? ?         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? ? ? ? 'sequence based on human alpha-satellite DNA' 
6 1 sample ? ? ? ? ? 'sequence based on human alpha-satellite DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 ? 
4 UNP H2B11_XENLA  P02281 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 ? 
5 PDB 3LJA         3LJA   5 ? ? ? 
6 PDB 3LJA         3LJA   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3LJA A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3LJA B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3LJA C 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
4  4 3LJA D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
5  1 3LJA E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3LJA F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3LJA G 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
8  4 3LJA H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
9  5 3LJA I 1 ? 147 ? 3LJA   -73 ? 73  ? -73 73  
10 6 3LJA J 1 ? 147 ? 3LJA   -73 ? 73  ? -73 73  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LJA ALA A 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 1 
4 3LJA THR D 29  ? UNP P02281 SER 33  'SEE REMARK 999' 29  2 
5 3LJA ALA E 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 3 
8 3LJA THR H 29  ? UNP P02281 SER 33  'SEE REMARK 999' 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3LJA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.68 
_exptl_crystal.density_percent_sol   54.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
;85 mM MnCl2, 60 mM KCl, 20 mM K-Cacodylate, 4 mg/ml NCP over well with 1/2 conc., pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K, EVAPORATION
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-02-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.89 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.89 
# 
_reflns.entry_id                     3LJA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             76.5 
_reflns.d_resolution_high            2.75 
_reflns.number_obs                   53707 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   89.5 
_reflns_shell.Rmerge_I_obs           0.425 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_redundancy        6.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7216 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3LJA 
_refine.ls_number_reflns_obs                     52580 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.19 
_refine.ls_d_res_high                            2.75 
_refine.ls_percent_reflns_obs                    95.38 
_refine.ls_R_factor_obs                          0.22324 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22250 
_refine.ls_R_factor_R_free                       0.25904 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1078 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.919 
_refine.correlation_coeff_Fo_to_Fc_free          0.882 
_refine.B_iso_mean                               54.531 
_refine.aniso_B[1][1]                            1.36 
_refine.aniso_B[2][2]                            -2.80 
_refine.aniso_B[3][3]                            1.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KX5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.149 
_refine.pdbx_overall_ESU_R_Free                  0.352 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6156 
_refine_hist.pdbx_number_atoms_nucleic_acid   6021 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12237 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        38.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.021  ? 13003 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.475  2.545  ? 18815 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.932  5.000  ? 764   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.624 21.131 ? 274   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.676 15.000 ? 1209  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.164 15.000 ? 89    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.074  0.200  ? 2134  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 7656  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.202  0.200  ? 4724  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.312  0.200  ? 8163  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.157  0.200  ? 335   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.186  0.200  ? 25    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.082  0.200  ? 4     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.687  1.500  ? 3834  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.317  2.000  ? 6170  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.322  3.000  ? 9169  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.138  4.500  ? 12645 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.750 
_refine_ls_shell.d_res_low                        2.821 
_refine_ls_shell.number_reflns_R_work             3544 
_refine_ls_shell.R_factor_R_work                  0.363 
_refine_ls_shell.percent_reflns_obs               87.93 
_refine_ls_shell.R_factor_R_free                  0.422 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             69 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LJA 
_struct.title                     'Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LJA 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
;Nucleosome, Divalent metal, Cation binding, Counterion, Compaction, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, STRUCTURAL PROTEIN-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 8 ? 
M  N N 7 ? 
N  N N 8 ? 
O  N N 7 ? 
P  N N 8 ? 
Q  N N 8 ? 
R  N N 8 ? 
S  N N 8 ? 
T  N N 8 ? 
U  N N 8 ? 
V  N N 8 ? 
W  N N 8 ? 
X  N N 8 ? 
Y  N N 8 ? 
Z  N N 8 ? 
AA N N 8 ? 
BA N N 8 ? 
CA N N 8 ? 
DA N N 8 ? 
EA N N 8 ? 
FA N N 8 ? 
GA N N 8 ? 
HA N N 8 ? 
IA N N 8 ? 
JA N N 8 ? 
KA N N 8 ? 
LA N N 8 ? 
MA N N 8 ? 
NA N N 8 ? 
OA N N 8 ? 
PA N N 8 ? 
QA N N 8 ? 
RA N N 8 ? 
SA N N 8 ? 
TA N N 8 ? 
UA N N 8 ? 
VA N N 8 ? 
WA N N 8 ? 
XA N N 8 ? 
YA N N 8 ? 
ZA N N 8 ? 
AB N N 8 ? 
BB N N 8 ? 
CB N N 8 ? 
DB N N 8 ? 
EB N N 8 ? 
FB N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? GLN A 55  ? GLY A 44  GLN A 55  1 ? 12 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 ALA C 45  ? ASN C 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 12 ILE C 79  ? ASN C 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 52  ? ASN D 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 100 ? ALA D 121 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? GLN E 55  ? GLY E 44  GLN E 55  1 ? 12 
HELX_P HELX_P20 20 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 ALA G 45  ? ASP G 72  ? ALA G 45  ASP G 72  1 ? 28 
HELX_P HELX_P30 30 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 100 ? SER H 120 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? J DG  40  N7  ? ? ? 1_555 XA MN .   MN ? ? J DG  -34 J MN 90  1_555 ? ? ? ? ? ? ?               2.029 ? 
metalc2   metalc ? ? I DG  139 N7  ? ? ? 1_555 BA MN .   MN ? ? I DG  65  I MN 86  1_555 ? ? ? ? ? ? ?               2.073 ? 
metalc3   metalc ? ? J DG  18  N7  ? ? ? 1_555 UA MN .   MN ? ? J DG  -56 J MN 87  1_555 ? ? ? ? ? ? ?               2.158 ? 
metalc4   metalc ? ? J DG  122 N7  ? ? ? 1_555 JA MN .   MN ? ? J DG  48  J MN 76  1_555 ? ? ? ? ? ? ?               2.162 ? 
metalc5   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 L  MN .   MN ? ? E ASP 77  E MN 136 1_555 ? ? ? ? ? ? ?               2.199 ? 
metalc6   metalc ? ? J DG  68  OP1 ? ? ? 1_555 ZA MN .   MN ? ? J DG  -6  J MN 92  1_555 ? ? ? ? ? ? ?               2.201 ? 
metalc7   metalc ? ? J DG  40  O6  ? ? ? 1_555 MA MN .   MN ? ? J DG  -34 J MN 79  1_555 ? ? ? ? ? ? ?               2.230 ? 
metalc8   metalc ? ? I DG  122 N7  ? ? ? 1_555 R  MN .   MN ? ? I DG  48  I MN 76  1_555 ? ? ? ? ? ? ?               2.233 ? 
metalc9   metalc ? ? H VAL 45  O   ? ? ? 1_555 N  MN .   MN ? ? H VAL 45  H MN 123 1_555 ? ? ? ? ? ? ?               2.241 ? 
metalc10  metalc ? ? I DG  71  N7  ? ? ? 1_555 T  MN .   MN ? ? I DG  -3  I MN 78  1_555 ? ? ? ? ? ? ?               2.251 ? 
metalc11  metalc ? ? I DG  39  N7  ? ? ? 1_555 S  MN .   MN ? ? I DG  -35 I MN 77  1_555 ? ? ? ? ? ? ?               2.259 ? 
metalc12  metalc ? ? J DG  101 N7  ? ? ? 1_555 IA MN .   MN ? ? J DG  27  J MN 75  1_555 ? ? ? ? ? ? ?               2.284 ? 
metalc13  metalc ? ? I DG  72  N7  ? ? ? 1_555 CA MN .   MN ? ? I DG  -2  I MN 87  1_555 ? ? ? ? ? ? ?               2.305 ? 
metalc14  metalc ? ? I DG  40  N7  ? ? ? 1_555 EA MN .   MN ? ? I DG  -34 I MN 89  1_555 ? ? ? ? ? ? ?               2.308 ? 
metalc15  metalc ? ? J DG  71  N7  ? ? ? 1_555 KA MN .   MN ? ? J DG  -3  J MN 77  1_555 ? ? ? ? ? ? ?               2.349 ? 
metalc16  metalc ? ? I DG  101 N7  ? ? ? 1_555 W  MN .   MN ? ? I DG  27  I MN 81  1_555 ? ? ? ? ? ? ?               2.367 ? 
metalc17  metalc ? ? J DC  85  OP2 ? ? ? 1_555 DB MN .   MN ? ? J DC  11  J MN 96  1_555 ? ? ? ? ? ? ?               2.493 ? 
metalc18  metalc ? ? J DA  78  N7  ? ? ? 1_555 EB MN .   MN ? ? J DA  4   J MN 106 1_555 ? ? ? ? ? ? ?               2.586 ? 
metalc19  metalc ? ? J DG  135 N7  ? ? ? 1_555 HA MN .   MN ? ? J DG  61  J MN 74  1_555 ? ? ? ? ? ? ?               2.596 ? 
metalc20  metalc ? ? I DC  85  OP2 ? ? ? 1_555 Y  MN .   MN ? ? I DC  11  I MN 83  1_555 ? ? ? ? ? ? ?               2.608 ? 
metalc21  metalc ? ? I DG  135 N7  ? ? ? 1_555 P  MN .   MN ? ? I DG  61  I MN 74  1_555 ? ? ? ? ? ? ?               2.657 ? 
metalc22  metalc ? ? I DG  79  O6  ? ? ? 1_555 U  MN .   MN ? ? I DG  5   I MN 79  1_555 ? ? ? ? ? ? ?               2.688 ? 
metalc23  metalc ? ? J DG  39  N7  ? ? ? 1_555 MA MN .   MN ? ? J DG  -35 J MN 79  1_555 ? ? ? ? ? ? ?               2.789 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J  DT 147 N3 ? ? I DA  -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J  DT 147 O4 ? ? I DA  -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J  DA 146 N1 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J  DA 146 N6 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J  DG 145 N1 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J  DG 145 O6 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J  DG 145 N2 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J  DT 144 N3 ? ? I DA  -70 J DT 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J  DT 144 O4 ? ? I DA  -70 J DT 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DA  5   N1  ? ? ? 1_555 J  DT 143 N3 ? ? I DA  -69 J DT 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DA  5   N6  ? ? ? 1_555 J  DT 143 O4 ? ? I DA  -69 J DT 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J  DA 142 N1 ? ? I DT  -68 J DA 68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J  DA 142 N6 ? ? I DT  -68 J DA 68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J  DT 141 N3 ? ? I DA  -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J  DT 141 O4 ? ? I DA  -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J  DA 140 N1 ? ? I DT  -66 J DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J  DA 140 N6 ? ? I DT  -66 J DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J  DG 139 N1 ? ? I DC  -65 J DG 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J  DG 139 O6 ? ? I DC  -65 J DG 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J  DG 139 N2 ? ? I DC  -65 J DG 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J  DG 138 N1 ? ? I DC  -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J  DG 138 O6 ? ? I DC  -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J  DG 138 N2 ? ? I DC  -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J  DT 137 N3 ? ? I DA  -63 J DT 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J  DT 137 O4 ? ? I DA  -63 J DT 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  12  N3  ? ? ? 1_555 J  DG 136 N1 ? ? I DC  -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  12  N4  ? ? ? 1_555 J  DG 136 O6 ? ? I DC  -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J  DG 136 N2 ? ? I DC  -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J  DG 135 N1 ? ? I DC  -61 J DG 61  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog30  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J  DA 134 N1 ? ? I DT  -60 J DA 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DT  14  O4  ? ? ? 1_555 J  DA 134 N6 ? ? I DT  -60 J DA 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J  DC 133 O2 ? ? I DG  -59 J DC 59  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog33  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J  DG 132 N1 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J  DG 132 O6 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J  DG 132 N2 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J  DT 131 N3 ? ? I DA  -57 J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J  DT 131 O4 ? ? I DA  -57 J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J  DC 130 N3 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J  DC 130 O2 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J  DC 130 N4 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J  DT 129 N3 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J  DT 129 O4 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J  DA 128 N1 ? ? I DT  -54 J DA 54  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog44  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J  DT 127 N3 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J  DT 127 O4 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J  DG 126 N1 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J  DG 126 O6 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J  DG 126 N2 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J  DA 125 N1 ? ? I DT  -51 J DA 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J  DA 125 N6 ? ? I DT  -51 J DA 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J  DT 124 N3 ? ? I DA  -50 J DT 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J  DT 124 O4 ? ? I DA  -50 J DT 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J  DG 123 N1 ? ? I DC  -49 J DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J  DG 123 O6 ? ? I DC  -49 J DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J  DG 123 N2 ? ? I DC  -49 J DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J  DG 122 N1 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J  DG 122 O6 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J  DG 122 N2 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J  DT 121 N3 ? ? I DA  -47 J DT 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J  DT 121 O4 ? ? I DA  -47 J DT 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J  DT 120 N3 ? ? I DA  -46 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J  DT 120 O4 ? ? I DA  -46 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J  DT 119 N3 ? ? I DA  -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J  DT 119 O4 ? ? I DA  -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J  DT 118 N3 ? ? I DA  -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J  DT 118 O4 ? ? I DA  -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J  DC 117 O2 ? ? I DG  -43 J DC 43  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog68  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J  DA 116 N1 ? ? I DT  -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J  DA 116 N6 ? ? I DT  -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J  DC 115 N3 ? ? I DG  -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J  DC 115 O2 ? ? I DG  -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J  DC 115 N4 ? ? I DG  -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J  DA 114 N1 ? ? I DT  -40 J DA 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J  DA 114 N6 ? ? I DT  -40 J DA 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J  DT 113 N3 ? ? I DA  -39 J DT 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J  DT 113 O4 ? ? I DA  -39 J DT 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J  DA 112 N1 ? ? I DT  -38 J DA 38  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog78  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J  DA 111 N1 ? ? I DT  -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J  DA 111 N6 ? ? I DT  -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J  DA 110 N1 ? ? I DT  -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J  DA 110 N6 ? ? I DT  -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J  DC 109 N3 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J  DC 109 O2 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J  DC 109 N4 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J  DC 108 N3 ? ? I DG  -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J  DC 108 O2 ? ? I DG  -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J  DC 108 N4 ? ? I DG  -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J  DT 107 N3 ? ? I DA  -33 J DT 33  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog89  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J  DT 106 N3 ? ? I DA  -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J  DT 106 O4 ? ? I DA  -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J  DT 105 N3 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DT 105 O4 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DC  44  N3  ? ? ? 1_555 J  DG 104 N1 ? ? I DC  -30 J DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DC  44  N4  ? ? ? 1_555 J  DG 104 O6 ? ? I DC  -30 J DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J  DG 104 N2 ? ? I DC  -30 J DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J  DA 103 N1 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J  DA 103 N6 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J  DC 102 N3 ? ? I DG  -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J  DC 102 O2 ? ? I DG  -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DG  46  O6  ? ? ? 1_555 J  DC 102 N4 ? ? I DG  -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J  DG 101 N1 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  47  N4  ? ? ? 1_555 J  DG 101 O6 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  47  O2  ? ? ? 1_555 J  DG 101 N2 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DT  48  N3  ? ? ? 1_555 J  DA 100 N1 ? ? I DT  -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DT  48  O4  ? ? ? 1_555 J  DA 100 N6 ? ? I DT  -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J  DG 99  N1 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J  DG 99  O6 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J  DG 99  N2 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  50  O2  ? ? ? 1_555 J  DG 98  N1 ? ? I DC  -24 J DG 24  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog110 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J  DT 97  N3 ? ? I DA  -23 J DT 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J  DT 97  O4 ? ? I DA  -23 J DT 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J  DA 96  N1 ? ? I DT  -22 J DA 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J  DA 96  N6 ? ? I DT  -22 J DA 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J  DG 95  N1 ? ? I DC  -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J  DG 95  O6 ? ? I DC  -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J  DG 95  N2 ? ? I DC  -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J  DT 94  N3 ? ? I DA  -20 J DT 20  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog118 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J  DT 93  N3 ? ? I DA  -19 J DT 19  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog119 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J  DC 90  N3 ? ? I DA  -17 J DC 16  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog120 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J  DT 91  N3 ? ? I DA  -17 J DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J  DT 91  O4 ? ? I DA  -17 J DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J  DC 90  N3 ? ? I DG  -16 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J  DC 90  O2 ? ? I DG  -16 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J  DC 90  N4 ? ? I DG  -16 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J  DC 89  N3 ? ? I DG  -15 J DC 15  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog126 hydrog ? ? I DC  60  N3  ? ? ? 1_555 J  DG 88  N1 ? ? I DC  -14 J DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DC  60  N4  ? ? ? 1_555 J  DG 88  O6 ? ? I DC  -14 J DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J  DG 88  N2 ? ? I DC  -14 J DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J  DT 87  N3 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J  DT 87  O4 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J  DA 86  N1 ? ? I DT  -12 J DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J  DA 86  N6 ? ? I DT  -12 J DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J  DC 85  N3 ? ? I DG  -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J  DC 85  O2 ? ? I DG  -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J  DC 85  N4 ? ? I DG  -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J  DA 84  N1 ? ? I DT  -10 J DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J  DA 84  N6 ? ? I DT  -10 J DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J  DA 83  N1 ? ? I DT  -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J  DA 83  N6 ? ? I DT  -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J  DG 82  N1 ? ? I DC  -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J  DG 82  O6 ? ? I DC  -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J  DG 82  N2 ? ? I DC  -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J  DT 81  N3 ? ? I DA  -7  J DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J  DT 81  O4 ? ? I DA  -7  J DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J  DC 80  N3 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J  DC 80  O2 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J  DC 80  N4 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J  DG 79  N1 ? ? I DC  -5  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J  DG 79  O6 ? ? I DC  -5  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J  DG 79  N2 ? ? I DC  -5  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J  DA 78  N1 ? ? I DT  -4  J DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J  DA 78  N6 ? ? I DT  -4  J DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J  DC 77  N3 ? ? I DG  -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J  DC 77  O2 ? ? I DG  -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J  DC 77  N4 ? ? I DG  -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DG  72  N1  ? ? ? 1_555 J  DC 76  N3 ? ? I DG  -2  J DC 2   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog157 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J  DT 75  N3 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J  DT 75  O4 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DA  74  N1  ? ? ? 1_555 J  DT 74  N3 ? ? I DA  0   J DT 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DA  74  N6  ? ? ? 1_555 J  DT 74  O4 ? ? I DA  0   J DT 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DT  75  N3  ? ? ? 1_555 J  DA 73  N1 ? ? I DT  1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DT  75  O4  ? ? ? 1_555 J  DA 73  N6 ? ? I DT  1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DC  76  N3  ? ? ? 1_555 J  DG 72  N1 ? ? I DC  2   J DG -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DC  76  N4  ? ? ? 1_555 J  DG 72  O6 ? ? I DC  2   J DG -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DC  76  O2  ? ? ? 1_555 J  DG 72  N2 ? ? I DC  2   J DG -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DC  77  N3  ? ? ? 1_555 J  DG 71  N1 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DC  77  N4  ? ? ? 1_555 J  DG 71  O6 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DC  77  O2  ? ? ? 1_555 J  DG 71  N2 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DA  78  N1  ? ? ? 1_555 J  DT 70  N3 ? ? I DA  4   J DT -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DA  78  N6  ? ? ? 1_555 J  DT 70  O4 ? ? I DA  4   J DT -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  79  N1  ? ? ? 1_555 J  DC 69  N3 ? ? I DG  5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DG  79  N2  ? ? ? 1_555 J  DC 69  O2 ? ? I DG  5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DG  79  O6  ? ? ? 1_555 J  DC 69  N4 ? ? I DG  5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DC  80  N3  ? ? ? 1_555 J  DG 68  N1 ? ? I DC  6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DC  80  N4  ? ? ? 1_555 J  DG 68  O6 ? ? I DC  6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DC  80  O2  ? ? ? 1_555 J  DG 68  N2 ? ? I DC  6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DT  81  N3  ? ? ? 1_555 J  DA 67  N1 ? ? I DT  7   J DA -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DT  81  O4  ? ? ? 1_555 J  DA 67  N6 ? ? I DT  7   J DA -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DG  82  N1  ? ? ? 1_555 J  DC 66  N3 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DG  82  N2  ? ? ? 1_555 J  DC 66  O2 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DG  82  O6  ? ? ? 1_555 J  DC 66  N4 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DA  83  N1  ? ? ? 1_555 J  DT 65  N3 ? ? I DA  9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DA  83  N6  ? ? ? 1_555 J  DT 65  O4 ? ? I DA  9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J  DT 64  N3 ? ? I DA  10  J DT -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J  DT 64  O4 ? ? I DA  10  J DT -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DC  85  N3  ? ? ? 1_555 J  DG 63  N1 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DC  85  N4  ? ? ? 1_555 J  DG 63  O6 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DC  85  O2  ? ? ? 1_555 J  DG 63  N2 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DA  86  N1  ? ? ? 1_555 J  DT 62  N3 ? ? I DA  12  J DT -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DA  86  N6  ? ? ? 1_555 J  DT 62  O4 ? ? I DA  12  J DT -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J  DA 61  N1 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J  DA 61  N6 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DG  88  N1  ? ? ? 1_555 J  DC 60  N3 ? ? I DG  14  J DC -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DG  88  N2  ? ? ? 1_555 J  DC 60  O2 ? ? I DG  14  J DC -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DG  88  O6  ? ? ? 1_555 J  DC 60  N4 ? ? I DG  14  J DC -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DC  89  N3  ? ? ? 1_555 J  DG 59  N1 ? ? I DC  15  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DC  89  N4  ? ? ? 1_555 J  DG 59  O6 ? ? I DC  15  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DC  89  O2  ? ? ? 1_555 J  DG 59  N2 ? ? I DC  15  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DC  90  N3  ? ? ? 1_555 J  DG 58  N1 ? ? I DC  16  J DG -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DC  90  N4  ? ? ? 1_555 J  DG 58  O6 ? ? I DC  16  J DG -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DC  90  O2  ? ? ? 1_555 J  DG 58  N2 ? ? I DC  16  J DG -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J  DA 57  N1 ? ? I DT  17  J DA -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J  DA 57  N6 ? ? I DT  17  J DA -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J  DA 56  N1 ? ? I DT  18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J  DA 56  N6 ? ? I DT  18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DT  93  N3  ? ? ? 1_555 J  DA 55  N1 ? ? I DT  19  J DA -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DT  93  O4  ? ? ? 1_555 J  DA 55  N6 ? ? I DT  19  J DA -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DT  94  N3  ? ? ? 1_555 J  DA 54  N1 ? ? I DT  20  J DA -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DT  94  O4  ? ? ? 1_555 J  DA 54  N6 ? ? I DT  20  J DA -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  95  N1  ? ? ? 1_555 J  DC 53  N3 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DG  95  N2  ? ? ? 1_555 J  DC 53  O2 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DG  95  O6  ? ? ? 1_555 J  DC 53  N4 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DA  96  N1  ? ? ? 1_555 J  DT 52  N3 ? ? I DA  22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DA  96  N6  ? ? ? 1_555 J  DT 52  O4 ? ? I DA  22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DT  97  N3  ? ? ? 1_555 J  DA 51  N1 ? ? I DT  23  J DA -23 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog216 hydrog ? ? I DG  98  N1  ? ? ? 1_555 J  DC 50  N3 ? ? I DG  24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  98  N2  ? ? ? 1_555 J  DC 50  O2 ? ? I DG  24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DG  98  O6  ? ? ? 1_555 J  DC 50  N4 ? ? I DG  24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J  DC 49  N3 ? ? I DG  25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J  DC 49  O2 ? ? I DG  25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J  DC 49  N4 ? ? I DG  25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DA  100 N1  ? ? ? 1_555 J  DT 48  N3 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DA  100 N6  ? ? ? 1_555 J  DT 48  O4 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DG  101 N1  ? ? ? 1_555 J  DC 47  N3 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DG  101 N2  ? ? ? 1_555 J  DC 47  O2 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DG  101 O6  ? ? ? 1_555 J  DC 47  N4 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DC  102 N3  ? ? ? 1_555 J  DG 46  N1 ? ? I DC  28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DC  102 N4  ? ? ? 1_555 J  DG 46  O6 ? ? I DC  28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DC  102 O2  ? ? ? 1_555 J  DG 46  N2 ? ? I DC  28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DA  103 N1  ? ? ? 1_555 J  DT 45  N3 ? ? I DA  29  J DT -29 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog231 hydrog ? ? I DG  104 N1  ? ? ? 1_555 J  DC 44  N3 ? ? I DG  30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DG  104 N2  ? ? ? 1_555 J  DC 44  O2 ? ? I DG  30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DG  104 O6  ? ? ? 1_555 J  DC 44  N4 ? ? I DG  30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J  DA 43  N1 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J  DA 43  N6 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DT  106 N3  ? ? ? 1_555 J  DA 42  N1 ? ? I DT  32  J DA -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DT  106 O4  ? ? ? 1_555 J  DA 42  N6 ? ? I DT  32  J DA -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DT  107 N3  ? ? ? 1_555 J  DA 41  N1 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DT  107 O4  ? ? ? 1_555 J  DA 41  N6 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DC  108 N3  ? ? ? 1_555 J  DG 40  N1 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DC  108 N4  ? ? ? 1_555 J  DG 40  O6 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DC  108 O2  ? ? ? 1_555 J  DG 40  N2 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DC  109 N3  ? ? ? 1_555 J  DG 39  N1 ? ? I DC  35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J  DG 39  O6 ? ? I DC  35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DC  109 O2  ? ? ? 1_555 J  DG 39  N2 ? ? I DC  35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J  DT 38  N3 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J  DT 38  O4 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DA  111 N1  ? ? ? 1_555 J  DT 37  N3 ? ? I DA  37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DA  111 N6  ? ? ? 1_555 J  DT 37  O4 ? ? I DA  37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J  DT 36  N3 ? ? I DA  38  J DT -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J  DT 36  O4 ? ? I DA  38  J DT -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DT  113 N3  ? ? ? 1_555 J  DA 35  N1 ? ? I DT  39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DT  113 O4  ? ? ? 1_555 J  DA 35  N6 ? ? I DT  39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J  DT 34  N3 ? ? I DA  40  J DT -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J  DT 34  O4 ? ? I DA  40  J DT -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J  DG 33  N1 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J  DG 33  O6 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J  DG 33  N2 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DA  116 N1  ? ? ? 1_555 J  DT 32  N3 ? ? I DA  42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DA  116 N6  ? ? ? 1_555 J  DT 32  O4 ? ? I DA  42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DC  117 N3  ? ? ? 1_555 J  DG 31  N1 ? ? I DC  43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DC  117 N4  ? ? ? 1_555 J  DG 31  O6 ? ? I DC  43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DC  117 O2  ? ? ? 1_555 J  DG 31  N2 ? ? I DC  43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J  DA 30  N1 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J  DA 30  N6 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J  DA 29  N1 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J  DA 29  N6 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DT  120 N3  ? ? ? 1_555 J  DA 28  N1 ? ? I DT  46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DT  120 O4  ? ? ? 1_555 J  DA 28  N6 ? ? I DT  46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DT  121 N3  ? ? ? 1_555 J  DA 27  N1 ? ? I DT  47  J DA -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DT  121 O4  ? ? ? 1_555 J  DA 27  N6 ? ? I DT  47  J DA -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  122 N1  ? ? ? 1_555 J  DC 26  N3 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DG  122 N2  ? ? ? 1_555 J  DC 26  O2 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DG  122 O6  ? ? ? 1_555 J  DC 26  N4 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DG  123 N1  ? ? ? 1_555 J  DC 25  N3 ? ? I DG  49  J DC -49 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog276 hydrog ? ? I DT  124 N3  ? ? ? 1_555 J  DA 24  N1 ? ? I DT  50  J DA -50 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog277 hydrog ? ? I DA  125 N1  ? ? ? 1_555 J  DT 23  N3 ? ? I DA  51  J DT -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DA  125 N6  ? ? ? 1_555 J  DT 23  O4 ? ? I DA  51  J DT -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DG  126 N1  ? ? ? 1_555 J  DC 22  N3 ? ? I DG  52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DG  126 N2  ? ? ? 1_555 J  DC 22  O2 ? ? I DG  52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  126 O6  ? ? ? 1_555 J  DC 22  N4 ? ? I DG  52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J  DA 21  N1 ? ? I DT  53  J DA -53 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog283 hydrog ? ? I DA  128 N1  ? ? ? 1_555 J  DT 20  N3 ? ? I DA  54  J DT -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DA  128 N6  ? ? ? 1_555 J  DT 20  O4 ? ? I DA  54  J DT -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J  DA 19  N1 ? ? I DT  55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J  DA 19  N6 ? ? I DT  55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DC  130 O2  ? ? ? 1_555 J  DG 18  N2 ? ? I DC  56  J DG -56 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog288 hydrog ? ? I DT  131 N3  ? ? ? 1_555 J  DA 17  N1 ? ? I DT  57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DT  131 O4  ? ? ? 1_555 J  DA 17  N6 ? ? I DT  57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  132 N1  ? ? ? 1_555 J  DC 16  N3 ? ? I DG  58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  132 N2  ? ? ? 1_555 J  DC 16  O2 ? ? I DG  58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DG  132 O6  ? ? ? 1_555 J  DC 16  N4 ? ? I DG  58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DC  133 N3  ? ? ? 1_555 J  DG 15  N1 ? ? I DC  59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DC  133 N4  ? ? ? 1_555 J  DG 15  O6 ? ? I DC  59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DC  133 O2  ? ? ? 1_555 J  DG 15  N2 ? ? I DC  59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DA  134 N1  ? ? ? 1_555 J  DT 14  N3 ? ? I DA  60  J DT -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DA  134 N6  ? ? ? 1_555 J  DT 14  O4 ? ? I DA  60  J DT -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DG  135 N1  ? ? ? 1_555 J  DC 13  N3 ? ? I DG  61  J DC -61 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog299 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J  DC 12  N3 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J  DC 12  O2 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J  DC 12  N4 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DT  137 N3  ? ? ? 1_555 J  DA 11  N1 ? ? I DT  63  J DA -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DT  137 O4  ? ? ? 1_555 J  DA 11  N6 ? ? I DT  63  J DA -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DG  138 N1  ? ? ? 1_555 J  DC 10  N3 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DG  138 N2  ? ? ? 1_555 J  DC 10  O2 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DG  138 O6  ? ? ? 1_555 J  DC 10  N4 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DG  139 N1  ? ? ? 1_555 J  DC 9   N3 ? ? I DG  65  J DC -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DG  139 N2  ? ? ? 1_555 J  DC 9   O2 ? ? I DG  65  J DC -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DG  139 O6  ? ? ? 1_555 J  DC 9   N4 ? ? I DG  65  J DC -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J  DT 8   N3 ? ? I DA  66  J DT -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J  DT 8   O4 ? ? I DA  66  J DT -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J  DA 7   N1 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J  DA 7   N6 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DA  142 N1  ? ? ? 1_555 J  DT 6   N3 ? ? I DA  68  J DT -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DA  142 N6  ? ? ? 1_555 J  DT 6   O4 ? ? I DA  68  J DT -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DT  143 N3  ? ? ? 1_555 J  DA 5   N1 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? I DT  143 O4  ? ? ? 1_555 J  DA 5   N6 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I DT  144 N3  ? ? ? 1_555 J  DA 4   N1 ? ? I DT  70  J DA -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I DT  144 O4  ? ? ? 1_555 J  DA 4   N6 ? ? I DT  70  J DA -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I DG  145 N1  ? ? ? 1_555 J  DC 3   N3 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I DG  145 N2  ? ? ? 1_555 J  DC 3   O2 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I DG  145 O6  ? ? ? 1_555 J  DC 3   N4 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I DA  146 N1  ? ? ? 1_555 J  DT 2   N3 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? I DA  146 N6  ? ? ? 1_555 J  DT 2   O4 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? I DT  147 N3  ? ? ? 1_555 J  DA 1   N1 ? ? I DT  73  J DA -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog326 hydrog ? ? I DT  147 O4  ? ? ? 1_555 J  DA 1   N6 ? ? I DT  73  J DA -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 50  ? ILE D 51  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 50  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O THR F 96  ? O THR F 96  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN E 136'   
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 74'    
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 74'    
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 75'    
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 76'    
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 76'    
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 77'    
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 77'    
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 78'    
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 79'    
BC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN J 79'    
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 80'    
BC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 81'    
BC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 83'    
BC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 83'    
BC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 86'    
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 87'    
BC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN H 123'   
CC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 89'    
CC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 87'    
CC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 88'    
CC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 89'    
CC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 90'    
CC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 92'    
CC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 96'    
CC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 106'   
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 G 3145' 
DC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 D 3146' 
DC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 3147' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 VAL D  45  ? VAL D 45  . ? 3_545 ? 
2  AC1 2 ASP E  77  ? ASP E 77  . ? 1_555 ? 
3  AC2 1 DG  J  135 ? DG  J 61  . ? 1_555 ? 
4  AC3 1 DG  I  135 ? DG  I 61  . ? 1_555 ? 
5  AC4 1 DG  J  101 ? DG  J 27  . ? 1_555 ? 
6  AC5 1 DG  I  122 ? DG  I 48  . ? 1_555 ? 
7  AC6 1 DG  J  122 ? DG  J 48  . ? 1_555 ? 
8  AC7 1 DG  J  71  ? DG  J -3  . ? 1_555 ? 
9  AC8 2 DG  I  39  ? DG  I -35 . ? 1_555 ? 
10 AC8 2 DG  I  40  ? DG  I -34 . ? 1_555 ? 
11 AC9 2 DG  I  71  ? DG  I -3  . ? 1_555 ? 
12 AC9 2 DG  I  72  ? DG  I -2  . ? 1_555 ? 
13 BC1 1 DG  I  79  ? DG  I 5   . ? 1_555 ? 
14 BC2 3 DG  J  39  ? DG  J -35 . ? 1_555 ? 
15 BC2 3 DG  J  40  ? DG  J -34 . ? 1_555 ? 
16 BC2 3 MN  XA .   ? MN  J 90  . ? 1_555 ? 
17 BC3 1 DG  J  79  ? DG  J 5   . ? 1_555 ? 
18 BC4 1 DG  I  101 ? DG  I 27  . ? 1_555 ? 
19 BC5 1 DC  I  85  ? DC  I 11  . ? 1_555 ? 
20 BC6 1 DC  J  115 ? DC  J 41  . ? 1_555 ? 
21 BC7 2 DG  I  138 ? DG  I 64  . ? 1_555 ? 
22 BC7 2 DG  I  139 ? DG  I 65  . ? 1_555 ? 
23 BC8 1 DG  I  72  ? DG  I -2  . ? 1_555 ? 
24 BC9 1 VAL H  45  ? VAL H 45  . ? 1_555 ? 
25 CC1 1 DG  I  40  ? DG  I -34 . ? 1_555 ? 
26 CC2 1 DG  J  18  ? DG  J -56 . ? 1_555 ? 
27 CC3 1 DA  J  67  ? DA  J -7  . ? 1_555 ? 
28 CC4 1 DG  J  138 ? DG  J 64  . ? 1_555 ? 
29 CC5 2 DG  J  40  ? DG  J -34 . ? 1_555 ? 
30 CC5 2 MN  MA .   ? MN  J 79  . ? 1_555 ? 
31 CC6 1 DG  J  68  ? DG  J -6  . ? 1_555 ? 
32 CC7 1 DC  J  85  ? DC  J 11  . ? 1_555 ? 
33 CC8 2 DC  J  77  ? DC  J 3   . ? 1_555 ? 
34 CC8 2 DA  J  78  ? DA  J 4   . ? 1_555 ? 
35 CC9 6 GLY G  44  ? GLY G 44  . ? 1_555 ? 
36 CC9 6 ALA G  45  ? ALA G 45  . ? 1_555 ? 
37 CC9 6 GLY G  46  ? GLY G 46  . ? 1_555 ? 
38 CC9 6 ALA G  47  ? ALA G 47  . ? 1_555 ? 
39 CC9 6 THR H  87  ? THR H 87  . ? 1_555 ? 
40 CC9 6 SER H  88  ? SER H 88  . ? 1_555 ? 
41 DC1 6 GLY C  44  ? GLY C 44  . ? 1_555 ? 
42 DC1 6 ALA C  45  ? ALA C 45  . ? 1_555 ? 
43 DC1 6 GLY C  46  ? GLY C 46  . ? 1_555 ? 
44 DC1 6 ALA C  47  ? ALA C 47  . ? 1_555 ? 
45 DC1 6 THR D  87  ? THR D 87  . ? 1_555 ? 
46 DC1 6 SER D  88  ? SER D 88  . ? 1_555 ? 
47 DC2 4 HIS H  46  ? HIS H 46  . ? 1_555 ? 
48 DC2 4 PRO H  47  ? PRO H 47  . ? 1_555 ? 
49 DC2 4 ASP H  48  ? ASP H 48  . ? 1_555 ? 
50 DC2 4 THR H  49  ? THR H 49  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3LJA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LJA 
_atom_sites.fract_transf_matrix[1][1]   0.009403 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009109 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005482 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1 37  ? -59.804 -30.016 85.536 1.00 68.59  ? 37   LYS A N     1 
ATOM   2     C  CA    . LYS A  1 37  ? -58.672 -29.437 84.748 1.00 68.70  ? 37   LYS A CA    1 
ATOM   3     C  C     . LYS A  1 37  ? -58.989 -29.402 83.241 1.00 68.38  ? 37   LYS A C     1 
ATOM   4     O  O     . LYS A  1 37  ? -59.279 -30.446 82.641 1.00 68.41  ? 37   LYS A O     1 
ATOM   5     C  CB    . LYS A  1 37  ? -57.385 -30.238 85.003 1.00 68.93  ? 37   LYS A CB    1 
ATOM   6     C  CG    . LYS A  1 37  ? -56.963 -30.331 86.474 1.00 69.52  ? 37   LYS A CG    1 
ATOM   7     C  CD    . LYS A  1 37  ? -55.930 -29.253 86.856 1.00 70.19  ? 37   LYS A CD    1 
ATOM   8     C  CE    . LYS A  1 37  ? -55.669 -29.231 88.370 1.00 69.57  ? 37   LYS A CE    1 
ATOM   9     N  NZ    . LYS A  1 37  ? -54.241 -28.958 88.723 1.00 69.31  ? 37   LYS A NZ    1 
ATOM   10    N  N     . PRO A  1 38  ? -58.959 -28.196 82.625 1.00 67.99  ? 38   PRO A N     1 
ATOM   11    C  CA    . PRO A  1 38  ? -59.051 -28.159 81.154 1.00 67.47  ? 38   PRO A CA    1 
ATOM   12    C  C     . PRO A  1 38  ? -57.763 -28.707 80.525 1.00 66.75  ? 38   PRO A C     1 
ATOM   13    O  O     . PRO A  1 38  ? -56.688 -28.634 81.132 1.00 66.76  ? 38   PRO A O     1 
ATOM   14    C  CB    . PRO A  1 38  ? -59.234 -26.662 80.830 1.00 67.46  ? 38   PRO A CB    1 
ATOM   15    C  CG    . PRO A  1 38  ? -59.485 -25.975 82.154 1.00 67.70  ? 38   PRO A CG    1 
ATOM   16    C  CD    . PRO A  1 38  ? -58.853 -26.843 83.206 1.00 67.91  ? 38   PRO A CD    1 
ATOM   17    N  N     . HIS A  1 39  ? -57.883 -29.254 79.322 1.00 65.82  ? 39   HIS A N     1 
ATOM   18    C  CA    . HIS A  1 39  ? -56.785 -29.983 78.686 1.00 64.77  ? 39   HIS A CA    1 
ATOM   19    C  C     . HIS A  1 39  ? -55.696 -29.076 78.127 1.00 63.43  ? 39   HIS A C     1 
ATOM   20    O  O     . HIS A  1 39  ? -55.994 -28.093 77.446 1.00 63.64  ? 39   HIS A O     1 
ATOM   21    C  CB    . HIS A  1 39  ? -57.322 -30.862 77.562 1.00 65.22  ? 39   HIS A CB    1 
ATOM   22    C  CG    . HIS A  1 39  ? -56.259 -31.629 76.851 1.00 66.18  ? 39   HIS A CG    1 
ATOM   23    N  ND1   . HIS A  1 39  ? -55.609 -31.137 75.739 1.00 66.82  ? 39   HIS A ND1   1 
ATOM   24    C  CD2   . HIS A  1 39  ? -55.710 -32.839 77.111 1.00 66.75  ? 39   HIS A CD2   1 
ATOM   25    C  CE1   . HIS A  1 39  ? -54.719 -32.024 75.332 1.00 67.30  ? 39   HIS A CE1   1 
ATOM   26    N  NE2   . HIS A  1 39  ? -54.761 -33.065 76.146 1.00 67.42  ? 39   HIS A NE2   1 
ATOM   27    N  N     . ARG A  1 40  ? -54.440 -29.434 78.399 1.00 61.46  ? 40   ARG A N     1 
ATOM   28    C  CA    . ARG A  1 40  ? -53.284 -28.667 77.929 1.00 59.45  ? 40   ARG A CA    1 
ATOM   29    C  C     . ARG A  1 40  ? -52.124 -29.545 77.509 1.00 58.19  ? 40   ARG A C     1 
ATOM   30    O  O     . ARG A  1 40  ? -51.878 -30.590 78.105 1.00 58.13  ? 40   ARG A O     1 
ATOM   31    C  CB    . ARG A  1 40  ? -52.794 -27.710 79.006 1.00 59.40  ? 40   ARG A CB    1 
ATOM   32    C  CG    . ARG A  1 40  ? -53.432 -26.353 78.954 1.00 58.51  ? 40   ARG A CG    1 
ATOM   33    C  CD    . ARG A  1 40  ? -52.779 -25.440 79.958 1.00 57.17  ? 40   ARG A CD    1 
ATOM   34    N  NE    . ARG A  1 40  ? -51.625 -24.754 79.397 1.00 56.61  ? 40   ARG A NE    1 
ATOM   35    C  CZ    . ARG A  1 40  ? -51.701 -23.632 78.692 1.00 57.13  ? 40   ARG A CZ    1 
ATOM   36    N  NH1   . ARG A  1 40  ? -52.880 -23.074 78.448 1.00 58.02  ? 40   ARG A NH1   1 
ATOM   37    N  NH2   . ARG A  1 40  ? -50.598 -23.065 78.227 1.00 57.32  ? 40   ARG A NH2   1 
ATOM   38    N  N     . TYR A  1 41  ? -51.397 -29.096 76.491 1.00 56.61  ? 41   TYR A N     1 
ATOM   39    C  CA    . TYR A  1 41  ? -50.218 -29.810 76.014 1.00 54.80  ? 41   TYR A CA    1 
ATOM   40    C  C     . TYR A  1 41  ? -48.931 -29.235 76.601 1.00 53.95  ? 41   TYR A C     1 
ATOM   41    O  O     . TYR A  1 41  ? -48.808 -28.020 76.748 1.00 53.60  ? 41   TYR A O     1 
ATOM   42    C  CB    . TYR A  1 41  ? -50.182 -29.786 74.491 1.00 54.26  ? 41   TYR A CB    1 
ATOM   43    C  CG    . TYR A  1 41  ? -51.118 -30.770 73.835 1.00 52.85  ? 41   TYR A CG    1 
ATOM   44    C  CD1   . TYR A  1 41  ? -52.130 -30.330 72.987 1.00 51.61  ? 41   TYR A CD1   1 
ATOM   45    C  CD2   . TYR A  1 41  ? -50.980 -32.144 74.050 1.00 52.19  ? 41   TYR A CD2   1 
ATOM   46    C  CE1   . TYR A  1 41  ? -52.986 -31.223 72.368 1.00 51.00  ? 41   TYR A CE1   1 
ATOM   47    C  CE2   . TYR A  1 41  ? -51.833 -33.052 73.440 1.00 52.23  ? 41   TYR A CE2   1 
ATOM   48    C  CZ    . TYR A  1 41  ? -52.835 -32.578 72.599 1.00 52.42  ? 41   TYR A CZ    1 
ATOM   49    O  OH    . TYR A  1 41  ? -53.693 -33.463 71.993 1.00 53.72  ? 41   TYR A OH    1 
ATOM   50    N  N     . ARG A  1 42  ? -47.985 -30.110 76.946 1.00 53.26  ? 42   ARG A N     1 
ATOM   51    C  CA    . ARG A  1 42  ? -46.705 -29.677 77.532 1.00 52.98  ? 42   ARG A CA    1 
ATOM   52    C  C     . ARG A  1 42  ? -45.974 -28.776 76.532 1.00 51.96  ? 42   ARG A C     1 
ATOM   53    O  O     . ARG A  1 42  ? -46.101 -28.978 75.326 1.00 52.36  ? 42   ARG A O     1 
ATOM   54    C  CB    . ARG A  1 42  ? -45.821 -30.872 77.941 1.00 53.22  ? 42   ARG A CB    1 
ATOM   55    C  CG    . ARG A  1 42  ? -46.516 -31.998 78.738 1.00 55.67  ? 42   ARG A CG    1 
ATOM   56    C  CD    . ARG A  1 42  ? -46.451 -31.851 80.274 1.00 60.83  ? 42   ARG A CD    1 
ATOM   57    N  NE    . ARG A  1 42  ? -46.697 -30.479 80.747 1.00 65.72  ? 42   ARG A NE    1 
ATOM   58    C  CZ    . ARG A  1 42  ? -47.885 -29.851 80.771 1.00 67.71  ? 42   ARG A CZ    1 
ATOM   59    N  NH1   . ARG A  1 42  ? -49.003 -30.451 80.348 1.00 68.08  ? 42   ARG A NH1   1 
ATOM   60    N  NH2   . ARG A  1 42  ? -47.955 -28.595 81.220 1.00 67.77  ? 42   ARG A NH2   1 
ATOM   61    N  N     . PRO A  1 43  ? -45.239 -27.757 77.015 1.00 50.89  ? 43   PRO A N     1 
ATOM   62    C  CA    . PRO A  1 43  ? -44.515 -26.928 76.055 1.00 49.76  ? 43   PRO A CA    1 
ATOM   63    C  C     . PRO A  1 43  ? -43.593 -27.776 75.204 1.00 48.53  ? 43   PRO A C     1 
ATOM   64    O  O     . PRO A  1 43  ? -42.860 -28.608 75.733 1.00 48.18  ? 43   PRO A O     1 
ATOM   65    C  CB    . PRO A  1 43  ? -43.711 -25.985 76.943 1.00 49.84  ? 43   PRO A CB    1 
ATOM   66    C  CG    . PRO A  1 43  ? -44.519 -25.881 78.185 1.00 50.59  ? 43   PRO A CG    1 
ATOM   67    C  CD    . PRO A  1 43  ? -45.035 -27.284 78.395 1.00 51.05  ? 43   PRO A CD    1 
ATOM   68    N  N     . GLY A  1 44  ? -43.689 -27.600 73.891 1.00 47.33  ? 44   GLY A N     1 
ATOM   69    C  CA    . GLY A  1 44  ? -42.841 -28.321 72.957 1.00 46.38  ? 44   GLY A CA    1 
ATOM   70    C  C     . GLY A  1 44  ? -43.523 -29.493 72.286 1.00 45.59  ? 44   GLY A C     1 
ATOM   71    O  O     . GLY A  1 44  ? -42.972 -30.087 71.354 1.00 45.75  ? 44   GLY A O     1 
ATOM   72    N  N     . THR A  1 45  ? -44.713 -29.846 72.757 1.00 44.42  ? 45   THR A N     1 
ATOM   73    C  CA    . THR A  1 45  ? -45.441 -30.940 72.146 1.00 43.39  ? 45   THR A CA    1 
ATOM   74    C  C     . THR A  1 45  ? -46.037 -30.483 70.830 1.00 42.94  ? 45   THR A C     1 
ATOM   75    O  O     . THR A  1 45  ? -45.973 -31.201 69.831 1.00 42.79  ? 45   THR A O     1 
ATOM   76    C  CB    . THR A  1 45  ? -46.509 -31.512 73.087 1.00 43.21  ? 45   THR A CB    1 
ATOM   77    O  OG1   . THR A  1 45  ? -45.852 -32.133 74.186 1.00 43.41  ? 45   THR A OG1   1 
ATOM   78    C  CG2   . THR A  1 45  ? -47.341 -32.585 72.406 1.00 42.75  ? 45   THR A CG2   1 
ATOM   79    N  N     . VAL A  1 46  ? -46.599 -29.282 70.825 1.00 42.42  ? 46   VAL A N     1 
ATOM   80    C  CA    . VAL A  1 46  ? -47.206 -28.767 69.609 1.00 42.02  ? 46   VAL A CA    1 
ATOM   81    C  C     . VAL A  1 46  ? -46.120 -28.338 68.646 1.00 41.43  ? 46   VAL A C     1 
ATOM   82    O  O     . VAL A  1 46  ? -46.303 -28.398 67.435 1.00 41.46  ? 46   VAL A O     1 
ATOM   83    C  CB    . VAL A  1 46  ? -48.165 -27.597 69.866 1.00 42.26  ? 46   VAL A CB    1 
ATOM   84    C  CG1   . VAL A  1 46  ? -49.194 -27.523 68.738 1.00 41.86  ? 46   VAL A CG1   1 
ATOM   85    C  CG2   . VAL A  1 46  ? -48.857 -27.768 71.211 1.00 42.09  ? 46   VAL A CG2   1 
ATOM   86    N  N     . ALA A  1 47  ? -44.987 -27.906 69.190 1.00 40.92  ? 47   ALA A N     1 
ATOM   87    C  CA    . ALA A  1 47  ? -43.845 -27.535 68.361 1.00 40.24  ? 47   ALA A CA    1 
ATOM   88    C  C     . ALA A  1 47  ? -43.461 -28.726 67.480 1.00 39.72  ? 47   ALA A C     1 
ATOM   89    O  O     . ALA A  1 47  ? -43.447 -28.607 66.250 1.00 39.77  ? 47   ALA A O     1 
ATOM   90    C  CB    . ALA A  1 47  ? -42.688 -27.088 69.209 1.00 40.06  ? 47   ALA A CB    1 
ATOM   91    N  N     . LEU A  1 48  ? -43.204 -29.873 68.111 1.00 38.70  ? 48   LEU A N     1 
ATOM   92    C  CA    . LEU A  1 48  ? -42.932 -31.117 67.396 1.00 38.34  ? 48   LEU A CA    1 
ATOM   93    C  C     . LEU A  1 48  ? -44.008 -31.468 66.353 1.00 38.14  ? 48   LEU A C     1 
ATOM   94    O  O     . LEU A  1 48  ? -43.701 -31.845 65.211 1.00 37.77  ? 48   LEU A O     1 
ATOM   95    C  CB    . LEU A  1 48  ? -42.767 -32.256 68.388 1.00 38.01  ? 48   LEU A CB    1 
ATOM   96    C  CG    . LEU A  1 48  ? -41.365 -32.705 68.786 1.00 39.23  ? 48   LEU A CG    1 
ATOM   97    C  CD1   . LEU A  1 48  ? -40.253 -31.721 68.424 1.00 41.11  ? 48   LEU A CD1   1 
ATOM   98    C  CD2   . LEU A  1 48  ? -41.346 -32.985 70.274 1.00 40.32  ? 48   LEU A CD2   1 
ATOM   99    N  N     . ARG A  1 49  ? -45.263 -31.319 66.758 1.00 37.59  ? 49   ARG A N     1 
ATOM   100   C  CA    . ARG A  1 49  ? -46.399 -31.605 65.910 1.00 37.37  ? 49   ARG A CA    1 
ATOM   101   C  C     . ARG A  1 49  ? -46.345 -30.751 64.638 1.00 36.93  ? 49   ARG A C     1 
ATOM   102   O  O     . ARG A  1 49  ? -46.688 -31.234 63.546 1.00 36.85  ? 49   ARG A O     1 
ATOM   103   C  CB    . ARG A  1 49  ? -47.682 -31.347 66.709 1.00 37.76  ? 49   ARG A CB    1 
ATOM   104   C  CG    . ARG A  1 49  ? -48.978 -31.771 66.053 1.00 38.82  ? 49   ARG A CG    1 
ATOM   105   C  CD    . ARG A  1 49  ? -50.010 -32.155 67.104 1.00 39.80  ? 49   ARG A CD    1 
ATOM   106   N  NE    . ARG A  1 49  ? -50.687 -30.982 67.666 1.00 40.48  ? 49   ARG A NE    1 
ATOM   107   C  CZ    . ARG A  1 49  ? -51.072 -30.876 68.935 1.00 39.45  ? 49   ARG A CZ    1 
ATOM   108   N  NH1   . ARG A  1 49  ? -50.837 -31.868 69.796 1.00 38.06  ? 49   ARG A NH1   1 
ATOM   109   N  NH2   . ARG A  1 49  ? -51.675 -29.766 69.348 1.00 39.35  ? 49   ARG A NH2   1 
ATOM   110   N  N     . GLU A  1 50  ? -45.894 -29.503 64.778 1.00 36.00  ? 50   GLU A N     1 
ATOM   111   C  CA    . GLU A  1 50  ? -45.787 -28.602 63.647 1.00 35.93  ? 50   GLU A CA    1 
ATOM   112   C  C     . GLU A  1 50  ? -44.573 -28.897 62.763 1.00 35.90  ? 50   GLU A C     1 
ATOM   113   O  O     . GLU A  1 50  ? -44.660 -28.842 61.536 1.00 35.86  ? 50   GLU A O     1 
ATOM   114   C  CB    . GLU A  1 50  ? -45.712 -27.174 64.119 1.00 35.97  ? 50   GLU A CB    1 
ATOM   115   C  CG    . GLU A  1 50  ? -46.921 -26.677 64.843 1.00 37.68  ? 50   GLU A CG    1 
ATOM   116   C  CD    . GLU A  1 50  ? -46.625 -25.371 65.560 1.00 40.57  ? 50   GLU A CD    1 
ATOM   117   O  OE1   . GLU A  1 50  ? -45.629 -24.708 65.192 1.00 41.42  ? 50   GLU A OE1   1 
ATOM   118   O  OE2   . GLU A  1 50  ? -47.374 -25.005 66.498 1.00 42.33  ? 50   GLU A OE2   1 
ATOM   119   N  N     . ILE A  1 51  ? -43.436 -29.198 63.380 1.00 35.83  ? 51   ILE A N     1 
ATOM   120   C  CA    . ILE A  1 51  ? -42.277 -29.612 62.616 1.00 35.51  ? 51   ILE A CA    1 
ATOM   121   C  C     . ILE A  1 51  ? -42.682 -30.771 61.730 1.00 35.87  ? 51   ILE A C     1 
ATOM   122   O  O     . ILE A  1 51  ? -42.315 -30.807 60.584 1.00 36.35  ? 51   ILE A O     1 
ATOM   123   C  CB    . ILE A  1 51  ? -41.066 -30.017 63.503 1.00 35.68  ? 51   ILE A CB    1 
ATOM   124   C  CG1   . ILE A  1 51  ? -40.542 -28.807 64.290 1.00 35.36  ? 51   ILE A CG1   1 
ATOM   125   C  CG2   . ILE A  1 51  ? -39.946 -30.598 62.649 1.00 33.88  ? 51   ILE A CG2   1 
ATOM   126   C  CD1   . ILE A  1 51  ? -39.479 -29.127 65.323 1.00 35.14  ? 51   ILE A CD1   1 
ATOM   127   N  N     . ARG A  1 52  ? -43.456 -31.713 62.248 1.00 36.45  ? 52   ARG A N     1 
ATOM   128   C  CA    . ARG A  1 52  ? -43.841 -32.874 61.453 1.00 36.81  ? 52   ARG A CA    1 
ATOM   129   C  C     . ARG A  1 52  ? -44.812 -32.500 60.340 1.00 36.93  ? 52   ARG A C     1 
ATOM   130   O  O     . ARG A  1 52  ? -44.707 -33.003 59.218 1.00 37.08  ? 52   ARG A O     1 
ATOM   131   C  CB    . ARG A  1 52  ? -44.393 -33.992 62.338 1.00 36.82  ? 52   ARG A CB    1 
ATOM   132   C  CG    . ARG A  1 52  ? -43.313 -34.629 63.185 1.00 38.33  ? 52   ARG A CG    1 
ATOM   133   C  CD    . ARG A  1 52  ? -43.694 -36.011 63.651 1.00 42.85  ? 52   ARG A CD    1 
ATOM   134   N  NE    . ARG A  1 52  ? -42.659 -36.585 64.525 1.00 47.40  ? 52   ARG A NE    1 
ATOM   135   C  CZ    . ARG A  1 52  ? -42.583 -36.412 65.850 1.00 49.13  ? 52   ARG A CZ    1 
ATOM   136   N  NH1   . ARG A  1 52  ? -43.477 -35.669 66.507 1.00 49.08  ? 52   ARG A NH1   1 
ATOM   137   N  NH2   . ARG A  1 52  ? -41.596 -36.985 66.527 1.00 50.43  ? 52   ARG A NH2   1 
ATOM   138   N  N     . ARG A  1 53  ? -45.733 -31.599 60.650 1.00 36.96  ? 53   ARG A N     1 
ATOM   139   C  CA    . ARG A  1 53  ? -46.670 -31.101 59.670 1.00 37.14  ? 53   ARG A CA    1 
ATOM   140   C  C     . ARG A  1 53  ? -45.986 -30.309 58.553 1.00 36.92  ? 53   ARG A C     1 
ATOM   141   O  O     . ARG A  1 53  ? -46.229 -30.562 57.375 1.00 37.43  ? 53   ARG A O     1 
ATOM   142   C  CB    . ARG A  1 53  ? -47.730 -30.246 60.350 1.00 37.57  ? 53   ARG A CB    1 
ATOM   143   C  CG    . ARG A  1 53  ? -48.625 -29.495 59.389 1.00 39.31  ? 53   ARG A CG    1 
ATOM   144   C  CD    . ARG A  1 53  ? -49.744 -28.839 60.138 1.00 43.43  ? 53   ARG A CD    1 
ATOM   145   N  NE    . ARG A  1 53  ? -50.498 -27.930 59.285 1.00 47.13  ? 53   ARG A NE    1 
ATOM   146   C  CZ    . ARG A  1 53  ? -50.857 -26.702 59.654 1.00 49.47  ? 53   ARG A CZ    1 
ATOM   147   N  NH1   . ARG A  1 53  ? -50.503 -26.240 60.854 1.00 50.64  ? 53   ARG A NH1   1 
ATOM   148   N  NH2   . ARG A  1 53  ? -51.556 -25.929 58.826 1.00 49.47  ? 53   ARG A NH2   1 
ATOM   149   N  N     . TYR A  1 54  ? -45.136 -29.353 58.905 1.00 36.29  ? 54   TYR A N     1 
ATOM   150   C  CA    . TYR A  1 54  ? -44.549 -28.502 57.875 1.00 35.61  ? 54   TYR A CA    1 
ATOM   151   C  C     . TYR A  1 54  ? -43.413 -29.165 57.078 1.00 35.12  ? 54   TYR A C     1 
ATOM   152   O  O     . TYR A  1 54  ? -43.051 -28.702 55.992 1.00 35.23  ? 54   TYR A O     1 
ATOM   153   C  CB    . TYR A  1 54  ? -44.145 -27.142 58.451 1.00 35.57  ? 54   TYR A CB    1 
ATOM   154   C  CG    . TYR A  1 54  ? -45.333 -26.329 58.876 1.00 35.52  ? 54   TYR A CG    1 
ATOM   155   C  CD1   . TYR A  1 54  ? -45.584 -26.080 60.216 1.00 35.50  ? 54   TYR A CD1   1 
ATOM   156   C  CD2   . TYR A  1 54  ? -46.229 -25.830 57.936 1.00 36.00  ? 54   TYR A CD2   1 
ATOM   157   C  CE1   . TYR A  1 54  ? -46.682 -25.339 60.616 1.00 35.40  ? 54   TYR A CE1   1 
ATOM   158   C  CE2   . TYR A  1 54  ? -47.336 -25.088 58.325 1.00 35.73  ? 54   TYR A CE2   1 
ATOM   159   C  CZ    . TYR A  1 54  ? -47.558 -24.853 59.665 1.00 35.98  ? 54   TYR A CZ    1 
ATOM   160   O  OH    . TYR A  1 54  ? -48.656 -24.121 60.055 1.00 36.65  ? 54   TYR A OH    1 
ATOM   161   N  N     . GLN A  1 55  ? -42.856 -30.244 57.604 1.00 34.34  ? 55   GLN A N     1 
ATOM   162   C  CA    . GLN A  1 55  ? -41.839 -30.967 56.870 1.00 34.02  ? 55   GLN A CA    1 
ATOM   163   C  C     . GLN A  1 55  ? -42.488 -31.946 55.905 1.00 34.85  ? 55   GLN A C     1 
ATOM   164   O  O     . GLN A  1 55  ? -41.819 -32.553 55.075 1.00 34.76  ? 55   GLN A O     1 
ATOM   165   C  CB    . GLN A  1 55  ? -40.862 -31.648 57.821 1.00 33.17  ? 55   GLN A CB    1 
ATOM   166   C  CG    . GLN A  1 55  ? -39.971 -30.648 58.523 1.00 31.67  ? 55   GLN A CG    1 
ATOM   167   C  CD    . GLN A  1 55  ? -38.737 -31.255 59.153 1.00 30.83  ? 55   GLN A CD    1 
ATOM   168   O  OE1   . GLN A  1 55  ? -38.668 -32.465 59.406 1.00 31.98  ? 55   GLN A OE1   1 
ATOM   169   N  NE2   . GLN A  1 55  ? -37.751 -30.412 59.423 1.00 27.77  ? 55   GLN A NE2   1 
ATOM   170   N  N     . LYS A  1 56  ? -43.809 -32.065 56.005 1.00 36.18  ? 56   LYS A N     1 
ATOM   171   C  CA    . LYS A  1 56  ? -44.576 -32.942 55.138 1.00 37.47  ? 56   LYS A CA    1 
ATOM   172   C  C     . LYS A  1 56  ? -45.148 -32.172 53.958 1.00 38.06  ? 56   LYS A C     1 
ATOM   173   O  O     . LYS A  1 56  ? -45.192 -32.685 52.836 1.00 38.41  ? 56   LYS A O     1 
ATOM   174   C  CB    . LYS A  1 56  ? -45.696 -33.603 55.920 1.00 37.67  ? 56   LYS A CB    1 
ATOM   175   C  CG    . LYS A  1 56  ? -45.975 -35.014 55.442 1.00 40.61  ? 56   LYS A CG    1 
ATOM   176   C  CD    . LYS A  1 56  ? -46.094 -35.997 56.612 1.00 43.98  ? 56   LYS A CD    1 
ATOM   177   C  CE    . LYS A  1 56  ? -47.282 -35.660 57.521 1.00 46.25  ? 56   LYS A CE    1 
ATOM   178   N  NZ    . LYS A  1 56  ? -47.358 -36.578 58.711 1.00 48.71  ? 56   LYS A NZ    1 
ATOM   179   N  N     . SER A  1 57  ? -45.562 -30.933 54.206 1.00 38.25  ? 57   SER A N     1 
ATOM   180   C  CA    . SER A  1 57  ? -46.148 -30.100 53.168 1.00 38.94  ? 57   SER A CA    1 
ATOM   181   C  C     . SER A  1 57  ? -45.092 -29.340 52.364 1.00 39.33  ? 57   SER A C     1 
ATOM   182   O  O     . SER A  1 57  ? -43.928 -29.248 52.778 1.00 39.71  ? 57   SER A O     1 
ATOM   183   C  CB    . SER A  1 57  ? -47.100 -29.107 53.812 1.00 39.23  ? 57   SER A CB    1 
ATOM   184   O  OG    . SER A  1 57  ? -46.380 -28.199 54.627 1.00 40.36  ? 57   SER A OG    1 
ATOM   185   N  N     . THR A  1 58  ? -45.497 -28.784 51.221 1.00 39.34  ? 58   THR A N     1 
ATOM   186   C  CA    . THR A  1 58  ? -44.589 -27.991 50.387 1.00 39.29  ? 58   THR A CA    1 
ATOM   187   C  C     . THR A  1 58  ? -45.102 -26.582 50.133 1.00 39.51  ? 58   THR A C     1 
ATOM   188   O  O     . THR A  1 58  ? -44.432 -25.770 49.502 1.00 39.58  ? 58   THR A O     1 
ATOM   189   C  CB    . THR A  1 58  ? -44.342 -28.651 49.024 1.00 39.15  ? 58   THR A CB    1 
ATOM   190   O  OG1   . THR A  1 58  ? -45.591 -28.832 48.352 1.00 39.15  ? 58   THR A OG1   1 
ATOM   191   C  CG2   . THR A  1 58  ? -43.661 -29.981 49.193 1.00 39.06  ? 58   THR A CG2   1 
ATOM   192   N  N     . GLU A  1 59  ? -46.301 -26.300 50.615 1.00 40.03  ? 59   GLU A N     1 
ATOM   193   C  CA    . GLU A  1 59  ? -46.912 -25.011 50.387 1.00 40.94  ? 59   GLU A CA    1 
ATOM   194   C  C     . GLU A  1 59  ? -46.025 -23.920 50.991 1.00 40.88  ? 59   GLU A C     1 
ATOM   195   O  O     . GLU A  1 59  ? -45.276 -24.167 51.940 1.00 40.62  ? 59   GLU A O     1 
ATOM   196   C  CB    . GLU A  1 59  ? -48.363 -24.987 50.920 1.00 41.21  ? 59   GLU A CB    1 
ATOM   197   C  CG    . GLU A  1 59  ? -48.568 -24.594 52.394 1.00 43.78  ? 59   GLU A CG    1 
ATOM   198   C  CD    . GLU A  1 59  ? -47.989 -25.598 53.387 1.00 47.83  ? 59   GLU A CD    1 
ATOM   199   O  OE1   . GLU A  1 59  ? -48.261 -25.468 54.606 1.00 49.56  ? 59   GLU A OE1   1 
ATOM   200   O  OE2   . GLU A  1 59  ? -47.259 -26.516 52.961 1.00 48.84  ? 59   GLU A OE2   1 
ATOM   201   N  N     . LEU A  1 60  ? -46.080 -22.731 50.401 1.00 40.95  ? 60   LEU A N     1 
ATOM   202   C  CA    . LEU A  1 60  ? -45.307 -21.603 50.894 1.00 40.99  ? 60   LEU A CA    1 
ATOM   203   C  C     . LEU A  1 60  ? -45.853 -21.137 52.235 1.00 40.35  ? 60   LEU A C     1 
ATOM   204   O  O     . LEU A  1 60  ? -47.031 -21.320 52.515 1.00 40.34  ? 60   LEU A O     1 
ATOM   205   C  CB    . LEU A  1 60  ? -45.308 -20.459 49.878 1.00 41.49  ? 60   LEU A CB    1 
ATOM   206   C  CG    . LEU A  1 60  ? -44.694 -20.795 48.517 1.00 42.39  ? 60   LEU A CG    1 
ATOM   207   C  CD1   . LEU A  1 60  ? -45.081 -19.744 47.498 1.00 44.46  ? 60   LEU A CD1   1 
ATOM   208   C  CD2   . LEU A  1 60  ? -43.187 -20.918 48.604 1.00 43.24  ? 60   LEU A CD2   1 
ATOM   209   N  N     . LEU A  1 61  ? -44.990 -20.537 53.052 1.00 39.64  ? 61   LEU A N     1 
ATOM   210   C  CA    . LEU A  1 61  ? -45.318 -20.265 54.445 1.00 38.66  ? 61   LEU A CA    1 
ATOM   211   C  C     . LEU A  1 61  ? -45.361 -18.787 54.790 1.00 38.49  ? 61   LEU A C     1 
ATOM   212   O  O     . LEU A  1 61  ? -45.726 -18.419 55.903 1.00 38.66  ? 61   LEU A O     1 
ATOM   213   C  CB    . LEU A  1 61  ? -44.385 -21.040 55.380 1.00 38.14  ? 61   LEU A CB    1 
ATOM   214   C  CG    . LEU A  1 61  ? -44.288 -22.544 55.093 1.00 38.00  ? 61   LEU A CG    1 
ATOM   215   C  CD1   . LEU A  1 61  ? -43.257 -23.257 55.969 1.00 36.49  ? 61   LEU A CD1   1 
ATOM   216   C  CD2   . LEU A  1 61  ? -45.656 -23.234 55.177 1.00 38.18  ? 61   LEU A CD2   1 
ATOM   217   N  N     . ILE A  1 62  ? -44.998 -17.932 53.846 1.00 38.53  ? 62   ILE A N     1 
ATOM   218   C  CA    . ILE A  1 62  ? -45.248 -16.501 54.003 1.00 39.04  ? 62   ILE A CA    1 
ATOM   219   C  C     . ILE A  1 62  ? -46.505 -16.169 53.200 1.00 39.69  ? 62   ILE A C     1 
ATOM   220   O  O     . ILE A  1 62  ? -46.703 -16.697 52.107 1.00 39.77  ? 62   ILE A O     1 
ATOM   221   C  CB    . ILE A  1 62  ? -44.043 -15.644 53.541 1.00 38.61  ? 62   ILE A CB    1 
ATOM   222   C  CG1   . ILE A  1 62  ? -42.799 -16.025 54.326 1.00 38.81  ? 62   ILE A CG1   1 
ATOM   223   C  CG2   . ILE A  1 62  ? -44.305 -14.150 53.738 1.00 38.16  ? 62   ILE A CG2   1 
ATOM   224   C  CD1   . ILE A  1 62  ? -41.522 -15.513 53.710 1.00 40.35  ? 62   ILE A CD1   1 
ATOM   225   N  N     . ARG A  1 63  ? -47.371 -15.326 53.745 1.00 40.71  ? 63   ARG A N     1 
ATOM   226   C  CA    . ARG A  1 63  ? -48.543 -14.892 52.983 1.00 42.20  ? 63   ARG A CA    1 
ATOM   227   C  C     . ARG A  1 63  ? -48.099 -14.129 51.726 1.00 42.26  ? 63   ARG A C     1 
ATOM   228   O  O     . ARG A  1 63  ? -47.148 -13.343 51.767 1.00 42.23  ? 63   ARG A O     1 
ATOM   229   C  CB    . ARG A  1 63  ? -49.495 -14.039 53.845 1.00 42.84  ? 63   ARG A CB    1 
ATOM   230   C  CG    . ARG A  1 63  ? -50.111 -14.748 55.057 1.00 45.62  ? 63   ARG A CG    1 
ATOM   231   C  CD    . ARG A  1 63  ? -49.757 -13.944 56.305 1.00 52.08  ? 63   ARG A CD    1 
ATOM   232   N  NE    . ARG A  1 63  ? -50.833 -13.071 56.807 1.00 57.43  ? 63   ARG A NE    1 
ATOM   233   C  CZ    . ARG A  1 63  ? -50.650 -11.860 57.360 1.00 59.28  ? 63   ARG A CZ    1 
ATOM   234   N  NH1   . ARG A  1 63  ? -49.436 -11.310 57.447 1.00 59.84  ? 63   ARG A NH1   1 
ATOM   235   N  NH2   . ARG A  1 63  ? -51.698 -11.176 57.806 1.00 58.89  ? 63   ARG A NH2   1 
ATOM   236   N  N     . LYS A  1 64  ? -48.815 -14.365 50.630 1.00 42.58  ? 64   LYS A N     1 
ATOM   237   C  CA    . LYS A  1 64  ? -48.453 -13.917 49.293 1.00 43.28  ? 64   LYS A CA    1 
ATOM   238   C  C     . LYS A  1 64  ? -48.386 -12.390 49.086 1.00 43.10  ? 64   LYS A C     1 
ATOM   239   O  O     . LYS A  1 64  ? -47.435 -11.880 48.508 1.00 43.20  ? 64   LYS A O     1 
ATOM   240   C  CB    . LYS A  1 64  ? -49.407 -14.563 48.290 1.00 43.04  ? 64   LYS A CB    1 
ATOM   241   C  CG    . LYS A  1 64  ? -48.947 -14.478 46.851 1.00 44.81  ? 64   LYS A CG    1 
ATOM   242   C  CD    . LYS A  1 64  ? -50.043 -14.900 45.866 1.00 45.15  ? 64   LYS A CD    1 
ATOM   243   C  CE    . LYS A  1 64  ? -49.977 -14.090 44.538 1.00 47.88  ? 64   LYS A CE    1 
ATOM   244   N  NZ    . LYS A  1 64  ? -50.180 -12.602 44.708 1.00 47.35  ? 64   LYS A NZ    1 
ATOM   245   N  N     . LEU A  1 65  ? -49.382 -11.659 49.562 1.00 43.34  ? 65   LEU A N     1 
ATOM   246   C  CA    . LEU A  1 65  ? -49.436 -10.208 49.332 1.00 43.46  ? 65   LEU A CA    1 
ATOM   247   C  C     . LEU A  1 65  ? -48.420 -9.376  50.123 1.00 43.31  ? 65   LEU A C     1 
ATOM   248   O  O     . LEU A  1 65  ? -47.816 -8.460  49.559 1.00 43.52  ? 65   LEU A O     1 
ATOM   249   C  CB    . LEU A  1 65  ? -50.858 -9.663  49.567 1.00 43.83  ? 65   LEU A CB    1 
ATOM   250   C  CG    . LEU A  1 65  ? -51.074 -8.163  49.351 1.00 43.79  ? 65   LEU A CG    1 
ATOM   251   C  CD1   . LEU A  1 65  ? -50.909 -7.816  47.870 1.00 44.52  ? 65   LEU A CD1   1 
ATOM   252   C  CD2   . LEU A  1 65  ? -52.424 -7.720  49.886 1.00 43.23  ? 65   LEU A CD2   1 
ATOM   253   N  N     . PRO A  1 66  ? -48.239 -9.668  51.430 1.00 43.11  ? 66   PRO A N     1 
ATOM   254   C  CA    . PRO A  1 66  ? -47.275 -8.867  52.174 1.00 42.80  ? 66   PRO A CA    1 
ATOM   255   C  C     . PRO A  1 66  ? -45.899 -9.025  51.554 1.00 42.79  ? 66   PRO A C     1 
ATOM   256   O  O     . PRO A  1 66  ? -45.125 -8.072  51.511 1.00 42.65  ? 66   PRO A O     1 
ATOM   257   C  CB    . PRO A  1 66  ? -47.278 -9.496  53.567 1.00 42.62  ? 66   PRO A CB    1 
ATOM   258   C  CG    . PRO A  1 66  ? -48.456 -10.334 53.636 1.00 42.79  ? 66   PRO A CG    1 
ATOM   259   C  CD    . PRO A  1 66  ? -48.844 -10.719 52.265 1.00 42.86  ? 66   PRO A CD    1 
ATOM   260   N  N     . PHE A  1 67  ? -45.615 -10.227 51.058 1.00 42.97  ? 67   PHE A N     1 
ATOM   261   C  CA    . PHE A  1 67  ? -44.351 -10.506 50.391 1.00 43.21  ? 67   PHE A CA    1 
ATOM   262   C  C     . PHE A  1 67  ? -44.194 -9.649  49.163 1.00 43.50  ? 67   PHE A C     1 
ATOM   263   O  O     . PHE A  1 67  ? -43.126 -9.073  48.923 1.00 43.75  ? 67   PHE A O     1 
ATOM   264   C  CB    . PHE A  1 67  ? -44.263 -11.958 49.965 1.00 42.83  ? 67   PHE A CB    1 
ATOM   265   C  CG    . PHE A  1 67  ? -42.897 -12.356 49.527 1.00 42.90  ? 67   PHE A CG    1 
ATOM   266   C  CD1   . PHE A  1 67  ? -41.952 -12.768 50.459 1.00 42.07  ? 67   PHE A CD1   1 
ATOM   267   C  CD2   . PHE A  1 67  ? -42.540 -12.305 48.187 1.00 42.45  ? 67   PHE A CD2   1 
ATOM   268   C  CE1   . PHE A  1 67  ? -40.684 -13.132 50.055 1.00 41.73  ? 67   PHE A CE1   1 
ATOM   269   C  CE2   . PHE A  1 67  ? -41.269 -12.675 47.785 1.00 41.36  ? 67   PHE A CE2   1 
ATOM   270   C  CZ    . PHE A  1 67  ? -40.344 -13.082 48.718 1.00 41.78  ? 67   PHE A CZ    1 
ATOM   271   N  N     . GLN A  1 68  ? -45.274 -9.576  48.391 1.00 43.63  ? 68   GLN A N     1 
ATOM   272   C  CA    . GLN A  1 68  ? -45.284 -8.812  47.173 1.00 43.72  ? 68   GLN A CA    1 
ATOM   273   C  C     . GLN A  1 68  ? -45.033 -7.347  47.479 1.00 43.43  ? 68   GLN A C     1 
ATOM   274   O  O     . GLN A  1 68  ? -44.210 -6.711  46.823 1.00 43.73  ? 68   GLN A O     1 
ATOM   275   C  CB    . GLN A  1 68  ? -46.594 -9.008  46.435 1.00 43.90  ? 68   GLN A CB    1 
ATOM   276   C  CG    . GLN A  1 68  ? -46.394 -8.922  44.959 1.00 46.63  ? 68   GLN A CG    1 
ATOM   277   C  CD    . GLN A  1 68  ? -47.679 -8.961  44.184 1.00 49.18  ? 68   GLN A CD    1 
ATOM   278   O  OE1   . GLN A  1 68  ? -48.472 -8.015  44.234 1.00 50.97  ? 68   GLN A OE1   1 
ATOM   279   N  NE2   . GLN A  1 68  ? -47.888 -10.046 43.436 1.00 48.88  ? 68   GLN A NE2   1 
ATOM   280   N  N     . ARG A  1 69  ? -45.707 -6.817  48.492 1.00 42.98  ? 69   ARG A N     1 
ATOM   281   C  CA    . ARG A  1 69  ? -45.437 -5.452  48.933 1.00 42.97  ? 69   ARG A CA    1 
ATOM   282   C  C     . ARG A  1 69  ? -43.955 -5.265  49.214 1.00 42.23  ? 69   ARG A C     1 
ATOM   283   O  O     . ARG A  1 69  ? -43.325 -4.333  48.703 1.00 41.93  ? 69   ARG A O     1 
ATOM   284   C  CB    . ARG A  1 69  ? -46.244 -5.102  50.193 1.00 43.77  ? 69   ARG A CB    1 
ATOM   285   C  CG    . ARG A  1 69  ? -47.628 -4.482  49.933 1.00 45.00  ? 69   ARG A CG    1 
ATOM   286   C  CD    . ARG A  1 69  ? -48.125 -3.703  51.148 1.00 46.28  ? 69   ARG A CD    1 
ATOM   287   N  NE    . ARG A  1 69  ? -48.369 -4.573  52.295 1.00 47.65  ? 69   ARG A NE    1 
ATOM   288   C  CZ    . ARG A  1 69  ? -49.429 -5.371  52.417 1.00 50.22  ? 69   ARG A CZ    1 
ATOM   289   N  NH1   . ARG A  1 69  ? -50.354 -5.427  51.457 1.00 51.92  ? 69   ARG A NH1   1 
ATOM   290   N  NH2   . ARG A  1 69  ? -49.572 -6.127  53.500 1.00 51.19  ? 69   ARG A NH2   1 
ATOM   291   N  N     . LEU A  1 70  ? -43.399 -6.170  50.014 1.00 41.60  ? 70   LEU A N     1 
ATOM   292   C  CA    . LEU A  1 70  ? -41.988 -6.112  50.362 1.00 41.15  ? 70   LEU A CA    1 
ATOM   293   C  C     . LEU A  1 70  ? -41.103 -6.066  49.125 1.00 41.03  ? 70   LEU A C     1 
ATOM   294   O  O     . LEU A  1 70  ? -40.288 -5.155  48.993 1.00 41.08  ? 70   LEU A O     1 
ATOM   295   C  CB    . LEU A  1 70  ? -41.603 -7.288  51.247 1.00 41.19  ? 70   LEU A CB    1 
ATOM   296   C  CG    . LEU A  1 70  ? -40.209 -7.327  51.864 1.00 40.42  ? 70   LEU A CG    1 
ATOM   297   C  CD1   . LEU A  1 70  ? -39.972 -6.175  52.817 1.00 38.61  ? 70   LEU A CD1   1 
ATOM   298   C  CD2   . LEU A  1 70  ? -40.106 -8.637  52.587 1.00 41.03  ? 70   LEU A CD2   1 
ATOM   299   N  N     . VAL A  1 71  ? -41.282 -7.021  48.214 1.00 40.67  ? 71   VAL A N     1 
ATOM   300   C  CA    . VAL A  1 71  ? -40.481 -7.077  46.999 1.00 40.56  ? 71   VAL A CA    1 
ATOM   301   C  C     . VAL A  1 71  ? -40.505 -5.744  46.238 1.00 41.00  ? 71   VAL A C     1 
ATOM   302   O  O     . VAL A  1 71  ? -39.454 -5.158  45.950 1.00 40.76  ? 71   VAL A O     1 
ATOM   303   C  CB    . VAL A  1 71  ? -40.938 -8.227  46.094 1.00 40.83  ? 71   VAL A CB    1 
ATOM   304   C  CG1   . VAL A  1 71  ? -40.341 -8.089  44.692 1.00 40.65  ? 71   VAL A CG1   1 
ATOM   305   C  CG2   . VAL A  1 71  ? -40.569 -9.570  46.708 1.00 39.54  ? 71   VAL A CG2   1 
ATOM   306   N  N     . ARG A  1 72  ? -41.711 -5.256  45.950 1.00 41.51  ? 72   ARG A N     1 
ATOM   307   C  CA    . ARG A  1 72  ? -41.900 -4.014  45.194 1.00 41.67  ? 72   ARG A CA    1 
ATOM   308   C  C     . ARG A  1 72  ? -41.196 -2.815  45.818 1.00 42.15  ? 72   ARG A C     1 
ATOM   309   O  O     . ARG A  1 72  ? -40.611 -2.003  45.097 1.00 42.45  ? 72   ARG A O     1 
ATOM   310   C  CB    . ARG A  1 72  ? -43.383 -3.714  45.009 1.00 41.40  ? 72   ARG A CB    1 
ATOM   311   C  CG    . ARG A  1 72  ? -44.099 -4.757  44.204 1.00 41.19  ? 72   ARG A CG    1 
ATOM   312   C  CD    . ARG A  1 72  ? -45.538 -4.374  43.948 1.00 42.59  ? 72   ARG A CD    1 
ATOM   313   N  NE    . ARG A  1 72  ? -46.245 -5.480  43.309 1.00 43.13  ? 72   ARG A NE    1 
ATOM   314   C  CZ    . ARG A  1 72  ? -46.311 -5.673  41.993 1.00 41.90  ? 72   ARG A CZ    1 
ATOM   315   N  NH1   . ARG A  1 72  ? -45.734 -4.830  41.153 1.00 40.55  ? 72   ARG A NH1   1 
ATOM   316   N  NH2   . ARG A  1 72  ? -46.960 -6.720  41.518 1.00 42.72  ? 72   ARG A NH2   1 
ATOM   317   N  N     . GLU A  1 73  ? -41.248 -2.711  47.147 1.00 42.58  ? 73   GLU A N     1 
ATOM   318   C  CA    . GLU A  1 73  ? -40.566 -1.636  47.873 1.00 42.95  ? 73   GLU A CA    1 
ATOM   319   C  C     . GLU A  1 73  ? -39.035 -1.698  47.747 1.00 42.68  ? 73   GLU A C     1 
ATOM   320   O  O     . GLU A  1 73  ? -38.389 -0.660  47.584 1.00 42.70  ? 73   GLU A O     1 
ATOM   321   C  CB    . GLU A  1 73  ? -40.965 -1.654  49.345 1.00 43.37  ? 73   GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 73  ? -40.320 -0.555  50.202 1.00 46.21  ? 73   GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 73  ? -40.139 -0.975  51.673 1.00 50.97  ? 73   GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 73  ? -41.161 -1.171  52.383 1.00 51.90  ? 73   GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 73  ? -38.968 -1.108  52.117 1.00 53.08  ? 73   GLU A OE2   1 
ATOM   326   N  N     . ILE A  1 74  ? -38.457 -2.898  47.829 1.00 42.18  ? 74   ILE A N     1 
ATOM   327   C  CA    . ILE A  1 74  ? -37.002 -3.037  47.743 1.00 41.81  ? 74   ILE A CA    1 
ATOM   328   C  C     . ILE A  1 74  ? -36.546 -2.649  46.346 1.00 42.32  ? 74   ILE A C     1 
ATOM   329   O  O     . ILE A  1 74  ? -35.570 -1.922  46.186 1.00 42.26  ? 74   ILE A O     1 
ATOM   330   C  CB    . ILE A  1 74  ? -36.518 -4.466  48.087 1.00 41.32  ? 74   ILE A CB    1 
ATOM   331   C  CG1   . ILE A  1 74  ? -36.635 -4.725  49.585 1.00 41.17  ? 74   ILE A CG1   1 
ATOM   332   C  CG2   . ILE A  1 74  ? -35.082 -4.648  47.702 1.00 40.06  ? 74   ILE A CG2   1 
ATOM   333   C  CD1   . ILE A  1 74  ? -36.931 -6.164  49.953 1.00 40.73  ? 74   ILE A CD1   1 
ATOM   334   N  N     . ALA A  1 75  ? -37.284 -3.115  45.343 1.00 42.82  ? 75   ALA A N     1 
ATOM   335   C  CA    . ALA A  1 75  ? -36.946 -2.863  43.951 1.00 43.66  ? 75   ALA A CA    1 
ATOM   336   C  C     . ALA A  1 75  ? -37.035 -1.397  43.593 1.00 44.34  ? 75   ALA A C     1 
ATOM   337   O  O     . ALA A  1 75  ? -36.287 -0.923  42.747 1.00 44.19  ? 75   ALA A O     1 
ATOM   338   C  CB    . ALA A  1 75  ? -37.844 -3.662  43.052 1.00 43.77  ? 75   ALA A CB    1 
ATOM   339   N  N     . GLN A  1 76  ? -37.953 -0.690  44.250 1.00 45.51  ? 76   GLN A N     1 
ATOM   340   C  CA    . GLN A  1 76  ? -38.184 0.730   44.005 1.00 46.73  ? 76   GLN A CA    1 
ATOM   341   C  C     . GLN A  1 76  ? -36.924 1.519   44.301 1.00 47.22  ? 76   GLN A C     1 
ATOM   342   O  O     . GLN A  1 76  ? -36.699 2.563   43.693 1.00 47.88  ? 76   GLN A O     1 
ATOM   343   C  CB    . GLN A  1 76  ? -39.383 1.251   44.823 1.00 46.97  ? 76   GLN A CB    1 
ATOM   344   C  CG    . GLN A  1 76  ? -39.744 2.751   44.645 1.00 48.50  ? 76   GLN A CG    1 
ATOM   345   C  CD    . GLN A  1 76  ? -40.645 3.067   43.423 1.00 51.50  ? 76   GLN A CD    1 
ATOM   346   O  OE1   . GLN A  1 76  ? -40.783 2.267   42.489 1.00 52.37  ? 76   GLN A OE1   1 
ATOM   347   N  NE2   . GLN A  1 76  ? -41.250 4.255   43.437 1.00 51.85  ? 76   GLN A NE2   1 
ATOM   348   N  N     . ASP A  1 77  ? -36.092 1.015   45.210 1.00 47.72  ? 77   ASP A N     1 
ATOM   349   C  CA    . ASP A  1 77  ? -34.807 1.657   45.493 1.00 48.35  ? 77   ASP A CA    1 
ATOM   350   C  C     . ASP A  1 77  ? -33.853 1.559   44.307 1.00 47.96  ? 77   ASP A C     1 
ATOM   351   O  O     . ASP A  1 77  ? -33.011 2.421   44.135 1.00 48.15  ? 77   ASP A O     1 
ATOM   352   C  CB    . ASP A  1 77  ? -34.129 1.049   46.723 1.00 49.27  ? 77   ASP A CB    1 
ATOM   353   C  CG    . ASP A  1 77  ? -34.976 1.157   47.998 1.00 52.26  ? 77   ASP A CG    1 
ATOM   354   O  OD1   . ASP A  1 77  ? -35.103 0.126   48.713 1.00 54.60  ? 77   ASP A OD1   1 
ATOM   355   O  OD2   . ASP A  1 77  ? -35.508 2.260   48.286 1.00 54.74  ? 77   ASP A OD2   1 
ATOM   356   N  N     . PHE A  1 78  ? -33.969 0.520   43.490 1.00 47.50  ? 78   PHE A N     1 
ATOM   357   C  CA    . PHE A  1 78  ? -33.010 0.348   42.405 1.00 47.48  ? 78   PHE A CA    1 
ATOM   358   C  C     . PHE A  1 78  ? -33.499 0.939   41.101 1.00 47.83  ? 78   PHE A C     1 
ATOM   359   O  O     . PHE A  1 78  ? -32.699 1.346   40.261 1.00 47.96  ? 78   PHE A O     1 
ATOM   360   C  CB    . PHE A  1 78  ? -32.634 -1.118  42.216 1.00 47.07  ? 78   PHE A CB    1 
ATOM   361   C  CG    . PHE A  1 78  ? -32.223 -1.788  43.477 1.00 46.66  ? 78   PHE A CG    1 
ATOM   362   C  CD1   . PHE A  1 78  ? -32.879 -2.932  43.910 1.00 46.29  ? 78   PHE A CD1   1 
ATOM   363   C  CD2   . PHE A  1 78  ? -31.199 -1.257  44.257 1.00 45.94  ? 78   PHE A CD2   1 
ATOM   364   C  CE1   . PHE A  1 78  ? -32.506 -3.552  45.097 1.00 46.73  ? 78   PHE A CE1   1 
ATOM   365   C  CE2   . PHE A  1 78  ? -30.821 -1.866  45.445 1.00 46.16  ? 78   PHE A CE2   1 
ATOM   366   C  CZ    . PHE A  1 78  ? -31.468 -3.018  45.867 1.00 46.26  ? 78   PHE A CZ    1 
ATOM   367   N  N     . LYS A  1 79  ? -34.814 0.967   40.932 1.00 48.19  ? 79   LYS A N     1 
ATOM   368   C  CA    . LYS A  1 79  ? -35.425 1.544   39.753 1.00 48.46  ? 79   LYS A CA    1 
ATOM   369   C  C     . LYS A  1 79  ? -36.883 1.819   40.042 1.00 48.55  ? 79   LYS A C     1 
ATOM   370   O  O     . LYS A  1 79  ? -37.615 0.939   40.498 1.00 48.89  ? 79   LYS A O     1 
ATOM   371   C  CB    . LYS A  1 79  ? -35.284 0.611   38.559 1.00 48.43  ? 79   LYS A CB    1 
ATOM   372   C  CG    . LYS A  1 79  ? -35.676 1.254   37.252 1.00 49.92  ? 79   LYS A CG    1 
ATOM   373   C  CD    . LYS A  1 79  ? -35.540 0.277   36.091 1.00 53.09  ? 79   LYS A CD    1 
ATOM   374   C  CE    . LYS A  1 79  ? -36.178 0.818   34.808 1.00 55.11  ? 79   LYS A CE    1 
ATOM   375   N  NZ    . LYS A  1 79  ? -35.823 2.257   34.556 1.00 56.57  ? 79   LYS A NZ    1 
ATOM   376   N  N     . THR A  1 80  ? -37.297 3.053   39.781 1.00 48.64  ? 80   THR A N     1 
ATOM   377   C  CA    . THR A  1 80  ? -38.679 3.475   39.980 1.00 48.53  ? 80   THR A CA    1 
ATOM   378   C  C     . THR A  1 80  ? -39.572 2.979   38.844 1.00 48.61  ? 80   THR A C     1 
ATOM   379   O  O     . THR A  1 80  ? -39.091 2.710   37.736 1.00 48.39  ? 80   THR A O     1 
ATOM   380   C  CB    . THR A  1 80  ? -38.774 4.993   40.015 1.00 48.54  ? 80   THR A CB    1 
ATOM   381   O  OG1   . THR A  1 80  ? -38.394 5.509   38.738 1.00 48.95  ? 80   THR A OG1   1 
ATOM   382   C  CG2   . THR A  1 80  ? -37.851 5.580   41.080 1.00 48.32  ? 80   THR A CG2   1 
ATOM   383   N  N     . ASP A  1 81  ? -40.869 2.852   39.135 1.00 48.87  ? 81   ASP A N     1 
ATOM   384   C  CA    . ASP A  1 81  ? -41.891 2.538   38.123 1.00 48.87  ? 81   ASP A CA    1 
ATOM   385   C  C     . ASP A  1 81  ? -41.782 1.108   37.565 1.00 48.35  ? 81   ASP A C     1 
ATOM   386   O  O     . ASP A  1 81  ? -41.905 0.884   36.363 1.00 48.71  ? 81   ASP A O     1 
ATOM   387   C  CB    . ASP A  1 81  ? -41.819 3.576   36.988 1.00 49.31  ? 81   ASP A CB    1 
ATOM   388   C  CG    . ASP A  1 81  ? -43.098 3.653   36.159 1.00 50.79  ? 81   ASP A CG    1 
ATOM   389   O  OD1   . ASP A  1 81  ? -44.155 3.138   36.614 1.00 52.28  ? 81   ASP A OD1   1 
ATOM   390   O  OD2   . ASP A  1 81  ? -43.035 4.247   35.048 1.00 51.52  ? 81   ASP A OD2   1 
ATOM   391   N  N     . LEU A  1 82  ? -41.550 0.132   38.433 1.00 47.37  ? 82   LEU A N     1 
ATOM   392   C  CA    . LEU A  1 82  ? -41.364 -1.221  37.953 1.00 46.15  ? 82   LEU A CA    1 
ATOM   393   C  C     . LEU A  1 82  ? -42.658 -1.994  37.908 1.00 45.70  ? 82   LEU A C     1 
ATOM   394   O  O     . LEU A  1 82  ? -43.634 -1.631  38.552 1.00 45.77  ? 82   LEU A O     1 
ATOM   395   C  CB    . LEU A  1 82  ? -40.324 -1.953  38.788 1.00 46.04  ? 82   LEU A CB    1 
ATOM   396   C  CG    . LEU A  1 82  ? -38.902 -1.546  38.410 1.00 45.92  ? 82   LEU A CG    1 
ATOM   397   C  CD1   . LEU A  1 82  ? -37.921 -1.983  39.471 1.00 46.12  ? 82   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A  1 82  ? -38.533 -2.138  37.064 1.00 45.87  ? 82   LEU A CD2   1 
ATOM   399   N  N     . ARG A  1 83  ? -42.660 -3.050  37.108 1.00 44.85  ? 83   ARG A N     1 
ATOM   400   C  CA    . ARG A  1 83  ? -43.748 -4.002  37.074 1.00 43.97  ? 83   ARG A CA    1 
ATOM   401   C  C     . ARG A  1 83  ? -43.112 -5.376  37.161 1.00 42.99  ? 83   ARG A C     1 
ATOM   402   O  O     . ARG A  1 83  ? -41.954 -5.531  36.770 1.00 43.06  ? 83   ARG A O     1 
ATOM   403   C  CB    . ARG A  1 83  ? -44.533 -3.859  35.775 1.00 44.45  ? 83   ARG A CB    1 
ATOM   404   C  CG    . ARG A  1 83  ? -45.396 -2.611  35.711 1.00 45.69  ? 83   ARG A CG    1 
ATOM   405   C  CD    . ARG A  1 83  ? -46.024 -2.423  34.337 1.00 48.18  ? 83   ARG A CD    1 
ATOM   406   N  NE    . ARG A  1 83  ? -47.266 -1.661  34.445 1.00 51.18  ? 83   ARG A NE    1 
ATOM   407   C  CZ    . ARG A  1 83  ? -48.474 -2.118  34.110 1.00 51.93  ? 83   ARG A CZ    1 
ATOM   408   N  NH1   . ARG A  1 83  ? -48.633 -3.338  33.598 1.00 51.50  ? 83   ARG A NH1   1 
ATOM   409   N  NH2   . ARG A  1 83  ? -49.533 -1.338  34.276 1.00 52.38  ? 83   ARG A NH2   1 
ATOM   410   N  N     . PHE A  1 84  ? -43.863 -6.362  37.654 1.00 41.33  ? 84   PHE A N     1 
ATOM   411   C  CA    . PHE A  1 84  ? -43.326 -7.691  37.940 1.00 39.93  ? 84   PHE A CA    1 
ATOM   412   C  C     . PHE A  1 84  ? -44.216 -8.761  37.366 1.00 39.24  ? 84   PHE A C     1 
ATOM   413   O  O     . PHE A  1 84  ? -45.385 -8.817  37.734 1.00 39.62  ? 84   PHE A O     1 
ATOM   414   C  CB    . PHE A  1 84  ? -43.277 -7.907  39.462 1.00 39.68  ? 84   PHE A CB    1 
ATOM   415   C  CG    . PHE A  1 84  ? -42.034 -7.384  40.112 1.00 39.15  ? 84   PHE A CG    1 
ATOM   416   C  CD1   . PHE A  1 84  ? -41.917 -6.033  40.444 1.00 38.57  ? 84   PHE A CD1   1 
ATOM   417   C  CD2   . PHE A  1 84  ? -40.971 -8.236  40.384 1.00 37.74  ? 84   PHE A CD2   1 
ATOM   418   C  CE1   . PHE A  1 84  ? -40.753 -5.542  41.027 1.00 37.43  ? 84   PHE A CE1   1 
ATOM   419   C  CE2   . PHE A  1 84  ? -39.809 -7.756  40.966 1.00 37.12  ? 84   PHE A CE2   1 
ATOM   420   C  CZ    . PHE A  1 84  ? -39.700 -6.408  41.286 1.00 38.00  ? 84   PHE A CZ    1 
ATOM   421   N  N     . GLN A  1 85  ? -43.702 -9.636  36.507 1.00 37.94  ? 85   GLN A N     1 
ATOM   422   C  CA    . GLN A  1 85  ? -44.512 -10.793 36.145 1.00 37.54  ? 85   GLN A CA    1 
ATOM   423   C  C     . GLN A  1 85  ? -44.894 -11.470 37.446 1.00 37.67  ? 85   GLN A C     1 
ATOM   424   O  O     . GLN A  1 85  ? -44.095 -11.502 38.380 1.00 37.93  ? 85   GLN A O     1 
ATOM   425   C  CB    . GLN A  1 85  ? -43.761 -11.791 35.281 1.00 37.27  ? 85   GLN A CB    1 
ATOM   426   C  CG    . GLN A  1 85  ? -43.158 -11.203 34.043 1.00 37.31  ? 85   GLN A CG    1 
ATOM   427   C  CD    . GLN A  1 85  ? -42.839 -12.241 33.000 1.00 36.19  ? 85   GLN A CD    1 
ATOM   428   O  OE1   . GLN A  1 85  ? -42.453 -13.366 33.312 1.00 36.67  ? 85   GLN A OE1   1 
ATOM   429   N  NE2   . GLN A  1 85  ? -43.000 -11.868 31.746 1.00 36.06  ? 85   GLN A NE2   1 
ATOM   430   N  N     . SER A  1 86  ? -46.105 -12.008 37.528 1.00 37.37  ? 86   SER A N     1 
ATOM   431   C  CA    . SER A  1 86  ? -46.512 -12.666 38.754 1.00 37.20  ? 86   SER A CA    1 
ATOM   432   C  C     . SER A  1 86  ? -45.626 -13.886 39.028 1.00 37.04  ? 86   SER A C     1 
ATOM   433   O  O     . SER A  1 86  ? -45.375 -14.230 40.176 1.00 37.71  ? 86   SER A O     1 
ATOM   434   C  CB    . SER A  1 86  ? -47.979 -13.058 38.710 1.00 36.92  ? 86   SER A CB    1 
ATOM   435   O  OG    . SER A  1 86  ? -48.117 -14.361 38.195 1.00 37.97  ? 86   SER A OG    1 
ATOM   436   N  N     . SER A  1 87  ? -45.144 -14.537 37.979 1.00 36.73  ? 87   SER A N     1 
ATOM   437   C  CA    . SER A  1 87  ? -44.250 -15.672 38.159 1.00 36.50  ? 87   SER A CA    1 
ATOM   438   C  C     . SER A  1 87  ? -42.865 -15.212 38.664 1.00 36.13  ? 87   SER A C     1 
ATOM   439   O  O     . SER A  1 87  ? -42.183 -15.960 39.371 1.00 35.88  ? 87   SER A O     1 
ATOM   440   C  CB    . SER A  1 87  ? -44.102 -16.430 36.860 1.00 36.31  ? 87   SER A CB    1 
ATOM   441   O  OG    . SER A  1 87  ? -43.460 -15.597 35.915 1.00 38.64  ? 87   SER A OG    1 
ATOM   442   N  N     . ALA A  1 88  ? -42.463 -13.988 38.308 1.00 35.27  ? 88   ALA A N     1 
ATOM   443   C  CA    . ALA A  1 88  ? -41.263 -13.385 38.884 1.00 34.55  ? 88   ALA A CA    1 
ATOM   444   C  C     . ALA A  1 88  ? -41.361 -13.269 40.405 1.00 34.37  ? 88   ALA A C     1 
ATOM   445   O  O     . ALA A  1 88  ? -40.398 -13.560 41.119 1.00 34.30  ? 88   ALA A O     1 
ATOM   446   C  CB    . ALA A  1 88  ? -40.996 -12.036 38.280 1.00 34.08  ? 88   ALA A CB    1 
ATOM   447   N  N     . VAL A  1 89  ? -42.519 -12.843 40.905 1.00 34.24  ? 89   VAL A N     1 
ATOM   448   C  CA    . VAL A  1 89  ? -42.681 -12.697 42.340 1.00 34.03  ? 89   VAL A CA    1 
ATOM   449   C  C     . VAL A  1 89  ? -42.747 -14.054 43.004 1.00 34.29  ? 89   VAL A C     1 
ATOM   450   O  O     . VAL A  1 89  ? -42.285 -14.208 44.122 1.00 33.97  ? 89   VAL A O     1 
ATOM   451   C  CB    . VAL A  1 89  ? -43.894 -11.861 42.738 1.00 33.98  ? 89   VAL A CB    1 
ATOM   452   C  CG1   . VAL A  1 89  ? -43.989 -11.789 44.268 1.00 33.80  ? 89   VAL A CG1   1 
ATOM   453   C  CG2   . VAL A  1 89  ? -43.771 -10.470 42.180 1.00 33.65  ? 89   VAL A CG2   1 
ATOM   454   N  N     . MET A  1 90  ? -43.297 -15.039 42.307 1.00 34.72  ? 90   MET A N     1 
ATOM   455   C  CA    . MET A  1 90  ? -43.340 -16.389 42.839 1.00 35.87  ? 90   MET A CA    1 
ATOM   456   C  C     . MET A  1 90  ? -41.951 -17.005 42.958 1.00 35.73  ? 90   MET A C     1 
ATOM   457   O  O     . MET A  1 90  ? -41.659 -17.681 43.934 1.00 36.26  ? 90   MET A O     1 
ATOM   458   C  CB    . MET A  1 90  ? -44.255 -17.272 41.999 1.00 36.64  ? 90   MET A CB    1 
ATOM   459   C  CG    . MET A  1 90  ? -45.717 -16.979 42.228 1.00 40.49  ? 90   MET A CG    1 
ATOM   460   S  SD    . MET A  1 90  ? -46.104 -17.043 44.005 1.00 50.37  ? 90   MET A SD    1 
ATOM   461   C  CE    . MET A  1 90  ? -46.351 -18.814 44.243 1.00 48.43  ? 90   MET A CE    1 
ATOM   462   N  N     . ALA A  1 91  ? -41.093 -16.765 41.969 1.00 35.34  ? 91   ALA A N     1 
ATOM   463   C  CA    . ALA A  1 91  ? -39.718 -17.242 42.013 1.00 34.60  ? 91   ALA A CA    1 
ATOM   464   C  C     . ALA A  1 91  ? -38.982 -16.708 43.244 1.00 34.40  ? 91   ALA A C     1 
ATOM   465   O  O     . ALA A  1 91  ? -38.374 -17.479 43.989 1.00 34.27  ? 91   ALA A O     1 
ATOM   466   C  CB    . ALA A  1 91  ? -38.989 -16.864 40.752 1.00 34.37  ? 91   ALA A CB    1 
ATOM   467   N  N     . LEU A  1 92  ? -39.055 -15.400 43.474 1.00 33.88  ? 92   LEU A N     1 
ATOM   468   C  CA    . LEU A  1 92  ? -38.435 -14.830 44.670 1.00 33.84  ? 92   LEU A CA    1 
ATOM   469   C  C     . LEU A  1 92  ? -38.929 -15.505 45.954 1.00 33.73  ? 92   LEU A C     1 
ATOM   470   O  O     . LEU A  1 92  ? -38.138 -15.812 46.836 1.00 33.91  ? 92   LEU A O     1 
ATOM   471   C  CB    . LEU A  1 92  ? -38.641 -13.309 44.751 1.00 33.52  ? 92   LEU A CB    1 
ATOM   472   C  CG    . LEU A  1 92  ? -37.908 -12.455 43.713 1.00 33.07  ? 92   LEU A CG    1 
ATOM   473   C  CD1   . LEU A  1 92  ? -38.433 -11.054 43.729 1.00 33.55  ? 92   LEU A CD1   1 
ATOM   474   C  CD2   . LEU A  1 92  ? -36.403 -12.446 43.915 1.00 31.47  ? 92   LEU A CD2   1 
ATOM   475   N  N     . GLN A  1 93  ? -40.228 -15.764 46.057 1.00 33.48  ? 93   GLN A N     1 
ATOM   476   C  CA    . GLN A  1 93  ? -40.731 -16.354 47.283 1.00 33.27  ? 93   GLN A CA    1 
ATOM   477   C  C     . GLN A  1 93  ? -40.182 -17.747 47.492 1.00 32.73  ? 93   GLN A C     1 
ATOM   478   O  O     . GLN A  1 93  ? -39.706 -18.064 48.578 1.00 32.47  ? 93   GLN A O     1 
ATOM   479   C  CB    . GLN A  1 93  ? -42.251 -16.328 47.380 1.00 33.37  ? 93   GLN A CB    1 
ATOM   480   C  CG    . GLN A  1 93  ? -42.663 -16.051 48.803 1.00 34.68  ? 93   GLN A CG    1 
ATOM   481   C  CD    . GLN A  1 93  ? -44.145 -16.013 49.006 1.00 36.81  ? 93   GLN A CD    1 
ATOM   482   O  OE1   . GLN A  1 93  ? -44.835 -15.121 48.505 1.00 38.17  ? 93   GLN A OE1   1 
ATOM   483   N  NE2   . GLN A  1 93  ? -44.654 -16.976 49.767 1.00 37.05  ? 93   GLN A NE2   1 
ATOM   484   N  N     . GLU A  1 94  ? -40.213 -18.566 46.450 1.00 32.10  ? 94   GLU A N     1 
ATOM   485   C  CA    . GLU A  1 94  ? -39.639 -19.894 46.540 1.00 32.30  ? 94   GLU A CA    1 
ATOM   486   C  C     . GLU A  1 94  ? -38.169 -19.852 46.973 1.00 31.97  ? 94   GLU A C     1 
ATOM   487   O  O     . GLU A  1 94  ? -37.757 -20.569 47.889 1.00 31.89  ? 94   GLU A O     1 
ATOM   488   C  CB    . GLU A  1 94  ? -39.779 -20.617 45.220 1.00 32.49  ? 94   GLU A CB    1 
ATOM   489   C  CG    . GLU A  1 94  ? -41.220 -20.907 44.830 1.00 35.04  ? 94   GLU A CG    1 
ATOM   490   C  CD    . GLU A  1 94  ? -41.769 -22.213 45.410 1.00 38.59  ? 94   GLU A CD    1 
ATOM   491   O  OE1   . GLU A  1 94  ? -43.018 -22.351 45.394 1.00 39.82  ? 94   GLU A OE1   1 
ATOM   492   O  OE2   . GLU A  1 94  ? -40.974 -23.092 45.859 1.00 38.72  ? 94   GLU A OE2   1 
ATOM   493   N  N     . ALA A  1 95  ? -37.393 -18.985 46.336 1.00 31.20  ? 95   ALA A N     1 
ATOM   494   C  CA    . ALA A  1 95  ? -35.990 -18.876 46.636 1.00 30.72  ? 95   ALA A CA    1 
ATOM   495   C  C     . ALA A  1 95  ? -35.750 -18.379 48.064 1.00 30.81  ? 95   ALA A C     1 
ATOM   496   O  O     . ALA A  1 95  ? -34.890 -18.917 48.776 1.00 30.97  ? 95   ALA A O     1 
ATOM   497   C  CB    . ALA A  1 95  ? -35.317 -17.989 45.632 1.00 30.52  ? 95   ALA A CB    1 
ATOM   498   N  N     . SER A  1 96  ? -36.515 -17.373 48.484 1.00 30.33  ? 96   SER A N     1 
ATOM   499   C  CA    . SER A  1 96  ? -36.396 -16.822 49.824 1.00 30.30  ? 96   SER A CA    1 
ATOM   500   C  C     . SER A  1 96  ? -36.732 -17.857 50.878 1.00 30.44  ? 96   SER A C     1 
ATOM   501   O  O     . SER A  1 96  ? -36.007 -18.035 51.844 1.00 30.82  ? 96   SER A O     1 
ATOM   502   C  CB    . SER A  1 96  ? -37.337 -15.640 49.990 1.00 30.27  ? 96   SER A CB    1 
ATOM   503   O  OG    . SER A  1 96  ? -36.993 -14.608 49.099 1.00 30.55  ? 96   SER A OG    1 
ATOM   504   N  N     . GLU A  1 97  ? -37.847 -18.540 50.698 1.00 30.71  ? 97   GLU A N     1 
ATOM   505   C  CA    . GLU A  1 97  ? -38.272 -19.517 51.677 1.00 31.33  ? 97   GLU A CA    1 
ATOM   506   C  C     . GLU A  1 97  ? -37.263 -20.660 51.754 1.00 30.31  ? 97   GLU A C     1 
ATOM   507   O  O     . GLU A  1 97  ? -36.834 -21.019 52.845 1.00 31.12  ? 97   GLU A O     1 
ATOM   508   C  CB    . GLU A  1 97  ? -39.708 -19.987 51.418 1.00 30.72  ? 97   GLU A CB    1 
ATOM   509   C  CG    . GLU A  1 97  ? -40.723 -18.835 51.537 1.00 32.85  ? 97   GLU A CG    1 
ATOM   510   C  CD    . GLU A  1 97  ? -42.163 -19.299 51.849 1.00 34.31  ? 97   GLU A CD    1 
ATOM   511   O  OE1   . GLU A  1 97  ? -42.388 -20.529 52.037 1.00 37.96  ? 97   GLU A OE1   1 
ATOM   512   O  OE2   . GLU A  1 97  ? -43.073 -18.427 51.917 1.00 37.35  ? 97   GLU A OE2   1 
ATOM   513   N  N     . ALA A  1 98  ? -36.830 -21.188 50.613 1.00 29.20  ? 98   ALA A N     1 
ATOM   514   C  CA    . ALA A  1 98  ? -35.827 -22.256 50.628 1.00 28.09  ? 98   ALA A CA    1 
ATOM   515   C  C     . ALA A  1 98  ? -34.536 -21.789 51.297 1.00 27.58  ? 98   ALA A C     1 
ATOM   516   O  O     . ALA A  1 98  ? -33.854 -22.578 51.960 1.00 27.53  ? 98   ALA A O     1 
ATOM   517   C  CB    . ALA A  1 98  ? -35.551 -22.754 49.242 1.00 28.18  ? 98   ALA A CB    1 
ATOM   518   N  N     . TYR A  1 99  ? -34.223 -20.503 51.141 1.00 26.50  ? 99   TYR A N     1 
ATOM   519   C  CA    . TYR A  1 99  ? -33.060 -19.939 51.777 1.00 25.43  ? 99   TYR A CA    1 
ATOM   520   C  C     . TYR A  1 99  ? -33.239 -19.882 53.275 1.00 25.57  ? 99   TYR A C     1 
ATOM   521   O  O     . TYR A  1 99  ? -32.356 -20.351 54.001 1.00 26.47  ? 99   TYR A O     1 
ATOM   522   C  CB    . TYR A  1 99  ? -32.735 -18.558 51.233 1.00 25.10  ? 99   TYR A CB    1 
ATOM   523   C  CG    . TYR A  1 99  ? -31.681 -17.822 52.023 1.00 24.36  ? 99   TYR A CG    1 
ATOM   524   C  CD1   . TYR A  1 99  ? -30.341 -18.171 51.926 1.00 24.57  ? 99   TYR A CD1   1 
ATOM   525   C  CD2   . TYR A  1 99  ? -32.024 -16.775 52.860 1.00 23.54  ? 99   TYR A CD2   1 
ATOM   526   C  CE1   . TYR A  1 99  ? -29.368 -17.494 52.647 1.00 23.94  ? 99   TYR A CE1   1 
ATOM   527   C  CE2   . TYR A  1 99  ? -31.073 -16.095 53.578 1.00 23.58  ? 99   TYR A CE2   1 
ATOM   528   C  CZ    . TYR A  1 99  ? -29.741 -16.457 53.470 1.00 24.73  ? 99   TYR A CZ    1 
ATOM   529   O  OH    . TYR A  1 99  ? -28.782 -15.779 54.208 1.00 25.68  ? 99   TYR A OH    1 
ATOM   530   N  N     . LEU A  1 100 ? -34.348 -19.323 53.758 1.00 24.90  ? 100  LEU A N     1 
ATOM   531   C  CA    . LEU A  1 100 ? -34.483 -19.163 55.196 1.00 24.71  ? 100  LEU A CA    1 
ATOM   532   C  C     . LEU A  1 100 ? -34.620 -20.511 55.862 1.00 25.09  ? 100  LEU A C     1 
ATOM   533   O  O     . LEU A  1 100 ? -33.997 -20.748 56.902 1.00 25.12  ? 100  LEU A O     1 
ATOM   534   C  CB    . LEU A  1 100 ? -35.640 -18.259 55.573 1.00 24.68  ? 100  LEU A CB    1 
ATOM   535   C  CG    . LEU A  1 100 ? -35.503 -16.750 55.340 1.00 24.85  ? 100  LEU A CG    1 
ATOM   536   C  CD1   . LEU A  1 100 ? -36.793 -16.076 55.779 1.00 24.46  ? 100  LEU A CD1   1 
ATOM   537   C  CD2   . LEU A  1 100 ? -34.301 -16.119 56.059 1.00 23.13  ? 100  LEU A CD2   1 
ATOM   538   N  N     . VAL A  1 101 ? -35.390 -21.414 55.240 1.00 25.04  ? 101  VAL A N     1 
ATOM   539   C  CA    . VAL A  1 101 ? -35.576 -22.773 55.767 1.00 24.87  ? 101  VAL A CA    1 
ATOM   540   C  C     . VAL A  1 101 ? -34.250 -23.514 55.978 1.00 25.02  ? 101  VAL A C     1 
ATOM   541   O  O     . VAL A  1 101 ? -34.066 -24.180 57.000 1.00 25.30  ? 101  VAL A O     1 
ATOM   542   C  CB    . VAL A  1 101 ? -36.528 -23.617 54.898 1.00 25.03  ? 101  VAL A CB    1 
ATOM   543   C  CG1   . VAL A  1 101 ? -36.409 -25.108 55.231 1.00 24.81  ? 101  VAL A CG1   1 
ATOM   544   C  CG2   . VAL A  1 101 ? -37.964 -23.164 55.084 1.00 25.06  ? 101  VAL A CG2   1 
ATOM   545   N  N     . ALA A  1 102 ? -33.326 -23.399 55.025 1.00 24.84  ? 102  ALA A N     1 
ATOM   546   C  CA    . ALA A  1 102 ? -32.003 -24.028 55.174 1.00 24.53  ? 102  ALA A CA    1 
ATOM   547   C  C     . ALA A  1 102 ? -31.116 -23.312 56.205 1.00 24.77  ? 102  ALA A C     1 
ATOM   548   O  O     . ALA A  1 102 ? -30.395 -23.960 56.966 1.00 25.08  ? 102  ALA A O     1 
ATOM   549   C  CB    . ALA A  1 102 ? -31.317 -24.115 53.864 1.00 23.98  ? 102  ALA A CB    1 
ATOM   550   N  N     . LEU A  1 103 ? -31.175 -21.984 56.245 1.00 24.50  ? 103  LEU A N     1 
ATOM   551   C  CA    . LEU A  1 103 ? -30.487 -21.244 57.286 1.00 24.57  ? 103  LEU A CA    1 
ATOM   552   C  C     . LEU A  1 103 ? -30.944 -21.684 58.682 1.00 25.69  ? 103  LEU A C     1 
ATOM   553   O  O     . LEU A  1 103 ? -30.128 -21.776 59.604 1.00 26.11  ? 103  LEU A O     1 
ATOM   554   C  CB    . LEU A  1 103 ? -30.708 -19.746 57.117 1.00 24.17  ? 103  LEU A CB    1 
ATOM   555   C  CG    . LEU A  1 103 ? -29.907 -18.830 58.035 1.00 22.07  ? 103  LEU A CG    1 
ATOM   556   C  CD1   . LEU A  1 103 ? -28.422 -19.056 57.809 1.00 21.63  ? 103  LEU A CD1   1 
ATOM   557   C  CD2   . LEU A  1 103 ? -30.287 -17.393 57.791 1.00 17.84  ? 103  LEU A CD2   1 
ATOM   558   N  N     . PHE A  1 104 ? -32.242 -21.956 58.838 1.00 26.31  ? 104  PHE A N     1 
ATOM   559   C  CA    . PHE A  1 104 ? -32.755 -22.455 60.110 1.00 26.38  ? 104  PHE A CA    1 
ATOM   560   C  C     . PHE A  1 104 ? -32.223 -23.833 60.448 1.00 27.33  ? 104  PHE A C     1 
ATOM   561   O  O     . PHE A  1 104 ? -31.912 -24.092 61.594 1.00 27.68  ? 104  PHE A O     1 
ATOM   562   C  CB    . PHE A  1 104 ? -34.281 -22.413 60.173 1.00 25.86  ? 104  PHE A CB    1 
ATOM   563   C  CG    . PHE A  1 104 ? -34.831 -21.046 60.446 1.00 24.18  ? 104  PHE A CG    1 
ATOM   564   C  CD1   . PHE A  1 104 ? -35.781 -20.489 59.605 1.00 23.59  ? 104  PHE A CD1   1 
ATOM   565   C  CD2   . PHE A  1 104 ? -34.381 -20.310 61.532 1.00 22.31  ? 104  PHE A CD2   1 
ATOM   566   C  CE1   . PHE A  1 104 ? -36.275 -19.216 59.847 1.00 23.62  ? 104  PHE A CE1   1 
ATOM   567   C  CE2   . PHE A  1 104 ? -34.854 -19.058 61.787 1.00 22.20  ? 104  PHE A CE2   1 
ATOM   568   C  CZ    . PHE A  1 104 ? -35.804 -18.496 60.941 1.00 24.61  ? 104  PHE A CZ    1 
ATOM   569   N  N     . GLU A  1 105 ? -32.099 -24.714 59.463 1.00 28.41  ? 105  GLU A N     1 
ATOM   570   C  CA    . GLU A  1 105 ? -31.443 -25.992 59.710 1.00 29.94  ? 105  GLU A CA    1 
ATOM   571   C  C     . GLU A  1 105 ? -30.079 -25.720 60.322 1.00 29.93  ? 105  GLU A C     1 
ATOM   572   O  O     . GLU A  1 105 ? -29.766 -26.288 61.358 1.00 30.67  ? 105  GLU A O     1 
ATOM   573   C  CB    . GLU A  1 105 ? -31.308 -26.836 58.439 1.00 29.37  ? 105  GLU A CB    1 
ATOM   574   C  CG    . GLU A  1 105 ? -32.618 -27.439 57.966 1.00 31.82  ? 105  GLU A CG    1 
ATOM   575   C  CD    . GLU A  1 105 ? -32.632 -27.917 56.488 1.00 32.88  ? 105  GLU A CD    1 
ATOM   576   O  OE1   . GLU A  1 105 ? -31.622 -28.507 56.015 1.00 36.25  ? 105  GLU A OE1   1 
ATOM   577   O  OE2   . GLU A  1 105 ? -33.685 -27.729 55.811 1.00 35.55  ? 105  GLU A OE2   1 
ATOM   578   N  N     . ASP A  1 106 ? -29.292 -24.826 59.716 1.00 29.94  ? 106  ASP A N     1 
ATOM   579   C  CA    . ASP A  1 106 ? -27.897 -24.605 60.135 1.00 30.24  ? 106  ASP A CA    1 
ATOM   580   C  C     . ASP A  1 106 ? -27.814 -23.931 61.509 1.00 29.78  ? 106  ASP A C     1 
ATOM   581   O  O     . ASP A  1 106 ? -27.005 -24.303 62.376 1.00 29.21  ? 106  ASP A O     1 
ATOM   582   C  CB    . ASP A  1 106 ? -27.144 -23.753 59.099 1.00 30.77  ? 106  ASP A CB    1 
ATOM   583   C  CG    . ASP A  1 106 ? -26.766 -24.530 57.823 1.00 33.32  ? 106  ASP A CG    1 
ATOM   584   O  OD1   . ASP A  1 106 ? -26.970 -25.773 57.766 1.00 36.80  ? 106  ASP A OD1   1 
ATOM   585   O  OD2   . ASP A  1 106 ? -26.255 -23.882 56.863 1.00 35.49  ? 106  ASP A OD2   1 
ATOM   586   N  N     . THR A  1 107 ? -28.665 -22.926 61.683 1.00 29.31  ? 107  THR A N     1 
ATOM   587   C  CA    . THR A  1 107 ? -28.861 -22.264 62.951 1.00 28.75  ? 107  THR A CA    1 
ATOM   588   C  C     . THR A  1 107 ? -29.211 -23.271 64.047 1.00 28.54  ? 107  THR A C     1 
ATOM   589   O  O     . THR A  1 107 ? -28.681 -23.211 65.157 1.00 28.22  ? 107  THR A O     1 
ATOM   590   C  CB    . THR A  1 107 ? -29.944 -21.194 62.800 1.00 28.92  ? 107  THR A CB    1 
ATOM   591   O  OG1   . THR A  1 107 ? -29.459 -20.179 61.909 1.00 29.20  ? 107  THR A OG1   1 
ATOM   592   C  CG2   . THR A  1 107 ? -30.290 -20.558 64.125 1.00 28.28  ? 107  THR A CG2   1 
ATOM   593   N  N     . ASN A  1 108 ? -30.078 -24.226 63.732 1.00 28.32  ? 108  ASN A N     1 
ATOM   594   C  CA    . ASN A  1 108 ? -30.430 -25.212 64.725 1.00 27.96  ? 108  ASN A CA    1 
ATOM   595   C  C     . ASN A  1 108 ? -29.231 -26.020 65.159 1.00 27.77  ? 108  ASN A C     1 
ATOM   596   O  O     . ASN A  1 108 ? -29.042 -26.270 66.356 1.00 27.75  ? 108  ASN A O     1 
ATOM   597   C  CB    . ASN A  1 108 ? -31.531 -26.125 64.244 1.00 28.02  ? 108  ASN A CB    1 
ATOM   598   C  CG    . ASN A  1 108 ? -32.378 -26.611 65.377 1.00 29.05  ? 108  ASN A CG    1 
ATOM   599   O  OD1   . ASN A  1 108 ? -32.601 -25.878 66.342 1.00 31.84  ? 108  ASN A OD1   1 
ATOM   600   N  ND2   . ASN A  1 108 ? -32.838 -27.846 65.295 1.00 28.56  ? 108  ASN A ND2   1 
ATOM   601   N  N     . LEU A  1 109 ? -28.408 -26.404 64.185 1.00 27.48  ? 109  LEU A N     1 
ATOM   602   C  CA    . LEU A  1 109 ? -27.148 -27.080 64.476 1.00 27.27  ? 109  LEU A CA    1 
ATOM   603   C  C     . LEU A  1 109 ? -26.225 -26.269 65.403 1.00 27.38  ? 109  LEU A C     1 
ATOM   604   O  O     . LEU A  1 109 ? -25.601 -26.832 66.305 1.00 27.32  ? 109  LEU A O     1 
ATOM   605   C  CB    . LEU A  1 109 ? -26.442 -27.497 63.192 1.00 26.76  ? 109  LEU A CB    1 
ATOM   606   C  CG    . LEU A  1 109 ? -27.155 -28.635 62.450 1.00 26.68  ? 109  LEU A CG    1 
ATOM   607   C  CD1   . LEU A  1 109 ? -26.526 -28.864 61.101 1.00 26.52  ? 109  LEU A CD1   1 
ATOM   608   C  CD2   . LEU A  1 109 ? -27.180 -29.946 63.235 1.00 25.20  ? 109  LEU A CD2   1 
ATOM   609   N  N     . CYS A  1 110 ? -26.182 -24.954 65.208 1.00 27.33  ? 110  CYS A N     1 
ATOM   610   C  CA    . CYS A  1 110 ? -25.375 -24.088 66.053 1.00 27.79  ? 110  CYS A CA    1 
ATOM   611   C  C     . CYS A  1 110 ? -25.872 -23.967 67.486 1.00 28.00  ? 110  CYS A C     1 
ATOM   612   O  O     . CYS A  1 110 ? -25.059 -23.969 68.421 1.00 28.59  ? 110  CYS A O     1 
ATOM   613   C  CB    . CYS A  1 110 ? -25.221 -22.725 65.416 1.00 27.50  ? 110  CYS A CB    1 
ATOM   614   S  SG    . CYS A  1 110 ? -24.328 -22.911 63.878 1.00 29.74  ? 110  CYS A SG    1 
ATOM   615   N  N     . ALA A  1 111 ? -27.192 -23.882 67.663 1.00 27.80  ? 111  ALA A N     1 
ATOM   616   C  CA    . ALA A  1 111 ? -27.795 -23.921 68.989 1.00 27.23  ? 111  ALA A CA    1 
ATOM   617   C  C     . ALA A  1 111 ? -27.531 -25.255 69.666 1.00 27.18  ? 111  ALA A C     1 
ATOM   618   O  O     . ALA A  1 111 ? -27.140 -25.298 70.821 1.00 27.71  ? 111  ALA A O     1 
ATOM   619   C  CB    . ALA A  1 111 ? -29.273 -23.647 68.916 1.00 27.15  ? 111  ALA A CB    1 
ATOM   620   N  N     . ILE A  1 112 ? -27.726 -26.347 68.948 1.00 27.12  ? 112  ILE A N     1 
ATOM   621   C  CA    . ILE A  1 112 ? -27.536 -27.643 69.542 1.00 27.36  ? 112  ILE A CA    1 
ATOM   622   C  C     . ILE A  1 112 ? -26.078 -27.825 69.912 1.00 28.29  ? 112  ILE A C     1 
ATOM   623   O  O     . ILE A  1 112 ? -25.755 -28.510 70.886 1.00 29.28  ? 112  ILE A O     1 
ATOM   624   C  CB    . ILE A  1 112 ? -28.008 -28.746 68.610 1.00 27.42  ? 112  ILE A CB    1 
ATOM   625   C  CG1   . ILE A  1 112 ? -29.534 -28.750 68.555 1.00 27.62  ? 112  ILE A CG1   1 
ATOM   626   C  CG2   . ILE A  1 112 ? -27.509 -30.111 69.069 1.00 26.65  ? 112  ILE A CG2   1 
ATOM   627   C  CD1   . ILE A  1 112 ? -30.091 -29.612 67.462 1.00 28.59  ? 112  ILE A CD1   1 
ATOM   628   N  N     . HIS A  1 113 ? -25.190 -27.184 69.157 1.00 28.86  ? 113  HIS A N     1 
ATOM   629   C  CA    . HIS A  1 113 ? -23.763 -27.333 69.391 1.00 28.68  ? 113  HIS A CA    1 
ATOM   630   C  C     . HIS A  1 113 ? -23.397 -26.726 70.740 1.00 29.71  ? 113  HIS A C     1 
ATOM   631   O  O     . HIS A  1 113 ? -22.490 -27.213 71.422 1.00 30.27  ? 113  HIS A O     1 
ATOM   632   C  CB    . HIS A  1 113 ? -22.969 -26.666 68.277 1.00 28.14  ? 113  HIS A CB    1 
ATOM   633   C  CG    . HIS A  1 113 ? -21.491 -26.874 68.372 1.00 25.13  ? 113  HIS A CG    1 
ATOM   634   N  ND1   . HIS A  1 113 ? -20.879 -28.052 68.002 1.00 23.25  ? 113  HIS A ND1   1 
ATOM   635   C  CD2   . HIS A  1 113 ? -20.501 -26.045 68.775 1.00 23.54  ? 113  HIS A CD2   1 
ATOM   636   C  CE1   . HIS A  1 113 ? -19.575 -27.940 68.173 1.00 21.84  ? 113  HIS A CE1   1 
ATOM   637   N  NE2   . HIS A  1 113 ? -19.318 -26.731 68.638 1.00 22.42  ? 113  HIS A NE2   1 
ATOM   638   N  N     . ALA A  1 114 ? -24.100 -25.666 71.118 1.00 30.05  ? 114  ALA A N     1 
ATOM   639   C  CA    . ALA A  1 114 ? -23.873 -25.042 72.399 1.00 30.90  ? 114  ALA A CA    1 
ATOM   640   C  C     . ALA A  1 114 ? -24.809 -25.622 73.464 1.00 32.30  ? 114  ALA A C     1 
ATOM   641   O  O     . ALA A  1 114 ? -25.115 -24.946 74.460 1.00 32.66  ? 114  ALA A O     1 
ATOM   642   C  CB    . ALA A  1 114 ? -24.046 -23.570 72.288 1.00 30.71  ? 114  ALA A CB    1 
ATOM   643   N  N     . LYS A  1 115 ? -25.251 -26.872 73.261 1.00 32.94  ? 115  LYS A N     1 
ATOM   644   C  CA    . LYS A  1 115 ? -26.059 -27.591 74.258 1.00 34.26  ? 115  LYS A CA    1 
ATOM   645   C  C     . LYS A  1 115 ? -27.372 -26.868 74.615 1.00 33.63  ? 115  LYS A C     1 
ATOM   646   O  O     . LYS A  1 115 ? -27.928 -27.044 75.708 1.00 33.76  ? 115  LYS A O     1 
ATOM   647   C  CB    . LYS A  1 115 ? -25.248 -27.875 75.536 1.00 34.00  ? 115  LYS A CB    1 
ATOM   648   C  CG    . LYS A  1 115 ? -24.116 -28.910 75.387 1.00 36.00  ? 115  LYS A CG    1 
ATOM   649   C  CD    . LYS A  1 115 ? -23.162 -28.832 76.602 1.00 37.13  ? 115  LYS A CD    1 
ATOM   650   C  CE    . LYS A  1 115 ? -21.780 -29.443 76.329 1.00 40.77  ? 115  LYS A CE    1 
ATOM   651   N  NZ    . LYS A  1 115 ? -21.769 -30.938 76.547 1.00 42.67  ? 115  LYS A NZ    1 
ATOM   652   N  N     . ARG A  1 116 ? -27.862 -26.056 73.690 1.00 32.91  ? 116  ARG A N     1 
ATOM   653   C  CA    . ARG A  1 116 ? -29.191 -25.495 73.823 1.00 31.92  ? 116  ARG A CA    1 
ATOM   654   C  C     . ARG A  1 116 ? -30.150 -26.190 72.857 1.00 31.59  ? 116  ARG A C     1 
ATOM   655   O  O     . ARG A  1 116 ? -29.781 -27.083 72.092 1.00 31.25  ? 116  ARG A O     1 
ATOM   656   C  CB    . ARG A  1 116 ? -29.169 -23.979 73.580 1.00 32.08  ? 116  ARG A CB    1 
ATOM   657   C  CG    . ARG A  1 116 ? -28.289 -23.180 74.553 1.00 31.06  ? 116  ARG A CG    1 
ATOM   658   C  CD    . ARG A  1 116 ? -28.393 -21.693 74.286 1.00 31.81  ? 116  ARG A CD    1 
ATOM   659   N  NE    . ARG A  1 116 ? -27.397 -21.215 73.315 1.00 34.69  ? 116  ARG A NE    1 
ATOM   660   C  CZ    . ARG A  1 116 ? -27.624 -20.968 72.017 1.00 34.29  ? 116  ARG A CZ    1 
ATOM   661   N  NH1   . ARG A  1 116 ? -28.822 -21.141 71.473 1.00 33.22  ? 116  ARG A NH1   1 
ATOM   662   N  NH2   . ARG A  1 116 ? -26.636 -20.540 71.247 1.00 34.57  ? 116  ARG A NH2   1 
ATOM   663   N  N     . VAL A  1 117 ? -31.401 -25.778 72.919 1.00 31.45  ? 117  VAL A N     1 
ATOM   664   C  CA    . VAL A  1 117 ? -32.431 -26.268 72.017 1.00 30.99  ? 117  VAL A CA    1 
ATOM   665   C  C     . VAL A  1 117 ? -33.272 -25.070 71.592 1.00 30.78  ? 117  VAL A C     1 
ATOM   666   O  O     . VAL A  1 117 ? -34.285 -25.222 70.932 1.00 31.04  ? 117  VAL A O     1 
ATOM   667   C  CB    . VAL A  1 117 ? -33.312 -27.358 72.690 1.00 31.33  ? 117  VAL A CB    1 
ATOM   668   C  CG1   . VAL A  1 117 ? -32.467 -28.594 73.061 1.00 30.51  ? 117  VAL A CG1   1 
ATOM   669   C  CG2   . VAL A  1 117 ? -34.047 -26.803 73.925 1.00 30.75  ? 117  VAL A CG2   1 
ATOM   670   N  N     . THR A  1 118 ? -32.828 -23.878 71.997 1.00 30.53  ? 118  THR A N     1 
ATOM   671   C  CA    . THR A  1 118 ? -33.453 -22.617 71.624 1.00 30.21  ? 118  THR A CA    1 
ATOM   672   C  C     . THR A  1 118 ? -32.537 -21.871 70.682 1.00 29.82  ? 118  THR A C     1 
ATOM   673   O  O     . THR A  1 118 ? -31.424 -21.539 71.063 1.00 30.07  ? 118  THR A O     1 
ATOM   674   C  CB    . THR A  1 118 ? -33.661 -21.696 72.849 1.00 30.08  ? 118  THR A CB    1 
ATOM   675   O  OG1   . THR A  1 118 ? -34.201 -22.449 73.936 1.00 30.07  ? 118  THR A OG1   1 
ATOM   676   C  CG2   . THR A  1 118 ? -34.596 -20.536 72.509 1.00 30.19  ? 118  THR A CG2   1 
ATOM   677   N  N     . ILE A  1 119 ? -33.009 -21.579 69.475 1.00 29.42  ? 119  ILE A N     1 
ATOM   678   C  CA    . ILE A  1 119 ? -32.197 -20.838 68.511 1.00 28.81  ? 119  ILE A CA    1 
ATOM   679   C  C     . ILE A  1 119 ? -32.169 -19.364 68.850 1.00 29.33  ? 119  ILE A C     1 
ATOM   680   O  O     . ILE A  1 119 ? -33.171 -18.804 69.246 1.00 29.29  ? 119  ILE A O     1 
ATOM   681   C  CB    . ILE A  1 119 ? -32.642 -21.068 67.061 1.00 28.22  ? 119  ILE A CB    1 
ATOM   682   C  CG1   . ILE A  1 119 ? -34.052 -20.551 66.827 1.00 26.85  ? 119  ILE A CG1   1 
ATOM   683   C  CG2   . ILE A  1 119 ? -32.554 -22.561 66.704 1.00 28.25  ? 119  ILE A CG2   1 
ATOM   684   C  CD1   . ILE A  1 119 ? -34.268 -20.043 65.452 1.00 24.90  ? 119  ILE A CD1   1 
ATOM   685   N  N     . MET A  1 120 ? -31.005 -18.747 68.704 1.00 30.21  ? 120  MET A N     1 
ATOM   686   C  CA    . MET A  1 120 ? -30.811 -17.354 69.065 1.00 31.74  ? 120  MET A CA    1 
ATOM   687   C  C     . MET A  1 120 ? -30.079 -16.610 67.956 1.00 31.38  ? 120  MET A C     1 
ATOM   688   O  O     . MET A  1 120 ? -29.498 -17.235 67.086 1.00 31.07  ? 120  MET A O     1 
ATOM   689   C  CB    . MET A  1 120 ? -30.013 -17.262 70.357 1.00 31.49  ? 120  MET A CB    1 
ATOM   690   C  CG    . MET A  1 120 ? -30.809 -17.597 71.578 1.00 32.76  ? 120  MET A CG    1 
ATOM   691   S  SD    . MET A  1 120 ? -29.779 -17.863 73.036 1.00 35.14  ? 120  MET A SD    1 
ATOM   692   C  CE    . MET A  1 120 ? -30.908 -18.866 74.039 1.00 32.80  ? 120  MET A CE    1 
ATOM   693   N  N     . PRO A  1 121 ? -30.099 -15.267 67.991 1.00 31.60  ? 121  PRO A N     1 
ATOM   694   C  CA    . PRO A  1 121 ? -29.505 -14.485 66.926 1.00 31.80  ? 121  PRO A CA    1 
ATOM   695   C  C     . PRO A  1 121 ? -28.046 -14.844 66.715 1.00 32.16  ? 121  PRO A C     1 
ATOM   696   O  O     . PRO A  1 121 ? -27.581 -14.886 65.576 1.00 32.79  ? 121  PRO A O     1 
ATOM   697   C  CB    . PRO A  1 121 ? -29.629 -13.041 67.437 1.00 31.82  ? 121  PRO A CB    1 
ATOM   698   C  CG    . PRO A  1 121 ? -30.792 -13.067 68.340 1.00 31.58  ? 121  PRO A CG    1 
ATOM   699   C  CD    . PRO A  1 121 ? -30.677 -14.399 69.032 1.00 32.02  ? 121  PRO A CD    1 
ATOM   700   N  N     . LYS A  1 122 ? -27.329 -15.115 67.798 1.00 32.11  ? 122  LYS A N     1 
ATOM   701   C  CA    . LYS A  1 122 ? -25.930 -15.475 67.678 1.00 31.94  ? 122  LYS A CA    1 
ATOM   702   C  C     . LYS A  1 122 ? -25.747 -16.802 66.927 1.00 31.25  ? 122  LYS A C     1 
ATOM   703   O  O     . LYS A  1 122 ? -24.715 -17.021 66.316 1.00 31.31  ? 122  LYS A O     1 
ATOM   704   C  CB    . LYS A  1 122 ? -25.253 -15.489 69.047 1.00 32.25  ? 122  LYS A CB    1 
ATOM   705   C  CG    . LYS A  1 122 ? -25.559 -16.715 69.874 1.00 34.73  ? 122  LYS A CG    1 
ATOM   706   C  CD    . LYS A  1 122 ? -25.070 -16.553 71.290 1.00 38.92  ? 122  LYS A CD    1 
ATOM   707   C  CE    . LYS A  1 122 ? -25.763 -17.556 72.186 1.00 42.21  ? 122  LYS A CE    1 
ATOM   708   N  NZ    . LYS A  1 122 ? -25.081 -17.637 73.511 1.00 45.91  ? 122  LYS A NZ    1 
ATOM   709   N  N     . ASP A  1 123 ? -26.755 -17.666 66.963 1.00 30.98  ? 123  ASP A N     1 
ATOM   710   C  CA    . ASP A  1 123 ? -26.764 -18.882 66.153 1.00 30.69  ? 123  ASP A CA    1 
ATOM   711   C  C     . ASP A  1 123 ? -26.897 -18.522 64.663 1.00 30.62  ? 123  ASP A C     1 
ATOM   712   O  O     . ASP A  1 123 ? -26.177 -19.070 63.825 1.00 30.85  ? 123  ASP A O     1 
ATOM   713   C  CB    . ASP A  1 123 ? -27.893 -19.832 66.572 1.00 30.49  ? 123  ASP A CB    1 
ATOM   714   C  CG    . ASP A  1 123 ? -27.802 -20.279 68.040 1.00 31.49  ? 123  ASP A CG    1 
ATOM   715   O  OD1   . ASP A  1 123 ? -26.713 -20.714 68.494 1.00 33.02  ? 123  ASP A OD1   1 
ATOM   716   O  OD2   . ASP A  1 123 ? -28.839 -20.229 68.742 1.00 30.89  ? 123  ASP A OD2   1 
ATOM   717   N  N     . ILE A  1 124 ? -27.800 -17.601 64.326 1.00 30.07  ? 124  ILE A N     1 
ATOM   718   C  CA    . ILE A  1 124 ? -27.928 -17.169 62.936 1.00 29.93  ? 124  ILE A CA    1 
ATOM   719   C  C     . ILE A  1 124 ? -26.634 -16.490 62.485 1.00 29.82  ? 124  ILE A C     1 
ATOM   720   O  O     . ILE A  1 124 ? -26.129 -16.764 61.399 1.00 29.90  ? 124  ILE A O     1 
ATOM   721   C  CB    . ILE A  1 124 ? -29.161 -16.255 62.698 1.00 29.86  ? 124  ILE A CB    1 
ATOM   722   C  CG1   . ILE A  1 124 ? -30.448 -17.076 62.815 1.00 30.38  ? 124  ILE A CG1   1 
ATOM   723   C  CG2   . ILE A  1 124 ? -29.109 -15.610 61.314 1.00 28.35  ? 124  ILE A CG2   1 
ATOM   724   C  CD1   . ILE A  1 124 ? -31.742 -16.269 62.685 1.00 30.58  ? 124  ILE A CD1   1 
ATOM   725   N  N     . GLN A  1 125 ? -26.091 -15.631 63.343 1.00 29.47  ? 125  GLN A N     1 
ATOM   726   C  CA    . GLN A  1 125 ? -24.846 -14.927 63.063 1.00 29.19  ? 125  GLN A CA    1 
ATOM   727   C  C     . GLN A  1 125 ? -23.661 -15.869 62.804 1.00 28.32  ? 125  GLN A C     1 
ATOM   728   O  O     . GLN A  1 125 ? -22.897 -15.673 61.867 1.00 28.33  ? 125  GLN A O     1 
ATOM   729   C  CB    . GLN A  1 125 ? -24.536 -13.961 64.204 1.00 29.56  ? 125  GLN A CB    1 
ATOM   730   C  CG    . GLN A  1 125 ? -25.373 -12.680 64.172 1.00 31.55  ? 125  GLN A CG    1 
ATOM   731   C  CD    . GLN A  1 125 ? -25.508 -12.018 65.542 1.00 34.66  ? 125  GLN A CD    1 
ATOM   732   O  OE1   . GLN A  1 125 ? -24.649 -12.180 66.424 1.00 36.41  ? 125  GLN A OE1   1 
ATOM   733   N  NE2   . GLN A  1 125 ? -26.598 -11.268 65.727 1.00 34.67  ? 125  GLN A NE2   1 
ATOM   734   N  N     . LEU A  1 126 ? -23.530 -16.903 63.623 1.00 27.35  ? 126  LEU A N     1 
ATOM   735   C  CA    . LEU A  1 126 ? -22.471 -17.876 63.445 1.00 26.12  ? 126  LEU A CA    1 
ATOM   736   C  C     . LEU A  1 126 ? -22.631 -18.658 62.143 1.00 26.08  ? 126  LEU A C     1 
ATOM   737   O  O     . LEU A  1 126 ? -21.660 -18.827 61.404 1.00 26.42  ? 126  LEU A O     1 
ATOM   738   C  CB    . LEU A  1 126 ? -22.400 -18.829 64.638 1.00 25.45  ? 126  LEU A CB    1 
ATOM   739   C  CG    . LEU A  1 126 ? -21.342 -19.930 64.538 1.00 24.62  ? 126  LEU A CG    1 
ATOM   740   C  CD1   . LEU A  1 126 ? -19.933 -19.373 64.747 1.00 23.57  ? 126  LEU A CD1   1 
ATOM   741   C  CD2   . LEU A  1 126 ? -21.624 -21.093 65.472 1.00 22.65  ? 126  LEU A CD2   1 
ATOM   742   N  N     . ALA A  1 127 ? -23.836 -19.147 61.864 1.00 25.44  ? 127  ALA A N     1 
ATOM   743   C  CA    . ALA A  1 127 ? -24.071 -19.860 60.622 1.00 25.25  ? 127  ALA A CA    1 
ATOM   744   C  C     . ALA A  1 127 ? -23.749 -19.008 59.385 1.00 25.49  ? 127  ALA A C     1 
ATOM   745   O  O     . ALA A  1 127 ? -23.109 -19.460 58.447 1.00 25.30  ? 127  ALA A O     1 
ATOM   746   C  CB    . ALA A  1 127 ? -25.470 -20.353 60.573 1.00 25.14  ? 127  ALA A CB    1 
ATOM   747   N  N     . ARG A  1 128 ? -24.169 -17.759 59.386 1.00 26.14  ? 128  ARG A N     1 
ATOM   748   C  CA    . ARG A  1 128 ? -23.914 -16.922 58.230 1.00 26.85  ? 128  ARG A CA    1 
ATOM   749   C  C     . ARG A  1 128 ? -22.426 -16.613 58.051 1.00 27.80  ? 128  ARG A C     1 
ATOM   750   O  O     . ARG A  1 128 ? -21.932 -16.616 56.917 1.00 28.00  ? 128  ARG A O     1 
ATOM   751   C  CB    . ARG A  1 128 ? -24.766 -15.666 58.276 1.00 26.32  ? 128  ARG A CB    1 
ATOM   752   C  CG    . ARG A  1 128 ? -26.223 -15.980 58.168 1.00 26.26  ? 128  ARG A CG    1 
ATOM   753   C  CD    . ARG A  1 128 ? -27.065 -14.734 58.025 1.00 28.17  ? 128  ARG A CD    1 
ATOM   754   N  NE    . ARG A  1 128 ? -26.769 -13.976 56.811 1.00 29.47  ? 128  ARG A NE    1 
ATOM   755   C  CZ    . ARG A  1 128 ? -26.377 -12.709 56.818 1.00 29.50  ? 128  ARG A CZ    1 
ATOM   756   N  NH1   . ARG A  1 128 ? -26.251 -12.074 57.971 1.00 29.55  ? 128  ARG A NH1   1 
ATOM   757   N  NH2   . ARG A  1 128 ? -26.128 -12.075 55.681 1.00 29.72  ? 128  ARG A NH2   1 
ATOM   758   N  N     . ARG A  1 129 ? -21.717 -16.364 59.154 1.00 28.31  ? 129  ARG A N     1 
ATOM   759   C  CA    . ARG A  1 129 ? -20.267 -16.138 59.103 1.00 29.55  ? 129  ARG A CA    1 
ATOM   760   C  C     . ARG A  1 129 ? -19.505 -17.334 58.510 1.00 30.17  ? 129  ARG A C     1 
ATOM   761   O  O     . ARG A  1 129 ? -18.656 -17.171 57.650 1.00 30.31  ? 129  ARG A O     1 
ATOM   762   C  CB    . ARG A  1 129 ? -19.724 -15.732 60.486 1.00 29.44  ? 129  ARG A CB    1 
ATOM   763   C  CG    . ARG A  1 129 ? -18.255 -16.005 60.753 1.00 30.53  ? 129  ARG A CG    1 
ATOM   764   C  CD    . ARG A  1 129 ? -17.300 -15.104 59.962 1.00 33.67  ? 129  ARG A CD    1 
ATOM   765   N  NE    . ARG A  1 129 ? -15.892 -15.492 60.146 1.00 36.69  ? 129  ARG A NE    1 
ATOM   766   C  CZ    . ARG A  1 129 ? -15.315 -16.603 59.651 1.00 37.52  ? 129  ARG A CZ    1 
ATOM   767   N  NH1   . ARG A  1 129 ? -16.007 -17.475 58.922 1.00 36.61  ? 129  ARG A NH1   1 
ATOM   768   N  NH2   . ARG A  1 129 ? -14.028 -16.857 59.891 1.00 36.70  ? 129  ARG A NH2   1 
ATOM   769   N  N     . ILE A  1 130 ? -19.835 -18.534 58.954 1.00 31.38  ? 130  ILE A N     1 
ATOM   770   C  CA    . ILE A  1 130 ? -19.183 -19.737 58.468 1.00 32.62  ? 130  ILE A CA    1 
ATOM   771   C  C     . ILE A  1 130 ? -19.531 -20.034 57.000 1.00 34.01  ? 130  ILE A C     1 
ATOM   772   O  O     . ILE A  1 130 ? -18.699 -20.543 56.253 1.00 34.33  ? 130  ILE A O     1 
ATOM   773   C  CB    . ILE A  1 130 ? -19.486 -20.927 59.393 1.00 32.35  ? 130  ILE A CB    1 
ATOM   774   C  CG1   . ILE A  1 130 ? -18.827 -20.693 60.747 1.00 32.13  ? 130  ILE A CG1   1 
ATOM   775   C  CG2   . ILE A  1 130 ? -18.973 -22.224 58.821 1.00 31.46  ? 130  ILE A CG2   1 
ATOM   776   C  CD1   . ILE A  1 130 ? -19.202 -21.723 61.783 1.00 33.02  ? 130  ILE A CD1   1 
ATOM   777   N  N     . ARG A  1 131 ? -20.745 -19.692 56.583 1.00 35.55  ? 131  ARG A N     1 
ATOM   778   C  CA    . ARG A  1 131 ? -21.140 -19.824 55.180 1.00 36.71  ? 131  ARG A CA    1 
ATOM   779   C  C     . ARG A  1 131 ? -20.433 -18.822 54.253 1.00 38.46  ? 131  ARG A C     1 
ATOM   780   O  O     . ARG A  1 131 ? -20.557 -18.906 53.034 1.00 38.40  ? 131  ARG A O     1 
ATOM   781   C  CB    . ARG A  1 131 ? -22.634 -19.592 55.048 1.00 36.21  ? 131  ARG A CB    1 
ATOM   782   C  CG    . ARG A  1 131 ? -23.499 -20.740 55.374 1.00 33.84  ? 131  ARG A CG    1 
ATOM   783   C  CD    . ARG A  1 131 ? -24.900 -20.229 55.361 1.00 32.00  ? 131  ARG A CD    1 
ATOM   784   N  NE    . ARG A  1 131 ? -25.869 -21.310 55.363 1.00 32.20  ? 131  ARG A NE    1 
ATOM   785   C  CZ    . ARG A  1 131 ? -27.102 -21.220 54.871 1.00 31.10  ? 131  ARG A CZ    1 
ATOM   786   N  NH1   . ARG A  1 131 ? -27.542 -20.081 54.324 1.00 28.98  ? 131  ARG A NH1   1 
ATOM   787   N  NH2   . ARG A  1 131 ? -27.899 -22.284 54.933 1.00 31.09  ? 131  ARG A NH2   1 
ATOM   788   N  N     . GLY A  1 132 ? -19.727 -17.858 54.834 1.00 40.54  ? 132  GLY A N     1 
ATOM   789   C  CA    . GLY A  1 132 ? -19.127 -16.784 54.060 1.00 43.24  ? 132  GLY A CA    1 
ATOM   790   C  C     . GLY A  1 132 ? -20.086 -15.669 53.684 1.00 45.29  ? 132  GLY A C     1 
ATOM   791   O  O     . GLY A  1 132 ? -19.752 -14.819 52.863 1.00 45.65  ? 132  GLY A O     1 
ATOM   792   N  N     . GLU A  1 133 ? -21.276 -15.645 54.283 1.00 47.48  ? 133  GLU A N     1 
ATOM   793   C  CA    . GLU A  1 133 ? -22.246 -14.588 53.977 1.00 49.44  ? 133  GLU A CA    1 
ATOM   794   C  C     . GLU A  1 133 ? -21.910 -13.306 54.737 1.00 51.33  ? 133  GLU A C     1 
ATOM   795   O  O     . GLU A  1 133 ? -22.051 -12.217 54.194 1.00 51.64  ? 133  GLU A O     1 
ATOM   796   C  CB    . GLU A  1 133 ? -23.680 -15.036 54.265 1.00 49.13  ? 133  GLU A CB    1 
ATOM   797   C  CG    . GLU A  1 133 ? -24.186 -16.214 53.428 1.00 48.92  ? 133  GLU A CG    1 
ATOM   798   C  CD    . GLU A  1 133 ? -25.659 -16.558 53.697 1.00 49.66  ? 133  GLU A CD    1 
ATOM   799   O  OE1   . GLU A  1 133 ? -26.352 -15.778 54.392 1.00 50.58  ? 133  GLU A OE1   1 
ATOM   800   O  OE2   . GLU A  1 133 ? -26.134 -17.610 53.212 1.00 49.21  ? 133  GLU A OE2   1 
ATOM   801   N  N     . ARG A  1 134 ? -21.475 -13.438 55.992 1.00 53.83  ? 134  ARG A N     1 
ATOM   802   C  CA    . ARG A  1 134 ? -20.969 -12.291 56.772 1.00 56.32  ? 134  ARG A CA    1 
ATOM   803   C  C     . ARG A  1 134 ? -19.480 -12.064 56.477 1.00 57.26  ? 134  ARG A C     1 
ATOM   804   O  O     . ARG A  1 134 ? -19.066 -10.919 56.225 1.00 57.70  ? 134  ARG A O     1 
ATOM   805   C  CB    . ARG A  1 134 ? -21.184 -12.454 58.292 1.00 56.05  ? 134  ARG A CB    1 
ATOM   806   C  CG    . ARG A  1 134 ? -22.542 -13.022 58.692 1.00 57.61  ? 134  ARG A CG    1 
ATOM   807   C  CD    . ARG A  1 134 ? -22.979 -12.685 60.127 1.00 57.82  ? 134  ARG A CD    1 
ATOM   808   N  NE    . ARG A  1 134 ? -22.082 -13.215 61.152 1.00 62.01  ? 134  ARG A NE    1 
ATOM   809   C  CZ    . ARG A  1 134 ? -21.496 -12.478 62.101 1.00 64.84  ? 134  ARG A CZ    1 
ATOM   810   N  NH1   . ARG A  1 134 ? -21.717 -11.162 62.183 1.00 65.67  ? 134  ARG A NH1   1 
ATOM   811   N  NH2   . ARG A  1 134 ? -20.688 -13.060 62.985 1.00 66.07  ? 134  ARG A NH2   1 
ATOM   812   N  N     . ALA A  1 135 ? -18.693 -13.149 56.509 1.00 58.26  ? 135  ALA A N     1 
ATOM   813   C  CA    . ALA A  1 135 ? -17.247 -13.094 56.237 1.00 59.14  ? 135  ALA A CA    1 
ATOM   814   C  C     . ALA A  1 135 ? -16.937 -12.827 54.746 1.00 59.75  ? 135  ALA A C     1 
ATOM   815   O  O     . ALA A  1 135 ? -17.085 -13.717 53.874 1.00 60.08  ? 135  ALA A O     1 
ATOM   816   C  CB    . ALA A  1 135 ? -16.550 -14.379 56.717 1.00 59.05  ? 135  ALA A CB    1 
ATOM   817   O  OXT   . ALA A  1 135 ? -16.525 -11.704 54.370 1.00 59.96  ? 135  ALA A OXT   1 
ATOM   818   N  N     . ASP B  2 24  ? -45.481 -0.743  58.055 1.00 57.40  ? 24   ASP B N     1 
ATOM   819   C  CA    . ASP B  2 24  ? -45.135 -2.198  58.008 1.00 57.43  ? 24   ASP B CA    1 
ATOM   820   C  C     . ASP B  2 24  ? -44.170 -2.544  56.859 1.00 56.71  ? 24   ASP B C     1 
ATOM   821   O  O     . ASP B  2 24  ? -43.089 -1.952  56.719 1.00 56.80  ? 24   ASP B O     1 
ATOM   822   C  CB    . ASP B  2 24  ? -46.418 -3.041  57.865 1.00 58.04  ? 24   ASP B CB    1 
ATOM   823   C  CG    . ASP B  2 24  ? -47.270 -3.080  59.151 1.00 59.57  ? 24   ASP B CG    1 
ATOM   824   O  OD1   . ASP B  2 24  ? -47.427 -2.024  59.817 1.00 59.45  ? 24   ASP B OD1   1 
ATOM   825   O  OD2   . ASP B  2 24  ? -47.805 -4.179  59.471 1.00 61.63  ? 24   ASP B OD2   1 
ATOM   826   N  N     . ASN B  2 25  ? -44.613 -3.499  56.035 1.00 55.71  ? 25   ASN B N     1 
ATOM   827   C  CA    . ASN B  2 25  ? -43.894 -4.070  54.874 1.00 54.16  ? 25   ASN B CA    1 
ATOM   828   C  C     . ASN B  2 25  ? -42.980 -5.225  55.248 1.00 53.34  ? 25   ASN B C     1 
ATOM   829   O  O     . ASN B  2 25  ? -43.401 -6.383  55.143 1.00 53.09  ? 25   ASN B O     1 
ATOM   830   C  CB    . ASN B  2 25  ? -43.231 -3.016  53.980 1.00 53.82  ? 25   ASN B CB    1 
ATOM   831   C  CG    . ASN B  2 25  ? -44.205 -2.423  52.969 1.00 52.99  ? 25   ASN B CG    1 
ATOM   832   O  OD1   . ASN B  2 25  ? -45.266 -3.004  52.684 1.00 49.98  ? 25   ASN B OD1   1 
ATOM   833   N  ND2   . ASN B  2 25  ? -43.854 -1.259  52.423 1.00 51.95  ? 25   ASN B ND2   1 
ATOM   834   N  N     . ILE B  2 26  ? -41.764 -4.924  55.705 1.00 52.19  ? 26   ILE B N     1 
ATOM   835   C  CA    . ILE B  2 26  ? -40.918 -5.963  56.275 1.00 51.28  ? 26   ILE B CA    1 
ATOM   836   C  C     . ILE B  2 26  ? -41.610 -6.563  57.500 1.00 51.00  ? 26   ILE B C     1 
ATOM   837   O  O     . ILE B  2 26  ? -41.616 -7.778  57.676 1.00 50.98  ? 26   ILE B O     1 
ATOM   838   C  CB    . ILE B  2 26  ? -39.482 -5.474  56.605 1.00 51.24  ? 26   ILE B CB    1 
