data_3LJK
# 
_entry.id   3LJK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3LJK         pdb_00003ljk 10.2210/pdb3ljk/pdb 
RCSB  RCSB057356   ?            ?                   
WWPDB D_1000057356 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          IDP02733 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3LJK 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Osipiuk, J.'                                                   1 
'Maltseva, N.'                                                  2 
'Hasseman, J.'                                                  3 
'Anderson, W.F.'                                                4 
'Joachimiak, A.'                                                5 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 6 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 7 
# 
_citation.id                        primary 
_citation.title                     'X-ray crystal structure of glucose-6-phosphate isomerase from Francisella tularensis.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Osipiuk, J.'    1 ? 
primary 'Maltseva, N.'   2 ? 
primary 'Hasseman, J.'   3 ? 
primary 'Anderson, W.F.' 4 ? 
primary 'Joachimiak, A.' 5 ? 
# 
_cell.length_a           115.064 
_cell.length_b           115.064 
_cell.length_c           84.455 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3LJK 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         3LJK 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase'        61935.395 1   5.3.1.9 F194L ? ? 
2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   1   ?       ?     ? ? 
3 non-polymer syn GLYCEROL                               92.094    1   ?       ?     ? ? 
4 non-polymer syn 'ISOPROPYL ALCOHOL'                    60.095    1   ?       ?     ? ? 
5 non-polymer syn 'CALCIUM ION'                          40.078    1   ?       ?     ? ? 
6 water       nat water                                  18.015    722 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SNA(MSE)LFCDDSKKYLKEQNINLKNEFDKDDKRVEKFSLKHQNIYFDYSKNLINDYILKSLLESAEKSSLKDKIKQ
(MSE)FNGAKINSTEHRAVLHTALRDLSSTPLIVDGQDIRQEVTKEKQRVKELVEKVVSGRWRGFSGKKITDIVNIGIGG
SDLGPK(MSE)VVRALQPYHCTDLKVHFVSNVDADSLLQALHVVDPETTLLIIASKSFSTEETLLNSISAREWLLDHYED
EKAVANHFVAISSKLDKVKEFGIDLEHCYK(MSE)WDWVGGRYSLWSSIG(MSE)SIAFAIGYDNFEKLLAGAYSVDKHF
KETEFSKNIPVI(MSE)ALLASYYSCTYNSQSQALLPYDERLCYFVDYLQQAD(MSE)ESNGKSVNIAGETVNYQTGVVL
WGGVGTNGQHAFHQLLHQGNIFIPVDFIAIATSHHNYDNHQQALLANCFAQSQAL(MSE)FGQSYD(MSE)VYNELLKSG
LNETQAKELAAHKVIPGNRPSTTILLDELSPYSLGALIALYEHKIFVQGVLWDINSYDQWGVELGKKLGKNILKA(MSE)
NDDSSDEYQNLDDSTRQLIAKVKNK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAMLFCDDSKKYLKEQNINLKNEFDKDDKRVEKFSLKHQNIYFDYSKNLINDYILKSLLESAEKSSLKDKIKQMFNGAK
INSTEHRAVLHTALRDLSSTPLIVDGQDIRQEVTKEKQRVKELVEKVVSGRWRGFSGKKITDIVNIGIGGSDLGPKMVVR
ALQPYHCTDLKVHFVSNVDADSLLQALHVVDPETTLLIIASKSFSTEETLLNSISAREWLLDHYEDEKAVANHFVAISSK
LDKVKEFGIDLEHCYKMWDWVGGRYSLWSSIGMSIAFAIGYDNFEKLLAGAYSVDKHFKETEFSKNIPVIMALLASYYSC
TYNSQSQALLPYDERLCYFVDYLQQADMESNGKSVNIAGETVNYQTGVVLWGGVGTNGQHAFHQLLHQGNIFIPVDFIAI
ATSHHNYDNHQQALLANCFAQSQALMFGQSYDMVYNELLKSGLNETQAKELAAHKVIPGNRPSTTILLDELSPYSLGALI
ALYEHKIFVQGVLWDINSYDQWGVELGKKLGKNILKAMNDDSSDEYQNLDDSTRQLIAKVKNK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         IDP02733 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   MSE n 
1 5   LEU n 
1 6   PHE n 
1 7   CYS n 
1 8   ASP n 
1 9   ASP n 
1 10  SER n 
1 11  LYS n 
1 12  LYS n 
1 13  TYR n 
1 14  LEU n 
1 15  LYS n 
1 16  GLU n 
1 17  GLN n 
1 18  ASN n 
1 19  ILE n 
1 20  ASN n 
1 21  LEU n 
1 22  LYS n 
1 23  ASN n 
1 24  GLU n 
1 25  PHE n 
1 26  ASP n 
1 27  LYS n 
1 28  ASP n 
1 29  ASP n 
1 30  LYS n 
1 31  ARG n 
1 32  VAL n 
1 33  GLU n 
1 34  LYS n 
1 35  PHE n 
1 36  SER n 
1 37  LEU n 
1 38  LYS n 
1 39  HIS n 
1 40  GLN n 
1 41  ASN n 
1 42  ILE n 
1 43  TYR n 
1 44  PHE n 
1 45  ASP n 
1 46  TYR n 
1 47  SER n 
1 48  LYS n 
1 49  ASN n 
1 50  LEU n 
1 51  ILE n 
1 52  ASN n 
1 53  ASP n 
1 54  TYR n 
1 55  ILE n 
1 56  LEU n 
1 57  LYS n 
1 58  SER n 
1 59  LEU n 
1 60  LEU n 
1 61  GLU n 
1 62  SER n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  SER n 
1 67  SER n 
1 68  LEU n 
1 69  LYS n 
1 70  ASP n 
1 71  LYS n 
1 72  ILE n 
1 73  LYS n 
1 74  GLN n 
1 75  MSE n 
1 76  PHE n 
1 77  ASN n 
1 78  GLY n 
1 79  ALA n 
1 80  LYS n 
1 81  ILE n 
1 82  ASN n 
1 83  SER n 
1 84  THR n 
1 85  GLU n 
1 86  HIS n 
1 87  ARG n 
1 88  ALA n 
1 89  VAL n 
1 90  LEU n 
1 91  HIS n 
1 92  THR n 
1 93  ALA n 
1 94  LEU n 
1 95  ARG n 
1 96  ASP n 
1 97  LEU n 
1 98  SER n 
1 99  SER n 
1 100 THR n 
1 101 PRO n 
1 102 LEU n 
1 103 ILE n 
1 104 VAL n 
1 105 ASP n 
1 106 GLY n 
1 107 GLN n 
1 108 ASP n 
1 109 ILE n 
1 110 ARG n 
1 111 GLN n 
1 112 GLU n 
1 113 VAL n 
1 114 THR n 
1 115 LYS n 
1 116 GLU n 
1 117 LYS n 
1 118 GLN n 
1 119 ARG n 
1 120 VAL n 
1 121 LYS n 
1 122 GLU n 
1 123 LEU n 
1 124 VAL n 
1 125 GLU n 
1 126 LYS n 
1 127 VAL n 
1 128 VAL n 
1 129 SER n 
1 130 GLY n 
1 131 ARG n 
1 132 TRP n 
1 133 ARG n 
1 134 GLY n 
1 135 PHE n 
1 136 SER n 
1 137 GLY n 
1 138 LYS n 
1 139 LYS n 
1 140 ILE n 
1 141 THR n 
1 142 ASP n 
1 143 ILE n 
1 144 VAL n 
1 145 ASN n 
1 146 ILE n 
1 147 GLY n 
1 148 ILE n 
1 149 GLY n 
1 150 GLY n 
1 151 SER n 
1 152 ASP n 
1 153 LEU n 
1 154 GLY n 
1 155 PRO n 
1 156 LYS n 
1 157 MSE n 
1 158 VAL n 
1 159 VAL n 
1 160 ARG n 
1 161 ALA n 
1 162 LEU n 
1 163 GLN n 
1 164 PRO n 
1 165 TYR n 
1 166 HIS n 
1 167 CYS n 
1 168 THR n 
1 169 ASP n 
1 170 LEU n 
1 171 LYS n 
1 172 VAL n 
1 173 HIS n 
1 174 PHE n 
1 175 VAL n 
1 176 SER n 
1 177 ASN n 
1 178 VAL n 
1 179 ASP n 
1 180 ALA n 
1 181 ASP n 
1 182 SER n 
1 183 LEU n 
1 184 LEU n 
1 185 GLN n 
1 186 ALA n 
1 187 LEU n 
1 188 HIS n 
1 189 VAL n 
1 190 VAL n 
1 191 ASP n 
1 192 PRO n 
1 193 GLU n 
1 194 THR n 
1 195 THR n 
1 196 LEU n 
1 197 LEU n 
1 198 ILE n 
1 199 ILE n 
1 200 ALA n 
1 201 SER n 
1 202 LYS n 
1 203 SER n 
1 204 PHE n 
1 205 SER n 
1 206 THR n 
1 207 GLU n 
1 208 GLU n 
1 209 THR n 
1 210 LEU n 
1 211 LEU n 
1 212 ASN n 
1 213 SER n 
1 214 ILE n 
1 215 SER n 
1 216 ALA n 
1 217 ARG n 
1 218 GLU n 
1 219 TRP n 
1 220 LEU n 
1 221 LEU n 
1 222 ASP n 
1 223 HIS n 
1 224 TYR n 
1 225 GLU n 
1 226 ASP n 
1 227 GLU n 
1 228 LYS n 
1 229 ALA n 
1 230 VAL n 
1 231 ALA n 
1 232 ASN n 
1 233 HIS n 
1 234 PHE n 
1 235 VAL n 
1 236 ALA n 
1 237 ILE n 
1 238 SER n 
1 239 SER n 
1 240 LYS n 
1 241 LEU n 
1 242 ASP n 
1 243 LYS n 
1 244 VAL n 
1 245 LYS n 
1 246 GLU n 
1 247 PHE n 
1 248 GLY n 
1 249 ILE n 
1 250 ASP n 
1 251 LEU n 
1 252 GLU n 
1 253 HIS n 
1 254 CYS n 
1 255 TYR n 
1 256 LYS n 
1 257 MSE n 
1 258 TRP n 
1 259 ASP n 
1 260 TRP n 
1 261 VAL n 
1 262 GLY n 
1 263 GLY n 
1 264 ARG n 
1 265 TYR n 
1 266 SER n 
1 267 LEU n 
1 268 TRP n 
1 269 SER n 
1 270 SER n 
1 271 ILE n 
1 272 GLY n 
1 273 MSE n 
1 274 SER n 
1 275 ILE n 
1 276 ALA n 
1 277 PHE n 
1 278 ALA n 
1 279 ILE n 
1 280 GLY n 
1 281 TYR n 
1 282 ASP n 
1 283 ASN n 
1 284 PHE n 
1 285 GLU n 
1 286 LYS n 
1 287 LEU n 
1 288 LEU n 
1 289 ALA n 
1 290 GLY n 
1 291 ALA n 
1 292 TYR n 
1 293 SER n 
1 294 VAL n 
1 295 ASP n 
1 296 LYS n 
1 297 HIS n 
1 298 PHE n 
1 299 LYS n 
1 300 GLU n 
1 301 THR n 
1 302 GLU n 
1 303 PHE n 
1 304 SER n 
1 305 LYS n 
1 306 ASN n 
1 307 ILE n 
1 308 PRO n 
1 309 VAL n 
1 310 ILE n 
1 311 MSE n 
1 312 ALA n 
1 313 LEU n 
1 314 LEU n 
1 315 ALA n 
1 316 SER n 
1 317 TYR n 
1 318 TYR n 
1 319 SER n 
1 320 CYS n 
1 321 THR n 
1 322 TYR n 
1 323 ASN n 
1 324 SER n 
1 325 GLN n 
1 326 SER n 
1 327 GLN n 
1 328 ALA n 
1 329 LEU n 
1 330 LEU n 
1 331 PRO n 
1 332 TYR n 
1 333 ASP n 
1 334 GLU n 
1 335 ARG n 
1 336 LEU n 
1 337 CYS n 
1 338 TYR n 
1 339 PHE n 
1 340 VAL n 
1 341 ASP n 
1 342 TYR n 
1 343 LEU n 
1 344 GLN n 
1 345 GLN n 
1 346 ALA n 
1 347 ASP n 
1 348 MSE n 
1 349 GLU n 
1 350 SER n 
1 351 ASN n 
1 352 GLY n 
1 353 LYS n 
1 354 SER n 
1 355 VAL n 
1 356 ASN n 
1 357 ILE n 
1 358 ALA n 
1 359 GLY n 
1 360 GLU n 
1 361 THR n 
1 362 VAL n 
1 363 ASN n 
1 364 TYR n 
1 365 GLN n 
1 366 THR n 
1 367 GLY n 
1 368 VAL n 
1 369 VAL n 
1 370 LEU n 
1 371 TRP n 
1 372 GLY n 
1 373 GLY n 
1 374 VAL n 
1 375 GLY n 
1 376 THR n 
1 377 ASN n 
1 378 GLY n 
1 379 GLN n 
1 380 HIS n 
1 381 ALA n 
1 382 PHE n 
1 383 HIS n 
1 384 GLN n 
1 385 LEU n 
1 386 LEU n 
1 387 HIS n 
1 388 GLN n 
1 389 GLY n 
1 390 ASN n 
1 391 ILE n 
1 392 PHE n 
1 393 ILE n 
1 394 PRO n 
1 395 VAL n 
1 396 ASP n 
1 397 PHE n 
1 398 ILE n 
1 399 ALA n 
1 400 ILE n 
1 401 ALA n 
1 402 THR n 
1 403 SER n 
1 404 HIS n 
1 405 HIS n 
1 406 ASN n 
1 407 TYR n 
1 408 ASP n 
1 409 ASN n 
1 410 HIS n 
1 411 GLN n 
1 412 GLN n 
1 413 ALA n 
1 414 LEU n 
1 415 LEU n 
1 416 ALA n 
1 417 ASN n 
1 418 CYS n 
1 419 PHE n 
1 420 ALA n 
1 421 GLN n 
1 422 SER n 
1 423 GLN n 
1 424 ALA n 
1 425 LEU n 
1 426 MSE n 
1 427 PHE n 
1 428 GLY n 
1 429 GLN n 
1 430 SER n 
1 431 TYR n 
1 432 ASP n 
1 433 MSE n 
1 434 VAL n 
1 435 TYR n 
1 436 ASN n 
1 437 GLU n 
1 438 LEU n 
1 439 LEU n 
1 440 LYS n 
1 441 SER n 
1 442 GLY n 
1 443 LEU n 
1 444 ASN n 
1 445 GLU n 
1 446 THR n 
1 447 GLN n 
1 448 ALA n 
1 449 LYS n 
1 450 GLU n 
1 451 LEU n 
1 452 ALA n 
1 453 ALA n 
1 454 HIS n 
1 455 LYS n 
1 456 VAL n 
1 457 ILE n 
1 458 PRO n 
1 459 GLY n 
1 460 ASN n 
1 461 ARG n 
1 462 PRO n 
1 463 SER n 
1 464 THR n 
1 465 THR n 
1 466 ILE n 
1 467 LEU n 
1 468 LEU n 
1 469 ASP n 
1 470 GLU n 
1 471 LEU n 
1 472 SER n 
1 473 PRO n 
1 474 TYR n 
1 475 SER n 
1 476 LEU n 
1 477 GLY n 
1 478 ALA n 
1 479 LEU n 
1 480 ILE n 
1 481 ALA n 
1 482 LEU n 
1 483 TYR n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 ILE n 
1 488 PHE n 
1 489 VAL n 
1 490 GLN n 
1 491 GLY n 
1 492 VAL n 
1 493 LEU n 
1 494 TRP n 
1 495 ASP n 
1 496 ILE n 
1 497 ASN n 
1 498 SER n 
1 499 TYR n 
1 500 ASP n 
1 501 GLN n 
1 502 TRP n 
1 503 GLY n 
1 504 VAL n 
1 505 GLU n 
1 506 LEU n 
1 507 GLY n 
1 508 LYS n 
1 509 LYS n 
1 510 LEU n 
1 511 GLY n 
1 512 LYS n 
1 513 ASN n 
1 514 ILE n 
1 515 LEU n 
1 516 LYS n 
1 517 ALA n 
1 518 MSE n 
1 519 ASN n 
1 520 ASP n 
1 521 ASP n 
1 522 SER n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 TYR n 
1 527 GLN n 
1 528 ASN n 
1 529 LEU n 
1 530 ASP n 
1 531 ASP n 
1 532 SER n 
1 533 THR n 
1 534 ARG n 
1 535 GLN n 
1 536 LEU n 
1 537 ILE n 
1 538 ALA n 
1 539 LYS n 
1 540 VAL n 
1 541 LYS n 
1 542 ASN n 
1 543 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FTT1315c, pgi' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'subsp. tularensis SCHU S4' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Francisella tularensis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     119856 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_FRATT 
_struct_ref.pdbx_db_accession          Q5NFC4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLFCDDSKKYLKEQNINLKNEFDKDDKRVEKFSLKHQNIYFDYSKNLINDYILKSLLESAEKSSLKDKIKQMFNGAKINS
TEHRAVLHTALRDLSSTPLIVDGQDIRQEVTKEKQRVKELVEKVVSGRWRGFSGKKITDIVNIGIGGSDLGPKMVVRALQ
PYHCTDLKVHFVSNVDADSLLQALHVVDPETTLFIIASKSFSTEETLLNSISAREWLLDHYEDEKAVANHFVAISSKLDK
VKEFGIDLEHCYKMWDWVGGRYSLWSSIGMSIAFAIGYDNFEKLLAGAYSVDKHFKETEFSKNIPVIMALLASYYSCTYN
SQSQALLPYDERLCYFVDYLQQADMESNGKSVNIAGETVNYQTGVVLWGGVGTNGQHAFHQLLHQGNIFIPVDFIAIATS
HHNYDNHQQALLANCFAQSQALMFGQSYDMVYNELLKSGLNETQAKELAAHKVIPGNRPSTTILLDELSPYSLGALIALY
EHKIFVQGVLWDINSYDQWGVELGKKLGKNILKAMNDDSSDEYQNLDDSTRQLIAKVKNK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3LJK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5NFC4 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  540 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       540 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LJK SER A 1   ? UNP Q5NFC4 ?   ?   'expression tag'      -2  1 
1 3LJK ASN A 2   ? UNP Q5NFC4 ?   ?   'expression tag'      -1  2 
1 3LJK ALA A 3   ? UNP Q5NFC4 ?   ?   'expression tag'      0   3 
1 3LJK LEU A 197 ? UNP Q5NFC4 PHE 194 'engineered mutation' 194 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                               'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                          ?                               'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                               ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                               'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                              ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                               'C6 H13 N O2'    131.173 
IPA non-polymer         . 'ISOPROPYL ALCOHOL'                    2-PROPANOL                      'C3 H8 O'        60.095  
LEU 'L-peptide linking' y LEUCINE                                ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                               'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ?                               'C6 H13 N O4 S'  195.237 
MSE 'L-peptide linking' n SELENOMETHIONINE                       ?                               'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3LJK 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.80 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    
'0.2 M Ca(OAc)2, 0.1 M MES buffer, 10% 2-propanol, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.pdbx_collection_date   2009-10-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
# 
_reflns.entry_id                     3LJK 
_reflns.d_resolution_high            1.480 
_reflns.d_resolution_low             32.2 
_reflns.number_obs                   106870 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_netI_over_sigmaI        12.700 
_reflns.pdbx_chi_squared             2.119 
_reflns.pdbx_redundancy              9.800 
_reflns.percent_possible_obs         99.100 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   106870 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        25.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.48 
_reflns_shell.d_res_low              1.51 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.679 
_reflns_shell.meanI_over_sigI_obs    2.08 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.796 
_reflns_shell.pdbx_redundancy        5.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4930 
_reflns_shell.percent_possible_all   92.00 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3LJK 
_refine.ls_d_res_high                            1.480 
_refine.ls_d_res_low                             32.300 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.640 
_refine.ls_number_reflns_obs                     106466 
_refine.ls_number_reflns_all                     106466 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: RESIDUAL ONLY' 
_refine.ls_R_factor_all                          0.126 
_refine.ls_R_factor_obs                          0.126 
_refine.ls_R_factor_R_work                       0.124 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.158 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  5315 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               16.275 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.430 
_refine.aniso_B[2][2]                            -0.430 
_refine.aniso_B[3][3]                            0.650 
_refine.aniso_B[1][2]                            -0.220 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.982 
_refine.correlation_coeff_Fo_to_Fc_free          0.974 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.061 
_refine.pdbx_overall_ESU_R_Free                  0.055 
_refine.overall_SU_ML                            0.031 
_refine.overall_SU_B                             1.803 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                60.16 
_refine.B_iso_min                                7.38 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.21 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4730 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             724 
_refine_hist.number_atoms_total               5477 
_refine_hist.d_res_high                       1.480 
_refine_hist.d_res_low                        32.300 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       4915 0.019  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         3366 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    6738 1.629  1.962  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      8374 1.015  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 674  5.654  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 244  36.750 25.779 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 958  12.914 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 14   14.800 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         742  0.108  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   5577 0.009  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     957  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2917 1.595  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         1182 0.542  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4779 2.390  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            1998 3.933  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           1888 5.734  4.500  ? 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr     8281 1.536  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.477 
_refine_ls_shell.d_res_low                        1.515 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               91.260 
_refine_ls_shell.number_reflns_R_work             6887 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.248 
_refine_ls_shell.R_factor_R_free                  0.304 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             340 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                7227 
_refine_ls_shell.number_reflns_obs                7227 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LJK 
_struct.title                     'Glucose-6-phosphate isomerase from Francisella tularensis.' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LJK 
_struct_keywords.text            
;structural genomics, IDP02733, glucose-6-phosphate, isomerase., Cytoplasm, Gluconeogenesis, Glycolysis, Isomerase, Center for Structural Genomics of Infectious Diseases, CSGID
;
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? GLU A 16  ? ASP A 5   GLU A 13  1 ? 9  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 28  ? ASN A 17  ASP A 25  1 ? 9  
HELX_P HELX_P3  3  LYS A 30  ? PHE A 35  ? LYS A 27  PHE A 32  1 ? 6  
HELX_P HELX_P4  4  ASN A 52  ? SER A 66  ? ASN A 49  SER A 63  1 ? 15 
HELX_P HELX_P5  5  SER A 67  ? GLY A 78  ? SER A 64  GLY A 75  1 ? 12 
HELX_P HELX_P6  6  LEU A 90  ? ASP A 96  ? LEU A 87  ASP A 93  5 ? 7  
HELX_P HELX_P7  7  ILE A 109 ? SER A 129 ? ILE A 106 SER A 126 1 ? 21 
HELX_P HELX_P8  8  ILE A 148 ? SER A 151 ? ILE A 145 SER A 148 5 ? 4  
HELX_P HELX_P9  9  ASP A 152 ? LEU A 162 ? ASP A 149 LEU A 159 1 ? 11 
HELX_P HELX_P10 10 GLN A 163 ? HIS A 166 ? GLN A 160 HIS A 163 5 ? 4  
HELX_P HELX_P11 11 ASP A 179 ? HIS A 188 ? ASP A 176 HIS A 185 1 ? 10 
HELX_P HELX_P12 12 VAL A 189 ? VAL A 190 ? VAL A 186 VAL A 187 5 ? 2  
HELX_P HELX_P13 13 ASP A 191 ? GLU A 193 ? ASP A 188 GLU A 190 5 ? 3  
HELX_P HELX_P14 14 THR A 206 ? GLU A 225 ? THR A 203 GLU A 222 1 ? 20 
HELX_P HELX_P15 15 ASP A 226 ? ASN A 232 ? ASP A 223 ASN A 229 5 ? 7  
HELX_P HELX_P16 16 LYS A 240 ? GLY A 248 ? LYS A 237 GLY A 245 1 ? 9  
HELX_P HELX_P17 17 ASP A 250 ? GLU A 252 ? ASP A 247 GLU A 249 5 ? 3  
HELX_P HELX_P18 18 GLY A 262 ? SER A 266 ? GLY A 259 SER A 263 5 ? 5  
HELX_P HELX_P19 19 SER A 269 ? ILE A 271 ? SER A 266 ILE A 268 5 ? 3  
HELX_P HELX_P20 20 GLY A 272 ? GLY A 280 ? GLY A 269 GLY A 277 1 ? 9  
HELX_P HELX_P21 21 GLY A 280 ? THR A 301 ? GLY A 277 THR A 298 1 ? 22 
HELX_P HELX_P22 22 GLU A 302 ? LYS A 305 ? GLU A 299 LYS A 302 5 ? 4  
HELX_P HELX_P23 23 ASN A 306 ? TYR A 322 ? ASN A 303 TYR A 319 1 ? 17 
HELX_P HELX_P24 24 ASP A 333 ? CYS A 337 ? ASP A 330 CYS A 334 5 ? 5  
HELX_P HELX_P25 25 TYR A 338 ? GLY A 352 ? TYR A 335 GLY A 349 1 ? 15 
HELX_P HELX_P26 26 THR A 376 ? ALA A 381 ? THR A 373 ALA A 378 5 ? 6  
HELX_P HELX_P27 27 PHE A 382 ? GLY A 389 ? PHE A 379 GLY A 386 1 ? 8  
HELX_P HELX_P28 28 TYR A 407 ? GLY A 428 ? TYR A 404 GLY A 425 1 ? 22 
HELX_P HELX_P29 29 SER A 430 ? SER A 441 ? SER A 427 SER A 438 1 ? 12 
HELX_P HELX_P30 30 ASN A 444 ? VAL A 456 ? ASN A 441 VAL A 453 1 ? 13 
HELX_P HELX_P31 31 SER A 472 ? ASP A 495 ? SER A 469 ASP A 492 1 ? 24 
HELX_P HELX_P32 32 GLN A 501 ? GLY A 503 ? GLN A 498 GLY A 500 5 ? 3  
HELX_P HELX_P33 33 VAL A 504 ? ASP A 520 ? VAL A 501 ASP A 517 1 ? 17 
HELX_P HELX_P34 34 SER A 523 ? LEU A 529 ? SER A 520 LEU A 526 1 ? 7  
HELX_P HELX_P35 35 ASP A 530 ? ASN A 542 ? ASP A 527 ASN A 539 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 7   SG A ? ? 1_555 A CYS 320 SG ? ? A CYS 4   A CYS 317  1_555 ? ? ? ? ? ? ? 2.112 ? ? 
covale1  covale both ? A ALA 3   C  ? ? ? 1_555 A MSE 4   N  ? ? A ALA 0   A MSE 1    1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2  covale both ? A MSE 4   C  ? ? ? 1_555 A LEU 5   N  ? ? A MSE 1   A LEU 2    1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale3  covale both ? A GLN 74  C  ? ? ? 1_555 A MSE 75  N  ? ? A GLN 71  A MSE 72   1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale4  covale both ? A MSE 75  C  ? ? ? 1_555 A PHE 76  N  ? ? A MSE 72  A PHE 73   1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale5  covale both ? A LYS 156 C  ? ? ? 1_555 A MSE 157 N  ? ? A LYS 153 A MSE 154  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale6  covale both ? A MSE 157 C  ? ? ? 1_555 A VAL 158 N  ? ? A MSE 154 A VAL 155  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale7  covale both ? A LYS 256 C  ? ? ? 1_555 A MSE 257 N  ? ? A LYS 253 A MSE 254  1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale8  covale both ? A MSE 257 C  ? ? ? 1_555 A TRP 258 N  ? ? A MSE 254 A TRP 255  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale9  covale both ? A GLY 272 C  ? ? ? 1_555 A MSE 273 N  ? ? A GLY 269 A MSE 270  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale10 covale both ? A MSE 273 C  ? ? ? 1_555 A SER 274 N  ? ? A MSE 270 A SER 271  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale11 covale both ? A ILE 310 C  ? ? ? 1_555 A MSE 311 N  ? ? A ILE 307 A MSE 308  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale12 covale both ? A MSE 311 C  ? ? ? 1_555 A ALA 312 N  ? ? A MSE 308 A ALA 309  1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale13 covale both ? A ASP 347 C  ? ? ? 1_555 A MSE 348 N  ? ? A ASP 344 A MSE 345  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale14 covale both ? A MSE 348 C  ? ? ? 1_555 A GLU 349 N  ? ? A MSE 345 A GLU 346  1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale15 covale both ? A LEU 425 C  ? ? ? 1_555 A MSE 426 N  ? ? A LEU 422 A MSE 423  1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale16 covale both ? A MSE 426 C  ? ? ? 1_555 A PHE 427 N  ? ? A MSE 423 A PHE 424  1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale17 covale both ? A ASP 432 C  ? ? ? 1_555 A MSE 433 N  ? ? A ASP 429 A MSE 430  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale18 covale both ? A MSE 433 C  ? ? ? 1_555 A VAL 434 N  ? ? A MSE 430 A VAL 431  1_555 ? ? ? ? ? ? ? 1.335 ? ? 
covale19 covale both ? A ALA 517 C  ? ? ? 1_555 A MSE 518 N  ? ? A ALA 514 A MSE 515  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale20 covale both ? A MSE 518 C  ? ? ? 1_555 A ASN 519 N  ? ? A MSE 515 A ASN 516  1_555 ? ? ? ? ? ? ? 1.318 ? ? 
metalc1  metalc ?    ? A GLU 64  O  ? ? ? 1_555 E CA  .   CA ? ? A GLU 61  A CA  604  1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc2  metalc ?    ? E CA  .   CA ? ? ? 1_555 F HOH .   O  ? ? A CA  604 A HOH 644  1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc3  metalc ?    ? E CA  .   CA ? ? ? 1_555 F HOH .   O  ? ? A CA  604 A HOH 645  1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc4  metalc ?    ? E CA  .   CA ? ? ? 1_555 F HOH .   O  ? ? A CA  604 A HOH 646  1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc5  metalc ?    ? E CA  .   CA ? ? ? 1_555 F HOH .   O  ? ? A CA  604 A HOH 733  1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc6  metalc ?    ? E CA  .   CA ? ? ? 1_555 F HOH .   O  ? ? A CA  604 A HOH 1074 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           375 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            372 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   THR 
_struct_mon_prot_cis.pdbx_label_seq_id_2    376 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    THR 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     373 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       10.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 36  ? HIS A 39  ? SER A 33  HIS A 36  
A 2 ILE A 42  ? ASP A 45  ? ILE A 39  ASP A 42  
A 3 SER A 463 ? LEU A 468 ? SER A 460 LEU A 465 
A 4 VAL A 395 ? ILE A 400 ? VAL A 392 ILE A 397 
A 5 SER A 326 ? PRO A 331 ? SER A 323 PRO A 328 
A 6 VAL A 369 ? GLY A 372 ? VAL A 366 GLY A 369 
B 1 ILE A 103 ? VAL A 104 ? ILE A 100 VAL A 101 
B 2 GLN A 107 ? ASP A 108 ? GLN A 104 ASP A 105 
C 1 LYS A 171 ? VAL A 175 ? LYS A 168 VAL A 172 
C 2 ASP A 142 ? ILE A 146 ? ASP A 139 ILE A 143 
C 3 THR A 195 ? ALA A 200 ? THR A 192 ALA A 197 
C 4 PHE A 234 ? ILE A 237 ? PHE A 231 ILE A 234 
C 5 CYS A 254 ? TYR A 255 ? CYS A 251 TYR A 252 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 37  ? N LEU A 34  O PHE A 44  ? O PHE A 41  
A 2 3 N ASP A 45  ? N ASP A 42  O THR A 465 ? O THR A 462 
A 3 4 O ILE A 466 ? O ILE A 463 N PHE A 397 ? N PHE A 394 
A 4 5 O ASP A 396 ? O ASP A 393 N LEU A 330 ? N LEU A 327 
A 5 6 N GLN A 327 ? N GLN A 324 O TRP A 371 ? O TRP A 368 
B 1 2 N VAL A 104 ? N VAL A 101 O GLN A 107 ? O GLN A 104 
C 1 2 O VAL A 175 ? O VAL A 172 N ASN A 145 ? N ASN A 142 
C 2 3 N ILE A 146 ? N ILE A 143 O ALA A 200 ? O ALA A 197 
C 3 4 N ILE A 199 ? N ILE A 196 O ILE A 237 ? O ILE A 234 
C 4 5 N ALA A 236 ? N ALA A 233 O TYR A 255 ? O TYR A 252 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MES 601 ? 9 'BINDING SITE FOR RESIDUE MES A 601' 
AC2 Software A GOL 602 ? 7 'BINDING SITE FOR RESIDUE GOL A 602' 
AC3 Software A IPA 603 ? 7 'BINDING SITE FOR RESIDUE IPA A 603' 
AC4 Software A CA  604 ? 7 'BINDING SITE FOR RESIDUE CA A 604'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 GLN A 163 ? GLN A 160  . ? 1_555 ? 
2  AC1 9 PRO A 164 ? PRO A 161  . ? 1_555 ? 
3  AC1 9 HIS A 166 ? HIS A 163  . ? 1_555 ? 
4  AC1 9 GLN A 185 ? GLN A 182  . ? 4_555 ? 
5  AC1 9 HIS A 188 ? HIS A 185  . ? 4_555 ? 
6  AC1 9 HIS A 404 ? HIS A 401  . ? 1_555 ? 
7  AC1 9 HOH F .   ? HOH A 756  . ? 4_555 ? 
8  AC1 9 HOH F .   ? HOH A 1053 . ? 1_555 ? 
9  AC1 9 HOH F .   ? HOH A 1221 . ? 1_555 ? 
10 AC2 7 LYS A 126 ? LYS A 123  . ? 1_555 ? 
11 AC2 7 TRP A 132 ? TRP A 129  . ? 1_555 ? 
12 AC2 7 ARG A 133 ? ARG A 130  . ? 1_555 ? 
13 AC2 7 HIS A 253 ? HIS A 250  . ? 1_555 ? 
14 AC2 7 HOH F .   ? HOH A 571  . ? 1_555 ? 
15 AC2 7 HOH F .   ? HOH A 1116 . ? 1_555 ? 
16 AC2 7 HOH F .   ? HOH A 1144 . ? 1_555 ? 
17 AC3 7 HIS A 39  ? HIS A 36   . ? 1_555 ? 
18 AC3 7 GLN A 40  ? GLN A 37   . ? 1_555 ? 
19 AC3 7 ASN A 41  ? ASN A 38   . ? 1_555 ? 
20 AC3 7 TYR A 474 ? TYR A 471  . ? 1_555 ? 
21 AC3 7 SER A 475 ? SER A 472  . ? 1_555 ? 
22 AC3 7 ALA A 478 ? ALA A 475  . ? 1_555 ? 
23 AC3 7 HOH F .   ? HOH A 952  . ? 1_555 ? 
24 AC4 7 GLU A 64  ? GLU A 61   . ? 1_555 ? 
25 AC4 7 GLU A 225 ? GLU A 222  . ? 5_665 ? 
26 AC4 7 HOH F .   ? HOH A 644  . ? 1_555 ? 
27 AC4 7 HOH F .   ? HOH A 645  . ? 1_555 ? 
28 AC4 7 HOH F .   ? HOH A 646  . ? 1_555 ? 
29 AC4 7 HOH F .   ? HOH A 733  . ? 1_555 ? 
30 AC4 7 HOH F .   ? HOH A 1074 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3LJK 
_atom_sites.fract_transf_matrix[1][1]   0.008691 
_atom_sites.fract_transf_matrix[1][2]   0.005018 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010035 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011841 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 66.308 77.156 14.242  0.70 28.48 ? -2   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 67.250 76.007 14.384  0.70 28.37 ? -2   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 68.382 76.150 13.368  0.70 27.53 ? -2   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 68.392 77.106 12.593  0.70 27.63 ? -2   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 66.493 74.703 14.152  0.70 27.93 ? -2   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 66.319 74.549 12.750  0.70 28.75 ? -2   SER A OG  1 
ATOM   7    N  N   . ASN A 1 2   ? 69.312 75.195 13.356  0.70 26.65 ? -1   ASN A N   1 
ATOM   8    C  CA  . ASN A 1 2   ? 70.456 75.239 12.430  0.70 25.83 ? -1   ASN A CA  1 
ATOM   9    C  C   . ASN A 1 2   ? 70.171 74.516 11.122  0.70 23.78 ? -1   ASN A C   1 
ATOM   10   O  O   . ASN A 1 2   ? 71.005 74.453 10.233  0.70 22.57 ? -1   ASN A O   1 
ATOM   11   C  CB  . ASN A 1 2   ? 71.687 74.594 13.090  0.70 26.73 ? -1   ASN A CB  1 
ATOM   12   C  CG  . ASN A 1 2   ? 72.172 75.363 14.296  0.70 29.86 ? -1   ASN A CG  1 
ATOM   13   O  OD1 . ASN A 1 2   ? 72.179 76.609 14.298  0.70 33.40 ? -1   ASN A OD1 1 
ATOM   14   N  ND2 . ASN A 1 2   ? 72.617 74.629 15.329  0.70 32.13 ? -1   ASN A ND2 1 
ATOM   15   N  N   . ALA A 1 3   ? 68.967 73.986 10.988  1.00 22.25 ? 0    ALA A N   1 
ATOM   16   C  CA  . ALA A 1 3   ? 68.633 73.219 9.775   1.00 20.19 ? 0    ALA A CA  1 
ATOM   17   C  C   . ALA A 1 3   ? 68.542 74.130 8.549   1.00 19.41 ? 0    ALA A C   1 
ATOM   18   O  O   . ALA A 1 3   ? 68.222 75.332 8.653   1.00 20.94 ? 0    ALA A O   1 
ATOM   19   C  CB  . ALA A 1 3   ? 67.362 72.417 9.947   1.00 20.02 ? 0    ALA A CB  1 
HETATM 20   N  N   . MSE A 1 4   ? 68.868 73.554 7.398   1.00 16.87 ? 1    MSE A N   1 
HETATM 21   C  CA  . MSE A 1 4   ? 68.710 74.232 6.127   1.00 15.60 ? 1    MSE A CA  1 
HETATM 22   C  C   . MSE A 1 4   ? 67.262 74.716 5.987   1.00 15.37 ? 1    MSE A C   1 
HETATM 23   O  O   . MSE A 1 4   ? 66.305 73.968 6.252   1.00 15.92 ? 1    MSE A O   1 
HETATM 24   C  CB  . MSE A 1 4   ? 69.003 73.284 4.963   1.00 15.97 ? 1    MSE A CB  1 
HETATM 25   C  CG  . MSE A 1 4   ? 69.011 73.959 3.641   1.00 16.77 ? 1    MSE A CG  1 
HETATM 26   SE SE  . MSE A 1 4   ? 68.882 72.677 2.177   0.70 17.71 ? 1    MSE A SE  1 
HETATM 27   C  CE  . MSE A 1 4   ? 66.961 72.298 2.246   1.00 15.50 ? 1    MSE A CE  1 
ATOM   28   N  N   . LEU A 1 5   ? 67.091 75.950 5.509   1.00 13.80 ? 2    LEU A N   1 
ATOM   29   C  CA  . LEU A 1 5   ? 65.734 76.468 5.227   1.00 12.93 ? 2    LEU A CA  1 
ATOM   30   C  C   . LEU A 1 5   ? 65.369 76.084 3.805   1.00 12.33 ? 2    LEU A C   1 
ATOM   31   O  O   . LEU A 1 5   ? 66.028 76.518 2.883   1.00 13.40 ? 2    LEU A O   1 
ATOM   32   C  CB  . LEU A 1 5   ? 65.691 78.009 5.373   1.00 12.86 ? 2    LEU A CB  1 
ATOM   33   C  CG  . LEU A 1 5   ? 64.354 78.701 5.030   1.00 12.29 ? 2    LEU A CG  1 
ATOM   34   C  CD1 . LEU A 1 5   ? 63.174 78.191 5.962   1.00 15.86 ? 2    LEU A CD1 1 
ATOM   35   C  CD2 . LEU A 1 5   ? 64.530 80.230 5.175   1.00 13.40 ? 2    LEU A CD2 1 
ATOM   36   N  N   . PHE A 1 6   ? 64.296 75.301 3.632   1.00 11.94 ? 3    PHE A N   1 
ATOM   37   C  CA  . PHE A 1 6   ? 63.821 74.971 2.307   1.00 11.90 ? 3    PHE A CA  1 
ATOM   38   C  C   . PHE A 1 6   ? 63.131 76.146 1.631   1.00 12.47 ? 3    PHE A C   1 
ATOM   39   O  O   . PHE A 1 6   ? 63.509 76.534 0.500   1.00 12.19 ? 3    PHE A O   1 
ATOM   40   C  CB  . PHE A 1 6   ? 62.867 73.758 2.350   1.00 11.70 ? 3    PHE A CB  1 
ATOM   41   C  CG  . PHE A 1 6   ? 62.360 73.373 0.964   1.00 12.62 ? 3    PHE A CG  1 
ATOM   42   C  CD1 . PHE A 1 6   ? 61.114 73.826 0.490   1.00 11.61 ? 3    PHE A CD1 1 
ATOM   43   C  CD2 . PHE A 1 6   ? 63.167 72.681 0.108   1.00 13.31 ? 3    PHE A CD2 1 
ATOM   44   C  CE1 . PHE A 1 6   ? 60.707 73.553 -0.780  1.00 12.81 ? 3    PHE A CE1 1 
ATOM   45   C  CE2 . PHE A 1 6   ? 62.759 72.392 -1.164  1.00 13.98 ? 3    PHE A CE2 1 
ATOM   46   C  CZ  . PHE A 1 6   ? 61.530 72.815 -1.600  1.00 13.65 ? 3    PHE A CZ  1 
ATOM   47   N  N   . CYS A 1 7   ? 62.114 76.717 2.300   1.00 12.82 ? 4    CYS A N   1 
ATOM   48   C  CA  A CYS A 1 7   ? 61.370 77.826 1.719   0.75 14.60 ? 4    CYS A CA  1 
ATOM   49   C  CA  B CYS A 1 7   ? 61.348 77.861 1.812   0.25 14.81 ? 4    CYS A CA  1 
ATOM   50   C  C   . CYS A 1 7   ? 62.107 79.145 1.965   1.00 14.87 ? 4    CYS A C   1 
ATOM   51   O  O   . CYS A 1 7   ? 61.811 79.913 2.848   1.00 17.48 ? 4    CYS A O   1 
ATOM   52   C  CB  A CYS A 1 7   ? 59.914 77.809 2.178   0.75 14.92 ? 4    CYS A CB  1 
ATOM   53   C  CB  B CYS A 1 7   ? 60.063 78.000 2.619   0.25 14.91 ? 4    CYS A CB  1 
ATOM   54   S  SG  A CYS A 1 7   ? 58.863 78.948 1.224   0.75 16.27 ? 4    CYS A SG  1 
ATOM   55   S  SG  B CYS A 1 7   ? 59.033 76.601 2.439   0.25 19.19 ? 4    CYS A SG  1 
ATOM   56   N  N   . ASP A 1 8   ? 63.085 79.371 1.108   1.00 15.78 ? 5    ASP A N   1 
ATOM   57   C  CA  . ASP A 1 8   ? 63.956 80.526 1.223   1.00 16.88 ? 5    ASP A CA  1 
ATOM   58   C  C   . ASP A 1 8   ? 63.757 81.484 0.046   1.00 17.07 ? 5    ASP A C   1 
ATOM   59   O  O   . ASP A 1 8   ? 62.934 81.234 -0.841  1.00 17.44 ? 5    ASP A O   1 
ATOM   60   C  CB  . ASP A 1 8   ? 65.398 80.091 1.401   1.00 17.59 ? 5    ASP A CB  1 
ATOM   61   C  CG  . ASP A 1 8   ? 66.004 79.373 0.176   1.00 19.10 ? 5    ASP A CG  1 
ATOM   62   O  OD1 . ASP A 1 8   ? 65.331 79.133 -0.825  1.00 20.24 ? 5    ASP A OD1 1 
ATOM   63   O  OD2 . ASP A 1 8   ? 67.221 79.065 0.232   1.00 21.02 ? 5    ASP A OD2 1 
ATOM   64   N  N   . ASP A 1 9   ? 64.473 82.618 0.071   1.00 19.29 ? 6    ASP A N   1 
ATOM   65   C  CA  . ASP A 1 9   ? 64.341 83.584 -1.021  1.00 21.24 ? 6    ASP A CA  1 
ATOM   66   C  C   . ASP A 1 9   ? 64.669 83.036 -2.394  1.00 20.94 ? 6    ASP A C   1 
ATOM   67   O  O   . ASP A 1 9   ? 64.007 83.411 -3.373  1.00 23.15 ? 6    ASP A O   1 
ATOM   68   C  CB  . ASP A 1 9   ? 65.227 84.787 -0.780  1.00 22.49 ? 6    ASP A CB  1 
ATOM   69   C  CG  . ASP A 1 9   ? 64.663 85.714 0.273   1.00 28.59 ? 6    ASP A CG  1 
ATOM   70   O  OD1 . ASP A 1 9   ? 63.488 85.568 0.678   1.00 34.03 ? 6    ASP A OD1 1 
ATOM   71   O  OD2 . ASP A 1 9   ? 65.423 86.578 0.720   1.00 35.26 ? 6    ASP A OD2 1 
ATOM   72   N  N   . SER A 1 10  ? 65.611 82.107 -2.478  1.00 20.43 ? 7    SER A N   1 
ATOM   73   C  CA  . SER A 1 10  ? 66.011 81.546 -3.758  1.00 22.06 ? 7    SER A CA  1 
ATOM   74   C  C   . SER A 1 10  ? 64.838 80.903 -4.458  1.00 21.27 ? 7    SER A C   1 
ATOM   75   O  O   . SER A 1 10  ? 64.738 80.968 -5.675  1.00 21.91 ? 7    SER A O   1 
ATOM   76   C  CB  . SER A 1 10  ? 67.180 80.537 -3.613  1.00 22.81 ? 7    SER A CB  1 
ATOM   77   O  OG  . SER A 1 10  ? 66.710 79.275 -3.279  1.00 29.23 ? 7    SER A OG  1 
ATOM   78   N  N   . LYS A 1 11  ? 63.939 80.278 -3.698  1.00 20.44 ? 8    LYS A N   1 
ATOM   79   C  CA  . LYS A 1 11  ? 62.827 79.539 -4.342  1.00 20.91 ? 8    LYS A CA  1 
ATOM   80   C  C   . LYS A 1 11  ? 61.931 80.443 -5.221  1.00 22.79 ? 8    LYS A C   1 
ATOM   81   O  O   . LYS A 1 11  ? 61.492 80.053 -6.308  1.00 23.08 ? 8    LYS A O   1 
ATOM   82   C  CB  . LYS A 1 11  ? 62.019 78.749 -3.307  1.00 20.01 ? 8    LYS A CB  1 
ATOM   83   C  CG  . LYS A 1 11  ? 62.758 77.729 -2.567  1.00 20.37 ? 8    LYS A CG  1 
ATOM   84   C  CD  . LYS A 1 11  ? 63.333 76.612 -3.411  1.00 21.30 ? 8    LYS A CD  1 
ATOM   85   C  CE  . LYS A 1 11  ? 64.120 75.641 -2.545  1.00 22.32 ? 8    LYS A CE  1 
ATOM   86   N  NZ  . LYS A 1 11  ? 65.319 76.269 -1.884  1.00 22.95 ? 8    LYS A NZ  1 
ATOM   87   N  N   . LYS A 1 12  ? 61.776 81.697 -4.828  1.00 24.53 ? 9    LYS A N   1 
ATOM   88   C  CA  A LYS A 1 12  ? 61.000 82.692 -5.570  0.70 25.15 ? 9    LYS A CA  1 
ATOM   89   C  CA  B LYS A 1 12  ? 60.983 82.676 -5.603  0.30 24.64 ? 9    LYS A CA  1 
ATOM   90   C  C   . LYS A 1 12  ? 61.635 83.021 -6.951  1.00 24.98 ? 9    LYS A C   1 
ATOM   91   O  O   . LYS A 1 12  ? 60.946 83.237 -7.952  1.00 25.50 ? 9    LYS A O   1 
ATOM   92   C  CB  A LYS A 1 12  ? 60.868 83.935 -4.676  0.70 26.30 ? 9    LYS A CB  1 
ATOM   93   C  CB  B LYS A 1 12  ? 60.719 83.954 -4.785  0.30 25.08 ? 9    LYS A CB  1 
ATOM   94   C  CG  A LYS A 1 12  ? 60.090 83.688 -3.326  0.70 27.97 ? 9    LYS A CG  1 
ATOM   95   C  CG  B LYS A 1 12  ? 61.778 85.055 -4.906  0.30 24.90 ? 9    LYS A CG  1 
ATOM   96   C  CD  A LYS A 1 12  ? 60.821 82.831 -2.245  0.70 29.43 ? 9    LYS A CD  1 
ATOM   97   C  CD  B LYS A 1 12  ? 61.623 86.116 -3.823  0.30 25.86 ? 9    LYS A CD  1 
ATOM   98   C  CE  A LYS A 1 12  ? 59.916 82.557 -1.033  0.70 30.24 ? 9    LYS A CE  1 
ATOM   99   C  CE  B LYS A 1 12  ? 62.728 87.145 -3.929  0.30 25.94 ? 9    LYS A CE  1 
ATOM   100  N  NZ  A LYS A 1 12  ? 58.523 82.184 -1.450  0.70 30.57 ? 9    LYS A NZ  1 
ATOM   101  N  NZ  B LYS A 1 12  ? 62.559 88.300 -3.002  0.30 26.94 ? 9    LYS A NZ  1 
ATOM   102  N  N   . TYR A 1 13  ? 62.946 83.029 -7.014  1.00 24.13 ? 10   TYR A N   1 
ATOM   103  C  CA  A TYR A 1 13  ? 63.652 83.300 -8.259  0.60 24.02 ? 10   TYR A CA  1 
ATOM   104  C  CA  B TYR A 1 13  ? 63.664 83.324 -8.244  0.40 23.89 ? 10   TYR A CA  1 
ATOM   105  C  C   . TYR A 1 13  ? 63.510 82.183 -9.265  1.00 22.93 ? 10   TYR A C   1 
ATOM   106  O  O   . TYR A 1 13  ? 63.570 82.395 -10.480 1.00 23.56 ? 10   TYR A O   1 
ATOM   107  C  CB  A TYR A 1 13  ? 65.126 83.593 -7.986  0.60 24.30 ? 10   TYR A CB  1 
ATOM   108  C  CB  B TYR A 1 13  ? 65.137 83.632 -7.922  0.40 24.11 ? 10   TYR A CB  1 
ATOM   109  C  CG  A TYR A 1 13  ? 65.316 84.968 -7.405  0.60 27.55 ? 10   TYR A CG  1 
ATOM   110  C  CG  B TYR A 1 13  ? 65.325 84.616 -6.761  0.40 26.27 ? 10   TYR A CG  1 
ATOM   111  C  CD1 A TYR A 1 13  ? 65.736 85.144 -6.087  0.60 30.04 ? 10   TYR A CD1 1 
ATOM   112  C  CD1 B TYR A 1 13  ? 64.429 85.670 -6.553  0.40 28.52 ? 10   TYR A CD1 1 
ATOM   113  C  CD2 A TYR A 1 13  ? 65.022 86.101 -8.168  0.60 29.89 ? 10   TYR A CD2 1 
ATOM   114  C  CD2 B TYR A 1 13  ? 66.396 84.485 -5.874  0.40 27.96 ? 10   TYR A CD2 1 
ATOM   115  C  CE1 A TYR A 1 13  ? 65.896 86.423 -5.557  0.60 31.59 ? 10   TYR A CE1 1 
ATOM   116  C  CE1 B TYR A 1 13  ? 64.600 86.568 -5.487  0.40 29.28 ? 10   TYR A CE1 1 
ATOM   117  C  CE2 A TYR A 1 13  ? 65.188 87.376 -7.650  0.60 31.85 ? 10   TYR A CE2 1 
ATOM   118  C  CE2 B TYR A 1 13  ? 66.568 85.370 -4.809  0.40 29.09 ? 10   TYR A CE2 1 
ATOM   119  C  CZ  A TYR A 1 13  ? 65.616 87.526 -6.345  0.60 33.43 ? 10   TYR A CZ  1 
ATOM   120  C  CZ  B TYR A 1 13  ? 65.670 86.407 -4.624  0.40 29.98 ? 10   TYR A CZ  1 
ATOM   121  O  OH  A TYR A 1 13  ? 65.774 88.776 -5.812  0.60 36.75 ? 10   TYR A OH  1 
ATOM   122  O  OH  B TYR A 1 13  ? 65.858 87.281 -3.568  0.40 32.29 ? 10   TYR A OH  1 
ATOM   123  N  N   . LEU A 1 14  ? 63.261 80.971 -8.770  1.00 21.27 ? 11   LEU A N   1 
ATOM   124  C  CA  . LEU A 1 14  ? 62.965 79.867 -9.655  1.00 20.69 ? 11   LEU A CA  1 
ATOM   125  C  C   . LEU A 1 14  ? 61.646 80.135 -10.400 1.00 19.99 ? 11   LEU A C   1 
ATOM   126  O  O   . LEU A 1 14  ? 61.566 79.899 -11.584 1.00 21.13 ? 11   LEU A O   1 
ATOM   127  C  CB  . LEU A 1 14  ? 62.887 78.574 -8.846  1.00 19.52 ? 11   LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 14  ? 64.178 78.158 -8.116  1.00 19.19 ? 11   LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 14  ? 63.888 76.833 -7.419  1.00 17.92 ? 11   LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 14  ? 65.376 78.108 -9.079  1.00 19.80 ? 11   LEU A CD2 1 
ATOM   131  N  N   . LYS A 1 15  ? 60.639 80.643 -9.712  1.00 20.37 ? 12   LYS A N   1 
ATOM   132  C  CA  . LYS A 1 15  ? 59.307 80.843 -10.315 1.00 21.72 ? 12   LYS A CA  1 
ATOM   133  C  C   . LYS A 1 15  ? 59.336 81.971 -11.355 1.00 21.50 ? 12   LYS A C   1 
ATOM   134  O  O   . LYS A 1 15  ? 58.559 81.970 -12.305 1.00 20.99 ? 12   LYS A O   1 
ATOM   135  C  CB  . LYS A 1 15  ? 58.296 81.106 -9.212  1.00 23.60 ? 12   LYS A CB  1 
ATOM   136  C  CG  . LYS A 1 15  ? 56.936 81.573 -9.649  1.00 26.48 ? 12   LYS A CG  1 
ATOM   137  C  CD  . LYS A 1 15  ? 56.048 81.728 -8.421  1.00 30.02 ? 12   LYS A CD  1 
ATOM   138  C  CE  . LYS A 1 15  ? 54.623 82.108 -8.753  1.00 31.90 ? 12   LYS A CE  1 
ATOM   139  N  NZ  . LYS A 1 15  ? 54.529 83.342 -9.556  1.00 34.75 ? 12   LYS A NZ  1 
ATOM   140  N  N   . GLU A 1 16  ? 60.269 82.915 -11.190 1.00 20.49 ? 13   GLU A N   1 
ATOM   141  C  CA  . GLU A 1 16  ? 60.545 83.957 -12.216 1.00 20.12 ? 13   GLU A CA  1 
ATOM   142  C  C   . GLU A 1 16  ? 61.078 83.435 -13.552 1.00 18.31 ? 13   GLU A C   1 
ATOM   143  O  O   . GLU A 1 16  ? 61.195 84.207 -14.544 1.00 18.80 ? 13   GLU A O   1 
ATOM   144  C  CB  . GLU A 1 16  ? 61.547 84.991 -11.673 1.00 20.99 ? 13   GLU A CB  1 
ATOM   145  C  CG  . GLU A 1 16  ? 60.965 85.850 -10.564 1.00 25.38 ? 13   GLU A CG  1 
ATOM   146  C  CD  . GLU A 1 16  ? 61.987 86.873 -10.023 1.00 31.70 ? 13   GLU A CD  1 
ATOM   147  O  OE1 . GLU A 1 16  ? 63.093 87.060 -10.626 1.00 34.95 ? 13   GLU A OE1 1 
ATOM   148  O  OE2 . GLU A 1 16  ? 61.678 87.474 -8.968  1.00 38.18 ? 13   GLU A OE2 1 
ATOM   149  N  N   . GLN A 1 17  ? 61.430 82.157 -13.613 1.00 17.46 ? 14   GLN A N   1 
ATOM   150  C  CA  . GLN A 1 17  ? 61.697 81.525 -14.903 1.00 16.39 ? 14   GLN A CA  1 
ATOM   151  C  C   . GLN A 1 17  ? 60.465 81.601 -15.826 1.00 16.04 ? 14   GLN A C   1 
ATOM   152  O  O   . GLN A 1 17  ? 60.630 81.447 -17.040 1.00 15.78 ? 14   GLN A O   1 
ATOM   153  C  CB  . GLN A 1 17  ? 62.127 80.062 -14.777 1.00 17.33 ? 14   GLN A CB  1 
ATOM   154  C  CG  . GLN A 1 17  ? 63.527 79.785 -14.178 1.00 18.11 ? 14   GLN A CG  1 
ATOM   155  C  CD  . GLN A 1 17  ? 64.628 80.040 -15.152 1.00 19.04 ? 14   GLN A CD  1 
ATOM   156  O  OE1 . GLN A 1 17  ? 64.795 79.311 -16.153 1.00 17.11 ? 14   GLN A OE1 1 
ATOM   157  N  NE2 . GLN A 1 17  ? 65.378 81.095 -14.901 1.00 21.27 ? 14   GLN A NE2 1 
ATOM   158  N  N   . ASN A 1 18  ? 59.271 81.794 -15.251 1.00 15.93 ? 15   ASN A N   1 
ATOM   159  C  CA  A ASN A 1 18  ? 58.036 81.922 -16.032 0.60 16.14 ? 15   ASN A CA  1 
ATOM   160  C  CA  B ASN A 1 18  ? 57.995 81.864 -15.984 0.40 16.01 ? 15   ASN A CA  1 
ATOM   161  C  C   . ASN A 1 18  ? 57.821 80.742 -17.006 1.00 15.30 ? 15   ASN A C   1 
ATOM   162  O  O   . ASN A 1 18  ? 57.630 80.934 -18.221 1.00 15.73 ? 15   ASN A O   1 
ATOM   163  C  CB  A ASN A 1 18  ? 58.026 83.290 -16.747 0.60 17.13 ? 15   ASN A CB  1 
ATOM   164  C  CB  B ASN A 1 18  ? 57.753 83.236 -16.600 0.40 16.94 ? 15   ASN A CB  1 
ATOM   165  C  CG  A ASN A 1 18  ? 57.891 84.465 -15.776 0.60 19.22 ? 15   ASN A CG  1 
ATOM   166  C  CG  B ASN A 1 18  ? 56.304 83.443 -16.959 0.40 18.18 ? 15   ASN A CG  1 
ATOM   167  O  OD1 A ASN A 1 18  ? 57.324 84.338 -14.678 0.60 19.42 ? 15   ASN A OD1 1 
ATOM   168  O  OD1 B ASN A 1 18  ? 55.425 82.722 -16.476 0.40 20.88 ? 15   ASN A OD1 1 
ATOM   169  N  ND2 A ASN A 1 18  ? 58.418 85.613 -16.177 0.60 20.63 ? 15   ASN A ND2 1 
ATOM   170  N  ND2 B ASN A 1 18  ? 56.041 84.413 -17.816 0.40 22.00 ? 15   ASN A ND2 1 
ATOM   171  N  N   . ILE A 1 19  ? 57.827 79.529 -16.468 1.00 13.56 ? 16   ILE A N   1 
ATOM   172  C  CA  . ILE A 1 19  ? 57.709 78.351 -17.308 1.00 12.87 ? 16   ILE A CA  1 
ATOM   173  C  C   . ILE A 1 19  ? 56.369 78.363 -18.043 1.00 12.31 ? 16   ILE A C   1 
ATOM   174  O  O   . ILE A 1 19  ? 55.318 78.594 -17.441 1.00 13.84 ? 16   ILE A O   1 
ATOM   175  C  CB  . ILE A 1 19  ? 57.777 77.025 -16.482 1.00 12.66 ? 16   ILE A CB  1 
ATOM   176  C  CG1 . ILE A 1 19  ? 59.116 76.880 -15.743 1.00 13.56 ? 16   ILE A CG1 1 
ATOM   177  C  CG2 . ILE A 1 19  ? 57.552 75.783 -17.420 1.00 14.91 ? 16   ILE A CG2 1 
ATOM   178  C  CD1 . ILE A 1 19  ? 60.347 76.950 -16.672 1.00 15.03 ? 16   ILE A CD1 1 
ATOM   179  N  N   . ASN A 1 20  ? 56.436 78.122 -19.351 1.00 11.52 ? 17   ASN A N   1 
ATOM   180  C  CA  . ASN A 1 20  ? 55.263 77.924 -20.178 1.00 12.32 ? 17   ASN A CA  1 
ATOM   181  C  C   . ASN A 1 20  ? 55.332 76.501 -20.728 1.00 12.56 ? 17   ASN A C   1 
ATOM   182  O  O   . ASN A 1 20  ? 56.233 76.158 -21.499 1.00 13.64 ? 17   ASN A O   1 
ATOM   183  C  CB  . ASN A 1 20  ? 55.183 78.952 -21.312 1.00 12.51 ? 17   ASN A CB  1 
ATOM   184  C  CG  . ASN A 1 20  ? 53.912 78.788 -22.107 1.00 16.18 ? 17   ASN A CG  1 
ATOM   185  O  OD1 . ASN A 1 20  ? 53.802 77.873 -22.898 1.00 14.09 ? 17   ASN A OD1 1 
ATOM   186  N  ND2 . ASN A 1 20  ? 52.900 79.627 -21.815 1.00 22.58 ? 17   ASN A ND2 1 
ATOM   187  N  N   . LEU A 1 21  ? 54.411 75.647 -20.274 1.00 12.29 ? 18   LEU A N   1 
ATOM   188  C  CA  . LEU A 1 21  ? 54.447 74.219 -20.631 1.00 12.42 ? 18   LEU A CA  1 
ATOM   189  C  C   . LEU A 1 21  ? 54.377 73.960 -22.142 1.00 13.43 ? 18   LEU A C   1 
ATOM   190  O  O   . LEU A 1 21  ? 55.164 73.176 -22.687 1.00 14.30 ? 18   LEU A O   1 
ATOM   191  C  CB  . LEU A 1 21  ? 53.310 73.471 -19.928 1.00 11.94 ? 18   LEU A CB  1 
ATOM   192  C  CG  . LEU A 1 21  ? 53.353 73.421 -18.410 1.00 11.98 ? 18   LEU A CG  1 
ATOM   193  C  CD1 . LEU A 1 21  ? 52.043 72.823 -17.843 1.00 13.15 ? 18   LEU A CD1 1 
ATOM   194  C  CD2 . LEU A 1 21  ? 54.591 72.629 -17.923 1.00 14.47 ? 18   LEU A CD2 1 
ATOM   195  N  N   . LYS A 1 22  ? 53.459 74.619 -22.834 1.00 14.08 ? 19   LYS A N   1 
ATOM   196  C  CA  A LYS A 1 22  ? 53.366 74.436 -24.272 0.60 15.04 ? 19   LYS A CA  1 
ATOM   197  C  CA  B LYS A 1 22  ? 53.353 74.454 -24.283 0.40 14.22 ? 19   LYS A CA  1 
ATOM   198  C  C   . LYS A 1 22  ? 54.693 74.776 -24.945 1.00 13.98 ? 19   LYS A C   1 
ATOM   199  O  O   . LYS A 1 22  ? 55.165 74.031 -25.810 1.00 14.91 ? 19   LYS A O   1 
ATOM   200  C  CB  A LYS A 1 22  ? 52.222 75.262 -24.878 0.60 14.90 ? 19   LYS A CB  1 
ATOM   201  C  CB  B LYS A 1 22  ? 52.278 75.369 -24.891 0.40 13.73 ? 19   LYS A CB  1 
ATOM   202  C  CG  A LYS A 1 22  ? 52.146 75.156 -26.394 0.60 19.62 ? 19   LYS A CG  1 
ATOM   203  C  CG  B LYS A 1 22  ? 50.824 75.138 -24.498 0.40 14.17 ? 19   LYS A CG  1 
ATOM   204  C  CD  A LYS A 1 22  ? 51.005 75.970 -26.943 0.60 20.78 ? 19   LYS A CD  1 
ATOM   205  C  CD  B LYS A 1 22  ? 50.106 76.445 -24.866 0.40 16.31 ? 19   LYS A CD  1 
ATOM   206  C  CE  A LYS A 1 22  ? 50.985 75.931 -28.495 0.60 22.86 ? 19   LYS A CE  1 
ATOM   207  C  CE  B LYS A 1 22  ? 48.678 76.511 -24.622 0.40 16.42 ? 19   LYS A CE  1 
ATOM   208  N  NZ  A LYS A 1 22  ? 52.300 76.179 -29.164 0.60 23.93 ? 19   LYS A NZ  1 
ATOM   209  N  NZ  B LYS A 1 22  ? 47.843 76.114 -25.771 0.40 20.35 ? 19   LYS A NZ  1 
ATOM   210  N  N   . ASN A 1 23  ? 55.326 75.866 -24.527 1.00 14.40 ? 20   ASN A N   1 
ATOM   211  C  CA  . ASN A 1 23  ? 56.580 76.313 -25.169 1.00 15.07 ? 20   ASN A CA  1 
ATOM   212  C  C   . ASN A 1 23  ? 57.684 75.293 -24.890 1.00 14.43 ? 20   ASN A C   1 
ATOM   213  O  O   . ASN A 1 23  ? 58.490 74.971 -25.770 1.00 15.56 ? 20   ASN A O   1 
ATOM   214  C  CB  . ASN A 1 23  ? 56.989 77.706 -24.668 1.00 15.05 ? 20   ASN A CB  1 
ATOM   215  C  CG  . ASN A 1 23  ? 56.105 78.827 -25.191 1.00 19.52 ? 20   ASN A CG  1 
ATOM   216  O  OD1 . ASN A 1 23  ? 55.255 78.642 -26.103 1.00 24.56 ? 20   ASN A OD1 1 
ATOM   217  N  ND2 . ASN A 1 23  ? 56.295 80.030 -24.606 1.00 25.81 ? 20   ASN A ND2 1 
ATOM   218  N  N   . GLU A 1 24  ? 57.716 74.769 -23.672 1.00 13.83 ? 21   GLU A N   1 
ATOM   219  C  CA  . GLU A 1 24  ? 58.736 73.798 -23.283 1.00 13.60 ? 21   GLU A CA  1 
ATOM   220  C  C   . GLU A 1 24  ? 58.636 72.531 -24.097 1.00 13.27 ? 21   GLU A C   1 
ATOM   221  O  O   . GLU A 1 24  ? 59.648 72.045 -24.545 1.00 14.89 ? 21   GLU A O   1 
ATOM   222  C  CB  . GLU A 1 24  ? 58.686 73.470 -21.783 1.00 13.79 ? 21   GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 24  ? 59.143 74.606 -20.886 1.00 16.05 ? 21   GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 24  ? 60.588 75.039 -21.091 1.00 19.14 ? 21   GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 24  ? 61.454 74.201 -21.454 1.00 19.21 ? 21   GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 24  ? 60.828 76.245 -20.881 1.00 22.53 ? 21   GLU A OE2 1 
ATOM   227  N  N   . PHE A 1 25  ? 57.434 71.972 -24.266 1.00 13.21 ? 22   PHE A N   1 
ATOM   228  C  CA  . PHE A 1 25  ? 57.234 70.766 -25.075 1.00 13.50 ? 22   PHE A CA  1 
ATOM   229  C  C   . PHE A 1 25  ? 57.535 71.002 -26.569 1.00 15.86 ? 22   PHE A C   1 
ATOM   230  O  O   . PHE A 1 25  ? 58.130 70.134 -27.236 1.00 17.18 ? 22   PHE A O   1 
ATOM   231  C  CB  . PHE A 1 25  ? 55.818 70.217 -24.883 1.00 14.12 ? 22   PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 25  ? 55.660 69.381 -23.643 1.00 12.95 ? 22   PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 25  ? 55.902 68.027 -23.674 1.00 13.29 ? 22   PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 25  ? 55.347 69.960 -22.446 1.00 11.72 ? 22   PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 25  ? 55.724 67.232 -22.557 1.00 13.16 ? 22   PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 25  ? 55.177 69.169 -21.326 1.00 11.83 ? 22   PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 25  ? 55.391 67.815 -21.392 1.00 13.31 ? 22   PHE A CZ  1 
ATOM   238  N  N   . ASP A 1 26  ? 57.214 72.206 -27.031 1.00 16.11 ? 23   ASP A N   1 
ATOM   239  C  CA  A ASP A 1 26  ? 57.526 72.602 -28.408 0.70 17.42 ? 23   ASP A CA  1 
ATOM   240  C  CA  B ASP A 1 26  ? 57.512 72.628 -28.400 0.30 16.99 ? 23   ASP A CA  1 
ATOM   241  C  C   . ASP A 1 26  ? 59.009 72.690 -28.681 1.00 17.33 ? 23   ASP A C   1 
ATOM   242  O  O   . ASP A 1 26  ? 59.453 72.288 -29.782 1.00 19.25 ? 23   ASP A O   1 
ATOM   243  C  CB  A ASP A 1 26  ? 56.833 73.933 -28.773 0.70 17.35 ? 23   ASP A CB  1 
ATOM   244  C  CB  B ASP A 1 26  ? 56.880 74.005 -28.674 0.30 16.77 ? 23   ASP A CB  1 
ATOM   245  C  CG  A ASP A 1 26  ? 55.350 73.759 -29.077 0.70 19.13 ? 23   ASP A CG  1 
ATOM   246  C  CG  B ASP A 1 26  ? 56.980 74.421 -30.131 0.30 17.76 ? 23   ASP A CG  1 
ATOM   247  O  OD1 A ASP A 1 26  ? 54.856 72.609 -29.070 0.70 26.23 ? 23   ASP A OD1 1 
ATOM   248  O  OD1 B ASP A 1 26  ? 56.531 73.643 -30.997 0.30 18.97 ? 23   ASP A OD1 1 
ATOM   249  O  OD2 A ASP A 1 26  ? 54.646 74.759 -29.304 0.70 25.17 ? 23   ASP A OD2 1 
ATOM   250  O  OD2 B ASP A 1 26  ? 57.498 75.526 -30.390 0.30 17.10 ? 23   ASP A OD2 1 
ATOM   251  N  N   . LYS A 1 27  ? 59.772 73.235 -27.739 1.00 16.36 ? 24   LYS A N   1 
ATOM   252  C  CA  A LYS A 1 27  ? 61.224 73.544 -27.886 0.60 17.14 ? 24   LYS A CA  1 
ATOM   253  C  CA  B LYS A 1 27  ? 61.181 73.490 -28.025 0.40 16.43 ? 24   LYS A CA  1 
ATOM   254  C  C   . LYS A 1 27  ? 62.143 72.389 -27.550 1.00 16.94 ? 24   LYS A C   1 
ATOM   255  O  O   . LYS A 1 27  ? 63.266 72.318 -28.018 1.00 18.56 ? 24   LYS A O   1 
ATOM   256  C  CB  A LYS A 1 27  ? 61.669 74.592 -26.858 0.60 18.14 ? 24   LYS A CB  1 
ATOM   257  C  CB  B LYS A 1 27  ? 61.567 74.859 -27.469 0.40 16.23 ? 24   LYS A CB  1 
ATOM   258  C  CG  A LYS A 1 27  ? 61.437 76.034 -27.127 0.60 21.10 ? 24   LYS A CG  1 
ATOM   259  C  CG  B LYS A 1 27  ? 60.703 76.003 -28.039 0.40 17.29 ? 24   LYS A CG  1 
ATOM   260  C  CD  A LYS A 1 27  ? 62.151 76.874 -26.043 0.60 24.40 ? 24   LYS A CD  1 
ATOM   261  C  CD  B LYS A 1 27  ? 60.695 76.037 -29.554 0.40 19.69 ? 24   LYS A CD  1 
ATOM   262  C  CE  A LYS A 1 27  ? 61.683 76.555 -24.625 0.60 25.36 ? 24   LYS A CE  1 
ATOM   263  C  CE  B LYS A 1 27  ? 60.164 77.357 -30.019 0.40 20.62 ? 24   LYS A CE  1 
ATOM   264  N  NZ  A LYS A 1 27  ? 62.214 77.548 -23.664 0.60 26.98 ? 24   LYS A NZ  1 
ATOM   265  N  NZ  B LYS A 1 27  ? 61.216 78.389 -29.851 0.40 21.51 ? 24   LYS A NZ  1 
ATOM   266  N  N   . ASP A 1 28  ? 61.686 71.548 -26.618 1.00 15.82 ? 25   ASP A N   1 
ATOM   267  C  CA  . ASP A 1 28  ? 62.520 70.528 -25.973 1.00 15.83 ? 25   ASP A CA  1 
ATOM   268  C  C   . ASP A 1 28  ? 62.048 69.110 -26.317 1.00 16.40 ? 25   ASP A C   1 
ATOM   269  O  O   . ASP A 1 28  ? 61.162 68.539 -25.673 1.00 15.42 ? 25   ASP A O   1 
ATOM   270  C  CB  . ASP A 1 28  ? 62.516 70.767 -24.451 1.00 16.03 ? 25   ASP A CB  1 
ATOM   271  C  CG  . ASP A 1 28  ? 63.470 69.874 -23.681 1.00 16.91 ? 25   ASP A CG  1 
ATOM   272  O  OD1 . ASP A 1 28  ? 64.145 69.056 -24.291 1.00 16.71 ? 25   ASP A OD1 1 
ATOM   273  O  OD2 . ASP A 1 28  ? 63.484 69.971 -22.409 1.00 17.66 ? 25   ASP A OD2 1 
ATOM   274  N  N   . ASP A 1 29  ? 62.677 68.516 -27.322 1.00 16.51 ? 26   ASP A N   1 
ATOM   275  C  CA  A ASP A 1 29  ? 62.221 67.184 -27.734 0.70 17.28 ? 26   ASP A CA  1 
ATOM   276  C  CA  B ASP A 1 29  ? 62.369 67.166 -27.811 0.30 16.96 ? 26   ASP A CA  1 
ATOM   277  C  C   . ASP A 1 29  ? 62.665 66.080 -26.767 1.00 16.79 ? 26   ASP A C   1 
ATOM   278  O  O   . ASP A 1 29  ? 62.282 64.913 -26.955 1.00 18.65 ? 26   ASP A O   1 
ATOM   279  C  CB  A ASP A 1 29  ? 62.578 66.840 -29.198 0.70 18.31 ? 26   ASP A CB  1 
ATOM   280  C  CB  B ASP A 1 29  ? 63.184 66.852 -29.097 0.30 17.18 ? 26   ASP A CB  1 
ATOM   281  C  CG  A ASP A 1 29  ? 64.064 66.779 -29.460 0.70 21.01 ? 26   ASP A CG  1 
ATOM   282  C  CG  B ASP A 1 29  ? 62.505 67.339 -30.382 0.30 19.02 ? 26   ASP A CG  1 
ATOM   283  O  OD1 A ASP A 1 29  ? 64.885 66.847 -28.512 0.70 22.80 ? 26   ASP A OD1 1 
ATOM   284  O  OD1 B ASP A 1 29  ? 61.496 68.069 -30.307 0.30 20.85 ? 26   ASP A OD1 1 
ATOM   285  O  OD2 A ASP A 1 29  ? 64.436 66.681 -30.653 0.70 25.84 ? 26   ASP A OD2 1 
ATOM   286  O  OD2 B ASP A 1 29  ? 62.984 66.982 -31.482 0.30 21.52 ? 26   ASP A OD2 1 
ATOM   287  N  N   . LYS A 1 30  ? 63.389 66.445 -25.696 1.00 15.07 ? 27   LYS A N   1 
ATOM   288  C  CA  A LYS A 1 30  ? 63.789 65.512 -24.634 0.50 14.89 ? 27   LYS A CA  1 
ATOM   289  C  CA  B LYS A 1 30  ? 63.726 65.458 -24.655 0.50 14.41 ? 27   LYS A CA  1 
ATOM   290  C  C   . LYS A 1 30  ? 62.984 65.734 -23.351 1.00 14.04 ? 27   LYS A C   1 
ATOM   291  O  O   . LYS A 1 30  ? 63.337 65.202 -22.305 1.00 13.60 ? 27   LYS A O   1 
ATOM   292  C  CB  A LYS A 1 30  ? 65.290 65.691 -24.328 0.50 15.46 ? 27   LYS A CB  1 
ATOM   293  C  CB  B LYS A 1 30  ? 65.252 65.379 -24.440 0.50 14.83 ? 27   LYS A CB  1 
ATOM   294  C  CG  A LYS A 1 30  ? 66.216 65.426 -25.546 0.50 17.84 ? 27   LYS A CG  1 
ATOM   295  C  CG  B LYS A 1 30  ? 66.006 64.702 -25.636 0.50 14.64 ? 27   LYS A CG  1 
ATOM   296  C  CD  A LYS A 1 30  ? 67.525 66.227 -25.457 0.50 22.35 ? 27   LYS A CD  1 
ATOM   297  C  CD  B LYS A 1 30  ? 65.747 63.196 -25.706 0.50 17.57 ? 27   LYS A CD  1 
ATOM   298  C  CE  A LYS A 1 30  ? 68.307 66.327 -26.812 0.50 23.81 ? 27   LYS A CE  1 
ATOM   299  C  CE  B LYS A 1 30  ? 66.733 62.412 -26.601 0.50 17.39 ? 27   LYS A CE  1 
ATOM   300  N  NZ  A LYS A 1 30  ? 67.795 67.334 -27.817 0.50 24.51 ? 27   LYS A NZ  1 
ATOM   301  N  NZ  B LYS A 1 30  ? 66.338 60.942 -26.847 0.50 18.49 ? 27   LYS A NZ  1 
ATOM   302  N  N   . ARG A 1 31  ? 61.932 66.535 -23.412 1.00 13.12 ? 28   ARG A N   1 
ATOM   303  C  CA  . ARG A 1 31  ? 61.255 66.906 -22.172 1.00 13.10 ? 28   ARG A CA  1 
ATOM   304  C  C   . ARG A 1 31  ? 60.756 65.714 -21.373 1.00 11.19 ? 28   ARG A C   1 
ATOM   305  O  O   . ARG A 1 31  ? 60.930 65.646 -20.154 1.00 12.56 ? 28   ARG A O   1 
ATOM   306  C  CB  . ARG A 1 31  ? 60.129 67.876 -22.409 1.00 13.41 ? 28   ARG A CB  1 
ATOM   307  C  CG  . ARG A 1 31  ? 59.505 68.327 -21.087 1.00 14.86 ? 28   ARG A CG  1 
ATOM   308  C  CD  . ARG A 1 31  ? 58.983 69.611 -21.056 1.00 15.90 ? 28   ARG A CD  1 
ATOM   309  N  NE  . ARG A 1 31  ? 58.332 69.896 -19.800 1.00 12.83 ? 28   ARG A NE  1 
ATOM   310  C  CZ  . ARG A 1 31  ? 58.752 70.772 -18.890 1.00 12.75 ? 28   ARG A CZ  1 
ATOM   311  N  NH1 . ARG A 1 31  ? 59.850 71.497 -19.074 1.00 12.63 ? 28   ARG A NH1 1 
ATOM   312  N  NH2 . ARG A 1 31  ? 58.042 70.963 -17.810 1.00 12.04 ? 28   ARG A NH2 1 
ATOM   313  N  N   . VAL A 1 32  ? 60.120 64.765 -22.051 1.00 11.27 ? 29   VAL A N   1 
ATOM   314  C  CA  . VAL A 1 32  ? 59.564 63.581 -21.377 1.00 11.21 ? 29   VAL A CA  1 
ATOM   315  C  C   . VAL A 1 32  ? 60.682 62.712 -20.816 1.00 11.72 ? 29   VAL A C   1 
ATOM   316  O  O   . VAL A 1 32  ? 60.594 62.294 -19.662 1.00 12.37 ? 29   VAL A O   1 
ATOM   317  C  CB  . VAL A 1 32  ? 58.559 62.796 -22.220 1.00 11.78 ? 29   VAL A CB  1 
ATOM   318  C  CG1 . VAL A 1 32  ? 58.111 61.494 -21.504 1.00 13.56 ? 29   VAL A CG1 1 
ATOM   319  C  CG2 . VAL A 1 32  ? 57.382 63.678 -22.600 1.00 12.50 ? 29   VAL A CG2 1 
ATOM   320  N  N   . GLU A 1 33  ? 61.735 62.452 -21.613 1.00 12.34 ? 30   GLU A N   1 
ATOM   321  C  CA  . GLU A 1 33  ? 62.882 61.678 -21.143 1.00 14.63 ? 30   GLU A CA  1 
ATOM   322  C  C   . GLU A 1 33  ? 63.488 62.314 -19.889 1.00 13.10 ? 30   GLU A C   1 
ATOM   323  O  O   . GLU A 1 33  ? 63.818 61.627 -18.908 1.00 14.95 ? 30   GLU A O   1 
ATOM   324  C  CB  . GLU A 1 33  ? 63.922 61.582 -22.267 1.00 16.03 ? 30   GLU A CB  1 
ATOM   325  C  CG  . GLU A 1 33  ? 65.124 60.730 -21.963 1.00 20.80 ? 30   GLU A CG  1 
ATOM   326  C  CD  . GLU A 1 33  ? 66.082 60.578 -23.135 1.00 29.87 ? 30   GLU A CD  1 
ATOM   327  O  OE1 . GLU A 1 33  ? 65.620 60.366 -24.290 1.00 33.71 ? 30   GLU A OE1 1 
ATOM   328  O  OE2 . GLU A 1 33  ? 67.300 60.654 -22.884 1.00 36.01 ? 30   GLU A OE2 1 
ATOM   329  N  N   . LYS A 1 34  ? 63.618 63.644 -19.877 1.00 13.02 ? 31   LYS A N   1 
ATOM   330  C  CA  . LYS A 1 34  ? 64.227 64.324 -18.742 1.00 13.16 ? 31   LYS A CA  1 
ATOM   331  C  C   . LYS A 1 34  ? 63.374 64.233 -17.471 1.00 12.26 ? 31   LYS A C   1 
ATOM   332  O  O   . LYS A 1 34  ? 63.889 64.053 -16.373 1.00 12.69 ? 31   LYS A O   1 
ATOM   333  C  CB  . LYS A 1 34  ? 64.441 65.809 -19.030 1.00 14.79 ? 31   LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 34  ? 65.565 66.171 -20.048 1.00 18.94 ? 31   LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 34  ? 65.318 67.711 -20.350 1.00 21.36 ? 31   LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 34  ? 66.225 68.414 -21.262 1.00 23.87 ? 31   LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 34  ? 65.834 69.850 -21.217 1.00 23.25 ? 31   LYS A NZ  1 
ATOM   338  N  N   . PHE A 1 35  ? 62.062 64.355 -17.647 1.00 12.16 ? 32   PHE A N   1 
ATOM   339  C  CA  . PHE A 1 35  ? 61.119 64.543 -16.540 1.00 10.09 ? 32   PHE A CA  1 
ATOM   340  C  C   . PHE A 1 35  ? 60.116 63.399 -16.412 1.00 10.51 ? 32   PHE A C   1 
ATOM   341  O  O   . PHE A 1 35  ? 58.926 63.587 -16.123 1.00 11.14 ? 32   PHE A O   1 
ATOM   342  C  CB  . PHE A 1 35  ? 60.428 65.909 -16.662 1.00 11.30 ? 32   PHE A CB  1 
ATOM   343  C  CG  . PHE A 1 35  ? 61.381 67.066 -16.717 1.00 11.94 ? 32   PHE A CG  1 
ATOM   344  C  CD1 . PHE A 1 35  ? 62.434 67.205 -15.788 1.00 13.14 ? 32   PHE A CD1 1 
ATOM   345  C  CD2 . PHE A 1 35  ? 61.243 68.013 -17.688 1.00 12.80 ? 32   PHE A CD2 1 
ATOM   346  C  CE1 . PHE A 1 35  ? 63.356 68.288 -15.896 1.00 14.23 ? 32   PHE A CE1 1 
ATOM   347  C  CE2 . PHE A 1 35  ? 62.171 69.117 -17.828 1.00 14.67 ? 32   PHE A CE2 1 
ATOM   348  C  CZ  . PHE A 1 35  ? 63.197 69.253 -16.922 1.00 13.49 ? 32   PHE A CZ  1 
ATOM   349  N  N   . SER A 1 36  ? 60.652 62.190 -16.498 1.00 10.87 ? 33   SER A N   1 
ATOM   350  C  CA  . SER A 1 36  ? 59.905 60.969 -16.198 1.00 11.09 ? 33   SER A CA  1 
ATOM   351  C  C   . SER A 1 36  ? 60.874 59.931 -15.611 1.00 11.39 ? 33   SER A C   1 
ATOM   352  O  O   . SER A 1 36  ? 62.110 59.976 -15.855 1.00 13.03 ? 33   SER A O   1 
ATOM   353  C  CB  . SER A 1 36  ? 59.169 60.431 -17.420 1.00 11.42 ? 33   SER A CB  1 
ATOM   354  O  OG  . SER A 1 36  ? 60.019 59.900 -18.418 1.00 12.73 ? 33   SER A OG  1 
ATOM   355  N  N   . LEU A 1 37  ? 60.295 58.994 -14.873 1.00 10.76 ? 34   LEU A N   1 
ATOM   356  C  CA  . LEU A 1 37  ? 61.053 57.924 -14.234 1.00 11.17 ? 34   LEU A CA  1 
ATOM   357  C  C   . LEU A 1 37  ? 60.204 56.653 -14.285 1.00 11.86 ? 34   LEU A C   1 
ATOM   358  O  O   . LEU A 1 37  ? 58.955 56.710 -14.384 1.00 11.89 ? 34   LEU A O   1 
ATOM   359  C  CB  . LEU A 1 37  ? 61.362 58.265 -12.762 1.00 11.71 ? 34   LEU A CB  1 
ATOM   360  C  CG  . LEU A 1 37  ? 62.322 59.442 -12.528 1.00 12.25 ? 34   LEU A CG  1 
ATOM   361  C  CD1 . LEU A 1 37  ? 62.300 59.859 -11.023 1.00 13.93 ? 34   LEU A CD1 1 
ATOM   362  C  CD2 . LEU A 1 37  ? 63.750 59.075 -12.971 1.00 13.18 ? 34   LEU A CD2 1 
ATOM   363  N  N   . LYS A 1 38  ? 60.880 55.519 -14.188 1.00 12.71 ? 35   LYS A N   1 
ATOM   364  C  CA  . LYS A 1 38  ? 60.234 54.217 -14.089 1.00 13.95 ? 35   LYS A CA  1 
ATOM   365  C  C   . LYS A 1 38  ? 60.710 53.487 -12.856 1.00 14.03 ? 35   LYS A C   1 
ATOM   366  O  O   . LYS A 1 38  ? 61.903 53.471 -12.553 1.00 17.04 ? 35   LYS A O   1 
ATOM   367  C  CB  . LYS A 1 38  ? 60.577 53.349 -15.300 1.00 15.95 ? 35   LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 38  ? 60.033 53.901 -16.573 1.00 21.40 ? 35   LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 38  ? 60.419 53.027 -17.802 1.00 29.95 ? 35   LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 38  ? 61.892 52.954 -18.030 1.00 34.54 ? 35   LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 38  ? 62.172 52.323 -19.357 1.00 36.92 ? 35   LYS A NZ  1 
ATOM   372  N  N   . HIS A 1 39  ? 59.786 52.851 -12.167 1.00 12.29 ? 36   HIS A N   1 
ATOM   373  C  CA  . HIS A 1 39  ? 60.138 51.848 -11.142 1.00 12.92 ? 36   HIS A CA  1 
ATOM   374  C  C   . HIS A 1 39  ? 59.324 50.612 -11.433 1.00 12.33 ? 36   HIS A C   1 
ATOM   375  O  O   . HIS A 1 39  ? 58.110 50.595 -11.232 1.00 11.80 ? 36   HIS A O   1 
ATOM   376  C  CB  . HIS A 1 39  ? 59.854 52.347 -9.737  1.00 13.81 ? 36   HIS A CB  1 
ATOM   377  C  CG  . HIS A 1 39  ? 59.903 51.254 -8.706  1.00 13.42 ? 36   HIS A CG  1 
ATOM   378  N  ND1 . HIS A 1 39  ? 61.063 50.604 -8.379  1.00 15.41 ? 36   HIS A ND1 1 
ATOM   379  C  CD2 . HIS A 1 39  ? 58.918 50.662 -7.983  1.00 13.27 ? 36   HIS A CD2 1 
ATOM   380  C  CE1 . HIS A 1 39  ? 60.799 49.669 -7.479  1.00 13.02 ? 36   HIS A CE1 1 
ATOM   381  N  NE2 . HIS A 1 39  ? 59.499 49.673 -7.225  1.00 12.74 ? 36   HIS A NE2 1 
ATOM   382  N  N   . GLN A 1 40  ? 59.994 49.600 -11.959 1.00 13.02 ? 37   GLN A N   1 
ATOM   383  C  CA  . GLN A 1 40  ? 59.384 48.348 -12.330 1.00 14.12 ? 37   GLN A CA  1 
ATOM   384  C  C   . GLN A 1 40  ? 58.296 48.709 -13.323 1.00 15.65 ? 37   GLN A C   1 
ATOM   385  O  O   . GLN A 1 40  ? 58.592 49.307 -14.348 1.00 16.80 ? 37   GLN A O   1 
ATOM   386  C  CB  . GLN A 1 40  ? 58.957 47.530 -11.095 1.00 13.39 ? 37   GLN A CB  1 
ATOM   387  C  CG  . GLN A 1 40  ? 60.220 47.035 -10.312 1.00 13.43 ? 37   GLN A CG  1 
ATOM   388  C  CD  . GLN A 1 40  ? 60.051 46.239 -9.073  1.00 13.72 ? 37   GLN A CD  1 
ATOM   389  O  OE1 . GLN A 1 40  ? 61.059 45.769 -8.471  1.00 18.54 ? 37   GLN A OE1 1 
ATOM   390  N  NE2 . GLN A 1 40  ? 58.886 46.092 -8.649  1.00 14.43 ? 37   GLN A NE2 1 
ATOM   391  N  N   . ASN A 1 41  ? 57.078 48.346 -13.032 1.00 15.00 ? 38   ASN A N   1 
ATOM   392  C  CA  . ASN A 1 41  ? 55.971 48.626 -13.931 1.00 17.08 ? 38   ASN A CA  1 
ATOM   393  C  C   . ASN A 1 41  ? 55.129 49.862 -13.547 1.00 16.00 ? 38   ASN A C   1 
ATOM   394  O  O   . ASN A 1 41  ? 53.990 49.995 -14.018 1.00 18.93 ? 38   ASN A O   1 
ATOM   395  C  CB  . ASN A 1 41  ? 55.102 47.378 -14.080 1.00 17.32 ? 38   ASN A CB  1 
ATOM   396  C  CG  . ASN A 1 41  ? 55.862 46.217 -14.710 1.00 20.33 ? 38   ASN A CG  1 
ATOM   397  O  OD1 . ASN A 1 41  ? 55.891 45.119 -14.156 1.00 31.08 ? 38   ASN A OD1 1 
ATOM   398  N  ND2 . ASN A 1 41  ? 56.473 46.464 -15.841 1.00 26.94 ? 38   ASN A ND2 1 
ATOM   399  N  N   . ILE A 1 42  ? 55.697 50.779 -12.758 1.00 13.15 ? 39   ILE A N   1 
ATOM   400  C  CA  . ILE A 1 42  ? 55.122 52.136 -12.508 1.00 12.07 ? 39   ILE A CA  1 
ATOM   401  C  C   . ILE A 1 42  ? 55.902 53.145 -13.336 1.00 11.22 ? 39   ILE A C   1 
ATOM   402  O  O   . ILE A 1 42  ? 57.148 53.135 -13.354 1.00 11.95 ? 39   ILE A O   1 
ATOM   403  C  CB  . ILE A 1 42  ? 55.187 52.532 -11.012 1.00 13.37 ? 39   ILE A CB  1 
ATOM   404  C  CG1 . ILE A 1 42  ? 54.186 51.605 -10.259 1.00 14.26 ? 39   ILE A CG1 1 
ATOM   405  C  CG2 . ILE A 1 42  ? 54.905 54.020 -10.798 1.00 14.79 ? 39   ILE A CG2 1 
ATOM   406  C  CD1 . ILE A 1 42  ? 54.157 51.719 -8.736  1.00 16.66 ? 39   ILE A CD1 1 
ATOM   407  N  N   . TYR A 1 43  ? 55.156 53.951 -14.094 1.00 9.97  ? 40   TYR A N   1 
ATOM   408  C  CA  . TYR A 1 43  ? 55.709 55.046 -14.856 1.00 9.74  ? 40   TYR A CA  1 
ATOM   409  C  C   . TYR A 1 43  ? 55.275 56.349 -14.206 1.00 10.32 ? 40   TYR A C   1 
ATOM   410  O  O   . TYR A 1 43  ? 54.090 56.591 -13.991 1.00 11.30 ? 40   TYR A O   1 
ATOM   411  C  CB  . TYR A 1 43  ? 55.178 54.961 -16.298 1.00 10.20 ? 40   TYR A CB  1 
ATOM   412  C  CG  . TYR A 1 43  ? 55.540 56.066 -17.239 1.00 11.27 ? 40   TYR A CG  1 
ATOM   413  C  CD1 . TYR A 1 43  ? 56.873 56.352 -17.532 1.00 12.14 ? 40   TYR A CD1 1 
ATOM   414  C  CD2 . TYR A 1 43  ? 54.554 56.804 -17.894 1.00 10.85 ? 40   TYR A CD2 1 
ATOM   415  C  CE1 . TYR A 1 43  ? 57.238 57.334 -18.443 1.00 11.88 ? 40   TYR A CE1 1 
ATOM   416  C  CE2 . TYR A 1 43  ? 54.900 57.814 -18.790 1.00 11.48 ? 40   TYR A CE2 1 
ATOM   417  C  CZ  . TYR A 1 43  ? 56.260 58.044 -19.087 1.00 11.30 ? 40   TYR A CZ  1 
ATOM   418  O  OH  . TYR A 1 43  ? 56.607 59.025 -20.029 1.00 11.65 ? 40   TYR A OH  1 
ATOM   419  N  N   . PHE A 1 44  ? 56.251 57.152 -13.862 1.00 9.52  ? 41   PHE A N   1 
ATOM   420  C  CA  . PHE A 1 44  ? 56.067 58.434 -13.198 1.00 9.87  ? 41   PHE A CA  1 
ATOM   421  C  C   . PHE A 1 44  ? 56.395 59.590 -14.110 1.00 10.53 ? 41   PHE A C   1 
ATOM   422  O  O   . PHE A 1 44  ? 57.558 59.885 -14.382 1.00 11.35 ? 41   PHE A O   1 
ATOM   423  C  CB  . PHE A 1 44  ? 56.948 58.427 -11.934 1.00 10.51 ? 41   PHE A CB  1 
ATOM   424  C  CG  . PHE A 1 44  ? 56.898 59.715 -11.121 1.00 10.50 ? 41   PHE A CG  1 
ATOM   425  C  CD1 . PHE A 1 44  ? 55.816 59.973 -10.361 1.00 12.07 ? 41   PHE A CD1 1 
ATOM   426  C  CD2 . PHE A 1 44  ? 57.953 60.633 -11.115 1.00 13.74 ? 41   PHE A CD2 1 
ATOM   427  C  CE1 . PHE A 1 44  ? 55.735 61.130 -9.626  1.00 15.44 ? 41   PHE A CE1 1 
ATOM   428  C  CE2 . PHE A 1 44  ? 57.903 61.781 -10.337 1.00 14.29 ? 41   PHE A CE2 1 
ATOM   429  C  CZ  . PHE A 1 44  ? 56.788 62.034 -9.608  1.00 14.06 ? 41   PHE A CZ  1 
ATOM   430  N  N   . ASP A 1 45  ? 55.355 60.239 -14.615 1.00 10.29 ? 42   ASP A N   1 
ATOM   431  C  CA  . ASP A 1 45  ? 55.515 61.307 -15.592 1.00 10.02 ? 42   ASP A CA  1 
ATOM   432  C  C   . ASP A 1 45  ? 55.271 62.635 -14.932 1.00 9.96  ? 42   ASP A C   1 
ATOM   433  O  O   . ASP A 1 45  ? 54.131 62.995 -14.667 1.00 10.59 ? 42   ASP A O   1 
ATOM   434  C  CB  . ASP A 1 45  ? 54.565 61.071 -16.766 1.00 10.62 ? 42   ASP A CB  1 
ATOM   435  C  CG  . ASP A 1 45  ? 54.614 62.193 -17.802 1.00 8.72  ? 42   ASP A CG  1 
ATOM   436  O  OD1 . ASP A 1 45  ? 55.471 63.114 -17.619 1.00 10.46 ? 42   ASP A OD1 1 
ATOM   437  O  OD2 . ASP A 1 45  ? 53.845 62.166 -18.791 1.00 12.10 ? 42   ASP A OD2 1 
ATOM   438  N  N   . TYR A 1 46  ? 56.350 63.375 -14.647 1.00 9.97  ? 43   TYR A N   1 
ATOM   439  C  CA  . TYR A 1 46  ? 56.216 64.703 -14.061 1.00 10.10 ? 43   TYR A CA  1 
ATOM   440  C  C   . TYR A 1 46  ? 56.520 65.831 -15.024 1.00 9.66  ? 43   TYR A C   1 
ATOM   441  O  O   . TYR A 1 46  ? 56.701 66.997 -14.633 1.00 10.14 ? 43   TYR A O   1 
ATOM   442  C  CB  . TYR A 1 46  ? 57.042 64.745 -12.748 1.00 10.40 ? 43   TYR A CB  1 
ATOM   443  C  CG  . TYR A 1 46  ? 58.550 64.697 -12.871 1.00 10.85 ? 43   TYR A CG  1 
ATOM   444  C  CD1 . TYR A 1 46  ? 59.306 65.871 -12.779 1.00 10.78 ? 43   TYR A CD1 1 
ATOM   445  C  CD2 . TYR A 1 46  ? 59.226 63.491 -12.958 1.00 10.32 ? 43   TYR A CD2 1 
ATOM   446  C  CE1 . TYR A 1 46  ? 60.694 65.824 -12.849 1.00 12.45 ? 43   TYR A CE1 1 
ATOM   447  C  CE2 . TYR A 1 46  ? 60.620 63.435 -13.009 1.00 12.40 ? 43   TYR A CE2 1 
ATOM   448  C  CZ  . TYR A 1 46  ? 61.355 64.605 -12.949 1.00 12.98 ? 43   TYR A CZ  1 
ATOM   449  O  OH  . TYR A 1 46  ? 62.755 64.577 -13.011 1.00 16.45 ? 43   TYR A OH  1 
ATOM   450  N  N   . SER A 1 47  ? 56.462 65.507 -16.297 1.00 9.64  ? 44   SER A N   1 
ATOM   451  C  CA  . SER A 1 47  ? 56.857 66.467 -17.343 1.00 9.25  ? 44   SER A CA  1 
ATOM   452  C  C   . SER A 1 47  ? 55.873 67.630 -17.552 1.00 9.25  ? 44   SER A C   1 
ATOM   453  O  O   . SER A 1 47  ? 56.267 68.669 -18.080 1.00 9.73  ? 44   SER A O   1 
ATOM   454  C  CB  . SER A 1 47  ? 57.100 65.739 -18.672 1.00 9.83  ? 44   SER A CB  1 
ATOM   455  O  OG  . SER A 1 47  ? 55.896 65.243 -19.240 1.00 10.86 ? 44   SER A OG  1 
ATOM   456  N  N   . LYS A 1 48  ? 54.610 67.509 -17.116 1.00 8.70  ? 45   LYS A N   1 
ATOM   457  C  CA  . LYS A 1 48  ? 53.647 68.624 -17.181 1.00 9.53  ? 45   LYS A CA  1 
ATOM   458  C  C   . LYS A 1 48  ? 53.726 69.515 -15.928 1.00 9.34  ? 45   LYS A C   1 
ATOM   459  O  O   . LYS A 1 48  ? 52.802 70.308 -15.661 1.00 10.55 ? 45   LYS A O   1 
ATOM   460  C  CB  . LYS A 1 48  ? 52.247 68.123 -17.430 1.00 10.17 ? 45   LYS A CB  1 
ATOM   461  C  CG  . LYS A 1 48  ? 52.042 67.298 -18.666 1.00 10.21 ? 45   LYS A CG  1 
ATOM   462  C  CD  . LYS A 1 48  ? 50.527 67.239 -19.019 1.00 10.11 ? 45   LYS A CD  1 