ATOM   839   C  CG1   . ILE B  2 26  ? -38.597 -6.645  57.062 1.00 50.36  ? 26   ILE B CG1   1 
ATOM   840   C  CG2   . ILE B  2 26  ? -39.495 -4.361  57.664 1.00 51.24  ? 26   ILE B CG2   1 
ATOM   841   C  CD1   . ILE B  2 26  ? -38.475 -7.789  56.071 1.00 48.30  ? 26   ILE B CD1   1 
ATOM   842   N  N     . GLN B  2 27  ? -42.227 -5.707  58.314 1.00 50.60  ? 27   GLN B N     1 
ATOM   843   C  CA    . GLN B  2 27  ? -43.026 -6.154  59.456 1.00 49.97  ? 27   GLN B CA    1 
ATOM   844   C  C     . GLN B  2 27  ? -44.222 -6.989  59.020 1.00 49.80  ? 27   GLN B C     1 
ATOM   845   O  O     . GLN B  2 27  ? -44.883 -7.615  59.848 1.00 50.20  ? 27   GLN B O     1 
ATOM   846   C  CB    . GLN B  2 27  ? -43.482 -4.966  60.298 1.00 49.81  ? 27   GLN B CB    1 
ATOM   847   C  CG    . GLN B  2 27  ? -42.337 -4.190  60.969 1.00 49.86  ? 27   GLN B CG    1 
ATOM   848   C  CD    . GLN B  2 27  ? -41.438 -5.071  61.825 1.00 49.88  ? 27   GLN B CD    1 
ATOM   849   O  OE1   . GLN B  2 27  ? -41.871 -6.098  62.351 1.00 50.58  ? 27   GLN B OE1   1 
ATOM   850   N  NE2   . GLN B  2 27  ? -40.176 -4.674  61.961 1.00 49.39  ? 27   GLN B NE2   1 
ATOM   851   N  N     . GLY B  2 28  ? -44.485 -7.007  57.715 1.00 49.32  ? 28   GLY B N     1 
ATOM   852   C  CA    . GLY B  2 28  ? -45.523 -7.852  57.141 1.00 48.58  ? 28   GLY B CA    1 
ATOM   853   C  C     . GLY B  2 28  ? -45.133 -9.318  57.123 1.00 48.25  ? 28   GLY B C     1 
ATOM   854   O  O     . GLY B  2 28  ? -46.003 -10.187 57.058 1.00 48.41  ? 28   GLY B O     1 
ATOM   855   N  N     . ILE B  2 29  ? -43.824 -9.588  57.143 1.00 47.52  ? 29   ILE B N     1 
ATOM   856   C  CA    . ILE B  2 29  ? -43.304 -10.928 57.380 1.00 46.45  ? 29   ILE B CA    1 
ATOM   857   C  C     . ILE B  2 29  ? -43.430 -11.159 58.886 1.00 45.88  ? 29   ILE B C     1 
ATOM   858   O  O     . ILE B  2 29  ? -42.634 -10.651 59.686 1.00 45.92  ? 29   ILE B O     1 
ATOM   859   C  CB    . ILE B  2 29  ? -41.833 -11.074 56.924 1.00 46.64  ? 29   ILE B CB    1 
ATOM   860   C  CG1   . ILE B  2 29  ? -41.613 -10.470 55.531 1.00 46.71  ? 29   ILE B CG1   1 
ATOM   861   C  CG2   . ILE B  2 29  ? -41.387 -12.542 56.963 1.00 46.69  ? 29   ILE B CG2   1 
ATOM   862   C  CD1   . ILE B  2 29  ? -42.318 -11.191 54.399 1.00 47.52  ? 29   ILE B CD1   1 
ATOM   863   N  N     . THR B  2 30  ? -44.450 -11.922 59.262 1.00 44.88  ? 30   THR B N     1 
ATOM   864   C  CA    . THR B  2 30  ? -44.925 -11.955 60.637 1.00 43.84  ? 30   THR B CA    1 
ATOM   865   C  C     . THR B  2 30  ? -44.254 -13.028 61.481 1.00 43.56  ? 30   THR B C     1 
ATOM   866   O  O     . THR B  2 30  ? -43.641 -13.958 60.951 1.00 43.84  ? 30   THR B O     1 
ATOM   867   C  CB    . THR B  2 30  ? -46.457 -12.144 60.678 1.00 43.72  ? 30   THR B CB    1 
ATOM   868   O  OG1   . THR B  2 30  ? -46.828 -13.280 59.891 1.00 43.18  ? 30   THR B OG1   1 
ATOM   869   C  CG2   . THR B  2 30  ? -47.150 -10.920 60.124 1.00 43.29  ? 30   THR B CG2   1 
ATOM   870   N  N     . LYS B  2 31  ? -44.372 -12.887 62.799 1.00 42.64  ? 31   LYS B N     1 
ATOM   871   C  CA    . LYS B  2 31  ? -43.898 -13.889 63.746 1.00 41.83  ? 31   LYS B CA    1 
ATOM   872   C  C     . LYS B  2 31  ? -44.383 -15.333 63.461 1.00 41.01  ? 31   LYS B C     1 
ATOM   873   O  O     . LYS B  2 31  ? -43.568 -16.261 63.419 1.00 41.28  ? 31   LYS B O     1 
ATOM   874   C  CB    . LYS B  2 31  ? -44.235 -13.444 65.170 1.00 42.07  ? 31   LYS B CB    1 
ATOM   875   C  CG    . LYS B  2 31  ? -44.162 -14.526 66.221 1.00 43.27  ? 31   LYS B CG    1 
ATOM   876   C  CD    . LYS B  2 31  ? -44.302 -13.907 67.587 1.00 45.84  ? 31   LYS B CD    1 
ATOM   877   C  CE    . LYS B  2 31  ? -44.451 -14.955 68.675 1.00 46.79  ? 31   LYS B CE    1 
ATOM   878   N  NZ    . LYS B  2 31  ? -44.753 -14.245 69.945 1.00 46.80  ? 31   LYS B NZ    1 
ATOM   879   N  N     . PRO B  2 32  ? -45.703 -15.543 63.294 1.00 40.02  ? 32   PRO B N     1 
ATOM   880   C  CA    . PRO B  2 32  ? -46.152 -16.873 62.867 1.00 39.01  ? 32   PRO B CA    1 
ATOM   881   C  C     . PRO B  2 32  ? -45.563 -17.380 61.537 1.00 38.11  ? 32   PRO B C     1 
ATOM   882   O  O     . PRO B  2 32  ? -45.391 -18.590 61.366 1.00 37.94  ? 32   PRO B O     1 
ATOM   883   C  CB    . PRO B  2 32  ? -47.671 -16.702 62.743 1.00 39.20  ? 32   PRO B CB    1 
ATOM   884   C  CG    . PRO B  2 32  ? -47.907 -15.231 62.683 1.00 39.49  ? 32   PRO B CG    1 
ATOM   885   C  CD    . PRO B  2 32  ? -46.842 -14.641 63.531 1.00 39.93  ? 32   PRO B CD    1 
ATOM   886   N  N     . ALA B  2 33  ? -45.278 -16.474 60.600 1.00 37.08  ? 33   ALA B N     1 
ATOM   887   C  CA    . ALA B  2 33  ? -44.702 -16.862 59.299 1.00 36.10  ? 33   ALA B CA    1 
ATOM   888   C  C     . ALA B  2 33  ? -43.291 -17.407 59.481 1.00 35.37  ? 33   ALA B C     1 
ATOM   889   O  O     . ALA B  2 33  ? -42.947 -18.499 58.975 1.00 35.23  ? 33   ALA B O     1 
ATOM   890   C  CB    . ALA B  2 33  ? -44.680 -15.682 58.347 1.00 35.81  ? 33   ALA B CB    1 
ATOM   891   N  N     . ILE B  2 34  ? -42.488 -16.630 60.207 1.00 34.05  ? 34   ILE B N     1 
ATOM   892   C  CA    . ILE B  2 34  ? -41.132 -16.998 60.547 1.00 33.23  ? 34   ILE B CA    1 
ATOM   893   C  C     . ILE B  2 34  ? -41.147 -18.272 61.371 1.00 33.28  ? 34   ILE B C     1 
ATOM   894   O  O     . ILE B  2 34  ? -40.293 -19.141 61.199 1.00 33.33  ? 34   ILE B O     1 
ATOM   895   C  CB    . ILE B  2 34  ? -40.431 -15.882 61.322 1.00 32.71  ? 34   ILE B CB    1 
ATOM   896   C  CG1   . ILE B  2 34  ? -40.275 -14.658 60.430 1.00 31.99  ? 34   ILE B CG1   1 
ATOM   897   C  CG2   . ILE B  2 34  ? -39.072 -16.344 61.807 1.00 32.38  ? 34   ILE B CG2   1 
ATOM   898   C  CD1   . ILE B  2 34  ? -40.253 -13.372 61.176 1.00 31.33  ? 34   ILE B CD1   1 
ATOM   899   N  N     . ARG B  2 35  ? -42.124 -18.393 62.258 1.00 33.28  ? 35   ARG B N     1 
ATOM   900   C  CA    . ARG B  2 35  ? -42.188 -19.576 63.084 1.00 33.60  ? 35   ARG B CA    1 
ATOM   901   C  C     . ARG B  2 35  ? -42.415 -20.795 62.205 1.00 33.10  ? 35   ARG B C     1 
ATOM   902   O  O     . ARG B  2 35  ? -41.696 -21.780 62.356 1.00 33.55  ? 35   ARG B O     1 
ATOM   903   C  CB    . ARG B  2 35  ? -43.233 -19.443 64.190 1.00 33.93  ? 35   ARG B CB    1 
ATOM   904   C  CG    . ARG B  2 35  ? -43.687 -20.775 64.764 1.00 37.04  ? 35   ARG B CG    1 
ATOM   905   C  CD    . ARG B  2 35  ? -44.598 -20.602 65.939 1.00 42.53  ? 35   ARG B CD    1 
ATOM   906   N  NE    . ARG B  2 35  ? -43.799 -20.215 67.092 1.00 47.85  ? 35   ARG B NE    1 
ATOM   907   C  CZ    . ARG B  2 35  ? -43.707 -18.977 67.565 1.00 50.84  ? 35   ARG B CZ    1 
ATOM   908   N  NH1   . ARG B  2 35  ? -44.403 -17.986 67.000 1.00 51.39  ? 35   ARG B NH1   1 
ATOM   909   N  NH2   . ARG B  2 35  ? -42.926 -18.737 68.618 1.00 52.15  ? 35   ARG B NH2   1 
ATOM   910   N  N     . ARG B  2 36  ? -43.377 -20.722 61.279 1.00 32.53  ? 36   ARG B N     1 
ATOM   911   C  CA    . ARG B  2 36  ? -43.667 -21.835 60.359 1.00 32.12  ? 36   ARG B CA    1 
ATOM   912   C  C     . ARG B  2 36  ? -42.441 -22.234 59.551 1.00 31.15  ? 36   ARG B C     1 
ATOM   913   O  O     . ARG B  2 36  ? -42.190 -23.412 59.360 1.00 31.14  ? 36   ARG B O     1 
ATOM   914   C  CB    . ARG B  2 36  ? -44.819 -21.507 59.409 1.00 32.29  ? 36   ARG B CB    1 
ATOM   915   C  CG    . ARG B  2 36  ? -46.224 -21.510 60.030 1.00 32.95  ? 36   ARG B CG    1 
ATOM   916   C  CD    . ARG B  2 36  ? -47.331 -21.422 58.944 1.00 33.48  ? 36   ARG B CD    1 
ATOM   917   N  NE    . ARG B  2 36  ? -47.270 -20.166 58.195 1.00 36.61  ? 36   ARG B NE    1 
ATOM   918   C  CZ    . ARG B  2 36  ? -47.787 -19.005 58.614 1.00 39.63  ? 36   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B  2 36  ? -48.446 -18.927 59.776 1.00 38.31  ? 36   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B  2 36  ? -47.652 -17.909 57.863 1.00 39.85  ? 36   ARG B NH2   1 
ATOM   921   N  N     . LEU B  2 37  ? -41.672 -21.244 59.096 1.00 30.55  ? 37   LEU B N     1 
ATOM   922   C  CA    . LEU B  2 37  ? -40.400 -21.473 58.392 1.00 29.36  ? 37   LEU B CA    1 
ATOM   923   C  C     . LEU B  2 37  ? -39.446 -22.266 59.232 1.00 28.84  ? 37   LEU B C     1 
ATOM   924   O  O     . LEU B  2 37  ? -38.993 -23.347 58.841 1.00 29.35  ? 37   LEU B O     1 
ATOM   925   C  CB    . LEU B  2 37  ? -39.740 -20.148 58.055 1.00 29.10  ? 37   LEU B CB    1 
ATOM   926   C  CG    . LEU B  2 37  ? -40.452 -19.427 56.922 1.00 29.19  ? 37   LEU B CG    1 
ATOM   927   C  CD1   . LEU B  2 37  ? -40.147 -17.942 56.963 1.00 27.94  ? 37   LEU B CD1   1 
ATOM   928   C  CD2   . LEU B  2 37  ? -40.064 -20.070 55.592 1.00 28.63  ? 37   LEU B CD2   1 
ATOM   929   N  N     . ALA B  2 38  ? -39.165 -21.726 60.407 1.00 28.26  ? 38   ALA B N     1 
ATOM   930   C  CA    . ALA B  2 38  ? -38.306 -22.374 61.382 1.00 27.93  ? 38   ALA B CA    1 
ATOM   931   C  C     . ALA B  2 38  ? -38.721 -23.813 61.628 1.00 27.62  ? 38   ALA B C     1 
ATOM   932   O  O     . ALA B  2 38  ? -37.868 -24.688 61.760 1.00 27.94  ? 38   ALA B O     1 
ATOM   933   C  CB    . ALA B  2 38  ? -38.304 -21.592 62.671 1.00 27.62  ? 38   ALA B CB    1 
ATOM   934   N  N     . ARG B  2 39  ? -40.025 -24.057 61.657 1.00 27.01  ? 39   ARG B N     1 
ATOM   935   C  CA    . ARG B  2 39  ? -40.533 -25.383 61.927 1.00 27.00  ? 39   ARG B CA    1 
ATOM   936   C  C     . ARG B  2 39  ? -40.177 -26.300 60.792 1.00 27.04  ? 39   ARG B C     1 
ATOM   937   O  O     . ARG B  2 39  ? -39.712 -27.415 61.014 1.00 26.91  ? 39   ARG B O     1 
ATOM   938   C  CB    . ARG B  2 39  ? -42.042 -25.356 62.151 1.00 27.30  ? 39   ARG B CB    1 
ATOM   939   C  CG    . ARG B  2 39  ? -42.469 -24.615 63.430 1.00 27.88  ? 39   ARG B CG    1 
ATOM   940   C  CD    . ARG B  2 39  ? -42.356 -25.507 64.641 1.00 30.49  ? 39   ARG B CD    1 
ATOM   941   N  NE    . ARG B  2 39  ? -42.857 -24.867 65.848 1.00 33.44  ? 39   ARG B NE    1 
ATOM   942   C  CZ    . ARG B  2 39  ? -42.087 -24.226 66.724 1.00 35.28  ? 39   ARG B CZ    1 
ATOM   943   N  NH1   . ARG B  2 39  ? -40.778 -24.143 66.522 1.00 34.69  ? 39   ARG B NH1   1 
ATOM   944   N  NH2   . ARG B  2 39  ? -42.621 -23.674 67.804 1.00 35.44  ? 39   ARG B NH2   1 
ATOM   945   N  N     . ARG B  2 40  ? -40.365 -25.827 59.565 1.00 27.23  ? 40   ARG B N     1 
ATOM   946   C  CA    . ARG B  2 40  ? -39.923 -26.594 58.411 1.00 27.03  ? 40   ARG B CA    1 
ATOM   947   C  C     . ARG B  2 40  ? -38.411 -26.888 58.495 1.00 26.69  ? 40   ARG B C     1 
ATOM   948   O  O     . ARG B  2 40  ? -37.951 -27.943 58.040 1.00 25.99  ? 40   ARG B O     1 
ATOM   949   C  CB    . ARG B  2 40  ? -40.294 -25.889 57.117 1.00 27.09  ? 40   ARG B CB    1 
ATOM   950   C  CG    . ARG B  2 40  ? -40.181 -26.783 55.894 1.00 27.84  ? 40   ARG B CG    1 
ATOM   951   C  CD    . ARG B  2 40  ? -40.822 -26.161 54.675 1.00 28.96  ? 40   ARG B CD    1 
ATOM   952   N  NE    . ARG B  2 40  ? -42.213 -26.580 54.557 1.00 30.80  ? 40   ARG B NE    1 
ATOM   953   C  CZ    . ARG B  2 40  ? -43.118 -26.001 53.769 1.00 30.83  ? 40   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B  2 40  ? -42.793 -24.954 53.012 1.00 27.96  ? 40   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B  2 40  ? -44.360 -26.474 53.754 1.00 30.79  ? 40   ARG B NH2   1 
ATOM   956   N  N     . GLY B  2 41  ? -37.666 -25.967 59.118 1.00 26.55  ? 41   GLY B N     1 
ATOM   957   C  CA    . GLY B  2 41  ? -36.222 -26.142 59.358 1.00 26.31  ? 41   GLY B CA    1 
ATOM   958   C  C     . GLY B  2 41  ? -35.891 -27.037 60.539 1.00 26.26  ? 41   GLY B C     1 
ATOM   959   O  O     . GLY B  2 41  ? -34.723 -27.260 60.869 1.00 25.52  ? 41   GLY B O     1 
ATOM   960   N  N     . GLY B  2 42  ? -36.936 -27.537 61.189 1.00 26.82  ? 42   GLY B N     1 
ATOM   961   C  CA    . GLY B  2 42  ? -36.789 -28.473 62.297 1.00 27.33  ? 42   GLY B CA    1 
ATOM   962   C  C     . GLY B  2 42  ? -36.493 -27.824 63.629 1.00 27.78  ? 42   GLY B C     1 
ATOM   963   O  O     . GLY B  2 42  ? -35.925 -28.467 64.507 1.00 28.24  ? 42   GLY B O     1 
ATOM   964   N  N     . VAL B  2 43  ? -36.871 -26.560 63.790 1.00 27.90  ? 43   VAL B N     1 
ATOM   965   C  CA    . VAL B  2 43  ? -36.608 -25.844 65.039 1.00 28.88  ? 43   VAL B CA    1 
ATOM   966   C  C     . VAL B  2 43  ? -37.737 -25.979 66.082 1.00 29.44  ? 43   VAL B C     1 
ATOM   967   O  O     . VAL B  2 43  ? -38.904 -25.712 65.794 1.00 29.36  ? 43   VAL B O     1 
ATOM   968   C  CB    . VAL B  2 43  ? -36.292 -24.364 64.769 1.00 28.68  ? 43   VAL B CB    1 
ATOM   969   C  CG1   . VAL B  2 43  ? -36.156 -23.606 66.050 1.00 28.11  ? 43   VAL B CG1   1 
ATOM   970   C  CG2   . VAL B  2 43  ? -35.017 -24.251 63.965 1.00 29.49  ? 43   VAL B CG2   1 
ATOM   971   N  N     . LYS B  2 44  ? -37.369 -26.386 67.295 1.00 30.38  ? 44   LYS B N     1 
ATOM   972   C  CA    . LYS B  2 44  ? -38.343 -26.609 68.369 1.00 31.19  ? 44   LYS B CA    1 
ATOM   973   C  C     . LYS B  2 44  ? -38.644 -25.365 69.183 1.00 31.60  ? 44   LYS B C     1 
ATOM   974   O  O     . LYS B  2 44  ? -39.786 -25.098 69.499 1.00 32.28  ? 44   LYS B O     1 
ATOM   975   C  CB    . LYS B  2 44  ? -37.850 -27.700 69.311 1.00 31.16  ? 44   LYS B CB    1 
ATOM   976   C  CG    . LYS B  2 44  ? -38.919 -28.277 70.190 1.00 31.43  ? 44   LYS B CG    1 
ATOM   977   C  CD    . LYS B  2 44  ? -38.350 -29.368 71.063 1.00 33.30  ? 44   LYS B CD    1 
ATOM   978   C  CE    . LYS B  2 44  ? -39.337 -29.783 72.142 1.00 34.31  ? 44   LYS B CE    1 
ATOM   979   N  NZ    . LYS B  2 44  ? -38.892 -31.053 72.774 1.00 33.45  ? 44   LYS B NZ    1 
ATOM   980   N  N     . ARG B  2 45  ? -37.623 -24.604 69.528 1.00 32.10  ? 45   ARG B N     1 
ATOM   981   C  CA    . ARG B  2 45  ? -37.799 -23.515 70.459 1.00 32.87  ? 45   ARG B CA    1 
ATOM   982   C  C     . ARG B  2 45  ? -37.068 -22.286 69.943 1.00 32.62  ? 45   ARG B C     1 
ATOM   983   O  O     . ARG B  2 45  ? -35.901 -22.368 69.539 1.00 32.61  ? 45   ARG B O     1 
ATOM   984   C  CB    . ARG B  2 45  ? -37.257 -23.935 71.826 1.00 33.30  ? 45   ARG B CB    1 
ATOM   985   C  CG    . ARG B  2 45  ? -37.941 -23.259 72.997 1.00 34.47  ? 45   ARG B CG    1 
ATOM   986   C  CD    . ARG B  2 45  ? -37.552 -23.894 74.339 1.00 34.60  ? 45   ARG B CD    1 
ATOM   987   N  NE    . ARG B  2 45  ? -38.143 -23.118 75.423 1.00 38.20  ? 45   ARG B NE    1 
ATOM   988   C  CZ    . ARG B  2 45  ? -37.652 -21.969 75.889 1.00 40.13  ? 45   ARG B CZ    1 
ATOM   989   N  NH1   . ARG B  2 45  ? -36.531 -21.448 75.407 1.00 39.35  ? 45   ARG B NH1   1 
ATOM   990   N  NH2   . ARG B  2 45  ? -38.290 -21.331 76.860 1.00 43.35  ? 45   ARG B NH2   1 
ATOM   991   N  N     . ILE B  2 46  ? -37.759 -21.152 69.973 1.00 32.09  ? 46   ILE B N     1 
ATOM   992   C  CA    . ILE B  2 46  ? -37.315 -19.956 69.295 1.00 31.71  ? 46   ILE B CA    1 
ATOM   993   C  C     . ILE B  2 46  ? -37.234 -18.780 70.266 1.00 32.03  ? 46   ILE B C     1 
ATOM   994   O  O     . ILE B  2 46  ? -38.175 -18.507 71.001 1.00 32.21  ? 46   ILE B O     1 
ATOM   995   C  CB    . ILE B  2 46  ? -38.289 -19.631 68.151 1.00 31.67  ? 46   ILE B CB    1 
ATOM   996   C  CG1   . ILE B  2 46  ? -38.264 -20.747 67.101 1.00 31.75  ? 46   ILE B CG1   1 
ATOM   997   C  CG2   . ILE B  2 46  ? -38.004 -18.270 67.541 1.00 30.27  ? 46   ILE B CG2   1 
ATOM   998   C  CD1   . ILE B  2 46  ? -39.447 -20.724 66.161 1.00 31.01  ? 46   ILE B CD1   1 
ATOM   999   N  N     . SER B  2 47  ? -36.105 -18.085 70.266 1.00 32.13  ? 47   SER B N     1 
ATOM   1000  C  CA    . SER B  2 47  ? -35.943 -16.910 71.099 1.00 32.27  ? 47   SER B CA    1 
ATOM   1001  C  C     . SER B  2 47  ? -36.661 -15.707 70.515 1.00 32.47  ? 47   SER B C     1 
ATOM   1002  O  O     . SER B  2 47  ? -36.741 -15.539 69.300 1.00 32.11  ? 47   SER B O     1 
ATOM   1003  C  CB    . SER B  2 47  ? -34.471 -16.586 71.295 1.00 32.12  ? 47   SER B CB    1 
ATOM   1004  O  OG    . SER B  2 47  ? -34.303 -15.181 71.434 1.00 33.57  ? 47   SER B OG    1 
ATOM   1005  N  N     . GLY B  2 48  ? -37.134 -14.841 71.405 1.00 32.98  ? 48   GLY B N     1 
ATOM   1006  C  CA    . GLY B  2 48  ? -37.957 -13.701 71.022 1.00 33.41  ? 48   GLY B CA    1 
ATOM   1007  C  C     . GLY B  2 48  ? -37.288 -12.734 70.071 1.00 34.18  ? 48   GLY B C     1 
ATOM   1008  O  O     . GLY B  2 48  ? -37.977 -12.018 69.330 1.00 34.74  ? 48   GLY B O     1 
ATOM   1009  N  N     . LEU B  2 49  ? -35.952 -12.700 70.083 1.00 34.47  ? 49   LEU B N     1 
ATOM   1010  C  CA    . LEU B  2 49  ? -35.200 -11.783 69.213 1.00 34.27  ? 49   LEU B CA    1 
ATOM   1011  C  C     . LEU B  2 49  ? -34.912 -12.357 67.812 1.00 34.49  ? 49   LEU B C     1 
ATOM   1012  O  O     . LEU B  2 49  ? -34.474 -11.628 66.910 1.00 34.89  ? 49   LEU B O     1 
ATOM   1013  C  CB    . LEU B  2 49  ? -33.915 -11.317 69.897 1.00 34.21  ? 49   LEU B CB    1 
ATOM   1014  C  CG    . LEU B  2 49  ? -34.039 -10.464 71.173 1.00 33.29  ? 49   LEU B CG    1 
ATOM   1015  C  CD1   . LEU B  2 49  ? -32.916 -10.789 72.124 1.00 32.02  ? 49   LEU B CD1   1 
ATOM   1016  C  CD2   . LEU B  2 49  ? -34.036 -8.985  70.869 1.00 31.80  ? 49   LEU B CD2   1 
ATOM   1017  N  N     . ILE B  2 50  ? -35.192 -13.645 67.617 1.00 34.41  ? 50   ILE B N     1 
ATOM   1018  C  CA    . ILE B  2 50  ? -35.042 -14.286 66.299 1.00 34.53  ? 50   ILE B CA    1 
ATOM   1019  C  C     . ILE B  2 50  ? -35.848 -13.603 65.180 1.00 35.00  ? 50   ILE B C     1 
ATOM   1020  O  O     . ILE B  2 50  ? -35.456 -13.640 64.020 1.00 35.12  ? 50   ILE B O     1 
ATOM   1021  C  CB    . ILE B  2 50  ? -35.376 -15.795 66.377 1.00 34.16  ? 50   ILE B CB    1 
ATOM   1022  C  CG1   . ILE B  2 50  ? -34.165 -16.599 66.876 1.00 34.02  ? 50   ILE B CG1   1 
ATOM   1023  C  CG2   . ILE B  2 50  ? -35.923 -16.328 65.066 1.00 33.79  ? 50   ILE B CG2   1 
ATOM   1024  C  CD1   . ILE B  2 50  ? -32.870 -16.394 66.097 1.00 33.25  ? 50   ILE B CD1   1 
ATOM   1025  N  N     . TYR B  2 51  ? -36.951 -12.957 65.538 1.00 35.74  ? 51   TYR B N     1 
ATOM   1026  C  CA    . TYR B  2 51  ? -37.842 -12.355 64.556 1.00 36.67  ? 51   TYR B CA    1 
ATOM   1027  C  C     . TYR B  2 51  ? -37.240 -11.113 63.898 1.00 37.76  ? 51   TYR B C     1 
ATOM   1028  O  O     . TYR B  2 51  ? -37.295 -10.967 62.678 1.00 38.27  ? 51   TYR B O     1 
ATOM   1029  C  CB    . TYR B  2 51  ? -39.222 -12.102 65.168 1.00 36.18  ? 51   TYR B CB    1 
ATOM   1030  C  CG    . TYR B  2 51  ? -39.771 -13.349 65.835 1.00 36.32  ? 51   TYR B CG    1 
ATOM   1031  C  CD1   . TYR B  2 51  ? -40.229 -14.427 65.081 1.00 34.95  ? 51   TYR B CD1   1 
ATOM   1032  C  CD2   . TYR B  2 51  ? -39.786 -13.468 67.223 1.00 35.54  ? 51   TYR B CD2   1 
ATOM   1033  C  CE1   . TYR B  2 51  ? -40.696 -15.574 65.694 1.00 34.99  ? 51   TYR B CE1   1 
ATOM   1034  C  CE2   . TYR B  2 51  ? -40.248 -14.608 67.841 1.00 34.31  ? 51   TYR B CE2   1 
ATOM   1035  C  CZ    . TYR B  2 51  ? -40.705 -15.661 67.083 1.00 35.76  ? 51   TYR B CZ    1 
ATOM   1036  O  OH    . TYR B  2 51  ? -41.177 -16.807 67.721 1.00 36.50  ? 51   TYR B OH    1 
ATOM   1037  N  N     . GLU B  2 52  ? -36.638 -10.231 64.682 1.00 38.71  ? 52   GLU B N     1 
ATOM   1038  C  CA    . GLU B  2 52  ? -35.923 -9.122  64.080 1.00 39.84  ? 52   GLU B CA    1 
ATOM   1039  C  C     . GLU B  2 52  ? -34.692 -9.588  63.313 1.00 39.72  ? 52   GLU B C     1 
ATOM   1040  O  O     . GLU B  2 52  ? -34.453 -9.103  62.215 1.00 40.44  ? 52   GLU B O     1 
ATOM   1041  C  CB    . GLU B  2 52  ? -35.563 -8.045  65.100 1.00 40.24  ? 52   GLU B CB    1 
ATOM   1042  C  CG    . GLU B  2 52  ? -36.772 -7.219  65.547 1.00 43.53  ? 52   GLU B CG    1 
ATOM   1043  C  CD    . GLU B  2 52  ? -37.445 -6.497  64.394 1.00 47.56  ? 52   GLU B CD    1 
ATOM   1044  O  OE1   . GLU B  2 52  ? -38.609 -6.829  64.059 1.00 49.20  ? 52   GLU B OE1   1 
ATOM   1045  O  OE2   . GLU B  2 52  ? -36.794 -5.605  63.811 1.00 49.43  ? 52   GLU B OE2   1 
ATOM   1046  N  N     . GLU B  2 53  ? -33.921 -10.529 63.852 1.00 39.20  ? 53   GLU B N     1 
ATOM   1047  C  CA    . GLU B  2 53  ? -32.725 -10.967 63.133 1.00 38.56  ? 53   GLU B CA    1 
ATOM   1048  C  C     . GLU B  2 53  ? -33.100 -11.524 61.752 1.00 37.90  ? 53   GLU B C     1 
ATOM   1049  O  O     . GLU B  2 53  ? -32.453 -11.186 60.751 1.00 37.69  ? 53   GLU B O     1 
ATOM   1050  C  CB    . GLU B  2 53  ? -31.905 -11.969 63.950 1.00 38.65  ? 53   GLU B CB    1 
ATOM   1051  C  CG    . GLU B  2 53  ? -30.464 -12.191 63.445 1.00 41.03  ? 53   GLU B CG    1 
ATOM   1052  C  CD    . GLU B  2 53  ? -29.473 -11.041 63.790 1.00 44.56  ? 53   GLU B CD    1 
ATOM   1053  O  OE1   . GLU B  2 53  ? -29.825 -10.144 64.592 1.00 46.11  ? 53   GLU B OE1   1 
ATOM   1054  O  OE2   . GLU B  2 53  ? -28.326 -11.039 63.267 1.00 44.65  ? 53   GLU B OE2   1 
ATOM   1055  N  N     . THR B  2 54  ? -34.161 -12.339 61.707 1.00 37.02  ? 54   THR B N     1 
ATOM   1056  C  CA    . THR B  2 54  ? -34.631 -12.987 60.475 1.00 36.31  ? 54   THR B CA    1 
ATOM   1057  C  C     . THR B  2 54  ? -35.041 -11.988 59.411 1.00 36.21  ? 54   THR B C     1 
ATOM   1058  O  O     . THR B  2 54  ? -34.658 -12.109 58.253 1.00 36.41  ? 54   THR B O     1 
ATOM   1059  C  CB    . THR B  2 54  ? -35.820 -13.911 60.745 1.00 36.20  ? 54   THR B CB    1 
ATOM   1060  O  OG1   . THR B  2 54  ? -35.446 -14.877 61.728 1.00 36.96  ? 54   THR B OG1   1 
ATOM   1061  C  CG2   . THR B  2 54  ? -36.244 -14.655 59.482 1.00 35.32  ? 54   THR B CG2   1 
ATOM   1062  N  N     . ARG B  2 55  ? -35.826 -10.997 59.807 1.00 35.90  ? 55   ARG B N     1 
ATOM   1063  C  CA    . ARG B  2 55  ? -36.294 -9.985  58.876 1.00 35.30  ? 55   ARG B CA    1 
ATOM   1064  C  C     . ARG B  2 55  ? -35.125 -9.273  58.219 1.00 34.56  ? 55   ARG B C     1 
ATOM   1065  O  O     . ARG B  2 55  ? -35.109 -9.077  57.002 1.00 34.91  ? 55   ARG B O     1 
ATOM   1066  C  CB    . ARG B  2 55  ? -37.227 -9.002  59.578 1.00 35.42  ? 55   ARG B CB    1 
ATOM   1067  C  CG    . ARG B  2 55  ? -38.554 -9.635  59.947 1.00 36.45  ? 55   ARG B CG    1 
ATOM   1068  C  CD    . ARG B  2 55  ? -39.603 -8.618  60.355 1.00 38.94  ? 55   ARG B CD    1 
ATOM   1069  N  NE    . ARG B  2 55  ? -40.702 -9.295  61.040 1.00 39.65  ? 55   ARG B NE    1 
ATOM   1070  C  CZ    . ARG B  2 55  ? -40.897 -9.273  62.354 1.00 40.54  ? 55   ARG B CZ    1 
ATOM   1071  N  NH1   . ARG B  2 55  ? -40.088 -8.577  63.156 1.00 40.04  ? 55   ARG B NH1   1 
ATOM   1072  N  NH2   . ARG B  2 55  ? -41.912 -9.949  62.867 1.00 41.41  ? 55   ARG B NH2   1 
ATOM   1073  N  N     . GLY B  2 56  ? -34.134 -8.915  59.020 1.00 33.57  ? 56   GLY B N     1 
ATOM   1074  C  CA    . GLY B  2 56  ? -32.946 -8.254  58.496 1.00 32.52  ? 56   GLY B CA    1 
ATOM   1075  C  C     . GLY B  2 56  ? -32.177 -9.145  57.544 1.00 31.75  ? 56   GLY B C     1 
ATOM   1076  O  O     . GLY B  2 56  ? -31.578 -8.667  56.588 1.00 31.97  ? 56   GLY B O     1 
ATOM   1077  N  N     . VAL B  2 57  ? -32.198 -10.446 57.813 1.00 30.95  ? 57   VAL B N     1 
ATOM   1078  C  CA    . VAL B  2 57  ? -31.560 -11.427 56.959 1.00 30.05  ? 57   VAL B CA    1 
ATOM   1079  C  C     . VAL B  2 57  ? -32.306 -11.549 55.633 1.00 29.69  ? 57   VAL B C     1 
ATOM   1080  O  O     . VAL B  2 57  ? -31.684 -11.596 54.580 1.00 29.45  ? 57   VAL B O     1 
ATOM   1081  C  CB    . VAL B  2 57  ? -31.431 -12.780 57.693 1.00 29.75  ? 57   VAL B CB    1 
ATOM   1082  C  CG1   . VAL B  2 57  ? -31.280 -13.930 56.744 1.00 29.95  ? 57   VAL B CG1   1 
ATOM   1083  C  CG2   . VAL B  2 57  ? -30.250 -12.738 58.598 1.00 30.47  ? 57   VAL B CG2   1 
ATOM   1084  N  N     . LEU B  2 58  ? -33.634 -11.583 55.689 1.00 29.65  ? 58   LEU B N     1 
ATOM   1085  C  CA    . LEU B  2 58  ? -34.450 -11.693 54.484 1.00 29.61  ? 58   LEU B CA    1 
ATOM   1086  C  C     . LEU B  2 58  ? -34.279 -10.472 53.622 1.00 29.91  ? 58   LEU B C     1 
ATOM   1087  O  O     . LEU B  2 58  ? -34.220 -10.576 52.390 1.00 30.40  ? 58   LEU B O     1 
ATOM   1088  C  CB    . LEU B  2 58  ? -35.923 -11.835 54.825 1.00 29.58  ? 58   LEU B CB    1 
ATOM   1089  C  CG    . LEU B  2 58  ? -36.888 -12.051 53.660 1.00 29.97  ? 58   LEU B CG    1 
ATOM   1090  C  CD1   . LEU B  2 58  ? -36.380 -13.097 52.674 1.00 29.79  ? 58   LEU B CD1   1 
ATOM   1091  C  CD2   . LEU B  2 58  ? -38.243 -12.460 54.192 1.00 31.31  ? 58   LEU B CD2   1 
ATOM   1092  N  N     . LYS B  2 59  ? -34.206 -9.308  54.259 1.00 29.56  ? 59   LYS B N     1 
ATOM   1093  C  CA    . LYS B  2 59  ? -34.062 -8.095  53.501 1.00 29.66  ? 59   LYS B CA    1 
ATOM   1094  C  C     . LYS B  2 59  ? -32.749 -8.114  52.722 1.00 29.38  ? 59   LYS B C     1 
ATOM   1095  O  O     . LYS B  2 59  ? -32.735 -7.766  51.549 1.00 29.93  ? 59   LYS B O     1 
ATOM   1096  C  CB    . LYS B  2 59  ? -34.209 -6.861  54.390 1.00 30.09  ? 59   LYS B CB    1 
ATOM   1097  C  CG    . LYS B  2 59  ? -34.321 -5.547  53.604 1.00 32.70  ? 59   LYS B CG    1 
ATOM   1098  C  CD    . LYS B  2 59  ? -35.058 -4.442  54.388 1.00 36.80  ? 59   LYS B CD    1 
ATOM   1099  C  CE    . LYS B  2 59  ? -34.137 -3.726  55.386 1.00 38.71  ? 59   LYS B CE    1 
ATOM   1100  N  NZ    . LYS B  2 59  ? -33.142 -2.859  54.674 1.00 40.70  ? 59   LYS B NZ    1 
ATOM   1101  N  N     . VAL B  2 60  ? -31.659 -8.552  53.352 1.00 28.80  ? 60   VAL B N     1 
ATOM   1102  C  CA    . VAL B  2 60  ? -30.342 -8.618  52.688 1.00 27.69  ? 60   VAL B CA    1 
ATOM   1103  C  C     . VAL B  2 60  ? -30.321 -9.622  51.513 1.00 27.87  ? 60   VAL B C     1 
ATOM   1104  O  O     . VAL B  2 60  ? -29.713 -9.360  50.471 1.00 28.12  ? 60   VAL B O     1 
ATOM   1105  C  CB    . VAL B  2 60  ? -29.225 -8.928  53.713 1.00 27.47  ? 60   VAL B CB    1 
ATOM   1106  C  CG1   . VAL B  2 60  ? -28.026 -9.569  53.042 1.00 27.00  ? 60   VAL B CG1   1 
ATOM   1107  C  CG2   . VAL B  2 60  ? -28.833 -7.692  54.464 1.00 25.24  ? 60   VAL B CG2   1 
ATOM   1108  N  N     . PHE B  2 61  ? -30.984 -10.762 51.684 1.00 27.75  ? 61   PHE B N     1 
ATOM   1109  C  CA    . PHE B  2 61  ? -31.150 -11.729 50.612 1.00 28.12  ? 61   PHE B CA    1 
ATOM   1110  C  C     . PHE B  2 61  ? -31.838 -11.070 49.413 1.00 28.67  ? 61   PHE B C     1 
ATOM   1111  O  O     . PHE B  2 61  ? -31.312 -11.112 48.292 1.00 28.88  ? 61   PHE B O     1 
ATOM   1112  C  CB    . PHE B  2 61  ? -31.953 -12.936 51.109 1.00 27.94  ? 61   PHE B CB    1 
ATOM   1113  C  CG    . PHE B  2 61  ? -32.126 -14.035 50.084 1.00 28.61  ? 61   PHE B CG    1 
ATOM   1114  C  CD1   . PHE B  2 61  ? -31.143 -15.017 49.911 1.00 29.00  ? 61   PHE B CD1   1 
ATOM   1115  C  CD2   . PHE B  2 61  ? -33.284 -14.109 49.302 1.00 28.69  ? 61   PHE B CD2   1 
ATOM   1116  C  CE1   . PHE B  2 61  ? -31.301 -16.047 48.956 1.00 27.82  ? 61   PHE B CE1   1 
ATOM   1117  C  CE2   . PHE B  2 61  ? -33.450 -15.132 48.347 1.00 27.74  ? 61   PHE B CE2   1 
ATOM   1118  C  CZ    . PHE B  2 61  ? -32.455 -16.102 48.180 1.00 27.66  ? 61   PHE B CZ    1 
ATOM   1119  N  N     . LEU B  2 62  ? -32.987 -10.438 49.656 1.00 29.12  ? 62   LEU B N     1 
ATOM   1120  C  CA    . LEU B  2 62  ? -33.810 -9.894  48.573 1.00 30.00  ? 62   LEU B CA    1 
ATOM   1121  C  C     . LEU B  2 62  ? -33.138 -8.756  47.829 1.00 30.61  ? 62   LEU B C     1 
ATOM   1122  O  O     . LEU B  2 62  ? -33.137 -8.747  46.601 1.00 31.22  ? 62   LEU B O     1 
ATOM   1123  C  CB    . LEU B  2 62  ? -35.196 -9.474  49.057 1.00 30.00  ? 62   LEU B CB    1 
ATOM   1124  C  CG    . LEU B  2 62  ? -36.119 -10.600 49.534 1.00 30.66  ? 62   LEU B CG    1 
ATOM   1125  C  CD1   . LEU B  2 62  ? -37.370 -10.022 50.158 1.00 31.46  ? 62   LEU B CD1   1 
ATOM   1126  C  CD2   . LEU B  2 62  ? -36.488 -11.553 48.413 1.00 30.25  ? 62   LEU B CD2   1 
ATOM   1127  N  N     . GLU B  2 63  ? -32.557 -7.810  48.561 1.00 31.04  ? 63   GLU B N     1 
ATOM   1128  C  CA    . GLU B  2 63  ? -31.766 -6.736  47.955 1.00 31.58  ? 63   GLU B CA    1 
ATOM   1129  C  C     . GLU B  2 63  ? -30.727 -7.307  47.013 1.00 31.39  ? 63   GLU B C     1 
ATOM   1130  O  O     . GLU B  2 63  ? -30.649 -6.909  45.849 1.00 31.77  ? 63   GLU B O     1 
ATOM   1131  C  CB    . GLU B  2 63  ? -31.056 -5.915  49.020 1.00 31.93  ? 63   GLU B CB    1 
ATOM   1132  C  CG    . GLU B  2 63  ? -31.984 -5.309  50.046 1.00 35.18  ? 63   GLU B CG    1 
ATOM   1133  C  CD    . GLU B  2 63  ? -31.253 -4.528  51.119 1.00 40.88  ? 63   GLU B CD    1 
ATOM   1134  O  OE1   . GLU B  2 63  ? -30.056 -4.810  51.395 1.00 41.33  ? 63   GLU B OE1   1 
ATOM   1135  O  OE2   . GLU B  2 63  ? -31.892 -3.621  51.701 1.00 44.82  ? 63   GLU B OE2   1 
ATOM   1136  N  N     . ASN B  2 64  ? -29.951 -8.265  47.509 1.00 30.99  ? 64   ASN B N     1 
ATOM   1137  C  CA    . ASN B  2 64  ? -28.903 -8.868  46.702 1.00 30.56  ? 64   ASN B CA    1 
ATOM   1138  C  C     . ASN B  2 64  ? -29.449 -9.433  45.417 1.00 30.43  ? 64   ASN B C     1 
ATOM   1139  O  O     . ASN B  2 64  ? -28.907 -9.158  44.350 1.00 30.36  ? 64   ASN B O     1 
ATOM   1140  C  CB    . ASN B  2 64  ? -28.138 -9.931  47.487 1.00 30.48  ? 64   ASN B CB    1 
ATOM   1141  C  CG    . ASN B  2 64  ? -27.097 -9.331  48.405 1.00 30.42  ? 64   ASN B CG    1 
ATOM   1142  O  OD1   . ASN B  2 64  ? -26.769 -8.152  48.300 1.00 32.01  ? 64   ASN B OD1   1 
ATOM   1143  N  ND2   . ASN B  2 64  ? -26.570 -10.133 49.308 1.00 31.11  ? 64   ASN B ND2   1 
ATOM   1144  N  N     . VAL B  2 65  ? -30.534 -10.199 45.518 1.00 30.22  ? 65   VAL B N     1 
ATOM   1145  C  CA    . VAL B  2 65  ? -31.129 -10.821 44.343 1.00 30.05  ? 65   VAL B CA    1 
ATOM   1146  C  C     . VAL B  2 65  ? -31.817 -9.810  43.417 1.00 30.13  ? 65   VAL B C     1 
ATOM   1147  O  O     . VAL B  2 65  ? -31.604 -9.830  42.204 1.00 30.25  ? 65   VAL B O     1 
ATOM   1148  C  CB    . VAL B  2 65  ? -32.103 -11.935 44.721 1.00 29.75  ? 65   VAL B CB    1 
ATOM   1149  C  CG1   . VAL B  2 65  ? -32.718 -12.527 43.477 1.00 29.56  ? 65   VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B  2 65  ? -31.377 -13.014 45.466 1.00 30.55  ? 65   VAL B CG2   1 
ATOM   1151  N  N     . ILE B  2 66  ? -32.625 -8.930  43.996 1.00 30.02  ? 66   ILE B N     1 
ATOM   1152  C  CA    . ILE B  2 66  ? -33.436 -7.991  43.228 1.00 29.99  ? 66   ILE B CA    1 
ATOM   1153  C  C     . ILE B  2 66  ? -32.548 -7.015  42.451 1.00 30.82  ? 66   ILE B C     1 
ATOM   1154  O  O     . ILE B  2 66  ? -32.795 -6.741  41.275 1.00 30.43  ? 66   ILE B O     1 
ATOM   1155  C  CB    . ILE B  2 66  ? -34.468 -7.265  44.148 1.00 29.54  ? 66   ILE B CB    1 
ATOM   1156  C  CG1   . ILE B  2 66  ? -35.588 -8.233  44.515 1.00 28.07  ? 66   ILE B CG1   1 
ATOM   1157  C  CG2   . ILE B  2 66  ? -35.027 -6.036  43.485 1.00 28.26  ? 66   ILE B CG2   1 
ATOM   1158  C  CD1   . ILE B  2 66  ? -36.388 -7.810  45.681 1.00 26.78  ? 66   ILE B CD1   1 
ATOM   1159  N  N     . ARG B  2 67  ? -31.504 -6.519  43.115 1.00 31.68  ? 67   ARG B N     1 
ATOM   1160  C  CA    . ARG B  2 67  ? -30.501 -5.678  42.475 1.00 32.70  ? 67   ARG B CA    1 
ATOM   1161  C  C     . ARG B  2 67  ? -30.068 -6.339  41.170 1.00 32.31  ? 67   ARG B C     1 
ATOM   1162  O  O     . ARG B  2 67  ? -30.111 -5.729  40.111 1.00 32.80  ? 67   ARG B O     1 
ATOM   1163  C  CB    . ARG B  2 67  ? -29.303 -5.503  43.409 1.00 32.35  ? 67   ARG B CB    1 
ATOM   1164  C  CG    . ARG B  2 67  ? -28.323 -4.410  43.022 1.00 34.16  ? 67   ARG B CG    1 
ATOM   1165  C  CD    . ARG B  2 67  ? -27.056 -4.455  43.900 1.00 35.21  ? 67   ARG B CD    1 
ATOM   1166  N  NE    . ARG B  2 67  ? -27.174 -3.661  45.134 1.00 41.18  ? 67   ARG B NE    1 
ATOM   1167  C  CZ    . ARG B  2 67  ? -27.281 -4.157  46.373 1.00 43.19  ? 67   ARG B CZ    1 
ATOM   1168  N  NH1   . ARG B  2 67  ? -27.292 -5.473  46.594 1.00 44.08  ? 67   ARG B NH1   1 
ATOM   1169  N  NH2   . ARG B  2 67  ? -27.385 -3.324  47.405 1.00 43.77  ? 67   ARG B NH2   1 
ATOM   1170  N  N     . ASP B  2 68  ? -29.688 -7.604  41.248 1.00 32.16  ? 68   ASP B N     1 
ATOM   1171  C  CA    . ASP B  2 68  ? -29.182 -8.304  40.085 1.00 32.27  ? 68   ASP B CA    1 
ATOM   1172  C  C     . ASP B  2 68  ? -30.271 -8.462  39.018 1.00 31.76  ? 68   ASP B C     1 
ATOM   1173  O  O     . ASP B  2 68  ? -29.992 -8.320  37.828 1.00 31.43  ? 68   ASP B O     1 
ATOM   1174  C  CB    . ASP B  2 68  ? -28.564 -9.653  40.480 1.00 32.43  ? 68   ASP B CB    1 
ATOM   1175  C  CG    . ASP B  2 68  ? -27.099 -9.535  40.970 1.00 34.43  ? 68   ASP B CG    1 
ATOM   1176  O  OD1   . ASP B  2 68  ? -26.611 -8.416  41.259 1.00 36.30  ? 68   ASP B OD1   1 
ATOM   1177  O  OD2   . ASP B  2 68  ? -26.421 -10.586 41.080 1.00 36.72  ? 68   ASP B OD2   1 
ATOM   1178  N  N     . ALA B  2 69  ? -31.500 -8.749  39.457 1.00 31.28  ? 69   ALA B N     1 
ATOM   1179  C  CA    . ALA B  2 69  ? -32.647 -8.970  38.555 1.00 30.17  ? 69   ALA B CA    1 
ATOM   1180  C  C     . ALA B  2 69  ? -33.006 -7.666  37.867 1.00 29.65  ? 69   ALA B C     1 
ATOM   1181  O  O     . ALA B  2 69  ? -33.127 -7.612  36.650 1.00 29.62  ? 69   ALA B O     1 
ATOM   1182  C  CB    . ALA B  2 69  ? -33.850 -9.536  39.307 1.00 29.46  ? 69   ALA B CB    1 
ATOM   1183  N  N     . VAL B  2 70  ? -33.143 -6.607  38.642 1.00 28.96  ? 70   VAL B N     1 
ATOM   1184  C  CA    . VAL B  2 70  ? -33.395 -5.315  38.061 1.00 29.06  ? 70   VAL B CA    1 
ATOM   1185  C  C     . VAL B  2 70  ? -32.266 -4.884  37.112 1.00 29.51  ? 70   VAL B C     1 
ATOM   1186  O  O     . VAL B  2 70  ? -32.489 -4.086  36.193 1.00 29.86  ? 70   VAL B O     1 
ATOM   1187  C  CB    . VAL B  2 70  ? -33.661 -4.266  39.143 1.00 28.79  ? 70   VAL B CB    1 
ATOM   1188  C  CG1   . VAL B  2 70  ? -33.563 -2.872  38.579 1.00 28.87  ? 70   VAL B CG1   1 
ATOM   1189  C  CG2   . VAL B  2 70  ? -35.037 -4.492  39.742 1.00 28.65  ? 70   VAL B CG2   1 
ATOM   1190  N  N     . THR B  2 71  ? -31.065 -5.416  37.311 1.00 29.48  ? 71   THR B N     1 
ATOM   1191  C  CA    . THR B  2 71  ? -29.967 -5.040  36.450 1.00 29.46  ? 71   THR B CA    1 
ATOM   1192  C  C     . THR B  2 71  ? -30.098 -5.691  35.109 1.00 29.83  ? 71   THR B C     1 
ATOM   1193  O  O     . THR B  2 71  ? -29.789 -5.084  34.094 1.00 30.46  ? 71   THR B O     1 
ATOM   1194  C  CB    . THR B  2 71  ? -28.624 -5.350  37.060 1.00 29.27  ? 71   THR B CB    1 
ATOM   1195  O  OG1   . THR B  2 71  ? -28.294 -4.291  37.947 1.00 29.85  ? 71   THR B OG1   1 
ATOM   1196  C  CG2   . THR B  2 71  ? -27.555 -5.389  36.004 1.00 29.32  ? 71   THR B CG2   1 
ATOM   1197  N  N     . TYR B  2 72  ? -30.550 -6.933  35.107 1.00 30.34  ? 72   TYR B N     1 
ATOM   1198  C  CA    . TYR B  2 72  ? -30.849 -7.624  33.877 1.00 30.99  ? 72   TYR B CA    1 
ATOM   1199  C  C     . TYR B  2 72  ? -32.017 -6.959  33.166 1.00 32.24  ? 72   TYR B C     1 
ATOM   1200  O  O     . TYR B  2 72  ? -32.087 -6.978  31.951 1.00 32.47  ? 72   TYR B O     1 
ATOM   1201  C  CB    . TYR B  2 72  ? -31.213 -9.058  34.169 1.00 30.18  ? 72   TYR B CB    1 
ATOM   1202  C  CG    . TYR B  2 72  ? -30.036 -9.962  34.408 1.00 29.91  ? 72   TYR B CG    1 
ATOM   1203  C  CD1   . TYR B  2 72  ? -29.887 -10.632 35.622 1.00 29.73  ? 72   TYR B CD1   1 
ATOM   1204  C  CD2   . TYR B  2 72  ? -29.091 -10.180 33.415 1.00 29.37  ? 72   TYR B CD2   1 
ATOM   1205  C  CE1   . TYR B  2 72  ? -28.823 -11.480 35.840 1.00 28.91  ? 72   TYR B CE1   1 
ATOM   1206  C  CE2   . TYR B  2 72  ? -28.023 -11.031 33.624 1.00 29.77  ? 72   TYR B CE2   1 
ATOM   1207  C  CZ    . TYR B  2 72  ? -27.895 -11.672 34.844 1.00 28.72  ? 72   TYR B CZ    1 
ATOM   1208  O  OH    . TYR B  2 72  ? -26.843 -12.511 35.054 1.00 28.36  ? 72   TYR B OH    1 
ATOM   1209  N  N     . THR B  2 73  ? -32.935 -6.387  33.944 1.00 33.85  ? 73   THR B N     1 
ATOM   1210  C  CA    . THR B  2 73  ? -34.128 -5.737  33.423 1.00 34.56  ? 73   THR B CA    1 
ATOM   1211  C  C     . THR B  2 73  ? -33.738 -4.449  32.706 1.00 35.56  ? 73   THR B C     1 
ATOM   1212  O  O     . THR B  2 73  ? -34.087 -4.276  31.532 1.00 35.96  ? 73   THR B O     1 
ATOM   1213  C  CB    . THR B  2 73  ? -35.174 -5.488  34.537 1.00 34.20  ? 73   THR B CB    1 
ATOM   1214  O  OG1   . THR B  2 73  ? -35.632 -6.751  35.033 1.00 34.39  ? 73   THR B OG1   1 
ATOM   1215  C  CG2   . THR B  2 73  ? -36.380 -4.720  33.998 1.00 33.61  ? 73   THR B CG2   1 
ATOM   1216  N  N     . GLU B  2 74  ? -33.000 -3.572  33.395 1.00 36.26  ? 74   GLU B N     1 
ATOM   1217  C  CA    . GLU B  2 74  ? -32.471 -2.339  32.792 1.00 37.59  ? 74   GLU B CA    1 
ATOM   1218  C  C     . GLU B  2 74  ? -31.745 -2.653  31.485 1.00 37.03  ? 74   GLU B C     1 
ATOM   1219  O  O     . GLU B  2 74  ? -31.926 -1.956  30.483 1.00 37.00  ? 74   GLU B O     1 
ATOM   1220  C  CB    . GLU B  2 74  ? -31.513 -1.581  33.741 1.00 37.43  ? 74   GLU B CB    1 
ATOM   1221  C  CG    . GLU B  2 74  ? -32.158 -0.994  35.019 1.00 39.89  ? 74   GLU B CG    1 
ATOM   1222  C  CD    . GLU B  2 74  ? -31.164 -0.241  35.957 1.00 40.42  ? 74   GLU B CD    1 
ATOM   1223  O  OE1   . GLU B  2 74  ? -30.047 -0.760  36.235 1.00 43.53  ? 74   GLU B OE1   1 
ATOM   1224  O  OE2   . GLU B  2 74  ? -31.518 0.871   36.437 1.00 43.48  ? 74   GLU B OE2   1 
ATOM   1225  N  N     . HIS B  2 75  ? -30.939 -3.714  31.498 1.00 36.72  ? 75   HIS B N     1 
ATOM   1226  C  CA    . HIS B  2 75  ? -30.115 -4.036  30.347 1.00 36.48  ? 75   HIS B CA    1 
ATOM   1227  C  C     . HIS B  2 75  ? -30.963 -4.295  29.111 1.00 36.74  ? 75   HIS B C     1 
ATOM   1228  O  O     . HIS B  2 75  ? -30.608 -3.879  28.008 1.00 37.20  ? 75   HIS B O     1 
ATOM   1229  C  CB    . HIS B  2 75  ? -29.205 -5.228  30.614 1.00 35.76  ? 75   HIS B CB    1 
ATOM   1230  C  CG    . HIS B  2 75  ? -28.368 -5.606  29.436 1.00 34.66  ? 75   HIS B CG    1 
ATOM   1231  N  ND1   . HIS B  2 75  ? -27.172 -4.988  29.148 1.00 33.43  ? 75   HIS B ND1   1 
ATOM   1232  C  CD2   . HIS B  2 75  ? -28.561 -6.523  28.458 1.00 34.32  ? 75   HIS B CD2   1 
ATOM   1233  C  CE1   . HIS B  2 75  ? -26.651 -5.524  28.057 1.00 33.20  ? 75   HIS B CE1   1 
ATOM   1234  N  NE2   . HIS B  2 75  ? -27.475 -6.455  27.615 1.00 32.43  ? 75   HIS B NE2   1 
ATOM   1235  N  N     . ALA B  2 76  ? -32.082 -4.977  29.301 1.00 36.77  ? 76   ALA B N     1 
ATOM   1236  C  CA    . ALA B  2 76  ? -32.916 -5.370  28.192 1.00 37.33  ? 76   ALA B CA    1 
ATOM   1237  C  C     . ALA B  2 76  ? -33.898 -4.240  27.857 1.00 37.83  ? 76   ALA B C     1 
ATOM   1238  O  O     . ALA B  2 76  ? -34.805 -4.398  27.034 1.00 38.09  ? 76   ALA B O     1 
ATOM   1239  C  CB    . ALA B  2 76  ? -33.644 -6.679  28.520 1.00 37.13  ? 76   ALA B CB    1 
ATOM   1240  N  N     . LYS B  2 77  ? -33.715 -3.093  28.503 1.00 38.27  ? 77   LYS B N     1 
ATOM   1241  C  CA    . LYS B  2 77  ? -34.587 -1.937  28.293 1.00 38.78  ? 77   LYS B CA    1 
ATOM   1242  C  C     . LYS B  2 77  ? -36.080 -2.275  28.504 1.00 38.29  ? 77   LYS B C     1 
ATOM   1243  O  O     . LYS B  2 77  ? -36.933 -1.868  27.717 1.00 38.86  ? 77   LYS B O     1 
ATOM   1244  C  CB    . LYS B  2 77  ? -34.378 -1.360  26.886 1.00 39.22  ? 77   LYS B CB    1 
ATOM   1245  C  CG    . LYS B  2 77  ? -32.932 -1.242  26.414 1.00 42.28  ? 77   LYS B CG    1 
ATOM   1246  C  CD    . LYS B  2 77  ? -32.771 -1.938  25.029 1.00 47.04  ? 77   LYS B CD    1 
ATOM   1247  C  CE    . LYS B  2 77  ? -32.026 -1.059  23.983 1.00 49.76  ? 77   LYS B CE    1 
ATOM   1248  N  NZ    . LYS B  2 77  ? -30.692 -0.533  24.438 1.00 50.41  ? 77   LYS B NZ    1 
ATOM   1249  N  N     . ARG B  2 78  ? -36.399 -3.021  29.554 1.00 37.35  ? 78   ARG B N     1 
ATOM   1250  C  CA    . ARG B  2 78  ? -37.785 -3.307  29.871 1.00 36.46  ? 78   ARG B CA    1 
ATOM   1251  C  C     . ARG B  2 78  ? -38.178 -2.561  31.126 1.00 36.61  ? 78   ARG B C     1 
ATOM   1252  O  O     . ARG B  2 78  ? -37.344 -1.929  31.761 1.00 36.88  ? 78   ARG B O     1 
ATOM   1253  C  CB    . ARG B  2 78  ? -37.995 -4.801  30.064 1.00 36.26  ? 78   ARG B CB    1 
ATOM   1254  C  CG    . ARG B  2 78  ? -37.764 -5.620  28.824 1.00 35.79  ? 78   ARG B CG    1 
ATOM   1255  C  CD    . ARG B  2 78  ? -38.238 -7.040  29.005 1.00 35.49  ? 78   ARG B CD    1 
ATOM   1256  N  NE    . ARG B  2 78  ? -37.139 -7.957  29.282 1.00 36.64  ? 78   ARG B NE    1 
ATOM   1257  C  CZ    . ARG B  2 78  ? -36.666 -8.218  30.496 1.00 36.68  ? 78   ARG B CZ    1 
ATOM   1258  N  NH1   . ARG B  2 78  ? -37.199 -7.630  31.560 1.00 37.89  ? 78   ARG B NH1   1 
ATOM   1259  N  NH2   . ARG B  2 78  ? -35.660 -9.069  30.647 1.00 35.86  ? 78   ARG B NH2   1 
ATOM   1260  N  N     . LYS B  2 79  ? -39.456 -2.621  31.477 1.00 36.83  ? 79   LYS B N     1 
ATOM   1261  C  CA    . LYS B  2 79  ? -39.950 -2.014  32.703 1.00 37.15  ? 79   LYS B CA    1 
ATOM   1262  C  C     . LYS B  2 79  ? -40.599 -3.100  33.545 1.00 36.98  ? 79   LYS B C     1 
ATOM   1263  O  O     . LYS B  2 79  ? -41.077 -2.843  34.654 1.00 37.44  ? 79   LYS B O     1 
ATOM   1264  C  CB    . LYS B  2 79  ? -40.945 -0.895  32.387 1.00 37.62  ? 79   LYS B CB    1 
ATOM   1265  C  CG    . LYS B  2 79  ? -40.365 0.184   31.502 1.00 39.53  ? 79   LYS B CG    1 
ATOM   1266  C  CD    . LYS B  2 79  ? -41.322 1.327   31.293 1.00 44.29  ? 79   LYS B CD    1 
ATOM   1267  C  CE    . LYS B  2 79  ? -40.892 2.154   30.070 1.00 47.91  ? 79   LYS B CE    1 
ATOM   1268  N  NZ    . LYS B  2 79  ? -41.606 3.481   29.963 1.00 49.20  ? 79   LYS B NZ    1 
ATOM   1269  N  N     . THR B  2 80  ? -40.603 -4.317  33.009 1.00 36.52  ? 80   THR B N     1 
ATOM   1270  C  CA    . THR B  2 80  ? -41.086 -5.491  33.724 1.00 36.47  ? 80   THR B CA    1 
ATOM   1271  C  C     . THR B  2 80  ? -39.947 -6.433  34.118 1.00 35.68  ? 80   THR B C     1 
ATOM   1272  O  O     . THR B  2 80  ? -39.183 -6.908  33.261 1.00 35.53  ? 80   THR B O     1 
ATOM   1273  C  CB    . THR B  2 80  ? -42.083 -6.302  32.859 1.00 37.07  ? 80   THR B CB    1 
ATOM   1274  O  OG1   . THR B  2 80  ? -43.064 -5.419  32.298 1.00 39.27  ? 80   THR B OG1   1 
ATOM   1275  C  CG2   . THR B  2 80  ? -42.773 -7.405  33.683 1.00 36.03  ? 80   THR B CG2   1 
ATOM   1276  N  N     . VAL B  2 81  ? -39.849 -6.708  35.415 1.00 34.64  ? 81   VAL B N     1 
ATOM   1277  C  CA    . VAL B  2 81  ? -38.993 -7.770  35.902 1.00 33.72  ? 81   VAL B CA    1 
ATOM   1278  C  C     . VAL B  2 81  ? -39.685 -9.069  35.544 1.00 33.25  ? 81   VAL B C     1 
ATOM   1279  O  O     . VAL B  2 81  ? -40.851 -9.272  35.885 1.00 33.05  ? 81   VAL B O     1 
ATOM   1280  C  CB    . VAL B  2 81  ? -38.786 -7.680  37.416 1.00 33.82  ? 81   VAL B CB    1 
ATOM   1281  C  CG1   . VAL B  2 81  ? -37.756 -8.717  37.883 1.00 34.34  ? 81   VAL B CG1   1 
ATOM   1282  C  CG2   . VAL B  2 81  ? -38.336 -6.288  37.800 1.00 33.20  ? 81   VAL B CG2   1 
ATOM   1283  N  N     . THR B  2 82  ? -38.978 -9.933  34.827 1.00 32.98  ? 82   THR B N     1 
ATOM   1284  C  CA    . THR B  2 82  ? -39.548 -11.211 34.400 1.00 32.99  ? 82   THR B CA    1 
ATOM   1285  C  C     . THR B  2 82  ? -38.961 -12.360 35.196 1.00 33.01  ? 82   THR B C     1 
ATOM   1286  O  O     . THR B  2 82  ? -37.895 -12.239 35.793 1.00 33.10  ? 82   THR B O     1 
ATOM   1287  C  CB    . THR B  2 82  ? -39.322 -11.467 32.904 1.00 32.87  ? 82   THR B CB    1 
ATOM   1288  O  OG1   . THR B  2 82  ? -37.920 -11.607 32.646 1.00 32.25  ? 82   THR B OG1   1 
ATOM   1289  C  CG2   . THR B  2 82  ? -39.873 -10.287 32.084 1.00 33.46  ? 82   THR B CG2   1 
ATOM   1290  N  N     . ALA B  2 83  ? -39.664 -13.481 35.210 1.00 33.13  ? 83   ALA B N     1 
ATOM   1291  C  CA    . ALA B  2 83  ? -39.208 -14.628 35.957 1.00 32.77  ? 83   ALA B CA    1 
ATOM   1292  C  C     . ALA B  2 83  ? -37.780 -14.929 35.541 1.00 32.74  ? 83   ALA B C     1 
ATOM   1293  O  O     . ALA B  2 83  ? -36.939 -15.141 36.410 1.00 33.19  ? 83   ALA B O     1 
ATOM   1294  C  CB    . ALA B  2 83  ? -40.119 -15.817 35.730 1.00 32.91  ? 83   ALA B CB    1 
ATOM   1295  N  N     . MET B  2 84  ? -37.498 -14.904 34.232 1.00 32.45  ? 84   MET B N     1 
ATOM   1296  C  CA    . MET B  2 84  ? -36.144 -15.145 33.720 1.00 32.44  ? 84   MET B CA    1 
ATOM   1297  C  C     . MET B  2 84  ? -35.094 -14.244 34.361 1.00 32.12  ? 84   MET B C     1 
ATOM   1298  O  O     . MET B  2 84  ? -34.020 -14.727 34.734 1.00 32.13  ? 84   MET B O     1 
ATOM   1299  C  CB    . MET B  2 84  ? -36.056 -15.000 32.203 1.00 32.86  ? 84   MET B CB    1 
ATOM   1300  C  CG    . MET B  2 84  ? -36.565 -16.180 31.405 1.00 34.13  ? 84   MET B CG    1 
ATOM   1301  S  SD    . MET B  2 84  ? -36.257 -17.761 32.198 1.00 40.69  ? 84   MET B SD    1 
ATOM   1302  C  CE    . MET B  2 84  ? -34.474 -17.913 32.114 1.00 38.95  ? 84   MET B CE    1 
ATOM   1303  N  N     . ASP B  2 85  ? -35.407 -12.956 34.501 1.00 31.22  ? 85   ASP B N     1 
ATOM   1304  C  CA    . ASP B  2 85  ? -34.518 -12.022 35.175 1.00 31.38  ? 85   ASP B CA    1 
ATOM   1305  C  C     . ASP B  2 85  ? -34.181 -12.460 36.599 1.00 31.01  ? 85   ASP B C     1 
ATOM   1306  O  O     . ASP B  2 85  ? -33.075 -12.204 37.088 1.00 31.29  ? 85   ASP B O     1 
ATOM   1307  C  CB    . ASP B  2 85  ? -35.135 -10.628 35.244 1.00 32.19  ? 85   ASP B CB    1 
ATOM   1308  C  CG    . ASP B  2 85  ? -35.222 -9.945  33.888 1.00 34.80  ? 85   ASP B CG    1 
ATOM   1309  O  OD1   . ASP B  2 85  ? -34.481 -10.366 32.952 1.00 38.81  ? 85   ASP B OD1   1 
ATOM   1310  O  OD2   . ASP B  2 85  ? -36.021 -8.980  33.775 1.00 34.07  ? 85   ASP B OD2   1 
ATOM   1311  N  N     . VAL B  2 86  ? -35.143 -13.094 37.265 1.00 30.10  ? 86   VAL B N     1 
ATOM   1312  C  CA    . VAL B  2 86  ? -35.007 -13.508 38.661 1.00 28.99  ? 86   VAL B CA    1 
ATOM   1313  C  C     . VAL B  2 86  ? -34.211 -14.798 38.677 1.00 28.79  ? 86   VAL B C     1 
ATOM   1314  O  O     . VAL B  2 86  ? -33.250 -14.936 39.432 1.00 28.88  ? 86   VAL B O     1 
ATOM   1315  C  CB    . VAL B  2 86  ? -36.407 -13.673 39.353 1.00 28.94  ? 86   VAL B CB    1 
ATOM   1316  C  CG1   . VAL B  2 86  ? -36.323 -14.465 40.634 1.00 27.84  ? 86   VAL B CG1   1 
ATOM   1317  C  CG2   . VAL B  2 86  ? -37.023 -12.319 39.622 1.00 28.28  ? 86   VAL B CG2   1 
ATOM   1318  N  N     . VAL B  2 87  ? -34.598 -15.725 37.811 1.00 28.10  ? 87   VAL B N     1 
ATOM   1319  C  CA    . VAL B  2 87  ? -33.872 -16.978 37.632 1.00 27.41  ? 87   VAL B CA    1 
ATOM   1320  C  C     . VAL B  2 87  ? -32.391 -16.792 37.303 1.00 27.33  ? 87   VAL B C     1 
ATOM   1321  O  O     . VAL B  2 87  ? -31.565 -17.550 37.788 1.00 27.17  ? 87   VAL B O     1 
ATOM   1322  C  CB    . VAL B  2 87  ? -34.566 -17.844 36.570 1.00 27.31  ? 87   VAL B CB    1 
ATOM   1323  C  CG1   . VAL B  2 87  ? -33.730 -19.066 36.189 1.00 26.20  ? 87   VAL B CG1   1 
ATOM   1324  C  CG2   . VAL B  2 87  ? -35.933 -18.249 37.075 1.00 26.51  ? 87   VAL B CG2   1 
ATOM   1325  N  N     . TYR B  2 88  ? -32.047 -15.793 36.501 1.00 27.85  ? 88   TYR B N     1 
ATOM   1326  C  CA    . TYR B  2 88  ? -30.637 -15.574 36.169 1.00 28.62  ? 88   TYR B CA    1 
ATOM   1327  C  C     . TYR B  2 88  ? -29.865 -14.955 37.329 1.00 28.45  ? 88   TYR B C     1 
ATOM   1328  O  O     . TYR B  2 88  ? -28.687 -15.257 37.519 1.00 28.47  ? 88   TYR B O     1 
ATOM   1329  C  CB    . TYR B  2 88  ? -30.459 -14.691 34.934 1.00 29.75  ? 88   TYR B CB    1 
ATOM   1330  C  CG    . TYR B  2 88  ? -30.981 -15.250 33.629 1.00 30.69  ? 88   TYR B CG    1 
ATOM   1331  C  CD1   . TYR B  2 88  ? -31.643 -14.419 32.735 1.00 31.40  ? 88   TYR B CD1   1 
ATOM   1332  C  CD2   . TYR B  2 88  ? -30.811 -16.587 33.286 1.00 31.24  ? 88   TYR B CD2   1 
ATOM   1333  C  CE1   . TYR B  2 88  ? -32.131 -14.882 31.538 1.00 31.93  ? 88   TYR B CE1   1 
ATOM   1334  C  CE2   . TYR B  2 88  ? -31.297 -17.074 32.076 1.00 32.69  ? 88   TYR B CE2   1 
ATOM   1335  C  CZ    . TYR B  2 88  ? -31.964 -16.200 31.207 1.00 32.97  ? 88   TYR B CZ    1 
ATOM   1336  O  OH    . TYR B  2 88  ? -32.468 -16.631 29.992 1.00 33.31  ? 88   TYR B OH    1 
ATOM   1337  N  N     . ALA B  2 89  ? -30.528 -14.077 38.082 1.00 28.21  ? 89   ALA B N     1 
ATOM   1338  C  CA    . ALA B  2 89  ? -29.945 -13.463 39.280 1.00 27.77  ? 89   ALA B CA    1 
ATOM   1339  C  C     . ALA B  2 89  ? -29.640 -14.541 40.328 1.00 27.79  ? 89   ALA B C     1 
ATOM   1340  O  O     . ALA B  2 89  ? -28.525 -14.602 40.856 1.00 27.93  ? 89   ALA B O     1 
ATOM   1341  C  CB    . ALA B  2 89  ? -30.874 -12.392 39.845 1.00 27.43  ? 89   ALA B CB    1 
ATOM   1342  N  N     . LEU B  2 90  ? -30.620 -15.405 40.594 1.00 27.24  ? 90   LEU B N     1 
ATOM   1343  C  CA    . LEU B  2 90  ? -30.414 -16.561 41.442 1.00 27.33  ? 90   LEU B CA    1 
ATOM   1344  C  C     . LEU B  2 90  ? -29.239 -17.432 40.965 1.00 28.00  ? 90   LEU B C     1 
ATOM   1345  O  O     . LEU B  2 90  ? -28.398 -17.836 41.776 1.00 28.03  ? 90   LEU B O     1 
ATOM   1346  C  CB    . LEU B  2 90  ? -31.702 -17.375 41.601 1.00 26.82  ? 90   LEU B CB    1 
ATOM   1347  C  CG    . LEU B  2 90  ? -32.846 -16.615 42.294 1.00 26.81  ? 90   LEU B CG    1 
ATOM   1348  C  CD1   . LEU B  2 90  ? -34.202 -17.268 42.118 1.00 25.17  ? 90   LEU B CD1   1 
ATOM   1349  C  CD2   . LEU B  2 90  ? -32.557 -16.388 43.765 1.00 26.27  ? 90   LEU B CD2   1 
ATOM   1350  N  N     . LYS B  2 91  ? -29.135 -17.679 39.662 1.00 28.56  ? 91   LYS B N     1 
ATOM   1351  C  CA    . LYS B  2 91  ? -28.037 -18.526 39.176 1.00 29.28  ? 91   LYS B CA    1 
ATOM   1352  C  C     . LYS B  2 91  ? -26.657 -17.951 39.497 1.00 29.26  ? 91   LYS B C     1 
ATOM   1353  O  O     . LYS B  2 91  ? -25.759 -18.674 39.899 1.00 29.57  ? 91   LYS B O     1 
ATOM   1354  C  CB    . LYS B  2 91  ? -28.146 -18.846 37.685 1.00 29.19  ? 91   LYS B CB    1 
ATOM   1355  C  CG    . LYS B  2 91  ? -27.256 -20.014 37.301 1.00 30.82  ? 91   LYS B CG    1 
ATOM   1356  C  CD    . LYS B  2 91  ? -27.273 -20.317 35.830 1.00 34.26  ? 91   LYS B CD    1 
ATOM   1357  C  CE    . LYS B  2 91  ? -28.105 -21.551 35.543 1.00 37.39  ? 91   LYS B CE    1 
ATOM   1358  N  NZ    . LYS B  2 91  ? -28.107 -21.859 34.079 1.00 40.12  ? 91   LYS B NZ    1 
ATOM   1359  N  N     . ARG B  2 92  ? -26.477 -16.656 39.341 1.00 29.48  ? 92   ARG B N     1 
ATOM   1360  C  CA    . ARG B  2 92  ? -25.155 -16.124 39.581 1.00 30.07  ? 92   ARG B CA    1 
ATOM   1361  C  C     . ARG B  2 92  ? -24.843 -15.866 41.062 1.00 31.03  ? 92   ARG B C     1 
ATOM   1362  O  O     . ARG B  2 92  ? -23.669 -15.710 41.399 1.00 31.48  ? 92   ARG B O     1 
ATOM   1363  C  CB    . ARG B  2 92  ? -24.879 -14.893 38.722 1.00 29.82  ? 92   ARG B CB    1 
ATOM   1364  C  CG    . ARG B  2 92  ? -25.645 -13.654 39.088 1.00 29.73  ? 92   ARG B CG    1 
ATOM   1365  C  CD    . ARG B  2 92  ? -25.185 -12.542 38.196 1.00 31.44  ? 92   ARG B CD    1 
ATOM   1366  N  NE    . ARG B  2 92  ? -23.753 -12.378 38.369 1.00 34.99  ? 92   ARG B NE    1 
ATOM   1367  C  CZ    . ARG B  2 92  ? -23.204 -11.534 39.242 1.00 37.14  ? 92   ARG B CZ    1 
ATOM   1368  N  NH1   . ARG B  2 92  ? -23.979 -10.742 39.994 1.00 37.10  ? 92   ARG B NH1   1 
ATOM   1369  N  NH2   . ARG B  2 92  ? -21.884 -11.474 39.355 1.00 36.28  ? 92   ARG B NH2   1 
ATOM   1370  N  N     . GLN B  2 93  ? -25.866 -15.818 41.936 1.00 31.19  ? 93   GLN B N     1 
ATOM   1371  C  CA    . GLN B  2 93  ? -25.629 -15.783 43.391 1.00 31.15  ? 93   GLN B CA    1 
ATOM   1372  C  C     . GLN B  2 93  ? -25.430 -17.207 43.932 1.00 30.60  ? 93   GLN B C     1 
ATOM   1373  O  O     . GLN B  2 93  ? -25.550 -17.418 45.142 1.00 30.26  ? 93   GLN B O     1 
ATOM   1374  C  CB    . GLN B  2 93  ? -26.808 -15.169 44.169 1.00 31.88  ? 93   GLN B CB    1 
ATOM   1375  C  CG    . GLN B  2 93  ? -27.251 -13.766 43.807 1.00 33.70  ? 93   GLN B CG    1 
ATOM   1376  C  CD    . GLN B  2 93  ? -26.317 -12.665 44.265 1.00 36.44  ? 93   GLN B CD    1 
ATOM   1377  O  OE1   . GLN B  2 93  ? -26.266 -11.614 43.639 1.00 38.73  ? 93   GLN B OE1   1 
ATOM   1378  N  NE2   . GLN B  2 93  ? -25.590 -12.884 45.359 1.00 38.61  ? 93   GLN B NE2   1 
ATOM   1379  N  N     . GLY B  2 94  ? -25.181 -18.169 43.038 1.00 29.81  ? 94   GLY B N     1 
ATOM   1380  C  CA    . GLY B  2 94  ? -25.072 -19.586 43.379 1.00 29.32  ? 94   GLY B CA    1 
ATOM   1381  C  C     . GLY B  2 94  ? -26.295 -20.226 44.031 1.00 29.56  ? 94   GLY B C     1 
ATOM   1382  O  O     . GLY B  2 94  ? -26.169 -21.205 44.782 1.00 29.97  ? 94   GLY B O     1 
ATOM   1383  N  N     . ARG B  2 95  ? -27.478 -19.679 43.756 1.00 29.26  ? 95   ARG B N     1 
ATOM   1384  C  CA    . ARG B  2 95  ? -28.733 -20.201 44.298 1.00 28.68  ? 95   ARG B CA    1 
ATOM   1385  C  C     . ARG B  2 95  ? -29.679 -20.623 43.181 1.00 28.14  ? 95   ARG B C     1 
ATOM   1386  O  O     . ARG B  2 95  ? -30.806 -20.168 43.118 1.00 28.45  ? 95   ARG B O     1 
ATOM   1387  C  CB    . ARG B  2 95  ? -29.400 -19.159 45.204 1.00 28.52  ? 95   ARG B CB    1 
ATOM   1388  C  CG    . ARG B  2 95  ? -28.526 -18.763 46.375 1.00 30.98  ? 95   ARG B CG    1 
ATOM   1389  C  CD    . ARG B  2 95  ? -29.299 -18.500 47.631 1.00 33.92  ? 95   ARG B CD    1 
ATOM   1390  N  NE    . ARG B  2 95  ? -30.130 -19.661 47.961 1.00 37.96  ? 95   ARG B NE    1 
ATOM   1391  C  CZ    . ARG B  2 95  ? -29.783 -20.642 48.794 1.00 38.44  ? 95   ARG B CZ    1 
ATOM   1392  N  NH1   . ARG B  2 95  ? -28.607 -20.630 49.427 1.00 39.61  ? 95   ARG B NH1   1 
ATOM   1393  N  NH2   . ARG B  2 95  ? -30.631 -21.632 49.010 1.00 38.19  ? 95   ARG B NH2   1 
ATOM   1394  N  N     . THR B  2 96  ? -29.211 -21.491 42.294 1.00 27.82  ? 96   THR B N     1 
ATOM   1395  C  CA    . THR B  2 96  ? -29.991 -21.920 41.129 1.00 27.50  ? 96   THR B CA    1 
ATOM   1396  C  C     . THR B  2 96  ? -31.391 -22.395 41.496 1.00 27.47  ? 96   THR B C     1 
ATOM   1397  O  O     . THR B  2 96  ? -31.561 -23.136 42.455 1.00 28.02  ? 96   THR B O     1 
ATOM   1398  C  CB    . THR B  2 96  ? -29.249 -23.020 40.388 1.00 26.95  ? 96   THR B CB    1 
ATOM   1399  O  OG1   . THR B  2 96  ? -28.102 -22.448 39.775 1.00 28.15  ? 96   THR B OG1   1 
ATOM   1400  C  CG2   . THR B  2 96  ? -30.089 -23.614 39.306 1.00 27.70  ? 96   THR B CG2   1 
ATOM   1401  N  N     . LEU B  2 97  ? -32.388 -21.972 40.726 1.00 27.50  ? 97   LEU B N     1 
ATOM   1402  C  CA    . LEU B  2 97  ? -33.769 -22.369 40.970 1.00 27.39  ? 97   LEU B CA    1 
ATOM   1403  C  C     . LEU B  2 97  ? -34.359 -23.085 39.759 1.00 27.83  ? 97   LEU B C     1 
ATOM   1404  O  O     . LEU B  2 97  ? -34.251 -22.612 38.633 1.00 27.81  ? 97   LEU B O     1 
ATOM   1405  C  CB    . LEU B  2 97  ? -34.611 -21.141 41.329 1.00 27.05  ? 97   LEU B CB    1 
ATOM   1406  C  CG    . LEU B  2 97  ? -36.099 -21.324 41.633 1.00 27.49  ? 97   LEU B CG    1 
ATOM   1407  C  CD1   . LEU B  2 97  ? -36.313 -22.280 42.795 1.00 26.77  ? 97   LEU B CD1   1 
ATOM   1408  C  CD2   . LEU B  2 97  ? -36.827 -19.991 41.882 1.00 27.25  ? 97   LEU B CD2   1 
ATOM   1409  N  N     . TYR B  2 98  ? -34.984 -24.228 40.009 1.00 28.45  ? 98   TYR B N     1 
ATOM   1410  C  CA    . TYR B  2 98  ? -35.645 -25.021 38.987 1.00 29.06  ? 98   TYR B CA    1 
ATOM   1411  C  C     . TYR B  2 98  ? -37.141 -24.775 39.045 1.00 31.09  ? 98   TYR B C     1 
ATOM   1412  O  O     . TYR B  2 98  ? -37.726 -24.710 40.134 1.00 31.34  ? 98   TYR B O     1 
ATOM   1413  C  CB    . TYR B  2 98  ? -35.381 -26.496 39.234 1.00 27.66  ? 98   TYR B CB    1 
ATOM   1414  C  CG    . TYR B  2 98  ? -34.028 -27.001 38.769 1.00 26.58  ? 98   TYR B CG    1 
ATOM   1415  C  CD1   . TYR B  2 98  ? -33.025 -26.116 38.310 1.00 26.17  ? 98   TYR B CD1   1 
ATOM   1416  C  CD2   . TYR B  2 98  ? -33.728 -28.359 38.825 1.00 23.69  ? 98   TYR B CD2   1 
ATOM   1417  C  CE1   . TYR B  2 98  ? -31.788 -26.583 37.890 1.00 23.83  ? 98   TYR B CE1   1 
ATOM   1418  C  CE2   . TYR B  2 98  ? -32.496 -28.830 38.415 1.00 24.16  ? 98   TYR B CE2   1 
ATOM   1419  C  CZ    . TYR B  2 98  ? -31.539 -27.940 37.941 1.00 25.02  ? 98   TYR B CZ    1 
ATOM   1420  O  OH    . TYR B  2 98  ? -30.327 -28.426 37.532 1.00 25.48  ? 98   TYR B OH    1 
ATOM   1421  N  N     . GLY B  2 99  ? -37.766 -24.621 37.880 1.00 33.10  ? 99   GLY B N     1 
ATOM   1422  C  CA    . GLY B  2 99  ? -39.212 -24.523 37.825 1.00 35.65  ? 99   GLY B CA    1 
ATOM   1423  C  C     . GLY B  2 99  ? -39.797 -23.293 37.176 1.00 37.72  ? 99   GLY B C     1 
ATOM   1424  O  O     . GLY B  2 99  ? -40.980 -23.270 36.876 1.00 38.24  ? 99   GLY B O     1 
ATOM   1425  N  N     . PHE B  2 100 ? -38.994 -22.267 36.949 1.00 39.80  ? 100  PHE B N     1 
ATOM   1426  C  CA    . PHE B  2 100 ? -39.535 -21.032 36.406 1.00 41.86  ? 100  PHE B CA    1 
ATOM   1427  C  C     . PHE B  2 100 ? -38.840 -20.605 35.119 1.00 43.65  ? 100  PHE B C     1 
ATOM   1428  O  O     . PHE B  2 100 ? -38.841 -19.430 34.789 1.00 43.74  ? 100  PHE B O     1 
ATOM   1429  C  CB    . PHE B  2 100 ? -39.433 -19.918 37.450 1.00 41.70  ? 100  PHE B CB    1 
ATOM   1430  C  CG    . PHE B  2 100 ? -40.297 -20.134 38.666 1.00 41.73  ? 100  PHE B CG    1 
ATOM   1431  C  CD1   . PHE B  2 100 ? -39.878 -20.966 39.703 1.00 41.36  ? 100  PHE B CD1   1 
ATOM   1432  C  CD2   . PHE B  2 100 ? -41.519 -19.478 38.791 1.00 42.02  ? 100  PHE B CD2   1 
ATOM   1433  C  CE1   . PHE B  2 100 ? -40.672 -21.165 40.834 1.00 40.77  ? 100  PHE B CE1   1 
ATOM   1434  C  CE2   . PHE B  2 100 ? -42.325 -19.662 39.925 1.00 42.47  ? 100  PHE B CE2   1 
ATOM   1435  C  CZ    . PHE B  2 100 ? -41.896 -20.510 40.948 1.00 41.78  ? 100  PHE B CZ    1 
ATOM   1436  N  N     . GLY B  2 101 ? -38.257 -21.555 34.389 1.00 45.94  ? 101  GLY B N     1 
ATOM   1437  C  CA    . GLY B  2 101 ? -37.384 -21.221 33.265 1.00 48.79  ? 101  GLY B CA    1 
ATOM   1438  C  C     . GLY B  2 101 ? -38.095 -21.199 31.919 1.00 51.33  ? 101  GLY B C     1 
ATOM   1439  O  O     . GLY B  2 101 ? -37.436 -21.317 30.858 1.00 51.81  ? 101  GLY B O     1 
ATOM   1440  N  N     . GLY B  2 102 ? -39.432 -21.039 31.959 1.00 52.86  ? 102  GLY B N     1 
ATOM   1441  C  CA    . GLY B  2 102 ? -40.312 -21.126 30.773 1.00 53.89  ? 102  GLY B CA    1 
ATOM   1442  C  C     . GLY B  2 102 ? -40.176 -20.023 29.715 1.00 54.80  ? 102  GLY B C     1 
ATOM   1443  O  O     . GLY B  2 102 ? -39.226 -19.214 29.713 1.00 55.02  ? 102  GLY B O     1 
ATOM   1444  O  OXT   . GLY B  2 102 ? -41.024 -19.912 28.807 1.00 55.17  ? 102  GLY B OXT   1 
ATOM   1445  N  N     . LYS C  3 15  ? -0.551  5.375   15.454 1.00 47.02  ? 15   LYS C N     1 
ATOM   1446  C  CA    . LYS C  3 15  ? -1.197  5.589   16.785 1.00 47.33  ? 15   LYS C CA    1 
ATOM   1447  C  C     . LYS C  3 15  ? -1.979  4.354   17.305 1.00 46.17  ? 15   LYS C C     1 
ATOM   1448  O  O     . LYS C  3 15  ? -2.955  3.910   16.683 1.00 46.17  ? 15   LYS C O     1 
ATOM   1449  C  CB    . LYS C  3 15  ? -2.101  6.827   16.727 1.00 47.32  ? 15   LYS C CB    1 
ATOM   1450  C  CG    . LYS C  3 15  ? -2.619  7.267   18.086 1.00 48.66  ? 15   LYS C CG    1 
ATOM   1451  C  CD    . LYS C  3 15  ? -3.366  8.591   18.008 1.00 49.40  ? 15   LYS C CD    1 
ATOM   1452  C  CE    . LYS C  3 15  ? -2.479  9.775   18.389 1.00 53.47  ? 15   LYS C CE    1 
ATOM   1453  N  NZ    . LYS C  3 15  ? -3.210  11.096  18.320 1.00 54.68  ? 15   LYS C NZ    1 
ATOM   1454  N  N     . THR C  3 16  ? -1.554  3.808   18.445 1.00 44.88  ? 16   THR C N     1 
ATOM   1455  C  CA    . THR C  3 16  ? -2.244  2.645   19.020 1.00 43.62  ? 16   THR C CA    1 
ATOM   1456  C  C     . THR C  3 16  ? -3.617  3.010   19.564 1.00 42.79  ? 16   THR C C     1 
ATOM   1457  O  O     . THR C  3 16  ? -3.868  4.145   19.997 1.00 42.66  ? 16   THR C O     1 
ATOM   1458  C  CB    . THR C  3 16  ? -1.467  1.957   20.170 1.00 43.55  ? 16   THR C CB    1 
ATOM   1459  O  OG1   . THR C  3 16  ? -1.321  2.862   21.277 1.00 44.13  ? 16   THR C OG1   1 
ATOM   1460  C  CG2   . THR C  3 16  ? -0.112  1.456   19.706 1.00 42.98  ? 16   THR C CG2   1 
ATOM   1461  N  N     . ARG C  3 17  ? -4.496  2.022   19.553 1.00 41.55  ? 17   ARG C N     1 
ATOM   1462  C  CA    . ARG C  3 17  ? -5.824  2.149   20.129 1.00 40.69  ? 17   ARG C CA    1 
ATOM   1463  C  C     . ARG C  3 17  ? -5.806  2.519   21.623 1.00 40.34  ? 17   ARG C C     1 
ATOM   1464  O  O     . ARG C  3 17  ? -6.664  3.271   22.094 1.00 39.74  ? 17   ARG C O     1 
ATOM   1465  C  CB    . ARG C  3 17  ? -6.587  0.852   19.906 1.00 40.41  ? 17   ARG C CB    1 
ATOM   1466  C  CG    . ARG C  3 17  ? -6.846  0.572   18.456 1.00 39.07  ? 17   ARG C CG    1 
ATOM   1467  C  CD    . ARG C  3 17  ? -8.055  -0.281  18.314 1.00 38.24  ? 17   ARG C CD    1 
ATOM   1468  N  NE    . ARG C  3 17  ? -7.690  -1.686  18.233 1.00 38.42  ? 17   ARG C NE    1 
ATOM   1469  C  CZ    . ARG C  3 17  ? -8.556  -2.683  18.362 1.00 37.89  ? 17   ARG C CZ    1 
ATOM   1470  N  NH1   . ARG C  3 17  ? -9.833  -2.412  18.611 1.00 37.19  ? 17   ARG C NH1   1 
ATOM   1471  N  NH2   . ARG C  3 17  ? -8.143  -3.942  18.246 1.00 37.17  ? 17   ARG C NH2   1 
ATOM   1472  N  N     . SER C  3 18  ? -4.823  1.982   22.348 1.00 40.04  ? 18   SER C N     1 
ATOM   1473  C  CA    . SER C  3 18  ? -4.588  2.334   23.740 1.00 39.54  ? 18   SER C CA    1 
ATOM   1474  C  C     . SER C  3 18  ? -4.393  3.828   23.924 1.00 39.91  ? 18   SER C C     1 
ATOM   1475  O  O     . SER C  3 18  ? -5.114  4.456   24.700 1.00 39.44  ? 18   SER C O     1 
ATOM   1476  C  CB    . SER C  3 18  ? -3.383  1.578   24.273 1.00 39.20  ? 18   SER C CB    1 
ATOM   1477  O  OG    . SER C  3 18  ? -3.665  0.200   24.323 1.00 38.75  ? 18   SER C OG    1 
ATOM   1478  N  N     . SER C  3 19  ? -3.438  4.410   23.198 1.00 40.67  ? 19   SER C N     1 
ATOM   1479  C  CA    . SER C  3 19  ? -3.172  5.847   23.355 1.00 41.48  ? 19   SER C CA    1 
ATOM   1480  C  C     . SER C  3 19  ? -4.373  6.665   22.875 1.00 41.11  ? 19   SER C C     1 
ATOM   1481  O  O     . SER C  3 19  ? -4.716  7.689   23.455 1.00 41.06  ? 19   SER C O     1 
ATOM   1482  C  CB    . SER C  3 19  ? -1.860  6.280   22.678 1.00 41.49  ? 19   SER C CB    1 
ATOM   1483  O  OG    . SER C  3 19  ? -2.018  6.424   21.281 1.00 43.98  ? 19   SER C OG    1 
ATOM   1484  N  N     . ARG C  3 20  ? -5.027  6.165   21.838 1.00 40.98  ? 20   ARG C N     1 
ATOM   1485  C  CA    . ARG C  3 20  ? -6.252  6.749   21.336 1.00 41.19  ? 20   ARG C CA    1 
ATOM   1486  C  C     . ARG C  3 20  ? -7.406  6.693   22.352 1.00 40.62  ? 20   ARG C C     1 
ATOM   1487  O  O     . ARG C  3 20  ? -8.308  7.516   22.305 1.00 40.98  ? 20   ARG C O     1 
ATOM   1488  C  CB    . ARG C  3 20  ? -6.623  6.056   20.016 1.00 42.01  ? 20   ARG C CB    1 
ATOM   1489  C  CG    . ARG C  3 20  ? -7.875  6.574   19.351 1.00 44.25  ? 20   ARG C CG    1 
ATOM   1490  C  CD    . ARG C  3 20  ? -7.759  6.558   17.858 1.00 48.93  ? 20   ARG C CD    1 
ATOM   1491  N  NE    . ARG C  3 20  ? -7.956  5.237   17.271 1.00 53.32  ? 20   ARG C NE    1 
ATOM   1492  C  CZ    . ARG C  3 20  ? -7.008  4.558   16.624 1.00 56.16  ? 20   ARG C CZ    1 
ATOM   1493  N  NH1   . ARG C  3 20  ? -5.781  5.069   16.496 1.00 57.85  ? 20   ARG C NH1   1 
ATOM   1494  N  NH2   . ARG C  3 20  ? -7.285  3.365   16.104 1.00 56.44  ? 20   ARG C NH2   1 
ATOM   1495  N  N     . ALA C  3 21  ? -7.387  5.730   23.270 1.00 40.17  ? 21   ALA C N     1 
ATOM   1496  C  CA    . ALA C  3 21  ? -8.428  5.645   24.301 1.00 39.41  ? 21   ALA C CA    1 
ATOM   1497  C  C     . ALA C  3 21  ? -7.970  6.258   25.625 1.00 39.10  ? 21   ALA C C     1 
ATOM   1498  O  O     . ALA C  3 21  ? -8.771  6.434   26.543 1.00 39.21  ? 21   ALA C O     1 
ATOM   1499  C  CB    . ALA C  3 21  ? -8.868  4.210   24.499 1.00 39.47  ? 21   ALA C CB    1 
ATOM   1500  N  N     . GLY C  3 22  ? -6.679  6.582   25.709 1.00 38.44  ? 22   GLY C N     1 
ATOM   1501  C  CA    . GLY C  3 22  ? -6.101  7.224   26.880 1.00 37.45  ? 22   GLY C CA    1 
ATOM   1502  C  C     . GLY C  3 22  ? -5.688  6.216   27.934 1.00 37.11  ? 22   GLY C C     1 
ATOM   1503  O  O     . GLY C  3 22  ? -5.726  6.513   29.133 1.00 37.31  ? 22   GLY C O     1 
ATOM   1504  N  N     . LEU C  3 23  ? -5.268  5.033   27.482 1.00 36.47  ? 23   LEU C N     1 
ATOM   1505  C  CA    . LEU C  3 23  ? -5.061  3.880   28.350 1.00 35.32  ? 23   LEU C CA    1 
ATOM   1506  C  C     . LEU C  3 23  ? -3.657  3.347   28.332 1.00 34.92  ? 23   LEU C C     1 
ATOM   1507  O  O     . LEU C  3 23  ? -2.983  3.352   27.308 1.00 34.91  ? 23   LEU C O     1 
ATOM   1508  C  CB    . LEU C  3 23  ? -6.018  2.745   27.983 1.00 35.10  ? 23   LEU C CB    1 
ATOM   1509  C  CG    . LEU C  3 23  ? -7.524  2.961   28.181 1.00 35.50  ? 23   LEU C CG    1 
ATOM   1510  C  CD1   . LEU C  3 23  ? -8.250  1.626   28.024 1.00 36.88  ? 23   LEU C CD1   1 
ATOM   1511  C  CD2   . LEU C  3 23  ? -7.888  3.584   29.521 1.00 33.29  ? 23   LEU C CD2   1 
ATOM   1512  N  N     . GLN C  3 24  ? -3.231  2.875   29.492 1.00 34.80  ? 24   GLN C N     1 
ATOM   1513  C  CA    . GLN C  3 24  ? -1.974  2.180   29.636 1.00 34.60  ? 24   GLN C CA    1 
ATOM   1514  C  C     . GLN C  3 24  ? -2.143  0.748   29.175 1.00 34.59  ? 24   GLN C C     1 
ATOM   1515  O  O     . GLN C  3 24  ? -1.303  0.218   28.461 1.00 35.27  ? 24   GLN C O     1 
ATOM   1516  C  CB    . GLN C  3 24  ? -1.544  2.232   31.096 1.00 34.96  ? 24   GLN C CB    1 
ATOM   1517  C  CG    . GLN C  3 24  ? -1.391  3.664   31.632 1.00 34.26  ? 24   GLN C CG    1 
ATOM   1518  C  CD    . GLN C  3 24  ? -0.400  4.455   30.810 1.00 33.14  ? 24   GLN C CD    1 
ATOM   1519  O  OE1   . GLN C  3 24  ? 0.732   4.026   30.604 1.00 33.31  ? 24   GLN C OE1   1 
ATOM   1520  N  NE2   . GLN C  3 24  ? -0.830  5.590   30.306 1.00 32.61  ? 24   GLN C NE2   1 
ATOM   1521  N  N     . PHE C  3 25  ? -3.258  0.134   29.555 1.00 34.37  ? 25   PHE C N     1 
ATOM   1522  C  CA    . PHE C  3 25  ? -3.543  -1.266  29.215 1.00 34.02  ? 25   PHE C CA    1 
ATOM   1523  C  C     . PHE C  3 25  ? -3.813  -1.465  27.719 1.00 34.07  ? 25   PHE C C     1 
ATOM   1524  O  O     . PHE C  3 25  ? -4.468  -0.631  27.094 1.00 34.86  ? 25   PHE C O     1 
ATOM   1525  C  CB    . PHE C  3 25  ? -4.699  -1.778  30.073 1.00 33.62  ? 25   PHE C CB    1 
ATOM   1526  C  CG    . PHE C  3 25  ? -4.258  -2.496  31.317 1.00 33.19  ? 25   PHE C CG    1 
ATOM   1527  C  CD1   . PHE C  3 25  ? -3.241  -1.992  32.107 1.00 32.27  ? 25   PHE C CD1   1 
ATOM   1528  C  CD2   . PHE C  3 25  ? -4.869  -3.688  31.697 1.00 34.09  ? 25   PHE C CD2   1 
ATOM   1529  C  CE1   . PHE C  3 25  ? -2.835  -2.657  33.251 1.00 32.82  ? 25   PHE C CE1   1 
ATOM   1530  C  CE2   . PHE C  3 25  ? -4.477  -4.362  32.846 1.00 33.45  ? 25   PHE C CE2   1 
ATOM   1531  C  CZ    . PHE C  3 25  ? -3.459  -3.847  33.627 1.00 33.38  ? 25   PHE C CZ    1 
ATOM   1532  N  N     . PRO C  3 26  ? -3.302  -2.564  27.135 1.00 33.72  ? 26   PRO C N     1 
ATOM   1533  C  CA    . PRO C  3 26  ? -3.279  -2.749  25.675 1.00 33.03  ? 26   PRO C CA    1 
ATOM   1534  C  C     . PRO C  3 26  ? -4.603  -3.132  25.054 1.00 32.64  ? 26   PRO C C     1 
ATOM   1535  O  O     . PRO C  3 26  ? -5.022  -4.277  25.185 1.00 33.09  ? 26   PRO C O     1 
ATOM   1536  C  CB    . PRO C  3 26  ? -2.274  -3.883  25.492 1.00 32.97  ? 26   PRO C CB    1 
ATOM   1537  C  CG    . PRO C  3 26  ? -2.346  -4.654  26.743 1.00 33.32  ? 26   PRO C CG    1 
ATOM   1538  C  CD    . PRO C  3 26  ? -2.680  -3.695  27.842 1.00 33.78  ? 26   PRO C CD    1 
ATOM   1539  N  N     . VAL C  3 27  ? -5.241  -2.202  24.345 1.00 32.40  ? 27   VAL C N     1 
ATOM   1540  C  CA    . VAL C  3 27  ? -6.567  -2.462  23.746 1.00 31.52  ? 27   VAL C CA    1 
ATOM   1541  C  C     . VAL C  3 27  ? -6.534  -3.584  22.708 1.00 31.82  ? 27   VAL C C     1 
ATOM   1542  O  O     . VAL C  3 27  ? -7.364  -4.497  22.758 1.00 32.48  ? 27   VAL C O     1 
ATOM   1543  C  CB    . VAL C  3 27  ? -7.220  -1.195  23.153 1.00 31.23  ? 27   VAL C CB    1 
ATOM   1544  C  CG1   . VAL C  3 27  ? -8.536  -1.532  22.472 1.00 30.55  ? 27   VAL C CG1   1 
ATOM   1545  C  CG2   . VAL C  3 27  ? -7.462  -0.173  24.231 1.00 29.86  ? 27   VAL C CG2   1 
ATOM   1546  N  N     . GLY C  3 28  ? -5.577  -3.530  21.785 1.00 31.59  ? 28   GLY C N     1 
ATOM   1547  C  CA    . GLY C  3 28  ? -5.466  -4.557  20.744 1.00 30.96  ? 28   GLY C CA    1 
ATOM   1548  C  C     . GLY C  3 28  ? -5.452  -5.975  21.288 1.00 30.62  ? 28   GLY C C     1 
ATOM   1549  O  O     . GLY C  3 28  ? -6.116  -6.852  20.753 1.00 30.65  ? 28   GLY C O     1 
ATOM   1550  N  N     . ARG C  3 29  ? -4.689  -6.192  22.357 1.00 30.38  ? 29   ARG C N     1 
ATOM   1551  C  CA    . ARG C  3 29  ? -4.554  -7.507  22.962 1.00 30.07  ? 29   ARG C CA    1 
ATOM   1552  C  C     . ARG C  3 29  ? -5.870  -7.935  23.589 1.00 30.36  ? 29   ARG C C     1 
ATOM   1553  O  O     . ARG C  3 29  ? -6.321  -9.056  23.384 1.00 30.41  ? 29   ARG C O     1 
ATOM   1554  C  CB    . ARG C  3 29  ? -3.457  -7.495  24.028 1.00 29.90  ? 29   ARG C CB    1 
ATOM   1555  C  CG    . ARG C  3 29  ? -3.298  -8.823  24.757 1.00 29.36  ? 29   ARG C CG    1 
ATOM   1556  C  CD    . ARG C  3 29  ? -2.216  -8.777  25.801 1.00 27.99  ? 29   ARG C CD    1 
ATOM   1557  N  NE    . ARG C  3 29  ? -0.878  -8.758  25.226 1.00 29.78  ? 29   ARG C NE    1 
ATOM   1558  C  CZ    . ARG C  3 29  ? 0.250   -8.877  25.928 1.00 31.76  ? 29   ARG C CZ    1 
ATOM   1559  N  NH1   . ARG C  3 29  ? 0.221   -9.029  27.244 1.00 33.42  ? 29   ARG C NH1   1 
ATOM   1560  N  NH2   . ARG C  3 29  ? 1.421   -8.852  25.312 1.00 32.79  ? 29   ARG C NH2   1 
ATOM   1561  N  N     . VAL C  3 30  ? -6.478  -7.041  24.362 1.00 30.46  ? 30   VAL C N     1 
ATOM   1562  C  CA    . VAL C  3 30  ? -7.761  -7.333  24.989 1.00 30.57  ? 30   VAL C CA    1 
ATOM   1563  C  C     . VAL C  3 30  ? -8.760  -7.702  23.886 1.00 31.40  ? 30   VAL C C     1 
ATOM   1564  O  O     . VAL C  3 30  ? -9.450  -8.720  23.978 1.00 31.39  ? 30   VAL C O     1 
ATOM   1565  C  CB    . VAL C  3 30  ? -8.263  -6.147  25.856 1.00 29.88  ? 30   VAL C CB    1 
ATOM   1566  C  CG1   . VAL C  3 30  ? -9.637  -6.420  26.418 1.00 29.07  ? 30   VAL C CG1   1 
ATOM   1567  C  CG2   . VAL C  3 30  ? -7.321  -5.894  26.964 1.00 29.00  ? 30   VAL C CG2   1 
ATOM   1568  N  N     . HIS C  3 31  ? -8.799  -6.887  22.835 1.00 32.26  ? 31   HIS C N     1 
ATOM   1569  C  CA    . HIS C  3 31  ? -9.660  -7.139  21.688 1.00 33.62  ? 31   HIS C CA    1 
ATOM   1570  C  C     . HIS C  3 31  ? -9.420  -8.521  21.117 1.00 33.89  ? 31   HIS C C     1 
ATOM   1571  O  O     . HIS C  3 31  ? -10.358 -9.207  20.723 1.00 34.08  ? 31   HIS C O     1 
ATOM   1572  C  CB    . HIS C  3 31  ? -9.404  -6.120  20.587 1.00 33.91  ? 31   HIS C CB    1 
ATOM   1573  C  CG    . HIS C  3 31  ? -10.536 -5.986  19.620 1.00 36.23  ? 31   HIS C CG    1 
ATOM   1574  N  ND1   . HIS C  3 31  ? -11.354 -7.043  19.281 1.00 38.52  ? 31   HIS C ND1   1 
ATOM   1575  C  CD2   . HIS C  3 31  ? -10.983 -4.922  18.910 1.00 37.26  ? 31   HIS C CD2   1 
ATOM   1576  C  CE1   . HIS C  3 31  ? -12.265 -6.630  18.414 1.00 38.41  ? 31   HIS C CE1   1 
ATOM   1577  N  NE2   . HIS C  3 31  ? -12.060 -5.349  18.169 1.00 37.61  ? 31   HIS C NE2   1 
ATOM   1578  N  N     . ARG C  3 32  ? -8.158  -8.922  21.068 1.00 34.15  ? 32   ARG C N     1 
ATOM   1579  C  CA    . ARG C  3 32  ? -7.806  -10.179 20.443 1.00 34.72  ? 32   ARG C CA    1 
ATOM   1580  C  C     . ARG C  3 32  ? -8.245  -11.354 21.309 1.00 35.32  ? 32   ARG C C     1 
ATOM   1581  O  O     . ARG C  3 32  ? -8.785  -12.335 20.794 1.00 35.66  ? 32   ARG C O     1 
ATOM   1582  C  CB    . ARG C  3 32  ? -6.307  -10.226 20.160 1.00 34.54  ? 32   ARG C CB    1 
ATOM   1583  C  CG    . ARG C  3 32  ? -5.840  -11.534 19.618 1.00 34.44  ? 32   ARG C CG    1 
ATOM   1584  C  CD    . ARG C  3 32  ? -4.384  -11.479 19.330 1.00 37.02  ? 32   ARG C CD    1 
ATOM   1585  N  NE    . ARG C  3 32  ? -3.566  -11.961 20.440 1.00 39.63  ? 32   ARG C NE    1 
ATOM   1586  C  CZ    . ARG C  3 32  ? -2.668  -11.218 21.082 1.00 40.81  ? 32   ARG C CZ    1 
ATOM   1587  N  NH1   . ARG C  3 32  ? -2.482  -9.951  20.730 1.00 40.82  ? 32   ARG C NH1   1 
ATOM   1588  N  NH2   . ARG C  3 32  ? -1.955  -11.739 22.075 1.00 40.18  ? 32   ARG C NH2   1 
ATOM   1589  N  N     . LEU C  3 33  ? -8.006  -11.238 22.618 1.00 35.82  ? 33   LEU C N     1 
ATOM   1590  C  CA    . LEU C  3 33  ? -8.384  -12.251 23.598 1.00 36.00  ? 33   LEU C CA    1 
ATOM   1591  C  C     . LEU C  3 33  ? -9.887  -12.415 23.646 1.00 36.94  ? 33   LEU C C     1 
ATOM   1592  O  O     . LEU C  3 33  ? -10.374 -13.516 23.869 1.00 37.09  ? 33   LEU C O     1 
ATOM   1593  C  CB    . LEU C  3 33  ? -7.827  -11.916 24.985 1.00 35.35  ? 33   LEU C CB    1 
ATOM   1594  C  CG    . LEU C  3 33  ? -6.296  -11.995 25.077 1.00 34.50  ? 33   LEU C CG    1 
ATOM   1595  C  CD1   . LEU C  3 33  ? -5.760  -11.349 26.327 1.00 34.44  ? 33   LEU C CD1   1 
ATOM   1596  C  CD2   . LEU C  3 33  ? -5.795  -13.412 25.000 1.00 33.44  ? 33   LEU C CD2   1 
ATOM   1597  N  N     . LEU C  3 34  ? -10.625 -11.333 23.402 1.00 38.14  ? 34   LEU C N     1 
ATOM   1598  C  CA    . LEU C  3 34  ? -12.079 -11.424 23.349 1.00 39.30  ? 34   LEU C CA    1 
ATOM   1599  C  C     . LEU C  3 34  ? -12.572 -12.335 22.207 1.00 40.78  ? 34   LEU C C     1 
ATOM   1600  O  O     . LEU C  3 34  ? -13.583 -13.037 22.357 1.00 41.00  ? 34   LEU C O     1 
ATOM   1601  C  CB    . LEU C  3 34  ? -12.715 -10.039 23.276 1.00 38.87  ? 34   LEU C CB    1 
ATOM   1602  C  CG    . LEU C  3 34  ? -12.882 -9.251  24.575 1.00 38.69  ? 34   LEU C CG    1 
ATOM   1603  C  CD1   . LEU C  3 34  ? -13.465 -7.892  24.275 1.00 38.16  ? 34   LEU C CD1   1 
ATOM   1604  C  CD2   . LEU C  3 34  ? -13.760 -9.975  25.599 1.00 38.39  ? 34   LEU C CD2   1 
ATOM   1605  N  N     . ARG C  3 35  ? -11.854 -12.340 21.080 1.00 42.31  ? 35   ARG C N     1 
ATOM   1606  C  CA    . ARG C  3 35  ? -12.203 -13.215 19.955 1.00 44.02  ? 35   ARG C CA    1 
ATOM   1607  C  C     . ARG C  3 35  ? -11.773 -14.657 20.216 1.00 44.33  ? 35   ARG C C     1 
ATOM   1608  O  O     . ARG C  3 35  ? -12.566 -15.581 20.078 1.00 44.51  ? 35   ARG C O     1 
ATOM   1609  C  CB    . ARG C  3 35  ? -11.600 -12.702 18.654 1.00 43.69  ? 35   ARG C CB    1 
ATOM   1610  C  CG    . ARG C  3 35  ? -12.015 -11.282 18.308 1.00 45.46  ? 35   ARG C CG    1 
ATOM   1611  C  CD    . ARG C  3 35  ? -11.497 -10.867 16.917 1.00 46.05  ? 35   ARG C CD    1 
ATOM   1612  N  NE    . ARG C  3 35  ? -11.772 -9.455  16.608 1.00 50.91  ? 35   ARG C NE    1 
ATOM   1613  C  CZ    . ARG C  3 35  ? -12.981 -8.954  16.329 1.00 52.94  ? 35   ARG C CZ    1 
ATOM   1614  N  NH1   . ARG C  3 35  ? -14.066 -9.734  16.333 1.00 53.54  ? 35   ARG C NH1   1 
ATOM   1615  N  NH2   . ARG C  3 35  ? -13.113 -7.658  16.060 1.00 54.04  ? 35   ARG C NH2   1 
ATOM   1616  N  N     . LYS C  3 36  ? -10.522 -14.838 20.617 1.00 45.13  ? 36   LYS C N     1 
ATOM   1617  C  CA    . LYS C  3 36  ? -9.976  -16.152 20.907 1.00 46.27  ? 36   LYS C CA    1 
ATOM   1618  C  C     . LYS C  3 36  ? -10.846 -16.921 21.903 1.00 46.12  ? 36   LYS C C     1 
ATOM   1619  O  O     . LYS C  3 36  ? -11.028 -18.133 21.773 1.00 46.41  ? 36   LYS C O     1 
ATOM   1620  C  CB    . LYS C  3 36  ? -8.555  -16.004 21.455 1.00 46.29  ? 36   LYS C CB    1 
ATOM   1621  C  CG    . LYS C  3 36  ? -7.741  -17.297 21.496 1.00 47.92  ? 36   LYS C CG    1 
ATOM   1622  C  CD    . LYS C  3 36  ? -6.274  -17.032 21.878 1.00 48.15  ? 36   LYS C CD    1 
ATOM   1623  C  CE    . LYS C  3 36  ? -6.072  -17.041 23.410 1.00 50.94  ? 36   LYS C CE    1 
ATOM   1624  N  NZ    . LYS C  3 36  ? -4.659  -16.706 23.783 1.00 51.84  ? 36   LYS C NZ    1 
ATOM   1625  N  N     . GLY C  3 37  ? -11.405 -16.208 22.877 1.00 45.97  ? 37   GLY C N     1 
ATOM   1626  C  CA    . GLY C  3 37  ? -12.132 -16.835 23.973 1.00 45.43  ? 37   GLY C CA    1 
ATOM   1627  C  C     . GLY C  3 37  ? -13.507 -17.412 23.682 1.00 45.38  ? 37   GLY C C     1 
ATOM   1628  O  O     . GLY C  3 37  ? -14.045 -18.134 24.530 1.00 45.56  ? 37   GLY C O     1 
ATOM   1629  N  N     . ASN C  3 38  ? -14.076 -17.106 22.511 1.00 45.00  ? 38   ASN C N     1 
ATOM   1630  C  CA    . ASN C  3 38  ? -15.422 -17.580 22.121 1.00 45.09  ? 38   ASN C CA    1 
ATOM   1631  C  C     . ASN C  3 38  ? -16.501 -17.134 23.089 1.00 44.50  ? 38   ASN C C     1 
ATOM   1632  O  O     . ASN C  3 38  ? -17.231 -17.953 23.667 1.00 44.56  ? 38   ASN C O     1 
ATOM   1633  C  CB    . ASN C  3 38  ? -15.484 -19.110 21.990 1.00 45.58  ? 38   ASN C CB    1 
ATOM   1634  C  CG    . ASN C  3 38  ? -14.577 -19.642 20.897 1.00 48.06  ? 38   ASN C CG    1 
ATOM   1635  O  OD1   . ASN C  3 38  ? -13.768 -20.555 21.137 1.00 50.00  ? 38   ASN C OD1   1 
ATOM   1636  N  ND2   . ASN C  3 38  ? -14.698 -19.074 19.686 1.00 49.55  ? 38   ASN C ND2   1 
ATOM   1637  N  N     . TYR C  3 39  ? -16.598 -15.833 23.281 1.00 43.59  ? 39   TYR C N     1 
ATOM   1638  C  CA    . TYR C  3 39  ? -17.569 -15.322 24.211 1.00 43.03  ? 39   TYR C CA    1 
ATOM   1639  C  C     . TYR C  3 39  ? -18.845 -14.965 23.474 1.00 43.14  ? 39   TYR C C     1 
ATOM   1640  O  O     . TYR C  3 39  ? -19.928 -14.993 24.051 1.00 43.56  ? 39   TYR C O     1 
ATOM   1641  C  CB    . TYR C  3 39  ? -16.985 -14.143 25.000 1.00 42.70  ? 39   TYR C CB    1 
ATOM   1642  C  CG    . TYR C  3 39  ? -15.802 -14.536 25.880 1.00 41.20  ? 39   TYR C CG    1 
ATOM   1643  C  CD1   . TYR C  3 39  ? -14.503 -14.263 25.493 1.00 39.37  ? 39   TYR C CD1   1 
ATOM   1644  C  CD2   . TYR C  3 39  ? -15.995 -15.194 27.095 1.00 40.51  ? 39   TYR C CD2   1 
ATOM   1645  C  CE1   . TYR C  3 39  ? -13.421 -14.627 26.292 1.00 39.97  ? 39   TYR C CE1   1 
ATOM   1646  C  CE2   . TYR C  3 39  ? -14.922 -15.564 27.898 1.00 40.14  ? 39   TYR C CE2   1 
ATOM   1647  C  CZ    . TYR C  3 39  ? -13.639 -15.279 27.491 1.00 40.95  ? 39   TYR C CZ    1 
ATOM   1648  O  OH    . TYR C  3 39  ? -12.567 -15.638 28.283 1.00 41.94  ? 39   TYR C OH    1 
ATOM   1649  N  N     . ALA C  3 40  ? -18.714 -14.663 22.186 1.00 43.11  ? 40   ALA C N     1 
ATOM   1650  C  CA    . ALA C  3 40  ? -19.853 -14.332 21.327 1.00 43.06  ? 40   ALA C CA    1 
ATOM   1651  C  C     . ALA C  3 40  ? -19.406 -14.304 19.879 1.00 43.27  ? 40   ALA C C     1 
ATOM   1652  O  O     . ALA C  3 40  ? -18.212 -14.224 19.601 1.00 43.16  ? 40   ALA C O     1 
ATOM   1653  C  CB    . ALA C  3 40  ? -20.463 -12.998 21.719 1.00 42.68  ? 40   ALA C CB    1 
ATOM   1654  N  N     . GLU C  3 41  ? -20.368 -14.371 18.959 1.00 43.80  ? 41   GLU C N     1 
ATOM   1655  C  CA    . GLU C  3 41  ? -20.075 -14.361 17.522 1.00 44.20  ? 41   GLU C CA    1 
ATOM   1656  C  C     . GLU C  3 41  ? -19.353 -13.085 17.090 1.00 43.62  ? 41   GLU C C     1 
ATOM   1657  O  O     . GLU C  3 41  ? -18.493 -13.127 16.235 1.00 43.88  ? 41   GLU C O     1 
ATOM   1658  C  CB    . GLU C  3 41  ? -21.364 -14.543 16.710 1.00 44.73  ? 41   GLU C CB    1 
ATOM   1659  C  CG    . GLU C  3 41  ? -21.320 -15.697 15.708 1.00 48.06  ? 41   GLU C CG    1 
ATOM   1660  C  CD    . GLU C  3 41  ? -21.028 -17.049 16.382 1.00 53.89  ? 41   GLU C CD    1 
ATOM   1661  O  OE1   . GLU C  3 41  ? -20.003 -17.694 16.021 1.00 55.80  ? 41   GLU C OE1   1 
ATOM   1662  O  OE2   . GLU C  3 41  ? -21.811 -17.458 17.287 1.00 55.10  ? 41   GLU C OE2   1 
ATOM   1663  N  N     . ARG C  3 42  ? -19.699 -11.950 17.686 1.00 43.15  ? 42   ARG C N     1 
ATOM   1664  C  CA    . ARG C  3 42  ? -19.070 -10.680 17.328 1.00 42.73  ? 42   ARG C CA    1 
ATOM   1665  C  C     . ARG C  3 42  ? -18.566 -9.922  18.555 1.00 41.94  ? 42   ARG C C     1 
ATOM   1666  O  O     . ARG C  3 42  ? -19.116 -10.061 19.642 1.00 41.72  ? 42   ARG C O     1 
ATOM   1667  C  CB    . ARG C  3 42  ? -20.054 -9.799  16.542 1.00 43.23  ? 42   ARG C CB    1 
ATOM   1668  C  CG    . ARG C  3 42  ? -20.427 -10.350 15.168 1.00 44.12  ? 42   ARG C CG    1 
ATOM   1669  C  CD    . ARG C  3 42  ? -21.883 -10.074 14.839 1.00 46.26  ? 42   ARG C CD    1 
ATOM   1670  N  NE    . ARG C  3 42  ? -22.075 -8.809  14.130 1.00 48.38  ? 42   ARG C NE    1 
ATOM   1671  C  CZ    . ARG C  3 42  ? -22.004 -8.674  12.806 1.00 49.63  ? 42   ARG C CZ    1 
ATOM   1672  N  NH1   . ARG C  3 42  ? -21.733 -9.720  12.029 1.00 49.49  ? 42   ARG C NH1   1 
ATOM   1673  N  NH2   . ARG C  3 42  ? -22.191 -7.483  12.253 1.00 50.93  ? 42   ARG C NH2   1 
ATOM   1674  N  N     . VAL C  3 43  ? -17.509 -9.133  18.367 1.00 40.96  ? 43   VAL C N     1 
ATOM   1675  C  CA    . VAL C  3 43  ? -17.053 -8.199  19.386 1.00 39.87  ? 43   VAL C CA    1 
ATOM   1676  C  C     . VAL C  3 43  ? -17.078 -6.810  18.806 1.00 39.01  ? 43   VAL C C     1 
ATOM   1677  O  O     . VAL C  3 43  ? -16.338 -6.528  17.878 1.00 39.43  ? 43   VAL C O     1 
ATOM   1678  C  CB    . VAL C  3 43  ? -15.606 -8.457  19.819 1.00 39.89  ? 43   VAL C CB    1 
ATOM   1679  C  CG1   . VAL C  3 43  ? -15.187 -7.436  20.875 1.00 39.32  ? 43   VAL C CG1   1 
ATOM   1680  C  CG2   . VAL C  3 43  ? -15.440 -9.854  20.343 1.00 39.71  ? 43   VAL C CG2   1 
ATOM   1681  N  N     . GLY C  3 44  ? -17.912 -5.946  19.361 1.00 38.09  ? 44   GLY C N     1 
ATOM   1682  C  CA    . GLY C  3 44  ? -17.936 -4.540  18.976 1.00 37.57  ? 44   GLY C CA    1 
ATOM   1683  C  C     . GLY C  3 44  ? -16.728 -3.750  19.452 1.00 37.22  ? 44   GLY C C     1 
ATOM   1684  O  O     . GLY C  3 44  ? -16.160 -4.047  20.504 1.00 37.53  ? 44   GLY C O     1 
ATOM   1685  N  N     . ALA C  3 45  ? -16.363 -2.729  18.677 1.00 36.66  ? 45   ALA C N     1 
ATOM   1686  C  CA    . ALA C  3 45  ? -15.149 -1.916  18.867 1.00 36.07  ? 45   ALA C CA    1 
ATOM   1687  C  C     . ALA C  3 45  ? -14.959 -1.309  20.262 1.00 35.58  ? 45   ALA C C     1 
ATOM   1688  O  O     . ALA C  3 45  ? -13.834 -1.205  20.753 1.00 35.73  ? 45   ALA C O     1 
ATOM   1689  C  CB    . ALA C  3 45  ? -15.112 -0.807  17.817 1.00 36.03  ? 45   ALA C CB    1 
ATOM   1690  N  N     . GLY C  3 46  ? -16.052 -0.899  20.885 1.00 34.86  ? 46   GLY C N     1 
ATOM   1691  C  CA    . GLY C  3 46  ? -15.999 -0.314  22.217 1.00 34.52  ? 46   GLY C CA    1 
ATOM   1692  C  C     . GLY C  3 46  ? -15.768 -1.300  23.351 1.00 34.18  ? 46   GLY C C     1 
ATOM   1693  O  O     . GLY C  3 46  ? -15.280 -0.911  24.414 1.00 34.34  ? 46   GLY C O     1 
ATOM   1694  N  N     . ALA C  3 47  ? -16.098 -2.573  23.134 1.00 33.36  ? 47   ALA C N     1 
ATOM   1695  C  CA    . ALA C  3 47  ? -15.967 -3.577  24.188 1.00 32.78  ? 47   ALA C CA    1 
ATOM   1696  C  C     . ALA C  3 47  ? -14.544 -3.720  24.748 1.00 32.41  ? 47   ALA C C     1 
ATOM   1697  O  O     . ALA C  3 47  ? -14.368 -3.642  25.962 1.00 32.68  ? 47   ALA C O     1 
ATOM   1698  C  CB    . ALA C  3 47  ? -16.516 -4.922  23.746 1.00 32.84  ? 47   ALA C CB    1 
ATOM   1699  N  N     . PRO C  3 48  ? -13.527 -3.913  23.881 1.00 31.67  ? 48   PRO C N     1 
ATOM   1700  C  CA    . PRO C  3 48  ? -12.182 -4.056  24.432 1.00 31.32  ? 48   PRO C CA    1 
ATOM   1701  C  C     . PRO C  3 48  ? -11.689 -2.789  25.112 1.00 31.15  ? 48   PRO C C     1 
ATOM   1702  O  O     . PRO C  3 48  ? -10.879 -2.861  26.030 1.00 31.55  ? 48   PRO C O     1 
ATOM   1703  C  CB    . PRO C  3 48  ? -11.326 -4.326  23.196 1.00 31.18  ? 48   PRO C CB    1 
ATOM   1704  C  CG    . PRO C  3 48  ? -12.108 -3.760  22.075 1.00 31.02  ? 48   PRO C CG    1 
ATOM   1705  C  CD    . PRO C  3 48  ? -13.522 -4.008  22.415 1.00 31.09  ? 48   PRO C CD    1 
ATOM   1706  N  N     . VAL C  3 49  ? -12.168 -1.637  24.661 1.00 30.84  ? 49   VAL C N     1 
ATOM   1707  C  CA    . VAL C  3 49  ? -11.678 -0.366  25.152 1.00 30.40  ? 49   VAL C CA    1 
ATOM   1708  C  C     . VAL C  3 49  ? -12.199 -0.203  26.558 1.00 30.25  ? 49   VAL C C     1 
ATOM   1709  O  O     . VAL C  3 49  ? -11.470 0.213   27.449 1.00 31.00  ? 49   VAL C O     1 
ATOM   1710  C  CB    . VAL C  3 49  ? -12.161 0.803   24.259 1.00 30.81  ? 49   VAL C CB    1 
ATOM   1711  C  CG1   . VAL C  3 49  ? -12.084 2.149   25.000 1.00 30.94  ? 49   VAL C CG1   1 
ATOM   1712  C  CG2   . VAL C  3 49  ? -11.377 0.846   22.946 1.00 29.75  ? 49   VAL C CG2   1 
ATOM   1713  N  N     . TYR C  3 50  ? -13.463 -0.553  26.751 1.00 29.57  ? 50   TYR C N     1 
ATOM   1714  C  CA    . TYR C  3 50  ? -14.096 -0.500  28.056 1.00 28.91  ? 50   TYR C CA    1 
ATOM   1715  C  C     . TYR C  3 50  ? -13.478 -1.520  29.017 1.00 28.80  ? 50   TYR C C     1 
ATOM   1716  O  O     . TYR C  3 50  ? -13.264 -1.232  30.200 1.00 29.56  ? 50   TYR C O     1 
ATOM   1717  C  CB    . TYR C  3 50  ? -15.579 -0.789  27.906 1.00 28.46  ? 50   TYR C CB    1 
ATOM   1718  C  CG    . TYR C  3 50  ? -16.446 -0.311  29.044 1.00 27.97  ? 50   TYR C CG    1 
ATOM   1719  C  CD1   . TYR C  3 50  ? -17.300 0.765   28.874 1.00 26.93  ? 50   TYR C CD1   1 
ATOM   1720  C  CD2   . TYR C  3 50  ? -16.442 -0.954  30.278 1.00 27.88  ? 50   TYR C CD2   1 
ATOM   1721  C  CE1   . TYR C  3 50  ? -18.117 1.205   29.888 1.00 27.21  ? 50   TYR C CE1   1 
ATOM   1722  C  CE2   . TYR C  3 50  ? -17.264 -0.515  31.312 1.00 28.21  ? 50   TYR C CE2   1 
ATOM   1723  C  CZ    . TYR C  3 50  ? -18.099 0.568   31.108 1.00 28.33  ? 50   TYR C CZ    1 
ATOM   1724  O  OH    . TYR C  3 50  ? -18.923 1.024   32.119 1.00 28.73  ? 50   TYR C OH    1 
ATOM   1725  N  N     . LEU C  3 51  ? -13.201 -2.714  28.517 1.00 27.84  ? 51   LEU C N     1 
ATOM   1726  C  CA    . LEU C  3 51  ? -12.660 -3.760  29.361 1.00 27.16  ? 51   LEU C CA    1 
ATOM   1727  C  C     . LEU C  3 51  ? -11.230 -3.422  29.799 1.00 26.95  ? 51   LEU C C     1 
ATOM   1728  O  O     . LEU C  3 51  ? -10.902 -3.567  30.971 1.00 27.08  ? 51   LEU C O     1 
ATOM   1729  C  CB    . LEU C  3 51  ? -12.760 -5.124  28.677 1.00 26.89  ? 51   LEU C CB    1 
ATOM   1730  C  CG    . LEU C  3 51  ? -12.385 -6.345  29.518 1.00 27.13  ? 51   LEU C CG    1 
ATOM   1731  C  CD1   . LEU C  3 51  ? -13.284 -6.501  30.705 1.00 26.44  ? 51   LEU C CD1   1 
ATOM   1732  C  CD2   . LEU C  3 51  ? -12.465 -7.582  28.663 1.00 28.03  ? 51   LEU C CD2   1 
ATOM   1733  N  N     . ALA C  3 52  ? -10.402 -2.941  28.873 1.00 26.33  ? 52   ALA C N     1 
ATOM   1734  C  CA    . ALA C  3 52  ? -9.070  -2.450  29.210 1.00 26.00  ? 52   ALA C CA    1 
ATOM   1735  C  C     . ALA C  3 52  ? -9.117  -1.326  30.246 1.00 25.99  ? 52   ALA C C     1 
ATOM   1736  O  O     . ALA C  3 52  ? -8.209  -1.216  31.079 1.00 26.38  ? 52   ALA C O     1 
ATOM   1737  C  CB    . ALA C  3 52  ? -8.347  -1.969  27.972 1.00 26.08  ? 52   ALA C CB    1 
ATOM   1738  N  N     . ALA C  3 53  ? -10.158 -0.491  30.192 1.00 25.35  ? 53   ALA C N     1 
ATOM   1739  C  CA    . ALA C  3 53  ? -10.319 0.603   31.155 1.00 24.82  ? 53   ALA C CA    1 
ATOM   1740  C  C     . ALA C  3 53  ? -10.616 0.071   32.550 1.00 24.62  ? 53   ALA C C     1 
ATOM   1741  O  O     . ALA C  3 53  ? -10.128 0.612   33.529 1.00 24.88  ? 53   ALA C O     1 
ATOM   1742  C  CB    . ALA C  3 53  ? -11.417 1.552   30.721 1.00 24.39  ? 53   ALA C CB    1 
ATOM   1743  N  N     . VAL C  3 54  ? -11.429 -0.979  32.635 1.00 24.03  ? 54   VAL C N     1 
ATOM   1744  C  CA    . VAL C  3 54  ? -11.809 -1.532  33.921 1.00 23.92  ? 54   VAL C CA    1 
ATOM   1745  C  C     . VAL C  3 54  ? -10.627 -2.296  34.539 1.00 24.32  ? 54   VAL C C     1 
ATOM   1746  O  O     . VAL C  3 54  ? -10.354 -2.180  35.734 1.00 24.33  ? 54   VAL C O     1 
ATOM   1747  C  CB    . VAL C  3 54  ? -13.100 -2.389  33.800 1.00 23.90  ? 54   VAL C CB    1 
ATOM   1748  C  CG1   . VAL C  3 54  ? -13.258 -3.353  34.964 1.00 22.23  ? 54   VAL C CG1   1 
ATOM   1749  C  CG2   . VAL C  3 54  ? -14.318 -1.474  33.687 1.00 23.06  ? 54   VAL C CG2   1 
ATOM   1750  N  N     . LEU C  3 55  ? -9.912  -3.035  33.696 1.00 24.54  ? 55   LEU C N     1 
ATOM   1751  C  CA    . LEU C  3 55  ? -8.777  -3.833  34.114 1.00 24.74  ? 55   LEU C CA    1 
ATOM   1752  C  C     . LEU C  3 55  ? -7.679  -2.941  34.640 1.00 25.52  ? 55   LEU C C     1 
ATOM   1753  O  O     . LEU C  3 55  ? -7.062  -3.245  35.673 1.00 25.96  ? 55   LEU C O     1 
ATOM   1754  C  CB    . LEU C  3 55  ? -8.273  -4.715  32.968 1.00 24.34  ? 55   LEU C CB    1 
ATOM   1755  C  CG    . LEU C  3 55  ? -9.231  -5.818  32.481 1.00 24.14  ? 55   LEU C CG    1 
ATOM   1756  C  CD1   . LEU C  3 55  ? -8.752  -6.450  31.176 1.00 24.80  ? 55   LEU C CD1   1 
ATOM   1757  C  CD2   . LEU C  3 55  ? -9.489  -6.900  33.523 1.00 23.21  ? 55   LEU C CD2   1 
ATOM   1758  N  N     . GLU C  3 56  ? -7.461  -1.821  33.957 1.00 26.08  ? 56   GLU C N     1 
ATOM   1759  C  CA    . GLU C  3 56  ? -6.471  -0.848  34.388 1.00 26.77  ? 56   GLU C CA    1 
ATOM   1760  C  C     . GLU C  3 56  ? -6.883  -0.163  35.683 1.00 26.64  ? 56   GLU C C     1 
ATOM   1761  O  O     . GLU C  3 56  ? -6.051  0.117   36.546 1.00 26.26  ? 56   GLU C O     1 
ATOM   1762  C  CB    . GLU C  3 56  ? -6.263  0.198   33.317 1.00 27.29  ? 56   GLU C CB    1 
ATOM   1763  C  CG    . GLU C  3 56  ? -5.144  1.165   33.632 1.00 30.50  ? 56   GLU C CG    1 
ATOM   1764  C  CD    . GLU C  3 56  ? -4.964  2.201   32.543 1.00 36.06  ? 56   GLU C CD    1 
ATOM   1765  O  OE1   . GLU C  3 56  ? -4.920  1.797   31.347 1.00 37.74  ? 56   GLU C OE1   1 
ATOM   1766  O  OE2   . GLU C  3 56  ? -4.871  3.411   32.879 1.00 37.48  ? 56   GLU C OE2   1 
ATOM   1767  N  N     . TYR C  3 57  ? -8.171  0.107   35.831 1.00 26.89  ? 57   TYR C N     1 
ATOM   1768  C  CA    . TYR C  3 57  ? -8.625  0.752   37.050 1.00 27.23  ? 57   TYR C CA    1 
ATOM   1769  C  C     . TYR C  3 57  ? -8.469  -0.141  38.287 1.00 26.97  ? 57   TYR C C     1 
ATOM   1770  O  O     . TYR C  3 57  ? -8.052  0.354   39.342 1.00 26.93  ? 57   TYR C O     1 
ATOM   1771  C  CB    . TYR C  3 57  ? -10.056 1.235   36.920 1.00 28.12  ? 57   TYR C CB    1 
ATOM   1772  C  CG    . TYR C  3 57  ? -10.687 1.529   38.246 1.00 29.35  ? 57   TYR C CG    1 
ATOM   1773  C  CD1   . TYR C  3 57  ? -10.292 2.631   38.994 1.00 30.96  ? 57   TYR C CD1   1 
ATOM   1774  C  CD2   . TYR C  3 57  ? -11.670 0.695   38.763 1.00 29.80  ? 57   TYR C CD2   1 
ATOM   1775  C  CE1   . TYR C  3 57  ? -10.872 2.898   40.222 1.00 31.84  ? 57   TYR C CE1   1 
ATOM   1776  C  CE2   . TYR C  3 57  ? -12.257 0.953   39.981 1.00 30.02  ? 57   TYR C CE2   1 
ATOM   1777  C  CZ    . TYR C  3 57  ? -11.855 2.050   40.710 1.00 30.88  ? 57   TYR C CZ    1 
ATOM   1778  O  OH    . TYR C  3 57  ? -12.444 2.310   41.935 1.00 31.42  ? 57   TYR C OH    1 
ATOM   1779  N  N     . LEU C  3 58  ? -8.785  -1.437  38.156 1.00 25.89  ? 58   LEU C N     1 
ATOM   1780  C  CA    . LEU C  3 58  ? -8.640  -2.369  39.266 1.00 25.15  ? 58   LEU C CA    1 
ATOM   1781  C  C     . LEU C  3 58  ? -7.174  -2.647  39.585 1.00 25.30  ? 58   LEU C C     1 
ATOM   1782  O  O     . LEU C  3 58  ? -6.791  -2.676  40.755 1.00 25.20  ? 58   LEU C O     1 
ATOM   1783  C  CB    . LEU C  3 58  ? -9.374  -3.670  39.002 1.00 24.99  ? 58   LEU C CB    1 
ATOM   1784  C  CG    . LEU C  3 58  ? -10.874 -3.549  38.764 1.00 24.57  ? 58   LEU C CG    1 
ATOM   1785  C  CD1   . LEU C  3 58  ? -11.406 -4.816  38.146 1.00 23.27  ? 58   LEU C CD1   1 
ATOM   1786  C  CD2   . LEU C  3 58  ? -11.653 -3.203  40.036 1.00 24.38  ? 58   LEU C CD2   1 
ATOM   1787  N  N     . THR C  3 59  ? -6.354  -2.842  38.553 1.00 24.98  ? 59   THR C N     1 
ATOM   1788  C  CA    . THR C  3 59  ? -4.915  -2.940  38.751 1.00 24.78  ? 59   THR C CA    1 
ATOM   1789  C  C     . THR C  3 59  ? -4.442  -1.750  39.578 1.00 25.04  ? 59   THR C C     1 
ATOM   1790  O  O     . THR C  3 59  ? -3.673  -1.906  40.526 1.00 25.40  ? 59   THR C O     1 
ATOM   1791  C  CB    . THR C  3 59  ? -4.194  -2.967  37.411 1.00 24.60  ? 59   THR C CB    1 
ATOM   1792  O  OG1   . THR C  3 59  ? -4.582  -4.147  36.713 1.00 25.37  ? 59   THR C OG1   1 
ATOM   1793  C  CG2   . THR C  3 59  ? -2.687  -2.985  37.567 1.00 24.01  ? 59   THR C CG2   1 
ATOM   1794  N  N     . ALA C  3 60  ? -4.939  -0.568  39.239 1.00 25.08  ? 60   ALA C N     1 
ATOM   1795  C  CA    . ALA C  3 60  ? -4.501  0.655   39.876 1.00 25.38  ? 60   ALA C CA    1 
ATOM   1796  C  C     . ALA C  3 60  ? -4.881  0.711   41.334 1.00 25.64  ? 60   ALA C C     1 
ATOM   1797  O  O     . ALA C  3 60  ? -4.071  1.080   42.173 1.00 25.71  ? 60   ALA C O     1 
ATOM   1798  C  CB    . ALA C  3 60  ? -5.062  1.858   39.142 1.00 25.60  ? 60   ALA C CB    1 
ATOM   1799  N  N     . GLU C  3 61  ? -6.120  0.331   41.625 1.00 26.15  ? 61   GLU C N     1 
ATOM   1800  C  CA    . GLU C  3 61  ? -6.686  0.390   42.970 1.00 26.39  ? 61   GLU C CA    1 
ATOM   1801  C  C     . GLU C  3 61  ? -5.990  -0.586  43.916 1.00 25.68  ? 61   GLU C C     1 
ATOM   1802  O  O     . GLU C  3 61  ? -5.832  -0.301  45.105 1.00 25.78  ? 61   GLU C O     1 
ATOM   1803  C  CB    . GLU C  3 61  ? -8.165  0.046   42.880 1.00 27.02  ? 61   GLU C CB    1 
ATOM   1804  C  CG    . GLU C  3 61  ? -8.919  0.125   44.168 1.00 31.79  ? 61   GLU C CG    1 
ATOM   1805  C  CD    . GLU C  3 61  ? -8.940  1.536   44.754 1.00 38.61  ? 61   GLU C CD    1 
ATOM   1806  O  OE1   . GLU C  3 61  ? -9.349  2.501   44.023 1.00 40.25  ? 61   GLU C OE1   1 
ATOM   1807  O  OE2   . GLU C  3 61  ? -8.561  1.659   45.956 1.00 40.16  ? 61   GLU C OE2   1 
ATOM   1808  N  N     . ILE C  3 62  ? -5.583  -1.739  43.397 1.00 24.65  ? 62   ILE C N     1 
ATOM   1809  C  CA    . ILE C  3 62  ? -4.927  -2.723  44.235 1.00 24.19  ? 62   ILE C CA    1 
ATOM   1810  C  C     . ILE C  3 62  ? -3.447  -2.429  44.418 1.00 23.72  ? 62   ILE C C     1 
ATOM   1811  O  O     . ILE C  3 62  ? -2.908  -2.704  45.484 1.00 23.69  ? 62   ILE C O     1 
ATOM   1812  C  CB    . ILE C  3 62  ? -5.177  -4.174  43.789 1.00 24.20  ? 62   ILE C CB    1 
ATOM   1813  C  CG1   . ILE C  3 62  ? -4.480  -5.139  44.720 1.00 24.89  ? 62   ILE C CG1   1 
ATOM   1814  C  CG2   . ILE C  3 62  ? -4.598  -4.440  42.449 1.00 25.31  ? 62   ILE C CG2   1 
ATOM   1815  C  CD1   . ILE C  3 62  ? -4.978  -6.537  44.567 1.00 28.04  ? 62   ILE C CD1   1 
ATOM   1816  N  N     . LEU C  3 63  ? -2.792  -1.857  43.406 1.00 23.25  ? 63   LEU C N     1 
ATOM   1817  C  CA    . LEU C  3 63  ? -1.399  -1.429  43.567 1.00 22.83  ? 63   LEU C CA    1 
ATOM   1818  C  C     . LEU C  3 63  ? -1.271  -0.162  44.462 1.00 23.15  ? 63   LEU C C     1 
ATOM   1819  O  O     . LEU C  3 63  ? -0.271  0.024   45.159 1.00 22.83  ? 63   LEU C O     1 
ATOM   1820  C  CB    . LEU C  3 63  ? -0.716  -1.234  42.214 1.00 22.58  ? 63   LEU C CB    1 
ATOM   1821  C  CG    . LEU C  3 63  ? -0.521  -2.430  41.270 1.00 22.47  ? 63   LEU C CG    1 
ATOM   1822  C  CD1   . LEU C  3 63  ? 0.080   -1.980  39.985 1.00 20.81  ? 63   LEU C CD1   1 
ATOM   1823  C  CD2   . LEU C  3 63  ? 0.346   -3.523  41.865 1.00 23.27  ? 63   LEU C CD2   1 
ATOM   1824  N  N     . GLU C  3 64  ? -2.286  0.698   44.453 1.00 23.25  ? 64   GLU C N     1 
ATOM   1825  C  CA    . GLU C  3 64  ? -2.315  1.825   45.362 1.00 24.03  ? 64   GLU C CA    1 
ATOM   1826  C  C     . GLU C  3 64  ? -2.252  1.314   46.779 1.00 24.06  ? 64   GLU C C     1 
ATOM   1827  O  O     . GLU C  3 64  ? -1.350  1.676   47.529 1.00 24.14  ? 64   GLU C O     1 
ATOM   1828  C  CB    . GLU C  3 64  ? -3.584  2.649   45.160 1.00 24.40  ? 64   GLU C CB    1 
ATOM   1829  C  CG    . GLU C  3 64  ? -3.786  3.797   46.155 1.00 28.28  ? 64   GLU C CG    1 
ATOM   1830  C  CD    . GLU C  3 64  ? -2.810  4.973   45.977 1.00 32.74  ? 64   GLU C CD    1 
ATOM   1831  O  OE1   . GLU C  3 64  ? -2.928  5.996   46.698 1.00 34.32  ? 64   GLU C OE1   1 
ATOM   1832  O  OE2   . GLU C  3 64  ? -1.915  4.885   45.121 1.00 36.95  ? 64   GLU C OE2   1 
ATOM   1833  N  N     . LEU C  3 65  ? -3.197  0.442   47.129 1.00 23.98  ? 65   LEU C N     1 
ATOM   1834  C  CA    . LEU C  3 65  ? -3.306  -0.087  48.486 1.00 23.66  ? 65   LEU C CA    1 
ATOM   1835  C  C     . LEU C  3 65  ? -2.167  -1.011  48.918 1.00 24.15  ? 65   LEU C C     1 
ATOM   1836  O  O     . LEU C  3 65  ? -1.817  -1.040  50.109 1.00 24.41  ? 65   LEU C O     1 
ATOM   1837  C  CB    . LEU C  3 65  ? -4.634  -0.816  48.669 1.00 23.57  ? 65   LEU C CB    1 
ATOM   1838  C  CG    . LEU C  3 65  ? -5.921  -0.004  48.572 1.00 22.25  ? 65   LEU C CG    1 
ATOM   1839  C  CD1   . LEU C  3 65  ? -7.070  -0.938  48.319 1.00 19.88  ? 65   LEU C CD1   1 
ATOM   1840  C  CD2   . LEU C  3 65  ? -6.123  0.829   49.825 1.00 18.27  ? 65   LEU C CD2   1 
ATOM   1841  N  N     . ALA C  3 66  ? -1.623  -1.789  47.977 1.00 24.26  ? 66   ALA C N     1 
ATOM   1842  C  CA    . ALA C  3 66  ? -0.497  -2.680  48.274 1.00 24.21  ? 66   ALA C CA    1 
ATOM   1843  C  C     . ALA C  3 66  ? 0.758   -1.860  48.524 1.00 24.73  ? 66   ALA C C     1 
ATOM   1844  O  O     . ALA C  3 66  ? 1.458   -2.073  49.514 1.00 24.58  ? 66   ALA C O     1 
ATOM   1845  C  CB    . ALA C  3 66  ? -0.284  -3.654  47.174 1.00 23.80  ? 66   ALA C CB    1 
ATOM   1846  N  N     . GLY C  3 67  ? 1.023   -0.905  47.635 1.00 25.08  ? 67   GLY C N     1 
ATOM   1847  C  CA    . GLY C  3 67  ? 2.033   0.107   47.875 1.00 25.39  ? 67   GLY C CA    1 
ATOM   1848  C  C     . GLY C  3 67  ? 1.994   0.696   49.282 1.00 25.99  ? 67   GLY C C     1 
ATOM   1849  O  O     . GLY C  3 67  ? 3.038   0.846   49.911 1.00 26.41  ? 67   GLY C O     1 
ATOM   1850  N  N     . ASN C  3 68  ? 0.819   1.033   49.802 1.00 26.14  ? 68   ASN C N     1 
ATOM   1851  C  CA    . ASN C  3 68  ? 0.784   1.596   51.154 1.00 26.77  ? 68   ASN C CA    1 
ATOM   1852  C  C     . ASN C  3 68  ? 1.197   0.552   52.166 1.00 27.12  ? 68   ASN C C     1 
ATOM   1853  O  O     . ASN C  3 68  ? 1.958   0.846   53.081 1.00 27.39  ? 68   ASN C O     1 
ATOM   1854  C  CB    . ASN C  3 68  ? -0.598  2.117   51.550 1.00 26.81  ? 68   ASN C CB    1 
ATOM   1855  C  CG    . ASN C  3 68  ? -1.109  3.216   50.643 1.00 27.18  ? 68   ASN C CG    1 
ATOM   1856  O  OD1   . ASN C  3 68  ? -0.328  3.962   50.037 1.00 27.88  ? 68   ASN C OD1   1 
ATOM   1857  N  ND2   . ASN C  3 68  ? -2.438  3.324   50.546 1.00 25.25  ? 68   ASN C ND2   1 
ATOM   1858  N  N     . ALA C  3 69  ? 0.686   -0.666  52.004 1.00 27.55  ? 69   ALA C N     1 
ATOM   1859  C  CA    . ALA C  3 69  ? 1.022   -1.758  52.908 1.00 28.38  ? 69   ALA C CA    1 
ATOM   1860  C  C     . ALA C  3 69  ? 2.534   -1.947  52.955 1.00 29.64  ? 69   ALA C C     1 
ATOM   1861  O  O     . ALA C  3 69  ? 3.094   -2.202  54.020 1.00 30.50  ? 69   ALA C O     1 
ATOM   1862  C  CB    . ALA C  3 69  ? 0.339   -3.031  52.490 1.00 27.67  ? 69   ALA C CB    1 
ATOM   1863  N  N     . ALA C  3 70  ? 3.184   -1.799  51.802 1.00 30.53  ? 70   ALA C N     1 
ATOM   1864  C  CA    . ALA C  3 70  ? 4.616   -1.912  51.692 1.00 31.58  ? 70   ALA C CA    1 
ATOM   1865  C  C     . ALA C  3 70  ? 5.297   -0.786  52.445 1.00 32.82  ? 70   ALA C C     1 
ATOM   1866  O  O     . ALA C  3 70  ? 6.271   -1.013  53.140 1.00 32.96  ? 70   ALA C O     1 
ATOM   1867  C  CB    . ALA C  3 70  ? 5.019   -1.875  50.250 1.00 31.39  ? 70   ALA C CB    1 
ATOM   1868  N  N     . ARG C  3 71  ? 4.788   0.429   52.293 1.00 34.54  ? 71   ARG C N     1 
ATOM   1869  C  CA    . ARG C  3 71  ? 5.360   1.587   52.955 1.00 36.64  ? 71   ARG C CA    1 
ATOM   1870  C  C     . ARG C  3 71  ? 5.200   1.450   54.455 1.00 36.99  ? 71   ARG C C     1 
ATOM   1871  O  O     . ARG C  3 71  ? 6.094   1.829   55.192 1.00 36.98  ? 71   ARG C O     1 
ATOM   1872  C  CB    . ARG C  3 71  ? 4.695   2.870   52.467 1.00 36.35  ? 71   ARG C CB    1 
ATOM   1873  C  CG    . ARG C  3 71  ? 5.487   4.170   52.733 1.00 38.16  ? 71   ARG C CG    1 
ATOM   1874  C  CD    . ARG C  3 71  ? 4.563   5.407   52.759 1.00 40.00  ? 71   ARG C CD    1 
ATOM   1875  N  NE    . ARG C  3 71  ? 3.303   5.141   53.493 1.00 48.96  ? 71   ARG C NE    1 
ATOM   1876  C  CZ    . ARG C  3 71  ? 2.083   5.028   52.939 1.00 51.86  ? 71   ARG C CZ    1 
ATOM   1877  N  NH1   . ARG C  3 71  ? 1.905   5.180   51.616 1.00 52.52  ? 71   ARG C NH1   1 
ATOM   1878  N  NH2   . ARG C  3 71  ? 1.027   4.762   53.713 1.00 52.47  ? 71   ARG C NH2   1 
ATOM   1879  N  N     . ASP C  3 72  ? 4.068   0.889   54.891 1.00 38.31  ? 72   ASP C N     1 
ATOM   1880  C  CA    . ASP C  3 72  ? 3.788   0.614   56.312 1.00 39.52  ? 72   ASP C CA    1 
ATOM   1881  C  C     . ASP C  3 72  ? 4.751   -0.385  56.998 1.00 40.09  ? 72   ASP C C     1 
ATOM   1882  O  O     . ASP C  3 72  ? 4.881   -0.373  58.215 1.00 40.12  ? 72   ASP C O     1 
ATOM   1883  C  CB    . ASP C  3 72  ? 2.352   0.101   56.477 1.00 39.61  ? 72   ASP C CB    1 
ATOM   1884  C  CG    . ASP C  3 72  ? 1.309   1.187   56.295 1.00 41.70  ? 72   ASP C CG    1 
ATOM   1885  O  OD1   . ASP C  3 72  ? 1.604   2.375   56.535 1.00 44.38  ? 72   ASP C OD1   1 
ATOM   1886  O  OD2   . ASP C  3 72  ? 0.166   0.858   55.913 1.00 44.76  ? 72   ASP C OD2   1 
ATOM   1887  N  N     . ASN C  3 73  ? 5.380   -1.266  56.222 1.00 40.66  ? 73   ASN C N     1 
ATOM   1888  C  CA    . ASN C  3 73  ? 6.345   -2.227  56.747 1.00 41.38  ? 73   ASN C CA    1 
ATOM   1889  C  C     . ASN C  3 73  ? 7.775   -1.838  56.386 1.00 41.01  ? 73   ASN C C     1 
ATOM   1890  O  O     . ASN C  3 73  ? 8.681   -2.683  56.350 1.00 41.10  ? 73   ASN C O     1 
ATOM   1891  C  CB    . ASN C  3 73  ? 6.039   -3.637  56.227 1.00 42.21  ? 73   ASN C CB    1 
ATOM   1892  C  CG    . ASN C  3 73  ? 4.699   -4.153  56.706 1.00 44.71  ? 73   ASN C CG    1 
ATOM   1893  O  OD1   . ASN C  3 73  ? 4.561   -4.559  57.863 1.00 48.40  ? 73   ASN C OD1   1 
ATOM   1894  N  ND2   . ASN C  3 73  ? 3.699   -4.137  55.825 1.00 45.82  ? 73   ASN C ND2   1 
ATOM   1895  N  N     . LYS C  3 74  ? 7.971   -0.554  56.109 1.00 40.32  ? 74   LYS C N     1 
ATOM   1896  C  CA    . LYS C  3 74  ? 9.298   -0.030  55.819 1.00 40.02  ? 74   LYS C CA    1 
ATOM   1897  C  C     . LYS C  3 74  ? 9.982   -0.723  54.636 1.00 38.82  ? 74   LYS C C     1 
ATOM   1898  O  O     . LYS C  3 74  ? 11.175  -0.996  54.674 1.00 39.03  ? 74   LYS C O     1 
ATOM   1899  C  CB    . LYS C  3 74  ? 10.161  -0.130  57.079 1.00 40.45  ? 74   LYS C CB    1 
ATOM   1900  C  CG    . LYS C  3 74  ? 9.585   0.644   58.278 1.00 41.57  ? 74   LYS C CG    1 
ATOM   1901  C  CD    . LYS C  3 74  ? 10.381  0.416   59.574 1.00 41.79  ? 74   LYS C CD    1 
ATOM   1902  C  CE    . LYS C  3 74  ? 9.611   0.945   60.812 1.00 44.02  ? 74   LYS C CE    1 
ATOM   1903  N  NZ    . LYS C  3 74  ? 9.198   2.403   60.716 1.00 45.41  ? 74   LYS C NZ    1 
ATOM   1904  N  N     . LYS C  3 75  ? 9.229   -1.009  53.580 1.00 37.50  ? 75   LYS C N     1 
ATOM   1905  C  CA    . LYS C  3 75  ? 9.789   -1.692  52.412 1.00 36.27  ? 75   LYS C CA    1 
ATOM   1906  C  C     . LYS C  3 75  ? 9.479   -0.909  51.150 1.00 35.18  ? 75   LYS C C     1 
ATOM   1907  O  O     . LYS C  3 75  ? 8.539   -0.107  51.114 1.00 35.11  ? 75   LYS C O     1 
ATOM   1908  C  CB    . LYS C  3 75  ? 9.223   -3.107  52.277 1.00 36.45  ? 75   LYS C CB    1 
ATOM   1909  C  CG    . LYS C  3 75  ? 9.175   -3.908  53.563 1.00 37.37  ? 75   LYS C CG    1 
ATOM   1910  C  CD    . LYS C  3 75  ? 10.454  -4.672  53.831 1.00 39.20  ? 75   LYS C CD    1 
ATOM   1911  C  CE    . LYS C  3 75  ? 10.437  -5.320  55.221 1.00 41.04  ? 75   LYS C CE    1 
ATOM   1912  N  NZ    . LYS C  3 75  ? 9.300   -6.297  55.398 1.00 43.50  ? 75   LYS C NZ    1 
ATOM   1913  N  N     . THR C  3 76  ? 10.268  -1.129  50.111 1.00 33.50  ? 76   THR C N     1 
ATOM   1914  C  CA    . THR C  3 76  ? 10.002  -0.440  48.869 1.00 32.40  ? 76   THR C CA    1 
ATOM   1915  C  C     . THR C  3 76  ? 9.562   -1.417  47.776 1.00 31.75  ? 76   THR C C     1 
ATOM   1916  O  O     . THR C  3 76  ? 9.158   -1.003  46.681 1.00 31.75  ? 76   THR C O     1 
ATOM   1917  C  CB    . THR C  3 76  ? 11.221  0.401   48.385 1.00 32.29  ? 76   THR C CB    1 
ATOM   1918  O  OG1   . THR C  3 76  ? 12.297  -0.463  47.996 1.00 32.84  ? 76   THR C OG1   1 
ATOM   1919  C  CG2   . THR C  3 76  ? 11.695  1.351   49.461 1.00 31.75  ? 76   THR C CG2   1 
ATOM   1920  N  N     . ARG C  3 77  ? 9.651   -2.711  48.055 1.00 30.16  ? 77   ARG C N     1 
ATOM   1921  C  CA    . ARG C  3 77  ? 9.264   -3.670  47.055 1.00 29.41  ? 77   ARG C CA    1 
ATOM   1922  C  C     . ARG C  3 77  ? 8.001   -4.427  47.450 1.00 28.69  ? 77   ARG C C     1 
ATOM   1923  O  O     . ARG C  3 77  ? 7.984   -5.169  48.440 1.00 28.99  ? 77   ARG C O     1 
ATOM   1924  C  CB    . ARG C  3 77  ? 10.399  -4.625  46.771 1.00 29.58  ? 77   ARG C CB    1 
ATOM   1925  C  CG    . ARG C  3 77  ? 10.057  -5.626  45.706 1.00 31.38  ? 77   ARG C CG    1 
ATOM   1926  C  CD    . ARG C  3 77  ? 11.166  -6.614  45.498 1.00 33.46  ? 77   ARG C CD    1 
ATOM   1927  N  NE    . ARG C  3 77  ? 12.349  -5.963  44.951 1.00 35.76  ? 77   ARG C NE    1 
ATOM   1928  C  CZ    . ARG C  3 77  ? 13.541  -5.946  45.540 1.00 36.71  ? 77   ARG C CZ    1 
ATOM   1929  N  NH1   . ARG C  3 77  ? 13.736  -6.559  46.703 1.00 35.65  ? 77   ARG C NH1   1 
ATOM   1930  N  NH2   . ARG C  3 77  ? 14.543  -5.312  44.951 1.00 38.58  ? 77   ARG C NH2   1 
ATOM   1931  N  N     . ILE C  3 78  ? 6.944   -4.235  46.670 1.00 27.49  ? 78   ILE C N     1 
ATOM   1932  C  CA    . ILE C  3 78  ? 5.716   -4.992  46.867 1.00 26.47  ? 78   ILE C CA    1 
ATOM   1933  C  C     . ILE C  3 78  ? 5.989   -6.493  46.730 1.00 26.14  ? 78   ILE C C     1 
ATOM   1934  O  O     . ILE C  3 78  ? 6.656   -6.934  45.797 1.00 26.33  ? 78   ILE C O     1 
ATOM   1935  C  CB    . ILE C  3 78  ? 4.605   -4.556  45.893 1.00 26.18  ? 78   ILE C CB    1 
ATOM   1936  C  CG1   . ILE C  3 78  ? 4.097   -3.167  46.281 1.00 25.03  ? 78   ILE C CG1   1 
ATOM   1937  C  CG2   . ILE C  3 78  ? 3.473   -5.561  45.899 1.00 25.37  ? 78   ILE C CG2   1 
ATOM   1938  C  CD1   . ILE C  3 78  ? 3.156   -2.577  45.305 1.00 24.34  ? 78   ILE C CD1   1 
ATOM   1939  N  N     . ILE C  3 79  ? 5.502   -7.257  47.699 1.00 25.14  ? 79   ILE C N     1 
ATOM   1940  C  CA    . ILE C  3 79  ? 5.579   -8.705  47.671 1.00 23.81  ? 79   ILE C CA    1 
ATOM   1941  C  C     . ILE C  3 79  ? 4.164   -9.220  47.975 1.00 23.24  ? 79   ILE C C     1 
ATOM   1942  O  O     . ILE C  3 79  ? 3.286   -8.430  48.329 1.00 23.07  ? 79   ILE C O     1 
ATOM   1943  C  CB    . ILE C  3 79  ? 6.640   -9.223  48.673 1.00 23.99  ? 79   ILE C CB    1 
ATOM   1944  C  CG1   . ILE C  3 79  ? 6.222   -8.948  50.132 1.00 24.59  ? 79   ILE C CG1   1 
ATOM   1945  C  CG2   . ILE C  3 79  ? 7.974   -8.586  48.362 1.00 23.42  ? 79   ILE C CG2   1 
ATOM   1946  C  CD1   . ILE C  3 79  ? 7.099   -9.634  51.192 1.00 22.52  ? 79   ILE C CD1   1 
ATOM   1947  N  N     . PRO C  3 80  ? 3.920   -10.528 47.790 1.00 22.23  ? 80   PRO C N     1 
ATOM   1948  C  CA    . PRO C  3 80  ? 2.572   -11.076 47.971 1.00 21.35  ? 80   PRO C CA    1 
ATOM   1949  C  C     . PRO C  3 80  ? 1.907   -10.755 49.292 1.00 20.80  ? 80   PRO C C     1 
ATOM   1950  O  O     . PRO C  3 80  ? 0.709   -10.525 49.316 1.00 20.96  ? 80   PRO C O     1 
ATOM   1951  C  CB    . PRO C  3 80  ? 2.793   -12.576 47.813 1.00 21.20  ? 80   PRO C CB    1 
ATOM   1952  C  CG    . PRO C  3 80  ? 3.923   -12.647 46.835 1.00 20.76  ? 80   PRO C CG    1 
ATOM   1953  C  CD    . PRO C  3 80  ? 4.854   -11.566 47.324 1.00 22.03  ? 80   PRO C CD    1 
ATOM   1954  N  N     . ARG C  3 81  ? 2.665   -10.716 50.378 1.00 20.38  ? 81   ARG C N     1 
ATOM   1955  C  CA    . ARG C  3 81  ? 2.098   -10.306 51.659 1.00 19.75  ? 81   ARG C CA    1 
ATOM   1956  C  C     . ARG C  3 81  ? 1.374   -8.969  51.519 1.00 20.02  ? 81   ARG C C     1 
ATOM   1957  O  O     . ARG C  3 81  ? 0.290   -8.754  52.084 1.00 20.11  ? 81   ARG C O     1 
ATOM   1958  C  CB    . ARG C  3 81  ? 3.192   -10.186 52.713 1.00 19.17  ? 81   ARG C CB    1 
ATOM   1959  C  CG    . ARG C  3 81  ? 2.710   -9.668  54.033 1.00 18.49  ? 81   ARG C CG    1 
ATOM   1960  C  CD    . ARG C  3 81  ? 1.888   -10.711 54.719 1.00 19.89  ? 81   ARG C CD    1 
ATOM   1961  N  NE    . ARG C  3 81  ? 1.513   -10.366 56.087 1.00 21.25  ? 81   ARG C NE    1 
ATOM   1962  C  CZ    . ARG C  3 81  ? 0.608   -11.030 56.804 1.00 21.51  ? 81   ARG C CZ    1 
ATOM   1963  N  NH1   . ARG C  3 81  ? -0.038  -12.075 56.291 1.00 21.36  ? 81   ARG C NH1   1 
ATOM   1964  N  NH2   . ARG C  3 81  ? 0.336   -10.647 58.038 1.00 22.41  ? 81   ARG C NH2   1 
ATOM   1965  N  N     . HIS C  3 82  ? 1.976   -8.066  50.754 1.00 20.06  ? 82   HIS C N     1 
ATOM   1966  C  CA    . HIS C  3 82  ? 1.431   -6.731  50.642 1.00 19.90  ? 82   HIS C CA    1 
ATOM   1967  C  C     . HIS C  3 82  ? 0.162   -6.747  49.828 1.00 19.74  ? 82   HIS C C     1 
ATOM   1968  O  O     . HIS C  3 82  ? -0.759  -5.981  50.101 1.00 20.09  ? 82   HIS C O     1 
ATOM   1969  C  CB    . HIS C  3 82  ? 2.458   -5.762  50.094 1.00 19.72  ? 82   HIS C CB    1 
ATOM   1970  C  CG    . HIS C  3 82  ? 3.704   -5.717  50.903 1.00 20.82  ? 82   HIS C CG    1 
ATOM   1971  N  ND1   . HIS C  3 82  ? 4.947   -5.508  50.347 1.00 24.37  ? 82   HIS C ND1   1 
ATOM   1972  C  CD2   . HIS C  3 82  ? 3.910   -5.893  52.228 1.00 22.96  ? 82   HIS C CD2   1 
ATOM   1973  C  CE1   . HIS C  3 82  ? 5.865   -5.531  51.298 1.00 24.75  ? 82   HIS C CE1   1 
ATOM   1974  N  NE2   . HIS C  3 82  ? 5.262   -5.760  52.450 1.00 25.33  ? 82   HIS C NE2   1 
ATOM   1975  N  N     . LEU C  3 83  ? 0.088   -7.647  48.858 1.00 19.32  ? 83   LEU C N     1 
ATOM   1976  C  CA    . LEU C  3 83  ? -1.133  -7.795  48.106 1.00 18.69  ? 83   LEU C CA    1 
ATOM   1977  C  C     . LEU C  3 83  ? -2.211  -8.327  49.021 1.00 18.88  ? 83   LEU C C     1 
ATOM   1978  O  O     . LEU C  3 83  ? -3.308  -7.783  49.078 1.00 18.70  ? 83   LEU C O     1 
ATOM   1979  C  CB    . LEU C  3 83  ? -0.912  -8.680  46.897 1.00 18.21  ? 83   LEU C CB    1 
ATOM   1980  C  CG    . LEU C  3 83  ? -0.058  -7.994  45.827 1.00 19.29  ? 83   LEU C CG    1 
ATOM   1981  C  CD1   . LEU C  3 83  ? 0.212   -8.904  44.655 1.00 19.85  ? 83   LEU C CD1   1 
ATOM   1982  C  CD2   . LEU C  3 83  ? -0.716  -6.723  45.342 1.00 20.71  ? 83   LEU C CD2   1 
ATOM   1983  N  N     . GLN C  3 84  ? -1.885  -9.357  49.784 1.00 19.50  ? 84   GLN C N     1 
ATOM   1984  C  CA    . GLN C  3 84  ? -2.866  -9.945  50.664 1.00 20.59  ? 84   GLN C CA    1 
ATOM   1985  C  C     . GLN C  3 84  ? -3.346  -8.915  51.684 1.00 21.53  ? 84   GLN C C     1 
ATOM   1986  O  O     . GLN C  3 84  ? -4.556  -8.769  51.888 1.00 22.12  ? 84   GLN C O     1 
ATOM   1987  C  CB    . GLN C  3 84  ? -2.284  -11.153 51.357 1.00 20.56  ? 84   GLN C CB    1 
ATOM   1988  C  CG    . GLN C  3 84  ? -3.065  -11.595 52.568 1.00 22.49  ? 84   GLN C CG    1 
ATOM   1989  C  CD    . GLN C  3 84  ? -4.186  -12.568 52.244 1.00 25.61  ? 84   GLN C CD    1 
ATOM   1990  O  OE1   . GLN C  3 84  ? -4.823  -12.504 51.184 1.00 26.96  ? 84   GLN C OE1   1 
ATOM   1991  N  NE2   . GLN C  3 84  ? -4.440  -13.473 53.169 1.00 25.52  ? 84   GLN C NE2   1 
ATOM   1992  N  N     . LEU C  3 85  ? -2.414  -8.181  52.299 1.00 21.82  ? 85   LEU C N     1 
ATOM   1993  C  CA    . LEU C  3 85  ? -2.792  -7.154  53.253 1.00 22.67  ? 85   LEU C CA    1 
ATOM   1994  C  C     . LEU C  3 85  ? -3.752  -6.150  52.638 1.00 22.99  ? 85   LEU C C     1 
ATOM   1995  O  O     . LEU C  3 85  ? -4.777  -5.822  53.238 1.00 23.56  ? 85   LEU C O     1 
ATOM   1996  C  CB    . LEU C  3 85  ? -1.567  -6.424  53.804 1.00 23.42  ? 85   LEU C CB    1 
ATOM   1997  C  CG    . LEU C  3 85  ? -0.681  -7.171  54.813 1.00 24.48  ? 85   LEU C CG    1 
ATOM   1998  C  CD1   . LEU C  3 85  ? 0.448   -6.287  55.292 1.00 23.46  ? 85   LEU C CD1   1 
ATOM   1999  C  CD2   . LEU C  3 85  ? -1.484  -7.715  55.988 1.00 25.11  ? 85   LEU C CD2   1 
ATOM   2000  N  N     . ALA C  3 86  ? -3.426  -5.678  51.438 1.00 22.85  ? 86   ALA C N     1 
ATOM   2001  C  CA    . ALA C  3 86  ? -4.250  -4.697  50.739 1.00 22.94  ? 86   ALA C CA    1 
ATOM   2002  C  C     . ALA C  3 86  ? -5.656  -5.202  50.434 1.00 23.24  ? 86   ALA C C     1 
ATOM   2003  O  O     . ALA C  3 86  ? -6.639  -4.475  50.596 1.00 23.65  ? 86   ALA C O     1 
ATOM   2004  C  CB    . ALA C  3 86  ? -3.567  -4.252  49.458 1.00 23.05  ? 86   ALA C CB    1 
ATOM   2005  N  N     . VAL C  3 87  ? -5.753  -6.446  49.993 1.00 23.26  ? 87   VAL C N     1 
ATOM   2006  C  CA    . VAL C  3 87  ? -7.038  -7.000  49.629 1.00 23.61  ? 87   VAL C CA    1 
ATOM   2007  C  C     . VAL C  3 87  ? -7.895  -7.254  50.871 1.00 24.18  ? 87   VAL C C     1 
ATOM   2008  O  O     . VAL C  3 87  ? -9.068  -6.878  50.919 1.00 24.22  ? 87   VAL C O     1 
ATOM   2009  C  CB    . VAL C  3 87  ? -6.849  -8.291  48.851 1.00 23.46  ? 87   VAL C CB    1 
ATOM   2010  C  CG1   . VAL C  3 87  ? -8.149  -9.010  48.700 1.00 23.61  ? 87   VAL C CG1   1 
ATOM   2011  C  CG2   . VAL C  3 87  ? -6.232  -8.000  47.497 1.00 23.53  ? 87   VAL C CG2   1 
ATOM   2012  N  N     . ARG C  3 88  ? -7.315  -7.883  51.885 1.00 24.61  ? 88   ARG C N     1 
ATOM   2013  C  CA    . ARG C  3 88  ? -8.120  -8.266  53.031 1.00 25.22  ? 88   ARG C CA    1 
ATOM   2014  C  C     . ARG C  3 88  ? -8.505  -7.048  53.876 1.00 26.45  ? 88   ARG C C     1 
ATOM   2015  O  O     . ARG C  3 88  ? -9.573  -7.024  54.464 1.00 27.17  ? 88   ARG C O     1 
ATOM   2016  C  CB    . ARG C  3 88  ? -7.442  -9.357  53.870 1.00 24.31  ? 88   ARG C CB    1 
ATOM   2017  C  CG    . ARG C  3 88  ? -7.119  -10.654 53.124 1.00 22.76  ? 88   ARG C CG    1 
ATOM   2018  C  CD    . ARG C  3 88  ? -8.288  -11.164 52.287 1.00 20.39  ? 88   ARG C CD    1 
ATOM   2019  N  NE    . ARG C  3 88  ? -7.886  -12.126 51.253 1.00 17.47  ? 88   ARG C NE    1 
ATOM   2020  C  CZ    . ARG C  3 88  ? -8.653  -12.494 50.220 1.00 15.34  ? 88   ARG C CZ    1 
ATOM   2021  N  NH1   . ARG C  3 88  ? -9.869  -11.973 50.035 1.00 14.57  ? 88   ARG C NH1   1 
ATOM   2022  N  NH2   . ARG C  3 88  ? -8.209  -13.403 49.370 1.00 11.69  ? 88   ARG C NH2   1 
ATOM   2023  N  N     . ASN C  3 89  ? -7.664  -6.024  53.905 1.00 27.27  ? 89   ASN C N     1 
ATOM   2024  C  CA    . ASN C  3 89  ? -7.999  -4.828  54.660 1.00 28.50  ? 89   ASN C CA    1 
ATOM   2025  C  C     . ASN C  3 89  ? -8.965  -3.893  53.962 1.00 29.53  ? 89   ASN C C     1 
ATOM   2026  O  O     . ASN C  3 89  ? -9.307  -2.855  54.520 1.00 29.91  ? 89   ASN C O     1 
ATOM   2027  C  CB    . ASN C  3 89  ? -6.741  -4.041  55.013 1.00 28.52  ? 89   ASN C CB    1 
ATOM   2028  C  CG    . ASN C  3 89  ? -6.003  -4.625  56.179 1.00 28.35  ? 89   ASN C CG    1 
ATOM   2029  O  OD1   . ASN C  3 89  ? -6.606  -5.042  57.161 1.00 27.53  ? 89   ASN C OD1   1 
ATOM   2030  N  ND2   . ASN C  3 89  ? -4.681  -4.653  56.085 1.00 29.14  ? 89   ASN C ND2   1 
ATOM   2031  N  N     . ASP C  3 90  ? -9.368  -4.225  52.735 1.00 30.94  ? 90   ASP C N     1 
ATOM   2032  C  CA    . ASP C  3 90  ? -10.304 -3.394  51.981 1.00 31.95  ? 90   ASP C CA    1 
ATOM   2033  C  C     . ASP C  3 90  ? -11.561 -4.142  51.718 1.00 32.16  ? 90   ASP C C     1 
ATOM   2034  O  O     . ASP C  3 90  ? -11.546 -5.149  51.030 1.00 32.58  ? 90   ASP C O     1 
ATOM   2035  C  CB    . ASP C  3 90  ? -9.767  -2.998  50.629 1.00 32.56  ? 90   ASP C CB    1 
ATOM   2036  C  CG    . ASP C  3 90  ? -10.841 -2.341  49.780 1.00 36.36  ? 90   ASP C CG    1 
ATOM   2037  O  OD1   . ASP C  3 90  ? -11.193 -1.176  50.085 1.00 39.84  ? 90   ASP C OD1   1 
ATOM   2038  O  OD2   . ASP C  3 90  ? -11.375 -2.994  48.844 1.00 39.73  ? 90   ASP C OD2   1 
ATOM   2039  N  N     . GLU C  3 91  ? -12.663 -3.610  52.215 1.00 32.84  ? 91   GLU C N     1 
ATOM   2040  C  CA    . GLU C  3 91  ? -13.930 -4.314  52.225 1.00 33.19  ? 91   GLU C CA    1 
ATOM   2041  C  C     . GLU C  3 91  ? -14.355 -4.815  50.844 1.00 32.42  ? 91   GLU C C     1 
ATOM   2042  O  O     . GLU C  3 91  ? -14.806 -5.949  50.691 1.00 32.21  ? 91   GLU C O     1 
ATOM   2043  C  CB    . GLU C  3 91  ? -14.988 -3.395  52.806 1.00 33.73  ? 91   GLU C CB    1 
ATOM   2044  C  CG    . GLU C  3 91  ? -15.917 -4.089  53.770 1.00 39.04  ? 91   GLU C CG    1 
ATOM   2045  C  CD    . GLU C  3 91  ? -17.199 -3.301  53.987 1.00 45.79  ? 91   GLU C CD    1 
ATOM   2046  O  OE1   . GLU C  3 91  ? -17.152 -2.253  54.685 1.00 47.22  ? 91   GLU C OE1   1 
ATOM   2047  O  OE2   . GLU C  3 91  ? -18.251 -3.733  53.447 1.00 48.88  ? 91   GLU C OE2   1 
ATOM   2048  N  N     . GLU C  3 92  ? -14.182 -3.975  49.832 1.00 31.88  ? 92   GLU C N     1 
ATOM   2049  C  CA    . GLU C  3 92  ? -14.669 -4.299  48.504 1.00 31.11  ? 92   GLU C CA    1 
ATOM   2050  C  C     . GLU C  3 92  ? -13.798 -5.261  47.707 1.00 29.88  ? 92   GLU C C     1 
ATOM   2051  O  O     . GLU C  3 92  ? -14.319 -6.189  47.068 1.00 29.43  ? 92   GLU C O     1 
ATOM   2052  C  CB    . GLU C  3 92  ? -14.971 -3.028  47.732 1.00 31.67  ? 92   GLU C CB    1 
ATOM   2053  C  CG    . GLU C  3 92  ? -16.366 -2.564  48.027 1.00 34.54  ? 92   GLU C CG    1 
ATOM   2054  C  CD    . GLU C  3 92  ? -16.740 -1.283  47.329 1.00 39.90  ? 92   GLU C CD    1 
ATOM   2055  O  OE1   . GLU C  3 92  ? -15.854 -0.655  46.690 1.00 41.70  ? 92   GLU C OE1   1 
ATOM   2056  O  OE2   . GLU C  3 92  ? -17.935 -0.901  47.437 1.00 42.47  ? 92   GLU C OE2   1 
ATOM   2057  N  N     . LEU C  3 93  ? -12.484 -5.040  47.735 1.00 28.36  ? 93   LEU C N     1 
ATOM   2058  C  CA    . LEU C  3 93  ? -11.569 -5.986  47.121 1.00 27.24  ? 93   LEU C CA    1 
ATOM   2059  C  C     . LEU C  3 93  ? -11.677 -7.312  47.832 1.00 26.90  ? 93   LEU C C     1 
ATOM   2060  O  O     . LEU C  3 93  ? -11.594 -8.367  47.204 1.00 26.84  ? 93   LEU C O     1 
ATOM   2061  C  CB    . LEU C  3 93  ? -10.127 -5.492  47.147 1.00 27.07  ? 93   LEU C CB    1 
ATOM   2062  C  CG    . LEU C  3 93  ? -9.745  -4.425  46.126 1.00 26.13  ? 93   LEU C CG    1 
ATOM   2063  C  CD1   . LEU C  3 93  ? -8.338  -3.954  46.378 1.00 24.79  ? 93   LEU C CD1   1 
ATOM   2064  C  CD2   . LEU C  3 93  ? -9.911  -4.921  44.678 1.00 25.18  ? 93   LEU C CD2   1 
ATOM   2065  N  N     . ASN C  3 94  ? -11.896 -7.263  49.142 1.00 26.51  ? 94   ASN C N     1 
ATOM   2066  C  CA    . ASN C  3 94  ? -12.089 -8.485  49.897 1.00 26.38  ? 94   ASN C CA    1 
ATOM   2067  C  C     . ASN C  3 94  ? -13.274 -9.328  49.445 1.00 26.72  ? 94   ASN C C     1 
ATOM   2068  O  O     . ASN C  3 94  ? -13.183 -10.552 49.467 1.00 26.91  ? 94   ASN C O     1 
ATOM   2069  C  CB    . ASN C  3 94  ? -12.192 -8.219  51.385 1.00 26.13  ? 94   ASN C CB    1 
ATOM   2070  C  CG    . ASN C  3 94  ? -12.218 -9.505  52.192 1.00 25.33  ? 94   ASN C CG    1 
ATOM   2071  O  OD1   . ASN C  3 94  ? -11.297 -10.318 52.106 1.00 26.76  ? 94   ASN C OD1   1 
ATOM   2072  N  ND2   . ASN C  3 94  ? -13.277 -9.704  52.956 1.00 22.25  ? 94   ASN C ND2   1 
ATOM   2073  N  N     . LYS C  3 95  ? -14.376 -8.694  49.047 1.00 27.07  ? 95   LYS C N     1 
ATOM   2074  C  CA    . LYS C  3 95  ? -15.504 -9.451  48.510 1.00 27.96  ? 95   LYS C CA    1 
ATOM   2075  C  C     . LYS C  3 95  ? -15.225 -9.946  47.091 1.00 27.40  ? 95   LYS C C     1 
ATOM   2076  O  O     . LYS C  3 95  ? -15.497 -11.107 46.778 1.00 27.23  ? 95   LYS C O     1 
ATOM   2077  C  CB    . LYS C  3 95  ? -16.820 -8.672  48.560 1.00 28.37  ? 95   LYS C CB    1 
ATOM   2078  C  CG    . LYS C  3 95  ? -18.025 -9.521  48.129 1.00 29.06  ? 95   LYS C CG    1 
ATOM   2079  C  CD    . LYS C  3 95  ? -19.358 -8.804  48.368 1.00 30.55  ? 95   LYS C CD    1 
ATOM   2080  C  CE    . LYS C  3 95  ? -20.580 -9.765  48.254 1.00 33.85  ? 95   LYS C CE    1 
ATOM   2081  N  NZ    . LYS C  3 95  ? -20.710 -10.415 46.895 1.00 36.69  ? 95   LYS C NZ    1 
ATOM   2082  N  N     . LEU C  3 96  ? -14.672 -9.076  46.243 1.00 26.88  ? 96   LEU C N     1 
ATOM   2083  C  CA    . LEU C  3 96  ? -14.379 -9.443  44.855 1.00 25.98  ? 96   LEU C CA    1 
ATOM   2084  C  C     . LEU C  3 96  ? -13.462 -10.640 44.791 1.00 26.18  ? 96   LEU C C     1 
ATOM   2085  O  O     . LEU C  3 96  ? -13.592 -11.467 43.880 1.00 27.09  ? 96   LEU C O     1 
ATOM   2086  C  CB    . LEU C  3 96  ? -13.744 -8.280  44.103 1.00 26.19  ? 96   LEU C CB    1 
ATOM   2087  C  CG    . LEU C  3 96  ? -13.264 -8.500  42.667 1.00 26.42  ? 96   LEU C CG    1 
ATOM   2088  C  CD1   . LEU C  3 96  ? -14.416 -8.976  41.777 1.00 26.05  ? 96   LEU C CD1   1 
ATOM   2089  C  CD2   . LEU C  3 96  ? -12.599 -7.243  42.110 1.00 25.41  ? 96   LEU C CD2   1 
ATOM   2090  N  N     . LEU C  3 97  ? -12.534 -10.733 45.746 1.00 25.41  ? 97   LEU C N     1 
ATOM   2091  C  CA    . LEU C  3 97  ? -11.559 -11.812 45.767 1.00 24.49  ? 97   LEU C CA    1 
ATOM   2092  C  C     . LEU C  3 97  ? -11.824 -12.728 46.950 1.00 24.65  ? 97   LEU C C     1 
ATOM   2093  O  O     . LEU C  3 97  ? -10.901 -13.388 47.485 1.00 24.61  ? 97   LEU C O     1 
ATOM   2094  C  CB    . LEU C  3 97  ? -10.154 -11.243 45.839 1.00 24.25  ? 97   LEU C CB    1 
ATOM   2095  C  CG    . LEU C  3 97  ? -9.727  -10.296 44.723 1.00 24.15  ? 97   LEU C CG    1 
ATOM   2096  C  CD1   . LEU C  3 97  ? -8.323  -9.839  44.959 1.00 23.06  ? 97   LEU C CD1   1 
ATOM   2097  C  CD2   . LEU C  3 97  ? -9.807  -10.974 43.378 1.00 25.85  ? 97   LEU C CD2   1 
ATOM   2098  N  N     . GLY C  3 98  ? -13.094 -12.772 47.352 1.00 24.05  ? 98   GLY C N     1 
ATOM   2099  C  CA    . GLY C  3 98  ? -13.516 -13.561 48.493 1.00 23.89  ? 98   GLY C CA    1 
ATOM   2100  C  C     . GLY C  3 98  ? -13.225 -15.046 48.412 1.00 23.96  ? 98   GLY C C     1 
ATOM   2101  O  O     . GLY C  3 98  ? -13.068 -15.691 49.425 1.00 24.57  ? 98   GLY C O     1 
ATOM   2102  N  N     . ARG C  3 99  ? -13.177 -15.595 47.212 1.00 24.19  ? 99   ARG C N     1 
ATOM   2103  C  CA    . ARG C  3 99  ? -12.909 -17.008 47.018 1.00 24.46  ? 99   ARG C CA    1 
ATOM   2104  C  C     . ARG C  3 99  ? -11.535 -17.220 46.362 1.00 23.71  ? 99   ARG C C     1 
ATOM   2105  O  O     . ARG C  3 99  ? -11.306 -18.225 45.690 1.00 24.22  ? 99   ARG C O     1 
ATOM   2106  C  CB    . ARG C  3 99  ? -13.994 -17.634 46.130 1.00 25.10  ? 99   ARG C CB    1 
ATOM   2107  C  CG    . ARG C  3 99  ? -15.418 -17.592 46.662 1.00 29.20  ? 99   ARG C CG    1 
ATOM   2108  C  CD    . ARG C  3 99  ? -15.669 -18.547 47.846 1.00 38.09  ? 99   ARG C CD    1 
ATOM   2109  N  NE    . ARG C  3 99  ? -17.047 -18.398 48.336 1.00 45.47  ? 99   ARG C NE    1 
ATOM   2110  C  CZ    . ARG C  3 99  ? -17.432 -18.395 49.622 1.00 48.92  ? 99   ARG C CZ    1 
ATOM   2111  N  NH1   . ARG C  3 99  ? -16.549 -18.546 50.618 1.00 49.59  ? 99   ARG C NH1   1 
ATOM   2112  N  NH2   . ARG C  3 99  ? -18.726 -18.236 49.915 1.00 49.05  ? 99   ARG C NH2   1 
ATOM   2113  N  N     . VAL C  3 100 ? -10.626 -16.275 46.535 1.00 22.38  ? 100  VAL C N     1 
ATOM   2114  C  CA    . VAL C  3 100 ? -9.343  -16.369 45.873 1.00 21.78  ? 100  VAL C CA    1 
ATOM   2115  C  C     . VAL C  3 100 ? -8.240  -16.545 46.908 1.00 21.27  ? 100  VAL C C     1 
ATOM   2116  O  O     . VAL C  3 100 ? -8.268  -15.900 47.941 1.00 21.27  ? 100  VAL C O     1 
ATOM   2117  C  CB    . VAL C  3 100 ? -9.084  -15.097 45.030 1.00 22.01  ? 100  VAL C CB    1 
ATOM   2118  C  CG1   . VAL C  3 100 ? -7.607  -14.942 44.678 1.00 21.26  ? 100  VAL C CG1   1 
ATOM   2119  C  CG2   . VAL C  3 100 ? -9.928  -15.126 43.777 1.00 22.04  ? 100  VAL C CG2   1 
ATOM   2120  N  N     . THR C  3 101 ? -7.270  -17.406 46.635 1.00 20.53  ? 101  THR C N     1 
ATOM   2121  C  CA    . THR C  3 101 ? -6.114  -17.518 47.502 1.00 20.34  ? 101  THR C CA    1 
ATOM   2122  C  C     . THR C  3 101 ? -4.912  -16.899 46.847 1.00 20.09  ? 101  THR C C     1 
ATOM   2123  O  O     . THR C  3 101 ? -4.559  -17.277 45.743 1.00 19.66  ? 101  THR C O     1 
ATOM   2124  C  CB    . THR C  3 101 ? -5.800  -18.988 47.813 1.00 20.88  ? 101  THR C CB    1 
ATOM   2125  O  OG1   . THR C  3 101 ? -6.944  -19.569 48.437 1.00 22.35  ? 101  THR C OG1   1 
ATOM   2126  C  CG2   . THR C  3 101 ? -4.585  -19.139 48.744 1.00 19.63  ? 101  THR C CG2   1 
ATOM   2127  N  N     . ILE C  3 102 ? -4.275  -15.976 47.564 1.00 20.01  ? 102  ILE C N     1 
ATOM   2128  C  CA    . ILE C  3 102 ? -3.061  -15.327 47.123 1.00 20.37  ? 102  ILE C CA    1 
ATOM   2129  C  C     . ILE C  3 102 ? -1.877  -16.081 47.720 1.00 21.02  ? 102  ILE C C     1 
ATOM   2130  O  O     . ILE C  3 102 ? -1.618  -15.966 48.901 1.00 21.27  ? 102  ILE C O     1 
ATOM   2131  C  CB    . ILE C  3 102 ? -3.041  -13.845 47.572 1.00 20.36  ? 102  ILE C CB    1 
ATOM   2132  C  CG1   . ILE C  3 102 ? -4.111  -13.043 46.831 1.00 20.22  ? 102  ILE C CG1   1 
ATOM   2133  C  CG2   . ILE C  3 102 ? -1.661  -13.212 47.386 1.00 20.44  ? 102  ILE C CG2   1 
ATOM   2134  C  CD1   . ILE C  3 102 ? -4.307  -11.644 47.347 1.00 18.27  ? 102  ILE C CD1   1 
ATOM   2135  N  N     . ALA C  3 103 ? -1.158  -16.846 46.898 1.00 21.87  ? 103  ALA C N     1 
ATOM   2136  C  CA    . ALA C  3 103 ? 0.024   -17.597 47.340 1.00 22.68  ? 103  ALA C CA    1 
ATOM   2137  C  C     . ALA C  3 103 ? 0.952   -16.706 48.132 1.00 23.29  ? 103  ALA C C     1 
ATOM   2138  O  O     . ALA C  3 103 ? 1.085   -15.528 47.801 1.00 23.56  ? 103  ALA C O     1 
ATOM   2139  C  CB    . ALA C  3 103 ? 0.779   -18.170 46.138 1.00 22.81  ? 103  ALA C CB    1 
ATOM   2140  N  N     . GLN C  3 104 ? 1.585   -17.278 49.162 1.00 23.77  ? 104  GLN C N     1 
ATOM   2141  C  CA    . GLN C  3 104 ? 2.518   -16.573 50.065 1.00 24.02  ? 104  GLN C CA    1 
ATOM   2142  C  C     . GLN C  3 104 ? 1.960   -15.289 50.730 1.00 24.11  ? 104  GLN C C     1 
ATOM   2143  O  O     . GLN C  3 104 ? 2.717   -14.408 51.141 1.00 24.71  ? 104  GLN C O     1 
ATOM   2144  C  CB    . GLN C  3 104 ? 3.869   -16.321 49.380 1.00 24.11  ? 104  GLN C CB    1 
ATOM   2145  C  CG    . GLN C  3 104 ? 4.800   -17.546 49.279 1.00 26.71  ? 104  GLN C CG    1 
ATOM   2146  C  CD    . GLN C  3 104 ? 5.307   -18.060 50.658 1.00 31.02  ? 104  GLN C CD    1 
ATOM   2147  O  OE1   . GLN C  3 104 ? 6.034   -17.355 51.393 1.00 31.45  ? 104  GLN C OE1   1 
ATOM   2148  N  NE2   . GLN C  3 104 ? 4.910   -19.290 51.007 1.00 29.67  ? 104  GLN C NE2   1 
ATOM   2149  N  N     . GLY C  3 105 ? 0.641   -15.184 50.859 1.00 23.76  ? 105  GLY C N     1 
ATOM   2150  C  CA    . GLY C  3 105 ? 0.055   -14.030 51.520 1.00 23.69  ? 105  GLY C CA    1 
ATOM   2151  C  C     . GLY C  3 105 ? -0.121  -14.087 53.043 1.00 23.94  ? 105  GLY C C     1 
ATOM   2152  O  O     . GLY C  3 105 ? -0.245  -13.032 53.698 1.00 24.25  ? 105  GLY C O     1 
ATOM   2153  N  N     . GLY C  3 106 ? -0.148  -15.293 53.616 1.00 23.30  ? 106  GLY C N     1 
ATOM   2154  C  CA    . GLY C  3 106 ? -0.507  -15.462 55.019 1.00 22.69  ? 106  GLY C CA    1 
ATOM   2155  C  C     . GLY C  3 106 ? -1.903  -14.950 55.297 1.00 22.48  ? 106  GLY C C     1 
ATOM   2156  O  O     . GLY C  3 106 ? -2.731  -14.955 54.413 1.00 22.91  ? 106  GLY C O     1 
ATOM   2157  N  N     . VAL C  3 107 ? -2.146  -14.480 56.520 1.00 22.91  ? 107  VAL C N     1 
ATOM   2158  C  CA    . VAL C  3 107 ? -3.466  -13.991 56.967 1.00 22.57  ? 107  VAL C CA    1 
ATOM   2159  C  C     . VAL C  3 107 ? -3.369  -12.660 57.726 1.00 23.21  ? 107  VAL C C     1 
ATOM   2160  O  O     . VAL C  3 107 ? -2.282  -12.162 57.965 1.00 23.31  ? 107  VAL C O     1 
ATOM   2161  C  CB    . VAL C  3 107 ? -4.138  -15.006 57.911 1.00 22.36  ? 107  VAL C CB    1 
ATOM   2162  C  CG1   . VAL C  3 107 ? -4.351  -16.346 57.223 1.00 19.46  ? 107  VAL C CG1   1 
ATOM   2163  C  CG2   . VAL C  3 107 ? -3.334  -15.137 59.208 1.00 21.43  ? 107  VAL C CG2   1 
ATOM   2164  N  N     . LEU C  3 108 ? -4.500  -12.082 58.113 1.00 24.24  ? 108  LEU C N     1 
ATOM   2165  C  CA    . LEU C  3 108 ? -4.480  -10.882 58.962 1.00 25.47  ? 108  LEU C CA    1 
ATOM   2166  C  C     . LEU C  3 108 ? -4.185  -11.190 60.437 1.00 26.95  ? 108  LEU C C     1 
ATOM   2167  O  O     . LEU C  3 108 ? -4.770  -12.113 61.004 1.00 27.18  ? 108  LEU C O     1 
ATOM   2168  C  CB    . LEU C  3 108 ? -5.820  -10.167 58.886 1.00 25.12  ? 108  LEU C CB    1 
ATOM   2169  C  CG    . LEU C  3 108 ? -6.224  -9.503  57.568 1.00 24.98  ? 108  LEU C CG    1 
ATOM   2170  C  CD1   . LEU C  3 108 ? -7.474  -8.637  57.779 1.00 22.99  ? 108  LEU C CD1   1 
ATOM   2171  C  CD2   . LEU C  3 108 ? -5.059  -8.660  56.985 1.00 23.90  ? 108  LEU C CD2   1 
ATOM   2172  N  N     . PRO C  3 109 ? -3.262  -10.433 61.072 1.00 28.35  ? 109  PRO C N     1 
ATOM   2173  C  CA    . PRO C  3 109 ? -3.183  -10.509 62.540 1.00 28.63  ? 109  PRO C CA    1 
ATOM   2174  C  C     . PRO C  3 109 ? -4.584  -10.356 63.128 1.00 29.32  ? 109  PRO C C     1 
ATOM   2175  O  O     . PRO C  3 109 ? -5.214  -9.335  62.909 1.00 29.76  ? 109  PRO C O     1 
ATOM   2176  C  CB    . PRO C  3 109 ? -2.338  -9.290  62.900 1.00 28.32  ? 109  PRO C CB    1 
ATOM   2177  C  CG    . PRO C  3 109 ? -1.424  -9.115  61.726 1.00 28.42  ? 109  PRO C CG    1 
ATOM   2178  C  CD    . PRO C  3 109 ? -2.247  -9.515  60.509 1.00 28.50  ? 109  PRO C CD    1 
ATOM   2179  N  N     . ASN C  3 110 ? -5.083  -11.375 63.818 1.00 29.98  ? 110  ASN C N     1 
ATOM   2180  C  CA    . ASN C  3 110 ? -6.417  -11.335 64.383 1.00 30.95  ? 110  ASN C CA    1 
ATOM   2181  C  C     . ASN C  3 110 ? -6.608  -12.468 65.384 1.00 31.55  ? 110  ASN C C     1 
ATOM   2182  O  O     . ASN C  3 110 ? -6.670  -13.635 64.988 1.00 31.79  ? 110  ASN C O     1 
ATOM   2183  C  CB    . ASN C  3 110 ? -7.462  -11.440 63.275 1.00 31.36  ? 110  ASN C CB    1 
ATOM   2184  C  CG    . ASN C  3 110 ? -8.860  -11.078 63.746 1.00 33.90  ? 110  ASN C CG    1 
ATOM   2185  O  OD1   . ASN C  3 110 ? -9.019  -10.294 64.686 1.00 38.03  ? 110  ASN C OD1   1 
ATOM   2186  N  ND2   . ASN C  3 110 ? -9.889  -11.635 63.086 1.00 34.11  ? 110  ASN C ND2   1 
ATOM   2187  N  N     . ILE C  3 111 ? -6.681  -12.114 66.677 1.00 31.89  ? 111  ILE C N     1 
ATOM   2188  C  CA    . ILE C  3 111 ? -6.964  -13.053 67.779 1.00 31.76  ? 111  ILE C CA    1 
ATOM   2189  C  C     . ILE C  3 111 ? -8.295  -12.671 68.401 1.00 32.27  ? 111  ILE C C     1 
ATOM   2190  O  O     . ILE C  3 111 ? -8.491  -11.511 68.737 1.00 32.39  ? 111  ILE C O     1 
ATOM   2191  C  CB    . ILE C  3 111 ? -5.917  -12.939 68.921 1.00 31.66  ? 111  ILE C CB    1 
ATOM   2192  C  CG1   . ILE C  3 111 ? -4.486  -13.036 68.388 1.00 30.80  ? 111  ILE C CG1   1 
ATOM   2193  C  CG2   . ILE C  3 111 ? -6.181  -13.990 69.999 1.00 31.57  ? 111  ILE C CG2   1 
ATOM   2194  C  CD1   . ILE C  3 111 ? -3.430  -12.624 69.369 1.00 29.39  ? 111  ILE C CD1   1 
ATOM   2195  N  N     . GLN C  3 112 ? -9.192  -13.641 68.569 1.00 32.90  ? 112  GLN C N     1 
ATOM   2196  C  CA    . GLN C  3 112 ? -10.481 -13.425 69.228 1.00 33.50  ? 112  GLN C CA    1 
ATOM   2197  C  C     . GLN C  3 112 ? -10.304 -12.999 70.678 1.00 34.43  ? 112  GLN C C     1 
ATOM   2198  O  O     . GLN C  3 112 ? -9.430  -13.511 71.380 1.00 34.29  ? 112  GLN C O     1 
ATOM   2199  C  CB    . GLN C  3 112 ? -11.300 -14.711 69.220 1.00 33.66  ? 112  GLN C CB    1 
ATOM   2200  C  CG    . GLN C  3 112 ? -11.593 -15.270 67.849 1.00 34.49  ? 112  GLN C CG    1 
ATOM   2201  C  CD    . GLN C  3 112 ? -12.491 -14.370 67.052 1.00 35.08  ? 112  GLN C CD    1 
ATOM   2202  O  OE1   . GLN C  3 112 ? -13.648 -14.175 67.407 1.00 35.48  ? 112  GLN C OE1   1 
ATOM   2203  N  NE2   . GLN C  3 112 ? -11.962 -13.807 65.963 1.00 35.52  ? 112  GLN C NE2   1 
ATOM   2204  N  N     . SER C  3 113 ? -11.169 -12.090 71.128 1.00 35.57  ? 113  SER C N     1 
ATOM   2205  C  CA    . SER C  3 113 ? -11.104 -11.506 72.470 1.00 36.62  ? 113  SER C CA    1 
ATOM   2206  C  C     . SER C  3 113 ? -11.076 -12.466 73.625 1.00 37.22  ? 113  SER C C     1 
ATOM   2207  O  O     . SER C  3 113 ? -10.243 -12.323 74.510 1.00 37.47  ? 113  SER C O     1 
ATOM   2208  C  CB    . SER C  3 113 ? -12.258 -10.551 72.683 1.00 36.59  ? 113  SER C CB    1 
ATOM   2209  O  OG    . SER C  3 113 ? -11.949 -9.324  72.063 1.00 38.72  ? 113  SER C OG    1 
ATOM   2210  N  N     . VAL C  3 114 ? -11.975 -13.447 73.628 1.00 37.97  ? 114  VAL C N     1 
ATOM   2211  C  CA    . VAL C  3 114 ? -12.052 -14.384 74.751 1.00 38.87  ? 114  VAL C CA    1 
ATOM   2212  C  C     . VAL C  3 114 ? -10.726 -15.109 74.983 1.00 39.27  ? 114  VAL C C     1 
ATOM   2213  O  O     . VAL C  3 114 ? -10.509 -15.706 76.033 1.00 39.83  ? 114  VAL C O     1 
ATOM   2214  C  CB    . VAL C  3 114 ? -13.209 -15.407 74.596 1.00 39.05  ? 114  VAL C CB    1 
ATOM   2215  C  CG1   . VAL C  3 114 ? -14.563 -14.698 74.520 1.00 39.90  ? 114  VAL C CG1   1 
ATOM   2216  C  CG2   . VAL C  3 114 ? -13.001 -16.299 73.357 1.00 39.92  ? 114  VAL C CG2   1 
ATOM   2217  N  N     . LEU C  3 115 ? -9.832  -15.037 74.008 1.00 39.70  ? 115  LEU C N     1 
ATOM   2218  C  CA    . LEU C  3 115 ? -8.569  -15.745 74.078 1.00 40.07  ? 115  LEU C CA    1 
ATOM   2219  C  C     . LEU C  3 115 ? -7.473  -14.976 74.807 1.00 41.00  ? 115  LEU C C     1 
ATOM   2220  O  O     . LEU C  3 115 ? -6.445  -15.558 75.173 1.00 40.59  ? 115  LEU C O     1 
ATOM   2221  C  CB    . LEU C  3 115 ? -8.110  -16.144 72.673 1.00 39.76  ? 115  LEU C CB    1 
ATOM   2222  C  CG    . LEU C  3 115 ? -9.030  -17.078 71.881 1.00 38.73  ? 115  LEU C CG    1 
ATOM   2223  C  CD1   . LEU C  3 115 ? -8.342  -17.450 70.603 1.00 38.26  ? 115  LEU C CD1   1 
ATOM   2224  C  CD2   . LEU C  3 115 ? -9.401  -18.328 72.661 1.00 36.59  ? 115  LEU C CD2   1 
ATOM   2225  N  N     . LEU C  3 116 ? -7.690  -13.677 75.013 1.00 42.39  ? 116  LEU C N     1 
ATOM   2226  C  CA    . LEU C  3 116 ? -6.726  -12.839 75.734 1.00 43.98  ? 116  LEU C CA    1 
ATOM   2227  C  C     . LEU C  3 116 ? -6.825  -13.058 77.240 1.00 45.60  ? 116  LEU C C     1 
ATOM   2228  O  O     . LEU C  3 116 ? -7.892  -13.386 77.750 1.00 45.70  ? 116  LEU C O     1 
ATOM   2229  C  CB    . LEU C  3 116 ? -6.922  -11.361 75.402 1.00 43.61  ? 116  LEU C CB    1 
ATOM   2230  C  CG    . LEU C  3 116 ? -6.847  -10.920 73.935 1.00 43.14  ? 116  LEU C CG    1 
ATOM   2231  C  CD1   . LEU C  3 116 ? -7.081  -9.428  73.830 1.00 42.22  ? 116  LEU C CD1   1 
ATOM   2232  C  CD2   . LEU C  3 116 ? -5.522  -11.296 73.282 1.00 42.60  ? 116  LEU C CD2   1 
ATOM   2233  N  N     . PRO C  3 117 ? -5.713  -12.876 77.969 1.00 47.39  ? 117  PRO C N     1 
ATOM   2234  C  CA    . PRO C  3 117 ? -5.811  -13.145 79.404 1.00 48.81  ? 117  PRO C CA    1 
ATOM   2235  C  C     . PRO C  3 117 ? -6.411  -11.952 80.146 1.00 50.18  ? 117  PRO C C     1 
ATOM   2236  O  O     . PRO C  3 117 ? -6.633  -10.900 79.532 1.00 50.25  ? 117  PRO C O     1 
ATOM   2237  C  CB    . PRO C  3 117 ? -4.344  -13.333 79.817 1.00 48.69  ? 117  PRO C CB    1 
ATOM   2238  C  CG    . PRO C  3 117 ? -3.573  -12.443 78.871 1.00 47.81  ? 117  PRO C CG    1 
ATOM   2239  C  CD    . PRO C  3 117 ? -4.362  -12.415 77.576 1.00 47.49  ? 117  PRO C CD    1 
ATOM   2240  N  N     . LYS C  3 118 ? -6.690  -12.136 81.439 1.00 51.97  ? 118  LYS C N     1 
ATOM   2241  C  CA    . LYS C  3 118 ? -6.803  -11.016 82.412 1.00 53.49  ? 118  LYS C CA    1 
ATOM   2242  C  C     . LYS C  3 118 ? -6.622  -11.441 83.874 1.00 53.92  ? 118  LYS C C     1 
ATOM   2243  O  O     . LYS C  3 118 ? -6.074  -12.516 84.166 1.00 54.53  ? 118  LYS C O     1 
ATOM   2244  C  CB    . LYS C  3 118 ? -8.098  -10.199 82.243 1.00 53.91  ? 118  LYS C CB    1 
ATOM   2245  C  CG    . LYS C  3 118 ? -7.867  -8.806  81.624 1.00 56.25  ? 118  LYS C CG    1 
ATOM   2246  C  CD    . LYS C  3 118 ? -7.665  -7.674  82.668 1.00 59.88  ? 118  LYS C CD    1 
ATOM   2247  C  CE    . LYS C  3 118 ? -6.449  -7.880  83.606 1.00 61.43  ? 118  LYS C CE    1 
ATOM   2248  N  NZ    . LYS C  3 118 ? -5.161  -8.164  82.891 1.00 62.36  ? 118  LYS C NZ    1 
ATOM   2249  N  N     . LYS D  4 24  ? 19.330  -18.875 20.417 1.00 93.63  ? 24   LYS D N     1 
ATOM   2250  C  CA    . LYS D  4 24  ? 17.893  -18.936 20.002 1.00 93.80  ? 24   LYS D CA    1 
ATOM   2251  C  C     . LYS D  4 24  ? 17.433  -20.389 19.749 1.00 93.60  ? 24   LYS D C     1 
ATOM   2252  O  O     . LYS D  4 24  ? 17.344  -20.838 18.593 1.00 93.77  ? 24   LYS D O     1 
ATOM   2253  C  CB    . LYS D  4 24  ? 17.654  -18.048 18.766 1.00 93.95  ? 24   LYS D CB    1 
ATOM   2254  C  CG    . LYS D  4 24  ? 16.234  -17.469 18.663 1.00 94.53  ? 24   LYS D CG    1 
ATOM   2255  C  CD    . LYS D  4 24  ? 16.021  -16.334 19.679 1.00 95.14  ? 24   LYS D CD    1 
ATOM   2256  C  CE    . LYS D  4 24  ? 14.541  -16.119 19.984 1.00 95.30  ? 24   LYS D CE    1 
ATOM   2257  N  NZ    . LYS D  4 24  ? 14.358  -15.113 21.087 1.00 95.70  ? 24   LYS D NZ    1 
ATOM   2258  N  N     . LYS D  4 25  ? 17.139  -21.106 20.839 1.00 93.14  ? 25   LYS D N     1 
ATOM   2259  C  CA    . LYS D  4 25  ? 16.825  -22.548 20.801 1.00 92.50  ? 25   LYS D CA    1 
ATOM   2260  C  C     . LYS D  4 25  ? 15.423  -22.837 20.252 1.00 91.69  ? 25   LYS D C     1 
ATOM   2261  O  O     . LYS D  4 25  ? 14.420  -22.574 20.930 1.00 91.61  ? 25   LYS D O     1 
ATOM   2262  C  CB    . LYS D  4 25  ? 16.980  -23.186 22.197 1.00 92.77  ? 25   LYS D CB    1 
ATOM   2263  C  CG    . LYS D  4 25  ? 18.415  -23.279 22.750 1.00 93.38  ? 25   LYS D CG    1 
ATOM   2264  C  CD    . LYS D  4 25  ? 18.918  -21.947 23.323 1.00 94.45  ? 25   LYS D CD    1 
ATOM   2265  C  CE    . LYS D  4 25  ? 17.976  -21.361 24.386 1.00 94.91  ? 25   LYS D CE    1 
ATOM   2266  N  NZ    . LYS D  4 25  ? 18.163  -21.980 25.730 1.00 95.17  ? 25   LYS D NZ    1 
ATOM   2267  N  N     . ARG D  4 26  ? 15.378  -23.381 19.030 1.00 90.62  ? 26   ARG D N     1 
ATOM   2268  C  CA    . ARG D  4 26  ? 14.134  -23.724 18.313 1.00 89.47  ? 26   ARG D CA    1 
ATOM   2269  C  C     . ARG D  4 26  ? 12.922  -22.942 18.847 1.00 88.51  ? 26   ARG D C     1 
ATOM   2270  O  O     . ARG D  4 26  ? 11.933  -23.538 19.286 1.00 88.68  ? 26   ARG D O     1 
ATOM   2271  C  CB    . ARG D  4 26  ? 13.899  -25.244 18.360 1.00 89.54  ? 26   ARG D CB    1 
ATOM   2272  C  CG    . ARG D  4 26  ? 13.051  -25.812 17.220 1.00 89.63  ? 26   ARG D CG    1 
ATOM   2273  C  CD    . ARG D  4 26  ? 13.298  -27.319 17.016 1.00 89.63  ? 26   ARG D CD    1 
ATOM   2274  N  NE    . ARG D  4 26  ? 12.591  -28.164 17.986 1.00 89.85  ? 26   ARG D NE    1 
ATOM   2275  C  CZ    . ARG D  4 26  ? 12.492  -29.494 17.909 1.00 90.58  ? 26   ARG D CZ    1 
ATOM   2276  N  NH1   . ARG D  4 26  ? 13.052  -30.161 16.903 1.00 91.09  ? 26   ARG D NH1   1 
ATOM   2277  N  NH2   . ARG D  4 26  ? 11.823  -30.170 18.841 1.00 90.90  ? 26   ARG D NH2   1 
ATOM   2278  N  N     . ARG D  4 27  ? 13.031  -21.608 18.801 1.00 86.99  ? 27   ARG D N     1 
ATOM   2279  C  CA    . ARG D  4 27  ? 12.106  -20.655 19.448 1.00 85.40  ? 27   ARG D CA    1 
ATOM   2280  C  C     . ARG D  4 27  ? 10.987  -21.252 20.309 1.00 83.70  ? 27   ARG D C     1 
ATOM   2281  O  O     . ARG D  4 27  ? 10.003  -21.794 19.786 1.00 83.50  ? 27   ARG D O     1 
ATOM   2282  C  CB    . ARG D  4 27  ? 11.520  -19.670 18.418 1.00 85.85  ? 27   ARG D CB    1 
ATOM   2283  C  CG    . ARG D  4 27  ? 10.427  -18.724 18.964 1.00 87.43  ? 27   ARG D CG    1 
ATOM   2284  C  CD    . ARG D  4 27  ? 10.989  -17.611 19.874 1.00 89.86  ? 27   ARG D CD    1 
ATOM   2285  N  NE    . ARG D  4 27  ? 9.930   -16.755 20.422 1.00 91.21  ? 27   ARG D NE    1 
ATOM   2286  C  CZ    . ARG D  4 27  ? 10.035  -15.437 20.618 1.00 92.16  ? 27   ARG D CZ    1 
ATOM   2287  N  NH1   . ARG D  4 27  ? 11.154  -14.791 20.301 1.00 92.43  ? 27   ARG D NH1   1 
ATOM   2288  N  NH2   . ARG D  4 27  ? 9.009   -14.754 21.121 1.00 92.06  ? 27   ARG D NH2   1 
ATOM   2289  N  N     . LYS D  4 28  ? 11.157  -21.147 21.629 1.00 81.60  ? 28   LYS D N     1 
ATOM   2290  C  CA    . LYS D  4 28  ? 10.088  -21.432 22.584 1.00 79.41  ? 28   LYS D CA    1 
ATOM   2291  C  C     . LYS D  4 28  ? 8.951   -20.464 22.294 1.00 77.61  ? 28   LYS D C     1 
ATOM   2292  O  O     . LYS D  4 28  ? 9.171   -19.253 22.264 1.00 77.31  ? 28   LYS D O     1 
ATOM   2293  C  CB    . LYS D  4 28  ? 10.584  -21.246 24.020 1.00 79.58  ? 28   LYS D CB    1 
ATOM   2294  C  CG    . LYS D  4 28  ? 9.490   -21.356 25.071 1.00 80.04  ? 28   LYS D CG    1 
ATOM   2295  C  CD    . LYS D  4 28  ? 9.905   -20.696 26.383 1.00 80.73  ? 28   LYS D CD    1 
ATOM   2296  C  CE    . LYS D  4 28  ? 8.698   -20.104 27.108 1.00 80.48  ? 28   LYS D CE    1 
ATOM   2297  N  NZ    . LYS D  4 28  ? 8.043   -19.027 26.301 1.00 80.52  ? 28   LYS D NZ    1 
ATOM   2298  N  N     . THR D  4 29  ? 7.754   -21.000 22.055 1.00 75.42  ? 29   THR D N     1 
ATOM   2299  C  CA    . THR D  4 29  ? 6.602   -20.176 21.688 1.00 73.33  ? 29   THR D CA    1 
ATOM   2300  C  C     . THR D  4 29  ? 6.307   -19.156 22.776 1.00 71.75  ? 29   THR D C     1 
ATOM   2301  O  O     . THR D  4 29  ? 6.285   -19.476 23.972 1.00 71.53  ? 29   THR D O     1 
ATOM   2302  C  CB    . THR D  4 29  ? 5.335   -21.000 21.389 1.00 73.58  ? 29   THR D CB    1 
ATOM   2303  O  OG1   . THR D  4 29  ? 5.012   -21.814 22.523 1.00 73.69  ? 29   THR D OG1   1 
ATOM   2304  C  CG2   . THR D  4 29  ? 5.526   -21.882 20.140 1.00 73.63  ? 29   THR D CG2   1 
ATOM   2305  N  N     . ARG D  4 30  ? 6.099   -17.922 22.330 1.00 69.63  ? 30   ARG D N     1 
ATOM   2306  C  CA    . ARG D  4 30  ? 6.043   -16.750 23.193 1.00 67.49  ? 30   ARG D CA    1 
ATOM   2307  C  C     . ARG D  4 30  ? 4.930   -16.820 24.236 1.00 65.55  ? 30   ARG D C     1 
ATOM   2308  O  O     . ARG D  4 30  ? 3.819   -17.267 23.945 1.00 65.07  ? 30   ARG D O     1 
ATOM   2309  C  CB    . ARG D  4 30  ? 5.903   -15.479 22.348 1.00 67.70  ? 30   ARG D CB    1 
ATOM   2310  C  CG    . ARG D  4 30  ? 4.943   -15.617 21.161 1.00 68.77  ? 30   ARG D CG    1 
ATOM   2311  C  CD    . ARG D  4 30  ? 4.045   -14.397 21.016 1.00 70.18  ? 30   ARG D CD    1 
ATOM   2312  N  NE    . ARG D  4 30  ? 4.788   -13.151 21.197 1.00 70.59  ? 30   ARG D NE    1 
ATOM   2313  C  CZ    . ARG D  4 30  ? 4.231   -11.953 21.351 1.00 71.24  ? 30   ARG D CZ    1 
ATOM   2314  N  NH1   . ARG D  4 30  ? 2.909   -11.815 21.343 1.00 71.71  ? 30   ARG D NH1   1 
ATOM   2315  N  NH2   . ARG D  4 30  ? 5.004   -10.887 21.515 1.00 71.37  ? 30   ARG D NH2   1 
ATOM   2316  N  N     . LYS D  4 31  ? 5.256   -16.384 25.452 1.00 63.18  ? 31   LYS D N     1 
ATOM   2317  C  CA    . LYS D  4 31  ? 4.295   -16.343 26.546 1.00 60.80  ? 31   LYS D CA    1 
ATOM   2318  C  C     . LYS D  4 31  ? 3.998   -14.912 26.956 1.00 58.50  ? 31   LYS D C     1 
ATOM   2319  O  O     . LYS D  4 31  ? 4.834   -14.225 27.528 1.00 58.38  ? 31   LYS D O     1 
ATOM   2320  C  CB    . LYS D  4 31  ? 4.772   -17.176 27.746 1.00 61.05  ? 31   LYS D CB    1 
ATOM   2321  C  CG    . LYS D  4 31  ? 3.665   -17.538 28.754 1.00 62.28  ? 31   LYS D CG    1 
ATOM   2322  C  CD    . LYS D  4 31  ? 2.262   -17.673 28.098 1.00 63.47  ? 31   LYS D CD    1 
ATOM   2323  C  CE    . LYS D  4 31  ? 1.571   -18.991 28.469 1.00 64.24  ? 31   LYS D CE    1 
ATOM   2324  N  NZ    . LYS D  4 31  ? 1.561   -19.243 29.943 1.00 65.14  ? 31   LYS D NZ    1 
ATOM   2325  N  N     . GLU D  4 32  ? 2.783   -14.484 26.662 1.00 55.70  ? 32   GLU D N     1 
ATOM   2326  C  CA    . GLU D  4 32  ? 2.364   -13.116 26.894 1.00 53.31  ? 32   GLU D CA    1 
ATOM   2327  C  C     . GLU D  4 32  ? 1.794   -12.909 28.301 1.00 50.17  ? 32   GLU D C     1 
ATOM   2328  O  O     . GLU D  4 32  ? 1.075   -13.773 28.821 1.00 49.85  ? 32   GLU D O     1 
ATOM   2329  C  CB    . GLU D  4 32  ? 1.319   -12.731 25.852 1.00 53.44  ? 32   GLU D CB    1 
ATOM   2330  C  CG    . GLU D  4 32  ? 0.154   -13.721 25.777 1.00 54.91  ? 32   GLU D CG    1 
ATOM   2331  C  CD    . GLU D  4 32  ? -1.012  -13.205 24.947 1.00 55.81  ? 32   GLU D CD    1 
ATOM   2332  O  OE1   . GLU D  4 32  ? -0.906  -12.067 24.408 1.00 59.28  ? 32   GLU D OE1   1 
ATOM   2333  O  OE2   . GLU D  4 32  ? -2.031  -13.942 24.838 1.00 58.21  ? 32   GLU D OE2   1 
ATOM   2334  N  N     . SER D  4 33  ? 2.120   -11.762 28.902 1.00 46.30  ? 33   SER D N     1 
ATOM   2335  C  CA    . SER D  4 33  ? 1.524   -11.346 30.171 1.00 42.37  ? 33   SER D CA    1 
ATOM   2336  C  C     . SER D  4 33  ? 1.276   -9.846  30.216 1.00 39.71  ? 33   SER D C     1 
ATOM   2337  O  O     . SER D  4 33  ? 1.668   -9.115  29.319 1.00 39.08  ? 33   SER D O     1 
ATOM   2338  C  CB    . SER D  4 33  ? 2.404   -11.759 31.346 1.00 42.43  ? 33   SER D CB    1 
ATOM   2339  O  OG    . SER D  4 33  ? 3.298   -10.721 31.692 1.00 41.93  ? 33   SER D OG    1 
ATOM   2340  N  N     . TYR D  4 34  ? 0.630   -9.402  31.285 1.00 36.53  ? 34   TYR D N     1 
ATOM   2341  C  CA    . TYR D  4 34  ? 0.352   -8.002  31.511 1.00 33.37  ? 34   TYR D CA    1 
ATOM   2342  C  C     . TYR D  4 34  ? 1.446   -7.253  32.306 1.00 31.92  ? 34   TYR D C     1 
ATOM   2343  O  O     . TYR D  4 34  ? 1.266   -6.094  32.629 1.00 31.46  ? 34   TYR D O     1 
ATOM   2344  C  CB    . TYR D  4 34  ? -0.980  -7.872  32.238 1.00 33.26  ? 34   TYR D CB    1 
ATOM   2345  C  CG    . TYR D  4 34  ? -2.182  -8.345  31.465 1.00 32.06  ? 34   TYR D CG    1 
ATOM   2346  C  CD1   . TYR D  4 34  ? -2.659  -9.631  31.621 1.00 32.20  ? 34   TYR D CD1   1 
ATOM   2347  C  CD2   . TYR D  4 34  ? -2.868  -7.491  30.604 1.00 31.61  ? 34   TYR D CD2   1 
ATOM   2348  C  CE1   . TYR D  4 34  ? -3.778  -10.072 30.922 1.00 32.33  ? 34   TYR D CE1   1 
ATOM   2349  C  CE2   . TYR D  4 34  ? -3.992  -7.923  29.894 1.00 31.27  ? 34   TYR D CE2   1 
ATOM   2350  C  CZ    . TYR D  4 34  ? -4.435  -9.214  30.065 1.00 32.13  ? 34   TYR D CZ    1 
ATOM   2351  O  OH    . TYR D  4 34  ? -5.531  -9.672  29.387 1.00 32.90  ? 34   TYR D OH    1 
ATOM   2352  N  N     . ALA D  4 35  ? 2.572   -7.901  32.599 1.00 30.27  ? 35   ALA D N     1 
ATOM   2353  C  CA    . ALA D  4 35  ? 3.636   -7.319  33.422 1.00 29.57  ? 35   ALA D CA    1 
ATOM   2354  C  C     . ALA D  4 35  ? 4.079   -5.878  33.115 1.00 29.29  ? 35   ALA D C     1 
ATOM   2355  O  O     . ALA D  4 35  ? 4.090   -5.022  34.017 1.00 29.34  ? 35   ALA D O     1 
ATOM   2356  C  CB    . ALA D  4 35  ? 4.844   -8.249  33.485 1.00 29.29  ? 35   ALA D CB    1 
ATOM   2357  N  N     . ILE D  4 36  ? 4.448   -5.596  31.869 1.00 28.98  ? 36   ILE D N     1 
ATOM   2358  C  CA    . ILE D  4 36  ? 4.926   -4.247  31.520 1.00 28.66  ? 36   ILE D CA    1 
ATOM   2359  C  C     . ILE D  4 36  ? 3.806   -3.211  31.738 1.00 28.64  ? 36   ILE D C     1 
ATOM   2360  O  O     . ILE D  4 36  ? 4.052   -2.069  32.160 1.00 28.47  ? 36   ILE D O     1 
ATOM   2361  C  CB    . ILE D  4 36  ? 5.551   -4.169  30.087 1.00 28.46  ? 36   ILE D CB    1 
ATOM   2362  C  CG1   . ILE D  4 36  ? 4.512   -4.433  29.012 1.00 28.88  ? 36   ILE D CG1   1 
ATOM   2363  C  CG2   . ILE D  4 36  ? 6.670   -5.180  29.932 1.00 27.54  ? 36   ILE D CG2   1 
ATOM   2364  C  CD1   . ILE D  4 36  ? 4.977   -4.112  27.616 1.00 28.40  ? 36   ILE D CD1   1 
ATOM   2365  N  N     . TYR D  4 37  ? 2.574   -3.650  31.490 1.00 28.24  ? 37   TYR D N     1 
ATOM   2366  C  CA    . TYR D  4 37  ? 1.390   -2.851  31.752 1.00 27.97  ? 37   TYR D CA    1 
ATOM   2367  C  C     . TYR D  4 37  ? 1.137   -2.625  33.234 1.00 27.64  ? 37   TYR D C     1 
ATOM   2368  O  O     . TYR D  4 37  ? 0.937   -1.494  33.658 1.00 27.82  ? 37   TYR D O     1 
ATOM   2369  C  CB    . TYR D  4 37  ? 0.191   -3.498  31.073 1.00 28.38  ? 37   TYR D CB    1 
ATOM   2370  C  CG    . TYR D  4 37  ? 0.459   -3.691  29.609 1.00 29.33  ? 37   TYR D CG    1 
ATOM   2371  C  CD1   . TYR D  4 37  ? 0.612   -4.960  29.067 1.00 29.60  ? 37   TYR D CD1   1 
ATOM   2372  C  CD2   . TYR D  4 37  ? 0.625   -2.583  28.767 1.00 29.41  ? 37   TYR D CD2   1 
ATOM   2373  C  CE1   . TYR D  4 37  ? 0.887   -5.123  27.712 1.00 30.18  ? 37   TYR D CE1   1 
ATOM   2374  C  CE2   . TYR D  4 37  ? 0.902   -2.738  27.434 1.00 28.51  ? 37   TYR D CE2   1 
ATOM   2375  C  CZ    . TYR D  4 37  ? 1.033   -4.000  26.912 1.00 29.18  ? 37   TYR D CZ    1 
ATOM   2376  O  OH    . TYR D  4 37  ? 1.295   -4.131  25.575 1.00 30.60  ? 37   TYR D OH    1 
ATOM   2377  N  N     . VAL D  4 38  ? 1.151   -3.691  34.025 1.00 27.33  ? 38   VAL D N     1 
ATOM   2378  C  CA    . VAL D  4 38  ? 1.038   -3.559  35.475 1.00 27.25  ? 38   VAL D CA    1 
ATOM   2379  C  C     . VAL D  4 38  ? 2.152   -2.639  35.959 1.00 27.47  ? 38   VAL D C     1 
ATOM   2380  O  O     . VAL D  4 38  ? 1.916   -1.713  36.721 1.00 27.44  ? 38   VAL D O     1 
ATOM   2381  C  CB    . VAL D  4 38  ? 1.091   -4.930  36.193 1.00 27.03  ? 38   VAL D CB    1 
ATOM   2382  C  CG1   . VAL D  4 38  ? 1.208   -4.759  37.698 1.00 26.41  ? 38   VAL D CG1   1 
ATOM   2383  C  CG2   . VAL D  4 38  ? -0.133  -5.721  35.861 1.00 27.03  ? 38   VAL D CG2   1 
ATOM   2384  N  N     . TYR D  4 39  ? 3.355   -2.868  35.465 1.00 27.91  ? 39   TYR D N     1 
ATOM   2385  C  CA    . TYR D  4 39  ? 4.469   -2.027  35.829 1.00 28.99  ? 39   TYR D CA    1 
ATOM   2386  C  C     . TYR D  4 39  ? 4.243   -0.519  35.542 1.00 28.44  ? 39   TYR D C     1 
ATOM   2387  O  O     . TYR D  4 39  ? 4.594   0.333   36.358 1.00 27.80  ? 39   TYR D O     1 
ATOM   2388  C  CB    . TYR D  4 39  ? 5.743   -2.558  35.168 1.00 30.65  ? 39   TYR D CB    1 
ATOM   2389  C  CG    . TYR D  4 39  ? 6.975   -1.923  35.718 1.00 32.98  ? 39   TYR D CG    1 
ATOM   2390  C  CD1   . TYR D  4 39  ? 7.577   -2.419  36.879 1.00 35.73  ? 39   TYR D CD1   1 
ATOM   2391  C  CD2   . TYR D  4 39  ? 7.536   -0.800  35.095 1.00 35.09  ? 39   TYR D CD2   1 
ATOM   2392  C  CE1   . TYR D  4 39  ? 8.720   -1.801  37.422 1.00 37.35  ? 39   TYR D CE1   1 
ATOM   2393  C  CE2   . TYR D  4 39  ? 8.679   -0.181  35.604 1.00 36.60  ? 39   TYR D CE2   1 
ATOM   2394  C  CZ    . TYR D  4 39  ? 9.268   -0.682  36.770 1.00 36.57  ? 39   TYR D CZ    1 
ATOM   2395  O  OH    . TYR D  4 39  ? 10.398  -0.068  37.274 1.00 36.71  ? 39   TYR D OH    1 
ATOM   2396  N  N     . LYS D  4 40  ? 3.651   -0.197  34.393 1.00 28.13  ? 40   LYS D N     1 
ATOM   2397  C  CA    . LYS D  4 40  ? 3.395   1.201   34.039 1.00 28.16  ? 40   LYS D CA    1 
ATOM   2398  C  C     . LYS D  4 40  ? 2.500   1.824   35.066 1.00 27.72  ? 40   LYS D C     1 
ATOM   2399  O  O     . LYS D  4 40  ? 2.761   2.922   35.546 1.00 28.26  ? 40   LYS D O     1 
ATOM   2400  C  CB    . LYS D  4 40  ? 2.726   1.333   32.677 1.00 28.10  ? 40   LYS D CB    1 
ATOM   2401  C  CG    . LYS D  4 40  ? 3.680   1.228   31.500 1.00 30.64  ? 40   LYS D CG    1 
ATOM   2402  C  CD    . LYS D  4 40  ? 2.931   0.915   30.216 1.00 33.36  ? 40   LYS D CD    1 
ATOM   2403  C  CE    . LYS D  4 40  ? 3.857   0.933   29.014 1.00 36.18  ? 40   LYS D CE    1 
ATOM   2404  N  NZ    . LYS D  4 40  ? 3.114   0.609   27.732 1.00 38.64  ? 40   LYS D NZ    1 
ATOM   2405  N  N     . VAL D  4 41  ? 1.444   1.103   35.415 1.00 27.20  ? 41   VAL D N     1 
ATOM   2406  C  CA    . VAL D  4 41  ? 0.425   1.631   36.286 1.00 26.38  ? 41   VAL D CA    1 
ATOM   2407  C  C     . VAL D  4 41  ? 1.048   1.821   37.662 1.00 26.63  ? 41   VAL D C     1 
ATOM   2408  O  O     . VAL D  4 41  ? 0.795   2.826   38.347 1.00 26.33  ? 41   VAL D O     1 
ATOM   2409  C  CB    . VAL D  4 41  ? -0.798  0.704   36.312 1.00 26.22  ? 41   VAL D CB    1 
ATOM   2410  C  CG1   . VAL D  4 41  ? -1.807  1.157   37.338 1.00 25.54  ? 41   VAL D CG1   1 
ATOM   2411  C  CG2   . VAL D  4 41  ? -1.454  0.673   34.946 1.00 25.99  ? 41   VAL D CG2   1 
ATOM   2412  N  N     . LEU D  4 42  ? 1.893   0.867   38.043 1.00 26.59  ? 42   LEU D N     1 
ATOM   2413  C  CA    . LEU D  4 42  ? 2.572   0.928   39.314 1.00 26.90  ? 42   LEU D CA    1 
ATOM   2414  C  C     . LEU D  4 42  ? 3.377   2.223   39.425 1.00 27.67  ? 42   LEU D C     1 
ATOM   2415  O  O     . LEU D  4 42  ? 3.240   2.962   40.405 1.00 27.74  ? 42   LEU D O     1 
ATOM   2416  C  CB    . LEU D  4 42  ? 3.449   -0.298  39.512 1.00 26.54  ? 42   LEU D CB    1 
ATOM   2417  C  CG    . LEU D  4 42  ? 4.307   -0.313  40.772 1.00 26.51  ? 42   LEU D CG    1 
ATOM   2418  C  CD1   . LEU D  4 42  ? 3.457   -0.308  42.039 1.00 26.23  ? 42   LEU D CD1   1 
ATOM   2419  C  CD2   . LEU D  4 42  ? 5.218   -1.521  40.735 1.00 27.00  ? 42   LEU D CD2   1 
ATOM   2420  N  N     . LYS D  4 43  ? 4.180   2.521   38.408 1.00 28.51  ? 43   LYS D N     1 
ATOM   2421  C  CA    . LYS D  4 43  ? 4.997   3.735   38.426 1.00 29.13  ? 43   LYS D CA    1 
ATOM   2422  C  C     . LYS D  4 43  ? 4.125   4.974   38.465 1.00 29.10  ? 43   LYS D C     1 
ATOM   2423  O  O     . LYS D  4 43  ? 4.562   6.018   38.943 1.00 30.00  ? 43   LYS D O     1 
ATOM   2424  C  CB    . LYS D  4 43  ? 5.969   3.798   37.244 1.00 29.35  ? 43   LYS D CB    1 
ATOM   2425  C  CG    . LYS D  4 43  ? 6.880   2.566   37.073 1.00 30.73  ? 43   LYS D CG    1 
ATOM   2426  C  CD    . LYS D  4 43  ? 8.160   2.614   37.913 1.00 33.24  ? 43   LYS D CD    1 
ATOM   2427  C  CE    . LYS D  4 43  ? 7.896   2.380   39.421 1.00 35.74  ? 43   LYS D CE    1 
ATOM   2428  N  NZ    . LYS D  4 43  ? 9.161   2.182   40.207 1.00 35.51  ? 43   LYS D NZ    1 
ATOM   2429  N  N     . GLN D  4 44  ? 2.886   4.866   37.997 1.00 28.49  ? 44   GLN D N     1 
ATOM   2430  C  CA    . GLN D  4 44  ? 1.961   5.985   38.130 1.00 28.06  ? 44   GLN D CA    1 
ATOM   2431  C  C     . GLN D  4 44  ? 1.474   6.205   39.566 1.00 28.02  ? 44   GLN D C     1 
ATOM   2432  O  O     . GLN D  4 44  ? 1.340   7.344   39.987 1.00 28.35  ? 44   GLN D O     1 
ATOM   2433  C  CB    . GLN D  4 44  ? 0.757   5.821   37.226 1.00 27.99  ? 44   GLN D CB    1 
ATOM   2434  C  CG    . GLN D  4 44  ? 1.048   5.870   35.748 1.00 29.58  ? 44   GLN D CG    1 
ATOM   2435  C  CD    . GLN D  4 44  ? -0.228  5.907   34.932 1.00 33.02  ? 44   GLN D CD    1 
ATOM   2436  O  OE1   . GLN D  4 44  ? -1.166  5.106   35.156 1.00 33.82  ? 44   GLN D OE1   1 
ATOM   2437  N  NE2   . GLN D  4 44  ? -0.290  6.850   33.991 1.00 32.01  ? 44   GLN D NE2   1 
ATOM   2438  N  N     . VAL D  4 45  ? 1.200   5.140   40.320 1.00 27.66  ? 45   VAL D N     1 
ATOM   2439  C  CA    . VAL D  4 45  ? 0.638   5.314   41.657 1.00 27.53  ? 45   VAL D CA    1 
ATOM   2440  C  C     . VAL D  4 45  ? 1.703   5.362   42.744 1.00 27.80  ? 45   VAL D C     1 
ATOM   2441  O  O     . VAL D  4 45  ? 1.519   5.959   43.796 1.00 27.92  ? 45   VAL D O     1 
ATOM   2442  C  CB    . VAL D  4 45  ? -0.458  4.278   41.979 1.00 27.46  ? 45   VAL D CB    1 
ATOM   2443  C  CG1   . VAL D  4 45  ? -1.527  4.307   40.909 1.00 28.24  ? 45   VAL D CG1   1 
ATOM   2444  C  CG2   . VAL D  4 45  ? 0.103   2.889   42.082 1.00 27.87  ? 45   VAL D CG2   1 
ATOM   2445  N  N     . HIS D  4 46  ? 2.838   4.747   42.485 1.00 28.39  ? 46   HIS D N     1 
ATOM   2446  C  CA    . HIS D  4 46  ? 3.895   4.730   43.472 1.00 28.95  ? 46   HIS D CA    1 
ATOM   2447  C  C     . HIS D  4 46  ? 5.233   4.816   42.771 1.00 29.70  ? 46   HIS D C     1 
ATOM   2448  O  O     . HIS D  4 46  ? 5.898   3.788   42.560 1.00 29.71  ? 46   HIS D O     1 
ATOM   2449  C  CB    . HIS D  4 46  ? 3.806   3.485   44.336 1.00 28.52  ? 46   HIS D CB    1 
ATOM   2450  C  CG    . HIS D  4 46  ? 2.705   3.538   45.340 1.00 28.53  ? 46   HIS D CG    1 
ATOM   2451  N  ND1   . HIS D  4 46  ? 2.607   4.543   46.277 1.00 28.85  ? 46   HIS D ND1   1 
ATOM   2452  C  CD2   . HIS D  4 46  ? 1.657   2.713   45.561 1.00 28.21  ? 46   HIS D CD2   1 
ATOM   2453  C  CE1   . HIS D  4 46  ? 1.550   4.331   47.039 1.00 28.18  ? 46   HIS D CE1   1 
ATOM   2454  N  NE2   . HIS D  4 46  ? 0.953   3.230   46.622 1.00 29.79  ? 46   HIS D NE2   1 
ATOM   2455  N  N     . PRO D  4 47  ? 5.645   6.054   42.433 1.00 30.34  ? 47   PRO D N     1 
ATOM   2456  C  CA    . PRO D  4 47  ? 6.771   6.259   41.531 1.00 30.96  ? 47   PRO D CA    1 
ATOM   2457  C  C     . PRO D  4 47  ? 8.077   5.672   42.063 1.00 32.01  ? 47   PRO D C     1 
ATOM   2458  O  O     . PRO D  4 47  ? 8.955   5.366   41.271 1.00 32.67  ? 47   PRO D O     1 
ATOM   2459  C  CB    . PRO D  4 47  ? 6.848   7.773   41.399 1.00 30.95  ? 47   PRO D CB    1 
ATOM   2460  C  CG    . PRO D  4 47  ? 5.467   8.283   41.872 1.00 30.38  ? 47   PRO D CG    1 
ATOM   2461  C  CD    . PRO D  4 47  ? 5.070   7.330   42.914 1.00 30.07  ? 47   PRO D CD    1 
ATOM   2462  N  N     . ASP D  4 48  ? 8.197   5.449   43.368 1.00 32.95  ? 48   ASP D N     1 
ATOM   2463  C  CA    . ASP D  4 48  ? 9.455   4.884   43.894 1.00 33.98  ? 48   ASP D CA    1 
ATOM   2464  C  C     . ASP D  4 48  ? 9.383   3.441   44.428 1.00 33.39  ? 48   ASP D C     1 
ATOM   2465  O  O     . ASP D  4 48  ? 10.273  2.990   45.158 1.00 33.92  ? 48   ASP D O     1 
ATOM   2466  C  CB    . ASP D  4 48  ? 10.076  5.842   44.923 1.00 34.62  ? 48   ASP D CB    1 
ATOM   2467  C  CG    . ASP D  4 48  ? 10.582  7.146   44.275 1.00 38.28  ? 48   ASP D CG    1 
ATOM   2468  O  OD1   . ASP D  4 48  ? 11.019  7.102   43.089 1.00 41.35  ? 48   ASP D OD1   1 
ATOM   2469  O  OD2   . ASP D  4 48  ? 10.541  8.212   44.944 1.00 41.22  ? 48   ASP D OD2   1 
ATOM   2470  N  N     . THR D  4 49  ? 8.351   2.711   44.028 1.00 32.02  ? 49   THR D N     1 
ATOM   2471  C  CA    . THR D  4 49  ? 8.104   1.396   44.569 1.00 30.74  ? 49   THR D CA    1 
ATOM   2472  C  C     . THR D  4 49  ? 8.349   0.330   43.512 1.00 29.82  ? 49   THR D C     1 
ATOM   2473  O  O     . THR D  4 49  ? 7.963   0.489   42.367 1.00 29.58  ? 49   THR D O     1 
ATOM   2474  C  CB    . THR D  4 49  ? 6.652   1.327   45.098 1.00 31.02  ? 49   THR D CB    1 
ATOM   2475  O  OG1   . THR D  4 49  ? 6.424   2.428   45.982 1.00 31.92  ? 49   THR D OG1   1 
ATOM   2476  C  CG2   . THR D  4 49  ? 6.372   0.046   45.847 1.00 30.59  ? 49   THR D CG2   1 
ATOM   2477  N  N     . GLY D  4 50  ? 9.005   -0.752  43.904 1.00 28.98  ? 50   GLY D N     1 
ATOM   2478  C  CA    . GLY D  4 50  ? 9.172   -1.901  43.034 1.00 28.08  ? 50   GLY D CA    1 
ATOM   2479  C  C     . GLY D  4 50  ? 8.104   -2.955  43.293 1.00 27.77  ? 50   GLY D C     1 
ATOM   2480  O  O     . GLY D  4 50  ? 7.220   -2.780  44.134 1.00 27.67  ? 50   GLY D O     1 
ATOM   2481  N  N     . ILE D  4 51  ? 8.188   -4.059  42.559 1.00 27.04  ? 51   ILE D N     1 
ATOM   2482  C  CA    . ILE D  4 51  ? 7.323   -5.197  42.785 1.00 25.92  ? 51   ILE D CA    1 
ATOM   2483  C  C     . ILE D  4 51  ? 8.133   -6.465  42.536 1.00 25.74  ? 51   ILE D C     1 
ATOM   2484  O  O     . ILE D  4 51  ? 8.851   -6.546  41.565 1.00 25.47  ? 51   ILE D O     1 
ATOM   2485  C  CB    . ILE D  4 51  ? 6.051   -5.125  41.900 1.00 26.11  ? 51   ILE D CB    1 
ATOM   2486  C  CG1   . ILE D  4 51  ? 5.020   -6.202  42.315 1.00 25.99  ? 51   ILE D CG1   1 
ATOM   2487  C  CG2   . ILE D  4 51  ? 6.407   -5.172  40.414 1.00 24.64  ? 51   ILE D CG2   1 
ATOM   2488  C  CD1   . ILE D  4 51  ? 3.611   -6.007  41.724 1.00 25.07  ? 51   ILE D CD1   1 
ATOM   2489  N  N     . SER D  4 52  ? 8.024   -7.430  43.436 1.00 25.51  ? 52   SER D N     1 
ATOM   2490  C  CA    . SER D  4 52  ? 8.723   -8.685  43.319 1.00 26.47  ? 52   SER D CA    1 
ATOM   2491  C  C     . SER D  4 52  ? 8.088   -9.523  42.210 1.00 27.30  ? 52   SER D C     1 
ATOM   2492  O  O     . SER D  4 52  ? 6.931   -9.309  41.862 1.00 27.52  ? 52   SER D O     1 
ATOM   2493  C  CB    . SER D  4 52  ? 8.672   -9.437  44.645 1.00 26.37  ? 52   SER D CB    1 
ATOM   2494  O  OG    . SER D  4 52  ? 7.449   -10.147 44.793 1.00 27.66  ? 52   SER D OG    1 
ATOM   2495  N  N     . SER D  4 53  ? 8.827   -10.475 41.645 1.00 27.83  ? 53   SER D N     1 
ATOM   2496  C  CA    . SER D  4 53  ? 8.306   -11.139 40.466 1.00 28.73  ? 53   SER D CA    1 
ATOM   2497  C  C     . SER D  4 53  ? 7.242   -12.140 40.844 1.00 28.99  ? 53   SER D C     1 
ATOM   2498  O  O     . SER D  4 53  ? 6.359   -12.434 40.033 1.00 30.17  ? 53   SER D O     1 
ATOM   2499  C  CB    . SER D  4 53  ? 9.398   -11.782 39.631 1.00 28.52  ? 53   SER D CB    1 
ATOM   2500  O  OG    . SER D  4 53  ? 9.977   -12.814 40.369 1.00 30.34  ? 53   SER D OG    1 
ATOM   2501  N  N     . LYS D  4 54  ? 7.304   -12.657 42.065 1.00 28.67  ? 54   LYS D N     1 
ATOM   2502  C  CA    . LYS D  4 54  ? 6.171   -13.408 42.605 1.00 28.43  ? 54   LYS D CA    1 
ATOM   2503  C  C     . LYS D  4 54  ? 4.930   -12.529 42.737 1.00 27.49  ? 54   LYS D C     1 
ATOM   2504  O  O     . LYS D  4 54  ? 3.828   -12.949 42.374 1.00 27.54  ? 54   LYS D O     1 
ATOM   2505  C  CB    . LYS D  4 54  ? 6.520   -14.053 43.934 1.00 28.62  ? 54   LYS D CB    1 
ATOM   2506  C  CG    . LYS D  4 54  ? 7.055   -15.447 43.758 1.00 32.82  ? 54   LYS D CG    1 
ATOM   2507  C  CD    . LYS D  4 54  ? 7.812   -15.930 44.990 1.00 38.44  ? 54   LYS D CD    1 
ATOM   2508  C  CE    . LYS D  4 54  ? 8.107   -17.426 44.893 1.00 40.61  ? 54   LYS D CE    1 
ATOM   2509  N  NZ    . LYS D  4 54  ? 8.378   -17.930 46.283 1.00 43.80  ? 54   LYS D NZ    1 
ATOM   2510  N  N     . ALA D  4 55  ? 5.106   -11.302 43.225 1.00 26.43  ? 55   ALA D N     1 
ATOM   2511  C  CA    . ALA D  4 55  ? 3.983   -10.364 43.308 1.00 25.44  ? 55   ALA D CA    1 
ATOM   2512  C  C     . ALA D  4 55  ? 3.393   -10.108 41.939 1.00 24.67  ? 55   ALA D C     1 
ATOM   2513  O  O     . ALA D  4 55  ? 2.197   -10.066 41.791 1.00 24.84  ? 55   ALA D O     1 
ATOM   2514  C  CB    . ALA D  4 55  ? 4.411   -9.060  43.954 1.00 25.32  ? 55   ALA D CB    1 
ATOM   2515  N  N     . MET D  4 56  ? 4.243   -9.958  40.934 1.00 24.21  ? 56   MET D N     1 
ATOM   2516  C  CA    . MET D  4 56  ? 3.808   -9.655  39.580 1.00 23.86  ? 56   MET D CA    1 
ATOM   2517  C  C     . MET D  4 56  ? 3.066   -10.849 39.037 1.00 23.32  ? 56   MET D C     1 
ATOM   2518  O  O     . MET D  4 56  ? 2.145   -10.717 38.255 1.00 23.51  ? 56   MET D O     1 
ATOM   2519  C  CB    . MET D  4 56  ? 5.008   -9.301  38.681 1.00 24.20  ? 56   MET D CB    1 
ATOM   2520  C  CG    . MET D  4 56  ? 4.666   -8.919  37.263 1.00 24.52  ? 56   MET D CG    1 
ATOM   2521  S  SD    . MET D  4 56  ? 3.609   -7.448  37.177 1.00 33.13  ? 56   MET D SD    1 
ATOM   2522  C  CE    . MET D  4 56  ? 4.780   -6.087  37.059 1.00 28.84  ? 56   MET D CE    1 
ATOM   2523  N  N     . SER D  4 57  ? 3.452   -12.027 39.468 1.00 22.87  ? 57   SER D N     1 
ATOM   2524  C  CA    . SER D  4 57  ? 2.741   -13.203 39.032 1.00 23.00  ? 57   SER D CA    1 
ATOM   2525  C  C     . SER D  4 57  ? 1.298   -13.205 39.570 1.00 23.00  ? 57   SER D C     1 
ATOM   2526  O  O     . SER D  4 57  ? 0.358   -13.533 38.834 1.00 22.92  ? 57   SER D O     1 
ATOM   2527  C  CB    . SER D  4 57  ? 3.501   -14.447 39.457 1.00 22.76  ? 57   SER D CB    1 
ATOM   2528  O  OG    . SER D  4 57  ? 2.883   -15.582 38.913 1.00 23.95  ? 57   SER D OG    1 
ATOM   2529  N  N     . ILE D  4 58  ? 1.124   -12.821 40.838 1.00 22.69  ? 58   ILE D N     1 
ATOM   2530  C  CA    . ILE D  4 58  ? -0.217  -12.633 41.407 1.00 22.84  ? 58   ILE D CA    1 
ATOM   2531  C  C     . ILE D  4 58  ? -1.026  -11.593 40.604 1.00 23.10  ? 58   ILE D C     1 
ATOM   2532  O  O     . ILE D  4 58  ? -2.210  -11.822 40.279 1.00 23.26  ? 58   ILE D O     1 
ATOM   2533  C  CB    . ILE D  4 58  ? -0.192  -12.156 42.886 1.00 22.88  ? 58   ILE D CB    1 
ATOM   2534  C  CG1   . ILE D  4 58  ? 0.714   -13.023 43.769 1.00 23.37  ? 58   ILE D CG1   1 
ATOM   2535  C  CG2   . ILE D  4 58  ? -1.610  -11.942 43.419 1.00 21.21  ? 58   ILE D CG2   1 
ATOM   2536  C  CD1   . ILE D  4 58  ? 0.153   -14.356 44.135 1.00 26.85  ? 58   ILE D CD1   1 
ATOM   2537  N  N     . MET D  4 59  ? -0.400  -10.456 40.305 1.00 22.55  ? 59   MET D N     1 
ATOM   2538  C  CA    . MET D  4 59  ? -1.078  -9.406  39.566 1.00 23.01  ? 59   MET D CA    1 
ATOM   2539  C  C     . MET D  4 59  ? -1.522  -9.917  38.207 1.00 23.14  ? 59   MET D C     1 
ATOM   2540  O  O     . MET D  4 59  ? -2.612  -9.608  37.728 1.00 23.13  ? 59   MET D O     1 
ATOM   2541  C  CB    . MET D  4 59  ? -0.190  -8.175  39.424 1.00 23.17  ? 59   MET D CB    1 
ATOM   2542  C  CG    . MET D  4 59  ? -0.041  -7.353  40.719 1.00 23.59  ? 59   MET D CG    1 
ATOM   2543  S  SD    . MET D  4 59  ? -1.642  -6.922  41.439 1.00 24.60  ? 59   MET D SD    1 
ATOM   2544  C  CE    . MET D  4 59  ? -2.363  -5.856  40.189 1.00 23.34  ? 59   MET D CE    1 
ATOM   2545  N  N     . ASN D  4 60  ? -0.692  -10.749 37.610 1.00 23.23  ? 60   ASN D N     1 
ATOM   2546  C  CA    . ASN D  4 60  ? -1.005  -11.284 36.318 1.00 23.78  ? 60   ASN D CA    1 
ATOM   2547  C  C     . ASN D  4 60  ? -2.223  -12.207 36.363 1.00 23.78  ? 60   ASN D C     1 
ATOM   2548  O  O     . ASN D  4 60  ? -3.124  -12.097 35.518 1.00 23.80  ? 60   ASN D O     1 
ATOM   2549  C  CB    . ASN D  4 60  ? 0.215   -11.981 35.725 1.00 24.25  ? 60   ASN D CB    1 
ATOM   2550  C  CG    . ASN D  4 60  ? 0.076   -12.208 34.244 1.00 26.40  ? 60   ASN D CG    1 
ATOM   2551  O  OD1   . ASN D  4 60  ? -0.202  -11.270 33.482 1.00 27.46  ? 60   ASN D OD1   1 
ATOM   2552  N  ND2   . ASN D  4 60  ? 0.246   -13.462 33.819 1.00 27.93  ? 60   ASN D ND2   1 
ATOM   2553  N  N     . SER D  4 61  ? -2.252  -13.104 37.351 1.00 23.39  ? 61   SER D N     1 
ATOM   2554  C  CA    . SER D  4 61  ? -3.417  -13.929 37.608 1.00 23.12  ? 61   SER D CA    1 
ATOM   2555  C  C     . SER D  4 61  ? -4.631  -13.088 37.902 1.00 23.38  ? 61   SER D C     1 
ATOM   2556  O  O     . SER D  4 61  ? -5.721  -13.415 37.454 1.00 24.23  ? 61   SER D O     1 
ATOM   2557  C  CB    . SER D  4 61  ? -3.191  -14.792 38.822 1.00 22.95  ? 61   SER D CB    1 
ATOM   2558  O  OG    . SER D  4 61  ? -2.074  -15.621 38.625 1.00 25.47  ? 61   SER D OG    1 
ATOM   2559  N  N     . PHE D  4 62  ? -4.457  -12.012 38.670 1.00 23.14  ? 62   PHE D N     1 
ATOM   2560  C  CA    . PHE D  4 62  ? -5.573  -11.153 38.999 1.00 22.73  ? 62   PHE D CA    1 
ATOM   2561  C  C     . PHE D  4 62  ? -6.202  -10.567 37.748 1.00 23.18  ? 62   PHE D C     1 
ATOM   2562  O  O     . PHE D  4 62  ? -7.416  -10.568 37.622 1.00 23.47  ? 62   PHE D O     1 
ATOM   2563  C  CB    . PHE D  4 62  ? -5.148  -10.040 39.947 1.00 22.67  ? 62   PHE D CB    1 
ATOM   2564  C  CG    . PHE D  4 62  ? -6.205  -8.989  40.169 1.00 21.68  ? 62   PHE D CG    1 
ATOM   2565  C  CD1   . PHE D  4 62  ? -7.392  -9.298  40.819 1.00 21.47  ? 62   PHE D CD1   1 
ATOM   2566  C  CD2   . PHE D  4 62  ? -6.004  -7.688  39.737 1.00 21.29  ? 62   PHE D CD2   1 
ATOM   2567  C  CE1   . PHE D  4 62  ? -8.363  -8.331  41.037 1.00 20.33  ? 62   PHE D CE1   1 
ATOM   2568  C  CE2   . PHE D  4 62  ? -6.975  -6.709  39.947 1.00 21.95  ? 62   PHE D CE2   1 
ATOM   2569  C  CZ    . PHE D  4 62  ? -8.155  -7.039  40.595 1.00 22.10  ? 62   PHE D CZ    1 
ATOM   2570  N  N     . VAL D  4 63  ? -5.381  -10.080 36.818 1.00 23.37  ? 63   VAL D N     1 
ATOM   2571  C  CA    . VAL D  4 63  ? -5.900  -9.455  35.602 1.00 22.98  ? 63   VAL D CA    1 
ATOM   2572  C  C     . VAL D  4 63  ? -6.589  -10.473 34.701 1.00 23.51  ? 63   VAL D C     1 
ATOM   2573  O  O     . VAL D  4 63  ? -7.645  -10.181 34.167 1.00 24.27  ? 63   VAL D O     1 
ATOM   2574  C  CB    . VAL D  4 63  ? -4.821  -8.655  34.818 1.00 22.85  ? 63   VAL D CB    1 
ATOM   2575  C  CG1   . VAL D  4 63  ? -5.421  -8.080  33.562 1.00 22.27  ? 63   VAL D CG1   1 
ATOM   2576  C  CG2   . VAL D  4 63  ? -4.233  -7.525  35.674 1.00 21.08  ? 63   VAL D CG2   1 
ATOM   2577  N  N     . ASN D  4 64  ? -6.022  -11.669 34.556 1.00 23.75  ? 64   ASN D N     1 
ATOM   2578  C  CA    . ASN D  4 64  ? -6.695  -12.728 33.820 1.00 24.11  ? 64   ASN D CA    1 
ATOM   2579  C  C     . ASN D  4 64  ? -7.992  -13.207 34.477 1.00 24.25  ? 64   ASN D C     1 
ATOM   2580  O  O     . ASN D  4 64  ? -8.999  -13.407 33.814 1.00 24.32  ? 64   ASN D O     1 
ATOM   2581  C  CB    . ASN D  4 64  ? -5.764  -13.898 33.617 1.00 24.48  ? 64   ASN D CB    1 
ATOM   2582  C  CG    . ASN D  4 64  ? -4.604  -13.565 32.716 1.00 26.93  ? 64   ASN D CG    1 
ATOM   2583  O  OD1   . ASN D  4 64  ? -4.785  -13.089 31.587 1.00 28.44  ? 64   ASN D OD1   1 
ATOM   2584  N  ND2   . ASN D  4 64  ? -3.388  -13.829 33.201 1.00 30.14  ? 64   ASN D ND2   1 
ATOM   2585  N  N     . ASP D  4 65  ? -7.969  -13.391 35.786 1.00 24.46  ? 65   ASP D N     1 
ATOM   2586  C  CA    . ASP D  4 65  ? -9.178  -13.727 36.522 1.00 24.91  ? 65   ASP D CA    1 
ATOM   2587  C  C     . ASP D  4 65  ? -10.340 -12.750 36.265 1.00 24.75  ? 65   ASP D C     1 
ATOM   2588  O  O     . ASP D  4 65  ? -11.431 -13.147 35.908 1.00 24.75  ? 65   ASP D O     1 
ATOM   2589  C  CB    . ASP D  4 65  ? -8.869  -13.817 38.011 1.00 24.93  ? 65   ASP D CB    1 
ATOM   2590  C  CG    . ASP D  4 65  ? -9.997  -14.441 38.800 1.00 26.87  ? 65   ASP D CG    1 
ATOM   2591  O  OD1   . ASP D  4 65  ? -10.693 -15.315 38.235 1.00 29.41  ? 65   ASP D OD1   1 
ATOM   2592  O  OD2   . ASP D  4 65  ? -10.196 -14.052 39.978 1.00 27.39  ? 65   ASP D OD2   1 
ATOM   2593  N  N     . VAL D  4 66  ? -10.093 -11.466 36.415 1.00 25.16  ? 66   VAL D N     1 
ATOM   2594  C  CA    . VAL D  4 66  ? -11.135 -10.472 36.243 1.00 25.79  ? 66   VAL D CA    1 
ATOM   2595  C  C     . VAL D  4 66  ? -11.614 -10.353 34.781 1.00 26.38  ? 66   VAL D C     1 
ATOM   2596  O  O     . VAL D  4 66  ? -12.795 -10.078 34.516 1.00 26.19  ? 66   VAL D O     1 
ATOM   2597  C  CB    . VAL D  4 66  ? -10.659 -9.128  36.801 1.00 25.92  ? 66   VAL D CB    1 
ATOM   2598  C  CG1   . VAL D  4 66  ? -11.608 -8.000  36.430 1.00 26.51  ? 66   VAL D CG1   1 
ATOM   2599  C  CG2   . VAL D  4 66  ? -10.514 -9.234  38.314 1.00 25.01  ? 66   VAL D CG2   1 
ATOM   2600  N  N     . PHE D  4 67  ? -10.695 -10.568 33.843 1.00 26.77  ? 67   PHE D N     1 
ATOM   2601  C  CA    . PHE D  4 67  ? -11.037 -10.561 32.434 1.00 27.01  ? 67   PHE D CA    1 
ATOM   2602  C  C     . PHE D  4 67  ? -12.026 -11.680 32.139 1.00 27.24  ? 67   PHE D C     1 
ATOM   2603  O  O     . PHE D  4 67  ? -13.039 -11.450 31.500 1.00 27.70  ? 67   PHE D O     1 
ATOM   2604  C  CB    . PHE D  4 67  ? -9.774  -10.698 31.571 1.00 27.23  ? 67   PHE D CB    1 
ATOM   2605  C  CG    . PHE D  4 67  ? -10.054 -10.891 30.102 1.00 27.69  ? 67   PHE D CG    1 
ATOM   2606  C  CD1   . PHE D  4 67  ? -9.820  -9.868  29.200 1.00 28.93  ? 67   PHE D CD1   1 
ATOM   2607  C  CD2   . PHE D  4 67  ? -10.543 -12.102 29.621 1.00 27.74  ? 67   PHE D CD2   1 
ATOM   2608  C  CE1   . PHE D  4 67  ? -10.087 -10.039 27.849 1.00 28.97  ? 67   PHE D CE1   1 
ATOM   2609  C  CE2   . PHE D  4 67  ? -10.810 -12.280 28.276 1.00 27.76  ? 67   PHE D CE2   1 
ATOM   2610  C  CZ    . PHE D  4 67  ? -10.588 -11.246 27.390 1.00 28.14  ? 67   PHE D CZ    1 
ATOM   2611  N  N     . GLU D  4 68  ? -11.739 -12.890 32.607 1.00 27.65  ? 68   GLU D N     1 
ATOM   2612  C  CA    . GLU D  4 68  ? -12.602 -14.032 32.315 1.00 28.41  ? 68   GLU D CA    1 
ATOM   2613  C  C     . GLU D  4 68  ? -13.951 -13.880 32.997 1.00 27.61  ? 68   GLU D C     1 
ATOM   2614  O  O     . GLU D  4 68  ? -14.982 -14.295 32.470 1.00 27.16  ? 68   GLU D O     1 
ATOM   2615  C  CB    . GLU D  4 68  ? -11.954 -15.345 32.740 1.00 29.01  ? 68   GLU D CB    1 
ATOM   2616  C  CG    . GLU D  4 68  ? -10.786 -15.783 31.854 1.00 34.10  ? 68   GLU D CG    1 
ATOM   2617  C  CD    . GLU D  4 68  ? -9.693  -16.537 32.639 1.00 40.36  ? 68   GLU D CD    1 
ATOM   2618  O  OE1   . GLU D  4 68  ? -8.484  -16.182 32.484 1.00 42.22  ? 68   GLU D OE1   1 
ATOM   2619  O  OE2   . GLU D  4 68  ? -10.050 -17.466 33.416 1.00 42.44  ? 68   GLU D OE2   1 
ATOM   2620  N  N     . ARG D  4 69  ? -13.945 -13.275 34.173 1.00 26.94  ? 69   ARG D N     1 
ATOM   2621  C  CA    . ARG D  4 69  ? -15.188 -13.091 34.872 1.00 26.46  ? 69   ARG D CA    1 
ATOM   2622  C  C     . ARG D  4 69  ? -16.064 -12.065 34.183 1.00 26.53  ? 69   ARG D C     1 
ATOM   2623  O  O     . ARG D  4 69  ? -17.285 -12.254 34.108 1.00 26.90  ? 69   ARG D O     1 
ATOM   2624  C  CB    . ARG D  4 69  ? -14.947 -12.690 36.303 1.00 26.32  ? 69   ARG D CB    1 
ATOM   2625  C  CG    . ARG D  4 69  ? -14.448 -13.804 37.168 1.00 25.64  ? 69   ARG D CG    1 
ATOM   2626  C  CD    . ARG D  4 69  ? -14.835 -13.460 38.564 1.00 24.69  ? 69   ARG D CD    1 
ATOM   2627  N  NE    . ARG D  4 69  ? -13.718 -13.522 39.478 1.00 23.44  ? 69   ARG D NE    1 
ATOM   2628  C  CZ    . ARG D  4 69  ? -13.810 -13.154 40.748 1.00 25.65  ? 69   ARG D CZ    1 
ATOM   2629  N  NH1   . ARG D  4 69  ? -14.966 -12.681 41.231 1.00 21.72  ? 69   ARG D NH1   1 
ATOM   2630  N  NH2   . ARG D  4 69  ? -12.738 -13.234 41.533 1.00 27.15  ? 69   ARG D NH2   1 
ATOM   2631  N  N     . ILE D  4 70  ? -15.464 -10.990 33.676 1.00 26.10  ? 70   ILE D N     1 
ATOM   2632  C  CA    . ILE D  4 70  ? -16.268 -9.961  33.035 1.00 25.98  ? 70   ILE D CA    1 
ATOM   2633  C  C     . ILE D  4 70  ? -16.755 -10.432 31.679 1.00 26.52  ? 70   ILE D C     1 
ATOM   2634  O  O     . ILE D  4 70  ? -17.949 -10.313 31.373 1.00 26.63  ? 70   ILE D O     1 
ATOM   2635  C  CB    . ILE D  4 70  ? -15.559 -8.625  32.908 1.00 25.72  ? 70   ILE D CB    1 
ATOM   2636  C  CG1   . ILE D  4 70  ? -15.404 -7.992  34.298 1.00 25.19  ? 70   ILE D CG1   1 
ATOM   2637  C  CG2   . ILE D  4 70  ? -16.364 -7.716  31.985 1.00 24.24  ? 70   ILE D CG2   1 
ATOM   2638  C  CD1   . ILE D  4 70  ? -14.390 -6.851  34.369 1.00 23.82  ? 70   ILE D CD1   1 
ATOM   2639  N  N     . ALA D  4 71  ? -15.842 -10.989 30.884 1.00 26.55  ? 71   ALA D N     1 
ATOM   2640  C  CA    . ALA D  4 71  ? -16.188 -11.438 29.542 1.00 26.65  ? 71   ALA D CA    1 
ATOM   2641  C  C     . ALA D  4 71  ? -17.206 -12.570 29.616 1.00 26.81  ? 71   ALA D C     1 
ATOM   2642  O  O     . ALA D  4 71  ? -18.057 -12.695 28.756 1.00 26.57  ? 71   ALA D O     1 
ATOM   2643  C  CB    . ALA D  4 71  ? -14.947 -11.867 28.784 1.00 26.37  ? 71   ALA D CB    1 
ATOM   2644  N  N     . GLY D  4 72  ? -17.113 -13.376 30.666 1.00 27.40  ? 72   GLY D N     1 
ATOM   2645  C  CA    . GLY D  4 72  ? -18.004 -14.511 30.864 1.00 28.00  ? 72   GLY D CA    1 
ATOM   2646  C  C     . GLY D  4 72  ? -19.413 -14.038 31.149 1.00 28.96  ? 72   GLY D C     1 
ATOM   2647  O  O     . GLY D  4 72  ? -20.359 -14.551 30.564 1.00 29.01  ? 72   GLY D O     1 
ATOM   2648  N  N     . GLU D  4 73  ? -19.561 -13.060 32.048 1.00 29.50  ? 73   GLU D N     1 
ATOM   2649  C  CA    . GLU D  4 73  ? -20.870 -12.475 32.317 1.00 30.45  ? 73   GLU D CA    1 
ATOM   2650  C  C     . GLU D  4 73  ? -21.383 -11.862 31.035 1.00 30.26  ? 73   GLU D C     1 
ATOM   2651  O  O     . GLU D  4 73  ? -22.558 -11.996 30.713 1.00 30.60  ? 73   GLU D O     1 
ATOM   2652  C  CB    . GLU D  4 73  ? -20.790 -11.371 33.373 1.00 30.95  ? 73   GLU D CB    1 
ATOM   2653  C  CG    . GLU D  4 73  ? -20.484 -11.836 34.775 1.00 35.30  ? 73   GLU D CG    1 
ATOM   2654  C  CD    . GLU D  4 73  ? -21.737 -12.269 35.535 1.00 41.66  ? 73   GLU D CD    1 
ATOM   2655  O  OE1   . GLU D  4 73  ? -22.869 -12.012 35.024 1.00 44.54  ? 73   GLU D OE1   1 
ATOM   2656  O  OE2   . GLU D  4 73  ? -21.589 -12.855 36.643 1.00 42.42  ? 73   GLU D OE2   1 
ATOM   2657  N  N     . ALA D  4 74  ? -20.495 -11.181 30.306 1.00 30.19  ? 74   ALA D N     1 
ATOM   2658  C  CA    . ALA D  4 74  ? -20.890 -10.488 29.089 1.00 30.16  ? 74   ALA D CA    1 
ATOM   2659  C  C     . ALA D  4 74  ? -21.446 -11.506 28.124 1.00 29.91  ? 74   ALA D C     1 
ATOM   2660  O  O     . ALA D  4 74  ? -22.514 -11.322 27.557 1.00 29.19  ? 74   ALA D O     1 
ATOM   2661  C  CB    . ALA D  4 74  ? -19.713 -9.736  28.477 1.00 29.98  ? 74   ALA D CB    1 
ATOM   2662  N  N     . SER D  4 75  ? -20.717 -12.600 27.984 1.00 30.49  ? 75   SER D N     1 
ATOM   2663  C  CA    . SER D  4 75  ? -21.104 -13.672 27.100 1.00 31.48  ? 75   SER D CA    1 
ATOM   2664  C  C     . SER D  4 75  ? -22.532 -14.098 27.412 1.00 32.10  ? 75   SER D C     1 
ATOM   2665  O  O     . SER D  4 75  ? -23.382 -14.106 26.517 1.00 32.41  ? 75   SER D O     1 
ATOM   2666  C  CB    . SER D  4 75  ? -20.140 -14.840 27.246 1.00 31.28  ? 75   SER D CB    1 
ATOM   2667  O  OG    . SER D  4 75  ? -20.472 -15.864 26.340 1.00 32.17  ? 75   SER D OG    1 
ATOM   2668  N  N     . ARG D  4 76  ? -22.783 -14.410 28.686 1.00 32.83  ? 76   ARG D N     1 
ATOM   2669  C  CA    . ARG D  4 76  ? -24.103 -14.816 29.194 1.00 33.45  ? 76   ARG D CA    1 
ATOM   2670  C  C     . ARG D  4 76  ? -25.208 -13.786 28.954 1.00 34.09  ? 76   ARG D C     1 
ATOM   2671  O  O     . ARG D  4 76  ? -26.279 -14.128 28.452 1.00 34.05  ? 76   ARG D O     1 
ATOM   2672  C  CB    . ARG D  4 76  ? -24.027 -15.184 30.681 1.00 33.36  ? 76   ARG D CB    1 
ATOM   2673  C  CG    . ARG D  4 76  ? -23.903 -16.678 30.942 1.00 32.91  ? 76   ARG D CG    1 
ATOM   2674  C  CD    . ARG D  4 76  ? -23.457 -16.988 32.376 1.00 33.05  ? 76   ARG D CD    1 
ATOM   2675  N  NE    . ARG D  4 76  ? -22.037 -17.336 32.414 1.00 32.73  ? 76   ARG D NE    1 
ATOM   2676  C  CZ    . ARG D  4 76  ? -21.133 -16.772 33.207 1.00 32.12  ? 76   ARG D CZ    1 
ATOM   2677  N  NH1   . ARG D  4 76  ? -21.481 -15.823 34.060 1.00 31.58  ? 76   ARG D NH1   1 
ATOM   2678  N  NH2   . ARG D  4 76  ? -19.869 -17.162 33.139 1.00 33.28  ? 76   ARG D NH2   1 
ATOM   2679  N  N     . LEU D  4 77  ? -24.946 -12.536 29.314 1.00 34.89  ? 77   LEU D N     1 
ATOM   2680  C  CA    . LEU D  4 77  ? -25.817 -11.432 28.921 1.00 36.12  ? 77   LEU D CA    1 
ATOM   2681  C  C     . LEU D  4 77  ? -26.269 -11.501 27.456 1.00 36.57  ? 77   LEU D C     1 
ATOM   2682  O  O     . LEU D  4 77  ? -27.473 -11.536 27.171 1.00 36.56  ? 77   LEU D O     1 
ATOM   2683  C  CB    . LEU D  4 77  ? -25.098 -10.116 29.137 1.00 36.23  ? 77   LEU D CB    1 
ATOM   2684  C  CG    . LEU D  4 77  ? -25.405 -9.415  30.435 1.00 38.06  ? 77   LEU D CG    1 
ATOM   2685  C  CD1   . LEU D  4 77  ? -24.402 -8.274  30.573 1.00 39.18  ? 77   LEU D CD1   1 
ATOM   2686  C  CD2   . LEU D  4 77  ? -26.849 -8.912  30.419 1.00 38.43  ? 77   LEU D CD2   1 
ATOM   2687  N  N     . ALA D  4 78  ? -25.295 -11.514 26.541 1.00 37.02  ? 78   ALA D N     1 
ATOM   2688  C  CA    . ALA D  4 78  ? -25.572 -11.544 25.114 1.00 37.86  ? 78   ALA D CA    1 
ATOM   2689  C  C     . ALA D  4 78  ? -26.567 -12.641 24.793 1.00 38.42  ? 78   ALA D C     1 
ATOM   2690  O  O     . ALA D  4 78  ? -27.620 -12.386 24.210 1.00 37.89  ? 78   ALA D O     1 
ATOM   2691  C  CB    . ALA D  4 78  ? -24.293 -11.733 24.321 1.00 37.77  ? 78   ALA D CB    1 
ATOM   2692  N  N     . HIS D  4 79  ? -26.241 -13.859 25.209 1.00 39.67  ? 79   HIS D N     1 
ATOM   2693  C  CA    . HIS D  4 79  ? -27.117 -14.976 24.942 1.00 40.97  ? 79   HIS D CA    1 
ATOM   2694  C  C     . HIS D  4 79  ? -28.499 -14.693 25.492 1.00 40.91  ? 79   HIS D C     1 
ATOM   2695  O  O     . HIS D  4 79  ? -29.444 -14.655 24.727 1.00 41.29  ? 79   HIS D O     1 
ATOM   2696  C  CB    . HIS D  4 79  ? -26.521 -16.309 25.397 1.00 41.49  ? 79   HIS D CB    1 
ATOM   2697  C  CG    . HIS D  4 79  ? -25.432 -16.820 24.490 1.00 44.88  ? 79   HIS D CG    1 
ATOM   2698  N  ND1   . HIS D  4 79  ? -25.678 -17.279 23.209 1.00 47.80  ? 79   HIS D ND1   1 
ATOM   2699  C  CD2   . HIS D  4 79  ? -24.092 -16.935 24.675 1.00 46.46  ? 79   HIS D CD2   1 
ATOM   2700  C  CE1   . HIS D  4 79  ? -24.539 -17.654 22.647 1.00 47.22  ? 79   HIS D CE1   1 
ATOM   2701  N  NE2   . HIS D  4 79  ? -23.562 -17.459 23.516 1.00 47.35  ? 79   HIS D NE2   1 
ATOM   2702  N  N     . TYR D  4 80  ? -28.618 -14.405 26.779 1.00 41.35  ? 80   TYR D N     1 
ATOM   2703  C  CA    . TYR D  4 80  ? -29.939 -14.170 27.370 1.00 41.84  ? 80   TYR D CA    1 
ATOM   2704  C  C     . TYR D  4 80  ? -30.832 -13.273 26.519 1.00 42.00  ? 80   TYR D C     1 
ATOM   2705  O  O     . TYR D  4 80  ? -32.031 -13.504 26.436 1.00 42.18  ? 80   TYR D O     1 
ATOM   2706  C  CB    . TYR D  4 80  ? -29.846 -13.618 28.796 1.00 42.39  ? 80   TYR D CB    1 
ATOM   2707  C  CG    . TYR D  4 80  ? -29.138 -14.527 29.794 1.00 43.32  ? 80   TYR D CG    1 
ATOM   2708  C  CD1   . TYR D  4 80  ? -28.592 -13.999 30.971 1.00 43.67  ? 80   TYR D CD1   1 
ATOM   2709  C  CD2   . TYR D  4 80  ? -28.993 -15.903 29.557 1.00 43.32  ? 80   TYR D CD2   1 
ATOM   2710  C  CE1   . TYR D  4 80  ? -27.942 -14.809 31.903 1.00 43.58  ? 80   TYR D CE1   1 
ATOM   2711  C  CE2   . TYR D  4 80  ? -28.335 -16.725 30.474 1.00 44.39  ? 80   TYR D CE2   1 
ATOM   2712  C  CZ    . TYR D  4 80  ? -27.811 -16.169 31.650 1.00 44.50  ? 80   TYR D CZ    1 
ATOM   2713  O  OH    . TYR D  4 80  ? -27.161 -16.971 32.573 1.00 44.07  ? 80   TYR D OH    1 
ATOM   2714  N  N     . ASN D  4 81  ? -30.246 -12.274 25.866 1.00 42.09  ? 81   ASN D N     1 
ATOM   2715  C  CA    . ASN D  4 81  ? -31.009 -11.377 25.005 1.00 41.79  ? 81   ASN D CA    1 
ATOM   2716  C  C     . ASN D  4 81  ? -30.945 -11.674 23.508 1.00 42.14  ? 81   ASN D C     1 
ATOM   2717  O  O     . ASN D  4 81  ? -31.246 -10.793 22.696 1.00 42.37  ? 81   ASN D O     1 
ATOM   2718  C  CB    . ASN D  4 81  ? -30.577 -9.944  25.235 1.00 41.47  ? 81   ASN D CB    1 
ATOM   2719  C  CG    . ASN D  4 81  ? -30.764 -9.517  26.649 1.00 41.49  ? 81   ASN D CG    1 
ATOM   2720  O  OD1   . ASN D  4 81  ? -31.762 -8.879  26.987 1.00 41.46  ? 81   ASN D OD1   1 
ATOM   2721  N  ND2   . ASN D  4 81  ? -29.803 -9.866  27.504 1.00 41.59  ? 81   ASN D ND2   1 
ATOM   2722  N  N     . LYS D  4 82  ? -30.562 -12.895 23.137 1.00 42.30  ? 82   LYS D N     1 
ATOM   2723  C  CA    . LYS D  4 82  ? -30.448 -13.284 21.719 1.00 42.57  ? 82   LYS D CA    1 
ATOM   2724  C  C     . LYS D  4 82  ? -29.639 -12.274 20.908 1.00 41.94  ? 82   LYS D C     1 
ATOM   2725  O  O     . LYS D  4 82  ? -30.096 -11.802 19.869 1.00 42.11  ? 82   LYS D O     1 
ATOM   2726  C  CB    . LYS D  4 82  ? -31.832 -13.454 21.070 1.00 42.85  ? 82   LYS D CB    1 
ATOM   2727  C  CG    . LYS D  4 82  ? -32.704 -14.540 21.671 1.00 45.17  ? 82   LYS D CG    1 
ATOM   2728  C  CD    . LYS D  4 82  ? -33.684 -13.964 22.685 1.00 49.85  ? 82   LYS D CD    1 
ATOM   2729  C  CE    . LYS D  4 82  ? -34.256 -15.054 23.610 1.00 52.73  ? 82   LYS D CE    1 
ATOM   2730  N  NZ    . LYS D  4 82  ? -34.798 -16.249 22.860 1.00 55.21  ? 82   LYS D NZ    1 
ATOM   2731  N  N     . ARG D  4 83  ? -28.455 -11.933 21.400 1.00 41.19  ? 83   ARG D N     1 
ATOM   2732  C  CA    . ARG D  4 83  ? -27.577 -10.991 20.730 1.00 40.79  ? 83   ARG D CA    1 
ATOM   2733  C  C     . ARG D  4 83  ? -26.274 -11.681 20.386 1.00 40.26  ? 83   ARG D C     1 
ATOM   2734  O  O     . ARG D  4 83  ? -25.700 -12.388 21.215 1.00 40.83  ? 83   ARG D O     1 
ATOM   2735  C  CB    . ARG D  4 83  ? -27.283 -9.802  21.636 1.00 41.03  ? 83   ARG D CB    1 
ATOM   2736  C  CG    . ARG D  4 83  ? -28.485 -8.967  21.980 1.00 42.53  ? 83   ARG D CG    1 
ATOM   2737  C  CD    . ARG D  4 83  ? -28.670 -7.826  20.998 1.00 46.31  ? 83   ARG D CD    1 
ATOM   2738  N  NE    . ARG D  4 83  ? -29.884 -7.060  21.286 1.00 48.91  ? 83   ARG D NE    1 
ATOM   2739  C  CZ    . ARG D  4 83  ? -31.106 -7.430  20.911 1.00 49.14  ? 83   ARG D CZ    1 
ATOM   2740  N  NH1   . ARG D  4 83  ? -31.287 -8.553  20.229 1.00 49.85  ? 83   ARG D NH1   1 
ATOM   2741  N  NH2   . ARG D  4 83  ? -32.149 -6.678  21.221 1.00 49.79  ? 83   ARG D NH2   1 
ATOM   2742  N  N     . SER D  4 84  ? -25.786 -11.471 19.177 1.00 39.29  ? 84   SER D N     1 
ATOM   2743  C  CA    . SER D  4 84  ? -24.569 -12.149 18.758 1.00 38.65  ? 84   SER D CA    1 
ATOM   2744  C  C     . SER D  4 84  ? -23.307 -11.283 18.941 1.00 37.96  ? 84   SER D C     1 
ATOM   2745  O  O     . SER D  4 84  ? -22.206 -11.687 18.581 1.00 37.36  ? 84   SER D O     1 
ATOM   2746  C  CB    . SER D  4 84  ? -24.728 -12.632 17.312 1.00 38.75  ? 84   SER D CB    1 
ATOM   2747  O  OG    . SER D  4 84  ? -25.196 -11.580 16.487 1.00 39.16  ? 84   SER D OG    1 
ATOM   2748  N  N     . THR D  4 85  ? -23.479 -10.105 19.532 1.00 37.56  ? 85   THR D N     1 
ATOM   2749  C  CA    . THR D  4 85  ? -22.404 -9.117  19.642 1.00 37.33  ? 85   THR D CA    1 
ATOM   2750  C  C     . THR D  4 85  ? -22.170 -8.688  21.095 1.00 36.69  ? 85   THR D C     1 
ATOM   2751  O  O     . THR D  4 85  ? -23.107 -8.333  21.803 1.00 36.75  ? 85   THR D O     1 
ATOM   2752  C  CB    . THR D  4 85  ? -22.745 -7.872  18.775 1.00 37.31  ? 85   THR D CB    1 
ATOM   2753  O  OG1   . THR D  4 85  ? -22.883 -8.279  17.414 1.00 38.75  ? 85   THR D OG1   1 
ATOM   2754  C  CG2   . THR D  4 85  ? -21.670 -6.798  18.850 1.00 37.03  ? 85   THR D CG2   1 
ATOM   2755  N  N     . ILE D  4 86  ? -20.924 -8.719  21.542 1.00 36.17  ? 86   ILE D N     1 
ATOM   2756  C  CA    . ILE D  4 86  ? -20.605 -8.168  22.856 1.00 36.04  ? 86   ILE D CA    1 
ATOM   2757  C  C     . ILE D  4 86  ? -20.153 -6.731  22.690 1.00 35.78  ? 86   ILE D C     1 
ATOM   2758  O  O     . ILE D  4 86  ? -19.080 -6.467  22.152 1.00 35.59  ? 86   ILE D O     1 
ATOM   2759  C  CB    . ILE D  4 86  ? -19.546 -8.997  23.620 1.00 35.94  ? 86   ILE D CB    1 
ATOM   2760  C  CG1   . ILE D  4 86  ? -20.162 -10.315 24.072 1.00 36.19  ? 86   ILE D CG1   1 
ATOM   2761  C  CG2   . ILE D  4 86  ? -19.066 -8.237  24.843 1.00 35.88  ? 86   ILE D CG2   1 
ATOM   2762  C  CD1   . ILE D  4 86  ? -19.203 -11.243 24.776 1.00 38.40  ? 86   ILE D CD1   1 
ATOM   2763  N  N     . THR D  4 87  ? -20.988 -5.804  23.133 1.00 35.44  ? 87   THR D N     1 
ATOM   2764  C  CA    . THR D  4 87  ? -20.657 -4.401  23.017 1.00 35.70  ? 87   THR D CA    1 
ATOM   2765  C  C     . THR D  4 87  ? -20.136 -3.875  24.345 1.00 35.18  ? 87   THR D C     1 
ATOM   2766  O  O     . THR D  4 87  ? -20.043 -4.603  25.324 1.00 35.36  ? 87   THR D O     1 
ATOM   2767  C  CB    . THR D  4 87  ? -21.883 -3.554  22.560 1.00 36.28  ? 87   THR D CB    1 
ATOM   2768  O  OG1   . THR D  4 87  ? -22.906 -3.589  23.567 1.00 37.92  ? 87   THR D OG1   1 
ATOM   2769  C  CG2   . THR D  4 87  ? -22.463 -4.062  21.235 1.00 36.01  ? 87   THR D CG2   1 
ATOM   2770  N  N     . SER D  4 88  ? -19.811 -2.595  24.375 1.00 34.95  ? 88   SER D N     1 
ATOM   2771  C  CA    . SER D  4 88  ? -19.377 -1.949  25.589 1.00 34.95  ? 88   SER D CA    1 
ATOM   2772  C  C     . SER D  4 88  ? -20.549 -1.857  26.555 1.00 35.50  ? 88   SER D C     1 
ATOM   2773  O  O     . SER D  4 88  ? -20.353 -1.742  27.774 1.00 36.17  ? 88   SER D O     1 
ATOM   2774  C  CB    . SER D  4 88  ? -18.800 -0.571  25.287 1.00 34.63  ? 88   SER D CB    1 
ATOM   2775  O  OG    . SER D  4 88  ? -19.837 0.344   25.022 1.00 34.01  ? 88   SER D OG    1 
ATOM   2776  N  N     . ARG D  4 89  ? -21.765 -1.940  26.020 1.00 35.42  ? 89   ARG D N     1 
ATOM   2777  C  CA    . ARG D  4 89  ? -22.946 -2.047  26.861 1.00 35.31  ? 89   ARG D CA    1 
ATOM   2778  C  C     . ARG D  4 89  ? -22.974 -3.379  27.646 1.00 34.94  ? 89   ARG D C     1 
ATOM   2779  O  O     . ARG D  4 89  ? -23.302 -3.403  28.834 1.00 35.03  ? 89   ARG D O     1 
ATOM   2780  C  CB    . ARG D  4 89  ? -24.194 -1.895  26.018 1.00 35.48  ? 89   ARG D CB    1 
ATOM   2781  C  CG    . ARG D  4 89  ? -25.162 -0.905  26.571 1.00 37.84  ? 89   ARG D CG    1 
ATOM   2782  C  CD    . ARG D  4 89  ? -26.451 -0.873  25.762 1.00 41.82  ? 89   ARG D CD    1 
ATOM   2783  N  NE    . ARG D  4 89  ? -27.594 -0.642  26.649 1.00 44.49  ? 89   ARG D NE    1 
ATOM   2784  C  CZ    . ARG D  4 89  ? -28.454 -1.584  27.033 1.00 45.40  ? 89   ARG D CZ    1 
ATOM   2785  N  NH1   . ARG D  4 89  ? -28.325 -2.831  26.590 1.00 45.34  ? 89   ARG D NH1   1 
ATOM   2786  N  NH2   . ARG D  4 89  ? -29.457 -1.273  27.849 1.00 46.27  ? 89   ARG D NH2   1 
ATOM   2787  N  N     . GLU D  4 90  ? -22.632 -4.482  26.987 1.00 34.20  ? 90   GLU D N     1 
ATOM   2788  C  CA    . GLU D  4 90  ? -22.575 -5.766  27.662 1.00 33.64  ? 90   GLU D CA    1 
ATOM   2789  C  C     . GLU D  4 90  ? -21.482 -5.780  28.736 1.00 33.17  ? 90   GLU D C     1 
ATOM   2790  O  O     . GLU D  4 90  ? -21.698 -6.286  29.839 1.00 33.81  ? 90   GLU D O     1 
ATOM   2791  C  CB    . GLU D  4 90  ? -22.354 -6.901  26.668 1.00 33.65  ? 90   GLU D CB    1 
ATOM   2792  C  CG    . GLU D  4 90  ? -23.624 -7.472  26.072 1.00 35.69  ? 90   GLU D CG    1 
ATOM   2793  C  CD    . GLU D  4 90  ? -24.357 -6.496  25.155 1.00 38.75  ? 90   GLU D CD    1 
ATOM   2794  O  OE1   . GLU D  4 90  ? -23.684 -5.836  24.332 1.00 40.33  ? 90   GLU D OE1   1 
ATOM   2795  O  OE2   . GLU D  4 90  ? -25.607 -6.397  25.249 1.00 39.01  ? 90   GLU D OE2   1 
ATOM   2796  N  N     . ILE D  4 91  ? -20.324 -5.206  28.428 1.00 31.92  ? 91   ILE D N     1 
ATOM   2797  C  CA    . ILE D  4 91  ? -19.221 -5.171  29.377 1.00 30.66  ? 91   ILE D CA    1 
ATOM   2798  C  C     . ILE D  4 91  ? -19.632 -4.362  30.609 1.00 30.71  ? 91   ILE D C     1 
ATOM   2799  O  O     . ILE D  4 91  ? -19.304 -4.721  31.750 1.00 30.69  ? 91   ILE D O     1 
ATOM   2800  C  CB    . ILE D  4 91  ? -17.922 -4.590  28.729 1.00 30.35  ? 91   ILE D CB    1 
ATOM   2801  C  CG1   . ILE D  4 91  ? -17.473 -5.442  27.528 1.00 29.30  ? 91   ILE D CG1   1 
ATOM   2802  C  CG2   . ILE D  4 91  ? -16.803 -4.459  29.757 1.00 28.75  ? 91   ILE D CG2   1 
ATOM   2803  C  CD1   . ILE D  4 91  ? -16.993 -6.845  27.876 1.00 25.86  ? 91   ILE D CD1   1 
ATOM   2804  N  N     . GLN D  4 92  ? -20.377 -3.286  30.372 1.00 30.24  ? 92   GLN D N     1 
ATOM   2805  C  CA    . GLN D  4 92  ? -20.792 -2.404  31.452 1.00 30.07  ? 92   GLN D CA    1 
ATOM   2806  C  C     . GLN D  4 92  ? -21.753 -3.086  32.428 1.00 29.43  ? 92   GLN D C     1 
ATOM   2807  O  O     . GLN D  4 92  ? -21.569 -3.010  33.637 1.00 29.73  ? 92   GLN D O     1 
ATOM   2808  C  CB    . GLN D  4 92  ? -21.386 -1.108  30.899 1.00 30.14  ? 92   GLN D CB    1 
ATOM   2809  C  CG    . GLN D  4 92  ? -21.831 -0.146  31.976 1.00 32.22  ? 92   GLN D CG    1 
ATOM   2810  C  CD    . GLN D  4 92  ? -22.140 1.230   31.453 1.00 33.92  ? 92   GLN D CD    1 
ATOM   2811  O  OE1   . GLN D  4 92  ? -23.274 1.522   31.081 1.00 34.76  ? 92   GLN D OE1   1 
ATOM   2812  N  NE2   . GLN D  4 92  ? -21.130 2.089   31.420 1.00 35.13  ? 92   GLN D NE2   1 
ATOM   2813  N  N     . THR D  4 93  ? -22.764 -3.765  31.910 1.00 28.70  ? 93   THR D N     1 
ATOM   2814  C  CA    . THR D  4 93  ? -23.683 -4.470  32.773 1.00 28.32  ? 93   THR D CA    1 
ATOM   2815  C  C     . THR D  4 93  ? -22.938 -5.540  33.571 1.00 28.23  ? 93   THR D C     1 
ATOM   2816  O  O     . THR D  4 93  ? -23.153 -5.673  34.781 1.00 28.02  ? 93   THR D O     1 
ATOM   2817  C  CB    . THR D  4 93  ? -24.841 -5.067  31.975 1.00 28.37  ? 93   THR D CB    1 
ATOM   2818  O  OG1   . THR D  4 93  ? -25.541 -4.005  31.333 1.00 29.28  ? 93   THR D OG1   1 
ATOM   2819  C  CG2   . THR D  4 93  ? -25.822 -5.820  32.884 1.00 27.30  ? 93   THR D CG2   1 
ATOM   2820  N  N     . ALA D  4 94  ? -22.058 -6.278  32.894 1.00 27.59  ? 94   ALA D N     1 
ATOM   2821  C  CA    . ALA D  4 94  ? -21.212 -7.275  33.529 1.00 27.31  ? 94   ALA D CA    1 
ATOM   2822  C  C     . ALA D  4 94  ? -20.475 -6.677  34.714 1.00 27.59  ? 94   ALA D C     1 
ATOM   2823  O  O     . ALA D  4 94  ? -20.432 -7.254  35.795 1.00 27.29  ? 94   ALA D O     1 
ATOM   2824  C  CB    . ALA D  4 94  ? -20.218 -7.804  32.527 1.00 27.67  ? 94   ALA D CB    1 
ATOM   2825  N  N     . VAL D  4 95  ? -19.900 -5.503  34.501 1.00 27.80  ? 95   VAL D N     1 
ATOM   2826  C  CA    . VAL D  4 95  ? -19.174 -4.810  35.545 1.00 28.23  ? 95   VAL D CA    1 
ATOM   2827  C  C     . VAL D  4 95  ? -20.084 -4.472  36.728 1.00 28.62  ? 95   VAL D C     1 
ATOM   2828  O  O     . VAL D  4 95  ? -19.685 -4.643  37.880 1.00 28.38  ? 95   VAL D O     1 
ATOM   2829  C  CB    . VAL D  4 95  ? -18.446 -3.561  34.979 1.00 28.38  ? 95   VAL D CB    1 
ATOM   2830  C  CG1   . VAL D  4 95  ? -18.049 -2.616  36.070 1.00 28.03  ? 95   VAL D CG1   1 
ATOM   2831  C  CG2   . VAL D  4 95  ? -17.216 -3.981  34.175 1.00 27.85  ? 95   VAL D CG2   1 
ATOM   2832  N  N     . ARG D  4 96  ? -21.303 -4.018  36.442 1.00 29.34  ? 96   ARG D N     1 
ATOM   2833  C  CA    . ARG D  4 96  ? -22.289 -3.708  37.500 1.00 30.04  ? 96   ARG D CA    1 
ATOM   2834  C  C     . ARG D  4 96  ? -22.710 -4.947  38.274 1.00 29.85  ? 96   ARG D C     1 
ATOM   2835  O  O     . ARG D  4 96  ? -22.828 -4.888  39.493 1.00 29.78  ? 96   ARG D O     1 
ATOM   2836  C  CB    . ARG D  4 96  ? -23.533 -3.000  36.946 1.00 30.13  ? 96   ARG D CB    1 
ATOM   2837  C  CG    . ARG D  4 96  ? -23.407 -1.491  36.863 1.00 32.51  ? 96   ARG D CG    1 
ATOM   2838  C  CD    . ARG D  4 96  ? -24.486 -0.887  35.964 1.00 37.35  ? 96   ARG D CD    1 
ATOM   2839  N  NE    . ARG D  4 96  ? -24.419 0.582   35.941 1.00 41.44  ? 96   ARG D NE    1 
ATOM   2840  C  CZ    . ARG D  4 96  ? -24.867 1.357   34.944 1.00 43.03  ? 96   ARG D CZ    1 
ATOM   2841  N  NH1   . ARG D  4 96  ? -25.419 0.834   33.846 1.00 41.68  ? 96   ARG D NH1   1 
ATOM   2842  N  NH2   . ARG D  4 96  ? -24.749 2.675   35.040 1.00 43.92  ? 96   ARG D NH2   1 
ATOM   2843  N  N     . LEU D  4 97  ? -22.924 -6.052  37.560 1.00 29.96  ? 97   LEU D N     1 
ATOM   2844  C  CA    . LEU D  4 97  ? -23.285 -7.322  38.172 1.00 30.56  ? 97   LEU D CA    1 
ATOM   2845  C  C     . LEU D  4 97  ? -22.151 -7.926  38.995 1.00 31.64  ? 97   LEU D C     1 
ATOM   2846  O  O     . LEU D  4 97  ? -22.389 -8.455  40.077 1.00 32.24  ? 97   LEU D O     1 
ATOM   2847  C  CB    . LEU D  4 97  ? -23.690 -8.339  37.126 1.00 29.92  ? 97   LEU D CB    1 
ATOM   2848  C  CG    . LEU D  4 97  ? -25.014 -8.191  36.390 1.00 29.43  ? 97   LEU D CG    1 
ATOM   2849  C  CD1   . LEU D  4 97  ? -25.062 -9.195  35.257 1.00 27.65  ? 97   LEU D CD1   1 
ATOM   2850  C  CD2   . LEU D  4 97  ? -26.172 -8.390  37.327 1.00 29.63  ? 97   LEU D CD2   1 
ATOM   2851  N  N     . LEU D  4 98  ? -20.923 -7.840  38.492 1.00 32.37  ? 98   LEU D N     1 
ATOM   2852  C  CA    . LEU D  4 98  ? -19.818 -8.561  39.088 1.00 32.68  ? 98   LEU D CA    1 
ATOM   2853  C  C     . LEU D  4 98  ? -19.109 -7.824  40.215 1.00 32.96  ? 98   LEU D C     1 
ATOM   2854  O  O     . LEU D  4 98  ? -18.729 -8.454  41.193 1.00 33.82  ? 98   LEU D O     1 
ATOM   2855  C  CB    . LEU D  4 98  ? -18.816 -8.982  38.021 1.00 32.89  ? 98   LEU D CB    1 
ATOM   2856  C  CG    . LEU D  4 98  ? -17.438 -9.297  38.611 1.00 34.75  ? 98   LEU D CG    1 
ATOM   2857  C  CD1   . LEU D  4 98  ? -17.364 -10.747 39.041 1.00 36.30  ? 98   LEU D CD1   1 
ATOM   2858  C  CD2   . LEU D  4 98  ? -16.326 -8.989  37.628 1.00 37.23  ? 98   LEU D CD2   1 
ATOM   2859  N  N     . LEU D  4 99  ? -18.917 -6.514  40.090 1.00 32.82  ? 99   LEU D N     1 
ATOM   2860  C  CA    . LEU D  4 99  ? -18.174 -5.756  41.095 1.00 33.00  ? 99   LEU D CA    1 
ATOM   2861  C  C     . LEU D  4 99  ? -19.107 -5.158  42.150 1.00 34.00  ? 99   LEU D C     1 
ATOM   2862  O  O     . LEU D  4 99  ? -20.273 -4.913  41.872 1.00 34.51  ? 99   LEU D O     1 
ATOM   2863  C  CB    . LEU D  4 99  ? -17.358 -4.634  40.441 1.00 32.78  ? 99   LEU D CB    1 
ATOM   2864  C  CG    . LEU D  4 99  ? -16.266 -4.856  39.388 1.00 31.93  ? 99   LEU D CG    1 
ATOM   2865  C  CD1   . LEU D  4 99  ? -15.608 -3.549  39.067 1.00 31.89  ? 99   LEU D CD1   1 
ATOM   2866  C  CD2   . LEU D  4 99  ? -15.208 -5.819  39.840 1.00 32.05  ? 99   LEU D CD2   1 
ATOM   2867  N  N     . PRO D  4 100 ? -18.613 -4.943  43.383 1.00 34.76  ? 100  PRO D N     1 
ATOM   2868  C  CA    . PRO D  4 100 ? -19.491 -4.362  44.397 1.00 35.24  ? 100  PRO D CA    1 
ATOM   2869  C  C     . PRO D  4 100 ? -19.393 -2.846  44.564 1.00 36.18  ? 100  PRO D C     1 
ATOM   2870  O  O     . PRO D  4 100 ? -18.332 -2.266  44.359 1.00 36.55  ? 100  PRO D O     1 
ATOM   2871  C  CB    . PRO D  4 100 ? -19.032 -5.057  45.670 1.00 34.98  ? 100  PRO D CB    1 
ATOM   2872  C  CG    . PRO D  4 100 ? -17.580 -5.446  45.402 1.00 34.88  ? 100  PRO D CG    1 
ATOM   2873  C  CD    . PRO D  4 100 ? -17.299 -5.304  43.944 1.00 34.68  ? 100  PRO D CD    1 
ATOM   2874  N  N     . GLY D  4 101 ? -20.514 -2.224  44.926 1.00 36.85  ? 101  GLY D N     1 
ATOM   2875  C  CA    . GLY D  4 101 ? -20.570 -0.823  45.318 1.00 37.48  ? 101  GLY D CA    1 
ATOM   2876  C  C     . GLY D  4 101 ? -19.673 0.160   44.608 1.00 38.42  ? 101  GLY D C     1 
ATOM   2877  O  O     . GLY D  4 101 ? -19.856 0.441   43.422 1.00 38.74  ? 101  GLY D O     1 
ATOM   2878  N  N     . GLU D  4 102 ? -18.707 0.699   45.348 1.00 39.24  ? 102  GLU D N     1 
ATOM   2879  C  CA    . GLU D  4 102 ? -17.873 1.797   44.857 1.00 40.22  ? 102  GLU D CA    1 
ATOM   2880  C  C     . GLU D  4 102 ? -16.899 1.371   43.778 1.00 40.25  ? 102  GLU D C     1 
ATOM   2881  O  O     . GLU D  4 102 ? -16.502 2.189   42.937 1.00 40.97  ? 102  GLU D O     1 
ATOM   2882  C  CB    . GLU D  4 102 ? -17.110 2.476   45.992 1.00 40.31  ? 102  GLU D CB    1 
ATOM   2883  C  CG    . GLU D  4 102 ? -17.998 3.159   47.015 1.00 43.42  ? 102  GLU D CG    1 
ATOM   2884  C  CD    . GLU D  4 102 ? -18.824 4.314   46.441 1.00 47.20  ? 102  GLU D CD    1 
ATOM   2885  O  OE1   . GLU D  4 102 ? -20.077 4.193   46.412 1.00 49.02  ? 102  GLU D OE1   1 
ATOM   2886  O  OE2   . GLU D  4 102 ? -18.225 5.338   46.025 1.00 48.58  ? 102  GLU D OE2   1 
ATOM   2887  N  N     . LEU D  4 103 ? -16.489 0.108   43.799 1.00 39.81  ? 103  LEU D N     1 
ATOM   2888  C  CA    . LEU D  4 103 ? -15.638 -0.376  42.727 1.00 39.60  ? 103  LEU D CA    1 
ATOM   2889  C  C     . LEU D  4 103 ? -16.383 -0.267  41.405 1.00 39.87  ? 103  LEU D C     1 
ATOM   2890  O  O     . LEU D  4 103 ? -15.819 0.199   40.421 1.00 39.97  ? 103  LEU D O     1 
ATOM   2891  C  CB    . LEU D  4 103 ? -15.162 -1.806  42.968 1.00 38.93  ? 103  LEU D CB    1 
ATOM   2892  C  CG    . LEU D  4 103 ? -14.006 -1.964  43.941 1.00 37.51  ? 103  LEU D CG    1 
ATOM   2893  C  CD1   . LEU D  4 103 ? -13.620 -3.432  43.987 1.00 36.42  ? 103  LEU D CD1   1 
ATOM   2894  C  CD2   . LEU D  4 103 ? -12.826 -1.085  43.563 1.00 34.55  ? 103  LEU D CD2   1 
ATOM   2895  N  N     . ALA D  4 104 ? -17.653 -0.665  41.408 1.00 40.27  ? 104  ALA D N     1 
ATOM   2896  C  CA    . ALA D  4 104 ? -18.473 -0.652  40.203 1.00 40.95  ? 104  ALA D CA    1 
ATOM   2897  C  C     . ALA D  4 104 ? -18.653 0.771   39.671 1.00 41.64  ? 104  ALA D C     1 
ATOM   2898  O  O     . ALA D  4 104 ? -18.386 1.025   38.495 1.00 41.85  ? 104  ALA D O     1 
ATOM   2899  C  CB    . ALA D  4 104 ? -19.809 -1.314  40.457 1.00 40.61  ? 104  ALA D CB    1 
ATOM   2900  N  N     . LYS D  4 105 ? -19.053 1.699   40.543 1.00 42.03  ? 105  LYS D N     1 
ATOM   2901  C  CA    . LYS D  4 105 ? -19.250 3.090   40.146 1.00 42.49  ? 105  LYS D CA    1 
ATOM   2902  C  C     . LYS D  4 105 ? -18.021 3.698   39.495 1.00 41.66  ? 105  LYS D C     1 
ATOM   2903  O  O     . LYS D  4 105 ? -18.135 4.379   38.475 1.00 41.97  ? 105  LYS D O     1 
ATOM   2904  C  CB    . LYS D  4 105 ? -19.714 3.952   41.319 1.00 42.58  ? 105  LYS D CB    1 
ATOM   2905  C  CG    . LYS D  4 105 ? -21.124 3.602   41.831 1.00 44.27  ? 105  LYS D CG    1 
ATOM   2906  C  CD    . LYS D  4 105 ? -21.639 4.643   42.865 1.00 44.93  ? 105  LYS D CD    1 
ATOM   2907  C  CE    . LYS D  4 105 ? -22.569 4.013   43.948 1.00 48.52  ? 105  LYS D CE    1 
ATOM   2908  N  NZ    . LYS D  4 105 ? -23.544 2.999   43.388 1.00 49.88  ? 105  LYS D NZ    1 
ATOM   2909  N  N     . HIS D  4 106 ? -16.848 3.447   40.056 1.00 40.93  ? 106  HIS D N     1 
ATOM   2910  C  CA    . HIS D  4 106 ? -15.640 3.999   39.457 1.00 40.47  ? 106  HIS D CA    1 
ATOM   2911  C  C     . HIS D  4 106 ? -15.253 3.277   38.178 1.00 39.50  ? 106  HIS D C     1 
ATOM   2912  O  O     . HIS D  4 106 ? -14.853 3.923   37.209 1.00 39.44  ? 106  HIS D O     1 
ATOM   2913  C  CB    . HIS D  4 106 ? -14.458 3.996   40.423 1.00 41.08  ? 106  HIS D CB    1 
ATOM   2914  C  CG    . HIS D  4 106 ? -14.647 4.854   41.638 1.00 43.13  ? 106  HIS D CG    1 
ATOM   2915  N  ND1   . HIS D  4 106 ? -15.159 6.134   41.582 1.00 44.78  ? 106  HIS D ND1   1 
ATOM   2916  C  CD2   . HIS D  4 106 ? -14.353 4.624   42.941 1.00 44.59  ? 106  HIS D CD2   1 
ATOM   2917  C  CE1   . HIS D  4 106 ? -15.192 6.648   42.799 1.00 45.49  ? 106  HIS D CE1   1 
ATOM   2918  N  NE2   . HIS D  4 106 ? -14.707 5.753   43.642 1.00 45.69  ? 106  HIS D NE2   1 
ATOM   2919  N  N     . ALA D  4 107 ? -15.364 1.948   38.171 1.00 38.18  ? 107  ALA D N     1 
ATOM   2920  C  CA    . ALA D  4 107 ? -15.037 1.167   36.970 1.00 37.22  ? 107  ALA D CA    1 
ATOM   2921  C  C     . ALA D  4 107 ? -15.911 1.592   35.789 1.00 36.54  ? 107  ALA D C     1 
ATOM   2922  O  O     . ALA D  4 107 ? -15.396 1.954   34.737 1.00 36.39  ? 107  ALA D O     1 
ATOM   2923  C  CB    . ALA D  4 107 ? -15.139 -0.333  37.230 1.00 36.87  ? 107  ALA D CB    1 
ATOM   2924  N  N     . VAL D  4 108 ? -17.226 1.581   35.984 1.00 35.96  ? 108  VAL D N     1 
ATOM   2925  C  CA    . VAL D  4 108 ? -18.166 2.112   34.998 1.00 35.91  ? 108  VAL D CA    1 
ATOM   2926  C  C     . VAL D  4 108 ? -17.717 3.470   34.469 1.00 36.03  ? 108  VAL D C     1 
ATOM   2927  O  O     . VAL D  4 108 ? -17.784 3.750   33.268 1.00 36.11  ? 108  VAL D O     1 
ATOM   2928  C  CB    . VAL D  4 108 ? -19.581 2.265   35.581 1.00 35.68  ? 108  VAL D CB    1 
ATOM   2929  C  CG1   . VAL D  4 108 ? -20.475 2.986   34.606 1.00 35.34  ? 108  VAL D CG1   1 
ATOM   2930  C  CG2   . VAL D  4 108 ? -20.163 0.912   35.898 1.00 35.38  ? 108  VAL D CG2   1 
ATOM   2931  N  N     . SER D  4 109 ? -17.243 4.305   35.378 1.00 36.12  ? 109  SER D N     1 
ATOM   2932  C  CA    . SER D  4 109 ? -16.853 5.653   35.033 1.00 36.26  ? 109  SER D CA    1 
ATOM   2933  C  C     . SER D  4 109 ? -15.598 5.702   34.164 1.00 36.04  ? 109  SER D C     1 
ATOM   2934  O  O     . SER D  4 109 ? -15.559 6.402   33.174 1.00 35.92  ? 109  SER D O     1 
ATOM   2935  C  CB    . SER D  4 109 ? -16.671 6.467   36.297 1.00 36.22  ? 109  SER D CB    1 
ATOM   2936  O  OG    . SER D  4 109 ? -16.547 7.822   35.963 1.00 37.84  ? 109  SER D OG    1 
ATOM   2937  N  N     . GLU D  4 110 ? -14.575 4.945   34.522 1.00 36.40  ? 110  GLU D N     1 
ATOM   2938  C  CA    . GLU D  4 110 ? -13.372 4.906   33.708 1.00 36.76  ? 110  GLU D CA    1 
ATOM   2939  C  C     . GLU D  4 110 ? -13.661 4.241   32.351 1.00 36.40  ? 110  GLU D C     1 
ATOM   2940  O  O     . GLU D  4 110 ? -12.990 4.510   31.353 1.00 36.45  ? 110  GLU D O     1 
ATOM   2941  C  CB    . GLU D  4 110 ? -12.229 4.226   34.472 1.00 36.86  ? 110  GLU D CB    1 
ATOM   2942  C  CG    . GLU D  4 110 ? -11.795 5.018   35.721 1.00 40.04  ? 110  GLU D CG    1 
ATOM   2943  C  CD    . GLU D  4 110 ? -10.355 5.557   35.663 1.00 44.62  ? 110  GLU D CD    1 
ATOM   2944  O  OE1   . GLU D  4 110 ? -10.152 6.739   35.279 1.00 45.75  ? 110  GLU D OE1   1 
ATOM   2945  O  OE2   . GLU D  4 110 ? -9.417  4.796   36.017 1.00 46.80  ? 110  GLU D OE2   1 
ATOM   2946  N  N     . GLY D  4 111 ? -14.682 3.400   32.309 1.00 36.00  ? 111  GLY D N     1 
ATOM   2947  C  CA    . GLY D  4 111 ? -15.014 2.705   31.083 1.00 35.89  ? 111  GLY D CA    1 
ATOM   2948  C  C     . GLY D  4 111 ? -15.661 3.647   30.099 1.00 35.86  ? 111  GLY D C     1 
ATOM   2949  O  O     . GLY D  4 111 ? -15.226 3.761   28.965 1.00 35.23  ? 111  GLY D O     1 
ATOM   2950  N  N     . THR D  4 112 ? -16.711 4.323   30.552 1.00 36.34  ? 112  THR D N     1 
ATOM   2951  C  CA    . THR D  4 112 ? -17.441 5.274   29.731 1.00 36.82  ? 112  THR D CA    1 
ATOM   2952  C  C     . THR D  4 112 ? -16.495 6.347   29.210 1.00 36.95  ? 112  THR D C     1 
ATOM   2953  O  O     . THR D  4 112 ? -16.488 6.644   28.028 1.00 36.91  ? 112  THR D O     1 
ATOM   2954  C  CB    . THR D  4 112 ? -18.559 5.949   30.535 1.00 36.86  ? 112  THR D CB    1 
ATOM   2955  O  OG1   . THR D  4 112 ? -19.360 4.945   31.170 1.00 38.25  ? 112  THR D OG1   1 
ATOM   2956  C  CG2   . THR D  4 112 ? -19.445 6.813   29.628 1.00 37.15  ? 112  THR D CG2   1 
ATOM   2957  N  N     . LYS D  4 113 ? -15.694 6.912   30.106 1.00 37.30  ? 113  LYS D N     1 
ATOM   2958  C  CA    . LYS D  4 113 ? -14.744 7.944   29.744 1.00 37.99  ? 113  LYS D CA    1 
ATOM   2959  C  C     . LYS D  4 113 ? -13.876 7.449   28.599 1.00 37.79  ? 113  LYS D C     1 
ATOM   2960  O  O     . LYS D  4 113 ? -13.790 8.095   27.564 1.00 38.19  ? 113  LYS D O     1 
ATOM   2961  C  CB    . LYS D  4 113 ? -13.885 8.367   30.949 1.00 37.72  ? 113  LYS D CB    1 
ATOM   2962  C  CG    . LYS D  4 113 ? -12.902 9.495   30.653 1.00 38.10  ? 113  LYS D CG    1 
ATOM   2963  C  CD    . LYS D  4 113 ? -11.804 9.651   31.716 1.00 39.56  ? 113  LYS D CD    1 
ATOM   2964  C  CE    . LYS D  4 113 ? -12.344 10.119  33.087 1.00 43.43  ? 113  LYS D CE    1 
ATOM   2965  N  NZ    . LYS D  4 113 ? -13.238 11.328  33.007 1.00 44.57  ? 113  LYS D NZ    1 
ATOM   2966  N  N     . ALA D  4 114 ? -13.262 6.288   28.779 1.00 37.87  ? 114  ALA D N     1 
ATOM   2967  C  CA    . ALA D  4 114 ? -12.348 5.753   27.789 1.00 37.74  ? 114  ALA D CA    1 
ATOM   2968  C  C     . ALA D  4 114 ? -13.039 5.566   26.436 1.00 37.78  ? 114  ALA D C     1 
ATOM   2969  O  O     . ALA D  4 114 ? -12.485 5.941   25.395 1.00 38.13  ? 114  ALA D O     1 
ATOM   2970  C  CB    . ALA D  4 114 ? -11.735 4.450   28.273 1.00 37.27  ? 114  ALA D CB    1 
ATOM   2971  N  N     . VAL D  4 115 ? -14.241 4.997   26.454 1.00 37.39  ? 115  VAL D N     1 
ATOM   2972  C  CA    . VAL D  4 115 ? -14.961 4.728   25.222 1.00 37.23  ? 115  VAL D CA    1 
ATOM   2973  C  C     . VAL D  4 115 ? -15.265 6.039   24.525 1.00 37.33  ? 115  VAL D C     1 
ATOM   2974  O  O     . VAL D  4 115 ? -14.921 6.211   23.358 1.00 37.27  ? 115  VAL D O     1 
ATOM   2975  C  CB    . VAL D  4 115 ? -16.227 3.878   25.462 1.00 37.17  ? 115  VAL D CB    1 
ATOM   2976  C  CG1   . VAL D  4 115 ? -17.130 3.856   24.242 1.00 36.22  ? 115  VAL D CG1   1 
ATOM   2977  C  CG2   . VAL D  4 115 ? -15.822 2.460   25.832 1.00 37.34  ? 115  VAL D CG2   1 
ATOM   2978  N  N     . THR D  4 116 ? -15.862 6.969   25.260 1.00 37.77  ? 116  THR D N     1 
ATOM   2979  C  CA    . THR D  4 116 ? -16.093 8.321   24.770 1.00 38.58  ? 116  THR D CA    1 
ATOM   2980  C  C     . THR D  4 116 ? -14.842 8.909   24.113 1.00 39.59  ? 116  THR D C     1 
ATOM   2981  O  O     . THR D  4 116 ? -14.890 9.308   22.958 1.00 39.94  ? 116  THR D O     1 
ATOM   2982  C  CB    . THR D  4 116 ? -16.619 9.250   25.878 1.00 38.40  ? 116  THR D CB    1 
ATOM   2983  O  OG1   . THR D  4 116 ? -17.808 8.686   26.460 1.00 38.24  ? 116  THR D OG1   1 
ATOM   2984  C  CG2   . THR D  4 116 ? -16.949 10.621  25.312 1.00 38.39  ? 116  THR D CG2   1 
ATOM   2985  N  N     . LYS D  4 117 ? -13.721 8.929   24.826 1.00 40.81  ? 117  LYS D N     1 
ATOM   2986  C  CA    . LYS D  4 117 ? -12.480 9.471   24.282 1.00 41.79  ? 117  LYS D CA    1 
ATOM   2987  C  C     . LYS D  4 117 ? -12.113 8.797   22.965 1.00 42.73  ? 117  LYS D C     1 
ATOM   2988  O  O     . LYS D  4 117 ? -11.659 9.450   22.025 1.00 43.01  ? 117  LYS D O     1 
ATOM   2989  C  CB    . LYS D  4 117 ? -11.330 9.338   25.289 1.00 41.27  ? 117  LYS D CB    1 
ATOM   2990  C  CG    . LYS D  4 117 ? -10.114 10.180  24.921 1.00 41.88  ? 117  LYS D CG    1 
ATOM   2991  C  CD    . LYS D  4 117 ? -8.922  9.980   25.854 1.00 42.32  ? 117  LYS D CD    1 
ATOM   2992  C  CE    . LYS D  4 117 ? -7.572  10.318  25.159 1.00 42.83  ? 117  LYS D CE    1 
ATOM   2993  N  NZ    . LYS D  4 117 ? -7.124  11.749  25.276 1.00 40.59  ? 117  LYS D NZ    1 
ATOM   2994  N  N     . TYR D  4 118 ? -12.331 7.490   22.899 1.00 44.14  ? 118  TYR D N     1 
ATOM   2995  C  CA    . TYR D  4 118 ? -11.888 6.680   21.769 1.00 45.50  ? 118  TYR D CA    1 
ATOM   2996  C  C     . TYR D  4 118 ? -12.687 6.970   20.494 1.00 46.99  ? 118  TYR D C     1 
ATOM   2997  O  O     . TYR D  4 118 ? -12.119 7.034   19.397 1.00 47.04  ? 118  TYR D O     1 
ATOM   2998  C  CB    . TYR D  4 118 ? -11.964 5.205   22.151 1.00 45.05  ? 118  TYR D CB    1 
ATOM   2999  C  CG    . TYR D  4 118 ? -11.646 4.219   21.055 1.00 44.63  ? 118  TYR D CG    1 
ATOM   3000  C  CD1   . TYR D  4 118 ? -10.335 3.766   20.845 1.00 44.01  ? 118  TYR D CD1   1 
ATOM   3001  C  CD2   . TYR D  4 118 ? -12.666 3.699   20.254 1.00 44.35  ? 118  TYR D CD2   1 
ATOM   3002  C  CE1   . TYR D  4 118 ? -10.048 2.833   19.840 1.00 44.07  ? 118  TYR D CE1   1 
ATOM   3003  C  CE2   . TYR D  4 118 ? -12.395 2.776   19.255 1.00 44.04  ? 118  TYR D CE2   1 
ATOM   3004  C  CZ    . TYR D  4 118 ? -11.094 2.350   19.052 1.00 44.66  ? 118  TYR D CZ    1 
ATOM   3005  O  OH    . TYR D  4 118 ? -10.860 1.442   18.056 1.00 45.64  ? 118  TYR D OH    1 
ATOM   3006  N  N     . THR D  4 119 ? -13.999 7.144   20.652 1.00 48.71  ? 119  THR D N     1 
ATOM   3007  C  CA    . THR D  4 119 ? -14.895 7.400   19.534 1.00 50.36  ? 119  THR D CA    1 
ATOM   3008  C  C     . THR D  4 119 ? -14.782 8.835   19.039 1.00 51.53  ? 119  THR D C     1 
ATOM   3009  O  O     . THR D  4 119 ? -15.138 9.123   17.902 1.00 52.24  ? 119  THR D O     1 
ATOM   3010  C  CB    . THR D  4 119 ? -16.359 7.140   19.909 1.00 50.41  ? 119  THR D CB    1 
ATOM   3011  O  OG1   . THR D  4 119 ? -16.798 8.131   20.852 1.00 50.98  ? 119  THR D OG1   1 
ATOM   3012  C  CG2   . THR D  4 119 ? -16.527 5.750   20.504 1.00 50.42  ? 119  THR D CG2   1 
ATOM   3013  N  N     . SER D  4 120 ? -14.298 9.733   19.891 1.00 52.97  ? 120  SER D N     1 
ATOM   3014  C  CA    . SER D  4 120 ? -14.126 11.141  19.525 1.00 54.23  ? 120  SER D CA    1 
ATOM   3015  C  C     . SER D  4 120 ? -12.883 11.348  18.656 1.00 55.50  ? 120  SER D C     1 
ATOM   3016  O  O     . SER D  4 120 ? -12.725 12.400  18.025 1.00 55.60  ? 120  SER D O     1 
ATOM   3017  C  CB    . SER D  4 120 ? -14.024 12.010  20.773 1.00 53.85  ? 120  SER D CB    1 
ATOM   3018  O  OG    . SER D  4 120 ? -12.745 11.859  21.358 1.00 53.51  ? 120  SER D OG    1 
ATOM   3019  N  N     . ALA D  4 121 ? -12.001 10.353  18.635 1.00 56.94  ? 121  ALA D N     1 
ATOM   3020  C  CA    . ALA D  4 121 ? -10.807 10.415  17.795 1.00 58.66  ? 121  ALA D CA    1 
ATOM   3021  C  C     . ALA D  4 121 ? -11.093 10.060  16.326 1.00 59.86  ? 121  ALA D C     1 
ATOM   3022  O  O     . ALA D  4 121 ? -11.867 9.141   16.050 1.00 60.19  ? 121  ALA D O     1 
ATOM   3023  C  CB    . ALA D  4 121 ? -9.727  9.523   18.356 1.00 58.53  ? 121  ALA D CB    1 
ATOM   3024  N  N     . LYS D  4 122 ? -10.470 10.810  15.407 1.00 61.26  ? 122  LYS D N     1 
ATOM   3025  C  CA    . LYS D  4 122 ? -10.484 10.573  13.934 1.00 62.60  ? 122  LYS D CA    1 
ATOM   3026  C  C     . LYS D  4 122 ? -11.397 11.539  13.146 1.00 63.09  ? 122  LYS D C     1 
ATOM   3027  O  O     . LYS D  4 122 ? -12.093 12.381  13.731 1.00 63.73  ? 122  LYS D O     1 
ATOM   3028  C  CB    . LYS D  4 122 ? -10.726 9.091   13.551 1.00 62.68  ? 122  LYS D CB    1 
ATOM   3029  C  CG    . LYS D  4 122 ? -9.513  8.165   13.789 1.00 62.89  ? 122  LYS D CG    1 
ATOM   3030  C  CD    . LYS D  4 122 ? -9.787  6.742   13.278 1.00 63.07  ? 122  LYS D CD    1 
ATOM   3031  C  CE    . LYS D  4 122 ? -8.510  5.886   13.210 1.00 63.11  ? 122  LYS D CE    1 
ATOM   3032  N  NZ    . LYS D  4 122 ? -8.790  4.487   12.764 1.00 61.93  ? 122  LYS D NZ    1 
ATOM   3033  O  OXT   . LYS D  4 122 ? -11.443 11.520  11.905 1.00 63.25  ? 122  LYS D OXT   1 
ATOM   3034  N  N     . LYS E  1 37  ? 12.121  -22.518 91.548 1.00 59.75  ? 37   LYS E N     1 
ATOM   3035  C  CA    . LYS E  1 37  ? 12.736  -21.289 90.952 1.00 59.55  ? 37   LYS E CA    1 
ATOM   3036  C  C     . LYS E  1 37  ? 12.727  -21.236 89.410 1.00 58.75  ? 37   LYS E C     1 
ATOM   3037  O  O     . LYS E  1 37  ? 12.266  -20.228 88.848 1.00 58.99  ? 37   LYS E O     1 
ATOM   3038  C  CB    . LYS E  1 37  ? 14.153  -21.016 91.518 1.00 59.89  ? 37   LYS E CB    1 
ATOM   3039  C  CG    . LYS E  1 37  ? 14.175  -20.121 92.765 1.00 61.28  ? 37   LYS E CG    1 
ATOM   3040  C  CD    . LYS E  1 37  ? 13.355  -18.842 92.539 1.00 63.90  ? 37   LYS E CD    1 
ATOM   3041  C  CE    . LYS E  1 37  ? 12.549  -18.468 93.796 1.00 66.13  ? 37   LYS E CE    1 
ATOM   3042  N  NZ    . LYS E  1 37  ? 11.131  -18.033 93.494 1.00 66.42  ? 37   LYS E NZ    1 
ATOM   3043  N  N     . PRO E  1 38  ? 13.222  -22.305 88.722 1.00 57.55  ? 38   PRO E N     1 
ATOM   3044  C  CA    . PRO E  1 38  ? 13.350  -22.240 87.244 1.00 56.26  ? 38   PRO E CA    1 
ATOM   3045  C  C     . PRO E  1 38  ? 12.116  -21.628 86.558 1.00 54.76  ? 38   PRO E C     1 
ATOM   3046  O  O     . PRO E  1 38  ? 10.985  -22.005 86.854 1.00 54.71  ? 38   PRO E O     1 
ATOM   3047  C  CB    . PRO E  1 38  ? 13.533  -23.709 86.817 1.00 56.40  ? 38   PRO E CB    1 
ATOM   3048  C  CG    . PRO E  1 38  ? 13.536  -24.543 88.091 1.00 57.19  ? 38   PRO E CG    1 
ATOM   3049  C  CD    . PRO E  1 38  ? 13.680  -23.601 89.266 1.00 57.39  ? 38   PRO E CD    1 
ATOM   3050  N  N     . HIS E  1 39  ? 12.344  -20.684 85.658 1.00 53.17  ? 39   HIS E N     1 
ATOM   3051  C  CA    . HIS E  1 39  ? 11.258  -19.927 85.018 1.00 51.78  ? 39   HIS E CA    1 
ATOM   3052  C  C     . HIS E  1 39  ? 10.292  -20.759 84.152 1.00 49.83  ? 39   HIS E C     1 
ATOM   3053  O  O     . HIS E  1 39  ? 10.709  -21.678 83.428 1.00 49.54  ? 39   HIS E O     1 
ATOM   3054  C  CB    . HIS E  1 39  ? 11.850  -18.796 84.183 1.00 52.54  ? 39   HIS E CB    1 
ATOM   3055  C  CG    . HIS E  1 39  ? 10.849  -17.774 83.748 1.00 54.94  ? 39   HIS E CG    1 
ATOM   3056  N  ND1   . HIS E  1 39  ? 10.122  -17.896 82.581 1.00 56.77  ? 39   HIS E ND1   1 
ATOM   3057  C  CD2   . HIS E  1 39  ? 10.467  -16.603 84.313 1.00 57.07  ? 39   HIS E CD2   1 
ATOM   3058  C  CE1   . HIS E  1 39  ? 9.331   -16.844 82.450 1.00 58.12  ? 39   HIS E CE1   1 
ATOM   3059  N  NE2   . HIS E  1 39  ? 9.521   -16.044 83.486 1.00 58.38  ? 39   HIS E NE2   1 
ATOM   3060  N  N     . ARG E  1 40  ? 9.003   -20.414 84.248 1.00 47.23  ? 40   ARG E N     1 
ATOM   3061  C  CA    . ARG E  1 40  ? 7.922   -21.025 83.461 1.00 44.53  ? 40   ARG E CA    1 
ATOM   3062  C  C     . ARG E  1 40  ? 6.917   -19.965 83.040 1.00 42.96  ? 40   ARG E C     1 
ATOM   3063  O  O     . ARG E  1 40  ? 6.516   -19.137 83.854 1.00 43.08  ? 40   ARG E O     1 
ATOM   3064  C  CB    . ARG E  1 40  ? 7.175   -22.081 84.274 1.00 43.99  ? 40   ARG E CB    1 
ATOM   3065  C  CG    . ARG E  1 40  ? 7.848   -23.422 84.315 1.00 43.75  ? 40   ARG E CG    1 
ATOM   3066  C  CD    . ARG E  1 40  ? 6.899   -24.506 84.773 1.00 42.31  ? 40   ARG E CD    1 
ATOM   3067  N  NE    . ARG E  1 40  ? 6.150   -25.079 83.663 1.00 42.96  ? 40   ARG E NE    1 
ATOM   3068  C  CZ    . ARG E  1 40  ? 6.577   -26.079 82.889 1.00 42.77  ? 40   ARG E CZ    1 
ATOM   3069  N  NH1   . ARG E  1 40  ? 7.769   -26.642 83.085 1.00 41.81  ? 40   ARG E NH1   1 
ATOM   3070  N  NH2   . ARG E  1 40  ? 5.801   -26.515 81.908 1.00 41.91  ? 40   ARG E NH2   1 
ATOM   3071  N  N     . TYR E  1 41  ? 6.501   -19.980 81.777 1.00 40.72  ? 41   TYR E N     1 
ATOM   3072  C  CA    . TYR E  1 41  ? 5.346   -19.178 81.391 1.00 38.33  ? 41   TYR E CA    1 
ATOM   3073  C  C     . TYR E  1 41  ? 4.091   -19.966 81.702 1.00 37.62  ? 41   TYR E C     1 
ATOM   3074  O  O     . TYR E  1 41  ? 4.104   -21.188 81.667 1.00 37.42  ? 41   TYR E O     1 
ATOM   3075  C  CB    . TYR E  1 41  ? 5.418   -18.781 79.925 1.00 37.30  ? 41   TYR E CB    1 
ATOM   3076  C  CG    . TYR E  1 41  ? 6.493   -17.758 79.637 1.00 35.14  ? 41   TYR E CG    1 
ATOM   3077  C  CD1   . TYR E  1 41  ? 7.684   -18.136 79.040 1.00 33.71  ? 41   TYR E CD1   1 
ATOM   3078  C  CD2   . TYR E  1 41  ? 6.319   -16.418 79.974 1.00 33.40  ? 41   TYR E CD2   1 
ATOM   3079  C  CE1   . TYR E  1 41  ? 8.672   -17.220 78.773 1.00 33.16  ? 41   TYR E CE1   1 
ATOM   3080  C  CE2   . TYR E  1 41  ? 7.305   -15.490 79.721 1.00 33.24  ? 41   TYR E CE2   1 
ATOM   3081  C  CZ    . TYR E  1 41  ? 8.482   -15.904 79.119 1.00 34.35  ? 41   TYR E CZ    1 
ATOM   3082  O  OH    . TYR E  1 41  ? 9.471   -15.002 78.843 1.00 35.17  ? 41   TYR E OH    1 
ATOM   3083  N  N     . ARG E  1 42  ? 3.016   -19.274 82.040 1.00 37.10  ? 42   ARG E N     1 
ATOM   3084  C  CA    . ARG E  1 42  ? 1.760   -19.944 82.347 1.00 36.96  ? 42   ARG E CA    1 
ATOM   3085  C  C     . ARG E  1 42  ? 1.135   -20.524 81.075 1.00 36.07  ? 42   ARG E C     1 
ATOM   3086  O  O     . ARG E  1 42  ? 1.355   -20.004 79.978 1.00 36.18  ? 42   ARG E O     1 
ATOM   3087  C  CB    . ARG E  1 42  ? 0.800   -18.959 82.991 1.00 37.53  ? 42   ARG E CB    1 
ATOM   3088  C  CG    . ARG E  1 42  ? 1.369   -18.242 84.199 1.00 40.80  ? 42   ARG E CG    1 
ATOM   3089  C  CD    . ARG E  1 42  ? 0.435   -17.134 84.657 1.00 46.65  ? 42   ARG E CD    1 
ATOM   3090  N  NE    . ARG E  1 42  ? -0.905  -17.649 84.967 1.00 50.43  ? 42   ARG E NE    1 
ATOM   3091  C  CZ    . ARG E  1 42  ? -1.966  -16.891 85.243 1.00 51.67  ? 42   ARG E CZ    1 
ATOM   3092  N  NH1   . ARG E  1 42  ? -1.873  -15.562 85.254 1.00 52.04  ? 42   ARG E NH1   1 
ATOM   3093  N  NH2   . ARG E  1 42  ? -3.127  -17.469 85.510 1.00 52.43  ? 42   ARG E NH2   1 
ATOM   3094  N  N     . PRO E  1 43  ? 0.356   -21.603 81.207 1.00 35.22  ? 43   PRO E N     1 
ATOM   3095  C  CA    . PRO E  1 43  ? -0.279  -22.192 80.039 1.00 34.65  ? 43   PRO E CA    1 
ATOM   3096  C  C     . PRO E  1 43  ? -1.153  -21.195 79.291 1.00 34.33  ? 43   PRO E C     1 
ATOM   3097  O  O     . PRO E  1 43  ? -2.068  -20.591 79.875 1.00 34.40  ? 43   PRO E O     1 
ATOM   3098  C  CB    . PRO E  1 43  ? -1.149  -23.295 80.641 1.00 34.56  ? 43   PRO E CB    1 
ATOM   3099  C  CG    . PRO E  1 43  ? -0.483  -23.660 81.877 1.00 34.70  ? 43   PRO E CG    1 
ATOM   3100  C  CD    . PRO E  1 43  ? 0.026   -22.356 82.426 1.00 35.43  ? 43   PRO E CD    1 
ATOM   3101  N  N     . GLY E  1 44  ? -0.861  -21.031 78.004 1.00 33.71  ? 44   GLY E N     1 
ATOM   3102  C  CA    . GLY E  1 44  ? -1.650  -20.172 77.139 1.00 32.83  ? 44   GLY E CA    1 
ATOM   3103  C  C     . GLY E  1 44  ? -0.826  -19.014 76.642 1.00 32.48  ? 44   GLY E C     1 
ATOM   3104  O  O     . GLY E  1 44  ? -1.186  -18.356 75.671 1.00 33.25  ? 44   GLY E O     1 
ATOM   3105  N  N     . THR E  1 45  ? 0.285   -18.757 77.313 1.00 31.88  ? 45   THR E N     1 
ATOM   3106  C  CA    . THR E  1 45  ? 1.085   -17.576 77.040 1.00 30.97  ? 45   THR E CA    1 
ATOM   3107  C  C     . THR E  1 45  ? 1.977   -17.819 75.848 1.00 30.80  ? 45   THR E C     1 
ATOM   3108  O  O     . THR E  1 45  ? 2.161   -16.942 75.022 1.00 30.99  ? 45   THR E O     1 
ATOM   3109  C  CB    . THR E  1 45  ? 1.918   -17.184 78.283 1.00 31.01  ? 45   THR E CB    1 
ATOM   3110  O  OG1   . THR E  1 45  ? 1.023   -16.822 79.341 1.00 31.39  ? 45   THR E OG1   1 
ATOM   3111  C  CG2   . THR E  1 45  ? 2.853   -16.021 77.998 1.00 28.69  ? 45   THR E CG2   1 
ATOM   3112  N  N     . VAL E  1 46  ? 2.543   -19.008 75.760 1.00 30.70  ? 46   VAL E N     1 
ATOM   3113  C  CA    . VAL E  1 46  ? 3.353   -19.328 74.610 1.00 30.96  ? 46   VAL E CA    1 
ATOM   3114  C  C     . VAL E  1 46  ? 2.411   -19.535 73.419 1.00 31.06  ? 46   VAL E C     1 
ATOM   3115  O  O     . VAL E  1 46  ? 2.753   -19.176 72.275 1.00 31.52  ? 46   VAL E O     1 
ATOM   3116  C  CB    . VAL E  1 46  ? 4.244   -20.563 74.867 1.00 31.05  ? 46   VAL E CB    1 
ATOM   3117  C  CG1   . VAL E  1 46  ? 5.180   -20.822 73.684 1.00 31.06  ? 46   VAL E CG1   1 
ATOM   3118  C  CG2   . VAL E  1 46  ? 5.061   -20.348 76.126 1.00 31.35  ? 46   VAL E CG2   1 
ATOM   3119  N  N     . ALA E  1 47  ? 1.222   -20.085 73.694 1.00 30.33  ? 47   ALA E N     1 
ATOM   3120  C  CA    . ALA E  1 47  ? 0.214   -20.279 72.665 1.00 29.86  ? 47   ALA E CA    1 
ATOM   3121  C  C     . ALA E  1 47  ? -0.119  -18.958 71.959 1.00 29.85  ? 47   ALA E C     1 
ATOM   3122  O  O     . ALA E  1 47  ? -0.111  -18.903 70.726 1.00 30.09  ? 47   ALA E O     1 
ATOM   3123  C  CB    . ALA E  1 47  ? -1.012  -20.908 73.239 1.00 29.72  ? 47   ALA E CB    1 
ATOM   3124  N  N     . LEU E  1 48  ? -0.369  -17.896 72.736 1.00 29.50  ? 48   LEU E N     1 
ATOM   3125  C  CA    . LEU E  1 48  ? -0.638  -16.557 72.190 1.00 29.01  ? 48   LEU E CA    1 
ATOM   3126  C  C     . LEU E  1 48  ? 0.588   -15.971 71.549 1.00 28.56  ? 48   LEU E C     1 
ATOM   3127  O  O     . LEU E  1 48  ? 0.491   -15.188 70.615 1.00 28.70  ? 48   LEU E O     1 
ATOM   3128  C  CB    . LEU E  1 48  ? -1.108  -15.598 73.266 1.00 28.80  ? 48   LEU E CB    1 
ATOM   3129  C  CG    . LEU E  1 48  ? -2.531  -15.758 73.762 1.00 30.57  ? 48   LEU E CG    1 
ATOM   3130  C  CD1   . LEU E  1 48  ? -2.682  -15.011 75.071 1.00 31.79  ? 48   LEU E CD1   1 
ATOM   3131  C  CD2   . LEU E  1 48  ? -3.542  -15.240 72.734 1.00 31.76  ? 48   LEU E CD2   1 
ATOM   3132  N  N     . ARG E  1 49  ? 1.752   -16.335 72.054 1.00 28.07  ? 49   ARG E N     1 
ATOM   3133  C  CA    . ARG E  1 49  ? 2.956   -15.823 71.476 1.00 28.30  ? 49   ARG E CA    1 
ATOM   3134  C  C     . ARG E  1 49  ? 3.070   -16.394 70.059 1.00 28.50  ? 49   ARG E C     1 
ATOM   3135  O  O     . ARG E  1 49  ? 3.492   -15.699 69.131 1.00 28.45  ? 49   ARG E O     1 
ATOM   3136  C  CB    . ARG E  1 49  ? 4.151   -16.210 72.330 1.00 28.38  ? 49   ARG E CB    1 
ATOM   3137  C  CG    . ARG E  1 49  ? 5.441   -15.544 71.880 1.00 30.42  ? 49   ARG E CG    1 
ATOM   3138  C  CD    . ARG E  1 49  ? 6.676   -16.073 72.599 1.00 31.27  ? 49   ARG E CD    1 
ATOM   3139  N  NE    . ARG E  1 49  ? 6.554   -15.850 74.031 1.00 31.59  ? 49   ARG E NE    1 
ATOM   3140  C  CZ    . ARG E  1 49  ? 7.161   -16.583 74.953 1.00 32.25  ? 49   ARG E CZ    1 
ATOM   3141  N  NH1   . ARG E  1 49  ? 7.958   -17.592 74.599 1.00 31.64  ? 49   ARG E NH1   1 
ATOM   3142  N  NH2   . ARG E  1 49  ? 6.955   -16.302 76.234 1.00 32.56  ? 49   ARG E NH2   1 
ATOM   3143  N  N     . GLU E  1 50  ? 2.656   -17.651 69.896 1.00 28.46  ? 50   GLU E N     1 
ATOM   3144  C  CA    . GLU E  1 50  ? 2.805   -18.340 68.621 1.00 28.54  ? 50   GLU E CA    1 
ATOM   3145  C  C     . GLU E  1 50  ? 1.765   -17.892 67.592 1.00 27.96  ? 50   GLU E C     1 
ATOM   3146  O  O     . GLU E  1 50  ? 2.057   -17.830 66.390 1.00 27.83  ? 50   GLU E O     1 
ATOM   3147  C  CB    . GLU E  1 50  ? 2.800   -19.859 68.812 1.00 29.02  ? 50   GLU E CB    1 
ATOM   3148  C  CG    . GLU E  1 50  ? 4.093   -20.418 69.377 1.00 30.52  ? 50   GLU E CG    1 
ATOM   3149  C  CD    . GLU E  1 50  ? 3.933   -21.820 69.957 1.00 36.06  ? 50   GLU E CD    1 
ATOM   3150  O  OE1   . GLU E  1 50  ? 4.976   -22.489 70.191 1.00 38.45  ? 50   GLU E OE1   1 
ATOM   3151  O  OE2   . GLU E  1 50  ? 2.776   -22.261 70.202 1.00 37.57  ? 50   GLU E OE2   1 
ATOM   3152  N  N     . ILE E  1 51  ? 0.563   -17.570 68.065 1.00 27.19  ? 51   ILE E N     1 
ATOM   3153  C  CA    . ILE E  1 51  ? -0.443  -16.986 67.194 1.00 26.39  ? 51   ILE E CA    1 
ATOM   3154  C  C     . ILE E  1 51  ? 0.093   -15.690 66.581 1.00 26.89  ? 51   ILE E C     1 
ATOM   3155  O  O     . ILE E  1 51  ? -0.025  -15.470 65.381 1.00 27.14  ? 51   ILE E O     1 
ATOM   3156  C  CB    . ILE E  1 51  ? -1.787  -16.756 67.900 1.00 26.20  ? 51   ILE E CB    1 
ATOM   3157  C  CG1   . ILE E  1 51  ? -2.384  -18.097 68.357 1.00 25.59  ? 51   ILE E CG1   1 
ATOM   3158  C  CG2   . ILE E  1 51  ? -2.758  -16.042 66.964 1.00 24.67  ? 51   ILE E CG2   1 
ATOM   3159  C  CD1   . ILE E  1 51  ? -3.654  -17.977 69.207 1.00 25.63  ? 51   ILE E CD1   1 
ATOM   3160  N  N     . ARG E  1 52  ? 0.723   -14.853 67.388 1.00 27.13  ? 52   ARG E N     1 
ATOM   3161  C  CA    . ARG E  1 52  ? 1.194   -13.578 66.888 1.00 27.58  ? 52   ARG E CA    1 
ATOM   3162  C  C     . ARG E  1 52  ? 2.296   -13.793 65.882 1.00 27.30  ? 52   ARG E C     1 
ATOM   3163  O  O     . ARG E  1 52  ? 2.421   -13.062 64.904 1.00 27.47  ? 52   ARG E O     1 
ATOM   3164  C  CB    . ARG E  1 52  ? 1.681   -12.692 68.034 1.00 27.94  ? 52   ARG E CB    1 
ATOM   3165  C  CG    . ARG E  1 52  ? 0.537   -12.135 68.866 1.00 30.25  ? 52   ARG E CG    1 
ATOM   3166  C  CD    . ARG E  1 52  ? 0.989   -11.155 69.930 1.00 32.09  ? 52   ARG E CD    1 
ATOM   3167  N  NE    . ARG E  1 52  ? -0.163  -10.780 70.744 1.00 34.78  ? 52   ARG E NE    1 
ATOM   3168  C  CZ    . ARG E  1 52  ? -0.444  -11.296 71.938 1.00 35.66  ? 52   ARG E CZ    1 
ATOM   3169  N  NH1   . ARG E  1 52  ? 0.362   -12.211 72.468 1.00 35.83  ? 52   ARG E NH1   1 
ATOM   3170  N  NH2   . ARG E  1 52  ? -1.529  -10.888 72.603 1.00 35.46  ? 52   ARG E NH2   1 
ATOM   3171  N  N     . ARG E  1 53  ? 3.099   -14.810 66.122 1.00 27.03  ? 53   ARG E N     1 
ATOM   3172  C  CA    . ARG E  1 53  ? 4.235   -15.033 65.282 1.00 27.04  ? 53   ARG E CA    1 
ATOM   3173  C  C     . ARG E  1 53  ? 3.745   -15.587 63.956 1.00 27.09  ? 53   ARG E C     1 
ATOM   3174  O  O     . ARG E  1 53  ? 4.075   -15.065 62.905 1.00 27.96  ? 53   ARG E O     1 
ATOM   3175  C  CB    . ARG E  1 53  ? 5.199   -15.991 65.957 1.00 26.94  ? 53   ARG E CB    1 
ATOM   3176  C  CG    . ARG E  1 53  ? 6.240   -16.519 65.031 1.00 28.25  ? 53   ARG E CG    1 
ATOM   3177  C  CD    . ARG E  1 53  ? 7.151   -17.483 65.728 1.00 31.13  ? 53   ARG E CD    1 
ATOM   3178  N  NE    . ARG E  1 53  ? 7.966   -18.142 64.721 1.00 34.25  ? 53   ARG E NE    1 
ATOM   3179  C  CZ    . ARG E  1 53  ? 8.633   -19.274 64.903 1.00 35.73  ? 53   ARG E CZ    1 
ATOM   3180  N  NH1   . ARG E  1 53  ? 8.592   -19.912 66.082 1.00 33.72  ? 53   ARG E NH1   1 
ATOM   3181  N  NH2   . ARG E  1 53  ? 9.340   -19.761 63.887 1.00 35.71  ? 53   ARG E NH2   1 
ATOM   3182  N  N     . TYR E  1 54  ? 2.924   -16.627 64.010 1.00 26.68  ? 54   TYR E N     1 
ATOM   3183  C  CA    . TYR E  1 54  ? 2.453   -17.269 62.792 1.00 25.93  ? 54   TYR E CA    1 
ATOM   3184  C  C     . TYR E  1 54  ? 1.507   -16.413 61.934 1.00 25.48  ? 54   TYR E C     1 
ATOM   3185  O  O     . TYR E  1 54  ? 1.438   -16.606 60.728 1.00 25.08  ? 54   TYR E O     1 
ATOM   3186  C  CB    . TYR E  1 54  ? 1.937   -18.687 63.098 1.00 25.28  ? 54   TYR E CB    1 
ATOM   3187  C  CG    . TYR E  1 54  ? 3.100   -19.560 63.464 1.00 24.69  ? 54   TYR E CG    1 
ATOM   3188  C  CD1   . TYR E  1 54  ? 3.137   -20.303 64.645 1.00 24.16  ? 54   TYR E CD1   1 
ATOM   3189  C  CD2   . TYR E  1 54  ? 4.216   -19.583 62.642 1.00 24.84  ? 54   TYR E CD2   1 
ATOM   3190  C  CE1   . TYR E  1 54  ? 4.258   -21.087 64.953 1.00 23.59  ? 54   TYR E CE1   1 
ATOM   3191  C  CE2   . TYR E  1 54  ? 5.328   -20.328 62.947 1.00 24.00  ? 54   TYR E CE2   1 
ATOM   3192  C  CZ    . TYR E  1 54  ? 5.356   -21.077 64.085 1.00 24.45  ? 54   TYR E CZ    1 
ATOM   3193  O  OH    . TYR E  1 54  ? 6.513   -21.802 64.292 1.00 25.06  ? 54   TYR E OH    1 
ATOM   3194  N  N     . GLN E  1 55  ? 0.822   -15.456 62.547 1.00 25.30  ? 55   GLN E N     1 
ATOM   3195  C  CA    . GLN E  1 55  ? -0.071  -14.573 61.798 1.00 25.94  ? 55   GLN E CA    1 
ATOM   3196  C  C     . GLN E  1 55  ? 0.698   -13.421 61.138 1.00 27.04  ? 55   GLN E C     1 
ATOM   3197  O  O     . GLN E  1 55  ? 0.160   -12.647 60.353 1.00 27.39  ? 55   GLN E O     1 
ATOM   3198  C  CB    . GLN E  1 55  ? -1.230  -14.071 62.677 1.00 25.53  ? 55   GLN E CB    1 
ATOM   3199  C  CG    . GLN E  1 55  ? -2.284  -15.135 62.949 1.00 24.14  ? 55   GLN E CG    1 
ATOM   3200  C  CD    . GLN E  1 55  ? -3.518  -14.627 63.669 1.00 25.00  ? 55   GLN E CD    1 
ATOM   3201  O  OE1   . GLN E  1 55  ? -3.554  -13.512 64.188 1.00 26.09  ? 55   GLN E OE1   1 
ATOM   3202  N  NE2   . GLN E  1 55  ? -4.543  -15.460 63.715 1.00 23.83  ? 55   GLN E NE2   1 
ATOM   3203  N  N     . LYS E  1 56  ? 1.976   -13.338 61.450 1.00 28.24  ? 56   LYS E N     1 
ATOM   3204  C  CA    . LYS E  1 56  ? 2.799   -12.253 61.003 1.00 29.34  ? 56   LYS E CA    1 
ATOM   3205  C  C     . LYS E  1 56  ? 3.655   -12.758 59.849 1.00 29.54  ? 56   LYS E C     1 
ATOM   3206  O  O     . LYS E  1 56  ? 4.111   -11.970 59.018 1.00 30.29  ? 56   LYS E O     1 
ATOM   3207  C  CB    . LYS E  1 56  ? 3.673   -11.791 62.158 1.00 29.80  ? 56   LYS E CB    1 
ATOM   3208  C  CG    . LYS E  1 56  ? 4.332   -10.456 61.960 1.00 33.12  ? 56   LYS E CG    1 
ATOM   3209  C  CD    . LYS E  1 56  ? 5.244   -10.142 63.155 1.00 38.50  ? 56   LYS E CD    1 
ATOM   3210  C  CE    . LYS E  1 56  ? 6.609   -9.570  62.678 1.00 41.43  ? 56   LYS E CE    1 
ATOM   3211  N  NZ    . LYS E  1 56  ? 7.667   -9.680  63.744 1.00 41.60  ? 56   LYS E NZ    1 
ATOM   3212  N  N     . SER E  1 57  ? 3.873   -14.064 59.776 1.00 28.96  ? 57   SER E N     1 
ATOM   3213  C  CA    . SER E  1 57  ? 4.706   -14.580 58.710 1.00 29.02  ? 57   SER E CA    1 
ATOM   3214  C  C     . SER E  1 57  ? 3.906   -15.263 57.617 1.00 29.18  ? 57   SER E C     1 
ATOM   3215  O  O     . SER E  1 57  ? 2.702   -15.547 57.768 1.00 29.66  ? 57   SER E O     1 
ATOM   3216  C  CB    . SER E  1 57  ? 5.772   -15.518 59.254 1.00 28.84  ? 57   SER E CB    1 
ATOM   3217  O  OG    . SER E  1 57  ? 5.182   -16.678 59.788 1.00 30.16  ? 57   SER E OG    1 
ATOM   3218  N  N     . THR E  1 58  ? 4.575   -15.555 56.509 1.00 29.00  ? 58   THR E N     1 
ATOM   3219  C  CA    . THR E  1 58  ? 3.868   -16.180 55.404 1.00 28.57  ? 58   THR E CA    1 
ATOM   3220  C  C     . THR E  1 58  ? 4.441   -17.510 54.942 1.00 28.13  ? 58   THR E C     1 
ATOM   3221  O  O     . THR E  1 58  ? 3.904   -18.097 54.019 1.00 28.89  ? 58   THR E O     1 
ATOM   3222  C  CB    . THR E  1 58  ? 3.755   -15.232 54.193 1.00 28.52  ? 58   THR E CB    1 
ATOM   3223  O  OG1   . THR E  1 58  ? 5.047   -15.023 53.640 1.00 27.74  ? 58   THR E OG1   1 
ATOM   3224  C  CG2   . THR E  1 58  ? 3.178   -13.889 54.612 1.00 29.01  ? 58   THR E CG2   1 
ATOM   3225  N  N     . GLU E  1 59  ? 5.509   -17.996 55.557 1.00 27.30  ? 59   GLU E N     1 
ATOM   3226  C  CA    . GLU E  1 59  ? 6.127   -19.213 55.062 1.00 27.18  ? 59   GLU E CA    1 
ATOM   3227  C  C     . GLU E  1 59  ? 5.162   -20.385 55.233 1.00 26.99  ? 59   GLU E C     1 
ATOM   3228  O  O     . GLU E  1 59  ? 4.242   -20.315 56.043 1.00 26.77  ? 59   GLU E O     1 
ATOM   3229  C  CB    . GLU E  1 59  ? 7.473   -19.460 55.740 1.00 27.20  ? 59   GLU E CB    1 
ATOM   3230  C  CG    . GLU E  1 59  ? 7.418   -20.168 57.074 1.00 29.49  ? 59   GLU E CG    1 
ATOM   3231  C  CD    . GLU E  1 59  ? 6.914   -19.289 58.219 1.00 34.75  ? 59   GLU E CD    1 
ATOM   3232  O  OE1   . GLU E  1 59  ? 7.092   -19.698 59.392 1.00 36.01  ? 59   GLU E OE1   1 
ATOM   3233  O  OE2   . GLU E  1 59  ? 6.339   -18.197 57.964 1.00 36.56  ? 59   GLU E OE2   1 
ATOM   3234  N  N     . LEU E  1 60  ? 5.331   -21.438 54.436 1.00 27.01  ? 60   LEU E N     1 
ATOM   3235  C  CA    . LEU E  1 60  ? 4.525   -22.652 54.614 1.00 27.07  ? 60   LEU E CA    1 
ATOM   3236  C  C     . LEU E  1 60  ? 4.867   -23.332 55.935 1.00 26.58  ? 60   LEU E C     1 
ATOM   3237  O  O     . LEU E  1 60  ? 5.941   -23.106 56.488 1.00 26.79  ? 60   LEU E O     1 
ATOM   3238  C  CB    . LEU E  1 60  ? 4.737   -23.617 53.458 1.00 27.57  ? 60   LEU E CB    1 
ATOM   3239  C  CG    . LEU E  1 60  ? 3.823   -23.491 52.250 1.00 28.33  ? 60   LEU E CG    1 
ATOM   3240  C  CD1   . LEU E  1 60  ? 2.962   -22.231 52.305 1.00 28.84  ? 60   LEU E CD1   1 
ATOM   3241  C  CD2   . LEU E  1 60  ? 4.682   -23.542 51.002 1.00 28.36  ? 60   LEU E CD2   1 
ATOM   3242  N  N     . LEU E  1 61  ? 3.956   -24.156 56.437 1.00 25.74  ? 61   LEU E N     1 
ATOM   3243  C  CA    . LEU E  1 61  ? 4.082   -24.670 57.794 1.00 25.07  ? 61   LEU E CA    1 
ATOM   3244  C  C     . LEU E  1 61  ? 4.163   -26.202 57.859 1.00 24.79  ? 61   LEU E C     1 
ATOM   3245  O  O     . LEU E  1 61  ? 4.575   -26.776 58.868 1.00 24.87  ? 61   LEU E O     1 
ATOM   3246  C  CB    . LEU E  1 61  ? 2.956   -24.108 58.671 1.00 24.70  ? 61   LEU E CB    1 
ATOM   3247  C  CG    . LEU E  1 61  ? 2.904   -22.568 58.790 1.00 24.77  ? 61   LEU E CG    1 
ATOM   3248  C  CD1   . LEU E  1 61  ? 1.618   -22.070 59.398 1.00 22.91  ? 61   LEU E CD1   1 
ATOM   3249  C  CD2   . LEU E  1 61  ? 4.075   -21.985 59.569 1.00 24.30  ? 61   LEU E CD2   1 
ATOM   3250  N  N     . ILE E  1 62  ? 3.772   -26.867 56.785 1.00 24.17  ? 62   ILE E N     1 
ATOM   3251  C  CA    . ILE E  1 62  ? 4.032   -28.281 56.657 1.00 24.00  ? 62   ILE E CA    1 
ATOM   3252  C  C     . ILE E  1 62  ? 5.404   -28.404 55.967 1.00 24.44  ? 62   ILE E C     1 
ATOM   3253  O  O     . ILE E  1 62  ? 5.669   -27.647 55.041 1.00 24.40  ? 62   ILE E O     1 
ATOM   3254  C  CB    . ILE E  1 62  ? 2.934   -28.969 55.841 1.00 23.49  ? 62   ILE E CB    1 
ATOM   3255  C  CG1   . ILE E  1 62  ? 1.567   -28.731 56.494 1.00 22.86  ? 62   ILE E CG1   1 
ATOM   3256  C  CG2   . ILE E  1 62  ? 3.200   -30.465 55.742 1.00 23.59  ? 62   ILE E CG2   1 
ATOM   3257  C  CD1   . ILE E  1 62  ? 0.367   -29.025 55.601 1.00 20.53  ? 62   ILE E CD1   1 
ATOM   3258  N  N     . ARG E  1 63  ? 6.267   -29.318 56.434 1.00 24.33  ? 63   ARG E N     1 
ATOM   3259  C  CA    . ARG E  1 63  ? 7.581   -29.559 55.814 1.00 24.88  ? 63   ARG E CA    1 
ATOM   3260  C  C     . ARG E  1 63  ? 7.455   -30.001 54.343 1.00 24.55  ? 63   ARG E C     1 
ATOM   3261  O  O     . ARG E  1 63  ? 6.559   -30.770 54.006 1.00 23.88  ? 63   ARG E O     1 
ATOM   3262  C  CB    . ARG E  1 63  ? 8.366   -30.627 56.592 1.00 25.73  ? 63   ARG E CB    1 
ATOM   3263  C  CG    . ARG E  1 63  ? 8.604   -30.413 58.110 1.00 27.60  ? 63   ARG E CG    1 
ATOM   3264  C  CD    . ARG E  1 63  ? 9.804   -29.512 58.415 1.00 32.10  ? 63   ARG E CD    1 
ATOM   3265  N  NE    . ARG E  1 63  ? 9.381   -28.142 58.745 1.00 36.54  ? 63   ARG E NE    1 
ATOM   3266  C  CZ    . ARG E  1 63  ? 9.671   -27.057 58.024 1.00 38.25  ? 63   ARG E CZ    1 
ATOM   3267  N  NH1   . ARG E  1 63  ? 10.407  -27.162 56.920 1.00 39.91  ? 63   ARG E NH1   1 
ATOM   3268  N  NH2   . ARG E  1 63  ? 9.228   -25.862 58.410 1.00 37.83  ? 63   ARG E NH2   1 
ATOM   3269  N  N     . LYS E  1 64  ? 8.361   -29.523 53.481 1.00 24.75  ? 64   LYS E N     1 
ATOM   3270  C  CA    . LYS E  1 64  ? 8.282   -29.740 52.014 1.00 25.07  ? 64   LYS E CA    1 
ATOM   3271  C  C     . LYS E  1 64  ? 8.261   -31.200 51.593 1.00 24.74  ? 64   LYS E C     1 
ATOM   3272  O  O     . LYS E  1 64  ? 7.307   -31.667 50.976 1.00 25.26  ? 64   LYS E O     1 
ATOM   3273  C  CB    . LYS E  1 64  ? 9.438   -29.073 51.271 1.00 25.13  ? 64   LYS E CB    1 
ATOM   3274  C  CG    . LYS E  1 64  ? 9.539   -27.583 51.415 1.00 27.59  ? 64   LYS E CG    1 
ATOM   3275  C  CD    . LYS E  1 64  ? 8.673   -26.818 50.426 1.00 31.08  ? 64   LYS E CD    1 
ATOM   3276  C  CE    . LYS E  1 64  ? 8.363   -25.406 50.967 1.00 33.42  ? 64   LYS E CE    1 
ATOM   3277  N  NZ    . LYS E  1 64  ? 9.577   -24.580 51.217 1.00 32.77  ? 64   LYS E NZ    1 
ATOM   3278  N  N     . LEU E  1 65  ? 9.326   -31.913 51.919 1.00 24.41  ? 65   LEU E N     1 
ATOM   3279  C  CA    . LEU E  1 65  ? 9.469   -33.277 51.487 1.00 24.05  ? 65   LEU E CA    1 
ATOM   3280  C  C     . LEU E  1 65  ? 8.354   -34.203 51.998 1.00 24.16  ? 65   LEU E C     1 
ATOM   3281  O  O     . LEU E  1 65  ? 7.788   -34.959 51.215 1.00 24.95  ? 65   LEU E O     1 
ATOM   3282  C  CB    . LEU E  1 65  ? 10.857  -33.798 51.838 1.00 23.93  ? 65   LEU E CB    1 
ATOM   3283  C  CG    . LEU E  1 65  ? 11.150  -35.240 51.445 1.00 23.42  ? 65   LEU E CG    1 
ATOM   3284  C  CD1   . LEU E  1 65  ? 11.064  -35.423 49.941 1.00 23.36  ? 65   LEU E CD1   1 
ATOM   3285  C  CD2   . LEU E  1 65  ? 12.515  -35.593 51.951 1.00 23.34  ? 65   LEU E CD2   1 
ATOM   3286  N  N     . PRO E  1 66  ? 8.032   -34.177 53.300 1.00 23.81  ? 66   PRO E N     1 
ATOM   3287  C  CA    . PRO E  1 66  ? 6.927   -35.054 53.657 1.00 23.57  ? 66   PRO E CA    1 
ATOM   3288  C  C     . PRO E  1 66  ? 5.632   -34.728 52.924 1.00 23.73  ? 66   PRO E C     1 
ATOM   3289  O  O     . PRO E  1 66  ? 4.839   -35.636 52.652 1.00 24.01  ? 66   PRO E O     1 
ATOM   3290  C  CB    . PRO E  1 66  ? 6.770   -34.829 55.161 1.00 23.18  ? 66   PRO E CB    1 
ATOM   3291  C  CG    . PRO E  1 66  ? 8.080   -34.399 55.595 1.00 23.35  ? 66   PRO E CG    1 
ATOM   3292  C  CD    . PRO E  1 66  ? 8.586   -33.516 54.487 1.00 23.57  ? 66   PRO E CD    1 
ATOM   3293  N  N     . PHE E  1 67  ? 5.401   -33.459 52.600 1.00 23.87  ? 67   PHE E N     1 
ATOM   3294  C  CA    . PHE E  1 67  ? 4.159   -33.109 51.883 1.00 23.90  ? 67   PHE E CA    1 
ATOM   3295  C  C     . PHE E  1 67  ? 4.186   -33.657 50.454 1.00 24.61  ? 67   PHE E C     1 
ATOM   3296  O  O     . PHE E  1 67  ? 3.181   -34.171 49.973 1.00 24.64  ? 67   PHE E O     1 
ATOM   3297  C  CB    . PHE E  1 67  ? 3.881   -31.607 51.884 1.00 22.76  ? 67   PHE E CB    1 
ATOM   3298  C  CG    . PHE E  1 67  ? 2.569   -31.253 51.292 1.00 21.49  ? 67   PHE E CG    1 
ATOM   3299  C  CD1   . PHE E  1 67  ? 1.409   -31.337 52.046 1.00 21.44  ? 67   PHE E CD1   1 
ATOM   3300  C  CD2   . PHE E  1 67  ? 2.474   -30.854 49.967 1.00 20.04  ? 67   PHE E CD2   1 
ATOM   3301  C  CE1   . PHE E  1 67  ? 0.163   -31.016 51.482 1.00 20.26  ? 67   PHE E CE1   1 
ATOM   3302  C  CE2   . PHE E  1 67  ? 1.254   -30.534 49.403 1.00 19.03  ? 67   PHE E CE2   1 
ATOM   3303  C  CZ    . PHE E  1 67  ? 0.091   -30.607 50.160 1.00 20.18  ? 67   PHE E CZ    1 
ATOM   3304  N  N     . GLN E  1 68  ? 5.341   -33.544 49.801 1.00 25.32  ? 68   GLN E N     1 
ATOM   3305  C  CA    . GLN E  1 68  ? 5.572   -34.095 48.472 1.00 27.09  ? 68   GLN E CA    1 
ATOM   3306  C  C     . GLN E  1 68  ? 5.269   -35.602 48.420 1.00 25.95  ? 68   GLN E C     1 
ATOM   3307  O  O     . GLN E  1 68  ? 4.585   -36.069 47.504 1.00 26.25  ? 68   GLN E O     1 
ATOM   3308  C  CB    . GLN E  1 68  ? 7.015   -33.803 48.032 1.00 26.54  ? 68   GLN E CB    1 
ATOM   3309  C  CG    . GLN E  1 68  ? 7.315   -34.196 46.581 1.00 31.18  ? 68   GLN E CG    1 
ATOM   3310  C  CD    . GLN E  1 68  ? 8.637   -33.617 46.037 1.00 32.40  ? 68   GLN E CD    1 
ATOM   3311  O  OE1   . GLN E  1 68  ? 8.631   -32.725 45.160 1.00 38.60  ? 68   GLN E OE1   1 
ATOM   3312  N  NE2   . GLN E  1 68  ? 9.775   -34.125 46.551 1.00 36.68  ? 68   GLN E NE2   1 
ATOM   3313  N  N     . ARG E  1 69  ? 5.752   -36.360 49.404 1.00 25.11  ? 69   ARG E N     1 
ATOM   3314  C  CA    . ARG E  1 69  ? 5.488   -37.796 49.441 1.00 24.37  ? 69   ARG E CA    1 
ATOM   3315  C  C     . ARG E  1 69  ? 4.019   -38.096 49.604 1.00 23.54  ? 69   ARG E C     1 
ATOM   3316  O  O     . ARG E  1 69  ? 3.505   -39.068 49.043 1.00 24.10  ? 69   ARG E O     1 
ATOM   3317  C  CB    . ARG E  1 69  ? 6.257   -38.488 50.556 1.00 24.50  ? 69   ARG E CB    1 
ATOM   3318  C  CG    . ARG E  1 69  ? 7.705   -38.788 50.212 1.00 25.05  ? 69   ARG E CG    1 
ATOM   3319  C  CD    . ARG E  1 69  ? 8.297   -39.784 51.210 1.00 26.28  ? 69   ARG E CD    1 
ATOM   3320  N  NE    . ARG E  1 69  ? 7.993   -39.433 52.596 1.00 25.58  ? 69   ARG E NE    1 
ATOM   3321  C  CZ    . ARG E  1 69  ? 8.824   -38.792 53.413 1.00 26.64  ? 69   ARG E CZ    1 
ATOM   3322  N  NH1   . ARG E  1 69  ? 10.042  -38.428 53.007 1.00 25.47  ? 69   ARG E NH1   1 
ATOM   3323  N  NH2   . ARG E  1 69  ? 8.435   -38.528 54.656 1.00 27.14  ? 69   ARG E NH2   1 
ATOM   3324  N  N     . LEU E  1 70  ? 3.330   -37.270 50.365 1.00 22.22  ? 70   LEU E N     1 
ATOM   3325  C  CA    . LEU E  1 70  ? 1.906   -37.479 50.518 1.00 21.49  ? 70   LEU E CA    1 
ATOM   3326  C  C     . LEU E  1 70  ? 1.196   -37.302 49.170 1.00 20.96  ? 70   LEU E C     1 
ATOM   3327  O  O     . LEU E  1 70  ? 0.389   -38.149 48.776 1.00 20.59  ? 70   LEU E O     1 
ATOM   3328  C  CB    . LEU E  1 70  ? 1.337   -36.563 51.598 1.00 21.36  ? 70   LEU E CB    1 
ATOM   3329  C  CG    . LEU E  1 70  ? -0.165  -36.645 51.837 1.00 21.16  ? 70   LEU E CG    1 
ATOM   3330  C  CD1   . LEU E  1 70  ? -0.611  -38.061 52.272 1.00 21.07  ? 70   LEU E CD1   1 
ATOM   3331  C  CD2   . LEU E  1 70  ? -0.566  -35.583 52.849 1.00 19.54  ? 70   LEU E CD2   1 
ATOM   3332  N  N     . VAL E  1 71  ? 1.533   -36.226 48.457 1.00 20.30  ? 71   VAL E N     1 
ATOM   3333  C  CA    . VAL E  1 71  ? 0.964   -35.942 47.145 1.00 19.82  ? 71   VAL E CA    1 
ATOM   3334  C  C     . VAL E  1 71  ? 1.243   -37.085 46.178 1.00 20.43  ? 71   VAL E C     1 
ATOM   3335  O  O     . VAL E  1 71  ? 0.350   -37.544 45.476 1.00 19.91  ? 71   VAL E O     1 
ATOM   3336  C  CB    . VAL E  1 71  ? 1.476   -34.623 46.599 1.00 19.54  ? 71   VAL E CB    1 
ATOM   3337  C  CG1   . VAL E  1 71  ? 1.243   -34.521 45.133 1.00 19.33  ? 71   VAL E CG1   1 
ATOM   3338  C  CG2   . VAL E  1 71  ? 0.790   -33.476 47.307 1.00 19.83  ? 71   VAL E CG2   1 
ATOM   3339  N  N     . ARG E  1 72  ? 2.473   -37.574 46.167 1.00 21.25  ? 72   ARG E N     1 
ATOM   3340  C  CA    . ARG E  1 72  ? 2.803   -38.692 45.299 1.00 22.48  ? 72   ARG E CA    1 
ATOM   3341  C  C     . ARG E  1 72  ? 2.078   -39.975 45.719 1.00 22.98  ? 72   ARG E C     1 
ATOM   3342  O  O     . ARG E  1 72  ? 1.685   -40.779 44.871 1.00 23.08  ? 72   ARG E O     1 
ATOM   3343  C  CB    . ARG E  1 72  ? 4.307   -38.901 45.242 1.00 22.59  ? 72   ARG E CB    1 
ATOM   3344  C  CG    . ARG E  1 72  ? 5.055   -37.706 44.665 1.00 25.58  ? 72   ARG E CG    1 
ATOM   3345  C  CD    . ARG E  1 72  ? 6.548   -37.973 44.613 1.00 30.10  ? 72   ARG E CD    1 
ATOM   3346  N  NE    . ARG E  1 72  ? 7.295   -36.749 44.318 1.00 36.07  ? 72   ARG E NE    1 
ATOM   3347  C  CZ    . ARG E  1 72  ? 7.525   -36.275 43.090 1.00 37.39  ? 72   ARG E CZ    1 
ATOM   3348  N  NH1   . ARG E  1 72  ? 7.062   -36.914 42.017 1.00 36.36  ? 72   ARG E NH1   1 
ATOM   3349  N  NH2   . ARG E  1 72  ? 8.215   -35.150 42.941 1.00 37.20  ? 72   ARG E NH2   1 
ATOM   3350  N  N     . GLU E  1 73  ? 1.890   -40.171 47.017 1.00 23.29  ? 73   GLU E N     1 
ATOM   3351  C  CA    . GLU E  1 73  ? 1.214   -41.362 47.466 1.00 24.13  ? 73   GLU E CA    1 
ATOM   3352  C  C     . GLU E  1 73  ? -0.256  -41.341 47.032 1.00 24.03  ? 73   GLU E C     1 
ATOM   3353  O  O     . GLU E  1 73  ? -0.755  -42.306 46.451 1.00 23.91  ? 73   GLU E O     1 
ATOM   3354  C  CB    . GLU E  1 73  ? 1.353   -41.519 48.972 1.00 23.95  ? 73   GLU E CB    1 
ATOM   3355  C  CG    . GLU E  1 73  ? 0.490   -42.625 49.552 1.00 25.02  ? 73   GLU E CG    1 
ATOM   3356  C  CD    . GLU E  1 73  ? 0.649   -42.802 51.059 1.00 26.23  ? 73   GLU E CD    1 
ATOM   3357  O  OE1   . GLU E  1 73  ? 1.800   -42.699 51.555 1.00 28.50  ? 73   GLU E OE1   1 
ATOM   3358  O  OE2   . GLU E  1 73  ? -0.385  -43.060 51.746 1.00 30.00  ? 73   GLU E OE2   1 
ATOM   3359  N  N     . ILE E  1 74  ? -0.946  -40.239 47.311 1.00 24.38  ? 74   ILE E N     1 
ATOM   3360  C  CA    . ILE E  1 74  ? -2.332  -40.087 46.881 1.00 24.14  ? 74   ILE E CA    1 
ATOM   3361  C  C     . ILE E  1 74  ? -2.466  -40.147 45.353 1.00 25.06  ? 74   ILE E C     1 
ATOM   3362  O  O     . ILE E  1 74  ? -3.379  -40.793 44.853 1.00 25.75  ? 74   ILE E O     1 
ATOM   3363  C  CB    . ILE E  1 74  ? -2.954  -38.796 47.413 1.00 23.80  ? 74   ILE E CB    1 
ATOM   3364  C  CG1   . ILE E  1 74  ? -3.071  -38.848 48.936 1.00 22.63  ? 74   ILE E CG1   1 
ATOM   3365  C  CG2   . ILE E  1 74  ? -4.325  -38.553 46.791 1.00 22.84  ? 74   ILE E CG2   1 
ATOM   3366  C  CD1   . ILE E  1 74  ? -3.209  -37.457 49.566 1.00 19.60  ? 74   ILE E CD1   1 
ATOM   3367  N  N     . ALA E  1 75  ? -1.567  -39.488 44.619 1.00 25.70  ? 75   ALA E N     1 
ATOM   3368  C  CA    . ALA E  1 75  ? -1.641  -39.446 43.154 1.00 26.44  ? 75   ALA E CA    1 
ATOM   3369  C  C     . ALA E  1 75  ? -1.546  -40.823 42.545 1.00 27.16  ? 75   ALA E C     1 
ATOM   3370  O  O     . ALA E  1 75  ? -2.347  -41.201 41.701 1.00 27.33  ? 75   ALA E O     1 
ATOM   3371  C  CB    . ALA E  1 75  ? -0.550  -38.586 42.596 1.00 26.42  ? 75   ALA E CB    1 
ATOM   3372  N  N     . GLN E  1 76  ? -0.553  -41.569 42.997 1.00 28.26  ? 76   GLN E N     1 
ATOM   3373  C  CA    . GLN E  1 76  ? -0.256  -42.894 42.495 1.00 29.15  ? 76   GLN E CA    1 
ATOM   3374  C  C     . GLN E  1 76  ? -1.385  -43.866 42.785 1.00 30.03  ? 76   GLN E C     1 
ATOM   3375  O  O     . GLN E  1 76  ? -1.580  -44.831 42.059 1.00 31.01  ? 76   GLN E O     1 
ATOM   3376  C  CB    . GLN E  1 76  ? 1.033   -43.340 43.138 1.00 29.12  ? 76   GLN E CB    1 
ATOM   3377  C  CG    . GLN E  1 76  ? 1.513   -44.716 42.844 1.00 30.19  ? 76   GLN E CG    1 
ATOM   3378  C  CD    . GLN E  1 76  ? 2.694   -45.047 43.726 1.00 30.81  ? 76   GLN E CD    1 
ATOM   3379  O  OE1   . GLN E  1 76  ? 2.592   -45.054 44.957 1.00 31.89  ? 76   GLN E OE1   1 
ATOM   3380  N  NE2   . GLN E  1 76  ? 3.829   -45.285 43.106 1.00 31.25  ? 76   GLN E NE2   1 
ATOM   3381  N  N     . ASP E  1 77  ? -2.153  -43.621 43.832 1.00 30.97  ? 77   ASP E N     1 
ATOM   3382  C  CA    . ASP E  1 77  ? -3.344  -44.426 44.032 1.00 32.08  ? 77   ASP E CA    1 
ATOM   3383  C  C     . ASP E  1 77  ? -4.423  -44.177 42.956 1.00 33.04  ? 77   ASP E C     1 
ATOM   3384  O  O     . ASP E  1 77  ? -5.221  -45.059 42.697 1.00 33.24  ? 77   ASP E O     1 
ATOM   3385  C  CB    . ASP E  1 77  ? -3.869  -44.295 45.459 1.00 31.67  ? 77   ASP E CB    1 
ATOM   3386  C  CG    . ASP E  1 77  ? -3.021  -45.078 46.473 1.00 32.95  ? 77   ASP E CG    1 
ATOM   3387  O  OD1   . ASP E  1 77  ? -2.285  -46.012 46.081 1.00 35.19  ? 77   ASP E OD1   1 
ATOM   3388  O  OD2   . ASP E  1 77  ? -3.085  -44.777 47.678 1.00 34.14  ? 77   ASP E OD2   1 
ATOM   3389  N  N     . PHE E  1 78  ? -4.421  -43.000 42.317 1.00 34.57  ? 78   PHE E N     1 
ATOM   3390  C  CA    . PHE E  1 78  ? -5.313  -42.710 41.169 1.00 35.83  ? 78   PHE E CA    1 
ATOM   3391  C  C     . PHE E  1 78  ? -4.737  -43.178 39.845 1.00 36.18  ? 78   PHE E C     1 
ATOM   3392  O  O     . PHE E  1 78  ? -5.474  -43.581 38.964 1.00 36.29  ? 78   PHE E O     1 
ATOM   3393  C  CB    . PHE E  1 78  ? -5.624  -41.213 41.011 1.00 36.33  ? 78   PHE E CB    1 
ATOM   3394  C  CG    . PHE E  1 78  ? -6.599  -40.683 42.014 1.00 38.38  ? 78   PHE E CG    1 
ATOM   3395  C  CD1   . PHE E  1 78  ? -6.278  -39.555 42.790 1.00 40.37  ? 78   PHE E CD1   1 
ATOM   3396  C  CD2   . PHE E  1 78  ? -7.829  -41.303 42.215 1.00 40.47  ? 78   PHE E CD2   1 
ATOM   3397  C  CE1   . PHE E  1 78  ? -7.176  -39.035 43.755 1.00 40.08  ? 78   PHE E CE1   1 
ATOM   3398  C  CE2   . PHE E  1 78  ? -8.745  -40.793 43.181 1.00 42.59  ? 78   PHE E CE2   1 
ATOM   3399  C  CZ    . PHE E  1 78  ? -8.408  -39.646 43.947 1.00 40.42  ? 78   PHE E CZ    1 
ATOM   3400  N  N     . LYS E  1 79  ? -3.425  -43.096 39.688 1.00 36.75  ? 79   LYS E N     1 
ATOM   3401  C  CA    . LYS E  1 79  ? -2.820  -43.366 38.405 1.00 37.60  ? 79   LYS E CA    1 
ATOM   3402  C  C     . LYS E  1 79  ? -1.346  -43.606 38.600 1.00 38.02  ? 79   LYS E C     1 
ATOM   3403  O  O     . LYS E  1 79  ? -0.673  -42.833 39.272 1.00 38.75  ? 79   LYS E O     1 
ATOM   3404  C  CB    . LYS E  1 79  ? -3.019  -42.161 37.496 1.00 37.52  ? 79   LYS E CB    1 
ATOM   3405  C  CG    . LYS E  1 79  ? -2.513  -42.348 36.092 1.00 39.46  ? 79   LYS E CG    1 
ATOM   3406  C  CD    . LYS E  1 79  ? -3.626  -42.820 35.138 1.00 41.83  ? 79   LYS E CD    1 
ATOM   3407  C  CE    . LYS E  1 79  ? -3.064  -43.711 34.033 1.00 42.53  ? 79   LYS E CE    1 
ATOM   3408  N  NZ    . LYS E  1 79  ? -1.720  -43.233 33.552 1.00 42.80  ? 79   LYS E NZ    1 
ATOM   3409  N  N     . THR E  1 80  ? -0.830  -44.665 38.004 1.00 38.57  ? 80   THR E N     1 
ATOM   3410  C  CA    . THR E  1 80  ? 0.599   -44.966 38.121 1.00 39.48  ? 80   THR E CA    1 
ATOM   3411  C  C     . THR E  1 80  ? 1.478   -44.118 37.194 1.00 39.59  ? 80   THR E C     1 
ATOM   3412  O  O     . THR E  1 80  ? 0.966   -43.408 36.322 1.00 40.02  ? 80   THR E O     1 
ATOM   3413  C  CB    . THR E  1 80  ? 0.865   -46.441 37.827 1.00 39.91  ? 80   THR E CB    1 
ATOM   3414  O  OG1   . THR E  1 80  ? 0.062   -46.852 36.697 1.00 40.14  ? 80   THR E OG1   1 
ATOM   3415  C  CG2   . THR E  1 80  ? 0.537   -47.280 39.065 1.00 39.55  ? 80   THR E CG2   1 
ATOM   3416  N  N     . ASP E  1 81  ? 2.793   -44.194 37.393 1.00 39.44  ? 81   ASP E N     1 
ATOM   3417  C  CA    . ASP E  1 81  ? 3.766   -43.581 36.484 1.00 39.98  ? 81   ASP E CA    1 
ATOM   3418  C  C     . ASP E  1 81  ? 3.473   -42.096 36.166 1.00 39.56  ? 81   ASP E C     1 
ATOM   3419  O  O     . ASP E  1 81  ? 3.687   -41.635 35.037 1.00 40.12  ? 81   ASP E O     1 
ATOM   3420  C  CB    . ASP E  1 81  ? 3.885   -44.402 35.178 1.00 40.46  ? 81   ASP E CB    1 
ATOM   3421  C  CG    . ASP E  1 81  ? 3.881   -45.921 35.421 1.00 43.21  ? 81   ASP E CG    1 
ATOM   3422  O  OD1   . ASP E  1 81  ? 2.861   -46.569 35.073 1.00 46.05  ? 81   ASP E OD1   1 
ATOM   3423  O  OD2   . ASP E  1 81  ? 4.881   -46.474 35.960 1.00 44.39  ? 81   ASP E OD2   1 
ATOM   3424  N  N     . LEU E  1 82  ? 2.967   -41.357 37.153 1.00 38.58  ? 82   LEU E N     1 
ATOM   3425  C  CA    . LEU E  1 82  ? 2.781   -39.913 37.026 1.00 37.27  ? 82   LEU E CA    1 
ATOM   3426  C  C     . LEU E  1 82  ? 4.012   -39.188 37.524 1.00 36.65  ? 82   LEU E C     1 
ATOM   3427  O  O     . LEU E  1 82  ? 4.663   -39.665 38.445 1.00 36.84  ? 82   LEU E O     1 
ATOM   3428  C  CB    . LEU E  1 82  ? 1.601   -39.459 37.866 1.00 37.17  ? 82   LEU E CB    1 
ATOM   3429  C  CG    . LEU E  1 82  ? 0.218   -39.761 37.317 1.00 36.93  ? 82   LEU E CG    1 
ATOM   3430  C  CD1   . LEU E  1 82  ? -0.798  -39.596 38.448 1.00 35.71  ? 82   LEU E CD1   1 
ATOM   3431  C  CD2   . LEU E  1 82  ? -0.092  -38.845 36.135 1.00 34.82  ? 82   LEU E CD2   1 