ATOM   463  C  CE  . LYS A 1 48  ? 50.109 66.168 -20.066 1.00 10.39 ? 45   LYS A CE  1 
ATOM   464  N  NZ  . LYS A 1 48  ? 50.219 64.772 -19.552 1.00 10.64 ? 45   LYS A NZ  1 
ATOM   465  N  N   . ASN A 1 49  ? 54.794 69.373 -15.108 1.00 9.78  ? 46   ASN A N   1 
ATOM   466  C  CA  . ASN A 1 49  ? 54.991 70.316 -13.997 1.00 10.55 ? 46   ASN A CA  1 
ATOM   467  C  C   . ASN A 1 49  ? 55.729 71.581 -14.454 1.00 9.50  ? 46   ASN A C   1 
ATOM   468  O  O   . ASN A 1 49  ? 56.450 71.565 -15.485 1.00 10.20 ? 46   ASN A O   1 
ATOM   469  C  CB  . ASN A 1 49  ? 55.739 69.606 -12.877 1.00 10.95 ? 46   ASN A CB  1 
ATOM   470  C  CG  . ASN A 1 49  ? 54.799 68.742 -12.081 1.00 12.39 ? 46   ASN A CG  1 
ATOM   471  O  OD1 . ASN A 1 49  ? 53.962 69.255 -11.288 1.00 10.36 ? 46   ASN A OD1 1 
ATOM   472  N  ND2 . ASN A 1 49  ? 54.856 67.442 -12.337 1.00 10.51 ? 46   ASN A ND2 1 
ATOM   473  N  N   . LEU A 1 50  ? 55.547 72.664 -13.679 1.00 11.16 ? 47   LEU A N   1 
ATOM   474  C  CA  . LEU A 1 50  ? 56.111 73.988 -13.999 1.00 10.92 ? 47   LEU A CA  1 
ATOM   475  C  C   . LEU A 1 50  ? 57.599 74.055 -13.632 1.00 11.03 ? 47   LEU A C   1 
ATOM   476  O  O   . LEU A 1 50  ? 57.991 74.812 -12.744 1.00 12.80 ? 47   LEU A O   1 
ATOM   477  C  CB  . LEU A 1 50  ? 55.294 75.147 -13.403 1.00 11.00 ? 47   LEU A CB  1 
ATOM   478  C  CG  . LEU A 1 50  ? 53.855 75.248 -13.952 1.00 11.84 ? 47   LEU A CG  1 
ATOM   479  C  CD1 . LEU A 1 50  ? 53.000 76.101 -13.022 1.00 16.14 ? 47   LEU A CD1 1 
ATOM   480  C  CD2 . LEU A 1 50  ? 53.835 75.766 -15.441 1.00 14.21 ? 47   LEU A CD2 1 
ATOM   481  N  N   . ILE A 1 51  ? 58.394 73.241 -14.319 1.00 11.05 ? 48   ILE A N   1 
ATOM   482  C  CA  . ILE A 1 51  ? 59.833 73.140 -14.095 1.00 11.70 ? 48   ILE A CA  1 
ATOM   483  C  C   . ILE A 1 51  ? 60.554 73.143 -15.440 1.00 12.72 ? 48   ILE A C   1 
ATOM   484  O  O   . ILE A 1 51  ? 59.957 72.880 -16.497 1.00 12.74 ? 48   ILE A O   1 
ATOM   485  C  CB  . ILE A 1 51  ? 60.188 71.841 -13.342 1.00 12.62 ? 48   ILE A CB  1 
ATOM   486  C  CG1 . ILE A 1 51  ? 59.802 70.552 -14.147 1.00 13.98 ? 48   ILE A CG1 1 
ATOM   487  C  CG2 . ILE A 1 51  ? 59.551 71.869 -11.966 1.00 14.77 ? 48   ILE A CG2 1 
ATOM   488  C  CD1 . ILE A 1 51  ? 60.192 69.318 -13.495 1.00 15.33 ? 48   ILE A CD1 1 
ATOM   489  N  N   . ASN A 1 52  ? 61.840 73.445 -15.379 1.00 12.79 ? 49   ASN A N   1 
ATOM   490  C  CA  . ASN A 1 52  ? 62.791 73.185 -16.438 1.00 12.82 ? 49   ASN A CA  1 
ATOM   491  C  C   . ASN A 1 52  ? 64.055 72.646 -15.768 1.00 12.89 ? 49   ASN A C   1 
ATOM   492  O  O   . ASN A 1 52  ? 64.063 72.389 -14.556 1.00 12.44 ? 49   ASN A O   1 
ATOM   493  C  CB  . ASN A 1 52  ? 63.062 74.459 -17.261 1.00 13.15 ? 49   ASN A CB  1 
ATOM   494  C  CG  . ASN A 1 52  ? 63.621 75.599 -16.434 1.00 13.05 ? 49   ASN A CG  1 
ATOM   495  O  OD1 . ASN A 1 52  ? 63.974 75.413 -15.296 1.00 14.66 ? 49   ASN A OD1 1 
ATOM   496  N  ND2 . ASN A 1 52  ? 63.745 76.771 -17.035 1.00 13.31 ? 49   ASN A ND2 1 
ATOM   497  N  N   . ASP A 1 53  ? 65.085 72.423 -16.557 1.00 13.87 ? 50   ASP A N   1 
ATOM   498  C  CA  . ASP A 1 53  ? 66.315 71.858 -15.999 1.00 14.21 ? 50   ASP A CA  1 
ATOM   499  C  C   . ASP A 1 53  ? 66.852 72.666 -14.812 1.00 14.66 ? 50   ASP A C   1 
ATOM   500  O  O   . ASP A 1 53  ? 67.254 72.085 -13.782 1.00 15.32 ? 50   ASP A O   1 
ATOM   501  C  CB  . ASP A 1 53  ? 67.398 71.770 -17.078 1.00 15.92 ? 50   ASP A CB  1 
ATOM   502  C  CG  . ASP A 1 53  ? 67.163 70.683 -18.128 1.00 20.55 ? 50   ASP A CG  1 
ATOM   503  O  OD1 . ASP A 1 53  ? 66.584 69.630 -17.842 1.00 29.04 ? 50   ASP A OD1 1 
ATOM   504  O  OD2 . ASP A 1 53  ? 67.630 70.879 -19.281 1.00 28.67 ? 50   ASP A OD2 1 
ATOM   505  N  N   . TYR A 1 54  ? 66.835 73.981 -14.922 1.00 14.27 ? 51   TYR A N   1 
ATOM   506  C  CA  . TYR A 1 54  ? 67.384 74.862 -13.907 1.00 14.66 ? 51   TYR A CA  1 
ATOM   507  C  C   . TYR A 1 54  ? 66.602 74.802 -12.604 1.00 14.08 ? 51   TYR A C   1 
ATOM   508  O  O   . TYR A 1 54  ? 67.195 74.729 -11.509 1.00 13.73 ? 51   TYR A O   1 
ATOM   509  C  CB  . TYR A 1 54  ? 67.380 76.254 -14.441 1.00 16.01 ? 51   TYR A CB  1 
ATOM   510  C  CG  . TYR A 1 54  ? 67.736 77.271 -13.425 1.00 16.18 ? 51   TYR A CG  1 
ATOM   511  C  CD1 . TYR A 1 54  ? 69.020 77.282 -12.864 1.00 23.09 ? 51   TYR A CD1 1 
ATOM   512  C  CD2 . TYR A 1 54  ? 66.811 78.223 -13.021 1.00 18.52 ? 51   TYR A CD2 1 
ATOM   513  C  CE1 . TYR A 1 54  ? 69.379 78.243 -11.943 1.00 24.44 ? 51   TYR A CE1 1 
ATOM   514  C  CE2 . TYR A 1 54  ? 67.144 79.189 -12.088 1.00 22.35 ? 51   TYR A CE2 1 
ATOM   515  C  CZ  . TYR A 1 54  ? 68.449 79.203 -11.576 1.00 25.17 ? 51   TYR A CZ  1 
ATOM   516  O  OH  . TYR A 1 54  ? 68.819 80.141 -10.660 1.00 28.01 ? 51   TYR A OH  1 
ATOM   517  N  N   . ILE A 1 55  ? 65.281 74.810 -12.696 1.00 12.44 ? 52   ILE A N   1 
ATOM   518  C  CA  . ILE A 1 55  ? 64.461 74.691 -11.500 1.00 11.76 ? 52   ILE A CA  1 
ATOM   519  C  C   . ILE A 1 55  ? 64.683 73.348 -10.835 1.00 12.97 ? 52   ILE A C   1 
ATOM   520  O  O   . ILE A 1 55  ? 64.865 73.281 -9.619  1.00 12.34 ? 52   ILE A O   1 
ATOM   521  C  CB  . ILE A 1 55  ? 62.959 74.923 -11.817 1.00 12.59 ? 52   ILE A CB  1 
ATOM   522  C  CG1 . ILE A 1 55  ? 62.744 76.380 -12.272 1.00 12.35 ? 52   ILE A CG1 1 
ATOM   523  C  CG2 . ILE A 1 55  ? 62.086 74.578 -10.594 1.00 12.36 ? 52   ILE A CG2 1 
ATOM   524  C  CD1 . ILE A 1 55  ? 61.332 76.634 -12.838 1.00 11.93 ? 52   ILE A CD1 1 
ATOM   525  N  N   . LEU A 1 56  ? 64.668 72.259 -11.608 1.00 12.11 ? 53   LEU A N   1 
ATOM   526  C  CA  . LEU A 1 56  ? 64.810 70.918 -11.015 1.00 13.57 ? 53   LEU A CA  1 
ATOM   527  C  C   . LEU A 1 56  ? 66.159 70.787 -10.368 1.00 13.02 ? 53   LEU A C   1 
ATOM   528  O  O   . LEU A 1 56  ? 66.275 70.239 -9.290  1.00 13.11 ? 53   LEU A O   1 
ATOM   529  C  CB  . LEU A 1 56  ? 64.657 69.834 -12.075 1.00 15.44 ? 53   LEU A CB  1 
ATOM   530  C  CG  . LEU A 1 56  ? 64.711 68.403 -11.538 1.00 19.35 ? 53   LEU A CG  1 
ATOM   531  C  CD1 . LEU A 1 56  ? 63.602 68.177 -10.530 1.00 20.46 ? 53   LEU A CD1 1 
ATOM   532  C  CD2 . LEU A 1 56  ? 64.612 67.459 -12.682 1.00 21.89 ? 53   LEU A CD2 1 
ATOM   533  N  N   . LYS A 1 57  ? 67.198 71.255 -11.048 1.00 13.59 ? 54   LYS A N   1 
ATOM   534  C  CA  A LYS A 1 57  ? 68.571 71.234 -10.494 0.60 13.94 ? 54   LYS A CA  1 
ATOM   535  C  CA  B LYS A 1 57  ? 68.529 71.161 -10.458 0.40 14.46 ? 54   LYS A CA  1 
ATOM   536  C  C   . LYS A 1 57  ? 68.629 71.943 -9.166  1.00 13.74 ? 54   LYS A C   1 
ATOM   537  O  O   . LYS A 1 57  ? 69.263 71.457 -8.198  1.00 16.12 ? 54   LYS A O   1 
ATOM   538  C  CB  A LYS A 1 57  ? 69.551 71.929 -11.438 0.60 14.55 ? 54   LYS A CB  1 
ATOM   539  C  CB  B LYS A 1 57  ? 69.587 71.585 -11.451 0.40 15.21 ? 54   LYS A CB  1 
ATOM   540  C  CG  A LYS A 1 57  ? 71.038 71.744 -11.049 0.60 14.65 ? 54   LYS A CG  1 
ATOM   541  C  CG  B LYS A 1 57  ? 70.108 70.411 -12.225 0.40 18.24 ? 54   LYS A CG  1 
ATOM   542  C  CD  A LYS A 1 57  ? 71.978 72.445 -12.068 0.60 15.77 ? 54   LYS A CD  1 
ATOM   543  C  CD  B LYS A 1 57  ? 69.389 69.151 -11.834 0.40 19.58 ? 54   LYS A CD  1 
ATOM   544  C  CE  A LYS A 1 57  ? 73.434 72.287 -11.703 0.60 19.95 ? 54   LYS A CE  1 
ATOM   545  C  CE  B LYS A 1 57  ? 69.775 67.981 -12.706 0.40 19.83 ? 54   LYS A CE  1 
ATOM   546  N  NZ  A LYS A 1 57  ? 73.898 70.863 -11.732 0.60 22.51 ? 54   LYS A NZ  1 
ATOM   547  N  NZ  B LYS A 1 57  ? 68.676 67.000 -12.691 0.40 19.44 ? 54   LYS A NZ  1 
ATOM   548  N  N   . SER A 1 58  ? 67.996 73.102 -9.103  1.00 13.69 ? 55   SER A N   1 
ATOM   549  C  CA  A SER A 1 58  ? 67.985 73.943 -7.876  0.60 13.52 ? 55   SER A CA  1 
ATOM   550  C  CA  B SER A 1 58  ? 68.041 73.897 -7.892  0.40 12.90 ? 55   SER A CA  1 
ATOM   551  C  C   . SER A 1 58  ? 67.295 73.190 -6.741  1.00 13.79 ? 55   SER A C   1 
ATOM   552  O  O   . SER A 1 58  ? 67.770 73.145 -5.607  1.00 13.64 ? 55   SER A O   1 
ATOM   553  C  CB  A SER A 1 58  ? 67.301 75.308 -8.094  0.60 14.61 ? 55   SER A CB  1 
ATOM   554  C  CB  B SER A 1 58  ? 67.513 75.287 -8.192  0.40 13.21 ? 55   SER A CB  1 
ATOM   555  O  OG  A SER A 1 58  ? 67.261 76.114 -6.892  0.60 15.05 ? 55   SER A OG  1 
ATOM   556  O  OG  B SER A 1 58  ? 68.198 75.799 -9.321  0.40 10.53 ? 55   SER A OG  1 
ATOM   557  N  N   . LEU A 1 59  ? 66.143 72.605 -7.049  1.00 11.66 ? 56   LEU A N   1 
ATOM   558  C  CA  . LEU A 1 59  ? 65.429 71.849 -6.036  1.00 11.64 ? 56   LEU A CA  1 
ATOM   559  C  C   . LEU A 1 59  ? 66.230 70.644 -5.536  1.00 12.42 ? 56   LEU A C   1 
ATOM   560  O  O   . LEU A 1 59  ? 66.250 70.368 -4.322  1.00 12.06 ? 56   LEU A O   1 
ATOM   561  C  CB  . LEU A 1 59  ? 64.050 71.411 -6.539  1.00 11.31 ? 56   LEU A CB  1 
ATOM   562  C  CG  . LEU A 1 59  ? 63.055 72.511 -6.909  1.00 11.86 ? 56   LEU A CG  1 
ATOM   563  C  CD1 . LEU A 1 59  ? 61.773 71.930 -7.576  1.00 13.18 ? 56   LEU A CD1 1 
ATOM   564  C  CD2 . LEU A 1 59  ? 62.721 73.352 -5.679  1.00 13.94 ? 56   LEU A CD2 1 
ATOM   565  N  N   . LEU A 1 60  ? 66.832 69.885 -6.460  1.00 12.03 ? 57   LEU A N   1 
ATOM   566  C  CA  . LEU A 1 60  ? 67.639 68.734 -6.098  1.00 12.44 ? 57   LEU A CA  1 
ATOM   567  C  C   . LEU A 1 60  ? 68.829 69.175 -5.246  1.00 12.21 ? 57   LEU A C   1 
ATOM   568  O  O   . LEU A 1 60  ? 69.206 68.444 -4.325  1.00 12.96 ? 57   LEU A O   1 
ATOM   569  C  CB  . LEU A 1 60  ? 68.094 67.960 -7.344  1.00 12.17 ? 57   LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 60  ? 67.023 67.157 -8.077  1.00 12.63 ? 57   LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 60  ? 67.439 66.788 -9.494  1.00 14.60 ? 57   LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 60  ? 66.704 65.907 -7.228  1.00 14.53 ? 57   LEU A CD2 1 
ATOM   573  N  N   . GLU A 1 61  ? 69.421 70.336 -5.540  1.00 13.01 ? 58   GLU A N   1 
ATOM   574  C  CA  . GLU A 1 61  ? 70.526 70.834 -4.724  1.00 14.56 ? 58   GLU A CA  1 
ATOM   575  C  C   . GLU A 1 61  ? 70.077 71.066 -3.310  1.00 13.86 ? 58   GLU A C   1 
ATOM   576  O  O   . GLU A 1 61  ? 70.816 70.752 -2.415  1.00 14.49 ? 58   GLU A O   1 
ATOM   577  C  CB  . GLU A 1 61  ? 71.176 72.090 -5.308  1.00 15.62 ? 58   GLU A CB  1 
ATOM   578  C  CG  . GLU A 1 61  ? 72.001 71.813 -6.485  1.00 21.33 ? 58   GLU A CG  1 
ATOM   579  C  CD  . GLU A 1 61  ? 72.536 73.075 -7.213  1.00 27.95 ? 58   GLU A CD  1 
ATOM   580  O  OE1 . GLU A 1 61  ? 72.004 74.230 -7.051  1.00 33.37 ? 58   GLU A OE1 1 
ATOM   581  O  OE2 . GLU A 1 61  ? 73.497 72.879 -7.972  1.00 33.27 ? 58   GLU A OE2 1 
ATOM   582  N  N   . SER A 1 62  ? 68.863 71.593 -3.122  1.00 13.71 ? 59   SER A N   1 
ATOM   583  C  CA  . SER A 1 62  ? 68.290 71.752 -1.775  1.00 13.95 ? 59   SER A CA  1 
ATOM   584  C  C   . SER A 1 62  ? 68.161 70.423 -1.071  1.00 13.24 ? 59   SER A C   1 
ATOM   585  O  O   . SER A 1 62  ? 68.543 70.298 0.101   1.00 13.63 ? 59   SER A O   1 
ATOM   586  C  CB  . SER A 1 62  ? 66.929 72.462 -1.804  1.00 15.08 ? 59   SER A CB  1 
ATOM   587  O  OG  . SER A 1 62  ? 67.082 73.727 -2.376  1.00 20.34 ? 59   SER A OG  1 
ATOM   588  N  N   . ALA A 1 63  ? 67.676 69.389 -1.768  1.00 12.46 ? 60   ALA A N   1 
ATOM   589  C  CA  . ALA A 1 63  ? 67.623 68.056 -1.167  1.00 11.73 ? 60   ALA A CA  1 
ATOM   590  C  C   . ALA A 1 63  ? 69.002 67.566 -0.786  1.00 11.49 ? 60   ALA A C   1 
ATOM   591  O  O   . ALA A 1 63  ? 69.187 67.016 0.323   1.00 11.97 ? 60   ALA A O   1 
ATOM   592  C  CB  . ALA A 1 63  ? 66.927 67.057 -2.123  1.00 12.37 ? 60   ALA A CB  1 
ATOM   593  N  N   . GLU A 1 64  ? 69.969 67.732 -1.676  1.00 11.64 ? 61   GLU A N   1 
ATOM   594  C  CA  . GLU A 1 64  ? 71.348 67.286 -1.402  1.00 11.94 ? 61   GLU A CA  1 
ATOM   595  C  C   . GLU A 1 64  ? 72.003 68.018 -0.236  1.00 11.75 ? 61   GLU A C   1 
ATOM   596  O  O   . GLU A 1 64  ? 72.778 67.420 0.524   1.00 12.31 ? 61   GLU A O   1 
ATOM   597  C  CB  . GLU A 1 64  ? 72.207 67.449 -2.653  1.00 11.82 ? 61   GLU A CB  1 
ATOM   598  C  CG  . GLU A 1 64  ? 71.840 66.516 -3.816  1.00 13.10 ? 61   GLU A CG  1 
ATOM   599  C  CD  . GLU A 1 64  ? 72.155 65.074 -3.629  1.00 15.96 ? 61   GLU A CD  1 
ATOM   600  O  OE1 . GLU A 1 64  ? 72.830 64.709 -2.644  1.00 18.90 ? 61   GLU A OE1 1 
ATOM   601  O  OE2 . GLU A 1 64  ? 71.678 64.270 -4.469  1.00 18.68 ? 61   GLU A OE2 1 
ATOM   602  N  N   . LYS A 1 65  ? 71.670 69.305 -0.058  1.00 12.16 ? 62   LYS A N   1 
ATOM   603  C  CA  A LYS A 1 65  ? 72.244 70.109 1.038   0.60 12.52 ? 62   LYS A CA  1 
ATOM   604  C  CA  B LYS A 1 65  ? 72.256 70.110 1.011   0.40 12.61 ? 62   LYS A CA  1 
ATOM   605  C  C   . LYS A 1 65  ? 71.561 69.849 2.384   1.00 12.88 ? 62   LYS A C   1 
ATOM   606  O  O   . LYS A 1 65  ? 72.104 70.193 3.460   1.00 13.99 ? 62   LYS A O   1 
ATOM   607  C  CB  A LYS A 1 65  ? 72.239 71.623 0.722   0.60 14.02 ? 62   LYS A CB  1 
ATOM   608  C  CB  B LYS A 1 65  ? 72.231 71.607 0.617   0.40 13.66 ? 62   LYS A CB  1 
ATOM   609  C  CG  A LYS A 1 65  ? 73.415 72.097 -0.117  0.60 17.68 ? 62   LYS A CG  1 
ATOM   610  C  CG  B LYS A 1 65  ? 73.007 72.038 -0.690  0.40 16.31 ? 62   LYS A CG  1 
ATOM   611  C  CD  A LYS A 1 65  ? 73.140 73.467 -0.798  0.60 21.09 ? 62   LYS A CD  1 
ATOM   612  C  CD  B LYS A 1 65  ? 73.642 70.898 -1.534  0.40 20.11 ? 62   LYS A CD  1 
ATOM   613  C  CE  A LYS A 1 65  ? 74.055 73.702 -2.039  0.60 24.70 ? 62   LYS A CE  1 
ATOM   614  C  CE  B LYS A 1 65  ? 73.898 71.271 -2.983  0.40 20.75 ? 62   LYS A CE  1 
ATOM   615  N  NZ  A LYS A 1 65  ? 73.567 74.774 -2.977  0.60 26.85 ? 62   LYS A NZ  1 
ATOM   616  N  NZ  B LYS A 1 65  ? 74.258 70.075 -3.813  0.40 22.40 ? 62   LYS A NZ  1 
ATOM   617  N  N   . SER A 1 66  ? 70.381 69.249 2.350   1.00 12.58 ? 63   SER A N   1 
ATOM   618  C  CA  . SER A 1 66  ? 69.583 69.024 3.538   1.00 12.34 ? 63   SER A CA  1 
ATOM   619  C  C   . SER A 1 66  ? 70.083 67.810 4.307   1.00 11.77 ? 63   SER A C   1 
ATOM   620  O  O   . SER A 1 66  ? 71.041 67.160 3.881   1.00 11.90 ? 63   SER A O   1 
ATOM   621  C  CB  . SER A 1 66  ? 68.108 68.799 3.170   1.00 12.26 ? 63   SER A CB  1 
ATOM   622  O  OG  . SER A 1 66  ? 67.916 67.483 2.633   1.00 12.09 ? 63   SER A OG  1 
ATOM   623  N  N   . SER A 1 67  ? 69.405 67.506 5.429   1.00 12.03 ? 64   SER A N   1 
ATOM   624  C  CA  A SER A 1 67  ? 69.700 66.314 6.200   0.70 12.31 ? 64   SER A CA  1 
ATOM   625  C  CA  B SER A 1 67  ? 69.686 66.310 6.217   0.30 12.10 ? 64   SER A CA  1 
ATOM   626  C  C   . SER A 1 67  ? 69.114 65.020 5.625   1.00 11.68 ? 64   SER A C   1 
ATOM   627  O  O   . SER A 1 67  ? 69.227 63.958 6.256   1.00 11.40 ? 64   SER A O   1 
ATOM   628  C  CB  A SER A 1 67  ? 69.200 66.500 7.640   0.70 12.93 ? 64   SER A CB  1 
ATOM   629  C  CB  B SER A 1 67  ? 69.129 66.470 7.643   0.30 12.43 ? 64   SER A CB  1 
ATOM   630  O  OG  A SER A 1 67  ? 67.787 66.632 7.650   0.70 16.04 ? 64   SER A OG  1 
ATOM   631  O  OG  B SER A 1 67  ? 69.710 67.567 8.315   0.30 14.40 ? 64   SER A OG  1 
ATOM   632  N  N   . LEU A 1 68  ? 68.501 65.091 4.438   1.00 11.24 ? 65   LEU A N   1 
ATOM   633  C  CA  . LEU A 1 68  ? 67.726 63.994 3.916   1.00 11.01 ? 65   LEU A CA  1 
ATOM   634  C  C   . LEU A 1 68  ? 68.513 62.694 3.781   1.00 9.82  ? 65   LEU A C   1 
ATOM   635  O  O   . LEU A 1 68  ? 68.024 61.630 4.198   1.00 10.34 ? 65   LEU A O   1 
ATOM   636  C  CB  . LEU A 1 68  ? 67.051 64.377 2.596   1.00 10.60 ? 65   LEU A CB  1 
ATOM   637  C  CG  . LEU A 1 68  ? 66.159 63.301 1.956   1.00 10.96 ? 65   LEU A CG  1 
ATOM   638  C  CD1 . LEU A 1 68  ? 64.973 62.912 2.858   1.00 11.76 ? 65   LEU A CD1 1 
ATOM   639  C  CD2 . LEU A 1 68  ? 65.625 63.795 0.560   1.00 12.73 ? 65   LEU A CD2 1 
ATOM   640  N  N   . LYS A 1 69  ? 69.708 62.724 3.218   1.00 11.28 ? 66   LYS A N   1 
ATOM   641  C  CA  . LYS A 1 69  ? 70.496 61.484 3.070   1.00 10.76 ? 66   LYS A CA  1 
ATOM   642  C  C   . LYS A 1 69  ? 70.690 60.775 4.434   1.00 11.57 ? 66   LYS A C   1 
ATOM   643  O  O   . LYS A 1 69  ? 70.499 59.544 4.592   1.00 11.55 ? 66   LYS A O   1 
ATOM   644  C  CB  . LYS A 1 69  ? 71.869 61.837 2.433   1.00 11.66 ? 66   LYS A CB  1 
ATOM   645  C  CG  . LYS A 1 69  ? 72.853 60.716 2.437   1.00 12.91 ? 66   LYS A CG  1 
ATOM   646  C  CD  . LYS A 1 69  ? 74.253 61.134 1.997   1.00 15.83 ? 66   LYS A CD  1 
ATOM   647  C  CE  . LYS A 1 69  ? 74.972 62.019 3.079   1.00 19.29 ? 66   LYS A CE  1 
ATOM   648  N  NZ  . LYS A 1 69  ? 76.379 62.482 2.729   1.00 20.29 ? 66   LYS A NZ  1 
ATOM   649  N  N   . ASP A 1 70  ? 71.055 61.556 5.444   1.00 11.42 ? 67   ASP A N   1 
ATOM   650  C  CA  A ASP A 1 70  ? 71.253 61.033 6.809   0.60 10.88 ? 67   ASP A CA  1 
ATOM   651  C  CA  B ASP A 1 70  ? 71.261 60.951 6.751   0.40 11.08 ? 67   ASP A CA  1 
ATOM   652  C  C   . ASP A 1 70  ? 69.930 60.509 7.401   1.00 10.55 ? 67   ASP A C   1 
ATOM   653  O  O   . ASP A 1 70  ? 69.873 59.452 8.046   1.00 11.04 ? 67   ASP A O   1 
ATOM   654  C  CB  A ASP A 1 70  ? 71.783 62.133 7.723   0.60 11.42 ? 67   ASP A CB  1 
ATOM   655  C  CB  B ASP A 1 70  ? 72.039 61.858 7.671   0.40 11.77 ? 67   ASP A CB  1 
ATOM   656  C  CG  A ASP A 1 70  ? 73.140 62.620 7.313   0.60 15.16 ? 67   ASP A CG  1 
ATOM   657  C  CG  B ASP A 1 70  ? 72.656 61.092 8.815   0.40 14.14 ? 67   ASP A CG  1 
ATOM   658  O  OD1 A ASP A 1 70  ? 73.919 61.797 6.820   0.60 15.79 ? 67   ASP A OD1 1 
ATOM   659  O  OD1 B ASP A 1 70  ? 73.358 60.084 8.561   0.40 19.00 ? 67   ASP A OD1 1 
ATOM   660  O  OD2 A ASP A 1 70  ? 73.406 63.840 7.451   0.60 21.96 ? 67   ASP A OD2 1 
ATOM   661  O  OD2 B ASP A 1 70  ? 72.418 61.483 9.956   0.40 18.11 ? 67   ASP A OD2 1 
ATOM   662  N  N   . LYS A 1 71  ? 68.852 61.268 7.187   1.00 10.42 ? 68   LYS A N   1 
ATOM   663  C  CA  A LYS A 1 71  ? 67.565 60.906 7.747   0.70 11.06 ? 68   LYS A CA  1 
ATOM   664  C  CA  B LYS A 1 71  ? 67.552 60.924 7.747   0.30 10.58 ? 68   LYS A CA  1 
ATOM   665  C  C   . LYS A 1 71  ? 67.007 59.620 7.159   1.00 10.22 ? 68   LYS A C   1 
ATOM   666  O  O   . LYS A 1 71  ? 66.375 58.831 7.865   1.00 11.18 ? 68   LYS A O   1 
ATOM   667  C  CB  A LYS A 1 71  ? 66.549 62.044 7.589   0.70 12.26 ? 68   LYS A CB  1 
ATOM   668  C  CB  B LYS A 1 71  ? 66.549 62.069 7.543   0.30 10.94 ? 68   LYS A CB  1 
ATOM   669  C  CG  A LYS A 1 71  ? 66.784 63.263 8.486   0.70 15.43 ? 68   LYS A CG  1 
ATOM   670  C  CG  B LYS A 1 71  ? 66.864 63.349 8.333   0.30 11.48 ? 68   LYS A CG  1 
ATOM   671  C  CD  A LYS A 1 71  ? 66.827 62.896 9.948   0.70 20.80 ? 68   LYS A CD  1 
ATOM   672  C  CD  B LYS A 1 71  ? 66.145 63.411 9.689   0.30 12.90 ? 68   LYS A CD  1 
ATOM   673  C  CE  A LYS A 1 71  ? 66.643 64.092 10.888  0.70 25.84 ? 68   LYS A CE  1 
ATOM   674  C  CE  B LYS A 1 71  ? 66.574 64.638 10.518  0.30 13.95 ? 68   LYS A CE  1 
ATOM   675  N  NZ  A LYS A 1 71  ? 66.947 65.447 10.287  0.70 28.05 ? 68   LYS A NZ  1 
ATOM   676  N  NZ  B LYS A 1 71  ? 66.114 64.580 11.955  0.30 14.26 ? 68   LYS A NZ  1 
ATOM   677  N  N   . ILE A 1 72  ? 67.227 59.392 5.855   1.00 11.17 ? 69   ILE A N   1 
ATOM   678  C  CA  . ILE A 1 72  ? 66.798 58.123 5.253   1.00 10.51 ? 69   ILE A CA  1 
ATOM   679  C  C   . ILE A 1 72  ? 67.488 56.920 5.943   1.00 11.01 ? 69   ILE A C   1 
ATOM   680  O  O   . ILE A 1 72  ? 66.851 55.933 6.335   1.00 11.42 ? 69   ILE A O   1 
ATOM   681  C  CB  . ILE A 1 72  ? 67.063 58.074 3.716   1.00 10.82 ? 69   ILE A CB  1 
ATOM   682  C  CG1 . ILE A 1 72  ? 66.202 59.111 2.985   1.00 11.35 ? 69   ILE A CG1 1 
ATOM   683  C  CG2 . ILE A 1 72  ? 66.821 56.687 3.191   1.00 13.59 ? 69   ILE A CG2 1 
ATOM   684  C  CD1 . ILE A 1 72  ? 66.511 59.285 1.460   1.00 13.76 ? 69   ILE A CD1 1 
ATOM   685  N  N   . LYS A 1 73  ? 68.808 57.038 6.134   1.00 10.95 ? 70   LYS A N   1 
ATOM   686  C  CA  A LYS A 1 73  ? 69.560 55.997 6.818   0.60 12.01 ? 70   LYS A CA  1 
ATOM   687  C  CA  B LYS A 1 73  ? 69.587 56.011 6.823   0.40 11.35 ? 70   LYS A CA  1 
ATOM   688  C  C   . LYS A 1 73  ? 69.044 55.802 8.236   1.00 11.66 ? 70   LYS A C   1 
ATOM   689  O  O   . LYS A 1 73  ? 68.857 54.664 8.701   1.00 12.73 ? 70   LYS A O   1 
ATOM   690  C  CB  A LYS A 1 73  ? 71.058 56.310 6.798   0.60 13.22 ? 70   LYS A CB  1 
ATOM   691  C  CB  B LYS A 1 73  ? 71.071 56.412 6.863   0.40 11.85 ? 70   LYS A CB  1 
ATOM   692  C  CG  A LYS A 1 73  ? 71.635 56.169 5.408   0.60 16.14 ? 70   LYS A CG  1 
ATOM   693  C  CG  B LYS A 1 73  ? 72.019 55.361 7.455   0.40 11.94 ? 70   LYS A CG  1 
ATOM   694  C  CD  A LYS A 1 73  ? 73.142 56.340 5.364   0.60 19.31 ? 70   LYS A CD  1 
ATOM   695  C  CD  B LYS A 1 73  ? 73.477 55.690 7.107   0.40 14.12 ? 70   LYS A CD  1 
ATOM   696  C  CE  A LYS A 1 73  ? 73.696 56.154 3.931   0.60 22.40 ? 70   LYS A CE  1 
ATOM   697  C  CE  B LYS A 1 73  ? 74.480 54.725 7.760   0.40 16.44 ? 70   LYS A CE  1 
ATOM   698  N  NZ  A LYS A 1 73  ? 73.467 57.284 2.940   0.60 19.06 ? 70   LYS A NZ  1 
ATOM   699  N  NZ  B LYS A 1 73  ? 75.886 54.963 7.280   0.40 19.18 ? 70   LYS A NZ  1 
ATOM   700  N  N   . GLN A 1 74  ? 68.813 56.905 8.940   1.00 11.94 ? 71   GLN A N   1 
ATOM   701  C  CA  . GLN A 1 74  ? 68.363 56.870 10.319  1.00 11.49 ? 71   GLN A CA  1 
ATOM   702  C  C   . GLN A 1 74  ? 66.981 56.186 10.427  1.00 10.85 ? 71   GLN A C   1 
ATOM   703  O  O   . GLN A 1 74  ? 66.724 55.383 11.342  1.00 11.67 ? 71   GLN A O   1 
ATOM   704  C  CB  . GLN A 1 74  ? 68.292 58.277 10.913  1.00 13.60 ? 71   GLN A CB  1 
ATOM   705  C  CG  . GLN A 1 74  ? 69.650 58.865 11.245  1.00 14.92 ? 71   GLN A CG  1 
ATOM   706  C  CD  . GLN A 1 74  ? 69.600 60.336 11.613  1.00 22.90 ? 71   GLN A CD  1 
ATOM   707  O  OE1 . GLN A 1 74  ? 68.545 60.902 11.886  1.00 28.68 ? 71   GLN A OE1 1 
ATOM   708  N  NE2 . GLN A 1 74  ? 70.768 60.958 11.629  1.00 29.35 ? 71   GLN A NE2 1 
HETATM 709  N  N   . MSE A 1 75  ? 66.074 56.491 9.514   1.00 10.41 ? 72   MSE A N   1 
HETATM 710  C  CA  A MSE A 1 75  ? 64.751 55.845 9.517   0.50 10.76 ? 72   MSE A CA  1 
HETATM 711  C  CA  B MSE A 1 75  ? 64.775 55.863 9.603   0.50 10.70 ? 72   MSE A CA  1 
HETATM 712  C  C   . MSE A 1 75  ? 64.944 54.341 9.453   1.00 10.82 ? 72   MSE A C   1 
HETATM 713  O  O   . MSE A 1 75  ? 64.440 53.572 10.267  1.00 11.16 ? 72   MSE A O   1 
HETATM 714  C  CB  A MSE A 1 75  ? 63.910 56.243 8.278   0.50 10.86 ? 72   MSE A CB  1 
HETATM 715  C  CB  B MSE A 1 75  ? 63.830 56.405 8.532   0.50 11.19 ? 72   MSE A CB  1 
HETATM 716  C  CG  A MSE A 1 75  ? 62.711 55.244 8.025   0.50 10.34 ? 72   MSE A CG  1 
HETATM 717  C  CG  B MSE A 1 75  ? 62.464 55.706 8.580   0.50 10.35 ? 72   MSE A CG  1 
HETATM 718  SE SE  A MSE A 1 75  ? 61.485 55.730 6.635   0.35 11.56 ? 72   MSE A SE  1 
HETATM 719  SE SE  B MSE A 1 75  ? 61.057 56.345 7.446   0.35 16.38 ? 72   MSE A SE  1 
HETATM 720  C  CE  A MSE A 1 75  ? 60.625 57.123 7.721   0.50 7.38  ? 72   MSE A CE  1 
HETATM 721  C  CE  B MSE A 1 75  ? 62.075 56.297 5.796   0.50 15.55 ? 72   MSE A CE  1 
ATOM   722  N  N   . PHE A 1 76  ? 65.629 53.895 8.406   1.00 11.08 ? 73   PHE A N   1 
ATOM   723  C  CA  . PHE A 1 76  ? 65.712 52.434 8.157   1.00 10.18 ? 73   PHE A CA  1 
ATOM   724  C  C   . PHE A 1 76  ? 66.478 51.707 9.237   1.00 11.14 ? 73   PHE A C   1 
ATOM   725  O  O   . PHE A 1 76  ? 66.204 50.529 9.486   1.00 12.75 ? 73   PHE A O   1 
ATOM   726  C  CB  . PHE A 1 76  ? 66.334 52.187 6.761   1.00 11.51 ? 73   PHE A CB  1 
ATOM   727  C  CG  . PHE A 1 76  ? 65.350 52.297 5.614   1.00 11.44 ? 73   PHE A CG  1 
ATOM   728  C  CD1 . PHE A 1 76  ? 64.655 51.178 5.201   1.00 12.44 ? 73   PHE A CD1 1 
ATOM   729  C  CD2 . PHE A 1 76  ? 65.139 53.498 4.924   1.00 11.24 ? 73   PHE A CD2 1 
ATOM   730  C  CE1 . PHE A 1 76  ? 63.746 51.258 4.160   1.00 13.31 ? 73   PHE A CE1 1 
ATOM   731  C  CE2 . PHE A 1 76  ? 64.259 53.564 3.869   1.00 11.77 ? 73   PHE A CE2 1 
ATOM   732  C  CZ  . PHE A 1 76  ? 63.551 52.450 3.502   1.00 12.49 ? 73   PHE A CZ  1 
ATOM   733  N  N   . ASN A 1 77  ? 67.450 52.369 9.863   1.00 11.36 ? 74   ASN A N   1 
ATOM   734  C  CA  . ASN A 1 77  ? 68.281 51.734 10.881  1.00 11.59 ? 74   ASN A CA  1 
ATOM   735  C  C   . ASN A 1 77  ? 67.678 51.756 12.281  1.00 10.86 ? 74   ASN A C   1 
ATOM   736  O  O   . ASN A 1 77  ? 68.282 51.279 13.229  1.00 12.17 ? 74   ASN A O   1 
ATOM   737  C  CB  . ASN A 1 77  ? 69.689 52.346 10.915  1.00 13.24 ? 74   ASN A CB  1 
ATOM   738  C  CG  . ASN A 1 77  ? 70.577 51.865 9.808   1.00 18.62 ? 74   ASN A CG  1 
ATOM   739  O  OD1 . ASN A 1 77  ? 70.386 50.773 9.257   1.00 26.91 ? 74   ASN A OD1 1 
ATOM   740  N  ND2 . ASN A 1 77  ? 71.620 52.649 9.518   1.00 24.15 ? 74   ASN A ND2 1 
ATOM   741  N  N   . GLY A 1 78  ? 66.502 52.345 12.435  1.00 10.87 ? 75   GLY A N   1 
ATOM   742  C  CA  . GLY A 1 78  ? 65.850 52.343 13.739  1.00 10.51 ? 75   GLY A CA  1 
ATOM   743  C  C   . GLY A 1 78  ? 66.250 53.437 14.684  1.00 10.70 ? 75   GLY A C   1 
ATOM   744  O  O   . GLY A 1 78  ? 65.967 53.315 15.880  1.00 11.81 ? 75   GLY A O   1 
ATOM   745  N  N   . ALA A 1 79  ? 66.870 54.512 14.176  1.00 10.93 ? 76   ALA A N   1 
ATOM   746  C  CA  . ALA A 1 79  ? 67.121 55.658 15.037  1.00 11.46 ? 76   ALA A CA  1 
ATOM   747  C  C   . ALA A 1 79  ? 65.793 56.293 15.463  1.00 10.74 ? 76   ALA A C   1 
ATOM   748  O  O   . ALA A 1 79  ? 64.762 56.165 14.778  1.00 10.97 ? 76   ALA A O   1 
ATOM   749  C  CB  . ALA A 1 79  ? 67.981 56.670 14.324  1.00 13.31 ? 76   ALA A CB  1 
ATOM   750  N  N   . LYS A 1 80  ? 65.797 56.949 16.617  1.00 11.28 ? 77   LYS A N   1 
ATOM   751  C  CA  . LYS A 1 80  ? 64.582 57.470 17.217  1.00 12.12 ? 77   LYS A CA  1 
ATOM   752  C  C   . LYS A 1 80  ? 64.230 58.839 16.607  1.00 12.36 ? 77   LYS A C   1 
ATOM   753  O  O   . LYS A 1 80  ? 64.249 59.915 17.280  1.00 15.20 ? 77   LYS A O   1 
ATOM   754  C  CB  . LYS A 1 80  ? 64.738 57.531 18.725  1.00 13.01 ? 77   LYS A CB  1 
ATOM   755  C  CG  . LYS A 1 80  ? 64.806 56.147 19.399  1.00 17.24 ? 77   LYS A CG  1 
ATOM   756  C  CD  . LYS A 1 80  ? 64.970 56.251 20.937  1.00 21.45 ? 77   LYS A CD  1 
ATOM   757  C  CE  . LYS A 1 80  ? 64.792 54.869 21.543  1.00 27.59 ? 77   LYS A CE  1 
ATOM   758  N  NZ  . LYS A 1 80  ? 65.870 54.017 21.024  1.00 31.59 ? 77   LYS A NZ  1 
ATOM   759  N  N   . ILE A 1 81  ? 63.893 58.799 15.309  1.00 12.16 ? 78   ILE A N   1 
ATOM   760  C  CA  . ILE A 1 81  ? 63.594 60.016 14.527  1.00 12.28 ? 78   ILE A CA  1 
ATOM   761  C  C   . ILE A 1 81  ? 62.225 60.645 14.851  1.00 12.97 ? 78   ILE A C   1 
ATOM   762  O  O   . ILE A 1 81  ? 61.994 61.801 14.520  1.00 14.79 ? 78   ILE A O   1 
ATOM   763  C  CB  . ILE A 1 81  ? 63.737 59.787 13.019  1.00 13.09 ? 78   ILE A CB  1 
ATOM   764  C  CG1 . ILE A 1 81  ? 62.679 58.858 12.467  1.00 13.83 ? 78   ILE A CG1 1 
ATOM   765  C  CG2 . ILE A 1 81  ? 65.185 59.328 12.660  1.00 15.21 ? 78   ILE A CG2 1 
ATOM   766  C  CD1 . ILE A 1 81  ? 62.537 58.940 10.907  1.00 14.90 ? 78   ILE A CD1 1 
ATOM   767  N  N   . ASN A 1 82  ? 61.367 59.893 15.553  1.00 11.79 ? 79   ASN A N   1 
ATOM   768  C  CA  . ASN A 1 82  ? 60.171 60.458 16.170  1.00 12.14 ? 79   ASN A CA  1 
ATOM   769  C  C   . ASN A 1 82  ? 60.642 61.054 17.486  1.00 12.29 ? 79   ASN A C   1 
ATOM   770  O  O   . ASN A 1 82  ? 60.614 60.412 18.527  1.00 12.84 ? 79   ASN A O   1 
ATOM   771  C  CB  . ASN A 1 82  ? 59.028 59.410 16.331  1.00 11.12 ? 79   ASN A CB  1 
ATOM   772  C  CG  . ASN A 1 82  ? 57.814 59.960 17.041  1.00 11.39 ? 79   ASN A CG  1 
ATOM   773  O  OD1 . ASN A 1 82  ? 57.810 61.136 17.519  1.00 12.66 ? 79   ASN A OD1 1 
ATOM   774  N  ND2 . ASN A 1 82  ? 56.777 59.116 17.173  1.00 11.16 ? 79   ASN A ND2 1 
ATOM   775  N  N   . SER A 1 83  ? 61.147 62.274 17.412  1.00 13.43 ? 80   SER A N   1 
ATOM   776  C  CA  . SER A 1 83  ? 61.948 62.800 18.498  1.00 15.38 ? 80   SER A CA  1 
ATOM   777  C  C   . SER A 1 83  ? 61.149 63.344 19.651  1.00 14.72 ? 80   SER A C   1 
ATOM   778  O  O   . SER A 1 83  ? 61.690 63.502 20.708  1.00 18.43 ? 80   SER A O   1 
ATOM   779  C  CB  . SER A 1 83  ? 62.863 63.891 17.969  1.00 18.50 ? 80   SER A CB  1 
ATOM   780  O  OG  . SER A 1 83  ? 62.135 64.803 17.255  1.00 20.19 ? 80   SER A OG  1 
ATOM   781  N  N   . THR A 1 84  ? 59.870 63.649 19.482  1.00 12.50 ? 81   THR A N   1 
ATOM   782  C  CA  . THR A 1 84  ? 59.081 64.124 20.597  1.00 11.90 ? 81   THR A CA  1 
ATOM   783  C  C   . THR A 1 84  ? 58.557 63.004 21.482  1.00 12.45 ? 81   THR A C   1 
ATOM   784  O  O   . THR A 1 84  ? 58.391 63.199 22.681  1.00 14.56 ? 81   THR A O   1 
ATOM   785  C  CB  . THR A 1 84  ? 57.902 65.000 20.131  1.00 10.86 ? 81   THR A CB  1 
ATOM   786  O  OG1 . THR A 1 84  ? 56.961 64.197 19.414  1.00 12.01 ? 81   THR A OG1 1 
ATOM   787  C  CG2 . THR A 1 84  ? 58.403 66.173 19.250  1.00 11.28 ? 81   THR A CG2 1 
ATOM   788  N  N   . GLU A 1 85  ? 58.369 61.820 20.902  1.00 11.87 ? 82   GLU A N   1 
ATOM   789  C  CA  . GLU A 1 85  ? 57.930 60.611 21.607  1.00 12.58 ? 82   GLU A CA  1 
ATOM   790  C  C   . GLU A 1 85  ? 59.134 59.690 21.887  1.00 13.26 ? 82   GLU A C   1 
ATOM   791  O  O   . GLU A 1 85  ? 58.940 58.685 22.536  1.00 15.01 ? 82   GLU A O   1 
ATOM   792  C  CB  . GLU A 1 85  ? 56.856 59.892 20.790  1.00 13.20 ? 82   GLU A CB  1 
ATOM   793  C  CG  . GLU A 1 85  ? 55.568 60.772 20.653  1.00 16.03 ? 82   GLU A CG  1 
ATOM   794  C  CD  . GLU A 1 85  ? 54.360 60.132 19.957  1.00 19.56 ? 82   GLU A CD  1 
ATOM   795  O  OE1 . GLU A 1 85  ? 54.539 59.688 18.851  1.00 22.91 ? 82   GLU A OE1 1 
ATOM   796  O  OE2 . GLU A 1 85  ? 53.194 60.180 20.473  1.00 24.52 ? 82   GLU A OE2 1 
ATOM   797  N  N   . HIS A 1 86  ? 60.327 60.021 21.383  1.00 13.43 ? 83   HIS A N   1 
ATOM   798  C  CA  . HIS A 1 86  ? 61.520 59.191 21.556  1.00 14.33 ? 83   HIS A CA  1 
ATOM   799  C  C   . HIS A 1 86  ? 61.298 57.752 21.041  1.00 13.52 ? 83   HIS A C   1 
ATOM   800  O  O   . HIS A 1 86  ? 61.507 56.767 21.767  1.00 14.65 ? 83   HIS A O   1 
ATOM   801  C  CB  . HIS A 1 86  ? 61.952 59.231 23.004  1.00 14.95 ? 83   HIS A CB  1 
ATOM   802  C  CG  . HIS A 1 86  ? 62.106 60.640 23.504  1.00 20.64 ? 83   HIS A CG  1 
ATOM   803  N  ND1 . HIS A 1 86  ? 61.262 61.193 24.444  1.00 26.46 ? 83   HIS A ND1 1 
ATOM   804  C  CD2 . HIS A 1 86  ? 62.907 61.640 23.085  1.00 25.84 ? 83   HIS A CD2 1 
ATOM   805  C  CE1 . HIS A 1 86  ? 61.586 62.460 24.636  1.00 28.24 ? 83   HIS A CE1 1 
ATOM   806  N  NE2 . HIS A 1 86  ? 62.602 62.752 23.842  1.00 26.85 ? 83   HIS A NE2 1 
ATOM   807  N  N   . ARG A 1 87  ? 60.846 57.682 19.801  1.00 11.33 ? 84   ARG A N   1 
ATOM   808  C  CA  . ARG A 1 87  ? 60.492 56.426 19.174  1.00 10.93 ? 84   ARG A CA  1 
ATOM   809  C  C   . ARG A 1 87  ? 61.172 56.282 17.826  1.00 10.75 ? 84   ARG A C   1 
ATOM   810  O  O   . ARG A 1 87  ? 61.354 57.259 17.096  1.00 10.93 ? 84   ARG A O   1 
ATOM   811  C  CB  . ARG A 1 87  ? 58.971 56.291 18.976  1.00 10.84 ? 84   ARG A CB  1 
ATOM   812  C  CG  . ARG A 1 87  ? 58.203 56.123 20.259  1.00 12.22 ? 84   ARG A CG  1 
ATOM   813  C  CD  . ARG A 1 87  ? 56.700 56.162 20.030  1.00 13.80 ? 84   ARG A CD  1 
ATOM   814  N  NE  . ARG A 1 87  ? 55.942 55.991 21.243  1.00 16.21 ? 84   ARG A NE  1 
ATOM   815  C  CZ  . ARG A 1 87  ? 54.614 55.959 21.288  1.00 22.08 ? 84   ARG A CZ  1 
ATOM   816  N  NH1 . ARG A 1 87  ? 53.882 56.056 20.173  1.00 22.20 ? 84   ARG A NH1 1 
ATOM   817  N  NH2 . ARG A 1 87  ? 54.001 55.817 22.465  1.00 26.80 ? 84   ARG A NH2 1 
ATOM   818  N  N   . ALA A 1 88  ? 61.471 55.030 17.455  1.00 11.09 ? 85   ALA A N   1 
ATOM   819  C  CA  . ALA A 1 88  ? 61.845 54.685 16.087  1.00 10.71 ? 85   ALA A CA  1 
ATOM   820  C  C   . ALA A 1 88  ? 60.608 54.752 15.187  1.00 10.81 ? 85   ALA A C   1 
ATOM   821  O  O   . ALA A 1 88  ? 59.487 54.839 15.675  1.00 10.55 ? 85   ALA A O   1 
ATOM   822  C  CB  . ALA A 1 88  ? 62.481 53.253 16.047  1.00 11.32 ? 85   ALA A CB  1 
ATOM   823  N  N   . VAL A 1 89  ? 60.856 54.750 13.885  1.00 10.30 ? 86   VAL A N   1 
ATOM   824  C  CA  . VAL A 1 89  ? 59.829 54.874 12.845  1.00 9.07  ? 86   VAL A CA  1 
ATOM   825  C  C   . VAL A 1 89  ? 60.138 53.782 11.828  1.00 9.76  ? 86   VAL A C   1 
ATOM   826  O  O   . VAL A 1 89  ? 60.951 53.971 10.921  1.00 10.55 ? 86   VAL A O   1 
ATOM   827  C  CB  . VAL A 1 89  ? 59.812 56.286 12.233  1.00 9.41  ? 86   VAL A CB  1 
ATOM   828  C  CG1 . VAL A 1 89  ? 58.845 56.391 11.067  1.00 11.16 ? 86   VAL A CG1 1 
ATOM   829  C  CG2 . VAL A 1 89  ? 59.505 57.359 13.347  1.00 10.47 ? 86   VAL A CG2 1 
ATOM   830  N  N   . LEU A 1 90  ? 59.496 52.622 12.043  1.00 10.33 ? 87   LEU A N   1 
ATOM   831  C  CA  . LEU A 1 90  ? 59.936 51.377 11.398  1.00 10.24 ? 87   LEU A CA  1 
ATOM   832  C  C   . LEU A 1 90  ? 58.787 50.652 10.702  1.00 9.49  ? 87   LEU A C   1 
ATOM   833  O  O   . LEU A 1 90  ? 58.810 49.411 10.540  1.00 10.33 ? 87   LEU A O   1 
ATOM   834  C  CB  . LEU A 1 90  ? 60.652 50.479 12.401  1.00 10.59 ? 87   LEU A CB  1 
ATOM   835  C  CG  . LEU A 1 90  ? 62.083 50.831 12.812  1.00 10.47 ? 87   LEU A CG  1 
ATOM   836  C  CD1 . LEU A 1 90  ? 62.515 49.939 13.945  1.00 12.80 ? 87   LEU A CD1 1 
ATOM   837  C  CD2 . LEU A 1 90  ? 63.017 50.769 11.623  1.00 12.46 ? 87   LEU A CD2 1 
ATOM   838  N  N   . HIS A 1 91  ? 57.821 51.424 10.136  1.00 9.51  ? 88   HIS A N   1 
ATOM   839  C  CA  . HIS A 1 91  ? 56.857 50.790 9.236   1.00 9.85  ? 88   HIS A CA  1 
ATOM   840  C  C   . HIS A 1 91  ? 57.546 50.065 8.060   1.00 9.26  ? 88   HIS A C   1 
ATOM   841  O  O   . HIS A 1 91  ? 57.048 49.024 7.604   1.00 9.70  ? 88   HIS A O   1 
ATOM   842  C  CB  . HIS A 1 91  ? 55.776 51.756 8.794   1.00 9.87  ? 88   HIS A CB  1 
ATOM   843  C  CG  . HIS A 1 91  ? 56.289 53.053 8.234   1.00 9.21  ? 88   HIS A CG  1 
ATOM   844  N  ND1 . HIS A 1 91  ? 56.673 54.080 9.070   1.00 9.04  ? 88   HIS A ND1 1 
ATOM   845  C  CD2 . HIS A 1 91  ? 56.502 53.482 6.951   1.00 10.98 ? 88   HIS A CD2 1 
ATOM   846  C  CE1 . HIS A 1 91  ? 57.066 55.098 8.315   1.00 11.22 ? 88   HIS A CE1 1 
ATOM   847  N  NE2 . HIS A 1 91  ? 56.997 54.759 7.032   1.00 11.62 ? 88   HIS A NE2 1 
ATOM   848  N  N   . THR A 1 92  ? 58.698 50.582 7.595   1.00 9.20  ? 89   THR A N   1 
ATOM   849  C  CA  . THR A 1 92  ? 59.478 49.891 6.590   1.00 9.38  ? 89   THR A CA  1 
ATOM   850  C  C   . THR A 1 92  ? 59.825 48.464 6.985   1.00 9.48  ? 89   THR A C   1 
ATOM   851  O  O   . THR A 1 92  ? 59.802 47.549 6.158   1.00 10.09 ? 89   THR A O   1 
ATOM   852  C  CB  . THR A 1 92  ? 60.737 50.679 6.210   1.00 10.16 ? 89   THR A CB  1 
ATOM   853  O  OG1 . THR A 1 92  ? 61.495 51.014 7.371   1.00 10.09 ? 89   THR A OG1 1 
ATOM   854  C  CG2 . THR A 1 92  ? 60.332 51.983 5.426   1.00 10.29 ? 89   THR A CG2 1 
ATOM   855  N  N   . ALA A 1 93  ? 60.147 48.250 8.256   1.00 9.18  ? 90   ALA A N   1 
ATOM   856  C  CA  . ALA A 1 93  ? 60.567 46.909 8.705   1.00 8.71  ? 90   ALA A CA  1 
ATOM   857  C  C   . ALA A 1 93  ? 59.439 45.874 8.581   1.00 8.29  ? 90   ALA A C   1 
ATOM   858  O  O   . ALA A 1 93  ? 59.673 44.684 8.425   1.00 9.49  ? 90   ALA A O   1 
ATOM   859  C  CB  . ALA A 1 93  ? 61.154 46.912 10.149  1.00 9.35  ? 90   ALA A CB  1 
ATOM   860  N  N   . LEU A 1 94  ? 58.187 46.343 8.625   1.00 8.63  ? 91   LEU A N   1 
ATOM   861  C  CA  . LEU A 1 94  ? 57.024 45.471 8.505   1.00 8.62  ? 91   LEU A CA  1 
ATOM   862  C  C   . LEU A 1 94  ? 56.997 44.705 7.208   1.00 8.60  ? 91   LEU A C   1 
ATOM   863  O  O   . LEU A 1 94  ? 56.406 43.615 7.156   1.00 9.76  ? 91   LEU A O   1 
ATOM   864  C  CB  . LEU A 1 94  ? 55.743 46.274 8.659   1.00 8.71  ? 91   LEU A CB  1 
ATOM   865  C  CG  . LEU A 1 94  ? 55.529 46.926 10.005  1.00 8.82  ? 91   LEU A CG  1 
ATOM   866  C  CD1 . LEU A 1 94  ? 54.356 47.902 9.942   1.00 9.99  ? 91   LEU A CD1 1 
ATOM   867  C  CD2 . LEU A 1 94  ? 55.441 45.901 11.143  1.00 10.04 ? 91   LEU A CD2 1 
ATOM   868  N  N   . ARG A 1 95  ? 57.589 45.279 6.148   1.00 8.62  ? 92   ARG A N   1 
ATOM   869  C  CA  . ARG A 1 95  ? 57.560 44.656 4.797   1.00 9.11  ? 92   ARG A CA  1 
ATOM   870  C  C   . ARG A 1 95  ? 58.952 44.289 4.304   1.00 8.67  ? 92   ARG A C   1 
ATOM   871  O  O   . ARG A 1 95  ? 59.140 43.985 3.132   1.00 9.69  ? 92   ARG A O   1 
ATOM   872  C  CB  . ARG A 1 95  ? 56.840 45.558 3.816   1.00 9.52  ? 92   ARG A CB  1 
ATOM   873  C  CG  . ARG A 1 95  ? 57.450 46.927 3.563   1.00 9.09  ? 92   ARG A CG  1 
ATOM   874  C  CD  . ARG A 1 95  ? 56.604 48.088 4.163   1.00 10.13 ? 92   ARG A CD  1 
ATOM   875  N  NE  . ARG A 1 95  ? 57.155 49.374 3.720   1.00 8.82  ? 92   ARG A NE  1 
ATOM   876  C  CZ  . ARG A 1 95  ? 56.486 50.524 3.816   1.00 9.71  ? 92   ARG A CZ  1 
ATOM   877  N  NH1 . ARG A 1 95  ? 56.993 51.628 3.341   1.00 10.47 ? 92   ARG A NH1 1 
ATOM   878  N  NH2 . ARG A 1 95  ? 55.321 50.586 4.432   1.00 10.52 ? 92   ARG A NH2 1 
ATOM   879  N  N   . ASP A 1 96  ? 59.950 44.264 5.179   1.00 8.80  ? 93   ASP A N   1 
ATOM   880  C  CA  . ASP A 1 96  ? 61.312 43.985 4.760   1.00 8.70  ? 93   ASP A CA  1 
ATOM   881  C  C   . ASP A 1 96  ? 61.468 42.598 4.112   1.00 9.69  ? 93   ASP A C   1 
ATOM   882  O  O   . ASP A 1 96  ? 60.999 41.562 4.615   1.00 11.28 ? 93   ASP A O   1 
ATOM   883  C  CB  . ASP A 1 96  ? 62.267 44.067 5.962   1.00 9.97  ? 93   ASP A CB  1 
ATOM   884  C  CG  . ASP A 1 96  ? 63.670 43.660 5.569   1.00 10.74 ? 93   ASP A CG  1 
ATOM   885  O  OD1 . ASP A 1 96  ? 64.293 44.409 4.760   1.00 11.04 ? 93   ASP A OD1 1 
ATOM   886  O  OD2 . ASP A 1 96  ? 64.113 42.549 5.942   1.00 10.72 ? 93   ASP A OD2 1 
ATOM   887  N  N   . LEU A 1 97  ? 62.219 42.605 3.019   1.00 10.20 ? 94   LEU A N   1 
ATOM   888  C  CA  . LEU A 1 97  ? 62.699 41.371 2.351   1.00 10.33 ? 94   LEU A CA  1 
ATOM   889  C  C   . LEU A 1 97  ? 64.221 41.290 2.301   1.00 11.40 ? 94   LEU A C   1 
ATOM   890  O  O   . LEU A 1 97  ? 64.750 40.303 1.785   1.00 14.86 ? 94   LEU A O   1 
ATOM   891  C  CB  . LEU A 1 97  ? 62.135 41.252 0.945   1.00 10.85 ? 94   LEU A CB  1 
ATOM   892  C  CG  . LEU A 1 97  ? 60.620 41.007 0.912   1.00 11.87 ? 94   LEU A CG  1 
ATOM   893  C  CD1 . LEU A 1 97  ? 60.080 41.187 -0.488  1.00 16.01 ? 94   LEU A CD1 1 
ATOM   894  C  CD2 . LEU A 1 97  ? 60.309 39.587 1.397   1.00 14.16 ? 94   LEU A CD2 1 
ATOM   895  N  N   . SER A 1 98  ? 64.931 42.320 2.787   1.00 11.50 ? 95   SER A N   1 
ATOM   896  C  CA  . SER A 1 98  ? 66.415 42.329 2.742   1.00 11.87 ? 95   SER A CA  1 
ATOM   897  C  C   . SER A 1 98  ? 67.061 41.344 3.730   1.00 12.69 ? 95   SER A C   1 
ATOM   898  O  O   . SER A 1 98  ? 68.158 40.821 3.493   1.00 14.67 ? 95   SER A O   1 
ATOM   899  C  CB  . SER A 1 98  ? 66.958 43.747 2.982   1.00 11.61 ? 95   SER A CB  1 
ATOM   900  O  OG  . SER A 1 98  ? 66.919 44.045 4.383   1.00 10.97 ? 95   SER A OG  1 
ATOM   901  N  N   . SER A 1 99  ? 66.407 41.154 4.866   1.00 11.83 ? 96   SER A N   1 
ATOM   902  C  CA  A SER A 1 99  ? 66.894 40.306 5.965   0.60 13.38 ? 96   SER A CA  1 
ATOM   903  C  CA  B SER A 1 99  ? 66.886 40.333 5.982   0.40 13.22 ? 96   SER A CA  1 
ATOM   904  C  C   . SER A 1 99  ? 68.211 40.802 6.598   1.00 13.53 ? 96   SER A C   1 
ATOM   905  O  O   . SER A 1 99  ? 68.889 40.039 7.304   1.00 14.45 ? 96   SER A O   1 
ATOM   906  C  CB  A SER A 1 99  ? 67.024 38.834 5.494   0.60 14.76 ? 96   SER A CB  1 
ATOM   907  C  CB  B SER A 1 99  ? 66.990 38.865 5.562   0.40 14.34 ? 96   SER A CB  1 
ATOM   908  O  OG  A SER A 1 99  ? 65.776 38.348 5.023   0.60 19.39 ? 96   SER A OG  1 
ATOM   909  O  OG  B SER A 1 99  ? 66.946 38.051 6.709   0.40 17.52 ? 96   SER A OG  1 
ATOM   910  N  N   . THR A 1 100 ? 68.539 42.078 6.431   1.00 10.74 ? 97   THR A N   1 
ATOM   911  C  CA  . THR A 1 100 ? 69.773 42.579 7.067   1.00 11.12 ? 97   THR A CA  1 
ATOM   912  C  C   . THR A 1 100 ? 69.596 42.692 8.564   1.00 11.20 ? 97   THR A C   1 
ATOM   913  O  O   . THR A 1 100 ? 68.464 42.733 9.071   1.00 11.46 ? 97   THR A O   1 
ATOM   914  C  CB  . THR A 1 100 ? 70.156 43.973 6.513   1.00 10.54 ? 97   THR A CB  1 
ATOM   915  O  OG1 . THR A 1 100 ? 69.063 44.899 6.746   1.00 12.37 ? 97   THR A OG1 1 
ATOM   916  C  CG2 . THR A 1 100 ? 70.491 43.899 4.978   1.00 11.98 ? 97   THR A CG2 1 
ATOM   917  N  N   . PRO A 1 101 ? 70.691 42.684 9.318   1.00 11.41 ? 98   PRO A N   1 
ATOM   918  C  CA  . PRO A 1 101 ? 70.554 42.749 10.770  1.00 10.54 ? 98   PRO A CA  1 
ATOM   919  C  C   . PRO A 1 101 ? 69.870 44.028 11.234  1.00 11.18 ? 98   PRO A C   1 
ATOM   920  O  O   . PRO A 1 101 ? 70.189 45.121 10.731  1.00 12.53 ? 98   PRO A O   1 
ATOM   921  C  CB  . PRO A 1 101 ? 72.011 42.677 11.268  1.00 11.21 ? 98   PRO A CB  1 
ATOM   922  C  CG  . PRO A 1 101 ? 72.783 42.238 10.157  1.00 12.96 ? 98   PRO A CG  1 
ATOM   923  C  CD  . PRO A 1 101 ? 72.092 42.595 8.908   1.00 11.23 ? 98   PRO A CD  1 
ATOM   924  N  N   . LEU A 1 102 ? 68.914 43.907 12.143  1.00 9.69  ? 99   LEU A N   1 
ATOM   925  C  CA  . LEU A 1 102 ? 68.234 45.088 12.684  1.00 9.96  ? 99   LEU A CA  1 
ATOM   926  C  C   . LEU A 1 102 ? 67.829 44.778 14.126  1.00 10.60 ? 99   LEU A C   1 
ATOM   927  O  O   . LEU A 1 102 ? 66.883 44.048 14.389  1.00 10.24 ? 99   LEU A O   1 
ATOM   928  C  CB  . LEU A 1 102 ? 67.037 45.472 11.791  1.00 11.09 ? 99   LEU A CB  1 
ATOM   929  C  CG  . LEU A 1 102 ? 66.306 46.757 12.154  1.00 11.19 ? 99   LEU A CG  1 
ATOM   930  C  CD1 . LEU A 1 102 ? 67.261 47.968 12.181  1.00 13.78 ? 99   LEU A CD1 1 
ATOM   931  C  CD2 . LEU A 1 102 ? 65.070 46.999 11.252  1.00 12.25 ? 99   LEU A CD2 1 
ATOM   932  N  N   . ILE A 1 103 ? 68.581 45.351 15.057  1.00 12.40 ? 100  ILE A N   1 
ATOM   933  C  CA  A ILE A 1 103 ? 68.383 45.164 16.497  0.60 13.52 ? 100  ILE A CA  1 
ATOM   934  C  CA  B ILE A 1 103 ? 68.270 45.223 16.476  0.40 13.41 ? 100  ILE A CA  1 
ATOM   935  C  C   . ILE A 1 103 ? 68.068 46.589 17.020  1.00 13.93 ? 100  ILE A C   1 
ATOM   936  O  O   . ILE A 1 103 ? 68.942 47.475 16.885  1.00 16.30 ? 100  ILE A O   1 
ATOM   937  C  CB  A ILE A 1 103 ? 69.661 44.511 17.146  0.60 12.82 ? 100  ILE A CB  1 
ATOM   938  C  CB  B ILE A 1 103 ? 69.353 44.621 17.309  0.40 12.78 ? 100  ILE A CB  1 
ATOM   939  C  CG1 A ILE A 1 103 ? 70.114 43.229 16.431  0.60 13.13 ? 100  ILE A CG1 1 
ATOM   940  C  CG1 B ILE A 1 103 ? 69.682 43.221 16.824  0.40 13.14 ? 100  ILE A CG1 1 
ATOM   941  C  CG2 A ILE A 1 103 ? 69.501 44.237 18.651  0.60 12.36 ? 100  ILE A CG2 1 
ATOM   942  C  CG2 B ILE A 1 103 ? 68.912 44.686 18.806  0.40 12.51 ? 100  ILE A CG2 1 
ATOM   943  C  CD1 A ILE A 1 103 ? 69.137 42.053 16.506  0.60 13.10 ? 100  ILE A CD1 1 
ATOM   944  C  CD1 B ILE A 1 103 ? 71.095 42.833 17.127  0.40 11.96 ? 100  ILE A CD1 1 
ATOM   945  N  N   . VAL A 1 104 ? 66.892 46.784 17.568  1.00 14.65 ? 101  VAL A N   1 
ATOM   946  C  CA  . VAL A 1 104 ? 66.425 48.107 18.021  1.00 16.49 ? 101  VAL A CA  1 
ATOM   947  C  C   . VAL A 1 104 ? 65.778 47.958 19.399  1.00 17.37 ? 101  VAL A C   1 
ATOM   948  O  O   . VAL A 1 104 ? 64.862 47.171 19.602  1.00 16.05 ? 101  VAL A O   1 
ATOM   949  C  CB  . VAL A 1 104 ? 65.479 48.745 16.961  1.00 16.87 ? 101  VAL A CB  1 
ATOM   950  C  CG1 . VAL A 1 104 ? 64.985 50.102 17.449  1.00 20.19 ? 101  VAL A CG1 1 
ATOM   951  C  CG2 . VAL A 1 104 ? 66.134 48.754 15.545  1.00 17.29 ? 101  VAL A CG2 1 
ATOM   952  N  N   . ASP A 1 105 ? 66.312 48.702 20.377  1.00 17.78 ? 102  ASP A N   1 
ATOM   953  C  CA  A ASP A 1 105 ? 65.873 48.650 21.785  0.70 18.47 ? 102  ASP A CA  1 
ATOM   954  C  CA  B ASP A 1 105 ? 65.733 48.658 21.712  0.30 17.57 ? 102  ASP A CA  1 
ATOM   955  C  C   . ASP A 1 105 ? 65.704 47.216 22.244  1.00 16.35 ? 102  ASP A C   1 
ATOM   956  O  O   . ASP A 1 105 ? 64.713 46.798 22.849  1.00 16.00 ? 102  ASP A O   1 
ATOM   957  C  CB  A ASP A 1 105 ? 64.566 49.389 22.042  0.70 20.79 ? 102  ASP A CB  1 
ATOM   958  C  CB  B ASP A 1 105 ? 64.303 49.255 21.678  0.30 18.72 ? 102  ASP A CB  1 
ATOM   959  C  CG  A ASP A 1 105 ? 64.690 50.892 22.000  0.70 24.25 ? 102  ASP A CG  1 
ATOM   960  C  CG  B ASP A 1 105 ? 63.549 49.071 22.995  0.30 20.47 ? 102  ASP A CG  1 
ATOM   961  O  OD1 A ASP A 1 105 ? 65.788 51.478 22.263  0.70 26.51 ? 102  ASP A OD1 1 
ATOM   962  O  OD1 B ASP A 1 105 ? 64.148 49.363 24.058  0.30 23.35 ? 102  ASP A OD1 1 
ATOM   963  O  OD2 A ASP A 1 105 ? 63.615 51.485 21.696  0.70 31.67 ? 102  ASP A OD2 1 
ATOM   964  O  OD2 B ASP A 1 105 ? 62.384 48.608 22.968  0.30 23.78 ? 102  ASP A OD2 1 
ATOM   965  N  N   . GLY A 1 106 ? 66.763 46.449 22.007  1.00 12.07 ? 103  GLY A N   1 
ATOM   966  C  CA  . GLY A 1 106 ? 66.815 45.072 22.506  1.00 9.62  ? 103  GLY A CA  1 
ATOM   967  C  C   . GLY A 1 106 ? 66.086 44.025 21.709  1.00 9.44  ? 103  GLY A C   1 
ATOM   968  O  O   . GLY A 1 106 ? 66.254 42.852 22.027  1.00 10.71 ? 103  GLY A O   1 
ATOM   969  N  N   . GLN A 1 107 ? 65.286 44.425 20.732  1.00 10.08 ? 104  GLN A N   1 
ATOM   970  C  CA  A GLN A 1 107 ? 64.541 43.413 19.981  0.60 11.72 ? 104  GLN A CA  1 
ATOM   971  C  CA  B GLN A 1 107 ? 64.444 43.561 19.894  0.40 10.78 ? 104  GLN A CA  1 
ATOM   972  C  C   . GLN A 1 107 ? 65.167 43.222 18.609  1.00 10.61 ? 104  GLN A C   1 
ATOM   973  O  O   . GLN A 1 107 ? 65.630 44.149 17.960  1.00 11.08 ? 104  GLN A O   1 
ATOM   974  C  CB  A GLN A 1 107 ? 63.041 43.721 19.838  0.60 13.50 ? 104  GLN A CB  1 
ATOM   975  C  CB  B GLN A 1 107 ? 63.183 44.362 19.466  0.40 11.16 ? 104  GLN A CB  1 
ATOM   976  C  CG  A GLN A 1 107 ? 62.265 43.892 21.097  0.60 16.59 ? 104  GLN A CG  1 
ATOM   977  C  CG  B GLN A 1 107 ? 62.338 44.805 20.619  0.40 12.70 ? 104  GLN A CG  1 
ATOM   978  C  CD  A GLN A 1 107 ? 60.780 43.574 20.882  0.60 19.71 ? 104  GLN A CD  1 
ATOM   979  C  CD  B GLN A 1 107 ? 60.945 45.324 20.205  0.40 13.78 ? 104  GLN A CD  1 
ATOM   980  O  OE1 A GLN A 1 107 ? 60.095 44.222 20.073  0.60 23.98 ? 104  GLN A OE1 1 
ATOM   981  O  OE1 B GLN A 1 107 ? 60.778 46.105 19.244  0.40 13.36 ? 104  GLN A OE1 1 
ATOM   982  N  NE2 A GLN A 1 107 ? 60.274 42.578 21.621  0.60 26.22 ? 104  GLN A NE2 1 
ATOM   983  N  NE2 B GLN A 1 107 ? 59.943 44.912 20.972  0.40 18.23 ? 104  GLN A NE2 1 
ATOM   984  N  N   . ASP A 1 108 ? 65.187 41.962 18.203  1.00 10.48 ? 105  ASP A N   1 
ATOM   985  C  CA  . ASP A 1 108 ? 65.589 41.590 16.869  1.00 10.12 ? 105  ASP A CA  1 
ATOM   986  C  C   . ASP A 1 108 ? 64.346 41.814 15.995  1.00 9.97  ? 105  ASP A C   1 
ATOM   987  O  O   . ASP A 1 108 ? 63.383 41.026 16.014  1.00 10.76 ? 105  ASP A O   1 
ATOM   988  C  CB  . ASP A 1 108 ? 66.013 40.146 16.816  1.00 10.38 ? 105  ASP A CB  1 
ATOM   989  C  CG  . ASP A 1 108 ? 66.479 39.721 15.441  1.00 9.46  ? 105  ASP A CG  1 
ATOM   990  O  OD1 . ASP A 1 108 ? 65.974 40.281 14.431  1.00 10.88 ? 105  ASP A OD1 1 
ATOM   991  O  OD2 . ASP A 1 108 ? 67.306 38.802 15.400  1.00 14.46 ? 105  ASP A OD2 1 
ATOM   992  N  N   . ILE A 1 109 ? 64.345 42.941 15.296  1.00 9.49  ? 106  ILE A N   1 
ATOM   993  C  CA  . ILE A 1 109 ? 63.145 43.378 14.546  1.00 10.00 ? 106  ILE A CA  1 
ATOM   994  C  C   . ILE A 1 109 ? 62.785 42.369 13.464  1.00 9.28  ? 106  ILE A C   1 
ATOM   995  O  O   . ILE A 1 109 ? 61.588 42.116 13.207  1.00 10.48 ? 106  ILE A O   1 
ATOM   996  C  CB  . ILE A 1 109 ? 63.339 44.779 13.960  1.00 10.51 ? 106  ILE A CB  1 
ATOM   997  C  CG1 . ILE A 1 109 ? 63.633 45.778 15.090  1.00 11.80 ? 106  ILE A CG1 1 
ATOM   998  C  CG2 . ILE A 1 109 ? 62.137 45.205 13.062  1.00 12.96 ? 106  ILE A CG2 1 
ATOM   999  C  CD1 . ILE A 1 109 ? 62.515 45.919 16.130  1.00 13.73 ? 106  ILE A CD1 1 
ATOM   1000 N  N   . ARG A 1 110 ? 63.798 41.771 12.824  1.00 9.31  ? 107  ARG A N   1 
ATOM   1001 C  CA  . ARG A 1 110 ? 63.528 40.766 11.805  1.00 10.06 ? 107  ARG A CA  1 
ATOM   1002 C  C   . ARG A 1 110 ? 62.775 39.595 12.383  1.00 9.04  ? 107  ARG A C   1 
ATOM   1003 O  O   . ARG A 1 110 ? 61.753 39.151 11.813  1.00 10.92 ? 107  ARG A O   1 
ATOM   1004 C  CB  . ARG A 1 110 ? 64.804 40.274 11.104  1.00 9.64  ? 107  ARG A CB  1 
ATOM   1005 C  CG  . ARG A 1 110 ? 65.643 41.364 10.509  1.00 11.07 ? 107  ARG A CG  1 
ATOM   1006 C  CD  . ARG A 1 110 ? 64.899 42.280 9.602   1.00 11.35 ? 107  ARG A CD  1 
ATOM   1007 N  NE  . ARG A 1 110 ? 65.781 43.198 8.902   1.00 10.02 ? 107  ARG A NE  1 
ATOM   1008 C  CZ  . ARG A 1 110 ? 65.402 44.384 8.434   1.00 9.66  ? 107  ARG A CZ  1 
ATOM   1009 N  NH1 . ARG A 1 110 ? 64.146 44.772 8.546   1.00 10.55 ? 107  ARG A NH1 1 
ATOM   1010 N  NH2 . ARG A 1 110 ? 66.260 45.183 7.834   1.00 11.54 ? 107  ARG A NH2 1 
ATOM   1011 N  N   . GLN A 1 111 ? 63.226 39.098 13.524  1.00 9.78  ? 108  GLN A N   1 
ATOM   1012 C  CA  . GLN A 1 111 ? 62.550 37.953 14.133  1.00 11.54 ? 108  GLN A CA  1 
ATOM   1013 C  C   . GLN A 1 111 ? 61.164 38.340 14.600  1.00 12.22 ? 108  GLN A C   1 
ATOM   1014 O  O   . GLN A 1 111 ? 60.222 37.558 14.445  1.00 12.74 ? 108  GLN A O   1 
ATOM   1015 C  CB  . GLN A 1 111 ? 63.343 37.415 15.337  1.00 14.72 ? 108  GLN A CB  1 
ATOM   1016 C  CG  . GLN A 1 111 ? 64.577 36.675 15.075  1.00 17.02 ? 108  GLN A CG  1 
ATOM   1017 C  CD  . GLN A 1 111 ? 65.083 35.867 16.315  1.00 22.31 ? 108  GLN A CD  1 
ATOM   1018 O  OE1 . GLN A 1 111 ? 64.291 35.273 17.092  1.00 28.08 ? 108  GLN A OE1 1 
ATOM   1019 N  NE2 . GLN A 1 111 ? 66.382 35.826 16.468  1.00 26.90 ? 108  GLN A NE2 1 
ATOM   1020 N  N   . GLU A 1 112 ? 61.027 39.525 15.203  1.00 10.69 ? 109  GLU A N   1 
ATOM   1021 C  CA  A GLU A 1 112 ? 59.729 39.868 15.728  0.60 11.06 ? 109  GLU A CA  1 
ATOM   1022 C  CA  B GLU A 1 112 ? 59.740 40.046 15.730  0.40 10.51 ? 109  GLU A CA  1 
ATOM   1023 C  C   . GLU A 1 112 ? 58.687 40.094 14.627  1.00 9.97  ? 109  GLU A C   1 
ATOM   1024 O  O   . GLU A 1 112 ? 57.539 39.618 14.795  1.00 10.36 ? 109  GLU A O   1 
ATOM   1025 C  CB  A GLU A 1 112 ? 59.800 41.000 16.720  0.60 11.44 ? 109  GLU A CB  1 
ATOM   1026 C  CB  B GLU A 1 112 ? 59.863 41.475 16.313  0.40 10.51 ? 109  GLU A CB  1 
ATOM   1027 C  CG  A GLU A 1 112 ? 60.669 40.651 17.949  0.60 13.77 ? 109  GLU A CG  1 
ATOM   1028 C  CG  B GLU A 1 112 ? 60.631 41.613 17.646  0.40 10.70 ? 109  GLU A CG  1 
ATOM   1029 C  CD  A GLU A 1 112 ? 60.112 39.467 18.747  0.60 18.56 ? 109  GLU A CD  1 
ATOM   1030 C  CD  B GLU A 1 112 ? 59.988 40.875 18.790  0.40 13.17 ? 109  GLU A CD  1 
ATOM   1031 O  OE1 A GLU A 1 112 ? 58.907 39.515 19.077  0.60 16.62 ? 109  GLU A OE1 1 
ATOM   1032 O  OE1 B GLU A 1 112 ? 60.683 40.697 19.804  0.40 16.73 ? 109  GLU A OE1 1 
ATOM   1033 O  OE2 A GLU A 1 112 ? 60.855 38.478 19.022  0.60 24.20 ? 109  GLU A OE2 1 
ATOM   1034 O  OE2 B GLU A 1 112 ? 58.807 40.453 18.658  0.40 17.60 ? 109  GLU A OE2 1 
ATOM   1035 N  N   . VAL A 1 113 ? 59.046 40.738 13.541  1.00 10.11 ? 110  VAL A N   1 
ATOM   1036 C  CA  . VAL A 1 113 ? 58.146 40.916 12.408  1.00 10.30 ? 110  VAL A CA  1 
ATOM   1037 C  C   . VAL A 1 113 ? 57.723 39.553 11.837  1.00 9.84  ? 110  VAL A C   1 
ATOM   1038 O  O   . VAL A 1 113 ? 56.527 39.289 11.595  1.00 10.79 ? 110  VAL A O   1 
ATOM   1039 C  CB  . VAL A 1 113 ? 58.766 41.850 11.352  1.00 9.15  ? 110  VAL A CB  1 
ATOM   1040 C  CG1 . VAL A 1 113 ? 57.949 41.803 10.026  1.00 9.78  ? 110  VAL A CG1 1 
ATOM   1041 C  CG2 . VAL A 1 113 ? 58.813 43.300 11.913  1.00 11.14 ? 110  VAL A CG2 1 
ATOM   1042 N  N   . THR A 1 114 ? 58.705 38.693 11.595  1.00 10.24 ? 111  THR A N   1 
ATOM   1043 C  CA  . THR A 1 114 ? 58.454 37.379 10.997  1.00 10.20 ? 111  THR A CA  1 
ATOM   1044 C  C   . THR A 1 114 ? 57.586 36.485 11.862  1.00 9.78  ? 111  THR A C   1 
ATOM   1045 O  O   . THR A 1 114 ? 56.642 35.869 11.369  1.00 10.78 ? 111  THR A O   1 
ATOM   1046 C  CB  . THR A 1 114 ? 59.784 36.709 10.667  1.00 11.53 ? 111  THR A CB  1 
ATOM   1047 O  OG1 . THR A 1 114 ? 60.461 37.539 9.679   1.00 13.34 ? 111  THR A OG1 1 
ATOM   1048 C  CG2 . THR A 1 114 ? 59.551 35.288 10.154  1.00 14.49 ? 111  THR A CG2 1 
ATOM   1049 N  N   . LYS A 1 115 ? 57.830 36.468 13.156  1.00 9.78  ? 112  LYS A N   1 
ATOM   1050 C  CA  A LYS A 1 115 ? 57.087 35.593 14.037  0.60 10.38 ? 112  LYS A CA  1 
ATOM   1051 C  CA  B LYS A 1 115 ? 57.094 35.620 14.088  0.40 10.33 ? 112  LYS A CA  1 
ATOM   1052 C  C   . LYS A 1 115 ? 55.640 36.077 14.153  1.00 10.32 ? 112  LYS A C   1 
ATOM   1053 O  O   . LYS A 1 115 ? 54.699 35.280 14.180  1.00 10.49 ? 112  LYS A O   1 
ATOM   1054 C  CB  A LYS A 1 115 ? 57.728 35.545 15.417  0.60 12.04 ? 112  LYS A CB  1 
ATOM   1055 C  CB  B LYS A 1 115 ? 57.729 35.734 15.477  0.40 11.50 ? 112  LYS A CB  1 
ATOM   1056 C  CG  A LYS A 1 115 ? 59.011 34.757 15.463  0.60 15.65 ? 112  LYS A CG  1 
ATOM   1057 C  CG  B LYS A 1 115 ? 57.048 34.958 16.626  0.40 14.03 ? 112  LYS A CG  1 
ATOM   1058 C  CD  A LYS A 1 115 ? 59.669 34.764 16.852  0.60 19.27 ? 112  LYS A CD  1 
ATOM   1059 C  CD  B LYS A 1 115 ? 57.962 35.066 17.905  0.40 16.95 ? 112  LYS A CD  1 
ATOM   1060 C  CE  A LYS A 1 115 ? 61.019 34.029 16.872  0.60 20.02 ? 112  LYS A CE  1 
ATOM   1061 C  CE  B LYS A 1 115 ? 57.413 34.393 19.158  0.40 20.33 ? 112  LYS A CE  1 
ATOM   1062 N  NZ  A LYS A 1 115 ? 61.680 34.071 18.252  0.60 22.35 ? 112  LYS A NZ  1 
ATOM   1063 N  NZ  B LYS A 1 115 ? 58.168 34.765 20.395  0.40 24.24 ? 112  LYS A NZ  1 
ATOM   1064 N  N   . GLU A 1 116 ? 55.448 37.385 14.191  1.00 9.17  ? 113  GLU A N   1 
ATOM   1065 C  CA  . GLU A 1 116 ? 54.066 37.931 14.248  1.00 9.63  ? 113  GLU A CA  1 
ATOM   1066 C  C   . GLU A 1 116 ? 53.288 37.614 12.969  1.00 9.74  ? 113  GLU A C   1 
ATOM   1067 O  O   . GLU A 1 116 ? 52.123 37.245 13.031  1.00 10.15 ? 113  GLU A O   1 
ATOM   1068 C  CB  . GLU A 1 116 ? 54.060 39.408 14.568  1.00 10.40 ? 113  GLU A CB  1 
ATOM   1069 C  CG  . GLU A 1 116 ? 52.752 40.004 14.746  1.00 11.40 ? 113  GLU A CG  1 
ATOM   1070 C  CD  . GLU A 1 116 ? 51.956 39.571 15.973  1.00 13.40 ? 113  GLU A CD  1 
ATOM   1071 O  OE1 . GLU A 1 116 ? 52.434 38.804 16.870  1.00 13.76 ? 113  GLU A OE1 1 
ATOM   1072 O  OE2 . GLU A 1 116 ? 50.773 40.043 15.987  1.00 14.40 ? 113  GLU A OE2 1 
ATOM   1073 N  N   . LYS A 1 117 ? 53.921 37.802 11.797  1.00 9.61  ? 114  LYS A N   1 
ATOM   1074 C  CA  A LYS A 1 117 ? 53.275 37.465 10.534  0.70 9.49  ? 114  LYS A CA  1 
ATOM   1075 C  CA  B LYS A 1 117 ? 53.306 37.448 10.517  0.30 9.85  ? 114  LYS A CA  1 
ATOM   1076 C  C   . LYS A 1 117 ? 52.863 36.000 10.529  1.00 10.25 ? 114  LYS A C   1 
ATOM   1077 O  O   . LYS A 1 117 ? 51.767 35.675 10.047  1.00 11.00 ? 114  LYS A O   1 
ATOM   1078 C  CB  A LYS A 1 117 ? 54.169 37.739 9.336   0.70 10.19 ? 114  LYS A CB  1 
ATOM   1079 C  CB  B LYS A 1 117 ? 54.273 37.644 9.351   0.30 10.26 ? 114  LYS A CB  1 
ATOM   1080 C  CG  A LYS A 1 117 ? 54.360 39.210 9.013   0.70 10.45 ? 114  LYS A CG  1 
ATOM   1081 C  CG  B LYS A 1 117 ? 54.526 39.079 8.986   0.30 10.40 ? 114  LYS A CG  1 
ATOM   1082 C  CD  A LYS A 1 117 ? 55.427 39.411 7.945   0.70 13.50 ? 114  LYS A CD  1 
ATOM   1083 C  CD  B LYS A 1 117 ? 55.494 39.182 7.832   0.30 12.35 ? 114  LYS A CD  1 
ATOM   1084 C  CE  A LYS A 1 117 ? 55.053 38.743 6.621   0.70 13.29 ? 114  LYS A CE  1 
ATOM   1085 C  CE  B LYS A 1 117 ? 55.718 40.625 7.452   0.30 12.85 ? 114  LYS A CE  1 
ATOM   1086 N  NZ  A LYS A 1 117 ? 56.236 38.728 5.675   0.70 12.31 ? 114  LYS A NZ  1 
ATOM   1087 N  NZ  B LYS A 1 117 ? 56.696 40.732 6.354   0.30 9.56  ? 114  LYS A NZ  1 
ATOM   1088 N  N   . GLN A 1 118 ? 53.695 35.119 11.075  1.00 10.32 ? 115  GLN A N   1 
ATOM   1089 C  CA  . GLN A 1 118 ? 53.325 33.723 11.130  1.00 11.33 ? 115  GLN A CA  1 
ATOM   1090 C  C   . GLN A 1 118 ? 52.075 33.492 11.996  1.00 11.11 ? 115  GLN A C   1 
ATOM   1091 O  O   . GLN A 1 118 ? 51.212 32.672 11.620  1.00 10.70 ? 115  GLN A O   1 
ATOM   1092 C  CB  . GLN A 1 118 ? 54.500 32.867 11.594  1.00 12.94 ? 115  GLN A CB  1 
ATOM   1093 C  CG  . GLN A 1 118 ? 54.285 31.351 11.559  1.00 15.94 ? 115  GLN A CG  1 
ATOM   1094 C  CD  . GLN A 1 118 ? 54.024 30.761 10.121  1.00 19.10 ? 115  GLN A CD  1 
ATOM   1095 O  OE1 . GLN A 1 118 ? 54.500 31.274 9.077   1.00 24.66 ? 115  GLN A OE1 1 
ATOM   1096 N  NE2 . GLN A 1 118 ? 53.247 29.709 10.075  1.00 25.00 ? 115  GLN A NE2 1 
ATOM   1097 N  N   . ARG A 1 119 ? 51.962 34.216 13.106  1.00 10.65 ? 116  ARG A N   1 
ATOM   1098 C  CA  . ARG A 1 119 ? 50.750 34.090 13.951  1.00 10.45 ? 116  ARG A CA  1 
ATOM   1099 C  C   . ARG A 1 119 ? 49.498 34.533 13.175  1.00 10.09 ? 116  ARG A C   1 
ATOM   1100 O  O   . ARG A 1 119 ? 48.448 33.886 13.243  1.00 10.82 ? 116  ARG A O   1 
ATOM   1101 C  CB  . ARG A 1 119 ? 50.816 34.960 15.215  1.00 11.34 ? 116  ARG A CB  1 
ATOM   1102 C  CG  . ARG A 1 119 ? 51.834 34.496 16.246  1.00 12.05 ? 116  ARG A CG  1 
ATOM   1103 C  CD  . ARG A 1 119 ? 51.838 35.454 17.389  1.00 13.38 ? 116  ARG A CD  1 
ATOM   1104 N  NE  . ARG A 1 119 ? 50.579 35.453 18.154  1.00 12.46 ? 116  ARG A NE  1 
ATOM   1105 C  CZ  . ARG A 1 119 ? 50.168 36.461 18.931  1.00 12.56 ? 116  ARG A CZ  1 
ATOM   1106 N  NH1 . ARG A 1 119 ? 50.785 37.644 18.925  1.00 13.49 ? 116  ARG A NH1 1 
ATOM   1107 N  NH2 . ARG A 1 119 ? 49.153 36.285 19.733  1.00 14.92 ? 116  ARG A NH2 1 
ATOM   1108 N  N   . VAL A 1 120 ? 49.608 35.638 12.417  1.00 9.22  ? 117  VAL A N   1 
ATOM   1109 C  CA  . VAL A 1 120 ? 48.445 36.129 11.679  1.00 9.71  ? 117  VAL A CA  1 
ATOM   1110 C  C   . VAL A 1 120 ? 48.085 35.169 10.545  1.00 9.64  ? 117  VAL A C   1 
ATOM   1111 O  O   . VAL A 1 120 ? 46.905 34.883 10.337  1.00 10.27 ? 117  VAL A O   1 
ATOM   1112 C  CB  . VAL A 1 120 ? 48.638 37.590 11.197  1.00 9.10  ? 117  VAL A CB  1 
ATOM   1113 C  CG1 . VAL A 1 120 ? 47.441 38.065 10.316  1.00 10.01 ? 117  VAL A CG1 1 
ATOM   1114 C  CG2 . VAL A 1 120 ? 48.893 38.558 12.395  1.00 12.64 ? 117  VAL A CG2 1 
ATOM   1115 N  N   . LYS A 1 121 ? 49.069 34.706 9.797   1.00 9.84  ? 118  LYS A N   1 
ATOM   1116 C  CA  . LYS A 1 121 ? 48.856 33.736 8.752   1.00 9.97  ? 118  LYS A CA  1 
ATOM   1117 C  C   . LYS A 1 121 ? 48.114 32.516 9.307   1.00 9.41  ? 118  LYS A C   1 
ATOM   1118 O  O   . LYS A 1 121 ? 47.177 32.018 8.675   1.00 10.92 ? 118  LYS A O   1 
ATOM   1119 C  CB  . LYS A 1 121 ? 50.176 33.354 8.070   1.00 10.00 ? 118  LYS A CB  1 
ATOM   1120 C  CG  . LYS A 1 121 ? 50.063 32.349 6.963   1.00 12.11 ? 118  LYS A CG  1 
ATOM   1121 C  CD  . LYS A 1 121 ? 51.381 32.091 6.309   1.00 17.15 ? 118  LYS A CD  1 
ATOM   1122 C  CE  . LYS A 1 121 ? 51.279 30.973 5.284   1.00 25.19 ? 118  LYS A CE  1 
ATOM   1123 N  NZ  . LYS A 1 121 ? 52.404 31.012 4.313   1.00 31.73 ? 118  LYS A NZ  1 
ATOM   1124 N  N   . GLU A 1 122 ? 48.565 32.014 10.452  1.00 9.78  ? 119  GLU A N   1 
ATOM   1125 C  CA  . GLU A 1 122 ? 47.950 30.839 11.025  1.00 10.42 ? 119  GLU A CA  1 
ATOM   1126 C  C   . GLU A 1 122 ? 46.493 31.103 11.448  1.00 10.14 ? 119  GLU A C   1 
ATOM   1127 O  O   . GLU A 1 122 ? 45.614 30.258 11.282  1.00 10.03 ? 119  GLU A O   1 
ATOM   1128 C  CB  . GLU A 1 122 ? 48.787 30.382 12.215  1.00 12.26 ? 119  GLU A CB  1 
ATOM   1129 C  CG  . GLU A 1 122 ? 50.054 29.704 11.797  1.00 17.43 ? 119  GLU A CG  1 
ATOM   1130 C  CD  . GLU A 1 122 ? 51.043 29.399 12.912  1.00 24.95 ? 119  GLU A CD  1 
ATOM   1131 O  OE1 . GLU A 1 122 ? 50.786 29.744 14.095  1.00 33.37 ? 119  GLU A OE1 1 
ATOM   1132 O  OE2 . GLU A 1 122 ? 52.103 28.812 12.584  1.00 27.71 ? 119  GLU A OE2 1 
ATOM   1133 N  N   . LEU A 1 123 ? 46.233 32.280 11.998  1.00 9.56  ? 120  LEU A N   1 
ATOM   1134 C  CA  . LEU A 1 123 ? 44.842 32.690 12.349  1.00 9.51  ? 120  LEU A CA  1 
ATOM   1135 C  C   . LEU A 1 123 ? 43.968 32.690 11.122  1.00 9.87  ? 120  LEU A C   1 
ATOM   1136 O  O   . LEU A 1 123 ? 42.890 32.073 11.109  1.00 9.93  ? 120  LEU A O   1 
ATOM   1137 C  CB  . LEU A 1 123 ? 44.836 34.073 12.996  1.00 10.37 ? 120  LEU A CB  1 
ATOM   1138 C  CG  . LEU A 1 123 ? 43.440 34.643 13.251  1.00 10.14 ? 120  LEU A CG  1 
ATOM   1139 C  CD1 . LEU A 1 123 ? 42.643 33.842 14.301  1.00 11.22 ? 120  LEU A CD1 1 
ATOM   1140 C  CD2 . LEU A 1 123 ? 43.530 36.153 13.592  1.00 12.16 ? 120  LEU A CD2 1 
ATOM   1141 N  N   . VAL A 1 124 ? 44.427 33.372 10.081  1.00 9.75  ? 121  VAL A N   1 
ATOM   1142 C  CA  . VAL A 1 124 ? 43.594 33.452 8.867   1.00 9.55  ? 121  VAL A CA  1 
ATOM   1143 C  C   . VAL A 1 124 ? 43.336 32.051 8.314   1.00 10.43 ? 121  VAL A C   1 
ATOM   1144 O  O   . VAL A 1 124 ? 42.207 31.756 7.954   1.00 11.23 ? 121  VAL A O   1 
ATOM   1145 C  CB  . VAL A 1 124 ? 44.263 34.388 7.808   1.00 9.71  ? 121  VAL A CB  1 
ATOM   1146 C  CG1 . VAL A 1 124 ? 43.552 34.323 6.447   1.00 11.71 ? 121  VAL A CG1 1 
ATOM   1147 C  CG2 . VAL A 1 124 ? 44.363 35.850 8.345   1.00 12.02 ? 121  VAL A CG2 1 
ATOM   1148 N  N   . GLU A 1 125 ? 44.360 31.209 8.210   1.00 11.42 ? 122  GLU A N   1 
ATOM   1149 C  CA  A GLU A 1 125 ? 44.204 29.834 7.688   0.60 11.97 ? 122  GLU A CA  1 
ATOM   1150 C  CA  B GLU A 1 125 ? 44.149 29.867 7.661   0.40 11.59 ? 122  GLU A CA  1 
ATOM   1151 C  C   . GLU A 1 125 ? 43.222 29.052 8.559   1.00 11.18 ? 122  GLU A C   1 
ATOM   1152 O  O   . GLU A 1 125 ? 42.394 28.304 8.059   1.00 12.79 ? 122  GLU A O   1 
ATOM   1153 C  CB  A GLU A 1 125 ? 45.551 29.088 7.689   0.60 13.19 ? 122  GLU A CB  1 
ATOM   1154 C  CB  B GLU A 1 125 ? 45.466 29.128 7.448   0.40 12.47 ? 122  GLU A CB  1 
ATOM   1155 C  CG  A GLU A 1 125 ? 45.510 27.575 7.303   0.60 17.79 ? 122  GLU A CG  1 
ATOM   1156 C  CG  B GLU A 1 125 ? 46.342 29.816 6.434   0.40 14.57 ? 122  GLU A CG  1 
ATOM   1157 C  CD  A GLU A 1 125 ? 45.055 27.322 5.903   0.60 20.69 ? 122  GLU A CD  1 
ATOM   1158 C  CD  B GLU A 1 125 ? 47.692 29.138 6.158   0.40 18.32 ? 122  GLU A CD  1 
ATOM   1159 O  OE1 A GLU A 1 125 ? 45.430 28.114 5.014   0.60 27.93 ? 122  GLU A OE1 1 
ATOM   1160 O  OE1 B GLU A 1 125 ? 48.226 28.412 7.022   0.40 24.32 ? 122  GLU A OE1 1 
ATOM   1161 O  OE2 A GLU A 1 125 ? 44.336 26.311 5.665   0.60 25.08 ? 122  GLU A OE2 1 
ATOM   1162 O  OE2 B GLU A 1 125 ? 48.231 29.349 5.057   0.40 20.60 ? 122  GLU A OE2 1 
ATOM   1163 N  N   . LYS A 1 126 ? 43.337 29.195 9.875   1.00 10.21 ? 123  LYS A N   1 
ATOM   1164 C  CA  . LYS A 1 126 ? 42.460 28.416 10.770  1.00 10.04 ? 123  LYS A CA  1 
ATOM   1165 C  C   . LYS A 1 126 ? 40.988 28.841 10.554  1.00 9.28  ? 123  LYS A C   1 
ATOM   1166 O  O   . LYS A 1 126 ? 40.103 28.028 10.576  1.00 10.27 ? 123  LYS A O   1 
ATOM   1167 C  CB  . LYS A 1 126 ? 42.883 28.709 12.206  1.00 10.59 ? 123  LYS A CB  1 
ATOM   1168 C  CG  . LYS A 1 126 ? 42.113 28.012 13.302  1.00 12.98 ? 123  LYS A CG  1 
ATOM   1169 C  CD  . LYS A 1 126 ? 42.704 28.144 14.688  1.00 16.10 ? 123  LYS A CD  1 
ATOM   1170 C  CE  . LYS A 1 126 ? 41.832 27.543 15.770  1.00 19.49 ? 123  LYS A CE  1 
ATOM   1171 N  NZ  . LYS A 1 126 ? 42.424 27.640 17.153  1.00 19.39 ? 123  LYS A NZ  1 
ATOM   1172 N  N   . VAL A 1 127 ? 40.740 30.131 10.389  1.00 8.87  ? 124  VAL A N   1 
ATOM   1173 C  CA  . VAL A 1 127 ? 39.390 30.613 10.173  1.00 10.11 ? 124  VAL A CA  1 
ATOM   1174 C  C   . VAL A 1 127 ? 38.846 30.240 8.774   1.00 11.26 ? 124  VAL A C   1 
ATOM   1175 O  O   . VAL A 1 127 ? 37.766 29.663 8.657   1.00 11.00 ? 124  VAL A O   1 
ATOM   1176 C  CB  . VAL A 1 127 ? 39.330 32.162 10.411  1.00 9.32  ? 124  VAL A CB  1 
ATOM   1177 C  CG1 . VAL A 1 127 ? 37.947 32.724 9.954   1.00 12.65 ? 124  VAL A CG1 1 
ATOM   1178 C  CG2 . VAL A 1 127 ? 39.637 32.469 11.882  1.00 11.04 ? 124  VAL A CG2 1 
ATOM   1179 N  N   . VAL A 1 128 ? 39.651 30.490 7.744   1.00 10.82 ? 125  VAL A N   1 
ATOM   1180 C  CA  . VAL A 1 128 ? 39.207 30.264 6.346   1.00 11.81 ? 125  VAL A CA  1 
ATOM   1181 C  C   . VAL A 1 128 ? 38.979 28.781 6.087   1.00 12.54 ? 125  VAL A C   1 
ATOM   1182 O  O   . VAL A 1 128 ? 38.026 28.440 5.369   1.00 14.94 ? 125  VAL A O   1 
ATOM   1183 C  CB  . VAL A 1 128 ? 40.193 30.885 5.326   1.00 12.08 ? 125  VAL A CB  1 
ATOM   1184 C  CG1 . VAL A 1 128 ? 39.858 30.463 3.890   1.00 13.78 ? 125  VAL A CG1 1 
ATOM   1185 C  CG2 . VAL A 1 128 ? 40.252 32.414 5.490   1.00 11.80 ? 125  VAL A CG2 1 
ATOM   1186 N  N   . SER A 1 129 ? 39.811 27.907 6.675   1.00 12.46 ? 126  SER A N   1 
ATOM   1187 C  CA  . SER A 1 129 ? 39.724 26.454 6.475   1.00 13.42 ? 126  SER A CA  1 
ATOM   1188 C  C   . SER A 1 129 ? 38.515 25.838 7.190   1.00 14.31 ? 126  SER A C   1 
ATOM   1189 O  O   . SER A 1 129 ? 38.182 24.674 6.970   1.00 17.40 ? 126  SER A O   1 
ATOM   1190 C  CB  . SER A 1 129 ? 40.975 25.692 6.985   1.00 14.25 ? 126  SER A CB  1 
ATOM   1191 O  OG  . SER A 1 129 ? 41.123 25.856 8.398   1.00 14.41 ? 126  SER A OG  1 
ATOM   1192 N  N   . GLY A 1 130 ? 37.878 26.602 8.075   1.00 14.72 ? 127  GLY A N   1 
ATOM   1193 C  CA  . GLY A 1 130 ? 36.791 26.093 8.866   1.00 14.32 ? 127  GLY A CA  1 
ATOM   1194 C  C   . GLY A 1 130 ? 37.211 25.410 10.132  1.00 14.39 ? 127  GLY A C   1 
ATOM   1195 O  O   . GLY A 1 130 ? 36.351 24.853 10.785  1.00 16.41 ? 127  GLY A O   1 
ATOM   1196 N  N   . ARG A 1 131 ? 38.514 25.397 10.481  1.00 14.67 ? 128  ARG A N   1 
ATOM   1197 C  CA  A ARG A 1 131 ? 38.963 24.819 11.742  0.70 14.82 ? 128  ARG A CA  1 
ATOM   1198 C  CA  B ARG A 1 131 ? 38.959 24.809 11.738  0.30 14.84 ? 128  ARG A CA  1 
ATOM   1199 C  C   . ARG A 1 131 ? 38.509 25.653 12.934  1.00 14.57 ? 128  ARG A C   1 
ATOM   1200 O  O   . ARG A 1 131 ? 38.098 25.096 13.979  1.00 16.80 ? 128  ARG A O   1 
ATOM   1201 C  CB  A ARG A 1 131 ? 40.468 24.605 11.782  0.70 15.18 ? 128  ARG A CB  1 
ATOM   1202 C  CB  B ARG A 1 131 ? 40.469 24.584 11.737  0.30 15.05 ? 128  ARG A CB  1 
ATOM   1203 C  CG  A ARG A 1 131 ? 40.861 23.318 11.062  0.70 18.91 ? 128  ARG A CG  1 
ATOM   1204 C  CG  B ARG A 1 131 ? 40.882 23.516 10.717  0.30 16.75 ? 128  ARG A CG  1 
ATOM   1205 C  CD  A ARG A 1 131 ? 42.334 23.036 11.163  0.70 24.25 ? 128  ARG A CD  1 
ATOM   1206 C  CD  B ARG A 1 131 ? 42.366 23.220 10.739  0.30 19.49 ? 128  ARG A CD  1 
ATOM   1207 N  NE  A ARG A 1 131 ? 43.134 23.966 10.366  0.70 26.64 ? 128  ARG A NE  1 
ATOM   1208 N  NE  B ARG A 1 131 ? 43.199 24.417 10.667  0.30 20.74 ? 128  ARG A NE  1 
ATOM   1209 C  CZ  A ARG A 1 131 ? 43.961 24.899 10.860  0.70 28.61 ? 128  ARG A CZ  1 
ATOM   1210 C  CZ  B ARG A 1 131 ? 43.860 24.811 9.579   0.30 21.57 ? 128  ARG A CZ  1 
ATOM   1211 N  NH1 A ARG A 1 131 ? 44.122 25.086 12.178  0.70 30.90 ? 128  ARG A NH1 1 
ATOM   1212 N  NH1 B ARG A 1 131 ? 43.779 24.118 8.451   0.30 21.64 ? 128  ARG A NH1 1 
ATOM   1213 N  NH2 A ARG A 1 131 ? 44.639 25.648 10.011  0.70 28.61 ? 128  ARG A NH2 1 
ATOM   1214 N  NH2 B ARG A 1 131 ? 44.600 25.909 9.613   0.30 21.94 ? 128  ARG A NH2 1 
ATOM   1215 N  N   . TRP A 1 132 ? 38.567 26.989 12.795  1.00 13.39 ? 129  TRP A N   1 
ATOM   1216 C  CA  . TRP A 1 132 ? 37.996 27.849 13.835  1.00 12.95 ? 129  TRP A CA  1 
ATOM   1217 C  C   . TRP A 1 132 ? 36.484 27.700 13.847  1.00 12.63 ? 129  TRP A C   1 
ATOM   1218 O  O   . TRP A 1 132 ? 35.818 27.895 12.808  1.00 15.13 ? 129  TRP A O   1 
ATOM   1219 C  CB  . TRP A 1 132 ? 38.286 29.303 13.509  1.00 12.25 ? 129  TRP A CB  1 
ATOM   1220 C  CG  . TRP A 1 132 ? 37.915 30.288 14.618  1.00 11.65 ? 129  TRP A CG  1 
ATOM   1221 C  CD1 . TRP A 1 132 ? 36.663 30.602 15.075  1.00 12.13 ? 129  TRP A CD1 1 
ATOM   1222 C  CD2 . TRP A 1 132 ? 38.845 31.006 15.473  1.00 11.01 ? 129  TRP A CD2 1 
ATOM   1223 N  NE1 . TRP A 1 132 ? 36.756 31.521 16.102  1.00 12.91 ? 129  TRP A NE1 1 
ATOM   1224 C  CE2 . TRP A 1 132 ? 38.073 31.790 16.360  1.00 12.05 ? 129  TRP A CE2 1 
ATOM   1225 C  CE3 . TRP A 1 132 ? 40.234 31.131 15.504  1.00 14.09 ? 129  TRP A CE3 1 
ATOM   1226 C  CZ2 . TRP A 1 132 ? 38.656 32.628 17.315  1.00 13.72 ? 129  TRP A CZ2 1 
ATOM   1227 C  CZ3 . TRP A 1 132 ? 40.810 31.963 16.464  1.00 14.32 ? 129  TRP A CZ3 1 
ATOM   1228 C  CH2 . TRP A 1 132 ? 40.025 32.710 17.330  1.00 14.46 ? 129  TRP A CH2 1 
ATOM   1229 N  N   . ARG A 1 133 ? 35.915 27.428 15.006  1.00 11.14 ? 130  ARG A N   1 
ATOM   1230 C  CA  . ARG A 1 133 ? 34.441 27.371 15.145  1.00 11.67 ? 130  ARG A CA  1 
ATOM   1231 C  C   . ARG A 1 133 ? 33.983 28.401 16.171  1.00 12.26 ? 130  ARG A C   1 
ATOM   1232 O  O   . ARG A 1 133 ? 34.648 28.657 17.178  1.00 12.60 ? 130  ARG A O   1 
ATOM   1233 C  CB  . ARG A 1 133 ? 34.020 25.958 15.591  1.00 12.68 ? 130  ARG A CB  1 
ATOM   1234 C  CG  . ARG A 1 133 ? 34.407 24.856 14.609  1.00 14.11 ? 130  ARG A CG  1 
ATOM   1235 C  CD  . ARG A 1 133 ? 33.816 25.071 13.228  1.00 17.49 ? 130  ARG A CD  1 
ATOM   1236 N  NE  . ARG A 1 133 ? 34.156 23.980 12.337  1.00 19.53 ? 130  ARG A NE  1 
ATOM   1237 C  CZ  . ARG A 1 133 ? 33.376 22.942 12.075  1.00 23.64 ? 130  ARG A CZ  1 
ATOM   1238 N  NH1 . ARG A 1 133 ? 32.169 22.848 12.634  1.00 26.28 ? 130  ARG A NH1 1 
ATOM   1239 N  NH2 . ARG A 1 133 ? 33.798 21.986 11.241  1.00 27.26 ? 130  ARG A NH2 1 
ATOM   1240 N  N   . GLY A 1 134 ? 32.808 28.961 15.939  1.00 11.62 ? 131  GLY A N   1 
ATOM   1241 C  CA  . GLY A 1 134 ? 32.165 29.775 16.960  1.00 12.43 ? 131  GLY A CA  1 
ATOM   1242 C  C   . GLY A 1 134 ? 31.726 28.938 18.139  1.00 11.57 ? 131  GLY A C   1 
ATOM   1243 O  O   . GLY A 1 134 ? 31.892 27.695 18.187  1.00 11.87 ? 131  GLY A O   1 
ATOM   1244 N  N   . PHE A 1 135 ? 31.165 29.591 19.131  1.00 11.41 ? 132  PHE A N   1 
ATOM   1245 C  CA  . PHE A 1 135 ? 30.867 28.925 20.430  1.00 11.80 ? 132  PHE A CA  1 