ATOM   3432  N  N     . ARG E  1 83  ? 4.326   -38.042 36.924 1.00 35.54  ? 83   ARG E N     1 
ATOM   3433  C  CA    . ARG E  1 83  ? 5.387   -37.171 37.418 1.00 34.69  ? 83   ARG E CA    1 
ATOM   3434  C  C     . ARG E  1 83  ? 4.789   -35.813 37.758 1.00 33.55  ? 83   ARG E C     1 
ATOM   3435  O  O     . ARG E  1 83  ? 3.648   -35.521 37.383 1.00 33.49  ? 83   ARG E O     1 
ATOM   3436  C  CB    . ARG E  1 83  ? 6.473   -36.992 36.358 1.00 35.61  ? 83   ARG E CB    1 
ATOM   3437  C  CG    . ARG E  1 83  ? 7.249   -38.249 36.029 1.00 37.40  ? 83   ARG E CG    1 
ATOM   3438  C  CD    . ARG E  1 83  ? 7.658   -38.224 34.568 1.00 40.47  ? 83   ARG E CD    1 
ATOM   3439  N  NE    . ARG E  1 83  ? 9.005   -37.701 34.380 1.00 43.23  ? 83   ARG E NE    1 
ATOM   3440  C  CZ    . ARG E  1 83  ? 10.112  -38.432 34.524 1.00 45.32  ? 83   ARG E CZ    1 
ATOM   3441  N  NH1   . ARG E  1 83  ? 10.029  -39.718 34.872 1.00 46.25  ? 83   ARG E NH1   1 
ATOM   3442  N  NH2   . ARG E  1 83  ? 11.306  -37.880 34.331 1.00 45.05  ? 83   ARG E NH2   1 
ATOM   3443  N  N     . PHE E  1 84  ? 5.554   -34.975 38.448 1.00 31.76  ? 84   PHE E N     1 
ATOM   3444  C  CA    . PHE E  1 84  ? 5.038   -33.691 38.900 1.00 30.46  ? 84   PHE E CA    1 
ATOM   3445  C  C     . PHE E  1 84  ? 6.034   -32.597 38.652 1.00 29.69  ? 84   PHE E C     1 
ATOM   3446  O  O     . PHE E  1 84  ? 7.180   -32.724 39.034 1.00 30.35  ? 84   PHE E O     1 
ATOM   3447  C  CB    . PHE E  1 84  ? 4.763   -33.750 40.402 1.00 30.21  ? 84   PHE E CB    1 
ATOM   3448  C  CG    . PHE E  1 84  ? 3.478   -34.444 40.769 1.00 29.78  ? 84   PHE E CG    1 
ATOM   3449  C  CD1   . PHE E  1 84  ? 3.399   -35.831 40.812 1.00 30.58  ? 84   PHE E CD1   1 
ATOM   3450  C  CD2   . PHE E  1 84  ? 2.355   -33.708 41.104 1.00 28.46  ? 84   PHE E CD2   1 
ATOM   3451  C  CE1   . PHE E  1 84  ? 2.210   -36.471 41.157 1.00 30.20  ? 84   PHE E CE1   1 
ATOM   3452  C  CE2   . PHE E  1 84  ? 1.175   -34.330 41.457 1.00 28.57  ? 84   PHE E CE2   1 
ATOM   3453  C  CZ    . PHE E  1 84  ? 1.098   -35.713 41.485 1.00 29.81  ? 84   PHE E CZ    1 
ATOM   3454  N  N     . GLN E  1 85  ? 5.619   -31.507 38.035 1.00 28.98  ? 85   GLN E N     1 
ATOM   3455  C  CA    . GLN E  1 85  ? 6.466   -30.323 38.025 1.00 28.70  ? 85   GLN E CA    1 
ATOM   3456  C  C     . GLN E  1 85  ? 6.581   -29.874 39.478 1.00 28.49  ? 85   GLN E C     1 
ATOM   3457  O  O     . GLN E  1 85  ? 5.627   -30.027 40.260 1.00 28.94  ? 85   GLN E O     1 
ATOM   3458  C  CB    . GLN E  1 85  ? 5.823   -29.205 37.220 1.00 28.80  ? 85   GLN E CB    1 
ATOM   3459  C  CG    . GLN E  1 85  ? 5.713   -29.436 35.734 1.00 28.67  ? 85   GLN E CG    1 
ATOM   3460  C  CD    . GLN E  1 85  ? 5.052   -28.262 35.028 1.00 29.22  ? 85   GLN E CD    1 
ATOM   3461  O  OE1   . GLN E  1 85  ? 4.289   -27.494 35.630 1.00 29.51  ? 85   GLN E OE1   1 
ATOM   3462  N  NE2   . GLN E  1 85  ? 5.332   -28.123 33.741 1.00 30.26  ? 85   GLN E NE2   1 
ATOM   3463  N  N     . SER E  1 86  ? 7.716   -29.330 39.885 1.00 27.59  ? 86   SER E N     1 
ATOM   3464  C  CA    . SER E  1 86  ? 7.798   -29.002 41.306 1.00 27.34  ? 86   SER E CA    1 
ATOM   3465  C  C     . SER E  1 86  ? 6.796   -27.919 41.699 1.00 26.89  ? 86   SER E C     1 
ATOM   3466  O  O     . SER E  1 86  ? 6.191   -27.997 42.761 1.00 27.49  ? 86   SER E O     1 
ATOM   3467  C  CB    . SER E  1 86  ? 9.206   -28.674 41.759 1.00 26.68  ? 86   SER E CB    1 
ATOM   3468  O  OG    . SER E  1 86  ? 9.772   -27.768 40.860 1.00 27.73  ? 86   SER E OG    1 
ATOM   3469  N  N     . SER E  1 87  ? 6.566   -26.938 40.837 1.00 26.01  ? 87   SER E N     1 
ATOM   3470  C  CA    . SER E  1 87  ? 5.667   -25.878 41.226 1.00 25.28  ? 87   SER E CA    1 
ATOM   3471  C  C     . SER E  1 87  ? 4.246   -26.386 41.281 1.00 24.88  ? 87   SER E C     1 
ATOM   3472  O  O     . SER E  1 87  ? 3.384   -25.734 41.854 1.00 25.41  ? 87   SER E O     1 
ATOM   3473  C  CB    . SER E  1 87  ? 5.769   -24.688 40.309 1.00 24.87  ? 87   SER E CB    1 
ATOM   3474  O  OG    . SER E  1 87  ? 5.182   -25.007 39.084 1.00 26.81  ? 87   SER E OG    1 
ATOM   3475  N  N     . ALA E  1 88  ? 4.006   -27.560 40.712 1.00 24.29  ? 88   ALA E N     1 
ATOM   3476  C  CA    . ALA E  1 88  ? 2.723   -28.228 40.879 1.00 23.69  ? 88   ALA E CA    1 
ATOM   3477  C  C     . ALA E  1 88  ? 2.554   -28.654 42.340 1.00 23.63  ? 88   ALA E C     1 
ATOM   3478  O  O     . ALA E  1 88  ? 1.457   -28.546 42.918 1.00 23.71  ? 88   ALA E O     1 
ATOM   3479  C  CB    . ALA E  1 88  ? 2.624   -29.430 39.964 1.00 23.17  ? 88   ALA E CB    1 
ATOM   3480  N  N     . VAL E  1 89  ? 3.644   -29.133 42.936 1.00 23.09  ? 89   VAL E N     1 
ATOM   3481  C  CA    . VAL E  1 89  ? 3.600   -29.577 44.320 1.00 22.62  ? 89   VAL E CA    1 
ATOM   3482  C  C     . VAL E  1 89  ? 3.456   -28.369 45.227 1.00 22.62  ? 89   VAL E C     1 
ATOM   3483  O  O     . VAL E  1 89  ? 2.684   -28.409 46.183 1.00 22.47  ? 89   VAL E O     1 
ATOM   3484  C  CB    . VAL E  1 89  ? 4.816   -30.451 44.733 1.00 22.22  ? 89   VAL E CB    1 
ATOM   3485  C  CG1   . VAL E  1 89  ? 4.544   -31.144 46.058 1.00 21.26  ? 89   VAL E CG1   1 
ATOM   3486  C  CG2   . VAL E  1 89  ? 5.090   -31.507 43.687 1.00 23.08  ? 89   VAL E CG2   1 
ATOM   3487  N  N     . MET E  1 90  ? 4.171   -27.295 44.914 1.00 22.58  ? 90   MET E N     1 
ATOM   3488  C  CA    . MET E  1 90  ? 4.013   -26.058 45.660 1.00 23.45  ? 90   MET E CA    1 
ATOM   3489  C  C     . MET E  1 90  ? 2.588   -25.545 45.573 1.00 22.92  ? 90   MET E C     1 
ATOM   3490  O  O     . MET E  1 90  ? 2.063   -25.030 46.563 1.00 23.18  ? 90   MET E O     1 
ATOM   3491  C  CB    . MET E  1 90  ? 4.973   -24.972 45.178 1.00 24.37  ? 90   MET E CB    1 
ATOM   3492  C  CG    . MET E  1 90  ? 6.414   -25.295 45.405 1.00 28.10  ? 90   MET E CG    1 
ATOM   3493  S  SD    . MET E  1 90  ? 6.633   -26.003 47.056 1.00 38.78  ? 90   MET E SD    1 
ATOM   3494  C  CE    . MET E  1 90  ? 6.742   -24.519 48.069 1.00 36.84  ? 90   MET E CE    1 
ATOM   3495  N  N     . ALA E  1 91  ? 1.957   -25.690 44.405 1.00 21.93  ? 91   ALA E N     1 
ATOM   3496  C  CA    . ALA E  1 91  ? 0.594   -25.211 44.240 1.00 21.05  ? 91   ALA E CA    1 
ATOM   3497  C  C     . ALA E  1 91  ? -0.355  -25.972 45.168 1.00 20.61  ? 91   ALA E C     1 
ATOM   3498  O  O     . ALA E  1 91  ? -1.203  -25.384 45.825 1.00 20.38  ? 91   ALA E O     1 
ATOM   3499  C  CB    . ALA E  1 91  ? 0.158   -25.286 42.792 1.00 20.33  ? 91   ALA E CB    1 
ATOM   3500  N  N     . LEU E  1 92  ? -0.195  -27.278 45.258 1.00 20.82  ? 92   LEU E N     1 
ATOM   3501  C  CA    . LEU E  1 92  ? -1.039  -28.053 46.173 1.00 21.30  ? 92   LEU E CA    1 
ATOM   3502  C  C     . LEU E  1 92  ? -0.820  -27.671 47.635 1.00 21.49  ? 92   LEU E C     1 
ATOM   3503  O  O     . LEU E  1 92  ? -1.778  -27.606 48.420 1.00 21.49  ? 92   LEU E O     1 
ATOM   3504  C  CB    . LEU E  1 92  ? -0.818  -29.553 45.983 1.00 21.26  ? 92   LEU E CB    1 
ATOM   3505  C  CG    . LEU E  1 92  ? -1.301  -30.115 44.648 1.00 20.99  ? 92   LEU E CG    1 
ATOM   3506  C  CD1   . LEU E  1 92  ? -0.549  -31.378 44.356 1.00 21.76  ? 92   LEU E CD1   1 
ATOM   3507  C  CD2   . LEU E  1 92  ? -2.782  -30.361 44.665 1.00 19.70  ? 92   LEU E CD2   1 
ATOM   3508  N  N     . GLN E  1 93  ? 0.430   -27.393 47.994 1.00 21.10  ? 93   GLN E N     1 
ATOM   3509  C  CA    . GLN E  1 93  ? 0.725   -27.055 49.364 1.00 21.31  ? 93   GLN E CA    1 
ATOM   3510  C  C     . GLN E  1 93  ? 0.167   -25.708 49.739 1.00 21.21  ? 93   GLN E C     1 
ATOM   3511  O  O     . GLN E  1 93  ? -0.318  -25.544 50.850 1.00 21.52  ? 93   GLN E O     1 
ATOM   3512  C  CB    . GLN E  1 93  ? 2.217   -27.131 49.672 1.00 21.37  ? 93   GLN E CB    1 
ATOM   3513  C  CG    . GLN E  1 93  ? 2.493   -27.350 51.148 1.00 22.81  ? 93   GLN E CG    1 
ATOM   3514  C  CD    . GLN E  1 93  ? 3.941   -27.674 51.445 1.00 25.62  ? 93   GLN E CD    1 
ATOM   3515  O  OE1   . GLN E  1 93  ? 4.689   -28.080 50.560 1.00 28.33  ? 93   GLN E OE1   1 
ATOM   3516  N  NE2   . GLN E  1 93  ? 4.346   -27.497 52.699 1.00 25.53  ? 93   GLN E NE2   1 
ATOM   3517  N  N     . GLU E  1 94  ? 0.229   -24.745 48.826 1.00 21.17  ? 94   GLU E N     1 
ATOM   3518  C  CA    . GLU E  1 94  ? -0.209  -23.395 49.143 1.00 21.46  ? 94   GLU E CA    1 
ATOM   3519  C  C     . GLU E  1 94  ? -1.696  -23.413 49.324 1.00 21.36  ? 94   GLU E C     1 
ATOM   3520  O  O     . GLU E  1 94  ? -2.227  -22.745 50.213 1.00 22.00  ? 94   GLU E O     1 
ATOM   3521  C  CB    . GLU E  1 94  ? 0.153   -22.411 48.053 1.00 21.79  ? 94   GLU E CB    1 
ATOM   3522  C  CG    . GLU E  1 94  ? 1.634   -22.105 47.934 1.00 24.80  ? 94   GLU E CG    1 
ATOM   3523  C  CD    . GLU E  1 94  ? 2.137   -21.027 48.907 1.00 31.80  ? 94   GLU E CD    1 
ATOM   3524  O  OE1   . GLU E  1 94  ? 1.304   -20.296 49.534 1.00 31.95  ? 94   GLU E OE1   1 
ATOM   3525  O  OE2   . GLU E  1 94  ? 3.397   -20.918 49.032 1.00 34.98  ? 94   GLU E OE2   1 
ATOM   3526  N  N     . ALA E  1 95  ? -2.359  -24.207 48.487 1.00 20.87  ? 95   ALA E N     1 
ATOM   3527  C  CA    . ALA E  1 95  ? -3.793  -24.360 48.520 1.00 20.23  ? 95   ALA E CA    1 
ATOM   3528  C  C     . ALA E  1 95  ? -4.216  -25.034 49.800 1.00 20.39  ? 95   ALA E C     1 
ATOM   3529  O  O     . ALA E  1 95  ? -5.055  -24.505 50.519 1.00 21.31  ? 95   ALA E O     1 
ATOM   3530  C  CB    . ALA E  1 95  ? -4.254  -25.156 47.344 1.00 19.91  ? 95   ALA E CB    1 
ATOM   3531  N  N     . SER E  1 96  ? -3.616  -26.189 50.091 1.00 20.39  ? 96   SER E N     1 
ATOM   3532  C  CA    . SER E  1 96  ? -3.939  -27.001 51.278 1.00 19.66  ? 96   SER E CA    1 
ATOM   3533  C  C     . SER E  1 96  ? -3.746  -26.254 52.587 1.00 19.74  ? 96   SER E C     1 
ATOM   3534  O  O     . SER E  1 96  ? -4.514  -26.445 53.533 1.00 19.63  ? 96   SER E O     1 
ATOM   3535  C  CB    . SER E  1 96  ? -3.074  -28.247 51.301 1.00 19.63  ? 96   SER E CB    1 
ATOM   3536  O  OG    . SER E  1 96  ? -3.277  -29.013 50.132 1.00 19.80  ? 96   SER E OG    1 
ATOM   3537  N  N     . GLU E  1 97  ? -2.726  -25.402 52.643 1.00 19.56  ? 97   GLU E N     1 
ATOM   3538  C  CA    . GLU E  1 97  ? -2.467  -24.641 53.847 1.00 20.13  ? 97   GLU E CA    1 
ATOM   3539  C  C     . GLU E  1 97  ? -3.445  -23.488 53.994 1.00 19.23  ? 97   GLU E C     1 
ATOM   3540  O  O     . GLU E  1 97  ? -3.841  -23.181 55.110 1.00 19.92  ? 97   GLU E O     1 
ATOM   3541  C  CB    . GLU E  1 97  ? -1.010  -24.202 53.941 1.00 19.41  ? 97   GLU E CB    1 
ATOM   3542  C  CG    . GLU E  1 97  ? -0.090  -25.402 54.179 1.00 22.06  ? 97   GLU E CG    1 
ATOM   3543  C  CD    . GLU E  1 97  ? 1.326   -25.049 54.675 1.00 23.92  ? 97   GLU E CD    1 
ATOM   3544  O  OE1   . GLU E  1 97  ? 1.614   -23.880 55.093 1.00 30.22  ? 97   GLU E OE1   1 
ATOM   3545  O  OE2   . GLU E  1 97  ? 2.173   -25.968 54.650 1.00 28.66  ? 97   GLU E OE2   1 
ATOM   3546  N  N     . ALA E  1 98  ? -3.858  -22.873 52.884 1.00 17.96  ? 98   ALA E N     1 
ATOM   3547  C  CA    . ALA E  1 98  ? -4.862  -21.832 52.936 1.00 16.50  ? 98   ALA E CA    1 
ATOM   3548  C  C     . ALA E  1 98  ? -6.165  -22.442 53.367 1.00 16.70  ? 98   ALA E C     1 
ATOM   3549  O  O     . ALA E  1 98  ? -6.930  -21.798 54.088 1.00 17.22  ? 98   ALA E O     1 
ATOM   3550  C  CB    . ALA E  1 98  ? -5.046  -21.224 51.629 1.00 16.31  ? 98   ALA E CB    1 
ATOM   3551  N  N     . TYR E  1 99  ? -6.430  -23.669 52.923 1.00 16.02  ? 99   TYR E N     1 
ATOM   3552  C  CA    . TYR E  1 99  ? -7.677  -24.328 53.250 1.00 16.00  ? 99   TYR E CA    1 
ATOM   3553  C  C     . TYR E  1 99  ? -7.746  -24.654 54.758 1.00 16.75  ? 99   TYR E C     1 
ATOM   3554  O  O     . TYR E  1 99  ? -8.682  -24.258 55.452 1.00 17.12  ? 99   TYR E O     1 
ATOM   3555  C  CB    . TYR E  1 99  ? -7.863  -25.574 52.405 1.00 15.46  ? 99   TYR E CB    1 
ATOM   3556  C  CG    . TYR E  1 99  ? -8.995  -26.449 52.866 1.00 15.35  ? 99   TYR E CG    1 
ATOM   3557  C  CD1   . TYR E  1 99  ? -10.319 -26.195 52.470 1.00 16.12  ? 99   TYR E CD1   1 
ATOM   3558  C  CD2   . TYR E  1 99  ? -8.756  -27.537 53.695 1.00 13.24  ? 99   TYR E CD2   1 
ATOM   3559  C  CE1   . TYR E  1 99  ? -11.382 -27.018 52.920 1.00 14.80  ? 99   TYR E CE1   1 
ATOM   3560  C  CE2   . TYR E  1 99  ? -9.789  -28.355 54.131 1.00 12.88  ? 99   TYR E CE2   1 
ATOM   3561  C  CZ    . TYR E  1 99  ? -11.093 -28.088 53.754 1.00 14.88  ? 99   TYR E CZ    1 
ATOM   3562  O  OH    . TYR E  1 99  ? -12.104 -28.914 54.214 1.00 17.00  ? 99   TYR E OH    1 
ATOM   3563  N  N     . LEU E  1 100 ? -6.733  -25.341 55.267 1.00 17.15  ? 100  LEU E N     1 
ATOM   3564  C  CA    . LEU E  1 100 ? -6.724  -25.767 56.658 1.00 16.47  ? 100  LEU E CA    1 
ATOM   3565  C  C     . LEU E  1 100 ? -6.724  -24.587 57.604 1.00 16.51  ? 100  LEU E C     1 
ATOM   3566  O  O     . LEU E  1 100 ? -7.429  -24.598 58.601 1.00 16.29  ? 100  LEU E O     1 
ATOM   3567  C  CB    . LEU E  1 100 ? -5.516  -26.660 56.922 1.00 16.35  ? 100  LEU E CB    1 
ATOM   3568  C  CG    . LEU E  1 100 ? -5.536  -28.061 56.305 1.00 15.19  ? 100  LEU E CG    1 
ATOM   3569  C  CD1   . LEU E  1 100 ? -4.263  -28.780 56.667 1.00 13.60  ? 100  LEU E CD1   1 
ATOM   3570  C  CD2   . LEU E  1 100 ? -6.741  -28.837 56.795 1.00 13.87  ? 100  LEU E CD2   1 
ATOM   3571  N  N     . VAL E  1 101 ? -5.941  -23.562 57.289 1.00 16.56  ? 101  VAL E N     1 
ATOM   3572  C  CA    . VAL E  1 101 ? -5.892  -22.378 58.133 1.00 16.49  ? 101  VAL E CA    1 
ATOM   3573  C  C     . VAL E  1 101 ? -7.268  -21.725 58.274 1.00 16.86  ? 101  VAL E C     1 
ATOM   3574  O  O     . VAL E  1 101 ? -7.654  -21.317 59.356 1.00 17.39  ? 101  VAL E O     1 
ATOM   3575  C  CB    . VAL E  1 101 ? -4.870  -21.373 57.617 1.00 16.26  ? 101  VAL E CB    1 
ATOM   3576  C  CG1   . VAL E  1 101 ? -5.107  -20.008 58.219 1.00 16.38  ? 101  VAL E CG1   1 
ATOM   3577  C  CG2   . VAL E  1 101 ? -3.473  -21.845 57.955 1.00 16.51  ? 101  VAL E CG2   1 
ATOM   3578  N  N     . ALA E  1 102 ? -8.017  -21.660 57.181 1.00 17.24  ? 102  ALA E N     1 
ATOM   3579  C  CA    . ALA E  1 102 ? -9.332  -21.050 57.184 1.00 17.06  ? 102  ALA E CA    1 
ATOM   3580  C  C     . ALA E  1 102 ? -10.343 -21.955 57.891 1.00 17.97  ? 102  ALA E C     1 
ATOM   3581  O  O     . ALA E  1 102 ? -11.309 -21.479 58.509 1.00 19.10  ? 102  ALA E O     1 
ATOM   3582  C  CB    . ALA E  1 102 ? -9.753  -20.781 55.804 1.00 15.98  ? 102  ALA E CB    1 
ATOM   3583  N  N     . LEU E  1 103 ? -10.137 -23.259 57.799 1.00 17.98  ? 103  LEU E N     1 
ATOM   3584  C  CA    . LEU E  1 103 ? -10.971 -24.191 58.524 1.00 18.29  ? 103  LEU E CA    1 
ATOM   3585  C  C     . LEU E  1 103 ? -10.789 -24.012 60.033 1.00 19.23  ? 103  LEU E C     1 
ATOM   3586  O  O     . LEU E  1 103 ? -11.778 -23.975 60.771 1.00 19.36  ? 103  LEU E O     1 
ATOM   3587  C  CB    . LEU E  1 103 ? -10.637 -25.609 58.120 1.00 17.97  ? 103  LEU E CB    1 
ATOM   3588  C  CG    . LEU E  1 103 ? -11.619 -26.659 58.569 1.00 18.05  ? 103  LEU E CG    1 
ATOM   3589  C  CD1   . LEU E  1 103 ? -12.979 -26.345 58.010 1.00 18.81  ? 103  LEU E CD1   1 
ATOM   3590  C  CD2   . LEU E  1 103 ? -11.131 -27.991 58.087 1.00 18.15  ? 103  LEU E CD2   1 
ATOM   3591  N  N     . PHE E  1 104 ? -9.538  -23.872 60.491 1.00 19.86  ? 104  PHE E N     1 
ATOM   3592  C  CA    . PHE E  1 104 ? -9.269  -23.671 61.923 1.00 20.22  ? 104  PHE E CA    1 
ATOM   3593  C  C     . PHE E  1 104 ? -9.856  -22.355 62.421 1.00 21.71  ? 104  PHE E C     1 
ATOM   3594  O  O     . PHE E  1 104 ? -10.252 -22.275 63.569 1.00 22.11  ? 104  PHE E O     1 
ATOM   3595  C  CB    . PHE E  1 104 ? -7.789  -23.728 62.261 1.00 19.14  ? 104  PHE E CB    1 
ATOM   3596  C  CG    . PHE E  1 104 ? -7.202  -25.097 62.236 1.00 17.57  ? 104  PHE E CG    1 
ATOM   3597  C  CD1   . PHE E  1 104 ? -6.101  -25.375 61.438 1.00 16.67  ? 104  PHE E CD1   1 
ATOM   3598  C  CD2   . PHE E  1 104 ? -7.727  -26.114 63.019 1.00 17.44  ? 104  PHE E CD2   1 
ATOM   3599  C  CE1   . PHE E  1 104 ? -5.538  -26.666 61.405 1.00 17.55  ? 104  PHE E CE1   1 
ATOM   3600  C  CE2   . PHE E  1 104 ? -7.167  -27.404 63.011 1.00 17.80  ? 104  PHE E CE2   1 
ATOM   3601  C  CZ    . PHE E  1 104 ? -6.066  -27.684 62.189 1.00 17.68  ? 104  PHE E CZ    1 
ATOM   3602  N  N     . GLU E  1 105 ? -9.929  -21.327 61.575 1.00 22.99  ? 105  GLU E N     1 
ATOM   3603  C  CA    . GLU E  1 105 ? -10.601 -20.096 61.991 1.00 24.23  ? 105  GLU E CA    1 
ATOM   3604  C  C     . GLU E  1 105 ? -12.040 -20.440 62.291 1.00 24.65  ? 105  GLU E C     1 
ATOM   3605  O  O     . GLU E  1 105 ? -12.550 -20.079 63.340 1.00 25.55  ? 105  GLU E O     1 
ATOM   3606  C  CB    . GLU E  1 105 ? -10.548 -19.012 60.928 1.00 23.82  ? 105  GLU E CB    1 
ATOM   3607  C  CG    . GLU E  1 105 ? -9.215  -18.337 60.811 1.00 28.50  ? 105  GLU E CG    1 
ATOM   3608  C  CD    . GLU E  1 105 ? -9.030  -17.547 59.501 1.00 35.15  ? 105  GLU E CD    1 
ATOM   3609  O  OE1   . GLU E  1 105 ? -10.043 -17.230 58.828 1.00 38.84  ? 105  GLU E OE1   1 
ATOM   3610  O  OE2   . GLU E  1 105 ? -7.860  -17.239 59.140 1.00 37.12  ? 105  GLU E OE2   1 
ATOM   3611  N  N     . ASP E  1 106 ? -12.686 -21.179 61.391 1.00 25.16  ? 106  ASP E N     1 
ATOM   3612  C  CA    . ASP E  1 106 ? -14.112 -21.487 61.533 1.00 25.49  ? 106  ASP E CA    1 
ATOM   3613  C  C     . ASP E  1 106 ? -14.383 -22.388 62.731 1.00 25.09  ? 106  ASP E C     1 
ATOM   3614  O  O     . ASP E  1 106 ? -15.359 -22.206 63.461 1.00 24.99  ? 106  ASP E O     1 
ATOM   3615  C  CB    . ASP E  1 106 ? -14.625 -22.128 60.255 1.00 25.74  ? 106  ASP E CB    1 
ATOM   3616  C  CG    . ASP E  1 106 ? -14.769 -21.131 59.132 1.00 28.62  ? 106  ASP E CG    1 
ATOM   3617  O  OD1   . ASP E  1 106 ? -14.596 -19.908 59.400 1.00 30.15  ? 106  ASP E OD1   1 
ATOM   3618  O  OD2   . ASP E  1 106 ? -15.073 -21.563 57.981 1.00 32.91  ? 106  ASP E OD2   1 
ATOM   3619  N  N     . THR E  1 107 ? -13.469 -23.338 62.918 1.00 24.38  ? 107  THR E N     1 
ATOM   3620  C  CA    . THR E  1 107 ? -13.459 -24.268 64.020 1.00 23.42  ? 107  THR E CA    1 
ATOM   3621  C  C     . THR E  1 107 ? -13.321 -23.500 65.308 1.00 22.39  ? 107  THR E C     1 
ATOM   3622  O  O     . THR E  1 107 ? -13.952 -23.821 66.291 1.00 22.37  ? 107  THR E O     1 
ATOM   3623  C  CB    . THR E  1 107 ? -12.292 -25.247 63.830 1.00 23.87  ? 107  THR E CB    1 
ATOM   3624  O  OG1   . THR E  1 107 ? -12.494 -25.965 62.604 1.00 26.06  ? 107  THR E OG1   1 
ATOM   3625  C  CG2   . THR E  1 107 ? -12.203 -26.254 64.948 1.00 23.68  ? 107  THR E CG2   1 
ATOM   3626  N  N     . ASN E  1 108 ? -12.515 -22.457 65.287 1.00 21.68  ? 108  ASN E N     1 
ATOM   3627  C  CA    . ASN E  1 108 ? -12.277 -21.680 66.469 1.00 21.25  ? 108  ASN E CA    1 
ATOM   3628  C  C     . ASN E  1 108 ? -13.530 -20.908 66.852 1.00 21.52  ? 108  ASN E C     1 
ATOM   3629  O  O     . ASN E  1 108 ? -13.819 -20.722 68.037 1.00 21.27  ? 108  ASN E O     1 
ATOM   3630  C  CB    . ASN E  1 108 ? -11.128 -20.717 66.229 1.00 20.96  ? 108  ASN E CB    1 
ATOM   3631  C  CG    . ASN E  1 108 ? -10.522 -20.210 67.507 1.00 20.41  ? 108  ASN E CG    1 
ATOM   3632  O  OD1   . ASN E  1 108 ? -10.736 -20.768 68.566 1.00 21.27  ? 108  ASN E OD1   1 
ATOM   3633  N  ND2   . ASN E  1 108 ? -9.765  -19.142 67.415 1.00 20.48  ? 108  ASN E ND2   1 
ATOM   3634  N  N     . LEU E  1 109 ? -14.270 -20.464 65.836 1.00 21.54  ? 109  LEU E N     1 
ATOM   3635  C  CA    . LEU E  1 109 ? -15.535 -19.769 66.040 1.00 21.32  ? 109  LEU E CA    1 
ATOM   3636  C  C     . LEU E  1 109 ? -16.605 -20.685 66.660 1.00 21.95  ? 109  LEU E C     1 
ATOM   3637  O  O     . LEU E  1 109 ? -17.400 -20.247 67.498 1.00 22.10  ? 109  LEU E O     1 
ATOM   3638  C  CB    . LEU E  1 109 ? -16.011 -19.186 64.724 1.00 20.58  ? 109  LEU E CB    1 
ATOM   3639  C  CG    . LEU E  1 109 ? -15.946 -17.673 64.560 1.00 19.32  ? 109  LEU E CG    1 
ATOM   3640  C  CD1   . LEU E  1 109 ? -14.859 -17.018 65.393 1.00 19.39  ? 109  LEU E CD1   1 
ATOM   3641  C  CD2   . LEU E  1 109 ? -15.804 -17.316 63.087 1.00 17.67  ? 109  LEU E CD2   1 
ATOM   3642  N  N     . CYS E  1 110 ? -16.589 -21.951 66.264 1.00 22.13  ? 110  CYS E N     1 
ATOM   3643  C  CA    . CYS E  1 110 ? -17.501 -22.945 66.802 1.00 23.33  ? 110  CYS E CA    1 
ATOM   3644  C  C     . CYS E  1 110 ? -17.240 -23.283 68.285 1.00 23.69  ? 110  CYS E C     1 
ATOM   3645  O  O     . CYS E  1 110 ? -18.177 -23.356 69.067 1.00 23.76  ? 110  CYS E O     1 
ATOM   3646  C  CB    . CYS E  1 110 ? -17.477 -24.201 65.919 1.00 23.26  ? 110  CYS E CB    1 
ATOM   3647  S  SG    . CYS E  1 110 ? -18.155 -23.901 64.251 1.00 24.25  ? 110  CYS E SG    1 
ATOM   3648  N  N     . ALA E  1 111 ? -15.970 -23.487 68.647 1.00 23.81  ? 111  ALA E N     1 
ATOM   3649  C  CA    . ALA E  1 111 ? -15.549 -23.664 70.034 1.00 23.78  ? 111  ALA E CA    1 
ATOM   3650  C  C     . ALA E  1 111 ? -16.061 -22.534 70.902 1.00 23.92  ? 111  ALA E C     1 
ATOM   3651  O  O     . ALA E  1 111 ? -16.735 -22.774 71.895 1.00 24.33  ? 111  ALA E O     1 
ATOM   3652  C  CB    . ALA E  1 111 ? -14.035 -23.725 70.125 1.00 23.74  ? 111  ALA E CB    1 
ATOM   3653  N  N     . ILE E  1 112 ? -15.743 -21.306 70.516 1.00 23.86  ? 112  ILE E N     1 
ATOM   3654  C  CA    . ILE E  1 112 ? -16.110 -20.131 71.267 1.00 23.94  ? 112  ILE E CA    1 
ATOM   3655  C  C     . ILE E  1 112 ? -17.615 -20.061 71.418 1.00 25.14  ? 112  ILE E C     1 
ATOM   3656  O  O     . ILE E  1 112 ? -18.121 -19.651 72.454 1.00 25.65  ? 112  ILE E O     1 
ATOM   3657  C  CB    . ILE E  1 112 ? -15.572 -18.892 70.575 1.00 23.77  ? 112  ILE E CB    1 
ATOM   3658  C  CG1   . ILE E  1 112 ? -14.060 -18.873 70.720 1.00 24.13  ? 112  ILE E CG1   1 
ATOM   3659  C  CG2   . ILE E  1 112 ? -16.196 -17.611 71.118 1.00 22.08  ? 112  ILE E CG2   1 
ATOM   3660  C  CD1   . ILE E  1 112 ? -13.396 -17.916 69.796 1.00 27.41  ? 112  ILE E CD1   1 
ATOM   3661  N  N     . HIS E  1 113 ? -18.334 -20.504 70.393 1.00 25.75  ? 113  HIS E N     1 
ATOM   3662  C  CA    . HIS E  1 113 ? -19.779 -20.529 70.443 1.00 26.03  ? 113  HIS E CA    1 
ATOM   3663  C  C     . HIS E  1 113 ? -20.270 -21.428 71.569 1.00 27.01  ? 113  HIS E C     1 
ATOM   3664  O  O     . HIS E  1 113 ? -21.275 -21.126 72.225 1.00 27.48  ? 113  HIS E O     1 
ATOM   3665  C  CB    . HIS E  1 113 ? -20.321 -21.021 69.112 1.00 25.74  ? 113  HIS E CB    1 
ATOM   3666  C  CG    . HIS E  1 113 ? -21.805 -20.936 69.000 1.00 25.00  ? 113  HIS E CG    1 
ATOM   3667  N  ND1   . HIS E  1 113 ? -22.482 -19.734 69.024 1.00 22.26  ? 113  HIS E ND1   1 
ATOM   3668  C  CD2   . HIS E  1 113 ? -22.744 -21.906 68.862 1.00 24.28  ? 113  HIS E CD2   1 
ATOM   3669  C  CE1   . HIS E  1 113 ? -23.778 -19.968 68.900 1.00 23.33  ? 113  HIS E CE1   1 
ATOM   3670  N  NE2   . HIS E  1 113 ? -23.965 -21.276 68.802 1.00 24.31  ? 113  HIS E NE2   1 
ATOM   3671  N  N     . ALA E  1 114 ? -19.552 -22.532 71.770 1.00 27.70  ? 114  ALA E N     1 
ATOM   3672  C  CA    . ALA E  1 114 ? -19.821 -23.501 72.817 1.00 28.31  ? 114  ALA E CA    1 
ATOM   3673  C  C     . ALA E  1 114 ? -19.196 -23.084 74.150 1.00 29.80  ? 114  ALA E C     1 
ATOM   3674  O  O     . ALA E  1 114 ? -19.167 -23.873 75.113 1.00 30.32  ? 114  ALA E O     1 
ATOM   3675  C  CB    . ALA E  1 114 ? -19.279 -24.828 72.407 1.00 27.93  ? 114  ALA E CB    1 
ATOM   3676  N  N     . LYS E  1 115 ? -18.672 -21.858 74.210 1.00 30.72  ? 115  LYS E N     1 
ATOM   3677  C  CA    . LYS E  1 115 ? -18.003 -21.361 75.415 1.00 31.43  ? 115  LYS E CA    1 
ATOM   3678  C  C     . LYS E  1 115 ? -16.782 -22.192 75.838 1.00 30.91  ? 115  LYS E C     1 
ATOM   3679  O  O     . LYS E  1 115 ? -16.525 -22.384 77.023 1.00 31.52  ? 115  LYS E O     1 
ATOM   3680  C  CB    . LYS E  1 115 ? -19.000 -21.243 76.564 1.00 32.09  ? 115  LYS E CB    1 
ATOM   3681  C  CG    . LYS E  1 115 ? -20.038 -20.133 76.379 1.00 35.58  ? 115  LYS E CG    1 
ATOM   3682  C  CD    . LYS E  1 115 ? -21.446 -20.685 76.674 1.00 41.06  ? 115  LYS E CD    1 
ATOM   3683  C  CE    . LYS E  1 115 ? -22.300 -19.681 77.465 1.00 44.75  ? 115  LYS E CE    1 
ATOM   3684  N  NZ    . LYS E  1 115 ? -22.256 -18.295 76.880 1.00 46.41  ? 115  LYS E NZ    1 
ATOM   3685  N  N     . ARG E  1 116 ? -16.021 -22.670 74.865 1.00 29.85  ? 116  ARG E N     1 
ATOM   3686  C  CA    . ARG E  1 116 ? -14.743 -23.269 75.148 1.00 28.87  ? 116  ARG E CA    1 
ATOM   3687  C  C     . ARG E  1 116 ? -13.677 -22.437 74.479 1.00 28.75  ? 116  ARG E C     1 
ATOM   3688  O  O     . ARG E  1 116 ? -13.978 -21.481 73.785 1.00 29.41  ? 116  ARG E O     1 
ATOM   3689  C  CB    . ARG E  1 116 ? -14.703 -24.680 74.611 1.00 28.71  ? 116  ARG E CB    1 
ATOM   3690  C  CG    . ARG E  1 116 ? -15.726 -25.594 75.243 1.00 28.81  ? 116  ARG E CG    1 
ATOM   3691  C  CD    . ARG E  1 116 ? -15.646 -26.996 74.660 1.00 29.31  ? 116  ARG E CD    1 
ATOM   3692  N  NE    . ARG E  1 116 ? -16.528 -27.180 73.501 1.00 29.19  ? 116  ARG E NE    1 
ATOM   3693  C  CZ    . ARG E  1 116 ? -16.133 -27.200 72.229 1.00 27.15  ? 116  ARG E CZ    1 
ATOM   3694  N  NH1   . ARG E  1 116 ? -14.863 -27.034 71.913 1.00 25.70  ? 116  ARG E NH1   1 
ATOM   3695  N  NH2   . ARG E  1 116 ? -17.027 -27.381 71.269 1.00 27.42  ? 116  ARG E NH2   1 
ATOM   3696  N  N     . VAL E  1 117 ? -12.421 -22.789 74.707 1.00 28.40  ? 117  VAL E N     1 
ATOM   3697  C  CA    . VAL E  1 117 ? -11.294 -22.179 74.008 1.00 27.47  ? 117  VAL E CA    1 
ATOM   3698  C  C     . VAL E  1 117 ? -10.458 -23.304 73.411 1.00 26.84  ? 117  VAL E C     1 
ATOM   3699  O  O     . VAL E  1 117 ? -9.404  -23.072 72.851 1.00 27.10  ? 117  VAL E O     1 
ATOM   3700  C  CB    . VAL E  1 117 ? -10.445 -21.290 74.959 1.00 27.51  ? 117  VAL E CB    1 
ATOM   3701  C  CG1   . VAL E  1 117 ? -11.328 -20.249 75.619 1.00 28.13  ? 117  VAL E CG1   1 
ATOM   3702  C  CG2   . VAL E  1 117 ? -9.756  -22.120 76.041 1.00 27.56  ? 117  VAL E CG2   1 
ATOM   3703  N  N     . THR E  1 118 ? -10.946 -24.528 73.544 1.00 26.15  ? 118  THR E N     1 
ATOM   3704  C  CA    . THR E  1 118 ? -10.263 -25.692 73.026 1.00 26.14  ? 118  THR E CA    1 
ATOM   3705  C  C     . THR E  1 118 ? -11.020 -26.247 71.829 1.00 25.94  ? 118  THR E C     1 
ATOM   3706  O  O     . THR E  1 118 ? -12.167 -26.658 71.979 1.00 25.50  ? 118  THR E O     1 
ATOM   3707  C  CB    . THR E  1 118 ? -10.234 -26.814 74.076 1.00 26.00  ? 118  THR E CB    1 
ATOM   3708  O  OG1   . THR E  1 118 ? -9.980  -26.259 75.369 1.00 26.61  ? 118  THR E OG1   1 
ATOM   3709  C  CG2   . THR E  1 118 ? -9.177  -27.850 73.729 1.00 25.08  ? 118  THR E CG2   1 
ATOM   3710  N  N     . ILE E  1 119 ? -10.379 -26.303 70.662 1.00 25.80  ? 119  ILE E N     1 
ATOM   3711  C  CA    . ILE E  1 119 ? -11.040 -26.875 69.494 1.00 25.95  ? 119  ILE E CA    1 
ATOM   3712  C  C     . ILE E  1 119 ? -11.115 -28.398 69.594 1.00 26.39  ? 119  ILE E C     1 
ATOM   3713  O  O     . ILE E  1 119 ? -10.151 -29.052 69.958 1.00 26.60  ? 119  ILE E O     1 
ATOM   3714  C  CB    . ILE E  1 119 ? -10.420 -26.424 68.153 1.00 25.44  ? 119  ILE E CB    1 
ATOM   3715  C  CG1   . ILE E  1 119 ? -8.945  -26.798 68.065 1.00 26.60  ? 119  ILE E CG1   1 
ATOM   3716  C  CG2   . ILE E  1 119 ? -10.585 -24.949 67.963 1.00 25.84  ? 119  ILE E CG2   1 
ATOM   3717  C  CD1   . ILE E  1 119 ? -8.373  -26.774 66.662 1.00 25.64  ? 119  ILE E CD1   1 
ATOM   3718  N  N     . MET E  1 120 ? -12.274 -28.959 69.286 1.00 26.95  ? 120  MET E N     1 
ATOM   3719  C  CA    . MET E  1 120 ? -12.444 -30.401 69.320 1.00 28.49  ? 120  MET E CA    1 
ATOM   3720  C  C     . MET E  1 120 ? -12.945 -30.885 67.974 1.00 28.03  ? 120  MET E C     1 
ATOM   3721  O  O     . MET E  1 120 ? -13.423 -30.072 67.180 1.00 28.12  ? 120  MET E O     1 
ATOM   3722  C  CB    . MET E  1 120 ? -13.420 -30.762 70.422 1.00 28.03  ? 120  MET E CB    1 
ATOM   3723  C  CG    . MET E  1 120 ? -12.947 -30.257 71.767 1.00 30.11  ? 120  MET E CG    1 
ATOM   3724  S  SD    . MET E  1 120 ? -14.186 -30.348 73.065 1.00 32.05  ? 120  MET E SD    1 
ATOM   3725  C  CE    . MET E  1 120 ? -14.325 -32.144 73.270 1.00 29.90  ? 120  MET E CE    1 
ATOM   3726  N  N     . PRO E  1 121 ? -12.833 -32.200 67.692 1.00 28.00  ? 121  PRO E N     1 
ATOM   3727  C  CA    . PRO E  1 121 ? -13.323 -32.695 66.400 1.00 28.14  ? 121  PRO E CA    1 
ATOM   3728  C  C     . PRO E  1 121 ? -14.766 -32.273 66.064 1.00 28.37  ? 121  PRO E C     1 
ATOM   3729  O  O     . PRO E  1 121 ? -15.080 -32.046 64.895 1.00 29.29  ? 121  PRO E O     1 
ATOM   3730  C  CB    . PRO E  1 121 ? -13.206 -34.218 66.540 1.00 27.57  ? 121  PRO E CB    1 
ATOM   3731  C  CG    . PRO E  1 121 ? -12.105 -34.407 67.475 1.00 27.11  ? 121  PRO E CG    1 
ATOM   3732  C  CD    . PRO E  1 121 ? -12.256 -33.294 68.487 1.00 27.82  ? 121  PRO E CD    1 
ATOM   3733  N  N     . LYS E  1 122 ? -15.632 -32.136 67.055 1.00 28.06  ? 122  LYS E N     1 
ATOM   3734  C  CA    . LYS E  1 122 ? -17.007 -31.773 66.726 1.00 28.20  ? 122  LYS E CA    1 
ATOM   3735  C  C     . LYS E  1 122 ? -17.121 -30.333 66.232 1.00 27.14  ? 122  LYS E C     1 
ATOM   3736  O  O     . LYS E  1 122 ? -18.105 -29.974 65.604 1.00 26.88  ? 122  LYS E O     1 
ATOM   3737  C  CB    . LYS E  1 122 ? -17.989 -32.070 67.877 1.00 28.47  ? 122  LYS E CB    1 
ATOM   3738  C  CG    . LYS E  1 122 ? -17.769 -31.259 69.126 1.00 31.07  ? 122  LYS E CG    1 
ATOM   3739  C  CD    . LYS E  1 122 ? -18.733 -31.673 70.206 1.00 35.90  ? 122  LYS E CD    1 
ATOM   3740  C  CE    . LYS E  1 122 ? -18.340 -31.053 71.524 1.00 38.60  ? 122  LYS E CE    1 
ATOM   3741  N  NZ    . LYS E  1 122 ? -18.680 -31.989 72.631 1.00 42.51  ? 122  LYS E NZ    1 
ATOM   3742  N  N     . ASP E  1 123 ? -16.116 -29.522 66.515 1.00 26.47  ? 123  ASP E N     1 
ATOM   3743  C  CA    . ASP E  1 123 ? -16.084 -28.172 65.992 1.00 26.43  ? 123  ASP E CA    1 
ATOM   3744  C  C     . ASP E  1 123 ? -15.656 -28.190 64.530 1.00 26.19  ? 123  ASP E C     1 
ATOM   3745  O  O     . ASP E  1 123 ? -16.122 -27.380 63.745 1.00 26.09  ? 123  ASP E O     1 
ATOM   3746  C  CB    . ASP E  1 123 ? -15.120 -27.298 66.784 1.00 26.72  ? 123  ASP E CB    1 
ATOM   3747  C  CG    . ASP E  1 123 ? -15.546 -27.107 68.227 1.00 28.40  ? 123  ASP E CG    1 
ATOM   3748  O  OD1   . ASP E  1 123 ? -16.748 -26.830 68.452 1.00 32.10  ? 123  ASP E OD1   1 
ATOM   3749  O  OD2   . ASP E  1 123 ? -14.682 -27.206 69.135 1.00 26.71  ? 123  ASP E OD2   1 
ATOM   3750  N  N     . ILE E  1 124 ? -14.763 -29.109 64.165 1.00 25.87  ? 124  ILE E N     1 
ATOM   3751  C  CA    . ILE E  1 124 ? -14.314 -29.216 62.787 1.00 25.47  ? 124  ILE E CA    1 
ATOM   3752  C  C     . ILE E  1 124 ? -15.499 -29.739 62.007 1.00 26.15  ? 124  ILE E C     1 
ATOM   3753  O  O     . ILE E  1 124 ? -15.832 -29.229 60.939 1.00 26.26  ? 124  ILE E O     1 
ATOM   3754  C  CB    . ILE E  1 124 ? -13.122 -30.178 62.619 1.00 25.40  ? 124  ILE E CB    1 
ATOM   3755  C  CG1   . ILE E  1 124 ? -11.884 -29.631 63.334 1.00 24.88  ? 124  ILE E CG1   1 
ATOM   3756  C  CG2   . ILE E  1 124 ? -12.825 -30.398 61.145 1.00 24.31  ? 124  ILE E CG2   1 
ATOM   3757  C  CD1   . ILE E  1 124 ? -10.566 -30.300 62.934 1.00 24.71  ? 124  ILE E CD1   1 
ATOM   3758  N  N     . GLN E  1 125 ? -16.164 -30.731 62.582 1.00 26.51  ? 125  GLN E N     1 
ATOM   3759  C  CA    . GLN E  1 125 ? -17.337 -31.314 61.970 1.00 26.78  ? 125  GLN E CA    1 
ATOM   3760  C  C     . GLN E  1 125 ? -18.460 -30.321 61.752 1.00 26.57  ? 125  GLN E C     1 
ATOM   3761  O  O     . GLN E  1 125 ? -19.109 -30.376 60.722 1.00 27.51  ? 125  GLN E O     1 
ATOM   3762  C  CB    . GLN E  1 125 ? -17.822 -32.513 62.771 1.00 26.85  ? 125  GLN E CB    1 
ATOM   3763  C  CG    . GLN E  1 125 ? -17.032 -33.789 62.458 1.00 29.19  ? 125  GLN E CG    1 
ATOM   3764  C  CD    . GLN E  1 125 ? -16.857 -34.693 63.664 1.00 32.40  ? 125  GLN E CD    1 
ATOM   3765  O  OE1   . GLN E  1 125 ? -15.808 -35.312 63.829 1.00 34.08  ? 125  GLN E OE1   1 
ATOM   3766  N  NE2   . GLN E  1 125 ? -17.871 -34.757 64.525 1.00 33.23  ? 125  GLN E NE2   1 
ATOM   3767  N  N     . LEU E  1 126 ? -18.699 -29.419 62.692 1.00 26.09  ? 126  LEU E N     1 
ATOM   3768  C  CA    . LEU E  1 126 ? -19.850 -28.555 62.560 1.00 26.25  ? 126  LEU E CA    1 
ATOM   3769  C  C     . LEU E  1 126 ? -19.513 -27.521 61.507 1.00 26.73  ? 126  LEU E C     1 
ATOM   3770  O  O     . LEU E  1 126 ? -20.351 -27.189 60.677 1.00 27.00  ? 126  LEU E O     1 
ATOM   3771  C  CB    . LEU E  1 126 ? -20.241 -27.896 63.894 1.00 26.19  ? 126  LEU E CB    1 
ATOM   3772  C  CG    . LEU E  1 126 ? -21.365 -26.848 63.840 1.00 26.17  ? 126  LEU E CG    1 
ATOM   3773  C  CD1   . LEU E  1 126 ? -22.722 -27.489 63.736 1.00 27.47  ? 126  LEU E CD1   1 
ATOM   3774  C  CD2   . LEU E  1 126 ? -21.364 -25.945 65.030 1.00 26.40  ? 126  LEU E CD2   1 
ATOM   3775  N  N     . ALA E  1 127 ? -18.283 -27.026 61.530 1.00 26.91  ? 127  ALA E N     1 
ATOM   3776  C  CA    . ALA E  1 127 ? -17.823 -26.095 60.509 1.00 27.61  ? 127  ALA E CA    1 
ATOM   3777  C  C     . ALA E  1 127 ? -17.982 -26.652 59.089 1.00 28.43  ? 127  ALA E C     1 
ATOM   3778  O  O     . ALA E  1 127 ? -18.416 -25.945 58.180 1.00 28.48  ? 127  ALA E O     1 
ATOM   3779  C  CB    . ALA E  1 127 ? -16.383 -25.712 60.754 1.00 27.63  ? 127  ALA E CB    1 
ATOM   3780  N  N     . ARG E  1 128 ? -17.630 -27.918 58.895 1.00 28.91  ? 128  ARG E N     1 
ATOM   3781  C  CA    . ARG E  1 128 ? -17.702 -28.503 57.574 1.00 29.25  ? 128  ARG E CA    1 
ATOM   3782  C  C     . ARG E  1 128 ? -19.144 -28.772 57.176 1.00 30.26  ? 128  ARG E C     1 
ATOM   3783  O  O     . ARG E  1 128 ? -19.493 -28.681 56.000 1.00 30.45  ? 128  ARG E O     1 
ATOM   3784  C  CB    . ARG E  1 128 ? -16.829 -29.746 57.488 1.00 28.63  ? 128  ARG E CB    1 
ATOM   3785  C  CG    . ARG E  1 128 ? -15.358 -29.428 57.694 1.00 28.52  ? 128  ARG E CG    1 
ATOM   3786  C  CD    . ARG E  1 128 ? -14.478 -30.657 57.678 1.00 29.07  ? 128  ARG E CD    1 
ATOM   3787  N  NE    . ARG E  1 128 ? -14.254 -31.125 56.318 1.00 31.43  ? 128  ARG E NE    1 
ATOM   3788  C  CZ    . ARG E  1 128 ? -14.742 -32.255 55.825 1.00 32.14  ? 128  ARG E CZ    1 
ATOM   3789  N  NH1   . ARG E  1 128 ? -15.457 -33.056 56.588 1.00 32.93  ? 128  ARG E NH1   1 
ATOM   3790  N  NH2   . ARG E  1 128 ? -14.508 -32.590 54.570 1.00 34.09  ? 128  ARG E NH2   1 
ATOM   3791  N  N     . ARG E  1 129 ? -19.996 -29.097 58.143 1.00 31.43  ? 129  ARG E N     1 
ATOM   3792  C  CA    . ARG E  1 129 ? -21.395 -29.311 57.818 1.00 32.62  ? 129  ARG E CA    1 
ATOM   3793  C  C     . ARG E  1 129 ? -22.005 -27.983 57.391 1.00 32.49  ? 129  ARG E C     1 
ATOM   3794  O  O     . ARG E  1 129 ? -22.724 -27.931 56.412 1.00 32.47  ? 129  ARG E O     1 
ATOM   3795  C  CB    . ARG E  1 129 ? -22.162 -29.962 58.963 1.00 32.87  ? 129  ARG E CB    1 
ATOM   3796  C  CG    . ARG E  1 129 ? -23.623 -30.285 58.635 1.00 37.05  ? 129  ARG E CG    1 
ATOM   3797  C  CD    . ARG E  1 129 ? -24.083 -31.584 59.350 1.00 43.42  ? 129  ARG E CD    1 
ATOM   3798  N  NE    . ARG E  1 129 ? -25.534 -31.818 59.224 1.00 48.06  ? 129  ARG E NE    1 
ATOM   3799  C  CZ    . ARG E  1 129 ? -26.308 -32.397 60.154 1.00 48.86  ? 129  ARG E CZ    1 
ATOM   3800  N  NH1   . ARG E  1 129 ? -25.800 -32.809 61.316 1.00 48.06  ? 129  ARG E NH1   1 
ATOM   3801  N  NH2   . ARG E  1 129 ? -27.613 -32.546 59.927 1.00 49.38  ? 129  ARG E NH2   1 
ATOM   3802  N  N     . ILE E  1 130 ? -21.670 -26.901 58.077 1.00 32.97  ? 130  ILE E N     1 
ATOM   3803  C  CA    . ILE E  1 130 ? -22.241 -25.598 57.713 1.00 33.73  ? 130  ILE E CA    1 
ATOM   3804  C  C     . ILE E  1 130 ? -21.714 -25.048 56.385 1.00 34.45  ? 130  ILE E C     1 
ATOM   3805  O  O     . ILE E  1 130 ? -22.477 -24.484 55.617 1.00 34.93  ? 130  ILE E O     1 
ATOM   3806  C  CB    . ILE E  1 130 ? -22.128 -24.566 58.845 1.00 33.29  ? 130  ILE E CB    1 
ATOM   3807  C  CG1   . ILE E  1 130 ? -22.975 -25.018 60.031 1.00 33.43  ? 130  ILE E CG1   1 
ATOM   3808  C  CG2   . ILE E  1 130 ? -22.629 -23.200 58.390 1.00 32.86  ? 130  ILE E CG2   1 
ATOM   3809  C  CD1   . ILE E  1 130 ? -22.662 -24.276 61.307 1.00 34.13  ? 130  ILE E CD1   1 
ATOM   3810  N  N     . ARG E  1 131 ? -20.422 -25.228 56.124 1.00 35.45  ? 131  ARG E N     1 
ATOM   3811  C  CA    . ARG E  1 131 ? -19.790 -24.864 54.850 1.00 36.38  ? 131  ARG E CA    1 
ATOM   3812  C  C     . ARG E  1 131 ? -20.322 -25.640 53.642 1.00 37.90  ? 131  ARG E C     1 
ATOM   3813  O  O     . ARG E  1 131 ? -19.959 -25.339 52.507 1.00 38.54  ? 131  ARG E O     1 
ATOM   3814  C  CB    . ARG E  1 131 ? -18.300 -25.141 54.917 1.00 35.71  ? 131  ARG E CB    1 
ATOM   3815  C  CG    . ARG E  1 131 ? -17.479 -24.088 55.540 1.00 34.28  ? 131  ARG E CG    1 
ATOM   3816  C  CD    . ARG E  1 131 ? -16.173 -24.717 55.958 1.00 33.37  ? 131  ARG E CD    1 
ATOM   3817  N  NE    . ARG E  1 131 ? -15.121 -23.733 56.170 1.00 31.99  ? 131  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E  1 131 ? -13.920 -23.795 55.609 1.00 31.51  ? 131  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E  1 131 ? -13.608 -24.809 54.813 1.00 30.81  ? 131  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E  1 131 ? -13.018 -22.849 55.866 1.00 31.49  ? 131  ARG E NH2   1 
ATOM   3821  N  N     . GLY E  1 132 ? -21.145 -26.654 53.873 1.00 39.25  ? 132  GLY E N     1 
ATOM   3822  C  CA    . GLY E  1 132 ? -21.712 -27.421 52.775 1.00 41.06  ? 132  GLY E CA    1 
ATOM   3823  C  C     . GLY E  1 132 ? -20.785 -28.488 52.248 1.00 42.60  ? 132  GLY E C     1 
ATOM   3824  O  O     . GLY E  1 132 ? -21.134 -29.200 51.316 1.00 42.58  ? 132  GLY E O     1 
ATOM   3825  N  N     . GLU E  1 133 ? -19.601 -28.600 52.848 1.00 44.76  ? 133  GLU E N     1 
ATOM   3826  C  CA    . GLU E  1 133 ? -18.653 -29.681 52.555 1.00 46.55  ? 133  GLU E CA    1 
ATOM   3827  C  C     . GLU E  1 133 ? -19.164 -31.065 52.960 1.00 48.60  ? 133  GLU E C     1 
ATOM   3828  O  O     . GLU E  1 133 ? -18.797 -32.070 52.339 1.00 48.87  ? 133  GLU E O     1 
ATOM   3829  C  CB    . GLU E  1 133 ? -17.329 -29.424 53.252 1.00 45.89  ? 133  GLU E CB    1 
ATOM   3830  C  CG    . GLU E  1 133 ? -16.472 -28.393 52.573 1.00 45.76  ? 133  GLU E CG    1 
ATOM   3831  C  CD    . GLU E  1 133 ? -15.184 -28.104 53.327 1.00 45.93  ? 133  GLU E CD    1 
ATOM   3832  O  OE1   . GLU E  1 133 ? -14.547 -29.055 53.857 1.00 45.82  ? 133  GLU E OE1   1 
ATOM   3833  O  OE2   . GLU E  1 133 ? -14.809 -26.916 53.382 1.00 45.48  ? 133  GLU E OE2   1 
ATOM   3834  N  N     . ARG E  1 134 ? -20.001 -31.125 54.000 1.00 51.20  ? 134  ARG E N     1 
ATOM   3835  C  CA    . ARG E  1 134 ? -20.521 -32.421 54.480 1.00 53.82  ? 134  ARG E CA    1 
ATOM   3836  C  C     . ARG E  1 134 ? -21.964 -32.769 54.085 1.00 54.70  ? 134  ARG E C     1 
ATOM   3837  O  O     . ARG E  1 134 ? -22.184 -33.713 53.305 1.00 55.35  ? 134  ARG E O     1 
ATOM   3838  C  CB    . ARG E  1 134 ? -20.317 -32.604 55.996 1.00 54.06  ? 134  ARG E CB    1 
ATOM   3839  C  CG    . ARG E  1 134 ? -18.960 -33.172 56.363 1.00 56.69  ? 134  ARG E CG    1 
ATOM   3840  C  CD    . ARG E  1 134 ? -18.693 -34.555 55.724 1.00 61.31  ? 134  ARG E CD    1 
ATOM   3841  N  NE    . ARG E  1 134 ? -17.385 -35.085 56.138 1.00 64.44  ? 134  ARG E NE    1 
ATOM   3842  C  CZ    . ARG E  1 134 ? -16.998 -36.359 56.055 1.00 65.63  ? 134  ARG E CZ    1 
ATOM   3843  N  NH1   . ARG E  1 134 ? -17.817 -37.284 55.560 1.00 66.64  ? 134  ARG E NH1   1 
ATOM   3844  N  NH2   . ARG E  1 134 ? -15.782 -36.709 56.480 1.00 65.70  ? 134  ARG E NH2   1 
ATOM   3845  N  N     . ALA E  1 135 ? -22.934 -32.032 54.633 1.00 55.59  ? 135  ALA E N     1 
ATOM   3846  C  CA    . ALA E  1 135 ? -24.356 -32.391 54.488 1.00 56.39  ? 135  ALA E CA    1 
ATOM   3847  C  C     . ALA E  1 135 ? -25.298 -31.169 54.515 1.00 56.80  ? 135  ALA E C     1 
ATOM   3848  O  O     . ALA E  1 135 ? -24.945 -30.075 54.029 1.00 56.81  ? 135  ALA E O     1 
ATOM   3849  C  CB    . ALA E  1 135 ? -24.778 -33.460 55.558 1.00 56.13  ? 135  ALA E CB    1 
ATOM   3850  O  OXT   . ALA E  1 135 ? -26.438 -31.259 55.011 1.00 57.06  ? 135  ALA E OXT   1 
ATOM   3851  N  N     . LYS F  2 16  ? 19.584  -49.743 38.595 1.00 86.86  ? 16   LYS F N     1 
ATOM   3852  C  CA    . LYS F  2 16  ? 19.535  -48.276 38.313 1.00 86.92  ? 16   LYS F CA    1 
ATOM   3853  C  C     . LYS F  2 16  ? 18.109  -47.675 38.417 1.00 86.73  ? 16   LYS F C     1 
ATOM   3854  O  O     . LYS F  2 16  ? 17.961  -46.439 38.405 1.00 87.02  ? 16   LYS F O     1 
ATOM   3855  C  CB    . LYS F  2 16  ? 20.164  -47.970 36.942 1.00 86.95  ? 16   LYS F CB    1 
ATOM   3856  C  CG    . LYS F  2 16  ? 20.734  -46.555 36.803 1.00 87.17  ? 16   LYS F CG    1 
ATOM   3857  C  CD    . LYS F  2 16  ? 20.948  -46.172 35.339 1.00 87.27  ? 16   LYS F CD    1 
ATOM   3858  C  CE    . LYS F  2 16  ? 21.117  -44.659 35.181 1.00 88.07  ? 16   LYS F CE    1 
ATOM   3859  N  NZ    . LYS F  2 16  ? 21.166  -44.202 33.754 1.00 87.79  ? 16   LYS F NZ    1 
ATOM   3860  N  N     . ARG F  2 17  ? 17.077  -48.532 38.525 1.00 86.11  ? 17   ARG F N     1 
ATOM   3861  C  CA    . ARG F  2 17  ? 15.665  -48.072 38.675 1.00 85.13  ? 17   ARG F CA    1 
ATOM   3862  C  C     . ARG F  2 17  ? 14.959  -48.419 40.002 1.00 83.80  ? 17   ARG F C     1 
ATOM   3863  O  O     . ARG F  2 17  ? 14.857  -49.588 40.395 1.00 83.57  ? 17   ARG F O     1 
ATOM   3864  C  CB    . ARG F  2 17  ? 14.799  -48.429 37.448 1.00 85.52  ? 17   ARG F CB    1 
ATOM   3865  C  CG    . ARG F  2 17  ? 14.333  -47.196 36.656 1.00 86.42  ? 17   ARG F CG    1 
ATOM   3866  C  CD    . ARG F  2 17  ? 15.504  -46.273 36.305 1.00 88.45  ? 17   ARG F CD    1 
ATOM   3867  N  NE    . ARG F  2 17  ? 15.307  -44.905 36.795 1.00 89.93  ? 17   ARG F NE    1 
ATOM   3868  C  CZ    . ARG F  2 17  ? 16.271  -43.987 36.904 1.00 90.61  ? 17   ARG F CZ    1 
ATOM   3869  N  NH1   . ARG F  2 17  ? 17.528  -44.272 36.564 1.00 90.62  ? 17   ARG F NH1   1 
ATOM   3870  N  NH2   . ARG F  2 17  ? 15.978  -42.774 37.358 1.00 90.82  ? 17   ARG F NH2   1 
ATOM   3871  N  N     . HIS F  2 18  ? 14.431  -47.362 40.629 1.00 82.13  ? 18   HIS F N     1 
ATOM   3872  C  CA    . HIS F  2 18  ? 14.100  -47.289 42.067 1.00 80.41  ? 18   HIS F CA    1 
ATOM   3873  C  C     . HIS F  2 18  ? 12.587  -47.410 42.390 1.00 78.03  ? 18   HIS F C     1 
ATOM   3874  O  O     . HIS F  2 18  ? 11.981  -48.493 42.269 1.00 77.44  ? 18   HIS F O     1 
ATOM   3875  C  CB    . HIS F  2 18  ? 14.659  -45.945 42.604 1.00 81.23  ? 18   HIS F CB    1 
ATOM   3876  C  CG    . HIS F  2 18  ? 15.102  -45.963 44.044 1.00 83.90  ? 18   HIS F CG    1 
ATOM   3877  N  ND1   . HIS F  2 18  ? 14.861  -44.909 44.907 1.00 86.24  ? 18   HIS F ND1   1 
ATOM   3878  C  CD2   . HIS F  2 18  ? 15.806  -46.877 44.759 1.00 85.69  ? 18   HIS F CD2   1 
ATOM   3879  C  CE1   . HIS F  2 18  ? 15.380  -45.182 46.092 1.00 86.90  ? 18   HIS F CE1   1 
ATOM   3880  N  NE2   . HIS F  2 18  ? 15.961  -46.368 46.029 1.00 86.97  ? 18   HIS F NE2   1 
ATOM   3881  N  N     . ARG F  2 19  ? 12.007  -46.265 42.775 1.00 75.12  ? 19   ARG F N     1 
ATOM   3882  C  CA    . ARG F  2 19  ? 10.627  -46.118 43.277 1.00 71.96  ? 19   ARG F CA    1 
ATOM   3883  C  C     . ARG F  2 19  ? 10.273  -47.085 44.409 1.00 68.65  ? 19   ARG F C     1 
ATOM   3884  O  O     . ARG F  2 19  ? 9.730   -48.162 44.184 1.00 68.32  ? 19   ARG F O     1 
ATOM   3885  C  CB    . ARG F  2 19  ? 9.587   -46.090 42.136 1.00 72.33  ? 19   ARG F CB    1 
ATOM   3886  C  CG    . ARG F  2 19  ? 9.408   -44.678 41.533 1.00 73.30  ? 19   ARG F CG    1 
ATOM   3887  C  CD    . ARG F  2 19  ? 8.695   -44.640 40.160 1.00 73.42  ? 19   ARG F CD    1 
ATOM   3888  N  NE    . ARG F  2 19  ? 8.798   -43.296 39.565 1.00 76.69  ? 19   ARG F NE    1 
ATOM   3889  C  CZ    . ARG F  2 19  ? 8.067   -42.820 38.549 1.00 76.98  ? 19   ARG F CZ    1 
ATOM   3890  N  NH1   . ARG F  2 19  ? 7.136   -43.562 37.954 1.00 77.36  ? 19   ARG F NH1   1 
ATOM   3891  N  NH2   . ARG F  2 19  ? 8.273   -41.579 38.125 1.00 76.64  ? 19   ARG F NH2   1 
ATOM   3892  N  N     . LYS F  2 20  ? 10.629  -46.678 45.625 1.00 64.71  ? 20   LYS F N     1 
ATOM   3893  C  CA    . LYS F  2 20  ? 10.231  -47.364 46.845 1.00 60.77  ? 20   LYS F CA    1 
ATOM   3894  C  C     . LYS F  2 20  ? 8.729   -47.193 47.113 1.00 57.96  ? 20   LYS F C     1 
ATOM   3895  O  O     . LYS F  2 20  ? 8.132   -46.173 46.776 1.00 57.35  ? 20   LYS F O     1 
ATOM   3896  C  CB    . LYS F  2 20  ? 11.030  -46.832 48.036 1.00 61.00  ? 20   LYS F CB    1 
ATOM   3897  C  CG    . LYS F  2 20  ? 10.933  -47.708 49.278 1.00 60.85  ? 20   LYS F CG    1 
ATOM   3898  C  CD    . LYS F  2 20  ? 11.136  -46.909 50.547 1.00 60.82  ? 20   LYS F CD    1 
ATOM   3899  C  CE    . LYS F  2 20  ? 10.290  -47.496 51.665 1.00 61.35  ? 20   LYS F CE    1 
ATOM   3900  N  NZ    . LYS F  2 20  ? 10.245  -46.608 52.852 1.00 61.00  ? 20   LYS F NZ    1 
ATOM   3901  N  N     . VAL F  2 21  ? 8.135   -48.211 47.723 1.00 54.35  ? 21   VAL F N     1 
ATOM   3902  C  CA    . VAL F  2 21  ? 6.735   -48.206 48.076 1.00 50.82  ? 21   VAL F CA    1 
ATOM   3903  C  C     . VAL F  2 21  ? 6.441   -46.992 48.937 1.00 48.82  ? 21   VAL F C     1 
ATOM   3904  O  O     . VAL F  2 21  ? 7.189   -46.671 49.861 1.00 48.54  ? 21   VAL F O     1 
ATOM   3905  C  CB    . VAL F  2 21  ? 6.357   -49.483 48.831 1.00 50.57  ? 21   VAL F CB    1 
ATOM   3906  C  CG1   . VAL F  2 21  ? 4.897   -49.476 49.199 1.00 50.18  ? 21   VAL F CG1   1 
ATOM   3907  C  CG2   . VAL F  2 21  ? 6.659   -50.686 47.982 1.00 51.34  ? 21   VAL F CG2   1 
ATOM   3908  N  N     . LEU F  2 22  ? 5.355   -46.309 48.604 1.00 46.18  ? 22   LEU F N     1 
ATOM   3909  C  CA    . LEU F  2 22  ? 4.893   -45.196 49.383 1.00 43.82  ? 22   LEU F CA    1 
ATOM   3910  C  C     . LEU F  2 22  ? 3.709   -45.625 50.228 1.00 42.54  ? 22   LEU F C     1 
ATOM   3911  O  O     . LEU F  2 22  ? 2.665   -46.013 49.705 1.00 41.98  ? 22   LEU F O     1 
ATOM   3912  C  CB    . LEU F  2 22  ? 4.499   -44.039 48.474 1.00 43.69  ? 22   LEU F CB    1 
ATOM   3913  C  CG    . LEU F  2 22  ? 5.557   -43.419 47.560 1.00 43.43  ? 22   LEU F CG    1 
ATOM   3914  C  CD1   . LEU F  2 22  ? 4.892   -42.413 46.634 1.00 43.54  ? 22   LEU F CD1   1 
ATOM   3915  C  CD2   . LEU F  2 22  ? 6.709   -42.766 48.335 1.00 43.74  ? 22   LEU F CD2   1 
ATOM   3916  N  N     . ARG F  2 23  ? 3.877   -45.559 51.542 1.00 41.28  ? 23   ARG F N     1 
ATOM   3917  C  CA    . ARG F  2 23  ? 2.762   -45.812 52.438 1.00 40.18  ? 23   ARG F CA    1 
ATOM   3918  C  C     . ARG F  2 23  ? 2.767   -44.957 53.704 1.00 39.56  ? 23   ARG F C     1 
ATOM   3919  O  O     . ARG F  2 23  ? 3.813   -44.708 54.290 1.00 39.48  ? 23   ARG F O     1 
ATOM   3920  C  CB    . ARG F  2 23  ? 2.662   -47.307 52.764 1.00 40.06  ? 23   ARG F CB    1 
ATOM   3921  C  CG    . ARG F  2 23  ? 3.819   -47.856 53.525 1.00 38.67  ? 23   ARG F CG    1 
ATOM   3922  C  CD    . ARG F  2 23  ? 3.926   -49.351 53.357 1.00 37.41  ? 23   ARG F CD    1 
ATOM   3923  N  NE    . ARG F  2 23  ? 5.074   -49.848 54.109 1.00 36.38  ? 23   ARG F NE    1 
ATOM   3924  C  CZ    . ARG F  2 23  ? 4.987   -50.390 55.313 1.00 35.17  ? 23   ARG F CZ    1 
ATOM   3925  N  NH1   . ARG F  2 23  ? 3.805   -50.544 55.902 1.00 35.37  ? 23   ARG F NH1   1 
ATOM   3926  N  NH2   . ARG F  2 23  ? 6.084   -50.785 55.920 1.00 34.88  ? 23   ARG F NH2   1 
ATOM   3927  N  N     . ASP F  2 24  ? 1.578   -44.501 54.096 1.00 38.92  ? 24   ASP F N     1 
ATOM   3928  C  CA    . ASP F  2 24  ? 1.347   -43.848 55.390 1.00 38.49  ? 24   ASP F CA    1 
ATOM   3929  C  C     . ASP F  2 24  ? 2.008   -42.493 55.547 1.00 37.48  ? 24   ASP F C     1 
ATOM   3930  O  O     . ASP F  2 24  ? 2.388   -42.095 56.648 1.00 37.19  ? 24   ASP F O     1 
ATOM   3931  C  CB    . ASP F  2 24  ? 1.791   -44.747 56.532 1.00 38.97  ? 24   ASP F CB    1 
ATOM   3932  C  CG    . ASP F  2 24  ? 1.019   -44.484 57.804 1.00 41.96  ? 24   ASP F CG    1 
ATOM   3933  O  OD1   . ASP F  2 24  ? -0.240  -44.381 57.723 1.00 44.88  ? 24   ASP F OD1   1 
ATOM   3934  O  OD2   . ASP F  2 24  ? 1.665   -44.407 58.883 1.00 44.13  ? 24   ASP F OD2   1 
ATOM   3935  N  N     . ASN F  2 25  ? 2.121   -41.769 54.444 1.00 36.10  ? 25   ASN F N     1 
ATOM   3936  C  CA    . ASN F  2 25  ? 2.744   -40.481 54.476 1.00 34.63  ? 25   ASN F CA    1 
ATOM   3937  C  C     . ASN F  2 25  ? 1.864   -39.431 55.145 1.00 34.00  ? 25   ASN F C     1 
ATOM   3938  O  O     . ASN F  2 25  ? 2.310   -38.322 55.401 1.00 34.32  ? 25   ASN F O     1 
ATOM   3939  C  CB    . ASN F  2 25  ? 3.143   -40.083 53.068 1.00 34.69  ? 25   ASN F CB    1 
ATOM   3940  C  CG    . ASN F  2 25  ? 4.376   -40.826 52.594 1.00 34.99  ? 25   ASN F CG    1 
ATOM   3941  O  OD1   . ASN F  2 25  ? 5.492   -40.502 52.990 1.00 35.99  ? 25   ASN F OD1   1 
ATOM   3942  N  ND2   . ASN F  2 25  ? 4.182   -41.832 51.749 1.00 33.82  ? 25   ASN F ND2   1 
ATOM   3943  N  N     . ILE F  2 26  ? 0.625   -39.784 55.464 1.00 32.92  ? 26   ILE F N     1 
ATOM   3944  C  CA    . ILE F  2 26  ? -0.259  -38.843 56.135 1.00 31.95  ? 26   ILE F CA    1 
ATOM   3945  C  C     . ILE F  2 26  ? 0.292   -38.521 57.528 1.00 31.90  ? 26   ILE F C     1 
ATOM   3946  O  O     . ILE F  2 26  ? 0.040   -37.435 58.087 1.00 31.67  ? 26   ILE F O     1 
ATOM   3947  C  CB    . ILE F  2 26  ? -1.742  -39.341 56.190 1.00 31.57  ? 26   ILE F CB    1 
ATOM   3948  C  CG1   . ILE F  2 26  ? -2.702  -38.183 56.440 1.00 30.51  ? 26   ILE F CG1   1 
ATOM   3949  C  CG2   . ILE F  2 26  ? -1.946  -40.380 57.270 1.00 30.93  ? 26   ILE F CG2   1 
ATOM   3950  C  CD1   . ILE F  2 26  ? -2.670  -37.095 55.404 1.00 30.58  ? 26   ILE F CD1   1 
ATOM   3951  N  N     . GLN F  2 27  ? 1.062   -39.460 58.072 1.00 31.41  ? 27   GLN F N     1 
ATOM   3952  C  CA    . GLN F  2 27  ? 1.722   -39.243 59.352 1.00 31.14  ? 27   GLN F CA    1 
ATOM   3953  C  C     . GLN F  2 27  ? 2.857   -38.251 59.206 1.00 31.00  ? 27   GLN F C     1 
ATOM   3954  O  O     . GLN F  2 27  ? 3.403   -37.798 60.205 1.00 32.02  ? 27   GLN F O     1 
ATOM   3955  C  CB    . GLN F  2 27  ? 2.187   -40.556 59.988 1.00 30.78  ? 27   GLN F CB    1 
ATOM   3956  C  CG    . GLN F  2 27  ? 1.036   -41.501 60.375 1.00 31.69  ? 27   GLN F CG    1 
ATOM   3957  C  CD    . GLN F  2 27  ? 0.013   -40.862 61.313 1.00 33.84  ? 27   GLN F CD    1 
ATOM   3958  O  OE1   . GLN F  2 27  ? 0.380   -40.304 62.340 1.00 37.94  ? 27   GLN F OE1   1 
ATOM   3959  N  NE2   . GLN F  2 27  ? -1.269  -40.945 60.969 1.00 33.27  ? 27   GLN F NE2   1 
ATOM   3960  N  N     . GLY F  2 28  ? 3.183   -37.872 57.974 1.00 30.51  ? 28   GLY F N     1 
ATOM   3961  C  CA    . GLY F  2 28  ? 4.132   -36.780 57.738 1.00 30.65  ? 28   GLY F CA    1 
ATOM   3962  C  C     . GLY F  2 28  ? 3.519   -35.398 57.969 1.00 31.01  ? 28   GLY F C     1 
ATOM   3963  O  O     . GLY F  2 28  ? 4.203   -34.366 57.873 1.00 30.78  ? 28   GLY F O     1 
ATOM   3964  N  N     . ILE F  2 29  ? 2.217   -35.372 58.237 1.00 30.76  ? 29   ILE F N     1 
ATOM   3965  C  CA    . ILE F  2 29  ? 1.571   -34.169 58.690 1.00 30.86  ? 29   ILE F CA    1 
ATOM   3966  C  C     . ILE F  2 29  ? 1.628   -34.321 60.195 1.00 30.77  ? 29   ILE F C     1 
ATOM   3967  O  O     . ILE F  2 29  ? 0.706   -34.881 60.832 1.00 31.15  ? 29   ILE F O     1 
ATOM   3968  C  CB    . ILE F  2 29  ? 0.117   -34.063 58.182 1.00 31.38  ? 29   ILE F CB    1 
ATOM   3969  C  CG1   . ILE F  2 29  ? 0.025   -34.367 56.678 1.00 32.57  ? 29   ILE F CG1   1 
ATOM   3970  C  CG2   . ILE F  2 29  ? -0.462  -32.699 58.486 1.00 31.33  ? 29   ILE F CG2   1 
ATOM   3971  C  CD1   . ILE F  2 29  ? 1.002   -33.541 55.771 1.00 33.09  ? 29   ILE F CD1   1 
ATOM   3972  N  N     . THR F  2 30  ? 2.739   -33.849 60.755 1.00 29.77  ? 30   THR F N     1 
ATOM   3973  C  CA    . THR F  2 30  ? 3.060   -34.092 62.140 1.00 28.96  ? 30   THR F CA    1 
ATOM   3974  C  C     . THR F  2 30  ? 2.243   -33.195 63.031 1.00 28.79  ? 30   THR F C     1 
ATOM   3975  O  O     . THR F  2 30  ? 1.806   -32.135 62.610 1.00 29.07  ? 30   THR F O     1 
ATOM   3976  C  CB    . THR F  2 30  ? 4.516   -33.807 62.424 1.00 28.73  ? 30   THR F CB    1 
ATOM   3977  O  OG1   . THR F  2 30  ? 4.785   -32.451 62.076 1.00 29.91  ? 30   THR F OG1   1 
ATOM   3978  C  CG2   . THR F  2 30  ? 5.427   -34.733 61.631 1.00 28.66  ? 30   THR F CG2   1 
ATOM   3979  N  N     . LYS F  2 31  ? 2.052   -33.643 64.269 1.00 28.25  ? 31   LYS F N     1 
ATOM   3980  C  CA    . LYS F  2 31  ? 1.454   -32.869 65.335 1.00 27.80  ? 31   LYS F CA    1 
ATOM   3981  C  C     . LYS F  2 31  ? 1.900   -31.385 65.404 1.00 27.37  ? 31   LYS F C     1 
ATOM   3982  O  O     . LYS F  2 31  ? 1.059   -30.492 65.522 1.00 27.46  ? 31   LYS F O     1 
ATOM   3983  C  CB    . LYS F  2 31  ? 1.749   -33.596 66.640 1.00 28.25  ? 31   LYS F CB    1 
ATOM   3984  C  CG    . LYS F  2 31  ? 1.092   -33.028 67.854 1.00 30.63  ? 31   LYS F CG    1 
ATOM   3985  C  CD    . LYS F  2 31  ? 1.523   -33.759 69.109 1.00 32.99  ? 31   LYS F CD    1 
ATOM   3986  C  CE    . LYS F  2 31  ? 1.201   -32.885 70.323 1.00 35.62  ? 31   LYS F CE    1 
ATOM   3987  N  NZ    . LYS F  2 31  ? 1.263   -33.682 71.577 1.00 38.19  ? 31   LYS F NZ    1 
ATOM   3988  N  N     . PRO F  2 32  ? 3.220   -31.110 65.369 1.00 26.74  ? 32   PRO F N     1 
ATOM   3989  C  CA    . PRO F  2 32  ? 3.695   -29.716 65.352 1.00 25.99  ? 32   PRO F CA    1 
ATOM   3990  C  C     . PRO F  2 32  ? 3.322   -28.899 64.102 1.00 25.40  ? 32   PRO F C     1 
ATOM   3991  O  O     . PRO F  2 32  ? 3.158   -27.673 64.178 1.00 25.35  ? 32   PRO F O     1 
ATOM   3992  C  CB    . PRO F  2 32  ? 5.220   -29.874 65.410 1.00 26.07  ? 32   PRO F CB    1 
ATOM   3993  C  CG    . PRO F  2 32  ? 5.453   -31.223 65.960 1.00 26.30  ? 32   PRO F CG    1 
ATOM   3994  C  CD    . PRO F  2 32  ? 4.351   -32.058 65.430 1.00 26.83  ? 32   PRO F CD    1 
ATOM   3995  N  N     . ALA F  2 33  ? 3.244   -29.554 62.950 1.00 24.39  ? 33   ALA F N     1 
ATOM   3996  C  CA    . ALA F  2 33  ? 2.835   -28.866 61.742 1.00 23.29  ? 33   ALA F CA    1 
ATOM   3997  C  C     . ALA F  2 33  ? 1.366   -28.477 61.859 1.00 23.07  ? 33   ALA F C     1 
ATOM   3998  O  O     . ALA F  2 33  ? 0.995   -27.351 61.526 1.00 23.45  ? 33   ALA F O     1 
ATOM   3999  C  CB    . ALA F  2 33  ? 3.064   -29.720 60.558 1.00 22.79  ? 33   ALA F CB    1 
ATOM   4000  N  N     . ILE F  2 34  ? 0.537   -29.396 62.356 1.00 22.67  ? 34   ILE F N     1 
ATOM   4001  C  CA    . ILE F  2 34  ? -0.877  -29.108 62.605 1.00 22.24  ? 34   ILE F CA    1 
ATOM   4002  C  C     . ILE F  2 34  ? -1.047  -27.999 63.654 1.00 22.61  ? 34   ILE F C     1 
ATOM   4003  O  O     . ILE F  2 34  ? -1.866  -27.104 63.481 1.00 23.06  ? 34   ILE F O     1 
ATOM   4004  C  CB    . ILE F  2 34  ? -1.649  -30.368 63.034 1.00 22.01  ? 34   ILE F CB    1 
ATOM   4005  C  CG1   . ILE F  2 34  ? -1.626  -31.410 61.907 1.00 21.94  ? 34   ILE F CG1   1 
ATOM   4006  C  CG2   . ILE F  2 34  ? -3.070  -30.010 63.435 1.00 19.96  ? 34   ILE F CG2   1 
ATOM   4007  C  CD1   . ILE F  2 34  ? -2.280  -32.746 62.258 1.00 22.17  ? 34   ILE F CD1   1 
ATOM   4008  N  N     . ARG F  2 35  ? -0.257  -28.042 64.723 1.00 22.57  ? 35   ARG F N     1 
ATOM   4009  C  CA    . ARG F  2 35  ? -0.298  -27.000 65.744 1.00 22.73  ? 35   ARG F CA    1 
ATOM   4010  C  C     . ARG F  2 35  ? 0.003   -25.640 65.143 1.00 21.82  ? 35   ARG F C     1 
ATOM   4011  O  O     . ARG F  2 35  ? -0.690  -24.676 65.426 1.00 21.99  ? 35   ARG F O     1 
ATOM   4012  C  CB    . ARG F  2 35  ? 0.691   -27.306 66.861 1.00 22.57  ? 35   ARG F CB    1 
ATOM   4013  C  CG    . ARG F  2 35  ? 0.749   -26.223 67.925 1.00 25.38  ? 35   ARG F CG    1 
ATOM   4014  C  CD    . ARG F  2 35  ? 1.780   -26.483 69.007 1.00 25.53  ? 35   ARG F CD    1 
ATOM   4015  N  NE    . ARG F  2 35  ? 1.780   -27.875 69.464 1.00 32.48  ? 35   ARG F NE    1 
ATOM   4016  C  CZ    . ARG F  2 35  ? 2.849   -28.670 69.372 1.00 36.77  ? 35   ARG F CZ    1 
ATOM   4017  N  NH1   . ARG F  2 35  ? 3.972   -28.192 68.833 1.00 39.07  ? 35   ARG F NH1   1 
ATOM   4018  N  NH2   . ARG F  2 35  ? 2.814   -29.935 69.810 1.00 37.74  ? 35   ARG F NH2   1 
ATOM   4019  N  N     . ARG F  2 36  ? 1.027   -25.564 64.298 1.00 21.16  ? 36   ARG F N     1 
ATOM   4020  C  CA    . ARG F  2 36  ? 1.403   -24.304 63.677 1.00 20.54  ? 36   ARG F CA    1 
ATOM   4021  C  C     . ARG F  2 36  ? 0.271   -23.781 62.793 1.00 20.22  ? 36   ARG F C     1 
ATOM   4022  O  O     . ARG F  2 36  ? -0.029  -22.583 62.799 1.00 19.98  ? 36   ARG F O     1 
ATOM   4023  C  CB    . ARG F  2 36  ? 2.679   -24.463 62.844 1.00 20.89  ? 36   ARG F CB    1 
ATOM   4024  C  CG    . ARG F  2 36  ? 3.965   -24.566 63.622 1.00 20.71  ? 36   ARG F CG    1 
ATOM   4025  C  CD    . ARG F  2 36  ? 5.173   -24.416 62.721 1.00 20.42  ? 36   ARG F CD    1 
ATOM   4026  N  NE    . ARG F  2 36  ? 5.351   -25.542 61.804 1.00 22.43  ? 36   ARG F NE    1 
ATOM   4027  C  CZ    . ARG F  2 36  ? 6.005   -26.679 62.083 1.00 23.59  ? 36   ARG F CZ    1 
ATOM   4028  N  NH1   . ARG F  2 36  ? 6.553   -26.883 63.286 1.00 21.84  ? 36   ARG F NH1   1 
ATOM   4029  N  NH2   . ARG F  2 36  ? 6.113   -27.625 61.141 1.00 22.18  ? 36   ARG F NH2   1 
ATOM   4030  N  N     . LEU F  2 37  ? -0.353  -24.679 62.035 1.00 19.57  ? 37   LEU F N     1 
ATOM   4031  C  CA    . LEU F  2 37  ? -1.467  -24.296 61.187 1.00 19.53  ? 37   LEU F CA    1 
ATOM   4032  C  C     . LEU F  2 37  ? -2.632  -23.722 62.012 1.00 19.76  ? 37   LEU F C     1 
ATOM   4033  O  O     . LEU F  2 37  ? -3.214  -22.680 61.645 1.00 19.98  ? 37   LEU F O     1 
ATOM   4034  C  CB    . LEU F  2 37  ? -1.931  -25.475 60.331 1.00 19.59  ? 37   LEU F CB    1 
ATOM   4035  C  CG    . LEU F  2 37  ? -0.997  -25.850 59.181 1.00 19.40  ? 37   LEU F CG    1 
ATOM   4036  C  CD1   . LEU F  2 37  ? -1.095  -27.317 58.779 1.00 18.05  ? 37   LEU F CD1   1 
ATOM   4037  C  CD2   . LEU F  2 37  ? -1.261  -24.936 58.008 1.00 19.05  ? 37   LEU F CD2   1 
ATOM   4038  N  N     . ALA F  2 38  ? -2.948  -24.380 63.128 1.00 19.10  ? 38   ALA F N     1 
ATOM   4039  C  CA    . ALA F  2 38  ? -3.996  -23.904 64.021 1.00 19.21  ? 38   ALA F CA    1 
ATOM   4040  C  C     . ALA F  2 38  ? -3.724  -22.499 64.574 1.00 19.25  ? 38   ALA F C     1 
ATOM   4041  O  O     . ALA F  2 38  ? -4.658  -21.704 64.772 1.00 19.25  ? 38   ALA F O     1 
ATOM   4042  C  CB    . ALA F  2 38  ? -4.190  -24.870 65.136 1.00 19.23  ? 38   ALA F CB    1 
ATOM   4043  N  N     . ARG F  2 39  ? -2.441  -22.207 64.797 1.00 19.15  ? 39   ARG F N     1 
ATOM   4044  C  CA    . ARG F  2 39  ? -1.980  -20.918 65.309 1.00 18.86  ? 39   ARG F CA    1 
ATOM   4045  C  C     . ARG F  2 39  ? -2.171  -19.810 64.323 1.00 18.96  ? 39   ARG F C     1 
ATOM   4046  O  O     . ARG F  2 39  ? -2.682  -18.760 64.663 1.00 19.38  ? 39   ARG F O     1 
ATOM   4047  C  CB    . ARG F  2 39  ? -0.513  -20.994 65.672 1.00 18.86  ? 39   ARG F CB    1 
ATOM   4048  C  CG    . ARG F  2 39  ? -0.237  -21.933 66.807 1.00 19.47  ? 39   ARG F CG    1 
ATOM   4049  C  CD    . ARG F  2 39  ? -0.628  -21.344 68.139 1.00 21.25  ? 39   ARG F CD    1 
ATOM   4050  N  NE    . ARG F  2 39  ? -0.135  -22.221 69.178 1.00 23.46  ? 39   ARG F NE    1 
ATOM   4051  C  CZ    . ARG F  2 39  ? -0.912  -22.993 69.921 1.00 25.52  ? 39   ARG F CZ    1 
ATOM   4052  N  NH1   . ARG F  2 39  ? -2.237  -22.962 69.777 1.00 25.95  ? 39   ARG F NH1   1 
ATOM   4053  N  NH2   . ARG F  2 39  ? -0.358  -23.782 70.821 1.00 26.46  ? 39   ARG F NH2   1 
ATOM   4054  N  N     . ARG F  2 40  ? -1.764  -20.043 63.080 1.00 19.26  ? 40   ARG F N     1 
ATOM   4055  C  CA    . ARG F  2 40  ? -2.040  -19.080 62.041 1.00 18.59  ? 40   ARG F CA    1 
ATOM   4056  C  C     . ARG F  2 40  ? -3.529  -18.847 62.035 1.00 18.23  ? 40   ARG F C     1 
ATOM   4057  O  O     . ARG F  2 40  ? -3.974  -17.755 61.761 1.00 18.17  ? 40   ARG F O     1 
ATOM   4058  C  CB    . ARG F  2 40  ? -1.567  -19.589 60.694 1.00 18.66  ? 40   ARG F CB    1 
ATOM   4059  C  CG    . ARG F  2 40  ? -1.536  -18.520 59.610 1.00 18.82  ? 40   ARG F CG    1 
ATOM   4060  C  CD    . ARG F  2 40  ? -0.658  -18.957 58.448 1.00 19.96  ? 40   ARG F CD    1 
ATOM   4061  N  NE    . ARG F  2 40  ? 0.711   -18.504 58.654 1.00 20.87  ? 40   ARG F NE    1 
ATOM   4062  C  CZ    . ARG F  2 40  ? 1.772   -18.917 57.970 1.00 19.69  ? 40   ARG F CZ    1 
ATOM   4063  N  NH1   . ARG F  2 40  ? 1.654   -19.821 57.021 1.00 17.15  ? 40   ARG F NH1   1 
ATOM   4064  N  NH2   . ARG F  2 40  ? 2.963   -18.410 58.254 1.00 20.52  ? 40   ARG F NH2   1 
ATOM   4065  N  N     . GLY F  2 41  ? -4.288  -19.887 62.364 1.00 18.47  ? 41   GLY F N     1 
ATOM   4066  C  CA    . GLY F  2 41  ? -5.744  -19.832 62.367 1.00 18.68  ? 41   GLY F CA    1 
ATOM   4067  C  C     . GLY F  2 41  ? -6.258  -19.174 63.625 1.00 18.95  ? 41   GLY F C     1 
ATOM   4068  O  O     . GLY F  2 41  ? -7.466  -19.052 63.812 1.00 19.72  ? 41   GLY F O     1 
ATOM   4069  N  N     . GLY F  2 42  ? -5.352  -18.747 64.496 1.00 18.79  ? 42   GLY F N     1 
ATOM   4070  C  CA    . GLY F  2 42  ? -5.753  -18.072 65.737 1.00 18.82  ? 42   GLY F CA    1 
ATOM   4071  C  C     . GLY F  2 42  ? -6.288  -18.983 66.834 1.00 18.58  ? 42   GLY F C     1 
ATOM   4072  O  O     . GLY F  2 42  ? -7.008  -18.539 67.727 1.00 18.48  ? 42   GLY F O     1 
ATOM   4073  N  N     . VAL F  2 43  ? -5.926  -20.256 66.771 1.00 18.41  ? 43   VAL F N     1 
ATOM   4074  C  CA    . VAL F  2 43  ? -6.324  -21.209 67.792 1.00 18.49  ? 43   VAL F CA    1 
ATOM   4075  C  C     . VAL F  2 43  ? -5.329  -21.312 68.924 1.00 19.41  ? 43   VAL F C     1 
ATOM   4076  O  O     . VAL F  2 43  ? -4.138  -21.561 68.720 1.00 19.44  ? 43   VAL F O     1 
ATOM   4077  C  CB    . VAL F  2 43  ? -6.519  -22.585 67.221 1.00 17.87  ? 43   VAL F CB    1 
ATOM   4078  C  CG1   . VAL F  2 43  ? -6.812  -23.549 68.318 1.00 16.59  ? 43   VAL F CG1   1 
ATOM   4079  C  CG2   . VAL F  2 43  ? -7.638  -22.540 66.228 1.00 17.73  ? 43   VAL F CG2   1 
ATOM   4080  N  N     . LYS F  2 44  ? -5.860  -21.143 70.130 1.00 21.12  ? 44   LYS F N     1 
ATOM   4081  C  CA    . LYS F  2 44  ? -5.080  -21.123 71.366 1.00 21.74  ? 44   LYS F CA    1 
ATOM   4082  C  C     . LYS F  2 44  ? -4.897  -22.487 72.001 1.00 21.85  ? 44   LYS F C     1 
ATOM   4083  O  O     . LYS F  2 44  ? -3.816  -22.812 72.419 1.00 23.07  ? 44   LYS F O     1 
ATOM   4084  C  CB    . LYS F  2 44  ? -5.742  -20.193 72.357 1.00 21.75  ? 44   LYS F CB    1 
ATOM   4085  C  CG    . LYS F  2 44  ? -4.912  -19.942 73.535 1.00 23.61  ? 44   LYS F CG    1 
ATOM   4086  C  CD    . LYS F  2 44  ? -5.609  -18.997 74.464 1.00 26.54  ? 44   LYS F CD    1 
ATOM   4087  C  CE    . LYS F  2 44  ? -4.786  -18.788 75.700 1.00 26.49  ? 44   LYS F CE    1 
ATOM   4088  N  NZ    . LYS F  2 44  ? -5.518  -17.843 76.534 1.00 27.34  ? 44   LYS F NZ    1 
ATOM   4089  N  N     . ARG F  2 45  ? -5.942  -23.291 72.071 1.00 22.10  ? 45   ARG F N     1 
ATOM   4090  C  CA    . ARG F  2 45  ? -5.854  -24.581 72.730 1.00 22.31  ? 45   ARG F CA    1 
ATOM   4091  C  C     . ARG F  2 45  ? -6.446  -25.661 71.827 1.00 22.43  ? 45   ARG F C     1 
ATOM   4092  O  O     . ARG F  2 45  ? -7.473  -25.445 71.178 1.00 22.79  ? 45   ARG F O     1 
ATOM   4093  C  CB    . ARG F  2 45  ? -6.623  -24.516 74.047 1.00 22.87  ? 45   ARG F CB    1 
ATOM   4094  C  CG    . ARG F  2 45  ? -6.074  -25.352 75.172 1.00 23.53  ? 45   ARG F CG    1 
ATOM   4095  C  CD    . ARG F  2 45  ? -6.696  -24.965 76.517 1.00 23.31  ? 45   ARG F CD    1 
ATOM   4096  N  NE    . ARG F  2 45  ? -6.282  -25.925 77.526 1.00 24.64  ? 45   ARG F NE    1 
ATOM   4097  C  CZ    . ARG F  2 45  ? -6.902  -27.086 77.751 1.00 25.85  ? 45   ARG F CZ    1 
ATOM   4098  N  NH1   . ARG F  2 45  ? -7.990  -27.419 77.075 1.00 24.12  ? 45   ARG F NH1   1 
ATOM   4099  N  NH2   . ARG F  2 45  ? -6.444  -27.919 78.675 1.00 27.69  ? 45   ARG F NH2   1 
ATOM   4100  N  N     . ILE F  2 46  ? -5.811  -26.827 71.811 1.00 22.14  ? 46   ILE F N     1 
ATOM   4101  C  CA    . ILE F  2 46  ? -6.112  -27.878 70.855 1.00 22.14  ? 46   ILE F CA    1 
ATOM   4102  C  C     . ILE F  2 46  ? -6.302  -29.224 71.557 1.00 22.89  ? 46   ILE F C     1 
ATOM   4103  O  O     . ILE F  2 46  ? -5.372  -29.754 72.193 1.00 23.09  ? 46   ILE F O     1 
ATOM   4104  C  CB    . ILE F  2 46  ? -4.955  -28.043 69.838 1.00 21.78  ? 46   ILE F CB    1 
ATOM   4105  C  CG1   . ILE F  2 46  ? -4.776  -26.790 68.997 1.00 21.24  ? 46   ILE F CG1   1 
ATOM   4106  C  CG2   . ILE F  2 46  ? -5.204  -29.237 68.935 1.00 21.78  ? 46   ILE F CG2   1 
ATOM   4107  C  CD1   . ILE F  2 46  ? -3.412  -26.682 68.348 1.00 20.28  ? 46   ILE F CD1   1 
ATOM   4108  N  N     . SER F  2 47  ? -7.494  -29.790 71.409 1.00 23.35  ? 47   SER F N     1 
ATOM   4109  C  CA    . SER F  2 47  ? -7.808  -31.094 71.972 1.00 24.20  ? 47   SER F CA    1 
ATOM   4110  C  C     . SER F  2 47  ? -6.972  -32.172 71.317 1.00 24.34  ? 47   SER F C     1 
ATOM   4111  O  O     . SER F  2 47  ? -6.550  -32.030 70.185 1.00 25.25  ? 47   SER F O     1 
ATOM   4112  C  CB    . SER F  2 47  ? -9.282  -31.398 71.760 1.00 24.33  ? 47   SER F CB    1 
ATOM   4113  O  OG    . SER F  2 47  ? -9.454  -32.762 71.436 1.00 26.55  ? 47   SER F OG    1 
ATOM   4114  N  N     . GLY F  2 48  ? -6.761  -33.274 72.012 1.00 24.73  ? 48   GLY F N     1 
ATOM   4115  C  CA    . GLY F  2 48  ? -5.820  -34.292 71.546 1.00 24.94  ? 48   GLY F CA    1 
ATOM   4116  C  C     . GLY F  2 48  ? -6.256  -35.058 70.318 1.00 25.39  ? 48   GLY F C     1 
ATOM   4117  O  O     . GLY F  2 48  ? -5.424  -35.576 69.581 1.00 26.05  ? 48   GLY F O     1 
ATOM   4118  N  N     . LEU F  2 49  ? -7.555  -35.143 70.081 1.00 25.54  ? 49   LEU F N     1 
ATOM   4119  C  CA    . LEU F  2 49  ? -8.038  -35.885 68.927 1.00 25.93  ? 49   LEU F CA    1 
ATOM   4120  C  C     . LEU F  2 49  ? -8.053  -35.050 67.615 1.00 26.55  ? 49   LEU F C     1 
ATOM   4121  O  O     . LEU F  2 49  ? -8.367  -35.571 66.535 1.00 26.49  ? 49   LEU F O     1 
ATOM   4122  C  CB    . LEU F  2 49  ? -9.413  -36.446 69.234 1.00 25.42  ? 49   LEU F CB    1 
ATOM   4123  C  CG    . LEU F  2 49  ? -9.489  -37.589 70.243 1.00 26.00  ? 49   LEU F CG    1 
ATOM   4124  C  CD1   . LEU F  2 49  ? -10.942 -37.802 70.621 1.00 26.84  ? 49   LEU F CD1   1 
ATOM   4125  C  CD2   . LEU F  2 49  ? -8.886  -38.891 69.705 1.00 25.77  ? 49   LEU F CD2   1 
ATOM   4126  N  N     . ILE F  2 50  ? -7.714  -33.760 67.709 1.00 26.69  ? 50   ILE F N     1 
ATOM   4127  C  CA    . ILE F  2 50  ? -7.766  -32.873 66.545 1.00 26.88  ? 50   ILE F CA    1 
ATOM   4128  C  C     . ILE F  2 50  ? -6.807  -33.358 65.458 1.00 27.19  ? 50   ILE F C     1 
ATOM   4129  O  O     . ILE F  2 50  ? -7.077  -33.197 64.268 1.00 27.31  ? 50   ILE F O     1 
ATOM   4130  C  CB    . ILE F  2 50  ? -7.486  -31.384 66.943 1.00 26.78  ? 50   ILE F CB    1 
ATOM   4131  C  CG1   . ILE F  2 50  ? -8.752  -30.707 67.485 1.00 27.03  ? 50   ILE F CG1   1 
ATOM   4132  C  CG2   . ILE F  2 50  ? -6.876  -30.579 65.807 1.00 25.89  ? 50   ILE F CG2   1 
ATOM   4133  C  CD1   . ILE F  2 50  ? -9.863  -30.479 66.495 1.00 25.95  ? 50   ILE F CD1   1 
ATOM   4134  N  N     . TYR F  2 51  ? -5.701  -33.971 65.867 1.00 27.35  ? 51   TYR F N     1 
ATOM   4135  C  CA    . TYR F  2 51  ? -4.623  -34.266 64.914 1.00 27.72  ? 51   TYR F CA    1 
ATOM   4136  C  C     . TYR F  2 51  ? -5.060  -35.279 63.897 1.00 28.08  ? 51   TYR F C     1 
ATOM   4137  O  O     . TYR F  2 51  ? -4.857  -35.075 62.699 1.00 28.55  ? 51   TYR F O     1 
ATOM   4138  C  CB    . TYR F  2 51  ? -3.299  -34.635 65.600 1.00 26.89  ? 51   TYR F CB    1 
ATOM   4139  C  CG    . TYR F  2 51  ? -2.908  -33.566 66.583 1.00 26.05  ? 51   TYR F CG    1 
ATOM   4140  C  CD1   . TYR F  2 51  ? -3.124  -33.743 67.954 1.00 25.19  ? 51   TYR F CD1   1 
ATOM   4141  C  CD2   . TYR F  2 51  ? -2.393  -32.350 66.143 1.00 24.24  ? 51   TYR F CD2   1 
ATOM   4142  C  CE1   . TYR F  2 51  ? -2.812  -32.757 68.853 1.00 23.82  ? 51   TYR F CE1   1 
ATOM   4143  C  CE2   . TYR F  2 51  ? -2.076  -31.353 67.033 1.00 24.21  ? 51   TYR F CE2   1 
ATOM   4144  C  CZ    . TYR F  2 51  ? -2.288  -31.571 68.383 1.00 25.55  ? 51   TYR F CZ    1 
ATOM   4145  O  OH    . TYR F  2 51  ? -1.972  -30.592 69.275 1.00 28.11  ? 51   TYR F OH    1 
ATOM   4146  N  N     . GLU F  2 52  ? -5.707  -36.335 64.365 1.00 28.37  ? 52   GLU F N     1 
ATOM   4147  C  CA    . GLU F  2 52  ? -6.130  -37.387 63.469 1.00 29.53  ? 52   GLU F CA    1 
ATOM   4148  C  C     . GLU F  2 52  ? -7.304  -36.889 62.588 1.00 28.90  ? 52   GLU F C     1 
ATOM   4149  O  O     . GLU F  2 52  ? -7.426  -37.255 61.425 1.00 29.22  ? 52   GLU F O     1 
ATOM   4150  C  CB    . GLU F  2 52  ? -6.448  -38.660 64.260 1.00 29.60  ? 52   GLU F CB    1 
ATOM   4151  C  CG    . GLU F  2 52  ? -5.968  -39.988 63.619 1.00 34.94  ? 52   GLU F CG    1 
ATOM   4152  C  CD    . GLU F  2 52  ? -4.665  -39.895 62.747 1.00 41.41  ? 52   GLU F CD    1 
ATOM   4153  O  OE1   . GLU F  2 52  ? -4.791  -40.048 61.499 1.00 45.00  ? 52   GLU F OE1   1 
ATOM   4154  O  OE2   . GLU F  2 52  ? -3.536  -39.701 63.282 1.00 41.14  ? 52   GLU F OE2   1 
ATOM   4155  N  N     . GLU F  2 53  ? -8.117  -36.007 63.135 1.00 28.02  ? 53   GLU F N     1 
ATOM   4156  C  CA    . GLU F  2 53  ? -9.226  -35.455 62.420 1.00 27.68  ? 53   GLU F CA    1 
ATOM   4157  C  C     . GLU F  2 53  ? -8.727  -34.584 61.266 1.00 27.40  ? 53   GLU F C     1 
ATOM   4158  O  O     . GLU F  2 53  ? -9.240  -34.674 60.143 1.00 27.34  ? 53   GLU F O     1 
ATOM   4159  C  CB    . GLU F  2 53  ? -10.065 -34.630 63.384 1.00 27.68  ? 53   GLU F CB    1 
ATOM   4160  C  CG    . GLU F  2 53  ? -11.408 -34.217 62.854 1.00 29.68  ? 53   GLU F CG    1 
ATOM   4161  C  CD    . GLU F  2 53  ? -12.460 -35.315 62.945 1.00 34.43  ? 53   GLU F CD    1 
ATOM   4162  O  OE1   . GLU F  2 53  ? -12.221 -36.371 63.587 1.00 35.26  ? 53   GLU F OE1   1 
ATOM   4163  O  OE2   . GLU F  2 53  ? -13.556 -35.111 62.369 1.00 37.67  ? 53   GLU F OE2   1 
ATOM   4164  N  N     . THR F  2 54  ? -7.728  -33.747 61.548 1.00 26.84  ? 54   THR F N     1 
ATOM   4165  C  CA    . THR F  2 54  ? -7.158  -32.827 60.562 1.00 26.07  ? 54   THR F CA    1 
ATOM   4166  C  C     . THR F  2 54  ? -6.494  -33.604 59.422 1.00 25.91  ? 54   THR F C     1 
ATOM   4167  O  O     . THR F  2 54  ? -6.603  -33.237 58.250 1.00 26.08  ? 54   THR F O     1 
ATOM   4168  C  CB    . THR F  2 54  ? -6.133  -31.857 61.211 1.00 26.23  ? 54   THR F CB    1 
ATOM   4169  O  OG1   . THR F  2 54  ? -6.768  -31.063 62.218 1.00 24.80  ? 54   THR F OG1   1 
ATOM   4170  C  CG2   . THR F  2 54  ? -5.536  -30.914 60.176 1.00 26.72  ? 54   THR F CG2   1 
ATOM   4171  N  N     . ARG F  2 55  ? -5.824  -34.694 59.758 1.00 25.57  ? 55   ARG F N     1 
ATOM   4172  C  CA    . ARG F  2 55  ? -5.198  -35.527 58.735 1.00 25.10  ? 55   ARG F CA    1 
ATOM   4173  C  C     . ARG F  2 55  ? -6.262  -36.085 57.805 1.00 24.99  ? 55   ARG F C     1 
ATOM   4174  O  O     . ARG F  2 55  ? -6.140  -35.972 56.592 1.00 25.72  ? 55   ARG F O     1 
ATOM   4175  C  CB    . ARG F  2 55  ? -4.360  -36.635 59.366 1.00 24.78  ? 55   ARG F CB    1 
ATOM   4176  C  CG    . ARG F  2 55  ? -3.171  -36.107 60.080 1.00 24.15  ? 55   ARG F CG    1 
ATOM   4177  C  CD    . ARG F  2 55  ? -2.272  -37.232 60.473 1.00 28.02  ? 55   ARG F CD    1 
ATOM   4178  N  NE    . ARG F  2 55  ? -1.205  -36.774 61.366 1.00 28.20  ? 55   ARG F NE    1 
ATOM   4179  C  CZ    . ARG F  2 55  ? -1.242  -36.911 62.684 1.00 26.75  ? 55   ARG F CZ    1 
ATOM   4180  N  NH1   . ARG F  2 55  ? -2.281  -37.490 63.261 1.00 26.20  ? 55   ARG F NH1   1 
ATOM   4181  N  NH2   . ARG F  2 55  ? -0.251  -36.454 63.419 1.00 28.54  ? 55   ARG F NH2   1 
ATOM   4182  N  N     . GLY F  2 56  ? -7.321  -36.656 58.368 1.00 24.44  ? 56   GLY F N     1 
ATOM   4183  C  CA    . GLY F  2 56  ? -8.474  -37.065 57.573 1.00 23.77  ? 56   GLY F CA    1 
ATOM   4184  C  C     . GLY F  2 56  ? -9.021  -35.962 56.669 1.00 23.69  ? 56   GLY F C     1 
ATOM   4185  O  O     . GLY F  2 56  ? -9.335  -36.217 55.508 1.00 24.18  ? 56   GLY F O     1 
ATOM   4186  N  N     . VAL F  2 57  ? -9.130  -34.740 57.189 1.00 22.97  ? 57   VAL F N     1 
ATOM   4187  C  CA    . VAL F  2 57  ? -9.651  -33.623 56.414 1.00 22.48  ? 57   VAL F CA    1 
ATOM   4188  C  C     . VAL F  2 57  ? -8.671  -33.218 55.304 1.00 22.50  ? 57   VAL F C     1 
ATOM   4189  O  O     . VAL F  2 57  ? -9.082  -32.877 54.206 1.00 23.06  ? 57   VAL F O     1 
ATOM   4190  C  CB    . VAL F  2 57  ? -10.078 -32.437 57.320 1.00 22.35  ? 57   VAL F CB    1 
ATOM   4191  C  CG1   . VAL F  2 57  ? -10.137 -31.135 56.566 1.00 21.99  ? 57   VAL F CG1   1 
ATOM   4192  C  CG2   . VAL F  2 57  ? -11.430 -32.710 57.917 1.00 22.46  ? 57   VAL F CG2   1 
ATOM   4193  N  N     . LEU F  2 58  ? -7.379  -33.289 55.554 1.00 22.34  ? 58   LEU F N     1 
ATOM   4194  C  CA    . LEU F  2 58  ? -6.435  -32.979 54.484 1.00 22.12  ? 58   LEU F CA    1 
ATOM   4195  C  C     . LEU F  2 58  ? -6.462  -34.048 53.408 1.00 22.55  ? 58   LEU F C     1 
ATOM   4196  O  O     . LEU F  2 58  ? -6.366  -33.737 52.224 1.00 22.84  ? 58   LEU F O     1 
ATOM   4197  C  CB    . LEU F  2 58  ? -5.007  -32.791 55.024 1.00 21.80  ? 58   LEU F CB    1 
ATOM   4198  C  CG    . LEU F  2 58  ? -3.873  -32.522 54.039 1.00 20.20  ? 58   LEU F CG    1 
ATOM   4199  C  CD1   . LEU F  2 58  ? -4.148  -31.273 53.244 1.00 19.24  ? 58   LEU F CD1   1 
ATOM   4200  C  CD2   . LEU F  2 58  ? -2.566  -32.394 54.779 1.00 21.55  ? 58   LEU F CD2   1 
ATOM   4201  N  N     . LYS F  2 59  ? -6.586  -35.306 53.815 1.00 23.18  ? 59   LYS F N     1 
ATOM   4202  C  CA    . LYS F  2 59  ? -6.585  -36.394 52.849 1.00 24.06  ? 59   LYS F CA    1 
ATOM   4203  C  C     . LYS F  2 59  ? -7.746  -36.248 51.863 1.00 24.03  ? 59   LYS F C     1 
ATOM   4204  O  O     . LYS F  2 59  ? -7.563  -36.440 50.659 1.00 25.12  ? 59   LYS F O     1 
ATOM   4205  C  CB    . LYS F  2 59  ? -6.640  -37.747 53.542 1.00 24.56  ? 59   LYS F CB    1 
ATOM   4206  C  CG    . LYS F  2 59  ? -6.231  -38.905 52.640 1.00 27.71  ? 59   LYS F CG    1 
ATOM   4207  C  CD    . LYS F  2 59  ? -6.020  -40.210 53.421 1.00 32.38  ? 59   LYS F CD    1 
ATOM   4208  C  CE    . LYS F  2 59  ? -6.432  -41.456 52.585 1.00 34.84  ? 59   LYS F CE    1 
ATOM   4209  N  NZ    . LYS F  2 59  ? -7.932  -41.628 52.487 1.00 33.83  ? 59   LYS F NZ    1 
ATOM   4210  N  N     . VAL F  2 60  ? -8.921  -35.883 52.362 1.00 22.87  ? 60   VAL F N     1 
ATOM   4211  C  CA    . VAL F  2 60  ? -10.081 -35.712 51.513 1.00 22.30  ? 60   VAL F CA    1 
ATOM   4212  C  C     . VAL F  2 60  ? -9.894  -34.511 50.581 1.00 22.17  ? 60   VAL F C     1 
ATOM   4213  O  O     . VAL F  2 60  ? -10.289 -34.545 49.413 1.00 22.96  ? 60   VAL F O     1 
ATOM   4214  C  CB    . VAL F  2 60  ? -11.375 -35.534 52.360 1.00 22.66  ? 60   VAL F CB    1 
ATOM   4215  C  CG1   . VAL F  2 60  ? -12.488 -34.915 51.542 1.00 21.91  ? 60   VAL F CG1   1 
ATOM   4216  C  CG2   . VAL F  2 60  ? -11.827 -36.860 52.965 1.00 21.83  ? 60   VAL F CG2   1 
ATOM   4217  N  N     . PHE F  2 61  ? -9.295  -33.447 51.087 1.00 21.06  ? 61   PHE F N     1 
ATOM   4218  C  CA    . PHE F  2 61  ? -9.091  -32.277 50.275 1.00 20.40  ? 61   PHE F CA    1 
ATOM   4219  C  C     . PHE F  2 61  ? -8.111  -32.578 49.141 1.00 20.88  ? 61   PHE F C     1 
ATOM   4220  O  O     . PHE F  2 61  ? -8.356  -32.212 47.999 1.00 20.77  ? 61   PHE F O     1 
ATOM   4221  C  CB    . PHE F  2 61  ? -8.615  -31.117 51.146 1.00 19.63  ? 61   PHE F CB    1 
ATOM   4222  C  CG    . PHE F  2 61  ? -8.286  -29.859 50.381 1.00 18.26  ? 61   PHE F CG    1 
ATOM   4223  C  CD1   . PHE F  2 61  ? -9.249  -28.882 50.177 1.00 15.52  ? 61   PHE F CD1   1 
ATOM   4224  C  CD2   . PHE F  2 61  ? -7.000  -29.648 49.885 1.00 16.70  ? 61   PHE F CD2   1 
ATOM   4225  C  CE1   . PHE F  2 61  ? -8.942  -27.727 49.501 1.00 14.36  ? 61   PHE F CE1   1 
ATOM   4226  C  CE2   . PHE F  2 61  ? -6.691  -28.494 49.194 1.00 15.00  ? 61   PHE F CE2   1 
ATOM   4227  C  CZ    . PHE F  2 61  ? -7.664  -27.533 49.008 1.00 15.84  ? 61   PHE F CZ    1 
ATOM   4228  N  N     . LEU F  2 62  ? -7.012  -33.256 49.454 1.00 21.53  ? 62   LEU F N     1 
ATOM   4229  C  CA    . LEU F  2 62  ? -6.012  -33.590 48.441 1.00 22.27  ? 62   LEU F CA    1 
ATOM   4230  C  C     . LEU F  2 62  ? -6.503  -34.580 47.409 1.00 22.81  ? 62   LEU F C     1 
ATOM   4231  O  O     . LEU F  2 62  ? -6.221  -34.427 46.238 1.00 22.92  ? 62   LEU F O     1 
ATOM   4232  C  CB    . LEU F  2 62  ? -4.742  -34.121 49.083 1.00 22.13  ? 62   LEU F CB    1 
ATOM   4233  C  CG    . LEU F  2 62  ? -3.939  -33.037 49.776 1.00 22.64  ? 62   LEU F CG    1 
ATOM   4234  C  CD1   . LEU F  2 62  ? -2.804  -33.658 50.525 1.00 21.50  ? 62   LEU F CD1   1 
ATOM   4235  C  CD2   . LEU F  2 62  ? -3.443  -32.030 48.741 1.00 24.08  ? 62   LEU F CD2   1 
ATOM   4236  N  N     . GLU F  2 63  ? -7.216  -35.612 47.842 1.00 23.68  ? 63   GLU F N     1 
ATOM   4237  C  CA    . GLU F  2 63  ? -7.792  -36.552 46.898 1.00 24.70  ? 63   GLU F CA    1 
ATOM   4238  C  C     . GLU F  2 63  ? -8.606  -35.844 45.838 1.00 24.63  ? 63   GLU F C     1 
ATOM   4239  O  O     . GLU F  2 63  ? -8.482  -36.167 44.661 1.00 25.18  ? 63   GLU F O     1 
ATOM   4240  C  CB    . GLU F  2 63  ? -8.686  -37.541 47.605 1.00 25.22  ? 63   GLU F CB    1 
ATOM   4241  C  CG    . GLU F  2 63  ? -7.942  -38.686 48.235 1.00 28.97  ? 63   GLU F CG    1 
ATOM   4242  C  CD    . GLU F  2 63  ? -8.766  -39.411 49.296 1.00 34.37  ? 63   GLU F CD    1 
ATOM   4243  O  OE1   . GLU F  2 63  ? -9.992  -39.156 49.408 1.00 35.39  ? 63   GLU F OE1   1 
ATOM   4244  O  OE2   . GLU F  2 63  ? -8.178  -40.237 50.035 1.00 38.22  ? 63   GLU F OE2   1 
ATOM   4245  N  N     . ASN F  2 64  ? -9.434  -34.886 46.252 1.00 24.28  ? 64   ASN F N     1 
ATOM   4246  C  CA    . ASN F  2 64  ? -10.338 -34.205 45.329 1.00 24.11  ? 64   ASN F CA    1 
ATOM   4247  C  C     . ASN F  2 64  ? -9.599  -33.297 44.386 1.00 23.76  ? 64   ASN F C     1 
ATOM   4248  O  O     . ASN F  2 64  ? -10.007 -33.128 43.248 1.00 24.43  ? 64   ASN F O     1 
ATOM   4249  C  CB    . ASN F  2 64  ? -11.398 -33.359 46.062 1.00 24.25  ? 64   ASN F CB    1 
ATOM   4250  C  CG    . ASN F  2 64  ? -12.432 -34.190 46.777 1.00 24.69  ? 64   ASN F CG    1 
ATOM   4251  O  OD1   . ASN F  2 64  ? -12.509 -35.399 46.608 1.00 26.64  ? 64   ASN F OD1   1 
ATOM   4252  N  ND2   . ASN F  2 64  ? -13.234 -33.537 47.602 1.00 26.90  ? 64   ASN F ND2   1 
ATOM   4253  N  N     . VAL F  2 65  ? -8.546  -32.666 44.864 1.00 23.35  ? 65   VAL F N     1 
ATOM   4254  C  CA    . VAL F  2 65  ? -7.877  -31.697 44.034 1.00 23.41  ? 65   VAL F CA    1 
ATOM   4255  C  C     . VAL F  2 65  ? -7.037  -32.493 43.067 1.00 23.75  ? 65   VAL F C     1 
ATOM   4256  O  O     . VAL F  2 65  ? -7.006  -32.183 41.888 1.00 23.96  ? 65   VAL F O     1 
ATOM   4257  C  CB    . VAL F  2 65  ? -7.023  -30.688 44.841 1.00 23.26  ? 65   VAL F CB    1 
ATOM   4258  C  CG1   . VAL F  2 65  ? -6.158  -29.856 43.916 1.00 22.05  ? 65   VAL F CG1   1 
ATOM   4259  C  CG2   . VAL F  2 65  ? -7.926  -29.782 45.655 1.00 22.68  ? 65   VAL F CG2   1 
ATOM   4260  N  N     . ILE F  2 66  ? -6.403  -33.547 43.562 1.00 24.18  ? 66   ILE F N     1 
ATOM   4261  C  CA    . ILE F  2 66  ? -5.547  -34.384 42.730 1.00 25.05  ? 66   ILE F CA    1 
ATOM   4262  C  C     . ILE F  2 66  ? -6.361  -35.154 41.684 1.00 25.71  ? 66   ILE F C     1 
ATOM   4263  O  O     . ILE F  2 66  ? -6.014  -35.129 40.508 1.00 26.04  ? 66   ILE F O     1 
ATOM   4264  C  CB    . ILE F  2 66  ? -4.639  -35.295 43.573 1.00 24.69  ? 66   ILE F CB    1 
ATOM   4265  C  CG1   . ILE F  2 66  ? -3.540  -34.456 44.224 1.00 24.86  ? 66   ILE F CG1   1 
ATOM   4266  C  CG2   . ILE F  2 66  ? -4.001  -36.358 42.712 1.00 25.39  ? 66   ILE F CG2   1 
ATOM   4267  C  CD1   . ILE F  2 66  ? -2.838  -35.113 45.415 1.00 23.28  ? 66   ILE F CD1   1 
ATOM   4268  N  N     . ARG F  2 67  ? -7.450  -35.802 42.093 1.00 26.28  ? 67   ARG F N     1 
ATOM   4269  C  CA    . ARG F  2 67  ? -8.332  -36.479 41.138 1.00 27.34  ? 67   ARG F CA    1 
ATOM   4270  C  C     . ARG F  2 67  ? -8.619  -35.591 39.933 1.00 26.83  ? 67   ARG F C     1 
ATOM   4271  O  O     . ARG F  2 67  ? -8.443  -36.017 38.815 1.00 26.81  ? 67   ARG F O     1 
ATOM   4272  C  CB    . ARG F  2 67  ? -9.631  -36.927 41.811 1.00 27.23  ? 67   ARG F CB    1 
ATOM   4273  C  CG    . ARG F  2 67  ? -10.693 -37.553 40.893 1.00 28.96  ? 67   ARG F CG    1 
ATOM   4274  C  CD    . ARG F  2 67  ? -11.979 -37.905 41.680 1.00 29.98  ? 67   ARG F CD    1 
ATOM   4275  N  NE    . ARG F  2 67  ? -11.685 -38.774 42.836 1.00 38.11  ? 67   ARG F NE    1 
ATOM   4276  C  CZ    . ARG F  2 67  ? -11.902 -38.466 44.127 1.00 40.41  ? 67   ARG F CZ    1 
ATOM   4277  N  NH1   . ARG F  2 67  ? -12.457 -37.306 44.469 1.00 41.05  ? 67   ARG F NH1   1 
ATOM   4278  N  NH2   . ARG F  2 67  ? -11.581 -39.336 45.087 1.00 40.37  ? 67   ARG F NH2   1 
ATOM   4279  N  N     . ASP F  2 68  ? -9.036  -34.349 40.166 1.00 27.06  ? 68   ASP F N     1 
ATOM   4280  C  CA    . ASP F  2 68  ? -9.308  -33.408 39.081 1.00 27.01  ? 68   ASP F CA    1 
ATOM   4281  C  C     . ASP F  2 68  ? -8.063  -33.009 38.325 1.00 26.66  ? 68   ASP F C     1 
ATOM   4282  O  O     . ASP F  2 68  ? -8.114  -32.806 37.116 1.00 26.57  ? 68   ASP F O     1 
ATOM   4283  C  CB    . ASP F  2 68  ? -9.947  -32.152 39.619 1.00 27.22  ? 68   ASP F CB    1 
ATOM   4284  C  CG    . ASP F  2 68  ? -11.419 -32.326 39.938 1.00 31.04  ? 68   ASP F CG    1 
ATOM   4285  O  OD1   . ASP F  2 68  ? -11.954 -33.470 39.874 1.00 33.51  ? 68   ASP F OD1   1 
ATOM   4286  O  OD2   . ASP F  2 68  ? -12.052 -31.287 40.266 1.00 34.91  ? 68   ASP F OD2   1 
ATOM   4287  N  N     . ALA F  2 69  ? -6.947  -32.877 39.044 1.00 26.33  ? 69   ALA F N     1 
ATOM   4288  C  CA    . ALA F  2 69  ? -5.692  -32.417 38.454 1.00 25.44  ? 69   ALA F CA    1 
ATOM   4289  C  C     . ALA F  2 69  ? -5.205  -33.458 37.465 1.00 25.22  ? 69   ALA F C     1 
ATOM   4290  O  O     . ALA F  2 69  ? -4.835  -33.133 36.332 1.00 25.30  ? 69   ALA F O     1 
ATOM   4291  C  CB    . ALA F  2 69  ? -4.664  -32.180 39.517 1.00 25.12  ? 69   ALA F CB    1 
ATOM   4292  N  N     . VAL F  2 70  ? -5.236  -34.712 37.898 1.00 24.66  ? 70   VAL F N     1 
ATOM   4293  C  CA    . VAL F  2 70  ? -4.866  -35.826 37.060 1.00 24.23  ? 70   VAL F CA    1 
ATOM   4294  C  C     . VAL F  2 70  ? -5.877  -36.020 35.935 1.00 24.68  ? 70   VAL F C     1 
ATOM   4295  O  O     . VAL F  2 70  ? -5.510  -36.436 34.840 1.00 25.11  ? 70   VAL F O     1 
ATOM   4296  C  CB    . VAL F  2 70  ? -4.673  -37.100 37.881 1.00 24.01  ? 70   VAL F CB    1 
ATOM   4297  C  CG1   . VAL F  2 70  ? -4.531  -38.311 36.985 1.00 23.20  ? 70   VAL F CG1   1 
ATOM   4298  C  CG2   . VAL F  2 70  ? -3.453  -36.945 38.767 1.00 23.00  ? 70   VAL F CG2   1 
ATOM   4299  N  N     . THR F  2 71  ? -7.136  -35.684 36.155 1.00 24.80  ? 71   THR F N     1 
ATOM   4300  C  CA    . THR F  2 71  ? -8.060  -35.800 35.046 1.00 25.15  ? 71   THR F CA    1 
ATOM   4301  C  C     . THR F  2 71  ? -7.657  -34.864 33.897 1.00 26.29  ? 71   THR F C     1 
ATOM   4302  O  O     . THR F  2 71  ? -7.601  -35.292 32.747 1.00 26.87  ? 71   THR F O     1 
ATOM   4303  C  CB    . THR F  2 71  ? -9.485  -35.647 35.482 1.00 24.81  ? 71   THR F CB    1 
ATOM   4304  O  OG1   . THR F  2 71  ? -9.791  -36.729 36.355 1.00 23.54  ? 71   THR F OG1   1 
ATOM   4305  C  CG2   . THR F  2 71  ? -10.410 -35.745 34.304 1.00 24.93  ? 71   THR F CG2   1 
ATOM   4306  N  N     . TYR F  2 72  ? -7.312  -33.617 34.212 1.00 26.83  ? 72   TYR F N     1 
ATOM   4307  C  CA    . TYR F  2 72  ? -6.785  -32.700 33.208 1.00 27.33  ? 72   TYR F CA    1 
ATOM   4308  C  C     . TYR F  2 72  ? -5.534  -33.216 32.475 1.00 28.65  ? 72   TYR F C     1 
ATOM   4309  O  O     . TYR F  2 72  ? -5.397  -33.050 31.261 1.00 29.10  ? 72   TYR F O     1 
ATOM   4310  C  CB    . TYR F  2 72  ? -6.490  -31.345 33.832 1.00 26.76  ? 72   TYR F CB    1 
ATOM   4311  C  CG    . TYR F  2 72  ? -7.720  -30.522 34.084 1.00 26.14  ? 72   TYR F CG    1 
ATOM   4312  C  CD1   . TYR F  2 72  ? -8.104  -30.172 35.382 1.00 26.27  ? 72   TYR F CD1   1 
ATOM   4313  C  CD2   . TYR F  2 72  ? -8.515  -30.103 33.036 1.00 24.94  ? 72   TYR F CD2   1 
ATOM   4314  C  CE1   . TYR F  2 72  ? -9.249  -29.417 35.610 1.00 26.25  ? 72   TYR F CE1   1 
ATOM   4315  C  CE2   . TYR F  2 72  ? -9.658  -29.360 33.258 1.00 25.96  ? 72   TYR F CE2   1 
ATOM   4316  C  CZ    . TYR F  2 72  ? -10.016 -29.016 34.538 1.00 25.83  ? 72   TYR F CZ    1 
ATOM   4317  O  OH    . TYR F  2 72  ? -11.143 -28.268 34.725 1.00 26.80  ? 72   TYR F OH    1 
ATOM   4318  N  N     . THR F  2 73  ? -4.622  -33.822 33.224 1.00 29.81  ? 73   THR F N     1 
ATOM   4319  C  CA    . THR F  2 73  ? -3.345  -34.290 32.698 1.00 30.36  ? 73   THR F CA    1 
ATOM   4320  C  C     . THR F  2 73  ? -3.583  -35.387 31.685 1.00 31.16  ? 73   THR F C     1 
ATOM   4321  O  O     . THR F  2 73  ? -3.107  -35.283 30.571 1.00 31.32  ? 73   THR F O     1 
ATOM   4322  C  CB    . THR F  2 73  ? -2.479  -34.843 33.834 1.00 30.23  ? 73   THR F CB    1 
ATOM   4323  O  OG1   . THR F  2 73  ? -2.291  -33.814 34.804 1.00 30.63  ? 73   THR F OG1   1 
ATOM   4324  C  CG2   . THR F  2 73  ? -1.130  -35.329 33.330 1.00 29.44  ? 73   THR F CG2   1 
ATOM   4325  N  N     . GLU F  2 74  ? -4.323  -36.424 32.087 1.00 31.91  ? 74   GLU F N     1 
ATOM   4326  C  CA    . GLU F  2 74  ? -4.670  -37.557 31.236 1.00 33.38  ? 74   GLU F CA    1 
ATOM   4327  C  C     . GLU F  2 74  ? -5.342  -37.084 29.959 1.00 32.54  ? 74   GLU F C     1 
ATOM   4328  O  O     . GLU F  2 74  ? -5.005  -37.529 28.858 1.00 32.53  ? 74   GLU F O     1 
ATOM   4329  C  CB    . GLU F  2 74  ? -5.638  -38.495 31.951 1.00 33.25  ? 74   GLU F CB    1 
ATOM   4330  C  CG    . GLU F  2 74  ? -5.016  -39.415 32.998 1.00 36.45  ? 74   GLU F CG    1 
ATOM   4331  C  CD    . GLU F  2 74  ? -5.938  -40.611 33.351 1.00 37.71  ? 74   GLU F CD    1 
ATOM   4332  O  OE1   . GLU F  2 74  ? -5.866  -41.641 32.621 1.00 42.97  ? 74   GLU F OE1   1 
ATOM   4333  O  OE2   . GLU F  2 74  ? -6.714  -40.530 34.357 1.00 41.44  ? 74   GLU F OE2   1 
ATOM   4334  N  N     . HIS F  2 75  ? -6.293  -36.172 30.107 1.00 32.22  ? 75   HIS F N     1 
ATOM   4335  C  CA    . HIS F  2 75  ? -6.979  -35.656 28.955 1.00 31.87  ? 75   HIS F CA    1 
ATOM   4336  C  C     . HIS F  2 75  ? -6.025  -35.038 27.946 1.00 31.87  ? 75   HIS F C     1 
ATOM   4337  O  O     . HIS F  2 75  ? -6.245  -35.151 26.744 1.00 31.98  ? 75   HIS F O     1 
ATOM   4338  C  CB    . HIS F  2 75  ? -8.007  -34.631 29.333 1.00 31.69  ? 75   HIS F CB    1 
ATOM   4339  C  CG    . HIS F  2 75  ? -8.648  -34.000 28.146 1.00 32.37  ? 75   HIS F CG    1 
ATOM   4340  N  ND1   . HIS F  2 75  ? -9.737  -34.554 27.515 1.00 32.82  ? 75   HIS F ND1   1 
ATOM   4341  C  CD2   . HIS F  2 75  ? -8.327  -32.886 27.443 1.00 33.00  ? 75   HIS F CD2   1 
ATOM   4342  C  CE1   . HIS F  2 75  ? -10.084 -33.789 26.493 1.00 34.16  ? 75   HIS F CE1   1 
ATOM   4343  N  NE2   . HIS F  2 75  ? -9.244  -32.770 26.428 1.00 33.56  ? 75   HIS F NE2   1 
ATOM   4344  N  N     . ALA F  2 76  ? -4.990  -34.359 28.435 1.00 31.28  ? 76   ALA F N     1 
ATOM   4345  C  CA    . ALA F  2 76  ? -3.995  -33.770 27.566 1.00 30.86  ? 76   ALA F CA    1 
ATOM   4346  C  C     . ALA F  2 76  ? -2.951  -34.808 27.129 1.00 31.16  ? 76   ALA F C     1 
ATOM   4347  O  O     . ALA F  2 76  ? -1.962  -34.465 26.487 1.00 30.59  ? 76   ALA F O     1 
ATOM   4348  C  CB    . ALA F  2 76  ? -3.345  -32.607 28.247 1.00 30.65  ? 76   ALA F CB    1 
ATOM   4349  N  N     . LYS F  2 77  ? -3.186  -36.074 27.476 1.00 31.80  ? 77   LYS F N     1 
ATOM   4350  C  CA    . LYS F  2 77  ? -2.275  -37.197 27.149 1.00 32.87  ? 77   LYS F CA    1 
ATOM   4351  C  C     . LYS F  2 77  ? -0.826  -36.991 27.615 1.00 32.48  ? 77   LYS F C     1 
ATOM   4352  O  O     . LYS F  2 77  ? 0.110   -37.457 26.961 1.00 32.53  ? 77   LYS F O     1 
ATOM   4353  C  CB    . LYS F  2 77  ? -2.305  -37.542 25.647 1.00 33.31  ? 77   LYS F CB    1 
ATOM   4354  C  CG    . LYS F  2 77  ? -3.693  -37.663 25.031 1.00 36.03  ? 77   LYS F CG    1 
ATOM   4355  C  CD    . LYS F  2 77  ? -3.653  -38.571 23.810 1.00 41.91  ? 77   LYS F CD    1 
ATOM   4356  C  CE    . LYS F  2 77  ? -5.005  -38.619 23.085 1.00 45.19  ? 77   LYS F CE    1 
ATOM   4357  N  NZ    . LYS F  2 77  ? -5.193  -37.467 22.114 1.00 47.85  ? 77   LYS F NZ    1 
ATOM   4358  N  N     . ARG F  2 78  ? -0.659  -36.291 28.739 1.00 31.91  ? 78   ARG F N     1 
ATOM   4359  C  CA    . ARG F  2 78  ? 0.641   -36.109 29.384 1.00 31.29  ? 78   ARG F CA    1 
ATOM   4360  C  C     . ARG F  2 78  ? 0.858   -37.119 30.501 1.00 31.18  ? 78   ARG F C     1 
ATOM   4361  O  O     . ARG F  2 78  ? -0.086  -37.758 30.967 1.00 30.63  ? 78   ARG F O     1 
ATOM   4362  C  CB    . ARG F  2 78  ? 0.761   -34.692 29.932 1.00 31.05  ? 78   ARG F CB    1 
ATOM   4363  C  CG    . ARG F  2 78  ? 0.964   -33.663 28.847 1.00 31.33  ? 78   ARG F CG    1 
ATOM   4364  C  CD    . ARG F  2 78  ? 1.376   -32.324 29.413 1.00 31.94  ? 78   ARG F CD    1 
ATOM   4365  N  NE    . ARG F  2 78  ? 0.208   -31.485 29.687 1.00 33.96  ? 78   ARG F NE    1 
ATOM   4366  C  CZ    . ARG F  2 78  ? -0.420  -31.381 30.864 1.00 33.45  ? 78   ARG F CZ    1 
ATOM   4367  N  NH1   . ARG F  2 78  ? -0.012  -32.071 31.941 1.00 33.10  ? 78   ARG F NH1   1 
ATOM   4368  N  NH2   . ARG F  2 78  ? -1.469  -30.574 30.957 1.00 29.91  ? 78   ARG F NH2   1 
ATOM   4369  N  N     . LYS F  2 79  ? 2.111   -37.260 30.923 1.00 31.53  ? 79   LYS F N     1 
ATOM   4370  C  CA    . LYS F  2 79  ? 2.470   -38.140 32.046 1.00 32.36  ? 79   LYS F CA    1 
ATOM   4371  C  C     . LYS F  2 79  ? 2.937   -37.335 33.265 1.00 31.26  ? 79   LYS F C     1 
ATOM   4372  O  O     . LYS F  2 79  ? 3.271   -37.903 34.302 1.00 31.20  ? 79   LYS F O     1 
ATOM   4373  C  CB    . LYS F  2 79  ? 3.534   -39.158 31.604 1.00 32.08  ? 79   LYS F CB    1 
ATOM   4374  C  CG    . LYS F  2 79  ? 2.985   -40.186 30.580 1.00 34.58  ? 79   LYS F CG    1 
ATOM   4375  C  CD    . LYS F  2 79  ? 4.077   -41.077 29.928 1.00 35.61  ? 79   LYS F CD    1 
ATOM   4376  C  CE    . LYS F  2 79  ? 4.270   -42.442 30.664 1.00 41.47  ? 79   LYS F CE    1 
ATOM   4377  N  NZ    . LYS F  2 79  ? 4.798   -42.301 32.084 1.00 42.77  ? 79   LYS F NZ    1 
ATOM   4378  N  N     . THR F  2 80  ? 2.928   -36.009 33.118 1.00 30.61  ? 80   THR F N     1 
ATOM   4379  C  CA    . THR F  2 80  ? 3.411   -35.049 34.111 1.00 29.97  ? 80   THR F CA    1 
ATOM   4380  C  C     . THR F  2 80  ? 2.285   -34.087 34.531 1.00 28.91  ? 80   THR F C     1 
ATOM   4381  O  O     . THR F  2 80  ? 1.706   -33.382 33.706 1.00 28.98  ? 80   THR F O     1 
ATOM   4382  C  CB    . THR F  2 80  ? 4.606   -34.237 33.524 1.00 30.35  ? 80   THR F CB    1 
ATOM   4383  O  OG1   . THR F  2 80  ? 5.582   -35.147 33.010 1.00 32.00  ? 80   THR F OG1   1 
ATOM   4384  C  CG2   . THR F  2 80  ? 5.273   -33.322 34.564 1.00 29.81  ? 80   THR F CG2   1 
ATOM   4385  N  N     . VAL F  2 81  ? 1.979   -34.062 35.817 1.00 27.88  ? 81   VAL F N     1 
ATOM   4386  C  CA    . VAL F  2 81  ? 1.020   -33.110 36.350 1.00 26.83  ? 81   VAL F CA    1 
ATOM   4387  C  C     . VAL F  2 81  ? 1.693   -31.745 36.397 1.00 26.47  ? 81   VAL F C     1 
ATOM   4388  O  O     . VAL F  2 81  ? 2.751   -31.595 36.987 1.00 26.36  ? 81   VAL F O     1 
ATOM   4389  C  CB    . VAL F  2 81  ? 0.573   -33.509 37.750 1.00 26.93  ? 81   VAL F CB    1 
ATOM   4390  C  CG1   . VAL F  2 81  ? -0.458  -32.513 38.297 1.00 26.55  ? 81   VAL F CG1   1 
ATOM   4391  C  CG2   . VAL F  2 81  ? 0.017   -34.937 37.741 1.00 25.83  ? 81   VAL F CG2   1 
ATOM   4392  N  N     . THR F  2 82  ? 1.089   -30.758 35.747 1.00 26.03  ? 82   THR F N     1 
ATOM   4393  C  CA    . THR F  2 82  ? 1.656   -29.422 35.683 1.00 25.74  ? 82   THR F CA    1 
ATOM   4394  C  C     . THR F  2 82  ? 1.022   -28.521 36.747 1.00 25.47  ? 82   THR F C     1 
ATOM   4395  O  O     . THR F  2 82  ? -0.044  -28.836 37.286 1.00 24.99  ? 82   THR F O     1 
ATOM   4396  C  CB    . THR F  2 82  ? 1.422   -28.786 34.284 1.00 25.92  ? 82   THR F CB    1 
ATOM   4397  O  OG1   . THR F  2 82  ? 0.018   -28.732 34.012 1.00 26.25  ? 82   THR F OG1   1 
ATOM   4398  C  CG2   . THR F  2 82  ? 2.099   -29.596 33.176 1.00 26.38  ? 82   THR F CG2   1 
ATOM   4399  N  N     . ALA F  2 83  ? 1.661   -27.386 37.027 1.00 25.23  ? 83   ALA F N     1 
ATOM   4400  C  CA    . ALA F  2 83  ? 1.029   -26.358 37.853 1.00 25.08  ? 83   ALA F CA    1 
ATOM   4401  C  C     . ALA F  2 83  ? -0.331  -25.924 37.280 1.00 25.36  ? 83   ALA F C     1 
ATOM   4402  O  O     . ALA F  2 83  ? -1.270  -25.684 38.045 1.00 25.76  ? 83   ALA F O     1 
ATOM   4403  C  CB    . ALA F  2 83  ? 1.929   -25.174 38.043 1.00 24.23  ? 83   ALA F CB    1 
ATOM   4404  N  N     . MET F  2 84  ? -0.450  -25.841 35.952 1.00 25.29  ? 84   MET F N     1 
ATOM   4405  C  CA    . MET F  2 84  ? -1.735  -25.473 35.349 1.00 25.06  ? 84   MET F CA    1 
ATOM   4406  C  C     . MET F  2 84  ? -2.818  -26.522 35.614 1.00 24.53  ? 84   MET F C     1 
ATOM   4407  O  O     . MET F  2 84  ? -3.956  -26.171 35.941 1.00 24.28  ? 84   MET F O     1 
ATOM   4408  C  CB    . MET F  2 84  ? -1.615  -25.178 33.854 1.00 25.14  ? 84   MET F CB    1 
ATOM   4409  C  CG    . MET F  2 84  ? -0.907  -23.874 33.525 1.00 27.54  ? 84   MET F CG    1 
ATOM   4410  S  SD    . MET F  2 84  ? -1.382  -22.412 34.526 1.00 34.88  ? 84   MET F SD    1 
ATOM   4411  C  CE    . MET F  2 84  ? -3.128  -22.251 34.135 1.00 32.10  ? 84   MET F CE    1 
ATOM   4412  N  N     . ASP F  2 85  ? -2.470  -27.802 35.512 1.00 23.58  ? 85   ASP F N     1 
ATOM   4413  C  CA    . ASP F  2 85  ? -3.413  -28.843 35.929 1.00 23.28  ? 85   ASP F CA    1 
ATOM   4414  C  C     . ASP F  2 85  ? -3.983  -28.593 37.318 1.00 21.70  ? 85   ASP F C     1 
ATOM   4415  O  O     . ASP F  2 85  ? -5.167  -28.706 37.515 1.00 21.89  ? 85   ASP F O     1 
ATOM   4416  C  CB    . ASP F  2 85  ? -2.778  -30.230 35.862 1.00 24.06  ? 85   ASP F CB    1 
ATOM   4417  C  CG    . ASP F  2 85  ? -2.270  -30.561 34.474 1.00 28.31  ? 85   ASP F CG    1 
ATOM   4418  O  OD1   . ASP F  2 85  ? -2.896  -30.064 33.498 1.00 31.90  ? 85   ASP F OD1   1 
ATOM   4419  O  OD2   . ASP F  2 85  ? -1.236  -31.276 34.351 1.00 30.99  ? 85   ASP F OD2   1 
ATOM   4420  N  N     . VAL F  2 86  ? -3.133  -28.235 38.269 1.00 20.31  ? 86   VAL F N     1 
ATOM   4421  C  CA    . VAL F  2 86  ? -3.540  -28.083 39.646 1.00 18.87  ? 86   VAL F CA    1 
ATOM   4422  C  C     . VAL F  2 86  ? -4.357  -26.820 39.793 1.00 19.30  ? 86   VAL F C     1 
ATOM   4423  O  O     . VAL F  2 86  ? -5.379  -26.815 40.483 1.00 19.33  ? 86   VAL F O     1 
ATOM   4424  C  CB    . VAL F  2 86  ? -2.324  -28.036 40.574 1.00 18.65  ? 86   VAL F CB    1 
ATOM   4425  C  CG1   . VAL F  2 86  ? -2.718  -27.572 41.943 1.00 16.80  ? 86   VAL F CG1   1 
ATOM   4426  C  CG2   . VAL F  2 86  ? -1.672  -29.394 40.644 1.00 17.69  ? 86   VAL F CG2   1 
ATOM   4427  N  N     . VAL F  2 87  ? -3.910  -25.754 39.133 1.00 19.30  ? 87   VAL F N     1 
ATOM   4428  C  CA    . VAL F  2 87  ? -4.619  -24.484 39.134 1.00 19.17  ? 87   VAL F CA    1 
ATOM   4429  C  C     . VAL F  2 87  ? -6.030  -24.609 38.551 1.00 20.07  ? 87   VAL F C     1 
ATOM   4430  O  O     . VAL F  2 87  ? -6.961  -24.073 39.125 1.00 20.57  ? 87   VAL F O     1 
ATOM   4431  C  CB    . VAL F  2 87  ? -3.790  -23.393 38.447 1.00 19.34  ? 87   VAL F CB    1 
ATOM   4432  C  CG1   . VAL F  2 87  ? -4.590  -22.102 38.229 1.00 16.35  ? 87   VAL F CG1   1 
ATOM   4433  C  CG2   . VAL F  2 87  ? -2.546  -23.123 39.286 1.00 18.73  ? 87   VAL F CG2   1 
ATOM   4434  N  N     . TYR F  2 88  ? -6.203  -25.332 37.448 1.00 20.95  ? 88   TYR F N     1 
ATOM   4435  C  CA    . TYR F  2 88  ? -7.547  -25.543 36.892 1.00 21.46  ? 88   TYR F CA    1 
ATOM   4436  C  C     . TYR F  2 88  ? -8.353  -26.440 37.782 1.00 21.49  ? 88   TYR F C     1 
ATOM   4437  O  O     . TYR F  2 88  ? -9.555  -26.242 37.916 1.00 21.86  ? 88   TYR F O     1 
ATOM   4438  C  CB    . TYR F  2 88  ? -7.547  -26.140 35.478 1.00 22.51  ? 88   TYR F CB    1 
ATOM   4439  C  CG    . TYR F  2 88  ? -6.810  -25.327 34.451 1.00 22.75  ? 88   TYR F CG    1 
ATOM   4440  C  CD1   . TYR F  2 88  ? -5.889  -25.932 33.615 1.00 23.05  ? 88   TYR F CD1   1 
ATOM   4441  C  CD2   . TYR F  2 88  ? -6.991  -23.949 34.352 1.00 23.64  ? 88   TYR F CD2   1 
ATOM   4442  C  CE1   . TYR F  2 88  ? -5.183  -25.215 32.680 1.00 24.38  ? 88   TYR F CE1   1 
ATOM   4443  C  CE2   . TYR F  2 88  ? -6.287  -23.204 33.419 1.00 24.51  ? 88   TYR F CE2   1 
ATOM   4444  C  CZ    . TYR F  2 88  ? -5.393  -23.861 32.578 1.00 25.52  ? 88   TYR F CZ    1 
ATOM   4445  O  OH    . TYR F  2 88  ? -4.671  -23.178 31.639 1.00 26.74  ? 88   TYR F OH    1 
ATOM   4446  N  N     . ALA F  2 89  ? -7.709  -27.423 38.397 1.00 21.30  ? 89   ALA F N     1 
ATOM   4447  C  CA    . ALA F  2 89  ? -8.414  -28.255 39.353 1.00 21.40  ? 89   ALA F CA    1 
ATOM   4448  C  C     . ALA F  2 89  ? -8.923  -27.387 40.504 1.00 22.43  ? 89   ALA F C     1 
ATOM   4449  O  O     . ALA F  2 89  ? -10.043 -27.569 40.969 1.00 23.34  ? 89   ALA F O     1 
ATOM   4450  C  CB    . ALA F  2 89  ? -7.549  -29.344 39.846 1.00 20.44  ? 89   ALA F CB    1 
ATOM   4451  N  N     . LEU F  2 90  ? -8.133  -26.412 40.940 1.00 22.99  ? 90   LEU F N     1 
ATOM   4452  C  CA    . LEU F  2 90  ? -8.550  -25.590 42.062 1.00 23.68  ? 90   LEU F CA    1 
ATOM   4453  C  C     . LEU F  2 90  ? -9.700  -24.648 41.704 1.00 24.73  ? 90   LEU F C     1 
ATOM   4454  O  O     . LEU F  2 90  ? -10.641 -24.495 42.478 1.00 24.92  ? 90   LEU F O     1 
ATOM   4455  C  CB    . LEU F  2 90  ? -7.361  -24.843 42.680 1.00 23.06  ? 90   LEU F CB    1 
ATOM   4456  C  CG    . LEU F  2 90  ? -6.355  -25.701 43.468 1.00 22.27  ? 90   LEU F CG    1 
ATOM   4457  C  CD1   . LEU F  2 90  ? -5.040  -24.961 43.664 1.00 18.69  ? 90   LEU F CD1   1 
ATOM   4458  C  CD2   . LEU F  2 90  ? -6.917  -26.184 44.821 1.00 19.95  ? 90   LEU F CD2   1 
ATOM   4459  N  N     . LYS F  2 91  ? -9.643  -24.039 40.529 1.00 26.12  ? 91   LYS F N     1 
ATOM   4460  C  CA    . LYS F  2 91  ? -10.681 -23.109 40.123 1.00 27.78  ? 91   LYS F CA    1 
ATOM   4461  C  C     . LYS F  2 91  ? -12.055 -23.771 40.079 1.00 28.41  ? 91   LYS F C     1 
ATOM   4462  O  O     . LYS F  2 91  ? -13.049 -23.187 40.536 1.00 28.99  ? 91   LYS F O     1 
ATOM   4463  C  CB    . LYS F  2 91  ? -10.384 -22.479 38.765 1.00 27.93  ? 91   LYS F CB    1 
ATOM   4464  C  CG    . LYS F  2 91  ? -11.205 -21.208 38.541 1.00 31.79  ? 91   LYS F CG    1 
ATOM   4465  C  CD    . LYS F  2 91  ? -11.365 -20.838 37.086 1.00 37.18  ? 91   LYS F CD    1 
ATOM   4466  C  CE    . LYS F  2 91  ? -10.301 -19.834 36.652 1.00 41.96  ? 91   LYS F CE    1 
ATOM   4467  N  NZ    . LYS F  2 91  ? -10.474 -19.415 35.212 1.00 44.32  ? 91   LYS F NZ    1 
ATOM   4468  N  N     . ARG F  2 92  ? -12.117 -24.985 39.540 1.00 28.88  ? 92   ARG F N     1 
ATOM   4469  C  CA    . ARG F  2 92  ? -13.406 -25.638 39.345 1.00 29.28  ? 92   ARG F CA    1 
ATOM   4470  C  C     . ARG F  2 92  ? -14.035 -26.114 40.655 1.00 29.64  ? 92   ARG F C     1 
ATOM   4471  O  O     . ARG F  2 92  ? -15.254 -26.241 40.757 1.00 30.13  ? 92   ARG F O     1 
ATOM   4472  C  CB    . ARG F  2 92  ? -13.311 -26.764 38.328 1.00 29.20  ? 92   ARG F CB    1 
ATOM   4473  C  CG    . ARG F  2 92  ? -12.731 -28.050 38.845 1.00 30.30  ? 92   ARG F CG    1 
ATOM   4474  C  CD    . ARG F  2 92  ? -12.987 -29.133 37.819 1.00 32.00  ? 92   ARG F CD    1 
ATOM   4475  N  NE    . ARG F  2 92  ? -14.417 -29.222 37.588 1.00 31.84  ? 92   ARG F NE    1 
ATOM   4476  C  CZ    . ARG F  2 92  ? -15.250 -29.921 38.350 1.00 33.04  ? 92   ARG F CZ    1 
ATOM   4477  N  NH1   . ARG F  2 92  ? -14.802 -30.633 39.384 1.00 31.68  ? 92   ARG F NH1   1 
ATOM   4478  N  NH2   . ARG F  2 92  ? -16.545 -29.924 38.061 1.00 35.63  ? 92   ARG F NH2   1 
ATOM   4479  N  N     . GLN F  2 93  ? -13.214 -26.348 41.667 1.00 29.42  ? 93   GLN F N     1 
ATOM   4480  C  CA    . GLN F  2 93  ? -13.743 -26.548 42.999 1.00 29.27  ? 93   GLN F CA    1 
ATOM   4481  C  C     . GLN F  2 93  ? -13.884 -25.252 43.778 1.00 28.31  ? 93   GLN F C     1 
ATOM   4482  O  O     . GLN F  2 93  ? -14.096 -25.279 44.977 1.00 28.48  ? 93   GLN F O     1 
ATOM   4483  C  CB    . GLN F  2 93  ? -12.860 -27.511 43.754 1.00 30.08  ? 93   GLN F CB    1 
ATOM   4484  C  CG    . GLN F  2 93  ? -13.040 -28.928 43.285 1.00 33.89  ? 93   GLN F CG    1 
ATOM   4485  C  CD    . GLN F  2 93  ? -11.825 -29.730 43.556 1.00 39.93  ? 93   GLN F CD    1 
ATOM   4486  O  OE1   . GLN F  2 93  ? -11.200 -29.596 44.628 1.00 43.63  ? 93   GLN F OE1   1 
ATOM   4487  N  NE2   . GLN F  2 93  ? -11.438 -30.560 42.585 1.00 40.35  ? 93   GLN F NE2   1 
ATOM   4488  N  N     . GLY F  2 94  ? -13.755 -24.115 43.101 1.00 27.43  ? 94   GLY F N     1 
ATOM   4489  C  CA    . GLY F  2 94  ? -13.939 -22.824 43.736 1.00 26.25  ? 94   GLY F CA    1 
ATOM   4490  C  C     . GLY F  2 94  ? -12.936 -22.490 44.828 1.00 25.93  ? 94   GLY F C     1 
ATOM   4491  O  O     . GLY F  2 94  ? -13.266 -21.780 45.771 1.00 26.10  ? 94   GLY F O     1 
ATOM   4492  N  N     . ARG F  2 95  ? -11.723 -23.018 44.729 1.00 25.09  ? 95   ARG F N     1 
ATOM   4493  C  CA    . ARG F  2 95  ? -10.621 -22.510 45.528 1.00 24.35  ? 95   ARG F CA    1 
ATOM   4494  C  C     . ARG F  2 95  ? -9.575  -21.884 44.565 1.00 23.94  ? 95   ARG F C     1 
ATOM   4495  O  O     . ARG F  2 95  ? -8.451  -22.384 44.459 1.00 24.04  ? 95   ARG F O     1 
ATOM   4496  C  CB    . ARG F  2 95  ? -9.959  -23.609 46.362 1.00 24.33  ? 95   ARG F CB    1 
ATOM   4497  C  CG    . ARG F  2 95  ? -10.845 -24.638 47.053 1.00 26.32  ? 95   ARG F CG    1 
ATOM   4498  C  CD    . ARG F  2 95  ? -11.252 -24.258 48.461 1.00 32.27  ? 95   ARG F CD    1 
ATOM   4499  N  NE    . ARG F  2 95  ? -10.184 -23.618 49.258 1.00 35.84  ? 95   ARG F NE    1 
ATOM   4500  C  CZ    . ARG F  2 95  ? -10.406 -22.767 50.267 1.00 35.06  ? 95   ARG F CZ    1 
ATOM   4501  N  NH1   . ARG F  2 95  ? -11.643 -22.446 50.612 1.00 35.51  ? 95   ARG F NH1   1 
ATOM   4502  N  NH2   . ARG F  2 95  ? -9.396  -22.238 50.940 1.00 35.26  ? 95   ARG F NH2   1 
ATOM   4503  N  N     . THR F  2 96  ? -9.935  -20.812 43.855 1.00 22.82  ? 96   THR F N     1 
ATOM   4504  C  CA    . THR F  2 96  ? -9.003  -20.167 42.918 1.00 22.21  ? 96   THR F CA    1 
ATOM   4505  C  C     . THR F  2 96  ? -7.660  -19.794 43.531 1.00 22.03  ? 96   THR F C     1 
ATOM   4506  O  O     . THR F  2 96  ? -7.589  -19.096 44.547 1.00 22.85  ? 96   THR F O     1 
ATOM   4507  C  CB    . THR F  2 96  ? -9.609  -18.914 42.289 1.00 21.87  ? 96   THR F CB    1 
ATOM   4508  O  OG1   . THR F  2 96  ? -10.744 -19.288 41.512 1.00 23.42  ? 96   THR F OG1   1 
ATOM   4509  C  CG2   . THR F  2 96  ? -8.637  -18.276 41.361 1.00 21.96  ? 96   THR F CG2   1 
ATOM   4510  N  N     . LEU F  2 97  ? -6.587  -20.224 42.891 1.00 21.46  ? 97   LEU F N     1 
ATOM   4511  C  CA    . LEU F  2 97  ? -5.268  -19.931 43.394 1.00 21.05  ? 97   LEU F CA    1 
ATOM   4512  C  C     . LEU F  2 97  ? -4.528  -18.976 42.485 1.00 21.07  ? 97   LEU F C     1 
ATOM   4513  O  O     . LEU F  2 97  ? -4.423  -19.231 41.318 1.00 21.52  ? 97   LEU F O     1 
ATOM   4514  C  CB    . LEU F  2 97  ? -4.480  -21.224 43.516 1.00 20.72  ? 97   LEU F CB    1 
ATOM   4515  C  CG    . LEU F  2 97  ? -3.060  -21.051 44.008 1.00 20.59  ? 97   LEU F CG    1 
ATOM   4516  C  CD1   . LEU F  2 97  ? -3.021  -20.281 45.336 1.00 21.48  ? 97   LEU F CD1   1 
ATOM   4517  C  CD2   . LEU F  2 97  ? -2.432  -22.410 44.133 1.00 20.98  ? 97   LEU F CD2   1 
ATOM   4518  N  N     . TYR F  2 98  ? -4.010  -17.882 43.033 1.00 21.40  ? 98   TYR F N     1 
ATOM   4519  C  CA    . TYR F  2 98  ? -3.163  -16.967 42.304 1.00 21.44  ? 98   TYR F CA    1 
ATOM   4520  C  C     . TYR F  2 98  ? -1.727  -17.211 42.657 1.00 22.46  ? 98   TYR F C     1 
ATOM   4521  O  O     . TYR F  2 98  ? -1.410  -17.480 43.821 1.00 23.03  ? 98   TYR F O     1 
ATOM   4522  C  CB    . TYR F  2 98  ? -3.439  -15.539 42.696 1.00 21.17  ? 98   TYR F CB    1 
ATOM   4523  C  CG    . TYR F  2 98  ? -4.726  -14.930 42.201 1.00 21.33  ? 98   TYR F CG    1 
ATOM   4524  C  CD1   . TYR F  2 98  ? -5.599  -15.617 41.351 1.00 22.50  ? 98   TYR F CD1   1 
ATOM   4525  C  CD2   . TYR F  2 98  ? -5.048  -13.632 42.558 1.00 19.64  ? 98   TYR F CD2   1 
ATOM   4526  C  CE1   . TYR F  2 98  ? -6.774  -15.022 40.922 1.00 21.62  ? 98   TYR F CE1   1 
ATOM   4527  C  CE2   . TYR F  2 98  ? -6.194  -13.044 42.140 1.00 20.01  ? 98   TYR F CE2   1 
ATOM   4528  C  CZ    . TYR F  2 98  ? -7.054  -13.732 41.335 1.00 21.05  ? 98   TYR F CZ    1 
ATOM   4529  O  OH    . TYR F  2 98  ? -8.194  -13.088 40.955 1.00 22.97  ? 98   TYR F OH    1 
ATOM   4530  N  N     . GLY F  2 99  ? -0.849  -17.086 41.667 1.00 22.80  ? 99   GLY F N     1 
ATOM   4531  C  CA    . GLY F  2 99  ? 0.570   -17.102 41.927 1.00 23.67  ? 99   GLY F CA    1 
ATOM   4532  C  C     . GLY F  2 99  ? 1.313   -18.133 41.126 1.00 24.88  ? 99   GLY F C     1 
ATOM   4533  O  O     . GLY F  2 99  ? 2.536   -18.135 41.111 1.00 25.26  ? 99   GLY F O     1 
ATOM   4534  N  N     . PHE F  2 100 ? 0.587   -18.999 40.435 1.00 26.25  ? 100  PHE F N     1 
ATOM   4535  C  CA    . PHE F  2 100 ? 1.220   -20.142 39.785 1.00 27.57  ? 100  PHE F CA    1 
ATOM   4536  C  C     . PHE F  2 100 ? 0.915   -20.296 38.307 1.00 28.62  ? 100  PHE F C     1 
ATOM   4537  O  O     . PHE F  2 100 ? 1.044   -21.388 37.767 1.00 29.00  ? 100  PHE F O     1 
ATOM   4538  C  CB    . PHE F  2 100 ? 0.852   -21.425 40.530 1.00 27.30  ? 100  PHE F CB    1 
ATOM   4539  C  CG    . PHE F  2 100 ? 1.503   -21.549 41.874 1.00 27.59  ? 100  PHE F CG    1 
ATOM   4540  C  CD1   . PHE F  2 100 ? 0.849   -21.120 43.021 1.00 26.91  ? 100  PHE F CD1   1 
ATOM   4541  C  CD2   . PHE F  2 100 ? 2.779   -22.113 41.996 1.00 28.63  ? 100  PHE F CD2   1 
ATOM   4542  C  CE1   . PHE F  2 100 ? 1.451   -21.255 44.277 1.00 27.68  ? 100  PHE F CE1   1 
ATOM   4543  C  CE2   . PHE F  2 100 ? 3.397   -22.254 43.257 1.00 28.32  ? 100  PHE F CE2   1 
ATOM   4544  C  CZ    . PHE F  2 100 ? 2.729   -21.820 44.395 1.00 27.23  ? 100  PHE F CZ    1 
ATOM   4545  N  N     . GLY F  2 101 ? 0.508   -19.219 37.654 1.00 30.09  ? 101  GLY F N     1 
ATOM   4546  C  CA    . GLY F  2 101 ? 0.218   -19.277 36.235 1.00 32.59  ? 101  GLY F CA    1 
ATOM   4547  C  C     . GLY F  2 101 ? -1.238  -19.046 35.885 1.00 34.60  ? 101  GLY F C     1 
ATOM   4548  O  O     . GLY F  2 101 ? -2.067  -18.759 36.756 1.00 35.41  ? 101  GLY F O     1 
ATOM   4549  N  N     . GLY F  2 102 ? -1.552  -19.143 34.595 1.00 36.06  ? 102  GLY F N     1 
ATOM   4550  C  CA    . GLY F  2 102 ? -2.924  -18.946 34.129 1.00 37.58  ? 102  GLY F CA    1 
ATOM   4551  C  C     . GLY F  2 102 ? -3.435  -17.528 34.342 1.00 38.51  ? 102  GLY F C     1 
ATOM   4552  O  O     . GLY F  2 102 ? -2.657  -16.565 34.456 1.00 38.93  ? 102  GLY F O     1 
ATOM   4553  O  OXT   . GLY F  2 102 ? -4.652  -17.317 34.405 1.00 38.87  ? 102  GLY F OXT   1 
ATOM   4554  N  N     . LYS G  3 13  ? -36.008 -36.549 4.754  1.00 78.36  ? 13   LYS G N     1 
ATOM   4555  C  CA    . LYS G  3 13  ? -35.061 -36.916 5.856  1.00 78.39  ? 13   LYS G CA    1 
ATOM   4556  C  C     . LYS G  3 13  ? -35.107 -38.422 6.173  1.00 77.93  ? 13   LYS G C     1 
ATOM   4557  O  O     . LYS G  3 13  ? -36.108 -38.911 6.718  1.00 78.10  ? 13   LYS G O     1 
ATOM   4558  C  CB    . LYS G  3 13  ? -35.375 -36.110 7.125  1.00 78.66  ? 13   LYS G CB    1 
ATOM   4559  C  CG    . LYS G  3 13  ? -35.447 -34.593 6.953  1.00 79.52  ? 13   LYS G CG    1 
ATOM   4560  C  CD    . LYS G  3 13  ? -35.174 -33.898 8.291  1.00 81.26  ? 13   LYS G CD    1 
ATOM   4561  C  CE    . LYS G  3 13  ? -35.964 -32.598 8.433  1.00 81.86  ? 13   LYS G CE    1 
ATOM   4562  N  NZ    . LYS G  3 13  ? -37.189 -32.759 9.333  1.00 82.04  ? 13   LYS G NZ    1 
ATOM   4563  N  N     . ALA G  3 14  ? -34.028 -39.142 5.847  1.00 77.11  ? 14   ALA G N     1 
ATOM   4564  C  CA    . ALA G  3 14  ? -33.977 -40.613 5.988  1.00 76.25  ? 14   ALA G CA    1 
ATOM   4565  C  C     . ALA G  3 14  ? -34.243 -41.103 7.426  1.00 75.56  ? 14   ALA G C     1 
ATOM   4566  O  O     . ALA G  3 14  ? -35.405 -41.276 7.824  1.00 75.59  ? 14   ALA G O     1 
ATOM   4567  C  CB    . ALA G  3 14  ? -32.649 -41.174 5.434  1.00 76.28  ? 14   ALA G CB    1 
ATOM   4568  N  N     . LYS G  3 15  ? -33.179 -41.334 8.196  1.00 74.41  ? 15   LYS G N     1 
ATOM   4569  C  CA    . LYS G  3 15  ? -33.332 -41.631 9.622  1.00 73.26  ? 15   LYS G CA    1 
ATOM   4570  C  C     . LYS G  3 15  ? -32.779 -40.497 10.468 1.00 72.10  ? 15   LYS G C     1 
ATOM   4571  O  O     . LYS G  3 15  ? -31.764 -39.877 10.107 1.00 72.05  ? 15   LYS G O     1 
ATOM   4572  C  CB    . LYS G  3 15  ? -32.682 -42.970 10.012 1.00 73.41  ? 15   LYS G CB    1 
ATOM   4573  C  CG    . LYS G  3 15  ? -33.490 -44.226 9.612  1.00 73.94  ? 15   LYS G CG    1 
ATOM   4574  C  CD    . LYS G  3 15  ? -35.004 -44.110 9.925  1.00 75.11  ? 15   LYS G CD    1 
ATOM   4575  C  CE    . LYS G  3 15  ? -35.348 -44.288 11.416 1.00 75.29  ? 15   LYS G CE    1 
ATOM   4576  N  NZ    . LYS G  3 15  ? -35.430 -45.724 11.826 1.00 74.95  ? 15   LYS G NZ    1 
ATOM   4577  N  N     . THR G  3 16  ? -33.457 -40.212 11.582 1.00 70.30  ? 16   THR G N     1 
ATOM   4578  C  CA    . THR G  3 16  ? -32.951 -39.225 12.531 1.00 68.37  ? 16   THR G CA    1 
ATOM   4579  C  C     . THR G  3 16  ? -31.647 -39.753 13.124 1.00 67.00  ? 16   THR G C     1 
ATOM   4580  O  O     . THR G  3 16  ? -31.460 -40.970 13.262 1.00 66.78  ? 16   THR G O     1 
ATOM   4581  C  CB    . THR G  3 16  ? -33.957 -38.898 13.676 1.00 68.40  ? 16   THR G CB    1 
ATOM   4582  O  OG1   . THR G  3 16  ? -34.178 -40.063 14.483 1.00 68.53  ? 16   THR G OG1   1 
ATOM   4583  C  CG2   . THR G  3 16  ? -35.284 -38.376 13.130 1.00 67.84  ? 16   THR G CG2   1 
ATOM   4584  N  N     . ARG G  3 17  ? -30.744 -38.833 13.452 1.00 65.25  ? 17   ARG G N     1 
ATOM   4585  C  CA    . ARG G  3 17  ? -29.516 -39.178 14.160 1.00 63.43  ? 17   ARG G CA    1 
ATOM   4586  C  C     . ARG G  3 17  ? -29.795 -39.811 15.541 1.00 62.32  ? 17   ARG G C     1 
ATOM   4587  O  O     . ARG G  3 17  ? -29.004 -40.619 16.030 1.00 62.11  ? 17   ARG G O     1 
ATOM   4588  C  CB    . ARG G  3 17  ? -28.620 -37.949 14.284 1.00 63.42  ? 17   ARG G CB    1 
ATOM   4589  C  CG    . ARG G  3 17  ? -27.876 -37.590 13.017 1.00 62.78  ? 17   ARG G CG    1 
ATOM   4590  C  CD    . ARG G  3 17  ? -26.777 -36.579 13.295 1.00 62.23  ? 17   ARG G CD    1 
ATOM   4591  N  NE    . ARG G  3 17  ? -27.246 -35.193 13.222 1.00 62.73  ? 17   ARG G NE    1 
ATOM   4592  C  CZ    . ARG G  3 17  ? -26.495 -34.124 13.496 1.00 62.95  ? 17   ARG G CZ    1 
ATOM   4593  N  NH1   . ARG G  3 17  ? -25.232 -34.273 13.882 1.00 62.68  ? 17   ARG G NH1   1 
ATOM   4594  N  NH2   . ARG G  3 17  ? -27.005 -32.901 13.391 1.00 62.72  ? 17   ARG G NH2   1 
ATOM   4595  N  N     . SER G  3 18  ? -30.927 -39.459 16.149 1.00 60.73  ? 18   SER G N     1 
ATOM   4596  C  CA    . SER G  3 18  ? -31.333 -40.036 17.425 1.00 59.58  ? 18   SER G CA    1 
ATOM   4597  C  C     . SER G  3 18  ? -31.667 -41.510 17.321 1.00 58.91  ? 18   SER G C     1 
ATOM   4598  O  O     . SER G  3 18  ? -31.353 -42.279 18.223 1.00 58.91  ? 18   SER G O     1 
ATOM   4599  C  CB    . SER G  3 18  ? -32.529 -39.293 17.986 1.00 59.48  ? 18   SER G CB    1 
ATOM   4600  O  OG    . SER G  3 18  ? -32.322 -37.905 17.867 1.00 59.50  ? 18   SER G OG    1 
ATOM   4601  N  N     . SER G  3 19  ? -32.318 -41.904 16.229 1.00 58.10  ? 19   SER G N     1 
ATOM   4602  C  CA    . SER G  3 19  ? -32.628 -43.312 15.999 1.00 57.08  ? 19   SER G CA    1 
ATOM   4603  C  C     . SER G  3 19  ? -31.355 -44.067 15.655 1.00 56.33  ? 19   SER G C     1 
ATOM   4604  O  O     . SER G  3 19  ? -31.166 -45.200 16.095 1.00 55.89  ? 19   SER G O     1 
ATOM   4605  C  CB    . SER G  3 19  ? -33.689 -43.473 14.912 1.00 57.17  ? 19   SER G CB    1 
ATOM   4606  O  OG    . SER G  3 19  ? -33.572 -42.466 13.920 1.00 57.71  ? 19   SER G OG    1 
ATOM   4607  N  N     . ARG G  3 20  ? -30.479 -43.415 14.891 1.00 55.74  ? 20   ARG G N     1 
ATOM   4608  C  CA    . ARG G  3 20  ? -29.148 -43.955 14.567 1.00 55.56  ? 20   ARG G CA    1 
ATOM   4609  C  C     . ARG G  3 20  ? -28.344 -44.232 15.831 1.00 54.39  ? 20   ARG G C     1 
ATOM   4610  O  O     . ARG G  3 20  ? -27.767 -45.305 15.981 1.00 54.35  ? 20   ARG G O     1 
ATOM   4611  C  CB    . ARG G  3 20  ? -28.365 -43.012 13.630 1.00 55.51  ? 20   ARG G CB    1 
ATOM   4612  C  CG    . ARG G  3 20  ? -28.418 -43.403 12.158 1.00 56.83  ? 20   ARG G CG    1 
ATOM   4613  C  CD    . ARG G  3 20  ? -27.773 -42.385 11.205 1.00 57.30  ? 20   ARG G CD    1 
ATOM   4614  N  NE    . ARG G  3 20  ? -27.734 -42.931 9.838  1.00 63.36  ? 20   ARG G NE    1 
ATOM   4615  C  CZ    . ARG G  3 20  ? -27.817 -42.221 8.703  1.00 65.66  ? 20   ARG G CZ    1 
ATOM   4616  N  NH1   . ARG G  3 20  ? -27.958 -40.895 8.720  1.00 66.55  ? 20   ARG G NH1   1 
ATOM   4617  N  NH2   . ARG G  3 20  ? -27.760 -42.847 7.530  1.00 65.96  ? 20   ARG G NH2   1 
ATOM   4618  N  N     . ALA G  3 21  ? -28.325 -43.256 16.737 1.00 53.27  ? 21   ALA G N     1 
ATOM   4619  C  CA    . ALA G  3 21  ? -27.622 -43.372 18.005 1.00 52.08  ? 21   ALA G CA    1 
ATOM   4620  C  C     . ALA G  3 21  ? -28.404 -44.245 18.985 1.00 51.53  ? 21   ALA G C     1 
ATOM   4621  O  O     . ALA G  3 21  ? -27.867 -44.699 19.998 1.00 51.45  ? 21   ALA G O     1 
ATOM   4622  C  CB    . ALA G  3 21  ? -27.385 -41.998 18.583 1.00 51.98  ? 21   ALA G CB    1 
ATOM   4623  N  N     . GLY G  3 22  ? -29.677 -44.475 18.673 1.00 50.79  ? 22   GLY G N     1 
ATOM   4624  C  CA    . GLY G  3 22  ? -30.524 -45.357 19.466 1.00 49.83  ? 22   GLY G CA    1 
ATOM   4625  C  C     . GLY G  3 22  ? -31.136 -44.636 20.638 1.00 49.19  ? 22   GLY G C     1 
ATOM   4626  O  O     . GLY G  3 22  ? -31.412 -45.246 21.666 1.00 49.27  ? 22   GLY G O     1 
ATOM   4627  N  N     . LEU G  3 23  ? -31.369 -43.338 20.469 1.00 48.32  ? 23   LEU G N     1 
ATOM   4628  C  CA    . LEU G  3 23  ? -31.752 -42.473 21.571 1.00 47.37  ? 23   LEU G CA    1 
ATOM   4629  C  C     . LEU G  3 23  ? -33.095 -41.825 21.333 1.00 47.23  ? 23   LEU G C     1 
ATOM   4630  O  O     . LEU G  3 23  ? -33.548 -41.692 20.201 1.00 47.65  ? 23   LEU G O     1 
ATOM   4631  C  CB    . LEU G  3 23  ? -30.701 -41.373 21.778 1.00 47.14  ? 23   LEU G CB    1 
ATOM   4632  C  CG    . LEU G  3 23  ? -29.207 -41.686 21.907 1.00 46.13  ? 23   LEU G CG    1 
ATOM   4633  C  CD1   . LEU G  3 23  ? -28.448 -40.390 21.918 1.00 45.29  ? 23   LEU G CD1   1 
ATOM   4634  C  CD2   . LEU G  3 23  ? -28.892 -42.477 23.155 1.00 45.21  ? 23   LEU G CD2   1 
ATOM   4635  N  N     . GLN G  3 24  ? -33.706 -41.386 22.420 1.00 46.95  ? 24   GLN G N     1 
ATOM   4636  C  CA    . GLN G  3 24  ? -34.956 -40.657 22.387 1.00 46.57  ? 24   GLN G CA    1 
ATOM   4637  C  C     . GLN G  3 24  ? -34.736 -39.157 22.517 1.00 45.98  ? 24   GLN G C     1 
ATOM   4638  O  O     . GLN G  3 24  ? -35.682 -38.377 22.391 1.00 46.49  ? 24   GLN G O     1 
ATOM   4639  C  CB    . GLN G  3 24  ? -35.824 -41.135 23.533 1.00 46.90  ? 24   GLN G CB    1 
ATOM   4640  C  CG    . GLN G  3 24  ? -35.810 -42.636 23.674 1.00 48.20  ? 24   GLN G CG    1 
ATOM   4641  C  CD    . GLN G  3 24  ? -36.694 -43.288 22.655 1.00 50.73  ? 24   GLN G CD    1 
ATOM   4642  O  OE1   . GLN G  3 24  ? -37.642 -42.670 22.163 1.00 52.71  ? 24   GLN G OE1   1 
ATOM   4643  N  NE2   . GLN G  3 24  ? -36.406 -44.546 22.331 1.00 51.80  ? 24   GLN G NE2   1 
ATOM   4644  N  N     . PHE G  3 25  ? -33.495 -38.757 22.777 1.00 45.00  ? 25   PHE G N     1 
ATOM   4645  C  CA    . PHE G  3 25  ? -33.149 -37.344 22.948 1.00 44.13  ? 25   PHE G CA    1 
ATOM   4646  C  C     . PHE G  3 25  ? -32.666 -36.716 21.642 1.00 43.36  ? 25   PHE G C     1 
ATOM   4647  O  O     . PHE G  3 25  ? -31.885 -37.333 20.927 1.00 43.83  ? 25   PHE G O     1 
ATOM   4648  C  CB    . PHE G  3 25  ? -32.100 -37.178 24.048 1.00 43.95  ? 25   PHE G CB    1 
ATOM   4649  C  CG    . PHE G  3 25  ? -32.647 -36.601 25.325 1.00 43.94  ? 25   PHE G CG    1 
ATOM   4650  C  CD1   . PHE G  3 25  ? -33.507 -37.342 26.131 1.00 43.56  ? 25   PHE G CD1   1 
ATOM   4651  C  CD2   . PHE G  3 25  ? -32.299 -35.310 25.721 1.00 43.42  ? 25   PHE G CD2   1 
ATOM   4652  C  CE1   . PHE G  3 25  ? -34.016 -36.814 27.306 1.00 43.19  ? 25   PHE G CE1   1 
ATOM   4653  C  CE2   . PHE G  3 25  ? -32.800 -34.774 26.895 1.00 43.00  ? 25   PHE G CE2   1 
ATOM   4654  C  CZ    . PHE G  3 25  ? -33.663 -35.528 27.690 1.00 43.36  ? 25   PHE G CZ    1 
ATOM   4655  N  N     . PRO G  3 26  ? -33.090 -35.469 21.351 1.00 42.45  ? 26   PRO G N     1 
ATOM   4656  C  CA    . PRO G  3 26  ? -32.890 -34.893 20.018 1.00 41.27  ? 26   PRO G CA    1 
ATOM   4657  C  C     . PRO G  3 26  ? -31.429 -34.523 19.724 1.00 40.37  ? 26   PRO G C     1 
ATOM   4658  O  O     . PRO G  3 26  ? -30.986 -33.411 20.027 1.00 40.18  ? 26   PRO G O     1 
ATOM   4659  C  CB    . PRO G  3 26  ? -33.779 -33.650 20.042 1.00 41.35  ? 26   PRO G CB    1 
ATOM   4660  C  CG    . PRO G  3 26  ? -33.802 -33.237 21.486 1.00 41.72  ? 26   PRO G CG    1 
ATOM   4661  C  CD    . PRO G  3 26  ? -33.728 -34.510 22.281 1.00 42.40  ? 26   PRO G CD    1 
ATOM   4662  N  N     . VAL G  3 27  ? -30.706 -35.459 19.113 1.00 39.22  ? 27   VAL G N     1 
ATOM   4663  C  CA    . VAL G  3 27  ? -29.317 -35.263 18.731 1.00 38.09  ? 27   VAL G CA    1 
ATOM   4664  C  C     . VAL G  3 27  ? -29.114 -33.989 17.936 1.00 38.26  ? 27   VAL G C     1 
ATOM   4665  O  O     . VAL G  3 27  ? -28.229 -33.198 18.259 1.00 39.04  ? 27   VAL G O     1 
ATOM   4666  C  CB    . VAL G  3 27  ? -28.779 -36.452 17.942 1.00 37.74  ? 27   VAL G CB    1 
ATOM   4667  C  CG1   . VAL G  3 27  ? -27.375 -36.183 17.476 1.00 37.08  ? 27   VAL G CG1   1 
ATOM   4668  C  CG2   . VAL G  3 27  ? -28.808 -37.701 18.797 1.00 36.84  ? 27   VAL G CG2   1 
ATOM   4669  N  N     . GLY G  3 28  ? -29.933 -33.778 16.911 1.00 38.00  ? 28   GLY G N     1 
ATOM   4670  C  CA    . GLY G  3 28  ? -29.799 -32.594 16.060 1.00 37.24  ? 28   GLY G CA    1 
ATOM   4671  C  C     . GLY G  3 28  ? -29.919 -31.297 16.831 1.00 36.80  ? 28   GLY G C     1 
ATOM   4672  O  O     . GLY G  3 28  ? -29.179 -30.350 16.582 1.00 36.85  ? 28   GLY G O     1 
ATOM   4673  N  N     . ARG G  3 29  ? -30.858 -31.258 17.771 1.00 36.46  ? 29   ARG G N     1 
ATOM   4674  C  CA    . ARG G  3 29  ? -31.053 -30.093 18.637 1.00 36.13  ? 29   ARG G CA    1 
ATOM   4675  C  C     . ARG G  3 29  ? -29.843 -29.845 19.520 1.00 35.85  ? 29   ARG G C     1 
ATOM   4676  O  O     . ARG G  3 29  ? -29.421 -28.706 19.671 1.00 35.44  ? 29   ARG G O     1 
ATOM   4677  C  CB    . ARG G  3 29  ? -32.290 -30.282 19.501 1.00 36.04  ? 29   ARG G CB    1 
ATOM   4678  C  CG    . ARG G  3 29  ? -32.613 -29.112 20.395 1.00 37.49  ? 29   ARG G CG    1 
ATOM   4679  C  CD    . ARG G  3 29  ? -33.855 -29.375 21.249 1.00 39.38  ? 29   ARG G CD    1 
ATOM   4680  N  NE    . ARG G  3 29  ? -35.086 -29.310 20.469 1.00 40.93  ? 29   ARG G NE    1 
ATOM   4681  C  CZ    . ARG G  3 29  ? -36.300 -29.173 20.995 1.00 42.90  ? 29   ARG G CZ    1 
ATOM   4682  N  NH1   . ARG G  3 29  ? -36.454 -29.078 22.308 1.00 44.36  ? 29   ARG G NH1   1 
ATOM   4683  N  NH2   . ARG G  3 29  ? -37.364 -29.126 20.208 1.00 43.82  ? 29   ARG G NH2   1 
ATOM   4684  N  N     . VAL G  3 30  ? -29.289 -30.914 20.092 1.00 35.76  ? 30   VAL G N     1 
ATOM   4685  C  CA    . VAL G  3 30  ? -28.093 -30.816 20.916 1.00 35.76  ? 30   VAL G CA    1 
ATOM   4686  C  C     . VAL G  3 30  ? -26.946 -30.287 20.067 1.00 36.82  ? 30   VAL G C     1 
ATOM   4687  O  O     . VAL G  3 30  ? -26.236 -29.373 20.490 1.00 37.51  ? 30   VAL G O     1 
ATOM   4688  C  CB    . VAL G  3 30  ? -27.720 -32.160 21.606 1.00 35.44  ? 30   VAL G CB    1 
ATOM   4689  C  CG1   . VAL G  3 30  ? -26.409 -32.040 22.334 1.00 35.00  ? 30   VAL G CG1   1 
ATOM   4690  C  CG2   . VAL G  3 30  ? -28.785 -32.574 22.595 1.00 34.22  ? 30   VAL G CG2   1 
ATOM   4691  N  N     . HIS G  3 31  ? -26.782 -30.819 18.858 1.00 37.77  ? 31   HIS G N     1 
ATOM   4692  C  CA    . HIS G  3 31  ? -25.741 -30.326 17.945 1.00 38.92  ? 31   HIS G CA    1 
ATOM   4693  C  C     . HIS G  3 31  ? -25.879 -28.824 17.706 1.00 39.07  ? 31   HIS G C     1 
ATOM   4694  O  O     . HIS G  3 31  ? -24.906 -28.072 17.785 1.00 39.09  ? 31   HIS G O     1 
ATOM   4695  C  CB    . HIS G  3 31  ? -25.790 -31.063 16.600 1.00 39.47  ? 31   HIS G CB    1 
ATOM   4696  C  CG    . HIS G  3 31  ? -24.497 -31.029 15.838 1.00 41.09  ? 31   HIS G CG    1 
ATOM   4697  N  ND1   . HIS G  3 31  ? -23.866 -29.855 15.481 1.00 43.06  ? 31   HIS G ND1   1 
ATOM   4698  C  CD2   . HIS G  3 31  ? -23.726 -32.032 15.352 1.00 42.44  ? 31   HIS G CD2   1 
ATOM   4699  C  CE1   . HIS G  3 31  ? -22.753 -30.138 14.827 1.00 42.91  ? 31   HIS G CE1   1 
ATOM   4700  N  NE2   . HIS G  3 31  ? -22.645 -31.451 14.733 1.00 42.42  ? 31   HIS G NE2   1 
ATOM   4701  N  N     . ARG G  3 32  ? -27.098 -28.393 17.418 1.00 39.53  ? 32   ARG G N     1 
ATOM   4702  C  CA    . ARG G  3 32  ? -27.338 -27.005 17.090 1.00 40.25  ? 32   ARG G CA    1 
ATOM   4703  C  C     . ARG G  3 32  ? -27.049 -26.130 18.297 1.00 40.48  ? 32   ARG G C     1 
ATOM   4704  O  O     . ARG G  3 32  ? -26.451 -25.064 18.164 1.00 40.59  ? 32   ARG G O     1 
ATOM   4705  C  CB    . ARG G  3 32  ? -28.766 -26.799 16.575 1.00 40.31  ? 32   ARG G CB    1 
ATOM   4706  C  CG    . ARG G  3 32  ? -29.216 -25.352 16.587 1.00 41.44  ? 32   ARG G CG    1 
ATOM   4707  C  CD    . ARG G  3 32  ? -30.551 -25.174 15.909 1.00 44.64  ? 32   ARG G CD    1 
ATOM   4708  N  NE    . ARG G  3 32  ? -31.624 -25.971 16.504 1.00 46.62  ? 32   ARG G NE    1 
ATOM   4709  C  CZ    . ARG G  3 32  ? -32.377 -25.582 17.534 1.00 47.81  ? 32   ARG G CZ    1 
ATOM   4710  N  NH1   . ARG G  3 32  ? -32.165 -24.409 18.115 1.00 48.47  ? 32   ARG G NH1   1 
ATOM   4711  N  NH2   . ARG G  3 32  ? -33.347 -26.372 17.993 1.00 48.33  ? 32   ARG G NH2   1 
ATOM   4712  N  N     . LEU G  3 33  ? -27.462 -26.596 19.472 1.00 40.95  ? 33   LEU G N     1 
ATOM   4713  C  CA    . LEU G  3 33  ? -27.280 -25.840 20.699 1.00 41.30  ? 33   LEU G CA    1 
ATOM   4714  C  C     . LEU G  3 33  ? -25.799 -25.684 21.051 1.00 41.75  ? 33   LEU G C     1 
ATOM   4715  O  O     . LEU G  3 33  ? -25.405 -24.664 21.635 1.00 41.49  ? 33   LEU G O     1 
ATOM   4716  C  CB    . LEU G  3 33  ? -28.074 -26.459 21.852 1.00 41.21  ? 33   LEU G CB    1 
ATOM   4717  C  CG    . LEU G  3 33  ? -29.584 -26.197 21.865 1.00 41.10  ? 33   LEU G CG    1 
ATOM   4718  C  CD1   . LEU G  3 33  ? -30.273 -27.026 22.933 1.00 41.45  ? 33   LEU G CD1   1 
ATOM   4719  C  CD2   . LEU G  3 33  ? -29.914 -24.727 22.060 1.00 41.31  ? 33   LEU G CD2   1 
ATOM   4720  N  N     . LEU G  3 34  ? -24.985 -26.673 20.678 1.00 42.22  ? 34   LEU G N     1 
ATOM   4721  C  CA    . LEU G  3 34  ? -23.538 -26.545 20.838 1.00 43.30  ? 34   LEU G CA    1 
ATOM   4722  C  C     . LEU G  3 34  ? -22.954 -25.418 19.987 1.00 44.33  ? 34   LEU G C     1 
ATOM   4723  O  O     . LEU G  3 34  ? -22.172 -24.613 20.492 1.00 44.89  ? 34   LEU G O     1 
ATOM   4724  C  CB    . LEU G  3 34  ? -22.815 -27.865 20.573 1.00 42.89  ? 34   LEU G CB    1 
ATOM   4725  C  CG    . LEU G  3 34  ? -22.875 -28.874 21.726 1.00 42.81  ? 34   LEU G CG    1 
ATOM   4726  C  CD1   . LEU G  3 34  ? -22.705 -30.300 21.247 1.00 41.03  ? 34   LEU G CD1   1 
ATOM   4727  C  CD2   . LEU G  3 34  ? -21.850 -28.564 22.813 1.00 43.64  ? 34   LEU G CD2   1 
ATOM   4728  N  N     . ARG G  3 35  ? -23.344 -25.340 18.715 1.00 45.56  ? 35   ARG G N     1 
ATOM   4729  C  CA    . ARG G  3 35  ? -22.815 -24.320 17.794 1.00 46.62  ? 35   ARG G CA    1 
ATOM   4730  C  C     . ARG G  3 35  ? -23.172 -22.905 18.218 1.00 46.88  ? 35   ARG G C     1 
ATOM   4731  O  O     . ARG G  3 35  ? -22.306 -22.034 18.291 1.00 47.28  ? 35   ARG G O     1 
ATOM   4732  C  CB    . ARG G  3 35  ? -23.330 -24.539 16.379 1.00 47.03  ? 35   ARG G CB    1 
ATOM   4733  C  CG    . ARG G  3 35  ? -23.510 -25.969 15.999 1.00 49.31  ? 35   ARG G CG    1 
ATOM   4734  C  CD    . ARG G  3 35  ? -23.866 -26.063 14.535 1.00 54.50  ? 35   ARG G CD    1 
ATOM   4735  N  NE    . ARG G  3 35  ? -23.193 -27.208 13.935 1.00 58.54  ? 35   ARG G NE    1 
ATOM   4736  C  CZ    . ARG G  3 35  ? -21.869 -27.302 13.788 1.00 61.20  ? 35   ARG G CZ    1 
ATOM   4737  N  NH1   . ARG G  3 35  ? -21.068 -26.317 14.204 1.00 61.94  ? 35   ARG G NH1   1 
ATOM   4738  N  NH2   . ARG G  3 35  ? -21.339 -28.384 13.227 1.00 62.18  ? 35   ARG G NH2   1 
ATOM   4739  N  N     . LYS G  3 36  ? -24.451 -22.673 18.489 1.00 47.37  ? 36   LYS G N     1 
ATOM   4740  C  CA    . LYS G  3 36  ? -24.913 -21.339 18.833 1.00 48.06  ? 36   LYS G CA    1 
ATOM   4741  C  C     . LYS G  3 36  ? -24.511 -21.057 20.266 1.00 47.97  ? 36   LYS G C     1 
ATOM   4742  O  O     . LYS G  3 36  ? -24.727 -19.960 20.788 1.00 48.37  ? 36   LYS G O     1 
ATOM   4743  C  CB    . LYS G  3 36  ? -26.433 -21.216 18.666 1.00 48.44  ? 36   LYS G CB    1 
ATOM   4744  C  CG    . LYS G  3 36  ? -27.230 -21.532 19.939 1.00 50.17  ? 36   LYS G CG    1 
ATOM   4745  C  CD    . LYS G  3 36  ? -28.584 -20.816 19.984 1.00 52.90  ? 36   LYS G CD    1 
ATOM   4746  C  CE    . LYS G  3 36  ? -29.231 -20.982 21.366 1.00 54.43  ? 36   LYS G CE    1 
ATOM   4747  N  NZ    . LYS G  3 36  ? -30.694 -20.662 21.365 1.00 55.14  ? 36   LYS G NZ    1 
ATOM   4748  N  N     . GLY G  3 37  ? -23.934 -22.069 20.905 1.00 47.79  ? 37   GLY G N     1 
ATOM   4749  C  CA    . GLY G  3 37  ? -23.562 -21.972 22.303 1.00 47.08  ? 37   GLY G CA    1 
ATOM   4750  C  C     . GLY G  3 37  ? -22.344 -21.109 22.492 1.00 46.69  ? 37   GLY G C     1 
ATOM   4751  O  O     . GLY G  3 37  ? -22.160 -20.534 23.554 1.00 46.66  ? 37   GLY G O     1 
ATOM   4752  N  N     . ASN G  3 38  ? -21.533 -20.995 21.445 1.00 46.44  ? 38   ASN G N     1 
ATOM   4753  C  CA    . ASN G  3 38  ? -20.228 -20.339 21.535 1.00 46.41  ? 38   ASN G CA    1 
ATOM   4754  C  C     . ASN G  3 38  ? -19.362 -21.062 22.553 1.00 46.02  ? 38   ASN G C     1 
ATOM   4755  O  O     . ASN G  3 38  ? -18.694 -20.452 23.378 1.00 46.36  ? 38   ASN G O     1 
ATOM   4756  C  CB    . ASN G  3 38  ? -20.346 -18.839 21.861 1.00 46.43  ? 38   ASN G CB    1 
ATOM   4757  C  CG    . ASN G  3 38  ? -20.845 -18.017 20.687 1.00 46.88  ? 38   ASN G CG    1 
ATOM   4758  O  OD1   . ASN G  3 38  ? -21.584 -17.052 20.866 1.00 47.13  ? 38   ASN G OD1   1 
ATOM   4759  N  ND2   . ASN G  3 38  ? -20.444 -18.397 19.478 1.00 47.81  ? 38   ASN G ND2   1 
ATOM   4760  N  N     . TYR G  3 39  ? -19.397 -22.381 22.483 1.00 45.65  ? 39   TYR G N     1 
ATOM   4761  C  CA    . TYR G  3 39  ? -18.610 -23.218 23.351 1.00 45.39  ? 39   TYR G CA    1 
ATOM   4762  C  C     . TYR G  3 39  ? -17.242 -23.479 22.730 1.00 46.18  ? 39   TYR G C     1 
ATOM   4763  O  O     . TYR G  3 39  ? -16.234 -23.520 23.439 1.00 46.55  ? 39   TYR G O     1 
ATOM   4764  C  CB    . TYR G  3 39  ? -19.377 -24.509 23.645 1.00 44.58  ? 39   TYR G CB    1 
ATOM   4765  C  CG    . TYR G  3 39  ? -20.616 -24.268 24.471 1.00 43.05  ? 39   TYR G CG    1 
ATOM   4766  C  CD1   . TYR G  3 39  ? -21.871 -24.577 23.995 1.00 41.62  ? 39   TYR G CD1   1 
ATOM   4767  C  CD2   . TYR G  3 39  ? -20.520 -23.703 25.733 1.00 43.04  ? 39   TYR G CD2   1 
ATOM   4768  C  CE1   . TYR G  3 39  ? -23.003 -24.347 24.773 1.00 42.14  ? 39   TYR G CE1   1 
ATOM   4769  C  CE2   . TYR G  3 39  ? -21.627 -23.463 26.506 1.00 42.13  ? 39   TYR G CE2   1 
ATOM   4770  C  CZ    . TYR G  3 39  ? -22.863 -23.782 26.031 1.00 42.86  ? 39   TYR G CZ    1 
ATOM   4771  O  OH    . TYR G  3 39  ? -23.947 -23.522 26.836 1.00 43.30  ? 39   TYR G OH    1 
ATOM   4772  N  N     . ALA G  3 40  ? -17.209 -23.633 21.405 1.00 46.90  ? 40   ALA G N     1 
ATOM   4773  C  CA    . ALA G  3 40  ? -15.959 -23.769 20.648 1.00 47.77  ? 40   ALA G CA    1 
ATOM   4774  C  C     . ALA G  3 40  ? -16.149 -23.351 19.192 1.00 48.64  ? 40   ALA G C     1 
ATOM   4775  O  O     . ALA G  3 40  ? -17.277 -23.289 18.702 1.00 48.93  ? 40   ALA G O     1 
ATOM   4776  C  CB    . ALA G  3 40  ? -15.443 -25.185 20.719 1.00 47.54  ? 40   ALA G CB    1 
ATOM   4777  N  N     . GLU G  3 41  ? -15.043 -23.066 18.506 1.00 49.41  ? 41   GLU G N     1 
ATOM   4778  C  CA    . GLU G  3 41  ? -15.075 -22.761 17.074 1.00 50.46  ? 41   GLU G CA    1 
ATOM   4779  C  C     . GLU G  3 41  ? -15.776 -23.869 16.244 1.00 49.81  ? 41   GLU G C     1 
ATOM   4780  O  O     . GLU G  3 41  ? -16.514 -23.570 15.314 1.00 50.27  ? 41   GLU G O     1 
ATOM   4781  C  CB    . GLU G  3 41  ? -13.648 -22.502 16.568 1.00 50.37  ? 41   GLU G CB    1 
ATOM   4782  C  CG    . GLU G  3 41  ? -13.538 -21.868 15.166 1.00 52.52  ? 41   GLU G CG    1 
ATOM   4783  C  CD    . GLU G  3 41  ? -12.177 -22.148 14.463 1.00 52.92  ? 41   GLU G CD    1 
ATOM   4784  O  OE1   . GLU G  3 41  ? -11.697 -23.314 14.492 1.00 55.79  ? 41   GLU G OE1   1 
ATOM   4785  O  OE2   . GLU G  3 41  ? -11.593 -21.204 13.865 1.00 54.84  ? 41   GLU G OE2   1 
ATOM   4786  N  N     . ARG G  3 42  ? -15.575 -25.137 16.598 1.00 49.19  ? 42   ARG G N     1 
ATOM   4787  C  CA    . ARG G  3 42  ? -16.100 -26.259 15.806 1.00 48.51  ? 42   ARG G CA    1 
ATOM   4788  C  C     . ARG G  3 42  ? -16.769 -27.334 16.675 1.00 47.78  ? 42   ARG G C     1 
ATOM   4789  O  O     . ARG G  3 42  ? -16.740 -27.231 17.902 1.00 47.92  ? 42   ARG G O     1 
ATOM   4790  C  CB    . ARG G  3 42  ? -14.965 -26.875 14.988 1.00 48.74  ? 42   ARG G CB    1 
ATOM   4791  C  CG    . ARG G  3 42  ? -14.534 -26.013 13.821 1.00 49.93  ? 42   ARG G CG    1 
ATOM   4792  C  CD    . ARG G  3 42  ? -13.063 -26.158 13.525 1.00 52.15  ? 42   ARG G CD    1 
ATOM   4793  N  NE    . ARG G  3 42  ? -12.741 -27.324 12.699 1.00 54.89  ? 42   ARG G NE    1 
ATOM   4794  C  CZ    . ARG G  3 42  ? -12.449 -27.265 11.398 1.00 55.60  ? 42   ARG G CZ    1 
ATOM   4795  N  NH1   . ARG G  3 42  ? -12.450 -26.098 10.760 1.00 54.31  ? 42   ARG G NH1   1 
ATOM   4796  N  NH2   . ARG G  3 42  ? -12.147 -28.376 10.735 1.00 56.01  ? 42   ARG G NH2   1 
ATOM   4797  N  N     . VAL G  3 43  ? -17.374 -28.351 16.050 1.00 46.44  ? 43   VAL G N     1 
ATOM   4798  C  CA    . VAL G  3 43  ? -18.059 -29.421 16.793 1.00 45.51  ? 43   VAL G CA    1 
ATOM   4799  C  C     . VAL G  3 43  ? -17.978 -30.778 16.106 1.00 45.04  ? 43   VAL G C     1 
ATOM   4800  O  O     . VAL G  3 43  ? -18.578 -30.980 15.056 1.00 45.25  ? 43   VAL G O     1 
ATOM   4801  C  CB    . VAL G  3 43  ? -19.578 -29.123 17.041 1.00 45.61  ? 43   VAL G CB    1 
ATOM   4802  C  CG1   . VAL G  3 43  ? -20.239 -30.278 17.811 1.00 44.70  ? 43   VAL G CG1   1 
ATOM   4803  C  CG2   . VAL G  3 43  ? -19.804 -27.780 17.762 1.00 44.70  ? 43   VAL G CG2   1 
ATOM   4804  N  N     . GLY G  3 44  ? -17.272 -31.713 16.729 1.00 44.49  ? 44   GLY G N     1 
ATOM   4805  C  CA    . GLY G  3 44  ? -17.188 -33.088 16.250 1.00 44.05  ? 44   GLY G CA    1 
ATOM   4806  C  C     . GLY G  3 44  ? -18.547 -33.755 16.134 1.00 43.95  ? 44   GLY G C     1 
ATOM   4807  O  O     . GLY G  3 44  ? -19.485 -33.405 16.832 1.00 44.11  ? 44   GLY G O     1 
ATOM   4808  N  N     . ALA G  3 45  ? -18.650 -34.719 15.233 1.00 43.84  ? 45   ALA G N     1 
ATOM   4809  C  CA    . ALA G  3 45  ? -19.902 -35.402 14.968 1.00 43.29  ? 45   ALA G CA    1 
ATOM   4810  C  C     . ALA G  3 45  ? -20.359 -36.202 16.176 1.00 42.99  ? 45   ALA G C     1 
ATOM   4811  O  O     . ALA G  3 45  ? -21.529 -36.164 16.526 1.00 43.09  ? 45   ALA G O     1 
ATOM   4812  C  CB    . ALA G  3 45  ? -19.749 -36.312 13.763 1.00 43.49  ? 45   ALA G CB    1 
ATOM   4813  N  N     . GLY G  3 46  ? -19.432 -36.915 16.813 1.00 42.51  ? 46   GLY G N     1 
ATOM   4814  C  CA    . GLY G  3 46  ? -19.764 -37.777 17.949 1.00 41.77  ? 46   GLY G CA    1 
ATOM   4815  C  C     . GLY G  3 46  ? -20.194 -37.053 19.216 1.00 41.24  ? 46   GLY G C     1 
ATOM   4816  O  O     . GLY G  3 46  ? -20.906 -37.627 20.047 1.00 41.39  ? 46   GLY G O     1 
ATOM   4817  N  N     . ALA G  3 47  ? -19.781 -35.793 19.354 1.00 40.37  ? 47   ALA G N     1 
ATOM   4818  C  CA    . ALA G  3 47  ? -19.947 -35.045 20.603 1.00 39.48  ? 47   ALA G CA    1 
ATOM   4819  C  C     . ALA G  3 47  ? -21.390 -34.797 21.031 1.00 38.92  ? 47   ALA G C     1 
ATOM   4820  O  O     . ALA G  3 47  ? -21.704 -34.993 22.206 1.00 38.89  ? 47   ALA G O     1 
ATOM   4821  C  CB    . ALA G  3 47  ? -19.157 -33.735 20.577 1.00 39.53  ? 47   ALA G CB    1 
ATOM   4822  N  N     . PRO G  3 48  ? -22.276 -34.367 20.102 1.00 38.37  ? 48   PRO G N     1 
ATOM   4823  C  CA    . PRO G  3 48  ? -23.680 -34.199 20.504 1.00 37.72  ? 48   PRO G CA    1 
ATOM   4824  C  C     . PRO G  3 48  ? -24.385 -35.526 20.708 1.00 37.07  ? 48   PRO G C     1 
ATOM   4825  O  O     . PRO G  3 48  ? -25.396 -35.576 21.396 1.00 37.28  ? 48   PRO G O     1 
ATOM   4826  C  CB    . PRO G  3 48  ? -24.301 -33.458 19.327 1.00 37.63  ? 48   PRO G CB    1 
ATOM   4827  C  CG    . PRO G  3 48  ? -23.482 -33.868 18.185 1.00 38.50  ? 48   PRO G CG    1 
ATOM   4828  C  CD    . PRO G  3 48  ? -22.078 -33.996 18.694 1.00 38.19  ? 48   PRO G CD    1 
ATOM   4829  N  N     . VAL G  3 49  ? -23.855 -36.592 20.118 1.00 36.48  ? 49   VAL G N     1 
ATOM   4830  C  CA    . VAL G  3 49  ? -24.389 -37.939 20.335 1.00 35.63  ? 49   VAL G CA    1 
ATOM   4831  C  C     . VAL G  3 49  ? -24.122 -38.331 21.780 1.00 35.18  ? 49   VAL G C     1 
ATOM   4832  O  O     . VAL G  3 49  ? -25.038 -38.663 22.529 1.00 35.47  ? 49   VAL G O     1 
ATOM   4833  C  CB    . VAL G  3 49  ? -23.771 -38.965 19.346 1.00 35.71  ? 49   VAL G CB    1 
ATOM   4834  C  CG1   . VAL G  3 49  ? -24.138 -40.382 19.729 1.00 35.58  ? 49   VAL G CG1   1 
ATOM   4835  C  CG2   . VAL G  3 49  ? -24.216 -38.663 17.911 1.00 34.59  ? 49   VAL G CG2   1 
ATOM   4836  N  N     . TYR G  3 50  ? -22.858 -38.258 22.168 1.00 34.54  ? 50   TYR G N     1 
ATOM   4837  C  CA    . TYR G  3 50  ? -22.446 -38.488 23.551 1.00 33.92  ? 50   TYR G CA    1 
ATOM   4838  C  C     . TYR G  3 50  ? -23.243 -37.638 24.553 1.00 33.48  ? 50   TYR G C     1 
ATOM   4839  O  O     . TYR G  3 50  ? -23.764 -38.153 25.557 1.00 33.43  ? 50   TYR G O     1 
ATOM   4840  C  CB    . TYR G  3 50  ? -20.958 -38.164 23.689 1.00 33.91  ? 50   TYR G CB    1 
ATOM   4841  C  CG    . TYR G  3 50  ? -20.242 -38.912 24.788 1.00 33.49  ? 50   TYR G CG    1 
ATOM   4842  C  CD1   . TYR G  3 50  ? -19.182 -39.773 24.492 1.00 32.48  ? 50   TYR G CD1   1 
ATOM   4843  C  CD2   . TYR G  3 50  ? -20.610 -38.744 26.116 1.00 32.69  ? 50   TYR G CD2   1 
ATOM   4844  C  CE1   . TYR G  3 50  ? -18.522 -40.448 25.491 1.00 33.25  ? 50   TYR G CE1   1 
ATOM   4845  C  CE2   . TYR G  3 50  ? -19.958 -39.406 27.123 1.00 33.67  ? 50   TYR G CE2   1 
ATOM   4846  C  CZ    . TYR G  3 50  ? -18.917 -40.257 26.815 1.00 34.41  ? 50   TYR G CZ    1 
ATOM   4847  O  OH    . TYR G  3 50  ? -18.286 -40.918 27.847 1.00 35.20  ? 50   TYR G OH    1 
ATOM   4848  N  N     . LEU G  3 51  ? -23.332 -36.340 24.282 1.00 32.36  ? 51   LEU G N     1 
ATOM   4849  C  CA    . LEU G  3 51  ? -23.962 -35.448 25.217 1.00 32.08  ? 51   LEU G CA    1 
ATOM   4850  C  C     . LEU G  3 51  ? -25.447 -35.775 25.359 1.00 32.27  ? 51   LEU G C     1 
ATOM   4851  O  O     . LEU G  3 51  ? -25.973 -35.797 26.476 1.00 32.93  ? 51   LEU G O     1 
ATOM   4852  C  CB    . LEU G  3 51  ? -23.718 -33.990 24.835 1.00 31.75  ? 51   LEU G CB    1 
ATOM   4853  C  CG    . LEU G  3 51  ? -24.341 -32.890 25.704 1.00 32.10  ? 51   LEU G CG    1 
ATOM   4854  C  CD1   . LEU G  3 51  ? -24.100 -33.085 27.194 1.00 31.84  ? 51   LEU G CD1   1 
ATOM   4855  C  CD2   . LEU G  3 51  ? -23.807 -31.552 25.270 1.00 32.10  ? 51   LEU G CD2   1 
ATOM   4856  N  N     . ALA G  3 52  ? -26.110 -36.075 24.245 1.00 32.03  ? 52   ALA G N     1 
ATOM   4857  C  CA    . ALA G  3 52  ? -27.535 -36.408 24.262 1.00 31.37  ? 52   ALA G CA    1 
ATOM   4858  C  C     . ALA G  3 52  ? -27.781 -37.681 25.066 1.00 31.28  ? 52   ALA G C     1 
ATOM   4859  O  O     . ALA G  3 52  ? -28.762 -37.777 25.806 1.00 30.58  ? 52   ALA G O     1 
ATOM   4860  C  CB    . ALA G  3 52  ? -28.055 -36.569 22.851 1.00 31.40  ? 52   ALA G CB    1 
ATOM   4861  N  N     . ALA G  3 53  ? -26.885 -38.657 24.921 1.00 31.24  ? 53   ALA G N     1 
ATOM   4862  C  CA    . ALA G  3 53  ? -27.019 -39.917 25.647 1.00 31.47  ? 53   ALA G CA    1 
ATOM   4863  C  C     . ALA G  3 53  ? -26.903 -39.666 27.140 1.00 31.98  ? 53   ALA G C     1 
ATOM   4864  O  O     . ALA G  3 53  ? -27.676 -40.215 27.941 1.00 32.32  ? 53   ALA G O     1 
ATOM   4865  C  CB    . ALA G  3 53  ? -25.974 -40.886 25.208 1.00 31.22  ? 53   ALA G CB    1 
ATOM   4866  N  N     . VAL G  3 54  ? -25.935 -38.825 27.501 1.00 32.11  ? 54   VAL G N     1 
ATOM   4867  C  CA    . VAL G  3 54  ? -25.700 -38.464 28.886 1.00 31.97  ? 54   VAL G CA    1 
ATOM   4868  C  C     . VAL G  3 54  ? -26.916 -37.770 29.495 1.00 32.22  ? 54   VAL G C     1 
ATOM   4869  O  O     . VAL G  3 54  ? -27.355 -38.125 30.595 1.00 32.29  ? 54   VAL G O     1 
ATOM   4870  C  CB    . VAL G  3 54  ? -24.451 -37.588 29.014 1.00 32.27  ? 54   VAL G CB    1 
ATOM   4871  C  CG1   . VAL G  3 54  ? -24.390 -36.900 30.400 1.00 30.62  ? 54   VAL G CG1   1 
ATOM   4872  C  CG2   . VAL G  3 54  ? -23.208 -38.429 28.714 1.00 31.22  ? 54   VAL G CG2   1 
ATOM   4873  N  N     . LEU G  3 55  ? -27.472 -36.803 28.778 1.00 32.21  ? 55   LEU G N     1 
ATOM   4874  C  CA    . LEU G  3 55  ? -28.641 -36.112 29.279 1.00 32.94  ? 55   LEU G CA    1 
ATOM   4875  C  C     . LEU G  3 55  ? -29.829 -37.065 29.414 1.00 34.16  ? 55   LEU G C     1 
ATOM   4876  O  O     . LEU G  3 55  ? -30.629 -36.945 30.355 1.00 34.44  ? 55   LEU G O     1 
ATOM   4877  C  CB    . LEU G  3 55  ? -28.995 -34.934 28.389 1.00 32.49  ? 55   LEU G CB    1 
ATOM   4878  C  CG    . LEU G  3 55  ? -27.947 -33.838 28.221 1.00 31.74  ? 55   LEU G CG    1 
ATOM   4879  C  CD1   . LEU G  3 55  ? -28.393 -32.930 27.099 1.00 31.00  ? 55   LEU G CD1   1 
ATOM   4880  C  CD2   . LEU G  3 55  ? -27.723 -33.048 29.522 1.00 30.55  ? 55   LEU G CD2   1 
ATOM   4881  N  N     . GLU G  3 56  ? -29.932 -38.023 28.489 1.00 35.14  ? 56   GLU G N     1 
ATOM   4882  C  CA    . GLU G  3 56  ? -31.044 -38.965 28.493 1.00 35.99  ? 56   GLU G CA    1 
ATOM   4883  C  C     . GLU G  3 56  ? -30.881 -39.900 29.657 1.00 35.49  ? 56   GLU G C     1 
ATOM   4884  O  O     . GLU G  3 56  ? -31.831 -40.153 30.404 1.00 35.94  ? 56   GLU G O     1 
ATOM   4885  C  CB    . GLU G  3 56  ? -31.114 -39.769 27.202 1.00 36.12  ? 56   GLU G CB    1 
ATOM   4886  C  CG    . GLU G  3 56  ? -32.418 -40.556 27.048 1.00 37.35  ? 56   GLU G CG    1 
ATOM   4887  C  CD    . GLU G  3 56  ? -32.496 -41.336 25.730 1.00 38.03  ? 56   GLU G CD    1 
ATOM   4888  O  OE1   . GLU G  3 56  ? -32.483 -42.591 25.777 1.00 41.61  ? 56   GLU G OE1   1 
ATOM   4889  O  OE2   . GLU G  3 56  ? -32.558 -40.702 24.651 1.00 39.24  ? 56   GLU G OE2   1 
ATOM   4890  N  N     . TYR G  3 57  ? -29.670 -40.398 29.827 1.00 34.88  ? 57   TYR G N     1 
ATOM   4891  C  CA    . TYR G  3 57  ? -29.391 -41.228 30.975 1.00 34.75  ? 57   TYR G CA    1 
ATOM   4892  C  C     . TYR G  3 57  ? -29.756 -40.535 32.302 1.00 34.57  ? 57   TYR G C     1 
ATOM   4893  O  O     . TYR G  3 57  ? -30.451 -41.115 33.135 1.00 34.66  ? 57   TYR G O     1 
ATOM   4894  C  CB    . TYR G  3 57  ? -27.925 -41.649 30.996 1.00 35.00  ? 57   TYR G CB    1 
ATOM   4895  C  CG    . TYR G  3 57  ? -27.541 -42.245 32.322 1.00 35.04  ? 57   TYR G CG    1 
ATOM   4896  C  CD1   . TYR G  3 57  ? -27.971 -43.522 32.667 1.00 34.20  ? 57   TYR G CD1   1 
ATOM   4897  C  CD2   . TYR G  3 57  ? -26.789 -41.514 33.252 1.00 34.86  ? 57   TYR G CD2   1 
ATOM   4898  C  CE1   . TYR G  3 57  ? -27.651 -44.069 33.874 1.00 35.21  ? 57   TYR G CE1   1 
ATOM   4899  C  CE2   . TYR G  3 57  ? -26.456 -42.060 34.478 1.00 34.58  ? 57   TYR G CE2   1 
ATOM   4900  C  CZ    . TYR G  3 57  ? -26.895 -43.341 34.776 1.00 35.18  ? 57   TYR G CZ    1 
ATOM   4901  O  OH    . TYR G  3 57  ? -26.589 -43.922 35.972 1.00 36.10  ? 57   TYR G OH    1 
ATOM   4902  N  N     . LEU G  3 58  ? -29.288 -39.305 32.497 1.00 33.95  ? 58   LEU G N     1 
ATOM   4903  C  CA    . LEU G  3 58  ? -29.499 -38.652 33.768 1.00 33.91  ? 58   LEU G CA    1 
ATOM   4904  C  C     . LEU G  3 58  ? -30.969 -38.403 34.001 1.00 34.49  ? 58   LEU G C     1 
ATOM   4905  O  O     . LEU G  3 58  ? -31.450 -38.493 35.130 1.00 34.62  ? 58   LEU G O     1 
ATOM   4906  C  CB    . LEU G  3 58  ? -28.703 -37.351 33.876 1.00 33.49  ? 58   LEU G CB    1 
ATOM   4907  C  CG    . LEU G  3 58  ? -27.215 -37.507 34.205 1.00 32.23  ? 58   LEU G CG    1 
ATOM   4908  C  CD1   . LEU G  3 58  ? -26.485 -36.211 33.994 1.00 30.94  ? 58   LEU G CD1   1 
ATOM   4909  C  CD2   . LEU G  3 58  ? -26.970 -38.050 35.612 1.00 29.90  ? 58   LEU G CD2   1 
ATOM   4910  N  N     . THR G  3 59  ? -31.689 -38.115 32.925 1.00 35.27  ? 59   THR G N     1 
ATOM   4911  C  CA    . THR G  3 59  ? -33.131 -37.909 33.009 1.00 35.77  ? 59   THR G CA    1 
ATOM   4912  C  C     . THR G  3 59  ? -33.840 -39.182 33.435 1.00 35.84  ? 59   THR G C     1 
ATOM   4913  O  O     . THR G  3 59  ? -34.752 -39.141 34.249 1.00 36.28  ? 59   THR G O     1 
ATOM   4914  C  CB    . THR G  3 59  ? -33.694 -37.418 31.681 1.00 35.88  ? 59   THR G CB    1 
ATOM   4915  O  OG1   . THR G  3 59  ? -33.329 -36.047 31.499 1.00 36.32  ? 59   THR G OG1   1 
ATOM   4916  C  CG2   . THR G  3 59  ? -35.191 -37.509 31.677 1.00 36.39  ? 59   THR G CG2   1 
ATOM   4917  N  N     . ALA G  3 60  ? -33.402 -40.313 32.903 1.00 36.01  ? 60   ALA G N     1 
ATOM   4918  C  CA    . ALA G  3 60  ? -33.997 -41.593 33.256 1.00 36.36  ? 60   ALA G CA    1 
ATOM   4919  C  C     . ALA G  3 60  ? -33.820 -41.900 34.736 1.00 36.74  ? 60   ALA G C     1 
ATOM   4920  O  O     . ALA G  3 60  ? -34.749 -42.378 35.400 1.00 36.92  ? 60   ALA G O     1 
ATOM   4921  C  CB    . ALA G  3 60  ? -33.403 -42.709 32.407 1.00 36.20  ? 60   ALA G CB    1 
ATOM   4922  N  N     . GLU G  3 61  ? -32.627 -41.621 35.252 1.00 36.97  ? 61   GLU G N     1 
ATOM   4923  C  CA    . GLU G  3 61  ? -32.319 -41.907 36.641 1.00 37.00  ? 61   GLU G CA    1 
ATOM   4924  C  C     . GLU G  3 61  ? -33.246 -41.138 37.573 1.00 36.41  ? 61   GLU G C     1 
ATOM   4925  O  O     . GLU G  3 61  ? -33.799 -41.718 38.500 1.00 36.61  ? 61   GLU G O     1 
ATOM   4926  C  CB    . GLU G  3 61  ? -30.868 -41.571 36.936 1.00 37.57  ? 61   GLU G CB    1 
ATOM   4927  C  CG    . GLU G  3 61  ? -30.399 -42.003 38.320 1.00 40.52  ? 61   GLU G CG    1 
ATOM   4928  C  CD    . GLU G  3 61  ? -30.170 -43.497 38.425 1.00 44.41  ? 61   GLU G CD    1 
ATOM   4929  O  OE1   . GLU G  3 61  ? -29.695 -44.094 37.424 1.00 45.96  ? 61   GLU G OE1   1 
ATOM   4930  O  OE2   . GLU G  3 61  ? -30.449 -44.066 39.512 1.00 45.33  ? 61   GLU G OE2   1 
ATOM   4931  N  N     . ILE G  3 62  ? -33.436 -39.847 37.322 1.00 35.70  ? 62   ILE G N     1 
ATOM   4932  C  CA    . ILE G  3 62  ? -34.292 -39.050 38.181 1.00 35.33  ? 62   ILE G CA    1 
ATOM   4933  C  C     . ILE G  3 62  ? -35.741 -39.463 38.049 1.00 35.49  ? 62   ILE G C     1 
ATOM   4934  O  O     . ILE G  3 62  ? -36.439 -39.576 39.051 1.00 35.67  ? 62   ILE G O     1 
ATOM   4935  C  CB    . ILE G  3 62  ? -34.183 -37.555 37.905 1.00 35.47  ? 62   ILE G CB    1 
ATOM   4936  C  CG1   . ILE G  3 62  ? -32.761 -37.073 38.134 1.00 36.30  ? 62   ILE G CG1   1 
ATOM   4937  C  CG2   . ILE G  3 62  ? -35.077 -36.761 38.844 1.00 34.76  ? 62   ILE G CG2   1 
ATOM   4938  C  CD1   . ILE G  3 62  ? -32.627 -35.578 37.980 1.00 37.03  ? 62   ILE G CD1   1 
ATOM   4939  N  N     . LEU G  3 63  ? -36.213 -39.694 36.829 1.00 35.60  ? 63   LEU G N     1 
ATOM   4940  C  CA    . LEU G  3 63  ? -37.614 -40.075 36.668 1.00 35.57  ? 63   LEU G CA    1 
ATOM   4941  C  C     . LEU G  3 63  ? -37.876 -41.436 37.296 1.00 36.27  ? 63   LEU G C     1 
ATOM   4942  O  O     . LEU G  3 63  ? -38.893 -41.633 37.946 1.00 36.12  ? 63   LEU G O     1 
ATOM   4943  C  CB    . LEU G  3 63  ? -38.051 -40.027 35.213 1.00 35.14  ? 63   LEU G CB    1 
ATOM   4944  C  CG    . LEU G  3 63  ? -38.107 -38.613 34.636 1.00 33.95  ? 63   LEU G CG    1 
ATOM   4945  C  CD1   . LEU G  3 63  ? -38.116 -38.658 33.136 1.00 32.60  ? 63   LEU G CD1   1 
ATOM   4946  C  CD2   . LEU G  3 63  ? -39.302 -37.817 35.160 1.00 33.41  ? 63   LEU G CD2   1 
ATOM   4947  N  N     . GLU G  3 64  ? -36.932 -42.354 37.140 1.00 37.19  ? 64   GLU G N     1 
ATOM   4948  C  CA    . GLU G  3 64  ? -37.019 -43.641 37.807 1.00 38.79  ? 64   GLU G CA    1 
ATOM   4949  C  C     . GLU G  3 64  ? -37.246 -43.478 39.323 1.00 39.35  ? 64   GLU G C     1 
ATOM   4950  O  O     . GLU G  3 64  ? -38.204 -44.020 39.887 1.00 39.54  ? 64   GLU G O     1 
ATOM   4951  C  CB    . GLU G  3 64  ? -35.761 -44.450 37.527 1.00 38.78  ? 64   GLU G CB    1 
ATOM   4952  C  CG    . GLU G  3 64  ? -35.641 -45.698 38.351 1.00 42.95  ? 64   GLU G CG    1 
ATOM   4953  C  CD    . GLU G  3 64  ? -36.560 -46.827 37.869 1.00 48.94  ? 64   GLU G CD    1 
ATOM   4954  O  OE1   . GLU G  3 64  ? -36.163 -47.537 36.904 1.00 49.94  ? 64   GLU G OE1   1 
ATOM   4955  O  OE2   . GLU G  3 64  ? -37.660 -47.014 38.472 1.00 50.40  ? 64   GLU G OE2   1 
ATOM   4956  N  N     . LEU G  3 65  ? -36.380 -42.703 39.972 1.00 39.81  ? 65   LEU G N     1 
ATOM   4957  C  CA    . LEU G  3 65  ? -36.423 -42.577 41.418 1.00 40.08  ? 65   LEU G CA    1 
ATOM   4958  C  C     . LEU G  3 65  ? -37.646 -41.793 41.865 1.00 40.38  ? 65   LEU G C     1 
ATOM   4959  O  O     . LEU G  3 65  ? -38.272 -42.132 42.862 1.00 40.12  ? 65   LEU G O     1 
ATOM   4960  C  CB    . LEU G  3 65  ? -35.124 -41.950 41.933 1.00 40.12  ? 65   LEU G CB    1 
ATOM   4961  C  CG    . LEU G  3 65  ? -33.928 -42.893 41.743 1.00 40.53  ? 65   LEU G CG    1 
ATOM   4962  C  CD1   . LEU G  3 65  ? -32.603 -42.159 41.722 1.00 40.69  ? 65   LEU G CD1   1 
ATOM   4963  C  CD2   . LEU G  3 65  ? -33.918 -43.988 42.799 1.00 40.75  ? 65   LEU G CD2   1 
ATOM   4964  N  N     . ALA G  3 66  ? -37.993 -40.760 41.102 1.00 40.85  ? 66   ALA G N     1 
ATOM   4965  C  CA    . ALA G  3 66  ? -39.137 -39.923 41.415 1.00 41.15  ? 66   ALA G CA    1 
ATOM   4966  C  C     . ALA G  3 66  ? -40.402 -40.710 41.181 1.00 41.70  ? 66   ALA G C     1 
ATOM   4967  O  O     . ALA G  3 66  ? -41.421 -40.447 41.819 1.00 41.89  ? 66   ALA G O     1 
ATOM   4968  C  CB    . ALA G  3 66  ? -39.127 -38.655 40.583 1.00 41.08  ? 66   ALA G CB    1 
ATOM   4969  N  N     . GLY G  3 67  ? -40.326 -41.680 40.269 1.00 42.40  ? 67   GLY G N     1 
ATOM   4970  C  CA    . GLY G  3 67  ? -41.422 -42.612 40.010 1.00 43.03  ? 67   GLY G CA    1 
ATOM   4971  C  C     . GLY G  3 67  ? -41.662 -43.473 41.231 1.00 43.57  ? 67   GLY G C     1 
ATOM   4972  O  O     . GLY G  3 67  ? -42.772 -43.527 41.749 1.00 43.59  ? 67   GLY G O     1 
ATOM   4973  N  N     . ASN G  3 68  ? -40.610 -44.131 41.703 1.00 44.20  ? 68   ASN G N     1 
ATOM   4974  C  CA    . ASN G  3 68  ? -40.665 -44.855 42.965 1.00 44.78  ? 68   ASN G CA    1 
ATOM   4975  C  C     . ASN G  3 68  ? -41.235 -44.011 44.086 1.00 45.06  ? 68   ASN G C     1 
ATOM   4976  O  O     . ASN G  3 68  ? -42.002 -44.496 44.890 1.00 45.44  ? 68   ASN G O     1 
ATOM   4977  C  CB    . ASN G  3 68  ? -39.277 -45.353 43.362 1.00 44.74  ? 68   ASN G CB    1 
ATOM   4978  C  CG    . ASN G  3 68  ? -38.749 -46.415 42.418 1.00 45.70  ? 68   ASN G CG    1 
ATOM   4979  O  OD1   . ASN G  3 68  ? -39.459 -46.865 41.509 1.00 45.76  ? 68   ASN G OD1   1 
ATOM   4980  N  ND2   . ASN G  3 68  ? -37.489 -46.818 42.619 1.00 45.78  ? 68   ASN G ND2   1 
ATOM   4981  N  N     . ALA G  3 69  ? -40.874 -42.743 44.138 1.00 45.64  ? 69   ALA G N     1 
ATOM   4982  C  CA    . ALA G  3 69  ? -41.353 -41.890 45.206 1.00 46.76  ? 69   ALA G CA    1 
ATOM   4983  C  C     . ALA G  3 69  ? -42.854 -41.651 45.100 1.00 47.68  ? 69   ALA G C     1 
ATOM   4984  O  O     . ALA G  3 69  ? -43.510 -41.358 46.098 1.00 47.81  ? 69   ALA G O     1 
ATOM   4985  C  CB    . ALA G  3 69  ? -40.607 -40.580 45.211 1.00 46.57  ? 69   ALA G CB    1 
ATOM   4986  N  N     . ALA G  3 70  ? -43.387 -41.778 43.889 1.00 48.80  ? 70   ALA G N     1 
ATOM   4987  C  CA    . ALA G  3 70  ? -44.808 -41.603 43.647 1.00 49.93  ? 70   ALA G CA    1 
ATOM   4988  C  C     . ALA G  3 70  ? -45.581 -42.847 44.050 1.00 51.04  ? 70   ALA G C     1 
ATOM   4989  O  O     . ALA G  3 70  ? -46.700 -42.739 44.536 1.00 51.21  ? 70   ALA G O     1 
ATOM   4990  C  CB    . ALA G  3 70  ? -45.063 -41.264 42.198 1.00 49.68  ? 70   ALA G CB    1 
ATOM   4991  N  N     . ARG G  3 71  ? -44.990 -44.022 43.844 1.00 52.50  ? 71   ARG G N     1 
ATOM   4992  C  CA    . ARG G  3 71  ? -45.590 -45.269 44.302 1.00 54.55  ? 71   ARG G CA    1 
ATOM   4993  C  C     . ARG G  3 71  ? -45.743 -45.212 45.826 1.00 54.85  ? 71   ARG G C     1 
ATOM   4994  O  O     . ARG G  3 71  ? -46.862 -45.265 46.329 1.00 55.05  ? 71   ARG G O     1 
ATOM   4995  C  CB    . ARG G  3 71  ? -44.742 -46.476 43.886 1.00 54.49  ? 71   ARG G CB    1 
ATOM   4996  C  CG    . ARG G  3 71  ? -45.528 -47.759 43.508 1.00 55.80  ? 71   ARG G CG    1 
ATOM   4997  C  CD    . ARG G  3 71  ? -44.781 -49.072 43.905 1.00 56.94  ? 71   ARG G CD    1 
ATOM   4998  N  NE    . ARG G  3 71  ? -43.330 -49.032 43.652 1.00 62.73  ? 71   ARG G NE    1 
ATOM   4999  C  CZ    . ARG G  3 71  ? -42.392 -48.786 44.581 1.00 65.30  ? 71   ARG G CZ    1 
ATOM   5000  N  NH1   . ARG G  3 71  ? -42.733 -48.565 45.854 1.00 66.42  ? 71   ARG G NH1   1 
ATOM   5001  N  NH2   . ARG G  3 71  ? -41.101 -48.754 44.239 1.00 65.73  ? 71   ARG G NH2   1 
ATOM   5002  N  N     . ASP G  3 72  ? -44.627 -45.050 46.541 1.00 55.51  ? 72   ASP G N     1 
ATOM   5003  C  CA    . ASP G  3 72  ? -44.608 -45.016 48.013 1.00 56.20  ? 72   ASP G CA    1 
ATOM   5004  C  C     . ASP G  3 72  ? -45.646 -44.090 48.613 1.00 56.19  ? 72   ASP G C     1 
ATOM   5005  O  O     . ASP G  3 72  ? -46.025 -44.258 49.769 1.00 56.35  ? 72   ASP G O     1 
ATOM   5006  C  CB    . ASP G  3 72  ? -43.250 -44.553 48.557 1.00 56.65  ? 72   ASP G CB    1 
ATOM   5007  C  CG    . ASP G  3 72  ? -42.056 -45.177 47.837 1.00 59.24  ? 72   ASP G CG    1 
ATOM   5008  O  OD1   . ASP G  3 72  ? -42.219 -46.213 47.126 1.00 61.26  ? 72   ASP G OD1   1 
ATOM   5009  O  OD2   . ASP G  3 72  ? -40.938 -44.612 47.994 1.00 60.93  ? 72   ASP G OD2   1 
ATOM   5010  N  N     . ASN G  3 73  ? -46.068 -43.088 47.851 1.00 56.12  ? 73   ASN G N     1 
ATOM   5011  C  CA    . ASN G  3 73  ? -47.018 -42.097 48.351 1.00 56.39  ? 73   ASN G CA    1 
ATOM   5012  C  C     . ASN G  3 73  ? -48.418 -42.350 47.787 1.00 56.02  ? 73   ASN G C     1 
ATOM   5013  O  O     . ASN G  3 73  ? -49.307 -41.501 47.912 1.00 55.87  ? 73   ASN G O     1 
ATOM   5014  C  CB    . ASN G  3 73  ? -46.541 -40.663 48.044 1.00 56.84  ? 73   ASN G CB    1 
ATOM   5015  C  CG    . ASN G  3 73  ? -45.153 -40.335 48.658 1.00 58.67  ? 73   ASN G CG    1 
ATOM   5016  O  OD1   . ASN G  3 73  ? -44.940 -39.237 49.201 1.00 60.29  ? 73   ASN G OD1   1 
ATOM   5017  N  ND2   . ASN G  3 73  ? -44.212 -41.277 48.561 1.00 59.63  ? 73   ASN G ND2   1 
ATOM   5018  N  N     . LYS G  3 74  ? -48.590 -43.528 47.173 1.00 55.47  ? 74   LYS G N     1 
ATOM   5019  C  CA    . LYS G  3 74  ? -49.863 -43.989 46.581 1.00 54.95  ? 74   LYS G CA    1 
ATOM   5020  C  C     . LYS G  3 74  ? -50.363 -43.097 45.443 1.00 53.77  ? 74   LYS G C     1 
ATOM   5021  O  O     . LYS G  3 74  ? -51.552 -42.837 45.318 1.00 53.73  ? 74   LYS G O     1 
ATOM   5022  C  CB    . LYS G  3 74  ? -50.957 -44.163 47.660 1.00 55.56  ? 74   LYS G CB    1 
ATOM   5023  C  CG    . LYS G  3 74  ? -50.650 -45.195 48.760 1.00 57.09  ? 74   LYS G CG    1 
ATOM   5024  C  CD    . LYS G  3 74  ? -50.574 -46.637 48.208 1.00 59.57  ? 74   LYS G CD    1 
ATOM   5025  C  CE    . LYS G  3 74  ? -50.811 -47.683 49.309 1.00 61.29  ? 74   LYS G CE    1 
ATOM   5026  N  NZ    . LYS G  3 74  ? -49.795 -47.653 50.419 1.00 61.18  ? 74   LYS G NZ    1 
ATOM   5027  N  N     . LYS G  3 75  ? -49.444 -42.634 44.609 1.00 52.68  ? 75   LYS G N     1 
ATOM   5028  C  CA    . LYS G  3 75  ? -49.788 -41.716 43.523 1.00 51.37  ? 75   LYS G CA    1 
ATOM   5029  C  C     . LYS G  3 75  ? -49.221 -42.190 42.202 1.00 50.08  ? 75   LYS G C     1 
ATOM   5030  O  O     . LYS G  3 75  ? -48.253 -42.941 42.165 1.00 49.95  ? 75   LYS G O     1 
ATOM   5031  C  CB    . LYS G  3 75  ? -49.282 -40.306 43.824 1.00 51.61  ? 75   LYS G CB    1 
ATOM   5032  C  CG    . LYS G  3 75  ? -49.861 -39.688 45.087 1.00 52.10  ? 75   LYS G CG    1 
ATOM   5033  C  CD    . LYS G  3 75  ? -49.446 -38.234 45.221 1.00 54.14  ? 75   LYS G CD    1 
ATOM   5034  C  CE    . LYS G  3 75  ? -50.077 -37.581 46.439 1.00 55.28  ? 75   LYS G CE    1 
ATOM   5035  N  NZ    . LYS G  3 75  ? -51.558 -37.783 46.488 1.00 55.79  ? 75   LYS G NZ    1 
ATOM   5036  N  N     . THR G  3 76  ? -49.835 -41.752 41.115 1.00 48.77  ? 76   THR G N     1 
ATOM   5037  C  CA    . THR G  3 76  ? -49.371 -42.133 39.781 1.00 47.49  ? 76   THR G CA    1 
ATOM   5038  C  C     . THR G  3 76  ? -48.912 -40.930 38.945 1.00 46.30  ? 76   THR G C     1 
ATOM   5039  O  O     . THR G  3 76  ? -48.343 -41.108 37.866 1.00 46.09  ? 76   THR G O     1 
ATOM   5040  C  CB    . THR G  3 76  ? -50.440 -42.937 39.002 1.00 47.53  ? 76   THR G CB    1 
ATOM   5041  O  OG1   . THR G  3 76  ? -51.721 -42.306 39.161 1.00 47.53  ? 76   THR G OG1   1 
ATOM   5042  C  CG2   . THR G  3 76  ? -50.494 -44.374 39.505 1.00 47.49  ? 76   THR G CG2   1 
ATOM   5043  N  N     . ARG G  3 77  ? -49.165 -39.715 39.434 1.00 44.51  ? 77   ARG G N     1 
ATOM   5044  C  CA    . ARG G  3 77  ? -48.590 -38.532 38.801 1.00 43.04  ? 77   ARG G CA    1 
ATOM   5045  C  C     . ARG G  3 77  ? -47.411 -37.937 39.599 1.00 41.41  ? 77   ARG G C     1 
ATOM   5046  O  O     . ARG G  3 77  ? -47.568 -37.558 40.763 1.00 40.93  ? 77   ARG G O     1 
ATOM   5047  C  CB    . ARG G  3 77  ? -49.653 -37.467 38.544 1.00 43.24  ? 77   ARG G CB    1 
ATOM   5048  C  CG    . ARG G  3 77  ? -49.147 -36.367 37.635 1.00 44.28  ? 77   ARG G CG    1 
ATOM   5049  C  CD    . ARG G  3 77  ? -50.171 -35.284 37.388 1.00 46.59  ? 77   ARG G CD    1 
ATOM   5050  N  NE    . ARG G  3 77  ? -51.273 -35.780 36.575 1.00 48.21  ? 77   ARG G NE    1 
ATOM   5051  C  CZ    . ARG G  3 77  ? -52.553 -35.717 36.932 1.00 49.79  ? 77   ARG G CZ    1 
ATOM   5052  N  NH1   . ARG G  3 77  ? -52.913 -35.152 38.081 1.00 48.74  ? 77   ARG G NH1   1 
ATOM   5053  N  NH2   . ARG G  3 77  ? -53.478 -36.212 36.128 1.00 51.23  ? 77   ARG G NH2   1 
ATOM   5054  N  N     . ILE G  3 78  ? -46.245 -37.859 38.952 1.00 39.31  ? 78   ILE G N     1 
ATOM   5055  C  CA    . ILE G  3 78  ? -45.082 -37.173 39.506 1.00 37.44  ? 78   ILE G CA    1 
ATOM   5056  C  C     . ILE G  3 78  ? -45.329 -35.668 39.637 1.00 36.72  ? 78   ILE G C     1 
ATOM   5057  O  O     . ILE G  3 78  ? -45.711 -34.989 38.681 1.00 36.56  ? 78   ILE G O     1 
ATOM   5058  C  CB    . ILE G  3 78  ? -43.838 -37.397 38.654 1.00 37.04  ? 78   ILE G CB    1 
ATOM   5059  C  CG1   . ILE G  3 78  ? -43.431 -38.849 38.708 1.00 36.49  ? 78   ILE G CG1   1 
ATOM   5060  C  CG2   . ILE G  3 78  ? -42.677 -36.548 39.137 1.00 37.24  ? 78   ILE G CG2   1 
ATOM   5061  C  CD1   . ILE G  3 78  ? -42.317 -39.170 37.752 1.00 37.66  ? 78   ILE G CD1   1 
ATOM   5062  N  N     . ILE G  3 79  ? -45.128 -35.172 40.850 1.00 35.90  ? 79   ILE G N     1 
ATOM   5063  C  CA    . ILE G  3 79  ? -45.191 -33.748 41.149 1.00 34.84  ? 79   ILE G CA    1 
ATOM   5064  C  C     . ILE G  3 79  ? -43.826 -33.325 41.722 1.00 34.09  ? 79   ILE G C     1 
ATOM   5065  O  O     . ILE G  3 79  ? -42.990 -34.186 42.026 1.00 34.15  ? 79   ILE G O     1 
ATOM   5066  C  CB    . ILE G  3 79  ? -46.382 -33.395 42.094 1.00 34.84  ? 79   ILE G CB    1 
ATOM   5067  C  CG1   . ILE G  3 79  ? -46.254 -34.087 43.457 1.00 34.26  ? 79   ILE G CG1   1 
ATOM   5068  C  CG2   . ILE G  3 79  ? -47.691 -33.761 41.434 1.00 33.80  ? 79   ILE G CG2   1 
ATOM   5069  C  CD1   . ILE G  3 79  ? -46.980 -33.366 44.585 1.00 31.92  ? 79   ILE G CD1   1 
ATOM   5070  N  N     . PRO G  3 80  ? -43.576 -32.010 41.821 1.00 33.00  ? 80   PRO G N     1 
ATOM   5071  C  CA    . PRO G  3 80  ? -42.277 -31.531 42.264 1.00 32.65  ? 80   PRO G CA    1 
ATOM   5072  C  C     . PRO G  3 80  ? -41.791 -32.239 43.519 1.00 32.29  ? 80   PRO G C     1 
ATOM   5073  O  O     . PRO G  3 80  ? -40.665 -32.721 43.547 1.00 32.63  ? 80   PRO G O     1 
ATOM   5074  C  CB    . PRO G  3 80  ? -42.545 -30.050 42.540 1.00 32.73  ? 80   PRO G CB    1 
ATOM   5075  C  CG    . PRO G  3 80  ? -43.570 -29.700 41.513 1.00 32.21  ? 80   PRO G CG    1 
ATOM   5076  C  CD    . PRO G  3 80  ? -44.479 -30.891 41.508 1.00 32.82  ? 80   PRO G CD    1 
ATOM   5077  N  N     . ARG G  3 81  ? -42.658 -32.314 44.528 1.00 31.82  ? 81   ARG G N     1 
ATOM   5078  C  CA    . ARG G  3 81  ? -42.387 -32.997 45.779 1.00 30.95  ? 81   ARG G CA    1 
ATOM   5079  C  C     . ARG G  3 81  ? -41.690 -34.309 45.539 1.00 30.74  ? 81   ARG G C     1 
ATOM   5080  O  O     . ARG G  3 81  ? -40.718 -34.622 46.219 1.00 31.02  ? 81   ARG G O     1 
ATOM   5081  C  CB    . ARG G  3 81  ? -43.694 -33.232 46.546 1.00 31.42  ? 81   ARG G CB    1 
ATOM   5082  C  CG    . ARG G  3 81  ? -43.573 -34.035 47.844 1.00 31.46  ? 81   ARG G CG    1 
ATOM   5083  C  CD    . ARG G  3 81  ? -42.562 -33.412 48.763 1.00 32.80  ? 81   ARG G CD    1 
ATOM   5084  N  NE    . ARG G  3 81  ? -42.570 -33.992 50.098 1.00 34.37  ? 81   ARG G NE    1 
ATOM   5085  C  CZ    . ARG G  3 81  ? -41.762 -33.594 51.078 1.00 33.99  ? 81   ARG G CZ    1 
ATOM   5086  N  NH1   . ARG G  3 81  ? -40.872 -32.624 50.856 1.00 32.84  ? 81   ARG G NH1   1 
ATOM   5087  N  NH2   . ARG G  3 81  ? -41.841 -34.166 52.275 1.00 32.62  ? 81   ARG G NH2   1 
ATOM   5088  N  N     . HIS G  3 82  ? -42.172 -35.082 44.577 1.00 30.30  ? 82   HIS G N     1 
ATOM   5089  C  CA    . HIS G  3 82  ? -41.553 -36.371 44.302 1.00 30.29  ? 82   HIS G CA    1 
ATOM   5090  C  C     . HIS G  3 82  ? -40.123 -36.252 43.787 1.00 30.23  ? 82   HIS G C     1 
ATOM   5091  O  O     . HIS G  3 82  ? -39.269 -37.085 44.127 1.00 30.30  ? 82   HIS G O     1 
ATOM   5092  C  CB    . HIS G  3 82  ? -42.401 -37.189 43.345 1.00 30.31  ? 82   HIS G CB    1 
ATOM   5093  C  CG    . HIS G  3 82  ? -43.814 -37.347 43.800 1.00 31.23  ? 82   HIS G CG    1 
ATOM   5094  N  ND1   . HIS G  3 82  ? -44.891 -37.037 43.003 1.00 30.80  ? 82   HIS G ND1   1 
ATOM   5095  C  CD2   . HIS G  3 82  ? -44.325 -37.743 44.987 1.00 31.24  ? 82   HIS G CD2   1 
ATOM   5096  C  CE1   . HIS G  3 82  ? -46.007 -37.254 43.671 1.00 30.18  ? 82   HIS G CE1   1 
ATOM   5097  N  NE2   . HIS G  3 82  ? -45.691 -37.688 44.875 1.00 31.23  ? 82   HIS G NE2   1 
ATOM   5098  N  N     . LEU G  3 83  ? -39.855 -35.220 42.989 1.00 29.99  ? 83   LEU G N     1 
ATOM   5099  C  CA    . LEU G  3 83  ? -38.512 -35.019 42.449 1.00 29.85  ? 83   LEU G CA    1 
ATOM   5100  C  C     . LEU G  3 83  ? -37.574 -34.629 43.573 1.00 30.19  ? 83   LEU G C     1 
ATOM   5101  O  O     . LEU G  3 83  ? -36.416 -35.047 43.589 1.00 30.11  ? 83   LEU G O     1 
ATOM   5102  C  CB    . LEU G  3 83  ? -38.495 -33.969 41.348 1.00 29.53  ? 83   LEU G CB    1 
ATOM   5103  C  CG    . LEU G  3 83  ? -39.259 -34.272 40.053 1.00 28.41  ? 83   LEU G CG    1 
ATOM   5104  C  CD1   . LEU G  3 83  ? -39.572 -32.992 39.284 1.00 25.69  ? 83   LEU G CD1   1 
ATOM   5105  C  CD2   . LEU G  3 83  ? -38.504 -35.258 39.174 1.00 27.05  ? 83   LEU G CD2   1 
ATOM   5106  N  N     . GLN G  3 84  ? -38.093 -33.864 44.531 1.00 30.36  ? 84   GLN G N     1 
ATOM   5107  C  CA    . GLN G  3 84  ? -37.317 -33.483 45.697 1.00 30.81  ? 84   GLN G CA    1 
ATOM   5108  C  C     . GLN G  3 84  ? -36.959 -34.670 46.580 1.00 31.50  ? 84   GLN G C     1 
ATOM   5109  O  O     . GLN G  3 84  ? -35.833 -34.742 47.068 1.00 32.46  ? 84   GLN G O     1 
ATOM   5110  C  CB    . GLN G  3 84  ? -38.033 -32.408 46.498 1.00 30.69  ? 84   GLN G CB    1 
ATOM   5111  C  CG    . GLN G  3 84  ? -37.383 -32.040 47.832 1.00 31.48  ? 84   GLN G CG    1 
ATOM   5112  C  CD    . GLN G  3 84  ? -36.076 -31.264 47.708 1.00 32.00  ? 84   GLN G CD    1 
ATOM   5113  O  OE1   . GLN G  3 84  ? -35.394 -31.309 46.685 1.00 32.64  ? 84   GLN G OE1   1 
ATOM   5114  N  NE2   . GLN G  3 84  ? -35.703 -30.583 48.777 1.00 30.90  ? 84   GLN G NE2   1 
ATOM   5115  N  N     . LEU G  3 85  ? -37.880 -35.611 46.782 1.00 31.45  ? 85   LEU G N     1 
ATOM   5116  C  CA    . LEU G  3 85  ? -37.561 -36.768 47.610 1.00 31.62  ? 85   LEU G CA    1 
ATOM   5117  C  C     . LEU G  3 85  ? -36.587 -37.687 46.888 1.00 31.61  ? 85   LEU G C     1 
ATOM   5118  O  O     . LEU G  3 85  ? -35.714 -38.283 47.520 1.00 31.66  ? 85   LEU G O     1 
ATOM   5119  C  CB    . LEU G  3 85  ? -38.813 -37.573 47.997 1.00 32.17  ? 85   LEU G CB    1 
ATOM   5120  C  CG    . LEU G  3 85  ? -39.974 -36.950 48.781 1.00 33.01  ? 85   LEU G CG    1 
ATOM   5121  C  CD1   . LEU G  3 85  ? -41.127 -37.940 48.873 1.00 33.65  ? 85   LEU G CD1   1 
ATOM   5122  C  CD2   . LEU G  3 85  ? -39.576 -36.464 50.163 1.00 31.66  ? 85   LEU G CD2   1 
ATOM   5123  N  N     . ALA G  3 86  ? -36.754 -37.815 45.574 1.00 31.26  ? 86   ALA G N     1 
ATOM   5124  C  CA    . ALA G  3 86  ? -35.851 -38.626 44.757 1.00 31.32  ? 86   ALA G CA    1 
ATOM   5125  C  C     . ALA G  3 86  ? -34.413 -38.123 44.822 1.00 31.25  ? 86   ALA G C     1 
ATOM   5126  O  O     . ALA G  3 86  ? -33.496 -38.887 45.108 1.00 31.29  ? 86   ALA G O     1 
ATOM   5127  C  CB    . ALA G  3 86  ? -36.315 -38.637 43.314 1.00 31.67  ? 86   ALA G CB    1 
ATOM   5128  N  N     . VAL G  3 87  ? -34.237 -36.835 44.537 1.00 30.88  ? 87   VAL G N     1 
ATOM   5129  C  CA    . VAL G  3 87  ? -32.938 -36.190 44.575 1.00 30.45  ? 87   VAL G CA    1 
ATOM   5130  C  C     . VAL G  3 87  ? -32.328 -36.204 45.985 1.00 30.48  ? 87   VAL G C     1 
ATOM   5131  O  O     . VAL G  3 87  ? -31.178 -36.617 46.162 1.00 30.14  ? 87   VAL G O     1 
ATOM   5132  C  CB    . VAL G  3 87  ? -32.995 -34.746 43.961 1.00 30.29  ? 87   VAL G CB    1 
ATOM   5133  C  CG1   . VAL G  3 87  ? -31.785 -33.912 44.359 1.00 30.57  ? 87   VAL G CG1   1 
ATOM   5134  C  CG2   . VAL G  3 87  ? -33.078 -34.813 42.455 1.00 29.00  ? 87   VAL G CG2   1 
ATOM   5135  N  N     . ARG G  3 88  ? -33.076 -35.773 46.992 1.00 30.66  ? 88   ARG G N     1 
ATOM   5136  C  CA    . ARG G  3 88  ? -32.460 -35.673 48.321 1.00 31.34  ? 88   ARG G CA    1 
ATOM   5137  C  C     . ARG G  3 88  ? -32.194 -36.999 49.027 1.00 32.05  ? 88   ARG G C     1 
ATOM   5138  O  O     . ARG G  3 88  ? -31.353 -37.065 49.892 1.00 32.74  ? 88   ARG G O     1 
ATOM   5139  C  CB    . ARG G  3 88  ? -33.209 -34.712 49.238 1.00 30.69  ? 88   ARG G CB    1 
ATOM   5140  C  CG    . ARG G  3 88  ? -33.385 -33.314 48.686 1.00 30.26  ? 88   ARG G CG    1 
ATOM   5141  C  CD    . ARG G  3 88  ? -32.099 -32.627 48.280 1.00 27.87  ? 88   ARG G CD    1 
ATOM   5142  N  NE    . ARG G  3 88  ? -32.385 -31.471 47.424 1.00 27.90  ? 88   ARG G NE    1 
ATOM   5143  C  CZ    . ARG G  3 88  ? -31.532 -30.930 46.549 1.00 26.36  ? 88   ARG G CZ    1 
ATOM   5144  N  NH1   . ARG G  3 88  ? -30.311 -31.427 46.395 1.00 25.09  ? 88   ARG G NH1   1 
ATOM   5145  N  NH2   . ARG G  3 88  ? -31.906 -29.878 45.832 1.00 24.87  ? 88   ARG G NH2   1 
ATOM   5146  N  N     . ASN G  3 89  ? -32.884 -38.060 48.650 1.00 33.16  ? 89   ASN G N     1 
ATOM   5147  C  CA    . ASN G  3 89  ? -32.618 -39.361 49.246 1.00 34.52  ? 89   ASN G CA    1 
ATOM   5148  C  C     . ASN G  3 89  ? -31.503 -40.124 48.593 1.00 35.33  ? 89   ASN G C     1 
ATOM   5149  O  O     . ASN G  3 89  ? -31.187 -41.225 49.031 1.00 35.72  ? 89   ASN G O     1 
ATOM   5150  C  CB    . ASN G  3 89  ? -33.862 -40.235 49.223 1.00 34.44  ? 89   ASN G CB    1 
ATOM   5151  C  CG    . ASN G  3 89  ? -34.805 -39.881 50.302 1.00 35.50  ? 89   ASN G CG    1 
ATOM   5152  O  OD1   . ASN G  3 89  ? -34.401 -39.701 51.455 1.00 37.87  ? 89   ASN G OD1   1 
ATOM   5153  N  ND2   . ASN G  3 89  ? -36.073 -39.744 49.953 1.00 35.31  ? 89   ASN G ND2   1 
ATOM   5154  N  N     . ASP G  3 90  ? -30.935 -39.559 47.533 1.00 36.49  ? 90   ASP G N     1 
ATOM   5155  C  CA    . ASP G  3 90  ? -29.898 -40.218 46.763 1.00 37.64  ? 90   ASP G CA    1 
ATOM   5156  C  C     . ASP G  3 90  ? -28.591 -39.481 46.930 1.00 38.29  ? 90   ASP G C     1 
ATOM   5157  O  O     . ASP G  3 90  ? -28.479 -38.319 46.555 1.00 38.86  ? 90   ASP G O     1 
ATOM   5158  C  CB    . ASP G  3 90  ? -30.267 -40.255 45.288 1.00 37.92  ? 90   ASP G CB    1 
ATOM   5159  C  CG    . ASP G  3 90  ? -29.243 -41.005 44.461 1.00 40.78  ? 90   ASP G CG    1 
ATOM   5160  O  OD1   . ASP G  3 90  ? -29.249 -42.259 44.505 1.00 42.68  ? 90   ASP G OD1   1 
ATOM   5161  O  OD2   . ASP G  3 90  ? -28.414 -40.343 43.786 1.00 44.38  ? 90   ASP G OD2   1 
ATOM   5162  N  N     . GLU G  3 91  ? -27.593 -40.152 47.479 1.00 39.04  ? 91   GLU G N     1 
ATOM   5163  C  CA    . GLU G  3 91  ? -26.330 -39.497 47.753 1.00 40.28  ? 91   GLU G CA    1 
ATOM   5164  C  C     . GLU G  3 91  ? -25.790 -38.803 46.512 1.00 39.43  ? 91   GLU G C     1 
ATOM   5165  O  O     . GLU G  3 91  ? -25.420 -37.626 46.563 1.00 39.92  ? 91   GLU G O     1 
ATOM   5166  C  CB    . GLU G  3 91  ? -25.299 -40.474 48.326 1.00 40.09  ? 91   GLU G CB    1 
ATOM   5167  C  CG    . GLU G  3 91  ? -24.099 -39.769 48.975 1.00 42.25  ? 91   GLU G CG    1 
ATOM   5168  C  CD    . GLU G  3 91  ? -22.970 -40.730 49.364 1.00 43.72  ? 91   GLU G CD    1 
ATOM   5169  O  OE1   . GLU G  3 91  ? -22.983 -41.905 48.892 1.00 47.86  ? 91   GLU G OE1   1 
ATOM   5170  O  OE2   . GLU G  3 91  ? -22.063 -40.306 50.137 1.00 47.72  ? 91   GLU G OE2   1 
ATOM   5171  N  N     . GLU G  3 92  ? -25.774 -39.509 45.388 1.00 38.95  ? 92   GLU G N     1 
ATOM   5172  C  CA    . GLU G  3 92  ? -25.136 -38.945 44.212 1.00 38.18  ? 92   GLU G CA    1 
ATOM   5173  C  C     . GLU G  3 92  ? -25.918 -37.844 43.504 1.00 36.74  ? 92   GLU G C     1 
ATOM   5174  O  O     . GLU G  3 92  ? -25.347 -36.817 43.163 1.00 36.87  ? 92   GLU G O     1 
ATOM   5175  C  CB    . GLU G  3 92  ? -24.635 -40.026 43.283 1.00 38.73  ? 92   GLU G CB    1 
ATOM   5176  C  CG    . GLU G  3 92  ? -23.304 -40.572 43.778 1.00 42.03  ? 92   GLU G CG    1 
ATOM   5177  C  CD    . GLU G  3 92  ? -22.758 -41.705 42.928 1.00 47.17  ? 92   GLU G CD    1 
ATOM   5178  O  OE1   . GLU G  3 92  ? -23.531 -42.277 42.121 1.00 49.43  ? 92   GLU G OE1   1 
ATOM   5179  O  OE2   . GLU G  3 92  ? -21.556 -42.033 43.080 1.00 49.42  ? 92   GLU G OE2   1 
ATOM   5180  N  N     . LEU G  3 93  ? -27.218 -38.020 43.322 1.00 35.04  ? 93   LEU G N     1 
ATOM   5181  C  CA    . LEU G  3 93  ? -28.000 -36.948 42.713 1.00 33.85  ? 93   LEU G CA    1 
ATOM   5182  C  C     . LEU G  3 93  ? -28.026 -35.696 43.589 1.00 33.22  ? 93   LEU G C     1 
ATOM   5183  O  O     . LEU G  3 93  ? -28.035 -34.573 43.084 1.00 32.68  ? 93   LEU G O     1 
ATOM   5184  C  CB    . LEU G  3 93  ? -29.417 -37.412 42.384 1.00 33.81  ? 93   LEU G CB    1 
ATOM   5185  C  CG    . LEU G  3 93  ? -29.597 -38.324 41.164 1.00 33.70  ? 93   LEU G CG    1 
ATOM   5186  C  CD1   . LEU G  3 93  ? -31.013 -38.828 41.091 1.00 33.78  ? 93   LEU G CD1   1 
ATOM   5187  C  CD2   . LEU G  3 93  ? -29.224 -37.628 39.857 1.00 33.97  ? 93   LEU G CD2   1 
ATOM   5188  N  N     . ASN G  3 94  ? -28.019 -35.912 44.906 1.00 32.66  ? 94   ASN G N     1 
ATOM   5189  C  CA    . ASN G  3 94  ? -28.069 -34.845 45.900 1.00 31.43  ? 94   ASN G CA    1 
ATOM   5190  C  C     . ASN G  3 94  ? -26.832 -33.962 45.858 1.00 31.12  ? 94   ASN G C     1 
ATOM   5191  O  O     . ASN G  3 94  ? -26.920 -32.767 46.122 1.00 30.68  ? 94   ASN G O     1 
ATOM   5192  C  CB    . ASN G  3 94  ? -28.261 -35.417 47.309 1.00 30.95  ? 94   ASN G CB    1 
ATOM   5193  C  CG    . ASN G  3 94  ? -28.207 -34.339 48.387 1.00 30.48  ? 94   ASN G CG    1 
ATOM   5194  O  OD1   . ASN G  3 94  ? -28.968 -33.366 48.360 1.00 29.40  ? 94   ASN G OD1   1 
ATOM   5195  N  ND2   . ASN G  3 94  ? -27.285 -34.491 49.319 1.00 28.77  ? 94   ASN G ND2   1 
ATOM   5196  N  N     . LYS G  3 95  ? -25.688 -34.559 45.536 1.00 30.94  ? 95   LYS G N     1 
ATOM   5197  C  CA    . LYS G  3 95  ? -24.438 -33.820 45.419 1.00 31.04  ? 95   LYS G CA    1 
ATOM   5198  C  C     . LYS G  3 95  ? -24.403 -33.036 44.109 1.00 30.62  ? 95   LYS G C     1 
ATOM   5199  O  O     . LYS G  3 95  ? -24.055 -31.858 44.081 1.00 30.40  ? 95   LYS G O     1 
ATOM   5200  C  CB    . LYS G  3 95  ? -23.253 -34.774 45.500 1.00 31.35  ? 95   LYS G CB    1 
ATOM   5201  C  CG    . LYS G  3 95  ? -21.905 -34.082 45.375 1.00 33.79  ? 95   LYS G CG    1 
ATOM   5202  C  CD    . LYS G  3 95  ? -20.771 -35.079 45.557 1.00 38.24  ? 95   LYS G CD    1 
ATOM   5203  C  CE    . LYS G  3 95  ? -19.412 -34.417 45.351 1.00 40.74  ? 95   LYS G CE    1 
ATOM   5204  N  NZ    . LYS G  3 95  ? -18.452 -35.429 44.779 1.00 43.03  ? 95   LYS G NZ    1 
ATOM   5205  N  N     . LEU G  3 96  ? -24.771 -33.704 43.025 1.00 30.21  ? 96   LEU G N     1 
ATOM   5206  C  CA    . LEU G  3 96  ? -24.923 -33.045 41.740 1.00 29.88  ? 96   LEU G CA    1 
ATOM   5207  C  C     . LEU G  3 96  ? -25.838 -31.828 41.821 1.00 29.24  ? 96   LEU G C     1 
ATOM   5208  O  O     . LEU G  3 96  ? -25.610 -30.818 41.144 1.00 29.60  ? 96   LEU G O     1 
ATOM   5209  C  CB    . LEU G  3 96  ? -25.478 -34.031 40.702 1.00 30.05  ? 96   LEU G CB    1 
ATOM   5210  C  CG    . LEU G  3 96  ? -25.785 -33.481 39.306 1.00 29.98  ? 96   LEU G CG    1 
ATOM   5211  C  CD1   . LEU G  3 96  ? -24.487 -33.094 38.589 1.00 29.63  ? 96   LEU G CD1   1 
ATOM   5212  C  CD2   . LEU G  3 96  ? -26.600 -34.498 38.503 1.00 29.98  ? 96   LEU G CD2   1 
ATOM   5213  N  N     . LEU G  3 97  ? -26.884 -31.937 42.629 1.00 28.22  ? 97   LEU G N     1 
ATOM   5214  C  CA    . LEU G  3 97  ? -27.894 -30.888 42.701 1.00 27.50  ? 97   LEU G CA    1 
ATOM   5215  C  C     . LEU G  3 97  ? -27.826 -30.154 44.028 1.00 27.09  ? 97   LEU G C     1 
ATOM   5216  O  O     . LEU G  3 97  ? -28.807 -29.566 44.488 1.00 26.92  ? 97   LEU G O     1 
ATOM   5217  C  CB    . LEU G  3 97  ? -29.281 -31.470 42.424 1.00 27.26  ? 97   LEU G CB    1 
ATOM   5218  C  CG    . LEU G  3 97  ? -29.427 -32.050 41.000 1.00 27.39  ? 97   LEU G CG    1 
ATOM   5219  C  CD1   . LEU G  3 97  ? -30.895 -32.374 40.659 1.00 26.42  ? 97   LEU G CD1   1 
ATOM   5220  C  CD2   . LEU G  3 97  ? -28.828 -31.119 39.949 1.00 25.55  ? 97   LEU G CD2   1 
ATOM   5221  N  N     . GLY G  3 98  ? -26.634 -30.183 44.610 1.00 26.81  ? 98   GLY G N     1 
ATOM   5222  C  CA    . GLY G  3 98  ? -26.372 -29.645 45.925 1.00 27.15  ? 98   GLY G CA    1 
ATOM   5223  C  C     . GLY G  3 98  ? -26.574 -28.154 46.057 1.00 27.82  ? 98   GLY G C     1 
ATOM   5224  O  O     . GLY G  3 98  ? -26.854 -27.662 47.144 1.00 27.86  ? 98   GLY G O     1 
ATOM   5225  N  N     . ARG G  3 99  ? -26.420 -27.422 44.962 1.00 28.45  ? 99   ARG G N     1 
ATOM   5226  C  CA    . ARG G  3 99  ? -26.664 -25.977 44.999 1.00 28.73  ? 99   ARG G CA    1 
ATOM   5227  C  C     . ARG G  3 99  ? -27.924 -25.594 44.202 1.00 27.98  ? 99   ARG G C     1 
ATOM   5228  O  O     . ARG G  3 99  ? -28.038 -24.481 43.719 1.00 28.32  ? 99   ARG G O     1 
ATOM   5229  C  CB    . ARG G  3 99  ? -25.420 -25.193 44.541 1.00 28.85  ? 99   ARG G CB    1 
ATOM   5230  C  CG    . ARG G  3 99  ? -24.175 -25.421 45.397 1.00 31.12  ? 99   ARG G CG    1 
ATOM   5231  C  CD    . ARG G  3 99  ? -24.229 -24.659 46.727 1.00 36.18  ? 99   ARG G CD    1 
ATOM   5232  N  NE    . ARG G  3 99  ? -24.105 -23.195 46.557 1.00 41.43  ? 99   ARG G NE    1 
ATOM   5233  C  CZ    . ARG G  3 99  ? -24.617 -22.274 47.392 1.00 42.30  ? 99   ARG G CZ    1 
ATOM   5234  N  NH1   . ARG G  3 99  ? -25.313 -22.634 48.469 1.00 41.52  ? 99   ARG G NH1   1 
ATOM   5235  N  NH2   . ARG G  3 99  ? -24.443 -20.978 47.145 1.00 42.14  ? 99   ARG G NH2   1 
ATOM   5236  N  N     . VAL G  3 100 ? -28.867 -26.524 44.097 1.00 27.41  ? 100  VAL G N     1 
ATOM   5237  C  CA    . VAL G  3 100 ? -30.105 -26.303 43.350 1.00 27.07  ? 100  VAL G CA    1 
ATOM   5238  C  C     . VAL G  3 100 ? -31.345 -26.320 44.240 1.00 26.83  ? 100  VAL G C     1 
ATOM   5239  O  O     . VAL G  3 100 ? -31.447 -27.127 45.154 1.00 26.74  ? 100  VAL G O     1 
ATOM   5240  C  CB    . VAL G  3 100 ? -30.282 -27.365 42.216 1.00 27.09  ? 100  VAL G CB    1 
ATOM   5241  C  CG1   . VAL G  3 100 ? -31.705 -27.367 41.712 1.00 26.84  ? 100  VAL G CG1   1 
ATOM   5242  C  CG2   . VAL G  3 100 ? -29.334 -27.088 41.072 1.00 25.39  ? 100  VAL G CG2   1 
ATOM   5243  N  N     . THR G  3 101 ? -32.284 -25.430 43.957 1.00 26.97  ? 101  THR G N     1 
ATOM   5244  C  CA    . THR G  3 101 ? -33.573 -25.420 44.629 1.00 27.65  ? 101  THR G CA    1 
ATOM   5245  C  C     . THR G  3 101 ? -34.637 -25.871 43.648 1.00 27.98  ? 101  THR G C     1 
ATOM   5246  O  O     . THR G  3 101 ? -34.816 -25.249 42.612 1.00 28.00  ? 101  THR G O     1 
ATOM   5247  C  CB    . THR G  3 101 ? -33.943 -24.018 45.115 1.00 27.34  ? 101  THR G CB    1 
ATOM   5248  O  OG1   . THR G  3 101 ? -32.983 -23.587 46.067 1.00 29.77  ? 101  THR G OG1   1 
ATOM   5249  C  CG2   . THR G  3 101 ? -35.268 -24.016 45.801 1.00 28.21  ? 101  THR G CG2   1 
ATOM   5250  N  N     . ILE G  3 102 ? -35.331 -26.953 43.988 1.00 28.57  ? 102  ILE G N     1 
ATOM   5251  C  CA    . ILE G  3 102 ? -36.480 -27.435 43.226 1.00 28.97  ? 102  ILE G CA    1 
ATOM   5252  C  C     . ILE G  3 102 ? -37.718 -26.762 43.785 1.00 29.59  ? 102  ILE G C     1 
ATOM   5253  O  O     . ILE G  3 102 ? -38.053 -26.957 44.940 1.00 29.46  ? 102  ILE G O     1 
ATOM   5254  C  CB    . ILE G  3 102 ? -36.632 -28.953 43.377 1.00 28.60  ? 102  ILE G CB    1 
ATOM   5255  C  CG1   . ILE G  3 102 ? -35.477 -29.663 42.693 1.00 28.58  ? 102  ILE G CG1   1 
ATOM   5256  C  CG2   . ILE G  3 102 ? -37.914 -29.431 42.778 1.00 28.00  ? 102  ILE G CG2   1 
ATOM   5257  C  CD1   . ILE G  3 102 ? -35.460 -31.124 42.967 1.00 29.11  ? 102  ILE G CD1   1 
ATOM   5258  N  N     . ALA G  3 103 ? -38.398 -25.960 42.972 1.00 30.63  ? 103  ALA G N     1 
ATOM   5259  C  CA    . ALA G  3 103 ? -39.564 -25.225 43.455 1.00 31.35  ? 103  ALA G CA    1 
ATOM   5260  C  C     . ALA G  3 103 ? -40.674 -26.170 43.924 1.00 31.92  ? 103  ALA G C     1 
ATOM   5261  O  O     . ALA G  3 103 ? -40.890 -27.242 43.338 1.00 31.89  ? 103  ALA G O     1 
ATOM   5262  C  CB    . ALA G  3 103 ? -40.075 -24.292 42.391 1.00 31.48  ? 103  ALA G CB    1 
ATOM   5263  N  N     . GLN G  3 104 ? -41.362 -25.763 44.990 1.00 32.31  ? 104  GLN G N     1 
ATOM   5264  C  CA    . GLN G  3 104 ? -42.441 -26.557 45.599 1.00 32.84  ? 104  GLN G CA    1 
ATOM   5265  C  C     . GLN G  3 104 ? -42.020 -27.979 45.939 1.00 32.25  ? 104  GLN G C     1 
ATOM   5266  O  O     . GLN G  3 104 ? -42.850 -28.866 45.939 1.00 33.23  ? 104  GLN G O     1 
ATOM   5267  C  CB    . GLN G  3 104 ? -43.722 -26.562 44.734 1.00 33.20  ? 104  GLN G CB    1 
ATOM   5268  C  CG    . GLN G  3 104 ? -44.516 -25.245 44.732 1.00 36.40  ? 104  GLN G CG    1 
ATOM   5269  C  CD    . GLN G  3 104 ? -45.335 -25.015 46.022 1.00 41.85  ? 104  GLN G CD    1 
ATOM   5270  O  OE1   . GLN G  3 104 ? -46.428 -25.577 46.197 1.00 43.28  ? 104  GLN G OE1   1 
ATOM   5271  N  NE2   . GLN G  3 104 ? -44.805 -24.177 46.924 1.00 43.61  ? 104  GLN G NE2   1 
ATOM   5272  N  N     . GLY G  3 105 ? -40.747 -28.194 46.244 1.00 31.56  ? 105  GLY G N     1 
ATOM   5273  C  CA    . GLY G  3 105 ? -40.290 -29.501 46.701 1.00 31.48  ? 105  GLY G CA    1 
ATOM   5274  C  C     . GLY G  3 105 ? -40.324 -29.774 48.211 1.00 31.79  ? 105  GLY G C     1 
ATOM   5275  O  O     . GLY G  3 105 ? -40.307 -30.941 48.625 1.00 31.83  ? 105  GLY G O     1 
ATOM   5276  N  N     . GLY G  3 106 ? -40.377 -28.717 49.036 1.00 31.43  ? 106  GLY G N     1 
ATOM   5277  C  CA    . GLY G  3 106 ? -40.317 -28.849 50.481 1.00 31.07  ? 106  GLY G CA    1 
ATOM   5278  C  C     . GLY G  3 106 ? -38.987 -29.430 50.910 1.00 31.59  ? 106  GLY G C     1 
ATOM   5279  O  O     . GLY G  3 106 ? -38.024 -29.365 50.173 1.00 31.73  ? 106  GLY G O     1 
ATOM   5280  N  N     . VAL G  3 107 ? -38.938 -30.029 52.095 1.00 32.30  ? 107  VAL G N     1 
ATOM   5281  C  CA    . VAL G  3 107 ? -37.696 -30.602 52.642 1.00 32.61  ? 107  VAL G CA    1 
ATOM   5282  C  C     . VAL G  3 107 ? -37.975 -32.028 53.112 1.00 33.50  ? 107  VAL G C     1 
ATOM   5283  O  O     . VAL G  3 107 ? -39.140 -32.428 53.153 1.00 33.73  ? 107  VAL G O     1 
ATOM   5284  C  CB    . VAL G  3 107 ? -37.155 -29.768 53.823 1.00 32.07  ? 107  VAL G CB    1 
ATOM   5285  C  CG1   . VAL G  3 107 ? -36.920 -28.345 53.405 1.00 30.99  ? 107  VAL G CG1   1 
ATOM   5286  C  CG2   . VAL G  3 107 ? -38.118 -29.804 54.974 1.00 31.56  ? 107  VAL G CG2   1 
ATOM   5287  N  N     . LEU G  3 108 ? -36.926 -32.788 53.449 1.00 34.38  ? 108  LEU G N     1 
ATOM   5288  C  CA    . LEU G  3 108 ? -37.090 -34.155 53.985 1.00 35.54  ? 108  LEU G CA    1 
ATOM   5289  C  C     . LEU G  3 108 ? -37.492 -34.157 55.463 1.00 36.96  ? 108  LEU G C     1 
ATOM   5290  O  O     . LEU G  3 108 ? -37.020 -33.317 56.238 1.00 37.37  ? 108  LEU G O     1 
ATOM   5291  C  CB    . LEU G  3 108 ? -35.797 -34.954 53.872 1.00 35.18  ? 108  LEU G CB    1 
ATOM   5292  C  CG    . LEU G  3 108 ? -35.132 -35.287 52.543 1.00 34.66  ? 108  LEU G CG    1 
ATOM   5293  C  CD1   . LEU G  3 108 ? -34.041 -36.340 52.770 1.00 32.99  ? 108  LEU G CD1   1 
ATOM   5294  C  CD2   . LEU G  3 108 ? -36.156 -35.782 51.531 1.00 34.86  ? 108  LEU G CD2   1 
ATOM   5295  N  N     . PRO G  3 109 ? -38.373 -35.092 55.868 1.00 38.04  ? 109  PRO G N     1 
ATOM   5296  C  CA    . PRO G  3 109 ? -38.669 -35.233 57.292 1.00 38.48  ? 109  PRO G CA    1 
ATOM   5297  C  C     . PRO G  3 109 ? -37.403 -35.513 58.101 1.00 39.01  ? 109  PRO G C     1 
ATOM   5298  O  O     . PRO G  3 109 ? -36.759 -36.542 57.908 1.00 38.92  ? 109  PRO G O     1 
ATOM   5299  C  CB    . PRO G  3 109 ? -39.632 -36.428 57.326 1.00 38.43  ? 109  PRO G CB    1 
ATOM   5300  C  CG    . PRO G  3 109 ? -40.343 -36.361 56.008 1.00 38.04  ? 109  PRO G CG    1 
ATOM   5301  C  CD    . PRO G  3 109 ? -39.191 -36.017 55.059 1.00 38.44  ? 109  PRO G CD    1 
ATOM   5302  N  N     . ASN G  3 110 ? -37.046 -34.577 58.979 1.00 39.70  ? 110  ASN G N     1 
ATOM   5303  C  CA    . ASN G  3 110 ? -35.826 -34.687 59.773 1.00 40.66  ? 110  ASN G CA    1 
ATOM   5304  C  C     . ASN G  3 110 ? -35.915 -33.893 61.062 1.00 40.87  ? 110  ASN G C     1 
ATOM   5305  O  O     . ASN G  3 110 ? -35.984 -32.662 61.040 1.00 41.13  ? 110  ASN G O     1 
ATOM   5306  C  CB    . ASN G  3 110 ? -34.614 -34.203 58.971 1.00 41.03  ? 110  ASN G CB    1 
ATOM   5307  C  CG    . ASN G  3 110 ? -33.300 -34.821 59.443 1.00 42.63  ? 110  ASN G CG    1 
ATOM   5308  O  OD1   . ASN G  3 110 ? -32.220 -34.333 59.102 1.00 44.17  ? 110  ASN G OD1   1 
ATOM   5309  N  ND2   . ASN G  3 110 ? -33.384 -35.907 60.216 1.00 44.81  ? 110  ASN G ND2   1 
ATOM   5310  N  N     . ILE G  3 111 ? -35.923 -34.601 62.185 1.00 41.17  ? 111  ILE G N     1 
ATOM   5311  C  CA    . ILE G  3 111 ? -35.848 -33.958 63.493 1.00 41.61  ? 111  ILE G CA    1 
ATOM   5312  C  C     . ILE G  3 111 ? -34.577 -34.378 64.231 1.00 41.73  ? 111  ILE G C     1 
ATOM   5313  O  O     . ILE G  3 111 ? -34.318 -35.572 64.383 1.00 41.90  ? 111  ILE G O     1 
ATOM   5314  C  CB    . ILE G  3 111 ? -37.074 -34.286 64.374 1.00 41.50  ? 111  ILE G CB    1 
ATOM   5315  C  CG1   . ILE G  3 111 ? -38.368 -33.955 63.633 1.00 41.77  ? 111  ILE G CG1   1 
ATOM   5316  C  CG2   . ILE G  3 111 ? -37.009 -33.497 65.682 1.00 41.90  ? 111  ILE G CG2   1 
ATOM   5317  C  CD1   . ILE G  3 111 ? -39.610 -34.650 64.191 1.00 43.15  ? 111  ILE G CD1   1 
ATOM   5318  N  N     . GLN G  3 112 ? -33.796 -33.402 64.687 1.00 41.95  ? 112  GLN G N     1 
ATOM   5319  C  CA    . GLN G  3 112 ? -32.643 -33.690 65.531 1.00 42.53  ? 112  GLN G CA    1 
ATOM   5320  C  C     . GLN G  3 112 ? -33.098 -34.437 66.772 1.00 42.92  ? 112  GLN G C     1 
ATOM   5321  O  O     . GLN G  3 112 ? -34.029 -34.003 67.477 1.00 42.66  ? 112  GLN G O     1 
ATOM   5322  C  CB    . GLN G  3 112 ? -31.919 -32.405 65.929 1.00 42.67  ? 112  GLN G CB    1 
ATOM   5323  C  CG    . GLN G  3 112 ? -31.495 -31.558 64.745 1.00 43.47  ? 112  GLN G CG    1 
ATOM   5324  C  CD    . GLN G  3 112 ? -30.725 -32.351 63.710 1.00 42.91  ? 112  GLN G CD    1 
ATOM   5325  O  OE1   . GLN G  3 112 ? -29.735 -32.990 64.024 1.00 43.83  ? 112  GLN G OE1   1 
ATOM   5326  N  NE2   . GLN G  3 112 ? -31.193 -32.324 62.469 1.00 43.86  ? 112  GLN G NE2   1 
ATOM   5327  N  N     . SER G  3 113 ? -32.446 -35.568 67.025 1.00 43.44  ? 113  SER G N     1 
ATOM   5328  C  CA    . SER G  3 113 ? -32.854 -36.477 68.098 1.00 44.17  ? 113  SER G CA    1 
ATOM   5329  C  C     . SER G  3 113 ? -32.922 -35.832 69.488 1.00 44.06  ? 113  SER G C     1 
ATOM   5330  O  O     . SER G  3 113 ? -33.821 -36.131 70.259 1.00 44.12  ? 113  SER G O     1 
ATOM   5331  C  CB    . SER G  3 113 ? -31.954 -37.712 68.129 1.00 44.19  ? 113  SER G CB    1 
ATOM   5332  O  OG    . SER G  3 113 ? -30.662 -37.357 68.598 1.00 45.53  ? 113  SER G OG    1 
ATOM   5333  N  N     . VAL G  3 114 ? -31.983 -34.944 69.796 1.00 44.44  ? 114  VAL G N     1 
ATOM   5334  C  CA    . VAL G  3 114 ? -31.985 -34.224 71.075 1.00 44.84  ? 114  VAL G CA    1 
ATOM   5335  C  C     . VAL G  3 114 ? -33.265 -33.397 71.313 1.00 45.27  ? 114  VAL G C     1 
ATOM   5336  O  O     . VAL G  3 114 ? -33.522 -32.953 72.428 1.00 45.50  ? 114  VAL G O     1 
ATOM   5337  C  CB    . VAL G  3 114 ? -30.729 -33.326 71.213 1.00 44.84  ? 114  VAL G CB    1 
ATOM   5338  C  CG1   . VAL G  3 114 ? -30.764 -32.177 70.198 1.00 44.54  ? 114  VAL G CG1   1 
ATOM   5339  C  CG2   . VAL G  3 114 ? -30.575 -32.793 72.653 1.00 44.37  ? 114  VAL G CG2   1 
ATOM   5340  N  N     . LEU G  3 115 ? -34.065 -33.190 70.273 1.00 45.83  ? 115  LEU G N     1 
ATOM   5341  C  CA    . LEU G  3 115 ? -35.312 -32.442 70.417 1.00 46.27  ? 115  LEU G CA    1 
ATOM   5342  C  C     . LEU G  3 115 ? -36.521 -33.337 70.699 1.00 47.18  ? 115  LEU G C     1 
ATOM   5343  O  O     . LEU G  3 115 ? -37.630 -32.840 70.881 1.00 47.16  ? 115  LEU G O     1 
ATOM   5344  C  CB    . LEU G  3 115 ? -35.561 -31.566 69.184 1.00 45.77  ? 115  LEU G CB    1 
ATOM   5345  C  CG    . LEU G  3 115 ? -34.514 -30.485 68.927 1.00 44.44  ? 115  LEU G CG    1 
ATOM   5346  C  CD1   . LEU G  3 115 ? -34.721 -29.869 67.573 1.00 43.61  ? 115  LEU G CD1   1 
ATOM   5347  C  CD2   . LEU G  3 115 ? -34.536 -29.421 70.003 1.00 43.40  ? 115  LEU G CD2   1 
ATOM   5348  N  N     . LEU G  3 116 ? -36.296 -34.648 70.740 1.00 48.57  ? 116  LEU G N     1 
ATOM   5349  C  CA    . LEU G  3 116 ? -37.356 -35.627 70.964 1.00 50.05  ? 116  LEU G CA    1 
ATOM   5350  C  C     . LEU G  3 116 ? -37.684 -35.800 72.442 1.00 51.49  ? 116  LEU G C     1 
ATOM   5351  O  O     . LEU G  3 116 ? -36.777 -35.781 73.278 1.00 51.38  ? 116  LEU G O     1 
ATOM   5352  C  CB    . LEU G  3 116 ? -36.983 -36.970 70.341 1.00 49.83  ? 116  LEU G CB    1 
ATOM   5353  C  CG    . LEU G  3 116 ? -36.949 -37.035 68.810 1.00 49.79  ? 116  LEU G CG    1 
ATOM   5354  C  CD1   . LEU G  3 116 ? -36.663 -38.471 68.346 1.00 49.71  ? 116  LEU G CD1   1 
ATOM   5355  C  CD2   . LEU G  3 116 ? -38.241 -36.504 68.175 1.00 48.64  ? 116  LEU G CD2   1 
ATOM   5356  N  N     . PRO G  3 117 ? -38.986 -35.991 72.762 1.00 53.11  ? 117  PRO G N     1 
ATOM   5357  C  CA    . PRO G  3 117 ? -39.553 -36.019 74.128 1.00 54.33  ? 117  PRO G CA    1 
ATOM   5358  C  C     . PRO G  3 117 ? -38.781 -36.856 75.147 1.00 55.40  ? 117  PRO G C     1 
ATOM   5359  O  O     . PRO G  3 117 ? -38.156 -37.851 74.780 1.00 55.40  ? 117  PRO G O     1 
ATOM   5360  C  CB    . PRO G  3 117 ? -40.951 -36.608 73.916 1.00 54.06  ? 117  PRO G CB    1 
ATOM   5361  C  CG    . PRO G  3 117 ? -41.326 -36.132 72.563 1.00 54.05  ? 117  PRO G CG    1 
ATOM   5362  C  CD    . PRO G  3 117 ? -40.040 -36.206 71.750 1.00 53.26  ? 117  PRO G CD    1 
ATOM   5363  N  N     . LYS G  3 118 ? -38.865 -36.428 76.414 1.00 56.93  ? 118  LYS G N     1 
ATOM   5364  C  CA    . LYS G  3 118 ? -38.139 -36.992 77.590 1.00 58.38  ? 118  LYS G CA    1 
ATOM   5365  C  C     . LYS G  3 118 ? -36.601 -36.853 77.593 1.00 58.34  ? 118  LYS G C     1 
ATOM   5366  O  O     . LYS G  3 118 ? -35.947 -37.025 76.544 1.00 58.71  ? 118  LYS G O     1 
ATOM   5367  C  CB    . LYS G  3 118 ? -38.600 -38.432 77.955 1.00 58.49  ? 118  LYS G CB    1 
ATOM   5368  C  CG    . LYS G  3 118 ? -37.937 -39.594 77.191 1.00 58.79  ? 118  LYS G CG    1 
ATOM   5369  C  CD    . LYS G  3 118 ? -38.862 -40.816 77.206 1.00 59.42  ? 118  LYS G CD    1 
ATOM   5370  C  CE    . LYS G  3 118 ? -38.075 -42.133 77.113 1.00 61.76  ? 118  LYS G CE    1 
ATOM   5371  N  NZ    . LYS G  3 118 ? -37.667 -42.464 75.702 1.00 62.35  ? 118  LYS G NZ    1 
ATOM   5372  N  N     . LYS H  4 24  ? -50.915 -18.991 10.358 1.00 94.67  ? 24   LYS H N     1 
ATOM   5373  C  CA    . LYS H  4 24  ? -50.875 -18.832 11.843 1.00 94.60  ? 24   LYS H CA    1 
ATOM   5374  C  C     . LYS H  4 24  ? -49.437 -18.990 12.360 1.00 94.47  ? 24   LYS H C     1 
ATOM   5375  O  O     . LYS H  4 24  ? -49.106 -19.974 13.037 1.00 94.49  ? 24   LYS H O     1 
ATOM   5376  C  CB    . LYS H  4 24  ? -51.836 -19.833 12.508 1.00 94.75  ? 24   LYS H CB    1 
ATOM   5377  C  CG    . LYS H  4 24  ? -52.268 -19.480 13.940 1.00 94.73  ? 24   LYS H CG    1 
ATOM   5378  C  CD    . LYS H  4 24  ? -53.373 -20.420 14.439 1.00 94.46  ? 24   LYS H CD    1 
ATOM   5379  C  CE    . LYS H  4 24  ? -54.775 -19.853 14.224 1.00 93.61  ? 24   LYS H CE    1 
ATOM   5380  N  NZ    . LYS H  4 24  ? -55.094 -18.765 15.191 1.00 92.93  ? 24   LYS H NZ    1 
ATOM   5381  N  N     . LYS H  4 25  ? -48.592 -18.008 12.030 1.00 94.23  ? 25   LYS H N     1 
ATOM   5382  C  CA    . LYS H  4 25  ? -47.173 -18.026 12.418 1.00 93.95  ? 25   LYS H CA    1 
ATOM   5383  C  C     . LYS H  4 25  ? -46.751 -16.871 13.335 1.00 93.49  ? 25   LYS H C     1 
ATOM   5384  O  O     . LYS H  4 25  ? -45.681 -16.929 13.946 1.00 93.61  ? 25   LYS H O     1 
ATOM   5385  C  CB    . LYS H  4 25  ? -46.253 -18.098 11.173 1.00 94.22  ? 25   LYS H CB    1 
ATOM   5386  C  CG    . LYS H  4 25  ? -46.216 -16.844 10.248 1.00 94.66  ? 25   LYS H CG    1 
ATOM   5387  C  CD    . LYS H  4 25  ? -45.206 -15.766 10.709 1.00 95.00  ? 25   LYS H CD    1 
ATOM   5388  C  CE    . LYS H  4 25  ? -43.776 -16.024 10.222 1.00 94.96  ? 25   LYS H CE    1 
ATOM   5389  N  NZ    . LYS H  4 25  ? -42.738 -15.382 11.088 1.00 94.40  ? 25   LYS H NZ    1 
ATOM   5390  N  N     . ARG H  4 26  ? -47.596 -15.840 13.425 1.00 92.80  ? 26   ARG H N     1 
ATOM   5391  C  CA    . ARG H  4 26  ? -47.242 -14.557 14.052 1.00 92.12  ? 26   ARG H CA    1 
ATOM   5392  C  C     . ARG H  4 26  ? -46.733 -14.646 15.501 1.00 91.56  ? 26   ARG H C     1 
ATOM   5393  O  O     . ARG H  4 26  ? -45.523 -14.582 15.739 1.00 91.60  ? 26   ARG H O     1 
ATOM   5394  C  CB    . ARG H  4 26  ? -48.403 -13.562 13.932 1.00 92.04  ? 26   ARG H CB    1 
ATOM   5395  C  CG    . ARG H  4 26  ? -48.024 -12.111 14.223 1.00 92.34  ? 26   ARG H CG    1 
ATOM   5396  C  CD    . ARG H  4 26  ? -49.257 -11.212 14.259 1.00 92.46  ? 26   ARG H CD    1 
ATOM   5397  N  NE    . ARG H  4 26  ? -50.355 -11.825 15.010 1.00 93.34  ? 26   ARG H NE    1 
ATOM   5398  C  CZ    . ARG H  4 26  ? -51.426 -11.178 15.467 1.00 93.35  ? 26   ARG H CZ    1 
ATOM   5399  N  NH1   . ARG H  4 26  ? -51.566 -9.871  15.273 1.00 93.33  ? 26   ARG H NH1   1 
ATOM   5400  N  NH2   . ARG H  4 26  ? -52.359 -11.846 16.133 1.00 92.63  ? 26   ARG H NH2   1 
ATOM   5401  N  N     . ARG H  4 27  ? -47.648 -14.808 16.456 1.00 90.78  ? 27   ARG H N     1 
ATOM   5402  C  CA    . ARG H  4 27  ? -47.293 -14.838 17.888 1.00 89.88  ? 27   ARG H CA    1 
ATOM   5403  C  C     . ARG H  4 27  ? -46.653 -16.183 18.294 1.00 88.70  ? 27   ARG H C     1 
ATOM   5404  O  O     . ARG H  4 27  ? -46.866 -16.701 19.402 1.00 88.66  ? 27   ARG H O     1 
ATOM   5405  C  CB    . ARG H  4 27  ? -48.514 -14.490 18.770 1.00 90.21  ? 27   ARG H CB    1 
ATOM   5406  C  CG    . ARG H  4 27  ? -49.312 -13.237 18.333 1.00 91.57  ? 27   ARG H CG    1 
ATOM   5407  C  CD    . ARG H  4 27  ? -48.524 -11.928 18.511 1.00 93.94  ? 27   ARG H CD    1 
ATOM   5408  N  NE    . ARG H  4 27  ? -49.028 -10.854 17.648 1.00 95.61  ? 27   ARG H NE    1 
ATOM   5409  C  CZ    . ARG H  4 27  ? -48.419 -9.683  17.450 1.00 96.75  ? 27   ARG H CZ    1 
ATOM   5410  N  NH1   . ARG H  4 27  ? -47.267 -9.410  18.057 1.00 97.06  ? 27   ARG H NH1   1 
ATOM   5411  N  NH2   . ARG H  4 27  ? -48.963 -8.779  16.639 1.00 96.82  ? 27   ARG H NH2   1 
ATOM   5412  N  N     . LYS H  4 28  ? -45.854 -16.726 17.379 1.00 86.97  ? 28   LYS H N     1 
ATOM   5413  C  CA    . LYS H  4 28  ? -45.233 -18.025 17.550 1.00 85.26  ? 28   LYS H CA    1 
ATOM   5414  C  C     . LYS H  4 28  ? -43.721 -17.861 17.473 1.00 83.68  ? 28   LYS H C     1 
ATOM   5415  O  O     . LYS H  4 28  ? -43.082 -18.287 16.496 1.00 83.97  ? 28   LYS H O     1 
ATOM   5416  C  CB    . LYS H  4 28  ? -45.752 -19.006 16.471 1.00 85.54  ? 28   LYS H CB    1 
ATOM   5417  C  CG    . LYS H  4 28  ? -45.010 -20.362 16.352 1.00 85.56  ? 28   LYS H CG    1 
ATOM   5418  C  CD    . LYS H  4 28  ? -45.129 -20.992 14.945 1.00 85.62  ? 28   LYS H CD    1 
ATOM   5419  C  CE    . LYS H  4 28  ? -44.497 -20.126 13.823 1.00 86.40  ? 28   LYS H CE    1 
ATOM   5420  N  NZ    . LYS H  4 28  ? -43.020 -19.871 13.949 1.00 86.29  ? 28   LYS H NZ    1 
ATOM   5421  N  N     . THR H  4 29  ? -43.129 -17.221 18.475 1.00 81.14  ? 29   THR H N     1 
ATOM   5422  C  CA    . THR H  4 29  ? -41.692 -17.368 18.592 1.00 78.68  ? 29   THR H CA    1 
ATOM   5423  C  C     . THR H  4 29  ? -41.524 -18.684 19.323 1.00 76.96  ? 29   THR H C     1 
ATOM   5424  O  O     . THR H  4 29  ? -41.781 -18.785 20.526 1.00 76.72  ? 29   THR H O     1 
ATOM   5425  C  CB    . THR H  4 29  ? -41.018 -16.203 19.295 1.00 78.77  ? 29   THR H CB    1 
ATOM   5426  O  OG1   . THR H  4 29  ? -41.468 -14.994 18.688 1.00 78.55  ? 29   THR H OG1   1 
ATOM   5427  C  CG2   . THR H  4 29  ? -39.505 -16.291 19.136 1.00 78.40  ? 29   THR H CG2   1 
ATOM   5428  N  N     . ARG H  4 30  ? -41.155 -19.700 18.552 1.00 74.61  ? 30   ARG H N     1 
ATOM   5429  C  CA    . ARG H  4 30  ? -41.027 -21.057 19.044 1.00 72.46  ? 30   ARG H CA    1 
ATOM   5430  C  C     . ARG H  4 30  ? -40.315 -21.101 20.390 1.00 70.62  ? 30   ARG H C     1 
ATOM   5431  O  O     . ARG H  4 30  ? -39.117 -20.809 20.477 1.00 70.62  ? 30   ARG H O     1 
ATOM   5432  C  CB    . ARG H  4 30  ? -40.239 -21.896 18.046 1.00 72.68  ? 30   ARG H CB    1 
ATOM   5433  C  CG    . ARG H  4 30  ? -40.939 -22.164 16.743 1.00 73.45  ? 30   ARG H CG    1 
ATOM   5434  C  CD    . ARG H  4 30  ? -40.027 -22.944 15.809 1.00 75.19  ? 30   ARG H CD    1 
ATOM   5435  N  NE    . ARG H  4 30  ? -39.638 -24.239 16.371 1.00 76.47  ? 30   ARG H NE    1 
ATOM   5436  C  CZ    . ARG H  4 30  ? -40.348 -25.362 16.254 1.00 77.12  ? 30   ARG H CZ    1 
ATOM   5437  N  NH1   . ARG H  4 30  ? -41.500 -25.366 15.587 1.00 77.20  ? 30   ARG H NH1   1 
ATOM   5438  N  NH2   . ARG H  4 30  ? -39.905 -26.487 16.807 1.00 77.34  ? 30   ARG H NH2   1 
ATOM   5439  N  N     . LYS H  4 31  ? -41.055 -21.454 21.438 1.00 67.98  ? 31   LYS H N     1 
ATOM   5440  C  CA    . LYS H  4 31  ? -40.441 -21.706 22.734 1.00 65.38  ? 31   LYS H CA    1 
ATOM   5441  C  C     . LYS H  4 31  ? -40.200 -23.203 22.910 1.00 62.95  ? 31   LYS H C     1 
ATOM   5442  O  O     . LYS H  4 31  ? -41.008 -23.905 23.508 1.00 62.66  ? 31   LYS H O     1 
ATOM   5443  C  CB    . LYS H  4 31  ? -41.297 -21.134 23.871 1.00 65.65  ? 31   LYS H CB    1 
ATOM   5444  C  CG    . LYS H  4 31  ? -40.488 -20.706 25.090 1.00 67.01  ? 31   LYS H CG    1 
ATOM   5445  C  CD    . LYS H  4 31  ? -39.528 -19.559 24.739 1.00 69.25  ? 31   LYS H CD    1 
ATOM   5446  C  CE    . LYS H  4 31  ? -38.836 -18.979 25.975 1.00 70.04  ? 31   LYS H CE    1 
ATOM   5447  N  NZ    . LYS H  4 31  ? -37.733 -19.845 26.487 1.00 70.25  ? 31   LYS H NZ    1 
ATOM   5448  N  N     . GLU H  4 32  ? -39.088 -23.688 22.373 1.00 60.05  ? 32   GLU H N     1 
ATOM   5449  C  CA    . GLU H  4 32  ? -38.758 -25.107 22.465 1.00 57.60  ? 32   GLU H CA    1 
ATOM   5450  C  C     . GLU H  4 32  ? -38.341 -25.517 23.881 1.00 55.16  ? 32   GLU H C     1 
ATOM   5451  O  O     . GLU H  4 32  ? -37.808 -24.707 24.640 1.00 54.83  ? 32   GLU H O     1 
ATOM   5452  C  CB    . GLU H  4 32  ? -37.672 -25.482 21.448 1.00 57.70  ? 32   GLU H CB    1 
ATOM   5453  C  CG    . GLU H  4 32  ? -36.302 -24.842 21.703 1.00 58.43  ? 32   GLU H CG    1 
ATOM   5454  C  CD    . GLU H  4 32  ? -35.365 -24.903 20.491 1.00 58.74  ? 32   GLU H CD    1 
ATOM   5455  O  OE1   . GLU H  4 32  ? -35.624 -25.705 19.558 1.00 60.26  ? 32   GLU H OE1   1 
ATOM   5456  O  OE2   . GLU H  4 32  ? -34.360 -24.147 20.482 1.00 59.17  ? 32   GLU H OE2   1 
ATOM   5457  N  N     . SER H  4 33  ? -38.607 -26.774 24.225 1.00 52.28  ? 33   SER H N     1 
ATOM   5458  C  CA    . SER H  4 33  ? -38.182 -27.359 25.491 1.00 49.60  ? 33   SER H CA    1 
ATOM   5459  C  C     . SER H  4 33  ? -37.892 -28.845 25.297 1.00 47.86  ? 33   SER H C     1 
ATOM   5460  O  O     . SER H  4 33  ? -38.116 -29.377 24.227 1.00 47.67  ? 33   SER H O     1 
ATOM   5461  C  CB    . SER H  4 33  ? -39.241 -27.133 26.572 1.00 49.62  ? 33   SER H CB    1 
ATOM   5462  O  OG    . SER H  4 33  ? -40.237 -28.129 26.547 1.00 49.20  ? 33   SER H OG    1 
ATOM   5463  N  N     . TYR H  4 34  ? -37.373 -29.512 26.318 1.00 45.96  ? 34   TYR H N     1 
ATOM   5464  C  CA    . TYR H  4 34  ? -37.099 -30.938 26.224 1.00 44.24  ? 34   TYR H CA    1 
ATOM   5465  C  C     . TYR H  4 34  ? -38.300 -31.778 26.612 1.00 43.84  ? 34   TYR H C     1 
ATOM   5466  O  O     . TYR H  4 34  ? -38.238 -33.002 26.571 1.00 43.56  ? 34   TYR H O     1 
ATOM   5467  C  CB    . TYR H  4 34  ? -35.940 -31.309 27.123 1.00 43.54  ? 34   TYR H CB    1 
ATOM   5468  C  CG    . TYR H  4 34  ? -34.604 -30.846 26.627 1.00 42.80  ? 34   TYR H CG    1 
ATOM   5469  C  CD1   . TYR H  4 34  ? -34.069 -29.627 27.046 1.00 41.83  ? 34   TYR H CD1   1 
ATOM   5470  C  CD2   . TYR H  4 34  ? -33.861 -31.631 25.746 1.00 40.46  ? 34   TYR H CD2   1 
ATOM   5471  C  CE1   . TYR H  4 34  ? -32.826 -29.205 26.595 1.00 41.44  ? 34   TYR H CE1   1 
ATOM   5472  C  CE2   . TYR H  4 34  ? -32.629 -31.216 25.288 1.00 40.15  ? 34   TYR H CE2   1 
ATOM   5473  C  CZ    . TYR H  4 34  ? -32.112 -30.006 25.715 1.00 41.37  ? 34   TYR H CZ    1 
ATOM   5474  O  OH    . TYR H  4 34  ? -30.875 -29.602 25.274 1.00 41.82  ? 34   TYR H OH    1 
ATOM   5475  N  N     . ALA H  4 35  ? -39.394 -31.107 26.960 1.00 43.72  ? 35   ALA H N     1 
ATOM   5476  C  CA    . ALA H  4 35  ? -40.570 -31.735 27.548 1.00 44.03  ? 35   ALA H CA    1 
ATOM   5477  C  C     . ALA H  4 35  ? -41.060 -33.010 26.862 1.00 44.49  ? 35   ALA H C     1 
ATOM   5478  O  O     . ALA H  4 35  ? -41.376 -33.987 27.545 1.00 45.16  ? 35   ALA H O     1 
ATOM   5479  C  CB    . ALA H  4 35  ? -41.695 -30.732 27.684 1.00 43.67  ? 35   ALA H CB    1 
ATOM   5480  N  N     . ILE H  4 36  ? -41.126 -33.034 25.536 1.00 44.68  ? 36   ILE H N     1 
ATOM   5481  C  CA    . ILE H  4 36  ? -41.651 -34.237 24.879 1.00 45.10  ? 36   ILE H CA    1 
ATOM   5482  C  C     . ILE H  4 36  ? -40.675 -35.409 24.924 1.00 45.31  ? 36   ILE H C     1 
ATOM   5483  O  O     . ILE H  4 36  ? -41.091 -36.570 24.897 1.00 45.74  ? 36   ILE H O     1 
ATOM   5484  C  CB    . ILE H  4 36  ? -42.170 -33.997 23.427 1.00 45.06  ? 36   ILE H CB    1 
ATOM   5485  C  CG1   . ILE H  4 36  ? -41.052 -33.508 22.512 1.00 44.58  ? 36   ILE H CG1   1 
ATOM   5486  C  CG2   . ILE H  4 36  ? -43.373 -33.035 23.439 1.00 45.21  ? 36   ILE H CG2   1 
ATOM   5487  C  CD1   . ILE H  4 36  ? -41.326 -33.728 21.068 1.00 44.28  ? 36   ILE H CD1   1 
ATOM   5488  N  N     . TYR H  4 37  ? -39.385 -35.097 25.002 1.00 45.37  ? 37   TYR H N     1 
ATOM   5489  C  CA    . TYR H  4 37  ? -38.348 -36.114 25.059 1.00 45.38  ? 37   TYR H CA    1 
ATOM   5490  C  C     . TYR H  4 37  ? -38.225 -36.627 26.470 1.00 45.18  ? 37   TYR H C     1 
ATOM   5491  O  O     . TYR H  4 37  ? -37.901 -37.792 26.676 1.00 45.33  ? 37   TYR H O     1 
ATOM   5492  C  CB    . TYR H  4 37  ? -37.019 -35.539 24.608 1.00 45.67  ? 37   TYR H CB    1 
ATOM   5493  C  CG    . TYR H  4 37  ? -37.124 -34.857 23.281 1.00 46.88  ? 37   TYR H CG    1 
ATOM   5494  C  CD1   . TYR H  4 37  ? -37.349 -33.485 23.199 1.00 46.17  ? 37   TYR H CD1   1 
ATOM   5495  C  CD2   . TYR H  4 37  ? -37.027 -35.588 22.092 1.00 47.76  ? 37   TYR H CD2   1 
ATOM   5496  C  CE1   . TYR H  4 37  ? -37.462 -32.861 21.981 1.00 46.30  ? 37   TYR H CE1   1 
ATOM   5497  C  CE2   . TYR H  4 37  ? -37.127 -34.966 20.868 1.00 46.98  ? 37   TYR H CE2   1 
ATOM   5498  C  CZ    . TYR H  4 37  ? -37.351 -33.607 20.822 1.00 46.71  ? 37   TYR H CZ    1 
ATOM   5499  O  OH    . TYR H  4 37  ? -37.451 -32.986 19.605 1.00 48.08  ? 37   TYR H OH    1 
ATOM   5500  N  N     . VAL H  4 38  ? -38.466 -35.747 27.438 1.00 44.80  ? 38   VAL H N     1 
ATOM   5501  C  CA    . VAL H  4 38  ? -38.544 -36.145 28.833 1.00 44.75  ? 38   VAL H CA    1 
ATOM   5502  C  C     . VAL H  4 38  ? -39.713 -37.105 28.950 1.00 45.38  ? 38   VAL H C     1 
ATOM   5503  O  O     . VAL H  4 38  ? -39.565 -38.209 29.494 1.00 45.43  ? 38   VAL H O     1 
ATOM   5504  C  CB    . VAL H  4 38  ? -38.736 -34.935 29.768 1.00 44.58  ? 38   VAL H CB    1 
ATOM   5505  C  CG1   . VAL H  4 38  ? -39.104 -35.379 31.167 1.00 44.00  ? 38   VAL H CG1   1 
ATOM   5506  C  CG2   . VAL H  4 38  ? -37.480 -34.090 29.800 1.00 43.75  ? 38   VAL H CG2   1 
ATOM   5507  N  N     . TYR H  4 39  ? -40.854 -36.696 28.392 1.00 45.90  ? 39   TYR H N     1 
ATOM   5508  C  CA    . TYR H  4 39  ? -42.061 -37.517 28.386 1.00 46.63  ? 39   TYR H CA    1 
ATOM   5509  C  C     . TYR H  4 39  ? -41.829 -38.930 27.819 1.00 46.45  ? 39   TYR H C     1 
ATOM   5510  O  O     . TYR H  4 39  ? -42.285 -39.906 28.402 1.00 46.60  ? 39   TYR H O     1 
ATOM   5511  C  CB    . TYR H  4 39  ? -43.208 -36.802 27.660 1.00 47.58  ? 39   TYR H CB    1 
ATOM   5512  C  CG    . TYR H  4 39  ? -44.544 -37.446 27.917 1.00 49.10  ? 39   TYR H CG    1 
ATOM   5513  C  CD1   . TYR H  4 39  ? -45.411 -36.938 28.886 1.00 51.08  ? 39   TYR H CD1   1 
ATOM   5514  C  CD2   . TYR H  4 39  ? -44.939 -38.585 27.199 1.00 50.76  ? 39   TYR H CD2   1 
ATOM   5515  C  CE1   . TYR H  4 39  ? -46.652 -37.555 29.137 1.00 52.43  ? 39   TYR H CE1   1 
ATOM   5516  C  CE2   . TYR H  4 39  ? -46.161 -39.208 27.437 1.00 51.30  ? 39   TYR H CE2   1 
ATOM   5517  C  CZ    . TYR H  4 39  ? -47.012 -38.694 28.404 1.00 51.34  ? 39   TYR H CZ    1 
ATOM   5518  O  OH    . TYR H  4 39  ? -48.217 -39.322 28.627 1.00 51.08  ? 39   TYR H OH    1 
ATOM   5519  N  N     . LYS H  4 40  ? -41.112 -39.040 26.705 1.00 46.14  ? 40   LYS H N     1 
ATOM   5520  C  CA    . LYS H  4 40  ? -40.802 -40.347 26.121 1.00 46.45  ? 40   LYS H CA    1 
ATOM   5521  C  C     . LYS H  4 40  ? -40.002 -41.248 27.052 1.00 45.96  ? 40   LYS H C     1 
ATOM   5522  O  O     . LYS H  4 40  ? -40.266 -42.444 27.149 1.00 45.71  ? 40   LYS H O     1 
ATOM   5523  C  CB    . LYS H  4 40  ? -40.040 -40.196 24.801 1.00 46.45  ? 40   LYS H CB    1 
ATOM   5524  C  CG    . LYS H  4 40  ? -40.865 -39.669 23.624 1.00 47.32  ? 40   LYS H CG    1 
ATOM   5525  C  CD    . LYS H  4 40  ? -40.029 -39.768 22.342 1.00 47.81  ? 40   LYS H CD    1 
ATOM   5526  C  CE    . LYS H  4 40  ? -40.575 -38.911 21.205 1.00 49.71  ? 40   LYS H CE    1 
ATOM   5527  N  NZ    . LYS H  4 40  ? -39.529 -38.784 20.133 1.00 50.40  ? 40   LYS H NZ    1 
ATOM   5528  N  N     . VAL H  4 41  ? -39.011 -40.668 27.725 1.00 46.06  ? 41   VAL H N     1 
ATOM   5529  C  CA    . VAL H  4 41  ? -38.124 -41.427 28.606 1.00 45.75  ? 41   VAL H CA    1 
ATOM   5530  C  C     . VAL H  4 41  ? -38.909 -41.889 29.826 1.00 45.77  ? 41   VAL H C     1 
ATOM   5531  O  O     . VAL H  4 41  ? -38.700 -42.995 30.342 1.00 45.16  ? 41   VAL H O     1 
ATOM   5532  C  CB    . VAL H  4 41  ? -36.888 -40.595 29.025 1.00 45.67  ? 41   VAL H CB    1 
ATOM   5533  C  CG1   . VAL H  4 41  ? -35.995 -41.383 29.973 1.00 45.26  ? 41   VAL H CG1   1 
ATOM   5534  C  CG2   . VAL H  4 41  ? -36.090 -40.181 27.799 1.00 45.99  ? 41   VAL H CG2   1 
ATOM   5535  N  N     . LEU H  4 42  ? -39.825 -41.033 30.273 1.00 45.82  ? 42   LEU H N     1 
ATOM   5536  C  CA    . LEU H  4 42  ? -40.685 -41.376 31.374 1.00 46.18  ? 42   LEU H CA    1 
ATOM   5537  C  C     . LEU H  4 42  ? -41.433 -42.673 31.080 1.00 47.11  ? 42   LEU H C     1 
ATOM   5538  O  O     . LEU H  4 42  ? -41.383 -43.620 31.884 1.00 47.31  ? 42   LEU H O     1 
ATOM   5539  C  CB    . LEU H  4 42  ? -41.652 -40.243 31.675 1.00 45.79  ? 42   LEU H CB    1 
ATOM   5540  C  CG    . LEU H  4 42  ? -42.751 -40.556 32.685 1.00 45.10  ? 42   LEU H CG    1 
ATOM   5541  C  CD1   . LEU H  4 42  ? -42.193 -41.191 33.941 1.00 45.07  ? 42   LEU H CD1   1 
ATOM   5542  C  CD2   . LEU H  4 42  ? -43.488 -39.295 33.032 1.00 45.33  ? 42   LEU H CD2   1 
ATOM   5543  N  N     . LYS H  4 43  ? -42.088 -42.732 29.919 1.00 47.65  ? 43   LYS H N     1 
ATOM   5544  C  CA    . LYS H  4 43  ? -42.898 -43.890 29.555 1.00 48.10  ? 43   LYS H CA    1 
ATOM   5545  C  C     . LYS H  4 43  ? -42.099 -45.182 29.459 1.00 48.53  ? 43   LYS H C     1 
ATOM   5546  O  O     . LYS H  4 43  ? -42.636 -46.258 29.707 1.00 49.32  ? 43   LYS H O     1 
ATOM   5547  C  CB    . LYS H  4 43  ? -43.676 -43.632 28.276 1.00 47.97  ? 43   LYS H CB    1 
ATOM   5548  C  CG    . LYS H  4 43  ? -44.604 -42.408 28.349 1.00 48.62  ? 43   LYS H CG    1 
ATOM   5549  C  CD    . LYS H  4 43  ? -45.971 -42.688 29.007 1.00 49.31  ? 43   LYS H CD    1 
ATOM   5550  C  CE    . LYS H  4 43  ? -45.962 -42.486 30.520 1.00 49.83  ? 43   LYS H CE    1 
ATOM   5551  N  NZ    . LYS H  4 43  ? -47.315 -42.095 31.038 1.00 49.74  ? 43   LYS H NZ    1 
ATOM   5552  N  N     . GLN H  4 44  ? -40.815 -45.093 29.143 1.00 48.77  ? 44   GLN H N     1 
ATOM   5553  C  CA    . GLN H  4 44  ? -39.983 -46.296 29.139 1.00 49.46  ? 44   GLN H CA    1 
ATOM   5554  C  C     . GLN H  4 44  ? -39.648 -46.833 30.525 1.00 49.32  ? 44   GLN H C     1 
ATOM   5555  O  O     . GLN H  4 44  ? -39.524 -48.039 30.698 1.00 49.56  ? 44   GLN H O     1 
ATOM   5556  C  CB    . GLN H  4 44  ? -38.687 -46.058 28.401 1.00 49.67  ? 44   GLN H CB    1 
ATOM   5557  C  CG    . GLN H  4 44  ? -38.862 -45.569 27.008 1.00 52.14  ? 44   GLN H CG    1 
ATOM   5558  C  CD    . GLN H  4 44  ? -37.528 -45.312 26.353 1.00 56.17  ? 44   GLN H CD    1 
ATOM   5559  O  OE1   . GLN H  4 44  ? -36.471 -45.673 26.891 1.00 56.94  ? 44   GLN H OE1   1 
ATOM   5560  N  NE2   . GLN H  4 44  ? -37.561 -44.690 25.180 1.00 57.61  ? 44   GLN H NE2   1 
ATOM   5561  N  N     . VAL H  4 45  ? -39.469 -45.951 31.503 1.00 49.24  ? 45   VAL H N     1 
ATOM   5562  C  CA    . VAL H  4 45  ? -39.097 -46.404 32.846 1.00 49.21  ? 45   VAL H CA    1 
ATOM   5563  C  C     . VAL H  4 45  ? -40.309 -46.585 33.771 1.00 49.41  ? 45   VAL H C     1 
ATOM   5564  O  O     . VAL H  4 45  ? -40.286 -47.430 34.663 1.00 49.54  ? 45   VAL H O     1 
ATOM   5565  C  CB    . VAL H  4 45  ? -37.990 -45.515 33.513 1.00 49.16  ? 45   VAL H CB    1 
ATOM   5566  C  CG1   . VAL H  4 45  ? -36.714 -45.533 32.691 1.00 48.60  ? 45   VAL H CG1   1 
ATOM   5567  C  CG2   . VAL H  4 45  ? -38.461 -44.091 33.723 1.00 48.86  ? 45   VAL H CG2   1 
ATOM   5568  N  N     . HIS H  4 46  ? -41.355 -45.795 33.546 1.00 49.48  ? 46   HIS H N     1 
ATOM   5569  C  CA    . HIS H  4 46  ? -42.586 -45.885 34.312 1.00 49.93  ? 46   HIS H CA    1 
ATOM   5570  C  C     . HIS H  4 46  ? -43.794 -45.661 33.402 1.00 50.17  ? 46   HIS H C     1 
ATOM   5571  O  O     . HIS H  4 46  ? -44.379 -44.568 33.388 1.00 49.98  ? 46   HIS H O     1 
ATOM   5572  C  CB    . HIS H  4 46  ? -42.576 -44.873 35.455 1.00 50.07  ? 46   HIS H CB    1 
ATOM   5573  C  CG    . HIS H  4 46  ? -41.614 -45.215 36.546 1.00 51.24  ? 46   HIS H CG    1 
ATOM   5574  N  ND1   . HIS H  4 46  ? -41.697 -46.386 37.267 1.00 51.70  ? 46   HIS H ND1   1 
ATOM   5575  C  CD2   . HIS H  4 46  ? -40.540 -44.549 37.032 1.00 52.34  ? 46   HIS H CD2   1 
ATOM   5576  C  CE1   . HIS H  4 46  ? -40.715 -46.428 38.150 1.00 52.31  ? 46   HIS H CE1   1 
ATOM   5577  N  NE2   . HIS H  4 46  ? -40.000 -45.324 38.030 1.00 52.59  ? 46   HIS H NE2   1 
ATOM   5578  N  N     . PRO H  4 47  ? -44.186 -46.706 32.649 1.00 50.46  ? 47   PRO H N     1 
ATOM   5579  C  CA    . PRO H  4 47  ? -45.180 -46.566 31.577 1.00 50.79  ? 47   PRO H CA    1 
ATOM   5580  C  C     . PRO H  4 47  ? -46.571 -46.167 32.059 1.00 50.91  ? 47   PRO H C     1 
ATOM   5581  O  O     . PRO H  4 47  ? -47.375 -45.687 31.265 1.00 50.93  ? 47   PRO H O     1 
ATOM   5582  C  CB    . PRO H  4 47  ? -45.205 -47.958 30.929 1.00 50.80  ? 47   PRO H CB    1 
ATOM   5583  C  CG    . PRO H  4 47  ? -43.941 -48.627 31.381 1.00 50.46  ? 47   PRO H CG    1 
ATOM   5584  C  CD    . PRO H  4 47  ? -43.712 -48.095 32.760 1.00 50.47  ? 47   PRO H CD    1 
ATOM   5585  N  N     . ASP H  4 48  ? -46.836 -46.326 33.350 1.00 51.00  ? 48   ASP H N     1 
ATOM   5586  C  CA    . ASP H  4 48  ? -48.150 -46.008 33.890 1.00 51.41  ? 48   ASP H CA    1 
ATOM   5587  C  C     . ASP H  4 48  ? -48.177 -44.767 34.793 1.00 51.22  ? 48   ASP H C     1 
ATOM   5588  O  O     . ASP H  4 48  ? -49.183 -44.471 35.456 1.00 51.52  ? 48   ASP H O     1 
ATOM   5589  C  CB    . ASP H  4 48  ? -48.697 -47.229 34.619 1.00 51.85  ? 48   ASP H CB    1 
ATOM   5590  C  CG    . ASP H  4 48  ? -48.837 -48.425 33.702 1.00 53.70  ? 48   ASP H CG    1 
ATOM   5591  O  OD1   . ASP H  4 48  ? -49.736 -48.395 32.831 1.00 56.42  ? 48   ASP H OD1   1 
ATOM   5592  O  OD2   . ASP H  4 48  ? -48.044 -49.387 33.835 1.00 55.69  ? 48   ASP H OD2   1 
ATOM   5593  N  N     . THR H  4 49  ? -47.075 -44.027 34.804 1.00 50.59  ? 49   THR H N     1 
ATOM   5594  C  CA    . THR H  4 49  ? -46.951 -42.864 35.668 1.00 49.24  ? 49   THR H CA    1 
ATOM   5595  C  C     . THR H  4 49  ? -47.000 -41.611 34.804 1.00 48.28  ? 49   THR H C     1 
ATOM   5596  O  O     . THR H  4 49  ? -46.440 -41.578 33.714 1.00 47.95  ? 49   THR H O     1 
ATOM   5597  C  CB    . THR H  4 49  ? -45.637 -42.928 36.475 1.00 49.53  ? 49   THR H CB    1 
ATOM   5598  O  OG1   . THR H  4 49  ? -45.410 -44.277 36.910 1.00 49.47  ? 49   THR H OG1   1 
ATOM   5599  C  CG2   . THR H  4 49  ? -45.689 -42.022 37.688 1.00 49.53  ? 49   THR H CG2   1 
ATOM   5600  N  N     . GLY H  4 50  ? -47.712 -40.602 35.284 1.00 47.48  ? 50   GLY H N     1 
ATOM   5601  C  CA    . GLY H  4 50  ? -47.793 -39.313 34.619 1.00 46.28  ? 50   GLY H CA    1 
ATOM   5602  C  C     . GLY H  4 50  ? -46.856 -38.333 35.295 1.00 45.68  ? 50   GLY H C     1 
ATOM   5603  O  O     . GLY H  4 50  ? -46.084 -38.701 36.173 1.00 45.79  ? 50   GLY H O     1 
ATOM   5604  N  N     . ILE H  4 51  ? -46.942 -37.073 34.897 1.00 44.79  ? 51   ILE H N     1 
ATOM   5605  C  CA    . ILE H  4 51  ? -46.044 -36.057 35.393 1.00 43.69  ? 51   ILE H CA    1 
ATOM   5606  C  C     . ILE H  4 51  ? -46.739 -34.711 35.248 1.00 42.94  ? 51   ILE H C     1 
ATOM   5607  O  O     . ILE H  4 51  ? -47.238 -34.394 34.173 1.00 42.84  ? 51   ILE H O     1 
ATOM   5608  C  CB    . ILE H  4 51  ? -44.687 -36.103 34.620 1.00 44.04  ? 51   ILE H CB    1 
ATOM   5609  C  CG1   . ILE H  4 51  ? -43.693 -35.066 35.176 1.00 44.04  ? 51   ILE H CG1   1 
ATOM   5610  C  CG2   . ILE H  4 51  ? -44.898 -35.964 33.088 1.00 43.59  ? 51   ILE H CG2   1 
ATOM   5611  C  CD1   . ILE H  4 51  ? -42.253 -35.296 34.729 1.00 43.54  ? 51   ILE H CD1   1 
ATOM   5612  N  N     . SER H  4 52  ? -46.788 -33.935 36.326 1.00 41.90  ? 52   SER H N     1 
ATOM   5613  C  CA    . SER H  4 52  ? -47.442 -32.631 36.288 1.00 41.42  ? 52   SER H CA    1 
ATOM   5614  C  C     . SER H  4 52  ? -46.622 -31.576 35.510 1.00 41.19  ? 52   SER H C     1 
ATOM   5615  O  O     . SER H  4 52  ? -45.424 -31.752 35.284 1.00 41.06  ? 52   SER H O     1 
ATOM   5616  C  CB    . SER H  4 52  ? -47.761 -32.150 37.707 1.00 41.62  ? 52   SER H CB    1 
ATOM   5617  O  OG    . SER H  4 52  ? -46.613 -31.629 38.372 1.00 41.56  ? 52   SER H OG    1 
ATOM   5618  N  N     . SER H  4 53  ? -47.279 -30.489 35.106 1.00 40.70  ? 53   SER H N     1 
ATOM   5619  C  CA    . SER H  4 53  ? -46.630 -29.395 34.386 1.00 40.54  ? 53   SER H CA    1 
ATOM   5620  C  C     . SER H  4 53  ? -45.458 -28.796 35.135 1.00 40.34  ? 53   SER H C     1 
ATOM   5621  O  O     . SER H  4 53  ? -44.345 -28.730 34.600 1.00 40.70  ? 53   SER H O     1 
ATOM   5622  C  CB    . SER H  4 53  ? -47.627 -28.294 34.061 1.00 40.26  ? 53   SER H CB    1 
ATOM   5623  O  OG    . SER H  4 53  ? -48.405 -28.702 32.959 1.00 40.96  ? 53   SER H OG    1 
ATOM   5624  N  N     . LYS H  4 54  ? -45.716 -28.352 36.364 1.00 39.71  ? 54   LYS H N     1 
ATOM   5625  C  CA    . LYS H  4 54  ? -44.664 -27.842 37.231 1.00 38.92  ? 54   LYS H CA    1 
ATOM   5626  C  C     . LYS H  4 54  ? -43.507 -28.848 37.336 1.00 38.00  ? 54   LYS H C     1 
ATOM   5627  O  O     . LYS H  4 54  ? -42.350 -28.465 37.212 1.00 38.58  ? 54   LYS H O     1 
ATOM   5628  C  CB    . LYS H  4 54  ? -45.223 -27.485 38.607 1.00 39.18  ? 54   LYS H CB    1 
ATOM   5629  C  CG    . LYS H  4 54  ? -46.309 -26.391 38.622 1.00 39.10  ? 54   LYS H CG    1 
ATOM   5630  C  CD    . LYS H  4 54  ? -47.080 -26.417 39.975 1.00 39.87  ? 54   LYS H CD    1 
ATOM   5631  C  CE    . LYS H  4 54  ? -48.135 -25.302 40.111 1.00 40.86  ? 54   LYS H CE    1 
ATOM   5632  N  NZ    . LYS H  4 54  ? -47.512 -23.939 40.054 1.00 43.22  ? 54   LYS H NZ    1 
ATOM   5633  N  N     . ALA H  4 55  ? -43.804 -30.131 37.511 1.00 36.56  ? 55   ALA H N     1 
ATOM   5634  C  CA    . ALA H  4 55  ? -42.751 -31.140 37.503 1.00 35.51  ? 55   ALA H CA    1 
ATOM   5635  C  C     . ALA H  4 55  ? -42.013 -31.218 36.162 1.00 35.08  ? 55   ALA H C     1 
ATOM   5636  O  O     . ALA H  4 55  ? -40.805 -31.414 36.111 1.00 34.97  ? 55   ALA H O     1 
ATOM   5637  C  CB    . ALA H  4 55  ? -43.307 -32.487 37.882 1.00 35.36  ? 55   ALA H CB    1 
ATOM   5638  N  N     . MET H  4 56  ? -42.744 -31.064 35.073 1.00 34.67  ? 56   MET H N     1 
ATOM   5639  C  CA    . MET H  4 56  ? -42.136 -31.118 33.761 1.00 34.37  ? 56   MET H CA    1 
ATOM   5640  C  C     . MET H  4 56  ? -41.211 -29.934 33.586 1.00 33.83  ? 56   MET H C     1 
ATOM   5641  O  O     . MET H  4 56  ? -40.137 -30.046 32.990 1.00 33.88  ? 56   MET H O     1 
ATOM   5642  C  CB    . MET H  4 56  ? -43.205 -31.104 32.675 1.00 34.57  ? 56   MET H CB    1 
ATOM   5643  C  CG    . MET H  4 56  ? -42.639 -31.163 31.284 1.00 35.84  ? 56   MET H CG    1 
ATOM   5644  S  SD    . MET H  4 56  ? -41.554 -32.578 31.101 1.00 40.95  ? 56   MET H SD    1 
ATOM   5645  C  CE    . MET H  4 56  ? -42.740 -33.857 30.676 1.00 39.81  ? 56   MET H CE    1 
ATOM   5646  N  N     . SER H  4 57  ? -41.639 -28.796 34.113 1.00 33.05  ? 57   SER H N     1 
ATOM   5647  C  CA    . SER H  4 57  ? -40.836 -27.596 34.089 1.00 32.53  ? 57   SER H CA    1 
ATOM   5648  C  C     . SER H  4 57  ? -39.505 -27.805 34.842 1.00 32.53  ? 57   SER H C     1 
ATOM   5649  O  O     . SER H  4 57  ? -38.430 -27.451 34.326 1.00 32.78  ? 57   SER H O     1 
ATOM   5650  C  CB    . SER H  4 57  ? -41.632 -26.453 34.674 1.00 32.35  ? 57   SER H CB    1 
ATOM   5651  O  OG    . SER H  4 57  ? -40.973 -25.239 34.451 1.00 32.95  ? 57   SER H OG    1 
ATOM   5652  N  N     . ILE H  4 58  ? -39.570 -28.412 36.036 1.00 31.89  ? 58   ILE H N     1 
ATOM   5653  C  CA    . ILE H  4 58  ? -38.360 -28.752 36.790 1.00 30.78  ? 58   ILE H CA    1 
ATOM   5654  C  C     . ILE H  4 58  ? -37.424 -29.543 35.909 1.00 30.42  ? 58   ILE H C     1 
ATOM   5655  O  O     . ILE H  4 58  ? -36.255 -29.242 35.859 1.00 30.43  ? 58   ILE H O     1 
ATOM   5656  C  CB    . ILE H  4 58  ? -38.631 -29.602 38.071 1.00 30.99  ? 58   ILE H CB    1 
ATOM   5657  C  CG1   . ILE H  4 58  ? -39.812 -29.082 38.929 1.00 30.48  ? 58   ILE H CG1   1 
ATOM   5658  C  CG2   . ILE H  4 58  ? -37.340 -29.845 38.863 1.00 29.74  ? 58   ILE H CG2   1 
ATOM   5659  C  CD1   . ILE H  4 58  ? -39.606 -27.835 39.694 1.00 28.46  ? 58   ILE H CD1   1 
ATOM   5660  N  N     . MET H  4 59  ? -37.937 -30.554 35.213 1.00 30.59  ? 59   MET H N     1 
ATOM   5661  C  CA    . MET H  4 59  ? -37.081 -31.428 34.399 1.00 31.09  ? 59   MET H CA    1 
ATOM   5662  C  C     . MET H  4 59  ? -36.477 -30.684 33.228 1.00 31.61  ? 59   MET H C     1 
ATOM   5663  O  O     . MET H  4 59  ? -35.322 -30.911 32.861 1.00 31.60  ? 59   MET H O     1 
ATOM   5664  C  CB    . MET H  4 59  ? -37.838 -32.635 33.873 1.00 30.98  ? 59   MET H CB    1 
ATOM   5665  C  CG    . MET H  4 59  ? -38.287 -33.604 34.938 1.00 31.13  ? 59   MET H CG    1 
ATOM   5666  S  SD    . MET H  4 59  ? -36.917 -34.334 35.825 1.00 32.13  ? 59   MET H SD    1 
ATOM   5667  C  CE    . MET H  4 59  ? -36.121 -35.287 34.542 1.00 31.69  ? 59   MET H CE    1 
ATOM   5668  N  N     . ASN H  4 60  ? -37.259 -29.786 32.641 1.00 32.14  ? 60   ASN H N     1 
ATOM   5669  C  CA    . ASN H  4 60  ? -36.742 -28.970 31.567 1.00 32.48  ? 60   ASN H CA    1 
ATOM   5670  C  C     . ASN H  4 60  ? -35.536 -28.170 32.051 1.00 32.24  ? 60   ASN H C     1 
ATOM   5671  O  O     . ASN H  4 60  ? -34.487 -28.155 31.390 1.00 32.16  ? 60   ASN H O     1 
ATOM   5672  C  CB    . ASN H  4 60  ? -37.813 -28.034 30.998 1.00 32.79  ? 60   ASN H CB    1 
ATOM   5673  C  CG    . ASN H  4 60  ? -37.404 -27.462 29.656 1.00 34.13  ? 60   ASN H CG    1 
ATOM   5674  O  OD1   . ASN H  4 60  ? -36.971 -28.205 28.769 1.00 37.01  ? 60   ASN H OD1   1 
ATOM   5675  N  ND2   . ASN H  4 60  ? -37.491 -26.143 29.508 1.00 34.88  ? 60   ASN H ND2   1 
ATOM   5676  N  N     . SER H  4 61  ? -35.701 -27.520 33.209 1.00 31.69  ? 61   SER H N     1 
ATOM   5677  C  CA    . SER H  4 61  ? -34.625 -26.792 33.862 1.00 31.25  ? 61   SER H CA    1 
ATOM   5678  C  C     . SER H  4 61  ? -33.458 -27.724 34.161 1.00 31.05  ? 61   SER H C     1 
ATOM   5679  O  O     . SER H  4 61  ? -32.317 -27.393 33.878 1.00 31.38  ? 61   SER H O     1 
ATOM   5680  C  CB    . SER H  4 61  ? -35.118 -26.140 35.147 1.00 31.20  ? 61   SER H CB    1 
ATOM   5681  O  OG    . SER H  4 61  ? -36.099 -25.159 34.868 1.00 31.82  ? 61   SER H OG    1 
ATOM   5682  N  N     . PHE H  4 62  ? -33.739 -28.901 34.695 1.00 30.60  ? 62   PHE H N     1 
ATOM   5683  C  CA    . PHE H  4 62  ? -32.689 -29.861 34.953 1.00 30.66  ? 62   PHE H CA    1 
ATOM   5684  C  C     . PHE H  4 62  ? -31.803 -30.144 33.744 1.00 31.12  ? 62   PHE H C     1 
ATOM   5685  O  O     . PHE H  4 62  ? -30.580 -30.096 33.835 1.00 31.25  ? 62   PHE H O     1 
ATOM   5686  C  CB    . PHE H  4 62  ? -33.277 -31.161 35.443 1.00 30.19  ? 62   PHE H CB    1 
ATOM   5687  C  CG    . PHE H  4 62  ? -32.262 -32.236 35.625 1.00 30.26  ? 62   PHE H CG    1 
ATOM   5688  C  CD1   . PHE H  4 62  ? -31.300 -32.138 36.639 1.00 29.84  ? 62   PHE H CD1   1 
ATOM   5689  C  CD2   . PHE H  4 62  ? -32.266 -33.354 34.803 1.00 29.74  ? 62   PHE H CD2   1 
ATOM   5690  C  CE1   . PHE H  4 62  ? -30.351 -33.138 36.828 1.00 28.77  ? 62   PHE H CE1   1 
ATOM   5691  C  CE2   . PHE H  4 62  ? -31.321 -34.371 34.981 1.00 30.27  ? 62   PHE H CE2   1 
ATOM   5692  C  CZ    . PHE H  4 62  ? -30.360 -34.263 35.999 1.00 29.84  ? 62   PHE H CZ    1 
ATOM   5693  N  N     . VAL H  4 63  ? -32.428 -30.437 32.611 1.00 31.63  ? 63   VAL H N     1 
ATOM   5694  C  CA    . VAL H  4 63  ? -31.705 -30.827 31.410 1.00 31.53  ? 63   VAL H CA    1 
ATOM   5695  C  C     . VAL H  4 63  ? -30.899 -29.649 30.873 1.00 31.86  ? 63   VAL H C     1 
ATOM   5696  O  O     . VAL H  4 63  ? -29.734 -29.816 30.488 1.00 31.78  ? 63   VAL H O     1 
ATOM   5697  C  CB    . VAL H  4 63  ? -32.670 -31.408 30.353 1.00 31.75  ? 63   VAL H CB    1 
ATOM   5698  C  CG1   . VAL H  4 63  ? -31.948 -31.702 29.047 1.00 31.34  ? 63   VAL H CG1   1 
ATOM   5699  C  CG2   . VAL H  4 63  ? -33.334 -32.671 30.900 1.00 30.30  ? 63   VAL H CG2   1 
ATOM   5700  N  N     . ASN H  4 64  ? -31.502 -28.459 30.888 1.00 32.06  ? 64   ASN H N     1 
ATOM   5701  C  CA    . ASN H  4 64  ? -30.780 -27.232 30.524 1.00 32.46  ? 64   ASN H CA    1 
ATOM   5702  C  C     . ASN H  4 64  ? -29.573 -26.956 31.390 1.00 32.64  ? 64   ASN H C     1 
ATOM   5703  O  O     . ASN H  4 64  ? -28.536 -26.535 30.887 1.00 33.25  ? 64   ASN H O     1 
ATOM   5704  C  CB    . ASN H  4 64  ? -31.686 -26.023 30.571 1.00 32.35  ? 64   ASN H CB    1 
ATOM   5705  C  CG    . ASN H  4 64  ? -32.593 -25.949 29.384 1.00 34.17  ? 64   ASN H CG    1 
ATOM   5706  O  OD1   . ASN H  4 64  ? -32.239 -26.391 28.291 1.00 36.15  ? 64   ASN H OD1   1 
ATOM   5707  N  ND2   . ASN H  4 64  ? -33.779 -25.397 29.583 1.00 36.20  ? 64   ASN H ND2   1 
ATOM   5708  N  N     . ASP H  4 65  ? -29.716 -27.191 32.690 1.00 32.42  ? 65   ASP H N     1 
ATOM   5709  C  CA    . ASP H  4 65  ? -28.647 -26.969 33.626 1.00 32.18  ? 65   ASP H CA    1 
ATOM   5710  C  C     . ASP H  4 65  ? -27.491 -27.909 33.322 1.00 31.65  ? 65   ASP H C     1 
ATOM   5711  O  O     . ASP H  4 65  ? -26.388 -27.462 33.045 1.00 31.57  ? 65   ASP H O     1 
ATOM   5712  C  CB    . ASP H  4 65  ? -29.159 -27.138 35.059 1.00 32.76  ? 65   ASP H CB    1 
ATOM   5713  C  CG    . ASP H  4 65  ? -28.169 -26.630 36.103 1.00 34.96  ? 65   ASP H CG    1 
ATOM   5714  O  OD1   . ASP H  4 65  ? -27.434 -25.665 35.798 1.00 38.23  ? 65   ASP H OD1   1 
ATOM   5715  O  OD2   . ASP H  4 65  ? -28.108 -27.203 37.221 1.00 36.17  ? 65   ASP H OD2   1 
ATOM   5716  N  N     . VAL H  4 66  ? -27.749 -29.209 33.327 1.00 31.32  ? 66   VAL H N     1 
ATOM   5717  C  CA    . VAL H  4 66  ? -26.698 -30.193 33.069 1.00 30.87  ? 66   VAL H CA    1 
ATOM   5718  C  C     . VAL H  4 66  ? -26.025 -29.986 31.715 1.00 30.93  ? 66   VAL H C     1 
ATOM   5719  O  O     . VAL H  4 66  ? -24.809 -30.139 31.587 1.00 31.05  ? 66   VAL H O     1 
ATOM   5720  C  CB    . VAL H  4 66  ? -27.223 -31.618 33.207 1.00 30.69  ? 66   VAL H CB    1 
ATOM   5721  C  CG1   . VAL H  4 66  ? -26.113 -32.600 33.004 1.00 31.35  ? 66   VAL H CG1   1 
ATOM   5722  C  CG2   . VAL H  4 66  ? -27.793 -31.817 34.596 1.00 30.62  ? 66   VAL H CG2   1 
ATOM   5723  N  N     . PHE H  4 67  ? -26.814 -29.617 30.711 1.00 31.19  ? 67   PHE H N     1 
ATOM   5724  C  CA    . PHE H  4 67  ? -26.267 -29.284 29.407 1.00 30.98  ? 67   PHE H CA    1 
ATOM   5725  C  C     . PHE H  4 67  ? -25.233 -28.167 29.535 1.00 31.31  ? 67   PHE H C     1 
ATOM   5726  O  O     . PHE H  4 67  ? -24.111 -28.318 29.054 1.00 31.72  ? 67   PHE H O     1 
ATOM   5727  C  CB    . PHE H  4 67  ? -27.374 -28.883 28.427 1.00 30.73  ? 67   PHE H CB    1 
ATOM   5728  C  CG    . PHE H  4 67  ? -26.867 -28.541 27.053 1.00 30.40  ? 67   PHE H CG    1 
ATOM   5729  C  CD1   . PHE H  4 67  ? -26.732 -29.527 26.082 1.00 31.22  ? 67   PHE H CD1   1 
ATOM   5730  C  CD2   . PHE H  4 67  ? -26.514 -27.229 26.729 1.00 30.62  ? 67   PHE H CD2   1 
ATOM   5731  C  CE1   . PHE H  4 67  ? -26.245 -29.216 24.801 1.00 31.34  ? 67   PHE H CE1   1 
ATOM   5732  C  CE2   . PHE H  4 67  ? -26.028 -26.904 25.450 1.00 30.67  ? 67   PHE H CE2   1 
ATOM   5733  C  CZ    . PHE H  4 67  ? -25.895 -27.902 24.489 1.00 30.56  ? 67   PHE H CZ    1 
ATOM   5734  N  N     . GLU H  4 68  ? -25.609 -27.059 30.180 1.00 31.10  ? 68   GLU H N     1 
ATOM   5735  C  CA    . GLU H  4 68  ? -24.720 -25.902 30.326 1.00 31.93  ? 68   GLU H CA    1 
ATOM   5736  C  C     . GLU H  4 68  ? -23.453 -26.235 31.113 1.00 30.70  ? 68   GLU H C     1 
ATOM   5737  O  O     . GLU H  4 68  ? -22.351 -25.822 30.738 1.00 30.45  ? 68   GLU H O     1 
ATOM   5738  C  CB    . GLU H  4 68  ? -25.448 -24.690 30.924 1.00 31.35  ? 68   GLU H CB    1 
ATOM   5739  C  CG    . GLU H  4 68  ? -26.182 -23.842 29.869 1.00 34.41  ? 68   GLU H CG    1 
ATOM   5740  C  CD    . GLU H  4 68  ? -27.313 -22.917 30.417 1.00 36.20  ? 68   GLU H CD    1 
ATOM   5741  O  OE1   . GLU H  4 68  ? -27.453 -22.725 31.659 1.00 41.27  ? 68   GLU H OE1   1 
ATOM   5742  O  OE2   . GLU H  4 68  ? -28.069 -22.352 29.575 1.00 41.74  ? 68   GLU H OE2   1 
ATOM   5743  N  N     . ARG H  4 69  ? -23.602 -27.019 32.175 1.00 29.71  ? 69   ARG H N     1 
ATOM   5744  C  CA    . ARG H  4 69  ? -22.457 -27.412 32.961 1.00 28.86  ? 69   ARG H CA    1 
ATOM   5745  C  C     . ARG H  4 69  ? -21.517 -28.275 32.132 1.00 28.55  ? 69   ARG H C     1 
ATOM   5746  O  O     . ARG H  4 69  ? -20.308 -28.019 32.071 1.00 28.18  ? 69   ARG H O     1 
ATOM   5747  C  CB    . ARG H  4 69  ? -22.887 -28.133 34.227 1.00 28.90  ? 69   ARG H CB    1 
ATOM   5748  C  CG    . ARG H  4 69  ? -23.631 -27.264 35.217 1.00 30.22  ? 69   ARG H CG    1 
ATOM   5749  C  CD    . ARG H  4 69  ? -23.523 -27.893 36.585 1.00 33.74  ? 69   ARG H CD    1 
ATOM   5750  N  NE    . ARG H  4 69  ? -24.814 -28.113 37.233 1.00 34.91  ? 69   ARG H NE    1 
ATOM   5751  C  CZ    . ARG H  4 69  ? -24.981 -28.876 38.315 1.00 36.08  ? 69   ARG H CZ    1 
ATOM   5752  N  NH1   . ARG H  4 69  ? -23.945 -29.496 38.871 1.00 34.22  ? 69   ARG H NH1   1 
ATOM   5753  N  NH2   . ARG H  4 69  ? -26.192 -29.031 38.841 1.00 37.96  ? 69   ARG H NH2   1 
ATOM   5754  N  N     . ILE H  4 70  ? -22.066 -29.287 31.470 1.00 28.17  ? 70   ILE H N     1 
ATOM   5755  C  CA    . ILE H  4 70  ? -21.213 -30.190 30.724 1.00 27.71  ? 70   ILE H CA    1 
ATOM   5756  C  C     . ILE H  4 70  ? -20.517 -29.451 29.594 1.00 27.96  ? 70   ILE H C     1 
ATOM   5757  O  O     . ILE H  4 70  ? -19.293 -29.496 29.513 1.00 28.10  ? 70   ILE H O     1 
ATOM   5758  C  CB    . ILE H  4 70  ? -21.961 -31.410 30.243 1.00 27.57  ? 70   ILE H CB    1 
ATOM   5759  C  CG1   . ILE H  4 70  ? -22.224 -32.314 31.436 1.00 27.39  ? 70   ILE H CG1   1 
ATOM   5760  C  CG2   . ILE H  4 70  ? -21.150 -32.169 29.207 1.00 26.80  ? 70   ILE H CG2   1 
ATOM   5761  C  CD1   . ILE H  4 70  ? -23.175 -33.419 31.151 1.00 27.23  ? 70   ILE H CD1   1 
ATOM   5762  N  N     . ALA H  4 71  ? -21.283 -28.746 28.763 1.00 27.84  ? 71   ALA H N     1 
ATOM   5763  C  CA    . ALA H  4 71  ? -20.721 -28.026 27.625 1.00 28.12  ? 71   ALA H CA    1 
ATOM   5764  C  C     . ALA H  4 71  ? -19.728 -26.953 28.041 1.00 28.28  ? 71   ALA H C     1 
ATOM   5765  O  O     . ALA H  4 71  ? -18.666 -26.807 27.432 1.00 27.84  ? 71   ALA H O     1 
ATOM   5766  C  CB    . ALA H  4 71  ? -21.816 -27.405 26.809 1.00 28.64  ? 71   ALA H CB    1 
ATOM   5767  N  N     . GLY H  4 72  ? -20.086 -26.193 29.073 1.00 28.43  ? 72   GLY H N     1 
ATOM   5768  C  CA    . GLY H  4 72  ? -19.216 -25.134 29.576 1.00 28.36  ? 72   GLY H CA    1 
ATOM   5769  C  C     . GLY H  4 72  ? -17.882 -25.705 29.996 1.00 28.74  ? 72   GLY H C     1 
ATOM   5770  O  O     . GLY H  4 72  ? -16.840 -25.087 29.784 1.00 29.05  ? 72   GLY H O     1 
ATOM   5771  N  N     . GLU H  4 73  ? -17.909 -26.898 30.579 1.00 28.77  ? 73   GLU H N     1 
ATOM   5772  C  CA    . GLU H  4 73  ? -16.700 -27.528 31.055 1.00 29.23  ? 73   GLU H CA    1 
ATOM   5773  C  C     . GLU H  4 73  ? -15.852 -28.030 29.897 1.00 28.93  ? 73   GLU H C     1 
ATOM   5774  O  O     . GLU H  4 73  ? -14.628 -27.948 29.939 1.00 28.95  ? 73   GLU H O     1 
ATOM   5775  C  CB    . GLU H  4 73  ? -17.058 -28.685 31.969 1.00 29.81  ? 73   GLU H CB    1 
ATOM   5776  C  CG    . GLU H  4 73  ? -15.878 -29.310 32.653 1.00 33.12  ? 73   GLU H CG    1 
ATOM   5777  C  CD    . GLU H  4 73  ? -15.300 -28.397 33.727 1.00 38.92  ? 73   GLU H CD    1 
ATOM   5778  O  OE1   . GLU H  4 73  ? -14.211 -27.788 33.450 1.00 39.39  ? 73   GLU H OE1   1 
ATOM   5779  O  OE2   . GLU H  4 73  ? -15.950 -28.298 34.824 1.00 38.57  ? 73   GLU H OE2   1 
ATOM   5780  N  N     . ALA H  4 74  ? -16.508 -28.560 28.869 1.00 28.92  ? 74   ALA H N     1 
ATOM   5781  C  CA    . ALA H  4 74  ? -15.828 -29.074 27.685 1.00 28.84  ? 74   ALA H CA    1 
ATOM   5782  C  C     . ALA H  4 74  ? -15.195 -27.933 26.937 1.00 28.86  ? 74   ALA H C     1 
ATOM   5783  O  O     . ALA H  4 74  ? -14.124 -28.075 26.387 1.00 28.93  ? 74   ALA H O     1 
ATOM   5784  C  CB    . ALA H  4 74  ? -16.802 -29.781 26.798 1.00 29.31  ? 74   ALA H CB    1 
ATOM   5785  N  N     . SER H  4 75  ? -15.869 -26.793 26.928 1.00 29.12  ? 75   SER H N     1 
ATOM   5786  C  CA    . SER H  4 75  ? -15.326 -25.587 26.349 1.00 29.59  ? 75   SER H CA    1 
ATOM   5787  C  C     . SER H  4 75  ? -14.016 -25.223 27.028 1.00 29.89  ? 75   SER H C     1 
ATOM   5788  O  O     . SER H  4 75  ? -12.997 -25.025 26.381 1.00 30.29  ? 75   SER H O     1 
ATOM   5789  C  CB    . SER H  4 75  ? -16.328 -24.446 26.491 1.00 29.68  ? 75   SER H CB    1 
ATOM   5790  O  OG    . SER H  4 75  ? -15.746 -23.213 26.091 1.00 30.63  ? 75   SER H OG    1 
ATOM   5791  N  N     . ARG H  4 76  ? -14.043 -25.142 28.348 1.00 30.60  ? 76   ARG H N     1 
ATOM   5792  C  CA    . ARG H  4 76  ? -12.822 -24.933 29.106 1.00 30.69  ? 76   ARG H CA    1 
ATOM   5793  C  C     . ARG H  4 76  ? -11.719 -25.945 28.740 1.00 30.29  ? 76   ARG H C     1 
ATOM   5794  O  O     . ARG H  4 76  ? -10.609 -25.547 28.417 1.00 29.95  ? 76   ARG H O     1 
ATOM   5795  C  CB    . ARG H  4 76  ? -13.128 -24.879 30.612 1.00 30.62  ? 76   ARG H CB    1 
ATOM   5796  C  CG    . ARG H  4 76  ? -13.378 -23.457 31.151 1.00 30.86  ? 76   ARG H CG    1 
ATOM   5797  C  CD    . ARG H  4 76  ? -14.058 -23.436 32.546 1.00 31.59  ? 76   ARG H CD    1 
ATOM   5798  N  NE    . ARG H  4 76  ? -15.499 -23.126 32.452 1.00 34.55  ? 76   ARG H NE    1 
ATOM   5799  C  CZ    . ARG H  4 76  ? -16.490 -23.925 32.862 1.00 35.88  ? 76   ARG H CZ    1 
ATOM   5800  N  NH1   . ARG H  4 76  ? -16.232 -25.104 33.433 1.00 36.31  ? 76   ARG H NH1   1 
ATOM   5801  N  NH2   . ARG H  4 76  ? -17.753 -23.539 32.711 1.00 36.91  ? 76   ARG H NH2   1 
ATOM   5802  N  N     . LEU H  4 77  ? -12.014 -27.236 28.751 1.00 30.57  ? 77   LEU H N     1 
ATOM   5803  C  CA    . LEU H  4 77  ? -10.987 -28.216 28.366 1.00 31.94  ? 77   LEU H CA    1 
ATOM   5804  C  C     . LEU H  4 77  ? -10.318 -27.885 27.027 1.00 32.44  ? 77   LEU H C     1 
ATOM   5805  O  O     . LEU H  4 77  ? -9.084  -27.865 26.931 1.00 32.71  ? 77   LEU H O     1 
ATOM   5806  C  CB    . LEU H  4 77  ? -11.543 -29.638 28.298 1.00 32.10  ? 77   LEU H CB    1 
ATOM   5807  C  CG    . LEU H  4 77  ? -11.788 -30.393 29.601 1.00 33.28  ? 77   LEU H CG    1 
ATOM   5808  C  CD1   . LEU H  4 77  ? -12.867 -31.450 29.392 1.00 33.54  ? 77   LEU H CD1   1 
ATOM   5809  C  CD2   . LEU H  4 77  ? -10.496 -31.014 30.134 1.00 34.44  ? 77   LEU H CD2   1 
ATOM   5810  N  N     . ALA H  4 78  ? -11.137 -27.639 26.002 1.00 32.77  ? 78   ALA H N     1 
ATOM   5811  C  CA    . ALA H  4 78  ? -10.654 -27.282 24.676 1.00 32.90  ? 78   ALA H CA    1 
ATOM   5812  C  C     . ALA H  4 78  ? -9.720  -26.084 24.733 1.00 33.39  ? 78   ALA H C     1 
ATOM   5813  O  O     . ALA H  4 78  ? -8.616  -26.148 24.220 1.00 33.42  ? 78   ALA H O     1 
ATOM   5814  C  CB    . ALA H  4 78  ? -11.812 -27.005 23.752 1.00 32.79  ? 78   ALA H CB    1 
ATOM   5815  N  N     . HIS H  4 79  ? -10.143 -24.995 25.362 1.00 34.33  ? 79   HIS H N     1 
ATOM   5816  C  CA    . HIS H  4 79  ? -9.264  -23.840 25.451 1.00 36.19  ? 79   HIS H CA    1 
ATOM   5817  C  C     . HIS H  4 79  ? -7.947  -24.178 26.156 1.00 36.61  ? 79   HIS H C     1 
ATOM   5818  O  O     . HIS H  4 79  ? -6.875  -23.869 25.636 1.00 36.91  ? 79   HIS H O     1 
ATOM   5819  C  CB    . HIS H  4 79  ? -9.959  -22.623 26.058 1.00 36.47  ? 79   HIS H CB    1 
ATOM   5820  C  CG    . HIS H  4 79  ? -10.928 -21.951 25.124 1.00 41.66  ? 79   HIS H CG    1 
ATOM   5821  N  ND1   . HIS H  4 79  ? -12.303 -22.096 25.231 1.00 45.72  ? 79   HIS H ND1   1 
ATOM   5822  C  CD2   . HIS H  4 79  ? -10.724 -21.124 24.064 1.00 44.11  ? 79   HIS H CD2   1 
ATOM   5823  C  CE1   . HIS H  4 79  ? -12.899 -21.391 24.282 1.00 45.82  ? 79   HIS H CE1   1 
ATOM   5824  N  NE2   . HIS H  4 79  ? -11.964 -20.789 23.563 1.00 45.35  ? 79   HIS H NE2   1 
ATOM   5825  N  N     . TYR H  4 80  ? -8.012  -24.854 27.300 1.00 37.10  ? 80   TYR H N     1 
ATOM   5826  C  CA    . TYR H  4 80  ? -6.787  -25.219 27.996 1.00 37.87  ? 80   TYR H CA    1 
ATOM   5827  C  C     . TYR H  4 80  ? -5.822  -25.897 27.054 1.00 38.04  ? 80   TYR H C     1 
ATOM   5828  O  O     . TYR H  4 80  ? -4.660  -25.533 27.005 1.00 38.45  ? 80   TYR H O     1 
ATOM   5829  C  CB    . TYR H  4 80  ? -7.049  -26.122 29.207 1.00 38.10  ? 80   TYR H CB    1 
ATOM   5830  C  CG    . TYR H  4 80  ? -7.926  -25.481 30.256 1.00 39.59  ? 80   TYR H CG    1 
ATOM   5831  C  CD1   . TYR H  4 80  ? -7.975  -24.074 30.401 1.00 39.48  ? 80   TYR H CD1   1 
ATOM   5832  C  CD2   . TYR H  4 80  ? -8.705  -26.267 31.118 1.00 38.68  ? 80   TYR H CD2   1 
ATOM   5833  C  CE1   . TYR H  4 80  ? -8.786  -23.488 31.352 1.00 38.31  ? 80   TYR H CE1   1 
ATOM   5834  C  CE2   . TYR H  4 80  ? -9.513  -25.676 32.078 1.00 37.44  ? 80   TYR H CE2   1 
ATOM   5835  C  CZ    . TYR H  4 80  ? -9.546  -24.295 32.187 1.00 38.05  ? 80   TYR H CZ    1 
ATOM   5836  O  OH    . TYR H  4 80  ? -10.337 -23.708 33.144 1.00 39.62  ? 80   TYR H OH    1 
ATOM   5837  N  N     . ASN H  4 81  ? -6.310  -26.859 26.282 1.00 38.20  ? 81   ASN H N     1 
ATOM   5838  C  CA    . ASN H  4 81  ? -5.446  -27.595 25.385 1.00 38.48  ? 81   ASN H CA    1 
ATOM   5839  C  C     . ASN H  4 81  ? -5.275  -26.996 24.004 1.00 39.13  ? 81   ASN H C     1 
ATOM   5840  O  O     . ASN H  4 81  ? -4.833  -27.677 23.085 1.00 39.46  ? 81   ASN H O     1 
ATOM   5841  C  CB    . ASN H  4 81  ? -5.919  -29.025 25.310 1.00 38.29  ? 81   ASN H CB    1 
ATOM   5842  C  CG    . ASN H  4 81  ? -5.931  -29.668 26.661 1.00 38.24  ? 81   ASN H CG    1 
ATOM   5843  O  OD1   . ASN H  4 81  ? -4.867  -29.991 27.217 1.00 37.28  ? 81   ASN H OD1   1 
ATOM   5844  N  ND2   . ASN H  4 81  ? -7.128  -29.817 27.235 1.00 36.24  ? 81   ASN H ND2   1 
ATOM   5845  N  N     . LYS H  4 82  ? -5.602  -25.714 23.865 1.00 40.03  ? 82   LYS H N     1 
ATOM   5846  C  CA    . LYS H  4 82  ? -5.420  -24.994 22.607 1.00 40.77  ? 82   LYS H CA    1 
ATOM   5847  C  C     . LYS H  4 82  ? -6.077  -25.737 21.437 1.00 40.35  ? 82   LYS H C     1 
ATOM   5848  O  O     . LYS H  4 82  ? -5.430  -25.972 20.421 1.00 40.66  ? 82   LYS H O     1 
ATOM   5849  C  CB    . LYS H  4 82  ? -3.917  -24.795 22.327 1.00 40.99  ? 82   LYS H CB    1 
ATOM   5850  C  CG    . LYS H  4 82  ? -3.181  -23.815 23.248 1.00 41.29  ? 82   LYS H CG    1 
ATOM   5851  C  CD    . LYS H  4 82  ? -1.674  -24.157 23.280 1.00 42.10  ? 82   LYS H CD    1 
ATOM   5852  C  CE    . LYS H  4 82  ? -0.807  -23.073 23.957 1.00 43.57  ? 82   LYS H CE    1 
ATOM   5853  N  NZ    . LYS H  4 82  ? -1.141  -22.862 25.408 1.00 45.48  ? 82   LYS H NZ    1 
ATOM   5854  N  N     . ARG H  4 83  ? -7.338  -26.133 21.597 1.00 39.90  ? 83   ARG H N     1 
ATOM   5855  C  CA    . ARG H  4 83  ? -8.096  -26.783 20.525 1.00 39.47  ? 83   ARG H CA    1 
ATOM   5856  C  C     . ARG H  4 83  ? -9.330  -25.978 20.172 1.00 39.30  ? 83   ARG H C     1 
ATOM   5857  O  O     . ARG H  4 83  ? -9.898  -25.277 21.018 1.00 39.23  ? 83   ARG H O     1 
ATOM   5858  C  CB    . ARG H  4 83  ? -8.551  -28.190 20.907 1.00 39.29  ? 83   ARG H CB    1 
ATOM   5859  C  CG    . ARG H  4 83  ? -7.487  -29.134 21.368 1.00 40.75  ? 83   ARG H CG    1 
ATOM   5860  C  CD    . ARG H  4 83  ? -6.363  -29.262 20.390 1.00 44.26  ? 83   ARG H CD    1 
ATOM   5861  N  NE    . ARG H  4 83  ? -5.543  -30.428 20.710 1.00 48.77  ? 83   ARG H NE    1 
ATOM   5862  C  CZ    . ARG H  4 83  ? -4.231  -30.519 20.487 1.00 51.42  ? 83   ARG H CZ    1 
ATOM   5863  N  NH1   . ARG H  4 83  ? -3.557  -29.508 19.942 1.00 52.85  ? 83   ARG H NH1   1 
ATOM   5864  N  NH2   . ARG H  4 83  ? -3.583  -31.628 20.817 1.00 52.52  ? 83   ARG H NH2   1 
ATOM   5865  N  N     . SER H  4 84  ? -9.767  -26.110 18.925 1.00 39.20  ? 84   SER H N     1 
ATOM   5866  C  CA    . SER H  4 84  ? -10.951 -25.400 18.442 1.00 39.11  ? 84   SER H CA    1 
ATOM   5867  C  C     . SER H  4 84  ? -12.194 -26.290 18.332 1.00 38.79  ? 84   SER H C     1 
ATOM   5868  O  O     . SER H  4 84  ? -13.281 -25.812 18.012 1.00 38.88  ? 84   SER H O     1 
ATOM   5869  C  CB    . SER H  4 84  ? -10.641 -24.677 17.119 1.00 39.39  ? 84   SER H CB    1 
ATOM   5870  O  OG    . SER H  4 84  ? -9.456  -25.178 16.491 1.00 40.39  ? 84   SER H OG    1 
ATOM   5871  N  N     . THR H  4 85  ? -12.038 -27.573 18.641 1.00 38.51  ? 85   THR H N     1 
ATOM   5872  C  CA    . THR H  4 85  ? -13.117 -28.546 18.489 1.00 38.35  ? 85   THR H CA    1 
ATOM   5873  C  C     . THR H  4 85  ? -13.553 -29.219 19.799 1.00 38.27  ? 85   THR H C     1 
ATOM   5874  O  O     . THR H  4 85  ? -12.753 -29.863 20.500 1.00 38.17  ? 85   THR H O     1 
ATOM   5875  C  CB    . THR H  4 85  ? -12.716 -29.652 17.484 1.00 38.35  ? 85   THR H CB    1 
ATOM   5876  O  OG1   . THR H  4 85  ? -11.998 -29.055 16.404 1.00 38.88  ? 85   THR H OG1   1 
ATOM   5877  C  CG2   . THR H  4 85  ? -13.947 -30.389 16.947 1.00 37.39  ? 85   THR H CG2   1 
ATOM   5878  N  N     . ILE H  4 86  ? -14.838 -29.091 20.106 1.00 38.05  ? 86   ILE H N     1 
ATOM   5879  C  CA    . ILE H  4 86  ? -15.424 -29.856 21.177 1.00 37.81  ? 86   ILE H CA    1 
ATOM   5880  C  C     . ILE H  4 86  ? -15.807 -31.204 20.617 1.00 37.72  ? 86   ILE H C     1 
ATOM   5881  O  O     . ILE H  4 86  ? -16.807 -31.335 19.921 1.00 37.64  ? 86   ILE H O     1 
ATOM   5882  C  CB    . ILE H  4 86  ? -16.619 -29.132 21.789 1.00 37.69  ? 86   ILE H CB    1 
ATOM   5883  C  CG1   . ILE H  4 86  ? -16.103 -27.936 22.586 1.00 38.16  ? 86   ILE H CG1   1 
ATOM   5884  C  CG2   . ILE H  4 86  ? -17.424 -30.082 22.687 1.00 37.64  ? 86   ILE H CG2   1 
ATOM   5885  C  CD1   . ILE H  4 86  ? -17.173 -27.108 23.266 1.00 38.95  ? 86   ILE H CD1   1 
ATOM   5886  N  N     . THR H  4 87  ? -14.980 -32.200 20.903 1.00 37.96  ? 87   THR H N     1 
ATOM   5887  C  CA    . THR H  4 87  ? -15.227 -33.557 20.423 1.00 38.52  ? 87   THR H CA    1 
ATOM   5888  C  C     . THR H  4 87  ? -15.932 -34.355 21.524 1.00 39.08  ? 87   THR H C     1 
ATOM   5889  O  O     . THR H  4 87  ? -16.312 -33.792 22.555 1.00 39.54  ? 87   THR H O     1 
ATOM   5890  C  CB    . THR H  4 87  ? -13.927 -34.259 20.015 1.00 38.22  ? 87   THR H CB    1 
ATOM   5891  O  OG1   . THR H  4 87  ? -13.226 -34.663 21.194 1.00 38.71  ? 87   THR H OG1   1 
ATOM   5892  C  CG2   . THR H  4 87  ? -13.052 -33.338 19.192 1.00 37.23  ? 87   THR H CG2   1 
ATOM   5893  N  N     . SER H  4 88  ? -16.133 -35.652 21.317 1.00 39.16  ? 88   SER H N     1 
ATOM   5894  C  CA    . SER H  4 88  ? -16.811 -36.438 22.339 1.00 39.63  ? 88   SER H CA    1 
ATOM   5895  C  C     . SER H  4 88  ? -15.827 -36.770 23.479 1.00 39.46  ? 88   SER H C     1 
ATOM   5896  O  O     . SER H  4 88  ? -16.217 -37.113 24.600 1.00 39.46  ? 88   SER H O     1 
ATOM   5897  C  CB    . SER H  4 88  ? -17.442 -37.695 21.737 1.00 39.73  ? 88   SER H CB    1 
ATOM   5898  O  OG    . SER H  4 88  ? -16.440 -38.574 21.267 1.00 40.92  ? 88   SER H OG    1 
ATOM   5899  N  N     . ARG H  4 89  ? -14.540 -36.638 23.194 1.00 38.99  ? 89   ARG H N     1 
ATOM   5900  C  CA    . ARG H  4 89  ? -13.551 -36.818 24.229 1.00 38.34  ? 89   ARG H CA    1 
ATOM   5901  C  C     . ARG H  4 89  ? -13.666 -35.729 25.300 1.00 37.36  ? 89   ARG H C     1 
ATOM   5902  O  O     . ARG H  4 89  ? -13.508 -36.006 26.492 1.00 37.07  ? 89   ARG H O     1 
ATOM   5903  C  CB    . ARG H  4 89  ? -12.166 -36.825 23.614 1.00 38.59  ? 89   ARG H CB    1 
ATOM   5904  C  CG    . ARG H  4 89  ? -11.181 -37.475 24.511 1.00 40.44  ? 89   ARG H CG    1 
ATOM   5905  C  CD    . ARG H  4 89  ? -9.982  -37.970 23.769 1.00 42.39  ? 89   ARG H CD    1 
ATOM   5906  N  NE    . ARG H  4 89  ? -8.912  -38.236 24.727 1.00 43.48  ? 89   ARG H NE    1 
ATOM   5907  C  CZ    . ARG H  4 89  ? -7.984  -37.351 25.054 1.00 42.74  ? 89   ARG H CZ    1 
ATOM   5908  N  NH1   . ARG H  4 89  ? -7.993  -36.151 24.482 1.00 41.70  ? 89   ARG H NH1   1 
ATOM   5909  N  NH2   . ARG H  4 89  ? -7.042  -37.679 25.931 1.00 42.72  ? 89   ARG H NH2   1 
ATOM   5910  N  N     . GLU H  4 90  ? -13.939 -34.500 24.856 1.00 36.16  ? 90   GLU H N     1 
ATOM   5911  C  CA    . GLU H  4 90  ? -14.164 -33.364 25.744 1.00 35.11  ? 90   GLU H CA    1 
ATOM   5912  C  C     . GLU H  4 90  ? -15.441 -33.518 26.551 1.00 34.18  ? 90   GLU H C     1 
ATOM   5913  O  O     . GLU H  4 90  ? -15.499 -33.105 27.707 1.00 34.41  ? 90   GLU H O     1 
ATOM   5914  C  CB    . GLU H  4 90  ? -14.249 -32.056 24.960 1.00 35.31  ? 90   GLU H CB    1 
ATOM   5915  C  CG    . GLU H  4 90  ? -12.935 -31.437 24.625 1.00 36.90  ? 90   GLU H CG    1 
ATOM   5916  C  CD    . GLU H  4 90  ? -12.151 -32.264 23.640 1.00 42.36  ? 90   GLU H CD    1 
ATOM   5917  O  OE1   . GLU H  4 90  ? -12.759 -32.770 22.658 1.00 44.07  ? 90   GLU H OE1   1 
ATOM   5918  O  OE2   . GLU H  4 90  ? -10.921 -32.410 23.847 1.00 44.46  ? 90   GLU H OE2   1 
ATOM   5919  N  N     . ILE H  4 91  ? -16.472 -34.083 25.936 1.00 32.79  ? 91   ILE H N     1 
ATOM   5920  C  CA    . ILE H  4 91  ? -17.705 -34.359 26.645 1.00 31.35  ? 91   ILE H CA    1 
ATOM   5921  C  C     . ILE H  4 91  ? -17.436 -35.413 27.707 1.00 31.17  ? 91   ILE H C     1 
ATOM   5922  O  O     . ILE H  4 91  ? -17.961 -35.310 28.819 1.00 31.21  ? 91   ILE H O     1 
ATOM   5923  C  CB    . ILE H  4 91  ? -18.845 -34.818 25.694 1.00 31.08  ? 91   ILE H CB    1 
ATOM   5924  C  CG1   . ILE H  4 91  ? -19.174 -33.731 24.657 1.00 30.82  ? 91   ILE H CG1   1 
ATOM   5925  C  CG2   . ILE H  4 91  ? -20.088 -35.230 26.476 1.00 29.16  ? 91   ILE H CG2   1 
ATOM   5926  C  CD1   . ILE H  4 91  ? -19.485 -32.336 25.222 1.00 29.89  ? 91   ILE H CD1   1 
ATOM   5927  N  N     . GLN H  4 92  ? -16.613 -36.409 27.376 1.00 30.37  ? 92   GLN H N     1 
ATOM   5928  C  CA    . GLN H  4 92  ? -16.294 -37.473 28.326 1.00 30.25  ? 92   GLN H CA    1 
ATOM   5929  C  C     . GLN H  4 92  ? -15.530 -36.969 29.565 1.00 29.98  ? 92   GLN H C     1 
ATOM   5930  O  O     . GLN H  4 92  ? -16.023 -37.094 30.692 1.00 30.33  ? 92   GLN H O     1 
ATOM   5931  C  CB    . GLN H  4 92  ? -15.536 -38.609 27.653 1.00 30.23  ? 92   GLN H CB    1 
ATOM   5932  C  CG    . GLN H  4 92  ? -15.465 -39.838 28.516 1.00 31.72  ? 92   GLN H CG    1 
ATOM   5933  C  CD    . GLN H  4 92  ? -14.948 -41.062 27.781 1.00 32.79  ? 92   GLN H CD    1 
ATOM   5934  O  OE1   . GLN H  4 92  ? -13.744 -41.205 27.563 1.00 33.24  ? 92   GLN H OE1   1 
ATOM   5935  N  NE2   . GLN H  4 92  ? -15.856 -41.961 27.417 1.00 32.86  ? 92   GLN H NE2   1 
ATOM   5936  N  N     . THR H  4 93  ? -14.352 -36.387 29.364 1.00 29.06  ? 93   THR H N     1 
ATOM   5937  C  CA    . THR H  4 93  ? -13.623 -35.780 30.452 1.00 28.89  ? 93   THR H CA    1 
ATOM   5938  C  C     . THR H  4 93  ? -14.529 -34.856 31.284 1.00 29.22  ? 93   THR H C     1 
ATOM   5939  O  O     . THR H  4 93  ? -14.513 -34.938 32.514 1.00 29.88  ? 93   THR H O     1 
ATOM   5940  C  CB    . THR H  4 93  ? -12.442 -34.990 29.933 1.00 28.72  ? 93   THR H CB    1 
ATOM   5941  O  OG1   . THR H  4 93  ? -11.636 -35.840 29.129 1.00 30.65  ? 93   THR H OG1   1 
ATOM   5942  C  CG2   . THR H  4 93  ? -11.592 -34.483 31.062 1.00 28.64  ? 93   THR H CG2   1 
ATOM   5943  N  N     . ALA H  4 94  ? -15.318 -33.995 30.633 1.00 28.85  ? 94   ALA H N     1 
ATOM   5944  C  CA    . ALA H  4 94  ? -16.245 -33.124 31.350 1.00 28.90  ? 94   ALA H CA    1 
ATOM   5945  C  C     . ALA H  4 94  ? -17.166 -33.904 32.278 1.00 29.31  ? 94   ALA H C     1 
ATOM   5946  O  O     . ALA H  4 94  ? -17.389 -33.507 33.425 1.00 29.59  ? 94   ALA H O     1 
ATOM   5947  C  CB    . ALA H  4 94  ? -17.057 -32.296 30.401 1.00 28.87  ? 94   ALA H CB    1 
ATOM   5948  N  N     . VAL H  4 95  ? -17.682 -35.026 31.790 1.00 29.49  ? 95   VAL H N     1 
ATOM   5949  C  CA    . VAL H  4 95  ? -18.598 -35.838 32.572 1.00 29.65  ? 95   VAL H CA    1 
ATOM   5950  C  C     . VAL H  4 95  ? -17.892 -36.373 33.813 1.00 30.10  ? 95   VAL H C     1 
ATOM   5951  O  O     . VAL H  4 95  ? -18.457 -36.369 34.914 1.00 29.86  ? 95   VAL H O     1 
ATOM   5952  C  CB    . VAL H  4 95  ? -19.180 -36.981 31.730 1.00 29.41  ? 95   VAL H CB    1 
ATOM   5953  C  CG1   . VAL H  4 95  ? -19.932 -37.934 32.588 1.00 29.18  ? 95   VAL H CG1   1 
ATOM   5954  C  CG2   . VAL H  4 95  ? -20.129 -36.422 30.694 1.00 30.30  ? 95   VAL H CG2   1 
ATOM   5955  N  N     . ARG H  4 96  ? -16.650 -36.811 33.629 1.00 30.39  ? 96   ARG H N     1 
ATOM   5956  C  CA    . ARG H  4 96  ? -15.871 -37.365 34.722 1.00 30.72  ? 96   ARG H CA    1 
ATOM   5957  C  C     . ARG H  4 96  ? -15.677 -36.318 35.801 1.00 30.66  ? 96   ARG H C     1 
ATOM   5958  O  O     . ARG H  4 96  ? -15.884 -36.607 36.977 1.00 31.12  ? 96   ARG H O     1 
ATOM   5959  C  CB    . ARG H  4 96  ? -14.533 -37.905 34.225 1.00 30.85  ? 96   ARG H CB    1 
ATOM   5960  C  CG    . ARG H  4 96  ? -14.658 -39.234 33.495 1.00 33.03  ? 96   ARG H CG    1 
ATOM   5961  C  CD    . ARG H  4 96  ? -13.321 -39.930 33.351 1.00 36.35  ? 96   ARG H CD    1 
ATOM   5962  N  NE    . ARG H  4 96  ? -13.504 -41.280 32.819 1.00 40.33  ? 96   ARG H NE    1 
ATOM   5963  C  CZ    . ARG H  4 96  ? -13.199 -41.657 31.568 1.00 42.49  ? 96   ARG H CZ    1 
ATOM   5964  N  NH1   . ARG H  4 96  ? -12.670 -40.792 30.692 1.00 41.02  ? 96   ARG H NH1   1 
ATOM   5965  N  NH2   . ARG H  4 96  ? -13.420 -42.917 31.190 1.00 42.07  ? 96   ARG H NH2   1 
ATOM   5966  N  N     . LEU H  4 97  ? -15.344 -35.100 35.382 1.00 30.19  ? 97   LEU H N     1 
ATOM   5967  C  CA    . LEU H  4 97  ? -15.063 -33.987 36.275 1.00 29.94  ? 97   LEU H CA    1 
ATOM   5968  C  C     . LEU H  4 97  ? -16.279 -33.457 37.022 1.00 30.26  ? 97   LEU H C     1 
ATOM   5969  O  O     . LEU H  4 97  ? -16.166 -32.704 37.971 1.00 29.89  ? 97   LEU H O     1 
ATOM   5970  C  CB    . LEU H  4 97  ? -14.465 -32.833 35.471 1.00 29.42  ? 97   LEU H CB    1 
ATOM   5971  C  CG    . LEU H  4 97  ? -13.036 -32.975 34.953 1.00 28.93  ? 97   LEU H CG    1 
ATOM   5972  C  CD1   . LEU H  4 97  ? -12.645 -31.781 34.091 1.00 27.50  ? 97   LEU H CD1   1 
ATOM   5973  C  CD2   . LEU H  4 97  ? -12.091 -33.119 36.119 1.00 28.53  ? 97   LEU H CD2   1 
ATOM   5974  N  N     . LEU H  4 98  ? -17.457 -33.848 36.596 1.00 31.34  ? 98   LEU H N     1 
ATOM   5975  C  CA    . LEU H  4 98  ? -18.638 -33.132 37.018 1.00 32.27  ? 98   LEU H CA    1 
ATOM   5976  C  C     . LEU H  4 98  ? -19.700 -34.027 37.663 1.00 32.24  ? 98   LEU H C     1 
ATOM   5977  O  O     . LEU H  4 98  ? -20.529 -33.561 38.441 1.00 32.52  ? 98   LEU H O     1 
ATOM   5978  C  CB    . LEU H  4 98  ? -19.196 -32.416 35.803 1.00 32.77  ? 98   LEU H CB    1 
ATOM   5979  C  CG    . LEU H  4 98  ? -20.164 -31.282 36.050 1.00 35.09  ? 98   LEU H CG    1 
ATOM   5980  C  CD1   . LEU H  4 98  ? -19.463 -29.937 35.833 1.00 35.76  ? 98   LEU H CD1   1 
ATOM   5981  C  CD2   . LEU H  4 98  ? -21.290 -31.512 35.062 1.00 37.92  ? 98   LEU H CD2   1 
ATOM   5982  N  N     . LEU H  4 99  ? -19.672 -35.313 37.347 1.00 32.34  ? 99   LEU H N     1 
ATOM   5983  C  CA    . LEU H  4 99  ? -20.618 -36.239 37.929 1.00 32.37  ? 99   LEU H CA    1 
ATOM   5984  C  C     . LEU H  4 99  ? -19.966 -37.056 39.047 1.00 33.68  ? 99   LEU H C     1 
ATOM   5985  O  O     . LEU H  4 99  ? -18.813 -37.487 38.923 1.00 34.19  ? 99   LEU H O     1 
ATOM   5986  C  CB    . LEU H  4 99  ? -21.231 -37.124 36.849 1.00 31.70  ? 99   LEU H CB    1 
ATOM   5987  C  CG    . LEU H  4 99  ? -22.068 -36.393 35.799 1.00 29.82  ? 99   LEU H CG    1 
ATOM   5988  C  CD1   . LEU H  4 99  ? -22.659 -37.344 34.845 1.00 29.02  ? 99   LEU H CD1   1 
ATOM   5989  C  CD2   . LEU H  4 99  ? -23.177 -35.641 36.437 1.00 30.16  ? 99   LEU H CD2   1 
ATOM   5990  N  N     . PRO H  4 100 ? -20.671 -37.193 40.182 1.00 34.51  ? 100  PRO H N     1 
ATOM   5991  C  CA    . PRO H  4 100 ? -20.293 -38.047 41.287 1.00 35.21  ? 100  PRO H CA    1 
ATOM   5992  C  C     . PRO H  4 100 ? -19.966 -39.475 40.864 1.00 36.26  ? 100  PRO H C     1 
ATOM   5993  O  O     . PRO H  4 100 ? -20.796 -40.164 40.269 1.00 35.91  ? 100  PRO H O     1 
ATOM   5994  C  CB    . PRO H  4 100 ? -21.545 -38.019 42.164 1.00 35.20  ? 100  PRO H CB    1 
ATOM   5995  C  CG    . PRO H  4 100 ? -22.085 -36.692 41.957 1.00 34.15  ? 100  PRO H CG    1 
ATOM   5996  C  CD    . PRO H  4 100 ? -21.883 -36.419 40.507 1.00 34.59  ? 100  PRO H CD    1 
ATOM   5997  N  N     . GLY H  4 101 ? -18.738 -39.881 41.182 1.00 37.71  ? 101  GLY H N     1 
ATOM   5998  C  CA    . GLY H  4 101 ? -18.215 -41.238 40.978 1.00 39.07  ? 101  GLY H CA    1 
ATOM   5999  C  C     . GLY H  4 101 ? -19.040 -42.219 40.173 1.00 40.04  ? 101  GLY H C     1 
ATOM   6000  O  O     . GLY H  4 101 ? -18.774 -42.430 38.990 1.00 40.31  ? 101  GLY H O     1 
ATOM   6001  N  N     . GLU H  4 102 ? -20.034 -42.830 40.809 1.00 40.90  ? 102  GLU H N     1 
ATOM   6002  C  CA    . GLU H  4 102 ? -20.761 -43.939 40.188 1.00 42.30  ? 102  GLU H CA    1 
ATOM   6003  C  C     . GLU H  4 102 ? -21.704 -43.458 39.080 1.00 42.48  ? 102  GLU H C     1 
ATOM   6004  O  O     . GLU H  4 102 ? -21.959 -44.170 38.102 1.00 42.79  ? 102  GLU H O     1 
ATOM   6005  C  CB    . GLU H  4 102 ? -21.522 -44.738 41.246 1.00 42.70  ? 102  GLU H CB    1 
ATOM   6006  C  CG    . GLU H  4 102 ? -22.300 -45.944 40.708 1.00 45.92  ? 102  GLU H CG    1 
ATOM   6007  C  CD    . GLU H  4 102 ? -21.442 -47.201 40.555 1.00 50.42  ? 102  GLU H CD    1 
ATOM   6008  O  OE1   . GLU H  4 102 ? -20.432 -47.348 41.289 1.00 51.56  ? 102  GLU H OE1   1 
ATOM   6009  O  OE2   . GLU H  4 102 ? -21.793 -48.052 39.701 1.00 52.53  ? 102  GLU H OE2   1 
ATOM   6010  N  N     . LEU H  4 103 ? -22.209 -42.241 39.241 1.00 42.68  ? 103  LEU H N     1 
ATOM   6011  C  CA    . LEU H  4 103 ? -23.101 -41.634 38.280 1.00 42.67  ? 103  LEU H CA    1 
ATOM   6012  C  C     . LEU H  4 103 ? -22.267 -41.281 37.060 1.00 43.06  ? 103  LEU H C     1 
ATOM   6013  O  O     . LEU H  4 103 ? -22.769 -41.286 35.938 1.00 43.37  ? 103  LEU H O     1 
ATOM   6014  C  CB    . LEU H  4 103 ? -23.737 -40.390 38.896 1.00 42.59  ? 103  LEU H CB    1 
ATOM   6015  C  CG    . LEU H  4 103 ? -25.125 -39.837 38.556 1.00 42.60  ? 103  LEU H CG    1 
ATOM   6016  C  CD1   . LEU H  4 103 ? -26.211 -40.892 38.484 1.00 41.53  ? 103  LEU H CD1   1 
ATOM   6017  C  CD2   . LEU H  4 103 ? -25.499 -38.770 39.581 1.00 42.29  ? 103  LEU H CD2   1 
ATOM   6018  N  N     . ALA H  4 104 ? -20.981 -41.012 37.272 1.00 43.26  ? 104  ALA H N     1 
ATOM   6019  C  CA    . ALA H  4 104 ? -20.077 -40.728 36.157 1.00 43.61  ? 104  ALA H CA    1 
ATOM   6020  C  C     . ALA H  4 104 ? -19.779 -41.998 35.366 1.00 44.19  ? 104  ALA H C     1 
ATOM   6021  O  O     . ALA H  4 104 ? -19.729 -41.976 34.138 1.00 44.14  ? 104  ALA H O     1 
ATOM   6022  C  CB    . ALA H  4 104 ? -18.797 -40.082 36.644 1.00 43.13  ? 104  ALA H CB    1 
ATOM   6023  N  N     . LYS H  4 105 ? -19.593 -43.105 36.077 1.00 44.98  ? 105  LYS H N     1 