ATOM   1246 C  C   . PHE A 1 135 ? 29.791 27.826 20.276  1.00 12.82 ? 132  PHE A C   1 
ATOM   1247 O  O   . PHE A 1 135 ? 29.838 26.835 20.994  1.00 15.19 ? 132  PHE A O   1 
ATOM   1248 C  CB  . PHE A 1 135 ? 30.447 29.999 21.453  1.00 11.70 ? 132  PHE A CB  1 
ATOM   1249 C  CG  . PHE A 1 135 ? 30.272 29.488 22.869  1.00 12.15 ? 132  PHE A CG  1 
ATOM   1250 C  CD1 . PHE A 1 135 ? 31.377 29.155 23.624  1.00 13.28 ? 132  PHE A CD1 1 
ATOM   1251 C  CD2 . PHE A 1 135 ? 28.987 29.395 23.443  1.00 14.92 ? 132  PHE A CD2 1 
ATOM   1252 C  CE1 . PHE A 1 135 ? 31.244 28.674 24.913  1.00 16.10 ? 132  PHE A CE1 1 
ATOM   1253 C  CE2 . PHE A 1 135 ? 28.861 28.946 24.727  1.00 15.88 ? 132  PHE A CE2 1 
ATOM   1254 C  CZ  . PHE A 1 135 ? 30.006 28.595 25.465  1.00 16.94 ? 132  PHE A CZ  1 
ATOM   1255 N  N   . SER A 1 136 ? 28.877 27.965 19.309  1.00 12.81 ? 133  SER A N   1 
ATOM   1256 C  CA  . SER A 1 136 ? 27.920 26.880 18.959  1.00 12.82 ? 133  SER A CA  1 
ATOM   1257 C  C   . SER A 1 136 ? 28.443 25.842 17.961  1.00 13.33 ? 133  SER A C   1 
ATOM   1258 O  O   . SER A 1 136 ? 27.698 24.933 17.556  1.00 15.12 ? 133  SER A O   1 
ATOM   1259 C  CB  . SER A 1 136 ? 26.609 27.450 18.467  1.00 13.26 ? 133  SER A CB  1 
ATOM   1260 O  OG  . SER A 1 136 ? 26.738 28.106 17.260  1.00 13.06 ? 133  SER A OG  1 
ATOM   1261 N  N   . GLY A 1 137 ? 29.693 25.982 17.535  1.00 12.53 ? 134  GLY A N   1 
ATOM   1262 C  CA  . GLY A 1 137 ? 30.285 24.970 16.695  1.00 12.88 ? 134  GLY A CA  1 
ATOM   1263 C  C   . GLY A 1 137 ? 30.277 25.253 15.207  1.00 12.33 ? 134  GLY A C   1 
ATOM   1264 O  O   . GLY A 1 137 ? 30.680 24.374 14.445  1.00 14.35 ? 134  GLY A O   1 
ATOM   1265 N  N   . LYS A 1 138 ? 29.861 26.452 14.785  1.00 12.06 ? 135  LYS A N   1 
ATOM   1266 C  CA  . LYS A 1 138 ? 29.730 26.766 13.359  1.00 11.57 ? 135  LYS A CA  1 
ATOM   1267 C  C   . LYS A 1 138 ? 30.960 27.453 12.781  1.00 11.64 ? 135  LYS A C   1 
ATOM   1268 O  O   . LYS A 1 138 ? 31.704 28.162 13.482  1.00 11.43 ? 135  LYS A O   1 
ATOM   1269 C  CB  . LYS A 1 138 ? 28.526 27.666 13.089  1.00 12.14 ? 135  LYS A CB  1 
ATOM   1270 C  CG  . LYS A 1 138 ? 27.201 27.132 13.553  1.00 14.37 ? 135  LYS A CG  1 
ATOM   1271 C  CD  . LYS A 1 138 ? 26.024 27.931 13.086  1.00 17.08 ? 135  LYS A CD  1 
ATOM   1272 C  CE  . LYS A 1 138 ? 24.722 27.310 13.533  1.00 21.53 ? 135  LYS A CE  1 
ATOM   1273 N  NZ  . LYS A 1 138 ? 23.542 28.171 13.201  1.00 26.99 ? 135  LYS A NZ  1 
ATOM   1274 N  N   . LYS A 1 139 ? 31.178 27.218 11.488  1.00 11.43 ? 136  LYS A N   1 
ATOM   1275 C  CA  . LYS A 1 139 ? 32.238 27.882 10.751  1.00 11.90 ? 136  LYS A CA  1 
ATOM   1276 C  C   . LYS A 1 139 ? 31.934 29.382 10.604  1.00 11.57 ? 136  LYS A C   1 
ATOM   1277 O  O   . LYS A 1 139 ? 30.789 29.825 10.509  1.00 11.79 ? 136  LYS A O   1 
ATOM   1278 C  CB  . LYS A 1 139 ? 32.416 27.204 9.375   1.00 12.26 ? 136  LYS A CB  1 
ATOM   1279 C  CG  . LYS A 1 139 ? 32.886 25.788 9.490   1.00 15.15 ? 136  LYS A CG  1 
ATOM   1280 C  CD  . LYS A 1 139 ? 33.034 25.114 8.142   1.00 17.93 ? 136  LYS A CD  1 
ATOM   1281 C  CE  . LYS A 1 139 ? 33.579 23.697 8.246   1.00 20.66 ? 136  LYS A CE  1 
ATOM   1282 N  NZ  . LYS A 1 139 ? 33.508 22.937 6.945   1.00 24.12 ? 136  LYS A NZ  1 
ATOM   1283 N  N   . ILE A 1 140 ? 33.002 30.170 10.588  1.00 10.05 ? 137  ILE A N   1 
ATOM   1284 C  CA  . ILE A 1 140 ? 32.902 31.622 10.427  1.00 9.73  ? 137  ILE A CA  1 
ATOM   1285 C  C   . ILE A 1 140 ? 32.638 31.997 8.977   1.00 10.32 ? 137  ILE A C   1 
ATOM   1286 O  O   . ILE A 1 140 ? 33.282 31.468 8.079   1.00 10.92 ? 137  ILE A O   1 
ATOM   1287 C  CB  . ILE A 1 140 ? 34.203 32.294 10.957  1.00 11.09 ? 137  ILE A CB  1 
ATOM   1288 C  CG1 . ILE A 1 140 ? 34.436 31.924 12.433  1.00 9.83  ? 137  ILE A CG1 1 
ATOM   1289 C  CG2 . ILE A 1 140 ? 34.205 33.809 10.717  1.00 10.52 ? 137  ILE A CG2 1 
ATOM   1290 C  CD1 . ILE A 1 140 ? 33.297 32.223 13.396  1.00 11.34 ? 137  ILE A CD1 1 
ATOM   1291 N  N   . THR A 1 141 ? 31.736 32.947 8.778   1.00 10.10 ? 138  THR A N   1 
ATOM   1292 C  CA  . THR A 1 141 ? 31.402 33.461 7.463   1.00 10.64 ? 138  THR A CA  1 
ATOM   1293 C  C   . THR A 1 141 ? 31.675 34.977 7.299   1.00 10.91 ? 138  THR A C   1 
ATOM   1294 O  O   . THR A 1 141 ? 31.718 35.473 6.172   1.00 11.50 ? 138  THR A O   1 
ATOM   1295 C  CB  . THR A 1 141 ? 29.917 33.217 7.107   1.00 12.02 ? 138  THR A CB  1 
ATOM   1296 O  OG1 . THR A 1 141 ? 29.090 33.828 8.104   1.00 11.35 ? 138  THR A OG1 1 
ATOM   1297 C  CG2 . THR A 1 141 ? 29.613 31.746 7.055   1.00 13.03 ? 138  THR A CG2 1 
ATOM   1298 N  N   . ASP A 1 142 ? 31.818 35.714 8.406   1.00 10.22 ? 139  ASP A N   1 
ATOM   1299 C  CA  . ASP A 1 142 ? 31.914 37.162 8.409   1.00 10.24 ? 139  ASP A CA  1 
ATOM   1300 C  C   . ASP A 1 142 ? 32.940 37.589 9.410   1.00 8.84  ? 139  ASP A C   1 
ATOM   1301 O  O   . ASP A 1 142 ? 33.054 37.016 10.496  1.00 10.68 ? 139  ASP A O   1 
ATOM   1302 C  CB  . ASP A 1 142 ? 30.580 37.827 8.793   1.00 10.34 ? 139  ASP A CB  1 
ATOM   1303 C  CG  . ASP A 1 142 ? 29.495 37.642 7.724   1.00 12.13 ? 139  ASP A CG  1 
ATOM   1304 O  OD1 . ASP A 1 142 ? 29.356 38.521 6.840   1.00 12.17 ? 139  ASP A OD1 1 
ATOM   1305 O  OD2 . ASP A 1 142 ? 28.801 36.608 7.739   1.00 14.42 ? 139  ASP A OD2 1 
ATOM   1306 N  N   . ILE A 1 143 ? 33.677 38.623 9.032   1.00 9.46  ? 140  ILE A N   1 
ATOM   1307 C  CA  . ILE A 1 143 ? 34.724 39.251 9.857   1.00 8.96  ? 140  ILE A CA  1 
ATOM   1308 C  C   . ILE A 1 143 ? 34.318 40.695 10.076  1.00 9.33  ? 140  ILE A C   1 
ATOM   1309 O  O   . ILE A 1 143 ? 33.972 41.382 9.115   1.00 10.66 ? 140  ILE A O   1 
ATOM   1310 C  CB  . ILE A 1 143 ? 36.089 39.252 9.171   1.00 8.89  ? 140  ILE A CB  1 
ATOM   1311 C  CG1 . ILE A 1 143 ? 36.516 37.834 8.814   1.00 10.25 ? 140  ILE A CG1 1 
ATOM   1312 C  CG2 . ILE A 1 143 ? 37.147 39.991 10.024  1.00 11.39 ? 140  ILE A CG2 1 
ATOM   1313 C  CD1 . ILE A 1 143 ? 36.720 36.890 9.985   1.00 11.74 ? 140  ILE A CD1 1 
ATOM   1314 N  N   . VAL A 1 144 ? 34.328 41.182 11.319  1.00 9.46  ? 141  VAL A N   1 
ATOM   1315 C  CA  . VAL A 1 144 ? 33.971 42.576 11.580  1.00 10.08 ? 141  VAL A CA  1 
ATOM   1316 C  C   . VAL A 1 144 ? 35.178 43.220 12.260  1.00 9.27  ? 141  VAL A C   1 
ATOM   1317 O  O   . VAL A 1 144 ? 35.549 42.865 13.383  1.00 10.85 ? 141  VAL A O   1 
ATOM   1318 C  CB  . VAL A 1 144 ? 32.745 42.738 12.473  1.00 9.94  ? 141  VAL A CB  1 
ATOM   1319 C  CG1 . VAL A 1 144 ? 32.483 44.253 12.747  1.00 11.52 ? 141  VAL A CG1 1 
ATOM   1320 C  CG2 . VAL A 1 144 ? 31.495 42.053 11.839  1.00 11.06 ? 141  VAL A CG2 1 
ATOM   1321 N  N   . ASN A 1 145 ? 35.802 44.160 11.563  1.00 9.00  ? 142  ASN A N   1 
ATOM   1322 C  CA  . ASN A 1 145 ? 36.912 44.954 12.135  1.00 10.07 ? 142  ASN A CA  1 
ATOM   1323 C  C   . ASN A 1 145 ? 36.336 46.140 12.888  1.00 10.34 ? 142  ASN A C   1 
ATOM   1324 O  O   . ASN A 1 145 ? 35.490 46.879 12.358  1.00 11.20 ? 142  ASN A O   1 
ATOM   1325 C  CB  . ASN A 1 145 ? 37.779 45.471 11.007  1.00 10.65 ? 142  ASN A CB  1 
ATOM   1326 C  CG  . ASN A 1 145 ? 39.130 46.019 11.479  1.00 11.82 ? 142  ASN A CG  1 
ATOM   1327 O  OD1 . ASN A 1 145 ? 40.015 45.257 11.922  1.00 14.22 ? 142  ASN A OD1 1 
ATOM   1328 N  ND2 . ASN A 1 145 ? 39.263 47.372 11.465  1.00 13.19 ? 142  ASN A ND2 1 
ATOM   1329 N  N   . ILE A 1 146 ? 36.764 46.327 14.119  1.00 9.23  ? 143  ILE A N   1 
ATOM   1330 C  CA  . ILE A 1 146 ? 36.332 47.449 14.958  1.00 9.72  ? 143  ILE A CA  1 
ATOM   1331 C  C   . ILE A 1 146 ? 37.575 48.283 15.266  1.00 9.52  ? 143  ILE A C   1 
ATOM   1332 O  O   . ILE A 1 146 ? 38.497 47.839 15.967  1.00 10.46 ? 143  ILE A O   1 
ATOM   1333 C  CB  . ILE A 1 146 ? 35.650 47.031 16.271  1.00 9.71  ? 143  ILE A CB  1 
ATOM   1334 C  CG1 . ILE A 1 146 ? 34.549 46.009 16.024  1.00 11.30 ? 143  ILE A CG1 1 
ATOM   1335 C  CG2 . ILE A 1 146 ? 35.145 48.268 17.058  1.00 11.65 ? 143  ILE A CG2 1 
ATOM   1336 C  CD1 . ILE A 1 146 ? 33.888 45.508 17.328  1.00 12.75 ? 143  ILE A CD1 1 
ATOM   1337 N  N   . GLY A 1 147 ? 37.607 49.473 14.702  1.00 9.69  ? 144  GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 147 ? 38.745 50.377 14.862  1.00 10.71 ? 144  GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 147 ? 38.468 51.680 14.211  1.00 10.18 ? 144  GLY A C   1 
ATOM   1340 O  O   . GLY A 1 147 ? 37.571 51.786 13.391  1.00 10.44 ? 144  GLY A O   1 
ATOM   1341 N  N   . ILE A 1 148 ? 39.273 52.706 14.512  1.00 10.55 ? 145  ILE A N   1 
ATOM   1342 C  CA  . ILE A 1 148 ? 39.062 54.039 13.926  1.00 10.49 ? 145  ILE A CA  1 
ATOM   1343 C  C   . ILE A 1 148 ? 40.419 54.649 13.567  1.00 12.22 ? 145  ILE A C   1 
ATOM   1344 O  O   . ILE A 1 148 ? 41.434 54.348 14.187  1.00 13.06 ? 145  ILE A O   1 
ATOM   1345 C  CB  . ILE A 1 148 ? 38.224 54.954 14.872  1.00 10.58 ? 145  ILE A CB  1 
ATOM   1346 C  CG1 . ILE A 1 148 ? 37.606 56.168 14.160  1.00 11.57 ? 145  ILE A CG1 1 
ATOM   1347 C  CG2 . ILE A 1 148 ? 39.004 55.318 16.120  1.00 12.38 ? 145  ILE A CG2 1 
ATOM   1348 C  CD1 . ILE A 1 148 ? 36.491 56.834 14.936  1.00 11.13 ? 145  ILE A CD1 1 
ATOM   1349 N  N   . GLY A 1 149 ? 40.436 55.456 12.526  1.00 11.18 ? 146  GLY A N   1 
ATOM   1350 C  CA  . GLY A 1 149 ? 41.664 56.073 12.083  1.00 11.79 ? 146  GLY A CA  1 
ATOM   1351 C  C   . GLY A 1 149 ? 42.603 55.088 11.433  1.00 11.22 ? 146  GLY A C   1 
ATOM   1352 O  O   . GLY A 1 149 ? 42.233 54.395 10.512  1.00 12.25 ? 146  GLY A O   1 
ATOM   1353 N  N   A GLY A 1 150 ? 43.805 55.081 12.011  0.60 11.46 ? 147  GLY A N   1 
ATOM   1354 N  N   B GLY A 1 150 ? 43.842 54.962 11.886  0.40 13.21 ? 147  GLY A N   1 
ATOM   1355 C  CA  A GLY A 1 150 ? 44.851 54.140 11.732  0.60 11.26 ? 147  GLY A CA  1 
ATOM   1356 C  CA  B GLY A 1 150 ? 44.786 54.071 11.189  0.40 14.51 ? 147  GLY A CA  1 
ATOM   1357 C  C   A GLY A 1 150 ? 44.416 52.690 11.811  0.60 11.07 ? 147  GLY A C   1 
ATOM   1358 C  C   B GLY A 1 150 ? 44.315 52.631 10.915  0.40 15.18 ? 147  GLY A C   1 
ATOM   1359 O  O   A GLY A 1 150 ? 44.979 51.824 11.131  0.60 11.77 ? 147  GLY A O   1 
ATOM   1360 O  O   B GLY A 1 150 ? 44.575 52.029 9.874   0.40 17.46 ? 147  GLY A O   1 
ATOM   1361 N  N   A SER A 1 151 ? 43.438 52.407 12.660  0.60 11.07 ? 148  SER A N   1 
ATOM   1362 N  N   B SER A 1 151 ? 43.601 52.044 11.843  0.40 15.16 ? 148  SER A N   1 
ATOM   1363 C  CA  A SER A 1 151 ? 42.948 51.039 12.833  0.60 10.49 ? 148  SER A CA  1 
ATOM   1364 C  CA  B SER A 1 151 ? 43.311 50.616 11.751  0.40 14.39 ? 148  SER A CA  1 
ATOM   1365 C  C   A SER A 1 151 ? 41.694 50.723 11.904  0.60 11.04 ? 148  SER A C   1 
ATOM   1366 C  C   B SER A 1 151 ? 42.020 50.410 11.036  0.40 14.32 ? 148  SER A C   1 
ATOM   1367 O  O   A SER A 1 151 ? 41.086 49.695 12.161  0.60 12.19 ? 148  SER A O   1 
ATOM   1368 O  O   B SER A 1 151 ? 41.589 49.310 10.668  0.40 13.09 ? 148  SER A O   1 
ATOM   1369 C  CB  A SER A 1 151 ? 42.685 50.809 14.339  0.60 9.83  ? 148  SER A CB  1 
ATOM   1370 C  CB  B SER A 1 151 ? 43.129 50.109 13.141  0.40 15.15 ? 148  SER A CB  1 
ATOM   1371 O  OG  A SER A 1 151 ? 43.919 50.841 15.052  0.60 12.17 ? 148  SER A OG  1 
ATOM   1372 O  OG  B SER A 1 151 ? 41.998 50.729 13.709  0.40 15.47 ? 148  SER A OG  1 
ATOM   1373 N  N   . ASP A 1 152 ? 41.394 51.514 10.817  1.00 12.67 ? 149  ASP A N   1 
ATOM   1374 C  CA  . ASP A 1 152 ? 40.238 51.426 9.933   1.00 12.39 ? 149  ASP A CA  1 
ATOM   1375 C  C   . ASP A 1 152 ? 40.579 51.777 8.495   1.00 12.81 ? 149  ASP A C   1 
ATOM   1376 O  O   . ASP A 1 152 ? 40.277 50.994 7.566   1.00 14.07 ? 149  ASP A O   1 
ATOM   1377 C  CB  . ASP A 1 152 ? 39.129 52.382 10.426  1.00 12.86 ? 149  ASP A CB  1 
ATOM   1378 C  CG  . ASP A 1 152 ? 37.942 52.524 9.482   1.00 12.73 ? 149  ASP A CG  1 
ATOM   1379 O  OD1 . ASP A 1 152 ? 37.212 51.537 9.294   1.00 13.26 ? 149  ASP A OD1 1 
ATOM   1380 O  OD2 . ASP A 1 152 ? 37.735 53.630 8.954   1.00 16.52 ? 149  ASP A OD2 1 
ATOM   1381 N  N   . LEU A 1 153 ? 41.106 52.976 8.250   1.00 12.07 ? 150  LEU A N   1 
ATOM   1382 C  CA  A LEU A 1 153 ? 41.171 53.511 6.884   0.60 11.95 ? 150  LEU A CA  1 
ATOM   1383 C  CA  B LEU A 1 153 ? 41.151 53.497 6.899   0.40 12.93 ? 150  LEU A CA  1 
ATOM   1384 C  C   . LEU A 1 153 ? 42.048 52.686 5.945   1.00 11.39 ? 150  LEU A C   1 
ATOM   1385 O  O   . LEU A 1 153 ? 41.677 52.446 4.787   1.00 11.66 ? 150  LEU A O   1 
ATOM   1386 C  CB  A LEU A 1 153 ? 41.705 54.980 6.866   0.60 12.62 ? 150  LEU A CB  1 
ATOM   1387 C  CB  B LEU A 1 153 ? 41.596 54.967 6.943   0.40 14.29 ? 150  LEU A CB  1 
ATOM   1388 C  CG  A LEU A 1 153 ? 40.888 56.105 7.501   0.60 9.45  ? 150  LEU A CG  1 
ATOM   1389 C  CG  B LEU A 1 153 ? 40.946 55.819 5.873   0.40 16.38 ? 150  LEU A CG  1 
ATOM   1390 C  CD1 A LEU A 1 153 ? 41.627 57.438 7.358   0.60 11.07 ? 150  LEU A CD1 1 
ATOM   1391 C  CD1 B LEU A 1 153 ? 39.457 55.502 5.713   0.40 19.45 ? 150  LEU A CD1 1 
ATOM   1392 C  CD2 A LEU A 1 153 ? 39.517 56.144 6.889   0.60 12.32 ? 150  LEU A CD2 1 
ATOM   1393 C  CD2 B LEU A 1 153 ? 41.181 57.274 6.213   0.40 18.60 ? 150  LEU A CD2 1 
ATOM   1394 N  N   . GLY A 1 154 ? 43.215 52.252 6.424   1.00 11.73 ? 151  GLY A N   1 
ATOM   1395 C  CA  . GLY A 1 154 ? 44.088 51.510 5.510   1.00 10.29 ? 151  GLY A CA  1 
ATOM   1396 C  C   . GLY A 1 154 ? 43.513 50.177 5.131   1.00 11.05 ? 151  GLY A C   1 
ATOM   1397 O  O   . GLY A 1 154 ? 43.409 49.865 3.947   1.00 11.47 ? 151  GLY A O   1 
ATOM   1398 N  N   . PRO A 1 155 ? 43.114 49.368 6.132   1.00 11.44 ? 152  PRO A N   1 
ATOM   1399 C  CA  . PRO A 1 155 ? 42.468 48.100 5.799   1.00 11.47 ? 152  PRO A CA  1 
ATOM   1400 C  C   . PRO A 1 155 ? 41.246 48.272 4.895   1.00 10.09 ? 152  PRO A C   1 
ATOM   1401 O  O   . PRO A 1 155 ? 41.109 47.513 3.906   1.00 11.15 ? 152  PRO A O   1 
ATOM   1402 C  CB  . PRO A 1 155 ? 42.153 47.515 7.172   1.00 13.24 ? 152  PRO A CB  1 
ATOM   1403 C  CG  . PRO A 1 155 ? 43.268 48.056 7.994   1.00 13.88 ? 152  PRO A CG  1 
ATOM   1404 C  CD  . PRO A 1 155 ? 43.451 49.443 7.562   1.00 11.54 ? 152  PRO A CD  1 
ATOM   1405 N  N   . LYS A 1 156 ? 40.364 49.198 5.219   1.00 11.05 ? 153  LYS A N   1 
ATOM   1406 C  CA  . LYS A 1 156 ? 39.148 49.422 4.422   1.00 10.92 ? 153  LYS A CA  1 
ATOM   1407 C  C   . LYS A 1 156 ? 39.501 49.791 2.978   1.00 10.25 ? 153  LYS A C   1 
ATOM   1408 O  O   . LYS A 1 156 ? 38.939 49.242 2.009   1.00 11.54 ? 153  LYS A O   1 
ATOM   1409 C  CB  . LYS A 1 156 ? 38.290 50.504 5.052   1.00 12.47 ? 153  LYS A CB  1 
ATOM   1410 C  CG  . LYS A 1 156 ? 36.976 50.781 4.359   1.00 15.16 ? 153  LYS A CG  1 
ATOM   1411 C  CD  . LYS A 1 156 ? 36.120 51.803 5.119   1.00 20.41 ? 153  LYS A CD  1 
ATOM   1412 C  CE  . LYS A 1 156 ? 36.679 53.160 4.969   1.00 25.52 ? 153  LYS A CE  1 
ATOM   1413 N  NZ  . LYS A 1 156 ? 35.595 54.278 4.927   1.00 27.77 ? 153  LYS A NZ  1 
HETATM 1414 N  N   . MSE A 1 157 ? 40.463 50.698 2.808   1.00 9.90  ? 154  MSE A N   1 
HETATM 1415 C  CA  . MSE A 1 157 ? 40.873 51.109 1.476   1.00 9.59  ? 154  MSE A CA  1 
HETATM 1416 C  C   . MSE A 1 157 ? 41.426 49.970 0.650   1.00 9.01  ? 154  MSE A C   1 
HETATM 1417 O  O   . MSE A 1 157 ? 41.153 49.847 -0.529  1.00 10.87 ? 154  MSE A O   1 
HETATM 1418 C  CB  . MSE A 1 157 ? 41.868 52.267 1.626   1.00 10.78 ? 154  MSE A CB  1 
HETATM 1419 C  CG  . MSE A 1 157 ? 42.369 52.828 0.330   1.00 12.02 ? 154  MSE A CG  1 
HETATM 1420 SE SE  . MSE A 1 157 ? 43.896 51.894 -0.471  0.70 13.60 ? 154  MSE A SE  1 
HETATM 1421 C  CE  . MSE A 1 157 ? 45.196 52.566 0.793   1.00 15.35 ? 154  MSE A CE  1 
ATOM   1422 N  N   . VAL A 1 158 ? 42.285 49.182 1.280   1.00 9.01  ? 155  VAL A N   1 
ATOM   1423 C  CA  . VAL A 1 158 ? 42.976 48.073 0.599   1.00 9.63  ? 155  VAL A CA  1 
ATOM   1424 C  C   . VAL A 1 158 ? 41.995 46.958 0.238   1.00 9.52  ? 155  VAL A C   1 
ATOM   1425 O  O   . VAL A 1 158 ? 42.061 46.394 -0.871  1.00 10.23 ? 155  VAL A O   1 
ATOM   1426 C  CB  . VAL A 1 158 ? 44.198 47.552 1.414   1.00 9.67  ? 155  VAL A CB  1 
ATOM   1427 C  CG1 . VAL A 1 158 ? 44.831 46.319 0.735   1.00 10.06 ? 155  VAL A CG1 1 
ATOM   1428 C  CG2 . VAL A 1 158 ? 45.245 48.661 1.530   1.00 11.03 ? 155  VAL A CG2 1 
ATOM   1429 N  N   . VAL A 1 159 ? 41.101 46.628 1.150   1.00 8.92  ? 156  VAL A N   1 
ATOM   1430 C  CA  . VAL A 1 159 ? 40.102 45.604 0.894   1.00 9.09  ? 156  VAL A CA  1 
ATOM   1431 C  C   . VAL A 1 159 ? 39.269 45.993 -0.345  1.00 9.34  ? 156  VAL A C   1 
ATOM   1432 O  O   . VAL A 1 159 ? 38.996 45.147 -1.210  1.00 10.93 ? 156  VAL A O   1 
ATOM   1433 C  CB  . VAL A 1 159 ? 39.265 45.272 2.144   1.00 9.93  ? 156  VAL A CB  1 
ATOM   1434 C  CG1 . VAL A 1 159 ? 37.992 44.447 1.785   1.00 11.60 ? 156  VAL A CG1 1 
ATOM   1435 C  CG2 . VAL A 1 159 ? 40.116 44.525 3.187   1.00 10.36 ? 156  VAL A CG2 1 
ATOM   1436 N  N   . ARG A 1 160 ? 38.847 47.260 -0.421  1.00 10.17 ? 157  ARG A N   1 
ATOM   1437 C  CA  . ARG A 1 160 ? 38.090 47.711 -1.603  1.00 9.48  ? 157  ARG A CA  1 
ATOM   1438 C  C   . ARG A 1 160 ? 38.961 47.706 -2.856  1.00 8.93  ? 157  ARG A C   1 
ATOM   1439 O  O   . ARG A 1 160 ? 38.510 47.251 -3.932  1.00 10.08 ? 157  ARG A O   1 
ATOM   1440 C  CB  . ARG A 1 160 ? 37.528 49.121 -1.380  1.00 10.46 ? 157  ARG A CB  1 
ATOM   1441 C  CG  . ARG A 1 160 ? 36.805 49.686 -2.617  1.00 11.28 ? 157  ARG A CG  1 
ATOM   1442 C  CD  . ARG A 1 160 ? 35.584 48.895 -2.974  1.00 11.39 ? 157  ARG A CD  1 
ATOM   1443 N  NE  . ARG A 1 160 ? 34.952 49.270 -4.236  1.00 13.14 ? 157  ARG A NE  1 
ATOM   1444 C  CZ  . ARG A 1 160 ? 35.170 48.666 -5.421  1.00 11.90 ? 157  ARG A CZ  1 
ATOM   1445 N  NH1 . ARG A 1 160 ? 36.111 47.782 -5.603  1.00 11.77 ? 157  ARG A NH1 1 
ATOM   1446 N  NH2 . ARG A 1 160 ? 34.436 49.005 -6.473  1.00 13.80 ? 157  ARG A NH2 1 
ATOM   1447 N  N   . ALA A 1 161 ? 40.198 48.202 -2.750  1.00 8.99  ? 158  ALA A N   1 
ATOM   1448 C  CA  . ALA A 1 161 ? 41.062 48.380 -3.888  1.00 9.38  ? 158  ALA A CA  1 
ATOM   1449 C  C   . ALA A 1 161 ? 41.410 47.041 -4.539  1.00 9.87  ? 158  ALA A C   1 
ATOM   1450 O  O   . ALA A 1 161 ? 41.628 46.970 -5.756  1.00 11.22 ? 158  ALA A O   1 
ATOM   1451 C  CB  . ALA A 1 161 ? 42.356 49.128 -3.485  1.00 9.96  ? 158  ALA A CB  1 
ATOM   1452 N  N   . LEU A 1 162 ? 41.432 45.973 -3.718  1.00 9.66  ? 159  LEU A N   1 
ATOM   1453 C  CA  . LEU A 1 162 ? 41.809 44.651 -4.170  1.00 9.98  ? 159  LEU A CA  1 
ATOM   1454 C  C   . LEU A 1 162 ? 40.589 43.709 -4.212  1.00 8.71  ? 159  LEU A C   1 
ATOM   1455 O  O   . LEU A 1 162 ? 40.732 42.500 -4.165  1.00 10.24 ? 159  LEU A O   1 
ATOM   1456 C  CB  . LEU A 1 162 ? 42.900 44.076 -3.250  1.00 9.65  ? 159  LEU A CB  1 
ATOM   1457 C  CG  . LEU A 1 162 ? 44.170 44.931 -3.222  1.00 9.32  ? 159  LEU A CG  1 
ATOM   1458 C  CD1 . LEU A 1 162 ? 45.206 44.352 -2.290  1.00 10.49 ? 159  LEU A CD1 1 
ATOM   1459 C  CD2 . LEU A 1 162 ? 44.748 45.104 -4.674  1.00 11.16 ? 159  LEU A CD2 1 
ATOM   1460 N  N   . GLN A 1 163 ? 39.384 44.274 -4.373  1.00 9.95  ? 160  GLN A N   1 
ATOM   1461 C  CA  . GLN A 1 163 ? 38.185 43.483 -4.477  1.00 9.70  ? 160  GLN A CA  1 
ATOM   1462 C  C   . GLN A 1 163 ? 38.235 42.328 -5.499  1.00 9.03  ? 160  GLN A C   1 
ATOM   1463 O  O   . GLN A 1 163 ? 37.738 41.232 -5.188  1.00 10.04 ? 160  GLN A O   1 
ATOM   1464 C  CB  . GLN A 1 163 ? 36.972 44.390 -4.618  1.00 10.15 ? 160  GLN A CB  1 
ATOM   1465 C  CG  . GLN A 1 163 ? 35.636 43.626 -4.416  1.00 13.67 ? 160  GLN A CG  1 
ATOM   1466 C  CD  . GLN A 1 163 ? 34.512 44.595 -4.422  1.00 16.63 ? 160  GLN A CD  1 
ATOM   1467 O  OE1 . GLN A 1 163 ? 34.272 45.372 -3.439  1.00 22.14 ? 160  GLN A OE1 1 
ATOM   1468 N  NE2 . GLN A 1 163 ? 33.817 44.633 -5.540  1.00 18.75 ? 160  GLN A NE2 1 
ATOM   1469 N  N   . PRO A 1 164 ? 38.846 42.522 -6.675  1.00 9.67  ? 161  PRO A N   1 
ATOM   1470 C  CA  . PRO A 1 164 ? 38.922 41.397 -7.622  1.00 9.45  ? 161  PRO A CA  1 
ATOM   1471 C  C   . PRO A 1 164 ? 39.673 40.175 -7.101  1.00 9.41  ? 161  PRO A C   1 
ATOM   1472 O  O   . PRO A 1 164 ? 39.486 39.082 -7.634  1.00 10.50 ? 161  PRO A O   1 
ATOM   1473 C  CB  . PRO A 1 164 ? 39.662 41.991 -8.841  1.00 10.16 ? 161  PRO A CB  1 
ATOM   1474 C  CG  . PRO A 1 164 ? 39.256 43.495 -8.763  1.00 11.01 ? 161  PRO A CG  1 
ATOM   1475 C  CD  . PRO A 1 164 ? 39.327 43.782 -7.280  1.00 9.43  ? 161  PRO A CD  1 
ATOM   1476 N  N   . TYR A 1 165 ? 40.492 40.384 -6.069  1.00 9.47  ? 162  TYR A N   1 
ATOM   1477 C  CA  . TYR A 1 165 ? 41.358 39.358 -5.458  1.00 9.30  ? 162  TYR A CA  1 
ATOM   1478 C  C   . TYR A 1 165 ? 40.731 38.713 -4.233  1.00 9.39  ? 162  TYR A C   1 
ATOM   1479 O  O   . TYR A 1 165 ? 41.369 37.864 -3.616  1.00 11.21 ? 162  TYR A O   1 
ATOM   1480 C  CB  . TYR A 1 165 ? 42.757 39.937 -5.127  1.00 9.53  ? 162  TYR A CB  1 
ATOM   1481 C  CG  . TYR A 1 165 ? 43.486 40.447 -6.355  1.00 9.04  ? 162  TYR A CG  1 
ATOM   1482 C  CD1 . TYR A 1 165 ? 44.366 39.628 -7.061  1.00 10.46 ? 162  TYR A CD1 1 
ATOM   1483 C  CD2 . TYR A 1 165 ? 43.240 41.715 -6.869  1.00 10.02 ? 162  TYR A CD2 1 
ATOM   1484 C  CE1 . TYR A 1 165 ? 45.033 40.085 -8.210  1.00 10.98 ? 162  TYR A CE1 1 
ATOM   1485 C  CE2 . TYR A 1 165 ? 43.892 42.181 -8.027  1.00 11.48 ? 162  TYR A CE2 1 
ATOM   1486 C  CZ  . TYR A 1 165 ? 44.750 41.371 -8.696  1.00 12.09 ? 162  TYR A CZ  1 
ATOM   1487 O  OH  . TYR A 1 165 ? 45.383 41.886 -9.808  1.00 12.32 ? 162  TYR A OH  1 
ATOM   1488 N  N   . HIS A 1 166 ? 39.515 39.115 -3.859  1.00 9.67  ? 163  HIS A N   1 
ATOM   1489 C  CA  . HIS A 1 166 ? 38.887 38.461 -2.713  1.00 10.22 ? 163  HIS A CA  1 
ATOM   1490 C  C   . HIS A 1 166 ? 38.715 36.960 -2.997  1.00 10.67 ? 163  HIS A C   1 
ATOM   1491 O  O   . HIS A 1 166 ? 38.277 36.562 -4.085  1.00 11.78 ? 163  HIS A O   1 
ATOM   1492 C  CB  . HIS A 1 166 ? 37.519 39.085 -2.376  1.00 10.79 ? 163  HIS A CB  1 
ATOM   1493 C  CG  . HIS A 1 166 ? 37.608 40.464 -1.793  1.00 12.21 ? 163  HIS A CG  1 
ATOM   1494 N  ND1 . HIS A 1 166 ? 36.531 41.050 -1.153  1.00 16.16 ? 163  HIS A ND1 1 
ATOM   1495 C  CD2 . HIS A 1 166 ? 38.618 41.367 -1.729  1.00 14.00 ? 163  HIS A CD2 1 
ATOM   1496 C  CE1 . HIS A 1 166 ? 36.869 42.265 -0.754  1.00 16.28 ? 163  HIS A CE1 1 
ATOM   1497 N  NE2 . HIS A 1 166 ? 38.137 42.486 -1.096  1.00 14.19 ? 163  HIS A NE2 1 
ATOM   1498 N  N   . CYS A 1 167 ? 39.059 36.120 -2.022  1.00 11.68 ? 164  CYS A N   1 
ATOM   1499 C  CA  . CYS A 1 167 ? 39.118 34.688 -2.272  1.00 11.65 ? 164  CYS A CA  1 
ATOM   1500 C  C   . CYS A 1 167 ? 38.936 33.763 -1.080  1.00 12.45 ? 164  CYS A C   1 
ATOM   1501 O  O   . CYS A 1 167 ? 39.178 32.551 -1.177  1.00 16.98 ? 164  CYS A O   1 
ATOM   1502 C  CB  . CYS A 1 167 ? 40.473 34.399 -2.894  1.00 11.55 ? 164  CYS A CB  1 
ATOM   1503 S  SG  . CYS A 1 167 ? 41.899 34.755 -1.953  1.00 13.21 ? 164  CYS A SG  1 
ATOM   1504 N  N   . THR A 1 168 ? 38.464 34.294 0.046   1.00 11.89 ? 165  THR A N   1 
ATOM   1505 C  CA  . THR A 1 168 ? 38.402 33.506 1.271   1.00 12.92 ? 165  THR A CA  1 
ATOM   1506 C  C   . THR A 1 168 ? 37.014 33.063 1.603   1.00 13.84 ? 165  THR A C   1 
ATOM   1507 O  O   . THR A 1 168 ? 36.839 32.342 2.619   1.00 15.35 ? 165  THR A O   1 
ATOM   1508 C  CB  . THR A 1 168 ? 38.862 34.334 2.457   1.00 11.94 ? 165  THR A CB  1 
ATOM   1509 O  OG1 . THR A 1 168 ? 38.018 35.515 2.503   1.00 12.05 ? 165  THR A OG1 1 
ATOM   1510 C  CG2 . THR A 1 168 ? 40.395 34.718 2.364   1.00 14.28 ? 165  THR A CG2 1 
ATOM   1511 N  N   . ASP A 1 169 ? 36.016 33.492 0.789   1.00 14.53 ? 166  ASP A N   1 
ATOM   1512 C  CA  A ASP A 1 169 ? 34.584 33.280 1.115   0.70 16.33 ? 166  ASP A CA  1 
ATOM   1513 C  CA  B ASP A 1 169 ? 34.583 33.322 1.092   0.30 15.99 ? 166  ASP A CA  1 
ATOM   1514 C  C   . ASP A 1 169 ? 34.123 33.931 2.423   1.00 15.50 ? 166  ASP A C   1 
ATOM   1515 O  O   . ASP A 1 169 ? 33.027 33.619 2.920   1.00 18.84 ? 166  ASP A O   1 
ATOM   1516 C  CB  A ASP A 1 169 ? 34.224 31.799 1.096   0.70 17.81 ? 166  ASP A CB  1 
ATOM   1517 C  CB  B ASP A 1 169 ? 34.153 31.865 0.952   0.30 16.83 ? 166  ASP A CB  1 
ATOM   1518 C  CG  A ASP A 1 169 ? 34.378 31.193 -0.286  0.70 22.58 ? 166  ASP A CG  1 
ATOM   1519 C  CG  B ASP A 1 169 ? 33.609 31.568 -0.431  0.30 20.09 ? 166  ASP A CG  1 
ATOM   1520 O  OD1 A ASP A 1 169 ? 33.964 31.843 -1.288  0.70 29.63 ? 166  ASP A OD1 1 
ATOM   1521 O  OD1 B ASP A 1 169 ? 34.243 31.991 -1.431  0.30 23.78 ? 166  ASP A OD1 1 
ATOM   1522 O  OD2 A ASP A 1 169 ? 34.892 30.075 -0.369  0.70 28.96 ? 166  ASP A OD2 1 
ATOM   1523 O  OD2 B ASP A 1 169 ? 32.552 30.927 -0.516  0.30 24.62 ? 166  ASP A OD2 1 
ATOM   1524 N  N   . LEU A 1 170 ? 34.919 34.850 2.955   1.00 13.31 ? 167  LEU A N   1 
ATOM   1525 C  CA  . LEU A 1 170 ? 34.493 35.642 4.111   1.00 12.36 ? 167  LEU A CA  1 
ATOM   1526 C  C   . LEU A 1 170 ? 34.062 37.016 3.641   1.00 13.23 ? 167  LEU A C   1 
ATOM   1527 O  O   . LEU A 1 170 ? 34.728 37.595 2.781   1.00 16.85 ? 167  LEU A O   1 
ATOM   1528 C  CB  . LEU A 1 170 ? 35.639 35.800 5.119   1.00 12.26 ? 167  LEU A CB  1 
ATOM   1529 C  CG  . LEU A 1 170 ? 36.183 34.522 5.732   1.00 12.41 ? 167  LEU A CG  1 
ATOM   1530 C  CD1 . LEU A 1 170 ? 37.432 34.840 6.473   1.00 11.99 ? 167  LEU A CD1 1 
ATOM   1531 C  CD2 . LEU A 1 170 ? 35.125 33.812 6.618   1.00 13.43 ? 167  LEU A CD2 1 
ATOM   1532 N  N   . LYS A 1 171 ? 33.038 37.572 4.258   1.00 12.07 ? 168  LYS A N   1 
ATOM   1533 C  CA  . LYS A 1 171 ? 32.694 38.975 4.041   1.00 12.52 ? 168  LYS A CA  1 
ATOM   1534 C  C   . LYS A 1 171 ? 33.279 39.773 5.194   1.00 11.72 ? 168  LYS A C   1 
ATOM   1535 O  O   . LYS A 1 171 ? 33.151 39.368 6.364   1.00 12.44 ? 168  LYS A O   1 
ATOM   1536 C  CB  . LYS A 1 171 ? 31.168 39.135 4.018   1.00 13.82 ? 168  LYS A CB  1 
ATOM   1537 C  CG  . LYS A 1 171 ? 30.501 38.475 2.793   1.00 17.91 ? 168  LYS A CG  1 
ATOM   1538 C  CD  . LYS A 1 171 ? 28.973 38.617 2.855   1.00 24.38 ? 168  LYS A CD  1 
ATOM   1539 C  CE  . LYS A 1 171 ? 28.260 37.821 1.779   1.00 28.97 ? 168  LYS A CE  1 
ATOM   1540 N  NZ  . LYS A 1 171 ? 26.972 38.501 1.364   1.00 33.14 ? 168  LYS A NZ  1 
ATOM   1541 N  N   . VAL A 1 172 ? 33.961 40.855 4.861   1.00 11.64 ? 169  VAL A N   1 
ATOM   1542 C  CA  . VAL A 1 172 ? 34.682 41.687 5.807   1.00 11.09 ? 169  VAL A CA  1 
ATOM   1543 C  C   . VAL A 1 172 ? 33.975 43.048 5.898   1.00 12.03 ? 169  VAL A C   1 
ATOM   1544 O  O   . VAL A 1 172 ? 33.702 43.691 4.872   1.00 15.24 ? 169  VAL A O   1 
ATOM   1545 C  CB  . VAL A 1 172 ? 36.172 41.891 5.412   1.00 12.69 ? 169  VAL A CB  1 
ATOM   1546 C  CG1 . VAL A 1 172 ? 36.894 42.774 6.443   1.00 14.07 ? 169  VAL A CG1 1 
ATOM   1547 C  CG2 . VAL A 1 172 ? 36.869 40.523 5.246   1.00 13.79 ? 169  VAL A CG2 1 
ATOM   1548 N  N   . HIS A 1 173 ? 33.691 43.436 7.112   1.00 10.91 ? 170  HIS A N   1 
ATOM   1549 C  CA  . HIS A 1 173 ? 32.937 44.624 7.456   1.00 11.06 ? 170  HIS A CA  1 
ATOM   1550 C  C   . HIS A 1 173 ? 33.778 45.531 8.375   1.00 10.88 ? 170  HIS A C   1 
ATOM   1551 O  O   . HIS A 1 173 ? 34.541 45.025 9.192   1.00 12.93 ? 170  HIS A O   1 
ATOM   1552 C  CB  . HIS A 1 173 ? 31.621 44.291 8.180   1.00 10.78 ? 170  HIS A CB  1 
ATOM   1553 C  CG  . HIS A 1 173 ? 30.851 43.157 7.579   1.00 11.20 ? 170  HIS A CG  1 
ATOM   1554 N  ND1 . HIS A 1 173 ? 29.745 43.356 6.819   1.00 15.96 ? 170  HIS A ND1 1 
ATOM   1555 C  CD2 . HIS A 1 173 ? 31.016 41.815 7.670   1.00 11.94 ? 170  HIS A CD2 1 
ATOM   1556 C  CE1 . HIS A 1 173 ? 29.265 42.174 6.439   1.00 16.64 ? 170  HIS A CE1 1 
ATOM   1557 N  NE2 . HIS A 1 173 ? 30.032 41.219 6.941   1.00 13.12 ? 170  HIS A NE2 1 
ATOM   1558 N  N   . PHE A 1 174 ? 33.598 46.841 8.255   1.00 10.58 ? 171  PHE A N   1 
ATOM   1559 C  CA  . PHE A 1 174 ? 34.384 47.828 8.989   1.00 10.12 ? 171  PHE A CA  1 
ATOM   1560 C  C   . PHE A 1 174 ? 33.483 48.708 9.835   1.00 10.19 ? 171  PHE A C   1 
ATOM   1561 O  O   . PHE A 1 174 ? 32.613 49.404 9.299   1.00 12.93 ? 171  PHE A O   1 
ATOM   1562 C  CB  . PHE A 1 174 ? 35.202 48.667 7.993   1.00 11.72 ? 171  PHE A CB  1 
ATOM   1563 C  CG  . PHE A 1 174 ? 36.253 47.878 7.308   1.00 11.69 ? 171  PHE A CG  1 
ATOM   1564 C  CD1 . PHE A 1 174 ? 37.460 47.658 7.939   1.00 13.62 ? 171  PHE A CD1 1 
ATOM   1565 C  CD2 . PHE A 1 174 ? 36.024 47.270 6.080   1.00 14.61 ? 171  PHE A CD2 1 
ATOM   1566 C  CE1 . PHE A 1 174 ? 38.415 46.831 7.354   1.00 15.44 ? 171  PHE A CE1 1 
ATOM   1567 C  CE2 . PHE A 1 174 ? 37.011 46.488 5.483   1.00 15.19 ? 171  PHE A CE2 1 
ATOM   1568 C  CZ  . PHE A 1 174 ? 38.174 46.268 6.152   1.00 14.36 ? 171  PHE A CZ  1 
ATOM   1569 N  N   . VAL A 1 175 ? 33.672 48.666 11.147  1.00 9.68  ? 172  VAL A N   1 
ATOM   1570 C  CA  . VAL A 1 175 ? 32.947 49.463 12.126  1.00 9.98  ? 172  VAL A CA  1 
ATOM   1571 C  C   . VAL A 1 175 ? 33.970 50.432 12.706  1.00 9.94  ? 172  VAL A C   1 
ATOM   1572 O  O   . VAL A 1 175 ? 35.068 50.000 13.082  1.00 11.52 ? 172  VAL A O   1 
ATOM   1573 C  CB  . VAL A 1 175 ? 32.340 48.577 13.213  1.00 9.49  ? 172  VAL A CB  1 
ATOM   1574 C  CG1 . VAL A 1 175 ? 31.808 49.394 14.403  1.00 9.20  ? 172  VAL A CG1 1 
ATOM   1575 C  CG2 . VAL A 1 175 ? 31.298 47.614 12.611  1.00 10.65 ? 172  VAL A CG2 1 
ATOM   1576 N  N   . SER A 1 176 ? 33.629 51.706 12.788  1.00 9.77  ? 173  SER A N   1 
ATOM   1577 C  CA  . SER A 1 176 ? 34.611 52.704 13.161  1.00 9.67  ? 173  SER A CA  1 
ATOM   1578 C  C   . SER A 1 176 ? 34.020 53.861 13.989  1.00 9.44  ? 173  SER A C   1 
ATOM   1579 O  O   . SER A 1 176 ? 34.378 54.049 15.145  1.00 10.13 ? 173  SER A O   1 
ATOM   1580 C  CB  . SER A 1 176 ? 35.280 53.240 11.898  1.00 10.52 ? 173  SER A CB  1 
ATOM   1581 O  OG  . SER A 1 176 ? 34.335 53.790 10.995  1.00 12.14 ? 173  SER A OG  1 
ATOM   1582 N  N   . ASN A 1 177 ? 33.163 54.670 13.376  1.00 9.80  ? 174  ASN A N   1 
ATOM   1583 C  CA  . ASN A 1 177 ? 32.572 55.804 14.050  1.00 8.60  ? 174  ASN A CA  1 
ATOM   1584 C  C   . ASN A 1 177 ? 31.897 55.401 15.368  1.00 8.13  ? 174  ASN A C   1 
ATOM   1585 O  O   . ASN A 1 177 ? 31.354 54.311 15.477  1.00 8.92  ? 174  ASN A O   1 
ATOM   1586 C  CB  . ASN A 1 177 ? 31.505 56.432 13.113  1.00 9.36  ? 174  ASN A CB  1 
ATOM   1587 C  CG  . ASN A 1 177 ? 31.240 57.891 13.358  1.00 8.98  ? 174  ASN A CG  1 
ATOM   1588 O  OD1 . ASN A 1 177 ? 31.369 58.396 14.485  1.00 10.00 ? 174  ASN A OD1 1 
ATOM   1589 N  ND2 . ASN A 1 177 ? 30.853 58.593 12.302  1.00 9.50  ? 174  ASN A ND2 1 
ATOM   1590 N  N   . VAL A 1 178 ? 31.933 56.262 16.376  1.00 9.04  ? 175  VAL A N   1 
ATOM   1591 C  CA  . VAL A 1 178 ? 31.099 56.037 17.542  1.00 9.27  ? 175  VAL A CA  1 
ATOM   1592 C  C   . VAL A 1 178 ? 29.610 56.162 17.204  1.00 8.63  ? 175  VAL A C   1 
ATOM   1593 O  O   . VAL A 1 178 ? 28.794 55.546 17.858  1.00 9.09  ? 175  VAL A O   1 
ATOM   1594 C  CB  . VAL A 1 178 ? 31.472 56.954 18.720  1.00 9.41  ? 175  VAL A CB  1 
ATOM   1595 C  CG1 . VAL A 1 178 ? 31.214 58.429 18.434  1.00 11.19 ? 175  VAL A CG1 1 
ATOM   1596 C  CG2 . VAL A 1 178 ? 30.847 56.478 20.012  1.00 10.83 ? 175  VAL A CG2 1 
ATOM   1597 N  N   . ASP A 1 179 ? 29.253 56.933 16.173  1.00 8.90  ? 176  ASP A N   1 
ATOM   1598 C  CA  . ASP A 1 179 ? 27.876 56.958 15.660  1.00 8.53  ? 176  ASP A CA  1 
ATOM   1599 C  C   . ASP A 1 179 ? 27.455 55.511 15.461  1.00 8.24  ? 176  ASP A C   1 
ATOM   1600 O  O   . ASP A 1 179 ? 28.045 54.810 14.640  1.00 9.41  ? 176  ASP A O   1 
ATOM   1601 C  CB  . ASP A 1 179 ? 27.853 57.686 14.304  1.00 7.84  ? 176  ASP A CB  1 
ATOM   1602 C  CG  . ASP A 1 179 ? 26.481 57.744 13.648  1.00 9.77  ? 176  ASP A CG  1 
ATOM   1603 O  OD1 . ASP A 1 179 ? 25.506 57.176 14.193  1.00 10.39 ? 176  ASP A OD1 1 
ATOM   1604 O  OD2 . ASP A 1 179 ? 26.408 58.401 12.592  1.00 11.32 ? 176  ASP A OD2 1 
ATOM   1605 N  N   . ALA A 1 180 ? 26.430 55.068 16.194  1.00 8.97  ? 177  ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 180 ? 26.048 53.661 16.195  1.00 8.83  ? 177  ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 180 ? 25.566 53.170 14.827  1.00 8.54  ? 177  ALA A C   1 
ATOM   1608 O  O   . ALA A 1 180 ? 25.436 51.957 14.603  1.00 10.59 ? 177  ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 180 ? 25.034 53.337 17.298  1.00 9.20  ? 177  ALA A CB  1 
ATOM   1610 N  N   . ASP A 1 181 ? 25.240 54.083 13.931  1.00 9.49  ? 178  ASP A N   1 
ATOM   1611 C  CA  . ASP A 1 181 ? 24.954 53.644 12.562  1.00 9.69  ? 178  ASP A CA  1 
ATOM   1612 C  C   . ASP A 1 181 ? 26.096 52.755 12.023  1.00 10.12 ? 178  ASP A C   1 
ATOM   1613 O  O   . ASP A 1 181 ? 25.821 51.823 11.293  1.00 10.92 ? 178  ASP A O   1 
ATOM   1614 C  CB  . ASP A 1 181 ? 24.741 54.862 11.653  1.00 9.99  ? 178  ASP A CB  1 
ATOM   1615 C  CG  . ASP A 1 181 ? 24.225 54.502 10.282  1.00 11.52 ? 178  ASP A CG  1 
ATOM   1616 O  OD1 . ASP A 1 181 ? 23.000 54.313 10.216  1.00 13.65 ? 178  ASP A OD1 1 
ATOM   1617 O  OD2 . ASP A 1 181 ? 25.005 54.444 9.332   1.00 12.59 ? 178  ASP A OD2 1 
ATOM   1618 N  N   . SER A 1 182 ? 27.355 53.051 12.336  1.00 9.64  ? 179  SER A N   1 
ATOM   1619 C  CA  . SER A 1 182 ? 28.475 52.241 11.855  1.00 9.41  ? 179  SER A CA  1 
ATOM   1620 C  C   . SER A 1 182 ? 28.383 50.795 12.350  1.00 9.13  ? 179  SER A C   1 
ATOM   1621 O  O   . SER A 1 182 ? 28.405 49.829 11.556  1.00 10.47 ? 179  SER A O   1 
ATOM   1622 C  CB  . SER A 1 182 ? 29.803 52.861 12.242  1.00 9.54  ? 179  SER A CB  1 
ATOM   1623 O  OG  . SER A 1 182 ? 30.882 52.172 11.637  1.00 10.44 ? 179  SER A OG  1 
ATOM   1624 N  N   . LEU A 1 183 ? 28.270 50.622 13.646  1.00 9.70  ? 180  LEU A N   1 
ATOM   1625 C  CA  . LEU A 1 183 ? 28.117 49.272 14.222  1.00 10.61 ? 180  LEU A CA  1 
ATOM   1626 C  C   . LEU A 1 183 ? 26.888 48.561 13.645  1.00 10.15 ? 180  LEU A C   1 
ATOM   1627 O  O   . LEU A 1 183 ? 26.953 47.368 13.266  1.00 10.27 ? 180  LEU A O   1 
ATOM   1628 C  CB  . LEU A 1 183 ? 28.029 49.329 15.751  1.00 11.25 ? 180  LEU A CB  1 
ATOM   1629 C  CG  . LEU A 1 183 ? 27.797 48.005 16.479  1.00 12.58 ? 180  LEU A CG  1 
ATOM   1630 C  CD1 . LEU A 1 183 ? 28.929 47.035 16.258  1.00 15.66 ? 180  LEU A CD1 1 
ATOM   1631 C  CD2 . LEU A 1 183 ? 27.571 48.306 17.989  1.00 14.95 ? 180  LEU A CD2 1 
ATOM   1632 N  N   . LEU A 1 184 ? 25.767 49.281 13.536  1.00 10.29 ? 181  LEU A N   1 
ATOM   1633 C  CA  . LEU A 1 184 ? 24.525 48.698 13.079  1.00 10.85 ? 181  LEU A CA  1 
ATOM   1634 C  C   . LEU A 1 184 ? 24.571 48.227 11.660  1.00 9.90  ? 181  LEU A C   1 
ATOM   1635 O  O   . LEU A 1 184 ? 23.924 47.234 11.328  1.00 11.41 ? 181  LEU A O   1 
ATOM   1636 C  CB  . LEU A 1 184 ? 23.349 49.650 13.313  1.00 12.02 ? 181  LEU A CB  1 
ATOM   1637 C  CG  . LEU A 1 184 ? 22.976 49.781 14.805  1.00 14.58 ? 181  LEU A CG  1 
ATOM   1638 C  CD1 . LEU A 1 184 ? 22.025 50.975 15.052  1.00 17.97 ? 181  LEU A CD1 1 
ATOM   1639 C  CD2 . LEU A 1 184 ? 22.391 48.522 15.376  1.00 18.64 ? 181  LEU A CD2 1 
ATOM   1640 N  N   . GLN A 1 185 ? 25.332 48.904 10.811  1.00 11.41 ? 182  GLN A N   1 
ATOM   1641 C  CA  . GLN A 1 185 ? 25.403 48.433 9.421   1.00 12.03 ? 182  GLN A CA  1 
ATOM   1642 C  C   . GLN A 1 185 ? 26.012 47.055 9.346   1.00 12.00 ? 182  GLN A C   1 
ATOM   1643 O  O   . GLN A 1 185 ? 25.653 46.268 8.469   1.00 14.53 ? 182  GLN A O   1 
ATOM   1644 C  CB  . GLN A 1 185 ? 26.183 49.362 8.494   1.00 13.26 ? 182  GLN A CB  1 
ATOM   1645 C  CG  . GLN A 1 185 ? 25.618 50.738 8.290   1.00 14.55 ? 182  GLN A CG  1 
ATOM   1646 C  CD  . GLN A 1 185 ? 24.154 50.711 8.039   1.00 16.25 ? 182  GLN A CD  1 
ATOM   1647 O  OE1 . GLN A 1 185 ? 23.704 50.131 7.024   1.00 19.43 ? 182  GLN A OE1 1 
ATOM   1648 N  NE2 . GLN A 1 185 ? 23.361 51.259 8.993   1.00 19.91 ? 182  GLN A NE2 1 
ATOM   1649 N  N   . ALA A 1 186 ? 26.949 46.762 10.244  1.00 10.97 ? 183  ALA A N   1 
ATOM   1650 C  CA  . ALA A 1 186 ? 27.506 45.412 10.327  1.00 11.60 ? 183  ALA A CA  1 
ATOM   1651 C  C   . ALA A 1 186 ? 26.549 44.469 11.010  1.00 11.43 ? 183  ALA A C   1 
ATOM   1652 O  O   . ALA A 1 186 ? 26.243 43.386 10.474  1.00 12.26 ? 183  ALA A O   1 
ATOM   1653 C  CB  . ALA A 1 186 ? 28.882 45.481 11.084  1.00 12.24 ? 183  ALA A CB  1 
ATOM   1654 N  N   . LEU A 1 187 ? 26.077 44.819 12.202  1.00 10.98 ? 184  LEU A N   1 
ATOM   1655 C  CA  . LEU A 1 187 ? 25.241 43.900 12.965  1.00 12.88 ? 184  LEU A CA  1 
ATOM   1656 C  C   . LEU A 1 187 ? 23.964 43.499 12.237  1.00 13.23 ? 184  LEU A C   1 
ATOM   1657 O  O   . LEU A 1 187 ? 23.476 42.374 12.392  1.00 16.21 ? 184  LEU A O   1 
ATOM   1658 C  CB  . LEU A 1 187 ? 24.922 44.442 14.378  1.00 14.03 ? 184  LEU A CB  1 
ATOM   1659 C  CG  . LEU A 1 187 ? 26.145 44.729 15.269  1.00 14.11 ? 184  LEU A CG  1 
ATOM   1660 C  CD1 . LEU A 1 187 ? 25.673 45.119 16.650  1.00 16.15 ? 184  LEU A CD1 1 
ATOM   1661 C  CD2 . LEU A 1 187 ? 27.187 43.568 15.337  1.00 15.37 ? 184  LEU A CD2 1 
ATOM   1662 N  N   . HIS A 1 188 ? 23.419 44.382 11.417  1.00 12.71 ? 185  HIS A N   1 
ATOM   1663 C  CA  . HIS A 1 188 ? 22.195 44.061 10.654  1.00 13.81 ? 185  HIS A CA  1 
ATOM   1664 C  C   . HIS A 1 188 ? 22.341 42.911 9.683   1.00 14.48 ? 185  HIS A C   1 
ATOM   1665 O  O   . HIS A 1 188 ? 21.332 42.304 9.297   1.00 17.97 ? 185  HIS A O   1 
ATOM   1666 C  CB  . HIS A 1 188 ? 21.698 45.301 9.874   1.00 14.47 ? 185  HIS A CB  1 
ATOM   1667 C  CG  . HIS A 1 188 ? 21.033 46.345 10.714  1.00 15.52 ? 185  HIS A CG  1 
ATOM   1668 N  ND1 . HIS A 1 188 ? 20.824 47.631 10.236  1.00 18.25 ? 185  HIS A ND1 1 
ATOM   1669 C  CD2 . HIS A 1 188 ? 20.556 46.328 11.979  1.00 18.75 ? 185  HIS A CD2 1 
ATOM   1670 C  CE1 . HIS A 1 188 ? 20.208 48.335 11.171  1.00 20.60 ? 185  HIS A CE1 1 
ATOM   1671 N  NE2 . HIS A 1 188 ? 20.031 47.570 12.234  1.00 18.30 ? 185  HIS A NE2 1 
ATOM   1672 N  N   . VAL A 1 189 ? 23.560 42.626 9.278   1.00 12.94 ? 186  VAL A N   1 
ATOM   1673 C  CA  . VAL A 1 189 ? 23.823 41.634 8.218   1.00 14.23 ? 186  VAL A CA  1 
ATOM   1674 C  C   . VAL A 1 189 ? 24.718 40.469 8.639   1.00 13.28 ? 186  VAL A C   1 
ATOM   1675 O  O   . VAL A 1 189 ? 25.088 39.627 7.798   1.00 15.50 ? 186  VAL A O   1 
ATOM   1676 C  CB  . VAL A 1 189 ? 24.369 42.322 6.937   1.00 14.94 ? 186  VAL A CB  1 
ATOM   1677 C  CG1 . VAL A 1 189 ? 23.362 43.268 6.347   1.00 18.38 ? 186  VAL A CG1 1 
ATOM   1678 C  CG2 . VAL A 1 189 ? 25.725 42.999 7.157   1.00 15.48 ? 186  VAL A CG2 1 
ATOM   1679 N  N   . VAL A 1 190 ? 25.042 40.390 9.935   1.00 12.36 ? 187  VAL A N   1 
ATOM   1680 C  CA  . VAL A 1 190 ? 25.866 39.273 10.455  1.00 11.56 ? 187  VAL A CA  1 
ATOM   1681 C  C   . VAL A 1 190 ? 25.152 38.520 11.555  1.00 12.15 ? 187  VAL A C   1 
ATOM   1682 O  O   . VAL A 1 190 ? 24.302 39.071 12.240  1.00 14.71 ? 187  VAL A O   1 
ATOM   1683 C  CB  . VAL A 1 190 ? 27.312 39.713 10.889  1.00 11.23 ? 187  VAL A CB  1 
ATOM   1684 C  CG1 . VAL A 1 190 ? 27.990 40.425 9.682   1.00 12.08 ? 187  VAL A CG1 1 
ATOM   1685 C  CG2 . VAL A 1 190 ? 27.292 40.592 12.140  1.00 13.04 ? 187  VAL A CG2 1 
ATOM   1686 N  N   . ASP A 1 191 ? 25.549 37.258 11.740  1.00 12.75 ? 188  ASP A N   1 
ATOM   1687 C  CA  . ASP A 1 191 ? 24.979 36.307 12.717  1.00 14.39 ? 188  ASP A CA  1 
ATOM   1688 C  C   . ASP A 1 191 ? 26.020 36.118 13.821  1.00 12.26 ? 188  ASP A C   1 
ATOM   1689 O  O   . ASP A 1 191 ? 27.158 35.827 13.510  1.00 12.74 ? 188  ASP A O   1 
ATOM   1690 C  CB  . ASP A 1 191 ? 24.753 34.975 11.944  1.00 14.53 ? 188  ASP A CB  1 
ATOM   1691 C  CG  . ASP A 1 191 ? 24.131 33.833 12.772  1.00 19.03 ? 188  ASP A CG  1 
ATOM   1692 O  OD1 . ASP A 1 191 ? 24.271 33.794 13.999  1.00 18.01 ? 188  ASP A OD1 1 
ATOM   1693 O  OD2 . ASP A 1 191 ? 23.497 32.934 12.131  1.00 26.97 ? 188  ASP A OD2 1 
ATOM   1694 N  N   . PRO A 1 192 ? 25.642 36.296 15.102  1.00 12.62 ? 189  PRO A N   1 
ATOM   1695 C  CA  . PRO A 1 192 ? 26.629 36.145 16.155  1.00 12.64 ? 189  PRO A CA  1 
ATOM   1696 C  C   . PRO A 1 192 ? 27.326 34.778 16.125  1.00 11.39 ? 189  PRO A C   1 
ATOM   1697 O  O   . PRO A 1 192 ? 28.480 34.694 16.566  1.00 12.84 ? 189  PRO A O   1 
ATOM   1698 C  CB  . PRO A 1 192 ? 25.846 36.360 17.453  1.00 14.60 ? 189  PRO A CB  1 
ATOM   1699 C  CG  . PRO A 1 192 ? 24.398 36.329 17.070  1.00 15.09 ? 189  PRO A CG  1 
ATOM   1700 C  CD  . PRO A 1 192 ? 24.306 36.648 15.617  1.00 13.00 ? 189  PRO A CD  1 
ATOM   1701 N  N   . GLU A 1 193 ? 26.639 33.713 15.667  1.00 11.05 ? 190  GLU A N   1 
ATOM   1702 C  CA  A GLU A 1 193 ? 27.249 32.395 15.700  0.60 10.73 ? 190  GLU A CA  1 
ATOM   1703 C  CA  B GLU A 1 193 ? 27.215 32.375 15.675  0.40 11.05 ? 190  GLU A CA  1 
ATOM   1704 C  C   . GLU A 1 193 ? 28.290 32.146 14.628  1.00 10.39 ? 190  GLU A C   1 
ATOM   1705 O  O   . GLU A 1 193 ? 29.072 31.199 14.755  1.00 10.50 ? 190  GLU A O   1 
ATOM   1706 C  CB  A GLU A 1 193 ? 26.172 31.298 15.667  0.60 10.84 ? 190  GLU A CB  1 
ATOM   1707 C  CB  B GLU A 1 193 ? 26.114 31.320 15.499  0.40 11.48 ? 190  GLU A CB  1 
ATOM   1708 C  CG  A GLU A 1 193 ? 25.185 31.384 16.844  0.60 10.81 ? 190  GLU A CG  1 
ATOM   1709 C  CG  B GLU A 1 193 ? 25.146 31.210 16.675  0.40 12.48 ? 190  GLU A CG  1 
ATOM   1710 C  CD  A GLU A 1 193 ? 24.275 30.155 17.001  0.60 12.53 ? 190  GLU A CD  1 
ATOM   1711 C  CD  B GLU A 1 193 ? 24.088 30.135 16.464  0.40 15.00 ? 190  GLU A CD  1 
ATOM   1712 O  OE1 A GLU A 1 193 ? 24.467 29.118 16.281  0.60 16.02 ? 190  GLU A OE1 1 
ATOM   1713 O  OE1 B GLU A 1 193 ? 24.407 28.918 16.600  0.40 16.40 ? 190  GLU A OE1 1 
ATOM   1714 O  OE2 A GLU A 1 193 ? 23.360 30.227 17.860  0.60 14.74 ? 190  GLU A OE2 1 
ATOM   1715 O  OE2 B GLU A 1 193 ? 22.935 30.516 16.155  0.40 17.15 ? 190  GLU A OE2 1 
ATOM   1716 N  N   . THR A 1 194 ? 28.342 33.014 13.618  1.00 10.16 ? 191  THR A N   1 
ATOM   1717 C  CA  . THR A 1 194 ? 29.238 32.820 12.494  1.00 10.31 ? 191  THR A CA  1 
ATOM   1718 C  C   . THR A 1 194 ? 30.132 34.028 12.196  1.00 10.13 ? 191  THR A C   1 
ATOM   1719 O  O   . THR A 1 194 ? 30.689 34.157 11.084  1.00 10.88 ? 191  THR A O   1 
ATOM   1720 C  CB  . THR A 1 194 ? 28.437 32.401 11.240  1.00 10.64 ? 191  THR A CB  1 
ATOM   1721 O  OG1 . THR A 1 194 ? 27.515 33.437 10.894  1.00 12.87 ? 191  THR A OG1 1 
ATOM   1722 C  CG2 . THR A 1 194 ? 27.705 31.058 11.450  1.00 11.66 ? 191  THR A CG2 1 
ATOM   1723 N  N   . THR A 1 195 ? 30.285 34.928 13.188  1.00 9.53  ? 192  THR A N   1 
ATOM   1724 C  CA  . THR A 1 195 ? 31.084 36.134 13.029  1.00 9.37  ? 192  THR A CA  1 
ATOM   1725 C  C   . THR A 1 195 ? 32.284 36.176 13.951  1.00 9.42  ? 192  THR A C   1 
ATOM   1726 O  O   . THR A 1 195 ? 32.191 35.780 15.100  1.00 10.17 ? 192  THR A O   1 
ATOM   1727 C  CB  . THR A 1 195 ? 30.218 37.372 13.298  1.00 10.10 ? 192  THR A CB  1 
ATOM   1728 O  OG1 . THR A 1 195 ? 29.079 37.332 12.434  1.00 11.56 ? 192  THR A OG1 1 
ATOM   1729 C  CG2 . THR A 1 195 ? 30.960 38.688 13.113  1.00 11.01 ? 192  THR A CG2 1 
ATOM   1730 N  N   . LEU A 1 196 ? 33.418 36.578 13.425  1.00 9.05  ? 193  LEU A N   1 
ATOM   1731 C  CA  . LEU A 1 196 ? 34.617 36.807 14.210  1.00 8.87  ? 193  LEU A CA  1 
ATOM   1732 C  C   . LEU A 1 196 ? 34.896 38.306 14.153  1.00 9.98  ? 193  LEU A C   1 
ATOM   1733 O  O   . LEU A 1 196 ? 34.957 38.878 13.068  1.00 9.56  ? 193  LEU A O   1 
ATOM   1734 C  CB  . LEU A 1 196 ? 35.825 36.037 13.619  1.00 10.11 ? 193  LEU A CB  1 
ATOM   1735 C  CG  . LEU A 1 196 ? 37.120 36.147 14.410  1.00 11.10 ? 193  LEU A CG  1 
ATOM   1736 C  CD1 . LEU A 1 196 ? 37.007 35.667 15.902  1.00 11.97 ? 193  LEU A CD1 1 
ATOM   1737 C  CD2 . LEU A 1 196 ? 38.255 35.365 13.653  1.00 14.42 ? 193  LEU A CD2 1 
ATOM   1738 N  N   . LEU A 1 197 ? 35.022 38.926 15.322  1.00 9.15  ? 194  LEU A N   1 
ATOM   1739 C  CA  . LEU A 1 197 ? 35.231 40.363 15.440  1.00 10.13 ? 194  LEU A CA  1 
ATOM   1740 C  C   . LEU A 1 197 ? 36.666 40.642 15.896  1.00 9.41  ? 194  LEU A C   1 
ATOM   1741 O  O   . LEU A 1 197 ? 37.195 39.889 16.706  1.00 10.20 ? 194  LEU A O   1 
ATOM   1742 C  CB  . LEU A 1 197 ? 34.253 40.956 16.446  1.00 9.95  ? 194  LEU A CB  1 
ATOM   1743 C  CG  . LEU A 1 197 ? 32.762 40.759 16.070  1.00 9.85  ? 194  LEU A CG  1 
ATOM   1744 C  CD1 . LEU A 1 197 ? 32.137 39.544 16.752  1.00 12.28 ? 194  LEU A CD1 1 
ATOM   1745 C  CD2 . LEU A 1 197 ? 31.961 42.040 16.320  1.00 13.56 ? 194  LEU A CD2 1 
ATOM   1746 N  N   . ILE A 1 198 ? 37.239 41.706 15.353  1.00 9.11  ? 195  ILE A N   1 
ATOM   1747 C  CA  . ILE A 1 198 ? 38.614 42.139 15.606  1.00 9.23  ? 195  ILE A CA  1 
ATOM   1748 C  C   . ILE A 1 198 ? 38.536 43.479 16.320  1.00 10.28 ? 195  ILE A C   1 
ATOM   1749 O  O   . ILE A 1 198 ? 37.925 44.399 15.797  1.00 11.24 ? 195  ILE A O   1 
ATOM   1750 C  CB  . ILE A 1 198 ? 39.387 42.355 14.299  1.00 9.58  ? 195  ILE A CB  1 
ATOM   1751 C  CG1 . ILE A 1 198 ? 39.480 41.081 13.479  1.00 10.28 ? 195  ILE A CG1 1 
ATOM   1752 C  CG2 . ILE A 1 198 ? 40.787 42.941 14.586  1.00 11.35 ? 195  ILE A CG2 1 
ATOM   1753 C  CD1 . ILE A 1 198 ? 39.812 41.348 11.989  1.00 13.13 ? 195  ILE A CD1 1 
ATOM   1754 N  N   . ILE A 1 199 ? 39.105 43.597 17.517  1.00 10.12 ? 196  ILE A N   1 
ATOM   1755 C  CA  . ILE A 1 199 ? 39.210 44.892 18.206  1.00 11.06 ? 196  ILE A CA  1 
ATOM   1756 C  C   . ILE A 1 199 ? 40.618 45.429 17.997  1.00 11.19 ? 196  ILE A C   1 
ATOM   1757 O  O   . ILE A 1 199 ? 41.576 44.860 18.551  1.00 11.85 ? 196  ILE A O   1 
ATOM   1758 C  CB  . ILE A 1 199 ? 38.882 44.797 19.691  1.00 10.89 ? 196  ILE A CB  1 
ATOM   1759 C  CG1 . ILE A 1 199 ? 37.493 44.188 19.943  1.00 12.94 ? 196  ILE A CG1 1 
ATOM   1760 C  CG2 . ILE A 1 199 ? 39.064 46.194 20.353  1.00 13.40 ? 196  ILE A CG2 1 
ATOM   1761 C  CD1 . ILE A 1 199 ? 37.298 43.875 21.334  1.00 15.75 ? 196  ILE A CD1 1 
ATOM   1762 N  N   . ALA A 1 200 ? 40.739 46.449 17.176  1.00 11.16 ? 197  ALA A N   1 
ATOM   1763 C  CA  . ALA A 1 200 ? 42.022 47.056 16.836  1.00 12.20 ? 197  ALA A CA  1 
ATOM   1764 C  C   . ALA A 1 200 ? 42.203 48.321 17.646  1.00 12.52 ? 197  ALA A C   1 
ATOM   1765 O  O   . ALA A 1 200 ? 41.630 49.341 17.300  1.00 13.73 ? 197  ALA A O   1 
ATOM   1766 C  CB  . ALA A 1 200 ? 42.104 47.355 15.354  1.00 13.92 ? 197  ALA A CB  1 
ATOM   1767 N  N   . SER A 1 201 ? 42.922 48.230 18.754  1.00 14.03 ? 198  SER A N   1 
ATOM   1768 C  CA  . SER A 1 201 ? 43.037 49.317 19.737  1.00 15.12 ? 198  SER A CA  1 
ATOM   1769 C  C   . SER A 1 201 ? 44.282 49.160 20.588  1.00 15.00 ? 198  SER A C   1 
ATOM   1770 O  O   . SER A 1 201 ? 44.338 48.361 21.509  1.00 14.76 ? 198  SER A O   1 
ATOM   1771 C  CB  . SER A 1 201 ? 41.802 49.392 20.630  1.00 14.82 ? 198  SER A CB  1 
ATOM   1772 O  OG  . SER A 1 201 ? 41.948 50.530 21.458  1.00 16.22 ? 198  SER A OG  1 
ATOM   1773 N  N   . LYS A 1 202 ? 45.276 50.001 20.314  1.00 16.90 ? 199  LYS A N   1 
ATOM   1774 C  CA  . LYS A 1 202 ? 46.595 49.914 20.956  1.00 18.30 ? 199  LYS A CA  1 
ATOM   1775 C  C   . LYS A 1 202 ? 46.518 49.781 22.456  1.00 16.50 ? 199  LYS A C   1 
ATOM   1776 O  O   . LYS A 1 202 ? 47.193 48.933 23.084  1.00 17.25 ? 199  LYS A O   1 
ATOM   1777 C  CB  . LYS A 1 202 ? 47.330 51.186 20.617  1.00 18.65 ? 199  LYS A CB  1 
ATOM   1778 C  CG  . LYS A 1 202 ? 48.650 51.356 21.279  1.00 22.69 ? 199  LYS A CG  1 
ATOM   1779 C  CD  . LYS A 1 202 ? 49.614 50.308 20.940  1.00 23.35 ? 199  LYS A CD  1 
ATOM   1780 C  CE  . LYS A 1 202 ? 50.904 50.514 21.753  1.00 28.02 ? 199  LYS A CE  1 
ATOM   1781 N  NZ  . LYS A 1 202 ? 51.942 49.640 21.219  1.00 29.77 ? 199  LYS A NZ  1 
ATOM   1782 N  N   . SER A 1 203 ? 45.764 50.687 23.080  1.00 17.80 ? 200  SER A N   1 
ATOM   1783 C  CA  . SER A 1 203 ? 45.661 50.731 24.525  1.00 17.62 ? 200  SER A CA  1 
ATOM   1784 C  C   . SER A 1 203 ? 44.330 50.277 25.100  1.00 17.27 ? 200  SER A C   1 
ATOM   1785 O  O   . SER A 1 203 ? 44.090 50.367 26.311  1.00 17.14 ? 200  SER A O   1 
ATOM   1786 C  CB  . SER A 1 203 ? 45.943 52.160 24.974  1.00 20.52 ? 200  SER A CB  1 
ATOM   1787 O  OG  . SER A 1 203 ? 47.326 52.425 24.707  1.00 26.16 ? 200  SER A OG  1 
ATOM   1788 N  N   . PHE A 1 204 ? 43.439 49.836 24.204  1.00 16.36 ? 201  PHE A N   1 
ATOM   1789 C  CA  A PHE A 1 204 ? 42.069 49.485 24.567  0.50 16.18 ? 201  PHE A CA  1 
ATOM   1790 C  CA  B PHE A 1 204 ? 42.066 49.504 24.582  0.50 16.88 ? 201  PHE A CA  1 
ATOM   1791 C  C   . PHE A 1 204 ? 41.389 50.690 25.229  1.00 17.69 ? 201  PHE A C   1 
ATOM   1792 O  O   . PHE A 1 204 ? 40.449 50.510 26.023  1.00 20.51 ? 201  PHE A O   1 
ATOM   1793 C  CB  A PHE A 1 204 ? 42.051 48.237 25.466  0.50 15.74 ? 201  PHE A CB  1 
ATOM   1794 C  CB  B PHE A 1 204 ? 42.003 48.275 25.497  0.50 16.93 ? 201  PHE A CB  1 
ATOM   1795 C  CG  A PHE A 1 204 ? 40.974 47.256 25.135  0.50 13.66 ? 201  PHE A CG  1 
ATOM   1796 C  CG  B PHE A 1 204 ? 41.453 47.084 24.832  0.50 17.85 ? 201  PHE A CG  1 
ATOM   1797 C  CD1 A PHE A 1 204 ? 41.166 46.306 24.115  0.50 12.86 ? 201  PHE A CD1 1 
ATOM   1798 C  CD1 B PHE A 1 204 ? 41.886 46.746 23.572  0.50 19.03 ? 201  PHE A CD1 1 
ATOM   1799 C  CD2 A PHE A 1 204 ? 39.772 47.267 25.805  0.50 14.61 ? 201  PHE A CD2 1 
ATOM   1800 C  CD2 B PHE A 1 204 ? 40.453 46.331 25.413  0.50 18.16 ? 201  PHE A CD2 1 
ATOM   1801 C  CE1 A PHE A 1 204 ? 40.190 45.409 23.791  0.50 12.58 ? 201  PHE A CE1 1 
ATOM   1802 C  CE1 B PHE A 1 204 ? 41.391 45.656 22.934  0.50 17.86 ? 201  PHE A CE1 1 
ATOM   1803 C  CE2 A PHE A 1 204 ? 38.781 46.332 25.494  0.50 12.38 ? 201  PHE A CE2 1 
ATOM   1804 C  CE2 B PHE A 1 204 ? 39.946 45.226 24.765  0.50 19.04 ? 201  PHE A CE2 1 
ATOM   1805 C  CZ  A PHE A 1 204 ? 38.989 45.407 24.489  0.50 12.87 ? 201  PHE A CZ  1 
ATOM   1806 C  CZ  B PHE A 1 204 ? 40.414 44.898 23.518  0.50 18.51 ? 201  PHE A CZ  1 
ATOM   1807 N  N   . SER A 1 205 ? 41.832 51.916 24.853  1.00 17.61 ? 202  SER A N   1 
ATOM   1808 C  CA  . SER A 1 205 ? 41.307 53.141 25.464  1.00 17.96 ? 202  SER A CA  1 
ATOM   1809 C  C   . SER A 1 205 ? 40.702 54.126 24.466  1.00 16.26 ? 202  SER A C   1 
ATOM   1810 O  O   . SER A 1 205 ? 40.067 55.072 24.881  1.00 18.82 ? 202  SER A O   1 
ATOM   1811 C  CB  . SER A 1 205 ? 42.391 53.869 26.301  1.00 18.90 ? 202  SER A CB  1 
ATOM   1812 O  OG  . SER A 1 205 ? 43.473 54.345 25.482  1.00 20.08 ? 202  SER A OG  1 
ATOM   1813 N  N   . THR A 1 206 ? 40.884 53.925 23.176  1.00 13.54 ? 203  THR A N   1 
ATOM   1814 C  CA  . THR A 1 206 ? 40.279 54.849 22.193  1.00 12.07 ? 203  THR A CA  1 
ATOM   1815 C  C   . THR A 1 206 ? 38.777 54.820 22.378  1.00 11.76 ? 203  THR A C   1 
ATOM   1816 O  O   . THR A 1 206 ? 38.156 53.748 22.369  1.00 11.19 ? 203  THR A O   1 
ATOM   1817 C  CB  . THR A 1 206 ? 40.629 54.449 20.783  1.00 13.05 ? 203  THR A CB  1 
ATOM   1818 O  OG1 . THR A 1 206 ? 42.048 54.459 20.668  1.00 16.39 ? 203  THR A OG1 1 
ATOM   1819 C  CG2 . THR A 1 206 ? 40.005 55.401 19.769  1.00 15.52 ? 203  THR A CG2 1 
ATOM   1820 N  N   . GLU A 1 207 ? 38.176 56.000 22.586  1.00 11.22 ? 204  GLU A N   1 
ATOM   1821 C  CA  . GLU A 1 207 ? 36.793 56.092 23.027  1.00 11.58 ? 204  GLU A CA  1 
ATOM   1822 C  C   . GLU A 1 207 ? 35.843 55.374 22.097  1.00 10.69 ? 204  GLU A C   1 
ATOM   1823 O  O   . GLU A 1 207 ? 34.997 54.583 22.531  1.00 11.40 ? 204  GLU A O   1 
ATOM   1824 C  CB  . GLU A 1 207 ? 36.375 57.582 23.164  1.00 13.39 ? 204  GLU A CB  1 
ATOM   1825 C  CG  . GLU A 1 207 ? 34.930 57.699 23.658  1.00 16.48 ? 204  GLU A CG  1 
ATOM   1826 C  CD  . GLU A 1 207 ? 34.274 59.059 23.509  1.00 20.34 ? 204  GLU A CD  1 
ATOM   1827 O  OE1 . GLU A 1 207 ? 34.752 59.843 22.689  1.00 22.28 ? 204  GLU A OE1 1 
ATOM   1828 O  OE2 . GLU A 1 207 ? 33.271 59.340 24.256  1.00 24.45 ? 204  GLU A OE2 1 
ATOM   1829 N  N   . GLU A 1 208 ? 35.912 55.688 20.804  1.00 10.41 ? 205  GLU A N   1 
ATOM   1830 C  CA  . GLU A 1 208 ? 34.928 55.126 19.892  1.00 10.87 ? 205  GLU A CA  1 
ATOM   1831 C  C   . GLU A 1 208 ? 35.009 53.603 19.849  1.00 10.46 ? 205  GLU A C   1 
ATOM   1832 O  O   . GLU A 1 208 ? 33.995 52.918 19.806  1.00 10.37 ? 205  GLU A O   1 
ATOM   1833 C  CB  . GLU A 1 208 ? 35.137 55.735 18.511  1.00 11.33 ? 205  GLU A CB  1 
ATOM   1834 C  CG  . GLU A 1 208 ? 35.014 57.266 18.468  1.00 11.59 ? 205  GLU A CG  1 
ATOM   1835 C  CD  . GLU A 1 208 ? 36.299 58.057 18.569  1.00 12.55 ? 205  GLU A CD  1 
ATOM   1836 O  OE1 . GLU A 1 208 ? 37.183 57.698 19.401  1.00 13.41 ? 205  GLU A OE1 1 
ATOM   1837 O  OE2 . GLU A 1 208 ? 36.368 59.082 17.863  1.00 12.33 ? 205  GLU A OE2 1 
ATOM   1838 N  N   . THR A 1 209 ? 36.235 53.097 19.808  1.00 10.87 ? 206  THR A N   1 
ATOM   1839 C  CA  . THR A 1 209 ? 36.495 51.686 19.711  1.00 9.63  ? 206  THR A CA  1 
ATOM   1840 C  C   . THR A 1 209 ? 36.059 50.982 20.979  1.00 10.33 ? 206  THR A C   1 
ATOM   1841 O  O   . THR A 1 209 ? 35.533 49.865 20.927  1.00 10.72 ? 206  THR A O   1 
ATOM   1842 C  CB  . THR A 1 209 ? 37.934 51.447 19.298  1.00 10.21 ? 206  THR A CB  1 
ATOM   1843 O  OG1 . THR A 1 209 ? 38.166 52.150 18.072  1.00 11.84 ? 206  THR A OG1 1 
ATOM   1844 C  CG2 . THR A 1 209 ? 38.225 49.922 19.137  1.00 11.69 ? 206  THR A CG2 1 
ATOM   1845 N  N   . LEU A 1 210 ? 36.237 51.632 22.121  1.00 10.28 ? 207  LEU A N   1 
ATOM   1846 C  CA  . LEU A 1 210 ? 35.812 51.057 23.389  1.00 10.69 ? 207  LEU A CA  1 
ATOM   1847 C  C   . LEU A 1 210 ? 34.282 50.920 23.391  1.00 9.90  ? 207  LEU A C   1 
ATOM   1848 O  O   . LEU A 1 210 ? 33.725 49.819 23.702  1.00 10.27 ? 207  LEU A O   1 
ATOM   1849 C  CB  . LEU A 1 210 ? 36.336 51.926 24.580  1.00 11.36 ? 207  LEU A CB  1 
ATOM   1850 C  CG  . LEU A 1 210 ? 35.953 51.456 25.974  1.00 16.65 ? 207  LEU A CG  1 
ATOM   1851 C  CD1 . LEU A 1 210 ? 36.510 50.038 26.254  1.00 20.84 ? 207  LEU A CD1 1 
ATOM   1852 C  CD2 . LEU A 1 210 ? 36.516 52.475 27.029  1.00 21.17 ? 207  LEU A CD2 1 
ATOM   1853 N  N   . LEU A 1 211 ? 33.543 51.981 23.042  1.00 9.45  ? 208  LEU A N   1 
ATOM   1854 C  CA  . LEU A 1 211 ? 32.076 51.901 23.030  1.00 9.59  ? 208  LEU A CA  1 
ATOM   1855 C  C   . LEU A 1 211 ? 31.573 50.862 22.006  1.00 8.48  ? 208  LEU A C   1 
ATOM   1856 O  O   . LEU A 1 211 ? 30.677 50.073 22.287  1.00 9.53  ? 208  LEU A O   1 
ATOM   1857 C  CB  . LEU A 1 211 ? 31.433 53.256 22.757  1.00 10.19 ? 208  LEU A CB  1 
ATOM   1858 C  CG  . LEU A 1 211 ? 31.058 54.128 23.940  1.00 14.22 ? 208  LEU A CG  1 
ATOM   1859 C  CD1 . LEU A 1 211 ? 32.283 54.439 24.778  1.00 18.32 ? 208  LEU A CD1 1 
ATOM   1860 C  CD2 . LEU A 1 211 ? 30.324 55.382 23.516  1.00 16.61 ? 208  LEU A CD2 1 
ATOM   1861 N  N   . ASN A 1 212 ? 32.183 50.830 20.833  1.00 9.23  ? 209  ASN A N   1 
ATOM   1862 C  CA  . ASN A 1 212 ? 31.818 49.865 19.800  1.00 9.24  ? 209  ASN A CA  1 
ATOM   1863 C  C   . ASN A 1 212 ? 32.098 48.434 20.273  1.00 9.18  ? 209  ASN A C   1 
ATOM   1864 O  O   . ASN A 1 212 ? 31.283 47.546 20.052  1.00 9.00  ? 209  ASN A O   1 
ATOM   1865 C  CB  . ASN A 1 212 ? 32.538 50.168 18.473  1.00 9.57  ? 209  ASN A CB  1 
ATOM   1866 C  CG  . ASN A 1 212 ? 31.894 51.297 17.711  1.00 8.85  ? 209  ASN A CG  1 
ATOM   1867 O  OD1 . ASN A 1 212 ? 30.662 51.485 17.804  1.00 10.75 ? 209  ASN A OD1 1 
ATOM   1868 N  ND2 . ASN A 1 212 ? 32.693 52.012 16.907  1.00 9.39  ? 209  ASN A ND2 1 
ATOM   1869 N  N   . SER A 1 213 ? 33.226 48.218 20.914  1.00 9.15  ? 210  SER A N   1 
ATOM   1870 C  CA  A SER A 1 213 ? 33.627 46.901 21.391  0.60 9.35  ? 210  SER A CA  1 
ATOM   1871 C  CA  B SER A 1 213 ? 33.556 46.864 21.303  0.40 9.14  ? 210  SER A CA  1 
ATOM   1872 C  C   . SER A 1 213 ? 32.630 46.400 22.442  1.00 9.37  ? 210  SER A C   1 
ATOM   1873 O  O   . SER A 1 213 ? 32.214 45.230 22.440  1.00 9.89  ? 210  SER A O   1 
ATOM   1874 C  CB  A SER A 1 213 ? 35.019 46.967 22.057  0.60 9.74  ? 210  SER A CB  1 
ATOM   1875 C  CB  B SER A 1 213 ? 35.033 46.715 21.670  0.40 9.47  ? 210  SER A CB  1 
ATOM   1876 O  OG  A SER A 1 213 ? 36.062 47.292 21.129  0.60 13.47 ? 210  SER A OG  1 
ATOM   1877 O  OG  B SER A 1 213 ? 35.351 47.450 22.834  0.40 11.10 ? 210  SER A OG  1 
ATOM   1878 N  N   . ILE A 1 214 ? 32.316 47.277 23.401  1.00 10.03 ? 211  ILE A N   1 
ATOM   1879 C  CA  . ILE A 1 214 ? 31.383 46.908 24.472  1.00 10.10 ? 211  ILE A CA  1 
ATOM   1880 C  C   . ILE A 1 214 ? 29.993 46.612 23.880  1.00 9.67  ? 211  ILE A C   1 
ATOM   1881 O  O   . ILE A 1 214 ? 29.316 45.668 24.280  1.00 10.16 ? 211  ILE A O   1 
ATOM   1882 C  CB  . ILE A 1 214 ? 31.354 47.986 25.533  1.00 9.90  ? 211  ILE A CB  1 
ATOM   1883 C  CG1 . ILE A 1 214 ? 32.678 48.034 26.269  1.00 12.51 ? 211  ILE A CG1 1 
ATOM   1884 C  CG2 . ILE A 1 214 ? 30.169 47.833 26.541  1.00 12.51 ? 211  ILE A CG2 1 
ATOM   1885 C  CD1 . ILE A 1 214 ? 32.850 49.288 27.136  1.00 16.72 ? 211  ILE A CD1 1 
ATOM   1886 N  N   . SER A 1 215 ? 29.539 47.435 22.938  1.00 9.25  ? 212  SER A N   1 
ATOM   1887 C  CA  . SER A 1 215 ? 28.245 47.210 22.361  1.00 8.90  ? 212  SER A CA  1 
ATOM   1888 C  C   . SER A 1 215 ? 28.225 45.915 21.524  1.00 9.36  ? 212  SER A C   1 
ATOM   1889 O  O   . SER A 1 215 ? 27.218 45.178 21.564  1.00 10.35 ? 212  SER A O   1 
ATOM   1890 C  CB  . SER A 1 215 ? 27.812 48.427 21.522  1.00 9.48  ? 212  SER A CB  1 
ATOM   1891 O  OG  . SER A 1 215 ? 27.565 49.538 22.321  1.00 9.69  ? 212  SER A OG  1 
ATOM   1892 N  N   . ALA A 1 216 ? 29.325 45.605 20.840  1.00 9.45  ? 213  ALA A N   1 
ATOM   1893 C  CA  . ALA A 1 216 ? 29.431 44.340 20.097  1.00 8.37  ? 213  ALA A CA  1 
ATOM   1894 C  C   . ALA A 1 216 ? 29.395 43.153 21.058  1.00 8.49  ? 213  ALA A C   1 
ATOM   1895 O  O   . ALA A 1 216 ? 28.763 42.131 20.795  1.00 9.25  ? 213  ALA A O   1 
ATOM   1896 C  CB  . ALA A 1 216 ? 30.679 44.333 19.229  1.00 9.49  ? 213  ALA A CB  1 
ATOM   1897 N  N   . ARG A 1 217 ? 30.093 43.288 22.178  1.00 9.72  ? 214  ARG A N   1 
ATOM   1898 C  CA  . ARG A 1 217 ? 30.129 42.226 23.168  1.00 9.27  ? 214  ARG A CA  1 
ATOM   1899 C  C   . ARG A 1 217 ? 28.710 41.998 23.715  1.00 10.16 ? 214  ARG A C   1 
ATOM   1900 O  O   . ARG A 1 217 ? 28.296 40.859 23.925  1.00 10.11 ? 214  ARG A O   1 
ATOM   1901 C  CB  . ARG A 1 217 ? 31.145 42.532 24.280  1.00 9.84  ? 214  ARG A CB  1 
ATOM   1902 C  CG  . ARG A 1 217 ? 31.445 41.376 25.249  1.00 10.53 ? 214  ARG A CG  1 
ATOM   1903 C  CD  . ARG A 1 217 ? 32.290 41.929 26.389  1.00 12.24 ? 214  ARG A CD  1 
ATOM   1904 N  NE  . ARG A 1 217 ? 32.874 40.908 27.222  1.00 14.90 ? 214  ARG A NE  1 
ATOM   1905 C  CZ  . ARG A 1 217 ? 32.290 40.339 28.281  1.00 18.63 ? 214  ARG A CZ  1 
ATOM   1906 N  NH1 . ARG A 1 217 ? 31.040 40.648 28.639  1.00 20.62 ? 214  ARG A NH1 1 
ATOM   1907 N  NH2 . ARG A 1 217 ? 32.970 39.425 28.980  1.00 19.27 ? 214  ARG A NH2 1 
ATOM   1908 N  N   . GLU A 1 218 ? 27.978 43.086 23.974  1.00 9.95  ? 215  GLU A N   1 
ATOM   1909 C  CA  A GLU A 1 218 ? 26.614 42.971 24.498  0.70 10.78 ? 215  GLU A CA  1 
ATOM   1910 C  CA  B GLU A 1 218 ? 26.608 43.000 24.496  0.30 10.48 ? 215  GLU A CA  1 
ATOM   1911 C  C   . GLU A 1 218 ? 25.708 42.267 23.485  1.00 10.63 ? 215  GLU A C   1 
ATOM   1912 O  O   . GLU A 1 218 ? 24.890 41.432 23.854  1.00 11.10 ? 215  GLU A O   1 
ATOM   1913 C  CB  A GLU A 1 218 ? 26.102 44.362 24.895  0.70 12.33 ? 215  GLU A CB  1 
ATOM   1914 C  CB  B GLU A 1 218 ? 26.060 44.407 24.854  0.30 11.18 ? 215  GLU A CB  1 
ATOM   1915 C  CG  A GLU A 1 218 ? 26.722 44.829 26.175  0.70 14.68 ? 215  GLU A CG  1 
ATOM   1916 C  CG  B GLU A 1 218 ? 24.696 44.354 25.562  0.30 11.95 ? 215  GLU A CG  1 
ATOM   1917 C  CD  A GLU A 1 218 ? 26.428 46.287 26.526  0.70 17.83 ? 215  GLU A CD  1 
ATOM   1918 C  CD  B GLU A 1 218 ? 24.140 45.702 26.081  0.30 14.86 ? 215  GLU A CD  1 
ATOM   1919 O  OE1 A GLU A 1 218 ? 25.820 47.020 25.692  0.70 23.52 ? 215  GLU A OE1 1 
ATOM   1920 O  OE1 B GLU A 1 218 ? 24.897 46.547 26.586  0.30 16.60 ? 215  GLU A OE1 1 
ATOM   1921 O  OE2 A GLU A 1 218 ? 26.869 46.714 27.635  0.70 20.37 ? 215  GLU A OE2 1 
ATOM   1922 O  OE2 B GLU A 1 218 ? 22.900 45.877 26.040  0.30 18.62 ? 215  GLU A OE2 1 
ATOM   1923 N  N   . TRP A 1 219 ? 25.864 42.570 22.197  1.00 9.94  ? 216  TRP A N   1 
ATOM   1924 C  CA  . TRP A 1 219 ? 25.118 41.900 21.141  1.00 9.54  ? 216  TRP A CA  1 
ATOM   1925 C  C   . TRP A 1 219 ? 25.392 40.400 21.137  1.00 9.76  ? 216  TRP A C   1 
ATOM   1926 O  O   . TRP A 1 219 ? 24.480 39.583 21.037  1.00 11.18 ? 216  TRP A O   1 
ATOM   1927 C  CB  . TRP A 1 219 ? 25.471 42.531 19.793  1.00 9.85  ? 216  TRP A CB  1 
ATOM   1928 C  CG  . TRP A 1 219 ? 25.100 41.826 18.548  1.00 9.73  ? 216  TRP A CG  1 
ATOM   1929 C  CD1 . TRP A 1 219 ? 23.911 41.861 17.889  1.00 11.50 ? 216  TRP A CD1 1 
ATOM   1930 C  CD2 . TRP A 1 219 ? 25.970 41.048 17.742  1.00 10.28 ? 216  TRP A CD2 1 
ATOM   1931 N  NE1 . TRP A 1 219 ? 23.970 41.139 16.744  1.00 12.54 ? 216  TRP A NE1 1 
ATOM   1932 C  CE2 . TRP A 1 219 ? 25.235 40.628 16.607  1.00 11.81 ? 216  TRP A CE2 1 
ATOM   1933 C  CE3 . TRP A 1 219 ? 27.309 40.689 17.846  1.00 11.66 ? 216  TRP A CE3 1 
ATOM   1934 C  CZ2 . TRP A 1 219 ? 25.809 39.886 15.560  1.00 12.28 ? 216  TRP A CZ2 1 
ATOM   1935 C  CZ3 . TRP A 1 219 ? 27.883 39.937 16.790  1.00 12.08 ? 216  TRP A CZ3 1 
ATOM   1936 C  CH2 . TRP A 1 219 ? 27.118 39.522 15.686  1.00 12.07 ? 216  TRP A CH2 1 
ATOM   1937 N  N   . LEU A 1 220 ? 26.671 40.048 21.233  1.00 9.47  ? 217  LEU A N   1 
ATOM   1938 C  CA  . LEU A 1 220 ? 27.081 38.639 21.195  1.00 9.45  ? 217  LEU A CA  1 
ATOM   1939 C  C   . LEU A 1 220 ? 26.492 37.902 22.382  1.00 9.94  ? 217  LEU A C   1 
ATOM   1940 O  O   . LEU A 1 220 ? 25.958 36.788 22.236  1.00 10.66 ? 217  LEU A O   1 
ATOM   1941 C  CB  . LEU A 1 220 ? 28.615 38.490 21.174  1.00 9.43  ? 217  LEU A CB  1 
ATOM   1942 C  CG  . LEU A 1 220 ? 29.109 37.060 20.793  1.00 12.63 ? 217  LEU A CG  1 
ATOM   1943 C  CD1 . LEU A 1 220 ? 29.274 36.920 19.322  1.00 15.18 ? 217  LEU A CD1 1 
ATOM   1944 C  CD2 . LEU A 1 220 ? 30.336 36.581 21.573  1.00 13.21 ? 217  LEU A CD2 1 
ATOM   1945 N  N   . LEU A 1 221 ? 26.593 38.514 23.545  1.00 11.12 ? 218  LEU A N   1 
ATOM   1946 C  CA  . LEU A 1 221 ? 26.124 37.895 24.788  1.00 11.84 ? 218  LEU A CA  1 
ATOM   1947 C  C   . LEU A 1 221 ? 24.610 37.910 24.928  1.00 12.76 ? 218  LEU A C   1 
ATOM   1948 O  O   . LEU A 1 221 ? 24.055 37.050 25.609  1.00 12.52 ? 218  LEU A O   1 
ATOM   1949 C  CB  . LEU A 1 221 ? 26.825 38.505 26.019  1.00 11.52 ? 218  LEU A CB  1 
ATOM   1950 C  CG  . LEU A 1 221 ? 28.356 38.155 25.919  1.00 15.24 ? 218  LEU A CG  1 
ATOM   1951 C  CD1 . LEU A 1 221 ? 29.068 38.580 27.163  1.00 17.80 ? 218  LEU A CD1 1 
ATOM   1952 C  CD2 . LEU A 1 221 ? 28.638 36.663 25.565  1.00 17.29 ? 218  LEU A CD2 1 
ATOM   1953 N  N   . ASP A 1 222 ? 23.921 38.885 24.326  1.00 11.94 ? 219  ASP A N   1 
ATOM   1954 C  CA  A ASP A 1 222 ? 22.471 38.812 24.277  0.70 12.55 ? 219  ASP A CA  1 
ATOM   1955 C  CA  B ASP A 1 222 ? 22.452 38.828 24.231  0.30 12.88 ? 219  ASP A CA  1 
ATOM   1956 C  C   . ASP A 1 222 ? 22.039 37.519 23.545  1.00 12.59 ? 219  ASP A C   1 
ATOM   1957 O  O   . ASP A 1 222 ? 21.049 36.896 23.887  1.00 13.81 ? 219  ASP A O   1 
ATOM   1958 C  CB  A ASP A 1 222 ? 21.888 40.034 23.597  0.70 13.61 ? 219  ASP A CB  1 
ATOM   1959 C  CB  B ASP A 1 222 ? 21.883 40.032 23.459  0.30 13.78 ? 219  ASP A CB  1 
ATOM   1960 C  CG  A ASP A 1 222 ? 20.447 39.866 23.319  0.70 13.85 ? 219  ASP A CG  1 
ATOM   1961 C  CG  B ASP A 1 222 ? 21.743 41.270 24.324  0.30 15.78 ? 219  ASP A CG  1 
ATOM   1962 O  OD1 A ASP A 1 222 ? 19.697 39.935 24.303  0.70 17.40 ? 219  ASP A OD1 1 
ATOM   1963 O  OD1 B ASP A 1 222 ? 22.003 41.158 25.541  0.30 18.48 ? 219  ASP A OD1 1 
ATOM   1964 O  OD2 A ASP A 1 222 ? 20.109 39.600 22.135  0.70 17.52 ? 219  ASP A OD2 1 
ATOM   1965 O  OD2 B ASP A 1 222 ? 21.382 42.347 23.782  0.30 19.16 ? 219  ASP A OD2 1 
ATOM   1966 N  N   . HIS A 1 223 ? 22.792 37.104 22.544  1.00 11.71 ? 220  HIS A N   1 
ATOM   1967 C  CA  . HIS A 1 223 ? 22.474 35.878 21.868  1.00 11.53 ? 220  HIS A CA  1 
ATOM   1968 C  C   . HIS A 1 223 ? 22.826 34.643 22.692  1.00 11.18 ? 220  HIS A C   1 
ATOM   1969 O  O   . HIS A 1 223 ? 22.021 33.746 22.873  1.00 11.90 ? 220  HIS A O   1 
ATOM   1970 C  CB  . HIS A 1 223 ? 23.176 35.807 20.516  1.00 12.94 ? 220  HIS A CB  1 
ATOM   1971 C  CG  . HIS A 1 223 ? 22.910 34.539 19.791  1.00 14.26 ? 220  HIS A CG  1 
ATOM   1972 N  ND1 . HIS A 1 223 ? 21.701 34.260 19.185  1.00 18.97 ? 220  HIS A ND1 1 
ATOM   1973 C  CD2 . HIS A 1 223 ? 23.683 33.443 19.614  1.00 15.85 ? 220  HIS A CD2 1 
ATOM   1974 C  CE1 . HIS A 1 223 ? 21.747 33.047 18.661  1.00 20.15 ? 220  HIS A CE1 1 
ATOM   1975 N  NE2 . HIS A 1 223 ? 22.943 32.534 18.897  1.00 20.10 ? 220  HIS A NE2 1 
ATOM   1976 N  N   . TYR A 1 224 ? 24.073 34.564 23.121  1.00 10.19 ? 221  TYR A N   1 
ATOM   1977 C  CA  . TYR A 1 224 ? 24.594 33.339 23.737  1.00 9.87  ? 221  TYR A CA  1 
ATOM   1978 C  C   . TYR A 1 224 ? 24.296 33.211 25.225  1.00 11.23 ? 221  TYR A C   1 
ATOM   1979 O  O   . TYR A 1 224 ? 24.232 32.086 25.752  1.00 11.89 ? 221  TYR A O   1 
ATOM   1980 C  CB  . TYR A 1 224 ? 26.091 33.245 23.520  1.00 11.22 ? 221  TYR A CB  1 
ATOM   1981 C  CG  . TYR A 1 224 ? 26.589 32.752 22.181  1.00 10.92 ? 221  TYR A CG  1 
ATOM   1982 C  CD1 . TYR A 1 224 ? 26.389 31.453 21.791  1.00 11.60 ? 221  TYR A CD1 1 
ATOM   1983 C  CD2 . TYR A 1 224 ? 27.322 33.564 21.339  1.00 11.75 ? 221  TYR A CD2 1 
ATOM   1984 C  CE1 . TYR A 1 224 ? 26.872 30.959 20.605  1.00 12.20 ? 221  TYR A CE1 1 
ATOM   1985 C  CE2 . TYR A 1 224 ? 27.843 33.063 20.158  1.00 11.77 ? 221  TYR A CE2 1 
ATOM   1986 C  CZ  . TYR A 1 224 ? 27.645 31.752 19.818  1.00 10.76 ? 221  TYR A CZ  1 
ATOM   1987 O  OH  . TYR A 1 224 ? 28.217 31.238 18.700  1.00 11.66 ? 221  TYR A OH  1 
ATOM   1988 N  N   . GLU A 1 225 ? 24.200 34.328 25.933  1.00 10.96 ? 222  GLU A N   1 
ATOM   1989 C  CA  . GLU A 1 225 ? 23.923 34.312 27.390  1.00 11.31 ? 222  GLU A CA  1 
ATOM   1990 C  C   . GLU A 1 225 ? 24.958 33.518 28.170  1.00 11.06 ? 222  GLU A C   1 
ATOM   1991 O  O   . GLU A 1 225 ? 24.633 32.870 29.173  1.00 13.05 ? 222  GLU A O   1 
ATOM   1992 C  CB  . GLU A 1 225 ? 22.487 33.806 27.651  1.00 11.84 ? 222  GLU A CB  1 
ATOM   1993 C  CG  . GLU A 1 225 ? 21.447 34.580 26.899  1.00 13.68 ? 222  GLU A CG  1 
ATOM   1994 C  CD  . GLU A 1 225 ? 20.019 34.078 27.101  1.00 15.35 ? 222  GLU A CD  1 
ATOM   1995 O  OE1 . GLU A 1 225 ? 19.826 32.979 27.630  1.00 17.64 ? 222  GLU A OE1 1 
ATOM   1996 O  OE2 . GLU A 1 225 ? 19.067 34.763 26.711  1.00 18.13 ? 222  GLU A OE2 1 
ATOM   1997 N  N   . ASP A 1 226 ? 26.192 33.536 27.687  1.00 12.56 ? 223  ASP A N   1 
ATOM   1998 C  CA  . ASP A 1 226 ? 27.306 32.785 28.271  1.00 13.51 ? 223  ASP A CA  1 
ATOM   1999 C  C   . ASP A 1 226 ? 28.571 33.558 27.934  1.00 14.20 ? 223  ASP A C   1 
ATOM   2000 O  O   . ASP A 1 226 ? 28.952 33.665 26.745  1.00 13.15 ? 223  ASP A O   1 
ATOM   2001 C  CB  . ASP A 1 226 ? 27.344 31.365 27.692  1.00 14.03 ? 223  ASP A CB  1 
ATOM   2002 C  CG  . ASP A 1 226 ? 28.323 30.446 28.421  1.00 15.33 ? 223  ASP A CG  1 
ATOM   2003 O  OD1 . ASP A 1 226 ? 29.301 30.981 29.011  1.00 15.60 ? 223  ASP A OD1 1 
ATOM   2004 O  OD2 . ASP A 1 226 ? 28.108 29.191 28.376  1.00 16.90 ? 223  ASP A OD2 1 
ATOM   2005 N  N   . GLU A 1 227 ? 29.208 34.114 28.981  1.00 15.50 ? 224  GLU A N   1 
ATOM   2006 C  CA  A GLU A 1 227 ? 30.458 34.894 28.904  0.60 17.06 ? 224  GLU A CA  1 
ATOM   2007 C  CA  B GLU A 1 227 ? 30.380 34.973 28.743  0.40 16.30 ? 224  GLU A CA  1 
ATOM   2008 C  C   . GLU A 1 227 ? 31.552 34.173 28.161  1.00 15.81 ? 224  GLU A C   1 
ATOM   2009 O  O   . GLU A 1 227 ? 32.444 34.799 27.580  1.00 15.38 ? 224  GLU A O   1 
ATOM   2010 C  CB  A GLU A 1 227 ? 30.979 35.120 30.348  0.60 18.28 ? 224  GLU A CB  1 
ATOM   2011 C  CB  B GLU A 1 227 ? 30.823 35.752 30.012  0.40 17.24 ? 224  GLU A CB  1 
ATOM   2012 C  CG  A GLU A 1 227 ? 30.147 36.112 31.168  0.60 22.25 ? 224  GLU A CG  1 
ATOM   2013 C  CG  B GLU A 1 227 ? 29.733 36.595 30.722  0.40 20.09 ? 224  GLU A CG  1 
ATOM   2014 C  CD  A GLU A 1 227 ? 30.564 37.580 30.948  0.60 26.15 ? 224  GLU A CD  1 
ATOM   2015 C  CD  B GLU A 1 227 ? 30.145 37.103 32.133  0.40 23.00 ? 224  GLU A CD  1 
ATOM   2016 O  OE1 A GLU A 1 227 ? 31.764 37.904 31.160  0.60 27.73 ? 224  GLU A OE1 1 
ATOM   2017 O  OE1 B GLU A 1 227 ? 31.238 36.734 32.647  0.40 22.79 ? 224  GLU A OE1 1 
ATOM   2018 O  OE2 A GLU A 1 227 ? 29.687 38.406 30.579  0.60 30.99 ? 224  GLU A OE2 1 
ATOM   2019 O  OE2 B GLU A 1 227 ? 29.353 37.875 32.729  0.40 26.95 ? 224  GLU A OE2 1 
ATOM   2020 N  N   . LYS A 1 228 ? 31.541 32.830 28.252  1.00 14.70 ? 225  LYS A N   1 
ATOM   2021 C  CA  A LYS A 1 228 ? 32.598 32.010 27.610  0.60 15.17 ? 225  LYS A CA  1 
ATOM   2022 C  CA  B LYS A 1 228 ? 32.610 32.020 27.623  0.40 14.88 ? 225  LYS A CA  1 
ATOM   2023 C  C   . LYS A 1 228 ? 32.587 32.105 26.091  1.00 13.69 ? 225  LYS A C   1 
ATOM   2024 O  O   . LYS A 1 228 ? 33.594 31.789 25.422  1.00 13.47 ? 225  LYS A O   1 
ATOM   2025 C  CB  A LYS A 1 228 ? 32.528 30.543 28.028  0.60 16.11 ? 225  LYS A CB  1 
ATOM   2026 C  CB  B LYS A 1 228 ? 32.569 30.552 28.061  0.40 15.48 ? 225  LYS A CB  1 
ATOM   2027 C  CG  A LYS A 1 228 ? 32.627 30.314 29.521  0.60 19.25 ? 225  LYS A CG  1 
ATOM   2028 C  CG  B LYS A 1 228 ? 33.088 30.250 29.472  0.40 17.69 ? 225  LYS A CG  1 
ATOM   2029 C  CD  A LYS A 1 228 ? 32.409 28.835 29.888  0.60 23.41 ? 225  LYS A CD  1 
ATOM   2030 C  CD  B LYS A 1 228 ? 33.051 28.736 29.706  0.40 20.35 ? 225  LYS A CD  1 
ATOM   2031 C  CE  A LYS A 1 228 ? 32.517 28.604 31.392  0.60 25.65 ? 225  LYS A CE  1 
ATOM   2032 C  CE  B LYS A 1 228 ? 33.720 28.308 31.009  0.40 21.16 ? 225  LYS A CE  1 
ATOM   2033 N  NZ  A LYS A 1 228 ? 33.444 29.592 32.039  0.60 28.32 ? 225  LYS A NZ  1 
ATOM   2034 N  NZ  B LYS A 1 228 ? 33.420 26.881 31.384  0.40 22.55 ? 225  LYS A NZ  1 
ATOM   2035 N  N   . ALA A 1 229 ? 31.482 32.580 25.509  1.00 12.41 ? 226  ALA A N   1 
ATOM   2036 C  CA  . ALA A 1 229 ? 31.403 32.695 24.052  1.00 11.45 ? 226  ALA A CA  1 
ATOM   2037 C  C   . ALA A 1 229 ? 32.335 33.753 23.472  1.00 10.94 ? 226  ALA A C   1 
ATOM   2038 O  O   . ALA A 1 229 ? 32.676 33.694 22.296  1.00 10.58 ? 226  ALA A O   1 
ATOM   2039 C  CB  . ALA A 1 229 ? 29.947 32.970 23.610  1.00 10.84 ? 226  ALA A CB  1 
ATOM   2040 N  N   . VAL A 1 230 ? 32.766 34.717 24.284  1.00 11.08 ? 227  VAL A N   1 
ATOM   2041 C  CA  . VAL A 1 230 ? 33.617 35.800 23.751  1.00 11.32 ? 227  VAL A CA  1 
ATOM   2042 C  C   . VAL A 1 230 ? 34.857 35.215 23.104  1.00 10.43 ? 227  VAL A C   1 
ATOM   2043 O  O   . VAL A 1 230 ? 35.312 35.721 22.073  1.00 11.66 ? 227  VAL A O   1 
ATOM   2044 C  CB  . VAL A 1 230 ? 33.953 36.865 24.858  1.00 11.42 ? 227  VAL A CB  1 
ATOM   2045 C  CG1 . VAL A 1 230 ? 35.000 37.853 24.398  1.00 13.17 ? 227  VAL A CG1 1 
ATOM   2046 C  CG2 . VAL A 1 230 ? 32.654 37.608 25.333  1.00 13.32 ? 227  VAL A CG2 1 
ATOM   2047 N  N   . ALA A 1 231 ? 35.470 34.234 23.749  1.00 11.25 ? 228  ALA A N   1 
ATOM   2048 C  CA  . ALA A 1 231 ? 36.747 33.708 23.257  1.00 11.96 ? 228  ALA A CA  1 
ATOM   2049 C  C   . ALA A 1 231 ? 36.693 33.121 21.838  1.00 11.58 ? 228  ALA A C   1 
ATOM   2050 O  O   . ALA A 1 231 ? 37.710 33.094 21.103  1.00 13.65 ? 228  ALA A O   1 
ATOM   2051 C  CB  . ALA A 1 231 ? 37.262 32.643 24.239  1.00 13.51 ? 228  ALA A CB  1 
ATOM   2052 N  N   . ASN A 1 232 ? 35.530 32.638 21.438  1.00 11.51 ? 229  ASN A N   1 
ATOM   2053 C  CA  . ASN A 1 232 ? 35.371 32.082 20.104  1.00 11.26 ? 229  ASN A CA  1 
ATOM   2054 C  C   . ASN A 1 232 ? 35.004 33.103 19.051  1.00 11.45 ? 229  ASN A C   1 
ATOM   2055 O  O   . ASN A 1 232 ? 34.905 32.764 17.854  1.00 12.00 ? 229  ASN A O   1 
ATOM   2056 C  CB  . ASN A 1 232 ? 34.255 31.001 20.088  1.00 13.12 ? 229  ASN A CB  1 
ATOM   2057 C  CG  . ASN A 1 232 ? 34.588 29.795 20.865  1.00 14.84 ? 229  ASN A CG  1 
ATOM   2058 O  OD1 . ASN A 1 232 ? 34.531 29.816 22.087  1.00 18.22 ? 229  ASN A OD1 1 
ATOM   2059 N  ND2 . ASN A 1 232 ? 34.872 28.672 20.144  1.00 18.05 ? 229  ASN A ND2 1 
ATOM   2060 N  N   . HIS A 1 233 ? 34.774 34.356 19.464  1.00 9.75  ? 230  HIS A N   1 
ATOM   2061 C  CA  . HIS A 1 233 ? 34.213 35.362 18.561  1.00 9.04  ? 230  HIS A CA  1 
ATOM   2062 C  C   . HIS A 1 233 ? 34.946 36.698 18.500  1.00 9.73  ? 230  HIS A C   1 
ATOM   2063 O  O   . HIS A 1 233 ? 34.568 37.565 17.686  1.00 11.38 ? 230  HIS A O   1 
ATOM   2064 C  CB  . HIS A 1 233 ? 32.730 35.551 18.874  1.00 10.02 ? 230  HIS A CB  1 
ATOM   2065 C  CG  . HIS A 1 233 ? 31.899 34.374 18.484  1.00 9.69  ? 230  HIS A CG  1 
ATOM   2066 N  ND1 . HIS A 1 233 ? 31.569 34.090 17.173  1.00 9.84  ? 230  HIS A ND1 1 
ATOM   2067 C  CD2 . HIS A 1 233 ? 31.368 33.373 19.239  1.00 9.61  ? 230  HIS A CD2 1 
ATOM   2068 C  CE1 . HIS A 1 233 ? 30.872 32.961 17.152  1.00 10.92 ? 230  HIS A CE1 1 
ATOM   2069 N  NE2 . HIS A 1 233 ? 30.715 32.519 18.391  1.00 10.53 ? 230  HIS A NE2 1 
ATOM   2070 N  N   . PHE A 1 234 ? 35.965 36.882 19.347  1.00 9.92  ? 231  PHE A N   1 
ATOM   2071 C  CA  . PHE A 1 234 ? 36.741 38.106 19.384  1.00 9.68  ? 231  PHE A CA  1 
ATOM   2072 C  C   . PHE A 1 234 ? 38.232 37.797 19.417  1.00 8.90  ? 231  PHE A C   1 
ATOM   2073 O  O   . PHE A 1 234 ? 38.683 36.937 20.157  1.00 10.45 ? 231  PHE A O   1 
ATOM   2074 C  CB  . PHE A 1 234 ? 36.393 38.974 20.595  1.00 10.15 ? 231  PHE A CB  1 
ATOM   2075 C  CG  . PHE A 1 234 ? 35.066 39.692 20.515  1.00 10.16 ? 231  PHE A CG  1 
ATOM   2076 C  CD1 . PHE A 1 234 ? 35.005 41.010 20.066  1.00 10.27 ? 231  PHE A CD1 1 
ATOM   2077 C  CD2 . PHE A 1 234 ? 33.925 39.101 20.963  1.00 10.71 ? 231  PHE A CD2 1 
ATOM   2078 C  CE1 . PHE A 1 234 ? 33.832 41.685 20.014  1.00 14.26 ? 231  PHE A CE1 1 
ATOM   2079 C  CE2 . PHE A 1 234 ? 32.742 39.766 20.917  1.00 13.30 ? 231  PHE A CE2 1 
ATOM   2080 C  CZ  . PHE A 1 234 ? 32.703 41.072 20.430  1.00 14.13 ? 231  PHE A CZ  1 
ATOM   2081 N  N   . VAL A 1 235 ? 38.985 38.560 18.635  1.00 8.67  ? 232  VAL A N   1 
ATOM   2082 C  CA  . VAL A 1 235 ? 40.433 38.698 18.762  1.00 10.01 ? 232  VAL A CA  1 
ATOM   2083 C  C   . VAL A 1 235 ? 40.751 40.188 18.910  1.00 9.57  ? 232  VAL A C   1 
ATOM   2084 O  O   . VAL A 1 235 ? 39.900 41.060 18.650  1.00 9.99  ? 232  VAL A O   1 
ATOM   2085 C  CB  . VAL A 1 235 ? 41.173 38.098 17.546  1.00 10.21 ? 232  VAL A CB  1 
ATOM   2086 C  CG1 . VAL A 1 235 ? 40.790 36.606 17.322  1.00 12.13 ? 232  VAL A CG1 1 
ATOM   2087 C  CG2 . VAL A 1 235 ? 40.954 38.910 16.250  1.00 10.22 ? 232  VAL A CG2 1 
ATOM   2088 N  N   . ALA A 1 236 ? 41.975 40.498 19.357  1.00 10.02 ? 233  ALA A N   1 
ATOM   2089 C  CA  . ALA A 1 236 ? 42.390 41.896 19.595  1.00 9.74  ? 233  ALA A CA  1 
ATOM   2090 C  C   . ALA A 1 236 ? 43.738 42.140 18.975  1.00 9.89  ? 233  ALA A C   1 
ATOM   2091 O  O   . ALA A 1 236 ? 44.578 41.205 18.924  1.00 10.79 ? 233  ALA A O   1 
ATOM   2092 C  CB  . ALA A 1 236 ? 42.445 42.206 21.081  1.00 12.61 ? 233  ALA A CB  1 
ATOM   2093 N  N   . ILE A 1 237 ? 43.975 43.380 18.583  1.00 10.94 ? 234  ILE A N   1 
ATOM   2094 C  CA  . ILE A 1 237 ? 45.303 43.874 18.186  1.00 11.22 ? 234  ILE A CA  1 
ATOM   2095 C  C   . ILE A 1 237 ? 45.537 44.984 19.157  1.00 11.63 ? 234  ILE A C   1 
ATOM   2096 O  O   . ILE A 1 237 ? 44.863 46.012 19.095  1.00 11.99 ? 234  ILE A O   1 
ATOM   2097 C  CB  . ILE A 1 237 ? 45.349 44.332 16.720  1.00 12.09 ? 234  ILE A CB  1 
ATOM   2098 C  CG1 . ILE A 1 237 ? 44.533 43.342 15.833  1.00 14.85 ? 234  ILE A CG1 1 
ATOM   2099 C  CG2 . ILE A 1 237 ? 46.784 44.549 16.292  1.00 15.06 ? 234  ILE A CG2 1 
ATOM   2100 C  CD1 . ILE A 1 237 ? 44.160 43.714 14.461  1.00 14.14 ? 234  ILE A CD1 1 
ATOM   2101 N  N   . SER A 1 238 ? 46.377 44.703 20.160  1.00 11.99 ? 235  SER A N   1 
ATOM   2102 C  CA  . SER A 1 238 ? 46.519 45.617 21.297  1.00 12.52 ? 235  SER A CA  1 
ATOM   2103 C  C   . SER A 1 238 ? 47.767 45.253 22.081  1.00 13.54 ? 235  SER A C   1 
ATOM   2104 O  O   . SER A 1 238 ? 48.180 44.101 22.113  1.00 14.43 ? 235  SER A O   1 
ATOM   2105 C  CB  . SER A 1 238 ? 45.285 45.474 22.235  1.00 12.91 ? 235  SER A CB  1 
ATOM   2106 O  OG  . SER A 1 238 ? 45.297 46.457 23.292  1.00 14.22 ? 235  SER A OG  1 
ATOM   2107 N  N   . SER A 1 239 ? 48.308 46.234 22.801  1.00 15.32 ? 236  SER A N   1 
ATOM   2108 C  CA  . SER A 1 239 ? 49.360 46.025 23.818  1.00 15.79 ? 236  SER A CA  1 
ATOM   2109 C  C   . SER A 1 239 ? 48.837 45.962 25.234  1.00 15.61 ? 236  SER A C   1 
ATOM   2110 O  O   . SER A 1 239 ? 49.614 45.707 26.151  1.00 17.37 ? 236  SER A O   1 
ATOM   2111 C  CB  . SER A 1 239 ? 50.384 47.162 23.727  1.00 18.96 ? 236  SER A CB  1 
ATOM   2112 O  OG  . SER A 1 239 ? 50.885 47.260 22.425  1.00 21.89 ? 236  SER A OG  1 
ATOM   2113 N  N   . LYS A 1 240 ? 47.551 46.238 25.443  1.00 14.76 ? 237  LYS A N   1 
ATOM   2114 C  CA  . LYS A 1 240 ? 46.973 46.346 26.778  1.00 16.25 ? 237  LYS A CA  1 
ATOM   2115 C  C   . LYS A 1 240 ? 46.420 45.010 27.225  1.00 15.62 ? 237  LYS A C   1 
ATOM   2116 O  O   . LYS A 1 240 ? 45.176 44.756 27.230  1.00 16.34 ? 237  LYS A O   1 
ATOM   2117 C  CB  . LYS A 1 240 ? 45.889 47.421 26.799  1.00 17.03 ? 237  LYS A CB  1 
ATOM   2118 C  CG  . LYS A 1 240 ? 45.603 47.982 28.216  1.00 18.06 ? 237  LYS A CG  1 
ATOM   2119 C  CD  . LYS A 1 240 ? 46.620 49.055 28.634  1.00 23.66 ? 237  LYS A CD  1 
ATOM   2120 C  CE  . LYS A 1 240 ? 46.538 49.397 30.123  1.00 28.23 ? 237  LYS A CE  1 
ATOM   2121 N  NZ  . LYS A 1 240 ? 47.078 48.361 31.033  1.00 30.78 ? 237  LYS A NZ  1 
ATOM   2122 N  N   . LEU A 1 241 ? 47.348 44.119 27.589  1.00 17.04 ? 238  LEU A N   1 
ATOM   2123 C  CA  . LEU A 1 241 ? 46.983 42.736 27.789  1.00 16.87 ? 238  LEU A CA  1 
ATOM   2124 C  C   . LEU A 1 241 ? 45.954 42.517 28.891  1.00 17.20 ? 238  LEU A C   1 
ATOM   2125 O  O   . LEU A 1 241 ? 45.068 41.642 28.751  1.00 17.42 ? 238  LEU A O   1 
ATOM   2126 C  CB  . LEU A 1 241 ? 48.222 41.890 28.067  1.00 18.81 ? 238  LEU A CB  1 
ATOM   2127 C  CG  . LEU A 1 241 ? 49.343 41.981 27.053  1.00 18.93 ? 238  LEU A CG  1 
ATOM   2128 C  CD1 . LEU A 1 241 ? 50.511 41.015 27.442  1.00 24.41 ? 238  LEU A CD1 1 
ATOM   2129 C  CD2 . LEU A 1 241 ? 48.839 41.643 25.672  1.00 23.13 ? 238  LEU A CD2 1 
ATOM   2130 N  N   . ASP A 1 242 ? 46.035 43.277 29.973  1.00 17.35 ? 239  ASP A N   1 
ATOM   2131 C  CA  . ASP A 1 242 ? 45.070 43.091 31.068  1.00 17.63 ? 239  ASP A CA  1 
ATOM   2132 C  C   . ASP A 1 242 ? 43.632 43.383 30.659  1.00 16.25 ? 239  ASP A C   1 
ATOM   2133 O  O   . ASP A 1 242 ? 42.708 42.612 30.992  1.00 15.33 ? 239  ASP A O   1 
ATOM   2134 C  CB  . ASP A 1 242 ? 45.448 43.896 32.332  1.00 18.46 ? 239  ASP A CB  1 
ATOM   2135 C  CG  . ASP A 1 242 ? 45.534 45.388 32.129  1.00 22.97 ? 239  ASP A CG  1 
ATOM   2136 O  OD1 . ASP A 1 242 ? 45.620 45.885 30.987  1.00 25.84 ? 239  ASP A OD1 1 
ATOM   2137 O  OD2 . ASP A 1 242 ? 45.502 46.091 33.197  1.00 28.75 ? 239  ASP A OD2 1 
ATOM   2138 N  N   . LYS A 1 243 ? 43.444 44.466 29.889  1.00 15.98 ? 240  LYS A N   1 
ATOM   2139 C  CA  A LYS A 1 243 ? 42.097 44.831 29.473  0.60 15.90 ? 240  LYS A CA  1 
ATOM   2140 C  CA  B LYS A 1 243 ? 42.105 44.853 29.446  0.40 15.96 ? 240  LYS A CA  1 
ATOM   2141 C  C   . LYS A 1 243 ? 41.559 43.852 28.422  1.00 15.11 ? 240  LYS A C   1 
ATOM   2142 O  O   . LYS A 1 243 ? 40.372 43.534 28.411  1.00 14.74 ? 240  LYS A O   1 
ATOM   2143 C  CB  A LYS A 1 243 ? 42.072 46.270 28.963  0.60 16.41 ? 240  LYS A CB  1 
ATOM   2144 C  CB  B LYS A 1 243 ? 42.127 46.263 28.849  0.40 16.56 ? 240  LYS A CB  1 
ATOM   2145 C  CG  A LYS A 1 243 ? 42.297 47.315 30.051  0.60 17.78 ? 240  LYS A CG  1 
ATOM   2146 C  CG  B LYS A 1 243 ? 42.403 47.390 29.854  0.40 18.15 ? 240  LYS A CG  1 
ATOM   2147 C  CD  A LYS A 1 243 ? 42.034 48.748 29.600  0.60 19.03 ? 240  LYS A CD  1 
ATOM   2148 C  CD  B LYS A 1 243 ? 41.223 47.637 30.806  0.40 20.37 ? 240  LYS A CD  1 
ATOM   2149 C  CE  A LYS A 1 243 ? 42.008 49.710 30.801  0.60 20.13 ? 240  LYS A CE  1 
ATOM   2150 C  CE  B LYS A 1 243 ? 41.672 48.369 32.062  0.40 22.32 ? 240  LYS A CE  1 
ATOM   2151 N  NZ  A LYS A 1 243 ? 42.150 51.144 30.385  0.60 21.97 ? 240  LYS A NZ  1 
ATOM   2152 N  NZ  B LYS A 1 243 ? 40.860 48.060 33.298  0.40 22.41 ? 240  LYS A NZ  1 
ATOM   2153 N  N   . VAL A 1 244 ? 42.433 43.330 27.565  1.00 13.61 ? 241  VAL A N   1 
ATOM   2154 C  CA  . VAL A 1 244 ? 42.049 42.315 26.586  1.00 13.58 ? 241  VAL A CA  1 
ATOM   2155 C  C   . VAL A 1 244 ? 41.580 41.031 27.280  1.00 13.94 ? 241  VAL A C   1 
ATOM   2156 O  O   . VAL A 1 244 ? 40.535 40.466 26.924  1.00 13.26 ? 241  VAL A O   1 
ATOM   2157 C  CB  . VAL A 1 244 ? 43.228 42.032 25.579  1.00 13.28 ? 241  VAL A CB  1 
ATOM   2158 C  CG1 . VAL A 1 244 ? 42.948 40.778 24.694  1.00 14.39 ? 241  VAL A CG1 1 
ATOM   2159 C  CG2 . VAL A 1 244 ? 43.587 43.250 24.701  1.00 14.22 ? 241  VAL A CG2 1 
ATOM   2160 N  N   . LYS A 1 245 ? 42.342 40.573 28.283  1.00 14.73 ? 242  LYS A N   1 
ATOM   2161 C  CA  . LYS A 1 245 ? 41.949 39.397 29.039  1.00 15.88 ? 242  LYS A CA  1 
ATOM   2162 C  C   . LYS A 1 245 ? 40.617 39.653 29.782  1.00 15.61 ? 242  LYS A C   1 
ATOM   2163 O  O   . LYS A 1 245 ? 39.728 38.770 29.787  1.00 16.06 ? 242  LYS A O   1 
ATOM   2164 C  CB  . LYS A 1 245 ? 43.105 39.007 29.981  1.00 17.88 ? 242  LYS A CB  1 
ATOM   2165 C  CG  . LYS A 1 245 ? 42.830 37.774 30.809  1.00 22.39 ? 242  LYS A CG  1 
ATOM   2166 C  CD  . LYS A 1 245 ? 43.951 37.438 31.797  1.00 28.17 ? 242  LYS A CD  1 
ATOM   2167 C  CE  . LYS A 1 245 ? 43.440 36.403 32.855  1.00 31.64 ? 242  LYS A CE  1 
ATOM   2168 N  NZ  . LYS A 1 245 ? 44.466 35.928 33.887  1.00 35.66 ? 242  LYS A NZ  1 
ATOM   2169 N  N   . GLU A 1 246 ? 40.471 40.823 30.398  1.00 15.19 ? 243  GLU A N   1 
ATOM   2170 C  CA  A GLU A 1 246 ? 39.237 41.161 31.137  0.70 16.53 ? 243  GLU A CA  1 
ATOM   2171 C  CA  B GLU A 1 246 ? 39.240 41.160 31.138  0.30 15.87 ? 243  GLU A CA  1 
ATOM   2172 C  C   . GLU A 1 246 ? 37.995 41.144 30.218  1.00 16.05 ? 243  GLU A C   1 
ATOM   2173 O  O   . GLU A 1 246 ? 36.887 40.817 30.641  1.00 17.56 ? 243  GLU A O   1 
ATOM   2174 C  CB  A GLU A 1 246 ? 39.380 42.554 31.783  0.70 18.08 ? 243  GLU A CB  1 
ATOM   2175 C  CB  B GLU A 1 246 ? 39.360 42.547 31.796  0.30 16.44 ? 243  GLU A CB  1 
ATOM   2176 C  CG  A GLU A 1 246 ? 38.177 43.006 32.676  0.70 21.46 ? 243  GLU A CG  1 
ATOM   2177 C  CG  B GLU A 1 246 ? 40.283 42.683 33.033  0.30 16.57 ? 243  GLU A CG  1 
ATOM   2178 C  CD  A GLU A 1 246 ? 38.127 44.531 32.965  0.70 26.45 ? 243  GLU A CD  1 
ATOM   2179 C  CD  B GLU A 1 246 ? 40.491 44.166 33.404  0.30 20.03 ? 243  GLU A CD  1 
ATOM   2180 O  OE1 A GLU A 1 246 ? 38.561 45.378 32.123  0.70 30.62 ? 243  GLU A OE1 1 
ATOM   2181 O  OE1 B GLU A 1 246 ? 39.557 44.759 33.987  0.30 23.77 ? 243  GLU A OE1 1 
ATOM   2182 O  OE2 A GLU A 1 246 ? 37.601 44.878 34.046  0.70 31.97 ? 243  GLU A OE2 1 
ATOM   2183 O  OE2 B GLU A 1 246 ? 41.562 44.750 33.091  0.30 20.87 ? 243  GLU A OE2 1 
ATOM   2184 N  N   . PHE A 1 247 ? 38.187 41.499 28.942  1.00 14.82 ? 244  PHE A N   1 
ATOM   2185 C  CA  . PHE A 1 247 ? 37.081 41.513 27.963  1.00 13.87 ? 244  PHE A CA  1 
ATOM   2186 C  C   . PHE A 1 247 ? 36.627 40.089 27.644  1.00 14.31 ? 244  PHE A C   1 
ATOM   2187 O  O   . PHE A 1 247 ? 35.483 39.870 27.264  1.00 14.92 ? 244  PHE A O   1 
ATOM   2188 C  CB  . PHE A 1 247 ? 37.594 42.205 26.697  1.00 13.17 ? 244  PHE A CB  1 
ATOM   2189 C  CG  . PHE A 1 247 ? 36.543 42.539 25.667  1.00 12.64 ? 244  PHE A CG  1 
ATOM   2190 C  CD1 . PHE A 1 247 ? 35.929 43.788 25.655  1.00 13.94 ? 244  PHE A CD1 1 
ATOM   2191 C  CD2 . PHE A 1 247 ? 36.218 41.646 24.679  1.00 12.68 ? 244  PHE A CD2 1 
ATOM   2192 C  CE1 . PHE A 1 247 ? 34.982 44.102 24.667  1.00 13.35 ? 244  PHE A CE1 1 
ATOM   2193 C  CE2 . PHE A 1 247 ? 35.283 41.957 23.704  1.00 13.12 ? 244  PHE A CE2 1 
ATOM   2194 C  CZ  . PHE A 1 247 ? 34.694 43.177 23.691  1.00 13.06 ? 244  PHE A CZ  1 
ATOM   2195 N  N   . GLY A 1 248 ? 37.536 39.125 27.814  1.00 13.84 ? 245  GLY A N   1 
ATOM   2196 C  CA  . GLY A 1 248 ? 37.283 37.716 27.573  1.00 14.39 ? 245  GLY A CA  1 
ATOM   2197 C  C   . GLY A 1 248 ? 37.994 37.107 26.401  1.00 14.05 ? 245  GLY A C   1 
ATOM   2198 O  O   . GLY A 1 248 ? 37.685 35.985 26.028  1.00 15.59 ? 245  GLY A O   1 
ATOM   2199 N  N   . ILE A 1 249 ? 38.961 37.834 25.847  1.00 15.20 ? 246  ILE A N   1 
ATOM   2200 C  CA  . ILE A 1 249 ? 39.762 37.360 24.736  1.00 14.05 ? 246  ILE A CA  1 
ATOM   2201 C  C   . ILE A 1 249 ? 40.983 36.597 25.249  1.00 16.55 ? 246  ILE A C   1 
ATOM   2202 O  O   . ILE A 1 249 ? 41.674 37.020 26.170  1.00 17.39 ? 246  ILE A O   1 
ATOM   2203 C  CB  . ILE A 1 249 ? 40.215 38.566 23.881  1.00 13.66 ? 246  ILE A CB  1 
ATOM   2204 C  CG1 . ILE A 1 249 ? 38.971 39.230 23.247  1.00 13.21 ? 246  ILE A CG1 1 
ATOM   2205 C  CG2 . ILE A 1 249 ? 41.275 38.218 22.836  1.00 12.93 ? 246  ILE A CG2 1 
ATOM   2206 C  CD1 . ILE A 1 249 ? 39.213 40.600 22.660  1.00 14.95 ? 246  ILE A CD1 1 
ATOM   2207 N  N   . ASP A 1 250 ? 41.238 35.468 24.590  1.00 17.78 ? 247  ASP A N   1 
ATOM   2208 C  CA  A ASP A 1 250 ? 42.385 34.607 24.895  0.70 18.34 ? 247  ASP A CA  1 
ATOM   2209 C  CA  B ASP A 1 250 ? 42.389 34.624 24.904  0.30 17.82 ? 247  ASP A CA  1 
ATOM   2210 C  C   . ASP A 1 250 ? 43.674 35.375 24.527  1.00 17.71 ? 247  ASP A C   1 
ATOM   2211 O  O   . ASP A 1 250 ? 43.739 35.948 23.444  1.00 17.15 ? 247  ASP A O   1 
ATOM   2212 C  CB  A ASP A 1 250 ? 42.344 33.330 24.024  0.70 19.06 ? 247  ASP A CB  1 
ATOM   2213 C  CB  B ASP A 1 250 ? 42.270 33.331 24.086  0.30 18.12 ? 247  ASP A CB  1 
ATOM   2214 C  CG  A ASP A 1 250 ? 41.184 32.378 24.352  0.70 21.50 ? 247  ASP A CG  1 
ATOM   2215 C  CG  B ASP A 1 250 ? 43.231 32.245 24.532  0.30 19.33 ? 247  ASP A CG  1 
ATOM   2216 O  OD1 A ASP A 1 250 ? 40.770 32.268 25.528  0.70 23.85 ? 247  ASP A OD1 1 
ATOM   2217 O  OD1 B ASP A 1 250 ? 44.429 32.534 24.770  0.30 22.45 ? 247  ASP A OD1 1 
ATOM   2218 O  OD2 A ASP A 1 250 ? 40.723 31.671 23.406  0.70 26.84 ? 247  ASP A OD2 1 
ATOM   2219 O  OD2 B ASP A 1 250 ? 42.771 31.085 24.618  0.30 19.75 ? 247  ASP A OD2 1 
ATOM   2220 N  N   . LEU A 1 251 ? 44.697 35.387 25.394  1.00 17.11 ? 248  LEU A N   1 
ATOM   2221 C  CA  A LEU A 1 251 ? 45.900 36.136 24.985  0.70 17.18 ? 248  LEU A CA  1 
ATOM   2222 C  CA  B LEU A 1 251 ? 46.055 35.957 25.138  0.30 16.37 ? 248  LEU A CA  1 
ATOM   2223 C  C   . LEU A 1 251 ? 46.677 35.509 23.812  1.00 15.14 ? 248  LEU A C   1 
ATOM   2224 O  O   . LEU A 1 251 ? 47.393 36.263 23.081  1.00 14.75 ? 248  LEU A O   1 
ATOM   2225 C  CB  A LEU A 1 251 ? 46.798 36.532 26.142  0.70 18.46 ? 248  LEU A CB  1 
ATOM   2226 C  CB  B LEU A 1 251 ? 47.014 35.502 26.259  0.30 16.68 ? 248  LEU A CB  1 
ATOM   2227 C  CG  A LEU A 1 251 ? 46.190 37.513 27.143  0.70 19.60 ? 248  LEU A CG  1 
ATOM   2228 C  CG  B LEU A 1 251 ? 48.452 36.052 26.233  0.30 17.17 ? 248  LEU A CG  1 
ATOM   2229 C  CD1 A LEU A 1 251 ? 47.245 37.799 28.197  0.70 22.75 ? 248  LEU A CD1 1 
ATOM   2230 C  CD1 B LEU A 1 251 ? 48.409 37.559 26.364  0.30 17.57 ? 248  LEU A CD1 1 
ATOM   2231 C  CD2 A LEU A 1 251 ? 45.710 38.821 26.486  0.70 21.06 ? 248  LEU A CD2 1 
ATOM   2232 C  CD2 B LEU A 1 251 ? 49.366 35.416 27.324  0.30 18.40 ? 248  LEU A CD2 1 
ATOM   2233 N  N   . GLU A 1 252 ? 46.430 34.234 23.477  1.00 13.82 ? 249  GLU A N   1 
ATOM   2234 C  CA  A GLU A 1 252 ? 46.845 33.611 22.189  0.60 14.98 ? 249  GLU A CA  1 
ATOM   2235 C  CA  B GLU A 1 252 ? 46.933 33.675 22.208  0.40 14.42 ? 249  GLU A CA  1 
ATOM   2236 C  C   . GLU A 1 252 ? 46.326 34.406 20.999  1.00 13.55 ? 249  GLU A C   1 
ATOM   2237 O  O   . GLU A 1 252 ? 46.895 34.381 19.895  1.00 14.00 ? 249  GLU A O   1 
ATOM   2238 C  CB  A GLU A 1 252 ? 46.299 32.154 22.064  0.60 16.02 ? 249  GLU A CB  1 
ATOM   2239 C  CB  B GLU A 1 252 ? 46.676 32.154 22.137  0.40 15.25 ? 249  GLU A CB  1 
ATOM   2240 C  CG  A GLU A 1 252 ? 46.732 31.468 20.723  0.60 21.11 ? 249  GLU A CG  1 
ATOM   2241 C  CG  B GLU A 1 252 ? 45.198 31.797 22.144  0.40 17.67 ? 249  GLU A CG  1 
ATOM   2242 C  CD  A GLU A 1 252 ? 46.436 29.975 20.628  0.60 27.90 ? 249  GLU A CD  1 
ATOM   2243 C  CD  B GLU A 1 252 ? 44.855 30.303 22.192  0.40 21.73 ? 249  GLU A CD  1 
ATOM   2244 O  OE1 A GLU A 1 252 ? 46.334 29.324 21.702  0.60 33.15 ? 249  GLU A OE1 1 
ATOM   2245 O  OE1 B GLU A 1 252 ? 45.025 29.624 21.153  0.40 24.45 ? 249  GLU A OE1 1 
ATOM   2246 O  OE2 A GLU A 1 252 ? 46.313 29.459 19.473  0.60 30.95 ? 249  GLU A OE2 1 
ATOM   2247 O  OE2 B GLU A 1 252 ? 44.343 29.821 23.234  0.40 24.76 ? 249  GLU A OE2 1 
ATOM   2248 N  N   . HIS A 1 253 ? 45.187 35.071 21.205  1.00 12.19 ? 250  HIS A N   1 
ATOM   2249 C  CA  . HIS A 1 253 ? 44.543 35.848 20.161  1.00 11.24 ? 250  HIS A CA  1 
ATOM   2250 C  C   . HIS A 1 253 ? 44.589 37.347 20.433  1.00 11.58 ? 250  HIS A C   1 
ATOM   2251 O  O   . HIS A 1 253 ? 43.704 38.105 19.994  1.00 11.53 ? 250  HIS A O   1 
ATOM   2252 C  CB  . HIS A 1 253 ? 43.101 35.389 19.999  1.00 12.91 ? 250  HIS A CB  1 
ATOM   2253 C  CG  . HIS A 1 253 ? 43.004 33.958 19.696  1.00 14.42 ? 250  HIS A CG  1 
ATOM   2254 N  ND1 . HIS A 1 253 ? 42.141 33.118 20.360  1.00 18.52 ? 250  HIS A ND1 1 
ATOM   2255 C  CD2 . HIS A 1 253 ? 43.679 33.192 18.800  1.00 16.39 ? 250  HIS A CD2 1 
ATOM   2256 C  CE1 . HIS A 1 253 ? 42.301 31.883 19.900  1.00 18.05 ? 250  HIS A CE1 1 
ATOM   2257 N  NE2 . HIS A 1 253 ? 43.198 31.901 18.933  1.00 17.79 ? 250  HIS A NE2 1 
ATOM   2258 N  N   . CYS A 1 254 ? 45.671 37.786 21.095  1.00 11.27 ? 251  CYS A N   1 
ATOM   2259 C  CA  . CYS A 1 254 ? 46.025 39.188 21.189  1.00 11.17 ? 251  CYS A CA  1 
ATOM   2260 C  C   . CYS A 1 254 ? 47.305 39.367 20.392  1.00 10.65 ? 251  CYS A C   1 
ATOM   2261 O  O   . CYS A 1 254 ? 48.331 38.765 20.694  1.00 12.50 ? 251  CYS A O   1 
ATOM   2262 C  CB  . CYS A 1 254 ? 46.239 39.596 22.625  1.00 11.28 ? 251  CYS A CB  1 
ATOM   2263 S  SG  . CYS A 1 254 ? 46.392 41.378 22.863  1.00 15.28 ? 251  CYS A SG  1 
ATOM   2264 N  N   . TYR A 1 255 ? 47.185 40.165 19.360  1.00 9.74  ? 252  TYR A N   1 
ATOM   2265 C  CA  . TYR A 1 255 ? 48.239 40.432 18.371  1.00 10.45 ? 252  TYR A CA  1 
ATOM   2266 C  C   . TYR A 1 255 ? 48.957 41.755 18.652  1.00 12.28 ? 252  TYR A C   1 
ATOM   2267 O  O   . TYR A 1 255 ? 48.462 42.672 19.304  1.00 12.32 ? 252  TYR A O   1 
ATOM   2268 C  CB  . TYR A 1 255 ? 47.623 40.292 16.966  1.00 11.44 ? 252  TYR A CB  1 
ATOM   2269 C  CG  . TYR A 1 255 ? 47.082 38.924 16.749  1.00 10.14 ? 252  TYR A CG  1 
ATOM   2270 C  CD1 . TYR A 1 255 ? 47.866 37.875 16.260  1.00 10.58 ? 252  TYR A CD1 1 
ATOM   2271 C  CD2 . TYR A 1 255 ? 45.776 38.610 17.128  1.00 10.30 ? 252  TYR A CD2 1 
ATOM   2272 C  CE1 . TYR A 1 255 ? 47.350 36.604 16.132  1.00 11.47 ? 252  TYR A CE1 1 
ATOM   2273 C  CE2 . TYR A 1 255 ? 45.268 37.335 17.010  1.00 11.02 ? 252  TYR A CE2 1 
ATOM   2274 C  CZ  . TYR A 1 255 ? 46.058 36.302 16.552  1.00 10.39 ? 252  TYR A CZ  1 
ATOM   2275 O  OH  . TYR A 1 255 ? 45.575 34.984 16.453  1.00 12.36 ? 252  TYR A OH  1 
ATOM   2276 N  N   . LYS A 1 256 ? 50.165 41.818 18.153  1.00 14.52 ? 253  LYS A N   1 
ATOM   2277 C  CA  . LYS A 1 256 ? 51.138 42.829 18.559  1.00 15.69 ? 253  LYS A CA  1 
ATOM   2278 C  C   . LYS A 1 256 ? 51.006 44.129 17.814  1.00 15.64 ? 253  LYS A C   1 
ATOM   2279 O  O   . LYS A 1 256 ? 50.720 44.163 16.644  1.00 18.24 ? 253  LYS A O   1 
ATOM   2280 C  CB  . LYS A 1 256 ? 52.554 42.301 18.356  1.00 17.06 ? 253  LYS A CB  1 
ATOM   2281 C  CG  . LYS A 1 256 ? 52.986 41.397 19.482  1.00 21.10 ? 253  LYS A CG  1 
ATOM   2282 C  CD  . LYS A 1 256 ? 54.446 41.012 19.445  1.00 24.88 ? 253  LYS A CD  1 
ATOM   2283 C  CE  . LYS A 1 256 ? 54.870 40.175 20.637  1.00 29.96 ? 253  LYS A CE  1 
ATOM   2284 N  NZ  . LYS A 1 256 ? 53.934 39.098 20.904  1.00 31.03 ? 253  LYS A NZ  1 
HETATM 2285 N  N   . MSE A 1 257 ? 51.234 45.216 18.559  1.00 16.94 ? 254  MSE A N   1 
HETATM 2286 C  CA  A MSE A 1 257 ? 51.342 46.555 18.036  0.70 16.78 ? 254  MSE A CA  1 
HETATM 2287 C  CA  B MSE A 1 257 ? 51.393 46.533 17.938  0.30 17.65 ? 254  MSE A CA  1 
HETATM 2288 C  C   . MSE A 1 257 ? 52.610 47.200 18.592  1.00 16.61 ? 254  MSE A C   1 
HETATM 2289 O  O   . MSE A 1 257 ? 52.680 47.428 19.823  1.00 20.42 ? 254  MSE A O   1 
HETATM 2290 C  CB  A MSE A 1 257 ? 50.127 47.337 18.534  0.70 16.35 ? 254  MSE A CB  1 
HETATM 2291 C  CB  B MSE A 1 257 ? 50.104 47.403 17.979  0.30 18.77 ? 254  MSE A CB  1 
HETATM 2292 C  CG  A MSE A 1 257 ? 48.864 46.743 17.973  0.70 16.37 ? 254  MSE A CG  1 
HETATM 2293 C  CG  B MSE A 1 257 ? 50.288 48.808 17.347  0.30 21.35 ? 254  MSE A CG  1 
HETATM 2294 SE SE  A MSE A 1 257 ? 47.323 47.878 18.161  0.49 17.79 ? 254  MSE A SE  1 
HETATM 2295 SE SE  B MSE A 1 257 ? 48.898 49.765 16.281  0.21 32.34 ? 254  MSE A SE  1 
HETATM 2296 C  CE  A MSE A 1 257 ? 47.992 49.503 17.295  0.70 17.92 ? 254  MSE A CE  1 
HETATM 2297 C  CE  B MSE A 1 257 ? 50.183 50.804 15.260  0.30 12.32 ? 254  MSE A CE  1 
ATOM   2298 N  N   . TRP A 1 258 ? 53.638 47.422 17.779  1.00 13.99 ? 255  TRP A N   1 
ATOM   2299 C  CA  . TRP A 1 258 ? 54.853 48.013 18.271  1.00 13.32 ? 255  TRP A CA  1 
ATOM   2300 C  C   . TRP A 1 258 ? 54.825 49.526 18.240  1.00 11.56 ? 255  TRP A C   1 
ATOM   2301 O  O   . TRP A 1 258 ? 54.214 50.102 17.353  1.00 12.00 ? 255  TRP A O   1 
ATOM   2302 C  CB  . TRP A 1 258 ? 56.060 47.472 17.458  1.00 13.89 ? 255  TRP A CB  1 
ATOM   2303 C  CG  . TRP A 1 258 ? 56.210 45.987 17.544  1.00 11.74 ? 255  TRP A CG  1 
ATOM   2304 C  CD1 . TRP A 1 258 ? 56.654 45.277 18.603  1.00 15.20 ? 255  TRP A CD1 1 
ATOM   2305 C  CD2 . TRP A 1 258 ? 55.928 45.041 16.508  1.00 12.94 ? 255  TRP A CD2 1 
ATOM   2306 N  NE1 . TRP A 1 258 ? 56.668 43.945 18.295  1.00 14.90 ? 255  TRP A NE1 1 
ATOM   2307 C  CE2 . TRP A 1 258 ? 56.221 43.775 17.014  1.00 13.26 ? 255  TRP A CE2 1 
ATOM   2308 C  CE3 . TRP A 1 258 ? 55.461 45.152 15.179  1.00 15.32 ? 255  TRP A CE3 1 
ATOM   2309 C  CZ2 . TRP A 1 258 ? 56.045 42.603 16.239  1.00 13.53 ? 255  TRP A CZ2 1 
ATOM   2310 C  CZ3 . TRP A 1 258 ? 55.292 44.013 14.431  1.00 15.29 ? 255  TRP A CZ3 1 
ATOM   2311 C  CH2 . TRP A 1 258 ? 55.581 42.758 14.962  1.00 15.47 ? 255  TRP A CH2 1 
ATOM   2312 N  N   . ASP A 1 259 ? 55.494 50.165 19.213  1.00 12.29 ? 256  ASP A N   1 
ATOM   2313 C  CA  A ASP A 1 259 ? 55.476 51.623 19.318  0.70 12.16 ? 256  ASP A CA  1 
ATOM   2314 C  CA  B ASP A 1 259 ? 55.414 51.624 19.284  0.30 12.42 ? 256  ASP A CA  1 
ATOM   2315 C  C   . ASP A 1 259 ? 56.130 52.316 18.121  1.00 12.14 ? 256  ASP A C   1 
ATOM   2316 O  O   . ASP A 1 259 ? 55.878 53.504 17.877  1.00 14.71 ? 256  ASP A O   1 
ATOM   2317 C  CB  A ASP A 1 259 ? 56.201 52.082 20.584  0.70 12.71 ? 256  ASP A CB  1 
ATOM   2318 C  CB  B ASP A 1 259 ? 55.822 52.191 20.660  0.30 12.89 ? 256  ASP A CB  1 
ATOM   2319 C  CG  A ASP A 1 259 ? 55.442 51.745 21.854  0.70 14.57 ? 256  ASP A CG  1 
ATOM   2320 C  CG  B ASP A 1 259 ? 57.319 52.138 20.937  0.30 14.39 ? 256  ASP A CG  1 
ATOM   2321 O  OD1 A ASP A 1 259 ? 54.208 51.487 21.785  0.70 20.85 ? 256  ASP A OD1 1 
ATOM   2322 O  OD1 B ASP A 1 259 ? 58.125 51.691 20.094  0.30 18.73 ? 256  ASP A OD1 1 
ATOM   2323 O  OD2 A ASP A 1 259 ? 56.075 51.804 22.933  0.70 21.51 ? 256  ASP A OD2 1 
ATOM   2324 O  OD2 B ASP A 1 259 ? 57.683 52.581 22.060  0.30 19.34 ? 256  ASP A OD2 1 
ATOM   2325 N  N   . TRP A 1 260 ? 56.945 51.589 17.367  1.00 11.06 ? 257  TRP A N   1 
ATOM   2326 C  CA  . TRP A 1 260 ? 57.603 52.105 16.164  1.00 10.62 ? 257  TRP A CA  1 
ATOM   2327 C  C   . TRP A 1 260 ? 56.753 51.999 14.897  1.00 10.15 ? 257  TRP A C   1 
ATOM   2328 O  O   . TRP A 1 260 ? 57.221 52.359 13.793  1.00 10.49 ? 257  TRP A O   1 
ATOM   2329 C  CB  . TRP A 1 260 ? 58.987 51.495 16.006  1.00 10.47 ? 257  TRP A CB  1 
ATOM   2330 C  CG  . TRP A 1 260 ? 59.110 50.013 16.250  1.00 10.41 ? 257  TRP A CG  1 
ATOM   2331 C  CD1 . TRP A 1 260 ? 59.631 49.440 17.361  1.00 12.49 ? 257  TRP A CD1 1 
ATOM   2332 C  CD2 . TRP A 1 260 ? 58.767 48.906 15.370  1.00 10.77 ? 257  TRP A CD2 1 
ATOM   2333 N  NE1 . TRP A 1 260 ? 59.629 48.064 17.251  1.00 13.69 ? 257  TRP A NE1 1 
ATOM   2334 C  CE2 . TRP A 1 260 ? 59.125 47.713 16.028  1.00 12.74 ? 257  TRP A CE2 1 
ATOM   2335 C  CE3 . TRP A 1 260 ? 58.225 48.823 14.070  1.00 10.75 ? 257  TRP A CE3 1 
ATOM   2336 C  CZ2 . TRP A 1 260 ? 58.913 46.457 15.463  1.00 12.49 ? 257  TRP A CZ2 1 
ATOM   2337 C  CZ3 . TRP A 1 260 ? 58.059 47.575 13.502  1.00 13.02 ? 257  TRP A CZ3 1 
ATOM   2338 C  CH2 . TRP A 1 260 ? 58.417 46.419 14.199  1.00 12.34 ? 257  TRP A CH2 1 
ATOM   2339 N  N   . VAL A 1 261 ? 55.517 51.567 15.047  1.00 10.47 ? 258  VAL A N   1 
ATOM   2340 C  CA  . VAL A 1 261 ? 54.532 51.552 13.946  1.00 10.06 ? 258  VAL A CA  1 
ATOM   2341 C  C   . VAL A 1 261 ? 53.439 52.612 14.259  1.00 10.50 ? 258  VAL A C   1 
ATOM   2342 O  O   . VAL A 1 261 ? 52.633 52.449 15.187  1.00 11.48 ? 258  VAL A O   1 
ATOM   2343 C  CB  . VAL A 1 261 ? 53.829 50.198 13.818  1.00 10.15 ? 258  VAL A CB  1 
ATOM   2344 C  CG1 . VAL A 1 261 ? 52.740 50.209 12.671  1.00 12.13 ? 258  VAL A CG1 1 
ATOM   2345 C  CG2 . VAL A 1 261 ? 54.870 49.075 13.562  1.00 12.41 ? 258  VAL A CG2 1 
ATOM   2346 N  N   . GLY A 1 262 ? 53.479 53.728 13.524  1.00 10.84 ? 259  GLY A N   1 
ATOM   2347 C  CA  . GLY A 1 262 ? 52.459 54.759 13.699  1.00 11.31 ? 259  GLY A CA  1 
ATOM   2348 C  C   . GLY A 1 262 ? 51.134 54.216 13.191  1.00 10.22 ? 259  GLY A C   1 
ATOM   2349 O  O   . GLY A 1 262 ? 51.101 53.470 12.195  1.00 10.51 ? 259  GLY A O   1 
ATOM   2350 N  N   . GLY A 1 263 ? 50.030 54.658 13.799  1.00 11.20 ? 260  GLY A N   1 
ATOM   2351 C  CA  . GLY A 1 263 ? 48.712 54.187 13.359  1.00 11.08 ? 260  GLY A CA  1 
ATOM   2352 C  C   . GLY A 1 263 ? 48.470 54.424 11.865  1.00 11.48 ? 260  GLY A C   1 
ATOM   2353 O  O   . GLY A 1 263 ? 47.954 53.579 11.132  1.00 11.81 ? 260  GLY A O   1 
ATOM   2354 N  N   . ARG A 1 264 ? 48.874 55.578 11.371  1.00 11.32 ? 261  ARG A N   1 
ATOM   2355 C  CA  . ARG A 1 264 ? 48.658 55.942 9.987   1.00 11.29 ? 261  ARG A CA  1 
ATOM   2356 C  C   . ARG A 1 264 ? 49.666 55.282 9.012   1.00 11.01 ? 261  ARG A C   1 
ATOM   2357 O  O   . ARG A 1 264 ? 49.599 55.525 7.798   1.00 11.26 ? 261  ARG A O   1 
ATOM   2358 C  CB  . ARG A 1 264 ? 48.657 57.460 9.802   1.00 11.74 ? 261  ARG A CB  1 
ATOM   2359 C  CG  . ARG A 1 264 ? 49.947 58.143 10.166  1.00 11.58 ? 261  ARG A CG  1 
ATOM   2360 C  CD  . ARG A 1 264 ? 49.737 59.685 10.188  1.00 10.84 ? 261  ARG A CD  1 
ATOM   2361 N  NE  . ARG A 1 264 ? 50.851 60.420 10.762  1.00 9.95  ? 261  ARG A NE  1 
ATOM   2362 C  CZ  . ARG A 1 264 ? 50.977 60.732 12.039  1.00 9.26  ? 261  ARG A CZ  1 
ATOM   2363 N  NH1 . ARG A 1 264 ? 52.069 61.294 12.439  1.00 10.79 ? 261  ARG A NH1 1 
ATOM   2364 N  NH2 . ARG A 1 264 ? 50.027 60.456 12.892  1.00 11.83 ? 261  ARG A NH2 1 
ATOM   2365 N  N   . TYR A 1 265 ? 50.511 54.396 9.571   1.00 10.36 ? 262  TYR A N   1 
ATOM   2366 C  CA  . TYR A 1 265 ? 51.476 53.585 8.844   1.00 10.40 ? 262  TYR A CA  1 
ATOM   2367 C  C   . TYR A 1 265 ? 51.361 52.118 9.222   1.00 10.04 ? 262  TYR A C   1 
ATOM   2368 O  O   . TYR A 1 265 ? 52.334 51.382 9.111   1.00 10.54 ? 262  TYR A O   1 
ATOM   2369 C  CB  . TYR A 1 265 ? 52.929 54.085 9.060   1.00 11.00 ? 262  TYR A CB  1 
ATOM   2370 C  CG  . TYR A 1 265 ? 53.129 55.535 8.647   1.00 9.70  ? 262  TYR A CG  1 
ATOM   2371 C  CD1 . TYR A 1 265 ? 53.303 55.866 7.328   1.00 10.34 ? 262  TYR A CD1 1 
ATOM   2372 C  CD2 . TYR A 1 265 ? 53.193 56.578 9.594   1.00 10.56 ? 262  TYR A CD2 1 
ATOM   2373 C  CE1 . TYR A 1 265 ? 53.422 57.190 6.925   1.00 10.30 ? 262  TYR A CE1 1 
ATOM   2374 C  CE2 . TYR A 1 265 ? 53.369 57.908 9.198   1.00 10.40 ? 262  TYR A CE2 1 
ATOM   2375 C  CZ  . TYR A 1 265 ? 53.501 58.210 7.873   1.00 10.74 ? 262  TYR A CZ  1 
ATOM   2376 O  OH  . TYR A 1 265 ? 53.679 59.510 7.424   1.00 12.16 ? 262  TYR A OH  1 
ATOM   2377 N  N   . SER A 1 266 ? 50.169 51.711 9.663   1.00 10.08 ? 263  SER A N   1 
ATOM   2378 C  CA  . SER A 1 266 ? 50.013 50.429 10.339  1.00 10.01 ? 263  SER A CA  1 
ATOM   2379 C  C   . SER A 1 266 ? 49.337 49.328 9.519   1.00 9.53  ? 263  SER A C   1 
ATOM   2380 O  O   . SER A 1 266 ? 49.333 48.169 9.973   1.00 9.69  ? 263  SER A O   1 
ATOM   2381 C  CB  . SER A 1 266 ? 49.260 50.578 11.657  1.00 11.10 ? 263  SER A CB  1 
ATOM   2382 O  OG  . SER A 1 266 ? 47.887 50.861 11.489  1.00 11.91 ? 263  SER A OG  1 
ATOM   2383 N  N   . LEU A 1 267 ? 48.834 49.599 8.312   1.00 10.16 ? 264  LEU A N   1 
ATOM   2384 C  CA  . LEU A 1 267 ? 48.129 48.520 7.586   1.00 9.50  ? 264  LEU A CA  1 
ATOM   2385 C  C   . LEU A 1 267 ? 49.044 47.338 7.269   1.00 9.38  ? 264  LEU A C   1 
ATOM   2386 O  O   . LEU A 1 267 ? 48.546 46.232 7.054   1.00 10.20 ? 264  LEU A O   1 
ATOM   2387 C  CB  . LEU A 1 267 ? 47.440 49.093 6.331   1.00 10.80 ? 264  LEU A CB  1 
ATOM   2388 C  CG  . LEU A 1 267 ? 48.322 49.485 5.147   1.00 10.06 ? 264  LEU A CG  1 
ATOM   2389 C  CD1 . LEU A 1 267 ? 48.734 48.312 4.261   1.00 11.10 ? 264  LEU A CD1 1 
ATOM   2390 C  CD2 . LEU A 1 267 ? 47.556 50.586 4.279   1.00 12.08 ? 264  LEU A CD2 1 
ATOM   2391 N  N   . TRP A 1 268 ? 50.354 47.576 7.256   1.00 9.32  ? 265  TRP A N   1 
ATOM   2392 C  CA  . TRP A 1 268 ? 51.369 46.558 6.939   1.00 8.96  ? 265  TRP A CA  1 
ATOM   2393 C  C   . TRP A 1 268 ? 51.605 45.567 8.100   1.00 9.56  ? 265  TRP A C   1 
ATOM   2394 O  O   . TRP A 1 268 ? 52.295 44.579 7.905   1.00 9.93  ? 265  TRP A O   1 
ATOM   2395 C  CB  . TRP A 1 268 ? 52.696 47.220 6.586   1.00 8.93  ? 265  TRP A CB  1 
ATOM   2396 C  CG  . TRP A 1 268 ? 52.564 48.475 5.756   1.00 9.10  ? 265  TRP A CG  1 
ATOM   2397 C  CD1 . TRP A 1 268 ? 52.558 49.758 6.210   1.00 9.87  ? 265  TRP A CD1 1 
ATOM   2398 C  CD2 . TRP A 1 268 ? 52.358 48.544 4.337   1.00 8.94  ? 265  TRP A CD2 1 
ATOM   2399 N  NE1 . TRP A 1 268 ? 52.337 50.644 5.172   1.00 9.91  ? 265  TRP A NE1 1 
ATOM   2400 C  CE2 . TRP A 1 268 ? 52.229 49.906 4.002   1.00 9.19  ? 265  TRP A CE2 1 
ATOM   2401 C  CE3 . TRP A 1 268 ? 52.264 47.576 3.324   1.00 9.48  ? 265  TRP A CE3 1 
ATOM   2402 C  CZ2 . TRP A 1 268 ? 52.041 50.331 2.694   1.00 9.86  ? 265  TRP A CZ2 1 
ATOM   2403 C  CZ3 . TRP A 1 268 ? 52.035 48.008 2.050   1.00 9.83  ? 265  TRP A CZ3 1 
ATOM   2404 C  CH2 . TRP A 1 268 ? 51.959 49.363 1.726   1.00 10.33 ? 265  TRP A CH2 1 
ATOM   2405 N  N   . SER A 1 269 ? 51.130 45.953 9.298   1.00 9.97  ? 266  SER A N   1 
ATOM   2406 C  CA  . SER A 1 269 ? 51.330 45.198 10.540  1.00 9.55  ? 266  SER A CA  1 
ATOM   2407 C  C   . SER A 1 269 ? 50.168 44.240 10.782  1.00 9.73  ? 266  SER A C   1 
ATOM   2408 O  O   . SER A 1 269 ? 49.333 44.018 9.870   1.00 9.88  ? 266  SER A O   1 
ATOM   2409 C  CB  . SER A 1 269 ? 51.455 46.169 11.682  1.00 8.86  ? 266  SER A CB  1 
ATOM   2410 O  OG  . SER A 1 269 ? 50.191 46.756 12.057  1.00 10.33 ? 266  SER A OG  1 
ATOM   2411 N  N   . SER A 1 270 ? 50.068 43.694 11.984  1.00 9.43  ? 267  SER A N   1 
ATOM   2412 C  CA  . SER A 1 270 ? 48.911 42.874 12.318  1.00 9.73  ? 267  SER A CA  1 
ATOM   2413 C  C   . SER A 1 270 ? 47.571 43.614 12.195  1.00 10.12 ? 267  SER A C   1 
ATOM   2414 O  O   . SER A 1 270 ? 46.532 42.997 12.068  1.00 10.05 ? 267  SER A O   1 
ATOM   2415 C  CB  . SER A 1 270 ? 49.066 42.309 13.712  1.00 10.26 ? 267  SER A CB  1 
ATOM   2416 O  OG  . SER A 1 270 ? 50.197 41.457 13.759  1.00 11.59 ? 267  SER A OG  1 
ATOM   2417 N  N   . ILE A 1 271 ? 47.623 44.946 12.261  1.00 10.44 ? 268  ILE A N   1 
ATOM   2418 C  CA  . ILE A 1 271 ? 46.445 45.789 12.052  1.00 11.93 ? 268  ILE A CA  1 
ATOM   2419 C  C   . ILE A 1 271 ? 45.824 45.486 10.693  1.00 13.03 ? 268  ILE A C   1 
ATOM   2420 O  O   . ILE A 1 271 ? 44.583 45.617 10.528  1.00 14.81 ? 268  ILE A O   1 
ATOM   2421 C  CB  . ILE A 1 271 ? 46.810 47.297 12.162  1.00 12.40 ? 268  ILE A CB  1 
ATOM   2422 C  CG1 . ILE A 1 271 ? 47.090 47.629 13.632  1.00 13.86 ? 268  ILE A CG1 1 
ATOM   2423 C  CG2 . ILE A 1 271 ? 45.697 48.221 11.550  1.00 13.23 ? 268  ILE A CG2 1 
ATOM   2424 C  CD1 . ILE A 1 271 ? 45.866 47.656 14.545  1.00 16.49 ? 268  ILE A CD1 1 
ATOM   2425 N  N   . GLY A 1 272 ? 46.632 45.068 9.720   1.00 12.16 ? 269  GLY A N   1 
ATOM   2426 C  CA  . GLY A 1 272 ? 46.121 44.711 8.394   1.00 12.64 ? 269  GLY A CA  1 
ATOM   2427 C  C   . GLY A 1 272 ? 45.475 43.346 8.277   1.00 12.26 ? 269  GLY A C   1 
ATOM   2428 O  O   . GLY A 1 272 ? 45.220 42.856 7.177   1.00 13.37 ? 269  GLY A O   1 
HETATM 2429 N  N   . MSE A 1 273 ? 45.251 42.618 9.382   1.00 10.53 ? 270  MSE A N   1 
HETATM 2430 C  CA  . MSE A 1 273 ? 44.764 41.261 9.252   1.00 11.24 ? 270  MSE A CA  1 
HETATM 2431 C  C   . MSE A 1 273 ? 43.454 41.177 8.476   1.00 9.62  ? 270  MSE A C   1 
HETATM 2432 O  O   . MSE A 1 273 ? 43.232 40.216 7.777   1.00 9.36  ? 270  MSE A O   1 
HETATM 2433 C  CB  . MSE A 1 273 ? 44.661 40.563 10.598  1.00 11.57 ? 270  MSE A CB  1 
HETATM 2434 C  CG  . MSE A 1 273 ? 43.702 41.126 11.551  1.00 12.04 ? 270  MSE A CG  1 
HETATM 2435 SE SE  . MSE A 1 273 ? 43.415 40.047 13.167  0.70 13.67 ? 270  MSE A SE  1 
HETATM 2436 C  CE  . MSE A 1 273 ? 45.281 39.933 13.746  1.00 14.55 ? 270  MSE A CE  1 
ATOM   2437 N  N   . SER A 1 274 ? 42.572 42.160 8.655   1.00 9.47  ? 271  SER A N   1 
ATOM   2438 C  CA  . SER A 1 274 ? 41.330 42.171 7.865   1.00 10.25 ? 271  SER A CA  1 
ATOM   2439 C  C   . SER A 1 274 ? 41.578 42.137 6.343   1.00 10.38 ? 271  SER A C   1 
ATOM   2440 O  O   . SER A 1 274 ? 40.740 41.620 5.593   1.00 10.17 ? 271  SER A O   1 
ATOM   2441 C  CB  . SER A 1 274 ? 40.404 43.299 8.257   1.00 11.18 ? 271  SER A CB  1 
ATOM   2442 O  OG  . SER A 1 274 ? 41.025 44.552 8.127   1.00 12.76 ? 271  SER A OG  1 
ATOM   2443 N  N   . ILE A 1 275 ? 42.686 42.714 5.875   1.00 10.09 ? 272  ILE A N   1 
ATOM   2444 C  CA  . ILE A 1 275 ? 43.075 42.597 4.461   1.00 10.32 ? 272  ILE A CA  1 
ATOM   2445 C  C   . ILE A 1 275 ? 43.279 41.132 4.138   1.00 9.49  ? 272  ILE A C   1 
ATOM   2446 O  O   . ILE A 1 275 ? 42.738 40.617 3.143   1.00 10.38 ? 272  ILE A O   1 
ATOM   2447 C  CB  . ILE A 1 275 ? 44.351 43.398 4.137   1.00 10.05 ? 272  ILE A CB  1 
ATOM   2448 C  CG1 . ILE A 1 275 ? 44.141 44.895 4.403   1.00 10.05 ? 272  ILE A CG1 1 
ATOM   2449 C  CG2 . ILE A 1 275 ? 44.784 43.098 2.714   1.00 11.55 ? 272  ILE A CG2 1 
ATOM   2450 C  CD1 . ILE A 1 275 ? 45.420 45.719 4.481   1.00 10.69 ? 272  ILE A CD1 1 
ATOM   2451 N  N   . ALA A 1 276 ? 44.100 40.434 4.907   1.00 9.26  ? 273  ALA A N   1 
ATOM   2452 C  CA  . ALA A 1 276 ? 44.344 38.994 4.686   1.00 9.57  ? 273  ALA A CA  1 
ATOM   2453 C  C   . ALA A 1 276 ? 43.070 38.144 4.757   1.00 9.53  ? 273  ALA A C   1 
ATOM   2454 O  O   . ALA A 1 276 ? 42.910 37.129 4.053   1.00 11.08 ? 273  ALA A O   1 
ATOM   2455 C  CB  . ALA A 1 276 ? 45.458 38.450 5.640   1.00 10.55 ? 273  ALA A CB  1 
ATOM   2456 N  N   . PHE A 1 277 ? 42.160 38.520 5.656   1.00 10.23 ? 274  PHE A N   1 
ATOM   2457 C  CA  . PHE A 1 277 ? 40.890 37.810 5.746   1.00 9.67  ? 274  PHE A CA  1 
ATOM   2458 C  C   . PHE A 1 277 ? 40.052 37.959 4.474   1.00 10.74 ? 274  PHE A C   1 
ATOM   2459 O  O   . PHE A 1 277 ? 39.180 37.111 4.240   1.00 13.09 ? 274  PHE A O   1 
ATOM   2460 C  CB  . PHE A 1 277 ? 40.053 38.266 6.954   1.00 9.49  ? 274  PHE A CB  1 
ATOM   2461 C  CG  . PHE A 1 277 ? 40.418 37.623 8.245   1.00 8.18  ? 274  PHE A CG  1 
ATOM   2462 C  CD1 . PHE A 1 277 ? 40.232 36.303 8.455   1.00 9.87  ? 274  PHE A CD1 1 
ATOM   2463 C  CD2 . PHE A 1 277 ? 40.909 38.395 9.294   1.00 10.08 ? 274  PHE A CD2 1 
ATOM   2464 C  CE1 . PHE A 1 277 ? 40.525 35.710 9.692   1.00 9.99  ? 274  PHE A CE1 1 
ATOM   2465 C  CE2 . PHE A 1 277 ? 41.218 37.798 10.525  1.00 10.89 ? 274  PHE A CE2 1 
ATOM   2466 C  CZ  . PHE A 1 277 ? 41.010 36.466 10.720  1.00 11.29 ? 274  PHE A CZ  1 
ATOM   2467 N  N   . ALA A 1 278 ? 40.279 39.013 3.685   1.00 10.39 ? 275  ALA A N   1 
ATOM   2468 C  CA  . ALA A 1 278 ? 39.561 39.191 2.401   1.00 10.45 ? 275  ALA A CA  1 
ATOM   2469 C  C   . ALA A 1 278 ? 40.297 38.537 1.220   1.00 10.58 ? 275  ALA A C   1 
ATOM   2470 O  O   . ALA A 1 278 ? 39.685 37.825 0.424   1.00 11.00 ? 275  ALA A O   1 
ATOM   2471 C  CB  . ALA A 1 278 ? 39.325 40.681 2.122   1.00 10.56 ? 275  ALA A CB  1 
ATOM   2472 N  N   . ILE A 1 279 ? 41.609 38.791 1.121   1.00 9.69  ? 276  ILE A N   1 
ATOM   2473 C  CA  . ILE A 1 279 ? 42.390 38.431 -0.074  1.00 9.80  ? 276  ILE A CA  1 
ATOM   2474 C  C   . ILE A 1 279 ? 43.357 37.260 0.118   1.00 9.97  ? 276  ILE A C   1 
ATOM   2475 O  O   . ILE A 1 279 ? 43.971 36.813 -0.851  1.00 10.17 ? 276  ILE A O   1 
ATOM   2476 C  CB  . ILE A 1 279 ? 43.155 39.623 -0.683  1.00 10.12 ? 276  ILE A CB  1 
ATOM   2477 C  CG1 . ILE A 1 279 ? 44.322 40.054 0.221   1.00 10.99 ? 276  ILE A CG1 1 
ATOM   2478 C  CG2 . ILE A 1 279 ? 42.156 40.764 -1.071  1.00 13.44 ? 276  ILE A CG2 1 
ATOM   2479 C  CD1 . ILE A 1 279 ? 45.194 41.278 -0.314  1.00 13.16 ? 276  ILE A CD1 1 
ATOM   2480 N  N   . GLY A 1 280 ? 43.384 36.673 1.314   1.00 9.97  ? 277  GLY A N   1 
ATOM   2481 C  CA  . GLY A 1 280 ? 44.297 35.602 1.682   1.00 9.97  ? 277  GLY A CA  1 
ATOM   2482 C  C   . GLY A 1 280 ? 45.681 36.125 2.033   1.00 9.99  ? 277  GLY A C   1 
ATOM   2483 O  O   . GLY A 1 280 ? 46.101 37.206 1.639   1.00 10.14 ? 277  GLY A O   1 
ATOM   2484 N  N   . TYR A 1 281 ? 46.413 35.332 2.785   1.00 9.93  ? 278  TYR A N   1 
ATOM   2485 C  CA  . TYR A 1 281 ? 47.710 35.745 3.261   1.00 10.29 ? 278  TYR A CA  1 
ATOM   2486 C  C   . TYR A 1 281 ? 48.729 35.856 2.125   1.00 10.05 ? 278  TYR A C   1 
ATOM   2487 O  O   . TYR A 1 281 ? 49.594 36.723 2.180   1.00 11.35 ? 278  TYR A O   1 
ATOM   2488 C  CB  . TYR A 1 281 ? 48.215 34.885 4.457   1.00 10.32 ? 278  TYR A CB  1 
ATOM   2489 C  CG  . TYR A 1 281 ? 49.138 35.700 5.336   1.00 9.92  ? 278  TYR A CG  1 
ATOM   2490 C  CD1 . TYR A 1 281 ? 48.634 36.503 6.336   1.00 10.62 ? 278  TYR A CD1 1 
ATOM   2491 C  CD2 . TYR A 1 281 ? 50.510 35.738 5.110   1.00 9.54  ? 278  TYR A CD2 1 
ATOM   2492 C  CE1 . TYR A 1 281 ? 49.458 37.353 7.055   1.00 11.48 ? 278  TYR A CE1 1 
ATOM   2493 C  CE2 . TYR A 1 281 ? 51.353 36.588 5.850   1.00 10.97 ? 278  TYR A CE2 1 
ATOM   2494 C  CZ  . TYR A 1 281 ? 50.835 37.398 6.787   1.00 10.03 ? 278  TYR A CZ  1 
ATOM   2495 O  OH  . TYR A 1 281 ? 51.656 38.285 7.472   1.00 11.37 ? 278  TYR A OH  1 
ATOM   2496 N  N   . ASP A 1 282 ? 48.657 34.998 1.093   1.00 10.90 ? 279  ASP A N   1 
ATOM   2497 C  CA  A ASP A 1 282 ? 49.610 35.065 -0.016  0.70 10.45 ? 279  ASP A CA  1 
ATOM   2498 C  CA  B ASP A 1 282 ? 49.644 35.088 0.011   0.30 10.70 ? 279  ASP A CA  1 
ATOM   2499 C  C   . ASP A 1 282 ? 49.526 36.434 -0.687  1.00 10.08 ? 279  ASP A C   1 
ATOM   2500 O  O   . ASP A 1 282 ? 50.531 37.070 -0.995  1.00 10.31 ? 279  ASP A O   1 
ATOM   2501 C  CB  A ASP A 1 282 ? 49.343 33.960 -1.054  0.70 11.93 ? 279  ASP A CB  1 
ATOM   2502 C  CB  B ASP A 1 282 ? 49.543 33.936 -0.996  0.30 11.41 ? 279  ASP A CB  1 
ATOM   2503 C  CG  A ASP A 1 282 ? 49.818 32.572 -0.626  0.70 15.96 ? 279  ASP A CG  1 
ATOM   2504 C  CG  B ASP A 1 282 ? 50.645 33.992 -2.066  0.30 14.43 ? 279  ASP A CG  1 
ATOM   2505 O  OD1 A ASP A 1 282 ? 50.574 32.408 0.368   0.70 20.35 ? 279  ASP A OD1 1 
ATOM   2506 O  OD1 B ASP A 1 282 ? 51.839 33.972 -1.700  0.30 16.09 ? 279  ASP A OD1 1 
ATOM   2507 O  OD2 A ASP A 1 282 ? 49.464 31.609 -1.370  0.70 22.85 ? 279  ASP A OD2 1 
ATOM   2508 O  OD2 B ASP A 1 282 ? 50.334 34.074 -3.276  0.30 17.72 ? 279  ASP A OD2 1 
ATOM   2509 N  N   . ASN A 1 283 ? 48.301 36.923 -0.899  1.00 10.20 ? 280  ASN A N   1 
ATOM   2510 C  CA  . ASN A 1 283 ? 48.122 38.255 -1.487  1.00 9.76  ? 280  ASN A CA  1 
ATOM   2511 C  C   . ASN A 1 283 ? 48.549 39.384 -0.563  1.00 9.67  ? 280  ASN A C   1 
ATOM   2512 O  O   . ASN A 1 283 ? 49.062 40.404 -1.029  1.00 9.96  ? 280  ASN A O   1 
ATOM   2513 C  CB  . ASN A 1 283 ? 46.699 38.433 -2.015  1.00 9.86  ? 280  ASN A CB  1 
ATOM   2514 C  CG  . ASN A 1 283 ? 46.465 37.726 -3.321  1.00 9.00  ? 280  ASN A CG  1 
ATOM   2515 O  OD1 . ASN A 1 283 ? 47.350 37.687 -4.200  1.00 11.02 ? 280  ASN A OD1 1 
ATOM   2516 N  ND2 . ASN A 1 283 ? 45.226 37.263 -3.514  1.00 9.89  ? 280  ASN A ND2 1 
ATOM   2517 N  N   . PHE A 1 284 ? 48.380 39.188 0.751   1.00 9.99  ? 281  PHE A N   1 
ATOM   2518 C  CA  . PHE A 1 284 ? 48.874 40.175 1.710   1.00 10.04 ? 281  PHE A CA  1 
ATOM   2519 C  C   . PHE A 1 284 ? 50.405 40.253 1.588   1.00 10.36 ? 281  PHE A C   1 
ATOM   2520 O  O   . PHE A 1 284 ? 50.994 41.339 1.622   1.00 9.27  ? 281  PHE A O   1 
ATOM   2521 C  CB  . PHE A 1 284 ? 48.406 39.835 3.143   1.00 10.37 ? 281  PHE A CB  1 
ATOM   2522 C  CG  . PHE A 1 284 ? 48.842 40.860 4.153   1.00 9.22  ? 281  PHE A CG  1 
ATOM   2523 C  CD1 . PHE A 1 284 ? 48.191 42.064 4.240   1.00 11.12 ? 281  PHE A CD1 1 
ATOM   2524 C  CD2 . PHE A 1 284 ? 49.896 40.607 5.054   1.00 11.06 ? 281  PHE A CD2 1 
ATOM   2525 C  CE1 . PHE A 1 284 ? 48.568 43.015 5.160   1.00 12.41 ? 281  PHE A CE1 1 
ATOM   2526 C  CE2 . PHE A 1 284 ? 50.294 41.564 5.974   1.00 12.12 ? 281  PHE A CE2 1 
ATOM   2527 C  CZ  . PHE A 1 284 ? 49.647 42.755 5.999   1.00 11.18 ? 281  PHE A CZ  1 
ATOM   2528 N  N   . GLU A 1 285 ? 51.072 39.105 1.441   1.00 10.24 ? 282  GLU A N   1 
ATOM   2529 C  CA  A GLU A 1 285 ? 52.528 39.105 1.235   0.60 10.56 ? 282  GLU A CA  1 
ATOM   2530 C  CA  B GLU A 1 285 ? 52.524 39.085 1.232   0.40 10.99 ? 282  GLU A CA  1 
ATOM   2531 C  C   . GLU A 1 285 ? 52.932 39.852 -0.030  1.00 10.39 ? 282  GLU A C   1 
ATOM   2532 O  O   . GLU A 1 285 ? 53.964 40.538 -0.045  1.00 10.78 ? 282  GLU A O   1 
ATOM   2533 C  CB  A GLU A 1 285 ? 53.123 37.720 1.202   0.60 10.91 ? 282  GLU A CB  1 
ATOM   2534 C  CB  B GLU A 1 285 ? 53.071 37.664 1.196   0.40 11.80 ? 282  GLU A CB  1 
ATOM   2535 C  CG  A GLU A 1 285 ? 53.099 36.972 2.530   0.60 13.27 ? 282  GLU A CG  1 
ATOM   2536 C  CG  B GLU A 1 285 ? 52.979 36.935 2.536   0.40 15.38 ? 282  GLU A CG  1 
ATOM   2537 C  CD  A GLU A 1 285 ? 54.343 37.181 3.396   0.60 14.31 ? 282  GLU A CD  1 
ATOM   2538 C  CD  B GLU A 1 285 ? 53.331 35.448 2.471   0.40 19.39 ? 282  GLU A CD  1 
ATOM   2539 O  OE1 A GLU A 1 285 ? 55.080 38.179 3.247   0.60 16.21 ? 282  GLU A OE1 1 
ATOM   2540 O  OE1 B GLU A 1 285 ? 53.384 34.842 1.376   0.40 24.40 ? 282  GLU A OE1 1 
ATOM   2541 O  OE2 A GLU A 1 285 ? 54.569 36.329 4.245   0.60 13.35 ? 282  GLU A OE2 1 
ATOM   2542 O  OE2 B GLU A 1 285 ? 53.507 34.867 3.539   0.40 22.45 ? 282  GLU A OE2 1 
ATOM   2543 N  N   . LYS A 1 286 ? 52.119 39.742 -1.095  1.00 9.46  ? 283  LYS A N   1 
ATOM   2544 C  CA  . LYS A 1 286 ? 52.409 40.467 -2.325  1.00 8.60  ? 283  LYS A CA  1 
ATOM   2545 C  C   . LYS A 1 286 ? 52.284 42.000 -2.123  1.00 8.94  ? 283  LYS A C   1 
ATOM   2546 O  O   . LYS A 1 286 ? 53.093 42.752 -2.677  1.00 9.26  ? 283  LYS A O   1 
ATOM   2547 C  CB  . LYS A 1 286 ? 51.506 39.994 -3.487  1.00 8.82  ? 283  LYS A CB  1 
ATOM   2548 C  CG  . LYS A 1 286 ? 51.792 38.542 -3.946  1.00 11.18 ? 283  LYS A CG  1 
ATOM   2549 C  CD  . LYS A 1 286 ? 50.821 38.045 -5.006  1.00 13.90 ? 283  LYS A CD  1 
ATOM   2550 C  CE  . LYS A 1 286 ? 51.092 36.619 -5.443  1.00 21.75 ? 283  LYS A CE  1 
ATOM   2551 N  NZ  . LYS A 1 286 ? 52.272 36.562 -6.250  1.00 25.94 ? 283  LYS A NZ  1 
ATOM   2552 N  N   . LEU A 1 287 ? 51.256 42.403 -1.388  1.00 8.87  ? 284  LEU A N   1 
ATOM   2553 C  CA  . LEU A 1 287 ? 51.113 43.822 -0.980  1.00 9.56  ? 284  LEU A CA  1 
ATOM   2554 C  C   . LEU A 1 287 ? 52.390 44.334 -0.294  1.00 8.69  ? 284  LEU A C   1 
ATOM   2555 O  O   . LEU A 1 287 ? 52.932 45.392 -0.661  1.00 9.84  ? 284  LEU A O   1 
ATOM   2556 C  CB  . LEU A 1 287 ? 49.866 43.959 -0.089  1.00 9.45  ? 284  LEU A CB  1 
ATOM   2557 C  CG  . LEU A 1 287 ? 49.571 45.353 0.483   1.00 10.08 ? 284  LEU A CG  1 
ATOM   2558 C  CD1 . LEU A 1 287 ? 48.988 46.316 -0.522  1.00 11.80 ? 284  LEU A CD1 1 
ATOM   2559 C  CD2 . LEU A 1 287 ? 48.678 45.210 1.711   1.00 11.72 ? 284  LEU A CD2 1 
ATOM   2560 N  N   . LEU A 1 288 ? 52.864 43.559 0.687   1.00 9.29  ? 285  LEU A N   1 
ATOM   2561 C  CA  A LEU A 1 288 ? 54.104 43.888 1.413   0.60 9.43  ? 285  LEU A CA  1 
ATOM   2562 C  CA  B LEU A 1 288 ? 54.058 43.992 1.381   0.40 9.15  ? 285  LEU A CA  1 
ATOM   2563 C  C   . LEU A 1 288 ? 55.305 43.996 0.473   1.00 9.20  ? 285  LEU A C   1 
ATOM   2564 O  O   . LEU A 1 288 ? 56.140 44.906 0.563   1.00 9.52  ? 285  LEU A O   1 
ATOM   2565 C  CB  A LEU A 1 288 ? 54.413 42.862 2.523   0.60 9.89  ? 285  LEU A CB  1 
ATOM   2566 C  CB  B LEU A 1 288 ? 54.241 43.204 2.673   0.40 8.56  ? 285  LEU A CB  1 
ATOM   2567 C  CG  A LEU A 1 288 ? 53.463 42.721 3.721   0.60 9.15  ? 285  LEU A CG  1 
ATOM   2568 C  CG  B LEU A 1 288 ? 53.470 43.698 3.906   0.40 8.50  ? 285  LEU A CG  1 
ATOM   2569 C  CD1 A LEU A 1 288 ? 53.818 41.532 4.569   0.60 11.26 ? 285  LEU A CD1 1 
ATOM   2570 C  CD1 B LEU A 1 288 ? 51.959 43.794 3.728   0.40 8.35  ? 285  LEU A CD1 1 
ATOM   2571 C  CD2 A LEU A 1 288 ? 53.414 44.002 4.574   0.60 14.23 ? 285  LEU A CD2 1 
ATOM   2572 C  CD2 B LEU A 1 288 ? 53.807 42.761 5.081   0.40 8.97  ? 285  LEU A CD2 1 
ATOM   2573 N  N   . ALA A 1 289 ? 55.407 43.020 -0.425  1.00 8.71  ? 286  ALA A N   1 
ATOM   2574 C  CA  . ALA A 1 289 ? 56.518 42.974 -1.344  1.00 8.44  ? 286  ALA A CA  1 
ATOM   2575 C  C   . ALA A 1 289 ? 56.556 44.166 -2.285  1.00 9.39  ? 286  ALA A C   1 
ATOM   2576 O  O   . ALA A 1 289 ? 57.634 44.673 -2.647  1.00 9.87  ? 286  ALA A O   1 
ATOM   2577 C  CB  . ALA A 1 289 ? 56.498 41.640 -2.133  1.00 9.33  ? 286  ALA A CB  1 
ATOM   2578 N  N   . GLY A 1 290 ? 55.373 44.628 -2.701  1.00 9.71  ? 287  GLY A N   1 
ATOM   2579 C  CA  . GLY A 1 290 ? 55.332 45.837 -3.533  1.00 9.69  ? 287  GLY A CA  1 
ATOM   2580 C  C   . GLY A 1 290 ? 55.852 47.062 -2.812  1.00 8.44  ? 287  GLY A C   1 
ATOM   2581 O  O   . GLY A 1 290 ? 56.612 47.865 -3.377  1.00 9.02  ? 287  GLY A O   1 
ATOM   2582 N  N   . ALA A 1 291 ? 55.466 47.217 -1.544  1.00 9.59  ? 288  ALA A N   1 
ATOM   2583 C  CA  . ALA A 1 291 ? 55.989 48.269 -0.724  1.00 9.21  ? 288  ALA A CA  1 
ATOM   2584 C  C   . ALA A 1 291 ? 57.522 48.138 -0.542  1.00 9.73  ? 288  ALA A C   1 
ATOM   2585 O  O   . ALA A 1 291 ? 58.233 49.133 -0.682  1.00 9.19  ? 288  ALA A O   1 
ATOM   2586 C  CB  . ALA A 1 291 ? 55.317 48.277 0.666   1.00 10.33 ? 288  ALA A CB  1 
ATOM   2587 N  N   . TYR A 1 292 ? 58.010 46.931 -0.283  1.00 9.47  ? 289  TYR A N   1 
ATOM   2588 C  CA  . TYR A 1 292 ? 59.458 46.730 -0.153  1.00 9.56  ? 289  TYR A CA  1 
ATOM   2589 C  C   . TYR A 1 292 ? 60.174 47.235 -1.416  1.00 9.07  ? 289  TYR A C   1 
ATOM   2590 O  O   . TYR A 1 292 ? 61.260 47.826 -1.358  1.00 10.13 ? 289  TYR A O   1 
ATOM   2591 C  CB  . TYR A 1 292 ? 59.797 45.260 0.095   1.00 9.43  ? 289  TYR A CB  1 
ATOM   2592 C  CG  . TYR A 1 292 ? 61.284 45.048 0.111   1.00 9.01  ? 289  TYR A CG  1 
ATOM   2593 C  CD1 . TYR A 1 292 ? 62.048 45.502 1.177   1.00 11.53 ? 289  TYR A CD1 1 
ATOM   2594 C  CD2 . TYR A 1 292 ? 61.940 44.536 -0.984  1.00 10.88 ? 289  TYR A CD2 1 
ATOM   2595 C  CE1 . TYR A 1 292 ? 63.456 45.422 1.164   1.00 12.30 ? 289  TYR A CE1 1 
ATOM   2596 C  CE2 . TYR A 1 292 ? 63.327 44.428 -1.005  1.00 12.32 ? 289  TYR A CE2 1 
ATOM   2597 C  CZ  . TYR A 1 292 ? 64.086 44.881 0.070   1.00 11.70 ? 289  TYR A CZ  1 
ATOM   2598 O  OH  . TYR A 1 292 ? 65.457 44.773 0.082   1.00 13.96 ? 289  TYR A OH  1 
ATOM   2599 N  N   . SER A 1 293 ? 59.589 46.934 -2.589  1.00 9.12  ? 290  SER A N   1 
ATOM   2600 C  CA  . SER A 1 293 ? 60.252 47.323 -3.845  1.00 9.67  ? 290  SER A CA  1 
ATOM   2601 C  C   . SER A 1 293 ? 60.538 48.821 -3.839  1.00 10.10 ? 290  SER A C   1 
ATOM   2602 O  O   . SER A 1 293 ? 61.597 49.283 -4.290  1.00 10.62 ? 290  SER A O   1 
ATOM   2603 C  CB  . SER A 1 293 ? 59.493 46.857 -5.102  1.00 10.72 ? 290  SER A CB  1 
ATOM   2604 O  OG  . SER A 1 293 ? 58.368 47.692 -5.420  1.00 11.39 ? 290  SER A OG  1 
ATOM   2605 N  N   . VAL A 1 294 ? 59.560 49.601 -3.380  1.00 9.46  ? 291  VAL A N   1 
ATOM   2606 C  CA  . VAL A 1 294 ? 59.669 51.058 -3.334  1.00 8.56  ? 291  VAL A CA  1 
ATOM   2607 C  C   . VAL A 1 294 ? 60.589 51.496 -2.204  1.00 9.23  ? 291  VAL A C   1 
ATOM   2608 O  O   . VAL A 1 294 ? 61.348 52.466 -2.359  1.00 9.84  ? 291  VAL A O   1 
ATOM   2609 C  CB  . VAL A 1 294 ? 58.278 51.683 -3.247  1.00 8.52  ? 291  VAL A CB  1 
ATOM   2610 C  CG1 . VAL A 1 294 ? 58.337 53.176 -2.785  1.00 9.47  ? 291  VAL A CG1 1 
ATOM   2611 C  CG2 . VAL A 1 294 ? 57.565 51.517 -4.627  1.00 10.81 ? 291  VAL A CG2 1 
ATOM   2612 N  N   . ASP A 1 295 ? 60.570 50.788 -1.072  1.00 9.40  ? 292  ASP A N   1 
ATOM   2613 C  CA  . ASP A 1 295 ? 61.512 51.086 0.010   1.00 8.99  ? 292  ASP A CA  1 
ATOM   2614 C  C   . ASP A 1 295 ? 62.967 50.970 -0.498  1.00 9.66  ? 292  ASP A C   1 
ATOM   2615 O  O   . ASP A 1 295 ? 63.797 51.841 -0.199  1.00 10.10 ? 292  ASP A O   1 
ATOM   2616 C  CB  . ASP A 1 295 ? 61.356 50.107 1.182   1.00 9.07  ? 292  ASP A CB  1 
ATOM   2617 C  CG  . ASP A 1 295 ? 60.054 50.249 1.929   1.00 9.37  ? 292  ASP A CG  1 
ATOM   2618 O  OD1 . ASP A 1 295 ? 59.368 51.302 1.814   1.00 10.16 ? 292  ASP A OD1 1 
ATOM   2619 O  OD2 . ASP A 1 295 ? 59.693 49.289 2.665   1.00 10.94 ? 292  ASP A OD2 1 
ATOM   2620 N  N   . LYS A 1 296 ? 63.263 49.904 -1.253  1.00 9.91  ? 293  LYS A N   1 
ATOM   2621 C  CA  . LYS A 1 296 ? 64.613 49.695 -1.792  1.00 10.38 ? 293  LYS A CA  1 
ATOM   2622 C  C   . LYS A 1 296 ? 64.966 50.803 -2.788  1.00 10.82 ? 293  LYS A C   1 
ATOM   2623 O  O   . LYS A 1 296 ? 66.066 51.374 -2.755  1.00 10.84 ? 293  LYS A O   1 
ATOM   2624 C  CB  . LYS A 1 296 ? 64.708 48.327 -2.441  1.00 11.15 ? 293  LYS A CB  1 
ATOM   2625 C  CG  . LYS A 1 296 ? 66.071 47.994 -3.039  1.00 14.00 ? 293  LYS A CG  1 
ATOM   2626 C  CD  . LYS A 1 296 ? 66.116 46.520 -3.502  1.00 15.73 ? 293  LYS A CD  1 
ATOM   2627 C  CE  . LYS A 1 296 ? 67.439 46.169 -4.132  1.00 23.16 ? 293  LYS A CE  1 
ATOM   2628 N  NZ  . LYS A 1 296 ? 68.510 46.132 -3.137  1.00 29.41 ? 293  LYS A NZ  1 
ATOM   2629 N  N   . HIS A 1 297 ? 64.018 51.148 -3.641  1.00 9.96  ? 294  HIS A N   1 
ATOM   2630 C  CA  . HIS A 1 297 ? 64.198 52.273 -4.573  1.00 10.37 ? 294  HIS A CA  1 
ATOM   2631 C  C   . HIS A 1 297 ? 64.544 53.546 -3.829  1.00 9.89  ? 294  HIS A C   1 
ATOM   2632 O  O   . HIS A 1 297 ? 65.484 54.258 -4.178  1.00 11.04 ? 294  HIS A O   1 
ATOM   2633 C  CB  . HIS A 1 297 ? 62.917 52.447 -5.399  1.00 10.26 ? 294  HIS A CB  1 
ATOM   2634 C  CG  . HIS A 1 297 ? 62.898 53.663 -6.264  1.00 11.75 ? 294  HIS A CG  1 
ATOM   2635 N  ND1 . HIS A 1 297 ? 62.294 54.867 -5.929  1.00 14.75 ? 294  HIS A ND1 1 
ATOM   2636 C  CD2 . HIS A 1 297 ? 63.442 53.849 -7.482  1.00 10.50 ? 294  HIS A CD2 1 
ATOM   2637 C  CE1 . HIS A 1 297 ? 62.474 55.731 -6.931  1.00 8.27  ? 294  HIS A CE1 1 
ATOM   2638 N  NE2 . HIS A 1 297 ? 63.128 55.118 -7.889  1.00 15.52 ? 294  HIS A NE2 1 
ATOM   2639 N  N   . PHE A 1 298 ? 63.748 53.869 -2.820  1.00 9.13  ? 295  PHE A N   1 
ATOM   2640 C  CA  . PHE A 1 298 ? 63.893 55.104 -2.092  1.00 10.37 ? 295  PHE A CA  1 
ATOM   2641 C  C   . PHE A 1 298 ? 65.219 55.191 -1.332  1.00 10.31 ? 295  PHE A C   1 
ATOM   2642 O  O   . PHE A 1 298 ? 65.899 56.221 -1.352  1.00 11.02 ? 295  PHE A O   1 
ATOM   2643 C  CB  . PHE A 1 298 ? 62.685 55.225 -1.093  1.00 9.25  ? 295  PHE A CB  1 
ATOM   2644 C  CG  . PHE A 1 298 ? 62.743 56.444 -0.199  1.00 9.60  ? 295  PHE A CG  1 
ATOM   2645 C  CD1 . PHE A 1 298 ? 62.824 57.713 -0.713  1.00 10.36 ? 295  PHE A CD1 1 
ATOM   2646 C  CD2 . PHE A 1 298 ? 62.702 56.310 1.148   1.00 11.31 ? 295  PHE A CD2 1 
ATOM   2647 C  CE1 . PHE A 1 298 ? 62.896 58.829 0.132   1.00 10.09 ? 295  PHE A CE1 1 
ATOM   2648 C  CE2 . PHE A 1 298 ? 62.770 57.373 1.982   1.00 11.26 ? 295  PHE A CE2 1 
ATOM   2649 C  CZ  . PHE A 1 298 ? 62.846 58.659 1.484   1.00 11.31 ? 295  PHE A CZ  1 
ATOM   2650 N  N   . LYS A 1 299 ? 65.563 54.078 -0.673  1.00 10.50 ? 296  LYS A N   1 
ATOM   2651 C  CA  . LYS A 1 299 ? 66.767 53.974 0.157   1.00 11.59 ? 296  LYS A CA  1 
ATOM   2652 C  C   . LYS A 1 299 ? 68.054 54.051 -0.691  1.00 11.60 ? 296  LYS A C   1 
ATOM   2653 O  O   . LYS A 1 299 ? 69.071 54.574 -0.229  1.00 13.82 ? 296  LYS A O   1 
ATOM   2654 C  CB  . LYS A 1 299 ? 66.734 52.634 0.941   1.00 12.76 ? 296  LYS A CB  1 
ATOM   2655 C  CG  . LYS A 1 299 ? 67.801 52.414 2.017   1.00 16.99 ? 296  LYS A CG  1 
ATOM   2656 C  CD  . LYS A 1 299 ? 67.522 51.034 2.645   1.00 22.50 ? 296  LYS A CD  1 
ATOM   2657 C  CE  . LYS A 1 299 ? 68.557 50.594 3.639   1.00 26.23 ? 296  LYS A CE  1 
ATOM   2658 N  NZ  . LYS A 1 299 ? 69.903 50.370 2.980   1.00 28.90 ? 296  LYS A NZ  1 
ATOM   2659 N  N   . GLU A 1 300 ? 68.012 53.553 -1.919  1.00 11.15 ? 297  GLU A N   1 
ATOM   2660 C  CA  . GLU A 1 300 ? 69.236 53.298 -2.675  1.00 11.81 ? 297  GLU A CA  1 
ATOM   2661 C  C   . GLU A 1 300 ? 69.470 54.242 -3.829  1.00 12.32 ? 297  GLU A C   1 
ATOM   2662 O  O   . GLU A 1 300 ? 70.598 54.298 -4.338  1.00 14.21 ? 297  GLU A O   1 
ATOM   2663 C  CB  . GLU A 1 300 ? 69.260 51.859 -3.204  1.00 12.50 ? 297  GLU A CB  1 
ATOM   2664 C  CG  . GLU A 1 300 ? 69.255 50.808 -2.129  1.00 13.44 ? 297  GLU A CG  1 
ATOM   2665 C  CD  . GLU A 1 300 ? 69.449 49.374 -2.675  1.00 18.65 ? 297  GLU A CD  1 
ATOM   2666 O  OE1 . GLU A 1 300 ? 69.327 49.144 -3.902  1.00 20.75 ? 297  GLU A OE1 1 
ATOM   2667 O  OE2 . GLU A 1 300 ? 69.757 48.502 -1.841  1.00 26.54 ? 297  GLU A OE2 1 
ATOM   2668 N  N   . THR A 1 301 ? 68.433 54.961 -4.262  1.00 11.17 ? 298  THR A N   1 
ATOM   2669 C  CA  . THR A 1 301 ? 68.523 55.684 -5.547  1.00 10.95 ? 298  THR A CA  1 
ATOM   2670 C  C   . THR A 1 301 ? 68.950 57.161 -5.329  1.00 11.29 ? 298  THR A C   1 
ATOM   2671 O  O   . THR A 1 301 ? 68.431 57.859 -4.447  1.00 11.43 ? 298  THR A O   1 
ATOM   2672 C  CB  . THR A 1 301 ? 67.212 55.622 -6.321  1.00 10.80 ? 298  THR A CB  1 
ATOM   2673 O  OG1 . THR A 1 301 ? 66.814 54.252 -6.463  1.00 13.10 ? 298  THR A OG1 1 
ATOM   2674 C  CG2 . THR A 1 301 ? 67.316 56.311 -7.695  1.00 11.22 ? 298  THR A CG2 1 
ATOM   2675 N  N   . GLU A 1 302 ? 69.891 57.629 -6.141  1.00 11.30 ? 299  GLU A N   1 
ATOM   2676 C  CA  . GLU A 1 302 ? 70.269 59.043 -6.128  1.00 12.39 ? 299  GLU A CA  1 
ATOM   2677 C  C   . GLU A 1 302 ? 69.041 59.934 -6.307  1.00 11.46 ? 299  GLU A C   1 
ATOM   2678 O  O   . GLU A 1 302 ? 68.091 59.583 -7.029  1.00 12.49 ? 299  GLU A O   1 
ATOM   2679 C  CB  . GLU A 1 302 ? 71.283 59.352 -7.227  1.00 13.32 ? 299  GLU A CB  1 
ATOM   2680 C  CG  . GLU A 1 302 ? 70.793 59.248 -8.636  1.00 17.27 ? 299  GLU A CG  1 
ATOM   2681 C  CD  . GLU A 1 302 ? 71.864 59.388 -9.683  1.00 24.07 ? 299  GLU A CD  1 
ATOM   2682 O  OE1 . GLU A 1 302 ? 72.838 60.164 -9.499  1.00 27.86 ? 299  GLU A OE1 1 
ATOM   2683 O  OE2 . GLU A 1 302 ? 71.719 58.721 -10.732 1.00 29.50 ? 299  GLU A OE2 1 
ATOM   2684 N  N   . PHE A 1 303 ? 69.036 61.080 -5.619  1.00 11.05 ? 300  PHE A N   1 
ATOM   2685 C  CA  . PHE A 1 303 ? 67.848 61.900 -5.548  1.00 10.09 ? 300  PHE A CA  1 
ATOM   2686 C  C   . PHE A 1 303 ? 67.282 62.322 -6.909  1.00 9.93  ? 300  PHE A C   1 
ATOM   2687 O  O   . PHE A 1 303 ? 66.040 62.409 -7.048  1.00 11.03 ? 300  PHE A O   1 
ATOM   2688 C  CB  . PHE A 1 303 ? 68.088 63.122 -4.703  1.00 10.39 ? 300  PHE A CB  1 
ATOM   2689 C  CG  . PHE A 1 303 ? 68.379 62.841 -3.242  1.00 10.42 ? 300  PHE A CG  1 
ATOM   2690 C  CD1 . PHE A 1 303 ? 68.044 61.647 -2.599  1.00 10.97 ? 300  PHE A CD1 1 
ATOM   2691 C  CD2 . PHE A 1 303 ? 69.004 63.812 -2.481  1.00 11.16 ? 300  PHE A CD2 1 
ATOM   2692 C  CE1 . PHE A 1 303 ? 68.335 61.437 -1.247  1.00 11.56 ? 300  PHE A CE1 1 
ATOM   2693 C  CE2 . PHE A 1 303 ? 69.286 63.580 -1.161  1.00 11.23 ? 300  PHE A CE2 1 
ATOM   2694 C  CZ  . PHE A 1 303 ? 68.915 62.418 -0.540  1.00 11.76 ? 300  PHE A CZ  1 
ATOM   2695 N  N   . SER A 1 304 ? 68.142 62.508 -7.914  1.00 11.28 ? 301  SER A N   1 
ATOM   2696 C  CA  . SER A 1 304 ? 67.674 62.949 -9.233  1.00 12.30 ? 301  SER A CA  1 
ATOM   2697 C  C   . SER A 1 304 ? 66.819 61.921 -9.978  1.00 12.42 ? 301  SER A C   1 
ATOM   2698 O  O   . SER A 1 304 ? 66.134 62.284 -10.935 1.00 14.75 ? 301  SER A O   1 
ATOM   2699 C  CB  . SER A 1 304 ? 68.836 63.367 -10.116 1.00 12.40 ? 301  SER A CB  1 
ATOM   2700 O  OG  . SER A 1 304 ? 69.674 62.243 -10.386 1.00 16.01 ? 301  SER A OG  1 
ATOM   2701 N  N   . LYS A 1 305 ? 66.871 60.664 -9.515  1.00 12.96 ? 302  LYS A N   1 
ATOM   2702 C  CA  A LYS A 1 305 ? 66.138 59.553 -10.110 0.60 12.68 ? 302  LYS A CA  1 
ATOM   2703 C  CA  B LYS A 1 305 ? 66.137 59.560 -10.127 0.40 12.32 ? 302  LYS A CA  1 
ATOM   2704 C  C   . LYS A 1 305 ? 65.217 58.869 -9.120  1.00 11.91 ? 302  LYS A C   1 
ATOM   2705 O  O   . LYS A 1 305 ? 64.750 57.756 -9.372  1.00 12.42 ? 302  LYS A O   1 
ATOM   2706 C  CB  A LYS A 1 305 ? 67.131 58.538 -10.674 0.60 14.04 ? 302  LYS A CB  1 
ATOM   2707 C  CB  B LYS A 1 305 ? 67.121 58.539 -10.722 0.40 13.02 ? 302  LYS A CB  1 
ATOM   2708 C  CG  A LYS A 1 305 ? 67.913 59.130 -11.830 0.60 16.13 ? 302  LYS A CG  1 
ATOM   2709 C  CG  B LYS A 1 305 ? 68.202 59.161 -11.636 0.40 13.46 ? 302  LYS A CG  1 
ATOM   2710 C  CD  A LYS A 1 305 ? 68.974 58.179 -12.309 0.60 21.70 ? 302  LYS A CD  1 
ATOM   2711 C  CD  B LYS A 1 305 ? 67.643 59.862 -12.893 0.40 14.86 ? 302  LYS A CD  1 
ATOM   2712 C  CE  A LYS A 1 305 ? 69.779 58.806 -13.431 0.60 24.66 ? 302  LYS A CE  1 
ATOM   2713 C  CE  B LYS A 1 305 ? 68.805 60.433 -13.762 0.40 16.43 ? 302  LYS A CE  1 
ATOM   2714 N  NZ  A LYS A 1 305 ? 69.023 58.818 -14.706 0.60 29.62 ? 302  LYS A NZ  1 
ATOM   2715 N  NZ  B LYS A 1 305 ? 68.330 61.362 -14.816 0.40 17.92 ? 302  LYS A NZ  1 
ATOM   2716 N  N   . ASN A 1 306 ? 64.933 59.556 -8.002  1.00 10.19 ? 303  ASN A N   1 
ATOM   2717 C  CA  . ASN A 1 306 ? 64.216 58.970 -6.839  1.00 9.65  ? 303  ASN A CA  1 
ATOM   2718 C  C   . ASN A 1 306 ? 62.798 59.511 -6.795  1.00 9.81  ? 303  ASN A C   1 
ATOM   2719 O  O   . ASN A 1 306 ? 62.583 60.680 -6.593  1.00 11.32 ? 303  ASN A O   1 
ATOM   2720 C  CB  . ASN A 1 306 ? 65.017 59.358 -5.592  1.00 10.58 ? 303  ASN A CB  1 
ATOM   2721 C  CG  . ASN A 1 306 ? 64.575 58.665 -4.331  1.00 11.30 ? 303  ASN A CG  1 
ATOM   2722 O  OD1 . ASN A 1 306 ? 63.371 58.617 -4.046  1.00 11.99 ? 303  ASN A OD1 1 
ATOM   2723 N  ND2 . ASN A 1 306 ? 65.546 58.122 -3.549  1.00 11.47 ? 303  ASN A ND2 1 
ATOM   2724 N  N   . ILE A 1 307 ? 61.817 58.664 -7.079  1.00 8.68  ? 304  ILE A N   1 
ATOM   2725 C  CA  . ILE A 1 307 ? 60.444 59.116 -7.301  1.00 9.46  ? 304  ILE A CA  1 
ATOM   2726 C  C   . ILE A 1 307 ? 59.846 59.852 -6.078  1.00 9.84  ? 304  ILE A C   1 
ATOM   2727 O  O   . ILE A 1 307 ? 59.352 60.952 -6.241  1.00 10.25 ? 304  ILE A O   1 
ATOM   2728 C  CB  . ILE A 1 307 ? 59.565 57.985 -7.854  1.00 9.38  ? 304  ILE A CB  1 
ATOM   2729 C  CG1 . ILE A 1 307 ? 60.026 57.547 -9.253  1.00 11.01 ? 304  ILE A CG1 1 
ATOM   2730 C  CG2 . ILE A 1 307 ? 58.074 58.403 -7.890  1.00 10.14 ? 304  ILE A CG2 1 
ATOM   2731 C  CD1 . ILE A 1 307 ? 59.412 56.214 -9.712  1.00 13.19 ? 304  ILE A CD1 1 
ATOM   2732 N  N   . PRO A 1 308 ? 59.925 59.275 -4.860  1.00 9.86  ? 305  PRO A N   1 
ATOM   2733 C  CA  . PRO A 1 308 ? 59.354 59.984 -3.720  1.00 10.87 ? 305  PRO A CA  1 
ATOM   2734 C  C   . PRO A 1 308 ? 60.044 61.333 -3.456  1.00 10.00 ? 305  PRO A C   1 
ATOM   2735 O  O   . PRO A 1 308 ? 59.381 62.284 -3.055  1.00 9.73  ? 305  PRO A O   1 
ATOM   2736 C  CB  . PRO A 1 308 ? 59.553 59.012 -2.546  1.00 11.91 ? 305  PRO A CB  1 
ATOM   2737 C  CG  . PRO A 1 308 ? 59.624 57.691 -3.188  1.00 11.48 ? 305  PRO A CG  1 
ATOM   2738 C  CD  . PRO A 1 308 ? 60.303 57.901 -4.487  1.00 9.61  ? 305  PRO A CD  1 
ATOM   2739 N  N   . VAL A 1 309 ? 61.353 61.416 -3.709  1.00 9.44  ? 306  VAL A N   1 
ATOM   2740 C  CA  . VAL A 1 309 ? 62.066 62.697 -3.517  1.00 9.42  ? 306  VAL A CA  1 
ATOM   2741 C  C   . VAL A 1 309 ? 61.552 63.742 -4.526  1.00 9.37  ? 306  VAL A C   1 
ATOM   2742 O  O   . VAL A 1 309 ? 61.294 64.881 -4.157  1.00 10.48 ? 306  VAL A O   1 
ATOM   2743 C  CB  . VAL A 1 309 ? 63.592 62.520 -3.583  1.00 9.86  ? 306  VAL A CB  1 
ATOM   2744 C  CG1 . VAL A 1 309 ? 64.264 63.895 -3.468  1.00 11.75 ? 306  VAL A CG1 1 
ATOM   2745 C  CG2 . VAL A 1 309 ? 64.077 61.529 -2.459  1.00 10.52 ? 306  VAL A CG2 1 
ATOM   2746 N  N   . ILE A 1 310 ? 61.421 63.359 -5.792  1.00 9.70  ? 307  ILE A N   1 
ATOM   2747 C  CA  . ILE A 1 310 ? 60.898 64.272 -6.796  1.00 10.15 ? 307  ILE A CA  1 
ATOM   2748 C  C   . ILE A 1 310 ? 59.446 64.708 -6.436  1.00 9.94  ? 307  ILE A C   1 
ATOM   2749 O  O   . ILE A 1 310 ? 59.084 65.870 -6.493  1.00 10.06 ? 307  ILE A O   1 
ATOM   2750 C  CB  . ILE A 1 310 ? 60.972 63.681 -8.227  1.00 11.49 ? 307  ILE A CB  1 
ATOM   2751 C  CG1 . ILE A 1 310 ? 62.441 63.409 -8.628  1.00 14.17 ? 307  ILE A CG1 1 
ATOM   2752 C  CG2 . ILE A 1 310 ? 60.285 64.621 -9.250  1.00 11.51 ? 307  ILE A CG2 1 
ATOM   2753 C  CD1 . ILE A 1 310 ? 63.208 64.559 -8.773  1.00 17.99 ? 307  ILE A CD1 1 
HETATM 2754 N  N   . MSE A 1 311 ? 58.609 63.752 -6.038  1.00 10.14 ? 308  MSE A N   1 
HETATM 2755 C  CA  . MSE A 1 311 ? 57.237 64.064 -5.631  1.00 10.61 ? 308  MSE A CA  1 
HETATM 2756 C  C   . MSE A 1 311 ? 57.233 65.128 -4.513  1.00 9.53  ? 308  MSE A C   1 
HETATM 2757 O  O   . MSE A 1 311 ? 56.449 66.118 -4.535  1.00 11.16 ? 308  MSE A O   1 
HETATM 2758 C  CB  . MSE A 1 311 ? 56.499 62.825 -5.097  1.00 10.97 ? 308  MSE A CB  1 
HETATM 2759 C  CG  . MSE A 1 311 ? 56.221 61.824 -6.161  1.00 10.55 ? 308  MSE A CG  1 
HETATM 2760 SE SE  . MSE A 1 311 ? 55.632 60.069 -5.537  0.70 14.28 ? 308  MSE A SE  1 
HETATM 2761 C  CE  . MSE A 1 311 ? 53.901 60.521 -4.821  1.00 15.40 ? 308  MSE A CE  1 
ATOM   2762 N  N   . ALA A 1 312 ? 58.091 64.917 -3.510  1.00 8.69  ? 309  ALA A N   1 
ATOM   2763 C  CA  . ALA A 1 312 ? 58.165 65.797 -2.364  1.00 8.94  ? 309  ALA A CA  1 
ATOM   2764 C  C   . ALA A 1 312 ? 58.666 67.193 -2.775  1.00 9.56  ? 309  ALA A C   1 
ATOM   2765 O  O   . ALA A 1 312 ? 58.122 68.218 -2.333  1.00 10.07 ? 309  ALA A O   1 
ATOM   2766 C  CB  . ALA A 1 312 ? 59.087 65.186 -1.301  1.00 9.38  ? 309  ALA A CB  1 
ATOM   2767 N  N   . LEU A 1 313 ? 59.720 67.235 -3.589  1.00 9.84  ? 310  LEU A N   1 
ATOM   2768 C  CA  . LEU A 1 313 ? 60.272 68.507 -4.016  1.00 9.22  ? 310  LEU A CA  1 
ATOM   2769 C  C   . LEU A 1 313 ? 59.261 69.323 -4.788  1.00 8.97  ? 310  LEU A C   1 
ATOM   2770 O  O   . LEU A 1 313 ? 59.166 70.547 -4.597  1.00 10.24 ? 310  LEU A O   1 
ATOM   2771 C  CB  . LEU A 1 313 ? 61.571 68.330 -4.809  1.00 9.09  ? 310  LEU A CB  1 
ATOM   2772 C  CG  . LEU A 1 313 ? 62.787 67.846 -4.025  1.00 9.75  ? 310  LEU A CG  1 
ATOM   2773 C  CD1 . LEU A 1 313 ? 63.930 67.409 -4.945  1.00 10.97 ? 310  LEU A CD1 1 
ATOM   2774 C  CD2 . LEU A 1 313 ? 63.246 68.965 -3.076  1.00 9.91  ? 310  LEU A CD2 1 
ATOM   2775 N  N   . LEU A 1 314 ? 58.564 68.678 -5.722  1.00 9.93  ? 311  LEU A N   1 
ATOM   2776 C  CA  . LEU A 1 314 ? 57.571 69.406 -6.501  1.00 10.22 ? 311  LEU A CA  1 
ATOM   2777 C  C   . LEU A 1 314 ? 56.480 69.967 -5.596  1.00 9.80  ? 311  LEU A C   1 
ATOM   2778 O  O   . LEU A 1 314 ? 56.091 71.145 -5.695  1.00 10.48 ? 311  LEU A O   1 
ATOM   2779 C  CB  . LEU A 1 314 ? 56.928 68.516 -7.562  1.00 10.77 ? 311  LEU A CB  1 
ATOM   2780 C  CG  . LEU A 1 314 ? 57.847 68.041 -8.684  1.00 11.71 ? 311  LEU A CG  1 
ATOM   2781 C  CD1 . LEU A 1 314 ? 57.172 66.905 -9.472  1.00 15.50 ? 311  LEU A CD1 1 
ATOM   2782 C  CD2 . LEU A 1 314 ? 58.146 69.224 -9.621  1.00 14.57 ? 311  LEU A CD2 1 
ATOM   2783 N  N   . ALA A 1 315 ? 55.965 69.132 -4.695  1.00 10.39 ? 312  ALA A N   1 
ATOM   2784 C  CA  . ALA A 1 315 ? 54.863 69.558 -3.813  1.00 10.05 ? 312  ALA A CA  1 
ATOM   2785 C  C   . ALA A 1 315 ? 55.274 70.746 -2.930  1.00 9.81  ? 312  ALA A C   1 
ATOM   2786 O  O   . ALA A 1 315 ? 54.590 71.768 -2.835  1.00 10.67 ? 312  ALA A O   1 
ATOM   2787 C  CB  . ALA A 1 315 ? 54.393 68.358 -2.960  1.00 10.02 ? 312  ALA A CB  1 
ATOM   2788 N  N   . SER A 1 316 ? 56.436 70.613 -2.299  1.00 9.37  ? 313  SER A N   1 
ATOM   2789 C  CA  . SER A 1 316 ? 56.903 71.654 -1.378  1.00 10.10 ? 313  SER A CA  1 
ATOM   2790 C  C   . SER A 1 316 ? 57.284 72.930 -2.163  1.00 9.93  ? 313  SER A C   1 
ATOM   2791 O  O   . SER A 1 316 ? 57.132 74.046 -1.657  1.00 10.77 ? 313  SER A O   1 
ATOM   2792 C  CB  . SER A 1 316 ? 58.045 71.140 -0.546  1.00 10.72 ? 313  SER A CB  1 
ATOM   2793 O  OG  . SER A 1 316 ? 57.575 70.119 0.288   1.00 11.95 ? 313  SER A OG  1 
ATOM   2794 N  N   . TYR A 1 317 ? 57.810 72.778 -3.375  1.00 10.81 ? 314  TYR A N   1 
ATOM   2795 C  CA  . TYR A 1 317 ? 58.103 73.929 -4.217  1.00 10.15 ? 314  TYR A CA  1 
ATOM   2796 C  C   . TYR A 1 317 ? 56.822 74.727 -4.480  1.00 10.55 ? 314  TYR A C   1 
ATOM   2797 O  O   . TYR A 1 317 ? 56.778 75.947 -4.304  1.00 10.56 ? 314  TYR A O   1 
ATOM   2798 C  CB  . TYR A 1 317 ? 58.752 73.488 -5.548  1.00 10.55 ? 314  TYR A CB  1 
ATOM   2799 C  CG  . TYR A 1 317 ? 58.886 74.583 -6.602  1.00 10.38 ? 314  TYR A CG  1 
ATOM   2800 C  CD1 . TYR A 1 317 ? 59.630 75.711 -6.376  1.00 10.42 ? 314  TYR A CD1 1 
ATOM   2801 C  CD2 . TYR A 1 317 ? 58.298 74.454 -7.843  1.00 10.95 ? 314  TYR A CD2 1 
ATOM   2802 C  CE1 . TYR A 1 317 ? 59.767 76.690 -7.335  1.00 11.72 ? 314  TYR A CE1 1 
ATOM   2803 C  CE2 . TYR A 1 317 ? 58.409 75.437 -8.820  1.00 12.77 ? 314  TYR A CE2 1 
ATOM   2804 C  CZ  . TYR A 1 317 ? 59.166 76.553 -8.561  1.00 11.77 ? 314  TYR A CZ  1 
ATOM   2805 O  OH  . TYR A 1 317 ? 59.304 77.544 -9.483  1.00 14.15 ? 314  TYR A OH  1 
ATOM   2806 N  N   . TYR A 1 318 ? 55.755 74.028 -4.886  1.00 9.92  ? 315  TYR A N   1 
ATOM   2807 C  CA  . TYR A 1 318 ? 54.508 74.716 -5.181  1.00 9.62  ? 315  TYR A CA  1 
ATOM   2808 C  C   . TYR A 1 318 ? 53.958 75.421 -3.927  1.00 9.59  ? 315  TYR A C   1 
ATOM   2809 O  O   . TYR A 1 318 ? 53.585 76.606 -3.982  1.00 11.49 ? 315  TYR A O   1 
ATOM   2810 C  CB  . TYR A 1 318 ? 53.487 73.753 -5.759  1.00 9.41  ? 315  TYR A CB  1 
ATOM   2811 C  CG  . TYR A 1 318 ? 53.765 73.264 -7.158  1.00 10.02 ? 315  TYR A CG  1 
ATOM   2812 C  CD1 . TYR A 1 318 ? 54.140 74.127 -8.204  1.00 10.25 ? 315  TYR A CD1 1 
ATOM   2813 C  CD2 . TYR A 1 318 ? 53.607 71.943 -7.461  1.00 11.10 ? 315  TYR A CD2 1 