ATOM   6024  C  CA    . LYS H  4 105 ? -19.250 -44.364 35.446 1.00 45.91  ? 105  LYS H CA    1 
ATOM   6025  C  C     . LYS H  4 105 ? -20.341 -44.771 34.452 1.00 45.38  ? 105  LYS H C     1 
ATOM   6026  O  O     . LYS H  4 105 ? -20.048 -45.115 33.307 1.00 45.34  ? 105  LYS H O     1 
ATOM   6027  C  CB    . LYS H  4 105 ? -19.012 -45.457 36.498 1.00 45.86  ? 105  LYS H CB    1 
ATOM   6028  C  CG    . LYS H  4 105 ? -18.439 -46.774 35.906 1.00 47.59  ? 105  LYS H CG    1 
ATOM   6029  C  CD    . LYS H  4 105 ? -18.530 -47.982 36.866 1.00 48.14  ? 105  LYS H CD    1 
ATOM   6030  C  CE    . LYS H  4 105 ? -19.989 -48.330 37.289 1.00 52.74  ? 105  LYS H CE    1 
ATOM   6031  N  NZ    . LYS H  4 105 ? -21.031 -48.370 36.175 1.00 53.63  ? 105  LYS H NZ    1 
ATOM   6032  N  N     . HIS H  4 106 ? -21.593 -44.708 34.891 1.00 45.26  ? 106  HIS H N     1 
ATOM   6033  C  CA    . HIS H  4 106 ? -22.724 -45.056 34.037 1.00 45.15  ? 106  HIS H CA    1 
ATOM   6034  C  C     . HIS H  4 106 ? -22.895 -44.108 32.864 1.00 44.45  ? 106  HIS H C     1 
ATOM   6035  O  O     . HIS H  4 106 ? -23.142 -44.557 31.752 1.00 44.84  ? 106  HIS H O     1 
ATOM   6036  C  CB    . HIS H  4 106 ? -24.013 -45.123 34.840 1.00 45.33  ? 106  HIS H CB    1 
ATOM   6037  C  CG    . HIS H  4 106 ? -24.133 -46.362 35.657 1.00 47.66  ? 106  HIS H CG    1 
ATOM   6038  N  ND1   . HIS H  4 106 ? -24.799 -47.483 35.212 1.00 51.00  ? 106  HIS H ND1   1 
ATOM   6039  C  CD2   . HIS H  4 106 ? -23.653 -46.669 36.884 1.00 49.81  ? 106  HIS H CD2   1 
ATOM   6040  C  CE1   . HIS H  4 106 ? -24.738 -48.425 36.137 1.00 51.55  ? 106  HIS H CE1   1 
ATOM   6041  N  NE2   . HIS H  4 106 ? -24.043 -47.957 37.159 1.00 51.41  ? 106  HIS H NE2   1 
ATOM   6042  N  N     . ALA H  4 107 ? -22.762 -42.806 33.109 1.00 43.40  ? 107  ALA H N     1 
ATOM   6043  C  CA    . ALA H  4 107 ? -22.886 -41.824 32.050 1.00 42.34  ? 107  ALA H CA    1 
ATOM   6044  C  C     . ALA H  4 107 ? -21.875 -42.080 30.943 1.00 42.07  ? 107  ALA H C     1 
ATOM   6045  O  O     . ALA H  4 107 ? -22.232 -42.036 29.764 1.00 41.96  ? 107  ALA H O     1 
ATOM   6046  C  CB    . ALA H  4 107 ? -22.733 -40.442 32.595 1.00 42.08  ? 107  ALA H CB    1 
ATOM   6047  N  N     . VAL H  4 108 ? -20.625 -42.352 31.318 1.00 41.71  ? 108  VAL H N     1 
ATOM   6048  C  CA    . VAL H  4 108 ? -19.571 -42.613 30.336 1.00 41.78  ? 108  VAL H CA    1 
ATOM   6049  C  C     . VAL H  4 108 ? -19.990 -43.803 29.493 1.00 42.16  ? 108  VAL H C     1 
ATOM   6050  O  O     . VAL H  4 108 ? -19.885 -43.793 28.264 1.00 42.16  ? 108  VAL H O     1 
ATOM   6051  C  CB    . VAL H  4 108 ? -18.181 -42.850 30.994 1.00 41.41  ? 108  VAL H CB    1 
ATOM   6052  C  CG1   . VAL H  4 108 ? -17.195 -43.358 30.001 1.00 40.28  ? 108  VAL H CG1   1 
ATOM   6053  C  CG2   . VAL H  4 108 ? -17.649 -41.567 31.555 1.00 41.37  ? 108  VAL H CG2   1 
ATOM   6054  N  N     . SER H  4 109 ? -20.507 -44.810 30.180 1.00 42.65  ? 109  SER H N     1 
ATOM   6055  C  CA    . SER H  4 109 ? -20.948 -46.032 29.558 1.00 42.95  ? 109  SER H CA    1 
ATOM   6056  C  C     . SER H  4 109 ? -22.062 -45.756 28.546 1.00 43.18  ? 109  SER H C     1 
ATOM   6057  O  O     . SER H  4 109 ? -21.971 -46.184 27.405 1.00 43.64  ? 109  SER H O     1 
ATOM   6058  C  CB    . SER H  4 109 ? -21.373 -47.010 30.641 1.00 42.69  ? 109  SER H CB    1 
ATOM   6059  O  OG    . SER H  4 109 ? -22.225 -48.004 30.133 1.00 44.50  ? 109  SER H OG    1 
ATOM   6060  N  N     . GLU H  4 110 ? -23.092 -45.017 28.941 1.00 43.53  ? 110  GLU H N     1 
ATOM   6061  C  CA    . GLU H  4 110 ? -24.182 -44.663 28.016 1.00 43.82  ? 110  GLU H CA    1 
ATOM   6062  C  C     . GLU H  4 110 ? -23.678 -43.886 26.813 1.00 43.84  ? 110  GLU H C     1 
ATOM   6063  O  O     . GLU H  4 110 ? -24.142 -44.092 25.698 1.00 43.81  ? 110  GLU H O     1 
ATOM   6064  C  CB    . GLU H  4 110 ? -25.259 -43.838 28.713 1.00 43.69  ? 110  GLU H CB    1 
ATOM   6065  C  CG    . GLU H  4 110 ? -25.983 -44.568 29.810 1.00 45.49  ? 110  GLU H CG    1 
ATOM   6066  C  CD    . GLU H  4 110 ? -26.849 -45.695 29.291 1.00 48.74  ? 110  GLU H CD    1 
ATOM   6067  O  OE1   . GLU H  4 110 ? -27.796 -45.428 28.516 1.00 51.37  ? 110  GLU H OE1   1 
ATOM   6068  O  OE2   . GLU H  4 110 ? -26.592 -46.854 29.666 1.00 49.95  ? 110  GLU H OE2   1 
ATOM   6069  N  N     . GLY H  4 111 ? -22.732 -42.988 27.056 1.00 44.15  ? 111  GLY H N     1 
ATOM   6070  C  CA    . GLY H  4 111 ? -22.170 -42.142 26.014 1.00 44.40  ? 111  GLY H CA    1 
ATOM   6071  C  C     . GLY H  4 111 ? -21.353 -42.923 25.012 1.00 44.65  ? 111  GLY H C     1 
ATOM   6072  O  O     . GLY H  4 111 ? -21.550 -42.784 23.812 1.00 44.68  ? 111  GLY H O     1 
ATOM   6073  N  N     . THR H  4 112 ? -20.441 -43.756 25.496 1.00 44.94  ? 112  THR H N     1 
ATOM   6074  C  CA    . THR H  4 112 ? -19.630 -44.560 24.604 1.00 45.74  ? 112  THR H CA    1 
ATOM   6075  C  C     . THR H  4 112 ? -20.532 -45.452 23.759 1.00 46.42  ? 112  THR H C     1 
ATOM   6076  O  O     . THR H  4 112 ? -20.303 -45.633 22.569 1.00 46.28  ? 112  THR H O     1 
ATOM   6077  C  CB    . THR H  4 112 ? -18.588 -45.379 25.377 1.00 45.56  ? 112  THR H CB    1 
ATOM   6078  O  OG1   . THR H  4 112 ? -17.764 -44.475 26.119 1.00 46.51  ? 112  THR H OG1   1 
ATOM   6079  C  CG2   . THR H  4 112 ? -17.695 -46.164 24.426 1.00 45.20  ? 112  THR H CG2   1 
ATOM   6080  N  N     . LYS H  4 113 ? -21.580 -45.970 24.385 1.00 47.38  ? 113  LYS H N     1 
ATOM   6081  C  CA    . LYS H  4 113 ? -22.515 -46.862 23.727 1.00 48.39  ? 113  LYS H CA    1 
ATOM   6082  C  C     . LYS H  4 113 ? -23.189 -46.179 22.538 1.00 48.90  ? 113  LYS H C     1 
ATOM   6083  O  O     . LYS H  4 113 ? -23.242 -46.746 21.445 1.00 49.41  ? 113  LYS H O     1 
ATOM   6084  C  CB    . LYS H  4 113 ? -23.550 -47.394 24.733 1.00 48.21  ? 113  LYS H CB    1 
ATOM   6085  C  CG    . LYS H  4 113 ? -24.647 -48.241 24.127 1.00 48.61  ? 113  LYS H CG    1 
ATOM   6086  C  CD    . LYS H  4 113 ? -25.728 -48.580 25.126 1.00 49.06  ? 113  LYS H CD    1 
ATOM   6087  C  CE    . LYS H  4 113 ? -25.645 -50.035 25.542 1.00 52.41  ? 113  LYS H CE    1 
ATOM   6088  N  NZ    . LYS H  4 113 ? -26.864 -50.449 26.321 1.00 54.49  ? 113  LYS H NZ    1 
ATOM   6089  N  N     . ALA H  4 114 ? -23.685 -44.964 22.739 1.00 49.55  ? 114  ALA H N     1 
ATOM   6090  C  CA    . ALA H  4 114 ? -24.434 -44.288 21.692 1.00 50.15  ? 114  ALA H CA    1 
ATOM   6091  C  C     . ALA H  4 114 ? -23.524 -43.789 20.576 1.00 51.03  ? 114  ALA H C     1 
ATOM   6092  O  O     . ALA H  4 114 ? -23.957 -43.678 19.437 1.00 51.28  ? 114  ALA H O     1 
ATOM   6093  C  CB    . ALA H  4 114 ? -25.256 -43.162 22.262 1.00 49.84  ? 114  ALA H CB    1 
ATOM   6094  N  N     . VAL H  4 115 ? -22.267 -43.489 20.894 1.00 52.10  ? 115  VAL H N     1 
ATOM   6095  C  CA    . VAL H  4 115 ? -21.310 -43.059 19.868 1.00 52.90  ? 115  VAL H CA    1 
ATOM   6096  C  C     . VAL H  4 115 ? -20.832 -44.257 19.045 1.00 53.56  ? 115  VAL H C     1 
ATOM   6097  O  O     . VAL H  4 115 ? -20.347 -44.094 17.935 1.00 53.79  ? 115  VAL H O     1 
ATOM   6098  C  CB    . VAL H  4 115 ? -20.129 -42.246 20.471 1.00 52.93  ? 115  VAL H CB    1 
ATOM   6099  C  CG1   . VAL H  4 115 ? -18.955 -42.112 19.486 1.00 52.80  ? 115  VAL H CG1   1 
ATOM   6100  C  CG2   . VAL H  4 115 ? -20.613 -40.864 20.905 1.00 53.00  ? 115  VAL H CG2   1 
ATOM   6101  N  N     . THR H  4 116 ? -20.989 -45.458 19.587 1.00 54.52  ? 116  THR H N     1 
ATOM   6102  C  CA    . THR H  4 116 ? -20.693 -46.675 18.851 1.00 55.57  ? 116  THR H CA    1 
ATOM   6103  C  C     . THR H  4 116 ? -21.815 -46.948 17.854 1.00 56.74  ? 116  THR H C     1 
ATOM   6104  O  O     . THR H  4 116 ? -21.589 -46.926 16.646 1.00 56.74  ? 116  THR H O     1 
ATOM   6105  C  CB    . THR H  4 116 ? -20.473 -47.852 19.804 1.00 55.26  ? 116  THR H CB    1 
ATOM   6106  O  OG1   . THR H  4 116 ? -19.157 -47.756 20.354 1.00 55.22  ? 116  THR H OG1   1 
ATOM   6107  C  CG2   . THR H  4 116 ? -20.613 -49.184 19.090 1.00 55.62  ? 116  THR H CG2   1 
ATOM   6108  N  N     . LYS H  4 117 ? -23.023 -47.168 18.362 1.00 58.30  ? 117  LYS H N     1 
ATOM   6109  C  CA    . LYS H  4 117 ? -24.179 -47.461 17.525 1.00 60.08  ? 117  LYS H CA    1 
ATOM   6110  C  C     . LYS H  4 117 ? -24.336 -46.464 16.370 1.00 60.85  ? 117  LYS H C     1 
ATOM   6111  O  O     . LYS H  4 117 ? -24.672 -46.850 15.252 1.00 61.21  ? 117  LYS H O     1 
ATOM   6112  C  CB    . LYS H  4 117 ? -25.448 -47.535 18.385 1.00 60.52  ? 117  LYS H CB    1 
ATOM   6113  C  CG    . LYS H  4 117 ? -26.760 -47.759 17.619 1.00 62.22  ? 117  LYS H CG    1 
ATOM   6114  C  CD    . LYS H  4 117 ? -26.874 -49.158 16.956 1.00 64.48  ? 117  LYS H CD    1 
ATOM   6115  C  CE    . LYS H  4 117 ? -28.127 -49.267 16.054 1.00 63.94  ? 117  LYS H CE    1 
ATOM   6116  N  NZ    . LYS H  4 117 ? -29.423 -48.941 16.762 1.00 64.81  ? 117  LYS H NZ    1 
ATOM   6117  N  N     . TYR H  4 118 ? -24.069 -45.193 16.648 1.00 61.87  ? 118  TYR H N     1 
ATOM   6118  C  CA    . TYR H  4 118 ? -24.124 -44.133 15.653 1.00 62.93  ? 118  TYR H CA    1 
ATOM   6119  C  C     . TYR H  4 118 ? -23.135 -44.361 14.499 1.00 64.40  ? 118  TYR H C     1 
ATOM   6120  O  O     . TYR H  4 118 ? -23.480 -44.148 13.333 1.00 64.57  ? 118  TYR H O     1 
ATOM   6121  C  CB    . TYR H  4 118 ? -23.854 -42.792 16.331 1.00 62.33  ? 118  TYR H CB    1 
ATOM   6122  C  CG    . TYR H  4 118 ? -23.942 -41.580 15.434 1.00 61.92  ? 118  TYR H CG    1 
ATOM   6123  C  CD1   . TYR H  4 118 ? -25.182 -41.070 15.035 1.00 61.75  ? 118  TYR H CD1   1 
ATOM   6124  C  CD2   . TYR H  4 118 ? -22.789 -40.923 15.001 1.00 61.22  ? 118  TYR H CD2   1 
ATOM   6125  C  CE1   . TYR H  4 118 ? -25.273 -39.944 14.212 1.00 61.38  ? 118  TYR H CE1   1 
ATOM   6126  C  CE2   . TYR H  4 118 ? -22.868 -39.794 14.180 1.00 61.27  ? 118  TYR H CE2   1 
ATOM   6127  C  CZ    . TYR H  4 118 ? -24.113 -39.314 13.793 1.00 61.56  ? 118  TYR H CZ    1 
ATOM   6128  O  OH    . TYR H  4 118 ? -24.204 -38.204 12.989 1.00 62.31  ? 118  TYR H OH    1 
ATOM   6129  N  N     . THR H  4 119 ? -21.913 -44.790 14.823 1.00 66.03  ? 119  THR H N     1 
ATOM   6130  C  CA    . THR H  4 119 ? -20.884 -45.036 13.810 1.00 67.65  ? 119  THR H CA    1 
ATOM   6131  C  C     . THR H  4 119 ? -21.226 -46.249 12.941 1.00 68.89  ? 119  THR H C     1 
ATOM   6132  O  O     . THR H  4 119 ? -21.257 -46.153 11.711 1.00 69.12  ? 119  THR H O     1 
ATOM   6133  C  CB    . THR H  4 119 ? -19.488 -45.212 14.442 1.00 67.66  ? 119  THR H CB    1 
ATOM   6134  O  OG1   . THR H  4 119 ? -19.186 -44.072 15.256 1.00 67.53  ? 119  THR H OG1   1 
ATOM   6135  C  CG2   . THR H  4 119 ? -18.410 -45.351 13.358 1.00 68.09  ? 119  THR H CG2   1 
ATOM   6136  N  N     . SER H  4 120 ? -21.501 -47.380 13.586 1.00 70.33  ? 120  SER H N     1 
ATOM   6137  C  CA    . SER H  4 120 ? -21.874 -48.610 12.888 1.00 71.81  ? 120  SER H CA    1 
ATOM   6138  C  C     . SER H  4 120 ? -23.223 -48.535 12.154 1.00 72.85  ? 120  SER H C     1 
ATOM   6139  O  O     . SER H  4 120 ? -23.660 -49.518 11.548 1.00 73.13  ? 120  SER H O     1 
ATOM   6140  C  CB    . SER H  4 120 ? -21.857 -49.790 13.862 1.00 71.77  ? 120  SER H CB    1 
ATOM   6141  O  OG    . SER H  4 120 ? -20.587 -49.888 14.485 1.00 72.21  ? 120  SER H OG    1 
ATOM   6142  N  N     . ALA H  4 121 ? -23.874 -47.375 12.203 1.00 74.03  ? 121  ALA H N     1 
ATOM   6143  C  CA    . ALA H  4 121 ? -25.126 -47.160 11.479 1.00 75.21  ? 121  ALA H CA    1 
ATOM   6144  C  C     . ALA H  4 121 ? -24.878 -46.524 10.109 1.00 76.20  ? 121  ALA H C     1 
ATOM   6145  O  O     . ALA H  4 121 ? -23.847 -45.867 9.899  1.00 76.41  ? 121  ALA H O     1 
ATOM   6146  C  CB    . ALA H  4 121 ? -26.080 -46.308 12.300 1.00 75.15  ? 121  ALA H CB    1 
ATOM   6147  N  N     . LYS H  4 122 ? -25.839 -46.725 9.198  1.00 77.21  ? 122  LYS H N     1 
ATOM   6148  C  CA    . LYS H  4 122 ? -25.814 -46.242 7.797  1.00 77.97  ? 122  LYS H CA    1 
ATOM   6149  C  C     . LYS H  4 122 ? -25.048 -44.927 7.532  1.00 78.28  ? 122  LYS H C     1 
ATOM   6150  O  O     . LYS H  4 122 ? -24.310 -44.824 6.544  1.00 78.43  ? 122  LYS H O     1 
ATOM   6151  C  CB    . LYS H  4 122 ? -27.257 -46.135 7.262  1.00 78.10  ? 122  LYS H CB    1 
ATOM   6152  C  CG    . LYS H  4 122 ? -27.399 -45.952 5.741  1.00 78.69  ? 122  LYS H CG    1 
ATOM   6153  C  CD    . LYS H  4 122 ? -27.151 -47.266 4.979  1.00 80.07  ? 122  LYS H CD    1 
ATOM   6154  C  CE    . LYS H  4 122 ? -28.013 -47.379 3.715  1.00 80.91  ? 122  LYS H CE    1 
ATOM   6155  N  NZ    . LYS H  4 122 ? -27.756 -46.301 2.704  1.00 81.41  ? 122  LYS H NZ    1 
ATOM   6156  O  OXT   . LYS H  4 122 ? -25.145 -43.933 8.270  1.00 78.42  ? 122  LYS H OXT   1 
ATOM   6157  O  "O5'" . DA  I  5 1   ? 2.392   0.953   95.041 1.00 97.92  ? -73  DA  I "O5'" 1 
ATOM   6158  C  "C5'" . DA  I  5 1   ? 3.209   0.460   93.963 1.00 98.20  ? -73  DA  I "C5'" 1 
ATOM   6159  C  "C4'" . DA  I  5 1   ? 4.405   -0.305  94.513 1.00 98.51  ? -73  DA  I "C4'" 1 
ATOM   6160  O  "O4'" . DA  I  5 1   ? 4.013   -1.673  94.828 1.00 98.74  ? -73  DA  I "O4'" 1 
ATOM   6161  C  "C3'" . DA  I  5 1   ? 5.584   -0.386  93.546 1.00 98.43  ? -73  DA  I "C3'" 1 
ATOM   6162  O  "O3'" . DA  I  5 1   ? 6.807   -0.036  94.190 1.00 98.17  ? -73  DA  I "O3'" 1 
ATOM   6163  C  "C2'" . DA  I  5 1   ? 5.602   -1.843  93.104 1.00 98.72  ? -73  DA  I "C2'" 1 
ATOM   6164  C  "C1'" . DA  I  5 1   ? 4.914   -2.591  94.236 1.00 98.64  ? -73  DA  I "C1'" 1 
ATOM   6165  N  N9    . DA  I  5 1   ? 4.194   -3.757  93.717 1.00 98.64  ? -73  DA  I N9    1 
ATOM   6166  C  C8    . DA  I  5 1   ? 3.101   -3.755  92.888 1.00 98.52  ? -73  DA  I C8    1 
ATOM   6167  N  N7    . DA  I  5 1   ? 2.669   -4.952  92.567 1.00 98.65  ? -73  DA  I N7    1 
ATOM   6168  C  C5    . DA  I  5 1   ? 3.545   -5.806  93.225 1.00 98.73  ? -73  DA  I C5    1 
ATOM   6169  C  C6    . DA  I  5 1   ? 3.633   -7.218  93.301 1.00 98.50  ? -73  DA  I C6    1 
ATOM   6170  N  N6    . DA  I  5 1   ? 2.790   -8.046  92.676 1.00 98.38  ? -73  DA  I N6    1 
ATOM   6171  N  N1    . DA  I  5 1   ? 4.628   -7.749  94.050 1.00 98.39  ? -73  DA  I N1    1 
ATOM   6172  C  C2    . DA  I  5 1   ? 5.478   -6.924  94.682 1.00 98.47  ? -73  DA  I C2    1 
ATOM   6173  N  N3    . DA  I  5 1   ? 5.492   -5.588  94.689 1.00 98.67  ? -73  DA  I N3    1 
ATOM   6174  C  C4    . DA  I  5 1   ? 4.494   -5.084  93.937 1.00 98.68  ? -73  DA  I C4    1 
ATOM   6175  P  P     . DT  I  5 2   ? 8.231   -0.208  93.462 1.00 98.21  ? -72  DT  I P     1 
ATOM   6176  O  OP1   . DT  I  5 2   ? 9.141   0.818   94.023 1.00 98.72  ? -72  DT  I OP1   1 
ATOM   6177  O  OP2   . DT  I  5 2   ? 8.059   -0.277  91.989 1.00 98.24  ? -72  DT  I OP2   1 
ATOM   6178  O  "O5'" . DT  I  5 2   ? 8.688   -1.644  93.994 1.00 96.46  ? -72  DT  I "O5'" 1 
ATOM   6179  C  "C5'" . DT  I  5 2   ? 9.503   -1.726  95.155 1.00 94.30  ? -72  DT  I "C5'" 1 
ATOM   6180  C  "C4'" . DT  I  5 2   ? 10.367  -2.974  95.109 1.00 92.48  ? -72  DT  I "C4'" 1 
ATOM   6181  O  "O4'" . DT  I  5 2   ? 9.556   -4.123  94.749 1.00 91.58  ? -72  DT  I "O4'" 1 
ATOM   6182  C  "C3'" . DT  I  5 2   ? 11.535  -2.950  94.131 1.00 91.36  ? -72  DT  I "C3'" 1 
ATOM   6183  O  "O3'" . DT  I  5 2   ? 12.602  -3.609  94.801 1.00 90.66  ? -72  DT  I "O3'" 1 
ATOM   6184  C  "C2'" . DT  I  5 2   ? 11.000  -3.731  92.928 1.00 90.78  ? -72  DT  I "C2'" 1 
ATOM   6185  C  "C1'" . DT  I  5 2   ? 10.088  -4.761  93.603 1.00 89.85  ? -72  DT  I "C1'" 1 
ATOM   6186  N  N1    . DT  I  5 2   ? 8.911   -5.308  92.815 1.00 89.04  ? -72  DT  I N1    1 
ATOM   6187  C  C2    . DT  I  5 2   ? 8.672   -6.669  92.837 1.00 88.18  ? -72  DT  I C2    1 
ATOM   6188  O  O2    . DT  I  5 2   ? 9.365   -7.464  93.440 1.00 88.20  ? -72  DT  I O2    1 
ATOM   6189  N  N3    . DT  I  5 2   ? 7.584   -7.077  92.112 1.00 88.03  ? -72  DT  I N3    1 
ATOM   6190  C  C4    . DT  I  5 2   ? 6.720   -6.279  91.383 1.00 88.65  ? -72  DT  I C4    1 
ATOM   6191  O  O4    . DT  I  5 2   ? 5.770   -6.752  90.765 1.00 88.69  ? -72  DT  I O4    1 
ATOM   6192  C  C5    . DT  I  5 2   ? 7.012   -4.865  91.401 1.00 88.39  ? -72  DT  I C5    1 
ATOM   6193  C  C7    . DT  I  5 2   ? 6.149   -3.899  90.642 1.00 88.40  ? -72  DT  I C7    1 
ATOM   6194  C  C6    . DT  I  5 2   ? 8.075   -4.454  92.111 1.00 88.76  ? -72  DT  I C6    1 
ATOM   6195  P  P     . DC  I  5 3   ? 14.054  -3.831  94.163 1.00 90.89  ? -71  DC  I P     1 
ATOM   6196  O  OP1   . DC  I  5 3   ? 15.019  -4.082  95.266 1.00 90.68  ? -71  DC  I OP1   1 
ATOM   6197  O  OP2   . DC  I  5 3   ? 14.309  -2.750  93.176 1.00 91.07  ? -71  DC  I OP2   1 
ATOM   6198  O  "O5'" . DC  I  5 3   ? 13.853  -5.194  93.358 1.00 88.79  ? -71  DC  I "O5'" 1 
ATOM   6199  C  "C5'" . DC  I  5 3   ? 13.644  -6.427  94.037 1.00 85.34  ? -71  DC  I "C5'" 1 
ATOM   6200  C  "C4'" . DC  I  5 3   ? 13.672  -7.573  93.037 1.00 82.86  ? -71  DC  I "C4'" 1 
ATOM   6201  O  "O4'" . DC  I  5 3   ? 12.412  -7.663  92.317 1.00 81.63  ? -71  DC  I "O4'" 1 
ATOM   6202  C  "C3'" . DC  I  5 3   ? 14.753  -7.487  91.964 1.00 81.05  ? -71  DC  I "C3'" 1 
ATOM   6203  O  "O3'" . DC  I  5 3   ? 15.254  -8.794  91.799 1.00 79.90  ? -71  DC  I "O3'" 1 
ATOM   6204  C  "C2'" . DC  I  5 3   ? 14.007  -7.009  90.719 1.00 80.10  ? -71  DC  I "C2'" 1 
ATOM   6205  C  "C1'" . DC  I  5 3   ? 12.683  -7.745  90.929 1.00 79.68  ? -71  DC  I "C1'" 1 
ATOM   6206  N  N1    . DC  I  5 3   ? 11.470  -7.242  90.186 1.00 79.08  ? -71  DC  I N1    1 
ATOM   6207  C  C2    . DC  I  5 3   ? 10.483  -8.169  89.798 1.00 78.20  ? -71  DC  I C2    1 
ATOM   6208  O  O2    . DC  I  5 3   ? 10.626  -9.372  90.061 1.00 77.68  ? -71  DC  I O2    1 
ATOM   6209  N  N3    . DC  I  5 3   ? 9.388   -7.715  89.135 1.00 77.66  ? -71  DC  I N3    1 
ATOM   6210  C  C4    . DC  I  5 3   ? 9.256   -6.415  88.858 1.00 78.12  ? -71  DC  I C4    1 
ATOM   6211  N  N4    . DC  I  5 3   ? 8.159   -6.032  88.200 1.00 78.17  ? -71  DC  I N4    1 
ATOM   6212  C  C5    . DC  I  5 3   ? 10.244  -5.455  89.239 1.00 78.04  ? -71  DC  I C5    1 
ATOM   6213  C  C6    . DC  I  5 3   ? 11.322  -5.908  89.898 1.00 78.74  ? -71  DC  I C6    1 
ATOM   6214  P  P     . DA  I  5 4   ? 16.782  -9.003  91.396 1.00 79.83  ? -70  DA  I P     1 
ATOM   6215  O  OP1   . DA  I  5 4   ? 17.520  -9.314  92.648 1.00 79.21  ? -70  DA  I OP1   1 
ATOM   6216  O  OP2   . DA  I  5 4   ? 17.161  -7.865  90.512 1.00 79.81  ? -70  DA  I OP2   1 
ATOM   6217  O  "O5'" . DA  I  5 4   ? 16.784  -10.319 90.486 1.00 76.86  ? -70  DA  I "O5'" 1 
ATOM   6218  C  "C5'" . DA  I  5 4   ? 16.025  -11.465 90.861 1.00 72.67  ? -70  DA  I "C5'" 1 
ATOM   6219  C  "C4'" . DA  I  5 4   ? 15.412  -12.121 89.634 1.00 68.66  ? -70  DA  I "C4'" 1 
ATOM   6220  O  "O4'" . DA  I  5 4   ? 14.260  -11.376 89.156 1.00 66.52  ? -70  DA  I "O4'" 1 
ATOM   6221  C  "C3'" . DA  I  5 4   ? 16.368  -12.256 88.460 1.00 67.14  ? -70  DA  I "C3'" 1 
ATOM   6222  O  "O3'" . DA  I  5 4   ? 16.183  -13.546 87.915 1.00 67.32  ? -70  DA  I "O3'" 1 
ATOM   6223  C  "C2'" . DA  I  5 4   ? 15.930  -11.144 87.510 1.00 66.42  ? -70  DA  I "C2'" 1 
ATOM   6224  C  "C1'" . DA  I  5 4   ? 14.423  -11.140 87.769 1.00 65.16  ? -70  DA  I "C1'" 1 
ATOM   6225  N  N9    . DA  I  5 4   ? 13.680  -9.930  87.387 1.00 64.36  ? -70  DA  I N9    1 
ATOM   6226  C  C8    . DA  I  5 4   ? 14.023  -8.609  87.535 1.00 63.90  ? -70  DA  I C8    1 
ATOM   6227  N  N7    . DA  I  5 4   ? 13.118  -7.763  87.087 1.00 63.46  ? -70  DA  I N7    1 
ATOM   6228  C  C5    . DA  I  5 4   ? 12.111  -8.587  86.607 1.00 63.72  ? -70  DA  I C5    1 
ATOM   6229  C  C6    . DA  I  5 4   ? 10.859  -8.333  85.997 1.00 64.11  ? -70  DA  I C6    1 
ATOM   6230  N  N6    . DA  I  5 4   ? 10.380  -7.110  85.751 1.00 64.00  ? -70  DA  I N6    1 
ATOM   6231  N  N1    . DA  I  5 4   ? 10.097  -9.393  85.644 1.00 64.10  ? -70  DA  I N1    1 
ATOM   6232  C  C2    . DA  I  5 4   ? 10.559  -10.629 85.882 1.00 63.84  ? -70  DA  I C2    1 
ATOM   6233  N  N3    . DA  I  5 4   ? 11.709  -10.994 86.444 1.00 63.35  ? -70  DA  I N3    1 
ATOM   6234  C  C4    . DA  I  5 4   ? 12.444  -9.921  86.785 1.00 63.89  ? -70  DA  I C4    1 
ATOM   6235  P  P     . DA  I  5 5   ? 17.437  -14.413 87.414 1.00 67.18  ? -69  DA  I P     1 
ATOM   6236  O  OP1   . DA  I  5 5   ? 17.906  -15.251 88.542 1.00 66.40  ? -69  DA  I OP1   1 
ATOM   6237  O  OP2   . DA  I  5 5   ? 18.361  -13.476 86.726 1.00 67.32  ? -69  DA  I OP2   1 
ATOM   6238  O  "O5'" . DA  I  5 5   ? 16.811  -15.376 86.285 1.00 66.04  ? -69  DA  I "O5'" 1 
ATOM   6239  C  "C5'" . DA  I  5 5   ? 15.528  -16.040 86.420 1.00 62.78  ? -69  DA  I "C5'" 1 
ATOM   6240  C  "C4'" . DA  I  5 5   ? 14.684  -15.935 85.147 1.00 60.67  ? -69  DA  I "C4'" 1 
ATOM   6241  O  "O4'" . DA  I  5 5   ? 14.020  -14.647 85.068 1.00 58.54  ? -69  DA  I "O4'" 1 
ATOM   6242  C  "C3'" . DA  I  5 5   ? 15.414  -16.117 83.812 1.00 59.98  ? -69  DA  I "C3'" 1 
ATOM   6243  O  "O3'" . DA  I  5 5   ? 14.758  -17.157 83.096 1.00 61.65  ? -69  DA  I "O3'" 1 
ATOM   6244  C  "C2'" . DA  I  5 5   ? 15.292  -14.767 83.110 1.00 57.27  ? -69  DA  I "C2'" 1 
ATOM   6245  C  "C1'" . DA  I  5 5   ? 14.013  -14.217 83.729 1.00 55.43  ? -69  DA  I "C1'" 1 
ATOM   6246  N  N9    . DA  I  5 5   ? 13.950  -12.765 83.747 1.00 54.45  ? -69  DA  I N9    1 
ATOM   6247  C  C8    . DA  I  5 5   ? 14.906  -11.932 84.244 1.00 54.55  ? -69  DA  I C8    1 
ATOM   6248  N  N7    . DA  I  5 5   ? 14.606  -10.664 84.129 1.00 54.96  ? -69  DA  I N7    1 
ATOM   6249  C  C5    . DA  I  5 5   ? 13.369  -10.656 83.517 1.00 54.03  ? -69  DA  I C5    1 
ATOM   6250  C  C6    . DA  I  5 5   ? 12.512  -9.611  83.118 1.00 53.95  ? -69  DA  I C6    1 
ATOM   6251  N  N6    . DA  I  5 5   ? 12.780  -8.321  83.293 1.00 53.42  ? -69  DA  I N6    1 
ATOM   6252  N  N1    . DA  I  5 5   ? 11.344  -9.950  82.531 1.00 54.73  ? -69  DA  I N1    1 
ATOM   6253  C  C2    . DA  I  5 5   ? 11.050  -11.250 82.356 1.00 54.43  ? -69  DA  I C2    1 
ATOM   6254  N  N3    . DA  I  5 5   ? 11.781  -12.316 82.688 1.00 54.05  ? -69  DA  I N3    1 
ATOM   6255  C  C4    . DA  I  5 5   ? 12.944  -11.950 83.272 1.00 54.21  ? -69  DA  I C4    1 
ATOM   6256  P  P     . DT  I  5 6   ? 15.422  -17.903 81.836 1.00 64.22  ? -68  DT  I P     1 
ATOM   6257  O  OP1   . DT  I  5 6   ? 15.273  -19.359 82.072 1.00 64.02  ? -68  DT  I OP1   1 
ATOM   6258  O  OP2   . DT  I  5 6   ? 16.765  -17.309 81.564 1.00 63.57  ? -68  DT  I OP2   1 
ATOM   6259  O  "O5'" . DT  I  5 6   ? 14.454  -17.492 80.617 1.00 62.70  ? -68  DT  I "O5'" 1 
ATOM   6260  C  "C5'" . DT  I  5 6   ? 13.236  -16.787 80.899 1.00 60.27  ? -68  DT  I "C5'" 1 
ATOM   6261  C  "C4'" . DT  I  5 6   ? 12.784  -15.957 79.712 1.00 58.67  ? -68  DT  I "C4'" 1 
ATOM   6262  O  "O4'" . DT  I  5 6   ? 12.788  -14.563 80.091 1.00 58.49  ? -68  DT  I "O4'" 1 
ATOM   6263  C  "C3'" . DT  I  5 6   ? 13.533  -16.082 78.394 1.00 57.90  ? -68  DT  I "C3'" 1 
ATOM   6264  O  "O3'" . DT  I  5 6   ? 12.575  -16.530 77.432 1.00 57.26  ? -68  DT  I "O3'" 1 
ATOM   6265  C  "C2'" . DT  I  5 6   ? 14.039  -14.667 78.121 1.00 57.51  ? -68  DT  I "C2'" 1 
ATOM   6266  C  "C1'" . DT  I  5 6   ? 13.095  -13.801 78.948 1.00 58.12  ? -68  DT  I "C1'" 1 
ATOM   6267  N  N1    . DT  I  5 6   ? 13.677  -12.518 79.429 1.00 57.91  ? -68  DT  I N1    1 
ATOM   6268  C  C2    . DT  I  5 6   ? 12.914  -11.363 79.390 1.00 58.24  ? -68  DT  I C2    1 
ATOM   6269  O  O2    . DT  I  5 6   ? 11.769  -11.311 78.979 1.00 58.90  ? -68  DT  I O2    1 
ATOM   6270  N  N3    . DT  I  5 6   ? 13.539  -10.239 79.857 1.00 58.35  ? -68  DT  I N3    1 
ATOM   6271  C  C4    . DT  I  5 6   ? 14.824  -10.163 80.361 1.00 58.64  ? -68  DT  I C4    1 
ATOM   6272  O  O4    . DT  I  5 6   ? 15.280  -9.097  80.753 1.00 58.45  ? -68  DT  I O4    1 
ATOM   6273  C  C5    . DT  I  5 6   ? 15.569  -11.409 80.384 1.00 58.44  ? -68  DT  I C5    1 
ATOM   6274  C  C7    . DT  I  5 6   ? 16.975  -11.468 80.900 1.00 58.31  ? -68  DT  I C7    1 
ATOM   6275  C  C6    . DT  I  5 6   ? 14.967  -12.511 79.927 1.00 57.93  ? -68  DT  I C6    1 
ATOM   6276  P  P     . DA  I  5 7   ? 12.848  -16.655 75.854 1.00 56.97  ? -67  DA  I P     1 
ATOM   6277  O  OP1   . DA  I  5 7   ? 12.300  -17.970 75.474 1.00 56.24  ? -67  DA  I OP1   1 
ATOM   6278  O  OP2   . DA  I  5 7   ? 14.256  -16.347 75.506 1.00 57.07  ? -67  DA  I OP2   1 
ATOM   6279  O  "O5'" . DA  I  5 7   ? 11.941  -15.480 75.272 1.00 54.37  ? -67  DA  I "O5'" 1 
ATOM   6280  C  "C5'" . DA  I  5 7   ? 10.563  -15.545 75.547 1.00 52.59  ? -67  DA  I "C5'" 1 
ATOM   6281  C  "C4'" . DA  I  5 7   ? 9.900   -14.219 75.252 1.00 51.73  ? -67  DA  I "C4'" 1 
ATOM   6282  O  "O4'" . DA  I  5 7   ? 10.611  -13.172 75.950 1.00 50.74  ? -67  DA  I "O4'" 1 
ATOM   6283  C  "C3'" . DA  I  5 7   ? 9.887   -13.820 73.784 1.00 51.49  ? -67  DA  I "C3'" 1 
ATOM   6284  O  "O3'" . DA  I  5 7   ? 8.688   -13.128 73.471 1.00 52.15  ? -67  DA  I "O3'" 1 
ATOM   6285  C  "C2'" . DA  I  5 7   ? 11.083  -12.885 73.701 1.00 51.16  ? -67  DA  I "C2'" 1 
ATOM   6286  C  "C1'" . DA  I  5 7   ? 10.980  -12.169 75.036 1.00 49.31  ? -67  DA  I "C1'" 1 
ATOM   6287  N  N9    . DA  I  5 7   ? 12.257  -11.629 75.482 1.00 48.74  ? -67  DA  I N9    1 
ATOM   6288  C  C8    . DA  I  5 7   ? 13.406  -12.332 75.702 1.00 48.00  ? -67  DA  I C8    1 
ATOM   6289  N  N7    . DA  I  5 7   ? 14.399  -11.582 76.106 1.00 47.58  ? -67  DA  I N7    1 
ATOM   6290  C  C5    . DA  I  5 7   ? 13.871  -10.304 76.148 1.00 48.02  ? -67  DA  I C5    1 
ATOM   6291  C  C6    . DA  I  5 7   ? 14.426  -9.049  76.503 1.00 48.63  ? -67  DA  I C6    1 
ATOM   6292  N  N6    . DA  I  5 7   ? 15.701  -8.891  76.893 1.00 48.36  ? -67  DA  I N6    1 
ATOM   6293  N  N1    . DA  I  5 7   ? 13.619  -7.962  76.439 1.00 48.21  ? -67  DA  I N1    1 
ATOM   6294  C  C2    . DA  I  5 7   ? 12.346  -8.130  76.043 1.00 48.38  ? -67  DA  I C2    1 
ATOM   6295  N  N3    . DA  I  5 7   ? 11.711  -9.256  75.694 1.00 48.09  ? -67  DA  I N3    1 
ATOM   6296  C  C4    . DA  I  5 7   ? 12.542  -10.314 75.764 1.00 48.00  ? -67  DA  I C4    1 
ATOM   6297  P  P     . DT  I  5 8   ? 8.334   -12.770 71.948 1.00 53.11  ? -66  DT  I P     1 
ATOM   6298  O  OP1   . DT  I  5 8   ? 6.859   -12.717 71.819 1.00 52.17  ? -66  DT  I OP1   1 
ATOM   6299  O  OP2   . DT  I  5 8   ? 9.184   -13.622 71.080 1.00 52.90  ? -66  DT  I OP2   1 
ATOM   6300  O  "O5'" . DT  I  5 8   ? 8.845   -11.276 71.805 1.00 54.02  ? -66  DT  I "O5'" 1 
ATOM   6301  C  "C5'" . DT  I  5 8   ? 8.137   -10.278 72.520 1.00 55.68  ? -66  DT  I "C5'" 1 
ATOM   6302  C  "C4'" . DT  I  5 8   ? 8.769   -8.950  72.209 1.00 56.59  ? -66  DT  I "C4'" 1 
ATOM   6303  O  "O4'" . DT  I  5 8   ? 10.106  -8.995  72.727 1.00 56.32  ? -66  DT  I "O4'" 1 
ATOM   6304  C  "C3'" . DT  I  5 8   ? 8.921   -8.676  70.724 1.00 58.25  ? -66  DT  I "C3'" 1 
ATOM   6305  O  "O3'" . DT  I  5 8   ? 8.276   -7.443  70.533 1.00 62.32  ? -66  DT  I "O3'" 1 
ATOM   6306  C  "C2'" . DT  I  5 8   ? 10.435  -8.656  70.472 1.00 56.70  ? -66  DT  I "C2'" 1 
ATOM   6307  C  "C1'" . DT  I  5 8   ? 10.950  -8.295  71.853 1.00 54.31  ? -66  DT  I "C1'" 1 
ATOM   6308  N  N1    . DT  I  5 8   ? 12.337  -8.694  72.225 1.00 53.16  ? -66  DT  I N1    1 
ATOM   6309  C  C2    . DT  I  5 8   ? 13.160  -7.704  72.718 1.00 52.86  ? -66  DT  I C2    1 
ATOM   6310  O  O2    . DT  I  5 8   ? 12.804  -6.533  72.827 1.00 52.67  ? -66  DT  I O2    1 
ATOM   6311  N  N3    . DT  I  5 8   ? 14.423  -8.141  73.057 1.00 52.64  ? -66  DT  I N3    1 
ATOM   6312  C  C4    . DT  I  5 8   ? 14.920  -9.437  72.967 1.00 52.93  ? -66  DT  I C4    1 
ATOM   6313  O  O4    . DT  I  5 8   ? 16.068  -9.733  73.298 1.00 53.06  ? -66  DT  I O4    1 
ATOM   6314  C  C5    . DT  I  5 8   ? 14.000  -10.424 72.456 1.00 52.84  ? -66  DT  I C5    1 
ATOM   6315  C  C7    . DT  I  5 8   ? 14.447  -11.858 72.314 1.00 52.82  ? -66  DT  I C7    1 
ATOM   6316  C  C6    . DT  I  5 8   ? 12.763  -10.008 72.118 1.00 52.62  ? -66  DT  I C6    1 
ATOM   6317  P  P     . DC  I  5 9   ? 8.144   -6.728  69.111 1.00 65.95  ? -65  DC  I P     1 
ATOM   6318  O  OP1   . DC  I  5 9   ? 6.823   -6.049  69.099 1.00 64.83  ? -65  DC  I OP1   1 
ATOM   6319  O  OP2   . DC  I  5 9   ? 8.536   -7.664  68.023 1.00 65.71  ? -65  DC  I OP2   1 
ATOM   6320  O  "O5'" . DC  I  5 9   ? 9.314   -5.640  69.235 1.00 68.09  ? -65  DC  I "O5'" 1 
ATOM   6321  C  "C5'" . DC  I  5 9   ? 9.264   -4.568  70.198 1.00 70.08  ? -65  DC  I "C5'" 1 
ATOM   6322  C  "C4'" . DC  I  5 9   ? 10.565  -3.780  70.156 1.00 71.46  ? -65  DC  I "C4'" 1 
ATOM   6323  O  "O4'" . DC  I  5 9   ? 11.663  -4.620  70.608 1.00 70.64  ? -65  DC  I "O4'" 1 
ATOM   6324  C  "C3'" . DC  I  5 9   ? 10.933  -3.293  68.757 1.00 72.65  ? -65  DC  I "C3'" 1 
ATOM   6325  O  "O3'" . DC  I  5 9   ? 10.741  -1.869  68.653 1.00 75.95  ? -65  DC  I "O3'" 1 
ATOM   6326  C  "C2'" . DC  I  5 9   ? 12.381  -3.748  68.546 1.00 71.42  ? -65  DC  I "C2'" 1 
ATOM   6327  C  "C1'" . DC  I  5 9   ? 12.835  -4.281  69.904 1.00 69.20  ? -65  DC  I "C1'" 1 
ATOM   6328  N  N1    . DC  I  5 9   ? 13.731  -5.493  69.853 1.00 68.31  ? -65  DC  I N1    1 
ATOM   6329  C  C2    . DC  I  5 9   ? 15.093  -5.413  70.258 1.00 68.12  ? -65  DC  I C2    1 
ATOM   6330  O  O2    . DC  I  5 9   ? 15.584  -4.347  70.656 1.00 67.81  ? -65  DC  I O2    1 
ATOM   6331  N  N3    . DC  I  5 9   ? 15.871  -6.525  70.205 1.00 67.40  ? -65  DC  I N3    1 
ATOM   6332  C  C4    . DC  I  5 9   ? 15.342  -7.673  69.775 1.00 67.72  ? -65  DC  I C4    1 
ATOM   6333  N  N4    . DC  I  5 9   ? 16.150  -8.736  69.741 1.00 67.77  ? -65  DC  I N4    1 
ATOM   6334  C  C5    . DC  I  5 9   ? 13.975  -7.782  69.356 1.00 67.37  ? -65  DC  I C5    1 
ATOM   6335  C  C6    . DC  I  5 9   ? 13.212  -6.682  69.413 1.00 67.35  ? -65  DC  I C6    1 
ATOM   6336  P  P     . DC  I  5 10  ? 10.621  -1.116  67.226 1.00 78.90  ? -64  DC  I P     1 
ATOM   6337  O  OP1   . DC  I  5 10  ? 10.000  0.212   67.467 1.00 78.04  ? -64  DC  I OP1   1 
ATOM   6338  O  OP2   . DC  I  5 10  ? 10.009  -2.031  66.222 1.00 78.06  ? -64  DC  I OP2   1 
ATOM   6339  O  "O5'" . DC  I  5 10  ? 12.163  -0.894  66.868 1.00 77.99  ? -64  DC  I "O5'" 1 
ATOM   6340  C  "C5'" . DC  I  5 10  ? 12.917  -0.077  67.755 1.00 78.49  ? -64  DC  I "C5'" 1 
ATOM   6341  C  "C4'" . DC  I  5 10  ? 14.377  -0.108  67.383 1.00 78.82  ? -64  DC  I "C4'" 1 
ATOM   6342  O  "O4'" . DC  I  5 10  ? 14.929  -1.386  67.787 1.00 77.80  ? -64  DC  I "O4'" 1 
ATOM   6343  C  "C3'" . DC  I  5 10  ? 14.627  0.029   65.882 1.00 79.70  ? -64  DC  I "C3'" 1 
ATOM   6344  O  "O3'" . DC  I  5 10  ? 15.746  0.896   65.646 1.00 81.03  ? -64  DC  I "O3'" 1 
ATOM   6345  C  "C2'" . DC  I  5 10  ? 14.895  -1.414  65.460 1.00 78.22  ? -64  DC  I "C2'" 1 
ATOM   6346  C  "C1'" . DC  I  5 10  ? 15.675  -1.872  66.691 1.00 76.49  ? -64  DC  I "C1'" 1 
ATOM   6347  N  N1    . DC  I  5 10  ? 15.939  -3.353  66.779 1.00 75.66  ? -64  DC  I N1    1 
ATOM   6348  C  C2    . DC  I  5 10  ? 17.099  -3.820  67.446 1.00 74.54  ? -64  DC  I C2    1 
ATOM   6349  O  O2    . DC  I  5 10  ? 17.894  -3.028  67.971 1.00 73.94  ? -64  DC  I O2    1 
ATOM   6350  N  N3    . DC  I  5 10  ? 17.323  -5.155  67.503 1.00 74.10  ? -64  DC  I N3    1 
ATOM   6351  C  C4    . DC  I  5 10  ? 16.457  -5.993  66.929 1.00 74.67  ? -64  DC  I C4    1 
ATOM   6352  N  N4    . DC  I  5 10  ? 16.735  -7.289  67.014 1.00 74.91  ? -64  DC  I N4    1 
ATOM   6353  C  C5    . DC  I  5 10  ? 15.279  -5.552  66.243 1.00 74.27  ? -64  DC  I C5    1 
ATOM   6354  C  C6    . DC  I  5 10  ? 15.062  -4.234  66.191 1.00 74.83  ? -64  DC  I C6    1 
ATOM   6355  P  P     . DA  I  5 11  ? 15.787  1.875   64.379 1.00 81.65  ? -63  DA  I P     1 
ATOM   6356  O  OP1   . DA  I  5 11  ? 14.624  2.797   64.465 1.00 80.82  ? -63  DA  I OP1   1 
ATOM   6357  O  OP2   . DA  I  5 11  ? 16.006  1.033   63.180 1.00 80.90  ? -63  DA  I OP2   1 
ATOM   6358  O  "O5'" . DA  I  5 11  ? 17.122  2.702   64.654 1.00 81.37  ? -63  DA  I "O5'" 1 
ATOM   6359  C  "C5'" . DA  I  5 11  ? 17.715  2.625   65.948 1.00 82.50  ? -63  DA  I "C5'" 1 
ATOM   6360  C  "C4'" . DA  I  5 11  ? 19.117  2.059   65.850 1.00 83.07  ? -63  DA  I "C4'" 1 
ATOM   6361  O  "O4'" . DA  I  5 11  ? 19.100  0.623   66.042 1.00 82.50  ? -63  DA  I "O4'" 1 
ATOM   6362  C  "C3'" . DA  I  5 11  ? 19.778  2.310   64.500 1.00 84.26  ? -63  DA  I "C3'" 1 
ATOM   6363  O  "O3'" . DA  I  5 11  ? 21.089  2.826   64.711 1.00 86.50  ? -63  DA  I "O3'" 1 
ATOM   6364  C  "C2'" . DA  I  5 11  ? 19.780  0.941   63.819 1.00 83.48  ? -63  DA  I "C2'" 1 
ATOM   6365  C  "C1'" . DA  I  5 11  ? 19.846  -0.006  65.010 1.00 81.65  ? -63  DA  I "C1'" 1 
ATOM   6366  N  N9    . DA  I  5 11  ? 19.311  -1.350  64.749 1.00 80.96  ? -63  DA  I N9    1 
ATOM   6367  C  C8    . DA  I  5 11  ? 18.073  -1.671  64.258 1.00 80.52  ? -63  DA  I C8    1 
ATOM   6368  N  N7    . DA  I  5 11  ? 17.859  -2.961  64.139 1.00 80.24  ? -63  DA  I N7    1 
ATOM   6369  C  C5    . DA  I  5 11  ? 19.043  -3.531  64.578 1.00 80.49  ? -63  DA  I C5    1 
ATOM   6370  C  C6    . DA  I  5 11  ? 19.477  -4.872  64.700 1.00 80.78  ? -63  DA  I C6    1 
ATOM   6371  N  N6    . DA  I  5 11  ? 18.712  -5.912  64.370 1.00 80.77  ? -63  DA  I N6    1 
ATOM   6372  N  N1    . DA  I  5 11  ? 20.726  -5.111  65.172 1.00 80.85  ? -63  DA  I N1    1 
ATOM   6373  C  C2    . DA  I  5 11  ? 21.498  -4.066  65.503 1.00 80.71  ? -63  DA  I C2    1 
ATOM   6374  N  N3    . DA  I  5 11  ? 21.199  -2.765  65.432 1.00 80.74  ? -63  DA  I N3    1 
ATOM   6375  C  C4    . DA  I  5 11  ? 19.951  -2.556  64.957 1.00 80.64  ? -63  DA  I C4    1 
ATOM   6376  P  P     . DC  I  5 12  ? 22.019  3.298   63.491 1.00 88.23  ? -62  DC  I P     1 
ATOM   6377  O  OP1   . DC  I  5 12  ? 22.939  4.306   64.071 1.00 88.31  ? -62  DC  I OP1   1 
ATOM   6378  O  OP2   . DC  I  5 12  ? 21.158  3.625   62.316 1.00 87.97  ? -62  DC  I OP2   1 
ATOM   6379  O  "O5'" . DC  I  5 12  ? 22.878  1.991   63.141 1.00 87.77  ? -62  DC  I "O5'" 1 
ATOM   6380  C  "C5'" . DC  I  5 12  ? 23.802  1.450   64.096 1.00 87.40  ? -62  DC  I "C5'" 1 
ATOM   6381  C  "C4'" . DC  I  5 12  ? 24.384  0.155   63.566 1.00 87.20  ? -62  DC  I "C4'" 1 
ATOM   6382  O  "O4'" . DC  I  5 12  ? 23.390  -0.904  63.655 1.00 86.73  ? -62  DC  I "O4'" 1 
ATOM   6383  C  "C3'" . DC  I  5 12  ? 24.781  0.242   62.092 1.00 87.20  ? -62  DC  I "C3'" 1 
ATOM   6384  O  "O3'" . DC  I  5 12  ? 26.187  0.109   61.905 1.00 87.47  ? -62  DC  I "O3'" 1 
ATOM   6385  C  "C2'" . DC  I  5 12  ? 24.023  -0.890  61.408 1.00 86.28  ? -62  DC  I "C2'" 1 
ATOM   6386  C  "C1'" . DC  I  5 12  ? 23.587  -1.781  62.562 1.00 85.11  ? -62  DC  I "C1'" 1 
ATOM   6387  N  N1    . DC  I  5 12  ? 22.346  -2.551  62.198 1.00 84.29  ? -62  DC  I N1    1 
ATOM   6388  C  C2    . DC  I  5 12  ? 22.362  -3.956  62.190 1.00 83.66  ? -62  DC  I C2    1 
ATOM   6389  O  O2    . DC  I  5 12  ? 23.393  -4.554  62.514 1.00 83.57  ? -62  DC  I O2    1 
ATOM   6390  N  N3    . DC  I  5 12  ? 21.232  -4.626  61.841 1.00 83.16  ? -62  DC  I N3    1 
ATOM   6391  C  C4    . DC  I  5 12  ? 20.133  -3.949  61.496 1.00 83.70  ? -62  DC  I C4    1 
ATOM   6392  N  N4    . DC  I  5 12  ? 19.043  -4.641  61.158 1.00 83.83  ? -62  DC  I N4    1 
ATOM   6393  C  C5    . DC  I  5 12  ? 20.095  -2.524  61.484 1.00 83.62  ? -62  DC  I C5    1 
ATOM   6394  C  C6    . DC  I  5 12  ? 21.211  -1.875  61.833 1.00 83.90  ? -62  DC  I C6    1 
ATOM   6395  P  P     . DC  I  5 13  ? 26.821  0.336   60.447 1.00 87.65  ? -61  DC  I P     1 
ATOM   6396  O  OP1   . DC  I  5 13  ? 28.205  0.818   60.644 1.00 88.10  ? -61  DC  I OP1   1 
ATOM   6397  O  OP2   . DC  I  5 13  ? 25.876  1.126   59.619 1.00 86.85  ? -61  DC  I OP2   1 
ATOM   6398  O  "O5'" . DC  I  5 13  ? 26.906  -1.163  59.892 1.00 88.24  ? -61  DC  I "O5'" 1 
ATOM   6399  C  "C5'" . DC  I  5 13  ? 27.521  -2.168  60.719 1.00 88.67  ? -61  DC  I "C5'" 1 
ATOM   6400  C  "C4'" . DC  I  5 13  ? 27.316  -3.568  60.168 1.00 88.69  ? -61  DC  I "C4'" 1 
ATOM   6401  O  "O4'" . DC  I  5 13  ? 25.915  -3.928  60.274 1.00 88.26  ? -61  DC  I "O4'" 1 
ATOM   6402  C  "C3'" . DC  I  5 13  ? 27.700  -3.718  58.700 1.00 89.17  ? -61  DC  I "C3'" 1 
ATOM   6403  O  "O3'" . DC  I  5 13  ? 28.959  -4.398  58.591 1.00 90.32  ? -61  DC  I "O3'" 1 
ATOM   6404  C  "C2'" . DC  I  5 13  ? 26.543  -4.481  58.046 1.00 88.51  ? -61  DC  I "C2'" 1 
ATOM   6405  C  "C1'" . DC  I  5 13  ? 25.524  -4.716  59.160 1.00 86.91  ? -61  DC  I "C1'" 1 
ATOM   6406  N  N1    . DC  I  5 13  ? 24.083  -4.410  58.777 1.00 85.88  ? -61  DC  I N1    1 
ATOM   6407  C  C2    . DC  I  5 13  ? 23.182  -5.464  58.531 1.00 85.31  ? -61  DC  I C2    1 
ATOM   6408  O  O2    . DC  I  5 13  ? 23.571  -6.635  58.621 1.00 84.87  ? -61  DC  I O2    1 
ATOM   6409  N  N3    . DC  I  5 13  ? 21.895  -5.171  58.198 1.00 85.02  ? -61  DC  I N3    1 
ATOM   6410  C  C4    . DC  I  5 13  ? 21.496  -3.900  58.105 1.00 84.98  ? -61  DC  I C4    1 
ATOM   6411  N  N4    . DC  I  5 13  ? 20.226  -3.669  57.771 1.00 84.96  ? -61  DC  I N4    1 
ATOM   6412  C  C5    . DC  I  5 13  ? 22.388  -2.814  58.349 1.00 84.79  ? -61  DC  I C5    1 
ATOM   6413  C  C6    . DC  I  5 13  ? 23.654  -3.111  58.675 1.00 85.17  ? -61  DC  I C6    1 
ATOM   6414  P  P     . DT  I  5 14  ? 29.706  -4.550  57.175 1.00 91.36  ? -60  DT  I P     1 
ATOM   6415  O  OP1   . DT  I  5 14  ? 31.128  -4.909  57.412 1.00 91.47  ? -60  DT  I OP1   1 
ATOM   6416  O  OP2   . DT  I  5 14  ? 29.360  -3.372  56.340 1.00 90.83  ? -60  DT  I OP2   1 
ATOM   6417  O  "O5'" . DT  I  5 14  ? 28.989  -5.842  56.577 1.00 90.91  ? -60  DT  I "O5'" 1 
ATOM   6418  C  "C5'" . DT  I  5 14  ? 29.138  -7.108  57.221 1.00 90.56  ? -60  DT  I "C5'" 1 
ATOM   6419  C  "C4'" . DT  I  5 14  ? 28.661  -8.175  56.263 1.00 90.31  ? -60  DT  I "C4'" 1 
ATOM   6420  O  "O4'" . DT  I  5 14  ? 27.215  -8.104  56.150 1.00 89.95  ? -60  DT  I "O4'" 1 
ATOM   6421  C  "C3'" . DT  I  5 14  ? 29.189  -7.995  54.846 1.00 90.23  ? -60  DT  I "C3'" 1 
ATOM   6422  O  "O3'" . DT  I  5 14  ? 29.325  -9.265  54.259 1.00 90.86  ? -60  DT  I "O3'" 1 
ATOM   6423  C  "C2'" . DT  I  5 14  ? 28.087  -7.194  54.156 1.00 89.83  ? -60  DT  I "C2'" 1 
ATOM   6424  C  "C1'" . DT  I  5 14  ? 26.844  -7.792  54.814 1.00 88.83  ? -60  DT  I "C1'" 1 
ATOM   6425  N  N1    . DT  I  5 14  ? 25.635  -6.904  54.848 1.00 88.30  ? -60  DT  I N1    1 
ATOM   6426  C  C2    . DT  I  5 14  ? 24.381  -7.485  54.939 1.00 87.78  ? -60  DT  I C2    1 
ATOM   6427  O  O2    . DT  I  5 14  ? 24.186  -8.686  54.987 1.00 87.79  ? -60  DT  I O2    1 
ATOM   6428  N  N3    . DT  I  5 14  ? 23.342  -6.592  54.972 1.00 87.45  ? -60  DT  I N3    1 
ATOM   6429  C  C4    . DT  I  5 14  ? 23.426  -5.214  54.922 1.00 87.77  ? -60  DT  I C4    1 
ATOM   6430  O  O4    . DT  I  5 14  ? 22.420  -4.517  54.957 1.00 87.70  ? -60  DT  I O4    1 
ATOM   6431  C  C5    . DT  I  5 14  ? 24.765  -4.669  54.828 1.00 87.76  ? -60  DT  I C5    1 
ATOM   6432  C  C7    . DT  I  5 14  ? 24.996  -3.191  54.769 1.00 87.84  ? -60  DT  I C7    1 
ATOM   6433  C  C6    . DT  I  5 14  ? 25.792  -5.528  54.796 1.00 87.89  ? -60  DT  I C6    1 
ATOM   6434  P  P     . DG  I  5 15  ? 30.357  -9.487  53.060 1.00 91.51  ? -59  DG  I P     1 
ATOM   6435  O  OP1   . DG  I  5 15  ? 31.610  -9.985  53.683 1.00 91.76  ? -59  DG  I OP1   1 
ATOM   6436  O  OP2   . DG  I  5 15  ? 30.372  -8.275  52.194 1.00 90.96  ? -59  DG  I OP2   1 
ATOM   6437  O  "O5'" . DG  I  5 15  ? 29.671  -10.691 52.248 1.00 90.42  ? -59  DG  I "O5'" 1 
ATOM   6438  C  "C5'" . DG  I  5 15  ? 29.382  -11.933 52.897 1.00 88.64  ? -59  DG  I "C5'" 1 
ATOM   6439  C  "C4'" . DG  I  5 15  ? 28.023  -12.447 52.470 1.00 87.01  ? -59  DG  I "C4'" 1 
ATOM   6440  O  "O4'" . DG  I  5 15  ? 27.012  -11.439 52.706 1.00 86.66  ? -59  DG  I "O4'" 1 
ATOM   6441  C  "C3'" . DG  I  5 15  ? 27.943  -12.802 50.997 1.00 86.52  ? -59  DG  I "C3'" 1 
ATOM   6442  O  "O3'" . DG  I  5 15  ? 27.457  -14.116 50.892 1.00 86.11  ? -59  DG  I "O3'" 1 
ATOM   6443  C  "C2'" . DG  I  5 15  ? 26.981  -11.790 50.378 1.00 86.32  ? -59  DG  I "C2'" 1 
ATOM   6444  C  "C1'" . DG  I  5 15  ? 26.178  -11.292 51.573 1.00 86.09  ? -59  DG  I "C1'" 1 
ATOM   6445  N  N9    . DG  I  5 15  ? 25.806  -9.878  51.496 1.00 86.12  ? -59  DG  I N9    1 
ATOM   6446  C  C8    . DG  I  5 15  ? 26.666  -8.806  51.421 1.00 85.89  ? -59  DG  I C8    1 
ATOM   6447  N  N7    . DG  I  5 15  ? 26.063  -7.650  51.368 1.00 85.94  ? -59  DG  I N7    1 
ATOM   6448  C  C5    . DG  I  5 15  ? 24.710  -7.967  51.411 1.00 85.89  ? -59  DG  I C5    1 
ATOM   6449  C  C6    . DG  I  5 15  ? 23.569  -7.122  51.385 1.00 85.47  ? -59  DG  I C6    1 
ATOM   6450  O  O6    . DG  I  5 15  ? 23.514  -5.888  51.322 1.00 85.43  ? -59  DG  I O6    1 
ATOM   6451  N  N1    . DG  I  5 15  ? 22.389  -7.848  51.444 1.00 85.64  ? -59  DG  I N1    1 
ATOM   6452  C  C2    . DG  I  5 15  ? 22.325  -9.219  51.522 1.00 85.78  ? -59  DG  I C2    1 
ATOM   6453  N  N2    . DG  I  5 15  ? 21.094  -9.739  51.572 1.00 85.92  ? -59  DG  I N2    1 
ATOM   6454  N  N3    . DG  I  5 15  ? 23.378  -10.028 51.550 1.00 85.42  ? -59  DG  I N3    1 
ATOM   6455  C  C4    . DG  I  5 15  ? 24.539  -9.337  51.491 1.00 85.81  ? -59  DG  I C4    1 
ATOM   6456  P  P     . DC  I  5 16  ? 27.688  -14.924 49.532 1.00 85.81  ? -58  DC  I P     1 
ATOM   6457  O  OP1   . DC  I  5 16  ? 27.833  -16.355 49.880 1.00 86.15  ? -58  DC  I OP1   1 
ATOM   6458  O  OP2   . DC  I  5 16  ? 28.719  -14.218 48.729 1.00 85.49  ? -58  DC  I OP2   1 
ATOM   6459  O  "O5'" . DC  I  5 16  ? 26.289  -14.756 48.779 1.00 85.25  ? -58  DC  I "O5'" 1 
ATOM   6460  C  "C5'" . DC  I  5 16  ? 25.040  -15.024 49.422 1.00 83.31  ? -58  DC  I "C5'" 1 
ATOM   6461  C  "C4'" . DC  I  5 16  ? 23.935  -14.415 48.590 1.00 81.49  ? -58  DC  I "C4'" 1 
ATOM   6462  O  "O4'" . DC  I  5 16  ? 23.889  -12.987 48.830 1.00 81.23  ? -58  DC  I "O4'" 1 
ATOM   6463  C  "C3'" . DC  I  5 16  ? 24.139  -14.575 47.088 1.00 80.96  ? -58  DC  I "C3'" 1 
ATOM   6464  O  "O3'" . DC  I  5 16  ? 22.933  -15.024 46.541 1.00 81.42  ? -58  DC  I "O3'" 1 
ATOM   6465  C  "C2'" . DC  I  5 16  ? 24.494  -13.178 46.594 1.00 80.58  ? -58  DC  I "C2'" 1 
ATOM   6466  C  "C1'" . DC  I  5 16  ? 23.692  -12.342 47.588 1.00 80.28  ? -58  DC  I "C1'" 1 
ATOM   6467  N  N1    . DC  I  5 16  ? 24.046  -10.874 47.693 1.00 80.02  ? -58  DC  I N1    1 
ATOM   6468  C  C2    . DC  I  5 16  ? 23.018  -9.931  47.836 1.00 79.48  ? -58  DC  I C2    1 
ATOM   6469  O  O2    . DC  I  5 16  ? 21.846  -10.311 47.878 1.00 79.40  ? -58  DC  I O2    1 
ATOM   6470  N  N3    . DC  I  5 16  ? 23.330  -8.615  47.928 1.00 79.21  ? -58  DC  I N3    1 
ATOM   6471  C  C4    . DC  I  5 16  ? 24.601  -8.223  47.880 1.00 79.21  ? -58  DC  I C4    1 
ATOM   6472  N  N4    . DC  I  5 16  ? 24.843  -6.918  47.974 1.00 79.50  ? -58  DC  I N4    1 
ATOM   6473  C  C5    . DC  I  5 16  ? 25.669  -9.153  47.733 1.00 79.32  ? -58  DC  I C5    1 
ATOM   6474  C  C6    . DC  I  5 16  ? 25.348  -10.451 47.643 1.00 79.90  ? -58  DC  I C6    1 
ATOM   6475  P  P     . DA  I  5 17  ? 22.803  -16.555 46.125 1.00 81.79  ? -57  DA  I P     1 
ATOM   6476  O  OP1   . DA  I  5 17  ? 23.362  -17.368 47.226 1.00 81.94  ? -57  DA  I OP1   1 
ATOM   6477  O  OP2   . DA  I  5 17  ? 23.316  -16.645 44.737 1.00 81.64  ? -57  DA  I OP2   1 
ATOM   6478  O  "O5'" . DA  I  5 17  ? 21.233  -16.864 46.085 1.00 81.87  ? -57  DA  I "O5'" 1 
ATOM   6479  C  "C5'" . DA  I  5 17  ? 20.361  -16.569 47.180 1.00 80.71  ? -57  DA  I "C5'" 1 
ATOM   6480  C  "C4'" . DA  I  5 17  ? 19.281  -15.594 46.728 1.00 80.00  ? -57  DA  I "C4'" 1 
ATOM   6481  O  "O4'" . DA  I  5 17  ? 19.836  -14.258 46.582 1.00 79.73  ? -57  DA  I "O4'" 1 
ATOM   6482  C  "C3'" . DA  I  5 17  ? 18.638  -15.935 45.392 1.00 79.64  ? -57  DA  I "C3'" 1 
ATOM   6483  O  "O3'" . DA  I  5 17  ? 17.232  -15.970 45.546 1.00 79.74  ? -57  DA  I "O3'" 1 
ATOM   6484  C  "C2'" . DA  I  5 17  ? 19.080  -14.837 44.423 1.00 79.08  ? -57  DA  I "C2'" 1 
ATOM   6485  C  "C1'" . DA  I  5 17  ? 19.493  -13.693 45.335 1.00 78.54  ? -57  DA  I "C1'" 1 
ATOM   6486  N  N9    . DA  I  5 17  ? 20.671  -12.995 44.838 1.00 78.54  ? -57  DA  I N9    1 
ATOM   6487  C  C8    . DA  I  5 17  ? 21.774  -13.574 44.269 1.00 78.36  ? -57  DA  I C8    1 
ATOM   6488  N  N7    . DA  I  5 17  ? 22.695  -12.713 43.908 1.00 78.74  ? -57  DA  I N7    1 
ATOM   6489  C  C5    . DA  I  5 17  ? 22.160  -11.483 44.264 1.00 78.42  ? -57  DA  I C5    1 
ATOM   6490  C  C6    . DA  I  5 17  ? 22.646  -10.167 44.142 1.00 77.98  ? -57  DA  I C6    1 
ATOM   6491  N  N6    . DA  I  5 17  ? 23.830  -9.893  43.602 1.00 78.03  ? -57  DA  I N6    1 
ATOM   6492  N  N1    . DA  I  5 17  ? 21.873  -9.153  44.586 1.00 77.91  ? -57  DA  I N1    1 
ATOM   6493  C  C2    . DA  I  5 17  ? 20.683  -9.447  45.120 1.00 78.06  ? -57  DA  I C2    1 
ATOM   6494  N  N3    . DA  I  5 17  ? 20.115  -10.645 45.288 1.00 78.11  ? -57  DA  I N3    1 
ATOM   6495  C  C4    . DA  I  5 17  ? 20.910  -11.634 44.838 1.00 78.49  ? -57  DA  I C4    1 
ATOM   6496  P  P     . DG  I  5 18  ? 16.290  -16.403 44.319 1.00 80.12  ? -56  DG  I P     1 
ATOM   6497  O  OP1   . DG  I  5 18  ? 15.254  -17.296 44.892 1.00 79.96  ? -56  DG  I OP1   1 
ATOM   6498  O  OP2   . DG  I  5 18  ? 17.117  -16.861 43.171 1.00 79.90  ? -56  DG  I OP2   1 
ATOM   6499  O  "O5'" . DG  I  5 18  ? 15.633  -15.011 43.872 1.00 77.74  ? -56  DG  I "O5'" 1 
ATOM   6500  C  "C5'" . DG  I  5 18  ? 15.403  -13.976 44.809 1.00 74.59  ? -56  DG  I "C5'" 1 
ATOM   6501  C  "C4'" . DG  I  5 18  ? 15.491  -12.626 44.128 1.00 72.46  ? -56  DG  I "C4'" 1 
ATOM   6502  O  "O4'" . DG  I  5 18  ? 16.852  -12.309 43.757 1.00 72.12  ? -56  DG  I "O4'" 1 
ATOM   6503  C  "C3'" . DG  I  5 18  ? 14.671  -12.478 42.853 1.00 71.23  ? -56  DG  I "C3'" 1 
ATOM   6504  O  "O3'" . DG  I  5 18  ? 13.751  -11.449 43.127 1.00 70.03  ? -56  DG  I "O3'" 1 
ATOM   6505  C  "C2'" . DG  I  5 18  ? 15.678  -12.081 41.768 1.00 70.91  ? -56  DG  I "C2'" 1 
ATOM   6506  C  "C1'" . DG  I  5 18  ? 16.815  -11.504 42.596 1.00 70.41  ? -56  DG  I "C1'" 1 
ATOM   6507  N  N9    . DG  I  5 18  ? 18.133  -11.571 41.969 1.00 70.13  ? -56  DG  I N9    1 
ATOM   6508  C  C8    . DG  I  5 18  ? 18.733  -12.660 41.380 1.00 69.87  ? -56  DG  I C8    1 
ATOM   6509  N  N7    . DG  I  5 18  ? 19.924  -12.411 40.921 1.00 69.79  ? -56  DG  I N7    1 
ATOM   6510  C  C5    . DG  I  5 18  ? 20.129  -11.075 41.230 1.00 69.66  ? -56  DG  I C5    1 
ATOM   6511  C  C6    . DG  I  5 18  ? 21.241  -10.243 40.983 1.00 69.68  ? -56  DG  I C6    1 
ATOM   6512  O  O6    . DG  I  5 18  ? 22.297  -10.535 40.423 1.00 70.10  ? -56  DG  I O6    1 
ATOM   6513  N  N1    . DG  I  5 18  ? 21.051  -8.948  41.456 1.00 69.93  ? -56  DG  I N1    1 
ATOM   6514  C  C2    . DG  I  5 18  ? 19.916  -8.513  42.097 1.00 69.89  ? -56  DG  I C2    1 
ATOM   6515  N  N2    . DG  I  5 18  ? 19.906  -7.236  42.494 1.00 69.92  ? -56  DG  I N2    1 
ATOM   6516  N  N3    . DG  I  5 18  ? 18.863  -9.282  42.339 1.00 70.03  ? -56  DG  I N3    1 
ATOM   6517  C  C4    . DG  I  5 18  ? 19.041  -10.546 41.881 1.00 69.89  ? -56  DG  I C4    1 
ATOM   6518  P  P     . DA  I  5 19  ? 12.712  -10.912 42.048 1.00 69.58  ? -55  DA  I P     1 
ATOM   6519  O  OP1   . DA  I  5 19  ? 11.514  -10.541 42.832 1.00 69.91  ? -55  DA  I OP1   1 
ATOM   6520  O  OP2   . DA  I  5 19  ? 12.606  -11.881 40.924 1.00 68.81  ? -55  DA  I OP2   1 
ATOM   6521  O  "O5'" . DA  I  5 19  ? 13.409  -9.582  41.514 1.00 67.65  ? -55  DA  I "O5'" 1 
ATOM   6522  C  "C5'" . DA  I  5 19  ? 13.762  -8.611  42.484 1.00 67.07  ? -55  DA  I "C5'" 1 
ATOM   6523  C  "C4'" . DA  I  5 19  ? 14.505  -7.445  41.863 1.00 65.98  ? -55  DA  I "C4'" 1 
ATOM   6524  O  "O4'" . DA  I  5 19  ? 15.834  -7.860  41.472 1.00 65.19  ? -55  DA  I "O4'" 1 
ATOM   6525  C  "C3'" . DA  I  5 19  ? 13.849  -6.850  40.626 1.00 65.41  ? -55  DA  I "C3'" 1 
ATOM   6526  O  "O3'" . DA  I  5 19  ? 13.845  -5.460  40.786 1.00 65.86  ? -55  DA  I "O3'" 1 
ATOM   6527  C  "C2'" . DA  I  5 19  ? 14.751  -7.297  39.483 1.00 64.54  ? -55  DA  I "C2'" 1 
ATOM   6528  C  "C1'" . DA  I  5 19  ? 16.096  -7.351  40.191 1.00 63.85  ? -55  DA  I "C1'" 1 
ATOM   6529  N  N9    . DA  I  5 19  ? 17.077  -8.238  39.593 1.00 63.33  ? -55  DA  I N9    1 
ATOM   6530  C  C8    . DA  I  5 19  ? 16.972  -9.580  39.332 1.00 63.41  ? -55  DA  I C8    1 
ATOM   6531  N  N7    . DA  I  5 19  ? 18.042  -10.108 38.786 1.00 63.04  ? -55  DA  I N7    1 
ATOM   6532  C  C5    . DA  I  5 19  ? 18.907  -9.025  38.692 1.00 63.86  ? -55  DA  I C5    1 
ATOM   6533  C  C6    . DA  I  5 19  ? 20.226  -8.884  38.202 1.00 63.50  ? -55  DA  I C6    1 
ATOM   6534  N  N6    . DA  I  5 19  ? 20.926  -9.897  37.698 1.00 63.44  ? -55  DA  I N6    1 
ATOM   6535  N  N1    . DA  I  5 19  ? 20.800  -7.659  38.254 1.00 63.45  ? -55  DA  I N1    1 
ATOM   6536  C  C2    . DA  I  5 19  ? 20.108  -6.629  38.768 1.00 63.30  ? -55  DA  I C2    1 
ATOM   6537  N  N3    . DA  I  5 19  ? 18.866  -6.634  39.255 1.00 63.44  ? -55  DA  I N3    1 
ATOM   6538  C  C4    . DA  I  5 19  ? 18.324  -7.867  39.187 1.00 63.59  ? -55  DA  I C4    1 
ATOM   6539  P  P     . DT  I  5 20  ? 13.050  -4.534  39.761 1.00 67.49  ? -54  DT  I P     1 
ATOM   6540  O  OP1   . DT  I  5 20  ? 12.582  -3.327  40.484 1.00 67.31  ? -54  DT  I OP1   1 
ATOM   6541  O  OP2   . DT  I  5 20  ? 12.106  -5.389  39.005 1.00 66.85  ? -54  DT  I OP2   1 
ATOM   6542  O  "O5'" . DT  I  5 20  ? 14.219  -4.062  38.778 1.00 69.45  ? -54  DT  I "O5'" 1 
ATOM   6543  C  "C5'" . DT  I  5 20  ? 15.392  -3.426  39.322 1.00 71.02  ? -54  DT  I "C5'" 1 
ATOM   6544  C  "C4'" . DT  I  5 20  ? 16.547  -3.340  38.334 1.00 71.46  ? -54  DT  I "C4'" 1 
ATOM   6545  O  "O4'" . DT  I  5 20  ? 17.117  -4.642  38.071 1.00 71.05  ? -54  DT  I "O4'" 1 
ATOM   6546  C  "C3'" . DT  I  5 20  ? 16.206  -2.724  36.982 1.00 72.16  ? -54  DT  I "C3'" 1 
ATOM   6547  O  "O3'" . DT  I  5 20  ? 16.885  -1.488  36.920 1.00 74.15  ? -54  DT  I "O3'" 1 
ATOM   6548  C  "C2'" . DT  I  5 20  ? 16.702  -3.730  35.941 1.00 71.25  ? -54  DT  I "C2'" 1 
ATOM   6549  C  "C1'" . DT  I  5 20  ? 17.608  -4.655  36.746 1.00 70.68  ? -54  DT  I "C1'" 1 
ATOM   6550  N  N1    . DT  I  5 20  ? 17.677  -6.089  36.281 1.00 70.63  ? -54  DT  I N1    1 
ATOM   6551  C  C2    . DT  I  5 20  ? 18.879  -6.562  35.796 1.00 70.77  ? -54  DT  I C2    1 
ATOM   6552  O  O2    . DT  I  5 20  ? 19.877  -5.860  35.724 1.00 70.75  ? -54  DT  I O2    1 
ATOM   6553  N  N3    . DT  I  5 20  ? 18.873  -7.887  35.403 1.00 70.47  ? -54  DT  I N3    1 
ATOM   6554  C  C4    . DT  I  5 20  ? 17.799  -8.769  35.443 1.00 70.60  ? -54  DT  I C4    1 
ATOM   6555  O  O4    . DT  I  5 20  ? 17.876  -9.937  35.065 1.00 70.40  ? -54  DT  I O4    1 
ATOM   6556  C  C5    . DT  I  5 20  ? 16.571  -8.215  35.963 1.00 70.59  ? -54  DT  I C5    1 
ATOM   6557  C  C7    . DT  I  5 20  ? 15.343  -9.080  36.052 1.00 70.43  ? -54  DT  I C7    1 
ATOM   6558  C  C6    . DT  I  5 20  ? 16.571  -6.925  36.351 1.00 70.64  ? -54  DT  I C6    1 
ATOM   6559  P  P     . DA  I  5 21  ? 16.535  -0.367  35.832 1.00 76.45  ? -53  DA  I P     1 
ATOM   6560  O  OP1   . DA  I  5 21  ? 16.822  0.950   36.455 1.00 76.10  ? -53  DA  I OP1   1 
ATOM   6561  O  OP2   . DA  I  5 21  ? 15.199  -0.621  35.230 1.00 75.64  ? -53  DA  I OP2   1 
ATOM   6562  O  "O5'" . DA  I  5 21  ? 17.660  -0.674  34.737 1.00 77.75  ? -53  DA  I "O5'" 1 
ATOM   6563  C  "C5'" . DA  I  5 21  ? 19.032  -0.539  35.100 1.00 80.47  ? -53  DA  I "C5'" 1 
ATOM   6564  C  "C4'" . DA  I  5 21  ? 19.944  -0.917  33.948 1.00 82.34  ? -53  DA  I "C4'" 1 
ATOM   6565  O  "O4'" . DA  I  5 21  ? 20.035  -2.360  33.831 1.00 82.44  ? -53  DA  I "O4'" 1 
ATOM   6566  C  "C3'" . DA  I  5 21  ? 19.530  -0.391  32.574 1.00 83.40  ? -53  DA  I "C3'" 1 
ATOM   6567  O  "O3'" . DA  I  5 21  ? 20.667  0.250   31.979 1.00 85.04  ? -53  DA  I "O3'" 1 
ATOM   6568  C  "C2'" . DA  I  5 21  ? 19.076  -1.659  31.837 1.00 83.24  ? -53  DA  I "C2'" 1 
ATOM   6569  C  "C1'" . DA  I  5 21  ? 19.987  -2.714  32.463 1.00 82.23  ? -53  DA  I "C1'" 1 
ATOM   6570  N  N9    . DA  I  5 21  ? 19.553  -4.111  32.383 1.00 81.88  ? -53  DA  I N9    1 
ATOM   6571  C  C8    . DA  I  5 21  ? 18.353  -4.637  32.777 1.00 81.91  ? -53  DA  I C8    1 
ATOM   6572  N  N7    . DA  I  5 21  ? 18.254  -5.936  32.599 1.00 81.92  ? -53  DA  I N7    1 
ATOM   6573  C  C5    . DA  I  5 21  ? 19.479  -6.295  32.056 1.00 81.77  ? -53  DA  I C5    1 
ATOM   6574  C  C6    . DA  I  5 21  ? 20.021  -7.537  31.637 1.00 81.79  ? -53  DA  I C6    1 
ATOM   6575  N  N6    . DA  I  5 21  ? 19.373  -8.705  31.694 1.00 81.56  ? -53  DA  I N6    1 
ATOM   6576  N  N1    . DA  I  5 21  ? 21.276  -7.537  31.140 1.00 82.16  ? -53  DA  I N1    1 
ATOM   6577  C  C2    . DA  I  5 21  ? 21.944  -6.374  31.065 1.00 82.19  ? -53  DA  I C2    1 
ATOM   6578  N  N3    . DA  I  5 21  ? 21.541  -5.152  31.426 1.00 81.88  ? -53  DA  I N3    1 
ATOM   6579  C  C4    . DA  I  5 21  ? 20.290  -5.178  31.919 1.00 81.74  ? -53  DA  I C4    1 
ATOM   6580  P  P     . DC  I  5 22  ? 20.557  1.277   30.752 1.00 86.60  ? -52  DC  I P     1 
ATOM   6581  O  OP1   . DC  I  5 22  ? 21.051  2.599   31.202 1.00 85.90  ? -52  DC  I OP1   1 
ATOM   6582  O  OP2   . DC  I  5 22  ? 19.199  1.175   30.160 1.00 86.25  ? -52  DC  I OP2   1 
ATOM   6583  O  "O5'" . DC  I  5 22  ? 21.606  0.650   29.716 1.00 87.13  ? -52  DC  I "O5'" 1 
ATOM   6584  C  "C5'" . DC  I  5 22  ? 21.434  -0.714  29.384 1.00 89.39  ? -52  DC  I "C5'" 1 
ATOM   6585  C  "C4'" . DC  I  5 22  ? 22.273  -1.136  28.204 1.00 91.31  ? -52  DC  I "C4'" 1 
ATOM   6586  O  "O4'" . DC  I  5 22  ? 22.451  -2.572  28.306 1.00 91.28  ? -52  DC  I "O4'" 1 
ATOM   6587  C  "C3'" . DC  I  5 22  ? 21.601  -0.846  26.867 1.00 93.29  ? -52  DC  I "C3'" 1 
ATOM   6588  O  "O3'" . DC  I  5 22  ? 22.525  -0.252  25.939 1.00 96.44  ? -52  DC  I "O3'" 1 
ATOM   6589  C  "C2'" . DC  I  5 22  ? 21.111  -2.200  26.364 1.00 92.50  ? -52  DC  I "C2'" 1 
ATOM   6590  C  "C1'" . DC  I  5 22  ? 21.758  -3.241  27.271 1.00 91.36  ? -52  DC  I "C1'" 1 
ATOM   6591  N  N1    . DC  I  5 22  ? 20.727  -4.186  27.825 1.00 91.28  ? -52  DC  I N1    1 
ATOM   6592  C  C2    . DC  I  5 22  ? 20.988  -5.566  27.830 1.00 90.96  ? -52  DC  I C2    1 
ATOM   6593  O  O2    . DC  I  5 22  ? 22.071  -5.978  27.400 1.00 91.02  ? -52  DC  I O2    1 
ATOM   6594  N  N3    . DC  I  5 22  ? 20.045  -6.415  28.314 1.00 90.66  ? -52  DC  I N3    1 
ATOM   6595  C  C4    . DC  I  5 22  ? 18.884  -5.934  28.769 1.00 90.75  ? -52  DC  I C4    1 
ATOM   6596  N  N4    . DC  I  5 22  ? 17.990  -6.811  29.232 1.00 90.85  ? -52  DC  I N4    1 
ATOM   6597  C  C5    . DC  I  5 22  ? 18.588  -4.536  28.766 1.00 90.76  ? -52  DC  I C5    1 
ATOM   6598  C  C6    . DC  I  5 22  ? 19.526  -3.707  28.289 1.00 90.96  ? -52  DC  I C6    1 
ATOM   6599  P  P     . DT  I  5 23  ? 22.096  0.138   24.435 1.00 98.37  ? -51  DT  I P     1 
ATOM   6600  O  OP1   . DT  I  5 23  ? 22.967  1.258   24.009 1.00 98.45  ? -51  DT  I OP1   1 
ATOM   6601  O  OP2   . DT  I  5 23  ? 20.623  0.331   24.396 1.00 98.50  ? -51  DT  I OP2   1 
ATOM   6602  O  "O5'" . DT  I  5 23  ? 22.456  -1.179  23.585 1.00 98.31  ? -51  DT  I "O5'" 1 
ATOM   6603  C  "C5'" . DT  I  5 23  ? 23.716  -1.837  23.725 1.00 98.97  ? -51  DT  I "C5'" 1 
ATOM   6604  C  "C4'" . DT  I  5 23  ? 23.671  -3.241  23.136 1.00 99.73  ? -51  DT  I "C4'" 1 
ATOM   6605  O  "O4'" . DT  I  5 23  ? 22.823  -4.107  23.941 1.00 99.71  ? -51  DT  I "O4'" 1 
ATOM   6606  C  "C3'" . DT  I  5 23  ? 23.152  -3.344  21.696 1.00 100.08 ? -51  DT  I "C3'" 1 
ATOM   6607  O  "O3'" . DT  I  5 23  ? 24.029  -4.165  20.908 1.00 100.55 ? -51  DT  I "O3'" 1 
ATOM   6608  C  "C2'" . DT  I  5 23  ? 21.784  -4.004  21.850 1.00 99.99  ? -51  DT  I "C2'" 1 
ATOM   6609  C  "C1'" . DT  I  5 23  ? 22.013  -4.884  23.076 1.00 99.49  ? -51  DT  I "C1'" 1 
ATOM   6610  N  N1    . DT  I  5 23  ? 20.761  -5.289  23.798 1.00 99.44  ? -51  DT  I N1    1 
ATOM   6611  C  C2    . DT  I  5 23  ? 20.563  -6.614  24.156 1.00 99.11  ? -51  DT  I C2    1 
ATOM   6612  O  O2    . DT  I  5 23  ? 21.350  -7.516  23.921 1.00 98.98  ? -51  DT  I O2    1 
ATOM   6613  N  N3    . DT  I  5 23  ? 19.383  -6.850  24.819 1.00 98.85  ? -51  DT  I N3    1 
ATOM   6614  C  C4    . DT  I  5 23  ? 18.406  -5.926  25.148 1.00 99.04  ? -51  DT  I C4    1 
ATOM   6615  O  O4    . DT  I  5 23  ? 17.389  -6.260  25.742 1.00 99.19  ? -51  DT  I O4    1 
ATOM   6616  C  C5    . DT  I  5 23  ? 18.672  -4.562  24.747 1.00 98.98  ? -51  DT  I C5    1 
ATOM   6617  C  C7    . DT  I  5 23  ? 17.703  -3.455  25.042 1.00 99.11  ? -51  DT  I C7    1 
ATOM   6618  C  C6    . DT  I  5 23  ? 19.818  -4.318  24.100 1.00 99.16  ? -51  DT  I C6    1 
ATOM   6619  P  P     . DA  I  5 24  ? 24.156  -4.016  19.316 1.00 100.20 ? -50  DA  I P     1 
ATOM   6620  O  OP1   . DA  I  5 24  ? 25.605  -4.127  18.979 1.00 99.70  ? -50  DA  I OP1   1 
ATOM   6621  O  OP2   . DA  I  5 24  ? 23.371  -2.818  18.901 1.00 99.86  ? -50  DA  I OP2   1 
ATOM   6622  O  "O5'" . DA  I  5 24  ? 23.393  -5.311  18.728 1.00 99.62  ? -50  DA  I "O5'" 1 
ATOM   6623  C  "C5'" . DA  I  5 24  ? 23.557  -6.638  19.329 1.00 98.49  ? -50  DA  I "C5'" 1 
ATOM   6624  C  "C4'" . DA  I  5 24  ? 22.433  -7.556  18.847 1.00 97.85  ? -50  DA  I "C4'" 1 
ATOM   6625  O  "O4'" . DA  I  5 24  ? 21.402  -7.667  19.872 1.00 97.88  ? -50  DA  I "O4'" 1 
ATOM   6626  C  "C3'" . DA  I  5 24  ? 21.717  -7.135  17.557 1.00 97.27  ? -50  DA  I "C3'" 1 
ATOM   6627  O  "O3'" . DA  I  5 24  ? 21.986  -8.113  16.524 1.00 96.05  ? -50  DA  I "O3'" 1 
ATOM   6628  C  "C2'" . DA  I  5 24  ? 20.237  -7.013  17.952 1.00 97.45  ? -50  DA  I "C2'" 1 
ATOM   6629  C  "C1'" . DA  I  5 24  ? 20.138  -7.825  19.246 1.00 97.36  ? -50  DA  I "C1'" 1 
ATOM   6630  N  N9    . DA  I  5 24  ? 19.065  -7.396  20.159 1.00 97.19  ? -50  DA  I N9    1 
ATOM   6631  C  C8    . DA  I  5 24  ? 18.713  -6.105  20.456 1.00 97.01  ? -50  DA  I C8    1 
ATOM   6632  N  N7    . DA  I  5 24  ? 17.718  -5.990  21.302 1.00 96.81  ? -50  DA  I N7    1 
ATOM   6633  C  C5    . DA  I  5 24  ? 17.385  -7.300  21.590 1.00 96.91  ? -50  DA  I C5    1 
ATOM   6634  C  C6    . DA  I  5 24  ? 16.398  -7.860  22.434 1.00 97.04  ? -50  DA  I C6    1 
ATOM   6635  N  N6    . DA  I  5 24  ? 15.554  -7.112  23.150 1.00 96.99  ? -50  DA  I N6    1 
ATOM   6636  N  N1    . DA  I  5 24  ? 16.314  -9.212  22.512 1.00 97.09  ? -50  DA  I N1    1 
ATOM   6637  C  C2    . DA  I  5 24  ? 17.168  -9.952  21.783 1.00 97.02  ? -50  DA  I C2    1 
ATOM   6638  N  N3    . DA  I  5 24  ? 18.139  -9.535  20.957 1.00 97.19  ? -50  DA  I N3    1 
ATOM   6639  C  C4    . DA  I  5 24  ? 18.202  -8.185  20.898 1.00 97.10  ? -50  DA  I C4    1 
ATOM   6640  P  P     . DC  I  5 25  ? 21.117  -8.271  15.178 1.00 94.82  ? -49  DC  I P     1 
ATOM   6641  O  OP1   . DC  I  5 25  ? 21.917  -9.047  14.203 1.00 94.49  ? -49  DC  I OP1   1 
ATOM   6642  O  OP2   . DC  I  5 25  ? 20.564  -6.949  14.798 1.00 94.47  ? -49  DC  I OP2   1 
ATOM   6643  O  "O5'" . DC  I  5 25  ? 19.911  -9.198  15.660 1.00 93.22  ? -49  DC  I "O5'" 1 
ATOM   6644  C  "C5'" . DC  I  5 25  ? 20.145  -10.482 16.254 1.00 91.05  ? -49  DC  I "C5'" 1 
ATOM   6645  C  "C4'" . DC  I  5 25  ? 18.829  -11.242 16.287 1.00 89.30  ? -49  DC  I "C4'" 1 
ATOM   6646  O  "O4'" . DC  I  5 25  ? 18.016  -10.747 17.387 1.00 88.81  ? -49  DC  I "O4'" 1 
ATOM   6647  C  "C3'" . DC  I  5 25  ? 17.999  -11.040 15.023 1.00 87.90  ? -49  DC  I "C3'" 1 
ATOM   6648  O  "O3'" . DC  I  5 25  ? 17.402  -12.243 14.580 1.00 85.99  ? -49  DC  I "O3'" 1 
ATOM   6649  C  "C2'" . DC  I  5 25  ? 16.935  -10.022 15.424 1.00 87.93  ? -49  DC  I "C2'" 1 
ATOM   6650  C  "C1'" . DC  I  5 25  ? 16.744  -10.352 16.899 1.00 87.88  ? -49  DC  I "C1'" 1 
ATOM   6651  N  N1    . DC  I  5 25  ? 16.151  -9.199  17.686 1.00 87.71  ? -49  DC  I N1    1 
ATOM   6652  C  C2    . DC  I  5 25  ? 15.105  -9.450  18.595 1.00 86.97  ? -49  DC  I C2    1 
ATOM   6653  O  O2    . DC  I  5 25  ? 14.699  -10.608 18.750 1.00 86.88  ? -49  DC  I O2    1 
ATOM   6654  N  N3    . DC  I  5 25  ? 14.565  -8.409  19.280 1.00 86.45  ? -49  DC  I N3    1 
ATOM   6655  C  C4    . DC  I  5 25  ? 15.022  -7.167  19.087 1.00 86.95  ? -49  DC  I C4    1 
ATOM   6656  N  N4    . DC  I  5 25  ? 14.459  -6.181  19.791 1.00 87.04  ? -49  DC  I N4    1 
ATOM   6657  C  C5    . DC  I  5 25  ? 16.079  -6.882  18.165 1.00 86.92  ? -49  DC  I C5    1 
ATOM   6658  C  C6    . DC  I  5 25  ? 16.606  -7.915  17.493 1.00 87.30  ? -49  DC  I C6    1 
ATOM   6659  P  P     . DC  I  5 26  ? 16.835  -12.284 13.081 1.00 85.21  ? -48  DC  I P     1 
ATOM   6660  O  OP1   . DC  I  5 26  ? 17.726  -13.217 12.358 1.00 85.13  ? -48  DC  I OP1   1 
ATOM   6661  O  OP2   . DC  I  5 26  ? 16.651  -10.892 12.597 1.00 84.15  ? -48  DC  I OP2   1 
ATOM   6662  O  "O5'" . DC  I  5 26  ? 15.362  -12.930 13.164 1.00 84.46  ? -48  DC  I "O5'" 1 
ATOM   6663  C  "C5'" . DC  I  5 26  ? 14.817  -13.591 14.324 1.00 82.60  ? -48  DC  I "C5'" 1 
ATOM   6664  C  "C4'" . DC  I  5 26  ? 13.354  -13.221 14.532 1.00 81.08  ? -48  DC  I "C4'" 1 
ATOM   6665  O  "O4'" . DC  I  5 26  ? 13.231  -12.029 15.352 1.00 80.26  ? -48  DC  I "O4'" 1 
ATOM   6666  C  "C3'" . DC  I  5 26  ? 12.553  -12.924 13.259 1.00 80.49  ? -48  DC  I "C3'" 1 
ATOM   6667  O  "O3'" . DC  I  5 26  ? 11.339  -13.655 13.285 1.00 80.68  ? -48  DC  I "O3'" 1 
ATOM   6668  C  "C2'" . DC  I  5 26  ? 12.279  -11.426 13.322 1.00 79.80  ? -48  DC  I "C2'" 1 
ATOM   6669  C  "C1'" . DC  I  5 26  ? 12.137  -11.300 14.830 1.00 79.57  ? -48  DC  I "C1'" 1 
ATOM   6670  N  N1    . DC  I  5 26  ? 12.158  -9.938  15.401 1.00 79.26  ? -48  DC  I N1    1 
ATOM   6671  C  C2    . DC  I  5 26  ? 11.348  -9.700  16.513 1.00 79.18  ? -48  DC  I C2    1 
ATOM   6672  O  O2    . DC  I  5 26  ? 10.658  -10.626 16.949 1.00 78.86  ? -48  DC  I O2    1 
ATOM   6673  N  N3    . DC  I  5 26  ? 11.348  -8.463  17.072 1.00 79.19  ? -48  DC  I N3    1 
ATOM   6674  C  C4    . DC  I  5 26  ? 12.116  -7.496  16.564 1.00 79.04  ? -48  DC  I C4    1 
ATOM   6675  N  N4    . DC  I  5 26  ? 12.082  -6.299  17.154 1.00 78.76  ? -48  DC  I N4    1 
ATOM   6676  C  C5    . DC  I  5 26  ? 12.955  -7.722  15.429 1.00 79.07  ? -48  DC  I C5    1 
ATOM   6677  C  C6    . DC  I  5 26  ? 12.948  -8.949  14.884 1.00 79.11  ? -48  DC  I C6    1 
ATOM   6678  P  P     . DA  I  5 27  ? 11.296  -15.072 12.554 1.00 81.19  ? -47  DA  I P     1 
ATOM   6679  O  OP1   . DA  I  5 27  ? 12.450  -15.850 13.085 1.00 81.05  ? -47  DA  I OP1   1 
ATOM   6680  O  OP2   . DA  I  5 27  ? 11.155  -14.787 11.106 1.00 80.44  ? -47  DA  I OP2   1 
ATOM   6681  O  "O5'" . DA  I  5 27  ? 9.923   -15.766 13.022 1.00 80.02  ? -47  DA  I "O5'" 1 
ATOM   6682  C  "C5'" . DA  I  5 27  ? 9.788   -16.389 14.308 1.00 77.84  ? -47  DA  I "C5'" 1 
ATOM   6683  C  "C4'" . DA  I  5 27  ? 8.527   -15.893 14.992 1.00 75.78  ? -47  DA  I "C4'" 1 
ATOM   6684  O  "O4'" . DA  I  5 27  ? 8.620   -14.459 15.176 1.00 74.34  ? -47  DA  I "O4'" 1 
ATOM   6685  C  "C3'" . DA  I  5 27  ? 7.237   -16.124 14.215 1.00 75.33  ? -47  DA  I "C3'" 1 
ATOM   6686  O  "O3'" . DA  I  5 27  ? 6.209   -16.457 15.138 1.00 76.08  ? -47  DA  I "O3'" 1 
ATOM   6687  C  "C2'" . DA  I  5 27  ? 6.990   -14.780 13.532 1.00 74.08  ? -47  DA  I "C2'" 1 
ATOM   6688  C  "C1'" . DA  I  5 27  ? 7.491   -13.829 14.606 1.00 73.49  ? -47  DA  I "C1'" 1 
ATOM   6689  N  N9    . DA  I  5 27  ? 7.917   -12.518 14.135 1.00 73.20  ? -47  DA  I N9    1 
ATOM   6690  C  C8    . DA  I  5 27  ? 8.365   -12.187 12.890 1.00 73.10  ? -47  DA  I C8    1 
ATOM   6691  N  N7    . DA  I  5 27  ? 8.684   -10.921 12.766 1.00 73.27  ? -47  DA  I N7    1 
ATOM   6692  C  C5    . DA  I  5 27  ? 8.434   -10.381 14.013 1.00 73.18  ? -47  DA  I C5    1 
ATOM   6693  C  C6    . DA  I  5 27  ? 8.567   -9.081  14.540 1.00 73.16  ? -47  DA  I C6    1 
ATOM   6694  N  N6    . DA  I  5 27  ? 9.008   -8.041  13.833 1.00 73.32  ? -47  DA  I N6    1 
ATOM   6695  N  N1    . DA  I  5 27  ? 8.227   -8.875  15.826 1.00 72.95  ? -47  DA  I N1    1 
ATOM   6696  C  C2    . DA  I  5 27  ? 7.779   -9.909  16.540 1.00 73.21  ? -47  DA  I C2    1 
ATOM   6697  N  N3    . DA  I  5 27  ? 7.613   -11.175 16.155 1.00 73.55  ? -47  DA  I N3    1 
ATOM   6698  C  C4    . DA  I  5 27  ? 7.961   -11.352 14.869 1.00 73.27  ? -47  DA  I C4    1 
ATOM   6699  P  P     . DA  I  5 28  ? 4.753   -16.915 14.636 1.00 77.36  ? -46  DA  I P     1 
ATOM   6700  O  OP1   . DA  I  5 28  ? 4.732   -18.401 14.606 1.00 77.29  ? -46  DA  I OP1   1 
ATOM   6701  O  OP2   . DA  I  5 28  ? 4.405   -16.141 13.415 1.00 76.42  ? -46  DA  I OP2   1 
ATOM   6702  O  "O5'" . DA  I  5 28  ? 3.766   -16.457 15.815 1.00 75.49  ? -46  DA  I "O5'" 1 
ATOM   6703  C  "C5'" . DA  I  5 28  ? 4.225   -15.722 16.946 1.00 72.77  ? -46  DA  I "C5'" 1 
ATOM   6704  C  "C4'" . DA  I  5 28  ? 3.657   -14.307 16.971 1.00 70.74  ? -46  DA  I "C4'" 1 
ATOM   6705  O  "O4'" . DA  I  5 28  ? 4.380   -13.466 16.041 1.00 69.29  ? -46  DA  I "O4'" 1 
ATOM   6706  C  "C3'" . DA  I  5 28  ? 2.171   -14.130 16.636 1.00 69.61  ? -46  DA  I "C3'" 1 
ATOM   6707  O  "O3'" . DA  I  5 28  ? 1.476   -13.861 17.877 1.00 69.34  ? -46  DA  I "O3'" 1 
ATOM   6708  C  "C2'" . DA  I  5 28  ? 2.155   -12.987 15.603 1.00 68.97  ? -46  DA  I "C2'" 1 
ATOM   6709  C  "C1'" . DA  I  5 28  ? 3.547   -12.363 15.755 1.00 68.38  ? -46  DA  I "C1'" 1 
ATOM   6710  N  N9    . DA  I  5 28  ? 4.128   -11.624 14.614 1.00 67.74  ? -46  DA  I N9    1 
ATOM   6711  C  C8    . DA  I  5 28  ? 4.351   -12.095 13.355 1.00 67.20  ? -46  DA  I C8    1 
ATOM   6712  N  N7    . DA  I  5 28  ? 4.896   -11.222 12.548 1.00 66.92  ? -46  DA  I N7    1 
ATOM   6713  C  C5    . DA  I  5 28  ? 5.059   -10.096 13.319 1.00 66.93  ? -46  DA  I C5    1 
ATOM   6714  C  C6    . DA  I  5 28  ? 5.588   -8.818  13.042 1.00 67.36  ? -46  DA  I C6    1 
ATOM   6715  N  N6    . DA  I  5 28  ? 6.069   -8.466  11.855 1.00 67.70  ? -46  DA  I N6    1 
ATOM   6716  N  N1    . DA  I  5 28  ? 5.613   -7.899  14.024 1.00 67.46  ? -46  DA  I N1    1 
ATOM   6717  C  C2    . DA  I  5 28  ? 5.129   -8.255  15.218 1.00 67.66  ? -46  DA  I C2    1 
ATOM   6718  N  N3    . DA  I  5 28  ? 4.603   -9.424  15.597 1.00 67.92  ? -46  DA  I N3    1 
ATOM   6719  C  C4    . DA  I  5 28  ? 4.595   -10.321 14.595 1.00 67.34  ? -46  DA  I C4    1 
ATOM   6720  P  P     . DA  I  5 29  ? -0.044  -13.347 18.012 1.00 69.65  ? -45  DA  I P     1 
ATOM   6721  O  OP1   . DA  I  5 29  ? -0.525  -13.717 19.359 1.00 69.63  ? -45  DA  I OP1   1 
ATOM   6722  O  OP2   . DA  I  5 29  ? -0.826  -13.743 16.824 1.00 70.39  ? -45  DA  I OP2   1 
ATOM   6723  O  "O5'" . DA  I  5 29  ? 0.086   -11.769 17.949 1.00 68.66  ? -45  DA  I "O5'" 1 
ATOM   6724  C  "C5'" . DA  I  5 29  ? 0.861   -11.130 18.925 1.00 68.65  ? -45  DA  I "C5'" 1 
ATOM   6725  C  "C4'" . DA  I  5 29  ? 0.801   -9.634  18.717 1.00 68.68  ? -45  DA  I "C4'" 1 
ATOM   6726  O  "O4'" . DA  I  5 29  ? 1.491   -9.274  17.501 1.00 68.41  ? -45  DA  I "O4'" 1 
ATOM   6727  C  "C3'" . DA  I  5 29  ? -0.597  -9.052  18.603 1.00 68.34  ? -45  DA  I "C3'" 1 
ATOM   6728  O  "O3'" . DA  I  5 29  ? -0.592  -7.946  19.478 1.00 68.31  ? -45  DA  I "O3'" 1 
ATOM   6729  C  "C2'" . DA  I  5 29  ? -0.739  -8.653  17.137 1.00 68.15  ? -45  DA  I "C2'" 1 
ATOM   6730  C  "C1'" . DA  I  5 29  ? 0.707   -8.383  16.748 1.00 68.54  ? -45  DA  I "C1'" 1 
ATOM   6731  N  N9    . DA  I  5 29  ? 1.037   -8.694  15.362 1.00 69.02  ? -45  DA  I N9    1 
ATOM   6732  C  C8    . DA  I  5 29  ? 0.702   -9.828  14.672 1.00 68.78  ? -45  DA  I C8    1 
ATOM   6733  N  N7    . DA  I  5 29  ? 1.141   -9.841  13.438 1.00 68.84  ? -45  DA  I N7    1 
ATOM   6734  C  C5    . DA  I  5 29  ? 1.814   -8.638  13.312 1.00 68.95  ? -45  DA  I C5    1 
ATOM   6735  C  C6    . DA  I  5 29  ? 2.513   -8.050  12.242 1.00 68.58  ? -45  DA  I C6    1 
ATOM   6736  N  N6    . DA  I  5 29  ? 2.646   -8.634  11.056 1.00 68.50  ? -45  DA  I N6    1 
ATOM   6737  N  N1    . DA  I  5 29  ? 3.076   -6.840  12.438 1.00 68.89  ? -45  DA  I N1    1 
ATOM   6738  C  C2    . DA  I  5 29  ? 2.942   -6.255  13.635 1.00 68.73  ? -45  DA  I C2    1 
ATOM   6739  N  N3    . DA  I  5 29  ? 2.316   -6.713  14.720 1.00 68.36  ? -45  DA  I N3    1 
ATOM   6740  C  C4    . DA  I  5 29  ? 1.767   -7.918  14.490 1.00 68.75  ? -45  DA  I C4    1 
ATOM   6741  P  P     . DA  I  5 30  ? -1.898  -7.127  19.882 1.00 67.63  ? -44  DA  I P     1 
ATOM   6742  O  OP1   . DA  I  5 30  ? -1.636  -6.694  21.271 1.00 68.25  ? -44  DA  I OP1   1 
ATOM   6743  O  OP2   . DA  I  5 30  ? -3.109  -7.901  19.499 1.00 67.86  ? -44  DA  I OP2   1 
ATOM   6744  O  "O5'" . DA  I  5 30  ? -1.881  -5.850  18.929 1.00 66.26  ? -44  DA  I "O5'" 1 
ATOM   6745  C  "C5'" . DA  I  5 30  ? -0.732  -5.040  18.844 1.00 64.48  ? -44  DA  I "C5'" 1 
ATOM   6746  C  "C4'" . DA  I  5 30  ? -0.925  -4.030  17.739 1.00 63.44  ? -44  DA  I "C4'" 1 
ATOM   6747  O  "O4'" . DA  I  5 30  ? -0.476  -4.615  16.501 1.00 63.62  ? -44  DA  I "O4'" 1 
ATOM   6748  C  "C3'" . DA  I  5 30  ? -2.369  -3.604  17.514 1.00 62.58  ? -44  DA  I "C3'" 1 
ATOM   6749  O  "O3'" . DA  I  5 30  ? -2.388  -2.225  17.696 1.00 61.98  ? -44  DA  I "O3'" 1 
ATOM   6750  C  "C2'" . DA  I  5 30  ? -2.687  -4.025  16.080 1.00 62.77  ? -44  DA  I "C2'" 1 
ATOM   6751  C  "C1'" . DA  I  5 30  ? -1.305  -4.166  15.454 1.00 63.02  ? -44  DA  I "C1'" 1 
ATOM   6752  N  N9    . DA  I  5 30  ? -1.175  -5.160  14.384 1.00 63.23  ? -44  DA  I N9    1 
ATOM   6753  C  C8    . DA  I  5 30  ? -1.549  -6.477  14.425 1.00 62.93  ? -44  DA  I C8    1 
ATOM   6754  N  N7    . DA  I  5 30  ? -1.293  -7.146  13.329 1.00 62.52  ? -44  DA  I N7    1 
ATOM   6755  C  C5    . DA  I  5 30  ? -0.706  -6.203  12.509 1.00 62.75  ? -44  DA  I C5    1 
ATOM   6756  C  C6    . DA  I  5 30  ? -0.197  -6.278  11.207 1.00 62.27  ? -44  DA  I C6    1 
ATOM   6757  N  N6    . DA  I  5 30  ? -0.218  -7.392  10.491 1.00 62.62  ? -44  DA  I N6    1 
ATOM   6758  N  N1    . DA  I  5 30  ? 0.330   -5.169  10.664 1.00 62.72  ? -44  DA  I N1    1 
ATOM   6759  C  C2    . DA  I  5 30  ? 0.360   -4.045  11.388 1.00 62.94  ? -44  DA  I C2    1 
ATOM   6760  N  N3    . DA  I  5 30  ? -0.086  -3.844  12.627 1.00 63.37  ? -44  DA  I N3    1 
ATOM   6761  C  C4    . DA  I  5 30  ? -0.613  -4.975  13.139 1.00 63.31  ? -44  DA  I C4    1 
ATOM   6762  P  P     . DG  I  5 31  ? -3.687  -1.343  17.478 1.00 61.87  ? -43  DG  I P     1 
ATOM   6763  O  OP1   . DG  I  5 31  ? -3.664  -0.270  18.486 1.00 63.18  ? -43  DG  I OP1   1 
ATOM   6764  O  OP2   . DG  I  5 31  ? -4.874  -2.219  17.343 1.00 63.16  ? -43  DG  I OP2   1 
ATOM   6765  O  "O5'" . DG  I  5 31  ? -3.379  -0.667  16.068 1.00 65.11  ? -43  DG  I "O5'" 1 
ATOM   6766  C  "C5'" . DG  I  5 31  ? -2.127  0.011   15.839 1.00 67.64  ? -43  DG  I "C5'" 1 
ATOM   6767  C  "C4'" . DG  I  5 31  ? -2.039  0.595   14.432 1.00 69.00  ? -43  DG  I "C4'" 1 
ATOM   6768  O  "O4'" . DG  I  5 31  ? -1.655  -0.442  13.495 1.00 68.24  ? -43  DG  I "O4'" 1 
ATOM   6769  C  "C3'" . DG  I  5 31  ? -3.342  1.209   13.915 1.00 70.00  ? -43  DG  I "C3'" 1 
ATOM   6770  O  "O3'" . DG  I  5 31  ? -3.100  2.401   13.184 1.00 72.15  ? -43  DG  I "O3'" 1 
ATOM   6771  C  "C2'" . DG  I  5 31  ? -3.902  0.122   13.015 1.00 69.06  ? -43  DG  I "C2'" 1 
ATOM   6772  C  "C1'" . DG  I  5 31  ? -2.633  -0.519  12.483 1.00 68.72  ? -43  DG  I "C1'" 1 
ATOM   6773  N  N9    . DG  I  5 31  ? -2.881  -1.913  12.192 1.00 68.66  ? -43  DG  I N9    1 
ATOM   6774  C  C8    . DG  I  5 31  ? -3.407  -2.844  13.047 1.00 68.70  ? -43  DG  I C8    1 
ATOM   6775  N  N7    . DG  I  5 31  ? -3.533  -4.025  12.518 1.00 68.66  ? -43  DG  I N7    1 
ATOM   6776  C  C5    . DG  I  5 31  ? -3.074  -3.857  11.221 1.00 68.90  ? -43  DG  I C5    1 
ATOM   6777  C  C6    . DG  I  5 31  ? -2.969  -4.792  10.166 1.00 68.85  ? -43  DG  I C6    1 
ATOM   6778  O  O6    . DG  I  5 31  ? -3.278  -5.992  10.184 1.00 68.64  ? -43  DG  I O6    1 
ATOM   6779  N  N1    . DG  I  5 31  ? -2.443  -4.215  9.010  1.00 68.69  ? -43  DG  I N1    1 
ATOM   6780  C  C2    . DG  I  5 31  ? -2.069  -2.896  8.888  1.00 68.63  ? -43  DG  I C2    1 
ATOM   6781  N  N2    . DG  I  5 31  ? -1.587  -2.521  7.697  1.00 68.71  ? -43  DG  I N2    1 
ATOM   6782  N  N3    . DG  I  5 31  ? -2.160  -2.007  9.868  1.00 68.85  ? -43  DG  I N3    1 
ATOM   6783  C  C4    . DG  I  5 31  ? -2.669  -2.558  11.001 1.00 68.93  ? -43  DG  I C4    1 
ATOM   6784  P  P     . DT  I  5 32  ? -4.311  3.310   12.641 1.00 74.22  ? -42  DT  I P     1 
ATOM   6785  O  OP1   . DT  I  5 32  ? -4.096  4.680   13.164 1.00 74.88  ? -42  DT  I OP1   1 
ATOM   6786  O  OP2   . DT  I  5 32  ? -5.619  2.657   12.875 1.00 74.25  ? -42  DT  I OP2   1 
ATOM   6787  O  "O5'" . DT  I  5 32  ? -4.061  3.297   11.057 1.00 75.99  ? -42  DT  I "O5'" 1 
ATOM   6788  C  "C5'" . DT  I  5 32  ? -2.802  2.885   10.483 1.00 77.50  ? -42  DT  I "C5'" 1 
ATOM   6789  C  "C4'" . DT  I  5 32  ? -2.969  2.641   8.994  1.00 78.47  ? -42  DT  I "C4'" 1 
ATOM   6790  O  "O4'" . DT  I  5 32  ? -3.039  1.214   8.761  1.00 78.10  ? -42  DT  I "O4'" 1 
ATOM   6791  C  "C3'" . DT  I  5 32  ? -4.243  3.257   8.422  1.00 79.87  ? -42  DT  I "C3'" 1 
ATOM   6792  O  "O3'" . DT  I  5 32  ? -3.960  4.049   7.274  1.00 82.74  ? -42  DT  I "O3'" 1 
ATOM   6793  C  "C2'" . DT  I  5 32  ? -5.138  2.067   8.092  1.00 78.87  ? -42  DT  I "C2'" 1 
ATOM   6794  C  "C1'" . DT  I  5 32  ? -4.149  0.919   7.943  1.00 77.89  ? -42  DT  I "C1'" 1 
ATOM   6795  N  N1    . DT  I  5 32  ? -4.750  -0.405  8.321  1.00 77.64  ? -42  DT  I N1    1 
ATOM   6796  C  C2    . DT  I  5 32  ? -4.762  -1.416  7.384  1.00 77.41  ? -42  DT  I C2    1 
ATOM   6797  O  O2    . DT  I  5 32  ? -4.298  -1.303  6.268  1.00 77.58  ? -42  DT  I O2    1 
ATOM   6798  N  N3    . DT  I  5 32  ? -5.342  -2.588  7.800  1.00 77.59  ? -42  DT  I N3    1 
ATOM   6799  C  C4    . DT  I  5 32  ? -5.906  -2.855  9.034  1.00 77.51  ? -42  DT  I C4    1 
ATOM   6800  O  O4    . DT  I  5 32  ? -6.396  -3.947  9.296  1.00 77.49  ? -42  DT  I O4    1 
ATOM   6801  C  C5    . DT  I  5 32  ? -5.874  -1.761  9.975  1.00 77.53  ? -42  DT  I C5    1 
ATOM   6802  C  C7    . DT  I  5 32  ? -6.460  -1.935  11.349 1.00 77.43  ? -42  DT  I C7    1 
ATOM   6803  C  C6    . DT  I  5 32  ? -5.307  -0.604  9.578  1.00 77.77  ? -42  DT  I C6    1 
ATOM   6804  P  P     . DG  I  5 33  ? -5.039  5.096   6.694  1.00 84.95  ? -41  DG  I P     1 
ATOM   6805  O  OP1   . DG  I  5 33  ? -4.327  6.376   6.494  1.00 84.48  ? -41  DG  I OP1   1 
ATOM   6806  O  OP2   . DG  I  5 33  ? -6.258  5.081   7.539  1.00 84.57  ? -41  DG  I OP2   1 
ATOM   6807  O  "O5'" . DG  I  5 33  ? -5.421  4.470   5.260  1.00 86.25  ? -41  DG  I "O5'" 1 
ATOM   6808  C  "C5'" . DG  I  5 33  ? -4.596  3.502   4.596  1.00 88.34  ? -41  DG  I "C5'" 1 
ATOM   6809  C  "C4'" . DG  I  5 33  ? -5.409  2.565   3.709  1.00 90.29  ? -41  DG  I "C4'" 1 
ATOM   6810  O  "O4'" . DG  I  5 33  ? -5.661  1.288   4.361  1.00 89.74  ? -41  DG  I "O4'" 1 
ATOM   6811  C  "C3'" . DG  I  5 33  ? -6.781  3.083   3.286  1.00 92.19  ? -41  DG  I "C3'" 1 
ATOM   6812  O  "O3'" . DG  I  5 33  ? -6.983  2.769   1.913  1.00 96.14  ? -41  DG  I "O3'" 1 
ATOM   6813  C  "C2'" . DG  I  5 33  ? -7.747  2.303   4.168  1.00 91.07  ? -41  DG  I "C2'" 1 
ATOM   6814  C  "C1'" . DG  I  5 33  ? -7.026  0.961   4.179  1.00 89.80  ? -41  DG  I "C1'" 1 
ATOM   6815  N  N9    . DG  I  5 33  ? -7.487  0.033   5.212  1.00 89.59  ? -41  DG  I N9    1 
ATOM   6816  C  C8    . DG  I  5 33  ? -7.715  0.307   6.539  1.00 89.31  ? -41  DG  I C8    1 
ATOM   6817  N  N7    . DG  I  5 33  ? -8.126  -0.728  7.216  1.00 89.37  ? -41  DG  I N7    1 
ATOM   6818  C  C5    . DG  I  5 33  ? -8.181  -1.759  6.285  1.00 89.49  ? -41  DG  I C5    1 
ATOM   6819  C  C6    . DG  I  5 33  ? -8.561  -3.125  6.428  1.00 89.54  ? -41  DG  I C6    1 
ATOM   6820  O  O6    . DG  I  5 33  ? -8.937  -3.722  7.442  1.00 89.37  ? -41  DG  I O6    1 
ATOM   6821  N  N1    . DG  I  5 33  ? -8.479  -3.834  5.233  1.00 89.45  ? -41  DG  I N1    1 
ATOM   6822  C  C2    . DG  I  5 33  ? -8.075  -3.283  4.044  1.00 89.39  ? -41  DG  I C2    1 
ATOM   6823  N  N2    . DG  I  5 33  ? -8.053  -4.115  2.999  1.00 89.51  ? -41  DG  I N2    1 
ATOM   6824  N  N3    . DG  I  5 33  ? -7.714  -2.013  3.889  1.00 89.45  ? -41  DG  I N3    1 
ATOM   6825  C  C4    . DG  I  5 33  ? -7.792  -1.303  5.044  1.00 89.49  ? -41  DG  I C4    1 
ATOM   6826  P  P     . DT  I  5 34  ? -7.604  3.846   0.898  1.00 99.06  ? -40  DT  I P     1 
ATOM   6827  O  OP1   . DT  I  5 34  ? -6.532  4.138   -0.089 1.00 99.16  ? -40  DT  I OP1   1 
ATOM   6828  O  OP2   . DT  I  5 34  ? -8.228  4.944   1.687  1.00 98.85  ? -40  DT  I OP2   1 
ATOM   6829  O  "O5'" . DT  I  5 34  ? -8.793  3.063   0.156  1.00 99.33  ? -40  DT  I "O5'" 1 
ATOM   6830  C  "C5'" . DT  I  5 34  ? -9.595  2.113   0.845  1.00 99.78  ? -40  DT  I "C5'" 1 
ATOM   6831  C  "C4'" . DT  I  5 34  ? -9.864  0.916   -0.055 1.00 100.07 ? -40  DT  I "C4'" 1 
ATOM   6832  O  "O4'" . DT  I  5 34  ? -9.723  -0.324  0.687  1.00 100.12 ? -40  DT  I "O4'" 1 
ATOM   6833  C  "C3'" . DT  I  5 34  ? -11.273 0.864   -0.633 1.00 100.46 ? -40  DT  I "C3'" 1 
ATOM   6834  O  "O3'" . DT  I  5 34  ? -11.285 0.094   -1.847 1.00 100.76 ? -40  DT  I "O3'" 1 
ATOM   6835  C  "C2'" . DT  I  5 34  ? -12.048 0.159   0.477  1.00 100.17 ? -40  DT  I "C2'" 1 
ATOM   6836  C  "C1'" . DT  I  5 34  ? -11.012 -0.837  1.006  1.00 99.72  ? -40  DT  I "C1'" 1 
ATOM   6837  N  N1    . DT  I  5 34  ? -11.112 -1.077  2.484  1.00 99.45  ? -40  DT  I N1    1 
ATOM   6838  C  C2    . DT  I  5 34  ? -11.123 -2.370  2.975  1.00 99.19  ? -40  DT  I C2    1 
ATOM   6839  O  O2    . DT  I  5 34  ? -11.053 -3.366  2.275  1.00 99.31  ? -40  DT  I O2    1 
ATOM   6840  N  N3    . DT  I  5 34  ? -11.218 -2.459  4.341  1.00 99.00  ? -40  DT  I N3    1 
ATOM   6841  C  C4    . DT  I  5 34  ? -11.307 -1.408  5.237  1.00 99.21  ? -40  DT  I C4    1 
ATOM   6842  O  O4    . DT  I  5 34  ? -11.390 -1.603  6.439  1.00 99.37  ? -40  DT  I O4    1 
ATOM   6843  C  C5    . DT  I  5 34  ? -11.292 -0.081  4.666  1.00 99.27  ? -40  DT  I C5    1 
ATOM   6844  C  C7    . DT  I  5 34  ? -11.379 1.145   5.528  1.00 99.22  ? -40  DT  I C7    1 
ATOM   6845  C  C6    . DT  I  5 34  ? -11.198 0.013   3.336  1.00 99.58  ? -40  DT  I C6    1 
ATOM   6846  P  P     . DA  I  5 35  ? -12.602 0.028   -2.764 1.00 100.75 ? -39  DA  I P     1 
ATOM   6847  O  OP1   . DA  I  5 35  ? -12.161 -0.058  -4.174 1.00 100.73 ? -39  DA  I OP1   1 
ATOM   6848  O  OP2   . DA  I  5 35  ? -13.528 1.115   -2.355 1.00 100.31 ? -39  DA  I OP2   1 
ATOM   6849  O  "O5'" . DA  I  5 35  ? -13.245 -1.377  -2.330 1.00 100.32 ? -39  DA  I "O5'" 1 
ATOM   6850  C  "C5'" . DA  I  5 35  ? -12.622 -2.635  -2.628 1.00 99.60  ? -39  DA  I "C5'" 1 
ATOM   6851  C  "C4'" . DA  I  5 35  ? -13.472 -3.793  -2.113 1.00 99.35  ? -39  DA  I "C4'" 1 
ATOM   6852  O  "O4'" . DA  I  5 35  ? -13.405 -3.853  -0.655 1.00 99.28  ? -39  DA  I "O4'" 1 
ATOM   6853  C  "C3'" . DA  I  5 35  ? -14.966 -3.740  -2.476 1.00 98.89  ? -39  DA  I "C3'" 1 
ATOM   6854  O  "O3'" . DA  I  5 35  ? -15.409 -5.010  -3.037 1.00 97.81  ? -39  DA  I "O3'" 1 
ATOM   6855  C  "C2'" . DA  I  5 35  ? -15.633 -3.371  -1.147 1.00 98.79  ? -39  DA  I "C2'" 1 
ATOM   6856  C  "C1'" . DA  I  5 35  ? -14.714 -4.075  -0.152 1.00 98.46  ? -39  DA  I "C1'" 1 
ATOM   6857  N  N9    . DA  I  5 35  ? -14.858 -3.625  1.241  1.00 98.23  ? -39  DA  I N9    1 
ATOM   6858  C  C8    . DA  I  5 35  ? -14.755 -2.349  1.730  1.00 98.14  ? -39  DA  I C8    1 
ATOM   6859  N  N7    . DA  I  5 35  ? -14.937 -2.246  3.025  1.00 97.79  ? -39  DA  I N7    1 
ATOM   6860  C  C5    . DA  I  5 35  ? -15.180 -3.549  3.419  1.00 97.87  ? -39  DA  I C5    1 
ATOM   6861  C  C6    . DA  I  5 35  ? -15.452 -4.125  4.677  1.00 98.07  ? -39  DA  I C6    1 
ATOM   6862  N  N6    . DA  I  5 35  ? -15.522 -3.411  5.803  1.00 98.11  ? -39  DA  I N6    1 
ATOM   6863  N  N1    . DA  I  5 35  ? -15.648 -5.463  4.738  1.00 98.19  ? -39  DA  I N1    1 
ATOM   6864  C  C2    . DA  I  5 35  ? -15.577 -6.180  3.606  1.00 98.07  ? -39  DA  I C2    1 
ATOM   6865  N  N3    . DA  I  5 35  ? -15.328 -5.748  2.366  1.00 98.14  ? -39  DA  I N3    1 
ATOM   6866  C  C4    . DA  I  5 35  ? -15.137 -4.413  2.337  1.00 98.02  ? -39  DA  I C4    1 
ATOM   6867  P  P     . DT  I  5 36  ? -16.948 -5.477  -3.175 1.00 96.96  ? -38  DT  I P     1 
ATOM   6868  O  OP1   . DT  I  5 36  ? -16.998 -6.535  -4.214 1.00 96.59  ? -38  DT  I OP1   1 
ATOM   6869  O  OP2   . DT  I  5 36  ? -17.837 -4.287  -3.272 1.00 96.19  ? -38  DT  I OP2   1 
ATOM   6870  O  "O5'" . DT  I  5 36  ? -17.209 -6.166  -1.749 1.00 96.14  ? -38  DT  I "O5'" 1 
ATOM   6871  C  "C5'" . DT  I  5 36  ? -16.991 -7.569  -1.506 1.00 93.41  ? -38  DT  I "C5'" 1 
ATOM   6872  C  "C4'" . DT  I  5 36  ? -17.862 -8.026  -0.347 1.00 90.90  ? -38  DT  I "C4'" 1 
ATOM   6873  O  "O4'" . DT  I  5 36  ? -17.611 -7.159  0.793  1.00 90.45  ? -38  DT  I "O4'" 1 
ATOM   6874  C  "C3'" . DT  I  5 36  ? -19.363 -7.954  -0.632 1.00 89.66  ? -38  DT  I "C3'" 1 
ATOM   6875  O  "O3'" . DT  I  5 36  ? -20.010 -9.171  -0.232 1.00 87.81  ? -38  DT  I "O3'" 1 
ATOM   6876  C  "C2'" . DT  I  5 36  ? -19.827 -6.737  0.172  1.00 89.84  ? -38  DT  I "C2'" 1 
ATOM   6877  C  "C1'" . DT  I  5 36  ? -18.848 -6.737  1.343  1.00 90.14  ? -38  DT  I "C1'" 1 
ATOM   6878  N  N1    . DT  I  5 36  ? -18.734 -5.406  2.089  1.00 90.13  ? -38  DT  I N1    1 
ATOM   6879  C  C2    . DT  I  5 36  ? -18.857 -5.376  3.475  1.00 89.97  ? -38  DT  I C2    1 
ATOM   6880  O  O2    . DT  I  5 36  ? -19.046 -6.366  4.165  1.00 89.72  ? -38  DT  I O2    1 
ATOM   6881  N  N3    . DT  I  5 36  ? -18.747 -4.124  4.042  1.00 89.80  ? -38  DT  I N3    1 
ATOM   6882  C  C4    . DT  I  5 36  ? -18.532 -2.919  3.390  1.00 89.87  ? -38  DT  I C4    1 
ATOM   6883  O  O4    . DT  I  5 36  ? -18.444 -1.848  3.987  1.00 89.56  ? -38  DT  I O4    1 
ATOM   6884  C  C5    . DT  I  5 36  ? -18.417 -3.018  1.952  1.00 90.06  ? -38  DT  I C5    1 
ATOM   6885  C  C7    . DT  I  5 36  ? -18.185 -1.781  1.132  1.00 90.14  ? -38  DT  I C7    1 
ATOM   6886  C  C6    . DT  I  5 36  ? -18.522 -4.232  1.379  1.00 89.99  ? -38  DT  I C6    1 
ATOM   6887  P  P     . DT  I  5 37  ? -21.604 -9.430  -0.336 1.00 86.25  ? -37  DT  I P     1 
ATOM   6888  O  OP1   . DT  I  5 37  ? -21.793 -10.551 -1.285 1.00 86.64  ? -37  DT  I OP1   1 
ATOM   6889  O  OP2   . DT  I  5 37  ? -22.335 -8.155  -0.537 1.00 85.70  ? -37  DT  I OP2   1 
ATOM   6890  O  "O5'" . DT  I  5 37  ? -21.985 -9.984  1.122  1.00 84.42  ? -37  DT  I "O5'" 1 
ATOM   6891  C  "C5'" . DT  I  5 37  ? -20.985 -10.358 2.099  1.00 80.03  ? -37  DT  I "C5'" 1 
ATOM   6892  C  "C4'" . DT  I  5 37  ? -21.430 -9.985  3.503  1.00 76.37  ? -37  DT  I "C4'" 1 
ATOM   6893  O  "O4'" . DT  I  5 37  ? -21.113 -8.593  3.762  1.00 75.73  ? -37  DT  I "O4'" 1 
ATOM   6894  C  "C3'" . DT  I  5 37  ? -22.931 -10.146 3.746  1.00 74.21  ? -37  DT  I "C3'" 1 
ATOM   6895  O  "O3'" . DT  I  5 37  ? -23.122 -10.976 4.876  1.00 71.27  ? -37  DT  I "O3'" 1 
ATOM   6896  C  "C2'" . DT  I  5 37  ? -23.449 -8.724  3.964  1.00 74.31  ? -37  DT  I "C2'" 1 
ATOM   6897  C  "C1'" . DT  I  5 37  ? -22.196 -8.011  4.462  1.00 75.23  ? -37  DT  I "C1'" 1 
ATOM   6898  N  N1    . DT  I  5 37  ? -22.179 -6.510  4.305  1.00 75.03  ? -37  DT  I N1    1 
ATOM   6899  C  C2    . DT  I  5 37  ? -22.182 -5.718  5.437  1.00 75.10  ? -37  DT  I C2    1 
ATOM   6900  O  O2    . DT  I  5 37  ? -22.206 -6.143  6.577  1.00 75.74  ? -37  DT  I O2    1 
ATOM   6901  N  N3    . DT  I  5 37  ? -22.161 -4.371  5.210  1.00 74.75  ? -37  DT  I N3    1 
ATOM   6902  C  C4    . DT  I  5 37  ? -22.135 -3.731  3.998  1.00 75.05  ? -37  DT  I C4    1 
ATOM   6903  O  O4    . DT  I  5 37  ? -22.121 -2.507  3.949  1.00 75.07  ? -37  DT  I O4    1 
ATOM   6904  C  C5    . DT  I  5 37  ? -22.134 -4.605  2.840  1.00 75.51  ? -37  DT  I C5    1 
ATOM   6905  C  C7    . DT  I  5 37  ? -22.110 -4.050  1.446  1.00 75.27  ? -37  DT  I C7    1 
ATOM   6906  C  C6    . DT  I  5 37  ? -22.154 -5.934  3.048  1.00 75.44  ? -37  DT  I C6    1 
ATOM   6907  P  P     . DT  I  5 38  ? -24.503 -11.735 5.176  1.00 69.40  ? -36  DT  I P     1 
ATOM   6908  O  OP1   . DT  I  5 38  ? -24.145 -13.132 5.525  1.00 68.55  ? -36  DT  I OP1   1 
ATOM   6909  O  OP2   . DT  I  5 38  ? -25.482 -11.439 4.108  1.00 68.77  ? -36  DT  I OP2   1 
ATOM   6910  O  "O5'" . DT  I  5 38  ? -25.061 -10.997 6.482  1.00 67.56  ? -36  DT  I "O5'" 1 
ATOM   6911  C  "C5'" . DT  I  5 38  ? -24.235 -10.809 7.630  1.00 63.82  ? -36  DT  I "C5'" 1 
ATOM   6912  C  "C4'" . DT  I  5 38  ? -24.776 -9.693  8.502  1.00 61.31  ? -36  DT  I "C4'" 1 
ATOM   6913  O  "O4'" . DT  I  5 38  ? -24.506 -8.399  7.905  1.00 60.40  ? -36  DT  I "O4'" 1 
ATOM   6914  C  "C3'" . DT  I  5 38  ? -26.281 -9.755  8.759  1.00 59.77  ? -36  DT  I "C3'" 1 
ATOM   6915  O  "O3'" . DT  I  5 38  ? -26.516 -9.773  10.173 1.00 57.94  ? -36  DT  I "O3'" 1 
ATOM   6916  C  "C2'" . DT  I  5 38  ? -26.813 -8.479  8.103  1.00 59.67  ? -36  DT  I "C2'" 1 
ATOM   6917  C  "C1'" . DT  I  5 38  ? -25.599 -7.565  8.208  1.00 60.62  ? -36  DT  I "C1'" 1 
ATOM   6918  N  N1    . DT  I  5 38  ? -25.601 -6.398  7.278  1.00 60.93  ? -36  DT  I N1    1 
ATOM   6919  C  C2    . DT  I  5 38  ? -25.613 -5.123  7.803  1.00 61.57  ? -36  DT  I C2    1 
ATOM   6920  O  O2    . DT  I  5 38  ? -25.630 -4.870  8.984  1.00 61.79  ? -36  DT  I O2    1 
ATOM   6921  N  N3    . DT  I  5 38  ? -25.617 -4.112  6.884  1.00 62.26  ? -36  DT  I N3    1 
ATOM   6922  C  C4    . DT  I  5 38  ? -25.607 -4.233  5.508  1.00 61.59  ? -36  DT  I C4    1 
ATOM   6923  O  O4    . DT  I  5 38  ? -25.609 -3.232  4.796  1.00 61.19  ? -36  DT  I O4    1 
ATOM   6924  C  C5    . DT  I  5 38  ? -25.593 -5.597  5.010  1.00 61.59  ? -36  DT  I C5    1 
ATOM   6925  C  C7    . DT  I  5 38  ? -25.582 -5.889  3.536  1.00 61.40  ? -36  DT  I C7    1 
ATOM   6926  C  C6    . DT  I  5 38  ? -25.590 -6.594  5.908  1.00 61.32  ? -36  DT  I C6    1 
ATOM   6927  P  P     . DG  I  5 39  ? -26.566 -11.130 11.025 1.00 56.05  ? -35  DG  I P     1 
ATOM   6928  O  OP1   . DG  I  5 39  ? -25.362 -11.946 10.759 1.00 54.74  ? -35  DG  I OP1   1 
ATOM   6929  O  OP2   . DG  I  5 39  ? -27.916 -11.712 10.879 1.00 55.52  ? -35  DG  I OP2   1 
ATOM   6930  O  "O5'" . DG  I  5 39  ? -26.481 -10.566 12.518 1.00 55.62  ? -35  DG  I "O5'" 1 
ATOM   6931  C  "C5'" . DG  I  5 39  ? -25.255 -10.155 13.095 1.00 53.88  ? -35  DG  I "C5'" 1 
ATOM   6932  C  "C4'" . DG  I  5 39  ? -25.438 -8.833  13.820 1.00 53.28  ? -35  DG  I "C4'" 1 
ATOM   6933  O  "O4'" . DG  I  5 39  ? -25.777 -7.802  12.859 1.00 53.52  ? -35  DG  I "O4'" 1 
ATOM   6934  C  "C3'" . DG  I  5 39  ? -26.509 -8.811  14.909 1.00 52.02  ? -35  DG  I "C3'" 1 
ATOM   6935  O  "O3'" . DG  I  5 39  ? -25.985 -8.240  16.104 1.00 49.27  ? -35  DG  I "O3'" 1 
ATOM   6936  C  "C2'" . DG  I  5 39  ? -27.623 -7.948  14.331 1.00 53.37  ? -35  DG  I "C2'" 1 
ATOM   6937  C  "C1'" . DG  I  5 39  ? -26.903 -7.080  13.304 1.00 55.64  ? -35  DG  I "C1'" 1 
ATOM   6938  N  N9    . DG  I  5 39  ? -27.710 -6.809  12.116 1.00 56.80  ? -35  DG  I N9    1 
ATOM   6939  C  C8    . DG  I  5 39  ? -28.463 -7.719  11.395 1.00 56.71  ? -35  DG  I C8    1 
ATOM   6940  N  N7    . DG  I  5 39  ? -29.081 -7.191  10.371 1.00 56.87  ? -35  DG  I N7    1 
ATOM   6941  C  C5    . DG  I  5 39  ? -28.705 -5.851  10.408 1.00 57.20  ? -35  DG  I C5    1 
ATOM   6942  C  C6    . DG  I  5 39  ? -29.055 -4.784  9.549  1.00 56.80  ? -35  DG  I C6    1 
ATOM   6943  O  O6    . DG  I  5 39  ? -29.800 -4.829  8.561  1.00 56.94  ? -35  DG  I O6    1 
ATOM   6944  N  N1    . DG  I  5 39  ? -28.471 -3.579  9.936  1.00 56.36  ? -35  DG  I N1    1 
ATOM   6945  C  C2    . DG  I  5 39  ? -27.641 -3.428  11.020 1.00 56.21  ? -35  DG  I C2    1 
ATOM   6946  N  N2    . DG  I  5 39  ? -27.161 -2.201  11.246 1.00 56.40  ? -35  DG  I N2    1 
ATOM   6947  N  N3    . DG  I  5 39  ? -27.303 -4.416  11.837 1.00 56.80  ? -35  DG  I N3    1 
ATOM   6948  C  C4    . DG  I  5 39  ? -27.867 -5.596  11.477 1.00 57.24  ? -35  DG  I C4    1 
ATOM   6949  P  P     . DG  I  5 40  ? -26.746 -8.380  17.504 1.00 47.31  ? -34  DG  I P     1 
ATOM   6950  O  OP1   . DG  I  5 40  ? -25.702 -8.255  18.541 1.00 47.81  ? -34  DG  I OP1   1 
ATOM   6951  O  OP2   . DG  I  5 40  ? -27.623 -9.566  17.472 1.00 46.07  ? -34  DG  I OP2   1 
ATOM   6952  O  "O5'" . DG  I  5 40  ? -27.682 -7.091  17.561 1.00 47.10  ? -34  DG  I "O5'" 1 
ATOM   6953  C  "C5'" . DG  I  5 40  ? -27.135 -5.790  17.353 1.00 47.92  ? -34  DG  I "C5'" 1 
ATOM   6954  C  "C4'" . DG  I  5 40  ? -28.213 -4.772  17.016 1.00 49.43  ? -34  DG  I "C4'" 1 
ATOM   6955  O  "O4'" . DG  I  5 40  ? -28.672 -4.973  15.656 1.00 51.07  ? -34  DG  I "O4'" 1 
ATOM   6956  C  "C3'" . DG  I  5 40  ? -29.483 -4.817  17.861 1.00 50.32  ? -34  DG  I "C3'" 1 
ATOM   6957  O  "O3'" . DG  I  5 40  ? -29.930 -3.511  18.037 1.00 51.63  ? -34  DG  I "O3'" 1 
ATOM   6958  C  "C2'" . DG  I  5 40  ? -30.484 -5.557  16.992 1.00 50.68  ? -34  DG  I "C2'" 1 
ATOM   6959  C  "C1'" . DG  I  5 40  ? -30.086 -4.936  15.663 1.00 51.22  ? -34  DG  I "C1'" 1 
ATOM   6960  N  N9    . DG  I  5 40  ? -30.659 -5.540  14.457 1.00 51.60  ? -34  DG  I N9    1 
ATOM   6961  C  C8    . DG  I  5 40  ? -31.098 -6.829  14.230 1.00 51.50  ? -34  DG  I C8    1 
ATOM   6962  N  N7    . DG  I  5 40  ? -31.573 -7.019  13.033 1.00 51.18  ? -34  DG  I N7    1 
ATOM   6963  C  C5    . DG  I  5 40  ? -31.439 -5.774  12.432 1.00 51.46  ? -34  DG  I C5    1 
ATOM   6964  C  C6    . DG  I  5 40  ? -31.776 -5.342  11.133 1.00 50.95  ? -34  DG  I C6    1 
ATOM   6965  O  O6    . DG  I  5 40  ? -32.270 -6.010  10.227 1.00 51.54  ? -34  DG  I O6    1 
ATOM   6966  N  N1    . DG  I  5 40  ? -31.483 -4.000  10.926 1.00 50.85  ? -34  DG  I N1    1 
ATOM   6967  C  C2    . DG  I  5 40  ? -30.933 -3.167  11.869 1.00 51.43  ? -34  DG  I C2    1 
ATOM   6968  N  N2    . DG  I  5 40  ? -30.718 -1.899  11.515 1.00 51.57  ? -34  DG  I N2    1 
ATOM   6969  N  N3    . DG  I  5 40  ? -30.600 -3.550  13.091 1.00 52.06  ? -34  DG  I N3    1 
ATOM   6970  C  C4    . DG  I  5 40  ? -30.883 -4.860  13.294 1.00 51.69  ? -34  DG  I C4    1 
ATOM   6971  P  P     . DA  I  5 41  ? -29.962 -2.901  19.505 1.00 54.35  ? -33  DA  I P     1 
ATOM   6972  O  OP1   . DA  I  5 41  ? -28.608 -3.134  20.063 1.00 54.90  ? -33  DA  I OP1   1 
ATOM   6973  O  OP2   . DA  I  5 41  ? -31.182 -3.388  20.198 1.00 53.21  ? -33  DA  I OP2   1 
ATOM   6974  O  "O5'" . DA  I  5 41  ? -30.112 -1.320  19.282 1.00 54.89  ? -33  DA  I "O5'" 1 
ATOM   6975  C  "C5'" . DA  I  5 41  ? -29.338 -0.602  18.311 1.00 55.74  ? -33  DA  I "C5'" 1 
ATOM   6976  C  "C4'" . DA  I  5 41  ? -30.180 0.439   17.577 1.00 56.61  ? -33  DA  I "C4'" 1 
ATOM   6977  O  "O4'" . DA  I  5 41  ? -30.833 -0.151  16.428 1.00 55.90  ? -33  DA  I "O4'" 1 
ATOM   6978  C  "C3'" . DA  I  5 41  ? -31.300 1.122   18.366 1.00 58.07  ? -33  DA  I "C3'" 1 
ATOM   6979  O  "O3'" . DA  I  5 41  ? -31.245 2.505   18.022 1.00 61.02  ? -33  DA  I "O3'" 1 
ATOM   6980  C  "C2'" . DA  I  5 41  ? -32.579 0.396   17.926 1.00 56.36  ? -33  DA  I "C2'" 1 
ATOM   6981  C  "C1'" . DA  I  5 41  ? -32.238 0.065   16.478 1.00 55.50  ? -33  DA  I "C1'" 1 
ATOM   6982  N  N9    . DA  I  5 41  ? -32.834 -1.140  15.901 1.00 55.24  ? -33  DA  I N9    1 
ATOM   6983  C  C8    . DA  I  5 41  ? -33.049 -2.348  16.506 1.00 55.07  ? -33  DA  I C8    1 
ATOM   6984  N  N7    . DA  I  5 41  ? -33.572 -3.255  15.717 1.00 54.78  ? -33  DA  I N7    1 
ATOM   6985  C  C5    . DA  I  5 41  ? -33.704 -2.601  14.506 1.00 54.74  ? -33  DA  I C5    1 
ATOM   6986  C  C6    . DA  I  5 41  ? -34.195 -3.008  13.253 1.00 54.60  ? -33  DA  I C6    1 
ATOM   6987  N  N6    . DA  I  5 41  ? -34.672 -4.223  13.002 1.00 54.89  ? -33  DA  I N6    1 
ATOM   6988  N  N1    . DA  I  5 41  ? -34.184 -2.111  12.254 1.00 55.29  ? -33  DA  I N1    1 
ATOM   6989  C  C2    . DA  I  5 41  ? -33.711 -0.879  12.486 1.00 55.05  ? -33  DA  I C2    1 
ATOM   6990  N  N3    . DA  I  5 41  ? -33.222 -0.379  13.615 1.00 55.13  ? -33  DA  I N3    1 
ATOM   6991  C  C4    . DA  I  5 41  ? -33.248 -1.299  14.598 1.00 55.16  ? -33  DA  I C4    1 
ATOM   6992  P  P     . DA  I  5 42  ? -32.343 3.590   18.436 1.00 63.58  ? -32  DA  I P     1 
ATOM   6993  O  OP1   . DA  I  5 42  ? -31.699 4.911   18.289 1.00 63.93  ? -32  DA  I OP1   1 
ATOM   6994  O  OP2   . DA  I  5 42  ? -32.986 3.194   19.707 1.00 63.42  ? -32  DA  I OP2   1 
ATOM   6995  O  "O5'" . DA  I  5 42  ? -33.429 3.450   17.273 1.00 65.62  ? -32  DA  I "O5'" 1 
ATOM   6996  C  "C5'" . DA  I  5 42  ? -33.123 3.794   15.917 1.00 67.88  ? -32  DA  I "C5'" 1 
ATOM   6997  C  "C4'" . DA  I  5 42  ? -34.408 3.846   15.107 1.00 69.41  ? -32  DA  I "C4'" 1 
ATOM   6998  O  "O4'" . DA  I  5 42  ? -34.814 2.509   14.722 1.00 69.76  ? -32  DA  I "O4'" 1 
ATOM   6999  C  "C3'" . DA  I  5 42  ? -35.582 4.447   15.866 1.00 70.26  ? -32  DA  I "C3'" 1 
ATOM   7000  O  "O3'" . DA  I  5 42  ? -36.129 5.506   15.104 1.00 72.23  ? -32  DA  I "O3'" 1 
ATOM   7001  C  "C2'" . DA  I  5 42  ? -36.573 3.299   16.060 1.00 69.87  ? -32  DA  I "C2'" 1 
ATOM   7002  C  "C1'" . DA  I  5 42  ? -36.195 2.336   14.945 1.00 69.57  ? -32  DA  I "C1'" 1 
ATOM   7003  N  N9    . DA  I  5 42  ? -36.387 0.931   15.276 1.00 69.61  ? -32  DA  I N9    1 
ATOM   7004  C  C8    . DA  I  5 42  ? -36.230 0.329   16.493 1.00 69.55  ? -32  DA  I C8    1 
ATOM   7005  N  N7    . DA  I  5 42  ? -36.468 -0.962  16.483 1.00 69.68  ? -32  DA  I N7    1 
ATOM   7006  C  C5    . DA  I  5 42  ? -36.800 -1.233  15.167 1.00 69.74  ? -32  DA  I C5    1 
ATOM   7007  C  C6    . DA  I  5 42  ? -37.161 -2.421  14.485 1.00 69.53  ? -32  DA  I C6    1 
ATOM   7008  N  N6    . DA  I  5 42  ? -37.255 -3.614  15.074 1.00 69.41  ? -32  DA  I N6    1 
ATOM   7009  N  N1    . DA  I  5 42  ? -37.430 -2.343  13.161 1.00 69.50  ? -32  DA  I N1    1 
ATOM   7010  C  C2    . DA  I  5 42  ? -37.348 -1.148  12.561 1.00 69.73  ? -32  DA  I C2    1 
ATOM   7011  N  N3    . DA  I  5 42  ? -37.019 0.035   13.095 1.00 70.03  ? -32  DA  I N3    1 
ATOM   7012  C  C4    . DA  I  5 42  ? -36.753 -0.073  14.410 1.00 69.95  ? -32  DA  I C4    1 
ATOM   7013  P  P     . DA  I  5 43  ? -37.072 6.587   15.817 1.00 74.09  ? -31  DA  I P     1 
ATOM   7014  O  OP1   . DA  I  5 43  ? -36.723 7.914   15.254 1.00 73.40  ? -31  DA  I OP1   1 
ATOM   7015  O  OP2   . DA  I  5 43  ? -36.980 6.364   17.284 1.00 73.61  ? -31  DA  I OP2   1 
ATOM   7016  O  "O5'" . DA  I  5 43  ? -38.551 6.157   15.349 1.00 73.89  ? -31  DA  I "O5'" 1 
ATOM   7017  C  "C5'" . DA  I  5 43  ? -38.907 6.037   13.975 1.00 74.29  ? -31  DA  I "C5'" 1 
ATOM   7018  C  "C4'" . DA  I  5 43  ? -40.038 5.039   13.757 1.00 75.24  ? -31  DA  I "C4'" 1 
ATOM   7019  O  "O4'" . DA  I  5 43  ? -39.622 3.705   14.144 1.00 74.65  ? -31  DA  I "O4'" 1 
ATOM   7020  C  "C3'" . DA  I  5 43  ? -41.350 5.297   14.507 1.00 76.15  ? -31  DA  I "C3'" 1 
ATOM   7021  O  "O3'" . DA  I  5 43  ? -42.346 5.693   13.558 1.00 78.48  ? -31  DA  I "O3'" 1 
ATOM   7022  C  "C2'" . DA  I  5 43  ? -41.695 3.960   15.172 1.00 75.04  ? -31  DA  I "C2'" 1 
ATOM   7023  C  "C1'" . DA  I  5 43  ? -40.790 2.969   14.447 1.00 73.81  ? -31  DA  I "C1'" 1 
ATOM   7024  N  N9    . DA  I  5 43  ? -40.403 1.807   15.247 1.00 73.60  ? -31  DA  I N9    1 
ATOM   7025  C  C8    . DA  I  5 43  ? -39.751 1.830   16.453 1.00 73.18  ? -31  DA  I C8    1 
ATOM   7026  N  N7    . DA  I  5 43  ? -39.518 0.643   16.958 1.00 73.07  ? -31  DA  I N7    1 
ATOM   7027  C  C5    . DA  I  5 43  ? -40.049 -0.223  16.020 1.00 73.01  ? -31  DA  I C5    1 
ATOM   7028  C  C6    . DA  I  5 43  ? -40.122 -1.628  15.972 1.00 73.12  ? -31  DA  I C6    1 
ATOM   7029  N  N6    . DA  I  5 43  ? -39.624 -2.391  16.944 1.00 73.01  ? -31  DA  I N6    1 
ATOM   7030  N  N1    . DA  I  5 43  ? -40.723 -2.207  14.899 1.00 73.44  ? -31  DA  I N1    1 
ATOM   7031  C  C2    . DA  I  5 43  ? -41.218 -1.413  13.933 1.00 73.03  ? -31  DA  I C2    1 
ATOM   7032  N  N3    . DA  I  5 43  ? -41.208 -0.075  13.874 1.00 72.91  ? -31  DA  I N3    1 
ATOM   7033  C  C4    . DA  I  5 43  ? -40.604 0.470   14.954 1.00 73.23  ? -31  DA  I C4    1 
ATOM   7034  P  P     . DC  I  5 44  ? -43.851 6.086   13.958 1.00 80.38  ? -30  DC  I P     1 
ATOM   7035  O  OP1   . DC  I  5 44  ? -44.378 7.006   12.920 1.00 80.65  ? -30  DC  I OP1   1 
ATOM   7036  O  OP2   . DC  I  5 44  ? -43.885 6.483   15.389 1.00 80.43  ? -30  DC  I OP2   1 
ATOM   7037  O  "O5'" . DC  I  5 44  ? -44.618 4.696   13.818 1.00 80.73  ? -30  DC  I "O5'" 1 
ATOM   7038  C  "C5'" . DC  I  5 44  ? -44.764 4.046   12.565 1.00 81.96  ? -30  DC  I "C5'" 1 
ATOM   7039  C  "C4'" . DC  I  5 44  ? -45.499 2.740   12.803 1.00 83.18  ? -30  DC  I "C4'" 1 
ATOM   7040  O  "O4'" . DC  I  5 44  ? -44.612 1.826   13.510 1.00 83.28  ? -30  DC  I "O4'" 1 
ATOM   7041  C  "C3'" . DC  I  5 44  ? -46.762 2.876   13.665 1.00 83.43  ? -30  DC  I "C3'" 1 
ATOM   7042  O  "O3'" . DC  I  5 44  ? -47.878 2.187   13.076 1.00 84.35  ? -30  DC  I "O3'" 1 
ATOM   7043  C  "C2'" . DC  I  5 44  ? -46.341 2.264   15.001 1.00 82.95  ? -30  DC  I "C2'" 1 
ATOM   7044  C  "C1'" . DC  I  5 44  ? -45.386 1.185   14.505 1.00 81.97  ? -30  DC  I "C1'" 1 
ATOM   7045  N  N1    . DC  I  5 44  ? -44.536 0.556   15.565 1.00 81.22  ? -30  DC  I N1    1 
ATOM   7046  C  C2    . DC  I  5 44  ? -44.300 -0.826  15.487 1.00 80.81  ? -30  DC  I C2    1 
ATOM   7047  O  O2    . DC  I  5 44  ? -44.781 -1.468  14.549 1.00 80.53  ? -30  DC  I O2    1 
ATOM   7048  N  N3    . DC  I  5 44  ? -43.545 -1.425  16.443 1.00 80.53  ? -30  DC  I N3    1 
ATOM   7049  C  C4    . DC  I  5 44  ? -43.042 -0.696  17.443 1.00 80.91  ? -30  DC  I C4    1 
ATOM   7050  N  N4    . DC  I  5 44  ? -42.303 -1.338  18.354 1.00 80.91  ? -30  DC  I N4    1 
ATOM   7051  C  C5    . DC  I  5 44  ? -43.270 0.716   17.545 1.00 80.59  ? -30  DC  I C5    1 
ATOM   7052  C  C6    . DC  I  5 44  ? -44.018 1.297   16.595 1.00 80.64  ? -30  DC  I C6    1 
ATOM   7053  P  P     . DT  I  5 45  ? -49.319 2.137   13.799 1.00 85.29  ? -29  DT  I P     1 
ATOM   7054  O  OP1   . DT  I  5 45  ? -50.353 1.999   12.747 1.00 85.25  ? -29  DT  I OP1   1 
ATOM   7055  O  OP2   . DT  I  5 45  ? -49.413 3.221   14.813 1.00 84.15  ? -29  DT  I OP2   1 
ATOM   7056  O  "O5'" . DT  I  5 45  ? -49.248 0.740   14.554 1.00 84.72  ? -29  DT  I "O5'" 1 
ATOM   7057  C  "C5'" . DT  I  5 45  ? -49.251 -0.466  13.810 1.00 84.46  ? -29  DT  I "C5'" 1 
ATOM   7058  C  "C4'" . DT  I  5 45  ? -49.515 -1.607  14.769 1.00 84.45  ? -29  DT  I "C4'" 1 
ATOM   7059  O  "O4'" . DT  I  5 45  ? -48.416 -1.736  15.712 1.00 84.25  ? -29  DT  I "O4'" 1 
ATOM   7060  C  "C3'" . DT  I  5 45  ? -50.772 -1.450  15.618 1.00 84.32  ? -29  DT  I "C3'" 1 
ATOM   7061  O  "O3'" . DT  I  5 45  ? -51.369 -2.723  15.668 1.00 84.19  ? -29  DT  I "O3'" 1 
ATOM   7062  C  "C2'" . DT  I  5 45  ? -50.244 -1.010  16.987 1.00 84.26  ? -29  DT  I "C2'" 1 
ATOM   7063  C  "C1'" . DT  I  5 45  ? -48.940 -1.808  17.029 1.00 83.79  ? -29  DT  I "C1'" 1 
ATOM   7064  N  N1    . DT  I  5 45  ? -47.864 -1.407  18.022 1.00 83.51  ? -29  DT  I N1    1 
ATOM   7065  C  C2    . DT  I  5 45  ? -47.013 -2.402  18.479 1.00 83.41  ? -29  DT  I C2    1 
ATOM   7066  O  O2    . DT  I  5 45  ? -47.098 -3.572  18.129 1.00 83.20  ? -29  DT  I O2    1 
ATOM   7067  N  N3    . DT  I  5 45  ? -46.049 -1.975  19.366 1.00 83.31  ? -29  DT  I N3    1 
ATOM   7068  C  C4    . DT  I  5 45  ? -45.849 -0.685  19.837 1.00 83.43  ? -29  DT  I C4    1 
ATOM   7069  O  O4    . DT  I  5 45  ? -44.953 -0.415  20.638 1.00 83.16  ? -29  DT  I O4    1 
ATOM   7070  C  C5    . DT  I  5 45  ? -46.770 0.308   19.320 1.00 83.36  ? -29  DT  I C5    1 
ATOM   7071  C  C7    . DT  I  5 45  ? -46.658 1.743   19.752 1.00 83.25  ? -29  DT  I C7    1 
ATOM   7072  C  C6    . DT  I  5 45  ? -47.716 -0.094  18.448 1.00 83.29  ? -29  DT  I C6    1 
ATOM   7073  P  P     . DG  I  5 46  ? -52.929 -2.904  15.431 1.00 83.37  ? -28  DG  I P     1 
ATOM   7074  O  OP1   . DG  I  5 46  ? -53.300 -1.983  14.334 1.00 83.07  ? -28  DG  I OP1   1 
ATOM   7075  O  OP2   . DG  I  5 46  ? -53.586 -2.773  16.756 1.00 82.85  ? -28  DG  I OP2   1 
ATOM   7076  O  "O5'" . DG  I  5 46  ? -53.066 -4.433  14.940 1.00 82.76  ? -28  DG  I "O5'" 1 
ATOM   7077  C  "C5'" . DG  I  5 46  ? -51.949 -5.322  14.770 1.00 82.46  ? -28  DG  I "C5'" 1 
ATOM   7078  C  "C4'" . DG  I  5 46  ? -51.797 -6.364  15.884 1.00 82.63  ? -28  DG  I "C4'" 1 
ATOM   7079  O  "O4'" . DG  I  5 46  ? -50.879 -5.888  16.908 1.00 82.76  ? -28  DG  I "O4'" 1 
ATOM   7080  C  "C3'" . DG  I  5 46  ? -53.037 -6.809  16.667 1.00 82.76  ? -28  DG  I "C3'" 1 
ATOM   7081  O  "O3'" . DG  I  5 46  ? -52.886 -8.178  17.067 1.00 83.02  ? -28  DG  I "O3'" 1 
ATOM   7082  C  "C2'" . DG  I  5 46  ? -53.014 -5.892  17.888 1.00 82.41  ? -28  DG  I "C2'" 1 
ATOM   7083  C  "C1'" . DG  I  5 46  ? -51.516 -5.938  18.176 1.00 81.95  ? -28  DG  I "C1'" 1 
ATOM   7084  N  N9    . DG  I  5 46  ? -50.972 -4.869  19.014 1.00 81.80  ? -28  DG  I N9    1 
ATOM   7085  C  C8    . DG  I  5 46  ? -51.309 -3.535  19.040 1.00 81.57  ? -28  DG  I C8    1 
ATOM   7086  N  N7    . DG  I  5 46  ? -50.621 -2.838  19.904 1.00 81.65  ? -28  DG  I N7    1 
ATOM   7087  C  C5    . DG  I  5 46  ? -49.768 -3.768  20.493 1.00 81.87  ? -28  DG  I C5    1 
ATOM   7088  C  C6    . DG  I  5 46  ? -48.781 -3.617  21.507 1.00 81.64  ? -28  DG  I C6    1 
ATOM   7089  O  O6    . DG  I  5 46  ? -48.443 -2.589  22.114 1.00 81.42  ? -28  DG  I O6    1 
ATOM   7090  N  N1    . DG  I  5 46  ? -48.155 -4.830  21.800 1.00 81.55  ? -28  DG  I N1    1 
ATOM   7091  C  C2    . DG  I  5 46  ? -48.444 -6.033  21.195 1.00 81.50  ? -28  DG  I C2    1 
ATOM   7092  N  N2    . DG  I  5 46  ? -47.746 -7.101  21.594 1.00 81.66  ? -28  DG  I N2    1 
ATOM   7093  N  N3    . DG  I  5 46  ? -49.355 -6.189  20.250 1.00 81.61  ? -28  DG  I N3    1 
ATOM   7094  C  C4    . DG  I  5 46  ? -49.976 -5.021  19.950 1.00 81.85  ? -28  DG  I C4    1 
ATOM   7095  P  P     . DC  I  5 47  ? -54.143 -9.080  17.514 1.00 83.41  ? -27  DC  I P     1 
ATOM   7096  O  OP1   . DC  I  5 47  ? -54.267 -10.159 16.509 1.00 83.24  ? -27  DC  I OP1   1 
ATOM   7097  O  OP2   . DC  I  5 47  ? -55.294 -8.206  17.849 1.00 82.62  ? -27  DC  I OP2   1 
ATOM   7098  O  "O5'" . DC  I  5 47  ? -53.700 -9.752  18.892 1.00 82.63  ? -27  DC  I "O5'" 1 
ATOM   7099  C  "C5'" . DC  I  5 47  ? -52.428 -10.368 19.100 1.00 81.01  ? -27  DC  I "C5'" 1 
ATOM   7100  C  "C4'" . DC  I  5 47  ? -52.180 -10.457 20.598 1.00 79.27  ? -27  DC  I "C4'" 1 
ATOM   7101  O  "O4'" . DC  I  5 47  ? -51.771 -9.146  21.079 1.00 78.65  ? -27  DC  I "O4'" 1 
ATOM   7102  C  "C3'" . DC  I  5 47  ? -53.399 -10.862 21.431 1.00 78.08  ? -27  DC  I "C3'" 1 
ATOM   7103  O  "O3'" . DC  I  5 47  ? -52.996 -11.594 22.571 1.00 77.48  ? -27  DC  I "O3'" 1 
ATOM   7104  C  "C2'" . DC  I  5 47  ? -53.937 -9.506  21.874 1.00 78.18  ? -27  DC  I "C2'" 1 
ATOM   7105  C  "C1'" . DC  I  5 47  ? -52.627 -8.764  22.141 1.00 77.93  ? -27  DC  I "C1'" 1 
ATOM   7106  N  N1    . DC  I  5 47  ? -52.713 -7.261  22.255 1.00 77.47  ? -27  DC  I N1    1 
ATOM   7107  C  C2    . DC  I  5 47  ? -51.773 -6.562  23.029 1.00 77.62  ? -27  DC  I C2    1 
ATOM   7108  O  O2    . DC  I  5 47  ? -50.871 -7.178  23.609 1.00 77.50  ? -27  DC  I O2    1 
ATOM   7109  N  N3    . DC  I  5 47  ? -51.870 -5.207  23.123 1.00 78.12  ? -27  DC  I N3    1 
ATOM   7110  C  C4    . DC  I  5 47  ? -52.844 -4.547  22.490 1.00 77.87  ? -27  DC  I C4    1 
ATOM   7111  N  N4    . DC  I  5 47  ? -52.894 -3.217  22.616 1.00 77.50  ? -27  DC  I N4    1 
ATOM   7112  C  C5    . DC  I  5 47  ? -53.808 -5.236  21.698 1.00 77.77  ? -27  DC  I C5    1 
ATOM   7113  C  C6    . DC  I  5 47  ? -53.703 -6.570  21.615 1.00 77.78  ? -27  DC  I C6    1 
ATOM   7114  P  P     . DT  I  5 48  ? -53.281 -13.155 22.799 1.00 76.93  ? -26  DT  I P     1 
ATOM   7115  O  OP1   . DT  I  5 48  ? -52.688 -13.953 21.696 1.00 76.29  ? -26  DT  I OP1   1 
ATOM   7116  O  OP2   . DT  I  5 48  ? -54.704 -13.302 23.176 1.00 76.38  ? -26  DT  I OP2   1 
ATOM   7117  O  "O5'" . DT  I  5 48  ? -52.385 -13.395 24.103 1.00 76.05  ? -26  DT  I "O5'" 1 
ATOM   7118  C  "C5'" . DT  I  5 48  ? -50.958 -13.343 23.994 1.00 74.03  ? -26  DT  I "C5'" 1 
ATOM   7119  C  "C4'" . DT  I  5 48  ? -50.330 -12.600 25.160 1.00 72.65  ? -26  DT  I "C4'" 1 
ATOM   7120  O  "O4'" . DT  I  5 48  ? -50.704 -11.192 25.137 1.00 72.61  ? -26  DT  I "O4'" 1 
ATOM   7121  C  "C3'" . DT  I  5 48  ? -50.707 -13.121 26.545 1.00 71.25  ? -26  DT  I "C3'" 1 
ATOM   7122  O  "O3'" . DT  I  5 48  ? -49.478 -13.282 27.275 1.00 68.79  ? -26  DT  I "O3'" 1 
ATOM   7123  C  "C2'" . DT  I  5 48  ? -51.630 -12.027 27.098 1.00 71.33  ? -26  DT  I "C2'" 1 
ATOM   7124  C  "C1'" . DT  I  5 48  ? -51.052 -10.773 26.441 1.00 71.92  ? -26  DT  I "C1'" 1 
ATOM   7125  N  N1    . DT  I  5 48  ? -51.926 -9.545  26.322 1.00 71.93  ? -26  DT  I N1    1 
ATOM   7126  C  C2    . DT  I  5 48  ? -51.445 -8.321  26.761 1.00 72.20  ? -26  DT  I C2    1 
ATOM   7127  O  O2    . DT  I  5 48  ? -50.352 -8.145  27.269 1.00 72.54  ? -26  DT  I O2    1 
ATOM   7128  N  N3    . DT  I  5 48  ? -52.302 -7.264  26.597 1.00 72.28  ? -26  DT  I N3    1 
ATOM   7129  C  C4    . DT  I  5 48  ? -53.567 -7.287  26.043 1.00 72.22  ? -26  DT  I C4    1 
ATOM   7130  O  O4    . DT  I  5 48  ? -54.229 -6.258  25.954 1.00 72.21  ? -26  DT  I O4    1 
ATOM   7131  C  C5    . DT  I  5 48  ? -54.019 -8.588  25.592 1.00 72.44  ? -26  DT  I C5    1 
ATOM   7132  C  C7    . DT  I  5 48  ? -55.377 -8.765  24.970 1.00 72.20  ? -26  DT  I C7    1 
ATOM   7133  C  C6    . DT  I  5 48  ? -53.186 -9.634  25.750 1.00 72.58  ? -26  DT  I C6    1 
ATOM   7134  P  P     . DC  I  5 49  ? -49.318 -14.219 28.562 1.00 65.50  ? -25  DC  I P     1 
ATOM   7135  O  OP1   . DC  I  5 49  ? -48.047 -14.976 28.427 1.00 64.38  ? -25  DC  I OP1   1 
ATOM   7136  O  OP2   . DC  I  5 49  ? -50.602 -14.937 28.719 1.00 65.41  ? -25  DC  I OP2   1 
ATOM   7137  O  "O5'" . DC  I  5 49  ? -49.193 -13.169 29.772 1.00 63.37  ? -25  DC  I "O5'" 1 
ATOM   7138  C  "C5'" . DC  I  5 49  ? -48.665 -11.851 29.623 1.00 60.92  ? -25  DC  I "C5'" 1 
ATOM   7139  C  "C4'" . DC  I  5 49  ? -49.085 -10.968 30.785 1.00 60.15  ? -25  DC  I "C4'" 1 
ATOM   7140  O  "O4'" . DC  I  5 49  ? -50.134 -10.044 30.385 1.00 61.08  ? -25  DC  I "O4'" 1 
ATOM   7141  C  "C3'" . DC  I  5 49  ? -49.641 -11.658 32.032 1.00 58.92  ? -25  DC  I "C3'" 1 
ATOM   7142  O  "O3'" . DC  I  5 49  ? -49.371 -10.848 33.160 1.00 56.01  ? -25  DC  I "O3'" 1 
ATOM   7143  C  "C2'" . DC  I  5 49  ? -51.140 -11.627 31.785 1.00 60.13  ? -25  DC  I "C2'" 1 
ATOM   7144  C  "C1'" . DC  I  5 49  ? -51.239 -10.198 31.263 1.00 61.77  ? -25  DC  I "C1'" 1 
ATOM   7145  N  N1    . DC  I  5 49  ? -52.455 -9.884  30.491 1.00 62.42  ? -25  DC  I N1    1 
ATOM   7146  C  C2    . DC  I  5 49  ? -52.838 -8.546  30.317 1.00 62.62  ? -25  DC  I C2    1 
ATOM   7147  O  O2    . DC  I  5 49  ? -52.172 -7.641  30.839 1.00 62.56  ? -25  DC  I O2    1 
ATOM   7148  N  N3    . DC  I  5 49  ? -53.955 -8.292  29.580 1.00 63.39  ? -25  DC  I N3    1 
ATOM   7149  C  C4    . DC  I  5 49  ? -54.653 -9.300  29.031 1.00 63.05  ? -25  DC  I C4    1 
ATOM   7150  N  N4    . DC  I  5 49  ? -55.737 -9.010  28.313 1.00 62.69  ? -25  DC  I N4    1 
ATOM   7151  C  C5    . DC  I  5 49  ? -54.273 -10.665 29.196 1.00 63.52  ? -25  DC  I C5    1 
ATOM   7152  C  C6    . DC  I  5 49  ? -53.177 -10.905 29.929 1.00 63.41  ? -25  DC  I C6    1 
ATOM   7153  P  P     . DC  I  5 50  ? -48.040 -11.022 34.012 1.00 52.03  ? -24  DC  I P     1 
ATOM   7154  O  OP1   . DC  I  5 50  ? -46.892 -11.181 33.091 1.00 51.54  ? -24  DC  I OP1   1 
ATOM   7155  O  OP2   . DC  I  5 50  ? -48.322 -12.027 35.059 1.00 53.30  ? -24  DC  I OP2   1 
ATOM   7156  O  "O5'" . DC  I  5 50  ? -47.986 -9.608  34.739 1.00 50.74  ? -24  DC  I "O5'" 1 
ATOM   7157  C  "C5'" . DC  I  5 50  ? -47.311 -8.542  34.128 1.00 51.43  ? -24  DC  I "C5'" 1 
ATOM   7158  C  "C4'" . DC  I  5 50  ? -47.994 -7.255  34.510 1.00 52.23  ? -24  DC  I "C4'" 1 
ATOM   7159  O  "O4'" . DC  I  5 50  ? -49.255 -7.211  33.812 1.00 53.74  ? -24  DC  I "O4'" 1 
ATOM   7160  C  "C3'" . DC  I  5 50  ? -48.310 -7.173  35.992 1.00 52.81  ? -24  DC  I "C3'" 1 
ATOM   7161  O  "O3'" . DC  I  5 50  ? -47.738 -5.997  36.537 1.00 52.66  ? -24  DC  I "O3'" 1 
ATOM   7162  C  "C2'" . DC  I  5 50  ? -49.837 -7.190  36.085 1.00 53.58  ? -24  DC  I "C2'" 1 
ATOM   7163  C  "C1'" . DC  I  5 50  ? -50.286 -6.796  34.685 1.00 54.74  ? -24  DC  I "C1'" 1 
ATOM   7164  N  N1    . DC  I  5 50  ? -51.575 -7.440  34.224 1.00 55.05  ? -24  DC  I N1    1 
ATOM   7165  C  C2    . DC  I  5 50  ? -52.671 -6.662  33.814 1.00 54.11  ? -24  DC  I C2    1 
ATOM   7166  O  O2    . DC  I  5 50  ? -52.594 -5.437  33.836 1.00 54.65  ? -24  DC  I O2    1 
ATOM   7167  N  N3    . DC  I  5 50  ? -53.806 -7.272  33.405 1.00 54.45  ? -24  DC  I N3    1 
ATOM   7168  C  C4    . DC  I  5 50  ? -53.884 -8.606  33.390 1.00 55.43  ? -24  DC  I C4    1 
ATOM   7169  N  N4    . DC  I  5 50  ? -55.019 -9.190  32.974 1.00 55.23  ? -24  DC  I N4    1 
ATOM   7170  C  C5    . DC  I  5 50  ? -52.784 -9.414  33.807 1.00 55.99  ? -24  DC  I C5    1 
ATOM   7171  C  C6    . DC  I  5 50  ? -51.662 -8.802  34.206 1.00 55.52  ? -24  DC  I C6    1 
ATOM   7172  P  P     . DA  I  5 51  ? -47.794 -5.788  38.114 1.00 52.08  ? -23  DA  I P     1 
ATOM   7173  O  OP1   . DA  I  5 51  ? -46.537 -5.156  38.550 1.00 52.51  ? -23  DA  I OP1   1 
ATOM   7174  O  OP2   . DA  I  5 51  ? -48.239 -7.065  38.718 1.00 50.04  ? -23  DA  I OP2   1 
ATOM   7175  O  "O5'" . DA  I  5 51  ? -48.933 -4.689  38.264 1.00 55.32  ? -23  DA  I "O5'" 1 
ATOM   7176  C  "C5'" . DA  I  5 51  ? -48.786 -3.394  37.661 1.00 59.42  ? -23  DA  I "C5'" 1 
ATOM   7177  C  "C4'" . DA  I  5 51  ? -49.974 -2.482  37.945 1.00 61.80  ? -23  DA  I "C4'" 1 
ATOM   7178  O  "O4'" . DA  I  5 51  ? -51.167 -3.009  37.319 1.00 63.02  ? -23  DA  I "O4'" 1 
ATOM   7179  C  "C3'" . DA  I  5 51  ? -50.342 -2.293  39.411 1.00 63.40  ? -23  DA  I "C3'" 1 
ATOM   7180  O  "O3'" . DA  I  5 51  ? -50.743 -0.958  39.582 1.00 66.07  ? -23  DA  I "O3'" 1 
ATOM   7181  C  "C2'" . DA  I  5 51  ? -51.511 -3.245  39.642 1.00 63.57  ? -23  DA  I "C2'" 1 
ATOM   7182  C  "C1'" . DA  I  5 51  ? -52.181 -3.250  38.280 1.00 64.43  ? -23  DA  I "C1'" 1 
ATOM   7183  N  N9    . DA  I  5 51  ? -52.778 -4.520  37.896 1.00 64.90  ? -23  DA  I N9    1 
ATOM   7184  C  C8    . DA  I  5 51  ? -52.277 -5.779  38.109 1.00 65.26  ? -23  DA  I C8    1 
ATOM   7185  N  N7    . DA  I  5 51  ? -53.028 -6.744  37.634 1.00 65.21  ? -23  DA  I N7    1 
ATOM   7186  C  C5    . DA  I  5 51  ? -54.086 -6.061  37.065 1.00 65.14  ? -23  DA  I C5    1 
ATOM   7187  C  C6    . DA  I  5 51  ? -55.229 -6.507  36.386 1.00 65.05  ? -23  DA  I C6    1 
ATOM   7188  N  N6    . DA  I  5 51  ? -55.453 -7.803  36.188 1.00 65.22  ? -23  DA  I N6    1 
ATOM   7189  N  N1    . DA  I  5 51  ? -56.117 -5.585  35.937 1.00 65.19  ? -23  DA  I N1    1 
ATOM   7190  C  C2    . DA  I  5 51  ? -55.862 -4.284  36.153 1.00 65.31  ? -23  DA  I C2    1 
ATOM   7191  N  N3    . DA  I  5 51  ? -54.813 -3.737  36.779 1.00 65.37  ? -23  DA  I N3    1 
ATOM   7192  C  C4    . DA  I  5 51  ? -53.955 -4.690  37.211 1.00 65.27  ? -23  DA  I C4    1 
ATOM   7193  P  P     . DT  I  5 52  ? -51.128 -0.366  41.020 1.00 68.46  ? -22  DT  I P     1 
ATOM   7194  O  OP1   . DT  I  5 52  ? -50.417 0.922   41.153 1.00 68.26  ? -22  DT  I OP1   1 
ATOM   7195  O  OP2   . DT  I  5 52  ? -50.969 -1.411  42.062 1.00 68.36  ? -22  DT  I OP2   1 
ATOM   7196  O  "O5'" . DT  I  5 52  ? -52.690 -0.043  40.877 1.00 70.37  ? -22  DT  I "O5'" 1 
ATOM   7197  C  "C5'" . DT  I  5 52  ? -53.421 -0.139  39.652 1.00 72.37  ? -22  DT  I "C5'" 1 
ATOM   7198  C  "C4'" . DT  I  5 52  ? -54.906 -0.230  39.954 1.00 74.27  ? -22  DT  I "C4'" 1 
ATOM   7199  O  "O4'" . DT  I  5 52  ? -55.443 -1.471  39.442 1.00 74.18  ? -22  DT  I "O4'" 1 
ATOM   7200  C  "C3'" . DT  I  5 52  ? -55.276 -0.207  41.432 1.00 76.22  ? -22  DT  I "C3'" 1 
ATOM   7201  O  "O3'" . DT  I  5 52  ? -56.322 0.745   41.588 1.00 81.21  ? -22  DT  I "O3'" 1 
ATOM   7202  C  "C2'" . DT  I  5 52  ? -55.708 -1.642  41.736 1.00 74.57  ? -22  DT  I "C2'" 1 
ATOM   7203  C  "C1'" . DT  I  5 52  ? -56.310 -2.036  40.400 1.00 73.06  ? -22  DT  I "C1'" 1 
ATOM   7204  N  N1    . DT  I  5 52  ? -56.380 -3.485  40.081 1.00 72.11  ? -22  DT  I N1    1 
ATOM   7205  C  C2    . DT  I  5 52  ? -57.374 -3.901  39.219 1.00 72.06  ? -22  DT  I C2    1 
ATOM   7206  O  O2    . DT  I  5 52  ? -58.200 -3.166  38.724 1.00 73.04  ? -22  DT  I O2    1 
ATOM   7207  N  N3    . DT  I  5 52  ? -57.396 -5.231  38.939 1.00 71.66  ? -22  DT  I N3    1 
ATOM   7208  C  C4    . DT  I  5 52  ? -56.521 -6.171  39.430 1.00 72.70  ? -22  DT  I C4    1 
ATOM   7209  O  O4    . DT  I  5 52  ? -56.641 -7.347  39.106 1.00 73.22  ? -22  DT  I O4    1 
ATOM   7210  C  C5    . DT  I  5 52  ? -55.487 -5.684  40.325 1.00 72.50  ? -22  DT  I C5    1 
ATOM   7211  C  C7    . DT  I  5 52  ? -54.482 -6.631  40.919 1.00 72.44  ? -22  DT  I C7    1 
ATOM   7212  C  C6    . DT  I  5 52  ? -55.463 -4.372  40.605 1.00 71.77  ? -22  DT  I C6    1 
ATOM   7213  P  P     . DC  I  5 53  ? -56.724 1.421   42.991 1.00 85.02  ? -21  DC  I P     1 
ATOM   7214  O  OP1   . DC  I  5 53  ? -56.453 2.883   42.894 1.00 84.45  ? -21  DC  I OP1   1 
ATOM   7215  O  OP2   . DC  I  5 53  ? -56.164 0.640   44.124 1.00 84.62  ? -21  DC  I OP2   1 
ATOM   7216  O  "O5'" . DC  I  5 53  ? -58.298 1.139   42.967 1.00 86.64  ? -21  DC  I "O5'" 1 
ATOM   7217  C  "C5'" . DC  I  5 53  ? -58.716 -0.200  42.841 1.00 90.35  ? -21  DC  I "C5'" 1 
ATOM   7218  C  "C4'" . DC  I  5 53  ? -60.120 -0.275  42.295 1.00 93.50  ? -21  DC  I "C4'" 1 
ATOM   7219  O  "O4'" . DC  I  5 53  ? -60.245 -1.428  41.430 1.00 93.91  ? -21  DC  I "O4'" 1 
ATOM   7220  C  "C3'" . DC  I  5 53  ? -61.150 -0.464  43.394 1.00 95.97  ? -21  DC  I "C3'" 1 
ATOM   7221  O  "O3'" . DC  I  5 53  ? -62.362 0.183   43.052 1.00 99.72  ? -21  DC  I "O3'" 1 
ATOM   7222  C  "C2'" . DC  I  5 53  ? -61.343 -1.971  43.478 1.00 95.27  ? -21  DC  I "C2'" 1 
ATOM   7223  C  "C1'" . DC  I  5 53  ? -60.994 -2.442  42.071 1.00 94.37  ? -21  DC  I "C1'" 1 
ATOM   7224  N  N1    . DC  I  5 53  ? -60.190 -3.687  42.107 1.00 94.21  ? -21  DC  I N1    1 
ATOM   7225  C  C2    . DC  I  5 53  ? -60.535 -4.748  41.257 1.00 94.37  ? -21  DC  I C2    1 
ATOM   7226  O  O2    . DC  I  5 53  ? -61.493 -4.632  40.479 1.00 94.22  ? -21  DC  I O2    1 
ATOM   7227  N  N3    . DC  I  5 53  ? -59.794 -5.885  41.312 1.00 94.47  ? -21  DC  I N3    1 
ATOM   7228  C  C4    . DC  I  5 53  ? -58.765 -5.981  42.160 1.00 94.36  ? -21  DC  I C4    1 
ATOM   7229  N  N4    . DC  I  5 53  ? -58.075 -7.127  42.165 1.00 94.25  ? -21  DC  I N4    1 
ATOM   7230  C  C5    . DC  I  5 53  ? -58.402 -4.910  43.038 1.00 94.31  ? -21  DC  I C5    1 
ATOM   7231  C  C6    . DC  I  5 53  ? -59.136 -3.793  42.978 1.00 93.99  ? -21  DC  I C6    1 
ATOM   7232  P  P     . DA  I  5 54  ? -63.396 0.566   44.214 1.00 102.10 ? -20  DA  I P     1 
ATOM   7233  O  OP1   . DA  I  5 54  ? -64.227 1.682   43.700 1.00 102.17 ? -20  DA  I OP1   1 
ATOM   7234  O  OP2   . DA  I  5 54  ? -62.641 0.742   45.480 1.00 101.89 ? -20  DA  I OP2   1 
ATOM   7235  O  "O5'" . DA  I  5 54  ? -64.276 -0.767  44.331 1.00 103.35 ? -20  DA  I "O5'" 1 
ATOM   7236  C  "C5'" . DA  I  5 54  ? -65.046 -1.204  43.215 1.00 106.16 ? -20  DA  I "C5'" 1 
ATOM   7237  C  "C4'" . DA  I  5 54  ? -65.926 -2.383  43.583 1.00 108.49 ? -20  DA  I "C4'" 1 
ATOM   7238  O  "O4'" . DA  I  5 54  ? -65.154 -3.596  43.405 1.00 108.96 ? -20  DA  I "O4'" 1 
ATOM   7239  C  "C3'" . DA  I  5 54  ? -66.479 -2.409  45.012 1.00 110.12 ? -20  DA  I "C3'" 1 
ATOM   7240  O  "O3'" . DA  I  5 54  ? -67.894 -2.771  44.974 1.00 112.64 ? -20  DA  I "O3'" 1 
ATOM   7241  C  "C2'" . DA  I  5 54  ? -65.533 -3.368  45.741 1.00 109.64 ? -20  DA  I "C2'" 1 
ATOM   7242  C  "C1'" . DA  I  5 54  ? -65.086 -4.309  44.623 1.00 109.41 ? -20  DA  I "C1'" 1 
ATOM   7243  N  N9    . DA  I  5 54  ? -63.732 -4.846  44.775 1.00 109.53 ? -20  DA  I N9    1 
ATOM   7244  C  C8    . DA  I  5 54  ? -62.642 -4.235  45.341 1.00 109.34 ? -20  DA  I C8    1 
ATOM   7245  N  N7    . DA  I  5 54  ? -61.559 -4.976  45.333 1.00 109.40 ? -20  DA  I N7    1 
ATOM   7246  C  C5    . DA  I  5 54  ? -61.965 -6.157  44.726 1.00 109.44 ? -20  DA  I C5    1 
ATOM   7247  C  C6    . DA  I  5 54  ? -61.289 -7.361  44.414 1.00 109.35 ? -20  DA  I C6    1 
ATOM   7248  N  N6    . DA  I  5 54  ? -59.999 -7.568  44.690 1.00 109.34 ? -20  DA  I N6    1 
ATOM   7249  N  N1    . DA  I  5 54  ? -61.990 -8.350  43.810 1.00 109.35 ? -20  DA  I N1    1 
ATOM   7250  C  C2    . DA  I  5 54  ? -63.288 -8.144  43.530 1.00 109.40 ? -20  DA  I C2    1 
ATOM   7251  N  N3    . DA  I  5 54  ? -64.030 -7.058  43.770 1.00 109.23 ? -20  DA  I N3    1 
ATOM   7252  C  C4    . DA  I  5 54  ? -63.305 -6.094  44.374 1.00 109.44 ? -20  DA  I C4    1 
ATOM   7253  P  P     . DA  I  5 55  ? -68.661 -3.811  45.937 1.00 114.44 ? -19  DA  I P     1 
ATOM   7254  O  OP1   . DA  I  5 55  ? -70.107 -3.725  45.628 1.00 114.23 ? -19  DA  I OP1   1 
ATOM   7255  O  OP2   . DA  I  5 55  ? -68.216 -3.576  47.333 1.00 114.16 ? -19  DA  I OP2   1 
ATOM   7256  O  "O5'" . DA  I  5 55  ? -68.112 -5.231  45.417 1.00 115.90 ? -19  DA  I "O5'" 1 
ATOM   7257  C  "C5'" . DA  I  5 55  ? -68.886 -6.439  45.421 1.00 117.84 ? -19  DA  I "C5'" 1 
ATOM   7258  C  "C4'" . DA  I  5 55  ? -68.516 -7.315  46.609 1.00 119.56 ? -19  DA  I "C4'" 1 
ATOM   7259  O  "O4'" . DA  I  5 55  ? -67.092 -7.621  46.606 1.00 120.02 ? -19  DA  I "O4'" 1 
ATOM   7260  C  "C3'" . DA  I  5 55  ? -68.804 -6.634  47.944 1.00 120.57 ? -19  DA  I "C3'" 1 
ATOM   7261  O  "O3'" . DA  I  5 55  ? -69.705 -7.378  48.729 1.00 122.03 ? -19  DA  I "O3'" 1 
ATOM   7262  C  "C2'" . DA  I  5 55  ? -67.457 -6.518  48.647 1.00 120.45 ? -19  DA  I "C2'" 1 
ATOM   7263  C  "C1'" . DA  I  5 55  ? -66.610 -7.565  47.939 1.00 120.10 ? -19  DA  I "C1'" 1 
ATOM   7264  N  N9    . DA  I  5 55  ? -65.186 -7.224  48.008 1.00 120.05 ? -19  DA  I N9    1 
ATOM   7265  C  C8    . DA  I  5 55  ? -64.654 -6.022  48.406 1.00 120.02 ? -19  DA  I C8    1 
ATOM   7266  N  N7    . DA  I  5 55  ? -63.345 -5.978  48.390 1.00 120.09 ? -19  DA  I N7    1 
ATOM   7267  C  C5    . DA  I  5 55  ? -62.991 -7.244  47.961 1.00 119.99 ? -19  DA  I C5    1 
ATOM   7268  C  C6    . DA  I  5 55  ? -61.737 -7.841  47.736 1.00 119.94 ? -19  DA  I C6    1 
ATOM   7269  N  N6    . DA  I  5 55  ? -60.588 -7.188  47.928 1.00 119.96 ? -19  DA  I N6    1 
ATOM   7270  N  N1    . DA  I  5 55  ? -61.717 -9.124  47.306 1.00 120.03 ? -19  DA  I N1    1 
ATOM   7271  C  C2    . DA  I  5 55  ? -62.882 -9.766  47.113 1.00 120.01 ? -19  DA  I C2    1 
ATOM   7272  N  N3    . DA  I  5 55  ? -64.123 -9.309  47.291 1.00 119.94 ? -19  DA  I N3    1 
ATOM   7273  C  C4    . DA  I  5 55  ? -64.108 -8.031  47.721 1.00 119.98 ? -19  DA  I C4    1 
ATOM   7274  P  P     . DA  I  5 56  ? -70.658 -6.583  49.741 1.00 123.29 ? -18  DA  I P     1 
ATOM   7275  O  OP1   . DA  I  5 56  ? -71.933 -6.387  49.006 1.00 123.17 ? -18  DA  I OP1   1 
ATOM   7276  O  OP2   . DA  I  5 56  ? -69.937 -5.403  50.285 1.00 123.29 ? -18  DA  I OP2   1 
ATOM   7277  O  "O5'" . DA  I  5 56  ? -70.866 -7.625  50.950 1.00 123.14 ? -18  DA  I "O5'" 1 
ATOM   7278  C  "C5'" . DA  I  5 56  ? -69.778 -8.348  51.542 1.00 122.35 ? -18  DA  I "C5'" 1 
ATOM   7279  C  "C4'" . DA  I  5 56  ? -69.724 -9.782  51.020 1.00 121.88 ? -18  DA  I "C4'" 1 
ATOM   7280  O  "O4'" . DA  I  5 56  ? -68.490 -9.995  50.280 1.00 121.99 ? -18  DA  I "O4'" 1 
ATOM   7281  C  "C3'" . DA  I  5 56  ? -69.745 -10.883 52.078 1.00 121.54 ? -18  DA  I "C3'" 1 
ATOM   7282  O  "O3'" . DA  I  5 56  ? -70.388 -12.071 51.552 1.00 120.71 ? -18  DA  I "O3'" 1 
ATOM   7283  C  "C2'" . DA  I  5 56  ? -68.253 -11.060 52.370 1.00 121.73 ? -18  DA  I "C2'" 1 
ATOM   7284  C  "C1'" . DA  I  5 56  ? -67.626 -10.875 50.987 1.00 121.49 ? -18  DA  I "C1'" 1 
ATOM   7285  N  N9    . DA  I  5 56  ? -66.263 -10.329 51.036 1.00 121.44 ? -18  DA  I N9    1 
ATOM   7286  C  C8    . DA  I  5 56  ? -65.897 -9.083  51.480 1.00 121.25 ? -18  DA  I C8    1 
ATOM   7287  N  N7    . DA  I  5 56  ? -64.609 -8.844  51.423 1.00 121.14 ? -18  DA  I N7    1 
ATOM   7288  C  C5    . DA  I  5 56  ? -64.085 -10.015 50.907 1.00 121.16 ? -18  DA  I C5    1 
ATOM   7289  C  C6    . DA  I  5 56  ? -62.763 -10.396 50.605 1.00 121.07 ? -18  DA  I C6    1 
ATOM   7290  N  N6    . DA  I  5 56  ? -61.722 -9.581  50.798 1.00 121.04 ? -18  DA  I N6    1 
ATOM   7291  N  N1    . DA  I  5 56  ? -62.565 -11.637 50.099 1.00 121.22 ? -18  DA  I N1    1 
ATOM   7292  C  C2    . DA  I  5 56  ? -63.625 -12.443 49.910 1.00 121.21 ? -18  DA  I C2    1 
ATOM   7293  N  N3    . DA  I  5 56  ? -64.916 -12.194 50.157 1.00 121.19 ? -18  DA  I N3    1 
ATOM   7294  C  C4    . DA  I  5 56  ? -65.084 -10.949 50.660 1.00 121.33 ? -18  DA  I C4    1 
ATOM   7295  P  P     . DA  I  5 57  ? -70.109 -13.565 52.089 1.00 119.86 ? -17  DA  I P     1 
ATOM   7296  O  OP1   . DA  I  5 57  ? -71.156 -14.447 51.522 1.00 119.70 ? -17  DA  I OP1   1 
ATOM   7297  O  OP2   . DA  I  5 57  ? -69.931 -13.506 53.563 1.00 119.49 ? -17  DA  I OP2   1 
ATOM   7298  O  "O5'" . DA  I  5 57  ? -68.696 -13.915 51.393 1.00 118.86 ? -17  DA  I "O5'" 1 
ATOM   7299  C  "C5'" . DA  I  5 57  ? -68.278 -15.247 51.048 1.00 116.55 ? -17  DA  I "C5'" 1 
ATOM   7300  C  "C4'" . DA  I  5 57  ? -67.206 -15.763 51.999 1.00 114.62 ? -17  DA  I "C4'" 1 
ATOM   7301  O  "O4'" . DA  I  5 57  ? -66.136 -14.788 52.161 1.00 114.15 ? -17  DA  I "O4'" 1 
ATOM   7302  C  "C3'" . DA  I  5 57  ? -67.718 -16.082 53.405 1.00 113.50 ? -17  DA  I "C3'" 1 
ATOM   7303  O  "O3'" . DA  I  5 57  ? -67.373 -17.437 53.731 1.00 112.30 ? -17  DA  I "O3'" 1 
ATOM   7304  C  "C2'" . DA  I  5 57  ? -67.043 -15.032 54.296 1.00 113.33 ? -17  DA  I "C2'" 1 
ATOM   7305  C  "C1'" . DA  I  5 57  ? -65.754 -14.757 53.528 1.00 112.87 ? -17  DA  I "C1'" 1 
ATOM   7306  N  N9    . DA  I  5 57  ? -65.095 -13.486 53.871 1.00 112.64 ? -17  DA  I N9    1 
ATOM   7307  C  C8    . DA  I  5 57  ? -65.669 -12.358 54.407 1.00 112.25 ? -17  DA  I C8    1 
ATOM   7308  N  N7    . DA  I  5 57  ? -64.829 -11.370 54.612 1.00 112.08 ? -17  DA  I N7    1 
ATOM   7309  C  C5    . DA  I  5 57  ? -63.610 -11.877 54.188 1.00 112.17 ? -17  DA  I C5    1 
ATOM   7310  C  C6    . DA  I  5 57  ? -62.308 -11.325 54.138 1.00 112.02 ? -17  DA  I C6    1 
ATOM   7311  N  N6    . DA  I  5 57  ? -62.002 -10.087 54.539 1.00 111.95 ? -17  DA  I N6    1 
ATOM   7312  N  N1    . DA  I  5 57  ? -61.316 -12.106 53.659 1.00 112.14 ? -17  DA  I N1    1 
ATOM   7313  C  C2    . DA  I  5 57  ? -61.603 -13.352 53.251 1.00 112.13 ? -17  DA  I C2    1 
ATOM   7314  N  N3    . DA  I  5 57  ? -62.781 -13.980 53.245 1.00 111.91 ? -17  DA  I N3    1 
ATOM   7315  C  C4    . DA  I  5 57  ? -63.754 -13.182 53.731 1.00 112.34 ? -17  DA  I C4    1 
ATOM   7316  P  P     . DG  I  5 58  ? -67.423 -18.055 55.220 1.00 111.24 ? -16  DG  I P     1 
ATOM   7317  O  OP1   . DG  I  5 58  ? -67.600 -19.522 55.085 1.00 110.76 ? -16  DG  I OP1   1 
ATOM   7318  O  OP2   . DG  I  5 58  ? -68.382 -17.285 56.051 1.00 111.35 ? -16  DG  I OP2   1 
ATOM   7319  O  "O5'" . DG  I  5 58  ? -65.943 -17.752 55.767 1.00 109.40 ? -16  DG  I "O5'" 1 
ATOM   7320  C  "C5'" . DG  I  5 58  ? -64.776 -18.278 55.100 1.00 105.74 ? -16  DG  I "C5'" 1 