ATOM   2814 C  CE1 . TYR A 1 318 ? 54.368 73.648 -9.458  1.00 11.49 ? 315  TYR A CE1 1 
ATOM   2815 C  CE2 . TYR A 1 318 ? 53.828 71.475 -8.747  1.00 10.43 ? 315  TYR A CE2 1 
ATOM   2816 C  CZ  . TYR A 1 318 ? 54.225 72.330 -9.742  1.00 9.77  ? 315  TYR A CZ  1 
ATOM   2817 O  OH  . TYR A 1 318 ? 54.423 71.846 -11.031 1.00 11.71 ? 315  TYR A OH  1 
ATOM   2818 N  N   . SER A 1 319 ? 53.939 74.730 -2.778  1.00 10.85 ? 316  SER A N   1 
ATOM   2819 C  CA  . SER A 1 319 ? 53.278 75.311 -1.629  1.00 11.82 ? 316  SER A CA  1 
ATOM   2820 C  C   . SER A 1 319 ? 54.120 76.416 -0.997  1.00 12.32 ? 316  SER A C   1 
ATOM   2821 O  O   . SER A 1 319 ? 53.568 77.281 -0.317  1.00 14.04 ? 316  SER A O   1 
ATOM   2822 C  CB  . SER A 1 319 ? 52.799 74.232 -0.618  1.00 12.04 ? 316  SER A CB  1 
ATOM   2823 O  OG  . SER A 1 319 ? 53.878 73.454 -0.052  1.00 12.62 ? 316  SER A OG  1 
ATOM   2824 N  N   . CYS A 1 320 ? 55.426 76.449 -1.293  1.00 11.19 ? 317  CYS A N   1 
ATOM   2825 C  CA  . CYS A 1 320 ? 56.314 77.550 -0.944  1.00 12.20 ? 317  CYS A CA  1 
ATOM   2826 C  C   . CYS A 1 320 ? 56.138 78.745 -1.871  1.00 12.37 ? 317  CYS A C   1 
ATOM   2827 O  O   . CYS A 1 320 ? 55.835 79.841 -1.414  1.00 16.61 ? 317  CYS A O   1 
ATOM   2828 C  CB  . CYS A 1 320 ? 57.784 77.092 -1.032  1.00 11.70 ? 317  CYS A CB  1 
ATOM   2829 S  SG  . CYS A 1 320 ? 58.991 78.431 -0.820  1.00 14.70 ? 317  CYS A SG  1 
ATOM   2830 N  N   . THR A 1 321 ? 56.309 78.518 -3.167  1.00 11.57 ? 318  THR A N   1 
ATOM   2831 C  CA  A THR A 1 321 ? 56.512 79.644 -4.099  0.70 11.99 ? 318  THR A CA  1 
ATOM   2832 C  CA  B THR A 1 321 ? 56.543 79.587 -4.136  0.30 11.66 ? 318  THR A CA  1 
ATOM   2833 C  C   . THR A 1 321 ? 55.244 80.161 -4.732  1.00 12.15 ? 318  THR A C   1 
ATOM   2834 O  O   . THR A 1 321 ? 55.159 81.346 -5.085  1.00 13.22 ? 318  THR A O   1 
ATOM   2835 C  CB  A THR A 1 321 ? 57.531 79.329 -5.241  0.70 13.11 ? 318  THR A CB  1 
ATOM   2836 C  CB  B THR A 1 321 ? 57.466 79.025 -5.249  0.30 11.67 ? 318  THR A CB  1 
ATOM   2837 O  OG1 A THR A 1 321 ? 57.048 78.281 -6.084  0.70 16.55 ? 318  THR A OG1 1 
ATOM   2838 O  OG1 B THR A 1 321 ? 58.559 78.319 -4.646  0.30 12.87 ? 318  THR A OG1 1 
ATOM   2839 C  CG2 A THR A 1 321 ? 58.877 78.985 -4.660  0.70 13.13 ? 318  THR A CG2 1 
ATOM   2840 C  CG2 B THR A 1 321 ? 58.037 80.116 -6.101  0.30 11.42 ? 318  THR A CG2 1 
ATOM   2841 N  N   . TYR A 1 322 ? 54.227 79.302 -4.829  1.00 11.56 ? 319  TYR A N   1 
ATOM   2842 C  CA  . TYR A 1 322 ? 52.951 79.712 -5.380  1.00 11.69 ? 319  TYR A CA  1 
ATOM   2843 C  C   . TYR A 1 322 ? 51.931 79.973 -4.227  1.00 13.38 ? 319  TYR A C   1 
ATOM   2844 O  O   . TYR A 1 322 ? 50.830 80.412 -4.474  1.00 16.15 ? 319  TYR A O   1 
ATOM   2845 C  CB  . TYR A 1 322 ? 52.434 78.623 -6.348  1.00 11.61 ? 319  TYR A CB  1 
ATOM   2846 C  CG  . TYR A 1 322 ? 53.166 78.549 -7.667  1.00 13.37 ? 319  TYR A CG  1 
ATOM   2847 C  CD1 . TYR A 1 322 ? 52.624 79.128 -8.817  1.00 18.46 ? 319  TYR A CD1 1 
ATOM   2848 C  CD2 . TYR A 1 322 ? 54.378 77.919 -7.794  1.00 12.61 ? 319  TYR A CD2 1 
ATOM   2849 C  CE1 . TYR A 1 322 ? 53.311 79.092 -10.017 1.00 19.77 ? 319  TYR A CE1 1 
ATOM   2850 C  CE2 . TYR A 1 322 ? 55.080 77.907 -8.961  1.00 14.46 ? 319  TYR A CE2 1 
ATOM   2851 C  CZ  . TYR A 1 322 ? 54.542 78.487 -10.075 1.00 17.55 ? 319  TYR A CZ  1 
ATOM   2852 O  OH  . TYR A 1 322 ? 55.246 78.445 -11.233 1.00 19.26 ? 319  TYR A OH  1 
ATOM   2853 N  N   . ASN A 1 323 ? 52.346 79.685 -2.997  1.00 14.36 ? 320  ASN A N   1 
ATOM   2854 C  CA  . ASN A 1 323 ? 51.526 79.859 -1.799  1.00 15.02 ? 320  ASN A CA  1 
ATOM   2855 C  C   . ASN A 1 323 ? 50.220 79.083 -1.849  1.00 14.18 ? 320  ASN A C   1 
ATOM   2856 O  O   . ASN A 1 323 ? 49.216 79.453 -1.216  1.00 15.31 ? 320  ASN A O   1 
ATOM   2857 C  CB  . ASN A 1 323 ? 51.306 81.341 -1.473  1.00 16.46 ? 320  ASN A CB  1 
ATOM   2858 C  CG  . ASN A 1 323 ? 52.611 82.103 -1.263  1.00 20.26 ? 320  ASN A CG  1 
ATOM   2859 O  OD1 . ASN A 1 323 ? 53.468 81.685 -0.476  1.00 23.08 ? 320  ASN A OD1 1 
ATOM   2860 N  ND2 . ASN A 1 323 ? 52.736 83.249 -1.926  1.00 24.94 ? 320  ASN A ND2 1 
ATOM   2861 N  N   . SER A 1 324 ? 50.245 78.005 -2.610  1.00 12.40 ? 321  SER A N   1 
ATOM   2862 C  CA  . SER A 1 324 ? 49.100 77.105 -2.677  1.00 10.71 ? 321  SER A CA  1 
ATOM   2863 C  C   . SER A 1 324 ? 48.892 76.446 -1.329  1.00 9.75  ? 321  SER A C   1 
ATOM   2864 O  O   . SER A 1 324 ? 49.839 76.232 -0.543  1.00 11.83 ? 321  SER A O   1 
ATOM   2865 C  CB  . SER A 1 324 ? 49.275 76.066 -3.798  1.00 10.96 ? 321  SER A CB  1 
ATOM   2866 O  OG  . SER A 1 324 ? 50.512 75.401 -3.711  1.00 12.65 ? 321  SER A OG  1 
ATOM   2867 N  N   . GLN A 1 325 ? 47.639 76.086 -1.046  1.00 9.53  ? 322  GLN A N   1 
ATOM   2868 C  CA  . GLN A 1 325 ? 47.217 75.584 0.251   1.00 10.31 ? 322  GLN A CA  1 
ATOM   2869 C  C   . GLN A 1 325 ? 46.480 74.246 0.141   1.00 9.65  ? 322  GLN A C   1 
ATOM   2870 O  O   . GLN A 1 325 ? 45.915 73.766 1.129   1.00 10.09 ? 322  GLN A O   1 
ATOM   2871 C  CB  . GLN A 1 325 ? 46.360 76.603 1.020   1.00 12.06 ? 322  GLN A CB  1 
ATOM   2872 C  CG  . GLN A 1 325 ? 47.077 77.946 1.257   1.00 12.71 ? 322  GLN A CG  1 
ATOM   2873 C  CD  . GLN A 1 325 ? 46.219 79.000 1.937   1.00 15.15 ? 322  GLN A CD  1 
ATOM   2874 O  OE1 . GLN A 1 325 ? 45.179 78.690 2.470   1.00 23.45 ? 322  GLN A OE1 1 
ATOM   2875 N  NE2 . GLN A 1 325 ? 46.549 80.255 1.727   1.00 22.16 ? 322  GLN A NE2 1 
ATOM   2876 N  N   . SER A 1 326 ? 46.500 73.626 -1.043  1.00 10.04 ? 323  SER A N   1 
ATOM   2877 C  CA  . SER A 1 326 ? 45.930 72.295 -1.236  1.00 10.09 ? 323  SER A CA  1 
ATOM   2878 C  C   . SER A 1 326 ? 46.600 71.619 -2.417  1.00 9.88  ? 323  SER A C   1 
ATOM   2879 O  O   . SER A 1 326 ? 47.280 72.261 -3.227  1.00 10.62 ? 323  SER A O   1 
ATOM   2880 C  CB  . SER A 1 326 ? 44.397 72.325 -1.453  1.00 11.64 ? 323  SER A CB  1 
ATOM   2881 O  OG  . SER A 1 326 ? 44.041 72.681 -2.776  1.00 11.52 ? 323  SER A OG  1 
ATOM   2882 N  N   . GLN A 1 327 ? 46.389 70.307 -2.478  1.00 10.27 ? 324  GLN A N   1 
ATOM   2883 C  CA  . GLN A 1 327 ? 46.820 69.462 -3.586  1.00 11.18 ? 324  GLN A CA  1 
ATOM   2884 C  C   . GLN A 1 327 ? 45.671 68.539 -3.905  1.00 10.42 ? 324  GLN A C   1 
ATOM   2885 O  O   . GLN A 1 327 ? 45.014 68.025 -2.986  1.00 10.74 ? 324  GLN A O   1 
ATOM   2886 C  CB  . GLN A 1 327 ? 48.012 68.536 -3.155  1.00 11.80 ? 324  GLN A CB  1 
ATOM   2887 C  CG  . GLN A 1 327 ? 49.333 69.234 -3.007  1.00 14.67 ? 324  GLN A CG  1 
ATOM   2888 C  CD  . GLN A 1 327 ? 50.396 68.278 -2.498  1.00 15.01 ? 324  GLN A CD  1 
ATOM   2889 O  OE1 . GLN A 1 327 ? 51.168 67.742 -3.297  1.00 15.34 ? 324  GLN A OE1 1 
ATOM   2890 N  NE2 . GLN A 1 327 ? 50.365 67.987 -1.205  1.00 13.99 ? 324  GLN A NE2 1 
ATOM   2891 N  N   . ALA A 1 328 ? 45.419 68.302 -5.198  1.00 10.37 ? 325  ALA A N   1 
ATOM   2892 C  CA  . ALA A 1 328 ? 44.380 67.386 -5.662  1.00 9.77  ? 325  ALA A CA  1 
ATOM   2893 C  C   . ALA A 1 328 ? 44.979 66.059 -6.147  1.00 10.13 ? 325  ALA A C   1 
ATOM   2894 O  O   . ALA A 1 328 ? 45.971 66.048 -6.864  1.00 10.86 ? 325  ALA A O   1 
ATOM   2895 C  CB  . ALA A 1 328 ? 43.583 68.032 -6.828  1.00 11.74 ? 325  ALA A CB  1 
ATOM   2896 N  N   . LEU A 1 329 ? 44.342 64.971 -5.759  1.00 9.37  ? 326  LEU A N   1 
ATOM   2897 C  CA  . LEU A 1 329 ? 44.739 63.649 -6.108  1.00 10.27 ? 326  LEU A CA  1 
ATOM   2898 C  C   . LEU A 1 329 ? 43.518 63.011 -6.784  1.00 9.99  ? 326  LEU A C   1 
ATOM   2899 O  O   . LEU A 1 329 ? 42.452 62.888 -6.139  1.00 10.76 ? 326  LEU A O   1 
ATOM   2900 C  CB  . LEU A 1 329 ? 45.187 62.891 -4.852  1.00 12.13 ? 326  LEU A CB  1 
ATOM   2901 C  CG  . LEU A 1 329 ? 45.497 61.410 -4.960  1.00 14.07 ? 326  LEU A CG  1 
ATOM   2902 C  CD1 . LEU A 1 329 ? 46.631 61.200 -5.918  1.00 16.14 ? 326  LEU A CD1 1 
ATOM   2903 C  CD2 . LEU A 1 329 ? 45.842 60.866 -3.565  1.00 18.09 ? 326  LEU A CD2 1 
ATOM   2904 N  N   . LEU A 1 330 ? 43.696 62.544 -8.002  1.00 9.92  ? 327  LEU A N   1 
ATOM   2905 C  CA  . LEU A 1 330 ? 42.600 62.136 -8.889  1.00 9.58  ? 327  LEU A CA  1 
ATOM   2906 C  C   . LEU A 1 330 ? 42.861 60.685 -9.398  1.00 9.62  ? 327  LEU A C   1 
ATOM   2907 O  O   . LEU A 1 330 ? 43.514 60.485 -10.426 1.00 9.96  ? 327  LEU A O   1 
ATOM   2908 C  CB  . LEU A 1 330 ? 42.458 63.104 -10.063 1.00 9.69  ? 327  LEU A CB  1 
ATOM   2909 C  CG  . LEU A 1 330 ? 42.413 64.591 -9.698  1.00 10.47 ? 327  LEU A CG  1 
ATOM   2910 C  CD1 . LEU A 1 330 ? 42.293 65.410 -10.981 1.00 11.15 ? 327  LEU A CD1 1 
ATOM   2911 C  CD2 . LEU A 1 330 ? 41.224 64.875 -8.752  1.00 10.74 ? 327  LEU A CD2 1 
ATOM   2912 N  N   . PRO A 1 331 ? 42.362 59.668 -8.655  1.00 9.52  ? 328  PRO A N   1 
ATOM   2913 C  CA  . PRO A 1 331 ? 42.589 58.261 -9.080  1.00 9.64  ? 328  PRO A CA  1 
ATOM   2914 C  C   . PRO A 1 331 ? 41.547 57.885 -10.099 1.00 10.28 ? 328  PRO A C   1 
ATOM   2915 O  O   . PRO A 1 331 ? 40.351 57.917 -9.807  1.00 10.64 ? 328  PRO A O   1 
ATOM   2916 C  CB  . PRO A 1 331 ? 42.490 57.452 -7.782  1.00 11.69 ? 328  PRO A CB  1 
ATOM   2917 C  CG  . PRO A 1 331 ? 42.390 58.486 -6.704  1.00 14.31 ? 328  PRO A CG  1 
ATOM   2918 C  CD  . PRO A 1 331 ? 41.864 59.731 -7.282  1.00 9.67  ? 328  PRO A CD  1 
ATOM   2919 N  N   . TYR A 1 332 ? 41.988 57.500 -11.284 1.00 9.52  ? 329  TYR A N   1 
ATOM   2920 C  CA  . TYR A 1 332 ? 41.104 57.129 -12.386 1.00 9.70  ? 329  TYR A CA  1 
ATOM   2921 C  C   . TYR A 1 332 ? 40.837 55.605 -12.345 1.00 8.66  ? 329  TYR A C   1 
ATOM   2922 O  O   . TYR A 1 332 ? 40.996 54.876 -13.310 1.00 9.98  ? 329  TYR A O   1 
ATOM   2923 C  CB  . TYR A 1 332 ? 41.680 57.582 -13.734 1.00 10.19 ? 329  TYR A CB  1 
ATOM   2924 C  CG  . TYR A 1 332 ? 41.239 58.986 -14.056 1.00 9.54  ? 329  TYR A CG  1 
ATOM   2925 C  CD1 . TYR A 1 332 ? 41.614 60.073 -13.283 1.00 9.62  ? 329  TYR A CD1 1 
ATOM   2926 C  CD2 . TYR A 1 332 ? 40.399 59.223 -15.161 1.00 9.68  ? 329  TYR A CD2 1 
ATOM   2927 C  CE1 . TYR A 1 332 ? 41.124 61.366 -13.587 1.00 9.21  ? 329  TYR A CE1 1 
ATOM   2928 C  CE2 . TYR A 1 332 ? 39.934 60.462 -15.484 1.00 10.05 ? 329  TYR A CE2 1 
ATOM   2929 C  CZ  . TYR A 1 332 ? 40.303 61.544 -14.706 1.00 8.87  ? 329  TYR A CZ  1 
ATOM   2930 O  OH  . TYR A 1 332 ? 39.811 62.807 -14.976 1.00 10.89 ? 329  TYR A OH  1 
ATOM   2931 N  N   . ASP A 1 333 ? 40.274 55.168 -11.220 1.00 9.60  ? 330  ASP A N   1 
ATOM   2932 C  CA  . ASP A 1 333 ? 39.849 53.783 -11.028 1.00 9.53  ? 330  ASP A CA  1 
ATOM   2933 C  C   . ASP A 1 333 ? 38.914 53.723 -9.838  1.00 9.61  ? 330  ASP A C   1 
ATOM   2934 O  O   . ASP A 1 333 ? 39.269 54.178 -8.735  1.00 10.20 ? 330  ASP A O   1 
ATOM   2935 C  CB  . ASP A 1 333 ? 41.044 52.831 -10.868 1.00 9.54  ? 330  ASP A CB  1 
ATOM   2936 C  CG  . ASP A 1 333 ? 40.651 51.375 -11.079 1.00 9.99  ? 330  ASP A CG  1 
ATOM   2937 O  OD1 . ASP A 1 333 ? 39.969 50.821 -10.178 1.00 11.54 ? 330  ASP A OD1 1 
ATOM   2938 O  OD2 . ASP A 1 333 ? 41.030 50.794 -12.142 1.00 12.17 ? 330  ASP A OD2 1 
ATOM   2939 N  N   . GLU A 1 334 ? 37.738 53.161 -10.055 1.00 9.52  ? 331  GLU A N   1 
ATOM   2940 C  CA  . GLU A 1 334 ? 36.736 52.973 -9.020  1.00 10.01 ? 331  GLU A CA  1 
ATOM   2941 C  C   . GLU A 1 334 ? 37.248 52.271 -7.794  1.00 9.49  ? 331  GLU A C   1 
ATOM   2942 O  O   . GLU A 1 334 ? 36.783 52.494 -6.675  1.00 10.55 ? 331  GLU A O   1 
ATOM   2943 C  CB  . GLU A 1 334 ? 35.617 52.159 -9.603  1.00 11.72 ? 331  GLU A CB  1 
ATOM   2944 C  CG  . GLU A 1 334 ? 34.690 52.901 -10.509 1.00 11.58 ? 331  GLU A CG  1 
ATOM   2945 C  CD  . GLU A 1 334 ? 33.797 53.844 -9.739  1.00 12.31 ? 331  GLU A CD  1 
ATOM   2946 O  OE1 . GLU A 1 334 ? 32.968 53.340 -8.882  1.00 15.05 ? 331  GLU A OE1 1 
ATOM   2947 O  OE2 . GLU A 1 334 ? 33.909 55.099 -9.934  1.00 14.24 ? 331  GLU A OE2 1 
ATOM   2948 N  N   . ARG A 1 335 ? 38.177 51.345 -8.006  1.00 9.45  ? 332  ARG A N   1 
ATOM   2949 C  CA  . ARG A 1 335 ? 38.708 50.573 -6.888  1.00 9.90  ? 332  ARG A CA  1 
ATOM   2950 C  C   . ARG A 1 335 ? 39.454 51.409 -5.873  1.00 10.82 ? 332  ARG A C   1 
ATOM   2951 O  O   . ARG A 1 335 ? 39.625 51.010 -4.746  1.00 11.24 ? 332  ARG A O   1 
ATOM   2952 C  CB  . ARG A 1 335 ? 39.554 49.388 -7.413  1.00 9.73  ? 332  ARG A CB  1 
ATOM   2953 C  CG  . ARG A 1 335 ? 38.764 48.347 -8.160  1.00 10.30 ? 332  ARG A CG  1 
ATOM   2954 C  CD  . ARG A 1 335 ? 39.664 47.372 -8.899  1.00 11.36 ? 332  ARG A CD  1 
ATOM   2955 N  NE  . ARG A 1 335 ? 40.381 47.984 -9.989  1.00 10.31 ? 332  ARG A NE  1 
ATOM   2956 C  CZ  . ARG A 1 335 ? 41.276 47.368 -10.758 1.00 10.75 ? 332  ARG A CZ  1 
ATOM   2957 N  NH1 . ARG A 1 335 ? 41.627 46.122 -10.500 1.00 10.67 ? 332  ARG A NH1 1 
ATOM   2958 N  NH2 . ARG A 1 335 ? 41.829 48.002 -11.790 1.00 10.23 ? 332  ARG A NH2 1 
ATOM   2959 N  N   . LEU A 1 336 ? 39.929 52.566 -6.315  1.00 10.19 ? 333  LEU A N   1 
ATOM   2960 C  CA  . LEU A 1 336 ? 40.674 53.484 -5.485  1.00 9.93  ? 333  LEU A CA  1 
ATOM   2961 C  C   . LEU A 1 336 ? 39.788 54.542 -4.808  1.00 10.04 ? 333  LEU A C   1 
ATOM   2962 O  O   . LEU A 1 336 ? 40.262 55.605 -4.386  1.00 11.24 ? 333  LEU A O   1 
ATOM   2963 C  CB  . LEU A 1 336 ? 41.807 54.126 -6.288  1.00 10.25 ? 333  LEU A CB  1 
ATOM   2964 C  CG  . LEU A 1 336 ? 42.953 53.169 -6.705  1.00 10.18 ? 333  LEU A CG  1 
ATOM   2965 C  CD1 . LEU A 1 336 ? 43.955 53.821 -7.660  1.00 12.08 ? 333  LEU A CD1 1 
ATOM   2966 C  CD2 . LEU A 1 336 ? 43.683 52.649 -5.442  1.00 12.68 ? 333  LEU A CD2 1 
ATOM   2967 N  N   . CYS A 1 337 ? 38.500 54.228 -4.646  1.00 11.07 ? 334  CYS A N   1 
ATOM   2968 C  CA  A CYS A 1 337 ? 37.589 55.175 -4.024  0.60 11.74 ? 334  CYS A CA  1 
ATOM   2969 C  CA  B CYS A 1 337 ? 37.530 55.130 -4.014  0.40 13.38 ? 334  CYS A CA  1 
ATOM   2970 C  C   . CYS A 1 337 ? 37.855 55.629 -2.596  1.00 11.83 ? 334  CYS A C   1 
ATOM   2971 O  O   . CYS A 1 337 ? 37.425 56.728 -2.247  1.00 13.27 ? 334  CYS A O   1 
ATOM   2972 C  CB  A CYS A 1 337 ? 36.180 54.726 -4.147  0.60 11.80 ? 334  CYS A CB  1 
ATOM   2973 C  CB  B CYS A 1 337 ? 36.109 54.566 -4.119  0.40 14.73 ? 334  CYS A CB  1 
ATOM   2974 S  SG  A CYS A 1 337 ? 35.804 53.212 -3.311  0.60 9.79  ? 334  CYS A SG  1 
ATOM   2975 S  SG  B CYS A 1 337 ? 35.199 54.081 -2.633  0.40 23.51 ? 334  CYS A SG  1 
ATOM   2976 N  N   . TYR A 1 338 ? 38.656 54.872 -1.820  1.00 10.74 ? 335  TYR A N   1 
ATOM   2977 C  CA  . TYR A 1 338 ? 39.044 55.314 -0.459  1.00 9.96  ? 335  TYR A CA  1 
ATOM   2978 C  C   . TYR A 1 338 ? 40.520 55.778 -0.393  1.00 11.00 ? 335  TYR A C   1 
ATOM   2979 O  O   . TYR A 1 338 ? 41.032 56.076 0.683   1.00 11.29 ? 335  TYR A O   1 
ATOM   2980 C  CB  . TYR A 1 338 ? 38.821 54.178 0.552   1.00 11.83 ? 335  TYR A CB  1 
ATOM   2981 C  CG  . TYR A 1 338 ? 37.386 53.737 0.677   1.00 12.81 ? 335  TYR A CG  1 
ATOM   2982 C  CD1 . TYR A 1 338 ? 36.432 54.605 1.108   1.00 18.54 ? 335  TYR A CD1 1 
ATOM   2983 C  CD2 . TYR A 1 338 ? 37.007 52.469 0.363   1.00 14.19 ? 335  TYR A CD2 1 
ATOM   2984 C  CE1 . TYR A 1 338 ? 35.115 54.189 1.233   1.00 22.03 ? 335  TYR A CE1 1 
ATOM   2985 C  CE2 . TYR A 1 338 ? 35.736 52.028 0.502   1.00 19.63 ? 335  TYR A CE2 1 
ATOM   2986 C  CZ  . TYR A 1 338 ? 34.773 52.885 0.908   1.00 20.82 ? 335  TYR A CZ  1 
ATOM   2987 O  OH  . TYR A 1 338 ? 33.468 52.433 1.067   1.00 27.92 ? 335  TYR A OH  1 
ATOM   2988 N  N   . PHE A 1 339 ? 41.201 55.843 -1.533  1.00 10.40 ? 336  PHE A N   1 
ATOM   2989 C  CA  . PHE A 1 339 ? 42.616 56.186 -1.598  1.00 10.13 ? 336  PHE A CA  1 
ATOM   2990 C  C   . PHE A 1 339 ? 42.887 57.605 -1.085  1.00 10.51 ? 336  PHE A C   1 
ATOM   2991 O  O   . PHE A 1 339 ? 43.786 57.818 -0.279  1.00 11.10 ? 336  PHE A O   1 
ATOM   2992 C  CB  . PHE A 1 339 ? 43.172 55.929 -3.002  1.00 11.01 ? 336  PHE A CB  1 
ATOM   2993 C  CG  . PHE A 1 339 ? 44.684 56.017 -3.112  1.00 11.03 ? 336  PHE A CG  1 
ATOM   2994 C  CD1 . PHE A 1 339 ? 45.522 55.050 -2.541  1.00 12.93 ? 336  PHE A CD1 1 
ATOM   2995 C  CD2 . PHE A 1 339 ? 45.241 57.060 -3.803  1.00 15.41 ? 336  PHE A CD2 1 
ATOM   2996 C  CE1 . PHE A 1 339 ? 46.913 55.143 -2.639  1.00 15.53 ? 336  PHE A CE1 1 
ATOM   2997 C  CE2 . PHE A 1 339 ? 46.612 57.161 -3.917  1.00 16.49 ? 336  PHE A CE2 1 
ATOM   2998 C  CZ  . PHE A 1 339 ? 47.444 56.193 -3.349  1.00 17.09 ? 336  PHE A CZ  1 
ATOM   2999 N  N   . VAL A 1 340 ? 42.115 58.567 -1.554  1.00 11.10 ? 337  VAL A N   1 
ATOM   3000 C  CA  . VAL A 1 340 ? 42.242 59.927 -1.070  1.00 12.24 ? 337  VAL A CA  1 
ATOM   3001 C  C   . VAL A 1 340 ? 41.992 60.006 0.437   1.00 11.74 ? 337  VAL A C   1 
ATOM   3002 O  O   . VAL A 1 340 ? 42.767 60.634 1.179   1.00 11.76 ? 337  VAL A O   1 
ATOM   3003 C  CB  . VAL A 1 340 ? 41.356 60.930 -1.863  1.00 11.90 ? 337  VAL A CB  1 
ATOM   3004 C  CG1 . VAL A 1 340 ? 41.313 62.293 -1.126  1.00 16.14 ? 337  VAL A CG1 1 
ATOM   3005 C  CG2 . VAL A 1 340 ? 41.826 61.086 -3.351  1.00 15.04 ? 337  VAL A CG2 1 
ATOM   3006 N  N   . ASP A 1 341 ? 40.927 59.349 0.918   1.00 11.33 ? 338  ASP A N   1 
ATOM   3007 C  CA  . ASP A 1 341 ? 40.603 59.389 2.338   1.00 11.71 ? 338  ASP A CA  1 
ATOM   3008 C  C   . ASP A 1 341 ? 41.806 58.871 3.177   1.00 11.12 ? 338  ASP A C   1 
ATOM   3009 O  O   . ASP A 1 341 ? 42.153 59.432 4.233   1.00 11.87 ? 338  ASP A O   1 
ATOM   3010 C  CB  . ASP A 1 341 ? 39.405 58.482 2.669   1.00 13.14 ? 338  ASP A CB  1 
ATOM   3011 C  CG  . ASP A 1 341 ? 38.068 58.993 2.115   1.00 20.77 ? 338  ASP A CG  1 
ATOM   3012 O  OD1 . ASP A 1 341 ? 37.966 60.133 1.656   1.00 28.52 ? 338  ASP A OD1 1 
ATOM   3013 O  OD2 . ASP A 1 341 ? 37.079 58.297 2.239   1.00 26.49 ? 338  ASP A OD2 1 
ATOM   3014 N  N   . TYR A 1 342 ? 42.418 57.782 2.701   1.00 9.82  ? 339  TYR A N   1 
ATOM   3015 C  CA  A TYR A 1 342 ? 43.552 57.171 3.377   0.60 10.12 ? 339  TYR A CA  1 
ATOM   3016 C  CA  B TYR A 1 342 ? 43.545 57.160 3.383   0.40 10.79 ? 339  TYR A CA  1 
ATOM   3017 C  C   . TYR A 1 342 ? 44.753 58.117 3.397   1.00 10.80 ? 339  TYR A C   1 
ATOM   3018 O  O   . TYR A 1 342 ? 45.368 58.345 4.428   1.00 11.02 ? 339  TYR A O   1 
ATOM   3019 C  CB  A TYR A 1 342 ? 43.929 55.854 2.665   0.60 9.69  ? 339  TYR A CB  1 
ATOM   3020 C  CB  B TYR A 1 342 ? 43.923 55.814 2.711   0.40 10.93 ? 339  TYR A CB  1 
ATOM   3021 C  CG  A TYR A 1 342 ? 45.140 55.227 3.336   0.60 7.88  ? 339  TYR A CG  1 
ATOM   3022 C  CG  B TYR A 1 342 ? 45.396 55.586 2.891   0.40 12.02 ? 339  TYR A CG  1 
ATOM   3023 C  CD1 A TYR A 1 342 ? 44.993 54.529 4.510   0.60 8.95  ? 339  TYR A CD1 1 
ATOM   3024 C  CD1 B TYR A 1 342 ? 45.897 55.060 4.068   0.40 12.92 ? 339  TYR A CD1 1 
ATOM   3025 C  CD2 A TYR A 1 342 ? 46.435 55.407 2.847   0.60 8.21  ? 339  TYR A CD2 1 
ATOM   3026 C  CD2 B TYR A 1 342 ? 46.299 55.974 1.906   0.40 13.02 ? 339  TYR A CD2 1 
ATOM   3027 C  CE1 A TYR A 1 342 ? 46.092 54.017 5.182   0.60 9.50  ? 339  TYR A CE1 1 
ATOM   3028 C  CE1 B TYR A 1 342 ? 47.252 54.921 4.255   0.40 15.16 ? 339  TYR A CE1 1 
ATOM   3029 C  CE2 A TYR A 1 342 ? 47.532 54.838 3.478   0.60 8.81  ? 339  TYR A CE2 1 
ATOM   3030 C  CE2 B TYR A 1 342 ? 47.651 55.829 2.098   0.40 15.79 ? 339  TYR A CE2 1 
ATOM   3031 C  CZ  A TYR A 1 342 ? 47.356 54.168 4.647   0.60 9.54  ? 339  TYR A CZ  1 
ATOM   3032 C  CZ  B TYR A 1 342 ? 48.114 55.322 3.259   0.40 14.04 ? 339  TYR A CZ  1 
ATOM   3033 O  OH  A TYR A 1 342 ? 48.449 53.662 5.284   0.60 11.57 ? 339  TYR A OH  1 
ATOM   3034 O  OH  B TYR A 1 342 ? 49.450 55.240 3.395   0.40 17.18 ? 339  TYR A OH  1 
ATOM   3035 N  N   . LEU A 1 343 ? 45.058 58.723 2.252   1.00 11.70 ? 340  LEU A N   1 
ATOM   3036 C  CA  A LEU A 1 343 ? 46.252 59.567 2.181   0.70 11.50 ? 340  LEU A CA  1 
ATOM   3037 C  CA  B LEU A 1 343 ? 46.201 59.622 2.088   0.30 11.90 ? 340  LEU A CA  1 
ATOM   3038 C  C   . LEU A 1 343 ? 46.020 60.901 2.893   1.00 11.34 ? 340  LEU A C   1 
ATOM   3039 O  O   . LEU A 1 343 ? 46.987 61.509 3.328   1.00 11.73 ? 340  LEU A O   1 
ATOM   3040 C  CB  A LEU A 1 343 ? 46.768 59.719 0.767   0.70 11.51 ? 340  LEU A CB  1 
ATOM   3041 C  CB  B LEU A 1 343 ? 46.380 59.967 0.612   0.30 12.41 ? 340  LEU A CB  1 
ATOM   3042 C  CG  A LEU A 1 343 ? 47.488 58.494 0.160   0.70 12.70 ? 340  LEU A CG  1 
ATOM   3043 C  CG  B LEU A 1 343 ? 47.679 60.679 0.272   0.30 13.61 ? 340  LEU A CG  1 
ATOM   3044 C  CD1 A LEU A 1 343 ? 47.899 58.841 -1.207  0.70 15.98 ? 340  LEU A CD1 1 
ATOM   3045 C  CD1 B LEU A 1 343 ? 48.837 59.965 0.898   0.30 12.38 ? 340  LEU A CD1 1 
ATOM   3046 C  CD2 A LEU A 1 343 ? 48.625 57.978 0.997   0.70 14.38 ? 340  LEU A CD2 1 
ATOM   3047 C  CD2 B LEU A 1 343 ? 47.788 60.815 -1.247  0.30 13.98 ? 340  LEU A CD2 1 
ATOM   3048 N  N   . GLN A 1 344 ? 44.770 61.348 3.054   1.00 11.82 ? 341  GLN A N   1 
ATOM   3049 C  CA  . GLN A 1 344 ? 44.501 62.522 3.892   1.00 11.94 ? 341  GLN A CA  1 
ATOM   3050 C  C   . GLN A 1 344 ? 45.048 62.304 5.283   1.00 12.20 ? 341  GLN A C   1 
ATOM   3051 O  O   . GLN A 1 344 ? 45.681 63.198 5.848   1.00 12.52 ? 341  GLN A O   1 
ATOM   3052 C  CB  . GLN A 1 344 ? 43.020 62.838 4.017   1.00 14.00 ? 341  GLN A CB  1 
ATOM   3053 C  CG  . GLN A 1 344 ? 42.460 63.452 2.835   1.00 16.85 ? 341  GLN A CG  1 
ATOM   3054 C  CD  . GLN A 1 344 ? 40.997 63.787 2.984   1.00 18.20 ? 341  GLN A CD  1 
ATOM   3055 O  OE1 . GLN A 1 344 ? 40.233 63.078 3.687   1.00 19.47 ? 341  GLN A OE1 1 
ATOM   3056 N  NE2 . GLN A 1 344 ? 40.578 64.884 2.328   1.00 15.07 ? 341  GLN A NE2 1 
ATOM   3057 N  N   . GLN A 1 345 ? 44.804 61.127 5.880   1.00 11.51 ? 342  GLN A N   1 
ATOM   3058 C  CA  . GLN A 1 345 ? 45.428 60.843 7.195   1.00 11.22 ? 342  GLN A CA  1 
ATOM   3059 C  C   . GLN A 1 345 ? 46.929 60.738 7.105   1.00 11.46 ? 342  GLN A C   1 
ATOM   3060 O  O   . GLN A 1 345 ? 47.660 61.404 7.843   1.00 12.57 ? 342  GLN A O   1 
ATOM   3061 C  CB  . GLN A 1 345 ? 44.888 59.536 7.834   1.00 12.68 ? 342  GLN A CB  1 
ATOM   3062 C  CG  . GLN A 1 345 ? 45.530 59.363 9.252   1.00 14.23 ? 342  GLN A CG  1 
ATOM   3063 C  CD  . GLN A 1 345 ? 45.032 58.217 10.082  1.00 15.31 ? 342  GLN A CD  1 
ATOM   3064 O  OE1 . GLN A 1 345 ? 44.249 57.401 9.580   1.00 20.38 ? 342  GLN A OE1 1 
ATOM   3065 N  NE2 . GLN A 1 345 ? 45.503 58.123 11.390  1.00 16.58 ? 342  GLN A NE2 1 
ATOM   3066 N  N   . ALA A 1 346 ? 47.445 59.971 6.149   1.00 10.14 ? 343  ALA A N   1 
ATOM   3067 C  CA  . ALA A 1 346 ? 48.910 59.790 6.097   1.00 9.98  ? 343  ALA A CA  1 
ATOM   3068 C  C   . ALA A 1 346 ? 49.628 61.126 5.963   1.00 10.81 ? 343  ALA A C   1 
ATOM   3069 O  O   . ALA A 1 346 ? 50.665 61.352 6.573   1.00 11.44 ? 343  ALA A O   1 
ATOM   3070 C  CB  . ALA A 1 346 ? 49.302 58.865 4.912   1.00 11.01 ? 343  ALA A CB  1 
ATOM   3071 N  N   . ASP A 1 347 ? 49.109 61.979 5.100   1.00 9.63  ? 344  ASP A N   1 
ATOM   3072 C  CA  . ASP A 1 347 ? 49.753 63.262 4.772   1.00 9.76  ? 344  ASP A CA  1 
ATOM   3073 C  C   . ASP A 1 347 ? 49.463 64.316 5.833   1.00 9.85  ? 344  ASP A C   1 
ATOM   3074 O  O   . ASP A 1 347 ? 50.368 64.788 6.536   1.00 10.29 ? 344  ASP A O   1 
ATOM   3075 C  CB  . ASP A 1 347 ? 49.275 63.679 3.389   1.00 9.87  ? 344  ASP A CB  1 
ATOM   3076 C  CG  . ASP A 1 347 ? 49.961 64.877 2.816   1.00 12.13 ? 344  ASP A CG  1 
ATOM   3077 O  OD1 . ASP A 1 347 ? 50.702 65.557 3.547   1.00 12.85 ? 344  ASP A OD1 1 
ATOM   3078 O  OD2 . ASP A 1 347 ? 49.758 65.133 1.589   1.00 13.61 ? 344  ASP A OD2 1 
HETATM 3079 N  N   . MSE A 1 348 ? 48.192 64.615 6.059   1.00 9.81  ? 345  MSE A N   1 
HETATM 3080 C  CA  . MSE A 1 348 ? 47.820 65.765 6.900   1.00 8.81  ? 345  MSE A CA  1 
HETATM 3081 C  C   . MSE A 1 348 ? 48.105 65.530 8.364   1.00 9.17  ? 345  MSE A C   1 
HETATM 3082 O  O   . MSE A 1 348 ? 48.506 66.459 9.058   1.00 9.67  ? 345  MSE A O   1 
HETATM 3083 C  CB  . MSE A 1 348 ? 46.370 66.192 6.697   1.00 9.14  ? 345  MSE A CB  1 
HETATM 3084 C  CG  . MSE A 1 348 ? 46.085 66.542 5.236   1.00 10.60 ? 345  MSE A CG  1 
HETATM 3085 SE SE  . MSE A 1 348 ? 44.190 66.840 4.826   0.70 16.04 ? 345  MSE A SE  1 
HETATM 3086 C  CE  . MSE A 1 348 ? 44.132 68.076 5.515   1.00 7.40  ? 345  MSE A CE  1 
ATOM   3087 N  N   . GLU A 1 349 ? 47.899 64.319 8.856   1.00 9.60  ? 346  GLU A N   1 
ATOM   3088 C  CA  . GLU A 1 349 ? 48.177 64.064 10.266  1.00 9.39  ? 346  GLU A CA  1 
ATOM   3089 C  C   . GLU A 1 349 ? 49.706 64.045 10.526  1.00 10.66 ? 346  GLU A C   1 
ATOM   3090 O  O   . GLU A 1 349 ? 50.148 64.320 11.623  1.00 11.08 ? 346  GLU A O   1 
ATOM   3091 C  CB  . GLU A 1 349 ? 47.554 62.763 10.731  1.00 11.07 ? 346  GLU A CB  1 
ATOM   3092 C  CG  . GLU A 1 349 ? 47.462 62.618 12.227  1.00 11.63 ? 346  GLU A CG  1 
ATOM   3093 C  CD  . GLU A 1 349 ? 46.673 61.390 12.666  1.00 13.57 ? 346  GLU A CD  1 
ATOM   3094 O  OE1 . GLU A 1 349 ? 47.208 60.272 12.515  1.00 14.62 ? 346  GLU A OE1 1 
ATOM   3095 O  OE2 . GLU A 1 349 ? 45.515 61.531 13.146  1.00 17.23 ? 346  GLU A OE2 1 
ATOM   3096 N  N   . SER A 1 350 ? 50.481 63.719 9.500   1.00 8.88  ? 347  SER A N   1 
ATOM   3097 C  CA  . SER A 1 350 ? 51.936 63.768 9.575   1.00 8.56  ? 347  SER A CA  1 
ATOM   3098 C  C   . SER A 1 350 ? 52.483 65.184 9.532   1.00 9.12  ? 347  SER A C   1 
ATOM   3099 O  O   . SER A 1 350 ? 53.292 65.568 10.385  1.00 9.82  ? 347  SER A O   1 
ATOM   3100 C  CB  . SER A 1 350 ? 52.589 62.961 8.465   1.00 8.71  ? 347  SER A CB  1 
ATOM   3101 O  OG  . SER A 1 350 ? 52.296 61.561 8.584   1.00 10.89 ? 347  SER A OG  1 
ATOM   3102 N  N   . ASN A 1 351 ? 52.051 65.956 8.533   1.00 9.61  ? 348  ASN A N   1 
ATOM   3103 C  CA  A ASN A 1 351 ? 52.734 67.210 8.220   0.60 9.16  ? 348  ASN A CA  1 
ATOM   3104 C  CA  B ASN A 1 351 ? 52.738 67.215 8.242   0.40 9.13  ? 348  ASN A CA  1 
ATOM   3105 C  C   . ASN A 1 351 ? 51.978 68.496 8.596   1.00 8.63  ? 348  ASN A C   1 
ATOM   3106 O  O   . ASN A 1 351 ? 52.498 69.597 8.386   1.00 9.90  ? 348  ASN A O   1 
ATOM   3107 C  CB  A ASN A 1 351 ? 53.255 67.238 6.772   0.60 9.59  ? 348  ASN A CB  1 
ATOM   3108 C  CB  B ASN A 1 351 ? 53.278 67.244 6.811   0.40 9.31  ? 348  ASN A CB  1 
ATOM   3109 C  CG  A ASN A 1 351 ? 54.353 66.184 6.503   0.60 9.27  ? 348  ASN A CG  1 
ATOM   3110 C  CG  B ASN A 1 351 ? 54.431 66.268 6.604   0.40 8.64  ? 348  ASN A CG  1 
ATOM   3111 O  OD1 A ASN A 1 351 ? 54.740 65.926 5.318   0.60 11.26 ? 348  ASN A OD1 1 
ATOM   3112 O  OD1 B ASN A 1 351 ? 55.093 65.881 7.559   0.40 9.47  ? 348  ASN A OD1 1 
ATOM   3113 N  ND2 A ASN A 1 351 ? 54.868 65.602 7.562   0.60 9.44  ? 348  ASN A ND2 1 
ATOM   3114 N  ND2 B ASN A 1 351 ? 54.689 65.889 5.326   0.40 10.32 ? 348  ASN A ND2 1 
ATOM   3115 N  N   . GLY A 1 352 ? 50.808 68.360 9.206   1.00 9.48  ? 349  GLY A N   1 
ATOM   3116 C  CA  . GLY A 1 352 ? 50.094 69.489 9.780   1.00 10.08 ? 349  GLY A CA  1 
ATOM   3117 C  C   . GLY A 1 352 ? 50.650 69.853 11.136  1.00 9.59  ? 349  GLY A C   1 
ATOM   3118 O  O   . GLY A 1 352 ? 50.083 69.523 12.166  1.00 10.06 ? 349  GLY A O   1 
ATOM   3119 N  N   . LYS A 1 353 ? 51.785 70.541 11.118  1.00 9.43  ? 350  LYS A N   1 
ATOM   3120 C  CA  . LYS A 1 353 ? 52.570 70.861 12.309  1.00 9.65  ? 350  LYS A CA  1 
ATOM   3121 C  C   . LYS A 1 353 ? 53.059 72.302 12.202  1.00 9.72  ? 350  LYS A C   1 
ATOM   3122 O  O   . LYS A 1 353 ? 53.460 72.765 11.131  1.00 11.30 ? 350  LYS A O   1 
ATOM   3123 C  CB  . LYS A 1 353 ? 53.831 69.968 12.429  1.00 9.53  ? 350  LYS A CB  1 
ATOM   3124 C  CG  . LYS A 1 353 ? 53.528 68.446 12.387  1.00 10.49 ? 350  LYS A CG  1 
ATOM   3125 C  CD  . LYS A 1 353 ? 52.864 67.973 13.613  1.00 9.31  ? 350  LYS A CD  1 
ATOM   3126 C  CE  . LYS A 1 353 ? 52.223 66.601 13.453  1.00 9.17  ? 350  LYS A CE  1 
ATOM   3127 N  NZ  . LYS A 1 353 ? 53.160 65.505 13.227  1.00 9.23  ? 350  LYS A NZ  1 
ATOM   3128 N  N   . SER A 1 354 ? 53.125 72.967 13.335  1.00 9.07  ? 351  SER A N   1 
ATOM   3129 C  CA  . SER A 1 354 ? 53.466 74.389 13.363  1.00 10.13 ? 351  SER A CA  1 
ATOM   3130 C  C   . SER A 1 354 ? 54.839 74.702 13.964  1.00 9.99  ? 351  SER A C   1 
ATOM   3131 O  O   . SER A 1 354 ? 55.306 75.848 13.884  1.00 11.05 ? 351  SER A O   1 
ATOM   3132 C  CB  . SER A 1 354 ? 52.393 75.192 14.115  1.00 10.19 ? 351  SER A CB  1 
ATOM   3133 O  OG  . SER A 1 354 ? 51.196 75.306 13.374  1.00 14.24 ? 351  SER A OG  1 
ATOM   3134 N  N   . VAL A 1 355 ? 55.440 73.705 14.596  1.00 9.94  ? 352  VAL A N   1 
ATOM   3135 C  CA  . VAL A 1 355 ? 56.769 73.826 15.190  1.00 10.51 ? 352  VAL A CA  1 
ATOM   3136 C  C   . VAL A 1 355 ? 57.750 72.844 14.562  1.00 10.88 ? 352  VAL A C   1 
ATOM   3137 O  O   . VAL A 1 355 ? 57.375 71.771 14.054  1.00 11.51 ? 352  VAL A O   1 
ATOM   3138 C  CB  . VAL A 1 355 ? 56.765 73.657 16.767  1.00 10.92 ? 352  VAL A CB  1 
ATOM   3139 C  CG1 . VAL A 1 355 ? 55.841 74.686 17.445  1.00 12.76 ? 352  VAL A CG1 1 
ATOM   3140 C  CG2 . VAL A 1 355 ? 56.387 72.217 17.147  1.00 11.17 ? 352  VAL A CG2 1 
ATOM   3141 N  N   . ASN A 1 356 ? 59.015 73.274 14.548  1.00 9.90  ? 353  ASN A N   1 
ATOM   3142 C  CA  . ASN A 1 356 ? 60.096 72.405 14.087  1.00 10.13 ? 353  ASN A CA  1 
ATOM   3143 C  C   . ASN A 1 356 ? 60.531 71.396 15.176  1.00 11.25 ? 353  ASN A C   1 
ATOM   3144 O  O   . ASN A 1 356 ? 59.986 71.361 16.275  1.00 10.95 ? 353  ASN A O   1 
ATOM   3145 C  CB  . ASN A 1 356 ? 61.251 73.230 13.508  1.00 10.74 ? 353  ASN A CB  1 
ATOM   3146 C  CG  . ASN A 1 356 ? 61.910 74.148 14.512  1.00 11.49 ? 353  ASN A CG  1 
ATOM   3147 O  OD1 . ASN A 1 356 ? 61.818 73.921 15.736  1.00 11.76 ? 353  ASN A OD1 1 
ATOM   3148 N  ND2 . ASN A 1 356 ? 62.635 75.173 14.001  1.00 11.88 ? 353  ASN A ND2 1 
ATOM   3149 N  N   . ILE A 1 357 ? 61.524 70.583 14.857  1.00 12.16 ? 354  ILE A N   1 
ATOM   3150 C  CA  . ILE A 1 357 ? 62.053 69.564 15.759  1.00 12.68 ? 354  ILE A CA  1 
ATOM   3151 C  C   . ILE A 1 357 ? 62.492 70.160 17.110  1.00 11.71 ? 354  ILE A C   1 
ATOM   3152 O  O   . ILE A 1 357 ? 62.267 69.569 18.160  1.00 13.31 ? 354  ILE A O   1 
ATOM   3153 C  CB  . ILE A 1 357 ? 63.196 68.782 15.083  1.00 13.45 ? 354  ILE A CB  1 
ATOM   3154 C  CG1 . ILE A 1 357 ? 62.681 67.974 13.865  1.00 18.30 ? 354  ILE A CG1 1 
ATOM   3155 C  CG2 . ILE A 1 357 ? 63.899 67.919 16.155  1.00 15.06 ? 354  ILE A CG2 1 
ATOM   3156 C  CD1 . ILE A 1 357 ? 61.667 67.056 14.192  1.00 20.45 ? 354  ILE A CD1 1 
ATOM   3157 N  N   . ALA A 1 358 ? 62.998 71.380 17.078  1.00 12.47 ? 355  ALA A N   1 
ATOM   3158 C  CA  . ALA A 1 358 ? 63.480 72.108 18.249  1.00 12.32 ? 355  ALA A CA  1 
ATOM   3159 C  C   . ALA A 1 358 ? 62.363 72.764 19.030  1.00 12.21 ? 355  ALA A C   1 
ATOM   3160 O  O   . ALA A 1 358 ? 62.620 73.349 20.122  1.00 14.62 ? 355  ALA A O   1 
ATOM   3161 C  CB  . ALA A 1 358 ? 64.509 73.206 17.814  1.00 14.30 ? 355  ALA A CB  1 
ATOM   3162 N  N   . GLY A 1 359 ? 61.136 72.677 18.515  1.00 12.20 ? 356  GLY A N   1 
ATOM   3163 C  CA  . GLY A 1 359 ? 59.999 73.287 19.173  1.00 12.83 ? 356  GLY A CA  1 
ATOM   3164 C  C   . GLY A 1 359 ? 59.741 74.755 18.882  1.00 12.98 ? 356  GLY A C   1 
ATOM   3165 O  O   . GLY A 1 359 ? 58.914 75.391 19.529  1.00 13.91 ? 356  GLY A O   1 
ATOM   3166 N  N   . GLU A 1 360 ? 60.410 75.299 17.879  1.00 12.14 ? 357  GLU A N   1 
ATOM   3167 C  CA  . GLU A 1 360 ? 60.237 76.685 17.528  1.00 12.83 ? 357  GLU A CA  1 
ATOM   3168 C  C   . GLU A 1 360 ? 59.097 76.805 16.536  1.00 11.81 ? 357  GLU A C   1 
ATOM   3169 O  O   . GLU A 1 360 ? 58.960 75.970 15.627  1.00 11.43 ? 357  GLU A O   1 
ATOM   3170 C  CB  . GLU A 1 360 ? 61.529 77.241 16.920  1.00 13.42 ? 357  GLU A CB  1 
ATOM   3171 C  CG  . GLU A 1 360 ? 62.760 77.083 17.811  1.00 14.84 ? 357  GLU A CG  1 
ATOM   3172 C  CD  . GLU A 1 360 ? 64.095 77.166 17.085  1.00 20.52 ? 357  GLU A CD  1 
ATOM   3173 O  OE1 . GLU A 1 360 ? 64.207 76.932 15.860  1.00 20.51 ? 357  GLU A OE1 1 
ATOM   3174 O  OE2 . GLU A 1 360 ? 65.085 77.452 17.787  1.00 28.12 ? 357  GLU A OE2 1 
ATOM   3175 N  N   . THR A 1 361 ? 58.292 77.854 16.671  1.00 11.45 ? 358  THR A N   1 
ATOM   3176 C  CA  . THR A 1 361 ? 57.230 78.097 15.682  1.00 12.29 ? 358  THR A CA  1 
ATOM   3177 C  C   . THR A 1 361 ? 57.895 78.468 14.344  1.00 12.25 ? 358  THR A C   1 
ATOM   3178 O  O   . THR A 1 361 ? 58.740 79.390 14.298  1.00 15.96 ? 358  THR A O   1 
ATOM   3179 C  CB  . THR A 1 361 ? 56.341 79.227 16.177  1.00 12.58 ? 358  THR A CB  1 
ATOM   3180 O  OG1 . THR A 1 361 ? 55.728 78.820 17.413  1.00 16.10 ? 358  THR A OG1 1 
ATOM   3181 C  CG2 . THR A 1 361 ? 55.255 79.559 15.071  1.00 15.58 ? 358  THR A CG2 1 
ATOM   3182 N  N   . VAL A 1 362 ? 57.525 77.782 13.266  1.00 12.00 ? 359  VAL A N   1 
ATOM   3183 C  CA  . VAL A 1 362 ? 58.118 78.001 11.930  1.00 12.60 ? 359  VAL A CA  1 
ATOM   3184 C  C   . VAL A 1 362 ? 57.448 79.171 11.213  1.00 13.94 ? 359  VAL A C   1 
ATOM   3185 O  O   . VAL A 1 362 ? 56.251 79.392 11.364  1.00 13.92 ? 359  VAL A O   1 
ATOM   3186 C  CB  . VAL A 1 362 ? 58.175 76.700 11.080  1.00 12.57 ? 359  VAL A CB  1 
ATOM   3187 C  CG1 . VAL A 1 362 ? 59.082 75.629 11.789  1.00 13.50 ? 359  VAL A CG1 1 
ATOM   3188 C  CG2 . VAL A 1 362 ? 56.783 76.165 10.709  1.00 11.94 ? 359  VAL A CG2 1 
ATOM   3189 N  N   . ASN A 1 363 ? 58.249 79.921 10.461  1.00 15.07 ? 360  ASN A N   1 
ATOM   3190 C  CA  A ASN A 1 363 ? 57.747 81.075 9.718   0.70 15.78 ? 360  ASN A CA  1 
ATOM   3191 C  CA  B ASN A 1 363 ? 57.808 81.091 9.716   0.30 15.56 ? 360  ASN A CA  1 
ATOM   3192 C  C   . ASN A 1 363 ? 57.452 80.775 8.263   1.00 15.67 ? 360  ASN A C   1 
ATOM   3193 O  O   . ASN A 1 363 ? 57.406 81.662 7.406   1.00 19.24 ? 360  ASN A O   1 
ATOM   3194 C  CB  A ASN A 1 363 ? 58.734 82.274 9.855   0.70 16.92 ? 360  ASN A CB  1 
ATOM   3195 C  CB  B ASN A 1 363 ? 58.931 82.150 9.751   0.30 16.12 ? 360  ASN A CB  1 
ATOM   3196 C  CG  A ASN A 1 363 ? 58.710 82.875 11.249  0.70 22.44 ? 360  ASN A CG  1 
ATOM   3197 C  CG  B ASN A 1 363 ? 58.469 83.503 9.273   0.30 17.88 ? 360  ASN A CG  1 
ATOM   3198 O  OD1 A ASN A 1 363 ? 57.642 82.964 11.878  0.70 29.05 ? 360  ASN A OD1 1 
ATOM   3199 O  OD1 B ASN A 1 363 ? 59.261 84.287 8.731   0.30 22.25 ? 360  ASN A OD1 1 
ATOM   3200 N  ND2 A ASN A 1 363 ? 59.872 83.284 11.746  0.70 26.90 ? 360  ASN A ND2 1 
ATOM   3201 N  ND2 B ASN A 1 363 ? 57.181 83.790 9.455   0.30 19.03 ? 360  ASN A ND2 1 
ATOM   3202 N  N   . TYR A 1 364 ? 57.268 79.524 7.958   1.00 11.74 ? 361  TYR A N   1 
ATOM   3203 C  CA  . TYR A 1 364 ? 56.877 79.077 6.607   1.00 11.64 ? 361  TYR A CA  1 
ATOM   3204 C  C   . TYR A 1 364 ? 55.720 78.103 6.745   1.00 10.57 ? 361  TYR A C   1 
ATOM   3205 O  O   . TYR A 1 364 ? 55.538 77.463 7.798   1.00 9.84  ? 361  TYR A O   1 
ATOM   3206 C  CB  . TYR A 1 364 ? 58.059 78.408 5.858   1.00 10.31 ? 361  TYR A CB  1 
ATOM   3207 C  CG  . TYR A 1 364 ? 58.845 77.414 6.710   1.00 11.12 ? 361  TYR A CG  1 
ATOM   3208 C  CD1 . TYR A 1 364 ? 58.452 76.085 6.839   1.00 11.08 ? 361  TYR A CD1 1 
ATOM   3209 C  CD2 . TYR A 1 364 ? 59.985 77.806 7.393   1.00 11.20 ? 361  TYR A CD2 1 
ATOM   3210 C  CE1 . TYR A 1 364 ? 59.164 75.194 7.611   1.00 11.12 ? 361  TYR A CE1 1 
ATOM   3211 C  CE2 . TYR A 1 364 ? 60.711 76.905 8.179   1.00 9.79  ? 361  TYR A CE2 1 
ATOM   3212 C  CZ  . TYR A 1 364 ? 60.312 75.601 8.264   1.00 9.64  ? 361  TYR A CZ  1 
ATOM   3213 O  OH  . TYR A 1 364 ? 61.032 74.735 9.003   1.00 10.79 ? 361  TYR A OH  1 
ATOM   3214 N  N   . GLN A 1 365 ? 54.956 77.975 5.677   1.00 10.08 ? 362  GLN A N   1 
ATOM   3215 C  CA  . GLN A 1 365 ? 53.826 77.035 5.638   1.00 9.94  ? 362  GLN A CA  1 
ATOM   3216 C  C   . GLN A 1 365 ? 54.339 75.583 5.607   1.00 10.81 ? 362  GLN A C   1 
ATOM   3217 O  O   . GLN A 1 365 ? 55.341 75.318 4.994   1.00 10.38 ? 362  GLN A O   1 
ATOM   3218 C  CB  . GLN A 1 365 ? 52.985 77.350 4.418   1.00 10.15 ? 362  GLN A CB  1 
ATOM   3219 C  CG  . GLN A 1 365 ? 51.644 76.589 4.381   1.00 10.22 ? 362  GLN A CG  1 
ATOM   3220 C  CD  . GLN A 1 365 ? 50.868 76.978 3.139   1.00 10.76 ? 362  GLN A CD  1 
ATOM   3221 O  OE1 . GLN A 1 365 ? 49.969 77.836 3.191   1.00 11.41 ? 362  GLN A OE1 1 
ATOM   3222 N  NE2 . GLN A 1 365 ? 51.229 76.372 2.007   1.00 12.03 ? 362  GLN A NE2 1 
ATOM   3223 N  N   . THR A 1 366 ? 53.676 74.677 6.293   1.00 9.37  ? 363  THR A N   1 
ATOM   3224 C  CA  . THR A 1 366 ? 54.033 73.259 6.272   1.00 9.50  ? 363  THR A CA  1 
ATOM   3225 C  C   . THR A 1 366 ? 52.949 72.477 5.495   1.00 9.67  ? 363  THR A C   1 
ATOM   3226 O  O   . THR A 1 366 ? 52.572 72.884 4.382   1.00 9.97  ? 363  THR A O   1 
ATOM   3227 C  CB  . THR A 1 366 ? 54.307 72.744 7.689   1.00 9.22  ? 363  THR A CB  1 
ATOM   3228 O  OG1 . THR A 1 366 ? 53.133 72.958 8.491   1.00 9.54  ? 363  THR A OG1 1 
ATOM   3229 C  CG2 . THR A 1 366 ? 55.546 73.446 8.273   1.00 11.49 ? 363  THR A CG2 1 
ATOM   3230 N  N   . GLY A 1 367 ? 52.374 71.403 6.055   1.00 9.10  ? 364  GLY A N   1 
ATOM   3231 C  CA  . GLY A 1 367 ? 51.503 70.547 5.271   1.00 10.00 ? 364  GLY A CA  1 
ATOM   3232 C  C   . GLY A 1 367 ? 50.243 71.235 4.840   1.00 9.92  ? 364  GLY A C   1 
ATOM   3233 O  O   . GLY A 1 367 ? 49.698 72.046 5.578   1.00 9.96  ? 364  GLY A O   1 
ATOM   3234 N  N   . VAL A 1 368 ? 49.813 70.938 3.599   1.00 9.73  ? 365  VAL A N   1 
ATOM   3235 C  CA  . VAL A 1 368 ? 48.603 71.523 3.036   1.00 10.05 ? 365  VAL A CA  1 
ATOM   3236 C  C   . VAL A 1 368 ? 47.453 70.476 3.007   1.00 9.72  ? 365  VAL A C   1 
ATOM   3237 O  O   . VAL A 1 368 ? 47.622 69.283 3.315   1.00 10.22 ? 365  VAL A O   1 
ATOM   3238 C  CB  . VAL A 1 368 ? 48.879 72.143 1.657   1.00 10.31 ? 365  VAL A CB  1 
ATOM   3239 C  CG1 . VAL A 1 368 ? 50.025 73.184 1.760   1.00 12.10 ? 365  VAL A CG1 1 
ATOM   3240 C  CG2 . VAL A 1 368 ? 49.142 71.126 0.536   1.00 10.98 ? 365  VAL A CG2 1 
ATOM   3241 N  N   . VAL A 1 369 ? 46.282 70.964 2.582   1.00 9.12  ? 366  VAL A N   1 
ATOM   3242 C  CA  . VAL A 1 369 ? 45.112 70.105 2.453   1.00 9.33  ? 366  VAL A CA  1 
ATOM   3243 C  C   . VAL A 1 369 ? 45.286 69.162 1.267   1.00 10.04 ? 366  VAL A C   1 
ATOM   3244 O  O   . VAL A 1 369 ? 45.591 69.608 0.155   1.00 11.89 ? 366  VAL A O   1 
ATOM   3245 C  CB  . VAL A 1 369 ? 43.834 70.955 2.310   1.00 9.17  ? 366  VAL A CB  1 
ATOM   3246 C  CG1 . VAL A 1 369 ? 42.617 70.063 2.049   1.00 11.68 ? 366  VAL A CG1 1 
ATOM   3247 C  CG2 . VAL A 1 369 ? 43.644 71.826 3.559   1.00 10.05 ? 366  VAL A CG2 1 
ATOM   3248 N  N   . LEU A 1 370 ? 45.042 67.877 1.481   1.00 10.63 ? 367  LEU A N   1 
ATOM   3249 C  CA  . LEU A 1 370 ? 44.996 66.891 0.437   1.00 10.74 ? 367  LEU A CA  1 
ATOM   3250 C  C   . LEU A 1 370 ? 43.541 66.564 0.179   1.00 11.29 ? 367  LEU A C   1 
ATOM   3251 O  O   . LEU A 1 370 ? 42.831 66.242 1.137   1.00 11.37 ? 367  LEU A O   1 
ATOM   3252 C  CB  . LEU A 1 370 ? 45.777 65.616 0.803   1.00 10.54 ? 367  LEU A CB  1 
ATOM   3253 C  CG  . LEU A 1 370 ? 45.973 64.593 -0.323  1.00 11.66 ? 367  LEU A CG  1 
ATOM   3254 C  CD1 . LEU A 1 370 ? 46.671 65.108 -1.550  1.00 14.00 ? 367  LEU A CD1 1 
ATOM   3255 C  CD2 . LEU A 1 370 ? 46.667 63.354 0.216   1.00 17.73 ? 367  LEU A CD2 1 
ATOM   3256 N  N   . TRP A 1 371 ? 43.113 66.616 -1.076  1.00 9.62  ? 368  TRP A N   1 
ATOM   3257 C  CA  . TRP A 1 371 ? 41.734 66.287 -1.405  1.00 10.35 ? 368  TRP A CA  1 
ATOM   3258 C  C   . TRP A 1 371 ? 41.723 65.704 -2.811  1.00 9.69  ? 368  TRP A C   1 
ATOM   3259 O  O   . TRP A 1 371 ? 42.767 65.634 -3.473  1.00 10.94 ? 368  TRP A O   1 
ATOM   3260 C  CB  . TRP A 1 371 ? 40.807 67.561 -1.289  1.00 9.16  ? 368  TRP A CB  1 
ATOM   3261 C  CG  . TRP A 1 371 ? 41.166 68.620 -2.300  1.00 9.56  ? 368  TRP A CG  1 
ATOM   3262 C  CD1 . TRP A 1 371 ? 42.230 69.463 -2.248  1.00 10.72 ? 368  TRP A CD1 1 
ATOM   3263 C  CD2 . TRP A 1 371 ? 40.531 68.853 -3.550  1.00 9.86  ? 368  TRP A CD2 1 
ATOM   3264 N  NE1 . TRP A 1 371 ? 42.292 70.249 -3.377  1.00 11.69 ? 368  TRP A NE1 1 
ATOM   3265 C  CE2 . TRP A 1 371 ? 41.261 69.876 -4.212  1.00 11.00 ? 368  TRP A CE2 1 
ATOM   3266 C  CE3 . TRP A 1 371 ? 39.404 68.326 -4.169  1.00 10.88 ? 368  TRP A CE3 1 
ATOM   3267 C  CZ2 . TRP A 1 371 ? 40.878 70.379 -5.483  1.00 11.38 ? 368  TRP A CZ2 1 
ATOM   3268 C  CZ3 . TRP A 1 371 ? 39.062 68.804 -5.440  1.00 12.65 ? 368  TRP A CZ3 1 
ATOM   3269 C  CH2 . TRP A 1 371 ? 39.770 69.820 -6.066  1.00 12.01 ? 368  TRP A CH2 1 
ATOM   3270 N  N   . GLY A 1 372 ? 40.542 65.314 -3.304  1.00 9.81  ? 369  GLY A N   1 
ATOM   3271 C  CA  . GLY A 1 372 ? 40.410 64.889 -4.680  1.00 10.94 ? 369  GLY A CA  1 
ATOM   3272 C  C   . GLY A 1 372 ? 39.224 64.024 -4.897  1.00 12.90 ? 369  GLY A C   1 
ATOM   3273 O  O   . GLY A 1 372 ? 38.197 64.205 -4.243  1.00 17.71 ? 369  GLY A O   1 
ATOM   3274 N  N   . GLY A 1 373 ? 39.308 63.119 -5.838  1.00 12.05 ? 370  GLY A N   1 
ATOM   3275 C  CA  . GLY A 1 373 ? 38.143 62.333 -6.185  1.00 13.80 ? 370  GLY A CA  1 
ATOM   3276 C  C   . GLY A 1 373 ? 38.425 61.450 -7.398  1.00 11.38 ? 370  GLY A C   1 
ATOM   3277 O  O   . GLY A 1 373 ? 39.259 61.770 -8.205  1.00 10.93 ? 370  GLY A O   1 
ATOM   3278 N  N   . VAL A 1 374 ? 37.733 60.317 -7.461  1.00 10.87 ? 371  VAL A N   1 
ATOM   3279 C  CA  . VAL A 1 374 ? 37.854 59.391 -8.548  1.00 10.29 ? 371  VAL A CA  1 
ATOM   3280 C  C   . VAL A 1 374 ? 37.401 60.011 -9.870  1.00 9.68  ? 371  VAL A C   1 
ATOM   3281 O  O   . VAL A 1 374 ? 36.409 60.719 -9.975  1.00 10.64 ? 371  VAL A O   1 
ATOM   3282 C  CB  . VAL A 1 374 ? 37.004 58.125 -8.221  1.00 10.54 ? 371  VAL A CB  1 
ATOM   3283 C  CG1 . VAL A 1 374 ? 36.738 57.203 -9.409  1.00 12.22 ? 371  VAL A CG1 1 
ATOM   3284 C  CG2 . VAL A 1 374 ? 37.645 57.352 -7.020  1.00 14.82 ? 371  VAL A CG2 1 
ATOM   3285 N  N   . GLY A 1 375 ? 38.182 59.710 -10.897 1.00 8.91  ? 372  GLY A N   1 
ATOM   3286 C  CA  . GLY A 1 375 ? 37.893 60.020 -12.292 1.00 9.38  ? 372  GLY A CA  1 
ATOM   3287 C  C   . GLY A 1 375 ? 37.295 58.774 -12.969 1.00 9.52  ? 372  GLY A C   1 
ATOM   3288 O  O   . GLY A 1 375 ? 37.668 57.635 -12.641 1.00 9.56  ? 372  GLY A O   1 
ATOM   3289 N  N   . THR A 1 376 ? 36.392 58.957 -13.932 1.00 9.06  ? 373  THR A N   1 
ATOM   3290 C  CA  . THR A 1 376 ? 36.078 60.259 -14.542 1.00 9.79  ? 373  THR A CA  1 
ATOM   3291 C  C   . THR A 1 376 ? 35.057 61.111 -13.783 1.00 9.66  ? 373  THR A C   1 
ATOM   3292 O  O   . THR A 1 376 ? 34.802 62.241 -14.181 1.00 9.95  ? 373  THR A O   1 
ATOM   3293 C  CB  . THR A 1 376 ? 35.560 60.104 -16.008 1.00 9.86  ? 373  THR A CB  1 
ATOM   3294 O  OG1 . THR A 1 376 ? 34.259 59.501 -15.955 1.00 10.03 ? 373  THR A OG1 1 
ATOM   3295 C  CG2 . THR A 1 376 ? 36.515 59.250 -16.884 1.00 10.71 ? 373  THR A CG2 1 
ATOM   3296 N  N   . ASN A 1 377 ? 34.471 60.575 -12.707 1.00 10.12 ? 374  ASN A N   1 
ATOM   3297 C  CA  . ASN A 1 377 ? 33.415 61.280 -12.018 1.00 9.79  ? 374  ASN A CA  1 
ATOM   3298 C  C   . ASN A 1 377 ? 33.776 62.715 -11.642 1.00 10.36 ? 374  ASN A C   1 
ATOM   3299 O  O   . ASN A 1 377 ? 32.911 63.612 -11.786 1.00 10.34 ? 374  ASN A O   1 
ATOM   3300 C  CB  . ASN A 1 377 ? 32.996 60.544 -10.767 1.00 10.38 ? 374  ASN A CB  1 
ATOM   3301 C  CG  . ASN A 1 377 ? 32.456 59.188 -11.076 1.00 11.88 ? 374  ASN A CG  1 
ATOM   3302 O  OD1 . ASN A 1 377 ? 33.184 58.344 -11.592 1.00 14.21 ? 374  ASN A OD1 1 
ATOM   3303 N  ND2 . ASN A 1 377 ? 31.175 58.945 -10.753 1.00 12.04 ? 374  ASN A ND2 1 
ATOM   3304 N  N   . GLY A 1 378 ? 34.991 62.951 -11.153 1.00 10.50 ? 375  GLY A N   1 
ATOM   3305 C  CA  . GLY A 1 378 ? 35.356 64.314 -10.747 1.00 9.51  ? 375  GLY A CA  1 
ATOM   3306 C  C   . GLY A 1 378 ? 35.269 65.335 -11.854 1.00 10.07 ? 375  GLY A C   1 
ATOM   3307 O  O   . GLY A 1 378 ? 35.072 66.508 -11.602 1.00 10.52 ? 375  GLY A O   1 
ATOM   3308 N  N   . GLN A 1 379 ? 35.399 64.888 -13.097 1.00 9.92  ? 376  GLN A N   1 
ATOM   3309 C  CA  . GLN A 1 379 ? 35.260 65.775 -14.249 1.00 9.84  ? 376  GLN A CA  1 
ATOM   3310 C  C   . GLN A 1 379 ? 33.915 66.484 -14.298 1.00 11.08 ? 376  GLN A C   1 
ATOM   3311 O  O   . GLN A 1 379 ? 33.774 67.570 -14.892 1.00 11.56 ? 376  GLN A O   1 
ATOM   3312 C  CB  . GLN A 1 379 ? 35.422 65.005 -15.557 1.00 9.87  ? 376  GLN A CB  1 
ATOM   3313 C  CG  . GLN A 1 379 ? 36.787 64.366 -15.743 1.00 8.93  ? 376  GLN A CG  1 
ATOM   3314 C  CD  . GLN A 1 379 ? 36.939 63.489 -16.937 1.00 8.91  ? 376  GLN A CD  1 
ATOM   3315 O  OE1 . GLN A 1 379 ? 36.112 63.507 -17.962 1.00 12.79 ? 376  GLN A OE1 1 
ATOM   3316 N  NE2 . GLN A 1 379 ? 37.961 62.716 -16.881 1.00 7.43  ? 376  GLN A NE2 1 
ATOM   3317 N  N   . HIS A 1 380 ? 32.920 65.834 -13.696 1.00 10.19 ? 377  HIS A N   1 
ATOM   3318 C  CA  . HIS A 1 380 ? 31.552 66.271 -13.651 1.00 10.76 ? 377  HIS A CA  1 
ATOM   3319 C  C   . HIS A 1 380 ? 31.163 66.809 -12.287 1.00 12.92 ? 377  HIS A C   1 
ATOM   3320 O  O   . HIS A 1 380 ? 29.955 66.929 -12.013 1.00 15.82 ? 377  HIS A O   1 
ATOM   3321 C  CB  . HIS A 1 380 ? 30.615 65.106 -14.019 1.00 10.92 ? 377  HIS A CB  1 
ATOM   3322 C  CG  . HIS A 1 380 ? 30.926 64.461 -15.329 1.00 10.79 ? 377  HIS A CG  1 
ATOM   3323 N  ND1 . HIS A 1 380 ? 30.300 64.805 -16.530 1.00 12.70 ? 377  HIS A ND1 1 
ATOM   3324 C  CD2 . HIS A 1 380 ? 31.811 63.468 -15.625 1.00 11.46 ? 377  HIS A CD2 1 
ATOM   3325 C  CE1 . HIS A 1 380 ? 30.802 64.039 -17.494 1.00 14.56 ? 377  HIS A CE1 1 
ATOM   3326 N  NE2 . HIS A 1 380 ? 31.760 63.268 -16.987 1.00 12.74 ? 377  HIS A NE2 1 
ATOM   3327 N  N   . ALA A 1 381 ? 32.128 67.106 -11.447 1.00 12.06 ? 378  ALA A N   1 
ATOM   3328 C  CA  . ALA A 1 381 ? 31.877 67.618 -10.100 1.00 12.46 ? 378  ALA A CA  1 
ATOM   3329 C  C   . ALA A 1 381 ? 32.721 68.858 -9.851  1.00 12.63 ? 378  ALA A C   1 
ATOM   3330 O  O   . ALA A 1 381 ? 32.179 69.949 -9.613  1.00 14.78 ? 378  ALA A O   1 
ATOM   3331 C  CB  . ALA A 1 381 ? 32.125 66.526 -9.025  1.00 13.60 ? 378  ALA A CB  1 
ATOM   3332 N  N   . PHE A 1 382 ? 34.047 68.723 -9.895  1.00 11.02 ? 379  PHE A N   1 
ATOM   3333 C  CA  . PHE A 1 382 ? 34.936 69.800 -9.492  1.00 11.08 ? 379  PHE A CA  1 
ATOM   3334 C  C   . PHE A 1 382 ? 36.024 70.175 -10.469 1.00 10.50 ? 379  PHE A C   1 
ATOM   3335 O  O   . PHE A 1 382 ? 36.756 71.147 -10.222 1.00 11.74 ? 379  PHE A O   1 
ATOM   3336 C  CB  . PHE A 1 382 ? 35.521 69.536 -8.098  1.00 11.25 ? 379  PHE A CB  1 
ATOM   3337 C  CG  . PHE A 1 382 ? 36.236 68.230 -7.985  1.00 10.68 ? 379  PHE A CG  1 
ATOM   3338 C  CD1 . PHE A 1 382 ? 37.491 68.097 -8.527  1.00 9.76  ? 379  PHE A CD1 1 
ATOM   3339 C  CD2 . PHE A 1 382 ? 35.616 67.127 -7.414  1.00 11.13 ? 379  PHE A CD2 1 
ATOM   3340 C  CE1 . PHE A 1 382 ? 38.145 66.877 -8.486  1.00 12.94 ? 379  PHE A CE1 1 
ATOM   3341 C  CE2 . PHE A 1 382 ? 36.277 65.897 -7.378  1.00 13.02 ? 379  PHE A CE2 1 
ATOM   3342 C  CZ  . PHE A 1 382 ? 37.544 65.782 -7.935  1.00 13.46 ? 379  PHE A CZ  1 
ATOM   3343 N  N   . HIS A 1 383 ? 36.211 69.414 -11.557 1.00 9.45  ? 380  HIS A N   1 
ATOM   3344 C  CA  . HIS A 1 383 ? 37.226 69.810 -12.510 1.00 9.13  ? 380  HIS A CA  1 
ATOM   3345 C  C   . HIS A 1 383 ? 36.946 71.205 -13.114 1.00 9.64  ? 380  HIS A C   1 
ATOM   3346 O  O   . HIS A 1 383 ? 37.885 71.882 -13.538 1.00 9.88  ? 380  HIS A O   1 
ATOM   3347 C  CB  . HIS A 1 383 ? 37.503 68.786 -13.614 1.00 9.98  ? 380  HIS A CB  1 
ATOM   3348 C  CG  . HIS A 1 383 ? 38.176 67.517 -13.170 1.00 9.66  ? 380  HIS A CG  1 
ATOM   3349 N  ND1 . HIS A 1 383 ? 38.961 66.778 -14.022 1.00 9.74  ? 380  HIS A ND1 1 
ATOM   3350 C  CD2 . HIS A 1 383 ? 38.118 66.819 -12.010 1.00 10.10 ? 380  HIS A CD2 1 
ATOM   3351 C  CE1 . HIS A 1 383 ? 39.373 65.684 -13.384 1.00 11.44 ? 380  HIS A CE1 1 
ATOM   3352 N  NE2 . HIS A 1 383 ? 38.895 65.689 -12.159 1.00 10.18 ? 380  HIS A NE2 1 
ATOM   3353 N  N   . GLN A 1 384 ? 35.673 71.633 -13.157 1.00 8.88  ? 381  GLN A N   1 
ATOM   3354 C  CA  . GLN A 1 384 ? 35.396 73.005 -13.564 1.00 8.36  ? 381  GLN A CA  1 
ATOM   3355 C  C   . GLN A 1 384 ? 36.303 74.008 -12.825 1.00 8.99  ? 381  GLN A C   1 
ATOM   3356 O  O   . GLN A 1 384 ? 36.818 74.941 -13.463 1.00 9.36  ? 381  GLN A O   1 
ATOM   3357 C  CB  . GLN A 1 384 ? 33.921 73.331 -13.333 1.00 9.30  ? 381  GLN A CB  1 
ATOM   3358 C  CG  . GLN A 1 384 ? 33.573 74.833 -13.306 1.00 9.11  ? 381  GLN A CG  1 
ATOM   3359 C  CD  . GLN A 1 384 ? 33.713 75.482 -14.643 1.00 8.95  ? 381  GLN A CD  1 
ATOM   3360 O  OE1 . GLN A 1 384 ? 33.447 74.866 -15.703 1.00 9.95  ? 381  GLN A OE1 1 
ATOM   3361 N  NE2 . GLN A 1 384 ? 34.145 76.752 -14.616 1.00 9.14  ? 381  GLN A NE2 1 
ATOM   3362 N  N   . LEU A 1 385 ? 36.465 73.827 -11.529 1.00 9.40  ? 382  LEU A N   1 
ATOM   3363 C  CA  . LEU A 1 385 ? 37.290 74.730 -10.744 1.00 8.43  ? 382  LEU A CA  1 
ATOM   3364 C  C   . LEU A 1 385 ? 38.775 74.530 -11.070 1.00 8.52  ? 382  LEU A C   1 
ATOM   3365 O  O   . LEU A 1 385 ? 39.557 75.506 -11.131 1.00 9.80  ? 382  LEU A O   1 
ATOM   3366 C  CB  . LEU A 1 385 ? 36.984 74.614 -9.247  1.00 8.77  ? 382  LEU A CB  1 
ATOM   3367 C  CG  . LEU A 1 385 ? 37.745 75.564 -8.297  1.00 9.28  ? 382  LEU A CG  1 
ATOM   3368 C  CD1 . LEU A 1 385 ? 36.842 75.981 -7.133  1.00 10.32 ? 382  LEU A CD1 1 
ATOM   3369 C  CD2 . LEU A 1 385 ? 39.095 75.005 -7.854  1.00 11.04 ? 382  LEU A CD2 1 
ATOM   3370 N  N   . LEU A 1 386 ? 39.202 73.279 -11.302 1.00 9.13  ? 383  LEU A N   1 
ATOM   3371 C  CA  . LEU A 1 386 ? 40.586 73.034 -11.700 1.00 9.03  ? 383  LEU A CA  1 
ATOM   3372 C  C   . LEU A 1 386 ? 40.944 73.727 -13.030 1.00 9.52  ? 383  LEU A C   1 
ATOM   3373 O  O   . LEU A 1 386 ? 42.092 74.164 -13.211 1.00 10.46 ? 383  LEU A O   1 
ATOM   3374 C  CB  . LEU A 1 386 ? 40.908 71.553 -11.788 1.00 9.08  ? 383  LEU A CB  1 
ATOM   3375 C  CG  . LEU A 1 386 ? 40.798 70.745 -10.494 1.00 10.20 ? 383  LEU A CG  1 
ATOM   3376 C  CD1 . LEU A 1 386 ? 41.088 69.240 -10.754 1.00 12.17 ? 383  LEU A CD1 1 
ATOM   3377 C  CD2 . LEU A 1 386 ? 41.657 71.284 -9.342  1.00 12.51 ? 383  LEU A CD2 1 
ATOM   3378 N  N   . HIS A 1 387 ? 39.969 73.839 -13.939 1.00 9.94  ? 384  HIS A N   1 
ATOM   3379 C  CA  . HIS A 1 387 ? 40.186 74.432 -15.242 1.00 10.22 ? 384  HIS A CA  1 
ATOM   3380 C  C   . HIS A 1 387 ? 39.979 75.970 -15.282 1.00 9.75  ? 384  HIS A C   1 
ATOM   3381 O  O   . HIS A 1 387 ? 40.723 76.674 -15.969 1.00 10.80 ? 384  HIS A O   1 
ATOM   3382 C  CB  . HIS A 1 387 ? 39.300 73.780 -16.289 1.00 10.08 ? 384  HIS A CB  1 
ATOM   3383 C  CG  . HIS A 1 387 ? 39.617 72.338 -16.537 1.00 9.63  ? 384  HIS A CG  1 
ATOM   3384 N  ND1 . HIS A 1 387 ? 40.875 71.916 -16.914 1.00 12.15 ? 384  HIS A ND1 1 
ATOM   3385 C  CD2 . HIS A 1 387 ? 38.837 71.222 -16.473 1.00 11.62 ? 384  HIS A CD2 1 
ATOM   3386 C  CE1 . HIS A 1 387 ? 40.851 70.598 -17.065 1.00 12.62 ? 384  HIS A CE1 1 
ATOM   3387 N  NE2 . HIS A 1 387 ? 39.637 70.152 -16.779 1.00 12.27 ? 384  HIS A NE2 1 
ATOM   3388 N  N   . GLN A 1 388 ? 38.933 76.477 -14.631 1.00 9.88  ? 385  GLN A N   1 
ATOM   3389 C  CA  . GLN A 1 388 ? 38.547 77.898 -14.732 1.00 9.79  ? 385  GLN A CA  1 
ATOM   3390 C  C   . GLN A 1 388 ? 38.481 78.673 -13.441 1.00 9.80  ? 385  GLN A C   1 
ATOM   3391 O  O   . GLN A 1 388 ? 38.129 79.852 -13.467 1.00 11.19 ? 385  GLN A O   1 
ATOM   3392 C  CB  . GLN A 1 388 ? 37.207 78.076 -15.436 1.00 11.06 ? 385  GLN A CB  1 
ATOM   3393 C  CG  . GLN A 1 388 ? 37.236 77.976 -16.933 1.00 12.18 ? 385  GLN A CG  1 
ATOM   3394 C  CD  . GLN A 1 388 ? 35.919 78.337 -17.604 1.00 9.08  ? 385  GLN A CD  1 
ATOM   3395 O  OE1 . GLN A 1 388 ? 34.845 78.025 -17.104 1.00 9.64  ? 385  GLN A OE1 1 
ATOM   3396 N  NE2 . GLN A 1 388 ? 36.022 79.003 -18.770 1.00 10.00 ? 385  GLN A NE2 1 
ATOM   3397 N  N   . GLY A 1 389 ? 38.718 78.025 -12.310 1.00 10.07 ? 386  GLY A N   1 
ATOM   3398 C  CA  . GLY A 1 389 ? 38.839 78.763 -11.073 1.00 9.78  ? 386  GLY A CA  1 
ATOM   3399 C  C   . GLY A 1 389 ? 40.137 79.547 -11.042 1.00 9.34  ? 386  GLY A C   1 
ATOM   3400 O  O   . GLY A 1 389 ? 40.915 79.503 -11.993 1.00 10.24 ? 386  GLY A O   1 
ATOM   3401 N  N   . ASN A 1 390 ? 40.355 80.267 -9.951  1.00 9.44  ? 387  ASN A N   1 
ATOM   3402 C  CA  . ASN A 1 390 ? 41.561 81.109 -9.825  1.00 9.78  ? 387  ASN A CA  1 
ATOM   3403 C  C   . ASN A 1 390 ? 42.337 80.775 -8.565  1.00 9.97  ? 387  ASN A C   1 
ATOM   3404 O  O   . ASN A 1 390 ? 42.983 81.639 -7.985  1.00 11.74 ? 387  ASN A O   1 
ATOM   3405 C  CB  . ASN A 1 390 ? 41.278 82.594 -10.043 1.00 9.89  ? 387  ASN A CB  1 
ATOM   3406 C  CG  . ASN A 1 390 ? 40.258 83.208 -9.074  1.00 9.26  ? 387  ASN A CG  1 
ATOM   3407 O  OD1 . ASN A 1 390 ? 39.965 82.678 -8.015  1.00 10.28 ? 387  ASN A OD1 1 
ATOM   3408 N  ND2 . ASN A 1 390 ? 39.749 84.416 -9.436  1.00 11.11 ? 387  ASN A ND2 1 
ATOM   3409 N  N   . ILE A 1 391 ? 42.355 79.479 -8.254  1.00 10.53 ? 388  ILE A N   1 
ATOM   3410 C  CA  . ILE A 1 391 ? 43.144 78.866 -7.157  1.00 11.03 ? 388  ILE A CA  1 
ATOM   3411 C  C   . ILE A 1 391 ? 44.232 77.998 -7.797  1.00 11.27 ? 388  ILE A C   1 
ATOM   3412 O  O   . ILE A 1 391 ? 43.955 77.167 -8.676  1.00 11.29 ? 388  ILE A O   1 
ATOM   3413 C  CB  . ILE A 1 391 ? 42.289 77.903 -6.273  1.00 12.74 ? 388  ILE A CB  1 
ATOM   3414 C  CG1 . ILE A 1 391 ? 40.883 78.450 -5.934  1.00 16.08 ? 388  ILE A CG1 1 
ATOM   3415 C  CG2 . ILE A 1 391 ? 43.084 77.506 -5.002  1.00 13.38 ? 388  ILE A CG2 1 
ATOM   3416 C  CD1 . ILE A 1 391 ? 40.902 79.725 -5.171  1.00 16.97 ? 388  ILE A CD1 1 
ATOM   3417 N  N   . PHE A 1 392 ? 45.483 78.176 -7.378  1.00 11.23 ? 389  PHE A N   1 
ATOM   3418 C  CA  . PHE A 1 392 ? 46.601 77.351 -7.842  1.00 10.72 ? 389  PHE A CA  1 
ATOM   3419 C  C   . PHE A 1 392 ? 46.618 76.029 -7.042  1.00 10.50 ? 389  PHE A C   1 
ATOM   3420 O  O   . PHE A 1 392 ? 46.729 76.048 -5.821  1.00 10.48 ? 389  PHE A O   1 
ATOM   3421 C  CB  . PHE A 1 392 ? 47.931 78.057 -7.643  1.00 11.11 ? 389  PHE A CB  1 
ATOM   3422 C  CG  . PHE A 1 392 ? 49.068 77.320 -8.293  1.00 11.22 ? 389  PHE A CG  1 
ATOM   3423 C  CD1 . PHE A 1 392 ? 49.377 77.571 -9.625  1.00 15.49 ? 389  PHE A CD1 1 
ATOM   3424 C  CD2 . PHE A 1 392 ? 49.743 76.326 -7.642  1.00 11.69 ? 389  PHE A CD2 1 
ATOM   3425 C  CE1 . PHE A 1 392 ? 50.365 76.895 -10.235 1.00 15.58 ? 389  PHE A CE1 1 
ATOM   3426 C  CE2 . PHE A 1 392 ? 50.779 75.664 -8.253  1.00 12.23 ? 389  PHE A CE2 1 
ATOM   3427 C  CZ  . PHE A 1 392 ? 51.093 75.936 -9.550  1.00 12.30 ? 389  PHE A CZ  1 
ATOM   3428 N  N   . ILE A 1 393 ? 46.449 74.907 -7.732  1.00 10.01 ? 390  ILE A N   1 
ATOM   3429 C  CA  . ILE A 1 393 ? 46.304 73.608 -7.109  1.00 10.71 ? 390  ILE A CA  1 
ATOM   3430 C  C   . ILE A 1 393 ? 47.127 72.587 -7.937  1.00 9.83  ? 390  ILE A C   1 
ATOM   3431 O  O   . ILE A 1 393 ? 46.767 72.255 -9.036  1.00 10.89 ? 390  ILE A O   1 
ATOM   3432 C  CB  . ILE A 1 393 ? 44.820 73.143 -7.106  1.00 11.19 ? 390  ILE A CB  1 
ATOM   3433 C  CG1 . ILE A 1 393 ? 43.933 74.175 -6.418  1.00 11.93 ? 390  ILE A CG1 1 
ATOM   3434 C  CG2 . ILE A 1 393 ? 44.700 71.778 -6.398  1.00 12.27 ? 390  ILE A CG2 1 
ATOM   3435 C  CD1 . ILE A 1 393 ? 42.429 74.053 -6.698  1.00 13.77 ? 390  ILE A CD1 1 
ATOM   3436 N  N   . PRO A 1 394 ? 48.223 72.057 -7.394  1.00 10.12 ? 391  PRO A N   1 
ATOM   3437 C  CA  . PRO A 1 394 ? 48.919 70.963 -8.053  1.00 11.08 ? 391  PRO A CA  1 
ATOM   3438 C  C   . PRO A 1 394 ? 48.014 69.733 -8.147  1.00 10.40 ? 391  PRO A C   1 
ATOM   3439 O  O   . PRO A 1 394 ? 47.232 69.501 -7.204  1.00 10.95 ? 391  PRO A O   1 
ATOM   3440 C  CB  . PRO A 1 394 ? 50.071 70.662 -7.077  1.00 11.31 ? 391  PRO A CB  1 
ATOM   3441 C  CG  . PRO A 1 394 ? 50.300 71.931 -6.335  1.00 11.34 ? 391  PRO A CG  1 
ATOM   3442 C  CD  . PRO A 1 394 ? 48.885 72.475 -6.146  1.00 9.85  ? 391  PRO A CD  1 
ATOM   3443 N  N   . VAL A 1 395 ? 48.128 68.960 -9.207  1.00 10.48 ? 392  VAL A N   1 
ATOM   3444 C  CA  . VAL A 1 395 ? 47.280 67.824 -9.493  1.00 9.21  ? 392  VAL A CA  1 
ATOM   3445 C  C   . VAL A 1 395 ? 48.112 66.572 -9.763  1.00 10.00 ? 392  VAL A C   1 
ATOM   3446 O  O   . VAL A 1 395 ? 49.016 66.600 -10.621 1.00 11.56 ? 392  VAL A O   1 
ATOM   3447 C  CB  . VAL A 1 395 ? 46.338 68.096 -10.722 1.00 10.85 ? 392  VAL A CB  1 
ATOM   3448 C  CG1 . VAL A 1 395 ? 45.551 66.849 -11.084 1.00 13.57 ? 392  VAL A CG1 1 
ATOM   3449 C  CG2 . VAL A 1 395 ? 45.408 69.283 -10.366 1.00 11.61 ? 392  VAL A CG2 1 
ATOM   3450 N  N   . ASP A 1 396 ? 47.799 65.488 -9.066  1.00 10.46 ? 393  ASP A N   1 
ATOM   3451 C  CA  . ASP A 1 396 ? 48.311 64.141 -9.366  1.00 11.11 ? 393  ASP A CA  1 
ATOM   3452 C  C   . ASP A 1 396 ? 47.151 63.328 -9.965  1.00 10.78 ? 393  ASP A C   1 
ATOM   3453 O  O   . ASP A 1 396 ? 46.093 63.233 -9.337  1.00 11.33 ? 393  ASP A O   1 
ATOM   3454 C  CB  . ASP A 1 396 ? 48.771 63.399 -8.097  1.00 10.81 ? 393  ASP A CB  1 
ATOM   3455 C  CG  . ASP A 1 396 ? 50.159 63.745 -7.583  1.00 12.68 ? 393  ASP A CG  1 
ATOM   3456 O  OD1 . ASP A 1 396 ? 50.889 64.545 -8.178  1.00 14.14 ? 393  ASP A OD1 1 
ATOM   3457 O  OD2 . ASP A 1 396 ? 50.490 63.159 -6.499  1.00 13.49 ? 393  ASP A OD2 1 
ATOM   3458 N  N   . PHE A 1 397 ? 47.386 62.674 -11.093 1.00 9.47  ? 394  PHE A N   1 
ATOM   3459 C  CA  . PHE A 1 397 ? 46.520 61.662 -11.668 1.00 9.00  ? 394  PHE A CA  1 
ATOM   3460 C  C   . PHE A 1 397 ? 47.112 60.289 -11.425 1.00 9.06  ? 394  PHE A C   1 
ATOM   3461 O  O   . PHE A 1 397 ? 48.313 60.098 -11.642 1.00 10.69 ? 394  PHE A O   1 
ATOM   3462 C  CB  . PHE A 1 397 ? 46.398 61.846 -13.180 1.00 9.13  ? 394  PHE A CB  1 
ATOM   3463 C  CG  . PHE A 1 397 ? 45.662 63.108 -13.594 1.00 8.32  ? 394  PHE A CG  1 
ATOM   3464 C  CD1 . PHE A 1 397 ? 44.306 63.094 -13.798 1.00 10.21 ? 394  PHE A CD1 1 
ATOM   3465 C  CD2 . PHE A 1 397 ? 46.346 64.272 -13.857 1.00 11.00 ? 394  PHE A CD2 1 
ATOM   3466 C  CE1 . PHE A 1 397 ? 43.604 64.211 -14.222 1.00 11.24 ? 394  PHE A CE1 1 
ATOM   3467 C  CE2 . PHE A 1 397 ? 45.666 65.408 -14.284 1.00 10.18 ? 394  PHE A CE2 1 
ATOM   3468 C  CZ  . PHE A 1 397 ? 44.287 65.392 -14.445 1.00 10.05 ? 394  PHE A CZ  1 
ATOM   3469 N  N   . ILE A 1 398 ? 46.292 59.334 -11.009 1.00 9.16  ? 395  ILE A N   1 
ATOM   3470 C  CA  A ILE A 1 398 ? 46.697 57.925 -10.975 0.60 9.28  ? 395  ILE A CA  1 
ATOM   3471 C  CA  B ILE A 1 398 ? 46.705 57.933 -10.972 0.40 9.86  ? 395  ILE A CA  1 
ATOM   3472 C  C   . ILE A 1 398 ? 45.913 57.201 -12.059 1.00 10.12 ? 395  ILE A C   1 
ATOM   3473 O  O   . ILE A 1 398 ? 44.672 57.206 -12.054 1.00 11.06 ? 395  ILE A O   1 
ATOM   3474 C  CB  A ILE A 1 398 ? 46.388 57.211 -9.631  0.60 9.38  ? 395  ILE A CB  1 
ATOM   3475 C  CB  B ILE A 1 398 ? 46.483 57.302 -9.569  0.40 10.48 ? 395  ILE A CB  1 
ATOM   3476 C  CG1 A ILE A 1 398 ? 46.728 58.106 -8.441  0.60 9.19  ? 395  ILE A CG1 1 
ATOM   3477 C  CG1 B ILE A 1 398 ? 47.403 57.995 -8.553  0.40 12.09 ? 395  ILE A CG1 1 
ATOM   3478 C  CG2 A ILE A 1 398 ? 47.189 55.873 -9.583  0.60 10.46 ? 395  ILE A CG2 1 
ATOM   3479 C  CG2 B ILE A 1 398 ? 46.749 55.770 -9.609  0.40 10.33 ? 395  ILE A CG2 1 
ATOM   3480 C  CD1 A ILE A 1 398 ? 48.241 58.457 -8.366  0.60 9.67  ? 395  ILE A CD1 1 
ATOM   3481 C  CD1 B ILE A 1 398 ? 47.096 57.686 -7.091  0.40 14.78 ? 395  ILE A CD1 1 
ATOM   3482 N  N   . ALA A 1 399 ? 46.630 56.590 -13.005 1.00 10.17 ? 396  ALA A N   1 
ATOM   3483 C  CA  . ALA A 1 399 ? 46.030 55.838 -14.095 1.00 10.28 ? 396  ALA A CA  1 
ATOM   3484 C  C   . ALA A 1 399 ? 46.460 54.382 -13.987 1.00 10.22 ? 396  ALA A C   1 
ATOM   3485 O  O   . ALA A 1 399 ? 47.599 54.116 -13.588 1.00 9.97  ? 396  ALA A O   1 
ATOM   3486 C  CB  . ALA A 1 399 ? 46.509 56.419 -15.492 1.00 12.45 ? 396  ALA A CB  1 
ATOM   3487 N  N   . ILE A 1 400 ? 45.563 53.473 -14.391 1.00 9.89  ? 397  ILE A N   1 
ATOM   3488 C  CA  . ILE A 1 400 ? 45.823 52.026 -14.366 1.00 10.44 ? 397  ILE A CA  1 
ATOM   3489 C  C   . ILE A 1 400 ? 45.677 51.529 -15.805 1.00 10.07 ? 397  ILE A C   1 
ATOM   3490 O  O   . ILE A 1 400 ? 44.613 51.672 -16.393 1.00 11.38 ? 397  ILE A O   1 
ATOM   3491 C  CB  . ILE A 1 400 ? 44.810 51.292 -13.430 1.00 11.47 ? 397  ILE A CB  1 
ATOM   3492 C  CG1 . ILE A 1 400 ? 44.661 51.997 -12.060 1.00 11.76 ? 397  ILE A CG1 1 
ATOM   3493 C  CG2 . ILE A 1 400 ? 45.192 49.822 -13.354 1.00 12.14 ? 397  ILE A CG2 1 
ATOM   3494 C  CD1 . ILE A 1 400 ? 45.908 52.003 -11.202 1.00 10.68 ? 397  ILE A CD1 1 
ATOM   3495 N  N   . ALA A 1 401 ? 46.744 50.973 -16.390 1.00 10.90 ? 398  ALA A N   1 
ATOM   3496 C  CA  . ALA A 1 401 ? 46.697 50.656 -17.823 1.00 11.97 ? 398  ALA A CA  1 
ATOM   3497 C  C   . ALA A 1 401 ? 45.679 49.580 -18.168 1.00 11.38 ? 398  ALA A C   1 
ATOM   3498 O  O   . ALA A 1 401 ? 44.942 49.701 -19.153 1.00 11.30 ? 398  ALA A O   1 
ATOM   3499 C  CB  . ALA A 1 401 ? 48.101 50.223 -18.330 1.00 10.99 ? 398  ALA A CB  1 
ATOM   3500 N  N   . THR A 1 402 ? 45.626 48.516 -17.359 1.00 11.38 ? 399  THR A N   1 
ATOM   3501 C  CA  A THR A 1 402 ? 44.692 47.425 -17.588 0.60 11.51 ? 399  THR A CA  1 
ATOM   3502 C  CA  B THR A 1 402 ? 44.729 47.394 -17.587 0.40 11.96 ? 399  THR A CA  1 
ATOM   3503 C  C   . THR A 1 402 ? 43.867 47.159 -16.356 1.00 11.69 ? 399  THR A C   1 
ATOM   3504 O  O   . THR A 1 402 ? 44.383 47.215 -15.246 1.00 12.37 ? 399  THR A O   1 
ATOM   3505 C  CB  A THR A 1 402 ? 45.388 46.149 -18.057 0.60 12.83 ? 399  THR A CB  1 
ATOM   3506 C  CB  B THR A 1 402 ? 45.523 46.125 -17.927 0.40 12.72 ? 399  THR A CB  1 
ATOM   3507 O  OG1 A THR A 1 402 ? 46.324 45.708 -17.075 0.60 13.46 ? 399  THR A OG1 1 
ATOM   3508 O  OG1 B THR A 1 402 ? 46.391 46.390 -19.045 0.40 15.82 ? 399  THR A OG1 1 
ATOM   3509 C  CG2 A THR A 1 402 ? 46.024 46.364 -19.469 0.60 14.67 ? 399  THR A CG2 1 
ATOM   3510 C  CG2 B THR A 1 402 ? 44.544 44.990 -18.286 0.40 15.04 ? 399  THR A CG2 1 
ATOM   3511 N  N   . SER A 1 403 ? 42.573 46.884 -16.548 1.00 11.69 ? 400  SER A N   1 
ATOM   3512 C  CA  . SER A 1 403 ? 41.663 46.614 -15.456 1.00 11.41 ? 400  SER A CA  1 
ATOM   3513 C  C   . SER A 1 403 ? 41.482 45.106 -15.264 1.00 11.95 ? 400  SER A C   1 
ATOM   3514 O  O   . SER A 1 403 ? 42.354 44.270 -15.592 1.00 14.73 ? 400  SER A O   1 
ATOM   3515 C  CB  . SER A 1 403 ? 40.340 47.363 -15.723 1.00 12.93 ? 400  SER A CB  1 
ATOM   3516 O  OG  . SER A 1 403 ? 39.417 47.195 -14.657 1.00 13.51 ? 400  SER A OG  1 
ATOM   3517 N  N   . HIS A 1 404 ? 40.373 44.726 -14.686 1.00 11.44 ? 401  HIS A N   1 
ATOM   3518 C  CA  . HIS A 1 404 ? 40.098 43.347 -14.315 1.00 11.85 ? 401  HIS A CA  1 
ATOM   3519 C  C   . HIS A 1 404 ? 38.939 42.736 -15.074 1.00 12.59 ? 401  HIS A C   1 
ATOM   3520 O  O   . HIS A 1 404 ? 38.316 41.791 -14.617 1.00 17.91 ? 401  HIS A O   1 
ATOM   3521 C  CB  . HIS A 1 404 ? 39.851 43.264 -12.800 1.00 12.62 ? 401  HIS A CB  1 
ATOM   3522 C  CG  . HIS A 1 404 ? 38.600 43.954 -12.353 1.00 12.38 ? 401  HIS A CG  1 
ATOM   3523 N  ND1 . HIS A 1 404 ? 37.421 43.282 -12.141 1.00 18.96 ? 401  HIS A ND1 1 
ATOM   3524 C  CD2 . HIS A 1 404 ? 38.348 45.259 -12.062 1.00 14.16 ? 401  HIS A CD2 1 
ATOM   3525 C  CE1 . HIS A 1 404 ? 36.489 44.153 -11.760 1.00 19.25 ? 401  HIS A CE1 1 
ATOM   3526 N  NE2 . HIS A 1 404 ? 37.023 45.360 -11.721 1.00 13.88 ? 401  HIS A NE2 1 
ATOM   3527 N  N   . HIS A 1 405 ? 38.613 43.283 -16.223 1.00 10.82 ? 402  HIS A N   1 
ATOM   3528 C  CA  . HIS A 1 405 ? 37.482 42.862 -17.043 1.00 11.06 ? 402  HIS A CA  1 
ATOM   3529 C  C   . HIS A 1 405 ? 37.838 43.052 -18.510 1.00 10.58 ? 402  HIS A C   1 
ATOM   3530 O  O   . HIS A 1 405 ? 38.912 43.595 -18.854 1.00 11.17 ? 402  HIS A O   1 
ATOM   3531 C  CB  . HIS A 1 405 ? 36.257 43.719 -16.683 1.00 10.40 ? 402  HIS A CB  1 
ATOM   3532 C  CG  . HIS A 1 405 ? 36.501 45.180 -16.908 1.00 9.62  ? 402  HIS A CG  1 
ATOM   3533 N  ND1 . HIS A 1 405 ? 36.560 45.702 -18.185 1.00 10.42 ? 402  HIS A ND1 1 
ATOM   3534 C  CD2 . HIS A 1 405 ? 36.838 46.194 -16.065 1.00 10.63 ? 402  HIS A CD2 1 
ATOM   3535 C  CE1 . HIS A 1 405 ? 36.866 46.985 -18.118 1.00 11.50 ? 402  HIS A CE1 1 
ATOM   3536 N  NE2 . HIS A 1 405 ? 37.042 47.315 -16.840 1.00 11.44 ? 402  HIS A NE2 1 
ATOM   3537 N  N   . ASN A 1 406 ? 36.910 42.656 -19.376 1.00 10.05 ? 403  ASN A N   1 
ATOM   3538 C  CA  . ASN A 1 406 ? 37.133 42.720 -20.825 1.00 9.81  ? 403  ASN A CA  1 
ATOM   3539 C  C   . ASN A 1 406 ? 36.275 43.742 -21.577 1.00 8.81  ? 403  ASN A C   1 
ATOM   3540 O  O   . ASN A 1 406 ? 36.087 43.666 -22.822 1.00 11.27 ? 403  ASN A O   1 
ATOM   3541 C  CB  . ASN A 1 406 ? 36.946 41.347 -21.433 1.00 10.14 ? 403  ASN A CB  1 
ATOM   3542 C  CG  . ASN A 1 406 ? 38.053 40.370 -20.988 1.00 12.22 ? 403  ASN A CG  1 
ATOM   3543 O  OD1 . ASN A 1 406 ? 39.230 40.699 -21.081 1.00 14.67 ? 403  ASN A OD1 1 
ATOM   3544 N  ND2 . ASN A 1 406 ? 37.671 39.243 -20.437 1.00 16.01 ? 403  ASN A ND2 1 
ATOM   3545 N  N   . TYR A 1 407 ? 35.802 44.744 -20.838 1.00 9.76  ? 404  TYR A N   1 
ATOM   3546 C  CA  . TYR A 1 407 ? 35.102 45.911 -21.472 1.00 9.49  ? 404  TYR A CA  1 
ATOM   3547 C  C   . TYR A 1 407 ? 36.173 46.905 -21.952 1.00 10.33 ? 404  TYR A C   1 
ATOM   3548 O  O   . TYR A 1 407 ? 36.388 47.972 -21.380 1.00 10.69 ? 404  TYR A O   1 
ATOM   3549 C  CB  . TYR A 1 407 ? 34.109 46.550 -20.498 1.00 10.06 ? 404  TYR A CB  1 
ATOM   3550 C  CG  . TYR A 1 407 ? 32.873 45.751 -20.271 1.00 10.70 ? 404  TYR A CG  1 
ATOM   3551 C  CD1 . TYR A 1 407 ? 31.721 46.030 -20.976 1.00 12.54 ? 404  TYR A CD1 1 
ATOM   3552 C  CD2 . TYR A 1 407 ? 32.833 44.733 -19.358 1.00 14.07 ? 404  TYR A CD2 1 
ATOM   3553 C  CE1 . TYR A 1 407 ? 30.576 45.359 -20.758 1.00 16.05 ? 404  TYR A CE1 1 
ATOM   3554 C  CE2 . TYR A 1 407 ? 31.672 44.009 -19.142 1.00 20.67 ? 404  TYR A CE2 1 
ATOM   3555 C  CZ  . TYR A 1 407 ? 30.540 44.345 -19.842 1.00 17.21 ? 404  TYR A CZ  1 
ATOM   3556 O  OH  . TYR A 1 407 ? 29.376 43.678 -19.673 1.00 21.01 ? 404  TYR A OH  1 
ATOM   3557 N  N   . ASP A 1 408 ? 36.877 46.502 -22.999 1.00 9.69  ? 405  ASP A N   1 
ATOM   3558 C  CA  . ASP A 1 408 ? 38.056 47.211 -23.435 1.00 10.00 ? 405  ASP A CA  1 
ATOM   3559 C  C   . ASP A 1 408 ? 37.722 48.630 -23.894 1.00 9.52  ? 405  ASP A C   1 
ATOM   3560 O  O   . ASP A 1 408 ? 38.546 49.543 -23.708 1.00 10.51 ? 405  ASP A O   1 
ATOM   3561 C  CB  . ASP A 1 408 ? 38.761 46.463 -24.546 1.00 10.82 ? 405  ASP A CB  1 
ATOM   3562 C  CG  . ASP A 1 408 ? 39.376 45.135 -24.078 1.00 14.41 ? 405  ASP A CG  1 
ATOM   3563 O  OD1 . ASP A 1 408 ? 39.535 44.907 -22.877 1.00 17.26 ? 405  ASP A OD1 1 
ATOM   3564 O  OD2 . ASP A 1 408 ? 39.723 44.360 -24.967 1.00 20.65 ? 405  ASP A OD2 1 
ATOM   3565 N  N   . ASN A 1 409 ? 36.512 48.836 -24.448 1.00 9.16  ? 406  ASN A N   1 
ATOM   3566 C  CA  . ASN A 1 409 ? 36.109 50.179 -24.858 1.00 8.93  ? 406  ASN A CA  1 
ATOM   3567 C  C   . ASN A 1 409 ? 35.959 51.121 -23.669 1.00 8.78  ? 406  ASN A C   1 
ATOM   3568 O  O   . ASN A 1 409 ? 36.340 52.287 -23.761 1.00 9.14  ? 406  ASN A O   1 
ATOM   3569 C  CB  . ASN A 1 409 ? 34.841 50.147 -25.699 1.00 9.27  ? 406  ASN A CB  1 
ATOM   3570 C  CG  . ASN A 1 409 ? 33.650 49.611 -24.982 1.00 12.45 ? 406  ASN A CG  1 
ATOM   3571 O  OD1 . ASN A 1 409 ? 33.737 48.654 -24.169 1.00 11.42 ? 406  ASN A OD1 1 
ATOM   3572 N  ND2 . ASN A 1 409 ? 32.495 50.254 -25.252 1.00 17.38 ? 406  ASN A ND2 1 
ATOM   3573 N  N   . HIS A 1 410 ? 35.460 50.601 -22.553 1.00 8.03  ? 407  HIS A N   1 
ATOM   3574 C  CA  . HIS A 1 410 ? 35.339 51.402 -21.364 1.00 7.80  ? 407  HIS A CA  1 
ATOM   3575 C  C   . HIS A 1 410 ? 36.725 51.782 -20.830 1.00 8.76  ? 407  HIS A C   1 
ATOM   3576 O  O   . HIS A 1 410 ? 36.955 52.913 -20.423 1.00 9.64  ? 407  HIS A O   1 
ATOM   3577 C  CB  . HIS A 1 410 ? 34.584 50.660 -20.259 1.00 7.71  ? 407  HIS A CB  1 
ATOM   3578 C  CG  . HIS A 1 410 ? 33.114 50.564 -20.469 1.00 8.01  ? 407  HIS A CG  1 
ATOM   3579 N  ND1 . HIS A 1 410 ? 32.224 51.210 -19.646 1.00 9.11  ? 407  HIS A ND1 1 
ATOM   3580 C  CD2 . HIS A 1 410 ? 32.365 49.839 -21.353 1.00 9.51  ? 407  HIS A CD2 1 
ATOM   3581 C  CE1 . HIS A 1 410 ? 30.987 50.902 -20.032 1.00 9.65  ? 407  HIS A CE1 1 
ATOM   3582 N  NE2 . HIS A 1 410 ? 31.043 50.093 -21.073 1.00 9.67  ? 407  HIS A NE2 1 
ATOM   3583 N  N   . GLN A 1 411 ? 37.637 50.818 -20.775 1.00 9.21  ? 408  GLN A N   1 
ATOM   3584 C  CA  . GLN A 1 411 ? 38.987 51.080 -20.249 1.00 9.60  ? 408  GLN A CA  1 
ATOM   3585 C  C   . GLN A 1 411 ? 39.738 52.097 -21.115 1.00 9.65  ? 408  GLN A C   1 
ATOM   3586 O  O   . GLN A 1 411 ? 40.397 52.985 -20.595 1.00 9.62  ? 408  GLN A O   1 
ATOM   3587 C  CB  . GLN A 1 411 ? 39.725 49.772 -20.135 1.00 10.58 ? 408  GLN A CB  1 
ATOM   3588 C  CG  . GLN A 1 411 ? 41.098 49.922 -19.561 1.00 10.58 ? 408  GLN A CG  1 
ATOM   3589 C  CD  . GLN A 1 411 ? 41.171 50.315 -18.068 1.00 12.07 ? 408  GLN A CD  1 
ATOM   3590 O  OE1 . GLN A 1 411 ? 40.157 50.335 -17.363 1.00 12.10 ? 408  GLN A OE1 1 
ATOM   3591 N  NE2 . GLN A 1 411 ? 42.392 50.605 -17.587 1.00 12.96 ? 408  GLN A NE2 1 
ATOM   3592 N  N   . GLN A 1 412 ? 39.601 51.976 -22.425 1.00 9.42  ? 409  GLN A N   1 
ATOM   3593 C  CA  . GLN A 1 412 ? 40.225 52.926 -23.318 1.00 10.45 ? 409  GLN A CA  1 
ATOM   3594 C  C   . GLN A 1 412 ? 39.689 54.357 -23.106 1.00 9.98  ? 409  GLN A C   1 
ATOM   3595 O  O   . GLN A 1 412 ? 40.473 55.323 -23.068 1.00 10.31 ? 409  GLN A O   1 
ATOM   3596 C  CB  . GLN A 1 412 ? 40.032 52.480 -24.749 1.00 11.53 ? 409  GLN A CB  1 
ATOM   3597 C  CG  . GLN A 1 412 ? 40.924 53.228 -25.681 1.00 16.74 ? 409  GLN A CG  1 
ATOM   3598 C  CD  . GLN A 1 412 ? 40.713 52.863 -27.112 1.00 22.10 ? 409  GLN A CD  1 
ATOM   3599 O  OE1 . GLN A 1 412 ? 39.593 52.936 -27.596 1.00 25.97 ? 409  GLN A OE1 1 
ATOM   3600 N  NE2 . GLN A 1 412 ? 41.779 52.468 -27.798 1.00 27.48 ? 409  GLN A NE2 1 
ATOM   3601 N  N   . ALA A 1 413 ? 38.361 54.480 -22.956 1.00 9.67  ? 410  ALA A N   1 
ATOM   3602 C  CA  . ALA A 1 413 ? 37.741 55.773 -22.734 1.00 8.91  ? 410  ALA A CA  1 
ATOM   3603 C  C   . ALA A 1 413 ? 38.188 56.348 -21.369 1.00 8.81  ? 410  ALA A C   1 
ATOM   3604 O  O   . ALA A 1 413 ? 38.408 57.547 -21.241 1.00 9.42  ? 410  ALA A O   1 
ATOM   3605 C  CB  . ALA A 1 413 ? 36.248 55.662 -22.776 1.00 8.78  ? 410  ALA A CB  1 
ATOM   3606 N  N   . LEU A 1 414 ? 38.298 55.505 -20.338 1.00 8.33  ? 411  LEU A N   1 
ATOM   3607 C  CA  . LEU A 1 414 ? 38.742 55.952 -19.025 1.00 8.59  ? 411  LEU A CA  1 
ATOM   3608 C  C   . LEU A 1 414 ? 40.127 56.583 -19.109 1.00 8.13  ? 411  LEU A C   1 
ATOM   3609 O  O   . LEU A 1 414 ? 40.348 57.699 -18.624 1.00 9.34  ? 411  LEU A O   1 
ATOM   3610 C  CB  . LEU A 1 414 ? 38.728 54.736 -18.087 1.00 8.81  ? 411  LEU A CB  1 
ATOM   3611 C  CG  . LEU A 1 414 ? 39.223 54.943 -16.652 1.00 9.33  ? 411  LEU A CG  1 
ATOM   3612 C  CD1 . LEU A 1 414 ? 38.354 55.952 -15.872 1.00 11.11 ? 411  LEU A CD1 1 
ATOM   3613 C  CD2 . LEU A 1 414 ? 39.332 53.593 -15.946 1.00 10.25 ? 411  LEU A CD2 1 
ATOM   3614 N  N   . LEU A 1 415 ? 41.056 55.904 -19.791 1.00 8.80  ? 412  LEU A N   1 
ATOM   3615 C  CA  . LEU A 1 415 ? 42.399 56.398 -19.956 1.00 8.38  ? 412  LEU A CA  1 
ATOM   3616 C  C   . LEU A 1 415 ? 42.439 57.638 -20.827 1.00 9.03  ? 412  LEU A C   1 
ATOM   3617 O  O   . LEU A 1 415 ? 43.176 58.597 -20.535 1.00 9.18  ? 412  LEU A O   1 
ATOM   3618 C  CB  . LEU A 1 415 ? 43.307 55.315 -20.504 1.00 9.41  ? 412  LEU A CB  1 
ATOM   3619 C  CG  . LEU A 1 415 ? 43.581 54.163 -19.543 1.00 9.02  ? 412  LEU A CG  1 
ATOM   3620 C  CD1 . LEU A 1 415 ? 44.110 52.945 -20.330 1.00 10.49 ? 412  LEU A CD1 1 
ATOM   3621 C  CD2 . LEU A 1 415 ? 44.498 54.569 -18.399 1.00 12.13 ? 412  LEU A CD2 1 
ATOM   3622 N  N   . ALA A 1 416 ? 41.692 57.633 -21.939 1.00 9.06  ? 413  ALA A N   1 
ATOM   3623 C  CA  . ALA A 1 416 ? 41.668 58.813 -22.801 1.00 9.34  ? 413  ALA A CA  1 
ATOM   3624 C  C   . ALA A 1 416 ? 41.216 60.059 -22.041 1.00 9.37  ? 413  ALA A C   1 
ATOM   3625 O  O   . ALA A 1 416 ? 41.769 61.154 -22.215 1.00 10.50 ? 413  ALA A O   1 
ATOM   3626 C  CB  . ALA A 1 416 ? 40.774 58.581 -24.027 1.00 9.36  ? 413  ALA A CB  1 
ATOM   3627 N  N   . ASN A 1 417 ? 40.225 59.886 -21.164 1.00 9.56  ? 414  ASN A N   1 
ATOM   3628 C  CA  . ASN A 1 417 ? 39.768 61.006 -20.323 1.00 9.09  ? 414  ASN A CA  1 
ATOM   3629 C  C   . ASN A 1 417 ? 40.860 61.443 -19.334 1.00 8.54  ? 414  ASN A C   1 
ATOM   3630 O  O   . ASN A 1 417 ? 41.072 62.638 -19.132 1.00 9.74  ? 414  ASN A O   1 
ATOM   3631 C  CB  . ASN A 1 417 ? 38.501 60.620 -19.557 1.00 8.90  ? 414  ASN A CB  1 
ATOM   3632 C  CG  . ASN A 1 417 ? 37.235 60.840 -20.378 1.00 10.09 ? 414  ASN A CG  1 
ATOM   3633 O  OD1 . ASN A 1 417 ? 36.744 61.981 -20.455 1.00 11.29 ? 414  ASN A OD1 1 
ATOM   3634 N  ND2 . ASN A 1 417 ? 36.758 59.786 -21.060 1.00 14.28 ? 414  ASN A ND2 1 
ATOM   3635 N  N   . CYS A 1 418 ? 41.496 60.495 -18.654 1.00 8.75  ? 415  CYS A N   1 
ATOM   3636 C  CA  . CYS A 1 418 ? 42.587 60.827 -17.752 1.00 9.57  ? 415  CYS A CA  1 
ATOM   3637 C  C   . CYS A 1 418 ? 43.617 61.683 -18.482 1.00 9.98  ? 415  CYS A C   1 
ATOM   3638 O  O   . CYS A 1 418 ? 44.009 62.770 -17.998 1.00 9.49  ? 415  CYS A O   1 
ATOM   3639 C  CB  . CYS A 1 418 ? 43.248 59.536 -17.232 1.00 9.05  ? 415  CYS A CB  1 
ATOM   3640 S  SG  . CYS A 1 418 ? 44.549 59.858 -16.009 1.00 11.52 ? 415  CYS A SG  1 
ATOM   3641 N  N   . PHE A 1 419 ? 44.101 61.207 -19.634 1.00 9.66  ? 416  PHE A N   1 
ATOM   3642 C  CA  . PHE A 1 419 ? 45.162 61.931 -20.361 1.00 9.45  ? 416  PHE A CA  1 
ATOM   3643 C  C   . PHE A 1 419 ? 44.671 63.253 -20.896 1.00 9.80  ? 416  PHE A C   1 
ATOM   3644 O  O   . PHE A 1 419 ? 45.423 64.227 -20.987 1.00 10.13 ? 416  PHE A O   1 
ATOM   3645 C  CB  . PHE A 1 419 ? 45.760 61.032 -21.460 1.00 9.36  ? 416  PHE A CB  1 
ATOM   3646 C  CG  . PHE A 1 419 ? 46.268 59.679 -20.965 1.00 11.00 ? 416  PHE A CG  1 
ATOM   3647 C  CD1 . PHE A 1 419 ? 46.637 59.452 -19.675 1.00 11.71 ? 416  PHE A CD1 1 
ATOM   3648 C  CD2 . PHE A 1 419 ? 46.303 58.610 -21.855 1.00 11.65 ? 416  PHE A CD2 1 
ATOM   3649 C  CE1 . PHE A 1 419 ? 47.092 58.186 -19.264 1.00 12.74 ? 416  PHE A CE1 1 
ATOM   3650 C  CE2 . PHE A 1 419 ? 46.779 57.366 -21.466 1.00 11.88 ? 416  PHE A CE2 1 
ATOM   3651 C  CZ  . PHE A 1 419 ? 47.167 57.165 -20.176 1.00 13.30 ? 416  PHE A CZ  1 
ATOM   3652 N  N   . ALA A 1 420 ? 43.397 63.300 -21.297 1.00 8.85  ? 417  ALA A N   1 
ATOM   3653 C  CA  . ALA A 1 420 ? 42.769 64.533 -21.803 1.00 9.61  ? 417  ALA A CA  1 
ATOM   3654 C  C   . ALA A 1 420 ? 42.688 65.629 -20.719 1.00 9.75  ? 417  ALA A C   1 
ATOM   3655 O  O   . ALA A 1 420 ? 42.822 66.828 -21.029 1.00 10.61 ? 417  ALA A O   1 
ATOM   3656 C  CB  . ALA A 1 420 ? 41.383 64.281 -22.402 1.00 10.17 ? 417  ALA A CB  1 
ATOM   3657 N  N   . GLN A 1 421 ? 42.474 65.221 -19.457 1.00 9.82  ? 418  GLN A N   1 
ATOM   3658 C  CA  . GLN A 1 421 ? 42.302 66.217 -18.421 1.00 9.66  ? 418  GLN A CA  1 
ATOM   3659 C  C   . GLN A 1 421 ? 43.676 66.858 -18.102 1.00 8.87  ? 418  GLN A C   1 
ATOM   3660 O  O   . GLN A 1 421 ? 43.754 68.072 -17.929 1.00 9.21  ? 418  GLN A O   1 
ATOM   3661 C  CB  . GLN A 1 421 ? 41.713 65.610 -17.151 1.00 9.38  ? 418  GLN A CB  1 
ATOM   3662 C  CG  . GLN A 1 421 ? 40.229 65.176 -17.309 1.00 10.13 ? 418  GLN A CG  1 
ATOM   3663 C  CD  . GLN A 1 421 ? 39.335 66.367 -17.555 1.00 10.50 ? 418  GLN A CD  1 
ATOM   3664 O  OE1 . GLN A 1 421 ? 39.383 67.319 -16.760 1.00 11.34 ? 418  GLN A OE1 1 
ATOM   3665 N  NE2 . GLN A 1 421 ? 38.481 66.322 -18.579 1.00 11.07 ? 418  GLN A NE2 1 
ATOM   3666 N  N   . SER A 1 422 ? 44.755 66.069 -18.064 1.00 9.70  ? 419  SER A N   1 
ATOM   3667 C  CA  . SER A 1 422 ? 46.104 66.676 -17.898 1.00 9.89  ? 419  SER A CA  1 
ATOM   3668 C  C   . SER A 1 422 ? 46.501 67.493 -19.119 1.00 10.08 ? 419  SER A C   1 
ATOM   3669 O  O   . SER A 1 422 ? 47.111 68.535 -18.975 1.00 10.33 ? 419  SER A O   1 
ATOM   3670 C  CB  . SER A 1 422 ? 47.151 65.605 -17.531 1.00 11.05 ? 419  SER A CB  1 
ATOM   3671 O  OG  . SER A 1 422 ? 47.338 64.678 -18.557 1.00 11.78 ? 419  SER A OG  1 
ATOM   3672 N  N   . GLN A 1 423 ? 46.134 67.055 -20.319 1.00 10.37 ? 420  GLN A N   1 
ATOM   3673 C  CA  . GLN A 1 423 ? 46.399 67.836 -21.488 1.00 10.48 ? 420  GLN A CA  1 
ATOM   3674 C  C   . GLN A 1 423 ? 45.610 69.146 -21.458 1.00 9.68  ? 420  GLN A C   1 
ATOM   3675 O  O   . GLN A 1 423 ? 46.172 70.203 -21.794 1.00 10.82 ? 420  GLN A O   1 
ATOM   3676 C  CB  . GLN A 1 423 ? 46.079 67.043 -22.722 1.00 11.06 ? 420  GLN A CB  1 
ATOM   3677 C  CG  . GLN A 1 423 ? 46.699 67.621 -24.009 1.00 12.16 ? 420  GLN A CG  1 
ATOM   3678 C  CD  . GLN A 1 423 ? 46.291 66.934 -25.281 1.00 12.50 ? 420  GLN A CD  1 
ATOM   3679 O  OE1 . GLN A 1 423 ? 45.115 66.706 -25.535 1.00 12.82 ? 420  GLN A OE1 1 
ATOM   3680 N  NE2 . GLN A 1 423 ? 47.272 66.660 -26.121 1.00 13.93 ? 420  GLN A NE2 1 
ATOM   3681 N  N   . ALA A 1 424 ? 44.347 69.118 -21.013 1.00 9.30  ? 421  ALA A N   1 
ATOM   3682 C  CA  . ALA A 1 424 ? 43.544 70.351 -20.905 1.00 9.44  ? 421  ALA A CA  1 
ATOM   3683 C  C   . ALA A 1 424 ? 44.135 71.343 -19.892 1.00 9.52  ? 421  ALA A C   1 
ATOM   3684 O  O   . ALA A 1 424 ? 44.168 72.569 -20.153 1.00 11.07 ? 421  ALA A O   1 
ATOM   3685 C  CB  . ALA A 1 424 ? 42.085 70.009 -20.561 1.00 9.74  ? 421  ALA A CB  1 
ATOM   3686 N  N   . LEU A 1 425 ? 44.603 70.833 -18.752 1.00 9.62  ? 422  LEU A N   1 
ATOM   3687 C  CA  . LEU A 1 425 ? 45.248 71.665 -17.760 1.00 9.96  ? 422  LEU A CA  1 
ATOM   3688 C  C   . LEU A 1 425 ? 46.466 72.363 -18.346 1.00 9.54  ? 422  LEU A C   1 
ATOM   3689 O  O   . LEU A 1 425 ? 46.704 73.546 -18.103 1.00 11.00 ? 422  LEU A O   1 
ATOM   3690 C  CB  . LEU A 1 425 ? 45.656 70.821 -16.556 1.00 9.41  ? 422  LEU A CB  1 
ATOM   3691 C  CG  . LEU A 1 425 ? 44.534 70.453 -15.590 1.00 9.75  ? 422  LEU A CG  1 
ATOM   3692 C  CD1 . LEU A 1 425 ? 45.079 69.390 -14.619 1.00 12.15 ? 422  LEU A CD1 1 
ATOM   3693 C  CD2 . LEU A 1 425 ? 43.931 71.640 -14.821 1.00 10.80 ? 422  LEU A CD2 1 
HETATM 3694 N  N   . MSE A 1 426 ? 47.242 71.608 -19.131 1.00 10.31 ? 423  MSE A N   1 
HETATM 3695 C  CA  A MSE A 1 426 ? 48.460 72.171 -19.770 0.60 10.88 ? 423  MSE A CA  1 
HETATM 3696 C  CA  B MSE A 1 426 ? 48.455 72.143 -19.770 0.40 10.73 ? 423  MSE A CA  1 
HETATM 3697 C  C   . MSE A 1 426 ? 48.141 73.205 -20.840 1.00 11.37 ? 423  MSE A C   1 
HETATM 3698 O  O   . MSE A 1 426 ? 48.748 74.303 -20.851 1.00 12.19 ? 423  MSE A O   1 
HETATM 3699 C  CB  A MSE A 1 426 ? 49.351 71.069 -20.347 0.60 12.06 ? 423  MSE A CB  1 
HETATM 3700 C  CB  B MSE A 1 426 ? 49.263 70.970 -20.342 0.40 11.41 ? 423  MSE A CB  1 
HETATM 3701 C  CG  A MSE A 1 426 ? 50.329 71.562 -21.395 0.60 13.88 ? 423  MSE A CG  1 
HETATM 3702 C  CG  B MSE A 1 426 ? 50.462 71.341 -21.145 0.40 12.00 ? 423  MSE A CG  1 
HETATM 3703 SE SE  A MSE A 1 426 ? 51.723 70.206 -21.561 0.42 17.35 ? 423  MSE A SE  1 
HETATM 3704 SE SE  B MSE A 1 426 ? 51.306 69.741 -21.940 0.28 11.38 ? 423  MSE A SE  1 
HETATM 3705 C  CE  A MSE A 1 426 ? 50.779 68.837 -22.542 0.60 20.32 ? 423  MSE A CE  1 
HETATM 3706 C  CE  B MSE A 1 426 ? 52.237 70.775 -23.394 0.40 7.78  ? 423  MSE A CE  1 
ATOM   3707 N  N   . PHE A 1 427 ? 47.223 72.882 -21.757 1.00 11.49 ? 424  PHE A N   1 
ATOM   3708 C  CA  A PHE A 1 427 ? 47.056 73.756 -22.922 0.60 10.90 ? 424  PHE A CA  1 
ATOM   3709 C  CA  B PHE A 1 427 ? 46.969 73.678 -22.965 0.40 12.29 ? 424  PHE A CA  1 
ATOM   3710 C  C   . PHE A 1 427 ? 46.033 74.881 -22.734 1.00 11.61 ? 424  PHE A C   1 
ATOM   3711 O  O   . PHE A 1 427 ? 46.250 76.000 -23.221 1.00 12.09 ? 424  PHE A O   1 
ATOM   3712 C  CB  A PHE A 1 427 ? 46.658 72.946 -24.155 0.60 10.04 ? 424  PHE A CB  1 
ATOM   3713 C  CB  B PHE A 1 427 ? 46.295 72.763 -24.013 0.40 13.04 ? 424  PHE A CB  1 
ATOM   3714 C  CG  A PHE A 1 427 ? 47.780 72.226 -24.819 0.60 9.76  ? 424  PHE A CG  1 
ATOM   3715 C  CG  B PHE A 1 427 ? 47.223 71.769 -24.684 0.40 16.28 ? 424  PHE A CG  1 
ATOM   3716 C  CD1 A PHE A 1 427 ? 48.036 70.903 -24.540 0.60 9.17  ? 424  PHE A CD1 1 
ATOM   3717 C  CD1 B PHE A 1 427 ? 48.508 71.557 -24.229 0.40 19.38 ? 424  PHE A CD1 1 
ATOM   3718 C  CD2 A PHE A 1 427 ? 48.497 72.829 -25.817 0.60 12.85 ? 424  PHE A CD2 1 
ATOM   3719 C  CD2 B PHE A 1 427 ? 46.790 71.040 -25.790 0.40 20.19 ? 424  PHE A CD2 1 
ATOM   3720 C  CE1 A PHE A 1 427 ? 49.051 70.243 -25.180 0.60 11.85 ? 424  PHE A CE1 1 
ATOM   3721 C  CE1 B PHE A 1 427 ? 49.352 70.662 -24.861 0.40 20.51 ? 424  PHE A CE1 1 
ATOM   3722 C  CE2 A PHE A 1 427 ? 49.516 72.157 -26.468 0.60 14.25 ? 424  PHE A CE2 1 
ATOM   3723 C  CE2 B PHE A 1 427 ? 47.645 70.141 -26.424 0.40 21.37 ? 424  PHE A CE2 1 
ATOM   3724 C  CZ  A PHE A 1 427 ? 49.797 70.870 -26.149 0.60 12.13 ? 424  PHE A CZ  1 
ATOM   3725 C  CZ  B PHE A 1 427 ? 48.916 69.955 -25.956 0.40 21.48 ? 424  PHE A CZ  1 
ATOM   3726 N  N   . GLY A 1 428 ? 44.929 74.621 -22.085 1.00 10.92 ? 425  GLY A N   1 
ATOM   3727 C  CA  . GLY A 1 428 ? 43.807 75.563 -22.054 1.00 11.07 ? 425  GLY A CA  1 
ATOM   3728 C  C   . GLY A 1 428 ? 43.285 75.850 -23.469 1.00 11.75 ? 425  GLY A C   1 
ATOM   3729 O  O   . GLY A 1 428 ? 43.549 75.101 -24.430 1.00 12.37 ? 425  GLY A O   1 
ATOM   3730 N  N   . GLN A 1 429 ? 42.572 76.961 -23.584 1.00 11.68 ? 426  GLN A N   1 
ATOM   3731 C  CA  A GLN A 1 429 ? 42.073 77.437 -24.871 0.60 11.54 ? 426  GLN A CA  1 
ATOM   3732 C  CA  B GLN A 1 429 ? 42.069 77.437 -24.864 0.40 12.24 ? 426  GLN A CA  1 
ATOM   3733 C  C   . GLN A 1 429 ? 41.912 78.951 -24.783 1.00 12.21 ? 426  GLN A C   1 
ATOM   3734 O  O   . GLN A 1 429 ? 41.274 79.475 -23.860 1.00 12.45 ? 426  GLN A O   1 
ATOM   3735 C  CB  A GLN A 1 429 ? 40.763 76.745 -25.327 0.60 12.56 ? 426  GLN A CB  1 
ATOM   3736 C  CB  B GLN A 1 429 ? 40.736 76.776 -25.226 0.40 13.33 ? 426  GLN A CB  1 
ATOM   3737 C  CG  A GLN A 1 429 ? 39.516 76.972 -24.408 0.60 11.27 ? 426  GLN A CG  1 
ATOM   3738 C  CG  B GLN A 1 429 ? 40.349 76.895 -26.694 0.40 14.84 ? 426  GLN A CG  1 
ATOM   3739 C  CD  A GLN A 1 429 ? 38.266 76.143 -24.795 0.60 13.00 ? 426  GLN A CD  1 
ATOM   3740 C  CD  B GLN A 1 429 ? 39.010 76.253 -26.996 0.40 16.26 ? 426  GLN A CD  1 
ATOM   3741 O  OE1 A GLN A 1 429 ? 38.371 75.231 -25.624 0.60 17.07 ? 426  GLN A OE1 1 
ATOM   3742 O  OE1 B GLN A 1 429 ? 38.306 75.835 -26.091 0.40 17.80 ? 426  GLN A OE1 1 
ATOM   3743 N  NE2 A GLN A 1 429 ? 37.082 76.433 -24.153 0.60 11.22 ? 426  GLN A NE2 1 
ATOM   3744 N  NE2 B GLN A 1 429 ? 38.636 76.202 -28.276 0.40 18.34 ? 426  GLN A NE2 1 
ATOM   3745 N  N   . SER A 1 430 ? 42.507 79.660 -25.742 1.00 12.98 ? 427  SER A N   1 
ATOM   3746 C  CA  . SER A 1 430 ? 42.556 81.107 -25.719 1.00 14.07 ? 427  SER A CA  1 
ATOM   3747 C  C   . SER A 1 430 ? 41.278 81.750 -26.287 1.00 13.69 ? 427  SER A C   1 
ATOM   3748 O  O   . SER A 1 430 ? 40.462 81.108 -26.922 1.00 14.18 ? 427  SER A O   1 
ATOM   3749 C  CB  . SER A 1 430 ? 43.719 81.599 -26.615 1.00 15.16 ? 427  SER A CB  1 
ATOM   3750 O  OG  . SER A 1 430 ? 43.410 81.334 -27.978 1.00 18.21 ? 427  SER A OG  1 
ATOM   3751 N  N   . TYR A 1 431 ? 41.139 83.040 -26.041 1.00 14.76 ? 428  TYR A N   1 
ATOM   3752 C  CA  . TYR A 1 431 ? 40.032 83.821 -26.602 1.00 14.83 ? 428  TYR A CA  1 
ATOM   3753 C  C   . TYR A 1 431 ? 39.943 83.648 -28.119 1.00 15.67 ? 428  TYR A C   1 
ATOM   3754 O  O   . TYR A 1 431 ? 38.854 83.374 -28.640 1.00 15.76 ? 428  TYR A O   1 
ATOM   3755 C  CB  . TYR A 1 431 ? 40.196 85.302 -26.247 1.00 15.25 ? 428  TYR A CB  1 
ATOM   3756 C  CG  . TYR A 1 431 ? 39.044 86.157 -26.728 1.00 17.24 ? 428  TYR A CG  1 
ATOM   3757 C  CD1 . TYR A 1 431 ? 37.989 86.490 -25.899 1.00 19.02 ? 428  TYR A CD1 1 
ATOM   3758 C  CD2 . TYR A 1 431 ? 39.021 86.616 -28.027 1.00 19.18 ? 428  TYR A CD2 1 
ATOM   3759 C  CE1 . TYR A 1 431 ? 36.941 87.273 -26.351 1.00 19.30 ? 428  TYR A CE1 1 
ATOM   3760 C  CE2 . TYR A 1 431 ? 37.982 87.361 -28.498 1.00 19.04 ? 428  TYR A CE2 1 
ATOM   3761 C  CZ  . TYR A 1 431 ? 36.935 87.701 -27.666 1.00 19.95 ? 428  TYR A CZ  1 
ATOM   3762 O  OH  . TYR A 1 431 ? 35.960 88.492 -28.239 1.00 22.90 ? 428  TYR A OH  1 
ATOM   3763 N  N   . ASP A 1 432 ? 41.047 83.790 -28.848 1.00 16.95 ? 429  ASP A N   1 
ATOM   3764 C  CA  A ASP A 1 432 ? 40.964 83.728 -30.300 0.60 17.67 ? 429  ASP A CA  1 
ATOM   3765 C  CA  B ASP A 1 432 ? 40.971 83.723 -30.309 0.40 17.86 ? 429  ASP A CA  1 
ATOM   3766 C  C   . ASP A 1 432 ? 40.476 82.369 -30.778 1.00 17.51 ? 429  ASP A C   1 
ATOM   3767 O  O   . ASP A 1 432 ? 39.666 82.270 -31.672 1.00 17.96 ? 429  ASP A O   1 
ATOM   3768 C  CB  A ASP A 1 432 ? 42.324 84.026 -30.945 0.60 18.08 ? 429  ASP A CB  1 
ATOM   3769 C  CB  B ASP A 1 432 ? 42.325 83.998 -30.971 0.40 18.45 ? 429  ASP A CB  1 
ATOM   3770 C  CG  A ASP A 1 432 ? 42.703 85.509 -30.900 0.60 20.47 ? 429  ASP A CG  1 
ATOM   3771 C  CG  B ASP A 1 432 ? 42.239 83.997 -32.498 0.40 21.14 ? 429  ASP A CG  1 
ATOM   3772 O  OD1 A ASP A 1 432 ? 41.894 86.358 -30.453 0.60 21.48 ? 429  ASP A OD1 1 
ATOM   3773 O  OD1 B ASP A 1 432 ? 41.435 84.781 -33.053 0.40 23.01 ? 429  ASP A OD1 1 
ATOM   3774 O  OD2 A ASP A 1 432 ? 43.833 85.809 -31.325 0.60 22.44 ? 429  ASP A OD2 1 
ATOM   3775 O  OD2 B ASP A 1 432 ? 42.974 83.205 -33.142 0.40 25.69 ? 429  ASP A OD2 1 
HETATM 3776 N  N   . MSE A 1 433 ? 40.951 81.303 -30.138 1.00 17.53 ? 430  MSE A N   1 
HETATM 3777 C  CA  A MSE A 1 433 ? 40.561 79.960 -30.481 0.70 17.15 ? 430  MSE A CA  1 
HETATM 3778 C  CA  B MSE A 1 433 ? 40.549 79.978 -30.554 0.30 17.35 ? 430  MSE A CA  1 
HETATM 3779 C  C   . MSE A 1 433 ? 39.064 79.774 -30.270 1.00 16.98 ? 430  MSE A C   1 
HETATM 3780 O  O   . MSE A 1 433 ? 38.352 79.250 -31.121 1.00 17.72 ? 430  MSE A O   1 
HETATM 3781 C  CB  A MSE A 1 433 ? 41.341 78.984 -29.587 0.70 18.45 ? 430  MSE A CB  1 
HETATM 3782 C  CB  B MSE A 1 433 ? 41.414 78.907 -29.891 0.30 18.18 ? 430  MSE A CB  1 
HETATM 3783 C  CG  A MSE A 1 433 ? 42.869 79.009 -29.814 0.70 22.68 ? 430  MSE A CG  1 
HETATM 3784 C  CG  B MSE A 1 433 ? 42.871 78.885 -30.396 0.30 20.08 ? 430  MSE A CG  1 
HETATM 3785 SE SE  A MSE A 1 433 ? 43.767 77.709 -28.632 0.49 30.21 ? 430  MSE A SE  1 
HETATM 3786 SE SE  B MSE A 1 433 ? 43.121 78.622 -32.322 0.21 25.47 ? 430  MSE A SE  1 
HETATM 3787 C  CE  A MSE A 1 433 ? 44.793 78.634 -27.272 0.70 25.65 ? 430  MSE A CE  1 
HETATM 3788 C  CE  B MSE A 1 433 ? 43.329 80.469 -32.950 0.30 24.51 ? 430  MSE A CE  1 
ATOM   3789 N  N   . VAL A 1 434 ? 38.600 80.203 -29.094 1.00 15.46 ? 431  VAL A N   1 
ATOM   3790 C  CA  . VAL A 1 434 ? 37.195 80.101 -28.758 1.00 15.30 ? 431  VAL A CA  1 
ATOM   3791 C  C   . VAL A 1 434 ? 36.307 80.916 -29.711 1.00 15.88 ? 431  VAL A C   1 
ATOM   3792 O  O   . VAL A 1 434 ? 35.283 80.427 -30.186 1.00 17.56 ? 431  VAL A O   1 
ATOM   3793 C  CB  . VAL A 1 434 ? 36.936 80.504 -27.256 1.00 14.70 ? 431  VAL A CB  1 
ATOM   3794 C  CG1 . VAL A 1 434 ? 35.428 80.688 -27.014 1.00 17.84 ? 431  VAL A CG1 1 
ATOM   3795 C  CG2 . VAL A 1 434 ? 37.593 79.419 -26.283 1.00 14.91 ? 431  VAL A CG2 1 
ATOM   3796 N  N   . TYR A 1 435 ? 36.702 82.159 -29.954 1.00 14.90 ? 432  TYR A N   1 
ATOM   3797 C  CA  . TYR A 1 435 ? 35.922 83.037 -30.757 1.00 16.24 ? 432  TYR A CA  1 
ATOM   3798 C  C   . TYR A 1 435 ? 35.739 82.451 -32.174 1.00 17.15 ? 432  TYR A C   1 
ATOM   3799 O  O   . TYR A 1 435 ? 34.609 82.404 -32.725 1.00 17.58 ? 432  TYR A O   1 
ATOM   3800 C  CB  . TYR A 1 435 ? 36.612 84.394 -30.798 1.00 16.38 ? 432  TYR A CB  1 
ATOM   3801 C  CG  . TYR A 1 435 ? 35.937 85.408 -31.684 1.00 17.83 ? 432  TYR A CG  1 
ATOM   3802 C  CD1 . TYR A 1 435 ? 34.875 86.168 -31.225 1.00 18.63 ? 432  TYR A CD1 1 
ATOM   3803 C  CD2 . TYR A 1 435 ? 36.393 85.617 -32.970 1.00 21.11 ? 432  TYR A CD2 1 
ATOM   3804 C  CE1 . TYR A 1 435 ? 34.252 87.109 -32.030 1.00 20.26 ? 432  TYR A CE1 1 
ATOM   3805 C  CE2 . TYR A 1 435 ? 35.799 86.580 -33.799 1.00 22.40 ? 432  TYR A CE2 1 
ATOM   3806 C  CZ  . TYR A 1 435 ? 34.720 87.311 -33.328 1.00 22.23 ? 432  TYR A CZ  1 
ATOM   3807 O  OH  . TYR A 1 435 ? 34.144 88.249 -34.172 1.00 26.56 ? 432  TYR A OH  1 
ATOM   3808 N  N   . ASN A 1 436 ? 36.831 81.966 -32.747 1.00 19.18 ? 433  ASN A N   1 
ATOM   3809 C  CA  . ASN A 1 436 ? 36.771 81.370 -34.082 1.00 21.68 ? 433  ASN A CA  1 
ATOM   3810 C  C   . ASN A 1 436 ? 35.875 80.136 -34.100 1.00 22.62 ? 433  ASN A C   1 
ATOM   3811 O  O   . ASN A 1 436 ? 35.094 79.969 -35.036 1.00 23.12 ? 433  ASN A O   1 
ATOM   3812 C  CB  . ASN A 1 436 ? 38.152 81.011 -34.596 1.00 22.87 ? 433  ASN A CB  1 
ATOM   3813 C  CG  . ASN A 1 436 ? 38.994 82.228 -34.917 1.00 25.33 ? 433  ASN A CG  1 
ATOM   3814 O  OD1 . ASN A 1 436 ? 38.486 83.318 -35.191 1.00 31.02 ? 433  ASN A OD1 1 
ATOM   3815 N  ND2 . ASN A 1 436 ? 40.307 82.033 -34.911 1.00 30.66 ? 433  ASN A ND2 1 
ATOM   3816 N  N   . GLU A 1 437 ? 35.943 79.309 -33.057 1.00 22.51 ? 434  GLU A N   1 
ATOM   3817 C  CA  A GLU A 1 437 ? 35.097 78.131 -32.917 0.60 23.30 ? 434  GLU A CA  1 
ATOM   3818 C  CA  B GLU A 1 437 ? 35.090 78.130 -32.972 0.40 22.96 ? 434  GLU A CA  1 
ATOM   3819 C  C   . GLU A 1 437 ? 33.621 78.524 -32.859 1.00 23.07 ? 434  GLU A C   1 
ATOM   3820 O  O   . GLU A 1 437 ? 32.771 77.877 -33.467 1.00 24.21 ? 434  GLU A O   1 
ATOM   3821 C  CB  A GLU A 1 437 ? 35.517 77.358 -31.646 0.60 24.15 ? 434  GLU A CB  1 
ATOM   3822 C  CB  B GLU A 1 437 ? 35.495 77.208 -31.807 0.40 23.34 ? 434  GLU A CB  1 
ATOM   3823 C  CG  A GLU A 1 437 ? 34.749 76.086 -31.323 0.60 26.51 ? 434  GLU A CG  1 
ATOM   3824 C  CG  B GLU A 1 437 ? 36.768 76.390 -32.052 0.40 24.42 ? 434  GLU A CG  1 
ATOM   3825 C  CD  A GLU A 1 437 ? 35.332 75.310 -30.130 0.60 30.69 ? 434  GLU A CD  1 
ATOM   3826 C  CD  B GLU A 1 437 ? 37.151 75.520 -30.863 0.40 25.82 ? 434  GLU A CD  1 
ATOM   3827 O  OE1 A GLU A 1 437 ? 35.261 75.797 -28.954 0.60 30.99 ? 434  GLU A OE1 1 
ATOM   3828 O  OE1 B GLU A 1 437 ? 36.726 75.847 -29.734 0.40 25.14 ? 434  GLU A OE1 1 
ATOM   3829 O  OE2 A GLU A 1 437 ? 35.854 74.192 -30.376 0.60 33.97 ? 434  GLU A OE2 1 
ATOM   3830 O  OE2 B GLU A 1 437 ? 37.890 74.522 -31.057 0.40 27.87 ? 434  GLU A OE2 1 
ATOM   3831 N  N   . LEU A 1 438 ? 33.305 79.590 -32.124 1.00 21.72 ? 435  LEU A N   1 
ATOM   3832 C  CA  . LEU A 1 438 ? 31.903 80.047 -32.019 1.00 21.17 ? 435  LEU A CA  1 
ATOM   3833 C  C   . LEU A 1 438 ? 31.352 80.528 -33.350 1.00 22.52 ? 435  LEU A C   1 
ATOM   3834 O  O   . LEU A 1 438 ? 30.209 80.184 -33.692 1.00 23.47 ? 435  LEU A O   1 
ATOM   3835 C  CB  . LEU A 1 438 ? 31.754 81.163 -31.005 1.00 20.16 ? 435  LEU A CB  1 
ATOM   3836 C  CG  . LEU A 1 438 ? 31.921 80.671 -29.573 1.00 17.85 ? 435  LEU A CG  1 
ATOM   3837 C  CD1 . LEU A 1 438 ? 31.931 81.882 -28.634 1.00 20.20 ? 435  LEU A CD1 1 
ATOM   3838 C  CD2 . LEU A 1 438 ? 30.848 79.631 -29.165 1.00 17.83 ? 435  LEU A CD2 1 
ATOM   3839 N  N   . LEU A 1 439 ? 32.140 81.308 -34.090 1.00 23.37 ? 436  LEU A N   1 
ATOM   3840 C  CA  . LEU A 1 439 ? 31.737 81.676 -35.448 1.00 24.69 ? 436  LEU A CA  1 
ATOM   3841 C  C   . LEU A 1 439 ? 31.450 80.462 -36.324 1.00 26.50 ? 436  LEU A C   1 
ATOM   3842 O  O   . LEU A 1 439 ? 30.442 80.458 -37.067 1.00 27.69 ? 436  LEU A O   1 
ATOM   3843 C  CB  . LEU A 1 439 ? 32.793 82.546 -36.130 1.00 23.38 ? 436  LEU A CB  1 
ATOM   3844 C  CG  . LEU A 1 439 ? 33.028 83.925 -35.516 1.00 24.38 ? 436  LEU A CG  1 
ATOM   3845 C  CD1 . LEU A 1 439 ? 34.109 84.630 -36.323 1.00 26.44 ? 436  LEU A CD1 1 
ATOM   3846 C  CD2 . LEU A 1 439 ? 31.746 84.753 -35.453 1.00 27.23 ? 436  LEU A CD2 1 
ATOM   3847 N  N   . LYS A 1 440 ? 32.321 79.457 -36.274 1.00 28.14 ? 437  LYS A N   1 
ATOM   3848 C  CA  A LYS A 1 440 ? 32.142 78.248 -37.083 0.60 29.85 ? 437  LYS A CA  1 
ATOM   3849 C  CA  B LYS A 1 440 ? 32.134 78.251 -37.086 0.40 29.52 ? 437  LYS A CA  1 
ATOM   3850 C  C   . LYS A 1 440 ? 30.908 77.449 -36.649 1.00 30.56 ? 437  LYS A C   1 
ATOM   3851 O  O   . LYS A 1 440 ? 30.338 76.693 -37.447 1.00 32.70 ? 437  LYS A O   1 
ATOM   3852 C  CB  A LYS A 1 440 ? 33.419 77.380 -37.061 0.60 30.41 ? 437  LYS A CB  1 
ATOM   3853 C  CB  B LYS A 1 440 ? 33.389 77.362 -37.076 0.40 29.68 ? 437  LYS A CB  1 
ATOM   3854 C  CG  A LYS A 1 440 ? 33.317 76.068 -37.859 0.60 31.61 ? 437  LYS A CG  1 
ATOM   3855 C  CG  B LYS A 1 440 ? 34.363 77.628 -38.223 0.40 29.58 ? 437  LYS A CG  1 
ATOM   3856 C  CD  A LYS A 1 440 ? 34.624 75.674 -38.542 0.60 33.27 ? 437  LYS A CD  1 
ATOM   3857 C  CD  B LYS A 1 440 ? 35.497 78.554 -37.810 0.40 29.14 ? 437  LYS A CD  1 
ATOM   3858 C  CE  A LYS A 1 440 ? 35.764 75.500 -37.558 0.60 34.66 ? 437  LYS A CE  1 
ATOM   3859 C  CE  B LYS A 1 440 ? 36.826 78.066 -38.364 0.40 28.06 ? 437  LYS A CE  1 
ATOM   3860 N  NZ  A LYS A 1 440 ? 36.849 74.610 -38.097 0.60 36.23 ? 437  LYS A NZ  1 
ATOM   3861 N  NZ  B LYS A 1 440 ? 37.962 78.765 -37.730 0.40 26.87 ? 437  LYS A NZ  1 
ATOM   3862 N  N   . SER A 1 441 ? 30.488 77.621 -35.397 1.00 30.87 ? 438  SER A N   1 
ATOM   3863 C  CA  . SER A 1 441 ? 29.301 76.967 -34.846 1.00 31.70 ? 438  SER A CA  1 
ATOM   3864 C  C   . SER A 1 441 ? 27.989 77.628 -35.288 1.00 31.46 ? 438  SER A C   1 
ATOM   3865 O  O   . SER A 1 441 ? 26.918 77.070 -35.034 1.00 32.79 ? 438  SER A O   1 
ATOM   3866 C  CB  . SER A 1 441 ? 29.362 76.937 -33.305 1.00 32.15 ? 438  SER A CB  1 
ATOM   3867 O  OG  . SER A 1 441 ? 28.859 78.137 -32.722 1.00 34.79 ? 438  SER A OG  1 
ATOM   3868 N  N   . GLY A 1 442 ? 28.077 78.799 -35.925 1.00 30.70 ? 439  GLY A N   1 
ATOM   3869 C  CA  . GLY A 1 442 ? 26.893 79.551 -36.382 1.00 30.20 ? 439  GLY A CA  1 
ATOM   3870 C  C   . GLY A 1 442 ? 26.530 80.810 -35.594 1.00 29.36 ? 439  GLY A C   1 
ATOM   3871 O  O   . GLY A 1 442 ? 25.527 81.458 -35.901 1.00 29.39 ? 439  GLY A O   1 
ATOM   3872 N  N   . LEU A 1 443 ? 27.302 81.173 -34.564 1.00 27.67 ? 440  LEU A N   1 
ATOM   3873 C  CA  . LEU A 1 443 ? 27.047 82.428 -33.871 1.00 26.36 ? 440  LEU A CA  1 
ATOM   3874 C  C   . LEU A 1 443 ? 27.514 83.567 -34.745 1.00 25.90 ? 440  LEU A C   1 
ATOM   3875 O  O   . LEU A 1 443 ? 28.456 83.427 -35.526 1.00 26.37 ? 440  LEU A O   1 
ATOM   3876 C  CB  . LEU A 1 443 ? 27.775 82.499 -32.496 1.00 25.45 ? 440  LEU A CB  1 
ATOM   3877 C  CG  . LEU A 1 443 ? 27.287 81.591 -31.366 1.00 27.16 ? 440  LEU A CG  1 
ATOM   3878 C  CD1 . LEU A 1 443 ? 27.941 82.028 -30.026 1.00 27.67 ? 440  LEU A CD1 1 
ATOM   3879 C  CD2 . LEU A 1 443 ? 25.775 81.561 -31.244 1.00 29.82 ? 440  LEU A CD2 1 
ATOM   3880 N  N   . ASN A 1 444 ? 26.838 84.703 -34.639 1.00 25.42 ? 441  ASN A N   1 
ATOM   3881 C  CA  . ASN A 1 444 ? 27.330 85.904 -35.286 1.00 25.02 ? 441  ASN A CA  1 
ATOM   3882 C  C   . ASN A 1 444 ? 28.389 86.551 -34.442 1.00 23.99 ? 441  ASN A C   1 
ATOM   3883 O  O   . ASN A 1 444 ? 28.667 86.096 -33.327 1.00 22.02 ? 441  ASN A O   1 
ATOM   3884 C  CB  . ASN A 1 444 ? 26.185 86.880 -35.668 1.00 25.87 ? 441  ASN A CB  1 
ATOM   3885 C  CG  . ASN A 1 444 ? 25.441 87.458 -34.459 1.00 26.65 ? 441  ASN A CG  1 
ATOM   3886 O  OD1 . ASN A 1 444 ? 26.029 87.737 -33.404 1.00 28.13 ? 441  ASN A OD1 1 
ATOM   3887 N  ND2 . ASN A 1 444 ? 24.133 87.678 -34.630 1.00 28.80 ? 441  ASN A ND2 1 
ATOM   3888 N  N   . GLU A 1 445 ? 29.008 87.581 -34.982 1.00 23.61 ? 442  GLU A N   1 
ATOM   3889 C  CA  A GLU A 1 445 ? 30.123 88.251 -34.319 0.60 23.88 ? 442  GLU A CA  1 
ATOM   3890 C  CA  B GLU A 1 445 ? 30.108 88.315 -34.328 0.40 23.77 ? 442  GLU A CA  1 
ATOM   3891 C  C   . GLU A 1 445 ? 29.724 88.813 -32.946 1.00 23.55 ? 442  GLU A C   1 
ATOM   3892 O  O   . GLU A 1 445 ? 30.470 88.652 -31.973 1.00 23.38 ? 442  GLU A O   1 
ATOM   3893 C  CB  A GLU A 1 445 ? 30.721 89.341 -35.226 0.60 24.86 ? 442  GLU A CB  1 
ATOM   3894 C  CB  B GLU A 1 445 ? 30.522 89.531 -35.173 0.40 24.32 ? 442  GLU A CB  1 
ATOM   3895 C  CG  A GLU A 1 445 ? 31.548 88.789 -36.429 0.60 26.18 ? 442  GLU A CG  1 
ATOM   3896 C  CG  B GLU A 1 445 ? 31.830 90.232 -34.717 0.40 25.44 ? 442  GLU A CG  1 
ATOM   3897 C  CD  A GLU A 1 445 ? 32.169 89.867 -37.336 0.60 29.38 ? 442  GLU A CD  1 
ATOM   3898 C  CD  B GLU A 1 445 ? 32.036 91.600 -35.358 0.40 26.73 ? 442  GLU A CD  1 
ATOM   3899 O  OE1 A GLU A 1 445 ? 31.602 90.977 -37.487 0.60 31.62 ? 442  GLU A OE1 1 
ATOM   3900 O  OE1 B GLU A 1 445 ? 31.034 92.267 -35.682 0.40 28.28 ? 442  GLU A OE1 1 
ATOM   3901 O  OE2 A GLU A 1 445 ? 33.228 89.585 -37.937 0.60 31.22 ? 442  GLU A OE2 1 
ATOM   3902 O  OE2 B GLU A 1 445 ? 33.205 92.016 -35.532 0.40 28.21 ? 442  GLU A OE2 1 
ATOM   3903 N  N   . THR A 1 446 ? 28.556 89.443 -32.842 1.00 23.81 ? 443  THR A N   1 
ATOM   3904 C  CA  . THR A 1 446 ? 28.127 90.021 -31.562 1.00 24.49 ? 443  THR A CA  1 
ATOM   3905 C  C   . THR A 1 446 ? 27.991 88.931 -30.500 1.00 22.95 ? 443  THR A C   1 
ATOM   3906 O  O   . THR A 1 446 ? 28.449 89.086 -29.343 1.00 24.47 ? 443  THR A O   1 
ATOM   3907 C  CB  . THR A 1 446 ? 26.792 90.736 -31.685 1.00 25.33 ? 443  THR A CB  1 
ATOM   3908 O  OG1 . THR A 1 446 ? 26.882 91.672 -32.751 1.00 28.85 ? 443  THR A OG1 1 
ATOM   3909 C  CG2 . THR A 1 446 ? 26.441 91.485 -30.362 1.00 26.62 ? 443  THR A CG2 1 
ATOM   3910 N  N   . GLN A 1 447 ? 27.342 87.828 -30.893 1.00 21.77 ? 444  GLN A N   1 
ATOM   3911 C  CA  . GLN A 1 447 ? 27.089 86.708 -29.999 1.00 20.85 ? 444  GLN A CA  1 
ATOM   3912 C  C   . GLN A 1 447 ? 28.390 86.053 -29.555 1.00 19.63 ? 444  GLN A C   1 
ATOM   3913 O  O   . GLN A 1 447 ? 28.565 85.729 -28.375 1.00 17.81 ? 444  GLN A O   1 
ATOM   3914 C  CB  . GLN A 1 447 ? 26.212 85.663 -30.692 1.00 21.07 ? 444  GLN A CB  1 
ATOM   3915 C  CG  . GLN A 1 447 ? 24.798 86.152 -30.988 1.00 24.71 ? 444  GLN A CG  1 
ATOM   3916 C  CD  . GLN A 1 447 ? 23.992 85.116 -31.814 1.00 27.62 ? 444  GLN A CD  1 
ATOM   3917 O  OE1 . GLN A 1 447 ? 24.465 84.597 -32.813 1.00 27.51 ? 444  GLN A OE1 1 
ATOM   3918 N  NE2 . GLN A 1 447 ? 22.797 84.800 -31.352 1.00 31.24 ? 444  GLN A NE2 1 
ATOM   3919 N  N   . ALA A 1 448 ? 29.294 85.871 -30.496 1.00 18.90 ? 445  ALA A N   1 
ATOM   3920 C  CA  . ALA A 1 448 ? 30.592 85.231 -30.238 1.00 18.05 ? 445  ALA A CA  1 
ATOM   3921 C  C   . ALA A 1 448 ? 31.467 86.101 -29.315 1.00 18.41 ? 445  ALA A C   1 
ATOM   3922 O  O   . ALA A 1 448 ? 32.108 85.610 -28.384 1.00 17.72 ? 445  ALA A O   1 
ATOM   3923 C  CB  . ALA A 1 448 ? 31.305 84.946 -31.556 1.00 19.34 ? 445  ALA A CB  1 
ATOM   3924 N  N   . LYS A 1 449 ? 31.477 87.399 -29.580 1.00 20.21 ? 446  LYS A N   1 
ATOM   3925 C  CA  A LYS A 1 449 ? 32.163 88.359 -28.716 0.60 21.43 ? 446  LYS A CA  1 
ATOM   3926 C  CA  B LYS A 1 449 ? 32.150 88.376 -28.726 0.40 20.72 ? 446  LYS A CA  1 
ATOM   3927 C  C   . LYS A 1 449 ? 31.614 88.371 -27.289 1.00 20.87 ? 446  LYS A C   1 
ATOM   3928 O  O   . LYS A 1 449 ? 32.380 88.527 -26.364 1.00 22.36 ? 446  LYS A O   1 
ATOM   3929 C  CB  A LYS A 1 449 ? 32.095 89.781 -29.303 0.60 22.48 ? 446  LYS A CB  1 
ATOM   3930 C  CB  B LYS A 1 449 ? 31.998 89.782 -29.326 0.40 21.13 ? 446  LYS A CB  1 
ATOM   3931 C  CG  A LYS A 1 449 ? 33.414 90.286 -29.849 0.60 25.86 ? 446  LYS A CG  1 
ATOM   3932 C  CG  B LYS A 1 449 ? 33.001 90.811 -28.832 0.40 21.74 ? 446  LYS A CG  1 
ATOM   3933 C  CD  A LYS A 1 449 ? 34.269 90.940 -28.732 0.60 29.08 ? 446  LYS A CD  1 
ATOM   3934 C  CD  B LYS A 1 449 ? 33.033 91.996 -29.830 0.40 22.07 ? 446  LYS A CD  1 
ATOM   3935 C  CE  A LYS A 1 449 ? 33.859 92.402 -28.454 0.60 30.02 ? 446  LYS A CE  1 
ATOM   3936 C  CE  B LYS A 1 449 ? 32.416 91.573 -31.163 0.40 23.26 ? 446  LYS A CE  1 
ATOM   3937 N  NZ  A LYS A 1 449 ? 34.469 92.905 -27.192 0.60 29.52 ? 446  LYS A NZ  1 
ATOM   3938 N  NZ  B LYS A 1 449 ? 32.683 92.496 -32.303 0.40 23.49 ? 446  LYS A NZ  1 
ATOM   3939 N  N   . GLU A 1 450 ? 30.304 88.206 -27.111 1.00 20.12 ? 447  GLU A N   1 
ATOM   3940 C  CA  A GLU A 1 450 ? 29.695 88.232 -25.776 0.60 20.28 ? 447  GLU A CA  1 
ATOM   3941 C  CA  B GLU A 1 450 ? 29.724 88.257 -25.760 0.40 19.42 ? 447  GLU A CA  1 
ATOM   3942 C  C   . GLU A 1 450 ? 30.037 86.968 -24.981 1.00 18.56 ? 447  GLU A C   1 
ATOM   3943 O  O   . GLU A 1 450 ? 30.205 87.004 -23.740 1.00 19.83 ? 447  GLU A O   1 
ATOM   3944 C  CB  A GLU A 1 450 ? 28.166 88.382 -25.840 0.60 21.53 ? 447  GLU A CB  1 
ATOM   3945 C  CB  B GLU A 1 450 ? 28.207 88.610 -25.742 0.40 20.03 ? 447  GLU A CB  1 
ATOM   3946 C  CG  A GLU A 1 450 ? 27.674 89.782 -25.454 0.60 25.56 ? 447  GLU A CG  1 
ATOM   3947 C  CG  B GLU A 1 450 ? 27.217 87.539 -26.229 0.40 19.87 ? 447  GLU A CG  1 
ATOM   3948 C  CD  A GLU A 1 450 ? 28.036 90.132 -24.000 0.60 29.46 ? 447  GLU A CD  1 
ATOM   3949 C  CD  B GLU A 1 450 ? 25.706 87.975 -26.218 0.40 21.26 ? 447  GLU A CD  1 
ATOM   3950 O  OE1 A GLU A 1 450 ? 28.575 91.229 -23.762 0.60 34.28 ? 447  GLU A OE1 1 
ATOM   3951 O  OE1 B GLU A 1 450 ? 24.839 87.264 -26.820 0.40 18.79 ? 447  GLU A OE1 1 
ATOM   3952 O  OE2 A GLU A 1 450 ? 27.800 89.296 -23.095 0.60 33.01 ? 447  GLU A OE2 1 
ATOM   3953 O  OE2 B GLU A 1 450 ? 25.375 88.997 -25.578 0.40 21.03 ? 447  GLU A OE2 1 
ATOM   3954 N  N   . LEU A 1 451 ? 30.133 85.838 -25.678 1.00 15.48 ? 448  LEU A N   1 
ATOM   3955 C  CA  . LEU A 1 451 ? 30.346 84.535 -25.041 1.00 14.08 ? 448  LEU A CA  1 
ATOM   3956 C  C   . LEU A 1 451 ? 31.825 84.105 -24.854 1.00 13.28 ? 448  LEU A C   1 
ATOM   3957 O  O   . LEU A 1 451 ? 32.145 83.425 -23.879 1.00 12.88 ? 448  LEU A O   1 
ATOM   3958 C  CB  . LEU A 1 451 ? 29.585 83.451 -25.797 1.00 14.05 ? 448  LEU A CB  1 
ATOM   3959 C  CG  . LEU A 1 451 ? 29.628 82.029 -25.245 1.00 14.02 ? 448  LEU A CG  1 
ATOM   3960 C  CD1 . LEU A 1 451 ? 29.185 81.987 -23.773 1.00 14.67 ? 448  LEU A CD1 1 
ATOM   3961 C  CD2 . LEU A 1 451 ? 28.748 81.140 -26.189 1.00 15.82 ? 448  LEU A CD2 1 
ATOM   3962 N  N   . ALA A 1 452 ? 32.697 84.458 -25.793 1.00 13.47 ? 449  ALA A N   1 
ATOM   3963 C  CA  . ALA A 1 452 ? 34.012 83.862 -25.872 1.00 13.36 ? 449  ALA A CA  1 
ATOM   3964 C  C   . ALA A 1 452 ? 34.779 83.985 -24.558 1.00 12.57 ? 449  ALA A C   1 
ATOM   3965 O  O   . ALA A 1 452 ? 35.443 83.017 -24.173 1.00 11.84 ? 449  ALA A O   1 
ATOM   3966 C  CB  . ALA A 1 452 ? 34.833 84.498 -26.992 1.00 13.81 ? 449  ALA A CB  1 
ATOM   3967 N  N   . ALA A 1 453 ? 34.774 85.161 -23.910 1.00 12.46 ? 450  ALA A N   1 
ATOM   3968 C  CA  . ALA A 1 453 ? 35.561 85.289 -22.655 1.00 13.77 ? 450  ALA A CA  1 
ATOM   3969 C  C   . ALA A 1 453 ? 35.163 84.293 -21.588 1.00 12.70 ? 450  ALA A C   1 
ATOM   3970 O  O   . ALA A 1 453 ? 36.027 83.825 -20.812 1.00 14.89 ? 450  ALA A O   1 
ATOM   3971 C  CB  . ALA A 1 453 ? 35.459 86.699 -22.079 1.00 14.71 ? 450  ALA A CB  1 
ATOM   3972 N  N   . HIS A 1 454 ? 33.904 83.869 -21.613 1.00 11.80 ? 451  HIS A N   1 
ATOM   3973 C  CA  . HIS A 1 454 ? 33.422 82.929 -20.610 1.00 11.03 ? 451  HIS A CA  1 
ATOM   3974 C  C   . HIS A 1 454 ? 33.917 81.519 -20.858 1.00 10.70 ? 451  HIS A C   1 
ATOM   3975 O  O   . HIS A 1 454 ? 33.878 80.699 -19.949 1.00 10.62 ? 451  HIS A O   1 
ATOM   3976 C  CB  . HIS A 1 454 ? 31.888 82.944 -20.541 1.00 10.78 ? 451  HIS A CB  1 
ATOM   3977 C  CG  . HIS A 1 454 ? 31.344 84.253 -20.107 1.00 9.66  ? 451  HIS A CG  1 
ATOM   3978 N  ND1 . HIS A 1 454 ? 31.235 84.630 -18.779 1.00 8.95  ? 451  HIS A ND1 1 
ATOM   3979 C  CD2 . HIS A 1 454 ? 31.001 85.342 -20.850 1.00 12.07 ? 451  HIS A CD2 1 
ATOM   3980 C  CE1 . HIS A 1 454 ? 30.782 85.873 -18.737 1.00 10.80 ? 451  HIS A CE1 1 
ATOM   3981 N  NE2 . HIS A 1 454 ? 30.654 86.334 -19.975 1.00 10.93 ? 451  HIS A NE2 1 
ATOM   3982 N  N   . LYS A 1 455 ? 34.386 81.210 -22.071 1.00 10.95 ? 452  LYS A N   1 
ATOM   3983 C  CA  A LYS A 1 455 ? 34.878 79.880 -22.427 0.60 11.47 ? 452  LYS A CA  1 
ATOM   3984 C  CA  B LYS A 1 455 ? 34.864 79.876 -22.407 0.40 11.23 ? 452  LYS A CA  1 
ATOM   3985 C  C   . LYS A 1 455 ? 36.395 79.787 -22.383 1.00 11.26 ? 452  LYS A C   1 
ATOM   3986 O  O   . LYS A 1 455 ? 36.950 78.718 -22.562 1.00 13.47 ? 452  LYS A O   1 
ATOM   3987 C  CB  A LYS A 1 455 ? 34.445 79.477 -23.824 0.60 11.78 ? 452  LYS A CB  1 
ATOM   3988 C  CB  B LYS A 1 455 ? 34.323 79.444 -23.768 0.40 11.27 ? 452  LYS A CB  1 
ATOM   3989 C  CG  A LYS A 1 455 ? 32.961 79.328 -23.969 0.60 13.00 ? 452  LYS A CG  1 
ATOM   3990 C  CG  B LYS A 1 455 ? 32.794 79.511 -23.844 0.40 10.84 ? 452  LYS A CG  1 
ATOM   3991 C  CD  A LYS A 1 455 ? 32.660 78.488 -25.174 0.60 15.68 ? 452  LYS A CD  1 
ATOM   3992 C  CD  B LYS A 1 455 ? 32.253 79.037 -25.188 0.40 11.09 ? 452  LYS A CD  1 
ATOM   3993 C  CE  A LYS A 1 455 ? 31.172 78.395 -25.413 0.60 17.63 ? 452  LYS A CE  1 
ATOM   3994 C  CE  B LYS A 1 455 ? 32.520 77.536 -25.432 0.40 11.64 ? 452  LYS A CE  1 
ATOM   3995 N  NZ  A LYS A 1 455 ? 30.863 77.163 -26.228 0.60 18.59 ? 452  LYS A NZ  1 
ATOM   3996 N  NZ  B LYS A 1 455 ? 32.085 77.088 -26.816 0.40 14.00 ? 452  LYS A NZ  1 
ATOM   3997 N  N   . VAL A 1 456 ? 37.074 80.908 -22.154 1.00 12.53 ? 453  VAL A N   1 
ATOM   3998 C  CA  . VAL A 1 456 ? 38.539 80.885 -22.141 1.00 11.89 ? 453  VAL A CA  1 
ATOM   3999 C  C   . VAL A 1 456 ? 38.997 80.042 -20.954 1.00 10.82 ? 453  VAL A C   1 
ATOM   4000 O  O   . VAL A 1 456 ? 38.466 80.171 -19.818 1.00 11.99 ? 453  VAL A O   1 
ATOM   4001 C  CB  . VAL A 1 456 ? 39.090 82.302 -22.058 1.00 13.13 ? 453  VAL A CB  1 
ATOM   4002 C  CG1 . VAL A 1 456 ? 40.642 82.303 -21.759 1.00 13.73 ? 453  VAL A CG1 1 
ATOM   4003 C  CG2 . VAL A 1 456 ? 38.801 83.067 -23.370 1.00 13.99 ? 453  VAL A CG2 1 
ATOM   4004 N  N   . ILE A 1 457 ? 39.969 79.175 -21.209 1.00 10.54 ? 454  ILE A N   1 
ATOM   4005 C  CA  . ILE A 1 457 ? 40.560 78.316 -20.189 1.00 11.55 ? 454  ILE A CA  1 
ATOM   4006 C  C   . ILE A 1 457 ? 42.062 78.679 -20.127 1.00 11.63 ? 454  ILE A C   1 
ATOM   4007 O  O   . ILE A 1 457 ? 42.775 78.538 -21.134 1.00 11.21 ? 454  ILE A O   1 
ATOM   4008 C  CB  . ILE A 1 457 ? 40.294 76.845 -20.529 1.00 12.19 ? 454  ILE A CB  1 
ATOM   4009 C  CG1 . ILE A 1 457 ? 38.747 76.620 -20.459 1.00 14.39 ? 454  ILE A CG1 1 
ATOM   4010 C  CG2 . ILE A 1 457 ? 41.024 75.883 -19.493 1.00 12.33 ? 454  ILE A CG2 1 
ATOM   4011 C  CD1 . ILE A 1 457 ? 38.318 75.311 -20.973 1.00 18.45 ? 454  ILE A CD1 1 
ATOM   4012 N  N   . PRO A 1 458 ? 42.516 79.233 -18.991 1.00 12.36 ? 455  PRO A N   1 
ATOM   4013 C  CA  . PRO A 1 458 ? 43.887 79.812 -19.022 1.00 13.05 ? 455  PRO A CA  1 
ATOM   4014 C  C   . PRO A 1 458 ? 44.982 78.791 -19.348 1.00 11.29 ? 455  PRO A C   1 
ATOM   4015 O  O   . PRO A 1 458 ? 45.950 79.109 -20.073 1.00 12.85 ? 455  PRO A O   1 
ATOM   4016 C  CB  . PRO A 1 458 ? 44.088 80.410 -17.617 1.00 14.35 ? 455  PRO A CB  1 
ATOM   4017 C  CG  . PRO A 1 458 ? 43.083 79.812 -16.812 1.00 15.97 ? 455  PRO A CG  1 
ATOM   4018 C  CD  . PRO A 1 458 ? 41.868 79.433 -17.681 1.00 14.16 ? 455  PRO A CD  1 
ATOM   4019 N  N   . GLY A 1 459 ? 44.862 77.559 -18.843 1.00 10.25 ? 456  GLY A N   1 
ATOM   4020 C  CA  . GLY A 1 459 ? 45.899 76.565 -19.097 1.00 10.08 ? 456  GLY A CA  1 
ATOM   4021 C  C   . GLY A 1 459 ? 47.183 76.925 -18.357 1.00 9.79  ? 456  GLY A C   1 
ATOM   4022 O  O   . GLY A 1 459 ? 47.236 77.766 -17.445 1.00 10.62 ? 456  GLY A O   1 
ATOM   4023 N  N   . ASN A 1 460 ? 48.244 76.258 -18.769 1.00 9.39  ? 457  ASN A N   1 
ATOM   4024 C  CA  . ASN A 1 460 ? 49.532 76.337 -18.109 1.00 9.28  ? 457  ASN A CA  1 
ATOM   4025 C  C   . ASN A 1 460 ? 49.485 75.860 -16.644 1.00 10.00 ? 457  ASN A C   1 
ATOM   4026 O  O   . ASN A 1 460 ? 50.238 76.358 -15.806 1.00 11.41 ? 457  ASN A O   1 
ATOM   4027 C  CB  . ASN A 1 460 ? 50.156 77.720 -18.172 1.00 10.73 ? 457  ASN A CB  1 
ATOM   4028 C  CG  . ASN A 1 460 ? 51.704 77.648 -18.210 1.00 10.16 ? 457  ASN A CG  1 
ATOM   4029 O  OD1 . ASN A 1 460 ? 52.251 76.747 -18.847 1.00 12.60 ? 457  ASN A OD1 1 
ATOM   4030 N  ND2 . ASN A 1 460 ? 52.397 78.553 -17.486 1.00 12.05 ? 457  ASN A ND2 1 
ATOM   4031 N  N   . ARG A 1 461 ? 48.569 74.931 -16.357 1.00 10.54 ? 458  ARG A N   1 
ATOM   4032 C  CA  . ARG A 1 461 ? 48.377 74.402 -15.030 1.00 10.33 ? 458  ARG A CA  1 
ATOM   4033 C  C   . ARG A 1 461 ? 49.021 73.013 -14.931 1.00 10.62 ? 458  ARG A C   1 
ATOM   4034 O  O   . ARG A 1 461 ? 48.876 72.220 -15.851 1.00 11.46 ? 458  ARG A O   1 
ATOM   4035 C  CB  . ARG A 1 461 ? 46.900 74.365 -14.678 1.00 10.34 ? 458  ARG A CB  1 
ATOM   4036 C  CG  . ARG A 1 461 ? 46.307 75.764 -14.599 1.00 10.78 ? 458  ARG A CG  1 
ATOM   4037 C  CD  . ARG A 1 461 ? 44.904 75.872 -14.138 1.00 10.20 ? 458  ARG A CD  1 
ATOM   4038 N  NE  . ARG A 1 461 ? 44.532 77.291 -14.064 1.00 11.31 ? 458  ARG A NE  1 
ATOM   4039 C  CZ  . ARG A 1 461 ? 43.502 77.814 -13.424 1.00 11.95 ? 458  ARG A CZ  1 
ATOM   4040 N  NH1 . ARG A 1 461 ? 42.619 77.052 -12.832 1.00 12.49 ? 458  ARG A NH1 1 
ATOM   4041 N  NH2 . ARG A 1 461 ? 43.378 79.127 -13.365 1.00 13.34 ? 458  ARG A NH2 1 
ATOM   4042 N  N   . PRO A 1 462 ? 49.768 72.754 -13.842 1.00 10.22 ? 459  PRO A N   1 
ATOM   4043 C  CA  . PRO A 1 462 ? 50.612 71.582 -13.722 1.00 10.68 ? 459  PRO A CA  1 
ATOM   4044 C  C   . PRO A 1 462 ? 49.851 70.303 -13.352 1.00 10.31 ? 459  PRO A C   1 
ATOM   4045 O  O   . PRO A 1 462 ? 48.812 70.315 -12.681 1.00 10.94 ? 459  PRO A O   1 
ATOM   4046 C  CB  . PRO A 1 462 ? 51.547 71.958 -12.604 1.00 11.21 ? 459  PRO A CB  1 
ATOM   4047 C  CG  . PRO A 1 462 ? 50.688 72.789 -11.685 1.00 11.62 ? 459  PRO A CG  1 
ATOM   4048 C  CD  . PRO A 1 462 ? 49.917 73.646 -12.680 1.00 10.47 ? 459  PRO A CD  1 
ATOM   4049 N  N   . SER A 1 463 ? 50.459 69.191 -13.726 1.00 9.56  ? 460  SER A N   1 
ATOM   4050 C  CA  . SER A 1 463 ? 50.054 67.885 -13.252 1.00 9.73  ? 460  SER A CA  1 
ATOM   4051 C  C   . SER A 1 463 ? 51.201 66.896 -13.356 1.00 9.58  ? 460  SER A C   1 
ATOM   4052 O  O   . SER A 1 463 ? 52.139 67.082 -14.119 1.00 9.60  ? 460  SER A O   1 
ATOM   4053 C  CB  . SER A 1 463 ? 48.854 67.385 -14.080 1.00 10.09 ? 460  SER A CB  1 
ATOM   4054 O  OG  . SER A 1 463 ? 49.180 67.175 -15.453 1.00 11.21 ? 460  SER A OG  1 
ATOM   4055 N  N   . THR A 1 464 ? 51.046 65.827 -12.580 1.00 8.90  ? 461  THR A N   1 
ATOM   4056 C  CA  . THR A 1 464 ? 51.826 64.602 -12.607 1.00 9.70  ? 461  THR A CA  1 
ATOM   4057 C  C   . THR A 1 464 ? 50.905 63.460 -12.942 1.00 8.85  ? 461  THR A C   1 
ATOM   4058 O  O   . THR A 1 464 ? 49.766 63.457 -12.446 1.00 10.19 ? 461  THR A O   1 
ATOM   4059 C  CB  . THR A 1 464 ? 52.485 64.358 -11.257 1.00 10.44 ? 461  THR A CB  1 
ATOM   4060 O  OG1 . THR A 1 464 ? 53.350 65.434 -10.954 1.00 11.95 ? 461  THR A OG1 1 
ATOM   4061 C  CG2 . THR A 1 464 ? 53.249 62.975 -11.205 1.00 12.52 ? 461  THR A CG2 1 
ATOM   4062 N  N   . THR A 1 465 ? 51.328 62.517 -13.781 1.00 9.59  ? 462  THR A N   1 
ATOM   4063 C  CA  . THR A 1 465 ? 50.553 61.292 -14.016 1.00 9.14  ? 462  THR A CA  1 
ATOM   4064 C  C   . THR A 1 465 ? 51.388 60.107 -13.575 1.00 9.12  ? 462  THR A C   1 
ATOM   4065 O  O   . THR A 1 465 ? 52.551 59.953 -14.039 1.00 10.97 ? 462  THR A O   1 
ATOM   4066 C  CB  . THR A 1 465 ? 50.085 61.161 -15.453 1.00 9.96  ? 462  THR A CB  1 
ATOM   4067 O  OG1 . THR A 1 465 ? 49.255 62.298 -15.785 1.00 10.45 ? 462  THR A OG1 1 
ATOM   4068 C  CG2 . THR A 1 465 ? 49.298 59.843 -15.680 1.00 11.34 ? 462  THR A CG2 1 
ATOM   4069 N  N   . ILE A 1 466 ? 50.835 59.315 -12.671 1.00 9.73  ? 463  ILE A N   1 
ATOM   4070 C  CA  . ILE A 1 466 ? 51.422 58.053 -12.243 1.00 10.17 ? 463  ILE A CA  1 
ATOM   4071 C  C   . ILE A 1 466 ? 50.634 56.925 -12.879 1.00 10.16 ? 463  ILE A C   1 
ATOM   4072 O  O   . ILE A 1 466 ? 49.455 56.797 -12.597 1.00 11.89 ? 463  ILE A O   1 
ATOM   4073 C  CB  . ILE A 1 466 ? 51.450 57.907 -10.693 1.00 11.07 ? 463  ILE A CB  1 
ATOM   4074 C  CG1 . ILE A 1 466 ? 52.080 59.168 -10.039 1.00 13.60 ? 463  ILE A CG1 1 
ATOM   4075 C  CG2 . ILE A 1 466 ? 52.103 56.592 -10.300 1.00 14.07 ? 463  ILE A CG2 1 
ATOM   4076 C  CD1 . ILE A 1 466 ? 52.199 59.150 -8.523  1.00 16.20 ? 463  ILE A CD1 1 
ATOM   4077 N  N   . LEU A 1 467 ? 51.281 56.161 -13.748 1.00 9.79  ? 464  LEU A N   1 
ATOM   4078 C  CA  . LEU A 1 467 ? 50.657 55.079 -14.494 1.00 10.10 ? 464  LEU A CA  1 
ATOM   4079 C  C   . LEU A 1 467 ? 51.166 53.732 -13.976 1.00 10.30 ? 464  LEU A C   1 
ATOM   4080 O  O   . LEU A 1 467 ? 52.357 53.429 -14.058 1.00 11.41 ? 464  LEU A O   1 
ATOM   4081 C  CB  . LEU A 1 467 ? 50.931 55.170 -16.005 1.00 10.23 ? 464  LEU A CB  1 
ATOM   4082 C  CG  . LEU A 1 467 ? 50.376 54.079 -16.929 1.00 11.00 ? 464  LEU A CG  1 
ATOM   4083 C  CD1 . LEU A 1 467 ? 48.849 54.116 -16.958 1.00 12.60 ? 464  LEU A CD1 1 
ATOM   4084 C  CD2 . LEU A 1 467 ? 50.978 54.263 -18.335 1.00 12.63 ? 464  LEU A CD2 1 
ATOM   4085 N  N   . LEU A 1 468 ? 50.224 52.919 -13.483 1.00 9.91  ? 465  LEU A N   1 
ATOM   4086 C  CA  . LEU A 1 468 ? 50.488 51.547 -13.105 1.00 10.81 ? 465  LEU A CA  1 
ATOM   4087 C  C   . LEU A 1 468 ? 50.094 50.616 -14.227 1.00 10.95 ? 465  LEU A C   1 
ATOM   4088 O  O   . LEU A 1 468 ? 49.130 50.907 -14.928 1.00 11.55 ? 465  LEU A O   1 
ATOM   4089 C  CB  . LEU A 1 468 ? 49.701 51.177 -11.852 1.00 10.25 ? 465  LEU A CB  1 
ATOM   4090 C  CG  . LEU A 1 468 ? 50.193 51.594 -10.466 1.00 11.39 ? 465  LEU A CG  1 
ATOM   4091 C  CD1 . LEU A 1 468 ? 50.527 53.071 -10.415 1.00 12.93 ? 465  LEU A CD1 1 
ATOM   4092 C  CD2 . LEU A 1 468 ? 49.247 51.167 -9.350  1.00 12.12 ? 465  LEU A CD2 1 
ATOM   4093 N  N   . ASP A 1 469 ? 50.780 49.476 -14.390 1.00 11.02 ? 466  ASP A N   1 
ATOM   4094 C  CA  . ASP A 1 469 ? 50.363 48.509 -15.399 1.00 9.99  ? 466  ASP A CA  1 
ATOM   4095 C  C   . ASP A 1 469 ? 49.000 47.893 -15.087 1.00 9.32  ? 466  ASP A C   1 
ATOM   4096 O  O   . ASP A 1 469 ? 48.185 47.662 -15.996 1.00 10.77 ? 466  ASP A O   1 
ATOM   4097 C  CB  . ASP A 1 469 ? 51.446 47.435 -15.606 1.00 12.10 ? 466  ASP A CB  1 
ATOM   4098 C  CG  . ASP A 1 469 ? 51.767 46.609 -14.365 1.00 15.56 ? 466  ASP A CG  1 
ATOM   4099 O  OD1 . ASP A 1 469 ? 51.631 47.020 -13.184 1.00 16.75 ? 466  ASP A OD1 1 
ATOM   4100 O  OD2 . ASP A 1 469 ? 52.233 45.445 -14.632 1.00 21.97 ? 466  ASP A OD2 1 
ATOM   4101 N  N   . GLU A 1 470 ? 48.783 47.610 -13.811 1.00 10.19 ? 467  GLU A N   1 
ATOM   4102 C  CA  . GLU A 1 470 ? 47.568 47.028 -13.310 1.00 10.66 ? 467  GLU A CA  1 
ATOM   4103 C  C   . GLU A 1 470 ? 47.465 47.378 -11.842 1.00 10.26 ? 467  GLU A C   1 
ATOM   4104 O  O   . GLU A 1 470 ? 48.477 47.803 -11.260 1.00 11.30 ? 467  GLU A O   1 
ATOM   4105 C  CB  . GLU A 1 470 ? 47.550 45.486 -13.491 1.00 12.07 ? 467  GLU A CB  1 
ATOM   4106 C  CG  . GLU A 1 470 ? 48.602 44.761 -12.737 1.00 14.88 ? 467  GLU A CG  1 
ATOM   4107 C  CD  . GLU A 1 470 ? 48.624 43.239 -12.958 1.00 19.81 ? 467  GLU A CD  1 
ATOM   4108 O  OE1 . GLU A 1 470 ? 48.171 42.758 -14.011 1.00 24.88 ? 467  GLU A OE1 1 
ATOM   4109 O  OE2 . GLU A 1 470 ? 49.154 42.530 -12.073 1.00 23.37 ? 467  GLU A OE2 1 
ATOM   4110 N  N   . LEU A 1 471 ? 46.289 47.159 -11.260 1.00 10.15 ? 468  LEU A N   1 
ATOM   4111 C  CA  . LEU A 1 471 ? 46.064 47.400 -9.824  1.00 9.81  ? 468  LEU A CA  1 
ATOM   4112 C  C   . LEU A 1 471 ? 45.983 46.047 -9.081  1.00 9.90  ? 468  LEU A C   1 
ATOM   4113 O  O   . LEU A 1 471 ? 44.924 45.419 -9.048  1.00 11.72 ? 468  LEU A O   1 
ATOM   4114 C  CB  . LEU A 1 471 ? 44.836 48.283 -9.552  1.00 10.22 ? 468  LEU A CB  1 
ATOM   4115 C  CG  . LEU A 1 471 ? 44.636 48.721 -8.088  1.00 9.98  ? 468  LEU A CG  1 
ATOM   4116 C  CD1 . LEU A 1 471 ? 45.778 49.611 -7.582  1.00 12.05 ? 468  LEU A CD1 1 
ATOM   4117 C  CD2 . LEU A 1 471 ? 43.276 49.386 -7.927  1.00 11.64 ? 468  LEU A CD2 1 
ATOM   4118 N  N   . SER A 1 472 ? 47.139 45.547 -8.684  1.00 9.59  ? 469  SER A N   1 
ATOM   4119 C  CA  . SER A 1 472 ? 47.303 44.255 -8.035  1.00 9.29  ? 469  SER A CA  1 
ATOM   4120 C  C   . SER A 1 472 ? 47.741 44.487 -6.594  1.00 9.66  ? 469  SER A C   1 
ATOM   4121 O  O   . SER A 1 472 ? 48.080 45.626 -6.216  1.00 9.57  ? 469  SER A O   1 
ATOM   4122 C  CB  . SER A 1 472 ? 48.414 43.477 -8.778  1.00 10.19 ? 469  SER A CB  1 
ATOM   4123 O  OG  . SER A 1 472 ? 49.659 44.203 -8.676  1.00 11.45 ? 469  SER A OG  1 
ATOM   4124 N  N   . PRO A 1 473 ? 47.736 43.429 -5.788  1.00 9.34  ? 470  PRO A N   1 
ATOM   4125 C  CA  . PRO A 1 473 ? 48.272 43.620 -4.436  1.00 9.29  ? 470  PRO A CA  1 
ATOM   4126 C  C   . PRO A 1 473 ? 49.669 44.265 -4.464  1.00 9.37  ? 470  PRO A C   1 
ATOM   4127 O  O   . PRO A 1 473 ? 49.930 45.220 -3.739  1.00 9.67  ? 470  PRO A O   1 
ATOM   4128 C  CB  . PRO A 1 473 ? 48.273 42.186 -3.874  1.00 10.30 ? 470  PRO A CB  1 
ATOM   4129 C  CG  . PRO A 1 473 ? 47.090 41.546 -4.590  1.00 9.40  ? 470  PRO A CG  1 
ATOM   4130 C  CD  . PRO A 1 473 ? 47.162 42.076 -5.964  1.00 9.27  ? 470  PRO A CD  1 
ATOM   4131 N  N   . TYR A 1 474 ? 50.551 43.772 -5.320  1.00 9.76  ? 471  TYR A N   1 
ATOM   4132 C  CA  . TYR A 1 474 ? 51.922 44.281 -5.383  1.00 9.03  ? 471  TYR A CA  1 
ATOM   4133 C  C   . TYR A 1 474 ? 51.965 45.731 -5.822  1.00 9.10  ? 471  TYR A C   1 
ATOM   4134 O  O   . TYR A 1 474 ? 52.651 46.544 -5.224  1.00 10.06 ? 471  TYR A O   1 
ATOM   4135 C  CB  . TYR A 1 474 ? 52.725 43.388 -6.304  1.00 9.68  ? 471  TYR A CB  1 
ATOM   4136 C  CG  . TYR A 1 474 ? 54.207 43.676 -6.419  1.00 9.79  ? 471  TYR A CG  1 
ATOM   4137 C  CD1 . TYR A 1 474 ? 55.123 42.975 -5.656  1.00 9.67  ? 471  TYR A CD1 1 
ATOM   4138 C  CD2 . TYR A 1 474 ? 54.699 44.651 -7.274  1.00 10.88 ? 471  TYR A CD2 1 
ATOM   4139 C  CE1 . TYR A 1 474 ? 56.484 43.187 -5.817  1.00 9.59  ? 471  TYR A CE1 1 
ATOM   4140 C  CE2 . TYR A 1 474 ? 56.062 44.888 -7.410  1.00 11.68 ? 471  TYR A CE2 1 
ATOM   4141 C  CZ  . TYR A 1 474 ? 56.941 44.177 -6.651  1.00 10.69 ? 471  TYR A CZ  1 
ATOM   4142 O  OH  . TYR A 1 474 ? 58.310 44.366 -6.810  1.00 13.67 ? 471  TYR A OH  1 
ATOM   4143 N  N   . SER A 1 475 ? 51.253 46.073 -6.904  1.00 8.86  ? 472  SER A N   1 
ATOM   4144 C  CA  . SER A 1 475 ? 51.338 47.444 -7.392  1.00 8.96  ? 472  SER A CA  1 
ATOM   4145 C  C   . SER A 1 475 ? 50.699 48.445 -6.421  1.00 9.03  ? 472  SER A C   1 
ATOM   4146 O  O   . SER A 1 475 ? 51.157 49.575 -6.316  1.00 10.31 ? 472  SER A O   1 
ATOM   4147 C  CB  . SER A 1 475 ? 50.800 47.601 -8.792  1.00 9.30  ? 472  SER A CB  1 
ATOM   4148 O  OG  . SER A 1 475 ? 49.390 47.505 -8.807  1.00 11.30 ? 472  SER A OG  1 
ATOM   4149 N  N   . LEU A 1 476 ? 49.649 48.038 -5.736  1.00 9.20  ? 473  LEU A N   1 
ATOM   4150 C  CA  . LEU A 1 476 ? 49.021 48.916 -4.746  1.00 9.51  ? 473  LEU A CA  1 
ATOM   4151 C  C   . LEU A 1 476 ? 49.997 49.152 -3.607  1.00 9.17  ? 473  LEU A C   1 
ATOM   4152 O  O   . LEU A 1 476 ? 50.121 50.270 -3.073  1.00 9.59  ? 473  LEU A O   1 
ATOM   4153 C  CB  . LEU A 1 476 ? 47.711 48.309 -4.244  1.00 9.77  ? 473  LEU A CB  1 
ATOM   4154 C  CG  . LEU A 1 476 ? 47.040 49.094 -3.104  1.00 9.92  ? 473  LEU A CG  1 
ATOM   4155 C  CD1 . LEU A 1 476 ? 46.633 50.501 -3.556  1.00 10.68 ? 473  LEU A CD1 1 
ATOM   4156 C  CD2 . LEU A 1 476 ? 45.816 48.301 -2.583  1.00 11.33 ? 473  LEU A CD2 1 
ATOM   4157 N  N   . GLY A 1 477 ? 50.698 48.096 -3.161  1.00 9.57  ? 474  GLY A N   1 
ATOM   4158 C  CA  . GLY A 1 477 ? 51.669 48.291 -2.098  1.00 9.32  ? 474  GLY A CA  1 
ATOM   4159 C  C   . GLY A 1 477 ? 52.763 49.281 -2.490  1.00 9.29  ? 474  GLY A C   1 
ATOM   4160 O  O   . GLY A 1 477 ? 53.137 50.141 -1.679  1.00 9.55  ? 474  GLY A O   1 
ATOM   4161 N  N   . ALA A 1 478 ? 53.246 49.186 -3.723  1.00 9.60  ? 475  ALA A N   1 
ATOM   4162 C  CA  . ALA A 1 478 ? 54.231 50.107 -4.239  1.00 8.47  ? 475  ALA A CA  1 
ATOM   4163 C  C   . ALA A 1 478 ? 53.674 51.537 -4.238  1.00 9.70  ? 475  ALA A C   1 
ATOM   4164 O  O   . ALA A 1 478 ? 54.347 52.482 -3.795  1.00 9.87  ? 475  ALA A O   1 
ATOM   4165 C  CB  . ALA A 1 478 ? 54.637 49.689 -5.642  1.00 10.19 ? 475  ALA A CB  1 
ATOM   4166 N  N   . LEU A 1 479 ? 52.444 51.715 -4.745  1.00 8.81  ? 476  LEU A N   1 
ATOM   4167 C  CA  . LEU A 1 479 ? 51.815 53.026 -4.808  1.00 9.33  ? 476  LEU A CA  1 
ATOM   4168 C  C   . LEU A 1 479 ? 51.713 53.707 -3.461  1.00 9.34  ? 476  LEU A C   1 
ATOM   4169 O  O   . LEU A 1 479 ? 52.044 54.903 -3.293  1.00 10.23 ? 476  LEU A O   1 
ATOM   4170 C  CB  . LEU A 1 479 ? 50.449 52.896 -5.516  1.00 8.98  ? 476  LEU A CB  1 
ATOM   4171 C  CG  . LEU A 1 479 ? 49.637 54.176 -5.644  1.00 11.06 ? 476  LEU A CG  1 
ATOM   4172 C  CD1 . LEU A 1 479 ? 50.398 55.200 -6.534  1.00 13.63 ? 476  LEU A CD1 1 
ATOM   4173 C  CD2 . LEU A 1 479 ? 48.223 53.869 -6.221  1.00 13.60 ? 476  LEU A CD2 1 
ATOM   4174 N  N   . ILE A 1 480 ? 51.211 52.957 -2.472  1.00 8.11  ? 477  ILE A N   1 
ATOM   4175 C  CA  . ILE A 1 480 ? 51.057 53.546 -1.127  1.00 8.93  ? 477  ILE A CA  1 
ATOM   4176 C  C   . ILE A 1 480 ? 52.445 53.962 -0.582  1.00 8.83  ? 477  ILE A C   1 
ATOM   4177 O  O   . ILE A 1 480 ? 52.602 55.041 -0.019  1.00 9.10  ? 477  ILE A O   1 
ATOM   4178 C  CB  . ILE A 1 480 ? 50.344 52.585 -0.133  1.00 9.66  ? 477  ILE A CB  1 
ATOM   4179 C  CG1 . ILE A 1 480 ? 48.955 52.154 -0.616  1.00 10.81 ? 477  ILE A CG1 1 
ATOM   4180 C  CG2 . ILE A 1 480 ? 50.273 53.203 1.250   1.00 10.63 ? 477  ILE A CG2 1 
ATOM   4181 C  CD1 . ILE A 1 480 ? 48.464 50.860 0.054   1.00 11.42 ? 477  ILE A CD1 1 
ATOM   4182 N  N   . ALA A 1 481 ? 53.426 53.080 -0.740  1.00 9.29  ? 478  ALA A N   1 
ATOM   4183 C  CA  . ALA A 1 481 ? 54.786 53.355 -0.232  1.00 9.30  ? 478  ALA A CA  1 
ATOM   4184 C  C   . ALA A 1 481 ? 55.390 54.606 -0.870  1.00 10.11 ? 478  ALA A C   1 
ATOM   4185 O  O   . ALA A 1 481 ? 56.112 55.356 -0.211  1.00 10.66 ? 478  ALA A O   1 
ATOM   4186 C  CB  . ALA A 1 481 ? 55.730 52.152 -0.375  1.00 10.10 ? 478  ALA A CB  1 
ATOM   4187 N  N   . LEU A 1 482 ? 55.111 54.845 -2.147  1.00 9.69  ? 479  LEU A N   1 
ATOM   4188 C  CA  . LEU A 1 482 ? 55.624 56.082 -2.793  1.00 9.90  ? 479  LEU A CA  1 
ATOM   4189 C  C   . LEU A 1 482 ? 55.164 57.325 -2.015  1.00 9.01  ? 479  LEU A C   1 
ATOM   4190 O  O   . LEU A 1 482 ? 55.940 58.210 -1.750  1.00 10.50 ? 479  LEU A O   1 
ATOM   4191 C  CB  . LEU A 1 482 ? 55.095 56.202 -4.229  1.00 9.81  ? 479  LEU A CB  1 
ATOM   4192 C  CG  . LEU A 1 482 ? 55.722 55.283 -5.289  1.00 10.53 ? 479  LEU A CG  1 
ATOM   4193 C  CD1 . LEU A 1 482 ? 54.987 55.394 -6.609  1.00 14.29 ? 479  LEU A CD1 1 
ATOM   4194 C  CD2 . LEU A 1 482 ? 57.260 55.514 -5.431  1.00 11.52 ? 479  LEU A CD2 1 
ATOM   4195 N  N   . TYR A 1 483 ? 53.865 57.360 -1.662  1.00 8.75  ? 480  TYR A N   1 
ATOM   4196 C  CA  . TYR A 1 483 ? 53.323 58.484 -0.893  1.00 9.15  ? 480  TYR A CA  1 
ATOM   4197 C  C   . TYR A 1 483 ? 53.817 58.505 0.531   1.00 9.17  ? 480  TYR A C   1 
ATOM   4198 O  O   . TYR A 1 483 ? 54.087 59.593 1.050   1.00 10.18 ? 480  TYR A O   1 
ATOM   4199 C  CB  . TYR A 1 483 ? 51.783 58.511 -0.978  1.00 10.60 ? 480  TYR A CB  1 
ATOM   4200 C  CG  . TYR A 1 483 ? 51.269 59.041 -2.307  1.00 9.43  ? 480  TYR A CG  1 
ATOM   4201 C  CD1 . TYR A 1 483 ? 51.117 60.399 -2.505  1.00 10.70 ? 480  TYR A CD1 1 
ATOM   4202 C  CD2 . TYR A 1 483 ? 50.964 58.196 -3.353  1.00 11.98 ? 480  TYR A CD2 1 
ATOM   4203 C  CE1 . TYR A 1 483 ? 50.704 60.929 -3.724  1.00 10.94 ? 480  TYR A CE1 1 
ATOM   4204 C  CE2 . TYR A 1 483 ? 50.557 58.682 -4.571  1.00 11.74 ? 480  TYR A CE2 1 
ATOM   4205 C  CZ  . TYR A 1 483 ? 50.433 60.055 -4.766  1.00 10.06 ? 480  TYR A CZ  1 
ATOM   4206 O  OH  . TYR A 1 483 ? 50.028 60.545 -5.979  1.00 12.52 ? 480  TYR A OH  1 
ATOM   4207 N  N   . GLU A 1 484 ? 53.990 57.347 1.170   1.00 8.77  ? 481  GLU A N   1 
ATOM   4208 C  CA  . GLU A 1 484 ? 54.586 57.349 2.522   1.00 9.39  ? 481  GLU A CA  1 
ATOM   4209 C  C   . GLU A 1 484 ? 55.928 58.067 2.509   1.00 8.99  ? 481  GLU A C   1 
ATOM   4210 O  O   . GLU A 1 484 ? 56.257 58.870 3.403   1.00 10.63 ? 481  GLU A O   1 
ATOM   4211 C  CB  . GLU A 1 484 ? 54.775 55.955 3.078   1.00 9.46  ? 481  GLU A CB  1 
ATOM   4212 C  CG  . GLU A 1 484 ? 53.447 55.249 3.406   1.00 10.01 ? 481  GLU A CG  1 
ATOM   4213 C  CD  . GLU A 1 484 ? 53.613 53.878 4.048   1.00 10.86 ? 481  GLU A CD  1 
ATOM   4214 O  OE1 . GLU A 1 484 ? 54.624 53.198 3.784   1.00 12.12 ? 481  GLU A OE1 1 
ATOM   4215 O  OE2 . GLU A 1 484 ? 52.663 53.446 4.742   1.00 10.76 ? 481  GLU A OE2 1 
ATOM   4216 N  N   . HIS A 1 485 ? 56.744 57.742 1.521   1.00 8.94  ? 482  HIS A N   1 
ATOM   4217 C  CA  . HIS A 1 485 ? 58.070 58.346 1.473   1.00 9.09  ? 482  HIS A CA  1 
ATOM   4218 C  C   . HIS A 1 485 ? 58.056 59.804 1.011   1.00 8.68  ? 482  HIS A C   1 
ATOM   4219 O  O   . HIS A 1 485 ? 58.877 60.601 1.482   1.00 9.23  ? 482  HIS A O   1 
ATOM   4220 C  CB  . HIS A 1 485 ? 59.058 57.496 0.670   1.00 10.03 ? 482  HIS A CB  1 
ATOM   4221 C  CG  . HIS A 1 485 ? 59.270 56.150 1.272   1.00 8.80  ? 482  HIS A CG  1 
ATOM   4222 N  ND1 . HIS A 1 485 ? 59.386 55.976 2.641   1.00 11.96 ? 482  HIS A ND1 1 
ATOM   4223 C  CD2 . HIS A 1 485 ? 59.408 54.931 0.714   1.00 11.00 ? 482  HIS A CD2 1 
ATOM   4224 C  CE1 . HIS A 1 485 ? 59.592 54.689 2.889   1.00 12.63 ? 482  HIS A CE1 1 
ATOM   4225 N  NE2 . HIS A 1 485 ? 59.614 54.034 1.733   1.00 10.51 ? 482  HIS A NE2 1 
ATOM   4226 N  N   . LYS A 1 486 ? 57.160 60.162 0.083   1.00 9.53  ? 483  LYS A N   1 
ATOM   4227 C  CA  . LYS A 1 486 ? 56.976 61.582 -0.236  1.00 9.52  ? 483  LYS A CA  1 
ATOM   4228 C  C   . LYS A 1 486 ? 56.751 62.407 1.049   1.00 9.31  ? 483  LYS A C   1 
ATOM   4229 O  O   . LYS A 1 486 ? 57.368 63.449 1.248   1.00 9.09  ? 483  LYS A O   1 
ATOM   4230 C  CB  . LYS A 1 486 ? 55.764 61.772 -1.155  1.00 9.34  ? 483  LYS A CB  1 
ATOM   4231 C  CG  . LYS A 1 486 ? 55.390 63.241 -1.428  1.00 10.02 ? 483  LYS A CG  1 
ATOM   4232 C  CD  . LYS A 1 486 ? 53.980 63.432 -2.018  1.00 9.93  ? 483  LYS A CD  1 
ATOM   4233 C  CE  . LYS A 1 486 ? 53.687 64.862 -2.328  1.00 11.23 ? 483  LYS A CE  1 
ATOM   4234 N  NZ  . LYS A 1 486 ? 52.277 65.052 -2.818  1.00 12.85 ? 483  LYS A NZ  1 
ATOM   4235 N  N   . ILE A 1 487 ? 55.856 61.912 1.901   1.00 8.31  ? 484  ILE A N   1 
ATOM   4236 C  CA  . ILE A 1 487 ? 55.456 62.612 3.131   1.00 8.63  ? 484  ILE A CA  1 
ATOM   4237 C  C   . ILE A 1 487 ? 56.681 62.752 4.067   1.00 9.34  ? 484  ILE A C   1 
ATOM   4238 O  O   . ILE A 1 487 ? 56.912 63.817 4.647   1.00 9.83  ? 484  ILE A O   1 
ATOM   4239 C  CB  . ILE A 1 487 ? 54.286 61.900 3.804   1.00 8.68  ? 484  ILE A CB  1 
ATOM   4240 C  CG1 . ILE A 1 487 ? 53.034 62.023 2.968   1.00 10.42 ? 484  ILE A CG1 1 
ATOM   4241 C  CG2 . ILE A 1 487 ? 54.046 62.360 5.255   1.00 10.32 ? 484  ILE A CG2 1 
ATOM   4242 C  CD1 . ILE A 1 487 ? 51.993 60.907 3.280   1.00 12.85 ? 484  ILE A CD1 1 
ATOM   4243 N  N   . PHE A 1 488 ? 57.465 61.685 4.183   1.00 9.39  ? 485  PHE A N   1 
ATOM   4244 C  CA  . PHE A 1 488 ? 58.703 61.697 4.965   1.00 9.04  ? 485  PHE A CA  1 
ATOM   4245 C  C   . PHE A 1 488 ? 59.651 62.777 4.428   1.00 9.05  ? 485  PHE A C   1 
ATOM   4246 O  O   . PHE A 1 488 ? 60.183 63.572 5.198   1.00 9.89  ? 485  PHE A O   1 
ATOM   4247 C  CB  . PHE A 1 488 ? 59.351 60.335 4.871   1.00 9.15  ? 485  PHE A CB  1 
ATOM   4248 C  CG  . PHE A 1 488 ? 60.714 60.212 5.490   1.00 10.85 ? 485  PHE A CG  1 
ATOM   4249 C  CD1 . PHE A 1 488 ? 61.003 60.625 6.767   1.00 12.73 ? 485  PHE A CD1 1 
ATOM   4250 C  CD2 . PHE A 1 488 ? 61.695 59.635 4.778   1.00 16.19 ? 485  PHE A CD2 1 
ATOM   4251 C  CE1 . PHE A 1 488 ? 62.271 60.503 7.287   1.00 12.91 ? 485  PHE A CE1 1 
ATOM   4252 C  CE2 . PHE A 1 488 ? 62.994 59.471 5.327   1.00 18.04 ? 485  PHE A CE2 1 
ATOM   4253 C  CZ  . PHE A 1 488 ? 63.253 59.909 6.583   1.00 14.15 ? 485  PHE A CZ  1 
ATOM   4254 N  N   . VAL A 1 489 ? 59.893 62.787 3.118   1.00 9.07  ? 486  VAL A N   1 
ATOM   4255 C  CA  . VAL A 1 489 ? 60.829 63.762 2.550   1.00 8.77  ? 486  VAL A CA  1 
ATOM   4256 C  C   . VAL A 1 489 ? 60.347 65.212 2.861   1.00 9.68  ? 486  VAL A C   1 
ATOM   4257 O  O   . VAL A 1 489 ? 61.141 66.079 3.230   1.00 9.10  ? 486  VAL A O   1 
ATOM   4258 C  CB  . VAL A 1 489 ? 61.046 63.541 1.047   1.00 9.72  ? 486  VAL A CB  1 
ATOM   4259 C  CG1 . VAL A 1 489 ? 61.881 64.701 0.440   1.00 10.66 ? 486  VAL A CG1 1 
ATOM   4260 C  CG2 . VAL A 1 489 ? 61.651 62.159 0.744   1.00 9.56  ? 486  VAL A CG2 1 
ATOM   4261 N  N   . GLN A 1 490 ? 59.058 65.478 2.656   1.00 9.21  ? 487  GLN A N   1 
ATOM   4262 C  CA  . GLN A 1 490 ? 58.578 66.797 2.910   1.00 9.16  ? 487  GLN A CA  1 
ATOM   4263 C  C   . GLN A 1 490 ? 58.800 67.218 4.364   1.00 9.55  ? 487  GLN A C   1 
ATOM   4264 O  O   . GLN A 1 490 ? 59.181 68.375 4.638   1.00 10.27 ? 487  GLN A O   1 
ATOM   4265 C  CB  . GLN A 1 490 ? 57.101 66.914 2.544   1.00 9.47  ? 487  GLN A CB  1 
ATOM   4266 C  CG  . GLN A 1 490 ? 56.824 66.869 1.054   1.00 10.31 ? 487  GLN A CG  1 
ATOM   4267 C  CD  . GLN A 1 490 ? 55.409 67.306 0.766   1.00 11.88 ? 487  GLN A CD  1 
ATOM   4268 O  OE1 . GLN A 1 490 ? 55.169 68.501 0.380   1.00 14.42 ? 487  GLN A OE1 1 
ATOM   4269 N  NE2 . GLN A 1 490 ? 54.472 66.419 1.018   1.00 8.88  ? 487  GLN A NE2 1 
ATOM   4270 N  N   . GLY A 1 491 ? 58.531 66.328 5.314   1.00 8.93  ? 488  GLY A N   1 
ATOM   4271 C  CA  . GLY A 1 491 ? 58.745 66.648 6.720   1.00 9.25  ? 488  GLY A CA  1 
ATOM   4272 C  C   . GLY A 1 491 ? 60.199 66.912 7.050   1.00 8.70  ? 488  GLY A C   1 
ATOM   4273 O  O   . GLY A 1 491 ? 60.491 67.850 7.797   1.00 10.61 ? 488  GLY A O   1 
ATOM   4274 N  N   . VAL A 1 492 ? 61.113 66.161 6.443   1.00 10.61 ? 489  VAL A N   1 
ATOM   4275 C  CA  . VAL A 1 492 ? 62.556 66.401 6.618   1.00 10.58 ? 489  VAL A CA  1 
ATOM   4276 C  C   . VAL A 1 492 ? 62.924 67.787 6.085   1.00 10.53 ? 489  VAL A C   1 
ATOM   4277 O  O   . VAL A 1 492 ? 63.606 68.573 6.758   1.00 10.62 ? 489  VAL A O   1 
ATOM   4278 C  CB  . VAL A 1 492 ? 63.403 65.304 5.938   1.00 11.14 ? 489  VAL A CB  1 
ATOM   4279 C  CG1 . VAL A 1 492 ? 64.901 65.709 5.922   1.00 12.96 ? 489  VAL A CG1 1 
ATOM   4280 C  CG2 . VAL A 1 492 ? 63.267 63.902 6.672   1.00 11.77 ? 489  VAL A CG2 1 
ATOM   4281 N  N   . LEU A 1 493 ? 62.459 68.106 4.871   1.00 9.79  ? 490  LEU A N   1 
ATOM   4282 C  CA  . LEU A 1 493 ? 62.821 69.414 4.278   1.00 10.51 ? 490  LEU A CA  1 
ATOM   4283 C  C   . LEU A 1 493 ? 62.265 70.569 5.120   1.00 9.78  ? 490  LEU A C   1 
ATOM   4284 O  O   . LEU A 1 493 ? 62.935 71.618 5.214   1.00 10.13 ? 490  LEU A O   1 
ATOM   4285 C  CB  . LEU A 1 493 ? 62.381 69.508 2.836   1.00 12.31 ? 490  LEU A CB  1 
ATOM   4286 C  CG  . LEU A 1 493 ? 63.097 68.535 1.885   1.00 12.74 ? 490  LEU A CG  1 
ATOM   4287 C  CD1 . LEU A 1 493 ? 62.462 68.488 0.486   1.00 14.34 ? 490  LEU A CD1 1 
ATOM   4288 C  CD2 . LEU A 1 493 ? 64.621 68.773 1.823   1.00 16.37 ? 490  LEU A CD2 1 
ATOM   4289 N  N   . TRP A 1 494 ? 61.094 70.380 5.737   1.00 9.53  ? 491  TRP A N   1 
ATOM   4290 C  CA  . TRP A 1 494 ? 60.499 71.397 6.587   1.00 9.53  ? 491  TRP A CA  1 
ATOM   4291 C  C   . TRP A 1 494 ? 60.974 71.354 8.038   1.00 9.67  ? 491  TRP A C   1 
ATOM   4292 O  O   . TRP A 1 494 ? 60.586 72.195 8.834   1.00 10.26 ? 491  TRP A O   1 
ATOM   4293 C  CB  . TRP A 1 494 ? 58.964 71.241 6.600   1.00 10.23 ? 491  TRP A CB  1 
ATOM   4294 C  CG  . TRP A 1 494 ? 58.260 71.665 5.350   1.00 10.63 ? 491  TRP A CG  1 
ATOM   4295 C  CD1 . TRP A 1 494 ? 58.589 72.691 4.525   1.00 11.60 ? 491  TRP A CD1 1 
ATOM   4296 C  CD2 . TRP A 1 494 ? 57.046 71.117 4.825   1.00 9.74  ? 491  TRP A CD2 1 
ATOM   4297 N  NE1 . TRP A 1 494 ? 57.704 72.778 3.491   1.00 10.26 ? 491  TRP A NE1 1 
ATOM   4298 C  CE2 . TRP A 1 494 ? 56.721 71.847 3.654   1.00 10.64 ? 491  TRP A CE2 1 
ATOM   4299 C  CE3 . TRP A 1 494 ? 56.192 70.085 5.236   1.00 8.89  ? 491  TRP A CE3 1 
ATOM   4300 C  CZ2 . TRP A 1 494 ? 55.593 71.544 2.863   1.00 10.68 ? 491  TRP A CZ2 1 
ATOM   4301 C  CZ3 . TRP A 1 494 ? 55.124 69.771 4.435   1.00 9.46  ? 491  TRP A CZ3 1 
ATOM   4302 C  CH2 . TRP A 1 494 ? 54.813 70.506 3.289   1.00 10.55 ? 491  TRP A CH2 1 
ATOM   4303 N  N   . ASP A 1 495 ? 61.850 70.412 8.379   1.00 9.59  ? 492  ASP A N   1 
ATOM   4304 C  CA  . ASP A 1 495 ? 62.392 70.294 9.720   1.00 10.06 ? 492  ASP A CA  1 
ATOM   4305 C  C   . ASP A 1 495 ? 61.347 70.099 10.810  1.00 9.62  ? 492  ASP A C   1 
ATOM   4306 O  O   . ASP A 1 495 ? 61.520 70.600 11.920  1.00 11.30 ? 492  ASP A O   1 
ATOM   4307 C  CB  . ASP A 1 495 ? 63.308 71.482 9.999   1.00 11.86 ? 492  ASP A CB  1 
ATOM   4308 C  CG  . ASP A 1 495 ? 64.194 71.318 11.217  1.00 13.40 ? 492  ASP A CG  1 
ATOM   4309 O  OD1 . ASP A 1 495 ? 64.651 70.201 11.446  1.00 17.43 ? 492  ASP A OD1 1 
ATOM   4310 O  OD2 . ASP A 1 495 ? 64.472 72.371 11.914  1.00 18.80 ? 492  ASP A OD2 1 
ATOM   4311 N  N   . ILE A 1 496 ? 60.287 69.335 10.478  1.00 9.93  ? 493  ILE A N   1 
ATOM   4312 C  CA  . ILE A 1 496 ? 59.229 68.973 11.412  1.00 9.52  ? 493  ILE A CA  1 
ATOM   4313 C  C   . ILE A 1 496 ? 59.303 67.491 11.749  1.00 9.48  ? 493  ILE A C   1 
ATOM   4314 O  O   . ILE A 1 496 ? 59.987 66.703 11.077  1.00 10.80 ? 493  ILE A O   1 
ATOM   4315 C  CB  . ILE A 1 496 ? 57.833 69.387 10.884  1.00 9.74  ? 493  ILE A CB  1 
ATOM   4316 C  CG1 . ILE A 1 496 ? 57.478 68.619 9.579   1.00 9.97  ? 493  ILE A CG1 1 
ATOM   4317 C  CG2 . ILE A 1 496 ? 57.787 70.945 10.772  1.00 11.72 ? 493  ILE A CG2 1 
ATOM   4318 C  CD1 . ILE A 1 496 ? 56.029 68.841 9.102   1.00 11.68 ? 493  ILE A CD1 1 
ATOM   4319 N  N   . ASN A 1 497 ? 58.529 67.092 12.764  1.00 9.98  ? 494  ASN A N   1 
ATOM   4320 C  CA  . ASN A 1 497 ? 58.379 65.684 13.141  1.00 9.47  ? 494  ASN A CA  1 
ATOM   4321 C  C   . ASN A 1 497 ? 57.091 65.166 12.497  1.00 9.68  ? 494  ASN A C   1 
ATOM   4322 O  O   . ASN A 1 497 ? 55.974 65.483 12.941  1.00 11.12 ? 494  ASN A O   1 
ATOM   4323 C  CB  . ASN A 1 497 ? 58.344 65.505 14.661  1.00 9.22  ? 494  ASN A CB  1 
ATOM   4324 C  CG  . ASN A 1 497 ? 58.241 64.031 15.072  1.00 9.56  ? 494  ASN A CG  1 
ATOM   4325 O  OD1 . ASN A 1 497 ? 58.421 63.124 14.223  1.00 12.60 ? 494  ASN A OD1 1 
ATOM   4326 N  ND2 . ASN A 1 497 ? 57.933 63.787 16.357  1.00 10.10 ? 494  ASN A ND2 1 
ATOM   4327 N  N   . SER A 1 498 ? 57.252 64.360 11.456  1.00 9.51  ? 495  SER A N   1 
ATOM   4328 C  CA  . SER A 1 498 ? 56.081 63.815 10.728  1.00 10.57 ? 495  SER A CA  1 
ATOM   4329 C  C   . SER A 1 498 ? 55.373 62.718 11.507  1.00 10.32 ? 495  SER A C   1 
ATOM   4330 O  O   . SER A 1 498 ? 54.359 62.229 11.036  1.00 11.31 ? 495  SER A O   1 
ATOM   4331 C  CB  . SER A 1 498 ? 56.514 63.268 9.376   1.00 11.18 ? 495  SER A CB  1 
ATOM   4332 O  OG  . SER A 1 498 ? 57.016 64.281 8.510   1.00 11.09 ? 495  SER A OG  1 
ATOM   4333 N  N   . TYR A 1 499 ? 55.932 62.277 12.652  1.00 10.00 ? 496  TYR A N   1 
ATOM   4334 C  CA  . TYR A 1 499 ? 55.520 60.994 13.251  1.00 9.12  ? 496  TYR A CA  1 
ATOM   4335 C  C   . TYR A 1 499 ? 54.799 61.074 14.578  1.00 9.71  ? 496  TYR A C   1 
ATOM   4336 O  O   . TYR A 1 499 ? 54.370 60.054 15.106  1.00 9.95  ? 496  TYR A O   1 
ATOM   4337 C  CB  . TYR A 1 499 ? 56.739 60.028 13.258  1.00 8.97  ? 496  TYR A CB  1 
ATOM   4338 C  CG  . TYR A 1 499 ? 57.201 59.816 11.845  1.00 10.45 ? 496  TYR A CG  1 
ATOM   4339 C  CD1 . TYR A 1 499 ? 56.403 59.144 10.926  1.00 10.16 ? 496  TYR A CD1 1 
ATOM   4340 C  CD2 . TYR A 1 499 ? 58.367 60.393 11.354  1.00 10.13 ? 496  TYR A CD2 1 
ATOM   4341 C  CE1 . TYR A 1 499 ? 56.706 59.087 9.601   1.00 11.28 ? 496  TYR A CE1 1 
ATOM   4342 C  CE2 . TYR A 1 499 ? 58.707 60.289 10.017  1.00 12.45 ? 496  TYR A CE2 1 
ATOM   4343 C  CZ  . TYR A 1 499 ? 57.861 59.669 9.122   1.00 11.05 ? 496  TYR A CZ  1 
ATOM   4344 O  OH  . TYR A 1 499 ? 58.179 59.619 7.786   1.00 13.63 ? 496  TYR A OH  1 
ATOM   4345 N  N   . ASP A 1 500 ? 54.615 62.295 15.080  1.00 9.76  ? 497  ASP A N   1 
ATOM   4346 C  CA  . ASP A 1 500 ? 53.780 62.560 16.254  1.00 9.00  ? 497  ASP A CA  1 
ATOM   4347 C  C   . ASP A 1 500 ? 52.404 63.131 15.822  1.00 9.02  ? 497  ASP A C   1 
ATOM   4348 O  O   . ASP A 1 500 ? 52.149 63.313 14.628  1.00 10.24 ? 497  ASP A O   1 
ATOM   4349 C  CB  . ASP A 1 500 ? 54.529 63.430 17.295  1.00 9.63  ? 497  ASP A CB  1 
ATOM   4350 C  CG  . ASP A 1 500 ? 54.865 64.811 16.808  1.00 9.42  ? 497  ASP A CG  1 
ATOM   4351 O  OD1 . ASP A 1 500 ? 54.250 65.279 15.793  1.00 10.46 ? 497  ASP A OD1 1 
ATOM   4352 O  OD2 . ASP A 1 500 ? 55.681 65.474 17.530  1.00 10.06 ? 497  ASP A OD2 1 
ATOM   4353 N  N   . GLN A 1 501 ? 51.517 63.327 16.795  1.00 10.44 ? 498  GLN A N   1 
ATOM   4354 C  CA  . GLN A 1 501 ? 50.175 63.886 16.531  1.00 10.08 ? 498  GLN A CA  1 
ATOM   4355 C  C   . GLN A 1 501 ? 49.576 64.429 17.813  1.00 10.65 ? 498  GLN A C   1 
ATOM   4356 O  O   . GLN A 1 501 ? 48.519 63.985 18.300  1.00 11.52 ? 498  GLN A O   1 
ATOM   4357 C  CB  . GLN A 1 501 ? 49.233 62.850 15.818  1.00 11.36 ? 498  GLN A CB  1 
ATOM   4358 C  CG  . GLN A 1 501 ? 49.047 61.515 16.563  1.00 12.50 ? 498  GLN A CG  1 
ATOM   4359 C  CD  . GLN A 1 501 ? 50.217 60.597 16.568  1.00 11.61 ? 498  GLN A CD  1 
ATOM   4360 O  OE1 . GLN A 1 501 ? 50.837 60.430 15.544  1.00 12.32 ? 498  GLN A OE1 1 
ATOM   4361 N  NE2 . GLN A 1 501 ? 50.553 59.984 17.743  1.00 14.20 ? 498  GLN A NE2 1 
ATOM   4362 N  N   . TRP A 1 502 ? 50.269 65.402 18.395  1.00 10.02 ? 499  TRP A N   1 
ATOM   4363 C  CA  . TRP A 1 502 ? 49.840 65.947 19.671  1.00 10.70 ? 499  TRP A CA  1 
ATOM   4364 C  C   . TRP A 1 502 ? 48.549 66.775 19.619  1.00 10.44 ? 499  TRP A C   1 
ATOM   4365 O  O   . TRP A 1 502 ? 47.901 67.002 20.649  1.00 12.50 ? 499  TRP A O   1 
ATOM   4366 C  CB  . TRP A 1 502 ? 50.966 66.791 20.263  1.00 10.79 ? 499  TRP A CB  1 
ATOM   4367 C  CG  . TRP A 1 502 ? 52.184 65.997 20.624  1.00 10.34 ? 499  TRP A CG  1 
ATOM   4368 C  CD1 . TRP A 1 502 ? 53.424 66.019 20.004  1.00 11.98 ? 499  TRP A CD1 1 
ATOM   4369 C  CD2 . TRP A 1 502 ? 52.274 65.018 21.656  1.00 11.11 ? 499  TRP A CD2 1 
ATOM   4370 N  NE1 . TRP A 1 502 ? 54.275 65.118 20.636  1.00 12.94 ? 499  TRP A NE1 1 
ATOM   4371 C  CE2 . TRP A 1 502 ? 53.601 64.507 21.651  1.00 12.78 ? 499  TRP A CE2 1 
ATOM   4372 C  CE3 . TRP A 1 502 ? 51.374 64.530 22.590  1.00 13.70 ? 499  TRP A CE3 1 
ATOM   4373 C  CZ2 . TRP A 1 502 ? 54.027 63.548 22.541  1.00 14.89 ? 499  TRP A CZ2 1 
ATOM   4374 C  CZ3 . TRP A 1 502 ? 51.821 63.585 23.487  1.00 18.20 ? 499  TRP A CZ3 1 
ATOM   4375 C  CH2 . TRP A 1 502 ? 53.120 63.087 23.434  1.00 17.67 ? 499  TRP A CH2 1 
ATOM   4376 N  N   . GLY A 1 503 ? 48.195 67.219 18.425  1.00 11.22 ? 500  GLY A N   1 
ATOM   4377 C  CA  . GLY A 1 503 ? 47.086 68.134 18.231  1.00 10.36 ? 500  GLY A CA  1 
ATOM   4378 C  C   . GLY A 1 503 ? 45.734 67.529 18.539  1.00 11.68 ? 500  GLY A C   1 
ATOM   4379 O  O   . GLY A 1 503 ? 44.783 68.270 18.741  1.00 13.48 ? 500  GLY A O   1 
ATOM   4380 N  N   . VAL A 1 504 ? 45.647 66.202 18.556  1.00 11.34 ? 501  VAL A N   1 
ATOM   4381 C  CA  . VAL A 1 504 ? 44.356 65.538 18.761  1.00 12.26 ? 501  VAL A CA  1 