ATOM   7321  C  "C4'" . DG  I  5 58  ? -63.507 -18.028 55.903 1.00 102.62 ? -16  DG  I "C4'" 1 
ATOM   7322  O  "O4'" . DG  I  5 58  ? -63.256 -16.600 55.998 1.00 101.66 ? -16  DG  I "O4'" 1 
ATOM   7323  C  "C3'" . DG  I  5 58  ? -63.520 -18.558 57.339 1.00 100.96 ? -16  DG  I "C3'" 1 
ATOM   7324  O  "O3'" . DG  I  5 58  ? -62.297 -19.231 57.642 1.00 99.79  ? -16  DG  I "O3'" 1 
ATOM   7325  C  "C2'" . DG  I  5 58  ? -63.667 -17.293 58.179 1.00 100.36 ? -16  DG  I "C2'" 1 
ATOM   7326  C  "C1'" . DG  I  5 58  ? -62.886 -16.303 57.324 1.00 99.90  ? -16  DG  I "C1'" 1 
ATOM   7327  N  N9    . DG  I  5 58  ? -63.157 -14.895 57.601 1.00 99.40  ? -16  DG  I N9    1 
ATOM   7328  C  C8    . DG  I  5 58  ? -64.279 -14.351 58.174 1.00 99.28  ? -16  DG  I C8    1 
ATOM   7329  N  N7    . DG  I  5 58  ? -64.222 -13.058 58.296 1.00 99.21  ? -16  DG  I N7    1 
ATOM   7330  C  C5    . DG  I  5 58  ? -62.984 -12.719 57.771 1.00 99.12  ? -16  DG  I C5    1 
ATOM   7331  C  C6    . DG  I  5 58  ? -62.359 -11.451 57.632 1.00 99.49  ? -16  DG  I C6    1 
ATOM   7332  O  O6    . DG  I  5 58  ? -62.784 -10.332 57.954 1.00 99.54  ? -16  DG  I O6    1 
ATOM   7333  N  N1    . DG  I  5 58  ? -61.098 -11.550 57.053 1.00 99.42  ? -16  DG  I N1    1 
ATOM   7334  C  C2    . DG  I  5 58  ? -60.522 -12.728 56.651 1.00 99.33  ? -16  DG  I C2    1 
ATOM   7335  N  N2    . DG  I  5 58  ? -59.307 -12.609 56.110 1.00 99.43  ? -16  DG  I N2    1 
ATOM   7336  N  N3    . DG  I  5 58  ? -61.089 -13.924 56.774 1.00 99.08  ? -16  DG  I N3    1 
ATOM   7337  C  C4    . DG  I  5 58  ? -62.317 -13.843 57.340 1.00 98.96  ? -16  DG  I C4    1 
ATOM   7338  P  P     . DG  I  5 59  ? -62.026 -20.767 57.247 1.00 99.21  ? -15  DG  I P     1 
ATOM   7339  O  OP1   . DG  I  5 59  ? -63.088 -21.220 56.310 1.00 99.20  ? -15  DG  I OP1   1 
ATOM   7340  O  OP2   . DG  I  5 59  ? -61.797 -21.513 58.509 1.00 98.66  ? -15  DG  I OP2   1 
ATOM   7341  O  "O5'" . DG  I  5 59  ? -60.623 -20.716 56.455 1.00 96.89  ? -15  DG  I "O5'" 1 
ATOM   7342  C  "C5'" . DG  I  5 59  ? -60.205 -19.585 55.658 1.00 92.77  ? -15  DG  I "C5'" 1 
ATOM   7343  C  "C4'" . DG  I  5 59  ? -58.886 -18.999 56.149 1.00 89.50  ? -15  DG  I "C4'" 1 
ATOM   7344  O  "O4'" . DG  I  5 59  ? -59.116 -17.745 56.854 1.00 88.78  ? -15  DG  I "O4'" 1 
ATOM   7345  C  "C3'" . DG  I  5 59  ? -58.074 -19.895 57.086 1.00 87.35  ? -15  DG  I "C3'" 1 
ATOM   7346  O  "O3'" . DG  I  5 59  ? -56.755 -20.002 56.538 1.00 84.08  ? -15  DG  I "O3'" 1 
ATOM   7347  C  "C2'" . DG  I  5 59  ? -58.178 -19.227 58.461 1.00 87.40  ? -15  DG  I "C2'" 1 
ATOM   7348  C  "C1'" . DG  I  5 59  ? -58.501 -17.770 58.132 1.00 87.95  ? -15  DG  I "C1'" 1 
ATOM   7349  N  N9    . DG  I  5 59  ? -59.408 -17.141 59.092 1.00 87.84  ? -15  DG  I N9    1 
ATOM   7350  C  C8    . DG  I  5 59  ? -60.368 -17.768 59.853 1.00 87.76  ? -15  DG  I C8    1 
ATOM   7351  N  N7    . DG  I  5 59  ? -61.034 -16.958 60.628 1.00 87.68  ? -15  DG  I N7    1 
ATOM   7352  C  C5    . DG  I  5 59  ? -60.492 -15.707 60.368 1.00 87.66  ? -15  DG  I C5    1 
ATOM   7353  C  C6    . DG  I  5 59  ? -60.815 -14.438 60.914 1.00 87.83  ? -15  DG  I C6    1 
ATOM   7354  O  O6    . DG  I  5 59  ? -61.676 -14.152 61.752 1.00 87.98  ? -15  DG  I O6    1 
ATOM   7355  N  N1    . DG  I  5 59  ? -60.026 -13.420 60.391 1.00 87.87  ? -15  DG  I N1    1 
ATOM   7356  C  C2    . DG  I  5 59  ? -59.045 -13.613 59.452 1.00 87.68  ? -15  DG  I C2    1 
ATOM   7357  N  N2    . DG  I  5 59  ? -58.394 -12.511 59.070 1.00 87.82  ? -15  DG  I N2    1 
ATOM   7358  N  N3    . DG  I  5 59  ? -58.728 -14.792 58.926 1.00 87.68  ? -15  DG  I N3    1 
ATOM   7359  C  C4    . DG  I  5 59  ? -59.488 -15.800 59.425 1.00 87.81  ? -15  DG  I C4    1 
ATOM   7360  P  P     . DC  I  5 60  ? -55.398 -20.158 57.381 1.00 81.57  ? -14  DC  I P     1 
ATOM   7361  O  OP1   . DC  I  5 60  ? -54.311 -20.313 56.388 1.00 81.80  ? -14  DC  I OP1   1 
ATOM   7362  O  OP2   . DC  I  5 60  ? -55.567 -21.156 58.460 1.00 81.39  ? -14  DC  I OP2   1 
ATOM   7363  O  "O5'" . DC  I  5 60  ? -55.246 -18.729 58.056 1.00 79.14  ? -14  DC  I "O5'" 1 
ATOM   7364  C  "C5'" . DC  I  5 60  ? -54.852 -17.635 57.255 1.00 75.71  ? -14  DC  I "C5'" 1 
ATOM   7365  C  "C4'" . DC  I  5 60  ? -54.418 -16.547 58.195 1.00 72.99  ? -14  DC  I "C4'" 1 
ATOM   7366  O  "O4'" . DC  I  5 60  ? -55.564 -16.218 59.011 1.00 72.89  ? -14  DC  I "O4'" 1 
ATOM   7367  C  "C3'" . DC  I  5 60  ? -53.305 -16.993 59.134 1.00 71.43  ? -14  DC  I "C3'" 1 
ATOM   7368  O  "O3'" . DC  I  5 60  ? -52.232 -16.081 58.986 1.00 69.12  ? -14  DC  I "O3'" 1 
ATOM   7369  C  "C2'" . DC  I  5 60  ? -53.944 -16.959 60.524 1.00 72.17  ? -14  DC  I "C2'" 1 
ATOM   7370  C  "C1'" . DC  I  5 60  ? -55.141 -16.030 60.342 1.00 72.64  ? -14  DC  I "C1'" 1 
ATOM   7371  N  N1    . DC  I  5 60  ? -56.319 -16.274 61.256 1.00 72.72  ? -14  DC  I N1    1 
ATOM   7372  C  C2    . DC  I  5 60  ? -56.928 -15.173 61.888 1.00 72.87  ? -14  DC  I C2    1 
ATOM   7373  O  O2    . DC  I  5 60  ? -56.488 -14.034 61.689 1.00 72.80  ? -14  DC  I O2    1 
ATOM   7374  N  N3    . DC  I  5 60  ? -57.990 -15.384 62.711 1.00 72.80  ? -14  DC  I N3    1 
ATOM   7375  C  C4    . DC  I  5 60  ? -58.443 -16.626 62.912 1.00 72.80  ? -14  DC  I C4    1 
ATOM   7376  N  N4    . DC  I  5 60  ? -59.493 -16.771 63.729 1.00 72.64  ? -14  DC  I N4    1 
ATOM   7377  C  C5    . DC  I  5 60  ? -57.841 -17.767 62.284 1.00 72.51  ? -14  DC  I C5    1 
ATOM   7378  C  C6    . DC  I  5 60  ? -56.797 -17.546 61.471 1.00 72.43  ? -14  DC  I C6    1 
ATOM   7379  P  P     . DA  I  5 61  ? -50.858 -16.187 59.795 1.00 66.94  ? -13  DA  I P     1 
ATOM   7380  O  OP1   . DA  I  5 61  ? -49.779 -16.050 58.795 1.00 67.60  ? -13  DA  I OP1   1 
ATOM   7381  O  OP2   . DA  I  5 61  ? -50.878 -17.366 60.683 1.00 66.87  ? -13  DA  I OP2   1 
ATOM   7382  O  "O5'" . DA  I  5 61  ? -50.903 -14.882 60.721 1.00 65.99  ? -13  DA  I "O5'" 1 
ATOM   7383  C  "C5'" . DA  I  5 61  ? -50.974 -13.577 60.145 1.00 65.22  ? -13  DA  I "C5'" 1 
ATOM   7384  C  "C4'" . DA  I  5 61  ? -51.401 -12.492 61.129 1.00 65.40  ? -13  DA  I "C4'" 1 
ATOM   7385  O  "O4'" . DA  I  5 61  ? -52.702 -12.787 61.695 1.00 65.45  ? -13  DA  I "O4'" 1 
ATOM   7386  C  "C3'" . DA  I  5 61  ? -50.473 -12.251 62.318 1.00 65.18  ? -13  DA  I "C3'" 1 
ATOM   7387  O  "O3'" . DA  I  5 61  ? -50.296 -10.875 62.483 1.00 65.21  ? -13  DA  I "O3'" 1 
ATOM   7388  C  "C2'" . DA  I  5 61  ? -51.219 -12.817 63.514 1.00 65.04  ? -13  DA  I "C2'" 1 
ATOM   7389  C  "C1'" . DA  I  5 61  ? -52.668 -12.650 63.100 1.00 65.61  ? -13  DA  I "C1'" 1 
ATOM   7390  N  N9    . DA  I  5 61  ? -53.548 -13.672 63.656 1.00 65.98  ? -13  DA  I N9    1 
ATOM   7391  C  C8    . DA  I  5 61  ? -53.589 -15.002 63.329 1.00 65.84  ? -13  DA  I C8    1 
ATOM   7392  N  N7    . DA  I  5 61  ? -54.497 -15.683 63.988 1.00 65.83  ? -13  DA  I N7    1 
ATOM   7393  C  C5    . DA  I  5 61  ? -55.097 -14.731 64.804 1.00 66.34  ? -13  DA  I C5    1 
ATOM   7394  C  C6    . DA  I  5 61  ? -56.135 -14.798 65.766 1.00 66.21  ? -13  DA  I C6    1 
ATOM   7395  N  N6    . DA  I  5 61  ? -56.787 -15.929 66.063 1.00 66.20  ? -13  DA  I N6    1 
ATOM   7396  N  N1    . DA  I  5 61  ? -56.481 -13.662 66.419 1.00 65.85  ? -13  DA  I N1    1 
ATOM   7397  C  C2    . DA  I  5 61  ? -55.842 -12.523 66.123 1.00 65.84  ? -13  DA  I C2    1 
ATOM   7398  N  N3    . DA  I  5 61  ? -54.850 -12.334 65.247 1.00 66.45  ? -13  DA  I N3    1 
ATOM   7399  C  C4    . DA  I  5 61  ? -54.522 -13.484 64.614 1.00 66.46  ? -13  DA  I C4    1 
ATOM   7400  P  P     . DT  I  5 62  ? -49.197 -10.319 63.495 1.00 65.93  ? -12  DT  I P     1 
ATOM   7401  O  OP1   . DT  I  5 62  ? -48.629 -9.112  62.858 1.00 66.40  ? -12  DT  I OP1   1 
ATOM   7402  O  OP2   . DT  I  5 62  ? -48.323 -11.416 63.965 1.00 65.98  ? -12  DT  I OP2   1 
ATOM   7403  O  "O5'" . DT  I  5 62  ? -50.083 -9.867  64.743 1.00 66.61  ? -12  DT  I "O5'" 1 
ATOM   7404  C  "C5'" . DT  I  5 62  ? -51.067 -8.839  64.591 1.00 67.05  ? -12  DT  I "C5'" 1 
ATOM   7405  C  "C4'" . DT  I  5 62  ? -51.896 -8.710  65.849 1.00 66.85  ? -12  DT  I "C4'" 1 
ATOM   7406  O  "O4'" . DT  I  5 62  ? -52.632 -9.939  66.057 1.00 66.12  ? -12  DT  I "O4'" 1 
ATOM   7407  C  "C3'" . DT  I  5 62  ? -51.035 -8.498  67.084 1.00 67.57  ? -12  DT  I "C3'" 1 
ATOM   7408  O  "O3'" . DT  I  5 62  ? -51.414 -7.296  67.725 1.00 68.90  ? -12  DT  I "O3'" 1 
ATOM   7409  C  "C2'" . DT  I  5 62  ? -51.272 -9.728  67.955 1.00 66.79  ? -12  DT  I "C2'" 1 
ATOM   7410  C  "C1'" . DT  I  5 62  ? -52.601 -10.239 67.430 1.00 66.56  ? -12  DT  I "C1'" 1 
ATOM   7411  N  N1    . DT  I  5 62  ? -52.797 -11.695 67.598 1.00 66.66  ? -12  DT  I N1    1 
ATOM   7412  C  C2    . DT  I  5 62  ? -53.843 -12.113 68.391 1.00 67.20  ? -12  DT  I C2    1 
ATOM   7413  O  O2    . DT  I  5 62  ? -54.602 -11.349 68.948 1.00 67.52  ? -12  DT  I O2    1 
ATOM   7414  N  N3    . DT  I  5 62  ? -53.978 -13.473 68.511 1.00 67.45  ? -12  DT  I N3    1 
ATOM   7415  C  C4    . DT  I  5 62  ? -53.178 -14.438 67.927 1.00 67.10  ? -12  DT  I C4    1 
ATOM   7416  O  O4    . DT  I  5 62  ? -53.383 -15.635 68.103 1.00 67.33  ? -12  DT  I O4    1 
ATOM   7417  C  C5    . DT  I  5 62  ? -52.090 -13.943 67.113 1.00 67.07  ? -12  DT  I C5    1 
ATOM   7418  C  C7    . DT  I  5 62  ? -51.157 -14.913 66.438 1.00 67.16  ? -12  DT  I C7    1 
ATOM   7419  C  C6    . DT  I  5 62  ? -51.952 -12.608 66.990 1.00 66.77  ? -12  DT  I C6    1 
ATOM   7420  P  P     . DG  I  5 63  ? -50.444 -6.625  68.808 1.00 70.78  ? -11  DG  I P     1 
ATOM   7421  O  OP1   . DG  I  5 63  ? -50.299 -5.202  68.424 1.00 70.10  ? -11  DG  I OP1   1 
ATOM   7422  O  OP2   . DG  I  5 63  ? -49.236 -7.463  69.018 1.00 69.51  ? -11  DG  I OP2   1 
ATOM   7423  O  "O5'" . DG  I  5 63  ? -51.300 -6.750  70.156 1.00 71.98  ? -11  DG  I "O5'" 1 
ATOM   7424  C  "C5'" . DG  I  5 63  ? -52.731 -6.877  70.176 1.00 73.62  ? -11  DG  I "C5'" 1 
ATOM   7425  C  "C4'" . DG  I  5 63  ? -53.214 -7.345  71.546 1.00 74.71  ? -11  DG  I "C4'" 1 
ATOM   7426  O  "O4'" . DG  I  5 63  ? -53.571 -8.754  71.479 1.00 74.70  ? -11  DG  I "O4'" 1 
ATOM   7427  C  "C3'" . DG  I  5 63  ? -52.211 -7.205  72.695 1.00 75.08  ? -11  DG  I "C3'" 1 
ATOM   7428  O  "O3'" . DG  I  5 63  ? -52.858 -6.675  73.857 1.00 76.18  ? -11  DG  I "O3'" 1 
ATOM   7429  C  "C2'" . DG  I  5 63  ? -51.698 -8.630  72.897 1.00 75.34  ? -11  DG  I "C2'" 1 
ATOM   7430  C  "C1'" . DG  I  5 63  ? -52.894 -9.476  72.486 1.00 75.31  ? -11  DG  I "C1'" 1 
ATOM   7431  N  N9    . DG  I  5 63  ? -52.527 -10.758 71.909 1.00 75.17  ? -11  DG  I N9    1 
ATOM   7432  C  C8    . DG  I  5 63  ? -51.563 -10.998 70.961 1.00 75.60  ? -11  DG  I C8    1 
ATOM   7433  N  N7    . DG  I  5 63  ? -51.448 -12.251 70.618 1.00 75.37  ? -11  DG  I N7    1 
ATOM   7434  C  C5    . DG  I  5 63  ? -52.408 -12.880 71.393 1.00 75.43  ? -11  DG  I C5    1 
ATOM   7435  C  C6    . DG  I  5 63  ? -52.757 -14.248 71.463 1.00 75.74  ? -11  DG  I C6    1 
ATOM   7436  O  O6    . DG  I  5 63  ? -52.265 -15.190 70.826 1.00 75.86  ? -11  DG  I O6    1 
ATOM   7437  N  N1    . DG  I  5 63  ? -53.781 -14.483 72.386 1.00 75.78  ? -11  DG  I N1    1 
ATOM   7438  C  C2    . DG  I  5 63  ? -54.389 -13.509 73.151 1.00 75.61  ? -11  DG  I C2    1 
ATOM   7439  N  N2    . DG  I  5 63  ? -55.356 -13.925 73.987 1.00 75.49  ? -11  DG  I N2    1 
ATOM   7440  N  N3    . DG  I  5 63  ? -54.067 -12.218 73.089 1.00 75.50  ? -11  DG  I N3    1 
ATOM   7441  C  C4    . DG  I  5 63  ? -53.079 -11.978 72.193 1.00 75.29  ? -11  DG  I C4    1 
ATOM   7442  P  P     . DT  I  5 64  ? -52.185 -6.668  75.324 1.00 77.13  ? -10  DT  I P     1 
ATOM   7443  O  OP1   . DT  I  5 64  ? -52.846 -5.593  76.099 1.00 77.24  ? -10  DT  I OP1   1 
ATOM   7444  O  OP2   . DT  I  5 64  ? -50.707 -6.733  75.219 1.00 76.54  ? -10  DT  I OP2   1 
ATOM   7445  O  "O5'" . DT  I  5 64  ? -52.672 -8.048  75.937 1.00 76.86  ? -10  DT  I "O5'" 1 
ATOM   7446  C  "C5'" . DT  I  5 64  ? -54.053 -8.305  76.123 1.00 76.36  ? -10  DT  I "C5'" 1 
ATOM   7447  C  "C4'" . DT  I  5 64  ? -54.143 -9.520  77.017 1.00 76.14  ? -10  DT  I "C4'" 1 
ATOM   7448  O  "O4'" . DT  I  5 64  ? -53.812 -10.709 76.250 1.00 76.13  ? -10  DT  I "O4'" 1 
ATOM   7449  C  "C3'" . DT  I  5 64  ? -53.178 -9.505  78.203 1.00 76.00  ? -10  DT  I "C3'" 1 
ATOM   7450  O  "O3'" . DT  I  5 64  ? -53.883 -10.019 79.320 1.00 76.64  ? -10  DT  I "O3'" 1 
ATOM   7451  C  "C2'" . DT  I  5 64  ? -52.057 -10.445 77.756 1.00 75.33  ? -10  DT  I "C2'" 1 
ATOM   7452  C  "C1'" . DT  I  5 64  ? -52.873 -11.476 76.986 1.00 74.24  ? -10  DT  I "C1'" 1 
ATOM   7453  N  N1    . DT  I  5 64  ? -52.099 -12.360 76.053 1.00 73.71  ? -10  DT  I N1    1 
ATOM   7454  C  C2    . DT  I  5 64  ? -52.452 -13.696 75.954 1.00 73.25  ? -10  DT  I C2    1 
ATOM   7455  O  O2    . DT  I  5 64  ? -53.356 -14.218 76.580 1.00 72.46  ? -10  DT  I O2    1 
ATOM   7456  N  N3    . DT  I  5 64  ? -51.686 -14.418 75.070 1.00 73.60  ? -10  DT  I N3    1 
ATOM   7457  C  C4    . DT  I  5 64  ? -50.630 -13.960 74.298 1.00 73.23  ? -10  DT  I C4    1 
ATOM   7458  O  O4    . DT  I  5 64  ? -50.014 -14.704 73.543 1.00 73.02  ? -10  DT  I O4    1 
ATOM   7459  C  C5    . DT  I  5 64  ? -50.313 -12.559 74.450 1.00 72.65  ? -10  DT  I C5    1 
ATOM   7460  C  C7    . DT  I  5 64  ? -49.191 -11.947 73.663 1.00 73.04  ? -10  DT  I C7    1 
ATOM   7461  C  C6    . DT  I  5 64  ? -51.054 -11.836 75.305 1.00 73.04  ? -10  DT  I C6    1 
ATOM   7462  P  P     . DT  I  5 65  ? -53.380 -9.920  80.839 1.00 76.66  ? -9   DT  I P     1 
ATOM   7463  O  OP1   . DT  I  5 65  ? -54.101 -8.742  81.388 1.00 76.40  ? -9   DT  I OP1   1 
ATOM   7464  O  OP2   . DT  I  5 65  ? -51.891 -10.018 80.928 1.00 76.28  ? -9   DT  I OP2   1 
ATOM   7465  O  "O5'" . DT  I  5 65  ? -53.988 -11.289 81.424 1.00 75.33  ? -9   DT  I "O5'" 1 
ATOM   7466  C  "C5'" . DT  I  5 65  ? -54.434 -12.309 80.520 1.00 73.92  ? -9   DT  I "C5'" 1 
ATOM   7467  C  "C4'" . DT  I  5 65  ? -54.352 -13.687 81.154 1.00 73.51  ? -9   DT  I "C4'" 1 
ATOM   7468  O  "O4'" . DT  I  5 65  ? -53.696 -14.643 80.275 1.00 73.29  ? -9   DT  I "O4'" 1 
ATOM   7469  C  "C3'" . DT  I  5 65  ? -53.592 -13.771 82.468 1.00 73.47  ? -9   DT  I "C3'" 1 
ATOM   7470  O  "O3'" . DT  I  5 65  ? -54.253 -14.755 83.260 1.00 73.33  ? -9   DT  I "O3'" 1 
ATOM   7471  C  "C2'" . DT  I  5 65  ? -52.178 -14.169 82.026 1.00 73.34  ? -9   DT  I "C2'" 1 
ATOM   7472  C  "C1'" . DT  I  5 65  ? -52.455 -15.069 80.821 1.00 72.59  ? -9   DT  I "C1'" 1 
ATOM   7473  N  N1    . DT  I  5 65  ? -51.419 -15.050 79.715 1.00 72.38  ? -9   DT  I N1    1 
ATOM   7474  C  C2    . DT  I  5 65  ? -51.223 -16.202 78.969 1.00 72.51  ? -9   DT  I C2    1 
ATOM   7475  O  O2    . DT  I  5 65  ? -51.830 -17.249 79.152 1.00 72.54  ? -9   DT  I O2    1 
ATOM   7476  N  N3    . DT  I  5 65  ? -50.272 -16.096 77.981 1.00 72.37  ? -9   DT  I N3    1 
ATOM   7477  C  C4    . DT  I  5 65  ? -49.513 -14.986 77.658 1.00 72.31  ? -9   DT  I C4    1 
ATOM   7478  O  O4    . DT  I  5 65  ? -48.695 -15.028 76.748 1.00 72.23  ? -9   DT  I O4    1 
ATOM   7479  C  C5    . DT  I  5 65  ? -49.760 -13.806 78.466 1.00 72.43  ? -9   DT  I C5    1 
ATOM   7480  C  C7    . DT  I  5 65  ? -48.999 -12.532 78.226 1.00 72.10  ? -9   DT  I C7    1 
ATOM   7481  C  C6    . DT  I  5 65  ? -50.688 -13.898 79.438 1.00 72.52  ? -9   DT  I C6    1 
ATOM   7482  P  P     . DC  I  5 66  ? -53.743 -15.158 84.721 1.00 73.49  ? -8   DC  I P     1 
ATOM   7483  O  OP1   . DC  I  5 66  ? -54.935 -15.619 85.485 1.00 73.67  ? -8   DC  I OP1   1 
ATOM   7484  O  OP2   . DC  I  5 66  ? -52.843 -14.103 85.254 1.00 72.92  ? -8   DC  I OP2   1 
ATOM   7485  O  "O5'" . DC  I  5 66  ? -52.812 -16.411 84.401 1.00 71.86  ? -8   DC  I "O5'" 1 
ATOM   7486  C  "C5'" . DC  I  5 66  ? -53.333 -17.550 83.730 1.00 69.47  ? -8   DC  I "C5'" 1 
ATOM   7487  C  "C4'" . DC  I  5 66  ? -52.254 -18.614 83.682 1.00 67.25  ? -8   DC  I "C4'" 1 
ATOM   7488  O  "O4'" . DC  I  5 66  ? -51.352 -18.356 82.573 1.00 66.22  ? -8   DC  I "O4'" 1 
ATOM   7489  C  "C3'" . DC  I  5 66  ? -51.410 -18.680 84.951 1.00 65.71  ? -8   DC  I "C3'" 1 
ATOM   7490  O  "O3'" . DC  I  5 66  ? -51.466 -20.033 85.391 1.00 65.06  ? -8   DC  I "O3'" 1 
ATOM   7491  C  "C2'" . DC  I  5 66  ? -50.024 -18.181 84.518 1.00 65.19  ? -8   DC  I "C2'" 1 
ATOM   7492  C  "C1'" . DC  I  5 66  ? -50.010 -18.456 83.010 1.00 64.95  ? -8   DC  I "C1'" 1 
ATOM   7493  N  N1    . DC  I  5 66  ? -49.137 -17.575 82.122 1.00 63.96  ? -8   DC  I N1    1 
ATOM   7494  C  C2    . DC  I  5 66  ? -48.563 -18.123 80.953 1.00 63.38  ? -8   DC  I C2    1 
ATOM   7495  O  O2    . DC  I  5 66  ? -48.770 -19.308 80.668 1.00 63.17  ? -8   DC  I O2    1 
ATOM   7496  N  N3    . DC  I  5 66  ? -47.786 -17.341 80.155 1.00 63.16  ? -8   DC  I N3    1 
ATOM   7497  C  C4    . DC  I  5 66  ? -47.573 -16.060 80.481 1.00 64.00  ? -8   DC  I C4    1 
ATOM   7498  N  N4    . DC  I  5 66  ? -46.807 -15.320 79.670 1.00 63.61  ? -8   DC  I N4    1 
ATOM   7499  C  C5    . DC  I  5 66  ? -48.147 -15.479 81.659 1.00 63.82  ? -8   DC  I C5    1 
ATOM   7500  C  C6    . DC  I  5 66  ? -48.912 -16.262 82.440 1.00 63.65  ? -8   DC  I C6    1 
ATOM   7501  P  P     . DA  I  5 67  ? -50.734 -20.549 86.715 1.00 65.12  ? -7   DA  I P     1 
ATOM   7502  O  OP1   . DA  I  5 67  ? -51.636 -21.486 87.423 1.00 65.27  ? -7   DA  I OP1   1 
ATOM   7503  O  OP2   . DA  I  5 67  ? -50.175 -19.374 87.425 1.00 65.13  ? -7   DA  I OP2   1 
ATOM   7504  O  "O5'" . DA  I  5 67  ? -49.517 -21.402 86.123 1.00 63.96  ? -7   DA  I "O5'" 1 
ATOM   7505  C  "C5'" . DA  I  5 67  ? -49.707 -22.639 85.420 1.00 61.89  ? -7   DA  I "C5'" 1 
ATOM   7506  C  "C4'" . DA  I  5 67  ? -48.404 -23.007 84.733 1.00 60.66  ? -7   DA  I "C4'" 1 
ATOM   7507  O  "O4'" . DA  I  5 67  ? -47.950 -21.885 83.920 1.00 59.91  ? -7   DA  I "O4'" 1 
ATOM   7508  C  "C3'" . DA  I  5 67  ? -47.260 -23.312 85.705 1.00 59.32  ? -7   DA  I "C3'" 1 
ATOM   7509  O  "O3'" . DA  I  5 67  ? -46.487 -24.358 85.204 1.00 57.76  ? -7   DA  I "O3'" 1 
ATOM   7510  C  "C2'" . DA  I  5 67  ? -46.434 -22.033 85.709 1.00 59.41  ? -7   DA  I "C2'" 1 
ATOM   7511  C  "C1'" . DA  I  5 67  ? -46.589 -21.654 84.241 1.00 59.67  ? -7   DA  I "C1'" 1 
ATOM   7512  N  N9    . DA  I  5 67  ? -46.205 -20.288 83.920 1.00 59.55  ? -7   DA  I N9    1 
ATOM   7513  C  C8    . DA  I  5 67  ? -46.385 -19.159 84.671 1.00 59.44  ? -7   DA  I C8    1 
ATOM   7514  N  N7    . DA  I  5 67  ? -45.921 -18.067 84.112 1.00 58.83  ? -7   DA  I N7    1 
ATOM   7515  C  C5    . DA  I  5 67  ? -45.400 -18.522 82.914 1.00 59.40  ? -7   DA  I C5    1 
ATOM   7516  C  C6    . DA  I  5 67  ? -44.763 -17.858 81.851 1.00 59.63  ? -7   DA  I C6    1 
ATOM   7517  N  N6    . DA  I  5 67  ? -44.559 -16.536 81.879 1.00 59.43  ? -7   DA  I N6    1 
ATOM   7518  N  N1    . DA  I  5 67  ? -44.356 -18.595 80.782 1.00 59.63  ? -7   DA  I N1    1 
ATOM   7519  C  C2    . DA  I  5 67  ? -44.582 -19.917 80.780 1.00 59.20  ? -7   DA  I C2    1 
ATOM   7520  N  N3    . DA  I  5 67  ? -45.169 -20.655 81.727 1.00 59.21  ? -7   DA  I N3    1 
ATOM   7521  C  C4    . DA  I  5 67  ? -45.559 -19.890 82.773 1.00 59.67  ? -7   DA  I C4    1 
ATOM   7522  P  P     . DG  I  5 68  ? -46.603 -25.802 85.856 1.00 57.55  ? -6   DG  I P     1 
ATOM   7523  O  OP1   . DG  I  5 68  ? -48.052 -26.104 85.968 1.00 58.35  ? -6   DG  I OP1   1 
ATOM   7524  O  OP2   . DG  I  5 68  ? -45.694 -25.815 87.024 1.00 57.00  ? -6   DG  I OP2   1 
ATOM   7525  O  "O5'" . DG  I  5 68  ? -45.980 -26.771 84.747 1.00 55.68  ? -6   DG  I "O5'" 1 
ATOM   7526  C  "C5'" . DG  I  5 68  ? -46.352 -26.582 83.373 1.00 53.03  ? -6   DG  I "C5'" 1 
ATOM   7527  C  "C4'" . DG  I  5 68  ? -45.168 -26.601 82.416 1.00 49.96  ? -6   DG  I "C4'" 1 
ATOM   7528  O  "O4'" . DG  I  5 68  ? -44.538 -25.300 82.341 1.00 48.38  ? -6   DG  I "O4'" 1 
ATOM   7529  C  "C3'" . DG  I  5 68  ? -44.066 -27.588 82.754 1.00 48.94  ? -6   DG  I "C3'" 1 
ATOM   7530  O  "O3'" . DG  I  5 68  ? -43.724 -28.189 81.536 1.00 49.15  ? -6   DG  I "O3'" 1 
ATOM   7531  C  "C2'" . DG  I  5 68  ? -42.950 -26.723 83.349 1.00 48.86  ? -6   DG  I "C2'" 1 
ATOM   7532  C  "C1'" . DG  I  5 68  ? -43.159 -25.378 82.663 1.00 48.58  ? -6   DG  I "C1'" 1 
ATOM   7533  N  N9    . DG  I  5 68  ? -42.959 -24.139 83.405 1.00 48.17  ? -6   DG  I N9    1 
ATOM   7534  C  C8    . DG  I  5 68  ? -43.298 -23.870 84.702 1.00 48.17  ? -6   DG  I C8    1 
ATOM   7535  N  N7    . DG  I  5 68  ? -43.038 -22.643 85.065 1.00 47.95  ? -6   DG  I N7    1 
ATOM   7536  C  C5    . DG  I  5 68  ? -42.514 -22.051 83.935 1.00 47.91  ? -6   DG  I C5    1 
ATOM   7537  C  C6    . DG  I  5 68  ? -42.061 -20.725 83.720 1.00 48.47  ? -6   DG  I C6    1 
ATOM   7538  O  O6    . DG  I  5 68  ? -42.021 -19.769 84.506 1.00 48.58  ? -6   DG  I O6    1 
ATOM   7539  N  N1    . DG  I  5 68  ? -41.595 -20.529 82.423 1.00 48.33  ? -6   DG  I N1    1 
ATOM   7540  C  C2    . DG  I  5 68  ? -41.573 -21.494 81.449 1.00 48.26  ? -6   DG  I C2    1 
ATOM   7541  N  N2    . DG  I  5 68  ? -41.088 -21.085 80.270 1.00 48.30  ? -6   DG  I N2    1 
ATOM   7542  N  N3    . DG  I  5 68  ? -42.002 -22.746 81.628 1.00 48.24  ? -6   DG  I N3    1 
ATOM   7543  C  C4    . DG  I  5 68  ? -42.465 -22.956 82.895 1.00 48.48  ? -6   DG  I C4    1 
ATOM   7544  P  P     . DC  I  5 69  ? -42.743 -29.443 81.452 1.00 49.88  ? -5   DC  I P     1 
ATOM   7545  O  OP1   . DC  I  5 69  ? -43.233 -30.362 80.411 1.00 49.61  ? -5   DC  I OP1   1 
ATOM   7546  O  OP2   . DC  I  5 69  ? -42.527 -29.953 82.820 1.00 49.35  ? -5   DC  I OP2   1 
ATOM   7547  O  "O5'" . DC  I  5 69  ? -41.389 -28.788 80.907 1.00 50.11  ? -5   DC  I "O5'" 1 
ATOM   7548  C  "C5'" . DC  I  5 69  ? -41.387 -27.605 80.109 1.00 49.94  ? -5   DC  I "C5'" 1 
ATOM   7549  C  "C4'" . DC  I  5 69  ? -39.976 -27.053 80.006 1.00 50.24  ? -5   DC  I "C4'" 1 
ATOM   7550  O  "O4'" . DC  I  5 69  ? -39.826 -25.849 80.808 1.00 51.48  ? -5   DC  I "O4'" 1 
ATOM   7551  C  "C3'" . DC  I  5 69  ? -38.867 -27.973 80.490 1.00 49.85  ? -5   DC  I "C3'" 1 
ATOM   7552  O  "O3'" . DC  I  5 69  ? -37.716 -27.611 79.759 1.00 49.30  ? -5   DC  I "O3'" 1 
ATOM   7553  C  "C2'" . DC  I  5 69  ? -38.681 -27.553 81.944 1.00 50.20  ? -5   DC  I "C2'" 1 
ATOM   7554  C  "C1'" . DC  I  5 69  ? -38.803 -26.038 81.774 1.00 51.75  ? -5   DC  I "C1'" 1 
ATOM   7555  N  N1    . DC  I  5 69  ? -39.149 -25.254 83.011 1.00 52.15  ? -5   DC  I N1    1 
ATOM   7556  C  C2    . DC  I  5 69  ? -39.040 -23.846 83.017 1.00 52.28  ? -5   DC  I C2    1 
ATOM   7557  O  O2    . DC  I  5 69  ? -38.656 -23.233 82.019 1.00 52.22  ? -5   DC  I O2    1 
ATOM   7558  N  N3    . DC  I  5 69  ? -39.361 -23.169 84.148 1.00 52.85  ? -5   DC  I N3    1 
ATOM   7559  C  C4    . DC  I  5 69  ? -39.773 -23.837 85.230 1.00 52.87  ? -5   DC  I C4    1 
ATOM   7560  N  N4    . DC  I  5 69  ? -40.072 -23.115 86.307 1.00 52.78  ? -5   DC  I N4    1 
ATOM   7561  C  C5    . DC  I  5 69  ? -39.898 -25.265 85.260 1.00 52.44  ? -5   DC  I C5    1 
ATOM   7562  C  C6    . DC  I  5 69  ? -39.573 -25.920 84.138 1.00 52.54  ? -5   DC  I C6    1 
ATOM   7563  P  P     . DT  I  5 70  ? -37.118 -28.490 78.564 1.00 46.79  ? -4   DT  I P     1 
ATOM   7564  O  OP1   . DT  I  5 70  ? -38.253 -28.916 77.703 1.00 46.04  ? -4   DT  I OP1   1 
ATOM   7565  O  OP2   . DT  I  5 70  ? -36.191 -29.506 79.137 1.00 44.98  ? -4   DT  I OP2   1 
ATOM   7566  O  "O5'" . DT  I  5 70  ? -36.264 -27.347 77.829 1.00 43.42  ? -4   DT  I "O5'" 1 
ATOM   7567  C  "C5'" . DT  I  5 70  ? -36.816 -26.063 77.699 1.00 41.52  ? -4   DT  I "C5'" 1 
ATOM   7568  C  "C4'" . DT  I  5 70  ? -35.806 -24.931 77.862 1.00 41.05  ? -4   DT  I "C4'" 1 
ATOM   7569  O  "O4'" . DT  I  5 70  ? -35.944 -24.271 79.159 1.00 40.18  ? -4   DT  I "O4'" 1 
ATOM   7570  C  "C3'" . DT  I  5 70  ? -34.327 -25.260 77.681 1.00 39.61  ? -4   DT  I "C3'" 1 
ATOM   7571  O  "O3'" . DT  I  5 70  ? -33.806 -24.247 76.781 1.00 38.15  ? -4   DT  I "O3'" 1 
ATOM   7572  C  "C2'" . DT  I  5 70  ? -33.795 -25.203 79.113 1.00 39.37  ? -4   DT  I "C2'" 1 
ATOM   7573  C  "C1'" . DT  I  5 70  ? -34.681 -24.143 79.784 1.00 39.55  ? -4   DT  I "C1'" 1 
ATOM   7574  N  N1    . DT  I  5 70  ? -34.966 -24.277 81.276 1.00 39.16  ? -4   DT  I N1    1 
ATOM   7575  C  C2    . DT  I  5 70  ? -35.263 -23.146 82.028 1.00 40.09  ? -4   DT  I C2    1 
ATOM   7576  O  O2    . DT  I  5 70  ? -35.296 -22.003 81.611 1.00 40.09  ? -4   DT  I O2    1 
ATOM   7577  N  N3    . DT  I  5 70  ? -35.522 -23.377 83.345 1.00 40.28  ? -4   DT  I N3    1 
ATOM   7578  C  C4    . DT  I  5 70  ? -35.533 -24.596 83.990 1.00 39.84  ? -4   DT  I C4    1 
ATOM   7579  O  O4    . DT  I  5 70  ? -35.798 -24.646 85.197 1.00 39.52  ? -4   DT  I O4    1 
ATOM   7580  C  C5    . DT  I  5 70  ? -35.218 -25.744 83.152 1.00 38.93  ? -4   DT  I C5    1 
ATOM   7581  C  C7    . DT  I  5 70  ? -35.174 -27.149 83.693 1.00 39.35  ? -4   DT  I C7    1 
ATOM   7582  C  C6    . DT  I  5 70  ? -34.963 -25.523 81.863 1.00 37.69  ? -4   DT  I C6    1 
ATOM   7583  P  P     . DG  I  5 71  ? -32.274 -24.112 76.324 1.00 34.90  ? -3   DG  I P     1 
ATOM   7584  O  OP1   . DG  I  5 71  ? -32.261 -23.870 74.871 1.00 36.10  ? -3   DG  I OP1   1 
ATOM   7585  O  OP2   . DG  I  5 71  ? -31.497 -25.247 76.849 1.00 34.24  ? -3   DG  I OP2   1 
ATOM   7586  O  "O5'" . DG  I  5 71  ? -31.823 -22.813 77.113 1.00 33.22  ? -3   DG  I "O5'" 1 
ATOM   7587  C  "C5'" . DG  I  5 71  ? -32.377 -21.560 76.881 1.00 33.94  ? -3   DG  I "C5'" 1 
ATOM   7588  C  "C4'" . DG  I  5 71  ? -31.696 -20.557 77.809 1.00 36.32  ? -3   DG  I "C4'" 1 
ATOM   7589  O  "O4'" . DG  I  5 71  ? -31.860 -20.877 79.214 1.00 36.88  ? -3   DG  I "O4'" 1 
ATOM   7590  C  "C3'" . DG  I  5 71  ? -30.192 -20.419 77.670 1.00 37.62  ? -3   DG  I "C3'" 1 
ATOM   7591  O  "O3'" . DG  I  5 71  ? -29.929 -19.079 77.978 1.00 41.72  ? -3   DG  I "O3'" 1 
ATOM   7592  C  "C2'" . DG  I  5 71  ? -29.602 -21.361 78.716 1.00 36.17  ? -3   DG  I "C2'" 1 
ATOM   7593  C  "C1'" . DG  I  5 71  ? -30.625 -21.190 79.833 1.00 35.39  ? -3   DG  I "C1'" 1 
ATOM   7594  N  N9    . DG  I  5 71  ? -30.888 -22.376 80.642 1.00 35.11  ? -3   DG  I N9    1 
ATOM   7595  C  C8    . DG  I  5 71  ? -30.858 -23.697 80.251 1.00 35.05  ? -3   DG  I C8    1 
ATOM   7596  N  N7    . DG  I  5 71  ? -31.145 -24.547 81.200 1.00 34.06  ? -3   DG  I N7    1 
ATOM   7597  C  C5    . DG  I  5 71  ? -31.405 -23.727 82.288 1.00 34.48  ? -3   DG  I C5    1 
ATOM   7598  C  C6    . DG  I  5 71  ? -31.785 -24.076 83.597 1.00 34.32  ? -3   DG  I C6    1 
ATOM   7599  O  O6    . DG  I  5 71  ? -31.956 -25.212 84.044 1.00 35.17  ? -3   DG  I O6    1 
ATOM   7600  N  N1    . DG  I  5 71  ? -31.944 -22.964 84.415 1.00 34.54  ? -3   DG  I N1    1 
ATOM   7601  C  C2    . DG  I  5 71  ? -31.758 -21.655 84.007 1.00 35.24  ? -3   DG  I C2    1 
ATOM   7602  N  N2    . DG  I  5 71  ? -31.951 -20.702 84.939 1.00 34.67  ? -3   DG  I N2    1 
ATOM   7603  N  N3    . DG  I  5 71  ? -31.412 -21.307 82.764 1.00 34.87  ? -3   DG  I N3    1 
ATOM   7604  C  C4    . DG  I  5 71  ? -31.253 -22.392 81.965 1.00 34.72  ? -3   DG  I C4    1 
ATOM   7605  P  P     . DG  I  5 72  ? -28.506 -18.479 77.602 1.00 43.52  ? -2   DG  I P     1 
ATOM   7606  O  OP1   . DG  I  5 72  ? -28.774 -17.262 76.812 1.00 41.55  ? -2   DG  I OP1   1 
ATOM   7607  O  OP2   . DG  I  5 72  ? -27.675 -19.640 77.165 1.00 41.67  ? -2   DG  I OP2   1 
ATOM   7608  O  "O5'" . DG  I  5 72  ? -27.889 -18.008 79.000 1.00 45.75  ? -2   DG  I "O5'" 1 
ATOM   7609  C  "C5'" . DG  I  5 72  ? -28.599 -17.239 79.981 1.00 48.69  ? -2   DG  I "C5'" 1 
ATOM   7610  C  "C4'" . DG  I  5 72  ? -27.999 -17.538 81.349 1.00 50.69  ? -2   DG  I "C4'" 1 
ATOM   7611  O  "O4'" . DG  I  5 72  ? -28.390 -18.880 81.751 1.00 50.43  ? -2   DG  I "O4'" 1 
ATOM   7612  C  "C3'" . DG  I  5 72  ? -26.465 -17.525 81.419 1.00 51.79  ? -2   DG  I "C3'" 1 
ATOM   7613  O  "O3'" . DG  I  5 72  ? -26.073 -16.734 82.514 1.00 54.49  ? -2   DG  I "O3'" 1 
ATOM   7614  C  "C2'" . DG  I  5 72  ? -26.083 -18.992 81.638 1.00 50.52  ? -2   DG  I "C2'" 1 
ATOM   7615  C  "C1'" . DG  I  5 72  ? -27.299 -19.471 82.411 1.00 48.98  ? -2   DG  I "C1'" 1 
ATOM   7616  N  N9    . DG  I  5 72  ? -27.485 -20.910 82.429 1.00 48.25  ? -2   DG  I N9    1 
ATOM   7617  C  C8    . DG  I  5 72  ? -27.216 -21.824 81.439 1.00 48.68  ? -2   DG  I C8    1 
ATOM   7618  N  N7    . DG  I  5 72  ? -27.487 -23.057 81.769 1.00 48.27  ? -2   DG  I N7    1 
ATOM   7619  C  C5    . DG  I  5 72  ? -27.957 -22.938 83.072 1.00 48.48  ? -2   DG  I C5    1 
ATOM   7620  C  C6    . DG  I  5 72  ? -28.408 -23.930 83.980 1.00 48.84  ? -2   DG  I C6    1 
ATOM   7621  O  O6    . DG  I  5 72  ? -28.484 -25.153 83.787 1.00 48.76  ? -2   DG  I O6    1 
ATOM   7622  N  N1    . DG  I  5 72  ? -28.802 -23.391 85.206 1.00 48.38  ? -2   DG  I N1    1 
ATOM   7623  C  C2    . DG  I  5 72  ? -28.756 -22.049 85.499 1.00 48.59  ? -2   DG  I C2    1 
ATOM   7624  N  N2    . DG  I  5 72  ? -29.173 -21.679 86.715 1.00 48.50  ? -2   DG  I N2    1 
ATOM   7625  N  N3    . DG  I  5 72  ? -28.336 -21.117 84.656 1.00 48.27  ? -2   DG  I N3    1 
ATOM   7626  C  C4    . DG  I  5 72  ? -27.959 -21.629 83.477 1.00 47.36  ? -2   DG  I C4    1 
ATOM   7627  P  P     . DA  I  5 73  ? -24.604 -16.107 82.678 1.00 56.37  ? -1   DA  I P     1 
ATOM   7628  O  OP1   . DA  I  5 73  ? -24.613 -14.849 81.902 1.00 55.70  ? -1   DA  I OP1   1 
ATOM   7629  O  OP2   . DA  I  5 73  ? -23.567 -17.155 82.503 1.00 54.62  ? -1   DA  I OP2   1 
ATOM   7630  O  "O5'" . DA  I  5 73  ? -24.612 -15.704 84.228 1.00 57.27  ? -1   DA  I "O5'" 1 
ATOM   7631  C  "C5'" . DA  I  5 73  ? -25.809 -15.890 85.001 1.00 57.84  ? -1   DA  I "C5'" 1 
ATOM   7632  C  "C4'" . DA  I  5 73  ? -25.528 -16.600 86.314 1.00 57.94  ? -1   DA  I "C4'" 1 
ATOM   7633  O  "O4'" . DA  I  5 73  ? -25.865 -18.008 86.256 1.00 57.25  ? -1   DA  I "O4'" 1 
ATOM   7634  C  "C3'" . DA  I  5 73  ? -24.087 -16.543 86.791 1.00 59.15  ? -1   DA  I "C3'" 1 
ATOM   7635  O  "O3'" . DA  I  5 73  ? -24.173 -16.173 88.149 1.00 62.13  ? -1   DA  I "O3'" 1 
ATOM   7636  C  "C2'" . DA  I  5 73  ? -23.554 -17.963 86.611 1.00 57.73  ? -1   DA  I "C2'" 1 
ATOM   7637  C  "C1'" . DA  I  5 73  ? -24.824 -18.769 86.830 1.00 56.16  ? -1   DA  I "C1'" 1 
ATOM   7638  N  N9    . DA  I  5 73  ? -24.839 -20.059 86.153 1.00 55.66  ? -1   DA  I N9    1 
ATOM   7639  C  C8    . DA  I  5 73  ? -24.452 -20.320 84.871 1.00 55.34  ? -1   DA  I C8    1 
ATOM   7640  N  N7    . DA  I  5 73  ? -24.589 -21.581 84.535 1.00 55.63  ? -1   DA  I N7    1 
ATOM   7641  C  C5    . DA  I  5 73  ? -25.105 -22.189 85.669 1.00 55.43  ? -1   DA  I C5    1 
ATOM   7642  C  C6    . DA  I  5 73  ? -25.482 -23.518 85.971 1.00 55.38  ? -1   DA  I C6    1 
ATOM   7643  N  N6    . DA  I  5 73  ? -25.388 -24.533 85.111 1.00 54.97  ? -1   DA  I N6    1 
ATOM   7644  N  N1    . DA  I  5 73  ? -25.964 -23.778 87.210 1.00 55.75  ? -1   DA  I N1    1 
ATOM   7645  C  C2    . DA  I  5 73  ? -26.069 -22.778 88.093 1.00 55.46  ? -1   DA  I C2    1 
ATOM   7646  N  N3    . DA  I  5 73  ? -25.750 -21.492 87.918 1.00 55.41  ? -1   DA  I N3    1 
ATOM   7647  C  C4    . DA  I  5 73  ? -25.271 -21.258 86.677 1.00 55.46  ? -1   DA  I C4    1 
ATOM   7648  P  P     . DA  I  5 74  ? -22.881 -15.733 88.972 1.00 62.88  ? 0    DA  I P     1 
ATOM   7649  O  OP1   . DA  I  5 74  ? -23.331 -14.678 89.913 1.00 62.95  ? 0    DA  I OP1   1 
ATOM   7650  O  OP2   . DA  I  5 74  ? -21.762 -15.486 88.028 1.00 63.12  ? 0    DA  I OP2   1 
ATOM   7651  O  "O5'" . DA  I  5 74  ? -22.571 -17.077 89.775 1.00 62.97  ? 0    DA  I "O5'" 1 
ATOM   7652  C  "C5'" . DA  I  5 74  ? -23.597 -17.618 90.579 1.00 63.59  ? 0    DA  I "C5'" 1 
ATOM   7653  C  "C4'" . DA  I  5 74  ? -23.122 -18.893 91.235 1.00 64.61  ? 0    DA  I "C4'" 1 
ATOM   7654  O  "O4'" . DA  I  5 74  ? -23.360 -19.981 90.316 1.00 64.99  ? 0    DA  I "O4'" 1 
ATOM   7655  C  "C3'" . DA  I  5 74  ? -21.643 -18.961 91.617 1.00 65.36  ? 0    DA  I "C3'" 1 
ATOM   7656  O  "O3'" . DA  I  5 74  ? -21.568 -19.555 92.913 1.00 66.65  ? 0    DA  I "O3'" 1 
ATOM   7657  C  "C2'" . DA  I  5 74  ? -21.043 -19.877 90.557 1.00 65.51  ? 0    DA  I "C2'" 1 
ATOM   7658  C  "C1'" . DA  I  5 74  ? -22.223 -20.809 90.303 1.00 64.92  ? 0    DA  I "C1'" 1 
ATOM   7659  N  N9    . DA  I  5 74  ? -22.169 -21.476 89.012 1.00 64.55  ? 0    DA  I N9    1 
ATOM   7660  C  C8    . DA  I  5 74  ? -21.863 -20.914 87.801 1.00 64.68  ? 0    DA  I C8    1 
ATOM   7661  N  N7    . DA  I  5 74  ? -21.888 -21.771 86.810 1.00 64.95  ? 0    DA  I N7    1 
ATOM   7662  C  C5    . DA  I  5 74  ? -22.237 -22.969 87.421 1.00 64.54  ? 0    DA  I C5    1 
ATOM   7663  C  C6    . DA  I  5 74  ? -22.432 -24.276 86.924 1.00 64.68  ? 0    DA  I C6    1 
ATOM   7664  N  N6    . DA  I  5 74  ? -22.295 -24.571 85.634 1.00 64.72  ? 0    DA  I N6    1 
ATOM   7665  N  N1    . DA  I  5 74  ? -22.772 -25.258 87.795 1.00 64.74  ? 0    DA  I N1    1 
ATOM   7666  C  C2    . DA  I  5 74  ? -22.909 -24.944 89.093 1.00 64.89  ? 0    DA  I C2    1 
ATOM   7667  N  N3    . DA  I  5 74  ? -22.753 -23.749 89.674 1.00 64.37  ? 0    DA  I N3    1 
ATOM   7668  C  C4    . DA  I  5 74  ? -22.414 -22.803 88.778 1.00 63.96  ? 0    DA  I C4    1 
ATOM   7669  P  P     . DT  I  5 75  ? -20.223 -19.688 93.776 1.00 66.58  ? 1    DT  I P     1 
ATOM   7670  O  OP1   . DT  I  5 75  ? -20.573 -19.230 95.148 1.00 65.46  ? 1    DT  I OP1   1 
ATOM   7671  O  OP2   . DT  I  5 75  ? -19.084 -19.093 93.016 1.00 65.61  ? 1    DT  I OP2   1 
ATOM   7672  O  "O5'" . DT  I  5 75  ? -19.988 -21.268 93.799 1.00 64.43  ? 1    DT  I "O5'" 1 
ATOM   7673  C  "C5'" . DT  I  5 75  ? -21.078 -22.144 94.061 1.00 63.70  ? 1    DT  I "C5'" 1 
ATOM   7674  C  "C4'" . DT  I  5 75  ? -20.544 -23.561 94.061 1.00 63.28  ? 1    DT  I "C4'" 1 
ATOM   7675  O  "O4'" . DT  I  5 75  ? -20.689 -24.138 92.736 1.00 62.78  ? 1    DT  I "O4'" 1 
ATOM   7676  C  "C3'" . DT  I  5 75  ? -19.063 -23.643 94.412 1.00 63.22  ? 1    DT  I "C3'" 1 
ATOM   7677  O  "O3'" . DT  I  5 75  ? -18.833 -24.666 95.357 1.00 64.73  ? 1    DT  I "O3'" 1 
ATOM   7678  C  "C2'" . DT  I  5 75  ? -18.360 -23.925 93.084 1.00 62.67  ? 1    DT  I "C2'" 1 
ATOM   7679  C  "C1'" . DT  I  5 75  ? -19.442 -24.683 92.319 1.00 60.86  ? 1    DT  I "C1'" 1 
ATOM   7680  N  N1    . DT  I  5 75  ? -19.334 -24.605 90.818 1.00 59.52  ? 1    DT  I N1    1 
ATOM   7681  C  C2    . DT  I  5 75  ? -19.583 -25.744 90.074 1.00 58.70  ? 1    DT  I C2    1 
ATOM   7682  O  O2    . DT  I  5 75  ? -19.879 -26.823 90.557 1.00 58.76  ? 1    DT  I O2    1 
ATOM   7683  N  N3    . DT  I  5 75  ? -19.469 -25.578 88.722 1.00 57.95  ? 1    DT  I N3    1 
ATOM   7684  C  C4    . DT  I  5 75  ? -19.148 -24.420 88.050 1.00 58.56  ? 1    DT  I C4    1 
ATOM   7685  O  O4    . DT  I  5 75  ? -19.081 -24.398 86.826 1.00 59.12  ? 1    DT  I O4    1 
ATOM   7686  C  C5    . DT  I  5 75  ? -18.898 -23.262 88.882 1.00 58.57  ? 1    DT  I C5    1 
ATOM   7687  C  C7    . DT  I  5 75  ? -18.535 -21.941 88.268 1.00 58.98  ? 1    DT  I C7    1 
ATOM   7688  C  C6    . DT  I  5 75  ? -19.006 -23.404 90.209 1.00 58.44  ? 1    DT  I C6    1 
ATOM   7689  P  P     . DC  I  5 76  ? -17.360 -24.820 95.980 1.00 67.20  ? 2    DC  I P     1 
ATOM   7690  O  OP1   . DC  I  5 76  ? -17.520 -25.215 97.399 1.00 68.31  ? 2    DC  I OP1   1 
ATOM   7691  O  OP2   . DC  I  5 76  ? -16.554 -23.607 95.669 1.00 66.35  ? 2    DC  I OP2   1 
ATOM   7692  O  "O5'" . DC  I  5 76  ? -16.794 -26.091 95.181 1.00 66.26  ? 2    DC  I "O5'" 1 
ATOM   7693  C  "C5'" . DC  I  5 76  ? -17.379 -27.375 95.423 1.00 65.48  ? 2    DC  I "C5'" 1 
ATOM   7694  C  "C4'" . DC  I  5 76  ? -16.993 -28.391 94.367 1.00 64.92  ? 2    DC  I "C4'" 1 
ATOM   7695  O  "O4'" . DC  I  5 76  ? -17.263 -27.880 93.031 1.00 64.72  ? 2    DC  I "O4'" 1 
ATOM   7696  C  "C3'" . DC  I  5 76  ? -15.524 -28.779 94.370 1.00 64.91  ? 2    DC  I "C3'" 1 
ATOM   7697  O  "O3'" . DC  I  5 76  ? -15.448 -30.183 94.331 1.00 66.30  ? 2    DC  I "O3'" 1 
ATOM   7698  C  "C2'" . DC  I  5 76  ? -14.982 -28.208 93.065 1.00 64.11  ? 2    DC  I "C2'" 1 
ATOM   7699  C  "C1'" . DC  I  5 76  ? -16.222 -28.318 92.178 1.00 62.93  ? 2    DC  I "C1'" 1 
ATOM   7700  N  N1    . DC  I  5 76  ? -16.209 -27.503 90.907 1.00 61.82  ? 2    DC  I N1    1 
ATOM   7701  C  C2    . DC  I  5 76  ? -16.308 -28.114 89.631 1.00 61.69  ? 2    DC  I C2    1 
ATOM   7702  O  O2    . DC  I  5 76  ? -16.408 -29.345 89.505 1.00 61.12  ? 2    DC  I O2    1 
ATOM   7703  N  N3    . DC  I  5 76  ? -16.293 -27.318 88.530 1.00 61.21  ? 2    DC  I N3    1 
ATOM   7704  C  C4    . DC  I  5 76  ? -16.184 -25.994 88.666 1.00 61.27  ? 2    DC  I C4    1 
ATOM   7705  N  N4    . DC  I  5 76  ? -16.173 -25.254 87.564 1.00 61.50  ? 2    DC  I N4    1 
ATOM   7706  C  C5    . DC  I  5 76  ? -16.079 -25.356 89.932 1.00 60.98  ? 2    DC  I C5    1 
ATOM   7707  C  C6    . DC  I  5 76  ? -16.100 -26.143 91.010 1.00 61.29  ? 2    DC  I C6    1 
ATOM   7708  P  P     . DC  I  5 77  ? -14.419 -30.886 95.323 1.00 67.20  ? 3    DC  I P     1 
ATOM   7709  O  OP1   . DC  I  5 77  ? -15.265 -31.593 96.321 1.00 66.91  ? 3    DC  I OP1   1 
ATOM   7710  O  OP2   . DC  I  5 77  ? -13.454 -29.825 95.723 1.00 67.00  ? 3    DC  I OP2   1 
ATOM   7711  O  "O5'" . DC  I  5 77  ? -13.586 -31.952 94.451 1.00 64.75  ? 3    DC  I "O5'" 1 
ATOM   7712  C  "C5'" . DC  I  5 77  ? -14.186 -32.845 93.490 1.00 61.69  ? 3    DC  I "C5'" 1 
ATOM   7713  C  "C4'" . DC  I  5 77  ? -13.352 -32.978 92.214 1.00 59.09  ? 3    DC  I "C4'" 1 
ATOM   7714  O  "O4'" . DC  I  5 77  ? -13.634 -31.886 91.285 1.00 57.17  ? 3    DC  I "O4'" 1 
ATOM   7715  C  "C3'" . DC  I  5 77  ? -11.829 -32.979 92.378 1.00 57.80  ? 3    DC  I "C3'" 1 
ATOM   7716  O  "O3'" . DC  I  5 77  ? -11.309 -33.992 91.538 1.00 59.08  ? 3    DC  I "O3'" 1 
ATOM   7717  C  "C2'" . DC  I  5 77  ? -11.415 -31.614 91.834 1.00 56.16  ? 3    DC  I "C2'" 1 
ATOM   7718  C  "C1'" . DC  I  5 77  ? -12.415 -31.500 90.685 1.00 54.42  ? 3    DC  I "C1'" 1 
ATOM   7719  N  N1    . DC  I  5 77  ? -12.543 -30.149 90.019 1.00 53.46  ? 3    DC  I N1    1 
ATOM   7720  C  C2    . DC  I  5 77  ? -12.850 -30.034 88.642 1.00 52.46  ? 3    DC  I C2    1 
ATOM   7721  O  O2    . DC  I  5 77  ? -13.024 -31.044 87.949 1.00 51.50  ? 3    DC  I O2    1 
ATOM   7722  N  N3    . DC  I  5 77  ? -12.950 -28.794 88.091 1.00 52.17  ? 3    DC  I N3    1 
ATOM   7723  C  C4    . DC  I  5 77  ? -12.751 -27.700 88.840 1.00 52.44  ? 3    DC  I C4    1 
ATOM   7724  N  N4    . DC  I  5 77  ? -12.844 -26.496 88.268 1.00 52.22  ? 3    DC  I N4    1 
ATOM   7725  C  C5    . DC  I  5 77  ? -12.439 -27.795 90.226 1.00 51.71  ? 3    DC  I C5    1 
ATOM   7726  C  C6    . DC  I  5 77  ? -12.346 -29.019 90.758 1.00 52.60  ? 3    DC  I C6    1 
ATOM   7727  P  P     . DA  I  5 78  ? -10.950 -35.448 92.084 1.00 58.86  ? 4    DA  I P     1 
ATOM   7728  O  OP1   . DA  I  5 78  ? -11.981 -35.773 93.100 1.00 59.05  ? 4    DA  I OP1   1 
ATOM   7729  O  OP2   . DA  I  5 78  ? -9.491  -35.402 92.355 1.00 58.70  ? 4    DA  I OP2   1 
ATOM   7730  O  "O5'" . DA  I  5 78  ? -11.119 -36.499 90.887 1.00 57.17  ? 4    DA  I "O5'" 1 
ATOM   7731  C  "C5'" . DA  I  5 78  ? -12.194 -36.445 89.957 1.00 55.28  ? 4    DA  I "C5'" 1 
ATOM   7732  C  "C4'" . DA  I  5 78  ? -11.669 -36.449 88.523 1.00 54.14  ? 4    DA  I "C4'" 1 
ATOM   7733  O  "O4'" . DA  I  5 78  ? -11.394 -35.100 88.070 1.00 51.82  ? 4    DA  I "O4'" 1 
ATOM   7734  C  "C3'" . DA  I  5 78  ? -10.389 -37.235 88.253 1.00 54.14  ? 4    DA  I "C3'" 1 
ATOM   7735  O  "O3'" . DA  I  5 78  ? -10.607 -37.911 87.031 1.00 56.17  ? 4    DA  I "O3'" 1 
ATOM   7736  C  "C2'" . DA  I  5 78  ? -9.284  -36.176 88.171 1.00 51.74  ? 4    DA  I "C2'" 1 
ATOM   7737  C  "C1'" . DA  I  5 78  ? -10.052 -34.972 87.654 1.00 50.53  ? 4    DA  I "C1'" 1 
ATOM   7738  N  N9    . DA  I  5 78  ? -9.618  -33.658 88.119 1.00 50.62  ? 4    DA  I N9    1 
ATOM   7739  C  C8    . DA  I  5 78  ? -9.021  -33.304 89.298 1.00 50.21  ? 4    DA  I C8    1 
ATOM   7740  N  N7    . DA  I  5 78  ? -8.777  -32.016 89.402 1.00 49.74  ? 4    DA  I N7    1 
ATOM   7741  C  C5    . DA  I  5 78  ? -9.250  -31.485 88.213 1.00 49.87  ? 4    DA  I C5    1 
ATOM   7742  C  C6    . DA  I  5 78  ? -9.294  -30.175 87.688 1.00 49.94  ? 4    DA  I C6    1 
ATOM   7743  N  N6    . DA  I  5 78  ? -8.822  -29.104 88.331 1.00 49.87  ? 4    DA  I N6    1 
ATOM   7744  N  N1    . DA  I  5 78  ? -9.847  -29.995 86.464 1.00 50.35  ? 4    DA  I N1    1 
ATOM   7745  C  C2    . DA  I  5 78  ? -10.322 -31.057 85.799 1.00 49.96  ? 4    DA  I C2    1 
ATOM   7746  N  N3    . DA  I  5 78  ? -10.337 -32.332 86.183 1.00 49.77  ? 4    DA  I N3    1 
ATOM   7747  C  C4    . DA  I  5 78  ? -9.782  -32.481 87.411 1.00 50.66  ? 4    DA  I C4    1 
ATOM   7748  P  P     . DG  I  5 79  ? -9.562  -38.954 86.435 1.00 57.58  ? 5    DG  I P     1 
ATOM   7749  O  OP1   . DG  I  5 79  ? -10.326 -40.065 85.829 1.00 58.37  ? 5    DG  I OP1   1 
ATOM   7750  O  OP2   . DG  I  5 79  ? -8.512  -39.203 87.444 1.00 58.89  ? 5    DG  I OP2   1 
ATOM   7751  O  "O5'" . DG  I  5 79  ? -8.865  -38.123 85.268 1.00 58.91  ? 5    DG  I "O5'" 1 
ATOM   7752  C  "C5'" . DG  I  5 79  ? -9.539  -37.651 84.086 1.00 58.13  ? 5    DG  I "C5'" 1 
ATOM   7753  C  "C4'" . DG  I  5 79  ? -8.570  -36.701 83.405 1.00 57.69  ? 5    DG  I "C4'" 1 
ATOM   7754  O  "O4'" . DG  I  5 79  ? -8.334  -35.567 84.283 1.00 56.97  ? 5    DG  I "O4'" 1 
ATOM   7755  C  "C3'" . DG  I  5 79  ? -7.179  -37.300 83.128 1.00 57.54  ? 5    DG  I "C3'" 1 
ATOM   7756  O  "O3'" . DG  I  5 79  ? -6.701  -36.973 81.816 1.00 57.17  ? 5    DG  I "O3'" 1 
ATOM   7757  C  "C2'" . DG  I  5 79  ? -6.282  -36.655 84.185 1.00 57.08  ? 5    DG  I "C2'" 1 
ATOM   7758  C  "C1'" . DG  I  5 79  ? -6.952  -35.289 84.247 1.00 56.66  ? 5    DG  I "C1'" 1 
ATOM   7759  N  N9    . DG  I  5 79  ? -6.569  -34.439 85.368 1.00 56.73  ? 5    DG  I N9    1 
ATOM   7760  C  C8    . DG  I  5 79  ? -6.114  -34.835 86.599 1.00 56.42  ? 5    DG  I C8    1 
ATOM   7761  N  N7    . DG  I  5 79  ? -5.853  -33.831 87.385 1.00 56.82  ? 5    DG  I N7    1 
ATOM   7762  C  C5    . DG  I  5 79  ? -6.142  -32.698 86.634 1.00 56.47  ? 5    DG  I C5    1 
ATOM   7763  C  C6    . DG  I  5 79  ? -6.047  -31.317 86.961 1.00 56.31  ? 5    DG  I C6    1 
ATOM   7764  O  O6    . DG  I  5 79  ? -5.678  -30.782 88.004 1.00 56.65  ? 5    DG  I O6    1 
ATOM   7765  N  N1    . DG  I  5 79  ? -6.424  -30.486 85.921 1.00 56.56  ? 5    DG  I N1    1 
ATOM   7766  C  C2    . DG  I  5 79  ? -6.853  -30.935 84.700 1.00 56.88  ? 5    DG  I C2    1 
ATOM   7767  N  N2    . DG  I  5 79  ? -7.177  -29.956 83.848 1.00 56.98  ? 5    DG  I N2    1 
ATOM   7768  N  N3    . DG  I  5 79  ? -6.959  -32.225 84.360 1.00 56.78  ? 5    DG  I N3    1 
ATOM   7769  C  C4    . DG  I  5 79  ? -6.584  -33.055 85.381 1.00 56.90  ? 5    DG  I C4    1 
ATOM   7770  P  P     . DC  I  5 80  ? -7.223  -37.700 80.487 1.00 56.38  ? 6    DC  I P     1 
ATOM   7771  O  OP1   . DC  I  5 80  ? -8.598  -38.242 80.679 1.00 57.40  ? 6    DC  I OP1   1 
ATOM   7772  O  OP2   . DC  I  5 80  ? -6.134  -38.572 79.988 1.00 54.73  ? 6    DC  I OP2   1 
ATOM   7773  O  "O5'" . DC  I  5 80  ? -7.369  -36.430 79.538 1.00 53.46  ? 6    DC  I "O5'" 1 
ATOM   7774  C  "C5'" . DC  I  5 80  ? -8.558  -35.649 79.517 1.00 48.37  ? 6    DC  I "C5'" 1 
ATOM   7775  C  "C4'" . DC  I  5 80  ? -8.128  -34.284 79.046 1.00 44.85  ? 6    DC  I "C4'" 1 
ATOM   7776  O  "O4'" . DC  I  5 80  ? -7.418  -33.621 80.121 1.00 44.61  ? 6    DC  I "O4'" 1 
ATOM   7777  C  "C3'" . DC  I  5 80  ? -7.146  -34.271 77.877 1.00 42.97  ? 6    DC  I "C3'" 1 
ATOM   7778  O  "O3'" . DC  I  5 80  ? -7.411  -33.060 77.183 1.00 41.15  ? 6    DC  I "O3'" 1 
ATOM   7779  C  "C2'" . DC  I  5 80  ? -5.782  -34.237 78.570 1.00 43.06  ? 6    DC  I "C2'" 1 
ATOM   7780  C  "C1'" . DC  I  5 80  ? -6.104  -33.275 79.712 1.00 43.92  ? 6    DC  I "C1'" 1 
ATOM   7781  N  N1    . DC  I  5 80  ? -5.238  -33.264 80.948 1.00 44.11  ? 6    DC  I N1    1 
ATOM   7782  C  C2    . DC  I  5 80  ? -4.952  -32.035 81.585 1.00 44.40  ? 6    DC  I C2    1 
ATOM   7783  O  O2    . DC  I  5 80  ? -5.383  -30.969 81.134 1.00 43.76  ? 6    DC  I O2    1 
ATOM   7784  N  N3    . DC  I  5 80  ? -4.195  -32.025 82.710 1.00 44.59  ? 6    DC  I N3    1 
ATOM   7785  C  C4    . DC  I  5 80  ? -3.731  -33.169 83.206 1.00 43.93  ? 6    DC  I C4    1 
ATOM   7786  N  N4    . DC  I  5 80  ? -2.993  -33.082 84.308 1.00 43.83  ? 6    DC  I N4    1 
ATOM   7787  C  C5    . DC  I  5 80  ? -3.998  -34.427 82.584 1.00 43.72  ? 6    DC  I C5    1 
ATOM   7788  C  C6    . DC  I  5 80  ? -4.753  -34.432 81.474 1.00 43.88  ? 6    DC  I C6    1 
ATOM   7789  P  P     . DT  I  5 81  ? -7.362  -32.870 75.604 1.00 37.70  ? 7    DT  I P     1 
ATOM   7790  O  OP1   . DT  I  5 81  ? -8.697  -32.319 75.246 1.00 36.32  ? 7    DT  I OP1   1 
ATOM   7791  O  OP2   . DT  I  5 81  ? -6.817  -34.086 74.970 1.00 37.66  ? 7    DT  I OP2   1 
ATOM   7792  O  "O5'" . DT  I  5 81  ? -6.203  -31.780 75.440 1.00 34.88  ? 7    DT  I "O5'" 1 
ATOM   7793  C  "C5'" . DT  I  5 81  ? -6.380  -30.472 75.961 1.00 32.19  ? 7    DT  I "C5'" 1 
ATOM   7794  C  "C4'" . DT  I  5 81  ? -5.071  -29.899 76.462 1.00 31.58  ? 7    DT  I "C4'" 1 
ATOM   7795  O  "O4'" . DT  I  5 81  ? -4.639  -30.642 77.625 1.00 32.86  ? 7    DT  I "O4'" 1 
ATOM   7796  C  "C3'" . DT  I  5 81  ? -3.883  -29.868 75.483 1.00 29.64  ? 7    DT  I "C3'" 1 
ATOM   7797  O  "O3'" . DT  I  5 81  ? -3.457  -28.549 75.388 1.00 26.74  ? 7    DT  I "O3'" 1 
ATOM   7798  C  "C2'" . DT  I  5 81  ? -2.811  -30.678 76.181 1.00 30.84  ? 7    DT  I "C2'" 1 
ATOM   7799  C  "C1'" . DT  I  5 81  ? -3.242  -30.531 77.639 1.00 34.28  ? 7    DT  I "C1'" 1 
ATOM   7800  N  N1    . DT  I  5 81  ? -2.663  -31.571 78.505 1.00 34.75  ? 7    DT  I N1    1 
ATOM   7801  C  C2    . DT  I  5 81  ? -2.166  -31.193 79.727 1.00 35.75  ? 7    DT  I C2    1 
ATOM   7802  O  O2    . DT  I  5 81  ? -2.189  -30.058 80.164 1.00 36.30  ? 7    DT  I O2    1 
ATOM   7803  N  N3    . DT  I  5 81  ? -1.625  -32.212 80.445 1.00 36.33  ? 7    DT  I N3    1 
ATOM   7804  C  C4    . DT  I  5 81  ? -1.526  -33.525 80.073 1.00 35.76  ? 7    DT  I C4    1 
ATOM   7805  O  O4    . DT  I  5 81  ? -1.019  -34.351 80.812 1.00 36.53  ? 7    DT  I O4    1 
ATOM   7806  C  C5    . DT  I  5 81  ? -2.063  -33.853 78.780 1.00 35.86  ? 7    DT  I C5    1 
ATOM   7807  C  C7    . DT  I  5 81  ? -2.016  -35.270 78.286 1.00 35.57  ? 7    DT  I C7    1 
ATOM   7808  C  C6    . DT  I  5 81  ? -2.598  -32.867 78.059 1.00 34.13  ? 7    DT  I C6    1 
ATOM   7809  P  P     . DG  I  5 82  ? -2.610  -27.970 74.185 1.00 25.61  ? 8    DG  I P     1 
ATOM   7810  O  OP1   . DG  I  5 82  ? -3.519  -27.231 73.314 1.00 27.34  ? 8    DG  I OP1   1 
ATOM   7811  O  OP2   . DG  I  5 82  ? -1.664  -28.952 73.649 1.00 24.56  ? 8    DG  I OP2   1 
ATOM   7812  O  "O5'" . DG  I  5 82  ? -1.711  -26.876 74.920 1.00 27.87  ? 8    DG  I "O5'" 1 
ATOM   7813  C  "C5'" . DG  I  5 82  ? -2.275  -25.999 75.894 1.00 27.78  ? 8    DG  I "C5'" 1 
ATOM   7814  C  "C4'" . DG  I  5 82  ? -1.165  -25.447 76.776 1.00 29.47  ? 8    DG  I "C4'" 1 
ATOM   7815  O  "O4'" . DG  I  5 82  ? -0.673  -26.433 77.722 1.00 29.70  ? 8    DG  I "O4'" 1 
ATOM   7816  C  "C3'" . DG  I  5 82  ? 0.073   -24.942 76.035 1.00 29.67  ? 8    DG  I "C3'" 1 
ATOM   7817  O  "O3'" . DG  I  5 82  ? 0.486   -23.782 76.718 1.00 29.58  ? 8    DG  I "O3'" 1 
ATOM   7818  C  "C2'" . DG  I  5 82  ? 1.095   -26.071 76.135 1.00 29.69  ? 8    DG  I "C2'" 1 
ATOM   7819  C  "C1'" . DG  I  5 82  ? 0.700   -26.715 77.450 1.00 33.00  ? 8    DG  I "C1'" 1 
ATOM   7820  N  N9    . DG  I  5 82  ? 0.775   -28.159 77.479 1.00 33.21  ? 8    DG  I N9    1 
ATOM   7821  C  C8    . DG  I  5 82  ? 0.354   -29.042 76.532 1.00 33.95  ? 8    DG  I C8    1 
ATOM   7822  N  N7    . DG  I  5 82  ? 0.530   -30.293 76.865 1.00 33.79  ? 8    DG  I N7    1 
ATOM   7823  C  C5    . DG  I  5 82  ? 1.081   -30.214 78.119 1.00 33.69  ? 8    DG  I C5    1 
ATOM   7824  C  C6    . DG  I  5 82  ? 1.476   -31.254 78.971 1.00 34.56  ? 8    DG  I C6    1 
ATOM   7825  O  O6    . DG  I  5 82  ? 1.387   -32.467 78.744 1.00 34.85  ? 8    DG  I O6    1 
ATOM   7826  N  N1    . DG  I  5 82  ? 2.007   -30.774 80.167 1.00 33.97  ? 8    DG  I N1    1 
ATOM   7827  C  C2    . DG  I  5 82  ? 2.114   -29.432 80.474 1.00 34.21  ? 8    DG  I C2    1 
ATOM   7828  N  N2    . DG  I  5 82  ? 2.644   -29.141 81.670 1.00 34.58  ? 8    DG  I N2    1 
ATOM   7829  N  N3    . DG  I  5 82  ? 1.748   -28.437 79.675 1.00 33.30  ? 8    DG  I N3    1 
ATOM   7830  C  C4    . DG  I  5 82  ? 1.241   -28.912 78.516 1.00 33.38  ? 8    DG  I C4    1 
ATOM   7831  P  P     . DA  I  5 83  ? 1.691   -22.909 76.201 1.00 28.24  ? 9    DA  I P     1 
ATOM   7832  O  OP1   . DA  I  5 83  ? 1.409   -21.484 76.474 1.00 29.15  ? 9    DA  I OP1   1 
ATOM   7833  O  OP2   . DA  I  5 83  ? 2.002   -23.352 74.847 1.00 31.72  ? 9    DA  I OP2   1 
ATOM   7834  O  "O5'" . DA  I  5 83  ? 2.900   -23.442 77.078 1.00 30.77  ? 9    DA  I "O5'" 1 
ATOM   7835  C  "C5'" . DA  I  5 83  ? 3.027   -23.153 78.477 1.00 31.25  ? 9    DA  I "C5'" 1 
ATOM   7836  C  "C4'" . DA  I  5 83  ? 4.329   -23.733 79.017 1.00 32.06  ? 9    DA  I "C4'" 1 
ATOM   7837  O  "O4'" . DA  I  5 83  ? 4.272   -25.179 79.040 1.00 31.21  ? 9    DA  I "O4'" 1 
ATOM   7838  C  "C3'" . DA  I  5 83  ? 5.604   -23.371 78.263 1.00 31.99  ? 9    DA  I "C3'" 1 
ATOM   7839  O  "O3'" . DA  I  5 83  ? 6.449   -22.860 79.255 1.00 35.08  ? 9    DA  I "O3'" 1 
ATOM   7840  C  "C2'" . DA  I  5 83  ? 6.116   -24.696 77.700 1.00 31.62  ? 9    DA  I "C2'" 1 
ATOM   7841  C  "C1'" . DA  I  5 83  ? 5.519   -25.708 78.658 1.00 32.72  ? 9    DA  I "C1'" 1 
ATOM   7842  N  N9    . DA  I  5 83  ? 5.115   -27.005 78.157 1.00 32.80  ? 9    DA  I N9    1 
ATOM   7843  C  C8    . DA  I  5 83  ? 4.416   -27.268 77.025 1.00 34.09  ? 9    DA  I C8    1 
ATOM   7844  N  N7    . DA  I  5 83  ? 4.148   -28.540 76.842 1.00 34.28  ? 9    DA  I N7    1 
ATOM   7845  C  C5    . DA  I  5 83  ? 4.690   -29.148 77.950 1.00 33.55  ? 9    DA  I C5    1 
ATOM   7846  C  C6    . DA  I  5 83  ? 4.732   -30.481 78.370 1.00 33.81  ? 9    DA  I C6    1 
ATOM   7847  N  N6    . DA  I  5 83  ? 4.204   -31.469 77.658 1.00 34.16  ? 9    DA  I N6    1 
ATOM   7848  N  N1    . DA  I  5 83  ? 5.350   -30.774 79.536 1.00 34.03  ? 9    DA  I N1    1 
ATOM   7849  C  C2    . DA  I  5 83  ? 5.886   -29.785 80.247 1.00 33.52  ? 9    DA  I C2    1 
ATOM   7850  N  N3    . DA  I  5 83  ? 5.901   -28.488 79.943 1.00 34.55  ? 9    DA  I N3    1 
ATOM   7851  C  C4    . DA  I  5 83  ? 5.287   -28.224 78.774 1.00 33.79  ? 9    DA  I C4    1 
ATOM   7852  P  P     . DA  I  5 84  ? 7.922   -22.290 78.993 1.00 36.63  ? 10   DA  I P     1 
ATOM   7853  O  OP1   . DA  I  5 84  ? 8.158   -21.268 80.047 1.00 35.79  ? 10   DA  I OP1   1 
ATOM   7854  O  OP2   . DA  I  5 84  ? 8.046   -21.971 77.556 1.00 35.93  ? 10   DA  I OP2   1 
ATOM   7855  O  "O5'" . DA  I  5 84  ? 8.860   -23.551 79.269 1.00 37.92  ? 10   DA  I "O5'" 1 
ATOM   7856  C  "C5'" . DA  I  5 84  ? 8.871   -24.207 80.537 1.00 39.38  ? 10   DA  I "C5'" 1 
ATOM   7857  C  "C4'" . DA  I  5 84  ? 9.930   -25.300 80.552 1.00 41.33  ? 10   DA  I "C4'" 1 
ATOM   7858  O  "O4'" . DA  I  5 84  ? 9.418   -26.541 80.009 1.00 41.93  ? 10   DA  I "O4'" 1 
ATOM   7859  C  "C3'" . DA  I  5 84  ? 11.208  -25.031 79.777 1.00 42.20  ? 10   DA  I "C3'" 1 
ATOM   7860  O  "O3'" . DA  I  5 84  ? 12.240  -25.551 80.579 1.00 45.10  ? 10   DA  I "O3'" 1 
ATOM   7861  C  "C2'" . DA  I  5 84  ? 11.029  -25.826 78.489 1.00 41.30  ? 10   DA  I "C2'" 1 
ATOM   7862  C  "C1'" . DA  I  5 84  ? 10.270  -27.032 79.007 1.00 41.71  ? 10   DA  I "C1'" 1 
ATOM   7863  N  N9    . DA  I  5 84  ? 9.369   -27.650 78.043 1.00 42.11  ? 10   DA  I N9    1 
ATOM   7864  C  C8    . DA  I  5 84  ? 8.687   -27.042 77.032 1.00 41.76  ? 10   DA  I C8    1 
ATOM   7865  N  N7    . DA  I  5 84  ? 7.938   -27.877 76.351 1.00 41.74  ? 10   DA  I N7    1 
ATOM   7866  C  C5    . DA  I  5 84  ? 8.137   -29.103 76.951 1.00 41.23  ? 10   DA  I C5    1 
ATOM   7867  C  C6    . DA  I  5 84  ? 7.640   -30.399 76.697 1.00 42.08  ? 10   DA  I C6    1 
ATOM   7868  N  N6    . DA  I  5 84  ? 6.781   -30.695 75.728 1.00 41.89  ? 10   DA  I N6    1 
ATOM   7869  N  N1    . DA  I  5 84  ? 8.047   -31.410 77.489 1.00 42.54  ? 10   DA  I N1    1 
ATOM   7870  C  C2    . DA  I  5 84  ? 8.904   -31.131 78.477 1.00 41.96  ? 10   DA  I C2    1 
ATOM   7871  N  N3    . DA  I  5 84  ? 9.437   -29.954 78.801 1.00 41.66  ? 10   DA  I N3    1 
ATOM   7872  C  C4    . DA  I  5 84  ? 9.013   -28.976 77.997 1.00 41.06  ? 10   DA  I C4    1 
ATOM   7873  P  P     . DC  I  5 85  ? 13.790  -25.367 80.239 1.00 46.01  ? 11   DC  I P     1 
ATOM   7874  O  OP1   . DC  I  5 85  ? 14.384  -24.899 81.505 1.00 47.31  ? 11   DC  I OP1   1 
ATOM   7875  O  OP2   . DC  I  5 85  ? 14.021  -24.611 78.989 1.00 44.41  ? 11   DC  I OP2   1 
ATOM   7876  O  "O5'" . DC  I  5 85  ? 14.214  -26.884 79.985 1.00 45.95  ? 11   DC  I "O5'" 1 
ATOM   7877  C  "C5'" . DC  I  5 85  ? 13.900  -27.871 80.958 1.00 47.59  ? 11   DC  I "C5'" 1 
ATOM   7878  C  "C4'" . DC  I  5 85  ? 14.323  -29.237 80.448 1.00 49.44  ? 11   DC  I "C4'" 1 
ATOM   7879  O  "O4'" . DC  I  5 85  ? 13.267  -29.855 79.669 1.00 49.18  ? 11   DC  I "O4'" 1 
ATOM   7880  C  "C3'" . DC  I  5 85  ? 15.539  -29.183 79.534 1.00 51.60  ? 11   DC  I "C3'" 1 
ATOM   7881  O  "O3'" . DC  I  5 85  ? 16.457  -30.187 79.912 1.00 55.05  ? 11   DC  I "O3'" 1 
ATOM   7882  C  "C2'" . DC  I  5 85  ? 14.988  -29.427 78.136 1.00 50.62  ? 11   DC  I "C2'" 1 
ATOM   7883  C  "C1'" . DC  I  5 85  ? 13.775  -30.295 78.429 1.00 49.47  ? 11   DC  I "C1'" 1 
ATOM   7884  N  N1    . DC  I  5 85  ? 12.775  -30.269 77.291 1.00 48.93  ? 11   DC  I N1    1 
ATOM   7885  C  C2    . DC  I  5 85  ? 12.076  -31.438 76.954 1.00 49.25  ? 11   DC  I C2    1 
ATOM   7886  O  O2    . DC  I  5 85  ? 12.232  -32.477 77.605 1.00 49.21  ? 11   DC  I O2    1 
ATOM   7887  N  N3    . DC  I  5 85  ? 11.211  -31.410 75.911 1.00 50.10  ? 11   DC  I N3    1 
ATOM   7888  C  C4    . DC  I  5 85  ? 11.040  -30.290 75.201 1.00 49.68  ? 11   DC  I C4    1 
ATOM   7889  N  N4    . DC  I  5 85  ? 10.175  -30.344 74.186 1.00 48.86  ? 11   DC  I N4    1 
ATOM   7890  C  C5    . DC  I  5 85  ? 11.751  -29.087 75.509 1.00 48.79  ? 11   DC  I C5    1 
ATOM   7891  C  C6    . DC  I  5 85  ? 12.597  -29.130 76.548 1.00 48.56  ? 11   DC  I C6    1 
ATOM   7892  P  P     . DA  I  5 86  ? 17.987  -30.104 79.442 1.00 56.74  ? 12   DA  I P     1 
ATOM   7893  O  OP1   . DA  I  5 86  ? 18.791  -29.856 80.660 1.00 57.11  ? 12   DA  I OP1   1 
ATOM   7894  O  OP2   . DA  I  5 86  ? 18.141  -29.237 78.248 1.00 55.67  ? 12   DA  I OP2   1 
ATOM   7895  O  "O5'" . DA  I  5 86  ? 18.186  -31.616 78.973 1.00 57.10  ? 12   DA  I "O5'" 1 
ATOM   7896  C  "C5'" . DA  I  5 86  ? 17.469  -32.663 79.617 1.00 58.32  ? 12   DA  I "C5'" 1 
ATOM   7897  C  "C4'" . DA  I  5 86  ? 17.448  -33.862 78.690 1.00 59.56  ? 12   DA  I "C4'" 1 
ATOM   7898  O  "O4'" . DA  I  5 86  ? 16.341  -33.747 77.753 1.00 60.24  ? 12   DA  I "O4'" 1 
ATOM   7899  C  "C3'" . DA  I  5 86  ? 18.717  -33.994 77.852 1.00 60.15  ? 12   DA  I "C3'" 1 
ATOM   7900  O  "O3'" . DA  I  5 86  ? 19.148  -35.354 77.830 1.00 60.85  ? 12   DA  I "O3'" 1 
ATOM   7901  C  "C2'" . DA  I  5 86  ? 18.328  -33.477 76.466 1.00 59.76  ? 12   DA  I "C2'" 1 
ATOM   7902  C  "C1'" . DA  I  5 86  ? 16.819  -33.725 76.416 1.00 59.53  ? 12   DA  I "C1'" 1 
ATOM   7903  N  N9    . DA  I  5 86  ? 16.101  -32.718 75.626 1.00 59.12  ? 12   DA  I N9    1 
ATOM   7904  C  C8    . DA  I  5 86  ? 16.303  -31.363 75.617 1.00 59.06  ? 12   DA  I C8    1 
ATOM   7905  N  N7    . DA  I  5 86  ? 15.515  -30.709 74.802 1.00 58.75  ? 12   DA  I N7    1 
ATOM   7906  C  C5    . DA  I  5 86  ? 14.747  -31.707 74.231 1.00 58.63  ? 12   DA  I C5    1 
ATOM   7907  C  C6    . DA  I  5 86  ? 13.715  -31.683 73.270 1.00 58.92  ? 12   DA  I C6    1 
ATOM   7908  N  N6    . DA  I  5 86  ? 13.271  -30.560 72.705 1.00 58.96  ? 12   DA  I N6    1 
ATOM   7909  N  N1    . DA  I  5 86  ? 13.154  -32.858 72.910 1.00 59.27  ? 12   DA  I N1    1 
ATOM   7910  C  C2    . DA  I  5 86  ? 13.599  -33.986 73.480 1.00 59.06  ? 12   DA  I C2    1 
ATOM   7911  N  N3    . DA  I  5 86  ? 14.558  -34.129 74.396 1.00 58.79  ? 12   DA  I N3    1 
ATOM   7912  C  C4    . DA  I  5 86  ? 15.097  -32.946 74.726 1.00 58.47  ? 12   DA  I C4    1 
ATOM   7913  P  P     . DT  I  5 87  ? 20.559  -35.770 77.181 1.00 60.35  ? 13   DT  I P     1 
ATOM   7914  O  OP1   . DT  I  5 87  ? 21.083  -36.833 78.066 1.00 59.87  ? 13   DT  I OP1   1 
ATOM   7915  O  OP2   . DT  I  5 87  ? 21.372  -34.581 76.785 1.00 59.35  ? 13   DT  I OP2   1 
ATOM   7916  O  "O5'" . DT  I  5 87  ? 20.082  -36.443 75.821 1.00 59.76  ? 13   DT  I "O5'" 1 
ATOM   7917  C  "C5'" . DT  I  5 87  ? 18.992  -37.369 75.802 1.00 57.86  ? 13   DT  I "C5'" 1 
ATOM   7918  C  "C4'" . DT  I  5 87  ? 18.661  -37.653 74.351 1.00 55.68  ? 13   DT  I "C4'" 1 
ATOM   7919  O  "O4'" . DT  I  5 87  ? 17.849  -36.584 73.802 1.00 55.12  ? 13   DT  I "O4'" 1 
ATOM   7920  C  "C3'" . DT  I  5 87  ? 19.900  -37.777 73.474 1.00 54.07  ? 13   DT  I "C3'" 1 
ATOM   7921  O  "O3'" . DT  I  5 87  ? 19.888  -39.145 73.033 1.00 53.60  ? 13   DT  I "O3'" 1 
ATOM   7922  C  "C2'" . DT  I  5 87  ? 19.768  -36.639 72.441 1.00 53.40  ? 13   DT  I "C2'" 1 
ATOM   7923  C  "C1'" . DT  I  5 87  ? 18.267  -36.326 72.476 1.00 54.30  ? 13   DT  I "C1'" 1 
ATOM   7924  N  N1    . DT  I  5 87  ? 17.740  -34.933 72.069 1.00 54.27  ? 13   DT  I N1    1 
ATOM   7925  C  C2    . DT  I  5 87  ? 16.598  -34.850 71.266 1.00 53.54  ? 13   DT  I C2    1 
ATOM   7926  O  O2    . DT  I  5 87  ? 15.980  -35.811 70.838 1.00 53.32  ? 13   DT  I O2    1 
ATOM   7927  N  N3    . DT  I  5 87  ? 16.179  -33.584 70.956 1.00 52.68  ? 13   DT  I N3    1 
ATOM   7928  C  C4    . DT  I  5 87  ? 16.755  -32.400 71.361 1.00 53.40  ? 13   DT  I C4    1 
ATOM   7929  O  O4    . DT  I  5 87  ? 16.277  -31.325 71.012 1.00 53.44  ? 13   DT  I O4    1 
ATOM   7930  C  C5    . DT  I  5 87  ? 17.934  -32.533 72.203 1.00 53.36  ? 13   DT  I C5    1 
ATOM   7931  C  C7    . DT  I  5 87  ? 18.654  -31.318 72.713 1.00 53.10  ? 13   DT  I C7    1 
ATOM   7932  C  C6    . DT  I  5 87  ? 18.362  -33.772 72.512 1.00 53.74  ? 13   DT  I C6    1 
ATOM   7933  P  P     . DG  I  5 88  ? 20.760  -39.739 71.831 1.00 53.94  ? 14   DG  I P     1 
ATOM   7934  O  OP1   . DG  I  5 88  ? 20.605  -41.212 71.856 1.00 52.39  ? 14   DG  I OP1   1 
ATOM   7935  O  OP2   . DG  I  5 88  ? 22.085  -39.072 71.793 1.00 51.61  ? 14   DG  I OP2   1 
ATOM   7936  O  "O5'" . DG  I  5 88  ? 19.942  -39.163 70.584 1.00 54.70  ? 14   DG  I "O5'" 1 
ATOM   7937  C  "C5'" . DG  I  5 88  ? 19.032  -39.932 69.806 1.00 54.66  ? 14   DG  I "C5'" 1 
ATOM   7938  C  "C4'" . DG  I  5 88  ? 18.819  -39.202 68.493 1.00 54.69  ? 14   DG  I "C4'" 1 
ATOM   7939  O  "O4'" . DG  I  5 88  ? 18.576  -37.808 68.783 1.00 55.29  ? 14   DG  I "O4'" 1 
ATOM   7940  C  "C3'" . DG  I  5 88  ? 20.005  -39.221 67.520 1.00 54.55  ? 14   DG  I "C3'" 1 
ATOM   7941  O  "O3'" . DG  I  5 88  ? 19.572  -39.553 66.196 1.00 53.66  ? 14   DG  I "O3'" 1 
ATOM   7942  C  "C2'" . DG  I  5 88  ? 20.553  -37.803 67.572 1.00 54.80  ? 14   DG  I "C2'" 1 
ATOM   7943  C  "C1'" . DG  I  5 88  ? 19.250  -37.061 67.803 1.00 57.19  ? 14   DG  I "C1'" 1 
ATOM   7944  N  N9    . DG  I  5 88  ? 19.375  -35.704 68.306 1.00 58.08  ? 14   DG  I N9    1 
ATOM   7945  C  C8    . DG  I  5 88  ? 20.259  -35.202 69.228 1.00 58.18  ? 14   DG  I C8    1 
ATOM   7946  N  N7    . DG  I  5 88  ? 20.103  -33.932 69.465 1.00 57.99  ? 14   DG  I N7    1 
ATOM   7947  C  C5    . DG  I  5 88  ? 19.051  -33.573 68.649 1.00 57.93  ? 14   DG  I C5    1 
ATOM   7948  C  C6    . DG  I  5 88  ? 18.432  -32.317 68.480 1.00 58.13  ? 14   DG  I C6    1 
ATOM   7949  O  O6    . DG  I  5 88  ? 18.727  -31.253 69.048 1.00 58.17  ? 14   DG  I O6    1 
ATOM   7950  N  N1    . DG  I  5 88  ? 17.384  -32.383 67.547 1.00 58.48  ? 14   DG  I N1    1 
ATOM   7951  C  C2    . DG  I  5 88  ? 16.996  -33.533 66.874 1.00 58.53  ? 14   DG  I C2    1 
ATOM   7952  N  N2    . DG  I  5 88  ? 15.969  -33.422 66.021 1.00 58.53  ? 14   DG  I N2    1 
ATOM   7953  N  N3    . DG  I  5 88  ? 17.574  -34.720 67.027 1.00 58.23  ? 14   DG  I N3    1 
ATOM   7954  C  C4    . DG  I  5 88  ? 18.587  -34.654 67.928 1.00 58.42  ? 14   DG  I C4    1 
ATOM   7955  P  P     . DC  I  5 89  ? 19.339  -41.078 65.768 1.00 52.81  ? 15   DC  I P     1 
ATOM   7956  O  OP1   . DC  I  5 89  ? 18.926  -41.880 66.944 1.00 51.27  ? 15   DC  I OP1   1 
ATOM   7957  O  OP2   . DC  I  5 89  ? 20.523  -41.429 64.949 1.00 50.80  ? 15   DC  I OP2   1 
ATOM   7958  O  "O5'" . DC  I  5 89  ? 18.038  -41.039 64.828 1.00 53.79  ? 15   DC  I "O5'" 1 
ATOM   7959  C  "C5'" . DC  I  5 89  ? 16.805  -40.393 65.202 1.00 54.16  ? 15   DC  I "C5'" 1 
ATOM   7960  C  "C4'" . DC  I  5 89  ? 16.236  -39.596 64.030 1.00 54.97  ? 15   DC  I "C4'" 1 
ATOM   7961  O  "O4'" . DC  I  5 89  ? 16.648  -38.202 64.093 1.00 55.38  ? 15   DC  I "O4'" 1 
ATOM   7962  C  "C3'" . DC  I  5 89  ? 16.698  -40.027 62.645 1.00 55.41  ? 15   DC  I "C3'" 1 
ATOM   7963  O  "O3'" . DC  I  5 89  ? 15.753  -39.597 61.676 1.00 55.65  ? 15   DC  I "O3'" 1 
ATOM   7964  C  "C2'" . DC  I  5 89  ? 17.995  -39.229 62.507 1.00 55.64  ? 15   DC  I "C2'" 1 
ATOM   7965  C  "C1'" . DC  I  5 89  ? 17.469  -37.881 62.979 1.00 55.61  ? 15   DC  I "C1'" 1 
ATOM   7966  N  N1    . DC  I  5 89  ? 18.430  -36.849 63.439 1.00 55.44  ? 15   DC  I N1    1 
ATOM   7967  C  C2    . DC  I  5 89  ? 18.006  -35.511 63.429 1.00 56.05  ? 15   DC  I C2    1 
ATOM   7968  O  O2    . DC  I  5 89  ? 16.878  -35.225 63.024 1.00 56.28  ? 15   DC  I O2    1 
ATOM   7969  N  N3    . DC  I  5 89  ? 18.845  -34.543 63.868 1.00 56.79  ? 15   DC  I N3    1 
ATOM   7970  C  C4    . DC  I  5 89  ? 20.061  -34.872 64.315 1.00 56.58  ? 15   DC  I C4    1 
ATOM   7971  N  N4    . DC  I  5 89  ? 20.843  -33.870 64.732 1.00 56.54  ? 15   DC  I N4    1 
ATOM   7972  C  C5    . DC  I  5 89  ? 20.519  -36.228 64.339 1.00 56.40  ? 15   DC  I C5    1 
ATOM   7973  C  C6    . DC  I  5 89  ? 19.672  -37.177 63.902 1.00 56.03  ? 15   DC  I C6    1 
ATOM   7974  P  P     . DC  I  5 90  ? 14.504  -40.490 61.244 1.00 56.50  ? 16   DC  I P     1 
ATOM   7975  O  OP1   . DC  I  5 90  ? 13.581  -40.582 62.403 1.00 56.21  ? 16   DC  I OP1   1 
ATOM   7976  O  OP2   . DC  I  5 90  ? 14.979  -41.741 60.608 1.00 55.69  ? 16   DC  I OP2   1 
ATOM   7977  O  "O5'" . DC  I  5 90  ? 13.890  -39.574 60.085 1.00 53.75  ? 16   DC  I "O5'" 1 
ATOM   7978  C  "C5'" . DC  I  5 90  ? 13.098  -38.441 60.390 1.00 50.27  ? 16   DC  I "C5'" 1 
ATOM   7979  C  "C4'" . DC  I  5 90  ? 13.496  -37.294 59.484 1.00 47.88  ? 16   DC  I "C4'" 1 
ATOM   7980  O  "O4'" . DC  I  5 90  ? 14.784  -36.749 59.868 1.00 46.93  ? 16   DC  I "O4'" 1 
ATOM   7981  C  "C3'" . DC  I  5 90  ? 13.660  -37.662 58.016 1.00 47.10  ? 16   DC  I "C3'" 1 
ATOM   7982  O  "O3'" . DC  I  5 90  ? 13.267  -36.547 57.234 1.00 46.58  ? 16   DC  I "O3'" 1 
ATOM   7983  C  "C2'" . DC  I  5 90  ? 15.162  -37.870 57.897 1.00 46.27  ? 16   DC  I "C2'" 1 
ATOM   7984  C  "C1'" . DC  I  5 90  ? 15.592  -36.657 58.705 1.00 46.49  ? 16   DC  I "C1'" 1 
ATOM   7985  N  N1    . DC  I  5 90  ? 17.038  -36.582 59.106 1.00 45.99  ? 16   DC  I N1    1 
ATOM   7986  C  C2    . DC  I  5 90  ? 17.617  -35.332 59.384 1.00 46.30  ? 16   DC  I C2    1 
ATOM   7987  O  O2    . DC  I  5 90  ? 16.954  -34.295 59.294 1.00 46.06  ? 16   DC  I O2    1 
ATOM   7988  N  N3    . DC  I  5 90  ? 18.919  -35.286 59.753 1.00 47.10  ? 16   DC  I N3    1 
ATOM   7989  C  C4    . DC  I  5 90  ? 19.624  -36.414 59.857 1.00 46.19  ? 16   DC  I C4    1 
ATOM   7990  N  N4    . DC  I  5 90  ? 20.895  -36.309 60.235 1.00 46.08  ? 16   DC  I N4    1 
ATOM   7991  C  C5    . DC  I  5 90  ? 19.058  -37.689 59.577 1.00 45.21  ? 16   DC  I C5    1 
ATOM   7992  C  C6    . DC  I  5 90  ? 17.778  -37.725 59.209 1.00 44.89  ? 16   DC  I C6    1 
ATOM   7993  P  P     . DT  I  5 91  ? 11.834  -36.455 56.538 1.00 43.73  ? 17   DT  I P     1 
ATOM   7994  O  OP1   . DT  I  5 91  ? 10.798  -36.635 57.580 1.00 41.19  ? 17   DT  I OP1   1 
ATOM   7995  O  OP2   . DT  I  5 91  ? 11.922  -37.305 55.320 1.00 43.05  ? 17   DT  I OP2   1 
ATOM   7996  O  "O5'" . DT  I  5 91  ? 11.833  -34.928 56.071 1.00 40.56  ? 17   DT  I "O5'" 1 
ATOM   7997  C  "C5'" . DT  I  5 91  ? 11.523  -33.930 57.006 1.00 38.95  ? 17   DT  I "C5'" 1 
ATOM   7998  C  "C4'" . DT  I  5 91  ? 12.476  -32.765 56.879 1.00 38.88  ? 17   DT  I "C4'" 1 
ATOM   7999  O  "O4'" . DT  I  5 91  ? 13.832  -33.225 57.059 1.00 40.49  ? 17   DT  I "O4'" 1 
ATOM   8000  C  "C3'" . DT  I  5 91  ? 12.451  -32.064 55.534 1.00 38.04  ? 17   DT  I "C3'" 1 
ATOM   8001  O  "O3'" . DT  I  5 91  ? 12.178  -30.709 55.731 1.00 35.03  ? 17   DT  I "O3'" 1 
ATOM   8002  C  "C2'" . DT  I  5 91  ? 13.843  -32.286 54.939 1.00 39.93  ? 17   DT  I "C2'" 1 
ATOM   8003  C  "C1'" . DT  I  5 91  ? 14.676  -32.510 56.184 1.00 41.80  ? 17   DT  I "C1'" 1 
ATOM   8004  N  N1    . DT  I  5 91  ? 15.896  -33.353 56.049 1.00 42.92  ? 17   DT  I N1    1 
ATOM   8005  C  C2    . DT  I  5 91  ? 17.113  -32.826 56.437 1.00 43.57  ? 17   DT  I C2    1 
ATOM   8006  O  O2    . DT  I  5 91  ? 17.246  -31.680 56.855 1.00 43.71  ? 17   DT  I O2    1 
ATOM   8007  N  N3    . DT  I  5 91  ? 18.168  -33.703 56.314 1.00 43.03  ? 17   DT  I N3    1 
ATOM   8008  C  C4    . DT  I  5 91  ? 18.130  -35.011 55.863 1.00 42.56  ? 17   DT  I C4    1 
ATOM   8009  O  O4    . DT  I  5 91  ? 19.125  -35.717 55.774 1.00 42.75  ? 17   DT  I O4    1 
ATOM   8010  C  C5    . DT  I  5 91  ? 16.834  -35.491 55.479 1.00 43.46  ? 17   DT  I C5    1 
ATOM   8011  C  C7    . DT  I  5 91  ? 16.682  -36.894 54.966 1.00 43.51  ? 17   DT  I C7    1 
ATOM   8012  C  C6    . DT  I  5 91  ? 15.786  -34.659 55.600 1.00 43.33  ? 17   DT  I C6    1 
ATOM   8013  P  P     . DT  I  5 92  ? 11.872  -29.829 54.454 1.00 33.32  ? 18   DT  I P     1 
ATOM   8014  O  OP1   . DT  I  5 92  ? 10.764  -28.909 54.749 1.00 35.05  ? 18   DT  I OP1   1 
ATOM   8015  O  OP2   . DT  I  5 92  ? 11.816  -30.696 53.262 1.00 32.30  ? 18   DT  I OP2   1 
ATOM   8016  O  "O5'" . DT  I  5 92  ? 13.187  -28.959 54.358 1.00 36.26  ? 18   DT  I "O5'" 1 
ATOM   8017  C  "C5'" . DT  I  5 92  ? 13.802  -28.385 55.474 1.00 39.18  ? 18   DT  I "C5'" 1 
ATOM   8018  C  "C4'" . DT  I  5 92  ? 15.223  -28.070 55.067 1.00 42.71  ? 18   DT  I "C4'" 1 
ATOM   8019  O  "O4'" . DT  I  5 92  ? 15.993  -29.295 54.981 1.00 43.74  ? 18   DT  I "O4'" 1 
ATOM   8020  C  "C3'" . DT  I  5 92  ? 15.339  -27.422 53.697 1.00 44.55  ? 18   DT  I "C3'" 1 
ATOM   8021  O  "O3'" . DT  I  5 92  ? 15.937  -26.171 53.914 1.00 48.31  ? 18   DT  I "O3'" 1 
ATOM   8022  C  "C2'" . DT  I  5 92  ? 16.214  -28.379 52.876 1.00 44.35  ? 18   DT  I "C2'" 1 
ATOM   8023  C  "C1'" . DT  I  5 92  ? 16.949  -29.162 53.951 1.00 44.31  ? 18   DT  I "C1'" 1 
ATOM   8024  N  N1    . DT  I  5 92  ? 17.428  -30.555 53.621 1.00 45.32  ? 18   DT  I N1    1 
ATOM   8025  C  C2    . DT  I  5 92  ? 18.729  -30.944 53.941 1.00 45.32  ? 18   DT  I C2    1 
ATOM   8026  O  O2    . DT  I  5 92  ? 19.560  -30.216 54.456 1.00 45.02  ? 18   DT  I O2    1 
ATOM   8027  N  N3    . DT  I  5 92  ? 19.047  -32.242 53.623 1.00 44.70  ? 18   DT  I N3    1 
ATOM   8028  C  C4    . DT  I  5 92  ? 18.227  -33.187 53.037 1.00 44.79  ? 18   DT  I C4    1 
ATOM   8029  O  O4    . DT  I  5 92  ? 18.613  -34.327 52.788 1.00 44.95  ? 18   DT  I O4    1 
ATOM   8030  C  C5    . DT  I  5 92  ? 16.887  -32.736 52.740 1.00 45.31  ? 18   DT  I C5    1 
ATOM   8031  C  C7    . DT  I  5 92  ? 15.904  -33.674 52.099 1.00 44.74  ? 18   DT  I C7    1 
ATOM   8032  C  C6    . DT  I  5 92  ? 16.555  -31.465 53.044 1.00 45.68  ? 18   DT  I C6    1 
ATOM   8033  P  P     . DT  I  5 93  ? 16.180  -25.116 52.728 1.00 52.62  ? 19   DT  I P     1 
ATOM   8034  O  OP1   . DT  I  5 93  ? 16.120  -23.773 53.352 1.00 51.87  ? 19   DT  I OP1   1 
ATOM   8035  O  OP2   . DT  I  5 93  ? 15.333  -25.448 51.559 1.00 52.07  ? 19   DT  I OP2   1 
ATOM   8036  O  "O5'" . DT  I  5 93  ? 17.670  -25.430 52.249 1.00 53.34  ? 19   DT  I "O5'" 1 
ATOM   8037  C  "C5'" . DT  I  5 93  ? 18.737  -25.627 53.161 1.00 54.56  ? 19   DT  I "C5'" 1 
ATOM   8038  C  "C4'" . DT  I  5 93  ? 19.996  -25.859 52.348 1.00 55.97  ? 19   DT  I "C4'" 1 
ATOM   8039  O  "O4'" . DT  I  5 93  ? 20.193  -27.275 52.131 1.00 55.02  ? 19   DT  I "O4'" 1 
ATOM   8040  C  "C3'" . DT  I  5 93  ? 19.991  -25.235 50.956 1.00 57.93  ? 19   DT  I "C3'" 1 
ATOM   8041  O  "O3'" . DT  I  5 93  ? 21.298  -24.670 50.757 1.00 62.22  ? 19   DT  I "O3'" 1 
ATOM   8042  C  "C2'" . DT  I  5 93  ? 19.663  -26.418 50.029 1.00 55.74  ? 19   DT  I "C2'" 1 
ATOM   8043  C  "C1'" . DT  I  5 93  ? 20.402  -27.536 50.758 1.00 53.97  ? 19   DT  I "C1'" 1 
ATOM   8044  N  N1    . DT  I  5 93  ? 19.948  -28.950 50.531 1.00 53.90  ? 19   DT  I N1    1 
ATOM   8045  C  C2    . DT  I  5 93  ? 20.837  -29.993 50.759 1.00 53.09  ? 19   DT  I C2    1 
ATOM   8046  O  O2    . DT  I  5 93  ? 21.994  -29.840 51.117 1.00 53.05  ? 19   DT  I O2    1 
ATOM   8047  N  N3    . DT  I  5 93  ? 20.323  -31.247 50.545 1.00 52.46  ? 19   DT  I N3    1 
ATOM   8048  C  C4    . DT  I  5 93  ? 19.038  -31.554 50.144 1.00 52.99  ? 19   DT  I C4    1 
ATOM   8049  O  O4    . DT  I  5 93  ? 18.690  -32.714 49.982 1.00 53.33  ? 19   DT  I O4    1 
ATOM   8050  C  C5    . DT  I  5 93  ? 18.156  -30.428 49.928 1.00 52.71  ? 19   DT  I C5    1 
ATOM   8051  C  C7    . DT  I  5 93  ? 16.740  -30.617 49.485 1.00 53.01  ? 19   DT  I C7    1 
ATOM   8052  C  C6    . DT  I  5 93  ? 18.642  -29.200 50.133 1.00 53.73  ? 19   DT  I C6    1 
ATOM   8053  P  P     . DT  I  5 94  ? 21.667  -23.623 49.594 1.00 64.63  ? 20   DT  I P     1 
ATOM   8054  O  OP1   . DT  I  5 94  ? 21.874  -22.310 50.257 1.00 64.38  ? 20   DT  I OP1   1 
ATOM   8055  O  OP2   . DT  I  5 94  ? 20.698  -23.753 48.475 1.00 64.46  ? 20   DT  I OP2   1 
ATOM   8056  O  "O5'" . DT  I  5 94  ? 23.075  -24.171 49.045 1.00 65.96  ? 20   DT  I "O5'" 1 
ATOM   8057  C  "C5'" . DT  I  5 94  ? 23.811  -25.208 49.710 1.00 68.38  ? 20   DT  I "C5'" 1 
ATOM   8058  C  "C4'" . DT  I  5 94  ? 24.535  -26.104 48.712 1.00 70.41  ? 20   DT  I "C4'" 1 
ATOM   8059  O  "O4'" . DT  I  5 94  ? 23.951  -27.437 48.709 1.00 70.00  ? 20   DT  I "O4'" 1 
ATOM   8060  C  "C3'" . DT  I  5 94  ? 24.532  -25.606 47.264 1.00 71.90  ? 20   DT  I "C3'" 1 
ATOM   8061  O  "O3'" . DT  I  5 94  ? 25.895  -25.468 46.845 1.00 75.33  ? 20   DT  I "O3'" 1 
ATOM   8062  C  "C2'" . DT  I  5 94  ? 23.760  -26.674 46.486 1.00 71.03  ? 20   DT  I "C2'" 1 
ATOM   8063  C  "C1'" . DT  I  5 94  ? 23.855  -27.909 47.383 1.00 69.20  ? 20   DT  I "C1'" 1 
ATOM   8064  N  N1    . DT  I  5 94  ? 22.690  -28.856 47.283 1.00 68.59  ? 20   DT  I N1    1 
ATOM   8065  C  C2    . DT  I  5 94  ? 22.902  -30.220 47.405 1.00 68.86  ? 20   DT  I C2    1 
ATOM   8066  O  O2    . DT  I  5 94  ? 23.993  -30.721 47.604 1.00 68.61  ? 20   DT  I O2    1 
ATOM   8067  N  N3    . DT  I  5 94  ? 21.775  -31.004 47.292 1.00 68.37  ? 20   DT  I N3    1 
ATOM   8068  C  C4    . DT  I  5 94  ? 20.481  -30.575 47.073 1.00 68.15  ? 20   DT  I C4    1 
ATOM   8069  O  O4    . DT  I  5 94  ? 19.550  -31.364 46.990 1.00 68.00  ? 20   DT  I O4    1 
ATOM   8070  C  C5    . DT  I  5 94  ? 20.322  -29.143 46.951 1.00 68.51  ? 20   DT  I C5    1 
ATOM   8071  C  C7    . DT  I  5 94  ? 18.966  -28.542 46.707 1.00 68.82  ? 20   DT  I C7    1 
ATOM   8072  C  C6    . DT  I  5 94  ? 21.415  -28.365 47.061 1.00 68.64  ? 20   DT  I C6    1 
ATOM   8073  P  P     . DG  I  5 95  ? 26.363  -24.957 45.391 1.00 77.62  ? 21   DG  I P     1 
ATOM   8074  O  OP1   . DG  I  5 95  ? 27.715  -24.379 45.578 1.00 77.47  ? 21   DG  I OP1   1 
ATOM   8075  O  OP2   . DG  I  5 95  ? 25.282  -24.136 44.781 1.00 77.10  ? 21   DG  I OP2   1 
ATOM   8076  O  "O5'" . DG  I  5 95  ? 26.531  -26.321 44.558 1.00 77.34  ? 21   DG  I "O5'" 1 
ATOM   8077  C  "C5'" . DG  I  5 95  ? 27.397  -27.373 45.014 1.00 77.46  ? 21   DG  I "C5'" 1 
ATOM   8078  C  "C4'" . DG  I  5 95  ? 27.319  -28.574 44.085 1.00 78.17  ? 21   DG  I "C4'" 1 
ATOM   8079  O  "O4'" . DG  I  5 95  ? 26.198  -29.431 44.449 1.00 77.97  ? 21   DG  I "O4'" 1 
ATOM   8080  C  "C3'" . DG  I  5 95  ? 27.147  -28.213 42.605 1.00 79.31  ? 21   DG  I "C3'" 1 
ATOM   8081  O  "O3'" . DG  I  5 95  ? 28.243  -28.771 41.835 1.00 80.76  ? 21   DG  I "O3'" 1 
ATOM   8082  C  "C2'" . DG  I  5 95  ? 25.757  -28.750 42.237 1.00 78.11  ? 21   DG  I "C2'" 1 
ATOM   8083  C  "C1'" . DG  I  5 95  ? 25.512  -29.845 43.277 1.00 76.94  ? 21   DG  I "C1'" 1 
ATOM   8084  N  N9    . DG  I  5 95  ? 24.079  -30.122 43.514 1.00 76.60  ? 21   DG  I N9    1 
ATOM   8085  C  C8    . DG  I  5 95  ? 23.048  -29.216 43.650 1.00 76.11  ? 21   DG  I C8    1 
ATOM   8086  N  N7    . DG  I  5 95  ? 21.878  -29.765 43.831 1.00 75.79  ? 21   DG  I N7    1 
ATOM   8087  C  C5    . DG  I  5 95  ? 22.138  -31.128 43.812 1.00 75.90  ? 21   DG  I C5    1 
ATOM   8088  C  C6    . DG  I  5 95  ? 21.262  -32.239 43.957 1.00 76.07  ? 21   DG  I C6    1 
ATOM   8089  O  O6    . DG  I  5 95  ? 20.041  -32.243 44.139 1.00 76.25  ? 21   DG  I O6    1 
ATOM   8090  N  N1    . DG  I  5 95  ? 21.927  -33.457 43.872 1.00 75.97  ? 21   DG  I N1    1 
ATOM   8091  C  C2    . DG  I  5 95  ? 23.278  -33.588 43.667 1.00 76.09  ? 21   DG  I C2    1 
ATOM   8092  N  N2    . DG  I  5 95  ? 23.747  -34.839 43.610 1.00 76.03  ? 21   DG  I N2    1 
ATOM   8093  N  N3    . DG  I  5 95  ? 24.113  -32.561 43.531 1.00 76.26  ? 21   DG  I N3    1 
ATOM   8094  C  C4    . DG  I  5 95  ? 23.482  -31.362 43.613 1.00 76.09  ? 21   DG  I C4    1 
ATOM   8095  P  P     . DA  I  5 96  ? 28.348  -28.754 40.223 1.00 81.43  ? 22   DA  I P     1 
ATOM   8096  O  OP1   . DA  I  5 96  ? 29.797  -28.680 39.909 1.00 81.48  ? 22   DA  I OP1   1 
ATOM   8097  O  OP2   . DA  I  5 96  ? 27.402  -27.753 39.653 1.00 80.71  ? 22   DA  I OP2   1 
ATOM   8098  O  "O5'" . DA  I  5 96  ? 27.863  -30.225 39.839 1.00 79.99  ? 22   DA  I "O5'" 1 
ATOM   8099  C  "C5'" . DA  I  5 96  ? 28.422  -31.322 40.576 1.00 79.92  ? 22   DA  I "C5'" 1 
ATOM   8100  C  "C4'" . DA  I  5 96  ? 27.936  -32.649 40.026 1.00 79.58  ? 22   DA  I "C4'" 1 
ATOM   8101  O  "O4'" . DA  I  5 96  ? 26.647  -33.002 40.608 1.00 78.86  ? 22   DA  I "O4'" 1 
ATOM   8102  C  "C3'" . DA  I  5 96  ? 27.757  -32.631 38.509 1.00 79.59  ? 22   DA  I "C3'" 1 
ATOM   8103  O  "O3'" . DA  I  5 96  ? 28.273  -33.834 37.952 1.00 80.42  ? 22   DA  I "O3'" 1 
ATOM   8104  C  "C2'" . DA  I  5 96  ? 26.247  -32.504 38.324 1.00 78.63  ? 22   DA  I "C2'" 1 
ATOM   8105  C  "C1'" . DA  I  5 96  ? 25.732  -33.258 39.551 1.00 77.31  ? 22   DA  I "C1'" 1 
ATOM   8106  N  N9    . DA  I  5 96  ? 24.363  -32.873 39.902 1.00 76.60  ? 22   DA  I N9    1 
ATOM   8107  C  C8    . DA  I  5 96  ? 23.852  -31.608 40.054 1.00 75.94  ? 22   DA  I C8    1 
ATOM   8108  N  N7    . DA  I  5 96  ? 22.579  -31.581 40.356 1.00 75.64  ? 22   DA  I N7    1 
ATOM   8109  C  C5    . DA  I  5 96  ? 22.229  -32.923 40.397 1.00 76.03  ? 22   DA  I C5    1 
ATOM   8110  C  C6    . DA  I  5 96  ? 21.013  -33.584 40.667 1.00 75.97  ? 22   DA  I C6    1 
ATOM   8111  N  N6    . DA  I  5 96  ? 19.882  -32.942 40.957 1.00 75.90  ? 22   DA  I N6    1 
ATOM   8112  N  N1    . DA  I  5 96  ? 21.012  -34.937 40.628 1.00 76.20  ? 22   DA  I N1    1 
ATOM   8113  C  C2    . DA  I  5 96  ? 22.147  -35.594 40.337 1.00 75.92  ? 22   DA  I C2    1 
ATOM   8114  N  N3    . DA  I  5 96  ? 23.350  -35.088 40.071 1.00 75.81  ? 22   DA  I N3    1 
ATOM   8115  C  C4    . DA  I  5 96  ? 23.318  -33.737 40.116 1.00 76.21  ? 22   DA  I C4    1 
ATOM   8116  P  P     . DT  I  5 97  ? 28.454  -34.010 36.367 1.00 80.97  ? 23   DT  I P     1 
ATOM   8117  O  OP1   . DT  I  5 97  ? 29.795  -34.627 36.193 1.00 80.30  ? 23   DT  I OP1   1 
ATOM   8118  O  OP2   . DT  I  5 97  ? 28.118  -32.734 35.683 1.00 79.79  ? 23   DT  I OP2   1 
ATOM   8119  O  "O5'" . DT  I  5 97  ? 27.307  -35.073 35.988 1.00 79.88  ? 23   DT  I "O5'" 1 
ATOM   8120  C  "C5'" . DT  I  5 97  ? 27.076  -36.256 36.785 1.00 78.77  ? 23   DT  I "C5'" 1 
ATOM   8121  C  "C4'" . DT  I  5 97  ? 25.795  -36.956 36.347 1.00 77.98  ? 23   DT  I "C4'" 1 
ATOM   8122  O  "O4'" . DT  I  5 97  ? 24.646  -36.545 37.140 1.00 77.04  ? 23   DT  I "O4'" 1 
ATOM   8123  C  "C3'" . DT  I  5 97  ? 25.410  -36.687 34.898 1.00 77.72  ? 23   DT  I "C3'" 1 
ATOM   8124  O  "O3'" . DT  I  5 97  ? 26.059  -37.672 34.088 1.00 78.04  ? 23   DT  I "O3'" 1 
ATOM   8125  C  "C2'" . DT  I  5 97  ? 23.887  -36.811 34.892 1.00 76.92  ? 23   DT  I "C2'" 1 
ATOM   8126  C  "C1'" . DT  I  5 97  ? 23.473  -36.648 36.351 1.00 75.34  ? 23   DT  I "C1'" 1 
ATOM   8127  N  N1    . DT  I  5 97  ? 22.575  -35.467 36.548 1.00 74.37  ? 23   DT  I N1    1 
ATOM   8128  C  C2    . DT  I  5 97  ? 21.247  -35.704 36.828 1.00 74.22  ? 23   DT  I C2    1 
ATOM   8129  O  O2    . DT  I  5 97  ? 20.792  -36.828 36.931 1.00 74.30  ? 23   DT  I O2    1 
ATOM   8130  N  N3    . DT  I  5 97  ? 20.470  -34.577 36.988 1.00 73.94  ? 23   DT  I N3    1 
ATOM   8131  C  C4    . DT  I  5 97  ? 20.882  -33.256 36.900 1.00 74.25  ? 23   DT  I C4    1 
ATOM   8132  O  O4    . DT  I  5 97  ? 20.101  -32.321 37.072 1.00 73.68  ? 23   DT  I O4    1 
ATOM   8133  C  C5    . DT  I  5 97  ? 22.295  -33.079 36.598 1.00 74.35  ? 23   DT  I C5    1 
ATOM   8134  C  C7    . DT  I  5 97  ? 22.894  -31.707 36.465 1.00 74.51  ? 23   DT  I C7    1 
ATOM   8135  C  C6    . DT  I  5 97  ? 23.058  -34.176 36.436 1.00 74.09  ? 23   DT  I C6    1 
ATOM   8136  P  P     . DG  I  5 98  ? 25.772  -37.861 32.518 1.00 78.06  ? 24   DG  I P     1 
ATOM   8137  O  OP1   . DG  I  5 98  ? 26.933  -38.601 31.965 1.00 78.28  ? 24   DG  I OP1   1 
ATOM   8138  O  OP2   . DG  I  5 98  ? 25.365  -36.561 31.927 1.00 76.70  ? 24   DG  I OP2   1 
ATOM   8139  O  "O5'" . DG  I  5 98  ? 24.501  -38.840 32.512 1.00 76.72  ? 24   DG  I "O5'" 1 
ATOM   8140  C  "C5'" . DG  I  5 98  ? 24.492  -40.119 33.172 1.00 74.26  ? 24   DG  I "C5'" 1 
ATOM   8141  C  "C4'" . DG  I  5 98  ? 23.081  -40.706 33.121 1.00 72.83  ? 24   DG  I "C4'" 1 
ATOM   8142  O  "O4'" . DG  I  5 98  ? 22.127  -39.752 33.662 1.00 71.65  ? 24   DG  I "O4'" 1 
ATOM   8143  C  "C3'" . DG  I  5 98  ? 22.536  -41.076 31.737 1.00 71.85  ? 24   DG  I "C3'" 1 
ATOM   8144  O  "O3'" . DG  I  5 98  ? 21.676  -42.233 31.851 1.00 72.20  ? 24   DG  I "O3'" 1 
ATOM   8145  C  "C2'" . DG  I  5 98  ? 21.805  -39.797 31.319 1.00 70.75  ? 24   DG  I "C2'" 1 
ATOM   8146  C  "C1'" . DG  I  5 98  ? 21.203  -39.372 32.659 1.00 69.86  ? 24   DG  I "C1'" 1 
ATOM   8147  N  N9    . DG  I  5 98  ? 20.960  -37.943 32.822 1.00 69.45  ? 24   DG  I N9    1 
ATOM   8148  C  C8    . DG  I  5 98  ? 21.730  -36.894 32.381 1.00 69.45  ? 24   DG  I C8    1 
ATOM   8149  N  N7    . DG  I  5 98  ? 21.244  -35.722 32.690 1.00 69.40  ? 24   DG  I N7    1 
ATOM   8150  C  C5    . DG  I  5 98  ? 20.077  -36.014 33.382 1.00 68.93  ? 24   DG  I C5    1 
ATOM   8151  C  C6    . DG  I  5 98  ? 19.120  -35.151 33.969 1.00 68.73  ? 24   DG  I C6    1 
ATOM   8152  O  O6    . DG  I  5 98  ? 19.105  -33.917 34.000 1.00 68.83  ? 24   DG  I O6    1 
ATOM   8153  N  N1    . DG  I  5 98  ? 18.086  -35.856 34.571 1.00 69.04  ? 24   DG  I N1    1 
ATOM   8154  C  C2    . DG  I  5 98  ? 17.991  -37.226 34.605 1.00 69.15  ? 24   DG  I C2    1 
ATOM   8155  N  N2    . DG  I  5 98  ? 16.921  -37.724 35.234 1.00 69.18  ? 24   DG  I N2    1 
ATOM   8156  N  N3    . DG  I  5 98  ? 18.876  -38.051 34.060 1.00 69.14  ? 24   DG  I N3    1 
ATOM   8157  C  C4    . DG  I  5 98  ? 19.891  -37.376 33.468 1.00 69.08  ? 24   DG  I C4    1 
ATOM   8158  P  P     . DG  I  5 99  ? 20.716  -42.759 30.659 1.00 73.07  ? 25   DG  I P     1 
ATOM   8159  O  OP1   . DG  I  5 99  ? 20.376  -44.173 30.952 1.00 71.55  ? 25   DG  I OP1   1 
ATOM   8160  O  OP2   . DG  I  5 99  ? 21.293  -42.345 29.350 1.00 72.37  ? 25   DG  I OP2   1 
ATOM   8161  O  "O5'" . DG  I  5 99  ? 19.399  -41.856 30.845 1.00 72.60  ? 25   DG  I "O5'" 1 
ATOM   8162  C  "C5'" . DG  I  5 99  ? 18.134  -42.321 31.353 1.00 69.44  ? 25   DG  I "C5'" 1 
ATOM   8163  C  "C4'" . DG  I  5 99  ? 17.073  -41.311 30.960 1.00 67.38  ? 25   DG  I "C4'" 1 
ATOM   8164  O  "O4'" . DG  I  5 99  ? 17.531  -39.961 31.237 1.00 66.44  ? 25   DG  I "O4'" 1 
ATOM   8165  C  "C3'" . DG  I  5 99  ? 16.753  -41.328 29.469 1.00 67.21  ? 25   DG  I "C3'" 1 
ATOM   8166  O  "O3'" . DG  I  5 99  ? 15.361  -41.366 29.300 1.00 67.70  ? 25   DG  I "O3'" 1 
ATOM   8167  C  "C2'" . DG  I  5 99  ? 17.353  -40.037 28.920 1.00 66.17  ? 25   DG  I "C2'" 1 
ATOM   8168  C  "C1'" . DG  I  5 99  ? 17.174  -39.155 30.140 1.00 65.26  ? 25   DG  I "C1'" 1 
ATOM   8169  N  N9    . DG  I  5 99  ? 17.976  -37.944 30.130 1.00 64.97  ? 25   DG  I N9    1 
ATOM   8170  C  C8    . DG  I  5 99  ? 19.240  -37.760 29.629 1.00 65.09  ? 25   DG  I C8    1 
ATOM   8171  N  N7    . DG  I  5 99  ? 19.683  -36.540 29.774 1.00 65.06  ? 25   DG  I N7    1 
ATOM   8172  C  C5    . DG  I  5 99  ? 18.640  -35.875 30.400 1.00 64.94  ? 25   DG  I C5    1 
ATOM   8173  C  C6    . DG  I  5 99  ? 18.527  -34.524 30.815 1.00 65.02  ? 25   DG  I C6    1 
ATOM   8174  O  O6    . DG  I  5 99  ? 19.362  -33.622 30.705 1.00 65.13  ? 25   DG  I O6    1 
ATOM   8175  N  N1    . DG  I  5 99  ? 17.300  -34.257 31.421 1.00 64.95  ? 25   DG  I N1    1 
ATOM   8176  C  C2    . DG  I  5 99  ? 16.306  -35.192 31.598 1.00 64.98  ? 25   DG  I C2    1 
ATOM   8177  N  N2    . DG  I  5 99  ? 15.191  -34.778 32.207 1.00 64.98  ? 25   DG  I N2    1 
ATOM   8178  N  N3    . DG  I  5 99  ? 16.394  -36.458 31.213 1.00 64.97  ? 25   DG  I N3    1 
ATOM   8179  C  C4    . DG  I  5 99  ? 17.586  -36.728 30.625 1.00 64.93  ? 25   DG  I C4    1 
ATOM   8180  P  P     . DA  I  5 100 ? 14.635  -42.788 29.312 1.00 69.17  ? 26   DA  I P     1 
ATOM   8181  O  OP1   . DA  I  5 100 ? 15.281  -43.673 30.325 1.00 68.71  ? 26   DA  I OP1   1 
ATOM   8182  O  OP2   . DA  I  5 100 ? 14.519  -43.253 27.909 1.00 68.92  ? 26   DA  I OP2   1 
ATOM   8183  O  "O5'" . DA  I  5 100 ? 13.176  -42.367 29.804 1.00 67.20  ? 26   DA  I "O5'" 1 
ATOM   8184  C  "C5'" . DA  I  5 100 ? 12.924  -42.153 31.189 1.00 65.21  ? 26   DA  I "C5'" 1 
ATOM   8185  C  "C4'" . DA  I  5 100 ? 11.905  -41.042 31.335 1.00 63.43  ? 26   DA  I "C4'" 1 
ATOM   8186  O  "O4'" . DA  I  5 100 ? 12.495  -39.740 31.059 1.00 62.50  ? 26   DA  I "O4'" 1 
ATOM   8187  C  "C3'" . DA  I  5 100 ? 10.697  -41.176 30.419 1.00 61.82  ? 26   DA  I "C3'" 1 
ATOM   8188  O  "O3'" . DA  I  5 100 ? 9.594   -40.833 31.239 1.00 60.65  ? 26   DA  I "O3'" 1 
ATOM   8189  C  "C2'" . DA  I  5 100 ? 10.986  -40.184 29.288 1.00 61.57  ? 26   DA  I "C2'" 1 
ATOM   8190  C  "C1'" . DA  I  5 100 ? 11.833  -39.111 29.977 1.00 61.72  ? 26   DA  I "C1'" 1 
ATOM   8191  N  N9    . DA  I  5 100 ? 12.895  -38.476 29.195 1.00 61.57  ? 26   DA  I N9    1 
ATOM   8192  C  C8    . DA  I  5 100 ? 13.757  -39.080 28.324 1.00 61.66  ? 26   DA  I C8    1 
ATOM   8193  N  N7    . DA  I  5 100 ? 14.626  -38.255 27.778 1.00 61.79  ? 26   DA  I N7    1 
ATOM   8194  C  C5    . DA  I  5 100 ? 14.332  -37.024 28.336 1.00 61.18  ? 26   DA  I C5    1 
ATOM   8195  C  C6    . DA  I  5 100 ? 14.895  -35.731 28.178 1.00 61.42  ? 26   DA  I C6    1 
ATOM   8196  N  N6    . DA  I  5 100 ? 15.915  -35.466 27.371 1.00 61.32  ? 26   DA  I N6    1 
ATOM   8197  N  N1    . DA  I  5 100 ? 14.367  -34.696 28.877 1.00 61.90  ? 26   DA  I N1    1 
ATOM   8198  C  C2    . DA  I  5 100 ? 13.329  -34.964 29.690 1.00 61.86  ? 26   DA  I C2    1 
ATOM   8199  N  N3    . DA  I  5 100 ? 12.721  -36.139 29.927 1.00 61.52  ? 26   DA  I N3    1 
ATOM   8200  C  C4    . DA  I  5 100 ? 13.269  -37.145 29.215 1.00 61.38  ? 26   DA  I C4    1 
ATOM   8201  P  P     . DG  I  5 101 ? 8.068   -40.958 30.788 1.00 60.24  ? 27   DG  I P     1 
ATOM   8202  O  OP1   . DG  I  5 101 ? 7.301   -41.262 32.015 1.00 59.57  ? 27   DG  I OP1   1 
ATOM   8203  O  OP2   . DG  I  5 101 ? 7.963   -41.856 29.609 1.00 60.29  ? 27   DG  I OP2   1 
ATOM   8204  O  "O5'" . DG  I  5 101 ? 7.740   -39.483 30.253 1.00 57.48  ? 27   DG  I "O5'" 1 
ATOM   8205  C  "C5'" . DG  I  5 101 ? 8.245   -38.321 30.885 1.00 54.05  ? 27   DG  I "C5'" 1 
ATOM   8206  C  "C4'" . DG  I  5 101 ? 7.945   -37.083 30.059 1.00 52.02  ? 27   DG  I "C4'" 1 
ATOM   8207  O  "O4'" . DG  I  5 101 ? 9.097   -36.720 29.258 1.00 51.63  ? 27   DG  I "O4'" 1 
ATOM   8208  C  "C3'" . DG  I  5 101 ? 6.783   -37.161 29.078 1.00 50.78  ? 27   DG  I "C3'" 1 
ATOM   8209  O  "O3'" . DG  I  5 101 ? 6.245   -35.851 29.017 1.00 50.26  ? 27   DG  I "O3'" 1 
ATOM   8210  C  "C2'" . DG  I  5 101 ? 7.485   -37.459 27.767 1.00 50.39  ? 27   DG  I "C2'" 1 
ATOM   8211  C  "C1'" . DG  I  5 101 ? 8.701   -36.547 27.910 1.00 51.73  ? 27   DG  I "C1'" 1 
ATOM   8212  N  N9    . DG  I  5 101 ? 9.856   -36.866 27.058 1.00 52.44  ? 27   DG  I N9    1 
ATOM   8213  C  C8    . DG  I  5 101 ? 10.141  -38.085 26.466 1.00 52.08  ? 27   DG  I C8    1 
ATOM   8214  N  N7    . DG  I  5 101 ? 11.243  -38.090 25.772 1.00 51.99  ? 27   DG  I N7    1 
ATOM   8215  C  C5    . DG  I  5 101 ? 11.729  -36.799 25.916 1.00 51.87  ? 27   DG  I C5    1 
ATOM   8216  C  C6    . DG  I  5 101 ? 12.899  -36.220 25.386 1.00 51.67  ? 27   DG  I C6    1 
ATOM   8217  O  O6    . DG  I  5 101 ? 13.741  -36.761 24.669 1.00 52.17  ? 27   DG  I O6    1 
ATOM   8218  N  N1    . DG  I  5 101 ? 13.050  -34.887 25.745 1.00 51.78  ? 27   DG  I N1    1 
ATOM   8219  C  C2    . DG  I  5 101 ? 12.163  -34.199 26.534 1.00 51.74  ? 27   DG  I C2    1 
ATOM   8220  N  N2    . DG  I  5 101 ? 12.481  -32.924 26.787 1.00 51.96  ? 27   DG  I N2    1 
ATOM   8221  N  N3    . DG  I  5 101 ? 11.056  -34.727 27.043 1.00 51.59  ? 27   DG  I N3    1 
ATOM   8222  C  C4    . DG  I  5 101 ? 10.897  -36.028 26.698 1.00 51.90  ? 27   DG  I C4    1 
ATOM   8223  P  P     . DC  I  5 102 ? 4.707   -35.505 29.199 1.00 47.18  ? 28   DC  I P     1 
ATOM   8224  O  OP1   . DC  I  5 102 ? 4.319   -35.919 30.555 1.00 49.08  ? 28   DC  I OP1   1 
ATOM   8225  O  OP2   . DC  I  5 102 ? 3.936   -36.006 28.055 1.00 47.63  ? 28   DC  I OP2   1 
ATOM   8226  O  "O5'" . DC  I  5 102 ? 4.763   -33.928 29.059 1.00 49.41  ? 28   DC  I "O5'" 1 
ATOM   8227  C  "C5'" . DC  I  5 102 ? 5.764   -33.206 29.746 1.00 52.81  ? 28   DC  I "C5'" 1 
ATOM   8228  C  "C4'" . DC  I  5 102 ? 6.352   -32.110 28.881 1.00 55.36  ? 28   DC  I "C4'" 1 
ATOM   8229  O  "O4'" . DC  I  5 102 ? 7.288   -32.678 27.942 1.00 55.40  ? 28   DC  I "O4'" 1 
ATOM   8230  C  "C3'" . DC  I  5 102 ? 5.378   -31.290 28.042 1.00 57.32  ? 28   DC  I "C3'" 1 
ATOM   8231  O  "O3'" . DC  I  5 102 ? 5.664   -29.925 28.353 1.00 60.77  ? 28   DC  I "O3'" 1 
ATOM   8232  C  "C2'" . DC  I  5 102 ? 5.708   -31.677 26.594 1.00 56.38  ? 28   DC  I "C2'" 1 
ATOM   8233  C  "C1'" . DC  I  5 102 ? 7.185   -32.018 26.704 1.00 55.31  ? 28   DC  I "C1'" 1 
ATOM   8234  N  N1    . DC  I  5 102 ? 7.720   -33.029 25.777 1.00 55.45  ? 28   DC  I N1    1 
ATOM   8235  C  C2    . DC  I  5 102 ? 8.938   -32.818 25.099 1.00 56.10  ? 28   DC  I C2    1 
ATOM   8236  O  O2    . DC  I  5 102 ? 9.562   -31.755 25.236 1.00 56.05  ? 28   DC  I O2    1 
ATOM   8237  N  N3    . DC  I  5 102 ? 9.404   -33.801 24.280 1.00 56.57  ? 28   DC  I N3    1 
ATOM   8238  C  C4    . DC  I  5 102 ? 8.724   -34.946 24.140 1.00 55.94  ? 28   DC  I C4    1 
ATOM   8239  N  N4    . DC  I  5 102 ? 9.219   -35.886 23.329 1.00 55.81  ? 28   DC  I N4    1 
ATOM   8240  C  C5    . DC  I  5 102 ? 7.499   -35.177 24.833 1.00 55.76  ? 28   DC  I C5    1 
ATOM   8241  C  C6    . DC  I  5 102 ? 7.045   -34.208 25.635 1.00 55.33  ? 28   DC  I C6    1 
ATOM   8242  P  P     . DA  I  5 103 ? 4.909   -28.667 27.704 1.00 63.13  ? 29   DA  I P     1 
ATOM   8243  O  OP1   . DA  I  5 103 ? 5.226   -27.501 28.571 1.00 62.75  ? 29   DA  I OP1   1 
ATOM   8244  O  OP2   . DA  I  5 103 ? 3.509   -29.051 27.402 1.00 62.14  ? 29   DA  I OP2   1 
ATOM   8245  O  "O5'" . DA  I  5 103 ? 5.674   -28.503 26.298 1.00 64.24  ? 29   DA  I "O5'" 1 
ATOM   8246  C  "C5'" . DA  I  5 103 ? 6.930   -27.812 26.194 1.00 64.76  ? 29   DA  I "C5'" 1 
ATOM   8247  C  "C4'" . DA  I  5 103 ? 7.360   -27.729 24.740 1.00 65.09  ? 29   DA  I "C4'" 1 
ATOM   8248  O  "O4'" . DA  I  5 103 ? 7.590   -29.074 24.248 1.00 64.49  ? 29   DA  I "O4'" 1 
ATOM   8249  C  "C3'" . DA  I  5 103 ? 6.323   -27.123 23.799 1.00 66.11  ? 29   DA  I "C3'" 1 
ATOM   8250  O  "O3'" . DA  I  5 103 ? 6.949   -26.210 22.885 1.00 68.80  ? 29   DA  I "O3'" 1 
ATOM   8251  C  "C2'" . DA  I  5 103 ? 5.721   -28.347 23.100 1.00 64.76  ? 29   DA  I "C2'" 1 
ATOM   8252  C  "C1'" . DA  I  5 103 ? 6.979   -29.193 22.980 1.00 63.15  ? 29   DA  I "C1'" 1 
ATOM   8253  N  N9    . DA  I  5 103 ? 6.797   -30.608 22.652 1.00 62.54  ? 29   DA  I N9    1 
ATOM   8254  C  C8    . DA  I  5 103 ? 5.781   -31.449 23.020 1.00 61.84  ? 29   DA  I C8    1 
ATOM   8255  N  N7    . DA  I  5 103 ? 5.916   -32.672 22.565 1.00 61.51  ? 29   DA  I N7    1 
ATOM   8256  C  C5    . DA  I  5 103 ? 7.105   -32.631 21.852 1.00 61.92  ? 29   DA  I C5    1 
ATOM   8257  C  C6    . DA  I  5 103 ? 7.820   -33.601 21.116 1.00 62.08  ? 29   DA  I C6    1 
ATOM   8258  N  N6    . DA  I  5 103 ? 7.422   -34.869 20.970 1.00 61.67  ? 29   DA  I N6    1 
ATOM   8259  N  N1    . DA  I  5 103 ? 8.973   -33.213 20.527 1.00 62.33  ? 29   DA  I N1    1 
ATOM   8260  C  C2    . DA  I  5 103 ? 9.387   -31.945 20.652 1.00 61.79  ? 29   DA  I C2    1 
ATOM   8261  N  N3    . DA  I  5 103 ? 8.803   -30.952 21.314 1.00 61.62  ? 29   DA  I N3    1 
ATOM   8262  C  C4    . DA  I  5 103 ? 7.661   -31.365 21.896 1.00 61.94  ? 29   DA  I C4    1 
ATOM   8263  P  P     . DG  I  5 104 ? 6.057   -25.358 21.843 1.00 71.20  ? 30   DG  I P     1 
ATOM   8264  O  OP1   . DG  I  5 104 ? 5.557   -24.173 22.573 1.00 70.77  ? 30   DG  I OP1   1 
ATOM   8265  O  OP2   . DG  I  5 104 ? 5.103   -26.262 21.141 1.00 69.75  ? 30   DG  I OP2   1 
ATOM   8266  O  "O5'" . DG  I  5 104 ? 7.117   -24.840 20.755 1.00 72.57  ? 30   DG  I "O5'" 1 
ATOM   8267  C  "C5'" . DG  I  5 104 ? 8.542   -25.029 20.877 1.00 72.47  ? 30   DG  I "C5'" 1 
ATOM   8268  C  "C4'" . DG  I  5 104 ? 9.157   -25.468 19.549 1.00 72.07  ? 30   DG  I "C4'" 1 
ATOM   8269  O  "O4'" . DG  I  5 104 ? 9.119   -26.914 19.418 1.00 71.14  ? 30   DG  I "O4'" 1 
ATOM   8270  C  "C3'" . DG  I  5 104 ? 8.495   -24.909 18.293 1.00 72.68  ? 30   DG  I "C3'" 1 
ATOM   8271  O  "O3'" . DG  I  5 104 ? 9.512   -24.441 17.416 1.00 74.63  ? 30   DG  I "O3'" 1 
ATOM   8272  C  "C2'" . DG  I  5 104 ? 7.715   -26.094 17.721 1.00 71.46  ? 30   DG  I "C2'" 1 
ATOM   8273  C  "C1'" . DG  I  5 104 ? 8.564   -27.279 18.171 1.00 70.07  ? 30   DG  I "C1'" 1 
ATOM   8274  N  N9    . DG  I  5 104 ? 7.849   -28.544 18.354 1.00 69.64  ? 30   DG  I N9    1 
ATOM   8275  C  C8    . DG  I  5 104 ? 6.772   -28.786 19.175 1.00 69.63  ? 30   DG  I C8    1 
ATOM   8276  N  N7    . DG  I  5 104 ? 6.342   -30.018 19.137 1.00 69.38  ? 30   DG  I N7    1 
ATOM   8277  C  C5    . DG  I  5 104 ? 7.194   -30.642 18.237 1.00 69.27  ? 30   DG  I C5    1 
ATOM   8278  C  C6    . DG  I  5 104 ? 7.222   -31.987 17.785 1.00 69.54  ? 30   DG  I C6    1 
ATOM   8279  O  O6    . DG  I  5 104 ? 6.481   -32.928 18.105 1.00 69.43  ? 30   DG  I O6    1 
ATOM   8280  N  N1    . DG  I  5 104 ? 8.248   -32.205 16.864 1.00 69.73  ? 30   DG  I N1    1 
ATOM   8281  C  C2    . DG  I  5 104 ? 9.133   -31.242 16.435 1.00 69.33  ? 30   DG  I C2    1 
ATOM   8282  N  N2    . DG  I  5 104 ? 10.050  -31.636 15.546 1.00 69.60  ? 30   DG  I N2    1 
ATOM   8283  N  N3    . DG  I  5 104 ? 9.115   -29.984 16.848 1.00 68.72  ? 30   DG  I N3    1 
ATOM   8284  C  C4    . DG  I  5 104 ? 8.127   -29.750 17.747 1.00 69.05  ? 30   DG  I C4    1 
ATOM   8285  P  P     . DT  I  5 105 ? 9.183   -23.501 16.162 1.00 76.07  ? 31   DT  I P     1 
ATOM   8286  O  OP1   . DT  I  5 105 ? 10.372  -22.636 15.944 1.00 75.92  ? 31   DT  I OP1   1 
ATOM   8287  O  OP2   . DT  I  5 105 ? 7.840   -22.894 16.345 1.00 76.42  ? 31   DT  I OP2   1 
ATOM   8288  O  "O5'" . DT  I  5 105 ? 9.076   -24.575 14.986 1.00 77.66  ? 31   DT  I "O5'" 1 
ATOM   8289  C  "C5'" . DT  I  5 105 ? 10.254  -25.248 14.543 1.00 80.30  ? 31   DT  I "C5'" 1 
ATOM   8290  C  "C4'" . DT  I  5 105 ? 9.952   -26.224 13.422 1.00 81.81  ? 31   DT  I "C4'" 1 
ATOM   8291  O  "O4'" . DT  I  5 105 ? 9.370   -27.431 13.975 1.00 81.99  ? 31   DT  I "O4'" 1 
ATOM   8292  C  "C3'" . DT  I  5 105 ? 8.989   -25.710 12.358 1.00 83.23  ? 31   DT  I "C3'" 1 
ATOM   8293  O  "O3'" . DT  I  5 105 ? 9.633   -25.813 11.086 1.00 86.12  ? 31   DT  I "O3'" 1 
ATOM   8294  C  "C2'" . DT  I  5 105 ? 7.765   -26.619 12.488 1.00 82.72  ? 31   DT  I "C2'" 1 
ATOM   8295  C  "C1'" . DT  I  5 105 ? 8.325   -27.879 13.146 1.00 81.68  ? 31   DT  I "C1'" 1 
ATOM   8296  N  N1    . DT  I  5 105 ? 7.338   -28.627 13.994 1.00 81.28  ? 31   DT  I N1    1 
ATOM   8297  C  C2    . DT  I  5 105 ? 7.290   -30.009 13.949 1.00 81.09  ? 31   DT  I C2    1 
ATOM   8298  O  O2    . DT  I  5 105 ? 8.011   -30.697 13.257 1.00 81.21  ? 31   DT  I O2    1 
ATOM   8299  N  N3    . DT  I  5 105 ? 6.345   -30.580 14.767 1.00 81.54  ? 31   DT  I N3    1 
ATOM   8300  C  C4    . DT  I  5 105 ? 5.456   -29.921 15.608 1.00 81.48  ? 31   DT  I C4    1 
ATOM   8301  O  O4    . DT  I  5 105 ? 4.651   -30.530 16.304 1.00 81.36  ? 31   DT  I O4    1 
ATOM   8302  C  C5    . DT  I  5 105 ? 5.554   -28.477 15.616 1.00 81.42  ? 31   DT  I C5    1 
ATOM   8303  C  C7    . DT  I  5 105 ? 4.647   -27.652 16.486 1.00 81.13  ? 31   DT  I C7    1 
ATOM   8304  C  C6    . DT  I  5 105 ? 6.479   -27.912 14.819 1.00 81.54  ? 31   DT  I C6    1 
ATOM   8305  P  P     . DT  I  5 106 ? 8.919   -25.439 9.693  1.00 87.59  ? 32   DT  I P     1 
ATOM   8306  O  OP1   . DT  I  5 106 ? 10.002  -24.940 8.814  1.00 87.93  ? 32   DT  I OP1   1 
ATOM   8307  O  OP2   . DT  I  5 106 ? 7.723   -24.594 9.948  1.00 87.45  ? 32   DT  I OP2   1 
ATOM   8308  O  "O5'" . DT  I  5 106 ? 8.418   -26.859 9.148  1.00 86.87  ? 32   DT  I "O5'" 1 
ATOM   8309  C  "C5'" . DT  I  5 106 ? 9.333   -27.937 8.973  1.00 87.22  ? 32   DT  I "C5'" 1 
ATOM   8310  C  "C4'" . DT  I  5 106 ? 8.626   -29.121 8.335  1.00 87.69  ? 32   DT  I "C4'" 1 
ATOM   8311  O  "O4'" . DT  I  5 106 ? 7.868   -29.822 9.359  1.00 87.10  ? 32   DT  I "O4'" 1 
ATOM   8312  C  "C3'" . DT  I  5 106 ? 7.639   -28.775 7.213  1.00 88.12  ? 32   DT  I "C3'" 1 
ATOM   8313  O  "O3'" . DT  I  5 106 ? 7.776   -29.691 6.114  1.00 89.52  ? 32   DT  I "O3'" 1 
ATOM   8314  C  "C2'" . DT  I  5 106 ? 6.281   -28.918 7.897  1.00 87.42  ? 32   DT  I "C2'" 1 
ATOM   8315  C  "C1'" . DT  I  5 106 ? 6.556   -30.046 8.886  1.00 86.14  ? 32   DT  I "C1'" 1 
ATOM   8316  N  N1    . DT  I  5 106 ? 5.612   -30.057 10.036 1.00 85.81  ? 32   DT  I N1    1 
ATOM   8317  C  C2    . DT  I  5 106 ? 5.164   -31.263 10.556 1.00 85.48  ? 32   DT  I C2    1 
ATOM   8318  O  O2    . DT  I  5 106 ? 5.497   -32.360 10.137 1.00 85.21  ? 32   DT  I O2    1 
ATOM   8319  N  N3    . DT  I  5 106 ? 4.292   -31.135 11.611 1.00 85.00  ? 32   DT  I N3    1 
ATOM   8320  C  C4    . DT  I  5 106 ? 3.837   -29.958 12.177 1.00 85.19  ? 32   DT  I C4    1 
ATOM   8321  O  O4    . DT  I  5 106 ? 3.058   -29.971 13.121 1.00 85.41  ? 32   DT  I O4    1 
ATOM   8322  C  C5    . DT  I  5 106 ? 4.342   -28.735 11.587 1.00 85.35  ? 32   DT  I C5    1 
ATOM   8323  C  C7    . DT  I  5 106 ? 3.933   -27.381 12.101 1.00 85.37  ? 32   DT  I C7    1 
ATOM   8324  C  C6    . DT  I  5 106 ? 5.193   -28.846 10.559 1.00 85.49  ? 32   DT  I C6    1 
ATOM   8325  P  P     . DT  I  5 107 ? 7.066   -29.474 4.684  1.00 90.07  ? 33   DT  I P     1 
ATOM   8326  O  OP1   . DT  I  5 107 ? 8.119   -28.970 3.773  1.00 89.85  ? 33   DT  I OP1   1 
ATOM   8327  O  OP2   . DT  I  5 107 ? 5.814   -28.696 4.864  1.00 89.54  ? 33   DT  I OP2   1 
ATOM   8328  O  "O5'" . DT  I  5 107 ? 6.659   -30.960 4.223  1.00 90.44  ? 33   DT  I "O5'" 1 
ATOM   8329  C  "C5'" . DT  I  5 107 ? 7.122   -32.119 4.935  1.00 92.04  ? 33   DT  I "C5'" 1 
ATOM   8330  C  "C4'" . DT  I  5 107 ? 5.978   -33.080 5.230  1.00 93.30  ? 33   DT  I "C4'" 1 
ATOM   8331  O  "O4'" . DT  I  5 107 ? 5.270   -32.680 6.437  1.00 93.88  ? 33   DT  I "O4'" 1 
ATOM   8332  C  "C3'" . DT  I  5 107 ? 4.911   -33.194 4.136  1.00 93.63  ? 33   DT  I "C3'" 1 
ATOM   8333  O  "O3'" . DT  I  5 107 ? 4.672   -34.567 3.811  1.00 93.44  ? 33   DT  I "O3'" 1 
ATOM   8334  C  "C2'" . DT  I  5 107 ? 3.676   -32.537 4.755  1.00 93.82  ? 33   DT  I "C2'" 1 
ATOM   8335  C  "C1'" . DT  I  5 107 ? 3.887   -32.893 6.223  1.00 93.94  ? 33   DT  I "C1'" 1 
ATOM   8336  N  N1    . DT  I  5 107 ? 3.065   -32.094 7.199  1.00 93.90  ? 33   DT  I N1    1 
ATOM   8337  C  C2    . DT  I  5 107 ? 2.275   -32.767 8.121  1.00 93.79  ? 33   DT  I C2    1 
ATOM   8338  O  O2    . DT  I  5 107 ? 2.198   -33.987 8.198  1.00 93.63  ? 33   DT  I O2    1 
ATOM   8339  N  N3    . DT  I  5 107 ? 1.565   -31.943 8.964  1.00 93.99  ? 33   DT  I N3    1 
ATOM   8340  C  C4    . DT  I  5 107 ? 1.563   -30.554 8.983  1.00 94.08  ? 33   DT  I C4    1 
ATOM   8341  O  O4    . DT  I  5 107 ? 0.885   -29.918 9.790  1.00 94.05  ? 33   DT  I O4    1 
ATOM   8342  C  C5    . DT  I  5 107 ? 2.408   -29.915 7.994  1.00 93.76  ? 33   DT  I C5    1 
ATOM   8343  C  C7    . DT  I  5 107 ? 2.494   -28.418 7.909  1.00 93.65  ? 33   DT  I C7    1 
ATOM   8344  C  C6    . DT  I  5 107 ? 3.107   -30.706 7.163  1.00 93.70  ? 33   DT  I C6    1 
ATOM   8345  P  P     . DC  I  5 108 ? 3.786   -34.954 2.530  1.00 93.21  ? 34   DC  I P     1 
ATOM   8346  O  OP1   . DC  I  5 108 ? 4.315   -36.243 2.021  1.00 92.65  ? 34   DC  I OP1   1 
ATOM   8347  O  OP2   . DC  I  5 108 ? 3.719   -33.755 1.654  1.00 92.15  ? 34   DC  I OP2   1 
ATOM   8348  O  "O5'" . DC  I  5 108 ? 2.301   -35.194 3.098  1.00 91.85  ? 34   DC  I "O5'" 1 
ATOM   8349  C  "C5'" . DC  I  5 108 ? 2.018   -36.006 4.245  1.00 89.87  ? 34   DC  I "C5'" 1 
ATOM   8350  C  "C4'" . DC  I  5 108 ? 0.536   -35.944 4.609  1.00 88.67  ? 34   DC  I "C4'" 1 
ATOM   8351  O  "O4'" . DC  I  5 108 ? 0.217   -34.778 5.416  1.00 88.02  ? 34   DC  I "O4'" 1 
ATOM   8352  C  "C3'" . DC  I  5 108 ? -0.435  -35.879 3.435  1.00 87.96  ? 34   DC  I "C3'" 1 
ATOM   8353  O  "O3'" . DC  I  5 108 ? -1.488  -36.764 3.693  1.00 87.28  ? 34   DC  I "O3'" 1 
ATOM   8354  C  "C2'" . DC  I  5 108 ? -0.954  -34.446 3.439  1.00 87.80  ? 34   DC  I "C2'" 1 
ATOM   8355  C  "C1'" . DC  I  5 108 ? -0.988  -34.200 4.941  1.00 87.07  ? 34   DC  I "C1'" 1 
ATOM   8356  N  N1    . DC  I  5 108 ? -1.036  -32.772 5.402  1.00 86.69  ? 34   DC  I N1    1 
ATOM   8357  C  C2    . DC  I  5 108 ? -1.281  -32.525 6.759  1.00 86.25  ? 34   DC  I C2    1 
ATOM   8358  O  O2    . DC  I  5 108 ? -1.459  -33.487 7.520  1.00 85.62  ? 34   DC  I O2    1 
ATOM   8359  N  N3    . DC  I  5 108 ? -1.317  -31.236 7.198  1.00 86.14  ? 34   DC  I N3    1 
ATOM   8360  C  C4    . DC  I  5 108 ? -1.122  -30.220 6.348  1.00 86.31  ? 34   DC  I C4    1 
ATOM   8361  N  N4    . DC  I  5 108 ? -1.168  -28.977 6.837  1.00 85.91  ? 34   DC  I N4    1 
ATOM   8362  C  C5    . DC  I  5 108 ? -0.866  -30.447 4.959  1.00 86.43  ? 34   DC  I C5    1 
ATOM   8363  C  C6    . DC  I  5 108 ? -0.831  -31.724 4.538  1.00 86.87  ? 34   DC  I C6    1 
ATOM   8364  P  P     . DC  I  5 109 ? -2.013  -37.615 2.465  1.00 86.96  ? 35   DC  I P     1 
ATOM   8365  O  OP1   . DC  I  5 109 ? -1.074  -38.752 2.332  1.00 87.06  ? 35   DC  I OP1   1 
ATOM   8366  O  OP2   . DC  I  5 109 ? -2.246  -36.657 1.357  1.00 86.49  ? 35   DC  I OP2   1 
ATOM   8367  O  "O5'" . DC  I  5 109 ? -3.440  -38.180 2.917  1.00 85.91  ? 35   DC  I "O5'" 1 
ATOM   8368  C  "C5'" . DC  I  5 109 ? -3.639  -38.830 4.174  1.00 84.15  ? 35   DC  I "C5'" 1 
ATOM   8369  C  "C4'" . DC  I  5 109 ? -4.866  -38.258 4.873  1.00 82.67  ? 35   DC  I "C4'" 1 
ATOM   8370  O  "O4'" . DC  I  5 109 ? -4.612  -36.870 5.195  1.00 81.93  ? 35   DC  I "O4'" 1 
ATOM   8371  C  "C3'" . DC  I  5 109 ? -6.169  -38.260 4.064  1.00 82.26  ? 35   DC  I "C3'" 1 
ATOM   8372  O  "O3'" . DC  I  5 109 ? -7.256  -38.756 4.846  1.00 82.07  ? 35   DC  I "O3'" 1 
ATOM   8373  C  "C2'" . DC  I  5 109 ? -6.384  -36.793 3.708  1.00 81.72  ? 35   DC  I "C2'" 1 
ATOM   8374  C  "C1'" . DC  I  5 109 ? -5.801  -36.157 4.959  1.00 81.45  ? 35   DC  I "C1'" 1 
ATOM   8375  N  N1    . DC  I  5 109 ? -5.509  -34.696 4.890  1.00 81.40  ? 35   DC  I N1    1 
ATOM   8376  C  C2    . DC  I  5 109 ? -5.669  -33.942 6.056  1.00 81.17  ? 35   DC  I C2    1 
ATOM   8377  O  O2    . DC  I  5 109 ? -6.038  -34.521 7.081  1.00 81.24  ? 35   DC  I O2    1 
ATOM   8378  N  N3    . DC  I  5 109 ? -5.416  -32.608 6.028  1.00 81.19  ? 35   DC  I N3    1 
ATOM   8379  C  C4    . DC  I  5 109 ? -5.020  -32.028 4.893  1.00 81.18  ? 35   DC  I C4    1 
ATOM   8380  N  N4    . DC  I  5 109 ? -4.785  -30.713 4.905  1.00 81.00  ? 35   DC  I N4    1 
ATOM   8381  C  C5    . DC  I  5 109 ? -4.849  -32.783 3.695  1.00 81.38  ? 35   DC  I C5    1 
ATOM   8382  C  C6    . DC  I  5 109 ? -5.100  -34.098 3.734  1.00 81.28  ? 35   DC  I C6    1 
ATOM   8383  P  P     . DA  I  5 110 ? -7.725  -40.281 4.722  1.00 82.17  ? 36   DA  I P     1 
ATOM   8384  O  OP1   . DA  I  5 110 ? -6.555  -41.147 5.036  1.00 81.44  ? 36   DA  I OP1   1 
ATOM   8385  O  OP2   . DA  I  5 110 ? -8.432  -40.404 3.427  1.00 81.74  ? 36   DA  I OP2   1 
ATOM   8386  O  "O5'" . DA  I  5 110 ? -8.842  -40.420 5.867  1.00 82.00  ? 36   DA  I "O5'" 1 
ATOM   8387  C  "C5'" . DA  I  5 110 ? -8.504  -40.668 7.239  1.00 80.89  ? 36   DA  I "C5'" 1 
ATOM   8388  C  "C4'" . DA  I  5 110 ? -9.245  -39.720 8.176  1.00 80.12  ? 36   DA  I "C4'" 1 
ATOM   8389  O  "O4'" . DA  I  5 110 ? -8.952  -38.339 7.836  1.00 79.90  ? 36   DA  I "O4'" 1 
ATOM   8390  C  "C3'" . DA  I  5 110 ? -10.769 -39.839 8.192  1.00 79.86  ? 36   DA  I "C3'" 1 
ATOM   8391  O  "O3'" . DA  I  5 110 ? -11.222 -39.824 9.568  1.00 79.00  ? 36   DA  I "O3'" 1 
ATOM   8392  C  "C2'" . DA  I  5 110 ? -11.237 -38.640 7.357  1.00 79.81  ? 36   DA  I "C2'" 1 
ATOM   8393  C  "C1'" . DA  I  5 110 ? -10.150 -37.609 7.642  1.00 80.31  ? 36   DA  I "C1'" 1 
ATOM   8394  N  N9    . DA  I  5 110 ? -9.924  -36.640 6.568  1.00 80.50  ? 36   DA  I N9    1 
ATOM   8395  C  C8    . DA  I  5 110 ? -9.840  -36.904 5.230  1.00 80.72  ? 36   DA  I C8    1 
ATOM   8396  N  N7    . DA  I  5 110 ? -9.621  -35.842 4.493  1.00 80.70  ? 36   DA  I N7    1 
ATOM   8397  C  C5    . DA  I  5 110 ? -9.551  -34.801 5.400  1.00 80.56  ? 36   DA  I C5    1 
ATOM   8398  C  C6    . DA  I  5 110 ? -9.335  -33.410 5.251  1.00 80.72  ? 36   DA  I C6    1 
ATOM   8399  N  N6    . DA  I  5 110 ? -9.151  -32.803 4.072  1.00 80.68  ? 36   DA  I N6    1 
ATOM   8400  N  N1    . DA  I  5 110 ? -9.323  -32.647 6.367  1.00 80.58  ? 36   DA  I N1    1 
ATOM   8401  C  C2    . DA  I  5 110 ? -9.512  -33.245 7.551  1.00 80.86  ? 36   DA  I C2    1 
ATOM   8402  N  N3    . DA  I  5 110 ? -9.724  -34.538 7.811  1.00 81.12  ? 36   DA  I N3    1 
ATOM   8403  C  C4    . DA  I  5 110 ? -9.732  -35.277 6.686  1.00 80.66  ? 36   DA  I C4    1 
ATOM   8404  P  P     . DA  I  5 111 ? -12.764 -39.650 9.987  1.00 77.79  ? 37   DA  I P     1 
ATOM   8405  O  OP1   . DA  I  5 111 ? -12.931 -40.146 11.377 1.00 78.12  ? 37   DA  I OP1   1 
ATOM   8406  O  OP2   . DA  I  5 111 ? -13.609 -40.189 8.893  1.00 77.46  ? 37   DA  I OP2   1 
ATOM   8407  O  "O5'" . DA  I  5 111 ? -12.939 -38.059 9.974  1.00 75.60  ? 37   DA  I "O5'" 1 
ATOM   8408  C  "C5'" . DA  I  5 111 ? -12.319 -37.199 10.937 1.00 71.97  ? 37   DA  I "C5'" 1 
ATOM   8409  C  "C4'" . DA  I  5 111 ? -12.949 -35.812 10.874 1.00 69.23  ? 37   DA  I "C4'" 1 
ATOM   8410  O  "O4'" . DA  I  5 111 ? -12.541 -35.138 9.654  1.00 68.49  ? 37   DA  I "O4'" 1 
ATOM   8411  C  "C3'" . DA  I  5 111 ? -14.477 -35.769 10.863 1.00 67.74  ? 37   DA  I "C3'" 1 
ATOM   8412  O  "O3'" . DA  I  5 111 ? -14.878 -34.614 11.592 1.00 65.99  ? 37   DA  I "O3'" 1 
ATOM   8413  C  "C2'" . DA  I  5 111 ? -14.794 -35.631 9.374  1.00 67.77  ? 37   DA  I "C2'" 1 
ATOM   8414  C  "C1'" . DA  I  5 111 ? -13.694 -34.648 9.000  1.00 68.61  ? 37   DA  I "C1'" 1 
ATOM   8415  N  N9    . DA  I  5 111 ? -13.453 -34.500 7.569  1.00 68.68  ? 37   DA  I N9    1 
ATOM   8416  C  C8    . DA  I  5 111 ? -13.669 -35.440 6.607  1.00 69.14  ? 37   DA  I C8    1 
ATOM   8417  N  N7    . DA  I  5 111 ? -13.370 -35.035 5.397  1.00 69.48  ? 37   DA  I N7    1 
ATOM   8418  C  C5    . DA  I  5 111 ? -12.925 -33.741 5.571  1.00 69.04  ? 37   DA  I C5    1 
ATOM   8419  C  C6    . DA  I  5 111 ? -12.453 -32.765 4.665  1.00 69.24  ? 37   DA  I C6    1 
ATOM   8420  N  N6    . DA  I  5 111 ? -12.351 -32.976 3.346  1.00 68.84  ? 37   DA  I N6    1 
ATOM   8421  N  N1    . DA  I  5 111 ? -12.088 -31.561 5.165  1.00 69.13  ? 37   DA  I N1    1 
ATOM   8422  C  C2    . DA  I  5 111 ? -12.182 -31.361 6.481  1.00 69.09  ? 37   DA  I C2    1 
ATOM   8423  N  N3    . DA  I  5 111 ? -12.609 -32.209 7.420  1.00 69.14  ? 37   DA  I N3    1 
ATOM   8424  C  C4    . DA  I  5 111 ? -12.968 -33.394 6.904  1.00 68.70  ? 37   DA  I C4    1 
ATOM   8425  P  P     . DA  I  5 112 ? -16.399 -34.286 11.976 1.00 63.90  ? 38   DA  I P     1 
ATOM   8426  O  OP1   . DA  I  5 112 ? -16.533 -34.746 13.374 1.00 64.06  ? 38   DA  I OP1   1 
ATOM   8427  O  OP2   . DA  I  5 112 ? -17.327 -34.797 10.945 1.00 62.83  ? 38   DA  I OP2   1 
ATOM   8428  O  "O5'" . DA  I  5 112 ? -16.455 -32.682 11.907 1.00 62.47  ? 38   DA  I "O5'" 1 
ATOM   8429  C  "C5'" . DA  I  5 112 ? -15.403 -31.921 12.477 1.00 61.59  ? 38   DA  I "C5'" 1 
ATOM   8430  C  "C4'" . DA  I  5 112 ? -15.338 -30.520 11.901 1.00 61.70  ? 38   DA  I "C4'" 1 
ATOM   8431  O  "O4'" . DA  I  5 112 ? -14.598 -30.537 10.645 1.00 62.00  ? 38   DA  I "O4'" 1 
ATOM   8432  C  "C3'" . DA  I  5 112 ? -16.688 -29.873 11.638 1.00 61.08  ? 38   DA  I "C3'" 1 
ATOM   8433  O  "O3'" . DA  I  5 112 ? -16.821 -28.640 12.314 1.00 60.54  ? 38   DA  I "O3'" 1 
ATOM   8434  C  "C2'" . DA  I  5 112 ? -16.684 -29.583 10.148 1.00 62.69  ? 38   DA  I "C2'" 1 
ATOM   8435  C  "C1'" . DA  I  5 112 ? -15.284 -29.844 9.626  1.00 62.57  ? 38   DA  I "C1'" 1 
ATOM   8436  N  N9    . DA  I  5 112 ? -15.432 -30.693 8.446  1.00 62.90  ? 38   DA  I N9    1 
ATOM   8437  C  C8    . DA  I  5 112 ? -15.884 -31.987 8.453  1.00 62.91  ? 38   DA  I C8    1 
ATOM   8438  N  N7    . DA  I  5 112 ? -15.958 -32.542 7.274  1.00 63.13  ? 38   DA  I N7    1 
ATOM   8439  C  C5    . DA  I  5 112 ? -15.542 -31.538 6.426  1.00 63.16  ? 38   DA  I C5    1 
ATOM   8440  C  C6    . DA  I  5 112 ? -15.395 -31.505 5.031  1.00 63.07  ? 38   DA  I C6    1 
ATOM   8441  N  N6    . DA  I  5 112 ? -15.674 -32.556 4.258  1.00 62.91  ? 38   DA  I N6    1 
ATOM   8442  N  N1    . DA  I  5 112 ? -14.950 -30.357 4.472  1.00 63.06  ? 38   DA  I N1    1 
ATOM   8443  C  C2    . DA  I  5 112 ? -14.674 -29.311 5.264  1.00 63.01  ? 38   DA  I C2    1 
ATOM   8444  N  N3    . DA  I  5 112 ? -14.779 -29.233 6.594  1.00 63.29  ? 38   DA  I N3    1 
ATOM   8445  C  C4    . DA  I  5 112 ? -15.222 -30.386 7.123  1.00 62.84  ? 38   DA  I C4    1 
ATOM   8446  P  P     . DT  I  5 113 ? -18.190 -27.827 12.198 1.00 59.63  ? 39   DT  I P     1 
ATOM   8447  O  OP1   . DT  I  5 113 ? -18.347 -26.960 13.377 1.00 59.47  ? 39   DT  I OP1   1 
ATOM   8448  O  OP2   . DT  I  5 113 ? -19.232 -28.813 11.839 1.00 60.20  ? 39   DT  I OP2   1 
ATOM   8449  O  "O5'" . DT  I  5 113 ? -17.975 -26.876 10.952 1.00 62.83  ? 39   DT  I "O5'" 1 
ATOM   8450  C  "C5'" . DT  I  5 113 ? -16.843 -26.023 10.890 1.00 67.30  ? 39   DT  I "C5'" 1 
ATOM   8451  C  "C4'" . DT  I  5 113 ? -16.914 -25.118 9.670  1.00 70.06  ? 39   DT  I "C4'" 1 
ATOM   8452  O  "O4'" . DT  I  5 113 ? -16.728 -25.900 8.463  1.00 70.66  ? 39   DT  I "O4'" 1 
ATOM   8453  C  "C3'" . DT  I  5 113 ? -18.221 -24.358 9.488  1.00 71.97  ? 39   DT  I "C3'" 1 
ATOM   8454  O  "O3'" . DT  I  5 113 ? -17.865 -23.057 9.052  1.00 75.84  ? 39   DT  I "O3'" 1 
ATOM   8455  C  "C2'" . DT  I  5 113 ? -18.978 -25.182 8.439  1.00 71.83  ? 39   DT  I "C2'" 1 
ATOM   8456  C  "C1'" . DT  I  5 113 ? -17.847 -25.776 7.598  1.00 71.04  ? 39   DT  I "C1'" 1 
ATOM   8457  N  N1    . DT  I  5 113 ? -18.052 -27.149 6.991  1.00 71.18  ? 39   DT  I N1    1 
ATOM   8458  C  C2    . DT  I  5 113 ? -17.587 -27.379 5.706  1.00 71.04  ? 39   DT  I C2    1 
ATOM   8459  O  O2    . DT  I  5 113 ? -17.043 -26.527 5.022  1.00 70.66  ? 39   DT  I O2    1 
ATOM   8460  N  N3    . DT  I  5 113 ? -17.794 -28.657 5.241  1.00 70.96  ? 39   DT  I N3    1 
ATOM   8461  C  C4    . DT  I  5 113 ? -18.394 -29.712 5.908  1.00 70.87  ? 39   DT  I C4    1 
ATOM   8462  O  O4    . DT  I  5 113 ? -18.523 -30.819 5.393  1.00 70.86  ? 39   DT  I O4    1 
ATOM   8463  C  C5    . DT  I  5 113 ? -18.854 -29.415 7.245  1.00 70.77  ? 39   DT  I C5    1 
ATOM   8464  C  C7    . DT  I  5 113 ? -19.525 -30.478 8.066  1.00 70.67  ? 39   DT  I C7    1 
ATOM   8465  C  C6    . DT  I  5 113 ? -18.659 -28.169 7.715  1.00 70.89  ? 39   DT  I C6    1 
ATOM   8466  P  P     . DA  I  5 114 ? -18.939 -21.947 8.616  1.00 79.57  ? 40   DA  I P     1 
ATOM   8467  O  OP1   . DA  I  5 114 ? -18.297 -20.611 8.753  1.00 79.40  ? 40   DA  I OP1   1 
ATOM   8468  O  OP2   . DA  I  5 114 ? -20.241 -22.250 9.268  1.00 78.41  ? 40   DA  I OP2   1 
ATOM   8469  O  "O5'" . DA  I  5 114 ? -19.102 -22.242 7.051  1.00 81.56  ? 40   DA  I "O5'" 1 
ATOM   8470  C  "C5'" . DA  I  5 114 ? -18.034 -22.061 6.110  1.00 83.20  ? 40   DA  I "C5'" 1 
ATOM   8471  C  "C4'" . DA  I  5 114 ? -18.626 -22.121 4.712  1.00 84.63  ? 40   DA  I "C4'" 1 
ATOM   8472  O  "O4'" . DA  I  5 114 ? -18.792 -23.508 4.319  1.00 83.86  ? 40   DA  I "O4'" 1 
ATOM   8473  C  "C3'" . DA  I  5 114 ? -20.005 -21.462 4.586  1.00 86.22  ? 40   DA  I "C3'" 1 
ATOM   8474  O  "O3'" . DA  I  5 114 ? -20.029 -20.586 3.447  1.00 89.67  ? 40   DA  I "O3'" 1 
ATOM   8475  C  "C2'" . DA  I  5 114 ? -20.976 -22.640 4.469  1.00 84.73  ? 40   DA  I "C2'" 1 
ATOM   8476  C  "C1'" . DA  I  5 114 ? -20.100 -23.701 3.811  1.00 83.27  ? 40   DA  I "C1'" 1 
ATOM   8477  N  N9    . DA  I  5 114 ? -20.500 -25.077 4.092  1.00 82.77  ? 40   DA  I N9    1 
ATOM   8478  C  C8    . DA  I  5 114 ? -20.707 -25.650 5.313  1.00 82.52  ? 40   DA  I C8    1 
ATOM   8479  N  N7    . DA  I  5 114 ? -21.053 -26.913 5.258  1.00 82.10  ? 40   DA  I N7    1 
ATOM   8480  C  C5    . DA  I  5 114 ? -21.079 -27.194 3.909  1.00 82.23  ? 40   DA  I C5    1 
ATOM   8481  C  C6    . DA  I  5 114 ? -21.373 -28.370 3.185  1.00 82.52  ? 40   DA  I C6    1 
ATOM   8482  N  N6    . DA  I  5 114 ? -21.717 -29.529 3.747  1.00 82.34  ? 40   DA  I N6    1 
ATOM   8483  N  N1    . DA  I  5 114 ? -21.304 -28.306 1.838  1.00 83.02  ? 40   DA  I N1    1 
ATOM   8484  C  C2    . DA  I  5 114 ? -20.964 -27.140 1.258  1.00 82.95  ? 40   DA  I C2    1 
ATOM   8485  N  N3    . DA  I  5 114 ? -20.657 -25.974 1.833  1.00 82.70  ? 40   DA  I N3    1 
ATOM   8486  C  C4    . DA  I  5 114 ? -20.737 -26.070 3.173  1.00 82.58  ? 40   DA  I C4    1 
ATOM   8487  P  P     . DC  I  5 115 ? -21.199 -19.515 3.147  1.00 92.23  ? 41   DC  I P     1 
ATOM   8488  O  OP1   . DC  I  5 115 ? -20.573 -18.463 2.310  1.00 92.25  ? 41   DC  I OP1   1 
ATOM   8489  O  OP2   . DC  I  5 115 ? -21.884 -19.126 4.408  1.00 91.97  ? 41   DC  I OP2   1 
ATOM   8490  O  "O5'" . DC  I  5 115 ? -22.236 -20.350 2.244  1.00 92.71  ? 41   DC  I "O5'" 1 
ATOM   8491  C  "C5'" . DC  I  5 115 ? -21.751 -21.098 1.117  1.00 93.48  ? 41   DC  I "C5'" 1 
ATOM   8492  C  "C4'" . DC  I  5 115 ? -22.866 -21.769 0.331  1.00 93.99  ? 41   DC  I "C4'" 1 
ATOM   8493  O  "O4'" . DC  I  5 115 ? -22.944 -23.178 0.677  1.00 93.62  ? 41   DC  I "O4'" 1 
ATOM   8494  C  "C3'" . DC  I  5 115 ? -24.270 -21.183 0.498  1.00 94.45  ? 41   DC  I "C3'" 1 
ATOM   8495  O  "O3'" . DC  I  5 115 ? -24.719 -20.812 -0.819 1.00 96.04  ? 41   DC  I "O3'" 1 
ATOM   8496  C  "C2'" . DC  I  5 115 ? -25.071 -22.310 1.156  1.00 93.63  ? 41   DC  I "C2'" 1 
ATOM   8497  C  "C1'" . DC  I  5 115 ? -24.305 -23.560 0.726  1.00 93.08  ? 41   DC  I "C1'" 1 
ATOM   8498  N  N1    . DC  I  5 115 ? -24.416 -24.760 1.635  1.00 92.73  ? 41   DC  I N1    1 
ATOM   8499  C  C2    . DC  I  5 115 ? -24.558 -26.055 1.091  1.00 92.49  ? 41   DC  I C2    1 
ATOM   8500  O  O2    . DC  I  5 115 ? -24.609 -26.224 -0.135 1.00 91.93  ? 41   DC  I O2    1 
ATOM   8501  N  N3    . DC  I  5 115 ? -24.644 -27.113 1.940  1.00 92.52  ? 41   DC  I N3    1 
ATOM   8502  C  C4    . DC  I  5 115 ? -24.589 -26.923 3.263  1.00 92.20  ? 41   DC  I C4    1 
ATOM   8503  N  N4    . DC  I  5 115 ? -24.679 -27.999 4.045  1.00 92.07  ? 41   DC  I N4    1 
ATOM   8504  C  C5    . DC  I  5 115 ? -24.441 -25.626 3.839  1.00 91.87  ? 41   DC  I C5    1 
ATOM   8505  C  C6    . DC  I  5 115 ? -24.357 -24.588 2.997  1.00 92.30  ? 41   DC  I C6    1 
ATOM   8506  P  P     . DA  I  5 116 ? -26.201 -20.331 -1.201 1.00 96.94  ? 42   DA  I P     1 
ATOM   8507  O  OP1   . DA  I  5 116 ? -26.075 -19.417 -2.355 1.00 96.98  ? 42   DA  I OP1   1 
ATOM   8508  O  OP2   . DA  I  5 116 ? -26.902 -19.842 0.005  1.00 96.61  ? 42   DA  I OP2   1 
ATOM   8509  O  "O5'" . DA  I  5 116 ? -26.884 -21.707 -1.673 1.00 98.92  ? 42   DA  I "O5'" 1 
ATOM   8510  C  "C5'" . DA  I  5 116 ? -26.388 -22.410 -2.822 1.00 101.71 ? 42   DA  I "C5'" 1 
ATOM   8511  C  "C4'" . DA  I  5 116 ? -27.176 -23.673 -3.160 1.00 103.84 ? 42   DA  I "C4'" 1 
ATOM   8512  O  "O4'" . DA  I  5 116 ? -26.935 -24.695 -2.156 1.00 104.81 ? 42   DA  I "O4'" 1 
ATOM   8513  C  "C3'" . DA  I  5 116 ? -28.696 -23.538 -3.277 1.00 105.05 ? 42   DA  I "C3'" 1 
ATOM   8514  O  "O3'" . DA  I  5 116 ? -29.160 -24.284 -4.418 1.00 106.39 ? 42   DA  I "O3'" 1 
ATOM   8515  C  "C2'" . DA  I  5 116 ? -29.206 -24.138 -1.968 1.00 105.19 ? 42   DA  I "C2'" 1 
ATOM   8516  C  "C1'" . DA  I  5 116 ? -28.172 -25.238 -1.728 1.00 105.61 ? 42   DA  I "C1'" 1 
ATOM   8517  N  N9    . DA  I  5 116 ? -28.068 -25.682 -0.332 1.00 105.96 ? 42   DA  I N9    1 
ATOM   8518  C  C8    . DA  I  5 116 ? -27.912 -24.888 0.777  1.00 105.95 ? 42   DA  I C8    1 
ATOM   8519  N  N7    . DA  I  5 116 ? -27.850 -25.554 1.907  1.00 106.01 ? 42   DA  I N7    1 
ATOM   8520  C  C5    . DA  I  5 116 ? -27.971 -26.880 1.521  1.00 105.90 ? 42   DA  I C5    1 
ATOM   8521  C  C6    . DA  I  5 116 ? -27.982 -28.089 2.256  1.00 105.80 ? 42   DA  I C6    1 
ATOM   8522  N  N6    . DA  I  5 116 ? -27.862 -28.137 3.586  1.00 105.66 ? 42   DA  I N6    1 
ATOM   8523  N  N1    . DA  I  5 116 ? -28.120 -29.248 1.568  1.00 105.91 ? 42   DA  I N1    1 
ATOM   8524  C  C2    . DA  I  5 116 ? -28.244 -29.195 0.232  1.00 105.90 ? 42   DA  I C2    1 
ATOM   8525  N  N3    . DA  I  5 116 ? -28.250 -28.121 -0.565 1.00 105.70 ? 42   DA  I N3    1 
ATOM   8526  C  C4    . DA  I  5 116 ? -28.108 -26.981 0.143  1.00 105.84 ? 42   DA  I C4    1 
ATOM   8527  P  P     . DC  I  5 117 ? -30.589 -24.054 -5.134 1.00 106.77 ? 43   DC  I P     1 
ATOM   8528  O  OP1   . DC  I  5 117 ? -30.329 -23.913 -6.585 1.00 106.50 ? 43   DC  I OP1   1 
ATOM   8529  O  OP2   . DC  I  5 117 ? -31.334 -22.987 -4.419 1.00 106.43 ? 43   DC  I OP2   1 
ATOM   8530  O  "O5'" . DC  I  5 117 ? -31.353 -25.445 -4.889 1.00 106.64 ? 43   DC  I "O5'" 1 
ATOM   8531  C  "C5'" . DC  I  5 117 ? -30.658 -26.708 -4.824 1.00 106.48 ? 43   DC  I "C5'" 1 
ATOM   8532  C  "C4'" . DC  I  5 117 ? -31.372 -27.700 -3.910 1.00 106.17 ? 43   DC  I "C4'" 1 
ATOM   8533  O  "O4'" . DC  I  5 117 ? -30.870 -27.588 -2.543 1.00 106.39 ? 43   DC  I "O4'" 1 
ATOM   8534  C  "C3'" . DC  I  5 117 ? -32.895 -27.528 -3.835 1.00 105.55 ? 43   DC  I "C3'" 1 
ATOM   8535  O  "O3'" . DC  I  5 117 ? -33.568 -28.712 -4.285 1.00 104.47 ? 43   DC  I "O3'" 1 
ATOM   8536  C  "C2'" . DC  I  5 117 ? -33.166 -27.230 -2.359 1.00 105.75 ? 43   DC  I "C2'" 1 
ATOM   8537  C  "C1'" . DC  I  5 117 ? -31.953 -27.849 -1.669 1.00 105.63 ? 43   DC  I "C1'" 1 
ATOM   8538  N  N1    . DC  I  5 117 ? -31.712 -27.356 -0.249 1.00 105.33 ? 43   DC  I N1    1 
ATOM   8539  C  C2    . DC  I  5 117 ? -31.501 -28.292 0.784  1.00 105.08 ? 43   DC  I C2    1 
ATOM   8540  O  O2    . DC  I  5 117 ? -31.496 -29.503 0.524  1.00 105.03 ? 43   DC  I O2    1 
ATOM   8541  N  N3    . DC  I  5 117 ? -31.297 -27.846 2.054  1.00 104.75 ? 43   DC  I N3    1 
ATOM   8542  C  C4    . DC  I  5 117 ? -31.302 -26.537 2.314  1.00 104.90 ? 43   DC  I C4    1 
ATOM   8543  N  N4    . DC  I  5 117 ? -31.093 -26.159 3.575  1.00 104.88 ? 43   DC  I N4    1 
ATOM   8544  C  C5    . DC  I  5 117 ? -31.518 -25.563 1.290  1.00 105.01 ? 43   DC  I C5    1 
ATOM   8545  C  C6    . DC  I  5 117 ? -31.719 -26.012 0.039  1.00 105.25 ? 43   DC  I C6    1 
ATOM   8546  P  P     . DT  I  5 118 ? -35.170 -28.800 -4.424 1.00 103.79 ? 44   DT  I P     1 
ATOM   8547  O  OP1   . DT  I  5 118 ? -35.451 -29.574 -5.656 1.00 103.89 ? 44   DT  I OP1   1 
ATOM   8548  O  OP2   . DT  I  5 118 ? -35.765 -27.452 -4.240 1.00 103.06 ? 44   DT  I OP2   1 
ATOM   8549  O  "O5'" . DT  I  5 118 ? -35.585 -29.719 -3.181 1.00 102.48 ? 44   DT  I "O5'" 1 
ATOM   8550  C  "C5'" . DT  I  5 118 ? -34.962 -30.997 -3.049 1.00 100.86 ? 44   DT  I "C5'" 1 
ATOM   8551  C  "C4'" . DT  I  5 118 ? -35.748 -31.963 -2.175 1.00 99.53  ? 44   DT  I "C4'" 1 
ATOM   8552  O  "O4'" . DT  I  5 118 ? -35.387 -31.794 -0.780 1.00 99.46  ? 44   DT  I "O4'" 1 
ATOM   8553  C  "C3'" . DT  I  5 118 ? -37.270 -31.877 -2.241 1.00 98.56  ? 44   DT  I "C3'" 1 
ATOM   8554  O  "O3'" . DT  I  5 118 ? -37.732 -33.245 -2.292 1.00 97.28  ? 44   DT  I "O3'" 1 
ATOM   8555  C  "C2'" . DT  I  5 118 ? -37.647 -31.049 -1.004 1.00 98.66  ? 44   DT  I "C2'" 1 
ATOM   8556  C  "C1'" . DT  I  5 118 ? -36.477 -31.272 -0.035 1.00 98.86  ? 44   DT  I "C1'" 1 
ATOM   8557  N  N1    . DT  I  5 118 ? -35.983 -30.078 0.768  1.00 98.79  ? 44   DT  I N1    1 
ATOM   8558  C  C2    . DT  I  5 118 ? -35.441 -30.291 2.033  1.00 98.42  ? 44   DT  I C2    1 
ATOM   8559  O  O2    . DT  I  5 118 ? -35.334 -31.383 2.562  1.00 98.29  ? 44   DT  I O2    1 
ATOM   8560  N  N3    . DT  I  5 118 ? -35.013 -29.159 2.679  1.00 98.32  ? 44   DT  I N3    1 
ATOM   8561  C  C4    . DT  I  5 118 ? -35.068 -27.858 2.207  1.00 98.61  ? 44   DT  I C4    1 
ATOM   8562  O  O4    . DT  I  5 118 ? -34.653 -26.918 2.878  1.00 98.52  ? 44   DT  I O4    1 
ATOM   8563  C  C5    . DT  I  5 118 ? -35.639 -27.696 0.883  1.00 98.46  ? 44   DT  I C5    1 
ATOM   8564  C  C7    . DT  I  5 118 ? -35.755 -26.335 0.260  1.00 98.31  ? 44   DT  I C7    1 
ATOM   8565  C  C6    . DT  I  5 118 ? -36.058 -28.797 0.235  1.00 98.44  ? 44   DT  I C6    1 
ATOM   8566  P  P     . DT  I  5 119 ? -38.977 -33.876 -1.501 1.00 96.08  ? 45   DT  I P     1 
ATOM   8567  O  OP1   . DT  I  5 119 ? -39.077 -35.308 -1.886 1.00 95.25  ? 45   DT  I OP1   1 
ATOM   8568  O  OP2   . DT  I  5 119 ? -40.143 -32.970 -1.652 1.00 95.99  ? 45   DT  I OP2   1 
ATOM   8569  O  "O5'" . DT  I  5 119 ? -38.504 -33.787 0.024  1.00 95.01  ? 45   DT  I "O5'" 1 
ATOM   8570  C  "C5'" . DT  I  5 119 ? -37.595 -34.728 0.602  1.00 92.29  ? 45   DT  I "C5'" 1 
ATOM   8571  C  "C4'" . DT  I  5 119 ? -37.838 -34.783 2.100  1.00 89.88  ? 45   DT  I "C4'" 1 
ATOM   8572  O  "O4'" . DT  I  5 119 ? -37.523 -33.499 2.687  1.00 89.39  ? 45   DT  I "O4'" 1 
ATOM   8573  C  "C3'" . DT  I  5 119 ? -39.280 -35.086 2.501  1.00 88.26  ? 45   DT  I "C3'" 1 
ATOM   8574  O  "O3'" . DT  I  5 119 ? -39.231 -36.097 3.489  1.00 86.28  ? 45   DT  I "O3'" 1 
ATOM   8575  C  "C2'" . DT  I  5 119 ? -39.826 -33.749 3.005  1.00 88.04  ? 45   DT  I "C2'" 1 
ATOM   8576  C  "C1'" . DT  I  5 119 ? -38.566 -33.091 3.546  1.00 88.70  ? 45   DT  I "C1'" 1 
ATOM   8577  N  N1    . DT  I  5 119 ? -38.542 -31.597 3.570  1.00 88.79  ? 45   DT  I N1    1 
ATOM   8578  C  C2    . DT  I  5 119 ? -37.983 -30.956 4.663  1.00 88.97  ? 45   DT  I C2    1 
ATOM   8579  O  O2    . DT  I  5 119 ? -37.519 -31.534 5.630  1.00 89.13  ? 45   DT  I O2    1 
ATOM   8580  N  N3    . DT  I  5 119 ? -37.988 -29.586 4.600  1.00 88.91  ? 45   DT  I N3    1 
ATOM   8581  C  C4    . DT  I  5 119 ? -38.478 -28.799 3.577  1.00 88.92  ? 45   DT  I C4    1 
ATOM   8582  O  O4    . DT  I  5 119 ? -38.426 -27.575 3.632  1.00 88.87  ? 45   DT  I O4    1 
ATOM   8583  C  C5    . DT  I  5 119 ? -39.046 -29.523 2.458  1.00 89.22  ? 45   DT  I C5    1 
ATOM   8584  C  C7    . DT  I  5 119 ? -39.615 -28.780 1.283  1.00 88.98  ? 45   DT  I C7    1 
ATOM   8585  C  C6    . DT  I  5 119 ? -39.046 -30.869 2.505  1.00 89.08  ? 45   DT  I C6    1 
ATOM   8586  P  P     . DT  I  5 120 ? -40.533 -36.769 4.139  1.00 85.24  ? 46   DT  I P     1 
ATOM   8587  O  OP1   . DT  I  5 120 ? -40.406 -38.240 4.031  1.00 85.01  ? 46   DT  I OP1   1 
ATOM   8588  O  OP2   . DT  I  5 120 ? -41.749 -36.081 3.657  1.00 85.19  ? 46   DT  I OP2   1 
ATOM   8589  O  "O5'" . DT  I  5 120 ? -40.345 -36.392 5.676  1.00 85.18  ? 46   DT  I "O5'" 1 
ATOM   8590  C  "C5'" . DT  I  5 120 ? -39.026 -36.257 6.222  1.00 83.43  ? 46   DT  I "C5'" 1 
ATOM   8591  C  "C4'" . DT  I  5 120 ? -39.035 -35.455 7.509  1.00 81.52  ? 46   DT  I "C4'" 1 
ATOM   8592  O  "O4'" . DT  I  5 120 ? -39.093 -34.041 7.212  1.00 80.53  ? 46   DT  I "O4'" 1 
ATOM   8593  C  "C3'" . DT  I  5 120 ? -40.191 -35.780 8.442  1.00 80.55  ? 46   DT  I "C3'" 1 
ATOM   8594  O  "O3'" . DT  I  5 120 ? -39.560 -36.341 9.575  1.00 79.45  ? 46   DT  I "O3'" 1 
ATOM   8595  C  "C2'" . DT  I  5 120 ? -40.924 -34.447 8.663  1.00 80.25  ? 46   DT  I "C2'" 1 
ATOM   8596  C  "C1'" . DT  I  5 120 ? -39.937 -33.399 8.140  1.00 80.61  ? 46   DT  I "C1'" 1 
ATOM   8597  N  N1    . DT  I  5 120 ? -40.480 -32.182 7.434  1.00 80.82  ? 46   DT  I N1    1 
ATOM   8598  C  C2    . DT  I  5 120 ? -40.320 -30.916 7.987  1.00 80.95  ? 46   DT  I C2    1 
ATOM   8599  O  O2    . DT  I  5 120 ? -39.777 -30.684 9.050  1.00 80.98  ? 46   DT  I O2    1 
ATOM   8600  N  N3    . DT  I  5 120 ? -40.839 -29.883 7.247  1.00 81.11  ? 46   DT  I N3    1 
ATOM   8601  C  C4    . DT  I  5 120 ? -41.484 -29.973 6.028  1.00 80.88  ? 46   DT  I C4    1 
ATOM   8602  O  O4    . DT  I  5 120 ? -41.903 -28.972 5.457  1.00 80.73  ? 46   DT  I O4    1 
ATOM   8603  C  C5    . DT  I  5 120 ? -41.612 -31.315 5.493  1.00 80.99  ? 46   DT  I C5    1 
ATOM   8604  C  C7    . DT  I  5 120 ? -42.291 -31.558 4.179  1.00 80.86  ? 46   DT  I C7    1 
ATOM   8605  C  C6    . DT  I  5 120 ? -41.108 -32.335 6.207  1.00 81.16  ? 46   DT  I C6    1 
ATOM   8606  P  P     . DT  I  5 121 ? -40.342 -36.994 10.804 1.00 79.04  ? 47   DT  I P     1 
ATOM   8607  O  OP1   . DT  I  5 121 ? -39.423 -37.964 11.450 1.00 78.25  ? 47   DT  I OP1   1 
ATOM   8608  O  OP2   . DT  I  5 121 ? -41.708 -37.398 10.394 1.00 78.57  ? 47   DT  I OP2   1 
ATOM   8609  O  "O5'" . DT  I  5 121 ? -40.482 -35.713 11.741 1.00 77.80  ? 47   DT  I "O5'" 1 
ATOM   8610  C  "C5'" . DT  I  5 121 ? -39.316 -35.062 12.232 1.00 75.57  ? 47   DT  I "C5'" 1 
ATOM   8611  C  "C4'" . DT  I  5 121 ? -39.721 -33.877 13.085 1.00 74.42  ? 47   DT  I "C4'" 1 
ATOM   8612  O  "O4'" . DT  I  5 121 ? -40.152 -32.813 12.200 1.00 74.13  ? 47   DT  I "O4'" 1 
ATOM   8613  C  "C3'" . DT  I  5 121 ? -40.862 -34.119 14.085 1.00 73.34  ? 47   DT  I "C3'" 1 
ATOM   8614  O  "O3'" . DT  I  5 121 ? -40.541 -33.479 15.300 1.00 70.74  ? 47   DT  I "O3'" 1 
ATOM   8615  C  "C2'" . DT  I  5 121 ? -42.053 -33.423 13.432 1.00 74.21  ? 47   DT  I "C2'" 1 
ATOM   8616  C  "C1'" . DT  I  5 121 ? -41.354 -32.268 12.707 1.00 75.23  ? 47   DT  I "C1'" 1 
ATOM   8617  N  N1    . DT  I  5 121 ? -42.108 -31.626 11.570 1.00 75.83  ? 47   DT  I N1    1 