ATOM   4382 C  C   . VAL A 1 504 ? 44.001 65.357 20.234  1.00 11.87 ? 501  VAL A C   1 
ATOM   4383 O  O   . VAL A 1 504 ? 42.863 65.015 20.587  1.00 13.10 ? 501  VAL A O   1 
ATOM   4384 C  CB  . VAL A 1 504 ? 44.332 64.155 18.020  1.00 11.94 ? 501  VAL A CB  1 
ATOM   4385 C  CG1 . VAL A 1 504 ? 44.607 64.360 16.483  1.00 15.94 ? 501  VAL A CG1 1 
ATOM   4386 C  CG2 . VAL A 1 504 ? 45.270 63.108 18.652  1.00 14.90 ? 501  VAL A CG2 1 
ATOM   4387 N  N   . GLU A 1 505 ? 44.960 65.557 21.135  1.00 12.27 ? 502  GLU A N   1 
ATOM   4388 C  CA  A GLU A 1 505 ? 44.773 65.283 22.567  0.70 13.69 ? 502  GLU A CA  1 
ATOM   4389 C  CA  B GLU A 1 505 ? 44.693 65.227 22.523  0.30 12.93 ? 502  GLU A CA  1 
ATOM   4390 C  C   . GLU A 1 505 ? 43.717 66.207 23.207  1.00 13.11 ? 502  GLU A C   1 
ATOM   4391 O  O   . GLU A 1 505 ? 42.913 65.792 24.033  1.00 12.98 ? 502  GLU A O   1 
ATOM   4392 C  CB  A GLU A 1 505 ? 46.107 65.498 23.314  0.70 15.63 ? 502  GLU A CB  1 
ATOM   4393 C  CB  B GLU A 1 505 ? 46.012 65.054 23.271  0.30 13.42 ? 502  GLU A CB  1 
ATOM   4394 C  CG  A GLU A 1 505 ? 47.260 64.505 23.072  0.70 18.90 ? 502  GLU A CG  1 
ATOM   4395 C  CG  B GLU A 1 505 ? 46.728 63.774 22.873  0.30 15.79 ? 502  GLU A CG  1 
ATOM   4396 C  CD  A GLU A 1 505 ? 48.214 64.366 24.312  0.70 22.61 ? 502  GLU A CD  1 
ATOM   4397 C  CD  B GLU A 1 505 ? 45.894 62.553 23.209  0.30 15.77 ? 502  GLU A CD  1 
ATOM   4398 O  OE1 A GLU A 1 505 ? 48.430 65.335 25.072  0.70 22.72 ? 502  GLU A OE1 1 
ATOM   4399 O  OE1 B GLU A 1 505 ? 45.482 62.416 24.390  0.30 20.26 ? 502  GLU A OE1 1 
ATOM   4400 O  OE2 A GLU A 1 505 ? 48.750 63.253 24.533  0.70 28.77 ? 502  GLU A OE2 1 
ATOM   4401 O  OE2 B GLU A 1 505 ? 45.648 61.729 22.307  0.30 17.00 ? 502  GLU A OE2 1 
ATOM   4402 N  N   . LEU A 1 506 ? 43.746 67.490 22.835  1.00 11.61 ? 503  LEU A N   1 
ATOM   4403 C  CA  . LEU A 1 506 ? 42.879 68.478 23.487  1.00 11.52 ? 503  LEU A CA  1 
ATOM   4404 C  C   . LEU A 1 506 ? 41.407 68.129 23.301  1.00 11.05 ? 503  LEU A C   1 
ATOM   4405 O  O   . LEU A 1 506 ? 40.633 68.127 24.243  1.00 10.92 ? 503  LEU A O   1 
ATOM   4406 C  CB  . LEU A 1 506 ? 43.168 69.882 23.013  1.00 11.84 ? 503  LEU A CB  1 
ATOM   4407 C  CG  . LEU A 1 506 ? 42.259 70.994 23.488  1.00 10.65 ? 503  LEU A CG  1 
ATOM   4408 C  CD1 . LEU A 1 506 ? 42.387 71.067 25.014  1.00 13.40 ? 503  LEU A CD1 1 
ATOM   4409 C  CD2 . LEU A 1 506 ? 42.629 72.295 22.800  1.00 12.93 ? 503  LEU A CD2 1 
ATOM   4410 N  N   . GLY A 1 507 ? 41.013 67.808 22.095  1.00 10.41 ? 504  GLY A N   1 
ATOM   4411 C  CA  . GLY A 1 507 ? 39.635 67.445 21.846  1.00 10.67 ? 504  GLY A CA  1 
ATOM   4412 C  C   . GLY A 1 507 ? 39.164 66.212 22.594  1.00 10.65 ? 504  GLY A C   1 
ATOM   4413 O  O   . GLY A 1 507 ? 38.003 66.146 22.973  1.00 10.54 ? 504  GLY A O   1 
ATOM   4414 N  N   . LYS A 1 508 ? 40.056 65.266 22.888  1.00 11.99 ? 505  LYS A N   1 
ATOM   4415 C  CA  . LYS A 1 508 ? 39.679 64.100 23.676  1.00 12.03 ? 505  LYS A CA  1 
ATOM   4416 C  C   . LYS A 1 508 ? 39.359 64.517 25.112  1.00 12.55 ? 505  LYS A C   1 
ATOM   4417 O  O   . LYS A 1 508 ? 38.413 64.070 25.721  1.00 12.42 ? 505  LYS A O   1 
ATOM   4418 C  CB  . LYS A 1 508 ? 40.766 63.020 23.638  1.00 12.61 ? 505  LYS A CB  1 
ATOM   4419 C  CG  . LYS A 1 508 ? 40.967 62.437 22.267  1.00 13.87 ? 505  LYS A CG  1 
ATOM   4420 C  CD  . LYS A 1 508 ? 42.177 61.529 22.219  1.00 15.60 ? 505  LYS A CD  1 
ATOM   4421 C  CE  . LYS A 1 508 ? 42.403 60.925 20.832  1.00 16.01 ? 505  LYS A CE  1 
ATOM   4422 N  NZ  . LYS A 1 508 ? 43.661 60.086 20.815  1.00 19.00 ? 505  LYS A NZ  1 
ATOM   4423 N  N   . LYS A 1 509 ? 40.195 65.384 25.664  1.00 12.40 ? 506  LYS A N   1 
ATOM   4424 C  CA  . LYS A 1 509 ? 40.006 65.903 27.008  1.00 13.27 ? 506  LYS A CA  1 
ATOM   4425 C  C   . LYS A 1 509 ? 38.722 66.711 27.118  1.00 12.45 ? 506  LYS A C   1 
ATOM   4426 O  O   . LYS A 1 509 ? 37.909 66.512 28.052  1.00 12.67 ? 506  LYS A O   1 
ATOM   4427 C  CB  . LYS A 1 509 ? 41.209 66.783 27.429  1.00 15.80 ? 506  LYS A CB  1 
ATOM   4428 C  CG  . LYS A 1 509 ? 41.055 67.367 28.812  1.00 19.51 ? 506  LYS A CG  1 
ATOM   4429 C  CD  . LYS A 1 509 ? 42.333 68.111 29.259  1.00 26.45 ? 506  LYS A CD  1 
ATOM   4430 C  CE  . LYS A 1 509 ? 42.471 69.448 28.561  1.00 29.08 ? 506  LYS A CE  1 
ATOM   4431 N  NZ  . LYS A 1 509 ? 43.808 70.078 28.797  1.00 32.87 ? 506  LYS A NZ  1 
ATOM   4432 N  N   . LEU A 1 510 ? 38.513 67.611 26.153  1.00 11.47 ? 507  LEU A N   1 
ATOM   4433 C  CA  . LEU A 1 510 ? 37.322 68.430 26.192  1.00 10.59 ? 507  LEU A CA  1 
ATOM   4434 C  C   . LEU A 1 510 ? 36.050 67.606 25.993  1.00 10.69 ? 507  LEU A C   1 
ATOM   4435 O  O   . LEU A 1 510 ? 35.018 67.932 26.582  1.00 12.09 ? 507  LEU A O   1 
ATOM   4436 C  CB  . LEU A 1 510 ? 37.404 69.562 25.178  1.00 10.89 ? 507  LEU A CB  1 
ATOM   4437 C  CG  . LEU A 1 510 ? 38.559 70.555 25.352  1.00 10.70 ? 507  LEU A CG  1 
ATOM   4438 C  CD1 . LEU A 1 510 ? 38.457 71.668 24.269  1.00 11.95 ? 507  LEU A CD1 1 
ATOM   4439 C  CD2 . LEU A 1 510 ? 38.607 71.073 26.788  1.00 11.97 ? 507  LEU A CD2 1 
ATOM   4440 N  N   . GLY A 1 511 ? 36.130 66.533 25.227  1.00 10.16 ? 508  GLY A N   1 
ATOM   4441 C  CA  . GLY A 1 511 ? 35.020 65.665 25.010  1.00 11.76 ? 508  GLY A CA  1 
ATOM   4442 C  C   . GLY A 1 511 ? 34.582 64.995 26.315  1.00 11.66 ? 508  GLY A C   1 
ATOM   4443 O  O   . GLY A 1 511 ? 33.381 64.851 26.574  1.00 12.47 ? 508  GLY A O   1 
ATOM   4444 N  N   . LYS A 1 512 ? 35.534 64.565 27.138  1.00 11.86 ? 509  LYS A N   1 
ATOM   4445 C  CA  A LYS A 1 512 ? 35.200 63.975 28.462  0.60 12.42 ? 509  LYS A CA  1 
ATOM   4446 C  CA  B LYS A 1 512 ? 35.185 63.966 28.436  0.40 12.52 ? 509  LYS A CA  1 
ATOM   4447 C  C   . LYS A 1 512 ? 34.490 64.970 29.344  1.00 12.21 ? 509  LYS A C   1 
ATOM   4448 O  O   . LYS A 1 512 ? 33.496 64.643 30.022  1.00 13.14 ? 509  LYS A O   1 
ATOM   4449 C  CB  A LYS A 1 512 ? 36.458 63.460 29.157  0.60 12.80 ? 509  LYS A CB  1 
ATOM   4450 C  CB  B LYS A 1 512 ? 36.430 63.379 29.087  0.40 12.80 ? 509  LYS A CB  1 
ATOM   4451 C  CG  A LYS A 1 512 ? 37.089 62.233 28.526  0.60 16.04 ? 509  LYS A CG  1 
ATOM   4452 C  CG  B LYS A 1 512 ? 37.008 62.177 28.347  0.40 16.00 ? 509  LYS A CG  1 
ATOM   4453 C  CD  A LYS A 1 512 ? 38.267 61.697 29.363  0.60 19.61 ? 509  LYS A CD  1 
ATOM   4454 C  CD  B LYS A 1 512 ? 38.259 61.685 29.032  0.40 19.30 ? 509  LYS A CD  1 
ATOM   4455 C  CE  A LYS A 1 512 ? 39.149 60.773 28.527  0.60 20.99 ? 509  LYS A CE  1 
ATOM   4456 C  CE  B LYS A 1 512 ? 38.190 62.005 30.512  0.40 20.66 ? 509  LYS A CE  1 
ATOM   4457 N  NZ  A LYS A 1 512 ? 40.418 60.355 29.210  0.60 26.53 ? 509  LYS A NZ  1 
ATOM   4458 N  NZ  B LYS A 1 512 ? 39.455 61.642 31.170  0.40 24.59 ? 509  LYS A NZ  1 
ATOM   4459 N  N   . ASN A 1 513 ? 34.965 66.225 29.302  1.00 12.07 ? 510  ASN A N   1 
ATOM   4460 C  CA  . ASN A 1 513 ? 34.389 67.287 30.125  1.00 12.85 ? 510  ASN A CA  1 
ATOM   4461 C  C   . ASN A 1 513 ? 32.948 67.602 29.662  1.00 12.01 ? 510  ASN A C   1 
ATOM   4462 O  O   . ASN A 1 513 ? 32.032 67.771 30.457  1.00 11.93 ? 510  ASN A O   1 
ATOM   4463 C  CB  . ASN A 1 513 ? 35.193 68.579 29.957  1.00 13.96 ? 510  ASN A CB  1 
ATOM   4464 C  CG  . ASN A 1 513 ? 36.577 68.560 30.567  1.00 21.37 ? 510  ASN A CG  1 
ATOM   4465 O  OD1 . ASN A 1 513 ? 36.923 67.692 31.366  1.00 26.22 ? 510  ASN A OD1 1 
ATOM   4466 N  ND2 . ASN A 1 513 ? 37.406 69.568 30.172  1.00 28.02 ? 510  ASN A ND2 1 
ATOM   4467 N  N   . ILE A 1 514 ? 32.749 67.645 28.347  1.00 11.13 ? 511  ILE A N   1 
ATOM   4468 C  CA  . ILE A 1 514 ? 31.414 67.926 27.792  1.00 10.93 ? 511  ILE A CA  1 
ATOM   4469 C  C   . ILE A 1 514 ? 30.424 66.779 28.073  1.00 12.02 ? 511  ILE A C   1 
ATOM   4470 O  O   . ILE A 1 514 ? 29.257 67.021 28.400  1.00 11.10 ? 511  ILE A O   1 
ATOM   4471 C  CB  . ILE A 1 514 ? 31.533 68.238 26.285  1.00 10.33 ? 511  ILE A CB  1 
ATOM   4472 C  CG1 . ILE A 1 514 ? 32.206 69.619 26.094  1.00 11.75 ? 511  ILE A CG1 1 
ATOM   4473 C  CG2 . ILE A 1 514 ? 30.126 68.157 25.626  1.00 11.66 ? 511  ILE A CG2 1 
ATOM   4474 C  CD1 . ILE A 1 514 ? 32.669 69.960 24.674  1.00 12.49 ? 511  ILE A CD1 1 
ATOM   4475 N  N   . LEU A 1 515 ? 30.895 65.535 28.056  1.00 13.25 ? 512  LEU A N   1 
ATOM   4476 C  CA  A LEU A 1 515 ? 30.053 64.399 28.410  0.60 15.49 ? 512  LEU A CA  1 
ATOM   4477 C  CA  B LEU A 1 515 ? 30.013 64.427 28.359  0.40 14.66 ? 512  LEU A CA  1 
ATOM   4478 C  C   . LEU A 1 515 ? 29.567 64.550 29.842  1.00 15.59 ? 512  LEU A C   1 
ATOM   4479 O  O   . LEU A 1 515 ? 28.402 64.323 30.159  1.00 17.18 ? 512  LEU A O   1 
ATOM   4480 C  CB  A LEU A 1 515 ? 30.834 63.083 28.303  0.60 16.37 ? 512  LEU A CB  1 
ATOM   4481 C  CB  B LEU A 1 515 ? 30.696 63.084 28.027  0.40 14.72 ? 512  LEU A CB  1 
ATOM   4482 C  CG  A LEU A 1 515 ? 30.732 62.381 26.964  0.60 17.93 ? 512  LEU A CG  1 
ATOM   4483 C  CG  B LEU A 1 515 ? 29.783 61.880 27.775  0.40 14.13 ? 512  LEU A CG  1 
ATOM   4484 C  CD1 A LEU A 1 515 ? 31.597 61.119 26.910  0.60 20.08 ? 512  LEU A CD1 1 
ATOM   4485 C  CD1 B LEU A 1 515 ? 29.036 62.072 26.469  0.40 15.99 ? 512  LEU A CD1 1 
ATOM   4486 C  CD2 A LEU A 1 515 ? 29.272 62.013 26.670  0.60 20.21 ? 512  LEU A CD2 1 
ATOM   4487 C  CD2 B LEU A 1 515 ? 30.620 60.576 27.761  0.40 12.35 ? 512  LEU A CD2 1 
ATOM   4488 N  N   . LYS A 1 516 ? 30.473 64.937 30.739  1.00 15.47 ? 513  LYS A N   1 
ATOM   4489 C  CA  A LYS A 1 516 ? 30.097 65.179 32.151  0.60 15.96 ? 513  LYS A CA  1 
ATOM   4490 C  CA  B LYS A 1 516 ? 30.081 65.158 32.139  0.40 16.08 ? 513  LYS A CA  1 
ATOM   4491 C  C   . LYS A 1 516 ? 29.050 66.292 32.263  1.00 15.79 ? 513  LYS A C   1 
ATOM   4492 O  O   . LYS A 1 516 ? 28.054 66.190 33.026  1.00 17.18 ? 513  LYS A O   1 
ATOM   4493 C  CB  A LYS A 1 516 ? 31.328 65.537 33.024  0.60 17.06 ? 513  LYS A CB  1 
ATOM   4494 C  CB  B LYS A 1 516 ? 31.316 65.429 33.017  0.40 16.98 ? 513  LYS A CB  1 
ATOM   4495 C  CG  A LYS A 1 516 ? 32.267 64.370 33.335  0.60 19.35 ? 513  LYS A CG  1 
ATOM   4496 C  CG  B LYS A 1 516 ? 31.023 65.537 34.509  0.40 19.12 ? 513  LYS A CG  1 
ATOM   4497 C  CD  A LYS A 1 516 ? 33.494 64.800 34.157  0.60 21.62 ? 513  LYS A CD  1 
ATOM   4498 C  CD  B LYS A 1 516 ? 32.105 64.850 35.325  0.40 21.79 ? 513  LYS A CD  1 
ATOM   4499 C  CE  A LYS A 1 516 ? 34.371 63.596 34.541  0.60 24.46 ? 513  LYS A CE  1 
ATOM   4500 C  CE  B LYS A 1 516 ? 32.017 65.209 36.801  0.40 23.70 ? 513  LYS A CE  1 
ATOM   4501 N  NZ  A LYS A 1 516 ? 34.993 62.962 33.337  0.60 25.81 ? 513  LYS A NZ  1 
ATOM   4502 N  NZ  B LYS A 1 516 ? 33.218 64.712 37.548  0.40 24.64 ? 513  LYS A NZ  1 
ATOM   4503 N  N   . ALA A 1 517 ? 29.270 67.390 31.531  1.00 14.66 ? 514  ALA A N   1 
ATOM   4504 C  CA  . ALA A 1 517 ? 28.329 68.505 31.530  1.00 14.37 ? 514  ALA A CA  1 
ATOM   4505 C  C   . ALA A 1 517 ? 26.953 68.121 30.973  1.00 15.28 ? 514  ALA A C   1 
ATOM   4506 O  O   . ALA A 1 517 ? 25.944 68.573 31.436  1.00 16.42 ? 514  ALA A O   1 
ATOM   4507 C  CB  . ALA A 1 517 ? 28.903 69.664 30.743  1.00 14.55 ? 514  ALA A CB  1 
HETATM 4508 N  N   . MSE A 1 518 ? 26.923 67.318 29.920  1.00 15.00 ? 515  MSE A N   1 
HETATM 4509 C  CA  . MSE A 1 518 ? 25.653 66.821 29.381  1.00 16.43 ? 515  MSE A CA  1 
HETATM 4510 C  C   . MSE A 1 518 ? 24.874 65.974 30.388  1.00 18.15 ? 515  MSE A C   1 
HETATM 4511 O  O   . MSE A 1 518 ? 23.660 65.813 30.264  1.00 19.88 ? 515  MSE A O   1 
HETATM 4512 C  CB  . MSE A 1 518 ? 25.916 65.985 28.130  1.00 16.11 ? 515  MSE A CB  1 
HETATM 4513 C  CG  . MSE A 1 518 ? 26.373 66.825 26.930  1.00 15.56 ? 515  MSE A CG  1 
HETATM 4514 SE SE  . MSE A 1 518 ? 26.880 65.898 25.349  0.70 19.64 ? 515  MSE A SE  1 
HETATM 4515 C  CE  . MSE A 1 518 ? 25.100 65.820 24.524  1.00 22.13 ? 515  MSE A CE  1 
ATOM   4516 N  N   . ASN A 1 519 ? 25.569 65.400 31.350  1.00 19.68 ? 516  ASN A N   1 
ATOM   4517 C  CA  . ASN A 1 519 ? 24.897 64.502 32.310  1.00 21.08 ? 516  ASN A CA  1 
ATOM   4518 C  C   . ASN A 1 519 ? 24.603 65.146 33.631  1.00 22.20 ? 516  ASN A C   1 
ATOM   4519 O  O   . ASN A 1 519 ? 23.879 64.551 34.447  1.00 23.62 ? 516  ASN A O   1 
ATOM   4520 C  CB  . ASN A 1 519 ? 25.689 63.185 32.446  1.00 21.59 ? 516  ASN A CB  1 
ATOM   4521 C  CG  . ASN A 1 519 ? 25.525 62.301 31.180  1.00 23.34 ? 516  ASN A CG  1 
ATOM   4522 O  OD1 . ASN A 1 519 ? 24.404 61.986 30.804  1.00 29.08 ? 516  ASN A OD1 1 
ATOM   4523 N  ND2 . ASN A 1 519 ? 26.617 61.980 30.494  1.00 28.58 ? 516  ASN A ND2 1 
ATOM   4524 N  N   . ASP A 1 520 ? 25.092 66.366 33.836  1.00 22.79 ? 517  ASP A N   1 
ATOM   4525 C  CA  . ASP A 1 520 ? 24.961 67.041 35.141  1.00 24.75 ? 517  ASP A CA  1 
ATOM   4526 C  C   . ASP A 1 520 ? 25.187 68.549 35.019  1.00 25.48 ? 517  ASP A C   1 
ATOM   4527 O  O   . ASP A 1 520 ? 26.335 69.027 35.056  1.00 24.08 ? 517  ASP A O   1 
ATOM   4528 C  CB  . ASP A 1 520 ? 25.942 66.434 36.150  1.00 25.12 ? 517  ASP A CB  1 
ATOM   4529 C  CG  . ASP A 1 520 ? 25.772 66.997 37.575  1.00 27.22 ? 517  ASP A CG  1 
ATOM   4530 O  OD1 . ASP A 1 520 ? 26.593 66.623 38.453  1.00 31.09 ? 517  ASP A OD1 1 
ATOM   4531 O  OD2 . ASP A 1 520 ? 24.844 67.815 37.811  1.00 29.06 ? 517  ASP A OD2 1 
ATOM   4532 N  N   . ASP A 1 521 ? 24.090 69.295 34.927  1.00 26.73 ? 518  ASP A N   1 
ATOM   4533 C  CA  . ASP A 1 521 ? 24.199 70.741 34.765  1.00 28.59 ? 518  ASP A CA  1 
ATOM   4534 C  C   . ASP A 1 521 ? 24.578 71.512 36.037  1.00 28.73 ? 518  ASP A C   1 
ATOM   4535 O  O   . ASP A 1 521 ? 24.718 72.737 35.977  1.00 29.97 ? 518  ASP A O   1 
ATOM   4536 C  CB  . ASP A 1 521 ? 22.972 71.341 34.033  1.00 29.43 ? 518  ASP A CB  1 
ATOM   4537 C  CG  . ASP A 1 521 ? 21.660 71.228 34.816  1.00 32.79 ? 518  ASP A CG  1 
ATOM   4538 O  OD1 . ASP A 1 521 ? 21.677 70.959 36.041  1.00 33.84 ? 518  ASP A OD1 1 
ATOM   4539 O  OD2 . ASP A 1 521 ? 20.599 71.446 34.171  1.00 37.06 ? 518  ASP A OD2 1 
ATOM   4540 N  N   . SER A 1 522 ? 24.782 70.797 37.153  1.00 28.15 ? 519  SER A N   1 
ATOM   4541 C  CA  . SER A 1 522 ? 25.332 71.391 38.375  1.00 27.65 ? 519  SER A CA  1 
ATOM   4542 C  C   . SER A 1 522 ? 26.849 71.203 38.484  1.00 26.56 ? 519  SER A C   1 
ATOM   4543 O  O   . SER A 1 522 ? 27.474 71.661 39.455  1.00 26.58 ? 519  SER A O   1 
ATOM   4544 C  CB  . SER A 1 522 ? 24.661 70.794 39.635  1.00 28.40 ? 519  SER A CB  1 
ATOM   4545 O  OG  . SER A 1 522 ? 25.309 69.579 40.039  1.00 30.58 ? 519  SER A OG  1 
ATOM   4546 N  N   . SER A 1 523 ? 27.459 70.525 37.505  1.00 24.94 ? 520  SER A N   1 
ATOM   4547 C  CA  . SER A 1 523 ? 28.849 70.176 37.612  1.00 24.31 ? 520  SER A CA  1 
ATOM   4548 C  C   . SER A 1 523 ? 29.714 71.396 37.348  1.00 24.54 ? 520  SER A C   1 
ATOM   4549 O  O   . SER A 1 523 ? 29.278 72.356 36.679  1.00 25.31 ? 520  SER A O   1 
ATOM   4550 C  CB  . SER A 1 523 ? 29.194 69.092 36.574  1.00 24.58 ? 520  SER A CB  1 
ATOM   4551 O  OG  . SER A 1 523 ? 28.867 69.525 35.249  1.00 22.92 ? 520  SER A OG  1 
ATOM   4552 N  N   . ASP A 1 524 ? 30.961 71.331 37.811  1.00 24.66 ? 521  ASP A N   1 
ATOM   4553 C  CA  . ASP A 1 524 ? 31.945 72.359 37.490  1.00 24.45 ? 521  ASP A CA  1 
ATOM   4554 C  C   . ASP A 1 524 ? 32.127 72.404 35.968  1.00 23.80 ? 521  ASP A C   1 
ATOM   4555 O  O   . ASP A 1 524 ? 32.293 73.462 35.379  1.00 23.89 ? 521  ASP A O   1 
ATOM   4556 C  CB  . ASP A 1 524 ? 33.283 72.069 38.171  1.00 24.76 ? 521  ASP A CB  1 
ATOM   4557 C  CG  . ASP A 1 524 ? 33.231 72.242 39.708  1.00 28.11 ? 521  ASP A CG  1 
ATOM   4558 O  OD1 . ASP A 1 524 ? 32.244 72.815 40.271  1.00 31.44 ? 521  ASP A OD1 1 
ATOM   4559 O  OD2 . ASP A 1 524 ? 34.228 71.795 40.328  1.00 31.25 ? 521  ASP A OD2 1 
ATOM   4560 N  N   . GLU A 1 525 ? 32.096 71.233 35.339  1.00 22.39 ? 522  GLU A N   1 
ATOM   4561 C  CA  . GLU A 1 525 ? 32.244 71.138 33.878  1.00 21.15 ? 522  GLU A CA  1 
ATOM   4562 C  C   . GLU A 1 525 ? 31.190 71.987 33.124  1.00 20.28 ? 522  GLU A C   1 
ATOM   4563 O  O   . GLU A 1 525 ? 31.507 72.704 32.147  1.00 19.75 ? 522  GLU A O   1 
ATOM   4564 C  CB  . GLU A 1 525 ? 32.172 69.683 33.413  1.00 22.04 ? 522  GLU A CB  1 
ATOM   4565 C  CG  . GLU A 1 525 ? 33.405 68.829 33.799  1.00 23.43 ? 522  GLU A CG  1 
ATOM   4566 C  CD  . GLU A 1 525 ? 33.486 68.425 35.273  1.00 26.50 ? 522  GLU A CD  1 
ATOM   4567 O  OE1 . GLU A 1 525 ? 32.465 68.495 36.026  1.00 24.12 ? 522  GLU A OE1 1 
ATOM   4568 O  OE2 . GLU A 1 525 ? 34.615 68.007 35.670  1.00 31.29 ? 522  GLU A OE2 1 
ATOM   4569 N  N   . TYR A 1 526 ? 29.944 71.877 33.545  1.00 18.72 ? 523  TYR A N   1 
ATOM   4570 C  CA  . TYR A 1 526 ? 28.886 72.647 32.909  1.00 18.72 ? 523  TYR A CA  1 
ATOM   4571 C  C   . TYR A 1 526 ? 29.059 74.147 33.173  1.00 18.78 ? 523  TYR A C   1 
ATOM   4572 O  O   . TYR A 1 526 ? 28.889 74.971 32.276  1.00 17.56 ? 523  TYR A O   1 
ATOM   4573 C  CB  . TYR A 1 526 ? 27.534 72.165 33.403  1.00 19.17 ? 523  TYR A CB  1 
ATOM   4574 C  CG  . TYR A 1 526 ? 26.376 72.818 32.738  1.00 19.19 ? 523  TYR A CG  1 
ATOM   4575 C  CD1 . TYR A 1 526 ? 25.718 72.190 31.679  1.00 19.47 ? 523  TYR A CD1 1 
ATOM   4576 C  CD2 . TYR A 1 526 ? 25.930 74.072 33.157  1.00 21.59 ? 523  TYR A CD2 1 
ATOM   4577 C  CE1 . TYR A 1 526 ? 24.652 72.797 31.048  1.00 21.76 ? 523  TYR A CE1 1 
ATOM   4578 C  CE2 . TYR A 1 526 ? 24.879 74.674 32.563  1.00 22.36 ? 523  TYR A CE2 1 
ATOM   4579 C  CZ  . TYR A 1 526 ? 24.222 74.031 31.513  1.00 21.32 ? 523  TYR A CZ  1 
ATOM   4580 O  OH  . TYR A 1 526 ? 23.173 74.633 30.883  1.00 25.88 ? 523  TYR A OH  1 
ATOM   4581 N  N   . GLN A 1 527 ? 29.393 74.489 34.417  1.00 19.15 ? 524  GLN A N   1 
ATOM   4582 C  CA  A GLN A 1 527 ? 29.631 75.872 34.809  0.60 19.36 ? 524  GLN A CA  1 
ATOM   4583 C  CA  B GLN A 1 527 ? 29.589 75.885 34.773  0.40 19.27 ? 524  GLN A CA  1 
ATOM   4584 C  C   . GLN A 1 527 ? 30.752 76.522 34.000  1.00 18.94 ? 524  GLN A C   1 
ATOM   4585 O  O   . GLN A 1 527 ? 30.680 77.705 33.656  1.00 21.04 ? 524  GLN A O   1 
ATOM   4586 C  CB  A GLN A 1 527 ? 29.957 75.943 36.329  0.60 19.93 ? 524  GLN A CB  1 
ATOM   4587 C  CB  B GLN A 1 527 ? 29.752 76.055 36.305  0.40 19.62 ? 524  GLN A CB  1 
ATOM   4588 C  CG  A GLN A 1 527 ? 30.430 77.311 36.828  0.60 22.44 ? 524  GLN A CG  1 
ATOM   4589 C  CG  B GLN A 1 527 ? 28.521 76.650 36.984  0.40 21.36 ? 524  GLN A CG  1 
ATOM   4590 C  CD  A GLN A 1 527 ? 30.183 77.494 38.319  0.60 25.00 ? 524  GLN A CD  1 
ATOM   4591 C  CD  B GLN A 1 527 ? 27.231 75.945 36.613  0.40 22.36 ? 524  GLN A CD  1 
ATOM   4592 O  OE1 A GLN A 1 527 ? 30.210 76.534 39.095  0.60 28.18 ? 524  GLN A OE1 1 
ATOM   4593 O  OE1 B GLN A 1 527 ? 26.213 76.588 36.342  0.40 23.75 ? 524  GLN A OE1 1 
ATOM   4594 N  NE2 A GLN A 1 527 ? 29.924 78.720 38.718  0.60 27.86 ? 524  GLN A NE2 1 
ATOM   4595 N  NE2 B GLN A 1 527 ? 27.266 74.616 36.604  0.40 23.41 ? 524  GLN A NE2 1 
ATOM   4596 N  N   . ASN A 1 528 ? 31.773 75.755 33.662  1.00 18.51 ? 525  ASN A N   1 
ATOM   4597 C  CA  . ASN A 1 528 ? 32.973 76.284 33.012  1.00 18.60 ? 525  ASN A CA  1 
ATOM   4598 C  C   . ASN A 1 528 ? 32.856 76.378 31.491  1.00 17.54 ? 525  ASN A C   1 
ATOM   4599 O  O   . ASN A 1 528 ? 33.740 76.919 30.848  1.00 17.44 ? 525  ASN A O   1 
ATOM   4600 C  CB  . ASN A 1 528 ? 34.192 75.422 33.366  1.00 19.42 ? 525  ASN A CB  1 
ATOM   4601 C  CG  . ASN A 1 528 ? 34.536 75.484 34.879  1.00 24.43 ? 525  ASN A CG  1 
ATOM   4602 O  OD1 . ASN A 1 528 ? 34.141 76.424 35.595  1.00 29.95 ? 525  ASN A OD1 1 
ATOM   4603 N  ND2 . ASN A 1 528 ? 35.243 74.459 35.364  1.00 30.87 ? 525  ASN A ND2 1 
ATOM   4604 N  N   . LEU A 1 529 ? 31.788 75.826 30.925  1.00 15.75 ? 526  LEU A N   1 
ATOM   4605 C  CA  . LEU A 1 529 ? 31.602 75.879 29.488  1.00 14.48 ? 526  LEU A CA  1 
ATOM   4606 C  C   . LEU A 1 529 ? 31.536 77.305 28.938  1.00 13.09 ? 526  LEU A C   1 
ATOM   4607 O  O   . LEU A 1 529 ? 31.002 78.220 29.585  1.00 13.59 ? 526  LEU A O   1 
ATOM   4608 C  CB  . LEU A 1 529 ? 30.326 75.165 29.032  1.00 13.58 ? 526  LEU A CB  1 
ATOM   4609 C  CG  . LEU A 1 529 ? 30.190 73.664 29.291  1.00 12.75 ? 526  LEU A CG  1 
ATOM   4610 C  CD1 . LEU A 1 529 ? 28.737 73.190 28.960  1.00 14.77 ? 526  LEU A CD1 1 
ATOM   4611 C  CD2 . LEU A 1 529 ? 31.269 72.822 28.553  1.00 15.44 ? 526  LEU A CD2 1 
ATOM   4612 N  N   . ASP A 1 530 ? 32.056 77.479 27.706  1.00 12.32 ? 527  ASP A N   1 
ATOM   4613 C  CA  . ASP A 1 530 ? 31.675 78.618 26.904  1.00 11.22 ? 527  ASP A CA  1 
ATOM   4614 C  C   . ASP A 1 530 ? 30.180 78.489 26.574  1.00 10.55 ? 527  ASP A C   1 
ATOM   4615 O  O   . ASP A 1 530 ? 29.617 77.387 26.535  1.00 11.67 ? 527  ASP A O   1 
ATOM   4616 C  CB  . ASP A 1 530 ? 32.454 78.720 25.632  1.00 11.23 ? 527  ASP A CB  1 
ATOM   4617 C  CG  . ASP A 1 530 ? 32.125 77.601 24.714  1.00 11.66 ? 527  ASP A CG  1 
ATOM   4618 O  OD1 . ASP A 1 530 ? 32.664 76.495 24.948  1.00 12.45 ? 527  ASP A OD1 1 
ATOM   4619 O  OD2 . ASP A 1 530 ? 31.291 77.855 23.803  1.00 11.34 ? 527  ASP A OD2 1 
ATOM   4620 N  N   . ASP A 1 531 ? 29.538 79.619 26.334  1.00 9.99  ? 528  ASP A N   1 
ATOM   4621 C  CA  . ASP A 1 531 ? 28.095 79.599 26.165  1.00 9.31  ? 528  ASP A CA  1 
ATOM   4622 C  C   . ASP A 1 531 ? 27.643 78.992 24.824  1.00 8.71  ? 528  ASP A C   1 
ATOM   4623 O  O   . ASP A 1 531 ? 26.499 78.566 24.724  1.00 9.18  ? 528  ASP A O   1 
ATOM   4624 C  CB  . ASP A 1 531 ? 27.483 80.967 26.351  1.00 9.22  ? 528  ASP A CB  1 
ATOM   4625 C  CG  . ASP A 1 531 ? 25.984 80.890 26.710  1.00 10.75 ? 528  ASP A CG  1 
ATOM   4626 O  OD1 . ASP A 1 531 ? 25.585 80.050 27.579  1.00 12.51 ? 528  ASP A OD1 1 
ATOM   4627 O  OD2 . ASP A 1 531 ? 25.210 81.660 26.090  1.00 14.44 ? 528  ASP A OD2 1 
ATOM   4628 N  N   . SER A 1 532 ? 28.503 78.956 23.824  1.00 8.77  ? 529  SER A N   1 
ATOM   4629 C  CA  . SER A 1 532 ? 28.146 78.256 22.583  1.00 9.01  ? 529  SER A CA  1 
ATOM   4630 C  C   . SER A 1 532 ? 27.972 76.780 22.854  1.00 8.73  ? 529  SER A C   1 
ATOM   4631 O  O   . SER A 1 532 ? 26.933 76.196 22.515  1.00 8.55  ? 529  SER A O   1 
ATOM   4632 C  CB  . SER A 1 532 ? 29.157 78.529 21.481  1.00 8.53  ? 529  SER A CB  1 
ATOM   4633 O  OG  . SER A 1 532 ? 28.977 77.636 20.387  1.00 9.44  ? 529  SER A OG  1 
ATOM   4634 N  N   . THR A 1 533 ? 28.985 76.166 23.465  1.00 8.67  ? 530  THR A N   1 
ATOM   4635 C  CA  . THR A 1 533 ? 28.896 74.749 23.839  1.00 8.92  ? 530  THR A CA  1 
ATOM   4636 C  C   . THR A 1 533 ? 27.681 74.512 24.755  1.00 8.89  ? 530  THR A C   1 
ATOM   4637 O  O   . THR A 1 533 ? 26.918 73.584 24.602  1.00 9.91  ? 530  THR A O   1 
ATOM   4638 C  CB  . THR A 1 533 ? 30.186 74.262 24.518  1.00 9.04  ? 530  THR A CB  1 
ATOM   4639 O  OG1 . THR A 1 533 ? 31.296 74.535 23.674  1.00 10.85 ? 530  THR A OG1 1 
ATOM   4640 C  CG2 . THR A 1 533 ? 30.098 72.773 24.879  1.00 11.24 ? 530  THR A CG2 1 
ATOM   4641 N  N   . ARG A 1 534 ? 27.478 75.413 25.705  1.00 9.08  ? 531  ARG A N   1 
ATOM   4642 C  CA  . ARG A 1 534 ? 26.355 75.228 26.654  1.00 9.36  ? 531  ARG A CA  1 
ATOM   4643 C  C   . ARG A 1 534 ? 24.983 75.243 25.943  1.00 10.66 ? 531  ARG A C   1 
ATOM   4644 O  O   . ARG A 1 534 ? 24.108 74.407 26.213  1.00 11.29 ? 531  ARG A O   1 
ATOM   4645 C  CB  . ARG A 1 534 ? 26.361 76.322 27.719  1.00 10.51 ? 531  ARG A CB  1 
ATOM   4646 C  CG  . ARG A 1 534 ? 25.261 76.175 28.789  1.00 11.41 ? 531  ARG A CG  1 
ATOM   4647 C  CD  . ARG A 1 534 ? 25.341 77.217 29.894  1.00 13.03 ? 531  ARG A CD  1 
ATOM   4648 N  NE  . ARG A 1 534 ? 26.596 77.144 30.635  1.00 14.19 ? 531  ARG A NE  1 
ATOM   4649 C  CZ  . ARG A 1 534 ? 27.630 77.973 30.478  1.00 13.63 ? 531  ARG A CZ  1 
ATOM   4650 N  NH1 . ARG A 1 534 ? 27.575 78.976 29.614  1.00 13.62 ? 531  ARG A NH1 1 
ATOM   4651 N  NH2 . ARG A 1 534 ? 28.711 77.821 31.236  1.00 14.86 ? 531  ARG A NH2 1 
ATOM   4652 N  N   . GLN A 1 535 ? 24.814 76.170 25.013  1.00 10.01 ? 532  GLN A N   1 
ATOM   4653 C  CA  . GLN A 1 535 ? 23.528 76.287 24.321  1.00 10.55 ? 532  GLN A CA  1 
ATOM   4654 C  C   . GLN A 1 535 ? 23.329 75.158 23.318  1.00 10.17 ? 532  GLN A C   1 
ATOM   4655 O  O   . GLN A 1 535 ? 22.195 74.736 23.084  1.00 12.01 ? 532  GLN A O   1 
ATOM   4656 C  CB  . GLN A 1 535 ? 23.334 77.686 23.696  1.00 9.65  ? 532  GLN A CB  1 
ATOM   4657 C  CG  . GLN A 1 535 ? 23.236 78.819 24.714  1.00 10.25 ? 532  GLN A CG  1 
ATOM   4658 C  CD  . GLN A 1 535 ? 22.400 78.503 25.942  1.00 15.06 ? 532  GLN A CD  1 
ATOM   4659 O  OE1 . GLN A 1 535 ? 21.252 78.056 25.834  1.00 15.94 ? 532  GLN A OE1 1 
ATOM   4660 N  NE2 . GLN A 1 535 ? 22.963 78.799 27.130  1.00 17.01 ? 532  GLN A NE2 1 
ATOM   4661 N  N   . LEU A 1 536 ? 24.407 74.605 22.745  1.00 9.97  ? 533  LEU A N   1 
ATOM   4662 C  CA  . LEU A 1 536 ? 24.287 73.416 21.876  1.00 10.08 ? 533  LEU A CA  1 
ATOM   4663 C  C   . LEU A 1 536 ? 23.838 72.225 22.685  1.00 11.18 ? 533  LEU A C   1 
ATOM   4664 O  O   . LEU A 1 536 ? 22.927 71.507 22.272  1.00 11.94 ? 533  LEU A O   1 
ATOM   4665 C  CB  . LEU A 1 536 ? 25.624 73.119 21.169  1.00 9.43  ? 533  LEU A CB  1 
ATOM   4666 C  CG  . LEU A 1 536 ? 25.954 74.060 19.973  1.00 9.20  ? 533  LEU A CG  1 
ATOM   4667 C  CD1 . LEU A 1 536 ? 27.473 74.087 19.614  1.00 10.71 ? 533  LEU A CD1 1 
ATOM   4668 C  CD2 . LEU A 1 536 ? 25.164 73.708 18.753  1.00 9.85  ? 533  LEU A CD2 1 
ATOM   4669 N  N   . ILE A 1 537 ? 24.388 72.057 23.888  1.00 11.20 ? 534  ILE A N   1 
ATOM   4670 C  CA  . ILE A 1 537 ? 23.945 70.963 24.770  1.00 12.89 ? 534  ILE A CA  1 
ATOM   4671 C  C   . ILE A 1 537 ? 22.472 71.147 25.114  1.00 13.06 ? 534  ILE A C   1 
ATOM   4672 O  O   . ILE A 1 537 ? 21.736 70.206 25.113  1.00 15.12 ? 534  ILE A O   1 
ATOM   4673 C  CB  . ILE A 1 537 ? 24.825 70.911 26.020  1.00 13.76 ? 534  ILE A CB  1 
ATOM   4674 C  CG1 . ILE A 1 537 ? 26.222 70.424 25.652  1.00 14.44 ? 534  ILE A CG1 1 
ATOM   4675 C  CG2 . ILE A 1 537 ? 24.157 70.076 27.151  1.00 17.53 ? 534  ILE A CG2 1 
ATOM   4676 C  CD1 . ILE A 1 537 ? 27.187 70.662 26.853  1.00 16.77 ? 534  ILE A CD1 1 
ATOM   4677 N  N   . ALA A 1 538 ? 22.053 72.374 25.443  1.00 13.53 ? 535  ALA A N   1 
ATOM   4678 C  CA  . ALA A 1 538 ? 20.657 72.640 25.757  1.00 14.06 ? 535  ALA A CA  1 
ATOM   4679 C  C   . ALA A 1 538 ? 19.709 72.337 24.607  1.00 16.14 ? 535  ALA A C   1 
ATOM   4680 O  O   . ALA A 1 538 ? 18.619 71.820 24.797  1.00 18.02 ? 535  ALA A O   1 
ATOM   4681 C  CB  . ALA A 1 538 ? 20.465 74.128 26.220  1.00 15.05 ? 535  ALA A CB  1 
ATOM   4682 N  N   . LYS A 1 539 ? 20.118 72.679 23.392  1.00 16.27 ? 536  LYS A N   1 
ATOM   4683 C  CA  . LYS A 1 539 ? 19.283 72.434 22.199  1.00 17.58 ? 536  LYS A CA  1 
ATOM   4684 C  C   . LYS A 1 539 ? 19.115 70.952 21.977  1.00 19.44 ? 536  LYS A C   1 
ATOM   4685 O  O   . LYS A 1 539 ? 18.074 70.510 21.493  1.00 22.54 ? 536  LYS A O   1 
ATOM   4686 C  CB  . LYS A 1 539 ? 19.906 73.037 20.956  1.00 18.41 ? 536  LYS A CB  1 
ATOM   4687 C  CG  . LYS A 1 539 ? 19.904 74.568 20.843  1.00 20.75 ? 536  LYS A CG  1 
ATOM   4688 C  CD  . LYS A 1 539 ? 18.550 75.131 20.731  1.00 26.06 ? 536  LYS A CD  1 
ATOM   4689 C  CE  . LYS A 1 539 ? 18.580 76.618 20.683  1.00 28.42 ? 536  LYS A CE  1 
ATOM   4690 N  NZ  . LYS A 1 539 ? 17.209 77.146 20.595  1.00 32.58 ? 536  LYS A NZ  1 
ATOM   4691 N  N   . VAL A 1 540 ? 20.143 70.176 22.292  1.00 20.05 ? 537  VAL A N   1 
ATOM   4692 C  CA  . VAL A 1 540 ? 20.069 68.736 22.123  1.00 21.85 ? 537  VAL A CA  1 
ATOM   4693 C  C   . VAL A 1 540 ? 19.061 68.164 23.096  1.00 27.47 ? 537  VAL A C   1 
ATOM   4694 O  O   . VAL A 1 540 ? 18.181 67.433 22.651  1.00 28.54 ? 537  VAL A O   1 
ATOM   4695 C  CB  . VAL A 1 540 ? 21.459 68.071 22.188  1.00 20.48 ? 537  VAL A CB  1 
ATOM   4696 C  CG1 . VAL A 1 540 ? 21.345 66.596 22.336  1.00 20.44 ? 537  VAL A CG1 1 
ATOM   4697 C  CG2 . VAL A 1 540 ? 22.273 68.462 20.917  1.00 16.14 ? 537  VAL A CG2 1 
ATOM   4698 N  N   . LYS A 1 541 ? 19.147 68.593 24.361  1.00 30.32 ? 538  LYS A N   1 
ATOM   4699 C  CA  A LYS A 1 541 ? 18.299 68.061 25.441  0.70 33.15 ? 538  LYS A CA  1 
ATOM   4700 C  CA  B LYS A 1 541 ? 18.327 68.082 25.470  0.30 32.58 ? 538  LYS A CA  1 
ATOM   4701 C  C   . LYS A 1 541 ? 16.854 68.438 25.319  1.00 34.74 ? 538  LYS A C   1 
ATOM   4702 O  O   . LYS A 1 541 ? 15.993 67.658 25.727  1.00 36.85 ? 538  LYS A O   1 
ATOM   4703 C  CB  A LYS A 1 541 ? 18.771 68.538 26.804  0.70 32.82 ? 538  LYS A CB  1 
ATOM   4704 C  CB  B LYS A 1 541 ? 18.864 68.624 26.814  0.30 32.07 ? 538  LYS A CB  1 
ATOM   4705 C  CG  A LYS A 1 541 ? 20.015 67.881 27.238  0.70 33.24 ? 538  LYS A CG  1 
ATOM   4706 C  CG  B LYS A 1 541 ? 17.993 68.350 28.067  0.30 30.83 ? 538  LYS A CG  1 
ATOM   4707 C  CD  A LYS A 1 541 ? 20.007 67.474 28.692  0.70 34.07 ? 538  LYS A CD  1 
ATOM   4708 C  CD  B LYS A 1 541 ? 18.668 68.839 29.348  0.30 28.20 ? 538  LYS A CD  1 
ATOM   4709 C  CE  A LYS A 1 541 ? 21.307 66.787 29.004  0.70 33.70 ? 538  LYS A CE  1 
ATOM   4710 C  CE  B LYS A 1 541 ? 17.706 68.822 30.542  0.30 27.04 ? 538  LYS A CE  1 
ATOM   4711 N  NZ  A LYS A 1 541 ? 22.419 67.760 28.914  0.70 32.09 ? 538  LYS A NZ  1 
ATOM   4712 N  NZ  B LYS A 1 541 ? 18.422 68.987 31.841  0.30 25.32 ? 538  LYS A NZ  1 
ATOM   4713 N  N   . ASN A 1 542 ? 16.565 69.624 24.777  1.00 37.42 ? 539  ASN A N   1 
ATOM   4714 C  CA  . ASN A 1 542 ? 15.183 70.117 24.795  1.00 40.88 ? 539  ASN A CA  1 
ATOM   4715 C  C   . ASN A 1 542 ? 14.471 69.819 23.486  0.70 42.67 ? 539  ASN A C   1 
ATOM   4716 O  O   . ASN A 1 542 ? 13.312 70.172 23.315  0.70 43.56 ? 539  ASN A O   1 
ATOM   4717 C  CB  . ASN A 1 542 ? 15.128 71.602 25.202  1.00 41.12 ? 539  ASN A CB  1 
ATOM   4718 C  CG  . ASN A 1 542 ? 15.682 71.844 26.627  1.00 41.73 ? 539  ASN A CG  1 
ATOM   4719 O  OD1 . ASN A 1 542 ? 15.231 71.226 27.610  1.00 44.32 ? 539  ASN A OD1 1 
ATOM   4720 N  ND2 . ASN A 1 542 ? 16.662 72.744 26.738  1.00 39.03 ? 539  ASN A ND2 1 
ATOM   4721 N  N   . LYS A 1 543 ? 15.190 69.139 22.590  0.70 44.55 ? 540  LYS A N   1 
ATOM   4722 C  CA  . LYS A 1 543 ? 14.609 68.362 21.491  0.70 45.60 ? 540  LYS A CA  1 
ATOM   4723 C  C   . LYS A 1 543 ? 13.228 67.818 21.819  0.70 46.02 ? 540  LYS A C   1 
ATOM   4724 O  O   . LYS A 1 543 ? 13.110 66.868 22.597  0.70 46.19 ? 540  LYS A O   1 
ATOM   4725 C  CB  . LYS A 1 543 ? 15.509 67.167 21.196  0.70 45.94 ? 540  LYS A CB  1 
ATOM   4726 C  CG  . LYS A 1 543 ? 16.420 67.360 20.029  0.70 46.44 ? 540  LYS A CG  1 
ATOM   4727 C  CD  . LYS A 1 543 ? 15.659 67.155 18.734  0.70 47.60 ? 540  LYS A CD  1 
ATOM   4728 C  CE  . LYS A 1 543 ? 15.203 65.707 18.524  0.70 47.24 ? 540  LYS A CE  1 
ATOM   4729 N  NZ  . LYS A 1 543 ? 13.751 65.587 18.194  0.70 47.68 ? 540  LYS A NZ  1 
ATOM   4730 O  OXT . LYS A 1 543 ? 12.226 68.312 21.313  0.70 46.46 ? 540  LYS A OXT 1 
HETATM 4731 O  O1  . MES B 2 .   ? 34.937 37.216 -4.450  0.70 36.62 ? 601  MES A O1  1 
HETATM 4732 C  C2  . MES B 2 .   ? 35.406 36.938 -5.754  0.70 33.97 ? 601  MES A C2  1 
HETATM 4733 C  C3  . MES B 2 .   ? 36.010 38.209 -6.283  0.70 30.75 ? 601  MES A C3  1 
HETATM 4734 N  N4  . MES B 2 .   ? 34.944 39.182 -6.426  0.70 31.46 ? 601  MES A N4  1 
HETATM 4735 C  C5  . MES B 2 .   ? 33.791 39.167 -5.554  0.70 35.86 ? 601  MES A C5  1 
HETATM 4736 C  C6  . MES B 2 .   ? 34.177 38.420 -4.269  0.70 36.67 ? 601  MES A C6  1 
HETATM 4737 C  C7  . MES B 2 .   ? 35.243 40.214 -7.401  0.70 25.21 ? 601  MES A C7  1 
HETATM 4738 C  C8  . MES B 2 .   ? 34.149 41.152 -7.864  0.70 22.85 ? 601  MES A C8  1 
HETATM 4739 S  S   . MES B 2 .   ? 34.879 42.487 -8.620  0.70 18.47 ? 601  MES A S   1 
HETATM 4740 O  O1S . MES B 2 .   ? 35.809 41.914 -9.657  0.70 23.41 ? 601  MES A O1S 1 
HETATM 4741 O  O2S . MES B 2 .   ? 33.916 43.165 -9.444  0.70 21.38 ? 601  MES A O2S 1 
HETATM 4742 O  O3S . MES B 2 .   ? 35.719 43.261 -7.657  0.70 16.07 ? 601  MES A O3S 1 
HETATM 4743 C  C1  . GOL C 3 .   ? 37.812 28.270 17.871  1.00 32.78 ? 602  GOL A C1  1 
HETATM 4744 O  O1  . GOL C 3 .   ? 37.603 26.936 17.367  1.00 30.17 ? 602  GOL A O1  1 
HETATM 4745 C  C2  . GOL C 3 .   ? 39.178 28.523 18.496  1.00 35.99 ? 602  GOL A C2  1 
HETATM 4746 O  O2  . GOL C 3 .   ? 39.932 27.348 18.760  1.00 34.71 ? 602  GOL A O2  1 
HETATM 4747 C  C3  . GOL C 3 .   ? 39.046 29.426 19.713  1.00 37.11 ? 602  GOL A C3  1 
HETATM 4748 O  O3  . GOL C 3 .   ? 40.143 29.300 20.578  1.00 40.54 ? 602  GOL A O3  1 
HETATM 4749 C  C1  . IPA D 4 .   ? 54.063 47.256 -9.399  1.00 23.57 ? 603  IPA A C1  1 
HETATM 4750 C  C2  . IPA D 4 .   ? 55.320 47.970 -9.752  1.00 28.64 ? 603  IPA A C2  1 
HETATM 4751 C  C3  . IPA D 4 .   ? 56.324 48.294 -8.622  1.00 24.84 ? 603  IPA A C3  1 
HETATM 4752 O  O2  . IPA D 4 .   ? 55.721 47.234 -10.849 1.00 28.43 ? 603  IPA A O2  1 
HETATM 4753 CA CA  . CA  E 5 .   ? 74.926 66.598 0.910   1.00 23.88 ? 604  CA  A CA  1 
HETATM 4754 O  O   . HOH F 6 .   ? 19.762 77.183 23.869  1.00 49.78 ? 541  HOH A O   1 
HETATM 4755 O  O   . HOH F 6 .   ? 22.810 39.003 27.973  1.00 45.38 ? 542  HOH A O   1 
HETATM 4756 O  O   . HOH F 6 .   ? 35.694 34.032 -2.734  1.00 48.33 ? 543  HOH A O   1 
HETATM 4757 O  O   . HOH F 6 .   ? 55.411 82.964 -12.455 1.00 44.94 ? 544  HOH A O   1 
HETATM 4758 O  O   . HOH F 6 .   ? 70.061 52.880 15.145  1.00 48.45 ? 545  HOH A O   1 
HETATM 4759 O  O   . HOH F 6 .   ? 45.157 54.399 21.638  1.00 42.33 ? 546  HOH A O   1 
HETATM 4760 O  O   . HOH F 6 .   ? 66.021 47.064 -8.701  1.00 46.38 ? 547  HOH A O   1 
HETATM 4761 O  O   . HOH F 6 .   ? 71.254 53.016 -7.221  1.00 39.13 ? 548  HOH A O   1 
HETATM 4762 O  O   . HOH F 6 .   ? 35.394 58.252 -3.323  1.00 42.18 ? 549  HOH A O   1 
HETATM 4763 O  O   . HOH F 6 .   ? 70.103 55.778 -10.698 1.00 44.57 ? 550  HOH A O   1 
HETATM 4764 O  O   . HOH F 6 .   ? 35.290 24.974 5.321   1.00 39.26 ? 551  HOH A O   1 
HETATM 4765 O  O   . HOH F 6 .   ? 68.222 78.214 2.489   1.00 36.06 ? 552  HOH A O   1 
HETATM 4766 O  O   . HOH F 6 .   ? 22.713 38.891 5.968   1.00 56.60 ? 553  HOH A O   1 
HETATM 4767 O  O   . HOH F 6 .   ? 20.751 29.316 16.688  1.00 44.97 ? 554  HOH A O   1 
HETATM 4768 O  O   . HOH F 6 .   ? 71.049 74.491 -2.359  1.00 36.88 ? 555  HOH A O   1 
HETATM 4769 O  O   . HOH F 6 .   ? 43.260 42.191 -13.667 1.00 34.61 ? 556  HOH A O   1 
HETATM 4770 O  O   . HOH F 6 .   ? 64.266 37.601 19.055  1.00 46.73 ? 557  HOH A O   1 
HETATM 4771 O  O   . HOH F 6 .   ? 19.976 39.643 27.197  1.00 47.28 ? 558  HOH A O   1 
HETATM 4772 O  O   . HOH F 6 .   ? 33.960 40.354 -1.747  1.00 42.83 ? 559  HOH A O   1 
HETATM 4773 O  O   . HOH F 6 .   ? 50.702 84.111 -3.680  1.00 43.70 ? 560  HOH A O   1 
HETATM 4774 O  O   . HOH F 6 .   ? 68.607 77.715 -1.738  1.00 38.93 ? 561  HOH A O   1 
HETATM 4775 O  O   . HOH F 6 .   ? 23.227 30.093 28.517  1.00 44.01 ? 562  HOH A O   1 
HETATM 4776 O  O   . HOH F 6 .   ? 34.552 59.458 27.499  1.00 42.19 ? 563  HOH A O   1 
HETATM 4777 O  O   . HOH F 6 .   ? 60.176 49.270 21.536  1.00 52.87 ? 564  HOH A O   1 
HETATM 4778 O  O   . HOH F 6 .   ? 63.780 74.836 -22.461 1.00 44.48 ? 565  HOH A O   1 
HETATM 4779 O  O   . HOH F 6 .   ? 71.963 65.149 9.628   1.00 41.83 ? 566  HOH A O   1 
HETATM 4780 O  O   . HOH F 6 .   ? 59.385 41.877 -7.461  1.00 41.04 ? 567  HOH A O   1 
HETATM 4781 O  O   . HOH F 6 .   ? 48.373 27.098 9.559   1.00 40.14 ? 568  HOH A O   1 
HETATM 4782 O  O   . HOH F 6 .   ? 46.458 53.349 28.817  1.00 41.96 ? 569  HOH A O   1 
HETATM 4783 O  O   . HOH F 6 .   ? 75.577 65.059 7.339   1.00 49.20 ? 570  HOH A O   1 
HETATM 4784 O  O   . HOH F 6 .   ? 42.658 28.262 20.568  1.00 43.15 ? 571  HOH A O   1 
HETATM 4785 O  O   . HOH F 6 .   ? 43.610 73.342 -26.536 1.00 38.84 ? 572  HOH A O   1 
HETATM 4786 O  O   . HOH F 6 .   ? 73.433 70.561 -9.220  1.00 50.18 ? 573  HOH A O   1 
HETATM 4787 O  O   . HOH F 6 .   ? 43.055 44.256 -20.888 1.00 36.06 ? 574  HOH A O   1 
HETATM 4788 O  O   . HOH F 6 .   ? 51.610 53.930 22.494  1.00 50.80 ? 575  HOH A O   1 
HETATM 4789 O  O   . HOH F 6 .   ? 48.784 39.343 -8.382  1.00 16.22 ? 576  HOH A O   1 
HETATM 4790 O  O   . HOH F 6 .   ? 53.347 39.967 -7.450  1.00 30.28 ? 577  HOH A O   1 
HETATM 4791 O  O   . HOH F 6 .   ? 39.148 59.666 24.871  1.00 21.83 ? 578  HOH A O   1 
HETATM 4792 O  O   . HOH F 6 .   ? 34.760 61.746 -5.185  1.00 34.11 ? 579  HOH A O   1 
HETATM 4793 O  O   . HOH F 6 .   ? 55.071 37.993 -2.478  1.00 24.57 ? 580  HOH A O   1 
HETATM 4794 O  O   . HOH F 6 .   ? 34.927 46.986 0.380   1.00 45.60 ? 581  HOH A O   1 
HETATM 4795 O  O   . HOH F 6 .   ? 30.371 57.050 27.210  1.00 19.98 ? 582  HOH A O   1 
HETATM 4796 O  O   . HOH F 6 .   ? 58.409 32.700 12.350  1.00 36.42 ? 583  HOH A O   1 
HETATM 4797 O  O   . HOH F 6 .   ? 27.370 86.559 -21.754 1.00 22.46 ? 584  HOH A O   1 
HETATM 4798 O  O   . HOH F 6 .   ? 25.296 28.231 22.354  1.00 29.93 ? 585  HOH A O   1 
HETATM 4799 O  O   . HOH F 6 .   ? 34.803 27.520 6.128   1.00 29.44 ? 586  HOH A O   1 
HETATM 4800 O  O   . HOH F 6 .   ? 45.377 42.497 -20.340 1.00 30.11 ? 587  HOH A O   1 
HETATM 4801 O  O   . HOH F 6 .   ? 58.367 36.746 3.027   1.00 32.57 ? 588  HOH A O   1 
HETATM 4802 O  O   . HOH F 6 .   ? 72.596 40.838 5.492   1.00 31.97 ? 589  HOH A O   1 
HETATM 4803 O  O   . HOH F 6 .   ? 32.467 42.904 -23.375 1.00 55.76 ? 590  HOH A O   1 
HETATM 4804 O  O   . HOH F 6 .   ? 35.123 37.329 30.657  1.00 46.10 ? 591  HOH A O   1 
HETATM 4805 O  O   . HOH F 6 .   ? 22.115 64.691 25.733  1.00 28.83 ? 592  HOH A O   1 
HETATM 4806 O  O   . HOH F 6 .   ? 63.530 40.606 -2.979  1.00 55.25 ? 593  HOH A O   1 
HETATM 4807 O  O   . HOH F 6 .   ? 73.763 44.788 3.563   1.00 33.73 ? 594  HOH A O   1 
HETATM 4808 O  O   . HOH F 6 .   ? 40.909 38.926 33.682  1.00 41.36 ? 595  HOH A O   1 
HETATM 4809 O  O   . HOH F 6 .   ? 18.590 37.102 28.984  1.00 29.94 ? 596  HOH A O   1 
HETATM 4810 O  O   . HOH F 6 .   ? 48.973 29.093 15.271  1.00 38.44 ? 597  HOH A O   1 
HETATM 4811 O  O   . HOH F 6 .   ? 52.567 83.591 -5.637  1.00 51.37 ? 598  HOH A O   1 
HETATM 4812 O  O   . HOH F 6 .   ? 72.079 42.393 1.645   1.00 45.14 ? 599  HOH A O   1 
HETATM 4813 O  O   . HOH F 6 .   ? 61.159 83.793 1.843   1.00 54.95 ? 600  HOH A O   1 
HETATM 4814 O  O   . HOH F 6 .   ? 74.109 43.031 5.943   1.00 29.52 ? 605  HOH A O   1 
HETATM 4815 O  O   . HOH F 6 .   ? 41.679 75.785 -29.381 1.00 45.77 ? 606  HOH A O   1 
HETATM 4816 O  O   . HOH F 6 .   ? 44.023 46.268 -12.745 1.00 11.68 ? 607  HOH A O   1 
HETATM 4817 O  O   . HOH F 6 .   ? 43.237 76.197 -16.968 1.00 11.87 ? 608  HOH A O   1 
HETATM 4818 O  O   . HOH F 6 .   ? 59.550 63.464 7.924   1.00 12.42 ? 609  HOH A O   1 
HETATM 4819 O  O   . HOH F 6 .   ? 63.922 47.209 7.197   1.00 16.16 ? 610  HOH A O   1 
HETATM 4820 O  O   . HOH F 6 .   ? 47.312 37.557 -6.981  1.00 15.99 ? 611  HOH A O   1 
HETATM 4821 O  O   . HOH F 6 .   ? 42.715 53.499 18.269  1.00 20.05 ? 612  HOH A O   1 
HETATM 4822 O  O   . HOH F 6 .   ? 56.252 76.414 2.595   1.00 18.32 ? 613  HOH A O   1 
HETATM 4823 O  O   . HOH F 6 .   ? 37.271 61.756 24.704  1.00 21.50 ? 614  HOH A O   1 
HETATM 4824 O  O   . HOH F 6 .   ? 73.277 62.844 -0.999  1.00 22.37 ? 615  HOH A O   1 
HETATM 4825 O  O   . HOH F 6 .   ? 57.539 43.709 -10.694 1.00 45.69 ? 616  HOH A O   1 
HETATM 4826 O  O   . HOH F 6 .   ? 50.261 42.254 22.133  1.00 26.42 ? 617  HOH A O   1 
HETATM 4827 O  O   . HOH F 6 .   ? 64.067 62.528 -12.680 1.00 21.17 ? 618  HOH A O   1 
HETATM 4828 O  O   . HOH F 6 .   ? 17.840 70.120 18.258  1.00 26.68 ? 619  HOH A O   1 
HETATM 4829 O  O   . HOH F 6 .   ? 35.857 59.768 -5.222  1.00 27.76 ? 620  HOH A O   1 
HETATM 4830 O  O   . HOH F 6 .   ? 43.770 55.978 23.030  1.00 37.91 ? 621  HOH A O   1 
HETATM 4831 O  O   . HOH F 6 .   ? 45.962 59.051 18.586  1.00 45.08 ? 622  HOH A O   1 
HETATM 4832 O  O   . HOH F 6 .   ? 65.363 51.778 -8.235  1.00 25.02 ? 623  HOH A O   1 
HETATM 4833 O  O   . HOH F 6 .   ? 60.397 36.780 7.131   1.00 30.57 ? 624  HOH A O   1 
HETATM 4834 O  O   . HOH F 6 .   ? 34.703 39.099 -19.401 1.00 44.09 ? 625  HOH A O   1 
HETATM 4835 O  O   . HOH F 6 .   ? 35.218 45.283 -1.091  1.00 33.79 ? 626  HOH A O   1 
HETATM 4836 O  O   . HOH F 6 .   ? 32.574 51.252 7.323   1.00 29.97 ? 627  HOH A O   1 
HETATM 4837 O  O   . HOH F 6 .   ? 27.008 49.718 26.397  1.00 32.64 ? 628  HOH A O   1 
HETATM 4838 O  O   . HOH F 6 .   ? 57.550 32.294 9.339   1.00 36.49 ? 629  HOH A O   1 
HETATM 4839 O  O   . HOH F 6 .   ? 34.356 36.299 28.766  1.00 31.70 ? 630  HOH A O   1 
HETATM 4840 O  O   . HOH F 6 .   ? 71.136 62.718 -7.986  1.00 29.17 ? 631  HOH A O   1 
HETATM 4841 O  O   . HOH F 6 .   ? 26.871 90.438 -35.293 1.00 36.78 ? 632  HOH A O   1 
HETATM 4842 O  O   . HOH F 6 .   ? 68.848 78.795 -7.170  1.00 53.56 ? 633  HOH A O   1 
HETATM 4843 O  O   . HOH F 6 .   ? 49.937 45.122 29.105  1.00 40.79 ? 634  HOH A O   1 
HETATM 4844 O  O   . HOH F 6 .   ? 64.966 67.964 10.819  1.00 27.80 ? 635  HOH A O   1 
HETATM 4845 O  O   . HOH F 6 .   ? 69.750 49.711 7.217   1.00 42.13 ? 636  HOH A O   1 
HETATM 4846 O  O   . HOH F 6 .   ? 54.058 28.593 14.113  1.00 47.45 ? 637  HOH A O   1 
HETATM 4847 O  O   . HOH F 6 .   ? 59.972 55.899 23.966  1.00 51.49 ? 638  HOH A O   1 
HETATM 4848 O  O   . HOH F 6 .   ? 31.878 68.630 39.199  1.00 52.81 ? 639  HOH A O   1 
HETATM 4849 O  O   . HOH F 6 .   ? 63.537 58.977 -18.448 1.00 39.67 ? 640  HOH A O   1 
HETATM 4850 O  O   . HOH F 6 .   ? 50.086 47.621 28.987  1.00 48.61 ? 641  HOH A O   1 
HETATM 4851 O  O   . HOH F 6 .   ? 45.982 42.076 -17.960 1.00 32.24 ? 642  HOH A O   1 
HETATM 4852 O  O   . HOH F 6 .   ? 58.927 38.045 7.286   1.00 28.20 ? 643  HOH A O   1 
HETATM 4853 O  O   . HOH F 6 .   ? 75.026 65.714 -1.389  1.00 18.61 ? 644  HOH A O   1 
HETATM 4854 O  O   . HOH F 6 .   ? 74.110 66.741 3.204   1.00 37.70 ? 645  HOH A O   1 
HETATM 4855 O  O   . HOH F 6 .   ? 75.578 68.375 2.628   1.00 42.53 ? 646  HOH A O   1 
HETATM 4856 O  O   . HOH F 6 .   ? 67.809 60.471 15.684  1.00 47.90 ? 647  HOH A O   1 
HETATM 4857 O  O   . HOH F 6 .   ? 29.947 28.092 6.456   1.00 24.07 ? 648  HOH A O   1 
HETATM 4858 O  O   . HOH F 6 .   ? 32.072 26.561 27.713  1.00 37.39 ? 649  HOH A O   1 
HETATM 4859 O  O   . HOH F 6 .   ? 55.532 39.343 -4.667  1.00 35.88 ? 650  HOH A O   1 
HETATM 4860 O  O   . HOH F 6 .   ? 52.424 41.105 -9.282  1.00 35.47 ? 651  HOH A O   1 
HETATM 4861 O  O   . HOH F 6 .   ? 63.615 45.116 -5.773  1.00 37.25 ? 652  HOH A O   1 
HETATM 4862 O  O   . HOH F 6 .   ? 72.405 57.349 -3.615  1.00 40.14 ? 653  HOH A O   1 
HETATM 4863 O  O   . HOH F 6 .   ? 71.541 56.181 -1.333  1.00 37.22 ? 654  HOH A O   1 
HETATM 4864 O  O   . HOH F 6 .   ? 53.520 77.449 16.655  1.00 32.42 ? 655  HOH A O   1 
HETATM 4865 O  O   . HOH F 6 .   ? 53.550 80.369 8.970   1.00 37.12 ? 656  HOH A O   1 
HETATM 4866 O  O   . HOH F 6 .   ? 43.124 84.595 -7.503  1.00 31.63 ? 657  HOH A O   1 
HETATM 4867 O  O   . HOH F 6 .   ? 38.442 39.173 -16.252 1.00 26.70 ? 658  HOH A O   1 
HETATM 4868 O  O   . HOH F 6 .   ? 36.041 38.395 -17.419 1.00 32.65 ? 659  HOH A O   1 
HETATM 4869 O  O   . HOH F 6 .   ? 28.934 41.392 -17.789 1.00 35.51 ? 660  HOH A O   1 
HETATM 4870 O  O   . HOH F 6 .   ? 38.463 49.315 -27.430 1.00 35.45 ? 661  HOH A O   1 
HETATM 4871 O  O   . HOH F 6 .   ? 45.667 69.670 -28.555 1.00 55.43 ? 662  HOH A O   1 
HETATM 4872 O  O   . HOH F 6 .   ? 29.013 83.085 -37.872 1.00 42.62 ? 663  HOH A O   1 
HETATM 4873 O  O   . HOH F 6 .   ? 39.562 83.885 -18.615 1.00 23.73 ? 664  HOH A O   1 
HETATM 4874 O  O   . HOH F 6 .   ? 70.394 49.309 14.156  1.00 33.65 ? 665  HOH A O   1 
HETATM 4875 O  O   . HOH F 6 .   ? 70.867 47.042 14.101  1.00 24.15 ? 666  HOH A O   1 
HETATM 4876 O  O   . HOH F 6 .   ? 61.710 81.473 6.897   1.00 44.53 ? 667  HOH A O   1 
HETATM 4877 O  O   . HOH F 6 .   ? 68.923 83.532 -4.217  1.00 41.16 ? 668  HOH A O   1 
HETATM 4878 O  O   . HOH F 6 .   ? 60.583 87.191 -14.419 1.00 55.07 ? 669  HOH A O   1 
HETATM 4879 O  O   . HOH F 6 .   ? 50.022 80.777 -20.762 1.00 51.81 ? 670  HOH A O   1 
HETATM 4880 O  O   . HOH F 6 .   ? 50.175 78.290 -22.516 1.00 33.86 ? 671  HOH A O   1 
HETATM 4881 O  O   . HOH F 6 .   ? 65.785 57.422 -15.351 1.00 43.99 ? 672  HOH A O   1 
HETATM 4882 O  O   . HOH F 6 .   ? 67.558 52.222 -9.579  1.00 46.76 ? 673  HOH A O   1 
HETATM 4883 O  O   . HOH F 6 .   ? 56.717 51.819 -18.164 1.00 42.91 ? 674  HOH A O   1 
HETATM 4884 O  O   . HOH F 6 .   ? 72.141 64.653 -11.346 1.00 43.98 ? 675  HOH A O   1 
HETATM 4885 O  O   A HOH F 6 .   ? 74.479 59.303 7.352   0.60 28.88 ? 676  HOH A O   1 
HETATM 4886 O  O   . HOH F 6 .   ? 71.758 58.076 14.355  1.00 46.21 ? 677  HOH A O   1 
HETATM 4887 O  O   . HOH F 6 .   ? 67.278 62.549 13.478  1.00 57.95 ? 678  HOH A O   1 
HETATM 4888 O  O   . HOH F 6 .   ? 70.626 57.161 16.708  1.00 41.70 ? 679  HOH A O   1 
HETATM 4889 O  O   A HOH F 6 .   ? 47.931 30.018 4.988   0.60 47.67 ? 680  HOH A O   1 
HETATM 4890 O  O   A HOH F 6 .   ? 49.283 28.727 8.112   0.60 34.44 ? 681  HOH A O   1 
HETATM 4891 O  O   . HOH F 6 .   ? 24.083 28.949 9.879   1.00 52.99 ? 682  HOH A O   1 
HETATM 4892 O  O   . HOH F 6 .   ? 32.632 31.158 4.797   1.00 57.78 ? 683  HOH A O   1 
HETATM 4893 O  O   . HOH F 6 .   ? 45.515 40.239 33.707  1.00 45.78 ? 684  HOH A O   1 
HETATM 4894 O  O   . HOH F 6 .   ? 38.749 48.628 32.213  1.00 52.10 ? 685  HOH A O   1 
HETATM 4895 O  O   . HOH F 6 .   ? 36.933 47.064 27.921  1.00 47.83 ? 686  HOH A O   1 
HETATM 4896 O  O   . HOH F 6 .   ? 37.829 49.556 29.761  1.00 48.71 ? 687  HOH A O   1 
HETATM 4897 O  O   . HOH F 6 .   ? 35.642 44.364 29.779  1.00 44.27 ? 688  HOH A O   1 
HETATM 4898 O  O   . HOH F 6 .   ? 50.840 33.442 20.915  1.00 48.50 ? 689  HOH A O   1 
HETATM 4899 O  O   . HOH F 6 .   ? 52.359 35.519 21.643  1.00 52.57 ? 690  HOH A O   1 
HETATM 4900 O  O   . HOH F 6 .   ? 67.979 63.714 -17.621 1.00 47.39 ? 691  HOH A O   1 
HETATM 4901 O  O   . HOH F 6 .   ? 52.770 81.916 13.944  1.00 39.63 ? 692  HOH A O   1 
HETATM 4902 O  O   . HOH F 6 .   ? 54.909 81.138 18.571  1.00 38.89 ? 693  HOH A O   1 
HETATM 4903 O  O   . HOH F 6 .   ? 55.073 82.499 12.286  1.00 42.89 ? 694  HOH A O   1 
HETATM 4904 O  O   . HOH F 6 .   ? 46.765 81.585 -8.734  1.00 43.60 ? 695  HOH A O   1 
HETATM 4905 O  O   . HOH F 6 .   ? 28.966 91.653 -28.399 1.00 38.42 ? 696  HOH A O   1 
HETATM 4906 O  O   . HOH F 6 .   ? 34.827 90.700 -32.633 1.00 53.24 ? 697  HOH A O   1 
HETATM 4907 O  O   . HOH F 6 .   ? 31.418 75.757 -30.378 1.00 49.14 ? 698  HOH A O   1 
HETATM 4908 O  O   . HOH F 6 .   ? 36.224 56.438 26.916  1.00 42.93 ? 699  HOH A O   1 
HETATM 4909 O  O   . HOH F 6 .   ? 40.361 57.643 28.296  1.00 54.01 ? 700  HOH A O   1 
HETATM 4910 O  O   . HOH F 6 .   ? 29.388 61.944 34.027  1.00 44.89 ? 701  HOH A O   1 
HETATM 4911 O  O   A HOH F 6 .   ? 27.206 73.999 37.085  0.60 30.62 ? 702  HOH A O   1 
HETATM 4912 O  O   . HOH F 6 .   ? 69.312 70.542 12.467  1.00 43.05 ? 703  HOH A O   1 
HETATM 4913 O  O   . HOH F 6 .   ? 66.928 67.024 12.808  1.00 44.03 ? 704  HOH A O   1 
HETATM 4914 O  O   . HOH F 6 .   ? 67.803 82.362 -11.359 1.00 39.99 ? 705  HOH A O   1 
HETATM 4915 O  O   . HOH F 6 .   ? 68.064 84.737 -9.879  1.00 47.19 ? 706  HOH A O   1 
HETATM 4916 O  O   . HOH F 6 .   ? 59.600 45.289 -13.985 1.00 52.25 ? 707  HOH A O   1 
HETATM 4917 O  O   . HOH F 6 .   ? 41.676 88.923 -25.859 1.00 57.05 ? 708  HOH A O   1 
HETATM 4918 O  O   . HOH F 6 .   ? 49.857 56.642 18.905  1.00 43.46 ? 709  HOH A O   1 
HETATM 4919 O  O   . HOH F 6 .   ? 51.854 71.120 -2.562  1.00 12.04 ? 710  HOH A O   1 
HETATM 4920 O  O   . HOH F 6 .   ? 48.548 43.383 -16.694 1.00 58.04 ? 711  HOH A O   1 
HETATM 4921 O  O   . HOH F 6 .   ? 21.172 42.640 20.407  1.00 40.45 ? 712  HOH A O   1 
HETATM 4922 O  O   . HOH F 6 .   ? 37.768 29.382 1.084   1.00 54.69 ? 713  HOH A O   1 
HETATM 4923 O  O   . HOH F 6 .   ? 42.564 22.323 7.372   1.00 40.47 ? 714  HOH A O   1 
HETATM 4924 O  O   . HOH F 6 .   ? 46.827 27.237 3.023   1.00 58.73 ? 715  HOH A O   1 
HETATM 4925 O  O   . HOH F 6 .   ? 61.045 79.553 10.712  1.00 24.48 ? 716  HOH A O   1 
HETATM 4926 O  O   . HOH F 6 .   ? 62.290 79.155 13.003  1.00 51.02 ? 717  HOH A O   1 
HETATM 4927 O  O   . HOH F 6 .   ? 31.118 31.936 32.892  1.00 45.12 ? 718  HOH A O   1 
HETATM 4928 O  O   . HOH F 6 .   ? 45.135 81.666 -14.303 1.00 50.28 ? 719  HOH A O   1 
HETATM 4929 O  O   . HOH F 6 .   ? 69.141 38.254 8.835   1.00 30.70 ? 720  HOH A O   1 
HETATM 4930 O  O   . HOH F 6 .   ? 64.289 77.419 11.866  1.00 41.70 ? 721  HOH A O   1 
HETATM 4931 O  O   . HOH F 6 .   ? 49.958 62.162 26.431  1.00 39.62 ? 722  HOH A O   1 
HETATM 4932 O  O   . HOH F 6 .   ? 34.524 79.374 29.193  1.00 32.39 ? 723  HOH A O   1 
HETATM 4933 O  O   . HOH F 6 .   ? 43.603 43.917 -11.550 1.00 20.86 ? 724  HOH A O   1 
HETATM 4934 O  O   . HOH F 6 .   ? 57.375 74.419 1.110   1.00 15.51 ? 725  HOH A O   1 
HETATM 4935 O  O   . HOH F 6 .   ? 42.737 73.775 -17.933 1.00 13.21 ? 726  HOH A O   1 
HETATM 4936 O  O   . HOH F 6 .   ? 59.993 63.953 10.451  1.00 13.82 ? 727  HOH A O   1 
HETATM 4937 O  O   . HOH F 6 .   ? 63.619 49.456 8.532   1.00 13.78 ? 728  HOH A O   1 
HETATM 4938 O  O   . HOH F 6 .   ? 34.664 40.975 -18.490 1.00 19.84 ? 729  HOH A O   1 
HETATM 4939 O  O   . HOH F 6 .   ? 42.892 55.612 16.368  1.00 32.22 ? 730  HOH A O   1 
HETATM 4940 O  O   . HOH F 6 .   ? 61.301 44.099 -6.002  1.00 20.43 ? 731  HOH A O   1 
HETATM 4941 O  O   . HOH F 6 .   ? 37.999 79.967 -8.212  1.00 9.62  ? 732  HOH A O   1 
HETATM 4942 O  O   . HOH F 6 .   ? 73.507 64.602 1.033   1.00 15.36 ? 733  HOH A O   1 
HETATM 4943 O  O   . HOH F 6 .   ? 42.415 45.325 -7.791  1.00 10.88 ? 734  HOH A O   1 
HETATM 4944 O  O   . HOH F 6 .   ? 55.869 54.044 11.857  1.00 11.08 ? 735  HOH A O   1 
HETATM 4945 O  O   . HOH F 6 .   ? 39.912 52.053 -2.151  1.00 11.70 ? 736  HOH A O   1 
HETATM 4946 O  O   . HOH F 6 .   ? 28.799 28.536 9.028   1.00 16.35 ? 737  HOH A O   1 
HETATM 4947 O  O   . HOH F 6 .   ? 56.225 39.938 1.438   1.00 12.48 ? 738  HOH A O   1 
HETATM 4948 O  O   . HOH F 6 .   ? 60.186 53.175 8.432   1.00 10.86 ? 739  HOH A O   1 
HETATM 4949 O  O   . HOH F 6 .   ? 63.123 40.240 6.925   1.00 12.86 ? 740  HOH A O   1 
HETATM 4950 O  O   . HOH F 6 .   ? 56.972 56.362 15.913  1.00 13.71 ? 741  HOH A O   1 
HETATM 4951 O  O   . HOH F 6 .   ? 37.906 65.483 -1.842  1.00 15.60 ? 742  HOH A O   1 
HETATM 4952 O  O   . HOH F 6 .   ? 57.697 41.456 3.238   1.00 14.44 ? 743  HOH A O   1 
HETATM 4953 O  O   . HOH F 6 .   ? 52.937 66.985 3.244   1.00 11.55 ? 744  HOH A O   1 
HETATM 4954 O  O   . HOH F 6 .   ? 29.084 52.390 15.789  1.00 9.77  ? 745  HOH A O   1 
HETATM 4955 O  O   . HOH F 6 .   ? 44.227 73.267 -11.476 1.00 12.43 ? 746  HOH A O   1 
HETATM 4956 O  O   . HOH F 6 .   ? 63.537 54.557 12.800  1.00 11.02 ? 747  HOH A O   1 
HETATM 4957 O  O   . HOH F 6 .   ? 57.919 56.640 5.120   1.00 12.75 ? 748  HOH A O   1 
HETATM 4958 O  O   . HOH F 6 .   ? 61.817 43.321 9.520   1.00 10.28 ? 749  HOH A O   1 
HETATM 4959 O  O   . HOH F 6 .   ? 49.701 67.882 5.014   1.00 11.28 ? 750  HOH A O   1 
HETATM 4960 O  O   . HOH F 6 .   ? 63.396 47.945 -5.892  1.00 14.49 ? 751  HOH A O   1 
HETATM 4961 O  O   . HOH F 6 .   ? 55.740 56.379 13.430  1.00 12.24 ? 752  HOH A O   1 
HETATM 4962 O  O   . HOH F 6 .   ? 53.109 65.282 -15.920 1.00 9.92  ? 753  HOH A O   1 
HETATM 4963 O  O   . HOH F 6 .   ? 41.548 51.198 -14.846 1.00 12.88 ? 754  HOH A O   1 
HETATM 4964 O  O   . HOH F 6 .   ? 33.320 81.010 -17.188 1.00 9.44  ? 755  HOH A O   1 
HETATM 4965 O  O   . HOH F 6 .   ? 21.694 54.438 7.829   1.00 11.27 ? 756  HOH A O   1 
HETATM 4966 O  O   . HOH F 6 .   ? 35.704 52.015 16.519  1.00 10.65 ? 757  HOH A O   1 
HETATM 4967 O  O   . HOH F 6 .   ? 38.658 59.765 20.415  1.00 12.94 ? 758  HOH A O   1 
HETATM 4968 O  O   . HOH F 6 .   ? 40.285 60.896 5.751   1.00 14.31 ? 759  HOH A O   1 
HETATM 4969 O  O   . HOH F 6 .   ? 61.235 47.476 3.843   1.00 11.83 ? 760  HOH A O   1 
HETATM 4970 O  O   . HOH F 6 .   ? 40.706 51.931 17.196  1.00 12.17 ? 761  HOH A O   1 
HETATM 4971 O  O   . HOH F 6 .   ? 41.408 77.119 -9.742  1.00 11.42 ? 762  HOH A O   1 
HETATM 4972 O  O   . HOH F 6 .   ? 52.171 66.833 16.833  1.00 9.96  ? 763  HOH A O   1 
HETATM 4973 O  O   . HOH F 6 .   ? 38.349 63.078 -10.983 1.00 13.11 ? 764  HOH A O   1 
HETATM 4974 O  O   . HOH F 6 .   ? 50.480 39.887 9.286   1.00 13.52 ? 765  HOH A O   1 
HETATM 4975 O  O   . HOH F 6 .   ? 37.100 49.362 11.008  1.00 13.76 ? 766  HOH A O   1 
HETATM 4976 O  O   . HOH F 6 .   ? 50.987 39.557 21.590  1.00 30.78 ? 767  HOH A O   1 
HETATM 4977 O  O   . HOH F 6 .   ? 46.966 62.265 -17.326 1.00 11.62 ? 768  HOH A O   1 
HETATM 4978 O  O   . HOH F 6 .   ? 38.353 55.846 10.484  1.00 13.08 ? 769  HOH A O   1 
HETATM 4979 O  O   . HOH F 6 .   ? 43.880 63.836 13.119  1.00 12.13 ? 770  HOH A O   1 
HETATM 4980 O  O   . HOH F 6 .   ? 46.843 72.210 -11.854 1.00 11.31 ? 771  HOH A O   1 
HETATM 4981 O  O   . HOH F 6 .   ? 49.914 73.049 -2.615  1.00 11.32 ? 772  HOH A O   1 
HETATM 4982 O  O   . HOH F 6 .   ? 24.593 57.522 16.740  1.00 10.44 ? 773  HOH A O   1 
HETATM 4983 O  O   . HOH F 6 .   ? 52.766 71.875 16.008  1.00 11.95 ? 774  HOH A O   1 
HETATM 4984 O  O   . HOH F 6 .   ? 27.584 53.462 8.719   1.00 13.21 ? 775  HOH A O   1 
HETATM 4985 O  O   . HOH F 6 .   ? 50.372 41.222 -6.928  1.00 12.91 ? 776  HOH A O   1 
HETATM 4986 O  O   . HOH F 6 .   ? 61.347 40.510 9.092   1.00 11.75 ? 777  HOH A O   1 
HETATM 4987 O  O   . HOH F 6 .   ? 54.477 41.653 11.578  1.00 13.33 ? 778  HOH A O   1 
HETATM 4988 O  O   . HOH F 6 .   ? 59.835 43.277 -3.794  1.00 14.43 ? 779  HOH A O   1 
HETATM 4989 O  O   . HOH F 6 .   ? 54.163 66.169 -6.074  1.00 13.03 ? 780  HOH A O   1 
HETATM 4990 O  O   . HOH F 6 .   ? 52.975 70.579 -0.028  1.00 13.17 ? 781  HOH A O   1 
HETATM 4991 O  O   . HOH F 6 .   ? 50.338 64.771 -16.480 1.00 11.58 ? 782  HOH A O   1 
HETATM 4992 O  O   . HOH F 6 .   ? 51.902 65.906 0.039   1.00 12.57 ? 783  HOH A O   1 
HETATM 4993 O  O   . HOH F 6 .   ? 30.975 73.601 21.125  1.00 11.00 ? 784  HOH A O   1 
HETATM 4994 O  O   . HOH F 6 .   ? 53.246 51.411 -16.408 1.00 27.24 ? 785  HOH A O   1 
HETATM 4995 O  O   . HOH F 6 .   ? 45.496 32.744 3.562   1.00 17.60 ? 786  HOH A O   1 
HETATM 4996 O  O   . HOH F 6 .   ? 53.541 58.039 13.250  1.00 13.54 ? 787  HOH A O   1 
HETATM 4997 O  O   . HOH F 6 .   ? 63.550 50.965 -9.246  1.00 30.02 ? 788  HOH A O   1 
HETATM 4998 O  O   . HOH F 6 .   ? 42.203 44.452 10.576  1.00 14.95 ? 789  HOH A O   1 
HETATM 4999 O  O   . HOH F 6 .   ? 54.435 56.103 17.350  1.00 18.65 ? 790  HOH A O   1 
HETATM 5000 O  O   . HOH F 6 .   ? 51.565 69.090 2.019   1.00 11.23 ? 791  HOH A O   1 
HETATM 5001 O  O   . HOH F 6 .   ? 40.144 58.263 -3.743  1.00 14.34 ? 792  HOH A O   1 
HETATM 5002 O  O   . HOH F 6 .   ? 57.095 69.017 14.301  1.00 12.63 ? 793  HOH A O   1 
HETATM 5003 O  O   . HOH F 6 .   ? 48.979 69.497 -16.834 1.00 10.70 ? 794  HOH A O   1 
HETATM 5004 O  O   . HOH F 6 .   ? 53.619 74.521 2.448   1.00 11.91 ? 795  HOH A O   1 
HETATM 5005 O  O   . HOH F 6 .   ? 47.673 40.574 -10.647 1.00 15.02 ? 796  HOH A O   1 
HETATM 5006 O  O   . HOH F 6 .   ? 56.712 48.577 21.263  1.00 25.67 ? 797  HOH A O   1 
HETATM 5007 O  O   . HOH F 6 .   ? 49.126 67.794 1.428   1.00 12.63 ? 798  HOH A O   1 
HETATM 5008 O  O   . HOH F 6 .   ? 51.138 57.853 14.661  1.00 15.81 ? 799  HOH A O   1 
HETATM 5009 O  O   . HOH F 6 .   ? 62.872 74.206 6.035   1.00 11.78 ? 800  HOH A O   1 
HETATM 5010 O  O   . HOH F 6 .   ? 25.840 49.535 24.232  1.00 28.96 ? 801  HOH A O   1 
HETATM 5011 O  O   . HOH F 6 .   ? 68.247 41.048 12.913  1.00 12.88 ? 802  HOH A O   1 
HETATM 5012 O  O   . HOH F 6 .   ? 42.881 54.041 -15.155 1.00 12.32 ? 803  HOH A O   1 
HETATM 5013 O  O   . HOH F 6 .   ? 35.687 28.989 10.391  1.00 11.16 ? 804  HOH A O   1 
HETATM 5014 O  O   . HOH F 6 .   ? 51.780 40.766 11.484  1.00 13.77 ? 805  HOH A O   1 
HETATM 5015 O  O   . HOH F 6 .   ? 60.543 52.878 19.294  1.00 18.56 ? 806  HOH A O   1 
HETATM 5016 O  O   . HOH F 6 .   ? 56.131 59.141 6.099   1.00 12.32 ? 807  HOH A O   1 
HETATM 5017 O  O   . HOH F 6 .   ? 34.537 52.178 8.900   1.00 17.08 ? 808  HOH A O   1 
HETATM 5018 O  O   . HOH F 6 .   ? 54.384 42.933 9.020   1.00 12.50 ? 809  HOH A O   1 
HETATM 5019 O  O   . HOH F 6 .   ? 45.346 75.498 -10.434 1.00 12.74 ? 810  HOH A O   1 
HETATM 5020 O  O   . HOH F 6 .   ? 39.614 62.084 18.784  1.00 12.56 ? 811  HOH A O   1 
HETATM 5021 O  O   . HOH F 6 .   ? 25.153 77.547 20.805  1.00 10.12 ? 812  HOH A O   1 
HETATM 5022 O  O   . HOH F 6 .   ? 48.607 57.655 13.439  1.00 15.24 ? 813  HOH A O   1 
HETATM 5023 O  O   . HOH F 6 .   ? 40.553 64.796 19.166  1.00 13.08 ? 814  HOH A O   1 
HETATM 5024 O  O   . HOH F 6 .   ? 44.900 51.790 17.797  1.00 22.43 ? 815  HOH A O   1 
HETATM 5025 O  O   . HOH F 6 .   ? 52.408 68.300 -5.844  0.70 14.42 ? 816  HOH A O   1 
HETATM 5026 O  O   . HOH F 6 .   ? 42.538 57.954 22.331  1.00 29.19 ? 817  HOH A O   1 
HETATM 5027 O  O   . HOH F 6 .   ? 64.095 61.661 -15.024 1.00 25.32 ? 818  HOH A O   1 
HETATM 5028 O  O   . HOH F 6 .   ? 36.509 65.356 20.604  1.00 12.57 ? 819  HOH A O   1 
HETATM 5029 O  O   . HOH F 6 .   ? 38.763 49.196 -13.025 1.00 14.30 ? 820  HOH A O   1 
HETATM 5030 O  O   . HOH F 6 .   ? 56.002 68.217 16.815  1.00 11.36 ? 821  HOH A O   1 
HETATM 5031 O  O   . HOH F 6 .   ? 54.042 77.828 12.214  1.00 13.61 ? 822  HOH A O   1 
HETATM 5032 O  O   . HOH F 6 .   ? 48.316 41.579 8.823   1.00 13.49 ? 823  HOH A O   1 
HETATM 5033 O  O   . HOH F 6 .   ? 31.919 47.707 6.015   1.00 16.75 ? 824  HOH A O   1 
HETATM 5034 O  O   . HOH F 6 .   ? 63.858 47.096 4.461   1.00 12.47 ? 825  HOH A O   1 
HETATM 5035 O  O   . HOH F 6 .   ? 30.790 63.309 -9.917  1.00 14.92 ? 826  HOH A O   1 
HETATM 5036 O  O   . HOH F 6 .   ? 59.152 70.163 2.497   1.00 12.31 ? 827  HOH A O   1 
HETATM 5037 O  O   . HOH F 6 .   ? 29.125 28.892 16.293  1.00 12.33 ? 828  HOH A O   1 
HETATM 5038 O  O   . HOH F 6 .   ? 32.498 67.202 -17.371 1.00 14.55 ? 829  HOH A O   1 
HETATM 5039 O  O   . HOH F 6 .   ? 44.033 82.141 -5.365  1.00 15.36 ? 830  HOH A O   1 
HETATM 5040 O  O   . HOH F 6 .   ? 47.265 33.020 15.614  1.00 14.50 ? 831  HOH A O   1 
HETATM 5041 O  O   . HOH F 6 .   ? 59.596 64.717 -25.011 1.00 13.29 ? 832  HOH A O   1 
HETATM 5042 O  O   . HOH F 6 .   ? 38.555 59.818 7.701   1.00 16.35 ? 833  HOH A O   1 
HETATM 5043 O  O   . HOH F 6 .   ? 46.989 67.206 -29.080 1.00 27.09 ? 834  HOH A O   1 
HETATM 5044 O  O   . HOH F 6 .   ? 29.851 49.451 9.250   1.00 15.94 ? 835  HOH A O   1 
HETATM 5045 O  O   . HOH F 6 .   ? 65.102 55.722 -11.147 1.00 17.63 ? 836  HOH A O   1 
HETATM 5046 O  O   . HOH F 6 .   ? 69.888 46.632 8.561   1.00 14.22 ? 837  HOH A O   1 
HETATM 5047 O  O   . HOH F 6 .   ? 69.634 70.748 7.475   1.00 16.04 ? 838  HOH A O   1 
HETATM 5048 O  O   . HOH F 6 .   ? 51.330 68.629 -10.197 1.00 17.84 ? 839  HOH A O   1 
HETATM 5049 O  O   . HOH F 6 .   ? 46.036 34.993 -1.151  1.00 13.44 ? 840  HOH A O   1 
HETATM 5050 O  O   . HOH F 6 .   ? 60.898 75.567 4.677   1.00 12.26 ? 841  HOH A O   1 
HETATM 5051 O  O   . HOH F 6 .   ? 68.337 57.622 -1.573  1.00 15.51 ? 842  HOH A O   1 
HETATM 5052 O  O   . HOH F 6 .   ? 31.393 53.091 9.141   1.00 18.51 ? 843  HOH A O   1 
HETATM 5053 O  O   . HOH F 6 .   ? 39.304 45.943 -20.304 1.00 15.19 ? 844  HOH A O   1 
HETATM 5054 O  O   . HOH F 6 .   ? 39.847 58.452 22.567  1.00 14.72 ? 845  HOH A O   1 
HETATM 5055 O  O   . HOH F 6 .   ? 50.164 63.744 -1.361  1.00 17.38 ? 846  HOH A O   1 
HETATM 5056 O  O   . HOH F 6 .   ? 48.088 52.258 7.582   1.00 15.77 ? 847  HOH A O   1 
HETATM 5057 O  O   . HOH F 6 .   ? 51.133 75.979 -21.444 1.00 14.48 ? 848  HOH A O   1 
HETATM 5058 O  O   . HOH F 6 .   ? 69.452 47.331 21.465  1.00 11.74 ? 849  HOH A O   1 
HETATM 5059 O  O   . HOH F 6 .   ? 55.672 79.146 3.114   1.00 14.04 ? 850  HOH A O   1 
HETATM 5060 O  O   . HOH F 6 .   ? 51.878 62.457 19.593  1.00 13.11 ? 851  HOH A O   1 
HETATM 5061 O  O   A HOH F 6 .   ? 57.398 41.347 5.793   0.70 12.02 ? 852  HOH A O   1 
HETATM 5062 O  O   B HOH F 6 .   ? 55.287 39.322 4.254   0.30 14.24 ? 852  HOH A O   1 
HETATM 5063 O  O   . HOH F 6 .   ? 54.961 32.719 15.348  1.00 17.46 ? 853  HOH A O   1 
HETATM 5064 O  O   . HOH F 6 .   ? 48.676 66.610 -5.928  1.00 14.75 ? 854  HOH A O   1 
HETATM 5065 O  O   . HOH F 6 .   ? 70.721 64.580 -6.912  1.00 27.03 ? 855  HOH A O   1 
HETATM 5066 O  O   . HOH F 6 .   ? 27.329 36.069 9.892   1.00 26.52 ? 856  HOH A O   1 
HETATM 5067 O  O   . HOH F 6 .   ? 52.827 63.877 -5.278  1.00 14.42 ? 857  HOH A O   1 
HETATM 5068 O  O   . HOH F 6 .   ? 26.987 39.491 5.822   1.00 20.42 ? 858  HOH A O   1 
HETATM 5069 O  O   . HOH F 6 .   ? 53.139 58.543 17.132  1.00 15.79 ? 859  HOH A O   1 
HETATM 5070 O  O   . HOH F 6 .   ? 45.554 76.146 -3.258  1.00 19.76 ? 860  HOH A O   1 
HETATM 5071 O  O   . HOH F 6 .   ? 28.210 45.662 6.628   1.00 21.48 ? 861  HOH A O   1 
HETATM 5072 O  O   . HOH F 6 .   ? 39.824 34.896 21.707  1.00 15.38 ? 862  HOH A O   1 
HETATM 5073 O  O   . HOH F 6 .   ? 29.118 50.838 24.776  1.00 15.33 ? 863  HOH A O   1 
HETATM 5074 O  O   . HOH F 6 .   ? 42.259 68.470 19.646  1.00 15.63 ? 864  HOH A O   1 
HETATM 5075 O  O   . HOH F 6 .   ? 70.788 57.840 2.544   1.00 15.49 ? 865  HOH A O   1 
HETATM 5076 O  O   . HOH F 6 .   ? 70.818 65.155 1.873   1.00 12.92 ? 866  HOH A O   1 
HETATM 5077 O  O   . HOH F 6 .   ? 59.677 40.981 6.927   1.00 18.91 ? 867  HOH A O   1 
HETATM 5078 O  O   . HOH F 6 .   ? 29.451 47.781 7.196   1.00 24.62 ? 868  HOH A O   1 
HETATM 5079 O  O   . HOH F 6 .   ? 51.341 43.449 -10.551 1.00 20.77 ? 869  HOH A O   1 
HETATM 5080 O  O   . HOH F 6 .   ? 71.446 61.598 -4.103  1.00 16.28 ? 870  HOH A O   1 
HETATM 5081 O  O   . HOH F 6 .   ? 57.702 77.313 -11.740 1.00 14.39 ? 871  HOH A O   1 
HETATM 5082 O  O   . HOH F 6 .   ? 50.794 67.234 -7.801  1.00 16.06 ? 872  HOH A O   1 
HETATM 5083 O  O   . HOH F 6 .   ? 55.818 67.659 -27.366 1.00 19.22 ? 873  HOH A O   1 
HETATM 5084 O  O   . HOH F 6 .   ? 35.044 62.300 -7.939  1.00 18.07 ? 874  HOH A O   1 
HETATM 5085 O  O   . HOH F 6 .   ? 64.406 74.752 8.198   1.00 19.88 ? 875  HOH A O   1 
HETATM 5086 O  O   . HOH F 6 .   ? 68.292 57.136 18.074  1.00 19.28 ? 876  HOH A O   1 
HETATM 5087 O  O   . HOH F 6 .   ? 24.540 45.853 21.630  1.00 16.41 ? 877  HOH A O   1 
HETATM 5088 O  O   . HOH F 6 .   ? 29.852 67.779 -17.743 1.00 23.33 ? 878  HOH A O   1 
HETATM 5089 O  O   . HOH F 6 .   ? 41.341 49.012 -23.795 1.00 18.13 ? 879  HOH A O   1 
HETATM 5090 O  O   . HOH F 6 .   ? 53.682 64.759 -8.444  1.00 15.39 ? 880  HOH A O   1 
HETATM 5091 O  O   . HOH F 6 .   ? 52.621 54.047 17.488  1.00 17.89 ? 881  HOH A O   1 
HETATM 5092 O  O   . HOH F 6 .   ? 50.558 54.965 5.206   1.00 17.07 ? 882  HOH A O   1 
HETATM 5093 O  O   . HOH F 6 .   ? 65.666 68.223 8.523   1.00 21.84 ? 883  HOH A O   1 
HETATM 5094 O  O   . HOH F 6 .   ? 71.897 47.525 18.278  1.00 18.61 ? 884  HOH A O   1 
HETATM 5095 O  O   . HOH F 6 .   ? 37.029 61.323 21.953  1.00 18.53 ? 885  HOH A O   1 
HETATM 5096 O  O   . HOH F 6 .   ? 39.511 51.100 22.438  1.00 15.47 ? 886  HOH A O   1 
HETATM 5097 O  O   . HOH F 6 .   ? 62.900 75.320 11.111  1.00 23.72 ? 887  HOH A O   1 
HETATM 5098 O  O   . HOH F 6 .   ? 53.598 79.508 1.325   1.00 16.62 ? 888  HOH A O   1 
HETATM 5099 O  O   . HOH F 6 .   ? 61.538 38.481 5.171   1.00 21.51 ? 889  HOH A O   1 
HETATM 5100 O  O   . HOH F 6 .   ? 34.265 41.488 2.046   1.00 31.02 ? 890  HOH A O   1 
HETATM 5101 O  O   . HOH F 6 .   ? 63.672 40.157 19.994  1.00 18.78 ? 891  HOH A O   1 
HETATM 5102 O  O   . HOH F 6 .   ? 61.716 62.804 -24.609 1.00 16.32 ? 892  HOH A O   1 
HETATM 5103 O  O   A HOH F 6 .   ? 45.354 52.612 8.454   0.60 10.79 ? 893  HOH A O   1 
HETATM 5104 O  O   . HOH F 6 .   ? 49.290 64.393 -4.118  1.00 18.71 ? 894  HOH A O   1 
HETATM 5105 O  O   . HOH F 6 .   ? 44.376 82.136 -12.090 1.00 33.62 ? 895  HOH A O   1 
HETATM 5106 O  O   . HOH F 6 .   ? 46.039 80.290 -5.490  1.00 20.00 ? 896  HOH A O   1 
HETATM 5107 O  O   . HOH F 6 .   ? 41.793 46.450 -19.330 1.00 18.47 ? 897  HOH A O   1 
HETATM 5108 O  O   . HOH F 6 .   ? 67.366 69.417 6.534   1.00 16.60 ? 898  HOH A O   1 
HETATM 5109 O  O   . HOH F 6 .   ? 32.706 46.080 -24.439 1.00 23.56 ? 899  HOH A O   1 
HETATM 5110 O  O   . HOH F 6 .   ? 58.623 57.824 -21.648 1.00 19.25 ? 900  HOH A O   1 
HETATM 5111 O  O   . HOH F 6 .   ? 61.993 66.997 19.067  1.00 17.82 ? 901  HOH A O   1 
HETATM 5112 O  O   . HOH F 6 .   ? 56.829 39.007 17.383  1.00 13.86 ? 902  HOH A O   1 
HETATM 5113 O  O   . HOH F 6 .   ? 70.158 58.905 0.100   1.00 20.44 ? 903  HOH A O   1 
HETATM 5114 O  O   . HOH F 6 .   ? 37.128 82.293 -18.638 1.00 18.28 ? 904  HOH A O   1 
HETATM 5115 O  O   . HOH F 6 .   ? 41.373 65.549 16.540  1.00 16.71 ? 905  HOH A O   1 
HETATM 5116 O  O   . HOH F 6 .   ? 32.666 50.114 5.127   1.00 31.99 ? 906  HOH A O   1 
HETATM 5117 O  O   . HOH F 6 .   ? 50.525 55.928 16.480  1.00 21.62 ? 907  HOH A O   1 
HETATM 5118 O  O   . HOH F 6 .   ? 59.547 40.528 -4.130  1.00 23.91 ? 908  HOH A O   1 
HETATM 5119 O  O   . HOH F 6 .   ? 66.621 43.320 -1.825  1.00 25.56 ? 909  HOH A O   1 
HETATM 5120 O  O   . HOH F 6 .   ? 57.179 38.045 -0.421  1.00 20.63 ? 910  HOH A O   1 
HETATM 5121 O  O   . HOH F 6 .   ? 36.386 53.675 -26.150 1.00 19.08 ? 911  HOH A O   1 
HETATM 5122 O  O   . HOH F 6 .   ? 28.935 51.484 7.391   1.00 21.10 ? 912  HOH A O   1 
HETATM 5123 O  O   . HOH F 6 .   ? 32.940 51.342 -4.810  1.00 23.45 ? 913  HOH A O   1 
HETATM 5124 O  O   . HOH F 6 .   ? 57.583 36.326 6.813   1.00 28.11 ? 914  HOH A O   1 
HETATM 5125 O  O   . HOH F 6 .   ? 21.599 48.244 7.611   1.00 20.80 ? 915  HOH A O   1 
HETATM 5126 O  O   . HOH F 6 .   ? 36.292 48.058 2.122   1.00 21.25 ? 916  HOH A O   1 
HETATM 5127 O  O   . HOH F 6 .   ? 38.302 48.602 22.996  1.00 19.99 ? 917  HOH A O   1 
HETATM 5128 O  O   . HOH F 6 .   ? 45.177 80.325 -10.433 1.00 25.58 ? 918  HOH A O   1 
HETATM 5129 O  O   . HOH F 6 .   ? 64.639 72.347 14.667  1.00 16.76 ? 919  HOH A O   1 
HETATM 5130 O  O   . HOH F 6 .   ? 66.828 75.341 -17.717 1.00 16.28 ? 920  HOH A O   1 
HETATM 5131 O  O   . HOH F 6 .   ? 44.678 59.825 15.019  1.00 29.46 ? 921  HOH A O   1 
HETATM 5132 O  O   . HOH F 6 .   ? 29.020 42.373 27.542  1.00 22.35 ? 922  HOH A O   1 
HETATM 5133 O  O   . HOH F 6 .   ? 62.832 49.514 -12.300 1.00 26.55 ? 923  HOH A O   1 
HETATM 5134 O  O   . HOH F 6 .   ? 47.119 56.764 6.779   1.00 17.47 ? 924  HOH A O   1 
HETATM 5135 O  O   . HOH F 6 .   ? 46.452 79.262 -15.184 1.00 19.07 ? 925  HOH A O   1 
HETATM 5136 O  O   . HOH F 6 .   ? 43.262 51.045 -23.492 1.00 21.42 ? 926  HOH A O   1 
HETATM 5137 O  O   . HOH F 6 .   ? 43.956 66.000 -27.858 1.00 25.67 ? 927  HOH A O   1 
HETATM 5138 O  O   . HOH F 6 .   ? 29.083 25.657 9.975   1.00 24.17 ? 928  HOH A O   1 
HETATM 5139 O  O   . HOH F 6 .   ? 69.828 55.234 2.374   1.00 18.20 ? 929  HOH A O   1 
HETATM 5140 O  O   . HOH F 6 .   ? 44.728 49.269 -21.799 1.00 19.85 ? 930  HOH A O   1 
HETATM 5141 O  O   . HOH F 6 .   ? 38.687 58.708 -0.805  1.00 22.27 ? 931  HOH A O   1 
HETATM 5142 O  O   . HOH F 6 .   ? 34.068 53.233 -6.375  1.00 21.04 ? 932  HOH A O   1 
HETATM 5143 O  O   . HOH F 6 .   ? 22.389 40.891 14.272  1.00 27.01 ? 933  HOH A O   1 
HETATM 5144 O  O   . HOH F 6 .   ? 30.382 34.911 3.855   1.00 22.45 ? 934  HOH A O   1 
HETATM 5145 O  O   . HOH F 6 .   ? 65.484 49.595 -6.740  1.00 25.03 ? 935  HOH A O   1 
HETATM 5146 O  O   . HOH F 6 .   ? 74.889 58.703 4.949   1.00 38.04 ? 936  HOH A O   1 
HETATM 5147 O  O   . HOH F 6 .   ? 63.879 53.361 -10.725 1.00 19.26 ? 937  HOH A O   1 
HETATM 5148 O  O   . HOH F 6 .   ? 65.753 71.343 5.642   1.00 18.47 ? 938  HOH A O   1 
HETATM 5149 O  O   . HOH F 6 .   ? 68.344 46.605 4.357   1.00 21.62 ? 939  HOH A O   1 
HETATM 5150 O  O   . HOH F 6 .   ? 54.573 37.490 17.823  1.00 21.30 ? 940  HOH A O   1 
HETATM 5151 O  O   . HOH F 6 .   ? 57.939 79.393 -13.505 1.00 18.18 ? 941  HOH A O   1 
HETATM 5152 O  O   . HOH F 6 .   ? 52.076 44.156 14.173  1.00 22.23 ? 942  HOH A O   1 
HETATM 5153 O  O   . HOH F 6 .   ? 59.075 78.287 -20.601 1.00 16.06 ? 943  HOH A O   1 
HETATM 5154 O  O   . HOH F 6 .   ? 62.025 71.596 -20.871 1.00 18.27 ? 944  HOH A O   1 
HETATM 5155 O  O   . HOH F 6 .   ? 67.700 48.543 8.002   1.00 34.37 ? 945  HOH A O   1 
HETATM 5156 O  O   . HOH F 6 .   ? 33.258 62.079 30.919  1.00 20.72 ? 946  HOH A O   1 
HETATM 5157 O  O   . HOH F 6 .   ? 72.315 64.431 4.843   1.00 19.34 ? 947  HOH A O   1 
HETATM 5158 O  O   . HOH F 6 .   ? 64.534 72.112 -19.379 1.00 19.80 ? 948  HOH A O   1 
HETATM 5159 O  O   . HOH F 6 .   ? 46.424 51.378 14.039  1.00 19.84 ? 949  HOH A O   1 
HETATM 5160 O  O   . HOH F 6 .   ? 30.418 51.811 26.986  1.00 21.59 ? 950  HOH A O   1 
HETATM 5161 O  O   . HOH F 6 .   ? 62.760 66.530 10.323  1.00 19.59 ? 951  HOH A O   1 
HETATM 5162 O  O   . HOH F 6 .   ? 52.897 45.796 -11.213 1.00 20.66 ? 952  HOH A O   1 
HETATM 5163 O  O   . HOH F 6 .   ? 35.678 34.276 26.943  1.00 18.78 ? 953  HOH A O   1 
HETATM 5164 O  O   . HOH F 6 .   ? 71.168 55.778 -7.943  1.00 21.56 ? 954  HOH A O   1 