ATOM   8618  C  C2    . DT  I  5 121 ? -41.966 -30.266 11.350 1.00 75.61  ? 47   DT  I C2    1 
ATOM   8619  O  O2    . DT  I  5 121 ? -41.271 -29.538 12.024 1.00 75.60  ? 47   DT  I O2    1 
ATOM   8620  N  N3    . DT  I  5 121 ? -42.682 -29.771 10.291 1.00 76.01  ? 47   DT  I N3    1 
ATOM   8621  C  C4    . DT  I  5 121 ? -43.513 -30.485 9.441  1.00 76.00  ? 47   DT  I C4    1 
ATOM   8622  O  O4    . DT  I  5 121 ? -44.108 -29.926 8.526  1.00 76.15  ? 47   DT  I O4    1 
ATOM   8623  C  C5    . DT  I  5 121 ? -43.622 -31.904 9.717  1.00 75.74  ? 47   DT  I C5    1 
ATOM   8624  C  C7    . DT  I  5 121 ? -44.485 -32.795 8.878  1.00 75.49  ? 47   DT  I C7    1 
ATOM   8625  C  C6    . DT  I  5 121 ? -42.926 -32.397 10.753 1.00 76.03  ? 47   DT  I C6    1 
ATOM   8626  P  P     . DG  I  5 122 ? -40.552 -34.165 16.739 1.00 68.83  ? 48   DG  I P     1 
ATOM   8627  O  OP1   . DG  I  5 122 ? -39.300 -34.938 16.945 1.00 68.54  ? 48   DG  I OP1   1 
ATOM   8628  O  OP2   . DG  I  5 122 ? -41.873 -34.784 16.956 1.00 68.85  ? 48   DG  I OP2   1 
ATOM   8629  O  "O5'" . DG  I  5 122 ? -40.482 -32.850 17.642 1.00 68.14  ? 48   DG  I "O5'" 1 
ATOM   8630  C  "C5'" . DG  I  5 122 ? -39.538 -31.809 17.343 1.00 66.43  ? 48   DG  I "C5'" 1 
ATOM   8631  C  "C4'" . DG  I  5 122 ? -40.056 -30.426 17.711 1.00 65.73  ? 48   DG  I "C4'" 1 
ATOM   8632  O  "O4'" . DG  I  5 122 ? -41.010 -29.946 16.731 1.00 66.42  ? 48   DG  I "O4'" 1 
ATOM   8633  C  "C3'" . DG  I  5 122 ? -40.792 -30.278 19.034 1.00 65.14  ? 48   DG  I "C3'" 1 
ATOM   8634  O  "O3'" . DG  I  5 122 ? -40.602 -28.947 19.470 1.00 63.36  ? 48   DG  I "O3'" 1 
ATOM   8635  C  "C2'" . DG  I  5 122 ? -42.252 -30.519 18.647 1.00 66.19  ? 48   DG  I "C2'" 1 
ATOM   8636  C  "C1'" . DG  I  5 122 ? -42.313 -29.819 17.296 1.00 67.72  ? 48   DG  I "C1'" 1 
ATOM   8637  N  N9    . DG  I  5 122 ? -43.262 -30.358 16.312 1.00 68.27  ? 48   DG  I N9    1 
ATOM   8638  C  C8    . DG  I  5 122 ? -43.695 -31.655 16.160 1.00 68.14  ? 48   DG  I C8    1 
ATOM   8639  N  N7    . DG  I  5 122 ? -44.521 -31.819 15.166 1.00 68.14  ? 48   DG  I N7    1 
ATOM   8640  C  C5    . DG  I  5 122 ? -44.639 -30.555 14.607 1.00 68.60  ? 48   DG  I C5    1 
ATOM   8641  C  C6    . DG  I  5 122 ? -45.394 -30.108 13.490 1.00 68.37  ? 48   DG  I C6    1 
ATOM   8642  O  O6    . DG  I  5 122 ? -46.138 -30.783 12.768 1.00 68.15  ? 48   DG  I O6    1 
ATOM   8643  N  N1    . DG  I  5 122 ? -45.236 -28.735 13.260 1.00 68.16  ? 48   DG  I N1    1 
ATOM   8644  C  C2    . DG  I  5 122 ? -44.433 -27.900 14.015 1.00 68.24  ? 48   DG  I C2    1 
ATOM   8645  N  N2    . DG  I  5 122 ? -44.375 -26.605 13.673 1.00 68.12  ? 48   DG  I N2    1 
ATOM   8646  N  N3    . DG  I  5 122 ? -43.720 -28.312 15.055 1.00 68.78  ? 48   DG  I N3    1 
ATOM   8647  C  C4    . DG  I  5 122 ? -43.866 -29.645 15.297 1.00 68.72  ? 48   DG  I C4    1 
ATOM   8648  P  P     . DG  I  5 123 ? -40.858 -28.518 20.982 1.00 61.19  ? 49   DG  I P     1 
ATOM   8649  O  OP1   . DG  I  5 123 ? -39.524 -28.252 21.546 1.00 62.06  ? 49   DG  I OP1   1 
ATOM   8650  O  OP2   . DG  I  5 123 ? -41.766 -29.491 21.612 1.00 61.21  ? 49   DG  I OP2   1 
ATOM   8651  O  "O5'" . DG  I  5 123 ? -41.662 -27.141 20.910 1.00 61.99  ? 49   DG  I "O5'" 1 
ATOM   8652  C  "C5'" . DG  I  5 123 ? -41.417 -26.194 19.891 1.00 63.39  ? 49   DG  I "C5'" 1 
ATOM   8653  C  "C4'" . DG  I  5 123 ? -42.701 -25.485 19.476 1.00 64.46  ? 49   DG  I "C4'" 1 
ATOM   8654  O  "O4'" . DG  I  5 123 ? -43.434 -26.258 18.495 1.00 64.30  ? 49   DG  I "O4'" 1 
ATOM   8655  C  "C3'" . DG  I  5 123 ? -43.696 -25.153 20.582 1.00 64.51  ? 49   DG  I "C3'" 1 
ATOM   8656  O  "O3'" . DG  I  5 123 ? -43.751 -23.748 20.596 1.00 66.01  ? 49   DG  I "O3'" 1 
ATOM   8657  C  "C2'" . DG  I  5 123 ? -45.007 -25.794 20.136 1.00 64.39  ? 49   DG  I "C2'" 1 
ATOM   8658  C  "C1'" . DG  I  5 123 ? -44.802 -25.962 18.634 1.00 65.02  ? 49   DG  I "C1'" 1 
ATOM   8659  N  N9    . DG  I  5 123 ? -45.477 -27.090 18.004 1.00 65.40  ? 49   DG  I N9    1 
ATOM   8660  C  C8    . DG  I  5 123 ? -45.438 -28.400 18.413 1.00 65.73  ? 49   DG  I C8    1 
ATOM   8661  N  N7    . DG  I  5 123 ? -46.113 -29.217 17.655 1.00 65.89  ? 49   DG  I N7    1 
ATOM   8662  C  C5    . DG  I  5 123 ? -46.628 -28.397 16.665 1.00 65.77  ? 49   DG  I C5    1 
ATOM   8663  C  C6    . DG  I  5 123 ? -47.445 -28.724 15.560 1.00 65.20  ? 49   DG  I C6    1 
ATOM   8664  O  O6    . DG  I  5 123 ? -47.882 -29.832 15.230 1.00 65.29  ? 49   DG  I O6    1 
ATOM   8665  N  N1    . DG  I  5 123 ? -47.744 -27.607 14.792 1.00 65.38  ? 49   DG  I N1    1 
ATOM   8666  C  C2    . DG  I  5 123 ? -47.312 -26.334 15.066 1.00 65.53  ? 49   DG  I C2    1 
ATOM   8667  N  N2    . DG  I  5 123 ? -47.699 -25.384 14.215 1.00 65.52  ? 49   DG  I N2    1 
ATOM   8668  N  N3    . DG  I  5 123 ? -46.548 -26.009 16.099 1.00 66.08  ? 49   DG  I N3    1 
ATOM   8669  C  C4    . DG  I  5 123 ? -46.242 -27.088 16.860 1.00 65.84  ? 49   DG  I C4    1 
ATOM   8670  P  P     . DT  I  5 124 ? -44.640 -22.919 21.626 1.00 68.28  ? 50   DT  I P     1 
ATOM   8671  O  OP1   . DT  I  5 124 ? -43.975 -21.610 21.833 1.00 68.21  ? 50   DT  I OP1   1 
ATOM   8672  O  OP2   . DT  I  5 124 ? -45.024 -23.772 22.775 1.00 67.85  ? 50   DT  I OP2   1 
ATOM   8673  O  "O5'" . DT  I  5 124 ? -45.956 -22.685 20.764 1.00 70.85  ? 50   DT  I "O5'" 1 
ATOM   8674  C  "C5'" . DT  I  5 124 ? -45.966 -21.735 19.702 1.00 73.62  ? 50   DT  I "C5'" 1 
ATOM   8675  C  "C4'" . DT  I  5 124 ? -47.304 -21.779 18.988 1.00 75.50  ? 50   DT  I "C4'" 1 
ATOM   8676  O  "O4'" . DT  I  5 124 ? -47.545 -23.123 18.508 1.00 75.14  ? 50   DT  I "O4'" 1 
ATOM   8677  C  "C3'" . DT  I  5 124 ? -48.505 -21.403 19.850 1.00 77.32  ? 50   DT  I "C3'" 1 
ATOM   8678  O  "O3'" . DT  I  5 124 ? -49.150 -20.284 19.235 1.00 81.12  ? 50   DT  I "O3'" 1 
ATOM   8679  C  "C2'" . DT  I  5 124 ? -49.356 -22.680 19.893 1.00 76.30  ? 50   DT  I "C2'" 1 
ATOM   8680  C  "C1'" . DT  I  5 124 ? -48.921 -23.383 18.615 1.00 75.27  ? 50   DT  I "C1'" 1 
ATOM   8681  N  N1    . DT  I  5 124 ? -49.097 -24.866 18.551 1.00 75.18  ? 50   DT  I N1    1 
ATOM   8682  C  C2    . DT  I  5 124 ? -49.773 -25.397 17.469 1.00 75.07  ? 50   DT  I C2    1 
ATOM   8683  O  O2    . DT  I  5 124 ? -50.245 -24.710 16.585 1.00 75.27  ? 50   DT  I O2    1 
ATOM   8684  N  N3    . DT  I  5 124 ? -49.892 -26.764 17.455 1.00 74.45  ? 50   DT  I N3    1 
ATOM   8685  C  C4    . DT  I  5 124 ? -49.402 -27.634 18.405 1.00 75.02  ? 50   DT  I C4    1 
ATOM   8686  O  O4    . DT  I  5 124 ? -49.556 -28.846 18.313 1.00 75.19  ? 50   DT  I O4    1 
ATOM   8687  C  C5    . DT  I  5 124 ? -48.695 -27.020 19.509 1.00 75.23  ? 50   DT  I C5    1 
ATOM   8688  C  C7    . DT  I  5 124 ? -48.122 -27.875 20.600 1.00 75.09  ? 50   DT  I C7    1 
ATOM   8689  C  C6    . DT  I  5 124 ? -48.574 -25.683 19.533 1.00 75.04  ? 50   DT  I C6    1 
ATOM   8690  P  P     . DA  I  5 125 ? -50.240 -19.369 19.981 1.00 84.69  ? 51   DA  I P     1 
ATOM   8691  O  OP1   . DA  I  5 125 ? -49.695 -17.990 20.024 1.00 84.70  ? 51   DA  I OP1   1 
ATOM   8692  O  OP2   . DA  I  5 125 ? -50.657 -20.047 21.237 1.00 83.96  ? 51   DA  I OP2   1 
ATOM   8693  O  "O5'" . DA  I  5 125 ? -51.489 -19.377 18.967 1.00 85.62  ? 51   DA  I "O5'" 1 
ATOM   8694  C  "C5'" . DA  I  5 125 ? -51.588 -20.387 17.962 1.00 88.36  ? 51   DA  I "C5'" 1 
ATOM   8695  C  "C4'" . DA  I  5 125 ? -52.991 -20.953 17.804 1.00 90.36  ? 51   DA  I "C4'" 1 
ATOM   8696  O  "O4'" . DA  I  5 125 ? -52.940 -22.394 17.627 1.00 90.31  ? 51   DA  I "O4'" 1 
ATOM   8697  C  "C3'" . DA  I  5 125 ? -53.993 -20.693 18.921 1.00 91.70  ? 51   DA  I "C3'" 1 
ATOM   8698  O  "O3'" . DA  I  5 125 ? -55.119 -20.132 18.265 1.00 93.93  ? 51   DA  I "O3'" 1 
ATOM   8699  C  "C2'" . DA  I  5 125 ? -54.267 -22.078 19.518 1.00 90.93  ? 51   DA  I "C2'" 1 
ATOM   8700  C  "C1'" . DA  I  5 125 ? -53.990 -23.007 18.342 1.00 89.92  ? 51   DA  I "C1'" 1 
ATOM   8701  N  N9    . DA  I  5 125 ? -53.532 -24.352 18.688 1.00 89.76  ? 51   DA  I N9    1 
ATOM   8702  C  C8    . DA  I  5 125 ? -52.763 -24.727 19.759 1.00 89.64  ? 51   DA  I C8    1 
ATOM   8703  N  N7    . DA  I  5 125 ? -52.501 -26.013 19.800 1.00 89.64  ? 51   DA  I N7    1 
ATOM   8704  C  C5    . DA  I  5 125 ? -53.136 -26.519 18.678 1.00 89.53  ? 51   DA  I C5    1 
ATOM   8705  C  C6    . DA  I  5 125 ? -53.243 -27.821 18.142 1.00 89.44  ? 51   DA  I C6    1 
ATOM   8706  N  N6    . DA  I  5 125 ? -52.682 -28.889 18.701 1.00 89.56  ? 51   DA  I N6    1 
ATOM   8707  N  N1    . DA  I  5 125 ? -53.951 -27.992 17.006 1.00 89.61  ? 51   DA  I N1    1 
ATOM   8708  C  C2    . DA  I  5 125 ? -54.516 -26.917 16.436 1.00 89.72  ? 51   DA  I C2    1 
ATOM   8709  N  N3    . DA  I  5 125 ? -54.481 -25.645 16.843 1.00 89.57  ? 51   DA  I N3    1 
ATOM   8710  C  C4    . DA  I  5 125 ? -53.772 -25.508 17.979 1.00 89.56  ? 51   DA  I C4    1 
ATOM   8711  P  P     . DG  I  5 126 ? -56.397 -19.542 19.021 1.00 95.72  ? 52   DG  I P     1 
ATOM   8712  O  OP1   . DG  I  5 126 ? -56.389 -18.075 18.783 1.00 95.14  ? 52   DG  I OP1   1 
ATOM   8713  O  OP2   . DG  I  5 126 ? -56.432 -20.044 20.416 1.00 95.54  ? 52   DG  I OP2   1 
ATOM   8714  O  "O5'" . DG  I  5 126 ? -57.600 -20.254 18.219 1.00 96.22  ? 52   DG  I "O5'" 1 
ATOM   8715  C  "C5'" . DG  I  5 126 ? -57.374 -21.458 17.464 1.00 97.00  ? 52   DG  I "C5'" 1 
ATOM   8716  C  "C4'" . DG  I  5 126 ? -58.606 -22.347 17.358 1.00 97.90  ? 52   DG  I "C4'" 1 
ATOM   8717  O  "O4'" . DG  I  5 126 ? -58.213 -23.750 17.366 1.00 97.80  ? 52   DG  I "O4'" 1 
ATOM   8718  C  "C3'" . DG  I  5 126 ? -59.642 -22.205 18.468 1.00 98.74  ? 52   DG  I "C3'" 1 
ATOM   8719  O  "O3'" . DG  I  5 126 ? -60.944 -22.398 17.906 1.00 100.56 ? 52   DG  I "O3'" 1 
ATOM   8720  C  "C2'" . DG  I  5 126 ? -59.258 -23.320 19.438 1.00 98.57  ? 52   DG  I "C2'" 1 
ATOM   8721  C  "C1'" . DG  I  5 126 ? -58.748 -24.416 18.501 1.00 97.78  ? 52   DG  I "C1'" 1 
ATOM   8722  N  N9    . DG  I  5 126 ? -57.733 -25.261 19.143 1.00 97.56  ? 52   DG  I N9    1 
ATOM   8723  C  C8    . DG  I  5 126 ? -56.733 -24.821 19.979 1.00 97.37  ? 52   DG  I C8    1 
ATOM   8724  N  N7    . DG  I  5 126 ? -55.963 -25.765 20.429 1.00 97.14  ? 52   DG  I N7    1 
ATOM   8725  C  C5    . DG  I  5 126 ? -56.481 -26.915 19.860 1.00 97.29  ? 52   DG  I C5    1 
ATOM   8726  C  C6    . DG  I  5 126 ? -56.047 -28.255 19.994 1.00 97.51  ? 52   DG  I C6    1 
ATOM   8727  O  O6    . DG  I  5 126 ? -55.098 -28.686 20.657 1.00 97.42  ? 52   DG  I O6    1 
ATOM   8728  N  N1    . DG  I  5 126 ? -56.829 -29.144 19.263 1.00 97.50  ? 52   DG  I N1    1 
ATOM   8729  C  C2    . DG  I  5 126 ? -57.903 -28.772 18.495 1.00 97.38  ? 52   DG  I C2    1 
ATOM   8730  N  N2    . DG  I  5 126 ? -58.522 -29.781 17.871 1.00 97.36  ? 52   DG  I N2    1 
ATOM   8731  N  N3    . DG  I  5 126 ? -58.328 -27.514 18.355 1.00 97.27  ? 52   DG  I N3    1 
ATOM   8732  C  C4    . DG  I  5 126 ? -57.574 -26.632 19.066 1.00 97.38  ? 52   DG  I C4    1 
ATOM   8733  P  P     . DT  I  5 127 ? -62.288 -22.450 18.790 1.00 101.57 ? 53   DT  I P     1 
ATOM   8734  O  OP1   . DT  I  5 127 ? -63.395 -21.955 17.936 1.00 101.54 ? 53   DT  I OP1   1 
ATOM   8735  O  OP2   . DT  I  5 127 ? -62.033 -21.806 20.104 1.00 101.28 ? 53   DT  I OP2   1 
ATOM   8736  O  "O5'" . DT  I  5 127 ? -62.478 -24.020 19.030 1.00 101.39 ? 53   DT  I "O5'" 1 
ATOM   8737  C  "C5'" . DT  I  5 127 ? -62.758 -24.908 17.950 1.00 102.33 ? 53   DT  I "C5'" 1 
ATOM   8738  C  "C4'" . DT  I  5 127 ? -63.195 -26.260 18.491 1.00 103.46 ? 53   DT  I "C4'" 1 
ATOM   8739  O  "O4'" . DT  I  5 127 ? -62.033 -27.002 18.959 1.00 103.97 ? 53   DT  I "O4'" 1 
ATOM   8740  C  "C3'" . DT  I  5 127 ? -64.177 -26.219 19.666 1.00 103.86 ? 53   DT  I "C3'" 1 
ATOM   8741  O  "O3'" . DT  I  5 127 ? -65.188 -27.227 19.481 1.00 103.92 ? 53   DT  I "O3'" 1 
ATOM   8742  C  "C2'" . DT  I  5 127 ? -63.265 -26.452 20.874 1.00 104.00 ? 53   DT  I "C2'" 1 
ATOM   8743  C  "C1'" . DT  I  5 127 ? -62.242 -27.428 20.295 1.00 103.83 ? 53   DT  I "C1'" 1 
ATOM   8744  N  N1    . DT  I  5 127 ? -60.930 -27.526 21.053 1.00 103.86 ? 53   DT  I N1    1 
ATOM   8745  C  C2    . DT  I  5 127 ? -60.209 -28.709 21.001 1.00 103.59 ? 53   DT  I C2    1 
ATOM   8746  O  O2    . DT  I  5 127 ? -60.555 -29.696 20.373 1.00 103.45 ? 53   DT  I O2    1 
ATOM   8747  N  N3    . DT  I  5 127 ? -59.040 -28.697 21.722 1.00 103.70 ? 53   DT  I N3    1 
ATOM   8748  C  C4    . DT  I  5 127 ? -58.525 -27.655 22.478 1.00 103.62 ? 53   DT  I C4    1 
ATOM   8749  O  O4    . DT  I  5 127 ? -57.463 -27.770 23.082 1.00 103.69 ? 53   DT  I O4    1 
ATOM   8750  C  C5    . DT  I  5 127 ? -59.321 -26.447 22.497 1.00 103.53 ? 53   DT  I C5    1 
ATOM   8751  C  C7    . DT  I  5 127 ? -58.877 -25.241 23.275 1.00 103.42 ? 53   DT  I C7    1 
ATOM   8752  C  C6    . DT  I  5 127 ? -60.467 -26.444 21.795 1.00 103.74 ? 53   DT  I C6    1 
ATOM   8753  P  P     . DA  I  5 128 ? -65.984 -27.928 20.683 1.00 103.88 ? 54   DA  I P     1 
ATOM   8754  O  OP1   . DA  I  5 128 ? -67.195 -28.558 20.116 1.00 104.37 ? 54   DA  I OP1   1 
ATOM   8755  O  OP2   . DA  I  5 128 ? -66.127 -26.958 21.793 1.00 103.73 ? 54   DA  I OP2   1 
ATOM   8756  O  "O5'" . DA  I  5 128 ? -64.989 -29.100 21.123 1.00 104.15 ? 54   DA  I "O5'" 1 
ATOM   8757  C  "C5'" . DA  I  5 128 ? -64.796 -30.259 20.304 1.00 104.28 ? 54   DA  I "C5'" 1 
ATOM   8758  C  "C4'" . DA  I  5 128 ? -64.870 -31.530 21.140 1.00 104.70 ? 54   DA  I "C4'" 1 
ATOM   8759  O  "O4'" . DA  I  5 128 ? -63.590 -31.822 21.771 1.00 104.84 ? 54   DA  I "O4'" 1 
ATOM   8760  C  "C3'" . DA  I  5 128 ? -65.895 -31.528 22.270 1.00 104.87 ? 54   DA  I "C3'" 1 
ATOM   8761  O  "O3'" . DA  I  5 128 ? -66.492 -32.829 22.300 1.00 105.74 ? 54   DA  I "O3'" 1 
ATOM   8762  C  "C2'" . DA  I  5 128 ? -65.065 -31.181 23.509 1.00 104.42 ? 54   DA  I "C2'" 1 
ATOM   8763  C  "C1'" . DA  I  5 128 ? -63.701 -31.794 23.187 1.00 103.86 ? 54   DA  I "C1'" 1 
ATOM   8764  N  N9    . DA  I  5 128 ? -62.559 -31.061 23.757 1.00 103.64 ? 54   DA  I N9    1 
ATOM   8765  C  C8    . DA  I  5 128 ? -62.398 -29.699 23.841 1.00 103.40 ? 54   DA  I C8    1 
ATOM   8766  N  N7    . DA  I  5 128 ? -61.274 -29.315 24.401 1.00 103.09 ? 54   DA  I N7    1 
ATOM   8767  C  C5    . DA  I  5 128 ? -60.648 -30.511 24.711 1.00 103.32 ? 54   DA  I C5    1 
ATOM   8768  C  C6    . DA  I  5 128 ? -59.412 -30.804 25.327 1.00 103.35 ? 54   DA  I C6    1 
ATOM   8769  N  N6    . DA  I  5 128 ? -58.563 -29.861 25.749 1.00 103.29 ? 54   DA  I N6    1 
ATOM   8770  N  N1    . DA  I  5 128 ? -59.081 -32.106 25.489 1.00 103.36 ? 54   DA  I N1    1 
ATOM   8771  C  C2    . DA  I  5 128 ? -59.927 -33.052 25.062 1.00 103.12 ? 54   DA  I C2    1 
ATOM   8772  N  N3    . DA  I  5 128 ? -61.113 -32.900 24.473 1.00 103.02 ? 54   DA  I N3    1 
ATOM   8773  C  C4    . DA  I  5 128 ? -61.421 -31.597 24.323 1.00 103.31 ? 54   DA  I C4    1 
ATOM   8774  P  P     . DT  I  5 129 ? -67.199 -33.460 23.597 1.00 106.44 ? 55   DT  I P     1 
ATOM   8775  O  OP1   . DT  I  5 129 ? -68.156 -34.505 23.157 1.00 106.14 ? 55   DT  I OP1   1 
ATOM   8776  O  OP2   . DT  I  5 129 ? -67.691 -32.349 24.452 1.00 106.33 ? 55   DT  I OP2   1 
ATOM   8777  O  "O5'" . DT  I  5 129 ? -65.957 -34.181 24.313 1.00 105.21 ? 55   DT  I "O5'" 1 
ATOM   8778  C  "C5'" . DT  I  5 129 ? -65.231 -35.224 23.653 1.00 102.88 ? 55   DT  I "C5'" 1 
ATOM   8779  C  "C4'" . DT  I  5 129 ? -64.408 -36.019 24.654 1.00 101.09 ? 55   DT  I "C4'" 1 
ATOM   8780  O  "O4'" . DT  I  5 129 ? -63.377 -35.187 25.244 1.00 100.44 ? 55   DT  I "O4'" 1 
ATOM   8781  C  "C3'" . DT  I  5 129 ? -65.176 -36.617 25.826 1.00 100.16 ? 55   DT  I "C3'" 1 
ATOM   8782  O  "O3'" . DT  I  5 129 ? -64.671 -37.939 25.958 1.00 99.71  ? 55   DT  I "O3'" 1 
ATOM   8783  C  "C2'" . DT  I  5 129 ? -64.852 -35.691 27.003 1.00 99.43  ? 55   DT  I "C2'" 1 
ATOM   8784  C  "C1'" . DT  I  5 129 ? -63.429 -35.257 26.659 1.00 99.34  ? 55   DT  I "C1'" 1 
ATOM   8785  N  N1    . DT  I  5 129 ? -62.954 -33.921 27.199 1.00 99.16  ? 55   DT  I N1    1 
ATOM   8786  C  C2    . DT  I  5 129 ? -61.656 -33.795 27.696 1.00 98.77  ? 55   DT  I C2    1 
ATOM   8787  O  O2    . DT  I  5 129 ? -60.837 -34.701 27.752 1.00 98.33  ? 55   DT  I O2    1 
ATOM   8788  N  N3    . DT  I  5 129 ? -61.335 -32.533 28.139 1.00 98.64  ? 55   DT  I N3    1 
ATOM   8789  C  C4    . DT  I  5 129 ? -62.147 -31.408 28.142 1.00 98.75  ? 55   DT  I C4    1 
ATOM   8790  O  O4    . DT  I  5 129 ? -61.749 -30.329 28.569 1.00 98.32  ? 55   DT  I O4    1 
ATOM   8791  C  C5    . DT  I  5 129 ? -63.484 -31.602 27.612 1.00 98.85  ? 55   DT  I C5    1 
ATOM   8792  C  C7    . DT  I  5 129 ? -64.463 -30.462 27.560 1.00 98.73  ? 55   DT  I C7    1 
ATOM   8793  C  C6    . DT  I  5 129 ? -63.815 -32.830 27.171 1.00 98.99  ? 55   DT  I C6    1 
ATOM   8794  P  P     . DC  I  5 130 ? -65.000 -38.917 27.182 1.00 99.46  ? 56   DC  I P     1 
ATOM   8795  O  OP1   . DC  I  5 130 ? -65.045 -40.295 26.631 1.00 99.28  ? 56   DC  I OP1   1 
ATOM   8796  O  OP2   . DC  I  5 130 ? -66.139 -38.368 27.964 1.00 98.98  ? 56   DC  I OP2   1 
ATOM   8797  O  "O5'" . DC  I  5 130 ? -63.678 -38.784 28.077 1.00 98.58  ? 56   DC  I "O5'" 1 
ATOM   8798  C  "C5'" . DC  I  5 130 ? -62.384 -39.161 27.578 1.00 96.08  ? 56   DC  I "C5'" 1 
ATOM   8799  C  "C4'" . DC  I  5 130 ? -61.295 -38.921 28.616 1.00 94.10  ? 56   DC  I "C4'" 1 
ATOM   8800  O  "O4'" . DC  I  5 130 ? -61.253 -37.517 28.989 1.00 94.11  ? 56   DC  I "O4'" 1 
ATOM   8801  C  "C3'" . DC  I  5 130 ? -61.455 -39.692 29.923 1.00 92.63  ? 56   DC  I "C3'" 1 
ATOM   8802  O  "O3'" . DC  I  5 130 ? -60.189 -40.234 30.265 1.00 90.52  ? 56   DC  I "O3'" 1 
ATOM   8803  C  "C2'" . DC  I  5 130 ? -61.942 -38.652 30.935 1.00 92.71  ? 56   DC  I "C2'" 1 
ATOM   8804  C  "C1'" . DC  I  5 130 ? -61.266 -37.392 30.402 1.00 93.72  ? 56   DC  I "C1'" 1 
ATOM   8805  N  N1    . DC  I  5 130 ? -61.892 -36.068 30.789 1.00 93.78  ? 56   DC  I N1    1 
ATOM   8806  C  C2    . DC  I  5 130 ? -61.220 -35.205 31.676 1.00 94.01  ? 56   DC  I C2    1 
ATOM   8807  O  O2    . DC  I  5 130 ? -60.126 -35.534 32.151 1.00 94.06  ? 56   DC  I O2    1 
ATOM   8808  N  N3    . DC  I  5 130 ? -61.791 -34.016 32.007 1.00 94.38  ? 56   DC  I N3    1 
ATOM   8809  C  C4    . DC  I  5 130 ? -62.974 -33.669 31.491 1.00 94.14  ? 56   DC  I C4    1 
ATOM   8810  N  N4    . DC  I  5 130 ? -63.490 -32.488 31.851 1.00 93.79  ? 56   DC  I N4    1 
ATOM   8811  C  C5    . DC  I  5 130 ? -63.674 -34.525 30.584 1.00 93.97  ? 56   DC  I C5    1 
ATOM   8812  C  C6    . DC  I  5 130 ? -63.101 -35.696 30.267 1.00 93.72  ? 56   DC  I C6    1 
ATOM   8813  P  P     . DT  I  5 131 ? -60.067 -41.615 31.069 1.00 89.17  ? 57   DT  I P     1 
ATOM   8814  O  OP1   . DT  I  5 131 ? -59.055 -42.474 30.404 1.00 88.01  ? 57   DT  I OP1   1 
ATOM   8815  O  OP2   . DT  I  5 131 ? -61.434 -42.137 31.302 1.00 89.07  ? 57   DT  I OP2   1 
ATOM   8816  O  "O5'" . DT  I  5 131 ? -59.509 -41.143 32.506 1.00 87.67  ? 57   DT  I "O5'" 1 
ATOM   8817  C  "C5'" . DT  I  5 131 ? -58.279 -40.409 32.676 1.00 83.07  ? 57   DT  I "C5'" 1 
ATOM   8818  C  "C4'" . DT  I  5 131 ? -58.145 -39.815 34.075 1.00 79.59  ? 57   DT  I "C4'" 1 
ATOM   8819  O  "O4'" . DT  I  5 131 ? -58.828 -38.535 34.166 1.00 78.25  ? 57   DT  I "O4'" 1 
ATOM   8820  C  "C3'" . DT  I  5 131 ? -58.673 -40.656 35.234 1.00 77.64  ? 57   DT  I "C3'" 1 
ATOM   8821  O  "O3'" . DT  I  5 131 ? -57.675 -40.691 36.224 1.00 75.06  ? 57   DT  I "O3'" 1 
ATOM   8822  C  "C2'" . DT  I  5 131 ? -59.896 -39.882 35.718 1.00 77.78  ? 57   DT  I "C2'" 1 
ATOM   8823  C  "C1'" . DT  I  5 131 ? -59.463 -38.451 35.417 1.00 77.78  ? 57   DT  I "C1'" 1 
ATOM   8824  N  N1    . DT  I  5 131 ? -60.549 -37.457 35.261 1.00 77.82  ? 57   DT  I N1    1 
ATOM   8825  C  C2    . DT  I  5 131 ? -60.339 -36.147 35.649 1.00 77.87  ? 57   DT  I C2    1 
ATOM   8826  O  O2    . DT  I  5 131 ? -59.305 -35.745 36.136 1.00 77.80  ? 57   DT  I O2    1 
ATOM   8827  N  N3    . DT  I  5 131 ? -61.406 -35.305 35.451 1.00 78.29  ? 57   DT  I N3    1 
ATOM   8828  C  C4    . DT  I  5 131 ? -62.638 -35.635 34.901 1.00 78.09  ? 57   DT  I C4    1 
ATOM   8829  O  O4    . DT  I  5 131 ? -63.524 -34.798 34.770 1.00 77.69  ? 57   DT  I O4    1 
ATOM   8830  C  C5    . DT  I  5 131 ? -62.795 -37.025 34.510 1.00 78.31  ? 57   DT  I C5    1 
ATOM   8831  C  C7    . DT  I  5 131 ? -64.073 -37.535 33.906 1.00 77.96  ? 57   DT  I C7    1 
ATOM   8832  C  C6    . DT  I  5 131 ? -61.754 -37.852 34.704 1.00 78.44  ? 57   DT  I C6    1 
ATOM   8833  P  P     . DG  I  5 132 ? -56.542 -41.816 36.198 1.00 73.27  ? 58   DG  I P     1 
ATOM   8834  O  OP1   . DG  I  5 132 ? -56.088 -42.034 34.807 1.00 73.32  ? 58   DG  I OP1   1 
ATOM   8835  O  OP2   . DG  I  5 132 ? -57.073 -42.957 36.970 1.00 73.68  ? 58   DG  I OP2   1 
ATOM   8836  O  "O5'" . DG  I  5 132 ? -55.363 -41.141 37.052 1.00 71.56  ? 58   DG  I "O5'" 1 
ATOM   8837  C  "C5'" . DG  I  5 132 ? -54.998 -39.775 36.819 1.00 67.82  ? 58   DG  I "C5'" 1 
ATOM   8838  C  "C4'" . DG  I  5 132 ? -54.452 -39.031 38.036 1.00 65.47  ? 58   DG  I "C4'" 1 
ATOM   8839  O  "O4'" . DG  I  5 132 ? -55.409 -38.026 38.448 1.00 64.55  ? 58   DG  I "O4'" 1 
ATOM   8840  C  "C3'" . DG  I  5 132 ? -54.079 -39.744 39.337 1.00 64.37  ? 58   DG  I "C3'" 1 
ATOM   8841  O  "O3'" . DG  I  5 132 ? -53.022 -38.944 39.954 1.00 63.51  ? 58   DG  I "O3'" 1 
ATOM   8842  C  "C2'" . DG  I  5 132 ? -55.408 -39.723 40.095 1.00 63.86  ? 58   DG  I "C2'" 1 
ATOM   8843  C  "C1'" . DG  I  5 132 ? -56.013 -38.385 39.675 1.00 63.57  ? 58   DG  I "C1'" 1 
ATOM   8844  N  N9    . DG  I  5 132 ? -57.426 -38.409 39.342 1.00 63.68  ? 58   DG  I N9    1 
ATOM   8845  C  C8    . DG  I  5 132 ? -58.144 -39.493 38.890 1.00 63.59  ? 58   DG  I C8    1 
ATOM   8846  N  N7    . DG  I  5 132 ? -59.390 -39.218 38.642 1.00 63.57  ? 58   DG  I N7    1 
ATOM   8847  C  C5    . DG  I  5 132 ? -59.507 -37.861 38.927 1.00 63.53  ? 58   DG  I C5    1 
ATOM   8848  C  C6    . DG  I  5 132 ? -60.637 -37.009 38.845 1.00 63.48  ? 58   DG  I C6    1 
ATOM   8849  O  O6    . DG  I  5 132 ? -61.780 -37.290 38.481 1.00 63.57  ? 58   DG  I O6    1 
ATOM   8850  N  N1    . DG  I  5 132 ? -60.354 -35.706 39.229 1.00 63.37  ? 58   DG  I N1    1 
ATOM   8851  C  C2    . DG  I  5 132 ? -59.118 -35.282 39.642 1.00 63.42  ? 58   DG  I C2    1 
ATOM   8852  N  N2    . DG  I  5 132 ? -59.056 -33.985 39.964 1.00 63.49  ? 58   DG  I N2    1 
ATOM   8853  N  N3    . DG  I  5 132 ? -58.036 -36.063 39.727 1.00 63.00  ? 58   DG  I N3    1 
ATOM   8854  C  C4    . DG  I  5 132 ? -58.304 -37.343 39.358 1.00 63.28  ? 58   DG  I C4    1 
ATOM   8855  P  P     . DC  I  5 133 ? -52.474 -39.004 41.470 1.00 61.63  ? 59   DC  I P     1 
ATOM   8856  O  OP1   . DC  I  5 133 ? -51.138 -38.371 41.508 1.00 62.36  ? 59   DC  I OP1   1 
ATOM   8857  O  OP2   . DC  I  5 133 ? -52.613 -40.392 41.961 1.00 61.75  ? 59   DC  I OP2   1 
ATOM   8858  O  "O5'" . DC  I  5 133 ? -53.484 -38.048 42.246 1.00 60.85  ? 59   DC  I "O5'" 1 
ATOM   8859  C  "C5'" . DC  I  5 133 ? -53.636 -36.683 41.876 1.00 61.04  ? 59   DC  I "C5'" 1 
ATOM   8860  C  "C4'" . DC  I  5 133 ? -54.362 -35.893 42.959 1.00 62.35  ? 59   DC  I "C4'" 1 
ATOM   8861  O  "O4'" . DC  I  5 133 ? -55.795 -35.904 42.740 1.00 63.46  ? 59   DC  I "O4'" 1 
ATOM   8862  C  "C3'" . DC  I  5 133 ? -54.251 -36.383 44.393 1.00 62.75  ? 59   DC  I "C3'" 1 
ATOM   8863  O  "O3'" . DC  I  5 133 ? -54.587 -35.279 45.215 1.00 63.01  ? 59   DC  I "O3'" 1 
ATOM   8864  C  "C2'" . DC  I  5 133 ? -55.343 -37.448 44.446 1.00 63.18  ? 59   DC  I "C2'" 1 
ATOM   8865  C  "C1'" . DC  I  5 133 ? -56.445 -36.623 43.778 1.00 63.80  ? 59   DC  I "C1'" 1 
ATOM   8866  N  N1    . DC  I  5 133 ? -57.619 -37.337 43.160 1.00 64.15  ? 59   DC  I N1    1 
ATOM   8867  C  C2    . DC  I  5 133 ? -58.757 -36.566 42.839 1.00 64.61  ? 59   DC  I C2    1 
ATOM   8868  O  O2    . DC  I  5 133 ? -58.764 -35.350 43.083 1.00 63.67  ? 59   DC  I O2    1 
ATOM   8869  N  N3    . DC  I  5 133 ? -59.830 -37.182 42.262 1.00 65.00  ? 59   DC  I N3    1 
ATOM   8870  C  C4    . DC  I  5 133 ? -59.795 -38.503 42.017 1.00 64.50  ? 59   DC  I C4    1 
ATOM   8871  N  N4    . DC  I  5 133 ? -60.879 -39.047 41.450 1.00 64.20  ? 59   DC  I N4    1 
ATOM   8872  C  C5    . DC  I  5 133 ? -58.648 -39.307 42.336 1.00 63.85  ? 59   DC  I C5    1 
ATOM   8873  C  C6    . DC  I  5 133 ? -57.595 -38.688 42.897 1.00 63.82  ? 59   DC  I C6    1 
ATOM   8874  P  P     . DA  I  5 134 ? -53.505 -34.663 46.212 1.00 63.52  ? 60   DA  I P     1 
ATOM   8875  O  OP1   . DA  I  5 134 ? -52.345 -34.350 45.341 1.00 63.15  ? 60   DA  I OP1   1 
ATOM   8876  O  OP2   . DA  I  5 134 ? -53.359 -35.562 47.390 1.00 61.79  ? 60   DA  I OP2   1 
ATOM   8877  O  "O5'" . DA  I  5 134 ? -54.203 -33.319 46.736 1.00 62.99  ? 60   DA  I "O5'" 1 
ATOM   8878  C  "C5'" . DA  I  5 134 ? -54.421 -32.235 45.836 1.00 64.82  ? 60   DA  I "C5'" 1 
ATOM   8879  C  "C4'" . DA  I  5 134 ? -55.660 -31.413 46.188 1.00 65.91  ? 60   DA  I "C4'" 1 
ATOM   8880  O  "O4'" . DA  I  5 134 ? -56.891 -32.129 45.896 1.00 66.68  ? 60   DA  I "O4'" 1 
ATOM   8881  C  "C3'" . DA  I  5 134 ? -55.822 -30.978 47.636 1.00 66.02  ? 60   DA  I "C3'" 1 
ATOM   8882  O  "O3'" . DA  I  5 134 ? -56.467 -29.731 47.610 1.00 66.44  ? 60   DA  I "O3'" 1 
ATOM   8883  C  "C2'" . DA  I  5 134 ? -56.723 -32.054 48.246 1.00 65.78  ? 60   DA  I "C2'" 1 
ATOM   8884  C  "C1'" . DA  I  5 134 ? -57.628 -32.426 47.076 1.00 65.03  ? 60   DA  I "C1'" 1 
ATOM   8885  N  N9    . DA  I  5 134 ? -57.959 -33.841 46.925 1.00 64.85  ? 60   DA  I N9    1 
ATOM   8886  C  C8    . DA  I  5 134 ? -57.132 -34.914 47.128 1.00 64.49  ? 60   DA  I C8    1 
ATOM   8887  N  N7    . DA  I  5 134 ? -57.683 -36.081 46.891 1.00 64.03  ? 60   DA  I N7    1 
ATOM   8888  C  C5    . DA  I  5 134 ? -58.962 -35.751 46.478 1.00 64.73  ? 60   DA  I C5    1 
ATOM   8889  C  C6    . DA  I  5 134 ? -60.057 -36.538 46.070 1.00 64.44  ? 60   DA  I C6    1 
ATOM   8890  N  N6    . DA  I  5 134 ? -60.001 -37.866 46.017 1.00 64.51  ? 60   DA  I N6    1 
ATOM   8891  N  N1    . DA  I  5 134 ? -61.204 -35.912 45.724 1.00 64.40  ? 60   DA  I N1    1 
ATOM   8892  C  C2    . DA  I  5 134 ? -61.250 -34.574 45.781 1.00 64.27  ? 60   DA  I C2    1 
ATOM   8893  N  N3    . DA  I  5 134 ? -60.286 -33.722 46.142 1.00 64.70  ? 60   DA  I N3    1 
ATOM   8894  C  C4    . DA  I  5 134 ? -59.155 -34.376 46.486 1.00 65.07  ? 60   DA  I C4    1 
ATOM   8895  P  P     . DG  I  5 135 ? -56.492 -28.829 48.925 1.00 67.00  ? 61   DG  I P     1 
ATOM   8896  O  OP1   . DG  I  5 135 ? -56.345 -27.420 48.502 1.00 66.84  ? 61   DG  I OP1   1 
ATOM   8897  O  OP2   . DG  I  5 135 ? -55.565 -29.424 49.909 1.00 66.45  ? 61   DG  I OP2   1 
ATOM   8898  O  "O5'" . DG  I  5 135 ? -57.983 -29.018 49.472 1.00 68.52  ? 61   DG  I "O5'" 1 
ATOM   8899  C  "C5'" . DG  I  5 135 ? -59.089 -29.155 48.565 1.00 69.16  ? 61   DG  I "C5'" 1 
ATOM   8900  C  "C4'" . DG  I  5 135 ? -60.326 -29.684 49.277 1.00 69.38  ? 61   DG  I "C4'" 1 
ATOM   8901  O  "O4'" . DG  I  5 135 ? -60.478 -31.115 49.076 1.00 68.39  ? 61   DG  I "O4'" 1 
ATOM   8902  C  "C3'" . DG  I  5 135 ? -60.359 -29.506 50.787 1.00 70.56  ? 61   DG  I "C3'" 1 
ATOM   8903  O  "O3'" . DG  I  5 135 ? -61.723 -29.356 51.139 1.00 75.17  ? 61   DG  I "O3'" 1 
ATOM   8904  C  "C2'" . DG  I  5 135 ? -59.803 -30.836 51.280 1.00 68.25  ? 61   DG  I "C2'" 1 
ATOM   8905  C  "C1'" . DG  I  5 135 ? -60.557 -31.757 50.334 1.00 65.74  ? 61   DG  I "C1'" 1 
ATOM   8906  N  N9    . DG  I  5 135 ? -60.047 -33.122 50.210 1.00 64.97  ? 61   DG  I N9    1 
ATOM   8907  C  C8    . DG  I  5 135 ? -58.789 -33.606 50.502 1.00 64.63  ? 61   DG  I C8    1 
ATOM   8908  N  N7    . DG  I  5 135 ? -58.644 -34.884 50.285 1.00 64.28  ? 61   DG  I N7    1 
ATOM   8909  C  C5    . DG  I  5 135 ? -59.890 -35.278 49.816 1.00 64.59  ? 61   DG  I C5    1 
ATOM   8910  C  C6    . DG  I  5 135 ? -60.350 -36.557 49.412 1.00 64.67  ? 61   DG  I C6    1 
ATOM   8911  O  O6    . DG  I  5 135 ? -59.723 -37.620 49.390 1.00 64.42  ? 61   DG  I O6    1 
ATOM   8912  N  N1    . DG  I  5 135 ? -61.687 -36.530 49.007 1.00 64.79  ? 61   DG  I N1    1 
ATOM   8913  C  C2    . DG  I  5 135 ? -62.482 -35.401 48.999 1.00 64.63  ? 61   DG  I C2    1 
ATOM   8914  N  N2    . DG  I  5 135 ? -63.740 -35.568 48.579 1.00 64.68  ? 61   DG  I N2    1 
ATOM   8915  N  N3    . DG  I  5 135 ? -62.071 -34.193 49.375 1.00 64.26  ? 61   DG  I N3    1 
ATOM   8916  C  C4    . DG  I  5 135 ? -60.766 -34.206 49.766 1.00 64.73  ? 61   DG  I C4    1 
ATOM   8917  P  P     . DG  I  5 136 ? -62.176 -28.911 52.610 1.00 78.95  ? 62   DG  I P     1 
ATOM   8918  O  OP1   . DG  I  5 136 ? -62.876 -27.606 52.479 1.00 78.68  ? 62   DG  I OP1   1 
ATOM   8919  O  OP2   . DG  I  5 136 ? -61.002 -29.025 53.517 1.00 78.75  ? 62   DG  I OP2   1 
ATOM   8920  O  "O5'" . DG  I  5 136 ? -63.259 -30.043 52.976 1.00 79.41  ? 62   DG  I "O5'" 1 
ATOM   8921  C  "C5'" . DG  I  5 136 ? -64.539 -30.013 52.323 1.00 80.51  ? 62   DG  I "C5'" 1 
ATOM   8922  C  "C4'" . DG  I  5 136 ? -65.408 -31.194 52.707 1.00 81.10  ? 62   DG  I "C4'" 1 
ATOM   8923  O  "O4'" . DG  I  5 136 ? -64.889 -32.404 52.095 1.00 80.90  ? 62   DG  I "O4'" 1 
ATOM   8924  C  "C3'" . DG  I  5 136 ? -65.488 -31.453 54.206 1.00 82.35  ? 62   DG  I "C3'" 1 
ATOM   8925  O  "O3'" . DG  I  5 136 ? -66.851 -31.380 54.618 1.00 85.55  ? 62   DG  I "O3'" 1 
ATOM   8926  C  "C2'" . DG  I  5 136 ? -64.898 -32.852 54.383 1.00 81.37  ? 62   DG  I "C2'" 1 
ATOM   8927  C  "C1'" . DG  I  5 136 ? -64.989 -33.482 52.997 1.00 79.14  ? 62   DG  I "C1'" 1 
ATOM   8928  N  N9    . DG  I  5 136 ? -63.863 -34.382 52.795 1.00 78.36  ? 62   DG  I N9    1 
ATOM   8929  C  C8    . DG  I  5 136 ? -62.550 -34.007 52.902 1.00 77.98  ? 62   DG  I C8    1 
ATOM   8930  N  N7    . DG  I  5 136 ? -61.715 -34.979 52.708 1.00 77.99  ? 62   DG  I N7    1 
ATOM   8931  C  C5    . DG  I  5 136 ? -62.520 -36.075 52.453 1.00 77.96  ? 62   DG  I C5    1 
ATOM   8932  C  C6    . DG  I  5 136 ? -62.143 -37.410 52.166 1.00 78.02  ? 62   DG  I C6    1 
ATOM   8933  O  O6    . DG  I  5 136 ? -61.002 -37.880 52.082 1.00 78.06  ? 62   DG  I O6    1 
ATOM   8934  N  N1    . DG  I  5 136 ? -63.246 -38.232 51.969 1.00 78.17  ? 62   DG  I N1    1 
ATOM   8935  C  C2    . DG  I  5 136 ? -64.551 -37.809 52.045 1.00 78.17  ? 62   DG  I C2    1 
ATOM   8936  N  N2    . DG  I  5 136 ? -65.459 -38.769 51.821 1.00 78.18  ? 62   DG  I N2    1 
ATOM   8937  N  N3    . DG  I  5 136 ? -64.924 -36.551 52.314 1.00 77.97  ? 62   DG  I N3    1 
ATOM   8938  C  C4    . DG  I  5 136 ? -63.855 -35.733 52.508 1.00 78.01  ? 62   DG  I C4    1 
ATOM   8939  P  P     . DT  I  5 137 ? -67.322 -31.792 56.098 1.00 87.85  ? 63   DT  I P     1 
ATOM   8940  O  OP1   . DT  I  5 137 ? -68.659 -31.191 56.318 1.00 87.31  ? 63   DT  I OP1   1 
ATOM   8941  O  OP2   . DT  I  5 137 ? -66.211 -31.501 57.039 1.00 87.62  ? 63   DT  I OP2   1 
ATOM   8942  O  "O5'" . DT  I  5 137 ? -67.467 -33.381 56.002 1.00 87.68  ? 63   DT  I "O5'" 1 
ATOM   8943  C  "C5'" . DT  I  5 137 ? -68.342 -33.985 55.058 1.00 88.55  ? 63   DT  I "C5'" 1 
ATOM   8944  C  "C4'" . DT  I  5 137 ? -68.570 -35.416 55.492 1.00 89.52  ? 63   DT  I "C4'" 1 
ATOM   8945  O  "O4'" . DT  I  5 137 ? -67.532 -36.260 54.928 1.00 89.64  ? 63   DT  I "O4'" 1 
ATOM   8946  C  "C3'" . DT  I  5 137 ? -68.508 -35.581 57.010 1.00 90.04  ? 63   DT  I "C3'" 1 
ATOM   8947  O  "O3'" . DT  I  5 137 ? -69.731 -36.131 57.500 1.00 91.22  ? 63   DT  I "O3'" 1 
ATOM   8948  C  "C2'" . DT  I  5 137 ? -67.318 -36.502 57.252 1.00 89.84  ? 63   DT  I "C2'" 1 
ATOM   8949  C  "C1'" . DT  I  5 137 ? -67.105 -37.182 55.907 1.00 89.55  ? 63   DT  I "C1'" 1 
ATOM   8950  N  N1    . DT  I  5 137 ? -65.659 -37.498 55.737 1.00 89.45  ? 63   DT  I N1    1 
ATOM   8951  C  C2    . DT  I  5 137 ? -65.231 -38.774 55.384 1.00 89.41  ? 63   DT  I C2    1 
ATOM   8952  O  O2    . DT  I  5 137 ? -65.960 -39.727 55.160 1.00 89.76  ? 63   DT  I O2    1 
ATOM   8953  N  N3    . DT  I  5 137 ? -63.872 -38.908 55.288 1.00 88.89  ? 63   DT  I N3    1 
ATOM   8954  C  C4    . DT  I  5 137 ? -62.924 -37.925 55.509 1.00 89.32  ? 63   DT  I C4    1 
ATOM   8955  O  O4    . DT  I  5 137 ? -61.730 -38.170 55.388 1.00 89.54  ? 63   DT  I O4    1 
ATOM   8956  C  C5    . DT  I  5 137 ? -63.436 -36.621 55.883 1.00 89.31  ? 63   DT  I C5    1 
ATOM   8957  C  C7    . DT  I  5 137 ? -62.531 -35.457 56.156 1.00 89.33  ? 63   DT  I C7    1 
ATOM   8958  C  C6    . DT  I  5 137 ? -64.759 -36.477 55.980 1.00 89.23  ? 63   DT  I C6    1 
ATOM   8959  P  P     . DG  I  5 138 ? -69.945 -36.561 59.036 1.00 91.73  ? 64   DG  I P     1 
ATOM   8960  O  OP1   . DG  I  5 138 ? -71.406 -36.542 59.289 1.00 91.85  ? 64   DG  I OP1   1 
ATOM   8961  O  OP2   . DG  I  5 138 ? -69.036 -35.775 59.911 1.00 91.43  ? 64   DG  I OP2   1 
ATOM   8962  O  "O5'" . DG  I  5 138 ? -69.445 -38.082 59.052 1.00 89.72  ? 64   DG  I "O5'" 1 
ATOM   8963  C  "C5'" . DG  I  5 138 ? -69.877 -39.040 58.079 1.00 86.85  ? 64   DG  I "C5'" 1 
ATOM   8964  C  "C4'" . DG  I  5 138 ? -69.334 -40.402 58.477 1.00 84.78  ? 64   DG  I "C4'" 1 
ATOM   8965  O  "O4'" . DG  I  5 138 ? -67.937 -40.507 58.085 1.00 83.60  ? 64   DG  I "O4'" 1 
ATOM   8966  C  "C3'" . DG  I  5 138 ? -69.394 -40.651 59.985 1.00 83.64  ? 64   DG  I "C3'" 1 
ATOM   8967  O  "O3'" . DG  I  5 138 ? -69.888 -41.967 60.265 1.00 82.72  ? 64   DG  I "O3'" 1 
ATOM   8968  C  "C2'" . DG  I  5 138 ? -67.954 -40.438 60.455 1.00 83.06  ? 64   DG  I "C2'" 1 
ATOM   8969  C  "C1'" . DG  I  5 138 ? -67.135 -40.812 59.218 1.00 82.12  ? 64   DG  I "C1'" 1 
ATOM   8970  N  N9    . DG  I  5 138 ? -65.813 -40.158 59.128 1.00 81.77  ? 64   DG  I N9    1 
ATOM   8971  C  C8    . DG  I  5 138 ? -65.477 -38.835 59.358 1.00 81.40  ? 64   DG  I C8    1 
ATOM   8972  N  N7    . DG  I  5 138 ? -64.204 -38.576 59.200 1.00 80.81  ? 64   DG  I N7    1 
ATOM   8973  C  C5    . DG  I  5 138 ? -63.657 -39.802 58.843 1.00 80.72  ? 64   DG  I C5    1 
ATOM   8974  C  C6    . DG  I  5 138 ? -62.324 -40.165 58.536 1.00 80.92  ? 64   DG  I C6    1 
ATOM   8975  O  O6    . DG  I  5 138 ? -61.318 -39.454 58.516 1.00 81.43  ? 64   DG  I O6    1 
ATOM   8976  N  N1    . DG  I  5 138 ? -62.186 -41.515 58.231 1.00 81.18  ? 64   DG  I N1    1 
ATOM   8977  C  C2    . DG  I  5 138 ? -63.223 -42.415 58.217 1.00 81.34  ? 64   DG  I C2    1 
ATOM   8978  N  N2    . DG  I  5 138 ? -62.910 -43.678 57.894 1.00 81.40  ? 64   DG  I N2    1 
ATOM   8979  N  N3    . DG  I  5 138 ? -64.482 -42.094 58.493 1.00 81.25  ? 64   DG  I N3    1 
ATOM   8980  C  C4    . DG  I  5 138 ? -64.628 -40.779 58.799 1.00 81.06  ? 64   DG  I C4    1 
ATOM   8981  P  P     . DG  I  5 139 ? -70.366 -42.408 61.744 1.00 81.96  ? 65   DG  I P     1 
ATOM   8982  O  OP1   . DG  I  5 139 ? -71.587 -43.231 61.571 1.00 81.76  ? 65   DG  I OP1   1 
ATOM   8983  O  OP2   . DG  I  5 139 ? -70.373 -41.226 62.655 1.00 80.06  ? 65   DG  I OP2   1 
ATOM   8984  O  "O5'" . DG  I  5 139 ? -69.207 -43.424 62.183 1.00 78.78  ? 65   DG  I "O5'" 1 
ATOM   8985  C  "C5'" . DG  I  5 139 ? -68.817 -44.494 61.309 1.00 74.70  ? 65   DG  I "C5'" 1 
ATOM   8986  C  "C4'" . DG  I  5 139 ? -67.417 -44.970 61.660 1.00 71.53  ? 65   DG  I "C4'" 1 
ATOM   8987  O  "O4'" . DG  I  5 139 ? -66.413 -43.959 61.340 1.00 69.51  ? 65   DG  I "O4'" 1 
ATOM   8988  C  "C3'" . DG  I  5 139 ? -67.250 -45.268 63.143 1.00 70.26  ? 65   DG  I "C3'" 1 
ATOM   8989  O  "O3'" . DG  I  5 139 ? -66.578 -46.501 63.258 1.00 69.79  ? 65   DG  I "O3'" 1 
ATOM   8990  C  "C2'" . DG  I  5 139 ? -66.428 -44.087 63.679 1.00 68.46  ? 65   DG  I "C2'" 1 
ATOM   8991  C  "C1'" . DG  I  5 139 ? -65.565 -43.762 62.465 1.00 65.37  ? 65   DG  I "C1'" 1 
ATOM   8992  N  N9    . DG  I  5 139 ? -64.959 -42.417 62.465 1.00 64.25  ? 65   DG  I N9    1 
ATOM   8993  C  C8    . DG  I  5 139 ? -65.517 -41.200 62.806 1.00 63.20  ? 65   DG  I C8    1 
ATOM   8994  N  N7    . DG  I  5 139 ? -64.700 -40.187 62.692 1.00 62.57  ? 65   DG  I N7    1 
ATOM   8995  C  C5    . DG  I  5 139 ? -63.520 -40.773 62.254 1.00 62.94  ? 65   DG  I C5    1 
ATOM   8996  C  C6    . DG  I  5 139 ? -62.265 -40.196 61.961 1.00 63.23  ? 65   DG  I C6    1 
ATOM   8997  O  O6    . DG  I  5 139 ? -61.953 -39.004 62.031 1.00 63.35  ? 65   DG  I O6    1 
ATOM   8998  N  N1    . DG  I  5 139 ? -61.325 -41.144 61.552 1.00 63.24  ? 65   DG  I N1    1 
ATOM   8999  C  C2    . DG  I  5 139 ? -61.572 -42.492 61.436 1.00 63.08  ? 65   DG  I C2    1 
ATOM   9000  N  N2    . DG  I  5 139 ? -60.564 -43.267 61.023 1.00 63.22  ? 65   DG  I N2    1 
ATOM   9001  N  N3    . DG  I  5 139 ? -62.739 -43.049 61.707 1.00 62.79  ? 65   DG  I N3    1 
ATOM   9002  C  C4    . DG  I  5 139 ? -63.660 -42.136 62.111 1.00 63.34  ? 65   DG  I C4    1 
ATOM   9003  P  P     . DA  I  5 140 ? -66.389 -47.165 64.701 1.00 70.54  ? 66   DA  I P     1 
ATOM   9004  O  OP1   . DA  I  5 140 ? -67.177 -48.420 64.704 1.00 71.20  ? 66   DA  I OP1   1 
ATOM   9005  O  OP2   . DA  I  5 140 ? -66.614 -46.158 65.775 1.00 69.61  ? 66   DA  I OP2   1 
ATOM   9006  O  "O5'" . DA  I  5 140 ? -64.838 -47.534 64.682 1.00 67.63  ? 66   DA  I "O5'" 1 
ATOM   9007  C  "C5'" . DA  I  5 140 ? -64.269 -48.118 63.532 1.00 64.40  ? 66   DA  I "C5'" 1 
ATOM   9008  C  "C4'" . DA  I  5 140 ? -62.755 -48.068 63.638 1.00 62.33  ? 66   DA  I "C4'" 1 
ATOM   9009  O  "O4'" . DA  I  5 140 ? -62.228 -46.720 63.511 1.00 60.03  ? 66   DA  I "O4'" 1 
ATOM   9010  C  "C3'" . DA  I  5 140 ? -62.189 -48.591 64.946 1.00 61.96  ? 66   DA  I "C3'" 1 
ATOM   9011  O  "O3'" . DA  I  5 140 ? -61.052 -49.324 64.546 1.00 63.68  ? 66   DA  I "O3'" 1 
ATOM   9012  C  "C2'" . DA  I  5 140 ? -61.864 -47.322 65.748 1.00 59.88  ? 66   DA  I "C2'" 1 
ATOM   9013  C  "C1'" . DA  I  5 140 ? -61.441 -46.373 64.635 1.00 56.85  ? 66   DA  I "C1'" 1 
ATOM   9014  N  N9    . DA  I  5 140 ? -61.714 -44.959 64.849 1.00 56.27  ? 66   DA  I N9    1 
ATOM   9015  C  C8    . DA  I  5 140 ? -62.905 -44.387 65.222 1.00 56.13  ? 66   DA  I C8    1 
ATOM   9016  N  N7    . DA  I  5 140 ? -62.879 -43.075 65.314 1.00 55.13  ? 66   DA  I N7    1 
ATOM   9017  C  C5    . DA  I  5 140 ? -61.584 -42.760 64.960 1.00 54.87  ? 66   DA  I C5    1 
ATOM   9018  C  C6    . DA  I  5 140 ? -60.916 -41.531 64.860 1.00 54.85  ? 66   DA  I C6    1 
ATOM   9019  N  N6    . DA  I  5 140 ? -61.491 -40.358 65.116 1.00 55.26  ? 66   DA  I N6    1 
ATOM   9020  N  N1    . DA  I  5 140 ? -59.625 -41.555 64.489 1.00 55.59  ? 66   DA  I N1    1 
ATOM   9021  C  C2    . DA  I  5 140 ? -59.041 -42.737 64.228 1.00 55.72  ? 66   DA  I C2    1 
ATOM   9022  N  N3    . DA  I  5 140 ? -59.560 -43.965 64.285 1.00 55.41  ? 66   DA  I N3    1 
ATOM   9023  C  C4    . DA  I  5 140 ? -60.851 -43.905 64.664 1.00 55.71  ? 66   DA  I C4    1 
ATOM   9024  P  P     . DT  I  5 141 ? -60.245 -50.218 65.588 1.00 65.75  ? 67   DT  I P     1 
ATOM   9025  O  OP1   . DT  I  5 141 ? -59.581 -51.298 64.818 1.00 65.24  ? 67   DT  I OP1   1 
ATOM   9026  O  OP2   . DT  I  5 141 ? -61.155 -50.526 66.724 1.00 64.77  ? 67   DT  I OP2   1 
ATOM   9027  O  "O5'" . DT  I  5 141 ? -59.127 -49.182 66.116 1.00 64.82  ? 67   DT  I "O5'" 1 
ATOM   9028  C  "C5'" . DT  I  5 141 ? -57.992 -48.750 65.336 1.00 62.46  ? 67   DT  I "C5'" 1 
ATOM   9029  C  "C4'" . DT  I  5 141 ? -57.089 -47.859 66.181 1.00 61.63  ? 67   DT  I "C4'" 1 
ATOM   9030  O  "O4'" . DT  I  5 141 ? -57.594 -46.495 66.181 1.00 60.51  ? 67   DT  I "O4'" 1 
ATOM   9031  C  "C3'" . DT  I  5 141 ? -56.956 -48.259 67.660 1.00 61.83  ? 67   DT  I "C3'" 1 
ATOM   9032  O  "O3'" . DT  I  5 141 ? -55.641 -48.069 68.135 1.00 63.66  ? 67   DT  I "O3'" 1 
ATOM   9033  C  "C2'" . DT  I  5 141 ? -57.865 -47.263 68.369 1.00 59.89  ? 67   DT  I "C2'" 1 
ATOM   9034  C  "C1'" . DT  I  5 141 ? -57.577 -46.040 67.512 1.00 58.56  ? 67   DT  I "C1'" 1 
ATOM   9035  N  N1    . DT  I  5 141 ? -58.506 -44.904 67.704 1.00 57.91  ? 67   DT  I N1    1 
ATOM   9036  C  C2    . DT  I  5 141 ? -58.015 -43.638 67.480 1.00 57.86  ? 67   DT  I C2    1 
ATOM   9037  O  O2    . DT  I  5 141 ? -56.878 -43.412 67.118 1.00 58.33  ? 67   DT  I O2    1 
ATOM   9038  N  N3    . DT  I  5 141 ? -58.906 -42.626 67.692 1.00 57.50  ? 67   DT  I N3    1 
ATOM   9039  C  C4    . DT  I  5 141 ? -60.212 -42.754 68.103 1.00 57.74  ? 67   DT  I C4    1 
ATOM   9040  O  O4    . DT  I  5 141 ? -60.915 -41.763 68.255 1.00 58.04  ? 67   DT  I O4    1 
ATOM   9041  C  C5    . DT  I  5 141 ? -60.674 -44.108 68.319 1.00 57.60  ? 67   DT  I C5    1 
ATOM   9042  C  C7    . DT  I  5 141 ? -62.081 -44.380 68.762 1.00 57.98  ? 67   DT  I C7    1 
ATOM   9043  C  C6    . DT  I  5 141 ? -59.809 -45.109 68.115 1.00 57.60  ? 67   DT  I C6    1 
ATOM   9044  P  P     . DA  I  5 142 ? -54.359 -48.915 67.665 1.00 66.28  ? 68   DA  I P     1 
ATOM   9045  O  OP1   . DA  I  5 142 ? -54.638 -49.551 66.350 1.00 67.19  ? 68   DA  I OP1   1 
ATOM   9046  O  OP2   . DA  I  5 142 ? -53.956 -49.739 68.837 1.00 66.15  ? 68   DA  I OP2   1 
ATOM   9047  O  "O5'" . DA  I  5 142 ? -53.214 -47.802 67.446 1.00 63.71  ? 68   DA  I "O5'" 1 
ATOM   9048  C  "C5'" . DA  I  5 142 ? -53.514 -46.575 66.762 1.00 60.11  ? 68   DA  I "C5'" 1 
ATOM   9049  C  "C4'" . DA  I  5 142 ? -52.687 -45.368 67.211 1.00 57.06  ? 68   DA  I "C4'" 1 
ATOM   9050  O  "O4'" . DA  I  5 142 ? -53.548 -44.277 67.646 1.00 54.30  ? 68   DA  I "O4'" 1 
ATOM   9051  C  "C3'" . DA  I  5 142 ? -51.671 -45.543 68.333 1.00 55.79  ? 68   DA  I "C3'" 1 
ATOM   9052  O  "O3'" . DA  I  5 142 ? -50.568 -44.696 67.992 1.00 55.57  ? 68   DA  I "O3'" 1 
ATOM   9053  C  "C2'" . DA  I  5 142 ? -52.449 -45.067 69.558 1.00 54.01  ? 68   DA  I "C2'" 1 
ATOM   9054  C  "C1'" . DA  I  5 142 ? -53.313 -43.946 68.990 1.00 51.46  ? 68   DA  I "C1'" 1 
ATOM   9055  N  N9    . DA  I  5 142 ? -54.639 -43.809 69.581 1.00 50.38  ? 68   DA  I N9    1 
ATOM   9056  C  C8    . DA  I  5 142 ? -55.489 -44.817 69.918 1.00 50.10  ? 68   DA  I C8    1 
ATOM   9057  N  N7    . DA  I  5 142 ? -56.626 -44.404 70.427 1.00 49.78  ? 68   DA  I N7    1 
ATOM   9058  C  C5    . DA  I  5 142 ? -56.513 -43.030 70.425 1.00 49.17  ? 68   DA  I C5    1 
ATOM   9059  C  C6    . DA  I  5 142 ? -57.389 -42.007 70.837 1.00 50.22  ? 68   DA  I C6    1 
ATOM   9060  N  N6    . DA  I  5 142 ? -58.599 -42.244 71.345 1.00 50.43  ? 68   DA  I N6    1 
ATOM   9061  N  N1    . DA  I  5 142 ? -56.985 -40.726 70.702 1.00 50.36  ? 68   DA  I N1    1 
ATOM   9062  C  C2    . DA  I  5 142 ? -55.771 -40.497 70.183 1.00 49.90  ? 68   DA  I C2    1 
ATOM   9063  N  N3    . DA  I  5 142 ? -54.869 -41.381 69.759 1.00 49.02  ? 68   DA  I N3    1 
ATOM   9064  C  C4    . DA  I  5 142 ? -55.300 -42.643 69.904 1.00 49.10  ? 68   DA  I C4    1 
ATOM   9065  P  P     . DT  I  5 143 ? -49.189 -44.635 68.811 1.00 54.61  ? 69   DT  I P     1 
ATOM   9066  O  OP1   . DT  I  5 143 ? -48.091 -44.436 67.833 1.00 54.62  ? 69   DT  I OP1   1 
ATOM   9067  O  OP2   . DT  I  5 143 ? -49.145 -45.764 69.773 1.00 53.79  ? 69   DT  I OP2   1 
ATOM   9068  O  "O5'" . DT  I  5 143 ? -49.396 -43.252 69.580 1.00 52.76  ? 69   DT  I "O5'" 1 
ATOM   9069  C  "C5'" . DT  I  5 143 ? -49.533 -42.082 68.786 1.00 50.10  ? 69   DT  I "C5'" 1 
ATOM   9070  C  "C4'" . DT  I  5 143 ? -49.727 -40.860 69.644 1.00 47.98  ? 69   DT  I "C4'" 1 
ATOM   9071  O  "O4'" . DT  I  5 143 ? -51.058 -40.907 70.197 1.00 48.36  ? 69   DT  I "O4'" 1 
ATOM   9072  C  "C3'" . DT  I  5 143 ? -48.778 -40.724 70.825 1.00 47.24  ? 69   DT  I "C3'" 1 
ATOM   9073  O  "O3'" . DT  I  5 143 ? -48.216 -39.421 70.714 1.00 46.55  ? 69   DT  I "O3'" 1 
ATOM   9074  C  "C2'" . DT  I  5 143 ? -49.671 -40.908 72.061 1.00 46.80  ? 69   DT  I "C2'" 1 
ATOM   9075  C  "C1'" . DT  I  5 143 ? -51.036 -40.466 71.537 1.00 46.56  ? 69   DT  I "C1'" 1 
ATOM   9076  N  N1    . DT  I  5 143 ? -52.265 -41.051 72.182 1.00 46.12  ? 69   DT  I N1    1 
ATOM   9077  C  C2    . DT  I  5 143 ? -53.298 -40.205 72.575 1.00 46.22  ? 69   DT  I C2    1 
ATOM   9078  O  O2    . DT  I  5 143 ? -53.293 -38.987 72.458 1.00 45.85  ? 69   DT  I O2    1 
ATOM   9079  N  N3    . DT  I  5 143 ? -54.371 -40.848 73.148 1.00 46.46  ? 69   DT  I N3    1 
ATOM   9080  C  C4    . DT  I  5 143 ? -54.522 -42.208 73.350 1.00 46.29  ? 69   DT  I C4    1 
ATOM   9081  O  O4    . DT  I  5 143 ? -55.538 -42.652 73.857 1.00 46.15  ? 69   DT  I O4    1 
ATOM   9082  C  C5    . DT  I  5 143 ? -53.422 -43.040 72.915 1.00 45.75  ? 69   DT  I C5    1 
ATOM   9083  C  C7    . DT  I  5 143 ? -53.481 -44.529 73.080 1.00 45.43  ? 69   DT  I C7    1 
ATOM   9084  C  C6    . DT  I  5 143 ? -52.366 -42.429 72.352 1.00 45.63  ? 69   DT  I C6    1 
ATOM   9085  P  P     . DT  I  5 144 ? -46.965 -38.935 71.592 1.00 46.33  ? 70   DT  I P     1 
ATOM   9086  O  OP1   . DT  I  5 144 ? -46.241 -37.941 70.771 1.00 46.09  ? 70   DT  I OP1   1 
ATOM   9087  O  OP2   . DT  I  5 144 ? -46.276 -40.151 72.088 1.00 45.03  ? 70   DT  I OP2   1 
ATOM   9088  O  "O5'" . DT  I  5 144 ? -47.682 -38.125 72.780 1.00 44.63  ? 70   DT  I "O5'" 1 
ATOM   9089  C  "C5'" . DT  I  5 144 ? -48.738 -37.229 72.384 1.00 44.50  ? 70   DT  I "C5'" 1 
ATOM   9090  C  "C4'" . DT  I  5 144 ? -49.535 -36.624 73.535 1.00 44.98  ? 70   DT  I "C4'" 1 
ATOM   9091  O  "O4'" . DT  I  5 144 ? -50.648 -37.474 73.930 1.00 44.83  ? 70   DT  I "O4'" 1 
ATOM   9092  C  "C3'" . DT  I  5 144 ? -48.754 -36.358 74.816 1.00 44.81  ? 70   DT  I "C3'" 1 
ATOM   9093  O  "O3'" . DT  I  5 144 ? -49.107 -35.060 75.261 1.00 44.45  ? 70   DT  I "O3'" 1 
ATOM   9094  C  "C2'" . DT  I  5 144 ? -49.207 -37.472 75.764 1.00 44.42  ? 70   DT  I "C2'" 1 
ATOM   9095  C  "C1'" . DT  I  5 144 ? -50.666 -37.606 75.337 1.00 43.09  ? 70   DT  I "C1'" 1 
ATOM   9096  N  N1    . DT  I  5 144 ? -51.329 -38.902 75.642 1.00 42.17  ? 70   DT  I N1    1 
ATOM   9097  C  C2    . DT  I  5 144 ? -52.630 -38.878 76.100 1.00 41.48  ? 70   DT  I C2    1 
ATOM   9098  O  O2    . DT  I  5 144 ? -53.267 -37.854 76.277 1.00 42.21  ? 70   DT  I O2    1 
ATOM   9099  N  N3    . DT  I  5 144 ? -53.168 -40.106 76.349 1.00 39.98  ? 70   DT  I N3    1 
ATOM   9100  C  C4    . DT  I  5 144 ? -52.548 -41.321 76.181 1.00 41.45  ? 70   DT  I C4    1 
ATOM   9101  O  O4    . DT  I  5 144 ? -53.141 -42.363 76.434 1.00 42.89  ? 70   DT  I O4    1 
ATOM   9102  C  C5    . DT  I  5 144 ? -51.184 -41.282 75.701 1.00 41.23  ? 70   DT  I C5    1 
ATOM   9103  C  C7    . DT  I  5 144 ? -50.396 -42.541 75.482 1.00 41.37  ? 70   DT  I C7    1 
ATOM   9104  C  C6    . DT  I  5 144 ? -50.649 -40.085 75.454 1.00 41.34  ? 70   DT  I C6    1 
ATOM   9105  P  P     . DG  I  5 145 ? -48.168 -34.343 76.321 1.00 44.65  ? 71   DG  I P     1 
ATOM   9106  O  OP1   . DG  I  5 145 ? -48.064 -32.899 76.002 1.00 44.31  ? 71   DG  I OP1   1 
ATOM   9107  O  OP2   . DG  I  5 145 ? -46.981 -35.195 76.520 1.00 45.63  ? 71   DG  I OP2   1 
ATOM   9108  O  "O5'" . DG  I  5 145 ? -49.047 -34.460 77.637 1.00 47.43  ? 71   DG  I "O5'" 1 
ATOM   9109  C  "C5'" . DG  I  5 145 ? -50.270 -33.688 77.728 1.00 49.95  ? 71   DG  I "C5'" 1 
ATOM   9110  C  "C4'" . DG  I  5 145 ? -51.028 -34.157 78.954 1.00 50.52  ? 71   DG  I "C4'" 1 
ATOM   9111  O  "O4'" . DG  I  5 145 ? -51.426 -35.536 78.750 1.00 50.08  ? 71   DG  I "O4'" 1 
ATOM   9112  C  "C3'" . DG  I  5 145 ? -50.132 -34.144 80.184 1.00 51.63  ? 71   DG  I "C3'" 1 
ATOM   9113  O  "O3'" . DG  I  5 145 ? -50.816 -33.487 81.240 1.00 55.02  ? 71   DG  I "O3'" 1 
ATOM   9114  C  "C2'" . DG  I  5 145 ? -49.795 -35.621 80.428 1.00 49.76  ? 71   DG  I "C2'" 1 
ATOM   9115  C  "C1'" . DG  I  5 145 ? -51.061 -36.280 79.892 1.00 47.49  ? 71   DG  I "C1'" 1 
ATOM   9116  N  N9    . DG  I  5 145 ? -51.000 -37.730 79.628 1.00 46.55  ? 71   DG  I N9    1 
ATOM   9117  C  C8    . DG  I  5 145 ? -49.953 -38.526 79.212 1.00 45.98  ? 71   DG  I C8    1 
ATOM   9118  N  N7    . DG  I  5 145 ? -50.267 -39.794 79.105 1.00 45.75  ? 71   DG  I N7    1 
ATOM   9119  C  C5    . DG  I  5 145 ? -51.610 -39.850 79.490 1.00 46.06  ? 71   DG  I C5    1 
ATOM   9120  C  C6    . DG  I  5 145 ? -52.525 -40.943 79.594 1.00 46.01  ? 71   DG  I C6    1 
ATOM   9121  O  O6    . DG  I  5 145 ? -52.319 -42.146 79.345 1.00 46.00  ? 71   DG  I O6    1 
ATOM   9122  N  N1    . DG  I  5 145 ? -53.790 -40.530 80.033 1.00 45.70  ? 71   DG  I N1    1 
ATOM   9123  C  C2    . DG  I  5 145 ? -54.130 -39.223 80.333 1.00 46.39  ? 71   DG  I C2    1 
ATOM   9124  N  N2    . DG  I  5 145 ? -55.382 -38.947 80.742 1.00 46.35  ? 71   DG  I N2    1 
ATOM   9125  N  N3    . DG  I  5 145 ? -53.285 -38.207 80.234 1.00 46.67  ? 71   DG  I N3    1 
ATOM   9126  C  C4    . DG  I  5 145 ? -52.057 -38.587 79.812 1.00 46.02  ? 71   DG  I C4    1 
ATOM   9127  P  P     . DA  I  5 146 ? -50.083 -33.196 82.645 1.00 57.60  ? 72   DA  I P     1 
ATOM   9128  O  OP1   . DA  I  5 146 ? -49.552 -31.817 82.609 1.00 56.71  ? 72   DA  I OP1   1 
ATOM   9129  O  OP2   . DA  I  5 146 ? -49.175 -34.328 82.965 1.00 56.04  ? 72   DA  I OP2   1 
ATOM   9130  O  "O5'" . DA  I  5 146 ? -51.328 -33.215 83.669 1.00 57.53  ? 72   DA  I "O5'" 1 
ATOM   9131  C  "C5'" . DA  I  5 146 ? -52.658 -32.850 83.257 1.00 57.95  ? 72   DA  I "C5'" 1 
ATOM   9132  C  "C4'" . DA  I  5 146 ? -53.685 -33.804 83.848 1.00 58.62  ? 72   DA  I "C4'" 1 
ATOM   9133  O  "O4'" . DA  I  5 146 ? -53.646 -35.061 83.127 1.00 57.08  ? 72   DA  I "O4'" 1 
ATOM   9134  C  "C3'" . DA  I  5 146 ? -53.443 -34.152 85.314 1.00 60.24  ? 72   DA  I "C3'" 1 
ATOM   9135  O  "O3'" . DA  I  5 146 ? -54.432 -33.572 86.171 1.00 65.02  ? 72   DA  I "O3'" 1 
ATOM   9136  C  "C2'" . DA  I  5 146 ? -53.523 -35.669 85.389 1.00 57.96  ? 72   DA  I "C2'" 1 
ATOM   9137  C  "C1'" . DA  I  5 146 ? -53.955 -36.115 84.003 1.00 54.29  ? 72   DA  I "C1'" 1 
ATOM   9138  N  N9    . DA  I  5 146 ? -53.140 -37.261 83.661 1.00 53.11  ? 72   DA  I N9    1 
ATOM   9139  C  C8    . DA  I  5 146 ? -51.823 -37.232 83.312 1.00 52.35  ? 72   DA  I C8    1 
ATOM   9140  N  N7    . DA  I  5 146 ? -51.310 -38.414 83.074 1.00 51.62  ? 72   DA  I N7    1 
ATOM   9141  C  C5    . DA  I  5 146 ? -52.360 -39.273 83.294 1.00 51.75  ? 72   DA  I C5    1 
ATOM   9142  C  C6    . DA  I  5 146 ? -52.447 -40.671 83.208 1.00 52.51  ? 72   DA  I C6    1 
ATOM   9143  N  N6    . DA  I  5 146 ? -51.396 -41.422 82.861 1.00 52.25  ? 72   DA  I N6    1 
ATOM   9144  N  N1    . DA  I  5 146 ? -53.644 -41.244 83.497 1.00 52.59  ? 72   DA  I N1    1 
ATOM   9145  C  C2    . DA  I  5 146 ? -54.674 -40.452 83.841 1.00 52.32  ? 72   DA  I C2    1 
ATOM   9146  N  N3    . DA  I  5 146 ? -54.703 -39.120 83.963 1.00 51.87  ? 72   DA  I N3    1 
ATOM   9147  C  C4    . DA  I  5 146 ? -53.502 -38.587 83.670 1.00 52.22  ? 72   DA  I C4    1 
ATOM   9148  P  P     . DT  I  5 147 ? -54.164 -33.455 87.758 1.00 68.61  ? 73   DT  I P     1 
ATOM   9149  O  OP1   . DT  I  5 147 ? -54.780 -32.171 88.173 1.00 66.96  ? 73   DT  I OP1   1 
ATOM   9150  O  OP2   . DT  I  5 147 ? -52.718 -33.717 88.020 1.00 66.95  ? 73   DT  I OP2   1 
ATOM   9151  O  "O5'" . DT  I  5 147 ? -55.049 -34.650 88.377 1.00 68.91  ? 73   DT  I "O5'" 1 
ATOM   9152  C  "C5'" . DT  I  5 147 ? -54.466 -35.863 88.863 1.00 69.77  ? 73   DT  I "C5'" 1 
ATOM   9153  C  "C4'" . DT  I  5 147 ? -55.438 -37.000 88.597 1.00 70.76  ? 73   DT  I "C4'" 1 
ATOM   9154  O  "O4'" . DT  I  5 147 ? -54.970 -37.802 87.484 1.00 70.03  ? 73   DT  I "O4'" 1 
ATOM   9155  C  "C3'" . DT  I  5 147 ? -55.643 -37.976 89.756 1.00 72.07  ? 73   DT  I "C3'" 1 
ATOM   9156  O  "O3'" . DT  I  5 147 ? -57.012 -38.447 89.790 1.00 73.68  ? 73   DT  I "O3'" 1 
ATOM   9157  C  "C2'" . DT  I  5 147 ? -54.640 -39.093 89.458 1.00 70.99  ? 73   DT  I "C2'" 1 
ATOM   9158  C  "C1'" . DT  I  5 147 ? -54.627 -39.102 87.930 1.00 69.29  ? 73   DT  I "C1'" 1 
ATOM   9159  N  N1    . DT  I  5 147 ? -53.314 -39.531 87.328 1.00 68.43  ? 73   DT  I N1    1 
ATOM   9160  C  C2    . DT  I  5 147 ? -53.145 -40.868 87.028 1.00 68.07  ? 73   DT  I C2    1 
ATOM   9161  O  O2    . DT  I  5 147 ? -53.994 -41.719 87.223 1.00 68.40  ? 73   DT  I O2    1 
ATOM   9162  N  N3    . DT  I  5 147 ? -51.936 -41.192 86.477 1.00 67.84  ? 73   DT  I N3    1 
ATOM   9163  C  C4    . DT  I  5 147 ? -50.891 -40.335 86.198 1.00 68.34  ? 73   DT  I C4    1 
ATOM   9164  O  O4    . DT  I  5 147 ? -49.853 -40.770 85.703 1.00 68.24  ? 73   DT  I O4    1 
ATOM   9165  C  C5    . DT  I  5 147 ? -51.125 -38.938 86.536 1.00 68.05  ? 73   DT  I C5    1 
ATOM   9166  C  C7    . DT  I  5 147 ? -50.077 -37.885 86.295 1.00 68.05  ? 73   DT  I C7    1 
ATOM   9167  C  C6    . DT  I  5 147 ? -52.310 -38.611 87.080 1.00 67.74  ? 73   DT  I C6    1 
ATOM   9168  O  "O5'" . DA  J  6 1   ? -49.939 -51.299 84.579 1.00 72.17  ? -73  DA  J "O5'" 1 
ATOM   9169  C  "C5'" . DA  J  6 1   ? -51.207 -51.876 84.926 1.00 72.29  ? -73  DA  J "C5'" 1 
ATOM   9170  C  "C4'" . DA  J  6 1   ? -52.037 -50.994 85.853 1.00 72.21  ? -73  DA  J "C4'" 1 
ATOM   9171  O  "O4'" . DA  J  6 1   ? -51.212 -49.983 86.485 1.00 71.39  ? -73  DA  J "O4'" 1 
ATOM   9172  C  "C3'" . DA  J  6 1   ? -53.135 -50.180 85.177 1.00 73.11  ? -73  DA  J "C3'" 1 
ATOM   9173  O  "O3'" . DA  J  6 1   ? -54.317 -50.947 85.009 1.00 75.97  ? -73  DA  J "O3'" 1 
ATOM   9174  C  "C2'" . DA  J  6 1   ? -53.385 -49.037 86.155 1.00 71.24  ? -73  DA  J "C2'" 1 
ATOM   9175  C  "C1'" . DA  J  6 1   ? -51.994 -48.822 86.732 1.00 68.52  ? -73  DA  J "C1'" 1 
ATOM   9176  N  N9    . DA  J  6 1   ? -51.299 -47.640 86.221 1.00 67.47  ? -73  DA  J N9    1 
ATOM   9177  C  C8    . DA  J  6 1   ? -50.141 -47.606 85.492 1.00 66.67  ? -73  DA  J C8    1 
ATOM   9178  N  N7    . DA  J  6 1   ? -49.747 -46.390 85.197 1.00 66.51  ? -73  DA  J N7    1 
ATOM   9179  C  C5    . DA  J  6 1   ? -50.711 -45.572 85.767 1.00 66.54  ? -73  DA  J C5    1 
ATOM   9180  C  C6    . DA  J  6 1   ? -50.879 -44.171 85.816 1.00 66.74  ? -73  DA  J C6    1 
ATOM   9181  N  N6    . DA  J  6 1   ? -50.035 -43.301 85.251 1.00 66.75  ? -73  DA  J N6    1 
ATOM   9182  N  N1    . DA  J  6 1   ? -51.957 -43.689 86.472 1.00 66.56  ? -73  DA  J N1    1 
ATOM   9183  C  C2    . DA  J  6 1   ? -52.814 -44.542 87.043 1.00 66.66  ? -73  DA  J C2    1 
ATOM   9184  N  N3    . DA  J  6 1   ? -52.761 -45.874 87.065 1.00 66.94  ? -73  DA  J N3    1 
ATOM   9185  C  C4    . DA  J  6 1   ? -51.677 -46.329 86.407 1.00 66.92  ? -73  DA  J C4    1 
ATOM   9186  P  P     . DT  J  6 2   ? -55.347 -50.561 83.841 1.00 78.34  ? -72  DT  J P     1 
ATOM   9187  O  OP1   . DT  J  6 2   ? -56.225 -51.735 83.633 1.00 78.32  ? -72  DT  J OP1   1 
ATOM   9188  O  OP2   . DT  J  6 2   ? -54.579 -50.015 82.693 1.00 78.32  ? -72  DT  J OP2   1 
ATOM   9189  O  "O5'" . DT  J  6 2   ? -56.173 -49.341 84.463 1.00 76.87  ? -72  DT  J "O5'" 1 
ATOM   9190  C  "C5'" . DT  J  6 2   ? -56.858 -49.450 85.697 1.00 76.28  ? -72  DT  J "C5'" 1 
ATOM   9191  C  "C4'" . DT  J  6 2   ? -57.610 -48.156 85.898 1.00 76.22  ? -72  DT  J "C4'" 1 
ATOM   9192  O  "O4'" . DT  J  6 2   ? -56.662 -47.060 86.013 1.00 75.06  ? -72  DT  J "O4'" 1 
ATOM   9193  C  "C3'" . DT  J  6 2   ? -58.501 -47.844 84.706 1.00 76.97  ? -72  DT  J "C3'" 1 
ATOM   9194  O  "O3'" . DT  J  6 2   ? -59.759 -47.362 85.112 1.00 79.13  ? -72  DT  J "O3'" 1 
ATOM   9195  C  "C2'" . DT  J  6 2   ? -57.741 -46.765 83.948 1.00 76.05  ? -72  DT  J "C2'" 1 
ATOM   9196  C  "C1'" . DT  J  6 2   ? -56.955 -46.069 85.049 1.00 73.57  ? -72  DT  J "C1'" 1 
ATOM   9197  N  N1    . DT  J  6 2   ? -55.718 -45.499 84.454 1.00 72.63  ? -72  DT  J N1    1 
ATOM   9198  C  C2    . DT  J  6 2   ? -55.567 -44.127 84.383 1.00 71.31  ? -72  DT  J C2    1 
ATOM   9199  O  O2    . DT  J  6 2   ? -56.379 -43.331 84.808 1.00 71.09  ? -72  DT  J O2    1 
ATOM   9200  N  N3    . DT  J  6 2   ? -54.400 -43.720 83.797 1.00 70.69  ? -72  DT  J N3    1 
ATOM   9201  C  C4    . DT  J  6 2   ? -53.404 -44.531 83.277 1.00 71.65  ? -72  DT  J C4    1 
ATOM   9202  O  O4    . DT  J  6 2   ? -52.394 -44.060 82.773 1.00 71.94  ? -72  DT  J O4    1 
ATOM   9203  C  C5    . DT  J  6 2   ? -53.623 -45.958 83.370 1.00 71.56  ? -72  DT  J C5    1 
ATOM   9204  C  C7    . DT  J  6 2   ? -52.607 -46.935 82.847 1.00 71.61  ? -72  DT  J C7    1 
ATOM   9205  C  C6    . DT  J  6 2   ? -54.762 -46.368 83.943 1.00 72.09  ? -72  DT  J C6    1 
ATOM   9206  P  P     . DC  J  6 3   ? -60.934 -47.286 84.021 1.00 81.42  ? -71  DC  J P     1 
ATOM   9207  O  OP1   . DC  J  6 3   ? -62.006 -48.199 84.488 1.00 81.76  ? -71  DC  J OP1   1 
ATOM   9208  O  OP2   . DC  J  6 3   ? -60.384 -47.513 82.658 1.00 80.63  ? -71  DC  J OP2   1 
ATOM   9209  O  "O5'" . DC  J  6 3   ? -61.444 -45.757 84.156 1.00 81.09  ? -71  DC  J "O5'" 1 
ATOM   9210  C  "C5'" . DC  J  6 3   ? -60.605 -44.679 84.631 1.00 80.96  ? -71  DC  J "C5'" 1 
ATOM   9211  C  "C4'" . DC  J  6 3   ? -60.589 -43.516 83.643 1.00 81.20  ? -71  DC  J "C4'" 1 
ATOM   9212  O  "O4'" . DC  J  6 3   ? -59.237 -43.236 83.168 1.00 80.97  ? -71  DC  J "O4'" 1 
ATOM   9213  C  "C3'" . DC  J  6 3   ? -61.416 -43.709 82.370 1.00 81.30  ? -71  DC  J "C3'" 1 
ATOM   9214  O  "O3'" . DC  J  6 3   ? -61.974 -42.455 81.999 1.00 81.36  ? -71  DC  J "O3'" 1 
ATOM   9215  C  "C2'" . DC  J  6 3   ? -60.362 -44.139 81.349 1.00 80.91  ? -71  DC  J "C2'" 1 
ATOM   9216  C  "C1'" . DC  J  6 3   ? -59.248 -43.171 81.744 1.00 80.08  ? -71  DC  J "C1'" 1 
ATOM   9217  N  N1    . DC  J  6 3   ? -57.881 -43.485 81.187 1.00 79.32  ? -71  DC  J N1    1 
ATOM   9218  C  C2    . DC  J  6 3   ? -56.898 -42.480 81.105 1.00 78.25  ? -71  DC  J C2    1 
ATOM   9219  O  O2    . DC  J  6 3   ? -57.151 -41.329 81.482 1.00 77.99  ? -71  DC  J O2    1 
ATOM   9220  N  N3    . DC  J  6 3   ? -55.677 -42.811 80.609 1.00 78.15  ? -71  DC  J N3    1 
ATOM   9221  C  C4    . DC  J  6 3   ? -55.421 -44.067 80.206 1.00 79.00  ? -71  DC  J C4    1 
ATOM   9222  N  N4    . DC  J  6 3   ? -54.207 -44.345 79.722 1.00 78.75  ? -71  DC  J N4    1 
ATOM   9223  C  C5    . DC  J  6 3   ? -56.400 -45.104 80.276 1.00 78.79  ? -71  DC  J C5    1 
ATOM   9224  C  C6    . DC  J  6 3   ? -57.598 -44.764 80.771 1.00 79.53  ? -71  DC  J C6    1 
ATOM   9225  P  P     . DA  J  6 4   ? -63.218 -42.369 80.989 1.00 81.18  ? -70  DA  J P     1 
ATOM   9226  O  OP1   . DA  J  6 4   ? -64.380 -42.858 81.768 1.00 81.83  ? -70  DA  J OP1   1 
ATOM   9227  O  OP2   . DA  J  6 4   ? -62.899 -43.043 79.702 1.00 80.44  ? -70  DA  J OP2   1 
ATOM   9228  O  "O5'" . DA  J  6 4   ? -63.363 -40.780 80.730 1.00 78.30  ? -70  DA  J "O5'" 1 
ATOM   9229  C  "C5'" . DA  J  6 4   ? -62.899 -39.772 81.653 1.00 73.55  ? -70  DA  J "C5'" 1 
ATOM   9230  C  "C4'" . DA  J  6 4   ? -62.069 -38.683 80.965 1.00 70.75  ? -70  DA  J "C4'" 1 
ATOM   9231  O  "O4'" . DA  J  6 4   ? -60.714 -39.103 80.600 1.00 68.80  ? -70  DA  J "O4'" 1 
ATOM   9232  C  "C3'" . DA  J  6 4   ? -62.652 -38.063 79.699 1.00 69.56  ? -70  DA  J "C3'" 1 
ATOM   9233  O  "O3'" . DA  J  6 4   ? -62.518 -36.655 79.826 1.00 69.91  ? -70  DA  J "O3'" 1 
ATOM   9234  C  "C2'" . DA  J  6 4   ? -61.798 -38.653 78.568 1.00 67.39  ? -70  DA  J "C2'" 1 
ATOM   9235  C  "C1'" . DA  J  6 4   ? -60.435 -38.803 79.240 1.00 64.56  ? -70  DA  J "C1'" 1 
ATOM   9236  N  N9    . DA  J  6 4   ? -59.553 -39.873 78.760 1.00 63.44  ? -70  DA  J N9    1 
ATOM   9237  C  C8    . DA  J  6 4   ? -59.830 -41.214 78.715 1.00 62.81  ? -70  DA  J C8    1 
ATOM   9238  N  N7    . DA  J  6 4   ? -58.851 -41.967 78.276 1.00 62.29  ? -70  DA  J N7    1 
ATOM   9239  C  C5    . DA  J  6 4   ? -57.856 -41.049 78.018 1.00 62.09  ? -70  DA  J C5    1 
ATOM   9240  C  C6    . DA  J  6 4   ? -56.557 -41.207 77.526 1.00 62.05  ? -70  DA  J C6    1 
ATOM   9241  N  N6    . DA  J  6 4   ? -56.066 -42.400 77.208 1.00 62.00  ? -70  DA  J N6    1 
ATOM   9242  N  N1    . DA  J  6 4   ? -55.796 -40.101 77.378 1.00 62.46  ? -70  DA  J N1    1 
ATOM   9243  C  C2    . DA  J  6 4   ? -56.310 -38.907 77.701 1.00 62.17  ? -70  DA  J C2    1 
ATOM   9244  N  N3    . DA  J  6 4   ? -57.525 -38.635 78.176 1.00 62.08  ? -70  DA  J N3    1 
ATOM   9245  C  C4    . DA  J  6 4   ? -58.257 -39.757 78.311 1.00 62.55  ? -70  DA  J C4    1 
ATOM   9246  P  P     . DA  J  6 5   ? -63.194 -35.655 78.777 1.00 71.40  ? -69  DA  J P     1 
ATOM   9247  O  OP1   . DA  J  6 5   ? -63.700 -34.473 79.518 1.00 71.11  ? -69  DA  J OP1   1 
ATOM   9248  O  OP2   . DA  J  6 5   ? -64.088 -36.413 77.867 1.00 71.42  ? -69  DA  J OP2   1 
ATOM   9249  O  "O5'" . DA  J  6 5   ? -61.943 -35.230 77.877 1.00 70.95  ? -69  DA  J "O5'" 1 
ATOM   9250  C  "C5'" . DA  J  6 5   ? -61.021 -34.183 78.243 1.00 67.33  ? -69  DA  J "C5'" 1 
ATOM   9251  C  "C4'" . DA  J  6 5   ? -59.989 -33.997 77.133 1.00 64.05  ? -69  DA  J "C4'" 1 
ATOM   9252  O  "O4'" . DA  J  6 5   ? -59.261 -35.228 76.838 1.00 62.53  ? -69  DA  J "O4'" 1 
ATOM   9253  C  "C3'" . DA  J  6 5   ? -60.580 -33.512 75.818 1.00 62.09  ? -69  DA  J "C3'" 1 
ATOM   9254  O  "O3'" . DA  J  6 5   ? -59.814 -32.359 75.469 1.00 61.46  ? -69  DA  J "O3'" 1 
ATOM   9255  C  "C2'" . DA  J  6 5   ? -60.437 -34.726 74.885 1.00 60.61  ? -69  DA  J "C2'" 1 
ATOM   9256  C  "C1'" . DA  J  6 5   ? -59.216 -35.456 75.449 1.00 59.36  ? -69  DA  J "C1'" 1 
ATOM   9257  N  N9    . DA  J  6 5   ? -59.148 -36.913 75.278 1.00 58.85  ? -69  DA  J N9    1 
ATOM   9258  C  C8    . DA  J  6 5   ? -60.130 -37.826 75.532 1.00 58.72  ? -69  DA  J C8    1 
ATOM   9259  N  N7    . DA  J  6 5   ? -59.787 -39.077 75.300 1.00 58.48  ? -69  DA  J N7    1 
ATOM   9260  C  C5    . DA  J  6 5   ? -58.487 -38.992 74.864 1.00 57.58  ? -69  DA  J C5    1 
ATOM   9261  C  C6    . DA  J  6 5   ? -57.559 -39.970 74.454 1.00 57.87  ? -69  DA  J C6    1 
ATOM   9262  N  N6    . DA  J  6 5   ? -57.824 -41.270 74.424 1.00 57.96  ? -69  DA  J N6    1 
ATOM   9263  N  N1    . DA  J  6 5   ? -56.333 -39.565 74.073 1.00 58.34  ? -69  DA  J N1    1 
ATOM   9264  C  C2    . DA  J  6 5   ? -56.065 -38.252 74.108 1.00 58.61  ? -69  DA  J C2    1 
ATOM   9265  N  N3    . DA  J  6 5   ? -56.860 -37.237 74.471 1.00 58.13  ? -69  DA  J N3    1 
ATOM   9266  C  C4    . DA  J  6 5   ? -58.074 -37.671 74.844 1.00 58.26  ? -69  DA  J C4    1 
ATOM   9267  P  P     . DT  J  6 6   ? -60.350 -31.175 74.529 1.00 61.51  ? -68  DT  J P     1 
ATOM   9268  O  OP1   . DT  J  6 6   ? -60.129 -29.883 75.219 1.00 61.14  ? -68  DT  J OP1   1 
ATOM   9269  O  OP2   . DT  J  6 6   ? -61.670 -31.539 73.957 1.00 61.04  ? -68  DT  J OP2   1 
ATOM   9270  O  "O5'" . DT  J  6 6   ? -59.293 -31.282 73.341 1.00 61.49  ? -68  DT  J "O5'" 1 
ATOM   9271  C  "C5'" . DT  J  6 6   ? -58.970 -32.601 72.949 1.00 60.20  ? -68  DT  J "C5'" 1 
ATOM   9272  C  "C4'" . DT  J  6 6   ? -57.677 -32.700 72.188 1.00 58.57  ? -68  DT  J "C4'" 1 
ATOM   9273  O  "O4'" . DT  J  6 6   ? -57.249 -34.081 72.286 1.00 57.92  ? -68  DT  J "O4'" 1 
ATOM   9274  C  "C3'" . DT  J  6 6   ? -57.871 -32.415 70.708 1.00 57.61  ? -68  DT  J "C3'" 1 
ATOM   9275  O  "O3'" . DT  J  6 6   ? -56.667 -31.880 70.167 1.00 56.43  ? -68  DT  J "O3'" 1 
ATOM   9276  C  "C2'" . DT  J  6 6   ? -58.254 -33.786 70.152 1.00 56.81  ? -68  DT  J "C2'" 1 
ATOM   9277  C  "C1'" . DT  J  6 6   ? -57.456 -34.733 71.049 1.00 56.90  ? -68  DT  J "C1'" 1 
ATOM   9278  N  N1    . DT  J  6 6   ? -58.112 -36.066 71.256 1.00 56.39  ? -68  DT  J N1    1 
ATOM   9279  C  C2    . DT  J  6 6   ? -57.350 -37.209 71.081 1.00 56.62  ? -68  DT  J C2    1 
ATOM   9280  O  O2    . DT  J  6 6   ? -56.172 -37.203 70.784 1.00 56.54  ? -68  DT  J O2    1 
ATOM   9281  N  N3    . DT  J  6 6   ? -58.016 -38.393 71.271 1.00 56.88  ? -68  DT  J N3    1 
ATOM   9282  C  C4    . DT  J  6 6   ? -59.346 -38.555 71.604 1.00 56.56  ? -68  DT  J C4    1 
ATOM   9283  O  O4    . DT  J  6 6   ? -59.821 -39.673 71.742 1.00 55.86  ? -68  DT  J O4    1 
ATOM   9284  C  C5    . DT  J  6 6   ? -60.099 -37.324 71.767 1.00 56.71  ? -68  DT  J C5    1 
ATOM   9285  C  C7    . DT  J  6 6   ? -61.558 -37.362 72.130 1.00 56.77  ? -68  DT  J C7    1 
ATOM   9286  C  C6    . DT  J  6 6   ? -59.455 -36.152 71.585 1.00 56.33  ? -68  DT  J C6    1 
ATOM   9287  P  P     . DA  J  6 7   ? -56.560 -31.354 68.656 1.00 55.75  ? -67  DA  J P     1 
ATOM   9288  O  OP1   . DA  J  6 7   ? -55.700 -30.155 68.736 1.00 56.02  ? -67  DA  J OP1   1 
ATOM   9289  O  OP2   . DA  J  6 7   ? -57.893 -31.260 68.011 1.00 54.99  ? -67  DA  J OP2   1 
ATOM   9290  O  "O5'" . DA  J  6 7   ? -55.740 -32.543 67.970 1.00 53.56  ? -67  DA  J "O5'" 1 
ATOM   9291  C  "C5'" . DA  J  6 7   ? -54.554 -32.866 68.654 1.00 52.38  ? -67  DA  J "C5'" 1 
ATOM   9292  C  "C4'" . DA  J  6 7   ? -53.835 -34.062 68.083 1.00 51.64  ? -67  DA  J "C4'" 1 
ATOM   9293  O  "O4'" . DA  J  6 7   ? -54.567 -35.270 68.374 1.00 51.16  ? -67  DA  J "O4'" 1 
ATOM   9294  C  "C3'" . DA  J  6 7   ? -53.638 -34.046 66.582 1.00 51.88  ? -67  DA  J "C3'" 1 
ATOM   9295  O  "O3'" . DA  J  6 7   ? -52.403 -34.707 66.381 1.00 53.42  ? -67  DA  J "O3'" 1 
ATOM   9296  C  "C2'" . DA  J  6 7   ? -54.833 -34.841 66.075 1.00 50.40  ? -67  DA  J "C2'" 1 
ATOM   9297  C  "C1'" . DA  J  6 7   ? -54.952 -35.900 67.168 1.00 48.90  ? -67  DA  J "C1'" 1 
ATOM   9298  N  N9    . DA  J  6 7   ? -56.297 -36.428 67.386 1.00 48.11  ? -67  DA  J N9    1 
ATOM   9299  C  C8    . DA  J  6 7   ? -57.420 -35.698 67.648 1.00 47.54  ? -67  DA  J C8    1 
ATOM   9300  N  N7    . DA  J  6 7   ? -58.496 -36.426 67.807 1.00 47.60  ? -67  DA  J N7    1 
ATOM   9301  C  C5    . DA  J  6 7   ? -58.046 -37.721 67.643 1.00 47.18  ? -67  DA  J C5    1 
ATOM   9302  C  C6    . DA  J  6 7   ? -58.711 -38.958 67.695 1.00 47.42  ? -67  DA  J C6    1 
ATOM   9303  N  N6    . DA  J  6 7   ? -60.014 -39.066 67.937 1.00 47.18  ? -67  DA  J N6    1 
ATOM   9304  N  N1    . DA  J  6 7   ? -57.979 -40.074 67.485 1.00 47.76  ? -67  DA  J N1    1 
ATOM   9305  C  C2    . DA  J  6 7   ? -56.664 -39.941 67.239 1.00 47.54  ? -67  DA  J C2    1 
ATOM   9306  N  N3    . DA  J  6 7   ? -55.929 -38.830 67.167 1.00 46.34  ? -67  DA  J N3    1 
ATOM   9307  C  C4    . DA  J  6 7   ? -56.689 -37.746 67.384 1.00 46.96  ? -67  DA  J C4    1 
ATOM   9308  P  P     . DT  J  6 8   ? -51.604 -34.614 65.002 1.00 54.58  ? -66  DT  J P     1 
ATOM   9309  O  OP1   . DT  J  6 8   ? -50.163 -34.727 65.352 1.00 54.47  ? -66  DT  J OP1   1 
ATOM   9310  O  OP2   . DT  J  6 8   ? -52.136 -33.487 64.190 1.00 53.33  ? -66  DT  J OP2   1 
ATOM   9311  O  "O5'" . DT  J  6 8   ? -52.021 -36.001 64.328 1.00 54.18  ? -66  DT  J "O5'" 1 
ATOM   9312  C  "C5'" . DT  J  6 8   ? -51.591 -37.192 64.985 1.00 54.28  ? -66  DT  J "C5'" 1 
ATOM   9313  C  "C4'" . DT  J  6 8   ? -52.037 -38.425 64.234 1.00 55.06  ? -66  DT  J "C4'" 1 
ATOM   9314  O  "O4'" . DT  J  6 8   ? -53.393 -38.768 64.603 1.00 55.11  ? -66  DT  J "O4'" 1 
ATOM   9315  C  "C3'" . DT  J  6 8   ? -52.069 -38.300 62.717 1.00 56.33  ? -66  DT  J "C3'" 1 
ATOM   9316  O  "O3'" . DT  J  6 8   ? -51.747 -39.583 62.231 1.00 58.80  ? -66  DT  J "O3'" 1 
ATOM   9317  C  "C2'" . DT  J  6 8   ? -53.524 -37.954 62.420 1.00 54.57  ? -66  DT  J "C2'" 1 
ATOM   9318  C  "C1'" . DT  J  6 8   ? -54.154 -38.913 63.419 1.00 53.68  ? -66  DT  J "C1'" 1 
ATOM   9319  N  N1    . DT  J  6 8   ? -55.598 -38.688 63.722 1.00 53.48  ? -66  DT  J N1    1 
ATOM   9320  C  C2    . DT  J  6 8   ? -56.400 -39.797 63.923 1.00 52.10  ? -66  DT  J C2    1 
ATOM   9321  O  O2    . DT  J  6 8   ? -55.988 -40.944 63.868 1.00 52.11  ? -66  DT  J O2    1 
ATOM   9322  N  N3    . DT  J  6 8   ? -57.711 -39.503 64.187 1.00 51.30  ? -66  DT  J N3    1 
ATOM   9323  C  C4    . DT  J  6 8   ? -58.286 -38.244 64.280 1.00 52.93  ? -66  DT  J C4    1 
ATOM   9324  O  O4    . DT  J  6 8   ? -59.487 -38.105 64.532 1.00 53.37  ? -66  DT  J O4    1 
ATOM   9325  C  C5    . DT  J  6 8   ? -57.389 -37.117 64.060 1.00 52.85  ? -66  DT  J C5    1 
ATOM   9326  C  C7    . DT  J  6 8   ? -57.878 -35.696 64.126 1.00 51.91  ? -66  DT  J C7    1 
ATOM   9327  C  C6    . DT  J  6 8   ? -56.102 -37.395 63.793 1.00 53.16  ? -66  DT  J C6    1 
ATOM   9328  P  P     . DC  J  6 9   ? -50.975 -39.808 60.849 1.00 60.65  ? -65  DC  J P     1 
ATOM   9329  O  OP1   . DC  J  6 9   ? -49.543 -40.032 61.206 1.00 60.12  ? -65  DC  J OP1   1 
ATOM   9330  O  OP2   . DC  J  6 9   ? -51.404 -38.749 59.897 1.00 58.97  ? -65  DC  J OP2   1 
ATOM   9331  O  "O5'" . DC  J  6 9   ? -51.588 -41.198 60.337 1.00 59.37  ? -65  DC  J "O5'" 1 
ATOM   9332  C  "C5'" . DC  J  6 9   ? -51.848 -42.259 61.249 1.00 59.19  ? -65  DC  J "C5'" 1 
ATOM   9333  C  "C4'" . DC  J  6 9   ? -53.153 -42.921 60.864 1.00 59.35  ? -65  DC  J "C4'" 1 
ATOM   9334  O  "O4'" . DC  J  6 9   ? -54.292 -42.189 61.390 1.00 58.81  ? -65  DC  J "O4'" 1 
ATOM   9335  C  "C3'" . DC  J  6 9   ? -53.359 -42.945 59.361 1.00 59.23  ? -65  DC  J "C3'" 1 
ATOM   9336  O  "O3'" . DC  J  6 9   ? -52.996 -44.229 58.910 1.00 61.57  ? -65  DC  J "O3'" 1 
ATOM   9337  C  "C2'" . DC  J  6 9   ? -54.843 -42.660 59.155 1.00 57.80  ? -65  DC  J "C2'" 1 
ATOM   9338  C  "C1'" . DC  J  6 9   ? -55.400 -42.440 60.553 1.00 55.57  ? -65  DC  J "C1'" 1 
ATOM   9339  N  N1    . DC  J  6 9   ? -56.316 -41.286 60.658 1.00 54.24  ? -65  DC  J N1    1 
ATOM   9340  C  C2    . DC  J  6 9   ? -57.658 -41.514 60.948 1.00 53.89  ? -65  DC  J C2    1 
ATOM   9341  O  O2    . DC  J  6 9   ? -58.019 -42.685 61.090 1.00 54.37  ? -65  DC  J O2    1 
ATOM   9342  N  N3    . DC  J  6 9   ? -58.508 -40.452 61.058 1.00 52.77  ? -65  DC  J N3    1 
ATOM   9343  C  C4    . DC  J  6 9   ? -58.046 -39.210 60.887 1.00 53.20  ? -65  DC  J C4    1 
ATOM   9344  N  N4    . DC  J  6 9   ? -58.892 -38.195 60.991 1.00 53.78  ? -65  DC  J N4    1 
ATOM   9345  C  C5    . DC  J  6 9   ? -56.684 -38.948 60.588 1.00 53.81  ? -65  DC  J C5    1 
ATOM   9346  C  C6    . DC  J  6 9   ? -55.865 -40.009 60.483 1.00 54.66  ? -65  DC  J C6    1 
ATOM   9347  P  P     . DC  J  6 10  ? -52.887 -44.545 57.343 1.00 63.06  ? -64  DC  J P     1 
ATOM   9348  O  OP1   . DC  J  6 10  ? -51.819 -45.554 57.148 1.00 62.27  ? -64  DC  J OP1   1 
ATOM   9349  O  OP2   . DC  J  6 10  ? -52.920 -43.269 56.580 1.00 61.74  ? -64  DC  J OP2   1 
ATOM   9350  O  "O5'" . DC  J  6 10  ? -54.280 -45.274 57.107 1.00 62.54  ? -64  DC  J "O5'" 1 
ATOM   9351  C  "C5'" . DC  J  6 10  ? -54.780 -46.226 58.048 1.00 61.87  ? -64  DC  J "C5'" 1 
ATOM   9352  C  "C4'" . DC  J  6 10  ? -56.161 -46.635 57.576 1.00 60.54  ? -64  DC  J "C4'" 1 
ATOM   9353  O  "O4'" . DC  J  6 10  ? -57.090 -45.580 57.924 1.00 59.01  ? -64  DC  J "O4'" 1 
ATOM   9354  C  "C3'" . DC  J  6 10  ? -56.234 -46.806 56.059 1.00 60.83  ? -64  DC  J "C3'" 1 
ATOM   9355  O  "O3'" . DC  J  6 10  ? -56.826 -48.071 55.769 1.00 62.43  ? -64  DC  J "O3'" 1 
ATOM   9356  C  "C2'" . DC  J  6 10  ? -57.006 -45.582 55.537 1.00 58.92  ? -64  DC  J "C2'" 1 
ATOM   9357  C  "C1'" . DC  J  6 10  ? -57.769 -45.111 56.774 1.00 56.52  ? -64  DC  J "C1'" 1 
ATOM   9358  N  N1    . DC  J  6 10  ? -57.955 -43.628 56.944 1.00 55.06  ? -64  DC  J N1    1 
ATOM   9359  C  C2    . DC  J  6 10  ? -59.191 -43.179 57.433 1.00 54.17  ? -64  DC  J C2    1 
ATOM   9360  O  O2    . DC  J  6 10  ? -60.073 -44.002 57.693 1.00 53.98  ? -64  DC  J O2    1 
ATOM   9361  N  N3    . DC  J  6 10  ? -59.397 -41.852 57.603 1.00 53.44  ? -64  DC  J N3    1 
ATOM   9362  C  C4    . DC  J  6 10  ? -58.422 -40.994 57.320 1.00 53.52  ? -64  DC  J C4    1 
ATOM   9363  N  N4    . DC  J  6 10  ? -58.690 -39.706 57.519 1.00 53.95  ? -64  DC  J N4    1 
ATOM   9364  C  C5    . DC  J  6 10  ? -57.153 -41.417 56.823 1.00 53.28  ? -64  DC  J C5    1 
ATOM   9365  C  C6    . DC  J  6 10  ? -56.962 -42.733 56.649 1.00 54.02  ? -64  DC  J C6    1 
ATOM   9366  P  P     . DA  J  6 11  ? -57.238 -48.521 54.281 1.00 64.33  ? -63  DA  J P     1 
ATOM   9367  O  OP1   . DA  J  6 11  ? -57.258 -50.011 54.297 1.00 63.02  ? -63  DA  J OP1   1 
ATOM   9368  O  OP2   . DA  J  6 11  ? -56.465 -47.757 53.258 1.00 62.46  ? -63  DA  J OP2   1 
ATOM   9369  O  "O5'" . DA  J  6 11  ? -58.746 -47.992 54.235 1.00 63.21  ? -63  DA  J "O5'" 1 
ATOM   9370  C  "C5'" . DA  J  6 11  ? -59.777 -48.810 54.759 1.00 61.91  ? -63  DA  J "C5'" 1 
ATOM   9371  C  "C4'" . DA  J  6 11  ? -61.087 -48.303 54.223 1.00 60.67  ? -63  DA  J "C4'" 1 
ATOM   9372  O  "O4'" . DA  J  6 11  ? -61.224 -46.957 54.728 1.00 58.60  ? -63  DA  J "O4'" 1 
ATOM   9373  C  "C3'" . DA  J  6 11  ? -61.135 -48.249 52.697 1.00 61.04  ? -63  DA  J "C3'" 1 
ATOM   9374  O  "O3'" . DA  J  6 11  ? -62.155 -49.152 52.209 1.00 63.06  ? -63  DA  J "O3'" 1 
ATOM   9375  C  "C2'" . DA  J  6 11  ? -61.391 -46.772 52.391 1.00 59.74  ? -63  DA  J "C2'" 1 
ATOM   9376  C  "C1'" . DA  J  6 11  ? -61.772 -46.142 53.733 1.00 57.62  ? -63  DA  J "C1'" 1 
ATOM   9377  N  N9    . DA  J  6 11  ? -61.196 -44.815 53.889 1.00 56.97  ? -63  DA  J N9    1 
ATOM   9378  C  C8    . DA  J  6 11  ? -59.891 -44.461 53.667 1.00 56.83  ? -63  DA  J C8    1 
ATOM   9379  N  N7    . DA  J  6 11  ? -59.636 -43.191 53.871 1.00 56.48  ? -63  DA  J N7    1 
ATOM   9380  C  C5    . DA  J  6 11  ? -60.858 -42.680 54.251 1.00 55.69  ? -63  DA  J C5    1 
ATOM   9381  C  C6    . DA  J  6 11  ? -61.249 -41.384 54.602 1.00 55.99  ? -63  DA  J C6    1 
ATOM   9382  N  N6    . DA  J  6 11  ? -60.392 -40.368 54.616 1.00 56.36  ? -63  DA  J N6    1 
ATOM   9383  N  N1    . DA  J  6 11  ? -62.542 -41.178 54.931 1.00 56.56  ? -63  DA  J N1    1 
ATOM   9384  C  C2    . DA  J  6 11  ? -63.380 -42.227 54.902 1.00 56.99  ? -63  DA  J C2    1 
ATOM   9385  N  N3    . DA  J  6 11  ? -63.121 -43.506 54.590 1.00 56.62  ? -63  DA  J N3    1 
ATOM   9386  C  C4    . DA  J  6 11  ? -61.831 -43.661 54.267 1.00 56.18  ? -63  DA  J C4    1 
ATOM   9387  P  P     . DC  J  6 12  ? -62.685 -49.160 50.689 1.00 64.36  ? -62  DC  J P     1 
ATOM   9388  O  OP1   . DC  J  6 12  ? -63.550 -50.350 50.491 1.00 64.28  ? -62  DC  J OP1   1 
ATOM   9389  O  OP2   . DC  J  6 12  ? -61.520 -48.945 49.799 1.00 63.67  ? -62  DC  J OP2   1 
ATOM   9390  O  "O5'" . DC  J  6 12  ? -63.628 -47.866 50.643 1.00 64.25  ? -62  DC  J "O5'" 1 
ATOM   9391  C  "C5'" . DC  J  6 12  ? -64.632 -47.662 51.635 1.00 64.93  ? -62  DC  J "C5'" 1 
ATOM   9392  C  "C4'" . DC  J  6 12  ? -65.313 -46.337 51.380 1.00 65.62  ? -62  DC  J "C4'" 1 
ATOM   9393  O  "O4'" . DC  J  6 12  ? -64.433 -45.278 51.848 1.00 65.36  ? -62  DC  J "O4'" 1 
ATOM   9394  C  "C3'" . DC  J  6 12  ? -65.589 -46.058 49.898 1.00 66.45  ? -62  DC  J "C3'" 1 
ATOM   9395  O  "O3'" . DC  J  6 12  ? -66.981 -45.762 49.659 1.00 68.62  ? -62  DC  J "O3'" 1 
ATOM   9396  C  "C2'" . DC  J  6 12  ? -64.702 -44.849 49.606 1.00 66.19  ? -62  DC  J "C2'" 1 
ATOM   9397  C  "C1'" . DC  J  6 12  ? -64.620 -44.182 50.976 1.00 64.28  ? -62  DC  J "C1'" 1 
ATOM   9398  N  N1    . DC  J  6 12  ? -63.516 -43.157 51.057 1.00 63.38  ? -62  DC  J N1    1 
ATOM   9399  C  C2    . DC  J  6 12  ? -63.792 -41.815 51.426 1.00 62.35  ? -62  DC  J C2    1 
ATOM   9400  O  O2    . DC  J  6 12  ? -64.938 -41.462 51.715 1.00 62.45  ? -62  DC  J O2    1 
ATOM   9401  N  N3    . DC  J  6 12  ? -62.777 -40.914 51.469 1.00 61.72  ? -62  DC  J N3    1 
ATOM   9402  C  C4    . DC  J  6 12  ? -61.535 -41.303 51.157 1.00 62.56  ? -62  DC  J C4    1 
ATOM   9403  N  N4    . DC  J  6 12  ? -60.569 -40.389 51.214 1.00 62.62  ? -62  DC  J N4    1 
ATOM   9404  C  C5    . DC  J  6 12  ? -61.225 -42.648 50.767 1.00 62.68  ? -62  DC  J C5    1 
ATOM   9405  C  C6    . DC  J  6 12  ? -62.233 -43.534 50.729 1.00 63.00  ? -62  DC  J C6    1 
ATOM   9406  P  P     . DC  J  6 13  ? -67.581 -45.359 48.214 1.00 69.07  ? -61  DC  J P     1 
ATOM   9407  O  OP1   . DC  J  6 13  ? -68.983 -45.824 48.179 1.00 69.31  ? -61  DC  J OP1   1 
ATOM   9408  O  OP2   . DC  J  6 13  ? -66.627 -45.795 47.172 1.00 67.76  ? -61  DC  J OP2   1 
ATOM   9409  O  "O5'" . DC  J  6 13  ? -67.612 -43.752 48.229 1.00 70.90  ? -61  DC  J "O5'" 1 
ATOM   9410  C  "C5'" . DC  J  6 13  ? -68.634 -43.015 48.923 1.00 72.58  ? -61  DC  J "C5'" 1 
ATOM   9411  C  "C4'" . DC  J  6 13  ? -68.564 -41.543 48.547 1.00 74.25  ? -61  DC  J "C4'" 1 
ATOM   9412  O  "O4'" . DC  J  6 13  ? -67.269 -41.028 48.966 1.00 74.85  ? -61  DC  J "O4'" 1 
ATOM   9413  C  "C3'" . DC  J  6 13  ? -68.683 -41.268 47.045 1.00 75.38  ? -61  DC  J "C3'" 1 
ATOM   9414  O  "O3'" . DC  J  6 13  ? -69.753 -40.378 46.715 1.00 77.11  ? -61  DC  J "O3'" 1 
ATOM   9415  C  "C2'" . DC  J  6 13  ? -67.350 -40.647 46.635 1.00 75.09  ? -61  DC  J "C2'" 1 
ATOM   9416  C  "C1'" . DC  J  6 13  ? -66.723 -40.201 47.952 1.00 74.02  ? -61  DC  J "C1'" 1 
ATOM   9417  N  N1    . DC  J  6 13  ? -65.222 -40.306 47.909 1.00 73.28  ? -61  DC  J N1    1 
ATOM   9418  C  C2    . DC  J  6 13  ? -64.414 -39.202 48.238 1.00 72.99  ? -61  DC  J C2    1 
ATOM   9419  O  O2    . DC  J  6 13  ? -64.946 -38.136 48.579 1.00 72.49  ? -61  DC  J O2    1 
ATOM   9420  N  N3    . DC  J  6 13  ? -63.055 -39.344 48.174 1.00 73.00  ? -61  DC  J N3    1 
ATOM   9421  C  C4    . DC  J  6 13  ? -62.508 -40.511 47.795 1.00 73.00  ? -61  DC  J C4    1 
ATOM   9422  N  N4    . DC  J  6 13  ? -61.179 -40.617 47.743 1.00 72.44  ? -61  DC  J N4    1 
ATOM   9423  C  C5    . DC  J  6 13  ? -63.312 -41.638 47.450 1.00 73.05  ? -61  DC  J C5    1 
ATOM   9424  C  C6    . DC  J  6 13  ? -64.645 -41.488 47.521 1.00 73.37  ? -61  DC  J C6    1 
ATOM   9425  P  P     . DT  J  6 14  ? -70.354 -40.363 45.218 1.00 78.26  ? -60  DT  J P     1 
ATOM   9426  O  OP1   . DT  J  6 14  ? -71.806 -40.651 45.299 1.00 78.24  ? -60  DT  J OP1   1 
ATOM   9427  O  OP2   . DT  J  6 14  ? -69.499 -41.177 44.320 1.00 77.03  ? -60  DT  J OP2   1 
ATOM   9428  O  "O5'" . DT  J  6 14  ? -70.176 -38.837 44.806 1.00 79.62  ? -60  DT  J "O5'" 1 
ATOM   9429  C  "C5'" . DT  J  6 14  ? -70.235 -37.782 45.758 1.00 82.60  ? -60  DT  J "C5'" 1 
ATOM   9430  C  "C4'" . DT  J  6 14  ? -69.379 -36.642 45.233 1.00 85.05  ? -60  DT  J "C4'" 1 
ATOM   9431  O  "O4'" . DT  J  6 14  ? -67.979 -36.936 45.502 1.00 85.43  ? -60  DT  J "O4'" 1 
ATOM   9432  C  "C3'" . DT  J  6 14  ? -69.478 -36.441 43.719 1.00 86.43  ? -60  DT  J "C3'" 1 
ATOM   9433  O  "O3'" . DT  J  6 14  ? -69.706 -35.076 43.399 1.00 88.49  ? -60  DT  J "O3'" 1 
ATOM   9434  C  "C2'" . DT  J  6 14  ? -68.124 -36.917 43.187 1.00 86.13  ? -60  DT  J "C2'" 1 
ATOM   9435  C  "C1'" . DT  J  6 14  ? -67.221 -36.569 44.365 1.00 85.29  ? -60  DT  J "C1'" 1 
ATOM   9436  N  N1    . DT  J  6 14  ? -65.879 -37.252 44.360 1.00 84.95  ? -60  DT  J N1    1 
ATOM   9437  C  C2    . DT  J  6 14  ? -64.743 -36.513 44.647 1.00 84.63  ? -60  DT  J C2    1 
ATOM   9438  O  O2    . DT  J  6 14  ? -64.759 -35.325 44.914 1.00 84.50  ? -60  DT  J O2    1 
ATOM   9439  N  N3    . DT  J  6 14  ? -63.568 -37.226 44.615 1.00 84.47  ? -60  DT  J N3    1 
ATOM   9440  C  C4    . DT  J  6 14  ? -63.421 -38.576 44.328 1.00 84.84  ? -60  DT  J C4    1 
ATOM   9441  O  O4    . DT  J  6 14  ? -62.321 -39.120 44.324 1.00 84.69  ? -60  DT  J O4    1 
ATOM   9442  C  C5    . DT  J  6 14  ? -64.646 -39.292 44.032 1.00 84.82  ? -60  DT  J C5    1 
ATOM   9443  C  C7    . DT  J  6 14  ? -64.623 -40.759 43.704 1.00 84.68  ? -60  DT  J C7    1 
ATOM   9444  C  C6    . DT  J  6 14  ? -65.798 -38.603 44.062 1.00 84.84  ? -60  DT  J C6    1 
ATOM   9445  P  P     . DG  J  6 15  ? -70.245 -34.678 41.937 1.00 90.42  ? -59  DG  J P     1 
ATOM   9446  O  OP1   . DG  J  6 15  ? -71.725 -34.720 42.019 1.00 90.64  ? -59  DG  J OP1   1 
ATOM   9447  O  OP2   . DG  J  6 15  ? -69.582 -35.500 40.889 1.00 90.20  ? -59  DG  J OP2   1 
ATOM   9448  O  "O5'" . DG  J  6 15  ? -69.720 -33.162 41.777 1.00 89.38  ? -59  DG  J "O5'" 1 
ATOM   9449  C  "C5'" . DG  J  6 15  ? -69.557 -32.276 42.903 1.00 88.10  ? -59  DG  J "C5'" 1 
ATOM   9450  C  "C4'" . DG  J  6 15  ? -68.270 -31.450 42.823 1.00 87.12  ? -59  DG  J "C4'" 1 
ATOM   9451  O  "O4'" . DG  J  6 15  ? -67.080 -32.282 42.929 1.00 86.28  ? -59  DG  J "O4'" 1 
ATOM   9452  C  "C3'" . DG  J  6 15  ? -68.089 -30.613 41.559 1.00 86.42  ? -59  DG  J "C3'" 1 
ATOM   9453  O  "O3'" . DG  J  6 15  ? -67.606 -29.305 41.901 1.00 85.66  ? -59  DG  J "O3'" 1 
ATOM   9454  C  "C2'" . DG  J  6 15  ? -67.089 -31.425 40.731 1.00 86.16  ? -59  DG  J "C2'" 1 
ATOM   9455  C  "C1'" . DG  J  6 15  ? -66.254 -32.146 41.790 1.00 85.47  ? -59  DG  J "C1'" 1 
ATOM   9456  N  N9    . DG  J  6 15  ? -65.817 -33.495 41.422 1.00 85.38  ? -59  DG  J N9    1 
ATOM   9457  C  C8    . DG  J  6 15  ? -66.579 -34.485 40.844 1.00 85.26  ? -59  DG  J C8    1 
ATOM   9458  N  N7    . DG  J  6 15  ? -65.932 -35.600 40.637 1.00 85.20  ? -59  DG  J N7    1 
ATOM   9459  C  C5    . DG  J  6 15  ? -64.652 -35.346 41.110 1.00 85.18  ? -59  DG  J C5    1 
ATOM   9460  C  C6    . DG  J  6 15  ? -63.507 -36.188 41.154 1.00 85.16  ? -59  DG  J C6    1 
ATOM   9461  O  O6    . DG  J  6 15  ? -63.390 -37.361 40.770 1.00 85.07  ? -59  DG  J O6    1 
ATOM   9462  N  N1    . DG  J  6 15  ? -62.406 -35.544 41.713 1.00 85.16  ? -59  DG  J N1    1 
ATOM   9463  C  C2    . DG  J  6 15  ? -62.421 -34.247 42.174 1.00 85.15  ? -59  DG  J C2    1 
ATOM   9464  N  N2    . DG  J  6 15  ? -61.267 -33.798 42.675 1.00 85.26  ? -59  DG  J N2    1 
ATOM   9465  N  N3    . DG  J  6 15  ? -63.483 -33.444 42.145 1.00 85.00  ? -59  DG  J N3    1 
ATOM   9466  C  C4    . DG  J  6 15  ? -64.566 -34.054 41.600 1.00 85.21  ? -59  DG  J C4    1 
ATOM   9467  P  P     . DC  J  6 16  ? -67.564 -28.111 40.823 1.00 85.61  ? -58  DC  J P     1 
ATOM   9468  O  OP1   . DC  J  6 16  ? -67.654 -26.838 41.577 1.00 84.51  ? -58  DC  J OP1   1 
ATOM   9469  O  OP2   . DC  J  6 16  ? -68.534 -28.431 39.747 1.00 85.20  ? -58  DC  J OP2   1 
ATOM   9470  O  "O5'" . DC  J  6 16  ? -66.099 -28.221 40.171 1.00 84.42  ? -58  DC  J "O5'" 1 
ATOM   9471  C  "C5'" . DC  J  6 16  ? -64.928 -27.802 40.883 1.00 82.36  ? -58  DC  J "C5'" 1 
ATOM   9472  C  "C4'" . DC  J  6 16  ? -63.670 -28.222 40.146 1.00 81.03  ? -58  DC  J "C4'" 1 
ATOM   9473  O  "O4'" . DC  J  6 16  ? -63.534 -29.670 40.136 1.00 79.90  ? -58  DC  J "O4'" 1 
ATOM   9474  C  "C3'" . DC  J  6 16  ? -63.615 -27.773 38.681 1.00 81.00  ? -58  DC  J "C3'" 1 
ATOM   9475  O  "O3'" . DC  J  6 16  ? -62.335 -27.254 38.368 1.00 81.61  ? -58  DC  J "O3'" 1 
ATOM   9476  C  "C2'" . DC  J  6 16  ? -63.815 -29.072 37.918 1.00 80.22  ? -58  DC  J "C2'" 1 
ATOM   9477  C  "C1'" . DC  J  6 16  ? -63.051 -30.000 38.854 1.00 79.31  ? -58  DC  J "C1'" 1 
ATOM   9478  N  N1    . DC  J  6 16  ? -63.221 -31.442 38.573 1.00 78.75  ? -58  DC  J N1    1 
ATOM   9479  C  C2    . DC  J  6 16  ? -62.158 -32.305 38.849 1.00 78.60  ? -58  DC  J C2    1 
ATOM   9480  O  O2    . DC  J  6 16  ? -61.122 -31.836 39.334 1.00 78.25  ? -58  DC  J O2    1 
ATOM   9481  N  N3    . DC  J  6 16  ? -62.308 -33.630 38.581 1.00 78.82  ? -58  DC  J N3    1 
ATOM   9482  C  C4    . DC  J  6 16  ? -63.457 -34.085 38.060 1.00 78.70  ? -58  DC  J C4    1 
ATOM   9483  N  N4    . DC  J  6 16  ? -63.568 -35.392 37.815 1.00 78.67  ? -58  DC  J N4    1 
ATOM   9484  C  C5    . DC  J  6 16  ? -64.549 -33.217 37.766 1.00 78.29  ? -58  DC  J C5    1 
ATOM   9485  C  C6    . DC  J  6 16  ? -64.385 -31.917 38.034 1.00 78.51  ? -58  DC  J C6    1 
ATOM   9486  P  P     . DA  J  6 17  ? -61.993 -25.713 38.572 1.00 81.85  ? -57  DA  J P     1 
ATOM   9487  O  OP1   . DA  J  6 17  ? -62.333 -25.319 39.959 1.00 81.46  ? -57  DA  J OP1   1 
ATOM   9488  O  OP2   . DA  J  6 17  ? -62.552 -24.972 37.421 1.00 81.76  ? -57  DA  J OP2   1 
ATOM   9489  O  "O5'" . DA  J  6 17  ? -60.407 -25.743 38.430 1.00 82.08  ? -57  DA  J "O5'" 1 
ATOM   9490  C  "C5'" . DA  J  6 17  ? -59.608 -25.770 39.605 1.00 82.17  ? -57  DA  J "C5'" 1 
ATOM   9491  C  "C4'" . DA  J  6 17  ? -58.379 -26.638 39.408 1.00 81.88  ? -57  DA  J "C4'" 1 
ATOM   9492  O  "O4'" . DA  J  6 17  ? -58.758 -27.962 38.954 1.00 81.10  ? -57  DA  J "O4'" 1 
ATOM   9493  C  "C3'" . DA  J  6 17  ? -57.368 -26.098 38.402 1.00 82.08  ? -57  DA  J "C3'" 1 
ATOM   9494  O  "O3'" . DA  J  6 17  ? -56.047 -26.296 38.961 1.00 82.80  ? -57  DA  J "O3'" 1 
ATOM   9495  C  "C2'" . DA  J  6 17  ? -57.658 -26.907 37.131 1.00 81.47  ? -57  DA  J "C2'" 1 
ATOM   9496  C  "C1'" . DA  J  6 17  ? -58.245 -28.216 37.663 1.00 80.87  ? -57  DA  J "C1'" 1 
ATOM   9497  N  N9    . DA  J  6 17  ? -59.357 -28.766 36.892 1.00 80.86  ? -57  DA  J N9    1 
ATOM   9498  C  C8    . DA  J  6 17  ? -60.372 -28.072 36.297 1.00 80.62  ? -57  DA  J C8    1 
ATOM   9499  N  N7    . DA  J  6 17  ? -61.236 -28.841 35.680 1.00 80.94  ? -57  DA  J N7    1 
ATOM   9500  C  C5    . DA  J  6 17  ? -60.772 -30.132 35.883 1.00 80.66  ? -57  DA  J C5    1 
ATOM   9501  C  C6    . DA  J  6 17  ? -61.242 -31.413 35.485 1.00 80.65  ? -57  DA  J C6    1 
ATOM   9502  N  N6    . DA  J  6 17  ? -62.342 -31.613 34.756 1.00 80.62  ? -57  DA  J N6    1 
ATOM   9503  N  N1    . DA  J  6 17  ? -60.532 -32.503 35.853 1.00 80.52  ? -57  DA  J N1    1 
ATOM   9504  C  C2    . DA  J  6 17  ? -59.423 -32.318 36.579 1.00 80.78  ? -57  DA  J C2    1 
ATOM   9505  N  N3    . DA  J  6 17  ? -58.887 -31.171 37.015 1.00 80.91  ? -57  DA  J N3    1 
ATOM   9506  C  C4    . DA  J  6 17  ? -59.610 -30.100 36.633 1.00 80.82  ? -57  DA  J C4    1 
ATOM   9507  P  P     . DG  J  6 18  ? -54.680 -25.892 38.214 1.00 82.37  ? -56  DG  J P     1 
ATOM   9508  O  OP1   . DG  J  6 18  ? -53.605 -25.782 39.228 1.00 81.92  ? -56  DG  J OP1   1 
ATOM   9509  O  OP2   . DG  J  6 18  ? -54.975 -24.741 37.326 1.00 82.90  ? -56  DG  J OP2   1 
ATOM   9510  O  "O5'" . DG  J  6 18  ? -54.387 -27.174 37.311 1.00 79.99  ? -56  DG  J "O5'" 1 
ATOM   9511  C  "C5'" . DG  J  6 18  ? -54.153 -28.417 37.943 1.00 78.18  ? -56  DG  J "C5'" 1 
ATOM   9512  C  "C4'" . DG  J  6 18  ? -54.126 -29.491 36.879 1.00 77.27  ? -56  DG  J "C4'" 1 
ATOM   9513  O  "O4'" . DG  J  6 18  ? -55.464 -29.714 36.368 1.00 78.09  ? -56  DG  J "O4'" 1 
ATOM   9514  C  "C3'" . DG  J  6 18  ? -53.296 -29.161 35.645 1.00 76.02  ? -56  DG  J "C3'" 1 
ATOM   9515  O  "O3'" . DG  J  6 18  ? -52.751 -30.370 35.220 1.00 74.12  ? -56  DG  J "O3'" 1 
ATOM   9516  C  "C2'" . DG  J  6 18  ? -54.332 -28.733 34.618 1.00 76.66  ? -56  DG  J "C2'" 1 
ATOM   9517  C  "C1'" . DG  J  6 18  ? -55.372 -29.791 34.958 1.00 77.65  ? -56  DG  J "C1'" 1 
ATOM   9518  N  N9    . DG  J  6 18  ? -56.677 -29.616 34.323 1.00 77.76  ? -56  DG  J N9    1 
ATOM   9519  C  C8    . DG  J  6 18  ? -57.331 -28.432 34.063 1.00 77.65  ? -56  DG  J C8    1 
ATOM   9520  N  N7    . DG  J  6 18  ? -58.485 -28.599 33.483 1.00 77.78  ? -56  DG  J N7    1 
ATOM   9521  C  C5    . DG  J  6 18  ? -58.604 -29.975 33.343 1.00 77.71  ? -56  DG  J C5    1 
ATOM   9522  C  C6    . DG  J  6 18  ? -59.646 -30.752 32.779 1.00 77.54  ? -56  DG  J C6    1 
ATOM   9523  O  O6    . DG  J  6 18  ? -60.699 -30.356 32.280 1.00 77.68  ? -56  DG  J O6    1 
ATOM   9524  N  N1    . DG  J  6 18  ? -59.391 -32.119 32.833 1.00 77.61  ? -56  DG  J N1    1 
ATOM   9525  C  C2    . DG  J  6 18  ? -58.252 -32.667 33.375 1.00 77.68  ? -56  DG  J C2    1 
ATOM   9526  N  N2    . DG  J  6 18  ? -58.176 -34.003 33.339 1.00 77.57  ? -56  DG  J N2    1 
ATOM   9527  N  N3    . DG  J  6 18  ? -57.258 -31.955 33.908 1.00 77.63  ? -56  DG  J N3    1 
ATOM   9528  C  C4    . DG  J  6 18  ? -57.500 -30.619 33.860 1.00 77.66  ? -56  DG  J C4    1 
ATOM   9529  P  P     . DA  J  6 19  ? -51.200 -30.498 34.941 1.00 72.13  ? -55  DA  J P     1 
ATOM   9530  O  OP1   . DA  J  6 19  ? -50.501 -30.723 36.226 1.00 72.33  ? -55  DA  J OP1   1 
ATOM   9531  O  OP2   . DA  J  6 19  ? -50.819 -29.377 34.060 1.00 72.21  ? -55  DA  J OP2   1 
ATOM   9532  O  "O5'" . DA  J  6 19  ? -51.158 -31.845 34.099 1.00 71.64  ? -55  DA  J "O5'" 1 
ATOM   9533  C  "C5'" . DA  J  6 19  ? -51.669 -33.003 34.715 1.00 72.19  ? -55  DA  J "C5'" 1 
ATOM   9534  C  "C4'" . DA  J  6 19  ? -52.590 -33.746 33.769 1.00 72.46  ? -55  DA  J "C4'" 1 
ATOM   9535  O  "O4'" . DA  J  6 19  ? -53.725 -32.930 33.400 1.00 71.65  ? -55  DA  J "O4'" 1 
ATOM   9536  C  "C3'" . DA  J  6 19  ? -51.925 -34.146 32.460 1.00 72.32  ? -55  DA  J "C3'" 1 
ATOM   9537  O  "O3'" . DA  J  6 19  ? -51.963 -35.548 32.319 1.00 72.97  ? -55  DA  J "O3'" 1 
ATOM   9538  C  "C2'" . DA  J  6 19  ? -52.748 -33.424 31.393 1.00 71.90  ? -55  DA  J "C2'" 1 
ATOM   9539  C  "C1'" . DA  J  6 19  ? -54.082 -33.342 32.105 1.00 71.03  ? -55  DA  J "C1'" 1 
ATOM   9540  N  N9    . DA  J  6 19  ? -55.032 -32.387 31.557 1.00 70.90  ? -55  DA  J N9    1 
ATOM   9541  C  C8    . DA  J  6 19  ? -55.002 -31.025 31.667 1.00 70.82  ? -55  DA  J C8    1 
ATOM   9542  N  N7    . DA  J  6 19  ? -56.005 -30.422 31.082 1.00 70.36  ? -55  DA  J N7    1 
ATOM   9543  C  C5    . DA  J  6 19  ? -56.744 -31.465 30.556 1.00 70.92  ? -55  DA  J C5    1 
ATOM   9544  C  C6    . DA  J  6 19  ? -57.939 -31.501 29.816 1.00 70.94  ? -55  DA  J C6    1 
ATOM   9545  N  N6    . DA  J  6 19  ? -58.597 -30.393 29.475 1.00 71.15  ? -55  DA  J N6    1 
ATOM   9546  N  N1    . DA  J  6 19  ? -58.427 -32.706 29.438 1.00 70.89  ? -55  DA  J N1    1 
ATOM   9547  C  C2    . DA  J  6 19  ? -57.757 -33.811 29.786 1.00 70.74  ? -55  DA  J C2    1 
ATOM   9548  N  N3    . DA  J  6 19  ? -56.622 -33.904 30.478 1.00 70.90  ? -55  DA  J N3    1 
ATOM   9549  C  C4    . DA  J  6 19  ? -56.164 -32.686 30.838 1.00 71.04  ? -55  DA  J C4    1 
ATOM   9550  P  P     . DT  J  6 20  ? -51.131 -36.157 31.106 1.00 74.94  ? -54  DT  J P     1 
ATOM   9551  O  OP1   . DT  J  6 20  ? -50.583 -37.479 31.486 1.00 75.42  ? -54  DT  J OP1   1 
ATOM   9552  O  OP2   . DT  J  6 20  ? -50.219 -35.090 30.639 1.00 74.01  ? -54  DT  J OP2   1 
ATOM   9553  O  "O5'" . DT  J  6 20  ? -52.262 -36.394 30.003 1.00 76.11  ? -54  DT  J "O5'" 1 
ATOM   9554  C  "C5'" . DT  J  6 20  ? -53.321 -37.314 30.248 1.00 78.02  ? -54  DT  J "C5'" 1 
ATOM   9555  C  "C4'" . DT  J  6 20  ? -54.278 -37.383 29.068 1.00 79.74  ? -54  DT  J "C4'" 1 
ATOM   9556  O  "O4'" . DT  J  6 20  ? -55.020 -36.146 28.923 1.00 79.42  ? -54  DT  J "O4'" 1 
ATOM   9557  C  "C3'" . DT  J  6 20  ? -53.639 -37.665 27.711 1.00 81.01  ? -54  DT  J "C3'" 1 
ATOM   9558  O  "O3'" . DT  J  6 20  ? -54.338 -38.753 27.128 1.00 83.84  ? -54  DT  J "O3'" 1 
ATOM   9559  C  "C2'" . DT  J  6 20  ? -53.810 -36.361 26.929 1.00 79.79  ? -54  DT  J "C2'" 1 
ATOM   9560  C  "C1'" . DT  J  6 20  ? -55.080 -35.799 27.554 1.00 78.55  ? -54  DT  J "C1'" 1 
ATOM   9561  N  N1    . DT  J  6 20  ? -55.282 -34.314 27.459 1.00 77.87  ? -54  DT  J N1    1 
ATOM   9562  C  C2    . DT  J  6 20  ? -56.442 -33.841 26.874 1.00 77.82  ? -54  DT  J C2    1 
ATOM   9563  O  O2    . DT  J  6 20  ? -57.319 -34.556 26.416 1.00 78.01  ? -54  DT  J O2    1 
ATOM   9564  N  N3    . DT  J  6 20  ? -56.554 -32.478 26.844 1.00 77.46  ? -54  DT  J N3    1 
ATOM   9565  C  C4    . DT  J  6 20  ? -55.650 -31.558 27.320 1.00 77.67  ? -54  DT  J C4    1 
ATOM   9566  O  O4    . DT  J  6 20  ? -55.864 -30.359 27.228 1.00 77.84  ? -54  DT  J O4    1 
ATOM   9567  C  C5    . DT  J  6 20  ? -54.459 -32.110 27.925 1.00 77.91  ? -54  DT  J C5    1 
ATOM   9568  C  C7    . DT  J  6 20  ? -53.393 -31.207 28.484 1.00 77.93  ? -54  DT  J C7    1 
ATOM   9569  C  C6    . DT  J  6 20  ? -54.337 -33.445 27.966 1.00 77.53  ? -54  DT  J C6    1 
ATOM   9570  P  P     . DA  J  6 21  ? -53.733 -39.589 25.906 1.00 86.23  ? -53  DA  J P     1 
ATOM   9571  O  OP1   . DA  J  6 21  ? -53.997 -41.031 26.135 1.00 85.51  ? -53  DA  J OP1   1 
ATOM   9572  O  OP2   . DA  J  6 21  ? -52.355 -39.123 25.630 1.00 86.35  ? -53  DA  J OP2   1 
ATOM   9573  O  "O5'" . DA  J  6 21  ? -54.674 -39.061 24.729 1.00 88.80  ? -53  DA  J "O5'" 1 
ATOM   9574  C  "C5'" . DA  J  6 21  ? -56.091 -38.958 24.939 1.00 92.11  ? -53  DA  J "C5'" 1 
ATOM   9575  C  "C4'" . DA  J  6 21  ? -56.793 -38.478 23.681 1.00 94.18  ? -53  DA  J "C4'" 1 
ATOM   9576  O  "O4'" . DA  J  6 21  ? -57.082 -37.059 23.792 1.00 93.98  ? -53  DA  J "O4'" 1 
ATOM   9577  C  "C3'" . DA  J  6 21  ? -55.980 -38.676 22.404 1.00 95.95  ? -53  DA  J "C3'" 1 
ATOM   9578  O  "O3'" . DA  J  6 21  ? -56.792 -39.226 21.365 1.00 98.86  ? -53  DA  J "O3'" 1 
ATOM   9579  C  "C2'" . DA  J  6 21  ? -55.470 -37.275 22.070 1.00 95.51  ? -53  DA  J "C2'" 1 
ATOM   9580  C  "C1'" . DA  J  6 21  ? -56.530 -36.366 22.688 1.00 94.43  ? -53  DA  J "C1'" 1 
ATOM   9581  N  N9    . DA  J  6 21  ? -55.980 -35.091 23.145 1.00 94.19  ? -53  DA  J N9    1 
ATOM   9582  C  C8    . DA  J  6 21  ? -54.786 -34.892 23.788 1.00 93.98  ? -53  DA  J C8    1 
ATOM   9583  N  N7    . DA  J  6 21  ? -54.541 -33.638 24.082 1.00 93.88  ? -53  DA  J N7    1 
ATOM   9584  C  C5    . DA  J  6 21  ? -55.648 -32.967 23.595 1.00 93.92  ? -53  DA  J C5    1 
ATOM   9585  C  C6    . DA  J  6 21  ? -56.001 -31.604 23.594 1.00 94.00  ? -53  DA  J C6    1 
ATOM   9586  N  N6    . DA  J  6 21  ? -55.224 -30.657 24.125 1.00 94.02  ? -53  DA  J N6    1 
ATOM   9587  N  N1    . DA  J  6 21  ? -57.181 -31.256 23.026 1.00 94.09  ? -53  DA  J N1    1 
ATOM   9588  C  C2    . DA  J  6 21  ? -57.954 -32.215 22.492 1.00 93.93  ? -53  DA  J C2    1 
ATOM   9589  N  N3    . DA  J  6 21  ? -57.729 -33.530 22.440 1.00 93.79  ? -53  DA  J N3    1 
ATOM   9590  C  C4    . DA  J  6 21  ? -56.549 -33.845 23.011 1.00 93.99  ? -53  DA  J C4    1 
ATOM   9591  P  P     . DC  J  6 22  ? -56.147 -39.797 20.007 1.00 101.02 ? -52  DC  J P     1 
ATOM   9592  O  OP1   . DC  J  6 22  ? -56.717 -41.144 19.775 1.00 101.32 ? -52  DC  J OP1   1 
ATOM   9593  O  OP2   . DC  J  6 22  ? -54.674 -39.621 20.041 1.00 100.91 ? -52  DC  J OP2   1 
ATOM   9594  O  "O5'" . DC  J  6 22  ? -56.735 -38.803 18.905 1.00 101.98 ? -52  DC  J "O5'" 1 
ATOM   9595  C  "C5'" . DC  J  6 22  ? -58.135 -38.565 18.866 1.00 104.23 ? -52  DC  J "C5'" 1 
ATOM   9596  C  "C4'" . DC  J  6 22  ? -58.396 -37.301 18.083 1.00 105.91 ? -52  DC  J "C4'" 1 
ATOM   9597  O  "O4'" . DC  J  6 22  ? -58.032 -36.143 18.881 1.00 106.16 ? -52  DC  J "O4'" 1 
ATOM   9598  C  "C3'" . DC  J  6 22  ? -57.585 -37.219 16.790 1.00 106.81 ? -52  DC  J "C3'" 1 
ATOM   9599  O  "O3'" . DC  J  6 22  ? -58.487 -37.136 15.687 1.00 107.99 ? -52  DC  J "O3'" 1 
ATOM   9600  C  "C2'" . DC  J  6 22  ? -56.725 -35.966 16.970 1.00 106.69 ? -52  DC  J "C2'" 1 
ATOM   9601  C  "C1'" . DC  J  6 22  ? -57.547 -35.169 17.981 1.00 106.31 ? -52  DC  J "C1'" 1 
ATOM   9602  N  N1    . DC  J  6 22  ? -56.785 -34.099 18.712 1.00 106.13 ? -52  DC  J N1    1 
ATOM   9603  C  C2    . DC  J  6 22  ? -57.320 -32.801 18.819 1.00 105.87 ? -52  DC  J C2    1 
ATOM   9604  O  O2    . DC  J  6 22  ? -58.421 -32.539 18.321 1.00 105.81 ? -52  DC  J O2    1 
ATOM   9605  N  N3    . DC  J  6 22  ? -56.610 -31.852 19.479 1.00 105.70 ? -52  DC  J N3    1 
ATOM   9606  C  C4    . DC  J  6 22  ? -55.422 -32.157 20.012 1.00 105.94 ? -52  DC  J C4    1 
ATOM   9607  N  N4    . DC  J  6 22  ? -54.761 -31.193 20.652 1.00 105.83 ? -52  DC  J N4    1 
ATOM   9608  C  C5    . DC  J  6 22  ? -54.855 -33.464 19.915 1.00 105.90 ? -52  DC  J C5    1 
ATOM   9609  C  C6    . DC  J  6 22  ? -55.564 -34.393 19.263 1.00 106.12 ? -52  DC  J C6    1 
ATOM   9610  P  P     . DT  J  6 23  ? -57.996 -37.108 14.161 1.00 108.57 ? -51  DT  J P     1 
ATOM   9611  O  OP1   . DT  J  6 23  ? -59.114 -37.630 13.342 1.00 108.40 ? -51  DT  J OP1   1 
ATOM   9612  O  OP2   . DT  J  6 23  ? -56.640 -37.702 14.047 1.00 108.31 ? -51  DT  J OP2   1 
ATOM   9613  O  "O5'" . DT  J  6 23  ? -57.875 -35.540 13.902 1.00 108.54 ? -51  DT  J "O5'" 1 
ATOM   9614  C  "C5'" . DT  J  6 23  ? -58.988 -34.695 14.175 1.00 109.16 ? -51  DT  J "C5'" 1 
ATOM   9615  C  "C4'" . DT  J  6 23  ? -58.731 -33.311 13.607 1.00 109.80 ? -51  DT  J "C4'" 1 
ATOM   9616  O  "O4'" . DT  J  6 23  ? -57.984 -32.530 14.576 1.00 109.98 ? -51  DT  J "O4'" 1 
ATOM   9617  C  "C3'" . DT  J  6 23  ? -57.930 -33.308 12.305 1.00 110.14 ? -51  DT  J "C3'" 1 
ATOM   9618  O  "O3'" . DT  J  6 23  ? -58.569 -32.458 11.346 1.00 110.14 ? -51  DT  J "O3'" 1 
ATOM   9619  C  "C2'" . DT  J  6 23  ? -56.537 -32.824 12.715 1.00 110.25 ? -51  DT  J "C2'" 1 
ATOM   9620  C  "C1'" . DT  J  6 23  ? -56.805 -32.017 13.987 1.00 110.05 ? -51  DT  J "C1'" 1 
ATOM   9621  N  N1    . DT  J  6 23  ? -55.685 -32.057 14.996 1.00 109.95 ? -51  DT  J N1    1 
ATOM   9622  C  C2    . DT  J  6 23  ? -55.400 -30.926 15.737 1.00 109.79 ? -51  DT  J C2    1 
ATOM   9623  O  O2    . DT  J  6 23  ? -56.005 -29.875 15.630 1.00 109.75 ? -51  DT  J O2    1 
ATOM   9624  N  N3    . DT  J  6 23  ? -54.361 -31.072 16.624 1.00 109.95 ? -51  DT  J N3    1 
ATOM   9625  C  C4    . DT  J  6 23  ? -53.595 -32.207 16.840 1.00 109.95 ? -51  DT  J C4    1 
ATOM   9626  O  O4    . DT  J  6 23  ? -52.686 -32.224 17.661 1.00 109.92 ? -51  DT  J O4    1 
ATOM   9627  C  C5    . DT  J  6 23  ? -53.941 -33.357 16.036 1.00 109.86 ? -51  DT  J C5    1 
ATOM   9628  C  C7    . DT  J  6 23  ? -53.191 -34.652 16.173 1.00 109.73 ? -51  DT  J C7    1 
ATOM   9629  C  C6    . DT  J  6 23  ? -54.955 -33.224 15.167 1.00 110.12 ? -51  DT  J C6    1 
ATOM   9630  P  P     . DA  J  6 24  ? -58.137 -32.392 9.798  1.00 109.80 ? -50  DA  J P     1 
ATOM   9631  O  OP1   . DA  J  6 24  ? -59.382 -32.422 8.996  1.00 109.87 ? -50  DA  J OP1   1 
ATOM   9632  O  OP2   . DA  J  6 24  ? -57.059 -33.379 9.524  1.00 109.56 ? -50  DA  J OP2   1 
ATOM   9633  O  "O5'" . DA  J  6 24  ? -57.529 -30.914 9.716  1.00 109.36 ? -50  DA  J "O5'" 1 
ATOM   9634  C  "C5'" . DA  J  6 24  ? -58.162 -29.842 10.430 1.00 109.20 ? -50  DA  J "C5'" 1 
ATOM   9635  C  "C4'" . DA  J  6 24  ? -57.310 -28.582 10.414 1.00 108.93 ? -50  DA  J "C4'" 1 
ATOM   9636  O  "O4'" . DA  J  6 24  ? -56.457 -28.499 11.593 1.00 109.06 ? -50  DA  J "O4'" 1 
ATOM   9637  C  "C3'" . DA  J  6 24  ? -56.392 -28.480 9.207  1.00 108.62 ? -50  DA  J "C3'" 1 
ATOM   9638  O  "O3'" . DA  J  6 24  ? -56.541 -27.184 8.652  1.00 107.53 ? -50  DA  J "O3'" 1 
ATOM   9639  C  "C2'" . DA  J  6 24  ? -54.994 -28.751 9.774  1.00 108.98 ? -50  DA  J "C2'" 1 
ATOM   9640  C  "C1'" . DA  J  6 24  ? -55.109 -28.275 11.218 1.00 109.01 ? -50  DA  J "C1'" 1 
ATOM   9641  N  N9    . DA  J  6 24  ? -54.226 -29.005 12.133 1.00 108.99 ? -50  DA  J N9    1 
ATOM   9642  C  C8    . DA  J  6 24  ? -54.161 -30.364 12.296 1.00 108.89 ? -50  DA  J C8    1 
ATOM   9643  N  N7    . DA  J  6 24  ? -53.284 -30.765 13.183 1.00 108.78 ? -50  DA  J N7    1 
ATOM   9644  C  C5    . DA  J  6 24  ? -52.724 -29.582 13.637 1.00 109.03 ? -50  DA  J C5    1 
ATOM   9645  C  C6    . DA  J  6 24  ? -51.716 -29.317 14.593 1.00 108.98 ? -50  DA  J C6    1 
ATOM   9646  N  N6    . DA  J  6 24  ? -51.089 -30.280 15.278 1.00 108.74 ? -50  DA  J N6    1 
ATOM   9647  N  N1    . DA  J  6 24  ? -51.384 -28.022 14.816 1.00 109.01 ? -50  DA  J N1    1 
ATOM   9648  C  C2    . DA  J  6 24  ? -52.019 -27.059 14.124 1.00 108.96 ? -50  DA  J C2    1 
ATOM   9649  N  N3    . DA  J  6 24  ? -52.981 -27.187 13.202 1.00 108.90 ? -50  DA  J N3    1 
ATOM   9650  C  C4    . DA  J  6 24  ? -53.292 -28.484 13.001 1.00 108.95 ? -50  DA  J C4    1 
ATOM   9651  P  P     . DC  J  6 25  ? -55.591 -26.710 7.458  1.00 106.60 ? -49  DC  J P     1 
ATOM   9652  O  OP1   . DC  J  6 25  ? -56.278 -25.599 6.763  1.00 106.51 ? -49  DC  J OP1   1 
ATOM   9653  O  OP2   . DC  J  6 25  ? -55.121 -27.908 6.712  1.00 106.13 ? -49  DC  J OP2   1 
ATOM   9654  O  "O5'" . DC  J  6 25  ? -54.347 -26.110 8.255  1.00 105.12 ? -49  DC  J "O5'" 1 
ATOM   9655  C  "C5'" . DC  J  6 25  ? -54.483 -24.981 9.110  1.00 102.72 ? -49  DC  J "C5'" 1 
ATOM   9656  C  "C4'" . DC  J  6 25  ? -53.094 -24.470 9.454  1.00 101.13 ? -49  DC  J "C4'" 1 
ATOM   9657  O  "O4'" . DC  J  6 25  ? -52.455 -25.363 10.404 1.00 100.51 ? -49  DC  J "O4'" 1 
ATOM   9658  C  "C3'" . DC  J  6 25  ? -52.138 -24.378 8.266  1.00 99.93  ? -49  DC  J "C3'" 1 
ATOM   9659  O  "O3'" . DC  J  6 25  ? -51.410 -23.170 8.360  1.00 98.08  ? -49  DC  J "O3'" 1 
ATOM   9660  C  "C2'" . DC  J  6 25  ? -51.221 -25.593 8.414  1.00 99.86  ? -49  DC  J "C2'" 1 
ATOM   9661  C  "C1'" . DC  J  6 25  ? -51.156 -25.688 9.936  1.00 99.61  ? -49  DC  J "C1'" 1 
ATOM   9662  N  N1    . DC  J  6 25  ? -50.786 -27.022 10.492 1.00 99.11  ? -49  DC  J N1    1 
ATOM   9663  C  C2    . DC  J  6 25  ? -49.839 -27.100 11.530 1.00 98.56  ? -49  DC  J C2    1 
ATOM   9664  O  O2    . DC  J  6 25  ? -49.313 -26.073 11.969 1.00 98.18  ? -49  DC  J O2    1 
ATOM   9665  N  N3    . DC  J  6 25  ? -49.523 -28.317 12.033 1.00 98.39  ? -49  DC  J N3    1 
ATOM   9666  C  C4    . DC  J  6 25  ? -50.109 -29.412 11.542 1.00 98.74  ? -49  DC  J C4    1 
ATOM   9667  N  N4    . DC  J  6 25  ? -49.765 -30.587 12.071 1.00 98.69  ? -49  DC  J N4    1 
ATOM   9668  C  C5    . DC  J  6 25  ? -51.076 -29.356 10.488 1.00 98.64  ? -49  DC  J C5    1 
ATOM   9669  C  C6    . DC  J  6 25  ? -51.384 -28.150 9.999  1.00 98.77  ? -49  DC  J C6    1 
ATOM   9670  P  P     . DC  J  6 26  ? -50.947 -22.434 7.020  1.00 96.61  ? -48  DC  J P     1 
ATOM   9671  O  OP1   . DC  J  6 26  ? -51.859 -21.273 6.838  1.00 96.70  ? -48  DC  J OP1   1 
ATOM   9672  O  OP2   . DC  J  6 26  ? -50.805 -23.468 5.964  1.00 96.41  ? -48  DC  J OP2   1 
ATOM   9673  O  "O5'" . DC  J  6 26  ? -49.481 -21.877 7.363  1.00 95.43  ? -48  DC  J "O5'" 1 
ATOM   9674  C  "C5'" . DC  J  6 26  ? -49.134 -21.447 8.691  1.00 93.36  ? -48  DC  J "C5'" 1 
ATOM   9675  C  "C4'" . DC  J  6 26  ? -47.823 -22.080 9.120  1.00 91.76  ? -48  DC  J "C4'" 1 
ATOM   9676  O  "O4'" . DC  J  6 26  ? -48.036 -23.459 9.531  1.00 90.79  ? -48  DC  J "O4'" 1 
ATOM   9677  C  "C3'" . DC  J  6 26  ? -46.771 -22.131 8.011  1.00 91.01  ? -48  DC  J "C3'" 1 
ATOM   9678  O  "O3'" . DC  J  6 26  ? -45.599 -21.415 8.371  1.00 90.83  ? -48  DC  J "O3'" 1 
ATOM   9679  C  "C2'" . DC  J  6 26  ? -46.485 -23.619 7.838  1.00 90.42  ? -48  DC  J "C2'" 1 
ATOM   9680  C  "C1'" . DC  J  6 26  ? -46.830 -24.119 9.232  1.00 90.17  ? -48  DC  J "C1'" 1 
ATOM   9681  N  N1    . DC  J  6 26  ? -46.904 -25.609 9.344  1.00 89.99  ? -48  DC  J N1    1 
ATOM   9682  C  C2    . DC  J  6 26  ? -46.223 -26.239 10.400 1.00 89.83  ? -48  DC  J C2    1 
ATOM   9683  O  O2    . DC  J  6 26  ? -45.604 -25.554 11.224 1.00 89.76  ? -48  DC  J O2    1 
ATOM   9684  N  N3    . DC  J  6 26  ? -46.262 -27.590 10.502 1.00 89.62  ? -48  DC  J N3    1 
ATOM   9685  C  C4    . DC  J  6 26  ? -46.938 -28.305 9.602  1.00 89.88  ? -48  DC  J C4    1 
ATOM   9686  N  N4    . DC  J  6 26  ? -46.945 -29.632 9.751  1.00 89.74  ? -48  DC  J N4    1 
ATOM   9687  C  C5    . DC  J  6 26  ? -47.634 -27.690 8.515  1.00 89.85  ? -48  DC  J C5    1 
ATOM   9688  C  C6    . DC  J  6 26  ? -47.588 -26.353 8.423  1.00 89.86  ? -48  DC  J C6    1 
ATOM   9689  P  P     . DA  J  6 27  ? -45.017 -20.322 7.361  1.00 90.89  ? -47  DA  J P     1 
ATOM   9690  O  OP1   . DA  J  6 27  ? -45.917 -19.146 7.454  1.00 91.08  ? -47  DA  J OP1   1 
ATOM   9691  O  OP2   . DA  J  6 27  ? -44.730 -20.961 6.055  1.00 90.15  ? -47  DA  J OP2   1 
ATOM   9692  O  "O5'" . DA  J  6 27  ? -43.596 -19.956 7.993  1.00 90.52  ? -47  DA  J "O5'" 1 
ATOM   9693  C  "C5'" . DA  J  6 27  ? -43.511 -19.094 9.120  1.00 89.31  ? -47  DA  J "C5'" 1 
ATOM   9694  C  "C4'" . DA  J  6 27  ? -42.571 -19.632 10.190 1.00 87.97  ? -47  DA  J "C4'" 1 
ATOM   9695  O  "O4'" . DA  J  6 27  ? -42.863 -21.033 10.417 1.00 86.88  ? -47  DA  J "O4'" 1 
ATOM   9696  C  "C3'" . DA  J  6 27  ? -41.084 -19.547 9.858  1.00 87.44  ? -47  DA  J "C3'" 1 
ATOM   9697  O  "O3'" . DA  J  6 27  ? -40.329 -19.279 11.046 1.00 87.38  ? -47  DA  J "O3'" 1 
ATOM   9698  C  "C2'" . DA  J  6 27  ? -40.794 -20.929 9.273  1.00 86.92  ? -47  DA  J "C2'" 1 
ATOM   9699  C  "C1'" . DA  J  6 27  ? -41.776 -21.839 10.007 1.00 86.22  ? -47  DA  J "C1'" 1 
ATOM   9700  N  N9    . DA  J  6 27  ? -42.333 -22.916 9.193  1.00 85.87  ? -47  DA  J N9    1 
ATOM   9701  C  C8    . DA  J  6 27  ? -42.800 -22.822 7.917  1.00 85.73  ? -47  DA  J C8    1 
ATOM   9702  N  N7    . DA  J  6 27  ? -43.252 -23.953 7.434  1.00 86.04  ? -47  DA  J N7    1 
ATOM   9703  C  C5    . DA  J  6 27  ? -43.076 -24.860 8.460  1.00 85.77  ? -47  DA  J C5    1 
ATOM   9704  C  C6    . DA  J  6 27  ? -43.356 -26.241 8.580  1.00 85.80  ? -47  DA  J C6    1 
ATOM   9705  N  N6    . DA  J  6 27  ? -43.899 -26.980 7.614  1.00 85.55  ? -47  DA  J N6    1 
ATOM   9706  N  N1    . DA  J  6 27  ? -43.054 -26.846 9.747  1.00 86.03  ? -47  DA  J N1    1 
ATOM   9707  C  C2    . DA  J  6 27  ? -42.506 -26.113 10.725 1.00 85.92  ? -47  DA  J C2    1 
ATOM   9708  N  N3    . DA  J  6 27  ? -42.198 -24.815 10.725 1.00 85.73  ? -47  DA  J N3    1 
ATOM   9709  C  C4    . DA  J  6 27  ? -42.509 -24.235 9.555  1.00 85.79  ? -47  DA  J C4    1 
ATOM   9710  P  P     . DA  J  6 28  ? -38.782 -18.828 11.025 1.00 87.74  ? -46  DA  J P     1 
ATOM   9711  O  OP1   . DA  J  6 28  ? -38.747 -17.356 11.184 1.00 87.29  ? -46  DA  J OP1   1 
ATOM   9712  O  OP2   . DA  J  6 28  ? -38.094 -19.460 9.873  1.00 87.09  ? -46  DA  J OP2   1 
ATOM   9713  O  "O5'" . DA  J  6 28  ? -38.201 -19.475 12.366 1.00 86.39  ? -46  DA  J "O5'" 1 
ATOM   9714  C  "C5'" . DA  J  6 28  ? -38.884 -20.534 13.026 1.00 85.06  ? -46  DA  J "C5'" 1 
ATOM   9715  C  "C4'" . DA  J  6 28  ? -38.172 -21.867 12.850 1.00 83.82  ? -46  DA  J "C4'" 1 
ATOM   9716  O  "O4'" . DA  J  6 28  ? -38.825 -22.656 11.826 1.00 83.51  ? -46  DA  J "O4'" 1 
ATOM   9717  C  "C3'" . DA  J  6 28  ? -36.706 -21.830 12.437 1.00 83.42  ? -46  DA  J "C3'" 1 
ATOM   9718  O  "O3'" . DA  J  6 28  ? -36.140 -22.953 13.055 1.00 83.55  ? -46  DA  J "O3'" 1 
ATOM   9719  C  "C2'" . DA  J  6 28  ? -36.769 -22.125 10.945 1.00 82.95  ? -46  DA  J "C2'" 1 
ATOM   9720  C  "C1'" . DA  J  6 28  ? -37.811 -23.229 11.030 1.00 82.44  ? -46  DA  J "C1'" 1 
ATOM   9721  N  N9    . DA  J  6 28  ? -38.376 -23.715 9.777  1.00 82.08  ? -46  DA  J N9    1 
ATOM   9722  C  C8    . DA  J  6 28  ? -38.553 -23.025 8.616  1.00 82.08  ? -46  DA  J C8    1 
ATOM   9723  N  N7    . DA  J  6 28  ? -39.095 -23.740 7.662  1.00 82.38  ? -46  DA  J N7    1 
ATOM   9724  C  C5    . DA  J  6 28  ? -39.284 -24.986 8.232  1.00 82.17  ? -46  DA  J C5    1 
ATOM   9725  C  C6    . DA  J  6 28  ? -39.817 -26.200 7.742  1.00 82.29  ? -46  DA  J C6    1 
ATOM   9726  N  N6    . DA  J  6 28  ? -40.279 -26.357 6.501  1.00 82.05  ? -46  DA  J N6    1 
ATOM   9727  N  N1    . DA  J  6 28  ? -39.861 -27.261 8.576  1.00 82.22  ? -46  DA  J N1    1 
ATOM   9728  C  C2    . DA  J  6 28  ? -39.397 -27.108 9.818  1.00 82.14  ? -46  DA  J C2    1 
ATOM   9729  N  N3    . DA  J  6 28  ? -38.876 -26.020 10.386 1.00 81.98  ? -46  DA  J N3    1 
ATOM   9730  C  C4    . DA  J  6 28  ? -38.849 -24.982 9.538  1.00 81.89  ? -46  DA  J C4    1 
ATOM   9731  P  P     . DA  J  6 29  ? -34.880 -22.920 14.029 1.00 82.70  ? -45  DA  J P     1 
ATOM   9732  O  OP1   . DA  J  6 29  ? -35.361 -22.356 15.313 1.00 82.31  ? -45  DA  J OP1   1 
ATOM   9733  O  OP2   . DA  J  6 29  ? -33.713 -22.335 13.314 1.00 82.26  ? -45  DA  J OP2   1 
ATOM   9734  O  "O5'" . DA  J  6 29  ? -34.631 -24.493 14.197 1.00 81.82  ? -45  DA  J "O5'" 1 
ATOM   9735  C  "C5'" . DA  J  6 29  ? -35.717 -25.316 14.625 1.00 81.36  ? -45  DA  J "C5'" 1 
ATOM   9736  C  "C4'" . DA  J  6 29  ? -35.618 -26.744 14.118 1.00 81.15  ? -45  DA  J "C4'" 1 
ATOM   9737  O  "O4'" . DA  J  6 29  ? -36.246 -26.863 12.819 1.00 80.83  ? -45  DA  J "O4'" 1 
ATOM   9738  C  "C3'" . DA  J  6 29  ? -34.215 -27.305 13.961 1.00 81.54  ? -45  DA  J "C3'" 1 
ATOM   9739  O  "O3'" . DA  J  6 29  ? -34.261 -28.644 14.377 1.00 82.74  ? -45  DA  J "O3'" 1 
ATOM   9740  C  "C2'" . DA  J  6 29  ? -33.968 -27.236 12.464 1.00 81.13  ? -45  DA  J "C2'" 1 
ATOM   9741  C  "C1'" . DA  J  6 29  ? -35.364 -27.482 11.908 1.00 81.16  ? -45  DA  J "C1'" 1 
ATOM   9742  N  N9    . DA  J  6 29  ? -35.591 -26.881 10.590 1.00 81.53  ? -45  DA  J N9    1 
ATOM   9743  C  C8    . DA  J  6 29  ? -35.384 -25.573 10.230 1.00 81.40  ? -45  DA  J C8    1 
ATOM   9744  N  N7    . DA  J  6 29  ? -35.671 -25.309 8.978  1.00 81.34  ? -45  DA  J N7    1 
ATOM   9745  C  C5    . DA  J  6 29  ? -36.098 -26.527 8.478  1.00 81.20  ? -45  DA  J C5    1 
ATOM   9746  C  C6    . DA  J  6 29  ? -36.553 -26.923 7.207  1.00 81.09  ? -45  DA  J C6    1 
ATOM   9747  N  N6    . DA  J  6 29  ? -36.644 -26.089 6.172  1.00 81.23  ? -45  DA  J N6    1 
ATOM   9748  N  N1    . DA  J  6 29  ? -36.903 -28.213 7.031  1.00 81.17  ? -45  DA  J N1    1 
ATOM   9749  C  C2    . DA  J  6 29  ? -36.816 -29.049 8.069  1.00 81.17  ? -45  DA  J C2    1 
ATOM   9750  N  N3    . DA  J  6 29  ? -36.404 -28.795 9.310  1.00 81.10  ? -45  DA  J N3    1 
ATOM   9751  C  C4    . DA  J  6 29  ? -36.057 -27.506 9.454  1.00 81.22  ? -45  DA  J C4    1 
ATOM   9752  P  P     . DA  J  6 30  ? -33.033 -29.345 15.117 1.00 83.43  ? -44  DA  J P     1 
ATOM   9753  O  OP1   . DA  J  6 30  ? -33.600 -29.866 16.381 1.00 83.68  ? -44  DA  J OP1   1 
ATOM   9754  O  OP2   . DA  J  6 30  ? -31.856 -28.434 15.118 1.00 83.31  ? -44  DA  J OP2   1 
ATOM   9755  O  "O5'" . DA  J  6 30  ? -32.713 -30.591 14.163 1.00 82.91  ? -44  DA  J "O5'" 1 
ATOM   9756  C  "C5'" . DA  J  6 30  ? -33.772 -31.472 13.795 1.00 83.37  ? -44  DA  J "C5'" 1 
ATOM   9757  C  "C4'" . DA  J  6 30  ? -33.623 -31.943 12.363 1.00 83.89  ? -44  DA  J "C4'" 1 
ATOM   9758  O  "O4'" . DA  J  6 30  ? -33.879 -30.859 11.436 1.00 84.30  ? -44  DA  J "O4'" 1 
ATOM   9759  C  "C3'" . DA  J  6 30  ? -32.230 -32.454 12.009 1.00 83.94  ? -44  DA  J "C3'" 1 
ATOM   9760  O  "O3'" . DA  J  6 30  ? -32.247 -33.874 11.958 1.00 83.49  ? -44  DA  J "O3'" 1 
ATOM   9761  C  "C2'" . DA  J  6 30  ? -31.898 -31.803 10.657 1.00 84.29  ? -44  DA  J "C2'" 1 
ATOM   9762  C  "C1'" . DA  J  6 30  ? -33.225 -31.190 10.220 1.00 84.63  ? -44  DA  J "C1'" 1 
ATOM   9763  N  N9    . DA  J  6 30  ? -33.164 -29.992 9.366  1.00 84.78  ? -44  DA  J N9    1 
ATOM   9764  C  C8    . DA  J  6 30  ? -32.718 -28.751 9.728  1.00 84.90  ? -44  DA  J C8    1 
ATOM   9765  N  N7    . DA  J  6 30  ? -32.788 -27.837 8.791  1.00 84.58  ? -44  DA  J N7    1 
ATOM   9766  C  C5    . DA  J  6 30  ? -33.324 -28.523 7.723  1.00 84.72  ? -44  DA  J C5    1 
ATOM   9767  C  C6    . DA  J  6 30  ? -33.648 -28.113 6.414  1.00 84.53  ? -44  DA  J C6    1 
ATOM   9768  N  N6    . DA  J  6 30  ? -33.460 -26.869 5.971  1.00 84.38  ? -44  DA  J N6    1 
ATOM   9769  N  N1    . DA  J  6 30  ? -34.172 -29.034 5.578  1.00 84.84  ? -44  DA  J N1    1 
ATOM   9770  C  C2    . DA  J  6 30  ? -34.358 -30.285 6.028  1.00 84.86  ? -44  DA  J C2    1 
ATOM   9771  N  N3    . DA  J  6 30  ? -34.084 -30.787 7.235  1.00 84.80  ? -44  DA  J N3    1 
ATOM   9772  C  C4    . DA  J  6 30  ? -33.567 -29.850 8.052  1.00 84.87  ? -44  DA  J C4    1 
ATOM   9773  P  P     . DG  J  6 31  ? -30.878 -34.706 11.895 1.00 84.12  ? -43  DG  J P     1 
ATOM   9774  O  OP1   . DG  J  6 31  ? -30.957 -35.864 12.815 1.00 84.13  ? -43  DG  J OP1   1 
ATOM   9775  O  OP2   . DG  J  6 31  ? -29.740 -33.759 12.005 1.00 83.82  ? -43  DG  J OP2   1 
ATOM   9776  O  "O5'" . DG  J  6 31  ? -30.918 -35.271 10.401 1.00 84.77  ? -43  DG  J "O5'" 1 
ATOM   9777  C  "C5'" . DG  J  6 31  ? -32.075 -35.932 9.892  1.00 85.17  ? -43  DG  J "C5'" 1 
ATOM   9778  C  "C4'" . DG  J  6 31  ? -32.040 -35.953 8.375  1.00 85.50  ? -43  DG  J "C4'" 1 
ATOM   9779  O  "O4'" . DG  J  6 31  ? -32.285 -34.623 7.850  1.00 85.00  ? -43  DG  J "O4'" 1 
ATOM   9780  C  "C3'" . DG  J  6 31  ? -30.723 -36.417 7.767  1.00 86.06  ? -43  DG  J "C3'" 1 
ATOM   9781  O  "O3'" . DG  J  6 31  ? -31.001 -37.491 6.872  1.00 87.94  ? -43  DG  J "O3'" 1 
ATOM   9782  C  "C2'" . DG  J  6 31  ? -30.181 -35.172 7.065  1.00 84.88  ? -43  DG  J "C2'" 1 
ATOM   9783  C  "C1'" . DG  J  6 31  ? -31.445 -34.393 6.746  1.00 84.32  ? -43  DG  J "C1'" 1 
ATOM   9784  N  N9    . DG  J  6 31  ? -31.221 -32.954 6.606  1.00 84.21  ? -43  DG  J N9    1 
ATOM   9785  C  C8    . DG  J  6 31  ? -30.711 -32.100 7.552  1.00 84.08  ? -43  DG  J C8    1 
ATOM   9786  N  N7    . DG  J  6 31  ? -30.615 -30.866 7.157  1.00 83.93  ? -43  DG  J N7    1 
ATOM   9787  C  C5    . DG  J  6 31  ? -31.084 -30.892 5.851  1.00 84.19  ? -43  DG  J C5    1 
ATOM   9788  C  C6    . DG  J  6 31  ? -31.215 -29.844 4.898  1.00 84.19  ? -43  DG  J C6    1 
ATOM   9789  O  O6    . DG  J  6 31  ? -30.939 -28.641 5.024  1.00 84.09  ? -43  DG  J O6    1 
ATOM   9790  N  N1    . DG  J  6 31  ? -31.742 -30.299 3.688  1.00 84.29  ? -43  DG  J N1    1 
ATOM   9791  C  C2    . DG  J  6 31  ? -32.089 -31.607 3.424  1.00 84.31  ? -43  DG  J C2    1 
ATOM   9792  N  N2    . DG  J  6 31  ? -32.580 -31.860 2.199  1.00 84.18  ? -43  DG  J N2    1 
ATOM   9793  N  N3    . DG  J  6 31  ? -31.966 -32.597 4.304  1.00 84.28  ? -43  DG  J N3    1 
ATOM   9794  C  C4    . DG  J  6 31  ? -31.463 -32.172 5.496  1.00 84.30  ? -43  DG  J C4    1 
ATOM   9795  P  P     . DT  J  6 32  ? -29.851 -38.392 6.204  1.00 89.42  ? -42  DT  J P     1 
ATOM   9796  O  OP1   . DT  J  6 32  ? -29.963 -39.757 6.770  1.00 89.24  ? -42  DT  J OP1   1 
ATOM   9797  O  OP2   . DT  J  6 32  ? -28.538 -37.710 6.281  1.00 89.16  ? -42  DT  J OP2   1 
ATOM   9798  O  "O5'" . DT  J  6 32  ? -30.309 -38.381 4.661  1.00 91.12  ? -42  DT  J "O5'" 1 
ATOM   9799  C  "C5'" . DT  J  6 32  ? -31.046 -37.276 4.102  1.00 93.38  ? -42  DT  J "C5'" 1 
ATOM   9800  C  "C4'" . DT  J  6 32  ? -30.410 -36.652 2.862  1.00 95.23  ? -42  DT  J "C4'" 1 
ATOM   9801  O  "O4'" . DT  J  6 32  ? -30.185 -35.232 3.073  1.00 95.75  ? -42  DT  J "O4'" 1 
ATOM   9802  C  "C3'" . DT  J  6 32  ? -29.074 -37.230 2.404  1.00 96.37  ? -42  DT  J "C3'" 1 
ATOM   9803  O  "O3'" . DT  J  6 32  ? -29.165 -37.557 1.019  1.00 97.93  ? -42  DT  J "O3'" 1 
ATOM   9804  C  "C2'" . DT  J  6 32  ? -28.058 -36.117 2.666  1.00 96.32  ? -42  DT  J "C2'" 1 
ATOM   9805  C  "C1'" . DT  J  6 32  ? -28.912 -34.856 2.582  1.00 96.46  ? -42  DT  J "C1'" 1 
ATOM   9806  N  N1    . DT  J  6 32  ? -28.420 -33.688 3.403  1.00 96.85  ? -42  DT  J N1    1 
ATOM   9807  C  C2    . DT  J  6 32  ? -28.654 -32.380 2.984  1.00 96.87  ? -42  DT  J C2    1 
ATOM   9808  O  O2    . DT  J  6 32  ? -29.236 -32.071 1.961  1.00 96.99  ? -42  DT  J O2    1 
ATOM   9809  N  N3    . DT  J  6 32  ? -28.166 -31.406 3.821  1.00 96.91  ? -42  DT  J N3    1 
ATOM   9810  C  C4    . DT  J  6 32  ? -27.483 -31.597 5.015  1.00 96.93  ? -42  DT  J C4    1 
ATOM   9811  O  O4    . DT  J  6 32  ? -27.091 -30.645 5.684  1.00 96.89  ? -42  DT  J O4    1 
ATOM   9812  C  C5    . DT  J  6 32  ? -27.268 -32.979 5.404  1.00 96.87  ? -42  DT  J C5    1 
ATOM   9813  C  C7    . DT  J  6 32  ? -26.543 -33.329 6.673  1.00 96.65  ? -42  DT  J C7    1 
ATOM   9814  C  C6    . DT  J  6 32  ? -27.743 -33.939 4.591  1.00 96.96  ? -42  DT  J C6    1 
ATOM   9815  P  P     . DG  J  6 33  ? -28.054 -38.462 0.301  1.00 99.30  ? -41  DG  J P     1 
ATOM   9816  O  OP1   . DG  J  6 33  ? -28.752 -39.477 -0.526 1.00 99.02  ? -41  DG  J OP1   1 
ATOM   9817  O  OP2   . DG  J  6 33  ? -27.070 -38.910 1.318  1.00 99.56  ? -41  DG  J OP2   1 
ATOM   9818  O  "O5'" . DG  J  6 33  ? -27.325 -37.392 -0.640 1.00 99.57  ? -41  DG  J "O5'" 1 
ATOM   9819  C  "C5'" . DG  J  6 33  ? -27.938 -36.950 -1.846 1.00 100.89 ? -41  DG  J "C5'" 1 
ATOM   9820  C  "C4'" . DG  J  6 33  ? -27.094 -35.877 -2.514 1.00 102.02 ? -41  DG  J "C4'" 1 
ATOM   9821  O  "O4'" . DG  J  6 33  ? -27.106 -34.676 -1.691 1.00 102.27 ? -41  DG  J "O4'" 1 
ATOM   9822  C  "C3'" . DG  J  6 33  ? -25.630 -36.253 -2.758 1.00 102.43 ? -41  DG  J "C3'" 1 
ATOM   9823  O  "O3'" . DG  J  6 33  ? -25.304 -36.028 -4.150 1.00 103.23 ? -41  DG  J "O3'" 1 
ATOM   9824  C  "C2'" . DG  J  6 33  ? -24.873 -35.383 -1.749 1.00 102.51 ? -41  DG  J "C2'" 1 
ATOM   9825  C  "C1'" . DG  J  6 33  ? -25.791 -34.176 -1.540 1.00 102.13 ? -41  DG  J "C1'" 1 
ATOM   9826  N  N9    . DG  J  6 33  ? -25.632 -33.542 -0.223 1.00 101.97 ? -41  DG  J N9    1 
ATOM   9827  C  C8    . DG  J  6 33  ? -25.646 -34.195 0.986  1.00 101.82 ? -41  DG  J C8    1 
ATOM   9828  N  N7    . DG  J  6 33  ? -25.476 -33.412 2.010  1.00 101.80 ? -41  DG  J N7    1 
ATOM   9829  C  C5    . DG  J  6 33  ? -25.338 -32.148 1.455  1.00 101.85 ? -41  DG  J C5    1 
ATOM   9830  C  C6    . DG  J  6 33  ? -25.128 -30.894 2.089  1.00 102.00 ? -41  DG  J C6    1 
ATOM   9831  O  O6    . DG  J  6 33  ? -25.019 -30.649 3.297  1.00 101.94 ? -41  DG  J O6    1 
ATOM   9832  N  N1    . DG  J  6 33  ? -25.039 -29.845 1.182  1.00 101.85 ? -41  DG  J N1    1 
ATOM   9833  C  C2    . DG  J  6 33  ? -25.138 -29.992 -0.175 1.00 101.76 ? -41  DG  J C2    1 
ATOM   9834  N  N2    . DG  J  6 33  ? -25.024 -28.854 -0.866 1.00 101.90 ? -41  DG  J N2    1 
ATOM   9835  N  N3    . DG  J  6 33  ? -25.338 -31.159 -0.791 1.00 101.74 ? -41  DG  J N3    1 
ATOM   9836  C  C4    . DG  J  6 33  ? -25.428 -32.204 0.079  1.00 101.80 ? -41  DG  J C4    1 
ATOM   9837  P  P     . DT  J  6 34  ? -23.901 -35.475 -4.727 1.00 104.17 ? -40  DT  J P     1 
ATOM   9838  O  OP1   . DT  J  6 34  ? -23.873 -35.786 -6.177 1.00 103.48 ? -40  DT  J OP1   1 
ATOM   9839  O  OP2   . DT  J  6 34  ? -22.795 -35.984 -3.873 1.00 103.89 ? -40  DT  J OP2   1 
ATOM   9840  O  "O5'" . DT  J  6 34  ? -24.042 -33.881 -4.523 1.00 103.81 ? -40  DT  J "O5'" 1 
ATOM   9841  C  "C5'" . DT  J  6 34  ? -23.647 -32.921 -5.516 1.00 103.52 ? -40  DT  J "C5'" 1 
ATOM   9842  C  "C4'" . DT  J  6 34  ? -22.490 -32.047 -5.044 1.00 103.44 ? -40  DT  J "C4'" 1 
ATOM   9843  O  "O4'" . DT  J  6 34  ? -22.661 -31.663 -3.647 1.00 103.59 ? -40  DT  J "O4'" 1 
ATOM   9844  C  "C3'" . DT  J  6 34  ? -21.105 -32.696 -5.129 1.00 103.44 ? -40  DT  J "C3'" 1 
ATOM   9845  O  "O3'" . DT  J  6 34  ? -20.110 -31.705 -5.356 1.00 103.20 ? -40  DT  J "O3'" 1 
ATOM   9846  C  "C2'" . DT  J  6 34  ? -20.917 -33.205 -3.707 1.00 103.68 ? -40  DT  J "C2'" 1 
ATOM   9847  C  "C1'" . DT  J  6 34  ? -21.440 -31.963 -2.987 1.00 103.78 ? -40  DT  J "C1'" 1 
ATOM   9848  N  N1    . DT  J  6 34  ? -21.573 -32.040 -1.484 1.00 103.82 ? -40  DT  J N1    1 
ATOM   9849  C  C2    . DT  J  6 34  ? -21.495 -30.868 -0.742 1.00 103.87 ? -40  DT  J C2    1 
ATOM   9850  O  O2    . DT  J  6 34  ? -21.336 -29.758 -1.232 1.00 103.53 ? -40  DT  J O2    1 
ATOM   9851  N  N3    . DT  J  6 34  ? -21.614 -31.047 0.620  1.00 103.92 ? -40  DT  J N3    1 
ATOM   9852  C  C4    . DT  J  6 34  ? -21.798 -32.246 1.297  1.00 103.82 ? -40  DT  J C4    1 
ATOM   9853  O  O4    . DT  J  6 34  ? -21.896 -32.291 2.520  1.00 103.67 ? -40  DT  J O4    1 
ATOM   9854  C  C5    . DT  J  6 34  ? -21.866 -33.428 0.464  1.00 103.74 ? -40  DT  J C5    1 
ATOM   9855  C  C7    . DT  J  6 34  ? -22.061 -34.787 1.071  1.00 103.67 ? -40  DT  J C7    1 
ATOM   9856  C  C6    . DT  J  6 34  ? -21.748 -33.269 -0.863 1.00 103.77 ? -40  DT  J C6    1 
ATOM   9857  P  P     . DA  J  6 35  ? -19.564 -31.297 -6.798 1.00 102.35 ? -39  DA  J P     1 
ATOM   9858  O  OP1   . DA  J  6 35  ? -20.742 -31.015 -7.653 1.00 102.93 ? -39  DA  J OP1   1 
ATOM   9859  O  OP2   . DA  J  6 35  ? -18.580 -32.332 -7.192 1.00 101.93 ? -39  DA  J OP2   1 
ATOM   9860  O  "O5'" . DA  J  6 35  ? -18.778 -29.917 -6.519 1.00 101.56 ? -39  DA  J "O5'" 1 
ATOM   9861  C  "C5'" . DA  J  6 35  ? -19.435 -28.716 -6.033 1.00 100.40 ? -39  DA  J "C5'" 1 
ATOM   9862  C  "C4'" . DA  J  6 35  ? -18.558 -27.842 -5.124 1.00 99.65  ? -39  DA  J "C4'" 1 
ATOM   9863  O  "O4'" . DA  J  6 35  ? -18.867 -28.102 -3.722 1.00 99.77  ? -39  DA  J "O4'" 1 
ATOM   9864  C  "C3'" . DA  J  6 35  ? -17.038 -28.005 -5.260 1.00 98.94  ? -39  DA  J "C3'" 1 
ATOM   9865  O  "O3'" . DA  J  6 35  ? -16.372 -26.730 -5.326 1.00 97.30  ? -39  DA  J "O3'" 1 
ATOM   9866  C  "C2'" . DA  J  6 35  ? -16.638 -28.809 -4.020 1.00 99.21  ? -39  DA  J "C2'" 1 
ATOM   9867  C  "C1'" . DA  J  6 35  ? -17.680 -28.378 -2.991 1.00 99.49  ? -39  DA  J "C1'" 1 
ATOM   9868  N  N9    . DA  J  6 35  ? -17.922 -29.381 -1.940 1.00 99.54  ? -39  DA  J N9    1 
ATOM   9869  C  C8    . DA  J  6 35  ? -18.093 -30.735 -2.099 1.00 99.48  ? -39  DA  J C8    1 
ATOM   9870  N  N7    . DA  J  6 35  ? -18.284 -31.401 -0.984 1.00 99.15  ? -39  DA  J N7    1 
ATOM   9871  C  C5    . DA  J  6 35  ? -18.233 -30.415 -0.015 1.00 99.49  ? -39  DA  J C5    1 
ATOM   9872  C  C6    . DA  J  6 35  ? -18.367 -30.465 1.389  1.00 99.49  ? -39  DA  J C6    1 
ATOM   9873  N  N6    . DA  J  6 35  ? -18.585 -31.601 2.061  1.00 99.34  ? -39  DA  J N6    1 
ATOM   9874  N  N1    . DA  J  6 35  ? -18.268 -29.301 2.072  1.00 99.42  ? -39  DA  J N1    1 
ATOM   9875  C  C2    . DA  J  6 35  ? -18.042 -28.165 1.391  1.00 99.27  ? -39  DA  J C2    1 
ATOM   9876  N  N3    . DA  J  6 35  ? -17.903 -27.991 0.075  1.00 99.17  ? -39  DA  J N3    1 
ATOM   9877  C  C4    . DA  J  6 35  ? -18.008 -29.164 -0.580 1.00 99.43  ? -39  DA  J C4    1 
ATOM   9878  P  P     . DT  J  6 36  ? -14.779 -26.610 -5.555 1.00 96.43  ? -38  DT  J P     1 
ATOM   9879  O  OP1   . DT  J  6 36  ? -14.522 -25.495 -6.492 1.00 96.24  ? -38  DT  J OP1   1 
ATOM   9880  O  OP2   . DT  J  6 36  ? -14.209 -27.955 -5.814 1.00 95.88  ? -38  DT  J OP2   1 
ATOM   9881  O  "O5'" . DT  J  6 36  ? -14.254 -26.132 -4.128 1.00 95.20  ? -38  DT  J "O5'" 1 
ATOM   9882  C  "C5'" . DT  J  6 36  ? -14.870 -25.031 -3.453 1.00 92.85  ? -38  DT  J "C5'" 1 
ATOM   9883  C  "C4'" . DT  J  6 36  ? -14.426 -25.003 -2.000 1.00 90.77  ? -38  DT  J "C4'" 1 
ATOM   9884  O  "O4'" . DT  J  6 36  ? -14.940 -26.168 -1.301 1.00 89.75  ? -38  DT  J "O4'" 1 
ATOM   9885  C  "C3'" . DT  J  6 36  ? -12.906 -25.022 -1.831 1.00 89.61  ? -38  DT  J "C3'" 1 
ATOM   9886  O  "O3'" . DT  J  6 36  ? -12.457 -23.756 -1.311 1.00 88.06  ? -38  DT  J "O3'" 1 
ATOM   9887  C  "C2'" . DT  J  6 36  ? -12.637 -26.214 -0.911 1.00 89.18  ? -38  DT  J "C2'" 1 
ATOM   9888  C  "C1'" . DT  J  6 36  ? -14.006 -26.499 -0.303 1.00 88.95  ? -38  DT  J "C1'" 1 
ATOM   9889  N  N1    . DT  J  6 36  ? -14.205 -27.917 0.154  1.00 88.86  ? -38  DT  J N1    1 
ATOM   9890  C  C2    . DT  J  6 36  ? -14.644 -28.135 1.448  1.00 88.35  ? -38  DT  J C2    1 
ATOM   9891  O  O2    . DT  J  6 36  ? -14.888 -27.242 2.241  1.00 88.12  ? -38  DT  J O2    1 
ATOM   9892  N  N3    . DT  J  6 36  ? -14.795 -29.456 1.787  1.00 88.01  ? -38  DT  J N3    1 
ATOM   9893  C  C4    . DT  J  6 36  ? -14.550 -30.558 0.990  1.00 88.29  ? -38  DT  J C4    1 
ATOM   9894  O  O4    . DT  J  6 36  ? -14.721 -31.696 1.408  1.00 88.34  ? -38  DT  J O4    1 
ATOM   9895  C  C5    . DT  J  6 36  ? -14.088 -30.270 -0.351 1.00 88.58  ? -38  DT  J C5    1 
ATOM   9896  C  C7    . DT  J  6 36  ? -13.791 -31.388 -1.313 1.00 88.34  ? -38  DT  J C7    1 
ATOM   9897  C  C6    . DT  J  6 36  ? -13.943 -28.979 -0.702 1.00 88.71  ? -38  DT  J C6    1 
ATOM   9898  P  P     . DT  J  6 37  ? -10.908 -23.435 -1.029 1.00 86.80  ? -37  DT  J P     1 
ATOM   9899  O  OP1   . DT  J  6 37  ? -10.710 -21.974 -1.168 1.00 86.21  ? -37  DT  J OP1   1 
ATOM   9900  O  OP2   . DT  J  6 37  ? -10.062 -24.382 -1.799 1.00 85.91  ? -37  DT  J OP2   1 
ATOM   9901  O  "O5'" . DT  J  6 37  ? -10.815 -23.797 0.532  1.00 86.92  ? -37  DT  J "O5'" 1 
ATOM   9902  C  "C5'" . DT  J  6 37  ? -11.896 -23.425 1.430  1.00 85.74  ? -37  DT  J "C5'" 1 
ATOM   9903  C  "C4'" . DT  J  6 37  ? -11.691 -23.889 2.867  1.00 84.13  ? -37  DT  J "C4'" 1 
ATOM   9904  O  "O4'" . DT  J  6 37  ? -12.062 -25.283 3.031  1.00 84.33  ? -37  DT  J "O4'" 1 
ATOM   9905  C  "C3'" . DT  J  6 37  ? -10.263 -23.769 3.374  1.00 83.20  ? -37  DT  J "C3'" 1 
ATOM   9906  O  "O3'" . DT  J  6 37  ? -10.309 -23.150 4.645  1.00 81.36  ? -37  DT  J "O3'" 1 
ATOM   9907  C  "C2'" . DT  J  6 37  ? -9.745  -25.208 3.417  1.00 83.40  ? -37  DT  J "C2'" 1 
ATOM   9908  C  "C1'" . DT  J  6 37  ? -11.020 -26.004 3.654  1.00 84.23  ? -37  DT  J "C1'" 1 
ATOM   9909  N  N1    . DT  J  6 37  ? -11.027 -27.398 3.107  1.00 84.40  ? -37  DT  J N1    1 
ATOM   9910  C  C2    . DT  J  6 37  ? -11.269 -28.454 3.961  1.00 84.81  ? -37  DT  J C2    1 
ATOM   9911  O  O2    . DT  J  6 37  ? -11.471 -28.337 5.150  1.00 85.50  ? -37  DT  J O2    1 
ATOM   9912  N  N3    . DT  J  6 37  ? -11.264 -29.693 3.383  1.00 84.93  ? -37  DT  J N3    1 
ATOM   9913  C  C4    . DT  J  6 37  ? -11.058 -29.991 2.055  1.00 84.77  ? -37  DT  J C4    1 
ATOM   9914  O  O4    . DT  J