HETATM 5165 O  O   . HOH F 6 .   ? 58.752 67.168 -26.166 1.00 19.67 ? 955  HOH A O   1 
HETATM 5166 O  O   . HOH F 6 .   ? 62.017 70.103 21.152  1.00 22.97 ? 956  HOH A O   1 
HETATM 5167 O  O   . HOH F 6 .   ? 48.631 44.620 30.814  1.00 34.91 ? 957  HOH A O   1 
HETATM 5168 O  O   . HOH F 6 .   ? 43.657 52.543 22.326  1.00 22.11 ? 958  HOH A O   1 
HETATM 5169 O  O   . HOH F 6 .   ? 71.866 60.536 -1.356  1.00 22.05 ? 959  HOH A O   1 
HETATM 5170 O  O   . HOH F 6 .   ? 51.525 58.253 20.281  1.00 25.83 ? 960  HOH A O   1 
HETATM 5171 O  O   . HOH F 6 .   ? 21.986 39.623 19.824  1.00 25.67 ? 961  HOH A O   1 
HETATM 5172 O  O   . HOH F 6 .   ? 35.650 30.514 4.274   1.00 22.31 ? 962  HOH A O   1 
HETATM 5173 O  O   . HOH F 6 .   ? 63.787 42.815 24.464  1.00 28.73 ? 963  HOH A O   1 
HETATM 5174 O  O   . HOH F 6 .   ? 66.719 75.390 0.233   1.00 20.11 ? 964  HOH A O   1 
HETATM 5175 O  O   . HOH F 6 .   ? 36.619 56.659 4.193   1.00 38.59 ? 965  HOH A O   1 
HETATM 5176 O  O   . HOH F 6 .   ? 43.320 75.164 -2.074  1.00 18.47 ? 966  HOH A O   1 
HETATM 5177 O  O   . HOH F 6 .   ? 45.541 30.708 15.203  1.00 21.80 ? 967  HOH A O   1 
HETATM 5178 O  O   . HOH F 6 .   ? 44.327 80.264 -22.795 1.00 22.19 ? 968  HOH A O   1 
HETATM 5179 O  O   . HOH F 6 .   ? 46.420 27.586 11.091  1.00 21.04 ? 969  HOH A O   1 
HETATM 5180 O  O   . HOH F 6 .   ? 56.437 34.889 8.765   1.00 21.52 ? 970  HOH A O   1 
HETATM 5181 O  O   . HOH F 6 .   ? 52.351 79.656 12.877  1.00 25.64 ? 971  HOH A O   1 
HETATM 5182 O  O   . HOH F 6 .   ? 66.504 47.521 0.707   1.00 23.02 ? 972  HOH A O   1 
HETATM 5183 O  O   . HOH F 6 .   ? 47.879 52.663 16.269  1.00 44.31 ? 973  HOH A O   1 
HETATM 5184 O  O   . HOH F 6 .   ? 35.080 29.712 25.142  1.00 35.39 ? 974  HOH A O   1 
HETATM 5185 O  O   . HOH F 6 .   ? 42.756 47.492 -22.075 1.00 26.90 ? 975  HOH A O   1 
HETATM 5186 O  O   . HOH F 6 .   ? 66.192 47.990 3.321   1.00 25.83 ? 976  HOH A O   1 
HETATM 5187 O  O   . HOH F 6 .   ? 57.689 51.485 -15.799 1.00 24.00 ? 977  HOH A O   1 
HETATM 5188 O  O   . HOH F 6 .   ? 24.269 41.420 26.767  1.00 22.50 ? 978  HOH A O   1 
HETATM 5189 O  O   . HOH F 6 .   ? 58.880 38.996 4.378   1.00 21.09 ? 979  HOH A O   1 
HETATM 5190 O  O   . HOH F 6 .   ? 33.234 25.612 19.445  1.00 23.33 ? 980  HOH A O   1 
HETATM 5191 O  O   . HOH F 6 .   ? 63.131 36.833 9.620   1.00 23.89 ? 981  HOH A O   1 
HETATM 5192 O  O   . HOH F 6 .   ? 63.829 55.651 -14.072 1.00 24.84 ? 982  HOH A O   1 
HETATM 5193 O  O   . HOH F 6 .   ? 45.202 55.431 8.239   1.00 21.68 ? 983  HOH A O   1 
HETATM 5194 O  O   . HOH F 6 .   ? 64.621 38.150 7.908   1.00 21.43 ? 984  HOH A O   1 
HETATM 5195 O  O   . HOH F 6 .   ? 35.828 57.778 7.217   1.00 50.04 ? 985  HOH A O   1 
HETATM 5196 O  O   A HOH F 6 .   ? 45.915 61.674 21.652  0.70 23.79 ? 986  HOH A O   1 
HETATM 5197 O  O   B HOH F 6 .   ? 47.132 65.290 26.816  0.30 55.35 ? 986  HOH A O   1 
HETATM 5198 O  O   . HOH F 6 .   ? 32.542 52.506 -27.268 1.00 20.72 ? 987  HOH A O   1 
HETATM 5199 O  O   . HOH F 6 .   ? 26.516 41.613 28.274  1.00 22.07 ? 988  HOH A O   1 
HETATM 5200 O  O   . HOH F 6 .   ? 19.202 34.527 23.324  1.00 22.06 ? 989  HOH A O   1 
HETATM 5201 O  O   . HOH F 6 .   ? 51.922 44.778 21.551  1.00 27.14 ? 990  HOH A O   1 
HETATM 5202 O  O   . HOH F 6 .   ? 52.097 44.620 25.982  1.00 27.65 ? 991  HOH A O   1 
HETATM 5203 O  O   . HOH F 6 .   ? 26.399 84.967 -26.839 1.00 26.92 ? 992  HOH A O   1 
HETATM 5204 O  O   . HOH F 6 .   ? 50.293 78.364 -14.079 1.00 31.96 ? 993  HOH A O   1 
HETATM 5205 O  O   . HOH F 6 .   ? 59.213 79.952 18.427  1.00 21.31 ? 994  HOH A O   1 
HETATM 5206 O  O   . HOH F 6 .   ? 52.826 46.989 15.033  1.00 21.47 ? 995  HOH A O   1 
HETATM 5207 O  O   . HOH F 6 .   ? 33.902 72.370 30.968  1.00 33.27 ? 996  HOH A O   1 
HETATM 5208 O  O   . HOH F 6 .   ? 35.710 35.579 -1.266  1.00 30.88 ? 997  HOH A O   1 
HETATM 5209 O  O   . HOH F 6 .   ? 26.072 28.056 26.933  1.00 20.30 ? 998  HOH A O   1 
HETATM 5210 O  O   . HOH F 6 .   ? 27.861 35.697 5.188   1.00 28.53 ? 999  HOH A O   1 
HETATM 5211 O  O   . HOH F 6 .   ? 44.232 29.882 17.468  1.00 22.90 ? 1000 HOH A O   1 
HETATM 5212 O  O   . HOH F 6 .   ? 56.954 77.384 19.610  1.00 19.02 ? 1001 HOH A O   1 
HETATM 5213 O  O   . HOH F 6 .   ? 39.823 51.066 28.627  1.00 37.17 ? 1002 HOH A O   1 
HETATM 5214 O  O   . HOH F 6 .   ? 44.446 57.096 13.965  1.00 26.11 ? 1003 HOH A O   1 
HETATM 5215 O  O   . HOH F 6 .   ? 35.627 30.361 7.048   1.00 20.98 ? 1004 HOH A O   1 
HETATM 5216 O  O   . HOH F 6 .   ? 50.528 48.206 14.693  1.00 21.76 ? 1005 HOH A O   1 
HETATM 5217 O  O   . HOH F 6 .   ? 36.707 37.462 0.614   1.00 25.83 ? 1006 HOH A O   1 
HETATM 5218 O  O   . HOH F 6 .   ? 35.960 54.745 7.370   1.00 31.01 ? 1007 HOH A O   1 
HETATM 5219 O  O   . HOH F 6 .   ? 34.002 49.446 2.763   1.00 36.23 ? 1008 HOH A O   1 
HETATM 5220 O  O   . HOH F 6 .   ? 42.324 82.202 -13.811 1.00 21.55 ? 1009 HOH A O   1 
HETATM 5221 O  O   . HOH F 6 .   ? 68.603 52.380 -7.190  1.00 24.68 ? 1010 HOH A O   1 
HETATM 5222 O  O   . HOH F 6 .   ? 66.751 53.080 18.418  1.00 30.90 ? 1011 HOH A O   1 
HETATM 5223 O  O   . HOH F 6 .   ? 68.239 49.881 -5.990  1.00 28.28 ? 1012 HOH A O   1 
HETATM 5224 O  O   . HOH F 6 .   ? 67.825 54.824 -11.388 1.00 36.70 ? 1013 HOH A O   1 
HETATM 5225 O  O   . HOH F 6 .   ? 71.490 66.684 -8.391  1.00 37.52 ? 1014 HOH A O   1 
HETATM 5226 O  O   . HOH F 6 .   ? 64.570 60.790 19.906  1.00 28.07 ? 1015 HOH A O   1 
HETATM 5227 O  O   . HOH F 6 .   ? 48.802 33.224 18.057  1.00 22.17 ? 1016 HOH A O   1 
HETATM 5228 O  O   . HOH F 6 .   ? 70.049 69.638 9.934   1.00 27.96 ? 1017 HOH A O   1 
HETATM 5229 O  O   . HOH F 6 .   ? 71.913 70.166 6.149   1.00 20.59 ? 1018 HOH A O   1 
HETATM 5230 O  O   . HOH F 6 .   ? 66.277 65.434 -15.627 1.00 25.50 ? 1019 HOH A O   1 
HETATM 5231 O  O   . HOH F 6 .   ? 23.690 46.654 6.611   1.00 29.01 ? 1020 HOH A O   1 
HETATM 5232 O  O   . HOH F 6 .   ? 69.309 77.669 5.052   1.00 30.28 ? 1021 HOH A O   1 
HETATM 5233 O  O   . HOH F 6 .   ? 23.959 46.874 24.006  1.00 24.95 ? 1022 HOH A O   1 
HETATM 5234 O  O   . HOH F 6 .   ? 26.471 29.732 8.212   1.00 25.70 ? 1023 HOH A O   1 
HETATM 5235 O  O   . HOH F 6 .   ? 38.303 45.138 29.260  1.00 24.54 ? 1024 HOH A O   1 
HETATM 5236 O  O   . HOH F 6 .   ? 46.805 32.696 0.825   1.00 26.88 ? 1025 HOH A O   1 
HETATM 5237 O  O   . HOH F 6 .   ? 48.795 40.053 -14.843 1.00 24.76 ? 1026 HOH A O   1 
HETATM 5238 O  O   . HOH F 6 .   ? 48.230 80.659 -4.131  1.00 27.23 ? 1027 HOH A O   1 
HETATM 5239 O  O   . HOH F 6 .   ? 43.584 84.912 -27.837 1.00 25.97 ? 1028 HOH A O   1 
HETATM 5240 O  O   . HOH F 6 .   ? 65.890 59.321 21.911  1.00 39.62 ? 1029 HOH A O   1 
HETATM 5241 O  O   . HOH F 6 .   ? 65.807 83.360 2.526   1.00 48.45 ? 1030 HOH A O   1 
HETATM 5242 O  O   . HOH F 6 .   ? 37.687 62.716 3.610   1.00 29.54 ? 1031 HOH A O   1 
HETATM 5243 O  O   . HOH F 6 .   ? 48.214 62.084 20.392  1.00 33.18 ? 1032 HOH A O   1 
HETATM 5244 O  O   . HOH F 6 .   ? 52.943 35.696 -1.816  1.00 27.57 ? 1033 HOH A O   1 
HETATM 5245 O  O   . HOH F 6 .   ? 32.127 46.972 -3.022  1.00 33.51 ? 1034 HOH A O   1 
HETATM 5246 O  O   . HOH F 6 .   ? 63.739 64.061 14.693  1.00 30.82 ? 1035 HOH A O   1 
HETATM 5247 O  O   . HOH F 6 .   ? 29.729 50.469 29.225  1.00 32.71 ? 1036 HOH A O   1 
HETATM 5248 O  O   . HOH F 6 .   ? 42.080 31.762 0.395   1.00 37.84 ? 1037 HOH A O   1 
HETATM 5249 O  O   . HOH F 6 .   ? 29.412 81.254 29.806  1.00 22.39 ? 1038 HOH A O   1 
HETATM 5250 O  O   . HOH F 6 .   ? 68.444 50.487 19.799  1.00 38.26 ? 1039 HOH A O   1 
HETATM 5251 O  O   . HOH F 6 .   ? 46.965 39.694 -17.144 1.00 29.81 ? 1040 HOH A O   1 
HETATM 5252 O  O   . HOH F 6 .   ? 19.836 36.268 19.101  1.00 33.02 ? 1041 HOH A O   1 
HETATM 5253 O  O   . HOH F 6 .   ? 57.317 81.379 3.341   1.00 24.08 ? 1042 HOH A O   1 
HETATM 5254 O  O   . HOH F 6 .   ? 45.468 41.276 -14.051 1.00 26.73 ? 1043 HOH A O   1 
HETATM 5255 O  O   . HOH F 6 .   ? 37.960 59.886 -3.645  1.00 30.32 ? 1044 HOH A O   1 
HETATM 5256 O  O   . HOH F 6 .   ? 44.386 82.900 -22.259 1.00 32.33 ? 1045 HOH A O   1 
HETATM 5257 O  O   . HOH F 6 .   ? 35.404 46.258 -26.023 1.00 30.84 ? 1046 HOH A O   1 
HETATM 5258 O  O   . HOH F 6 .   ? 50.641 80.593 -15.994 1.00 27.08 ? 1047 HOH A O   1 
HETATM 5259 O  O   . HOH F 6 .   ? 43.299 31.669 3.232   1.00 34.12 ? 1048 HOH A O   1 
HETATM 5260 O  O   . HOH F 6 .   ? 34.513 43.950 1.376   1.00 36.76 ? 1049 HOH A O   1 
HETATM 5261 O  O   . HOH F 6 .   ? 69.963 52.536 6.577   1.00 25.43 ? 1050 HOH A O   1 
HETATM 5262 O  O   . HOH F 6 .   ? 67.152 64.431 -13.143 1.00 29.35 ? 1051 HOH A O   1 
HETATM 5263 O  O   . HOH F 6 .   ? 66.782 78.189 -17.808 1.00 17.34 ? 1052 HOH A O   1 
HETATM 5264 O  O   . HOH F 6 .   ? 37.578 40.447 -11.700 1.00 29.59 ? 1053 HOH A O   1 
HETATM 5265 O  O   . HOH F 6 .   ? 32.623 56.754 -8.215  1.00 36.10 ? 1054 HOH A O   1 
HETATM 5266 O  O   . HOH F 6 .   ? 67.007 67.863 -16.184 1.00 34.16 ? 1055 HOH A O   1 
HETATM 5267 O  O   . HOH F 6 .   ? 57.200 31.441 14.354  1.00 27.97 ? 1056 HOH A O   1 
HETATM 5268 O  O   . HOH F 6 .   ? 25.104 29.725 24.961  1.00 19.31 ? 1057 HOH A O   1 
HETATM 5269 O  O   . HOH F 6 .   ? 66.792 69.755 13.130  1.00 32.80 ? 1058 HOH A O   1 
HETATM 5270 O  O   . HOH F 6 .   ? 61.556 62.501 11.802  1.00 26.86 ? 1059 HOH A O   1 
HETATM 5271 O  O   . HOH F 6 .   ? 32.705 57.663 26.310  1.00 24.34 ? 1060 HOH A O   1 
HETATM 5272 O  O   . HOH F 6 .   ? 68.650 58.796 -24.868 1.00 24.09 ? 1061 HOH A O   1 
HETATM 5273 O  O   . HOH F 6 .   ? 63.554 64.257 11.643  1.00 32.93 ? 1062 HOH A O   1 
HETATM 5274 O  O   . HOH F 6 .   ? 26.468 33.524 5.755   1.00 39.74 ? 1063 HOH A O   1 
HETATM 5275 O  O   . HOH F 6 .   ? 44.990 43.564 -15.768 1.00 24.88 ? 1064 HOH A O   1 
HETATM 5276 O  O   . HOH F 6 .   ? 63.055 77.145 -19.817 1.00 26.94 ? 1065 HOH A O   1 
HETATM 5277 O  O   . HOH F 6 .   ? 52.934 30.946 15.202  1.00 33.80 ? 1066 HOH A O   1 
HETATM 5278 O  O   . HOH F 6 .   ? 53.288 81.796 -19.565 1.00 42.93 ? 1067 HOH A O   1 
HETATM 5279 O  O   . HOH F 6 .   ? 67.240 38.248 8.913   1.00 32.53 ? 1068 HOH A O   1 
HETATM 5280 O  O   . HOH F 6 .   ? 60.996 57.268 -17.988 1.00 24.85 ? 1069 HOH A O   1 
HETATM 5281 O  O   . HOH F 6 .   ? 68.348 69.378 -14.415 1.00 29.17 ? 1070 HOH A O   1 
HETATM 5282 O  O   . HOH F 6 .   ? 54.699 80.405 -15.345 1.00 24.67 ? 1071 HOH A O   1 
HETATM 5283 O  O   . HOH F 6 .   ? 44.476 33.864 27.936  1.00 32.47 ? 1072 HOH A O   1 
HETATM 5284 O  O   . HOH F 6 .   ? 25.198 49.403 4.942   1.00 32.04 ? 1073 HOH A O   1 
HETATM 5285 O  O   . HOH F 6 .   ? 75.345 68.625 -0.431  1.00 24.51 ? 1074 HOH A O   1 
HETATM 5286 O  O   . HOH F 6 .   ? 48.175 83.338 -3.586  1.00 39.50 ? 1075 HOH A O   1 
HETATM 5287 O  O   A HOH F 6 .   ? 45.554 32.206 25.285  0.70 27.04 ? 1076 HOH A O   1 
HETATM 5288 O  O   A HOH F 6 .   ? 69.347 66.148 -12.715 0.60 31.75 ? 1077 HOH A O   1 
HETATM 5289 O  O   . HOH F 6 .   ? 68.018 81.934 -0.443  1.00 30.06 ? 1078 HOH A O   1 
HETATM 5290 O  O   . HOH F 6 .   ? 22.191 33.251 15.624  1.00 31.06 ? 1079 HOH A O   1 
HETATM 5291 O  O   . HOH F 6 .   ? 61.080 49.353 -15.606 1.00 35.05 ? 1080 HOH A O   1 
HETATM 5292 O  O   . HOH F 6 .   ? 26.232 32.666 8.389   1.00 31.03 ? 1081 HOH A O   1 
HETATM 5293 O  O   . HOH F 6 .   ? 69.556 74.778 -17.666 1.00 25.56 ? 1082 HOH A O   1 
HETATM 5294 O  O   . HOH F 6 .   ? 28.776 77.156 -27.162 1.00 35.61 ? 1083 HOH A O   1 
HETATM 5295 O  O   . HOH F 6 .   ? 48.019 78.841 -13.014 1.00 24.11 ? 1084 HOH A O   1 
HETATM 5296 O  O   . HOH F 6 .   ? 51.725 50.632 18.029  1.00 30.28 ? 1085 HOH A O   1 
HETATM 5297 O  O   . HOH F 6 .   ? 63.750 40.489 23.214  1.00 32.23 ? 1086 HOH A O   1 
HETATM 5298 O  O   . HOH F 6 .   ? 41.578 62.697 27.439  1.00 28.71 ? 1087 HOH A O   1 
HETATM 5299 O  O   . HOH F 6 .   ? 62.118 47.750 19.404  1.00 33.09 ? 1088 HOH A O   1 
HETATM 5300 O  O   . HOH F 6 .   ? 66.615 70.844 15.691  1.00 29.33 ? 1089 HOH A O   1 
HETATM 5301 O  O   . HOH F 6 .   ? 22.539 43.946 22.158  1.00 39.56 ? 1090 HOH A O   1 
HETATM 5302 O  O   . HOH F 6 .   ? 70.401 48.340 5.066   1.00 37.95 ? 1091 HOH A O   1 
HETATM 5303 O  O   . HOH F 6 .   ? 36.609 31.938 27.842  1.00 37.32 ? 1092 HOH A O   1 
HETATM 5304 O  O   . HOH F 6 .   ? 26.510 84.678 -24.035 1.00 28.83 ? 1093 HOH A O   1 
HETATM 5305 O  O   . HOH F 6 .   ? 42.998 84.259 -24.178 1.00 24.05 ? 1094 HOH A O   1 
HETATM 5306 O  O   . HOH F 6 .   ? 36.001 72.181 32.940  1.00 32.30 ? 1095 HOH A O   1 
HETATM 5307 O  O   . HOH F 6 .   ? 57.050 61.905 24.991  1.00 38.06 ? 1096 HOH A O   1 
HETATM 5308 O  O   . HOH F 6 .   ? 51.376 33.150 2.754   1.00 25.92 ? 1097 HOH A O   1 
HETATM 5309 O  O   . HOH F 6 .   ? 39.462 77.798 -33.207 1.00 31.14 ? 1098 HOH A O   1 
HETATM 5310 O  O   . HOH F 6 .   ? 69.490 74.994 -4.658  1.00 29.68 ? 1099 HOH A O   1 
HETATM 5311 O  O   . HOH F 6 .   ? 69.270 48.523 0.692   1.00 37.64 ? 1100 HOH A O   1 
HETATM 5312 O  O   . HOH F 6 .   ? 39.027 30.271 -2.262  1.00 38.28 ? 1101 HOH A O   1 
HETATM 5313 O  O   . HOH F 6 .   ? 53.987 34.247 7.531   1.00 30.74 ? 1102 HOH A O   1 
HETATM 5314 O  O   . HOH F 6 .   ? 70.370 73.673 -15.241 1.00 28.37 ? 1103 HOH A O   1 
HETATM 5315 O  O   . HOH F 6 .   ? 72.986 67.914 7.426   1.00 33.71 ? 1104 HOH A O   1 
HETATM 5316 O  O   . HOH F 6 .   ? 37.346 22.338 13.858  1.00 31.88 ? 1105 HOH A O   1 
HETATM 5317 O  O   . HOH F 6 .   ? 69.814 45.974 1.864   1.00 35.73 ? 1106 HOH A O   1 
HETATM 5318 O  O   . HOH F 6 .   ? 57.065 83.162 -4.848  1.00 25.34 ? 1107 HOH A O   1 
HETATM 5319 O  O   . HOH F 6 .   ? 59.944 53.432 22.079  1.00 40.33 ? 1108 HOH A O   1 
HETATM 5320 O  O   . HOH F 6 .   ? 39.103 55.710 27.260  1.00 38.35 ? 1109 HOH A O   1 
HETATM 5321 O  O   . HOH F 6 .   ? 38.753 85.445 -20.643 1.00 23.96 ? 1110 HOH A O   1 
HETATM 5322 O  O   . HOH F 6 .   ? 60.741 80.045 -19.252 1.00 23.46 ? 1111 HOH A O   1 
HETATM 5323 O  O   . HOH F 6 .   ? 38.800 65.744 30.603  1.00 30.68 ? 1112 HOH A O   1 
HETATM 5324 O  O   . HOH F 6 .   ? 59.862 60.714 -25.358 1.00 25.93 ? 1113 HOH A O   1 
HETATM 5325 O  O   . HOH F 6 .   ? 53.289 72.165 -27.044 1.00 28.64 ? 1114 HOH A O   1 
HETATM 5326 O  O   . HOH F 6 .   ? 57.594 54.832 23.476  1.00 44.34 ? 1115 HOH A O   1 
HETATM 5327 O  O   . HOH F 6 .   ? 39.368 25.125 16.596  1.00 33.03 ? 1116 HOH A O   1 
HETATM 5328 O  O   . HOH F 6 .   ? 36.727 21.645 10.821  1.00 32.43 ? 1117 HOH A O   1 
HETATM 5329 O  O   . HOH F 6 .   ? 60.107 55.873 -20.170 1.00 30.83 ? 1118 HOH A O   1 
HETATM 5330 O  O   . HOH F 6 .   ? 21.526 39.538 10.878  1.00 47.16 ? 1119 HOH A O   1 
HETATM 5331 O  O   . HOH F 6 .   ? 27.928 49.818 5.178   1.00 33.81 ? 1120 HOH A O   1 
HETATM 5332 O  O   . HOH F 6 .   ? 56.849 57.723 23.875  1.00 38.72 ? 1121 HOH A O   1 
HETATM 5333 O  O   . HOH F 6 .   ? 60.116 63.911 -28.743 1.00 32.74 ? 1122 HOH A O   1 
HETATM 5334 O  O   . HOH F 6 .   ? 64.570 69.901 -29.012 1.00 36.66 ? 1123 HOH A O   1 
HETATM 5335 O  O   . HOH F 6 .   ? 32.096 89.058 -22.594 1.00 33.90 ? 1124 HOH A O   1 
HETATM 5336 O  O   . HOH F 6 .   ? 28.187 64.144 34.995  1.00 36.43 ? 1125 HOH A O   1 
HETATM 5337 O  O   . HOH F 6 .   ? 49.262 81.166 -11.515 1.00 43.45 ? 1126 HOH A O   1 
HETATM 5338 O  O   . HOH F 6 .   ? 22.658 73.717 28.764  1.00 28.05 ? 1127 HOH A O   1 
HETATM 5339 O  O   . HOH F 6 .   ? 44.066 51.598 28.743  1.00 37.32 ? 1128 HOH A O   1 
HETATM 5340 O  O   . HOH F 6 .   ? 71.162 75.419 -9.249  1.00 37.85 ? 1129 HOH A O   1 
HETATM 5341 O  O   . HOH F 6 .   ? 23.212 30.747 13.257  1.00 39.67 ? 1130 HOH A O   1 
HETATM 5342 O  O   . HOH F 6 .   ? 58.596 66.124 -29.141 1.00 35.49 ? 1131 HOH A O   1 
HETATM 5343 O  O   . HOH F 6 .   ? 48.555 41.780 32.077  1.00 50.53 ? 1132 HOH A O   1 
HETATM 5344 O  O   . HOH F 6 .   ? 34.013 59.862 29.693  1.00 37.92 ? 1133 HOH A O   1 
HETATM 5345 O  O   . HOH F 6 .   ? 58.415 80.114 -22.695 1.00 30.25 ? 1134 HOH A O   1 
HETATM 5346 O  O   . HOH F 6 .   ? 58.955 38.330 -2.399  1.00 34.75 ? 1135 HOH A O   1 
HETATM 5347 O  O   . HOH F 6 .   ? 46.833 32.071 5.894   1.00 25.28 ? 1136 HOH A O   1 
HETATM 5348 O  O   . HOH F 6 .   ? 59.379 68.861 -29.354 1.00 28.74 ? 1137 HOH A O   1 
HETATM 5349 O  O   . HOH F 6 .   ? 30.931 48.210 30.383  1.00 54.35 ? 1138 HOH A O   1 
HETATM 5350 O  O   . HOH F 6 .   ? 54.847 35.537 19.386  1.00 36.96 ? 1139 HOH A O   1 
HETATM 5351 O  O   . HOH F 6 .   ? 60.126 81.072 4.441   1.00 39.02 ? 1140 HOH A O   1 
HETATM 5352 O  O   . HOH F 6 .   ? 43.085 28.812 4.093   1.00 46.17 ? 1141 HOH A O   1 
HETATM 5353 O  O   . HOH F 6 .   ? 41.418 60.251 26.349  1.00 41.51 ? 1142 HOH A O   1 
HETATM 5354 O  O   . HOH F 6 .   ? 50.055 37.202 23.171  1.00 39.67 ? 1143 HOH A O   1 
HETATM 5355 O  O   . HOH F 6 .   ? 36.017 25.679 19.156  1.00 30.73 ? 1144 HOH A O   1 
HETATM 5356 O  O   . HOH F 6 .   ? 31.984 25.866 22.790  1.00 48.82 ? 1145 HOH A O   1 
HETATM 5357 O  O   . HOH F 6 .   ? 46.250 77.984 -11.453 1.00 26.09 ? 1146 HOH A O   1 
HETATM 5358 O  O   . HOH F 6 .   ? 33.537 87.632 -24.258 1.00 31.72 ? 1147 HOH A O   1 
HETATM 5359 O  O   . HOH F 6 .   ? 51.818 53.009 19.737  1.00 34.73 ? 1148 HOH A O   1 
HETATM 5360 O  O   . HOH F 6 .   ? 64.965 66.966 19.446  1.00 33.72 ? 1149 HOH A O   1 
HETATM 5361 O  O   . HOH F 6 .   ? 57.784 82.291 -20.532 1.00 32.44 ? 1150 HOH A O   1 
HETATM 5362 O  O   . HOH F 6 .   ? 32.853 44.188 -25.682 1.00 29.11 ? 1151 HOH A O   1 
HETATM 5363 O  O   . HOH F 6 .   ? 49.427 79.990 1.573   1.00 26.50 ? 1152 HOH A O   1 
HETATM 5364 O  O   . HOH F 6 .   ? 34.316 42.516 30.678  1.00 46.22 ? 1153 HOH A O   1 
HETATM 5365 O  O   . HOH F 6 .   ? 33.118 52.847 27.711  1.00 38.01 ? 1154 HOH A O   1 
HETATM 5366 O  O   . HOH F 6 .   ? 45.579 78.052 -24.853 1.00 44.12 ? 1155 HOH A O   1 
HETATM 5367 O  O   . HOH F 6 .   ? 26.333 77.719 33.819  1.00 33.02 ? 1156 HOH A O   1 
HETATM 5368 O  O   . HOH F 6 .   ? 32.307 46.053 3.917   1.00 38.97 ? 1157 HOH A O   1 
HETATM 5369 O  O   . HOH F 6 .   ? 34.312 76.032 -23.136 1.00 30.99 ? 1158 HOH A O   1 
HETATM 5370 O  O   . HOH F 6 .   ? 47.773 67.651 25.665  1.00 31.25 ? 1159 HOH A O   1 
HETATM 5371 O  O   . HOH F 6 .   ? 43.747 63.858 25.994  1.00 29.59 ? 1160 HOH A O   1 
HETATM 5372 O  O   . HOH F 6 .   ? 37.571 61.909 -2.065  1.00 42.31 ? 1161 HOH A O   1 
HETATM 5373 O  O   . HOH F 6 .   ? 67.798 51.029 23.550  1.00 49.54 ? 1162 HOH A O   1 
HETATM 5374 O  O   . HOH F 6 .   ? 39.538 33.593 27.543  1.00 42.02 ? 1163 HOH A O   1 
HETATM 5375 O  O   . HOH F 6 .   ? 51.909 33.494 -6.194  1.00 43.76 ? 1164 HOH A O   1 
HETATM 5376 O  O   . HOH F 6 .   ? 52.093 42.791 23.752  1.00 36.28 ? 1165 HOH A O   1 
HETATM 5377 O  O   . HOH F 6 .   ? 44.897 68.478 26.400  1.00 37.46 ? 1166 HOH A O   1 
HETATM 5378 O  O   A HOH F 6 .   ? 53.901 33.770 4.730   0.60 27.78 ? 1167 HOH A O   1 
HETATM 5379 O  O   . HOH F 6 .   ? 61.553 70.206 -30.885 1.00 42.33 ? 1168 HOH A O   1 
HETATM 5380 O  O   . HOH F 6 .   ? 37.387 22.408 8.215   1.00 40.49 ? 1169 HOH A O   1 
HETATM 5381 O  O   . HOH F 6 .   ? 64.479 53.060 -14.615 1.00 34.26 ? 1170 HOH A O   1 
HETATM 5382 O  O   . HOH F 6 .   ? 58.048 38.081 21.134  1.00 43.14 ? 1171 HOH A O   1 
HETATM 5383 O  O   . HOH F 6 .   ? 54.979 33.106 18.071  1.00 36.01 ? 1172 HOH A O   1 
HETATM 5384 O  O   . HOH F 6 .   ? 37.702 53.880 -30.153 1.00 35.09 ? 1173 HOH A O   1 
HETATM 5385 O  O   . HOH F 6 .   ? 54.174 69.860 -28.166 1.00 36.23 ? 1174 HOH A O   1 
HETATM 5386 O  O   . HOH F 6 .   ? 76.390 62.478 6.574   1.00 25.10 ? 1175 HOH A O   1 
HETATM 5387 O  O   . HOH F 6 .   ? 60.530 59.158 -23.003 1.00 35.00 ? 1176 HOH A O   1 
HETATM 5388 O  O   . HOH F 6 .   ? 63.622 46.499 -9.618  1.00 57.22 ? 1177 HOH A O   1 
HETATM 5389 O  O   . HOH F 6 .   ? 51.279 78.824 15.853  1.00 40.88 ? 1178 HOH A O   1 
HETATM 5390 O  O   . HOH F 6 .   ? 28.171 33.680 31.670  1.00 27.84 ? 1179 HOH A O   1 
HETATM 5391 O  O   . HOH F 6 .   ? 23.293 69.170 31.178  1.00 30.64 ? 1180 HOH A O   1 
HETATM 5392 O  O   . HOH F 6 .   ? 39.235 53.826 29.228  1.00 34.35 ? 1181 HOH A O   1 
HETATM 5393 O  O   . HOH F 6 .   ? 21.343 71.611 29.223  1.00 37.18 ? 1182 HOH A O   1 
HETATM 5394 O  O   . HOH F 6 .   ? 66.553 59.961 -15.626 1.00 38.16 ? 1183 HOH A O   1 
HETATM 5395 O  O   . HOH F 6 .   ? 28.706 79.644 34.107  1.00 33.27 ? 1184 HOH A O   1 
HETATM 5396 O  O   . HOH F 6 .   ? 69.283 75.318 -0.645  1.00 38.93 ? 1185 HOH A O   1 
HETATM 5397 O  O   . HOH F 6 .   ? 65.040 82.644 -12.808 1.00 30.69 ? 1186 HOH A O   1 
HETATM 5398 O  O   . HOH F 6 .   ? 24.600 35.754 8.216   1.00 49.24 ? 1187 HOH A O   1 
HETATM 5399 O  O   . HOH F 6 .   ? 42.971 41.090 33.322  1.00 37.23 ? 1188 HOH A O   1 
HETATM 5400 O  O   . HOH F 6 .   ? 70.727 53.277 4.098   1.00 32.87 ? 1189 HOH A O   1 
HETATM 5401 O  O   . HOH F 6 .   ? 26.538 41.151 3.657   1.00 41.88 ? 1190 HOH A O   1 
HETATM 5402 O  O   . HOH F 6 .   ? 35.748 40.613 -14.340 1.00 37.30 ? 1191 HOH A O   1 
HETATM 5403 O  O   . HOH F 6 .   ? 39.835 44.824 -27.517 1.00 38.16 ? 1192 HOH A O   1 
HETATM 5404 O  O   . HOH F 6 .   ? 66.562 75.970 -4.315  1.00 36.08 ? 1193 HOH A O   1 
HETATM 5405 O  O   . HOH F 6 .   ? 30.886 35.073 0.951   1.00 40.79 ? 1194 HOH A O   1 
HETATM 5406 O  O   . HOH F 6 .   ? 47.535 54.422 22.609  1.00 44.31 ? 1195 HOH A O   1 
HETATM 5407 O  O   . HOH F 6 .   ? 34.521 61.430 25.754  1.00 41.09 ? 1196 HOH A O   1 
HETATM 5408 O  O   . HOH F 6 .   ? 71.050 66.610 -10.952 1.00 43.82 ? 1197 HOH A O   1 
HETATM 5409 O  O   . HOH F 6 .   ? 24.936 83.007 -27.411 1.00 37.42 ? 1198 HOH A O   1 
HETATM 5410 O  O   . HOH F 6 .   ? 54.552 82.404 -25.064 1.00 38.16 ? 1199 HOH A O   1 
HETATM 5411 O  O   . HOH F 6 .   ? 32.813 53.827 4.303   1.00 35.62 ? 1200 HOH A O   1 
HETATM 5412 O  O   . HOH F 6 .   ? 26.648 23.496 14.385  1.00 50.80 ? 1201 HOH A O   1 
HETATM 5413 O  O   . HOH F 6 .   ? 57.689 41.907 20.084  1.00 29.16 ? 1202 HOH A O   1 
HETATM 5414 O  O   . HOH F 6 .   ? 68.530 67.401 10.764  1.00 37.30 ? 1203 HOH A O   1 
HETATM 5415 O  O   . HOH F 6 .   ? 40.178 54.940 3.556   1.00 33.04 ? 1204 HOH A O   1 
HETATM 5416 O  O   . HOH F 6 .   ? 45.120 84.606 -5.625  1.00 40.37 ? 1205 HOH A O   1 
HETATM 5417 O  O   . HOH F 6 .   ? 46.993 56.594 15.481  1.00 39.89 ? 1206 HOH A O   1 
HETATM 5418 O  O   . HOH F 6 .   ? 33.467 50.966 -29.228 1.00 36.29 ? 1207 HOH A O   1 
HETATM 5419 O  O   . HOH F 6 .   ? 39.492 23.112 4.626   1.00 43.94 ? 1208 HOH A O   1 
HETATM 5420 O  O   . HOH F 6 .   ? 54.465 46.438 22.002  1.00 45.04 ? 1209 HOH A O   1 
HETATM 5421 O  O   . HOH F 6 .   ? 18.040 64.819 22.610  1.00 34.04 ? 1210 HOH A O   1 
HETATM 5422 O  O   . HOH F 6 .   ? 72.761 47.031 3.431   1.00 43.86 ? 1211 HOH A O   1 
HETATM 5423 O  O   . HOH F 6 .   ? 44.793 49.016 33.420  1.00 48.88 ? 1212 HOH A O   1 
HETATM 5424 O  O   . HOH F 6 .   ? 22.623 67.347 26.301  1.00 27.99 ? 1213 HOH A O   1 
HETATM 5425 O  O   . HOH F 6 .   ? 41.265 27.122 3.088   1.00 36.35 ? 1214 HOH A O   1 
HETATM 5426 O  O   . HOH F 6 .   ? 69.738 41.456 1.355   1.00 37.64 ? 1215 HOH A O   1 
HETATM 5427 O  O   . HOH F 6 .   ? 62.913 80.149 9.050   1.00 37.91 ? 1216 HOH A O   1 
HETATM 5428 O  O   . HOH F 6 .   ? 48.907 49.859 25.744  1.00 47.45 ? 1217 HOH A O   1 
HETATM 5429 O  O   . HOH F 6 .   ? 50.435 81.988 -7.073  1.00 47.35 ? 1218 HOH A O   1 
HETATM 5430 O  O   . HOH F 6 .   ? 66.610 61.436 -17.888 1.00 36.66 ? 1219 HOH A O   1 
HETATM 5431 O  O   . HOH F 6 .   ? 62.928 37.177 3.372   1.00 46.87 ? 1220 HOH A O   1 
HETATM 5432 O  O   . HOH F 6 .   ? 34.674 40.714 -11.960 1.00 38.75 ? 1221 HOH A O   1 
HETATM 5433 O  O   . HOH F 6 .   ? 73.707 60.259 -4.823  1.00 37.38 ? 1222 HOH A O   1 
HETATM 5434 O  O   . HOH F 6 .   ? 61.112 34.629 13.619  1.00 36.70 ? 1223 HOH A O   1 
HETATM 5435 O  O   . HOH F 6 .   ? 70.672 39.985 4.195   1.00 34.39 ? 1224 HOH A O   1 
HETATM 5436 O  O   . HOH F 6 .   ? 56.895 81.977 0.313   1.00 45.97 ? 1225 HOH A O   1 
HETATM 5437 O  O   . HOH F 6 .   ? 67.082 80.946 -7.378  1.00 35.70 ? 1226 HOH A O   1 
HETATM 5438 O  O   . HOH F 6 .   ? 20.798 30.401 26.617  1.00 36.30 ? 1227 HOH A O   1 
HETATM 5439 O  O   . HOH F 6 .   ? 40.157 36.019 28.988  1.00 48.19 ? 1228 HOH A O   1 
HETATM 5440 O  O   . HOH F 6 .   ? 21.664 67.801 35.133  1.00 31.23 ? 1229 HOH A O   1 
HETATM 5441 O  O   . HOH F 6 .   ? 28.824 31.968 3.508   1.00 47.03 ? 1230 HOH A O   1 
HETATM 5442 O  O   . HOH F 6 .   ? 64.887 43.186 -4.089  1.00 37.06 ? 1231 HOH A O   1 
HETATM 5443 O  O   . HOH F 6 .   ? 41.364 63.460 30.055  1.00 40.33 ? 1232 HOH A O   1 
HETATM 5444 O  O   . HOH F 6 .   ? 71.425 69.284 -8.560  1.00 38.44 ? 1233 HOH A O   1 
HETATM 5445 O  O   . HOH F 6 .   ? 45.490 81.693 -29.779 1.00 38.35 ? 1234 HOH A O   1 
HETATM 5446 O  O   . HOH F 6 .   ? 23.644 29.182 20.165  1.00 33.53 ? 1235 HOH A O   1 
HETATM 5447 O  O   . HOH F 6 .   ? 21.744 78.611 29.874  1.00 29.83 ? 1236 HOH A O   1 
HETATM 5448 O  O   . HOH F 6 .   ? 32.741 36.762 -0.150  1.00 52.53 ? 1237 HOH A O   1 
HETATM 5449 O  O   . HOH F 6 .   ? 25.969 37.226 3.977   1.00 37.88 ? 1238 HOH A O   1 
HETATM 5450 O  O   . HOH F 6 .   ? 37.566 76.953 -35.179 1.00 43.01 ? 1239 HOH A O   1 
HETATM 5451 O  O   . HOH F 6 .   ? 53.980 49.255 23.581  1.00 42.21 ? 1240 HOH A O   1 
HETATM 5452 O  O   . HOH F 6 .   ? 65.576 44.548 -7.872  1.00 60.16 ? 1241 HOH A O   1 
HETATM 5453 O  O   . HOH F 6 .   ? 64.910 57.689 24.386  1.00 50.57 ? 1242 HOH A O   1 
HETATM 5454 O  O   . HOH F 6 .   ? 65.691 74.459 -20.032 1.00 34.27 ? 1243 HOH A O   1 
HETATM 5455 O  O   . HOH F 6 .   ? 61.802 50.539 19.874  1.00 38.32 ? 1244 HOH A O   1 
HETATM 5456 O  O   . HOH F 6 .   ? 54.449 80.185 -12.980 1.00 45.88 ? 1245 HOH A O   1 
HETATM 5457 O  O   . HOH F 6 .   ? 18.672 48.609 14.689  1.00 42.53 ? 1246 HOH A O   1 
HETATM 5458 O  O   A HOH F 6 .   ? 68.734 62.238 -13.765 0.60 43.78 ? 1247 HOH A O   1 
HETATM 5459 O  O   . HOH F 6 .   ? 30.856 42.769 3.249   1.00 52.43 ? 1248 HOH A O   1 
HETATM 5460 O  O   . HOH F 6 .   ? 19.462 77.302 27.817  1.00 32.21 ? 1249 HOH A O   1 
HETATM 5461 O  O   . HOH F 6 .   ? 70.723 76.250 1.364   1.00 46.69 ? 1250 HOH A O   1 
HETATM 5462 O  O   . HOH F 6 .   ? 66.687 81.832 -9.729  1.00 44.40 ? 1251 HOH A O   1 
HETATM 5463 O  O   . HOH F 6 .   ? 65.228 77.256 9.123   1.00 42.64 ? 1252 HOH A O   1 
HETATM 5464 O  O   . HOH F 6 .   ? 63.677 83.824 4.337   1.00 48.99 ? 1253 HOH A O   1 
HETATM 5465 O  O   . HOH F 6 .   ? 45.680 54.590 15.103  1.00 38.43 ? 1254 HOH A O   1 
HETATM 5466 O  O   . HOH F 6 .   ? 33.048 55.688 -5.434  1.00 44.34 ? 1255 HOH A O   1 
HETATM 5467 O  O   . HOH F 6 .   ? 32.507 29.317 6.134   1.00 39.63 ? 1256 HOH A O   1 
HETATM 5468 O  O   . HOH F 6 .   ? 29.486 44.481 26.969  1.00 31.19 ? 1257 HOH A O   1 
HETATM 5469 O  O   . HOH F 6 .   ? 28.706 45.306 28.922  1.00 49.18 ? 1258 HOH A O   1 
HETATM 5470 O  O   . HOH F 6 .   ? 53.106 44.696 -17.219 1.00 45.14 ? 1259 HOH A O   1 
HETATM 5471 O  O   . HOH F 6 .   ? 30.791 61.298 31.941  1.00 38.84 ? 1260 HOH A O   1 
HETATM 5472 O  O   . HOH F 6 .   ? 63.168 45.479 24.346  1.00 37.07 ? 1261 HOH A O   1 
HETATM 5473 O  O   . HOH F 6 .   ? 22.943 26.892 17.201  1.00 40.51 ? 1262 HOH A O   1 
HETATM 5474 O  O   . HOH F 6 .   ? 46.367 54.729 19.420  1.00 46.58 ? 1263 HOH A O   1 
HETATM 5475 O  O   . HOH F 6 .   ? 75.101 39.119 5.258   1.00 41.73 ? 1264 HOH A O   1 
HETATM 5476 O  O   . HOH F 6 .   ? 21.951 36.080 12.034  1.00 50.85 ? 1265 HOH A O   1 
HETATM 5477 O  O   . HOH F 6 .   ? 41.710 72.929 -28.274 1.00 34.14 ? 1266 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 1   ? 0.3482 0.3563 0.3775 -0.0192 0.0043  0.0008  -2   SER A N   
2    C  CA  . SER A 1   ? 0.3447 0.3604 0.3728 -0.0226 -0.0034 -0.0039 -2   SER A CA  
3    C  C   . SER A 1   ? 0.3369 0.3560 0.3531 -0.0141 -0.0079 -0.0070 -2   SER A C   
4    O  O   . SER A 1   ? 0.3413 0.3408 0.3678 -0.0320 0.0038  -0.0095 -2   SER A O   
5    C  CB  . SER A 1   ? 0.3339 0.3518 0.3753 -0.0263 -0.0154 -0.0066 -2   SER A CB  
6    O  OG  . SER A 1   ? 0.3276 0.3915 0.3731 -0.0350 0.0019  -0.0072 -2   SER A OG  
7    N  N   . ASN A 2   ? 0.3218 0.3571 0.3336 -0.0100 -0.0142 -0.0126 -1   ASN A N   
8    C  CA  . ASN A 2   ? 0.3129 0.3528 0.3157 -0.0011 -0.0183 -0.0100 -1   ASN A CA  
9    C  C   . ASN A 2   ? 0.2765 0.3292 0.2976 -0.0034 -0.0160 -0.0073 -1   ASN A C   
10   O  O   . ASN A 2   ? 0.2402 0.3449 0.2723 0.0004  -0.0439 -0.0205 -1   ASN A O   
11   C  CB  . ASN A 2   ? 0.3205 0.3622 0.3327 0.0009  -0.0176 -0.0113 -1   ASN A CB  
12   C  CG  . ASN A 2   ? 0.4034 0.3927 0.3384 0.0163  -0.0177 -0.0105 -1   ASN A CG  
13   O  OD1 . ASN A 2   ? 0.4592 0.4112 0.3983 0.0162  0.0023  -0.0151 -1   ASN A OD1 
14   N  ND2 . ASN A 2   ? 0.4335 0.4402 0.3469 0.0412  -0.0261 0.0023  -1   ASN A ND2 
15   N  N   . ALA A 3   ? 0.2667 0.3020 0.2766 -0.0038 -0.0102 -0.0024 0    ALA A N   
16   C  CA  . ALA A 3   ? 0.2492 0.2632 0.2544 -0.0002 -0.0070 0.0100  0    ALA A CA  
17   C  C   . ALA A 3   ? 0.2428 0.2508 0.2437 0.0053  -0.0087 0.0068  0    ALA A C   
18   O  O   . ALA A 3   ? 0.2623 0.2761 0.2571 0.0174  -0.0124 0.0013  0    ALA A O   
19   C  CB  . ALA A 3   ? 0.2451 0.2529 0.2626 -0.0108 0.0199  0.0210  0    ALA A CB  
20   N  N   . MSE A 4   ? 0.2024 0.2144 0.2242 0.0063  -0.0066 0.0094  1    MSE A N   
21   C  CA  . MSE A 4   ? 0.1979 0.1953 0.1992 -0.0011 -0.0028 0.0124  1    MSE A CA  
22   C  C   . MSE A 4   ? 0.1953 0.1881 0.2004 0.0052  -0.0044 0.0106  1    MSE A C   
23   O  O   . MSE A 4   ? 0.2016 0.1920 0.2112 0.0009  -0.0021 0.0270  1    MSE A O   
24   C  CB  . MSE A 4   ? 0.2028 0.1916 0.2122 0.0111  -0.0017 0.0206  1    MSE A CB  
25   C  CG  . MSE A 4   ? 0.2096 0.2103 0.2172 -0.0060 0.0092  0.0122  1    MSE A CG  
26   SE SE  . MSE A 4   ? 0.2356 0.2142 0.2231 0.0147  -0.0004 0.0210  1    MSE A SE  
27   C  CE  . MSE A 4   ? 0.1416 0.2162 0.2310 0.0439  0.0164  -0.0114 1    MSE A CE  
28   N  N   . LEU A 5   ? 0.1804 0.1653 0.1784 -0.0062 -0.0036 0.0110  2    LEU A N   
29   C  CA  . LEU A 5   ? 0.1738 0.1570 0.1602 -0.0040 -0.0020 0.0033  2    LEU A CA  
30   C  C   . LEU A 5   ? 0.1564 0.1566 0.1553 -0.0175 -0.0027 0.0005  2    LEU A C   
31   O  O   . LEU A 5   ? 0.1804 0.1761 0.1526 -0.0093 0.0106  -0.0015 2    LEU A O   
32   C  CB  . LEU A 5   ? 0.1652 0.1523 0.1709 -0.0174 -0.0025 0.0043  2    LEU A CB  
33   C  CG  . LEU A 5   ? 0.1754 0.1568 0.1345 -0.0026 0.0102  -0.0009 2    LEU A CG  
34   C  CD1 . LEU A 5   ? 0.1512 0.2346 0.2165 -0.0195 0.0329  0.0442  2    LEU A CD1 
35   C  CD2 . LEU A 5   ? 0.1762 0.1646 0.1682 -0.0103 0.0142  -0.0018 2    LEU A CD2 
36   N  N   . PHE A 6   ? 0.1525 0.1480 0.1532 -0.0165 -0.0108 -0.0021 3    PHE A N   
37   C  CA  . PHE A 6   ? 0.1479 0.1589 0.1452 -0.0172 -0.0038 -0.0007 3    PHE A CA  
38   C  C   . PHE A 6   ? 0.1547 0.1700 0.1490 -0.0141 0.0049  0.0034  3    PHE A C   
39   O  O   . PHE A 6   ? 0.1589 0.1669 0.1372 -0.0014 0.0040  0.0210  3    PHE A O   
40   C  CB  . PHE A 6   ? 0.1501 0.1507 0.1435 -0.0148 -0.0037 0.0027  3    PHE A CB  
41   C  CG  . PHE A 6   ? 0.1556 0.1608 0.1629 -0.0265 -0.0188 -0.0074 3    PHE A CG  
42   C  CD1 . PHE A 6   ? 0.1608 0.1391 0.1412 -0.0183 -0.0109 -0.0019 3    PHE A CD1 
43   C  CD2 . PHE A 6   ? 0.1641 0.1560 0.1854 -0.0210 -0.0213 -0.0042 3    PHE A CD2 
44   C  CE1 . PHE A 6   ? 0.1598 0.1751 0.1518 -0.0193 -0.0309 0.0169  3    PHE A CE1 
45   C  CE2 . PHE A 6   ? 0.1743 0.1804 0.1763 -0.0213 -0.0023 -0.0242 3    PHE A CE2 
46   C  CZ  . PHE A 6   ? 0.1981 0.1982 0.1222 -0.0270 -0.0374 -0.0170 3    PHE A CZ  
47   N  N   . CYS A 7   ? 0.1524 0.1783 0.1561 -0.0031 0.0061  0.0144  4    CYS A N   
48   C  CA  A CYS A 7   ? 0.1651 0.1956 0.1939 -0.0085 0.0054  0.0060  4    CYS A CA  
49   C  CA  B CYS A 7   ? 0.1793 0.1920 0.1911 -0.0098 0.0087  -0.0007 4    CYS A CA  
50   C  C   . CYS A 7   ? 0.1847 0.1871 0.1932 -0.0075 0.0078  -0.0063 4    CYS A C   
51   O  O   . CYS A 7   ? 0.2037 0.2410 0.2193 -0.0077 0.0205  -0.0125 4    CYS A O   
52   C  CB  A CYS A 7   ? 0.1724 0.1976 0.1968 -0.0041 0.0092  0.0193  4    CYS A CB  
53   C  CB  B CYS A 7   ? 0.1816 0.1925 0.1921 -0.0066 0.0100  0.0029  4    CYS A CB  
54   S  SG  A CYS A 7   ? 0.1832 0.1860 0.2489 -0.0033 -0.0278 0.0141  4    CYS A SG  
55   S  SG  B CYS A 7   ? 0.2464 0.2241 0.2586 -0.0301 0.0102  -0.0228 4    CYS A SG  
56   N  N   . ASP A 8   ? 0.2089 0.1848 0.2057 -0.0366 0.0177  -0.0088 5    ASP A N   
57   C  CA  . ASP A 8   ? 0.2322 0.1876 0.2214 -0.0379 0.0125  -0.0160 5    ASP A CA  
58   C  C   . ASP A 8   ? 0.2307 0.1854 0.2323 -0.0434 0.0060  -0.0021 5    ASP A C   
59   O  O   . ASP A 8   ? 0.2545 0.1771 0.2310 -0.0157 0.0260  0.0071  5    ASP A O   
60   C  CB  . ASP A 8   ? 0.2351 0.2084 0.2248 -0.0373 0.0180  -0.0151 5    ASP A CB  
61   C  CG  . ASP A 8   ? 0.2336 0.2444 0.2474 -0.0382 0.0161  -0.0248 5    ASP A CG  
62   O  OD1 . ASP A 8   ? 0.2276 0.3023 0.2388 -0.0117 0.0199  -0.0262 5    ASP A OD1 
63   O  OD2 . ASP A 8   ? 0.2295 0.2949 0.2741 0.0382  0.0406  -0.0054 5    ASP A OD2 
64   N  N   . ASP A 9   ? 0.2528 0.2176 0.2623 -0.0479 0.0083  -0.0087 6    ASP A N   
65   C  CA  . ASP A 9   ? 0.2686 0.2497 0.2885 -0.0409 0.0007  -0.0067 6    ASP A CA  
66   C  C   . ASP A 9   ? 0.2597 0.2580 0.2778 -0.0365 0.0024  0.0041  6    ASP A C   
67   O  O   . ASP A 9   ? 0.2960 0.2715 0.3120 -0.0259 0.0159  0.0301  6    ASP A O   
68   C  CB  . ASP A 9   ? 0.2876 0.2559 0.3109 -0.0433 0.0062  -0.0122 6    ASP A CB  
69   C  CG  . ASP A 9   ? 0.3568 0.3515 0.3777 -0.0375 0.0188  -0.0494 6    ASP A CG  
70   O  OD1 . ASP A 9   ? 0.3686 0.4508 0.4734 0.0050  0.0362  -0.0664 6    ASP A OD1 
71   O  OD2 . ASP A 9   ? 0.4362 0.4140 0.4895 -0.0830 0.0067  -0.0859 6    ASP A OD2 
72   N  N   . SER A 10  ? 0.2351 0.2707 0.2703 -0.0385 0.0060  0.0050  7    SER A N   
73   C  CA  . SER A 10  ? 0.2704 0.2953 0.2723 -0.0125 0.0033  0.0029  7    SER A CA  
74   C  C   . SER A 10  ? 0.2589 0.2967 0.2523 -0.0169 0.0054  0.0035  7    SER A C   
75   O  O   . SER A 10  ? 0.2725 0.3092 0.2506 -0.0017 -0.0007 0.0114  7    SER A O   
76   C  CB  . SER A 10  ? 0.2805 0.3121 0.2740 -0.0038 0.0069  0.0006  7    SER A CB  
77   O  OG  . SER A 10  ? 0.3902 0.3690 0.3514 0.0314  0.0197  -0.0022 7    SER A OG  
78   N  N   . LYS A 11  ? 0.2472 0.2884 0.2409 -0.0136 0.0003  0.0040  8    LYS A N   
79   C  CA  . LYS A 11  ? 0.2647 0.2798 0.2500 -0.0256 0.0005  -0.0023 8    LYS A CA  
80   C  C   . LYS A 11  ? 0.2826 0.2958 0.2875 -0.0092 -0.0149 -0.0139 8    LYS A C   
81   O  O   . LYS A 11  ? 0.3056 0.2904 0.2807 -0.0293 -0.0177 -0.0273 8    LYS A O   
82   C  CB  . LYS A 11  ? 0.2423 0.2852 0.2328 -0.0224 0.0004  -0.0031 8    LYS A CB  
83   C  CG  . LYS A 11  ? 0.2537 0.2838 0.2364 -0.0229 -0.0065 0.0026  8    LYS A CG  
84   C  CD  . LYS A 11  ? 0.2829 0.2864 0.2398 -0.0178 -0.0260 0.0003  8    LYS A CD  
85   C  CE  . LYS A 11  ? 0.2908 0.2700 0.2873 -0.0169 -0.0291 0.0165  8    LYS A CE  
86   N  NZ  . LYS A 11  ? 0.2671 0.2949 0.3099 -0.0648 0.0129  0.0236  8    LYS A NZ  
87   N  N   . LYS A 12  ? 0.3103 0.3165 0.3051 -0.0010 -0.0220 -0.0194 9    LYS A N   
88   C  CA  A LYS A 12  ? 0.3308 0.3134 0.3113 0.0017  -0.0095 -0.0053 9    LYS A CA  
89   C  CA  B LYS A 12  ? 0.3207 0.3092 0.3062 0.0031  -0.0136 -0.0063 9    LYS A CA  
90   C  C   . LYS A 12  ? 0.3246 0.3150 0.3095 0.0074  -0.0162 -0.0030 9    LYS A C   
91   O  O   . LYS A 12  ? 0.3425 0.3208 0.3054 0.0155  -0.0398 -0.0171 9    LYS A O   
92   C  CB  A LYS A 12  ? 0.3406 0.3333 0.3253 0.0035  -0.0073 -0.0059 9    LYS A CB  
93   C  CB  B LYS A 12  ? 0.3247 0.3177 0.3105 0.0065  -0.0120 -0.0049 9    LYS A CB  
94   C  CG  A LYS A 12  ? 0.3550 0.3513 0.3562 -0.0058 0.0128  -0.0031 9    LYS A CG  
95   C  CG  B LYS A 12  ? 0.3257 0.3046 0.3157 0.0097  -0.0074 0.0018  9    LYS A CG  
96   C  CD  A LYS A 12  ? 0.3795 0.3530 0.3856 -0.0199 0.0196  0.0018  9    LYS A CD  
97   C  CD  B LYS A 12  ? 0.3386 0.3256 0.3182 0.0153  -0.0042 -0.0018 9    LYS A CD  
98   C  CE  A LYS A 12  ? 0.3593 0.3712 0.4185 -0.0130 0.0272  -0.0066 9    LYS A CE  
99   C  CE  B LYS A 12  ? 0.3424 0.3194 0.3236 0.0171  -0.0060 -0.0036 9    LYS A CE  
100  N  NZ  A LYS A 12  ? 0.3781 0.3028 0.4805 -0.0256 0.0111  -0.0067 9    LYS A NZ  
101  N  NZ  B LYS A 12  ? 0.3690 0.3302 0.3242 0.0350  -0.0045 -0.0020 9    LYS A NZ  
102  N  N   . TYR A 13  ? 0.3224 0.2963 0.2981 -0.0134 -0.0125 -0.0018 10   TYR A N   
103  C  CA  A TYR A 13  ? 0.3226 0.2870 0.3029 -0.0154 -0.0100 0.0049  10   TYR A CA  
104  C  CA  B TYR A 13  ? 0.3191 0.2876 0.3007 -0.0149 -0.0077 0.0040  10   TYR A CA  
105  C  C   . TYR A 13  ? 0.3087 0.2698 0.2925 -0.0298 -0.0054 0.0124  10   TYR A C   
106  O  O   . TYR A 13  ? 0.3246 0.2679 0.3026 -0.0262 -0.0109 0.0055  10   TYR A O   
107  C  CB  A TYR A 13  ? 0.3238 0.2906 0.3086 -0.0187 -0.0108 0.0069  10   TYR A CB  
108  C  CB  B TYR A 13  ? 0.3182 0.2914 0.3062 -0.0168 -0.0064 0.0049  10   TYR A CB  
109  C  CG  A TYR A 13  ? 0.3850 0.3118 0.3499 -0.0152 -0.0154 -0.0061 10   TYR A CG  
110  C  CG  B TYR A 13  ? 0.3562 0.3141 0.3277 -0.0134 0.0021  -0.0064 10   TYR A CG  
111  C  CD1 A TYR A 13  ? 0.4316 0.3354 0.3742 -0.0168 -0.0266 0.0002  10   TYR A CD1 
112  C  CD1 B TYR A 13  ? 0.3711 0.3523 0.3600 -0.0041 0.0121  -0.0191 10   TYR A CD1 
113  C  CD2 A TYR A 13  ? 0.4330 0.3318 0.3709 0.0022  -0.0182 0.0172  10   TYR A CD2 
114  C  CD2 B TYR A 13  ? 0.3718 0.3346 0.3559 -0.0044 -0.0024 -0.0152 10   TYR A CD2 
115  C  CE1 A TYR A 13  ? 0.4593 0.3484 0.3923 -0.0170 -0.0326 -0.0200 10   TYR A CE1 
116  C  CE1 B TYR A 13  ? 0.3872 0.3622 0.3630 -0.0122 0.0149  -0.0244 10   TYR A CE1 
117  C  CE2 A TYR A 13  ? 0.4622 0.3480 0.3999 -0.0009 -0.0335 -0.0034 10   TYR A CE2 
118  C  CE2 B TYR A 13  ? 0.3881 0.3504 0.3667 -0.0126 0.0016  -0.0226 10   TYR A CE2 
119  C  CZ  A TYR A 13  ? 0.4889 0.3683 0.4127 -0.0091 -0.0291 -0.0098 10   TYR A CZ  
120  C  CZ  B TYR A 13  ? 0.3997 0.3656 0.3738 -0.0076 0.0079  -0.0265 10   TYR A CZ  
121  O  OH  A TYR A 13  ? 0.5445 0.3814 0.4703 -0.0249 -0.0314 -0.0366 10   TYR A OH  
122  O  OH  B TYR A 13  ? 0.4441 0.4046 0.3780 -0.0044 0.0139  -0.0421 10   TYR A OH  
123  N  N   . LEU A 14  ? 0.3135 0.2295 0.2652 -0.0379 -0.0144 0.0120  11   LEU A N   
124  C  CA  . LEU A 14  ? 0.2961 0.2419 0.2480 -0.0419 -0.0140 0.0173  11   LEU A CA  
125  C  C   . LEU A 14  ? 0.2841 0.2243 0.2509 -0.0458 -0.0145 0.0207  11   LEU A C   
126  O  O   . LEU A 14  ? 0.3118 0.2320 0.2589 -0.0620 -0.0258 0.0265  11   LEU A O   
127  C  CB  . LEU A 14  ? 0.2748 0.2335 0.2332 -0.0489 -0.0187 0.0191  11   LEU A CB  
128  C  CG  . LEU A 14  ? 0.2739 0.2349 0.2200 -0.0540 -0.0267 0.0180  11   LEU A CG  
129  C  CD1 . LEU A 14  ? 0.3127 0.1928 0.1753 -0.0673 -0.0369 0.0178  11   LEU A CD1 
130  C  CD2 . LEU A 14  ? 0.2569 0.2670 0.2283 -0.0696 -0.0340 -0.0093 11   LEU A CD2 
131  N  N   . LYS A 15  ? 0.2798 0.2346 0.2594 -0.0374 -0.0247 0.0152  12   LYS A N   
132  C  CA  . LYS A 15  ? 0.2776 0.2731 0.2746 -0.0340 -0.0141 0.0085  12   LYS A CA  
133  C  C   . LYS A 15  ? 0.2764 0.2737 0.2666 -0.0328 -0.0219 0.0081  12   LYS A C   
134  O  O   . LYS A 15  ? 0.2653 0.2741 0.2579 -0.0534 -0.0380 0.0120  12   LYS A O   
135  C  CB  . LYS A 15  ? 0.3033 0.2998 0.2936 -0.0197 -0.0086 0.0044  12   LYS A CB  
136  C  CG  . LYS A 15  ? 0.3068 0.3685 0.3307 -0.0076 -0.0120 0.0086  12   LYS A CG  
137  C  CD  . LYS A 15  ? 0.3688 0.4055 0.3661 0.0045  0.0094  0.0101  12   LYS A CD  
138  C  CE  . LYS A 15  ? 0.3766 0.4241 0.4113 0.0017  0.0117  0.0162  12   LYS A CE  
139  N  NZ  . LYS A 15  ? 0.4339 0.4214 0.4648 0.0109  0.0363  0.0090  12   LYS A NZ  
140  N  N   . GLU A 16  ? 0.2694 0.2545 0.2546 -0.0436 -0.0234 -0.0005 13   GLU A N   
141  C  CA  . GLU A 16  ? 0.2705 0.2479 0.2459 -0.0431 -0.0209 0.0061  13   GLU A CA  
142  C  C   . GLU A 16  ? 0.2437 0.2255 0.2264 -0.0515 -0.0267 0.0092  13   GLU A C   
143  O  O   . GLU A 16  ? 0.2782 0.2220 0.2138 -0.0615 -0.0434 0.0244  13   GLU A O   
144  C  CB  . GLU A 16  ? 0.2978 0.2440 0.2556 -0.0414 -0.0228 0.0010  13   GLU A CB  
145  C  CG  . GLU A 16  ? 0.3803 0.2876 0.2961 -0.0154 -0.0041 -0.0107 13   GLU A CG  
146  C  CD  . GLU A 16  ? 0.4797 0.3507 0.3737 -0.0287 0.0033  -0.0687 13   GLU A CD  
147  O  OE1 . GLU A 16  ? 0.5129 0.3997 0.4152 -0.0615 0.0144  -0.0716 13   GLU A OE1 
148  O  OE2 . GLU A 16  ? 0.6235 0.4052 0.4220 0.0160  0.0357  -0.1165 13   GLU A OE2 
149  N  N   . GLN A 17  ? 0.2154 0.2369 0.2108 -0.0392 -0.0240 0.0146  14   GLN A N   
150  C  CA  . GLN A 17  ? 0.2083 0.2223 0.1920 -0.0347 -0.0100 0.0196  14   GLN A CA  
151  C  C   . GLN A 17  ? 0.2029 0.2212 0.1853 -0.0184 -0.0149 0.0210  14   GLN A C   
152  O  O   . GLN A 17  ? 0.1937 0.2414 0.1644 -0.0322 -0.0510 0.0258  14   GLN A O   
153  C  CB  . GLN A 17  ? 0.2139 0.2403 0.2041 -0.0163 -0.0077 0.0219  14   GLN A CB  
154  C  CG  . GLN A 17  ? 0.2534 0.2402 0.1945 -0.0259 -0.0259 0.0255  14   GLN A CG  
155  C  CD  . GLN A 17  ? 0.2473 0.2420 0.2340 -0.0495 -0.0256 -0.0045 14   GLN A CD  
156  O  OE1 . GLN A 17  ? 0.2275 0.1679 0.2546 -0.0601 -0.0001 -0.0205 14   GLN A OE1 
157  N  NE2 . GLN A 17  ? 0.3110 0.2574 0.2396 -0.1028 -0.0619 -0.0006 14   GLN A NE2 
158  N  N   . ASN A 18  ? 0.2181 0.2002 0.1869 -0.0133 -0.0255 0.0213  15   ASN A N   
159  C  CA  A ASN A 18  ? 0.2216 0.1936 0.1979 -0.0156 -0.0218 0.0097  15   ASN A CA  
160  C  CA  B ASN A 18  ? 0.2175 0.1920 0.1987 -0.0113 -0.0201 0.0097  15   ASN A CA  
161  C  C   . ASN A 18  ? 0.2081 0.1818 0.1912 -0.0207 -0.0242 0.0139  15   ASN A C   
162  O  O   . ASN A 18  ? 0.2129 0.1809 0.2036 -0.0357 -0.0354 0.0039  15   ASN A O   
163  C  CB  A ASN A 18  ? 0.2466 0.2068 0.1972 -0.0089 -0.0284 0.0069  15   ASN A CB  
164  C  CB  B ASN A 18  ? 0.2413 0.1994 0.2028 -0.0027 -0.0210 0.0059  15   ASN A CB  
165  C  CG  A ASN A 18  ? 0.2799 0.2214 0.2287 -0.0276 -0.0262 -0.0120 15   ASN A CG  
166  C  CG  B ASN A 18  ? 0.2487 0.2096 0.2326 -0.0007 -0.0206 -0.0107 15   ASN A CG  
167  O  OD1 A ASN A 18  ? 0.3200 0.2039 0.2140 -0.0471 -0.0359 -0.0459 15   ASN A OD1 
168  O  OD1 B ASN A 18  ? 0.3038 0.2185 0.2708 0.0412  0.0135  -0.0037 15   ASN A OD1 
169  N  ND2 A ASN A 18  ? 0.3491 0.2459 0.1887 -0.0127 -0.0506 0.0214  15   ASN A ND2 
170  N  ND2 B ASN A 18  ? 0.3357 0.2193 0.2808 0.0220  -0.0304 -0.0275 15   ASN A ND2 
171  N  N   . ILE A 19  ? 0.1712 0.1638 0.1802 -0.0089 -0.0272 0.0186  16   ILE A N   
172  C  CA  . ILE A 19  ? 0.1648 0.1614 0.1628 -0.0236 -0.0085 0.0104  16   ILE A CA  
173  C  C   . ILE A 19  ? 0.1446 0.1676 0.1554 -0.0204 0.0046  0.0142  16   ILE A C   
174  O  O   . ILE A 19  ? 0.1557 0.1861 0.1840 -0.0375 0.0073  0.0087  16   ILE A O   
175  C  CB  . ILE A 19  ? 0.1450 0.1612 0.1745 -0.0170 -0.0101 0.0173  16   ILE A CB  
176  C  CG1 . ILE A 19  ? 0.1729 0.1644 0.1777 -0.0402 -0.0268 0.0077  16   ILE A CG1 
177  C  CG2 . ILE A 19  ? 0.1948 0.1783 0.1934 0.0050  0.0071  -0.0141 16   ILE A CG2 
178  C  CD1 . ILE A 19  ? 0.1648 0.2468 0.1593 -0.0285 -0.0187 0.0134  16   ILE A CD1 
179  N  N   . ASN A 20  ? 0.1292 0.1640 0.1444 -0.0260 0.0106  0.0149  17   ASN A N   
180  C  CA  . ASN A 20  ? 0.1549 0.1717 0.1414 -0.0086 0.0022  0.0081  17   ASN A CA  
181  C  C   . ASN A 20  ? 0.1566 0.1634 0.1573 -0.0114 0.0059  0.0191  17   ASN A C   
182  O  O   . ASN A 20  ? 0.1668 0.1781 0.1733 -0.0148 0.0059  0.0110  17   ASN A O   
183  C  CB  . ASN A 20  ? 0.1499 0.1581 0.1672 0.0069  -0.0034 0.0069  17   ASN A CB  
184  C  CG  . ASN A 20  ? 0.2071 0.2007 0.2070 0.0299  -0.0421 -0.0296 17   ASN A CG  
185  O  OD1 . ASN A 20  ? 0.2070 0.1815 0.1465 0.0028  -0.0170 0.0068  17   ASN A OD1 
186  N  ND2 . ASN A 20  ? 0.2617 0.2838 0.3123 0.0723  -0.0764 -0.0740 17   ASN A ND2 
187  N  N   . LEU A 21  ? 0.1508 0.1657 0.1504 -0.0277 -0.0049 0.0149  18   LEU A N   
188  C  CA  . LEU A 21  ? 0.1439 0.1758 0.1520 -0.0133 -0.0021 0.0044  18   LEU A CA  
189  C  C   . LEU A 21  ? 0.1627 0.1790 0.1685 -0.0178 0.0046  0.0089  18   LEU A C   
190  O  O   . LEU A 21  ? 0.1865 0.1992 0.1575 -0.0329 0.0387  0.0122  18   LEU A O   
191  C  CB  . LEU A 21  ? 0.1503 0.1758 0.1274 -0.0129 0.0061  0.0011  18   LEU A CB  
192  C  CG  . LEU A 21  ? 0.1513 0.1776 0.1262 -0.0093 0.0047  0.0232  18   LEU A CG  
193  C  CD1 . LEU A 21  ? 0.1031 0.2035 0.1928 -0.0158 -0.0002 0.0391  18   LEU A CD1 
194  C  CD2 . LEU A 21  ? 0.1399 0.1970 0.2127 0.0011  -0.0170 0.0348  18   LEU A CD2 
195  N  N   . LYS A 22  ? 0.1699 0.1952 0.1696 -0.0115 -0.0073 0.0098  19   LYS A N   
196  C  CA  A LYS A 22  ? 0.1867 0.2051 0.1794 -0.0033 -0.0086 0.0072  19   LYS A CA  
197  C  CA  B LYS A 22  ? 0.1790 0.1949 0.1661 -0.0037 -0.0080 0.0104  19   LYS A CA  
198  C  C   . LYS A 22  ? 0.1783 0.1910 0.1617 0.0014  -0.0123 0.0155  19   LYS A C   
199  O  O   . LYS A 22  ? 0.1741 0.2282 0.1641 0.0070  0.0004  0.0065  19   LYS A O   
200  C  CB  A LYS A 22  ? 0.1773 0.2092 0.1796 -0.0056 -0.0197 0.0079  19   LYS A CB  
201  C  CB  B LYS A 22  ? 0.1730 0.1932 0.1554 -0.0061 -0.0160 0.0123  19   LYS A CB  
202  C  CG  A LYS A 22  ? 0.2525 0.2726 0.2200 0.0041  -0.0094 -0.0082 19   LYS A CG  
203  C  CG  B LYS A 22  ? 0.1953 0.2130 0.1299 -0.0040 -0.0042 0.0169  19   LYS A CG  
204  C  CD  A LYS A 22  ? 0.2784 0.2819 0.2293 0.0118  -0.0257 0.0224  19   LYS A CD  
205  C  CD  B LYS A 22  ? 0.2634 0.2163 0.1399 0.0076  0.0000  0.0237  19   LYS A CD  
206  C  CE  A LYS A 22  ? 0.2892 0.3279 0.2512 0.0189  -0.0312 0.0023  19   LYS A CE  
207  C  CE  B LYS A 22  ? 0.2712 0.2082 0.1445 -0.0039 0.0085  0.0348  19   LYS A CE  
208  N  NZ  A LYS A 22  ? 0.3253 0.3253 0.2583 0.0068  -0.0122 0.0052  19   LYS A NZ  
209  N  NZ  B LYS A 22  ? 0.3149 0.2372 0.2209 -0.0119 0.0130  -0.0388 19   LYS A NZ  
210  N  N   . ASN A 23  ? 0.1762 0.1951 0.1758 -0.0014 0.0002  0.0076  20   ASN A N   
211  C  CA  . ASN A 23  ? 0.1895 0.2044 0.1787 -0.0045 0.0070  0.0109  20   ASN A CA  
212  C  C   . ASN A 23  ? 0.1716 0.1998 0.1767 -0.0064 0.0154  0.0131  20   ASN A C   
213  O  O   . ASN A 23  ? 0.2039 0.2190 0.1682 0.0278  0.0152  0.0021  20   ASN A O   
214  C  CB  . ASN A 23  ? 0.1862 0.2038 0.1814 -0.0158 0.0104  0.0196  20   ASN A CB  
215  C  CG  . ASN A 23  ? 0.2498 0.2583 0.2332 -0.0057 -0.0085 0.0104  20   ASN A CG  
216  O  OD1 . ASN A 23  ? 0.3470 0.3199 0.2663 -0.0015 -0.0689 0.0385  20   ASN A OD1 
217  N  ND2 . ASN A 23  ? 0.3944 0.2860 0.3004 -0.0125 -0.0089 0.0055  20   ASN A ND2 
218  N  N   . GLU A 24  ? 0.1661 0.1999 0.1594 -0.0072 0.0134  0.0029  21   GLU A N   
219  C  CA  . GLU A 24  ? 0.1662 0.1793 0.1711 -0.0159 0.0177  0.0132  21   GLU A CA  
220  C  C   . GLU A 24  ? 0.1705 0.1798 0.1536 -0.0091 0.0120  0.0141  21   GLU A C   
221  O  O   . GLU A 24  ? 0.1801 0.1843 0.2010 -0.0092 0.0116  0.0096  21   GLU A O   
222  C  CB  . GLU A 24  ? 0.1722 0.1897 0.1619 -0.0099 -0.0004 -0.0016 21   GLU A CB  
223  C  CG  . GLU A 24  ? 0.1887 0.1787 0.2424 -0.0293 -0.0042 0.0070  21   GLU A CG  
224  C  CD  . GLU A 24  ? 0.1961 0.2144 0.3167 -0.0070 0.0152  -0.0102 21   GLU A CD  
225  O  OE1 . GLU A 24  ? 0.1944 0.2362 0.2992 0.0240  -0.0230 -0.0160 21   GLU A OE1 
226  O  OE2 . GLU A 24  ? 0.2091 0.2635 0.3832 -0.0523 0.0055  -0.0723 21   GLU A OE2 
227  N  N   . PHE A 25  ? 0.1690 0.1885 0.1443 0.0041  0.0134  0.0213  22   PHE A N   
228  C  CA  . PHE A 25  ? 0.1866 0.1799 0.1464 -0.0011 0.0224  0.0148  22   PHE A CA  
229  C  C   . PHE A 25  ? 0.2326 0.2036 0.1665 0.0023  0.0263  0.0098  22   PHE A C   
230  O  O   . PHE A 25  ? 0.2690 0.1992 0.1844 0.0003  0.0288  0.0055  22   PHE A O   
231  C  CB  . PHE A 25  ? 0.1964 0.1805 0.1593 -0.0064 0.0214  0.0040  22   PHE A CB  
232  C  CG  . PHE A 25  ? 0.1837 0.1662 0.1419 -0.0134 -0.0037 0.0000  22   PHE A CG  
233  C  CD1 . PHE A 25  ? 0.1725 0.1648 0.1674 -0.0164 -0.0054 -0.0054 22   PHE A CD1 
234  C  CD2 . PHE A 25  ? 0.1766 0.1279 0.1407 -0.0177 -0.0002 0.0091  22   PHE A CD2 
235  C  CE1 . PHE A 25  ? 0.1831 0.1577 0.1590 -0.0098 -0.0225 -0.0202 22   PHE A CE1 
236  C  CE2 . PHE A 25  ? 0.1741 0.1652 0.1102 -0.0217 0.0104  0.0070  22   PHE A CE2 
237  C  CZ  . PHE A 25  ? 0.1812 0.1821 0.1424 -0.0207 -0.0007 0.0225  22   PHE A CZ  
238  N  N   . ASP A 26  ? 0.2383 0.2195 0.1543 0.0089  0.0272  0.0192  23   ASP A N   
239  C  CA  A ASP A 26  ? 0.2613 0.2280 0.1725 0.0028  0.0310  0.0184  23   ASP A CA  
240  C  CA  B ASP A 26  ? 0.2491 0.2241 0.1723 0.0056  0.0229  0.0148  23   ASP A CA  
241  C  C   . ASP A 26  ? 0.2504 0.2210 0.1869 0.0050  0.0245  0.0170  23   ASP A C   
242  O  O   . ASP A 26  ? 0.2872 0.2545 0.1895 0.0107  0.0488  0.0092  23   ASP A O   
243  C  CB  A ASP A 26  ? 0.2782 0.2267 0.1543 0.0042  0.0212  0.0303  23   ASP A CB  
244  C  CB  B ASP A 26  ? 0.2525 0.2242 0.1605 0.0068  0.0141  0.0191  23   ASP A CB  
245  C  CG  A ASP A 26  ? 0.2958 0.2455 0.1853 -0.0137 0.0399  0.0421  23   ASP A CG  
246  C  CG  B ASP A 26  ? 0.2652 0.2450 0.1643 0.0095  0.0082  0.0181  23   ASP A CG  
247  O  OD1 A ASP A 26  ? 0.3823 0.2740 0.3403 -0.0225 -0.0201 0.0028  23   ASP A OD1 
248  O  OD1 B ASP A 26  ? 0.2833 0.2719 0.1654 0.0229  -0.0275 0.0193  23   ASP A OD1 
249  O  OD2 A ASP A 26  ? 0.3624 0.2981 0.2956 0.0166  0.0410  0.0131  23   ASP A OD2 
250  O  OD2 B ASP A 26  ? 0.2671 0.2574 0.1252 0.0087  -0.0085 0.0372  23   ASP A OD2 
251  N  N   . LYS A 27  ? 0.2219 0.2154 0.1840 -0.0016 0.0254  0.0305  24   LYS A N   
252  C  CA  A LYS A 27  ? 0.2184 0.2264 0.2061 -0.0018 0.0278  0.0261  24   LYS A CA  
253  C  CA  B LYS A 27  ? 0.2118 0.2163 0.1961 -0.0014 0.0255  0.0269  24   LYS A CA  
254  C  C   . LYS A 27  ? 0.2109 0.2231 0.2097 -0.0024 0.0293  0.0290  24   LYS A C   
255  O  O   . LYS A 27  ? 0.2324 0.2350 0.2378 -0.0085 0.0408  0.0366  24   LYS A O   
256  C  CB  A LYS A 27  ? 0.2272 0.2420 0.2198 -0.0010 0.0259  0.0179  24   LYS A CB  
257  C  CB  B LYS A 27  ? 0.2099 0.2122 0.1944 0.0002  0.0244  0.0254  24   LYS A CB  
258  C  CG  A LYS A 27  ? 0.2658 0.2695 0.2661 -0.0082 0.0267  0.0021  24   LYS A CG  
259  C  CG  B LYS A 27  ? 0.2155 0.2273 0.2138 0.0003  0.0103  0.0206  24   LYS A CG  
260  C  CD  A LYS A 27  ? 0.3105 0.3205 0.2959 -0.0094 0.0132  -0.0118 24   LYS A CD  
261  C  CD  B LYS A 27  ? 0.2516 0.2485 0.2479 0.0020  -0.0001 0.0041  24   LYS A CD  
262  C  CE  A LYS A 27  ? 0.3295 0.3211 0.3128 -0.0156 0.0207  -0.0104 24   LYS A CE  
263  C  CE  B LYS A 27  ? 0.2691 0.2596 0.2547 0.0012  -0.0046 0.0187  24   LYS A CE  
264  N  NZ  A LYS A 27  ? 0.3315 0.3750 0.3184 -0.0081 -0.0065 -0.0237 24   LYS A NZ  
265  N  NZ  B LYS A 27  ? 0.2661 0.2600 0.2909 0.0075  -0.0343 -0.0025 24   LYS A NZ  
266  N  N   . ASP A 28  ? 0.1960 0.2078 0.1971 -0.0128 0.0319  0.0299  25   ASP A N   
267  C  CA  . ASP A 28  ? 0.1884 0.2102 0.2027 -0.0092 0.0154  0.0107  25   ASP A CA  
268  C  C   . ASP A 28  ? 0.2063 0.2189 0.1978 -0.0104 0.0105  0.0048  25   ASP A C   
269  O  O   . ASP A 28  ? 0.2073 0.2120 0.1663 -0.0167 0.0088  0.0064  25   ASP A O   
270  C  CB  . ASP A 28  ? 0.1980 0.2039 0.2069 -0.0189 0.0121  0.0062  25   ASP A CB  
271  C  CG  . ASP A 28  ? 0.1855 0.2320 0.2249 -0.0265 0.0213  0.0048  25   ASP A CG  
272  O  OD1 . ASP A 28  ? 0.1919 0.2046 0.2381 -0.0227 0.0069  0.0025  25   ASP A OD1 
273  O  OD2 . ASP A 28  ? 0.2025 0.2552 0.2132 0.0035  0.0174  0.0001  25   ASP A OD2 
274  N  N   . ASP A 29  ? 0.2274 0.2255 0.1744 -0.0057 0.0079  0.0048  26   ASP A N   
275  C  CA  A ASP A 29  ? 0.2397 0.2252 0.1915 -0.0080 0.0140  0.0067  26   ASP A CA  
276  C  CA  B ASP A 29  ? 0.2298 0.2204 0.1942 -0.0080 0.0079  0.0056  26   ASP A CA  
277  C  C   . ASP A 29  ? 0.2295 0.2192 0.1891 -0.0114 0.0099  0.0052  26   ASP A C   
278  O  O   . ASP A 29  ? 0.2835 0.2250 0.2000 -0.0158 0.0056  -0.0087 26   ASP A O   
279  C  CB  A ASP A 29  ? 0.2654 0.2343 0.1958 -0.0050 0.0078  0.0066  26   ASP A CB  
280  C  CB  B ASP A 29  ? 0.2284 0.2246 0.1996 -0.0060 0.0071  0.0068  26   ASP A CB  
281  C  CG  A ASP A 29  ? 0.2812 0.3060 0.2108 -0.0045 0.0336  0.0055  26   ASP A CG  
282  C  CG  B ASP A 29  ? 0.2579 0.2474 0.2170 -0.0095 0.0045  0.0093  26   ASP A CG  
283  O  OD1 A ASP A 29  ? 0.2869 0.3665 0.2126 0.0079  0.0393  0.0248  26   ASP A OD1 
284  O  OD1 B ASP A 29  ? 0.2729 0.2836 0.2355 0.0032  0.0017  0.0080  26   ASP A OD1 
285  O  OD2 A ASP A 29  ? 0.3802 0.3752 0.2264 -0.0175 0.0314  0.0173  26   ASP A OD2 
286  O  OD2 B ASP A 29  ? 0.2988 0.2664 0.2521 -0.0013 0.0054  0.0008  26   ASP A OD2 
287  N  N   . LYS A 30  ? 0.1836 0.2108 0.1779 -0.0061 0.0179  0.0000  27   LYS A N   
288  C  CA  A LYS A 30  ? 0.1822 0.2054 0.1779 -0.0049 0.0182  -0.0006 27   LYS A CA  
289  C  CA  B LYS A 30  ? 0.1718 0.1992 0.1762 -0.0076 0.0201  -0.0006 27   LYS A CA  
290  C  C   . LYS A 30  ? 0.1715 0.1929 0.1687 -0.0049 0.0112  0.0018  27   LYS A C   
291  O  O   . LYS A 30  ? 0.1372 0.2137 0.1656 -0.0240 0.0017  0.0113  27   LYS A O   
292  C  CB  A LYS A 30  ? 0.1909 0.2111 0.1854 -0.0067 0.0159  -0.0055 27   LYS A CB  
293  C  CB  B LYS A 30  ? 0.1760 0.2030 0.1842 -0.0111 0.0197  -0.0054 27   LYS A CB  
294  C  CG  A LYS A 30  ? 0.2336 0.2446 0.1994 0.0007  0.0316  0.0004  27   LYS A CG  
295  C  CG  B LYS A 30  ? 0.1711 0.1994 0.1859 -0.0120 0.0420  -0.0020 27   LYS A CG  
296  C  CD  A LYS A 30  ? 0.2846 0.2865 0.2778 -0.0143 0.0043  -0.0129 27   LYS A CD  
297  C  CD  B LYS A 30  ? 0.2009 0.2213 0.2450 -0.0225 0.0277  -0.0118 27   LYS A CD  
298  C  CE  A LYS A 30  ? 0.3160 0.3019 0.2868 -0.0209 0.0052  -0.0124 27   LYS A CE  
299  C  CE  B LYS A 30  ? 0.2291 0.2135 0.2179 -0.0441 0.0467  0.0007  27   LYS A CE  
300  N  NZ  A LYS A 30  ? 0.3498 0.3045 0.2769 -0.0366 0.0290  -0.0006 27   LYS A NZ  
301  N  NZ  B LYS A 30  ? 0.2155 0.2368 0.2503 -0.0860 0.0448  0.0166  27   LYS A NZ  
302  N  N   . ARG A 31  ? 0.1589 0.1892 0.1503 -0.0050 0.0029  0.0017  28   ARG A N   
303  C  CA  . ARG A 31  ? 0.1630 0.1821 0.1527 0.0007  0.0096  0.0078  28   ARG A CA  
304  C  C   . ARG A 31  ? 0.1511 0.1658 0.1079 0.0013  0.0000  0.0182  28   ARG A C   
305  O  O   . ARG A 31  ? 0.1594 0.2040 0.1135 0.0072  -0.0006 0.0301  28   ARG A O   
306  C  CB  . ARG A 31  ? 0.1862 0.1771 0.1460 0.0048  0.0306  0.0052  28   ARG A CB  
307  C  CG  . ARG A 31  ? 0.2285 0.1874 0.1486 0.0242  0.0694  0.0217  28   ARG A CG  
308  C  CD  . ARG A 31  ? 0.2391 0.1891 0.1759 -0.0173 0.0626  0.0249  28   ARG A CD  
309  N  NE  . ARG A 31  ? 0.1834 0.1600 0.1440 -0.0413 0.0297  0.0066  28   ARG A NE  
310  C  CZ  . ARG A 31  ? 0.1544 0.1831 0.1469 -0.0308 0.0049  0.0017  28   ARG A CZ  
311  N  NH1 . ARG A 31  ? 0.1556 0.1670 0.1572 -0.0210 0.0275  -0.0076 28   ARG A NH1 
312  N  NH2 . ARG A 31  ? 0.1289 0.2033 0.1249 -0.0279 -0.0150 0.0024  28   ARG A NH2 
313  N  N   . VAL A 32  ? 0.1508 0.1620 0.1152 -0.0070 0.0123  0.0192  29   VAL A N   
314  C  CA  . VAL A 32  ? 0.1520 0.1512 0.1225 -0.0141 0.0085  0.0133  29   VAL A CA  
315  C  C   . VAL A 32  ? 0.1425 0.1718 0.1310 -0.0071 0.0143  0.0024  29   VAL A C   
316  O  O   . VAL A 32  ? 0.1522 0.1659 0.1518 -0.0172 0.0031  0.0158  29   VAL A O   
317  C  CB  . VAL A 32  ? 0.1415 0.1672 0.1388 -0.0154 0.0051  0.0077  29   VAL A CB  
318  C  CG1 . VAL A 32  ? 0.1856 0.1591 0.1702 -0.0357 0.0223  0.0164  29   VAL A CG1 
319  C  CG2 . VAL A 32  ? 0.1510 0.1645 0.1593 0.0093  0.0061  0.0321  29   VAL A CG2 
320  N  N   . GLU A 33  ? 0.1386 0.1837 0.1464 -0.0031 0.0147  0.0042  30   GLU A N   
321  C  CA  . GLU A 33  ? 0.1753 0.1957 0.1847 -0.0008 0.0044  0.0064  30   GLU A CA  
322  C  C   . GLU A 33  ? 0.1662 0.1844 0.1471 0.0007  0.0140  0.0104  30   GLU A C   
323  O  O   . GLU A 33  ? 0.1689 0.2037 0.1953 0.0072  -0.0140 0.0312  30   GLU A O   
324  C  CB  . GLU A 33  ? 0.1958 0.2162 0.1968 0.0105  0.0111  -0.0031 30   GLU A CB  
325  C  CG  . GLU A 33  ? 0.2434 0.2919 0.2549 0.0088  0.0084  0.0122  30   GLU A CG  
326  C  CD  . GLU A 33  ? 0.3262 0.4557 0.3528 0.0068  0.0459  -0.0107 30   GLU A CD  
327  O  OE1 . GLU A 33  ? 0.4138 0.5243 0.3425 0.0109  0.1055  -0.0312 30   GLU A OE1 
328  O  OE2 . GLU A 33  ? 0.3576 0.5391 0.4714 0.0144  0.0232  -0.0115 30   GLU A OE2 
329  N  N   . LYS A 34  ? 0.1602 0.1860 0.1485 0.0047  0.0114  0.0184  31   LYS A N   
330  C  CA  . LYS A 34  ? 0.1547 0.1938 0.1516 -0.0037 0.0058  0.0021  31   LYS A CA  
331  C  C   . LYS A 34  ? 0.1428 0.1879 0.1350 -0.0020 0.0024  0.0160  31   LYS A C   
332  O  O   . LYS A 34  ? 0.1488 0.2052 0.1282 0.0063  -0.0041 0.0153  31   LYS A O   
333  C  CB  . LYS A 34  ? 0.1865 0.2142 0.1612 -0.0121 -0.0124 -0.0050 31   LYS A CB  
334  C  CG  . LYS A 34  ? 0.2322 0.2559 0.2314 -0.0106 0.0073  -0.0261 31   LYS A CG  
335  C  CD  . LYS A 34  ? 0.2814 0.2593 0.2707 -0.0207 -0.0096 0.0002  31   LYS A CD  
336  C  CE  . LYS A 34  ? 0.3157 0.2864 0.3049 -0.0192 -0.0207 -0.0189 31   LYS A CE  
337  N  NZ  . LYS A 34  ? 0.2923 0.2542 0.3367 -0.0380 -0.0164 -0.0097 31   LYS A NZ  
338  N  N   . PHE A 35  ? 0.1421 0.1846 0.1353 0.0036  0.0040  0.0030  32   PHE A N   
339  C  CA  . PHE A 35  ? 0.1211 0.1528 0.1094 -0.0007 0.0086  0.0078  32   PHE A CA  
340  C  C   . PHE A 35  ? 0.1221 0.1516 0.1255 0.0068  0.0057  -0.0028 32   PHE A C   
341  O  O   . PHE A 35  ? 0.1152 0.1596 0.1482 0.0240  0.0139  0.0182  32   PHE A O   
342  C  CB  . PHE A 35  ? 0.1537 0.1551 0.1206 -0.0073 0.0114  -0.0095 32   PHE A CB  
343  C  CG  . PHE A 35  ? 0.1183 0.1934 0.1418 -0.0288 0.0043  0.0055  32   PHE A CG  
344  C  CD1 . PHE A 35  ? 0.1481 0.2036 0.1473 -0.0405 -0.0112 0.0095  32   PHE A CD1 
345  C  CD2 . PHE A 35  ? 0.1656 0.1711 0.1494 -0.0219 -0.0398 0.0022  32   PHE A CD2 
346  C  CE1 . PHE A 35  ? 0.1600 0.2203 0.1601 -0.0418 -0.0254 0.0128  32   PHE A CE1 
347  C  CE2 . PHE A 35  ? 0.1822 0.1656 0.2095 -0.0082 -0.0541 0.0254  32   PHE A CE2 
348  C  CZ  . PHE A 35  ? 0.1437 0.1390 0.2295 -0.0460 -0.0400 0.0139  32   PHE A CZ  
349  N  N   . SER A 36  ? 0.1202 0.1479 0.1449 0.0076  0.0130  0.0151  33   SER A N   
350  C  CA  . SER A 36  ? 0.1280 0.1530 0.1402 0.0113  0.0017  0.0193  33   SER A CA  
351  C  C   . SER A 36  ? 0.1214 0.1514 0.1598 0.0171  0.0036  0.0265  33   SER A C   
352  O  O   . SER A 36  ? 0.1188 0.1869 0.1891 0.0117  0.0095  0.0312  33   SER A O   
353  C  CB  . SER A 36  ? 0.1392 0.1541 0.1403 0.0028  0.0134  0.0046  33   SER A CB  
354  O  OG  . SER A 36  ? 0.1736 0.1880 0.1218 0.0417  -0.0152 -0.0151 33   SER A OG  
355  N  N   . LEU A 37  ? 0.1124 0.1549 0.1412 0.0166  -0.0053 0.0300  34   LEU A N   
356  C  CA  . LEU A 37  ? 0.1165 0.1499 0.1577 0.0190  -0.0073 0.0173  34   LEU A CA  
357  C  C   . LEU A 37  ? 0.1349 0.1521 0.1633 0.0054  -0.0072 0.0309  34   LEU A C   
358  O  O   . LEU A 37  ? 0.1218 0.1570 0.1729 0.0025  -0.0141 0.0081  34   LEU A O   
359  C  CB  . LEU A 37  ? 0.1310 0.1490 0.1649 0.0242  -0.0231 0.0250  34   LEU A CB  
360  C  CG  . LEU A 37  ? 0.1244 0.1762 0.1647 0.0179  -0.0075 0.0251  34   LEU A CG  
361  C  CD1 . LEU A 37  ? 0.1720 0.2246 0.1326 -0.0044 -0.0246 0.0158  34   LEU A CD1 
362  C  CD2 . LEU A 37  ? 0.1504 0.1817 0.1687 0.0408  0.0182  0.0436  34   LEU A CD2 
363  N  N   . LYS A 38  ? 0.1422 0.1686 0.1721 0.0047  -0.0074 0.0158  35   LYS A N   
364  C  CA  . LYS A 38  ? 0.1637 0.1846 0.1815 0.0001  -0.0100 0.0325  35   LYS A CA  
365  C  C   . LYS A 38  ? 0.1625 0.1775 0.1931 0.0008  -0.0138 0.0353  35   LYS A C   
366  O  O   . LYS A 38  ? 0.1684 0.2267 0.2523 -0.0073 -0.0041 0.0565  35   LYS A O   
367  C  CB  . LYS A 38  ? 0.2028 0.1957 0.2075 0.0036  -0.0252 0.0177  35   LYS A CB  
368  C  CG  . LYS A 38  ? 0.2760 0.2817 0.2551 0.0232  -0.0113 0.0145  35   LYS A CG  
369  C  CD  . LYS A 38  ? 0.3947 0.4005 0.3426 0.0206  0.0095  -0.0497 35   LYS A CD  
370  C  CE  . LYS A 38  ? 0.4446 0.4741 0.3934 0.0313  0.0085  -0.0610 35   LYS A CE  
371  N  NZ  . LYS A 38  ? 0.5152 0.5069 0.3804 0.0341  0.0054  -0.0931 35   LYS A NZ  
372  N  N   . HIS A 39  ? 0.1379 0.1623 0.1665 0.0059  -0.0052 0.0301  36   HIS A N   
373  C  CA  . HIS A 39  ? 0.1538 0.1738 0.1633 0.0029  -0.0092 0.0173  36   HIS A CA  
374  C  C   . HIS A 39  ? 0.1649 0.1632 0.1402 0.0050  -0.0062 0.0106  36   HIS A C   
375  O  O   . HIS A 39  ? 0.1548 0.1587 0.1345 0.0071  -0.0211 0.0065  36   HIS A O   
376  C  CB  . HIS A 39  ? 0.1965 0.1727 0.1554 0.0043  -0.0283 0.0052  36   HIS A CB  
377  C  CG  . HIS A 39  ? 0.1827 0.1572 0.1698 -0.0084 -0.0159 0.0123  36   HIS A CG  
378  N  ND1 . HIS A 39  ? 0.2269 0.1811 0.1774 0.0091  -0.0645 0.0118  36   HIS A ND1 
379  C  CD2 . HIS A 39  ? 0.1632 0.1732 0.1678 -0.0004 -0.0187 0.0143  36   HIS A CD2 
380  C  CE1 . HIS A 39  ? 0.1612 0.1622 0.1711 0.0120  -0.0328 0.0163  36   HIS A CE1 
381  N  NE2 . HIS A 39  ? 0.1691 0.1725 0.1424 0.0094  -0.0186 -0.0021 36   HIS A NE2 
382  N  N   . GLN A 40  ? 0.1722 0.1577 0.1646 0.0000  -0.0067 -0.0042 37   GLN A N   
383  C  CA  . GLN A 40  ? 0.1875 0.1710 0.1780 -0.0006 -0.0242 -0.0080 37   GLN A CA  
384  C  C   . GLN A 40  ? 0.2153 0.1775 0.2018 0.0039  -0.0264 -0.0133 37   GLN A C   
385  O  O   . GLN A 40  ? 0.2457 0.1998 0.1926 -0.0154 -0.0496 0.0006  37   GLN A O   
386  C  CB  . GLN A 40  ? 0.1693 0.1502 0.1892 0.0000  -0.0215 -0.0136 37   GLN A CB  
387  C  CG  . GLN A 40  ? 0.1502 0.1762 0.1839 0.0010  -0.0142 0.0054  37   GLN A CG  
388  C  CD  . GLN A 40  ? 0.1383 0.2035 0.1794 0.0273  -0.0178 0.0329  37   GLN A CD  
389  O  OE1 . GLN A 40  ? 0.1882 0.2490 0.2671 0.0567  -0.0037 0.0726  37   GLN A OE1 
390  N  NE2 . GLN A 40  ? 0.1255 0.2313 0.1914 0.0059  -0.0183 0.0382  37   GLN A NE2 
391  N  N   . ASN A 41  ? 0.1693 0.1765 0.2238 0.0074  -0.0479 -0.0190 38   ASN A N   
392  C  CA  . ASN A 41  ? 0.2206 0.1898 0.2383 0.0106  -0.0452 -0.0067 38   ASN A CA  
393  C  C   . ASN A 41  ? 0.1752 0.1835 0.2493 0.0091  -0.0383 0.0005  38   ASN A C   
394  O  O   . ASN A 41  ? 0.2018 0.2005 0.3167 0.0056  -0.0887 -0.0111 38   ASN A O   
395  C  CB  . ASN A 41  ? 0.2031 0.1974 0.2573 0.0106  -0.0438 -0.0127 38   ASN A CB  
396  C  CG  . ASN A 41  ? 0.2765 0.2126 0.2832 0.0150  -0.0357 -0.0234 38   ASN A CG  
397  O  OD1 . ASN A 41  ? 0.4402 0.2788 0.4618 0.0170  -0.0378 0.0097  38   ASN A OD1 
398  N  ND2 . ASN A 41  ? 0.4274 0.2353 0.3608 -0.0128 0.0116  -0.0512 38   ASN A ND2 
399  N  N   . ILE A 42  ? 0.1608 0.1622 0.1767 0.0199  -0.0404 0.0079  39   ILE A N   
400  C  CA  . ILE A 42  ? 0.1371 0.1510 0.1706 0.0145  -0.0222 0.0171  39   ILE A CA  
401  C  C   . ILE A 42  ? 0.1284 0.1421 0.1556 0.0103  -0.0235 0.0047  39   ILE A C   
402  O  O   . ILE A 42  ? 0.1283 0.1480 0.1776 -0.0050 -0.0298 0.0277  39   ILE A O   
403  C  CB  . ILE A 42  ? 0.1474 0.1699 0.1906 0.0137  -0.0062 0.0284  39   ILE A CB  
404  C  CG1 . ILE A 42  ? 0.1509 0.2016 0.1891 0.0216  -0.0039 0.0639  39   ILE A CG1 
405  C  CG2 . ILE A 42  ? 0.2085 0.1656 0.1878 0.0168  -0.0219 -0.0082 39   ILE A CG2 
406  C  CD1 . ILE A 42  ? 0.2131 0.2552 0.1645 0.0134  -0.0476 0.0474  39   ILE A CD1 
407  N  N   . TYR A 43  ? 0.1147 0.1264 0.1376 0.0081  -0.0110 0.0101  40   TYR A N   
408  C  CA  . TYR A 43  ? 0.1248 0.1210 0.1239 0.0036  -0.0106 0.0025  40   TYR A CA  
409  C  C   . TYR A 43  ? 0.1165 0.1271 0.1482 0.0118  -0.0037 0.0076  40   TYR A C   
410  O  O   . TYR A 43  ? 0.1105 0.1303 0.1882 0.0082  0.0078  -0.0084 40   TYR A O   
411  C  CB  . TYR A 43  ? 0.1303 0.1246 0.1327 0.0191  -0.0150 -0.0107 40   TYR A CB  
412  C  CG  . TYR A 43  ? 0.1463 0.1540 0.1276 0.0141  -0.0144 0.0015  40   TYR A CG  
413  C  CD1 . TYR A 43  ? 0.1506 0.1738 0.1366 0.0074  -0.0144 0.0379  40   TYR A CD1 
414  C  CD2 . TYR A 43  ? 0.1277 0.1507 0.1338 -0.0042 -0.0129 0.0032  40   TYR A CD2 
415  C  CE1 . TYR A 43  ? 0.1409 0.1577 0.1527 -0.0115 -0.0043 0.0179  40   TYR A CE1 
416  C  CE2 . TYR A 43  ? 0.1350 0.1558 0.1451 -0.0193 -0.0009 0.0112  40   TYR A CE2 
417  C  CZ  . TYR A 43  ? 0.1334 0.1422 0.1537 0.0004  0.0078  0.0039  40   TYR A CZ  
418  O  OH  . TYR A 43  ? 0.1417 0.1541 0.1469 -0.0190 0.0097  0.0104  40   TYR A OH  
419  N  N   . PHE A 44  ? 0.1063 0.1191 0.1362 0.0098  -0.0018 0.0033  41   PHE A N   
420  C  CA  . PHE A 44  ? 0.1100 0.1210 0.1437 -0.0065 -0.0076 0.0081  41   PHE A CA  
421  C  C   . PHE A 44  ? 0.1171 0.1417 0.1412 -0.0054 -0.0128 0.0191  41   PHE A C   
422  O  O   . PHE A 44  ? 0.1114 0.1679 0.1519 0.0078  -0.0071 0.0303  41   PHE A O   
423  C  CB  . PHE A 44  ? 0.1194 0.1383 0.1414 -0.0042 -0.0110 0.0158  41   PHE A CB  
424  C  CG  . PHE A 44  ? 0.1390 0.1436 0.1161 -0.0057 -0.0125 0.0137  41   PHE A CG  
425  C  CD1 . PHE A 44  ? 0.1185 0.1766 0.1633 -0.0062 -0.0305 -0.0100 41   PHE A CD1 
426  C  CD2 . PHE A 44  ? 0.2148 0.1524 0.1548 -0.0066 0.0129  0.0234  41   PHE A CD2 
427  C  CE1 . PHE A 44  ? 0.1779 0.2007 0.2078 0.0433  -0.0199 -0.0192 41   PHE A CE1 
428  C  CE2 . PHE A 44  ? 0.2005 0.1635 0.1788 -0.0343 -0.0016 0.0375  41   PHE A CE2 
429  C  CZ  . PHE A 44  ? 0.2239 0.1535 0.1566 0.0210  -0.0049 0.0171  41   PHE A CZ  
430  N  N   . ASP A 45  ? 0.1180 0.1261 0.1466 -0.0127 -0.0107 0.0077  42   ASP A N   
431  C  CA  . ASP A 45  ? 0.1143 0.1308 0.1353 -0.0082 -0.0062 0.0028  42   ASP A CA  
432  C  C   . ASP A 45  ? 0.1186 0.1302 0.1294 -0.0137 -0.0014 0.0013  42   ASP A C   
433  O  O   . ASP A 45  ? 0.1219 0.1375 0.1429 -0.0101 0.0054  0.0123  42   ASP A O   
434  C  CB  . ASP A 45  ? 0.1147 0.1427 0.1461 -0.0048 -0.0123 -0.0040 42   ASP A CB  
435  C  CG  . ASP A 45  ? 0.1146 0.1171 0.0996 -0.0059 -0.0102 -0.0101 42   ASP A CG  
436  O  OD1 . ASP A 45  ? 0.1393 0.1193 0.1388 -0.0359 -0.0048 -0.0019 42   ASP A OD1 
437  O  OD2 . ASP A 45  ? 0.1594 0.1752 0.1249 -0.0170 -0.0325 0.0078  42   ASP A OD2 
438  N  N   . TYR A 46  ? 0.1173 0.1331 0.1285 -0.0023 -0.0010 0.0028  43   TYR A N   
439  C  CA  . TYR A 46  ? 0.1266 0.1357 0.1213 -0.0039 0.0063  0.0013  43   TYR A CA  
440  C  C   . TYR A 46  ? 0.1088 0.1251 0.1329 0.0046  -0.0114 -0.0020 43   TYR A C   
441  O  O   . TYR A 46  ? 0.1194 0.1193 0.1464 -0.0014 -0.0099 -0.0104 43   TYR A O   
442  C  CB  . TYR A 46  ? 0.1203 0.1508 0.1240 -0.0199 0.0071  0.0009  43   TYR A CB  
443  C  CG  . TYR A 46  ? 0.1345 0.1531 0.1243 -0.0107 -0.0046 0.0166  43   TYR A CG  
444  C  CD1 . TYR A 46  ? 0.1125 0.1571 0.1398 -0.0063 -0.0169 -0.0103 43   TYR A CD1 
445  C  CD2 . TYR A 46  ? 0.1090 0.1450 0.1381 -0.0295 -0.0005 -0.0020 43   TYR A CD2 
446  C  CE1 . TYR A 46  ? 0.1343 0.1956 0.1431 -0.0196 -0.0091 0.0124  43   TYR A CE1 
447  C  CE2 . TYR A 46  ? 0.1277 0.1816 0.1615 0.0380  -0.0102 0.0022  43   TYR A CE2 
448  C  CZ  . TYR A 46  ? 0.1292 0.2161 0.1478 0.0146  -0.0151 0.0097  43   TYR A CZ  
449  O  OH  . TYR A 46  ? 0.1342 0.3047 0.1858 0.0140  -0.0116 0.0462  43   TYR A OH  
450  N  N   . SER A 47  ? 0.1136 0.1192 0.1334 -0.0011 -0.0101 0.0008  44   SER A N   
451  C  CA  . SER A 47  ? 0.1078 0.1340 0.1097 0.0039  -0.0051 0.0078  44   SER A CA  
452  C  C   . SER A 47  ? 0.1070 0.1217 0.1225 -0.0059 -0.0055 0.0054  44   SER A C   
453  O  O   . SER A 47  ? 0.1285 0.1294 0.1118 0.0016  0.0068  0.0075  44   SER A O   
454  C  CB  . SER A 47  ? 0.1279 0.1296 0.1160 0.0112  -0.0223 0.0013  44   SER A CB  
455  O  OG  . SER A 47  ? 0.1507 0.1467 0.1149 0.0016  -0.0211 -0.0032 44   SER A OG  
456  N  N   . LYS A 48  ? 0.1061 0.1091 0.1153 0.0000  -0.0009 0.0105  45   LYS A N   
457  C  CA  . LYS A 48  ? 0.1043 0.1353 0.1222 -0.0040 -0.0049 -0.0033 45   LYS A CA  
458  C  C   . LYS A 48  ? 0.1165 0.1286 0.1095 0.0080  -0.0001 0.0020  45   LYS A C   
459  O  O   . LYS A 48  ? 0.1195 0.1459 0.1355 0.0133  -0.0088 -0.0089 45   LYS A O   
460  C  CB  . LYS A 48  ? 0.1190 0.1257 0.1415 -0.0008 0.0034  0.0000  45   LYS A CB  
461  C  CG  . LYS A 48  ? 0.1264 0.1567 0.1049 -0.0263 0.0097  -0.0007 45   LYS A CG  
462  C  CD  . LYS A 48  ? 0.1349 0.1248 0.1243 -0.0053 0.0092  -0.0173 45   LYS A CD  
463  C  CE  . LYS A 48  ? 0.1292 0.1487 0.1168 -0.0066 0.0163  -0.0092 45   LYS A CE  
464  N  NZ  . LYS A 48  ? 0.1358 0.1150 0.1534 0.0006  -0.0141 -0.0080 45   LYS A NZ  
465  N  N   . ASN A 49  ? 0.1291 0.1163 0.1260 -0.0012 -0.0079 0.0035  46   ASN A N   
466  C  CA  . ASN A 49  ? 0.1473 0.1304 0.1230 -0.0070 -0.0057 0.0108  46   ASN A CA  
467  C  C   . ASN A 49  ? 0.1262 0.1161 0.1186 -0.0018 0.0007  0.0138  46   ASN A C   
468  O  O   . ASN A 49  ? 0.1315 0.1364 0.1196 -0.0161 0.0015  0.0128  46   ASN A O   
469  C  CB  . ASN A 49  ? 0.1530 0.1294 0.1335 -0.0053 -0.0221 -0.0047 46   ASN A CB  
470  C  CG  . ASN A 49  ? 0.1672 0.1518 0.1517 -0.0055 0.0149  -0.0024 46   ASN A CG  
471  O  OD1 . ASN A 49  ? 0.1519 0.1250 0.1164 -0.0118 -0.0097 0.0035  46   ASN A OD1 
472  N  ND2 . ASN A 49  ? 0.1497 0.1059 0.1437 0.0056  -0.0313 0.0004  46   ASN A ND2 
473  N  N   . LEU A 50  ? 0.1527 0.1357 0.1354 -0.0250 0.0065  0.0084  47   LEU A N   
474  C  CA  . LEU A 50  ? 0.1420 0.1365 0.1363 -0.0220 -0.0002 0.0084  47   LEU A CA  
475  C  C   . LEU A 50  ? 0.1352 0.1473 0.1362 -0.0209 -0.0042 0.0039  47   LEU A C   
476  O  O   . LEU A 50  ? 0.1528 0.1850 0.1485 -0.0370 -0.0094 -0.0153 47   LEU A O   
477  C  CB  . LEU A 50  ? 0.1483 0.1559 0.1138 -0.0182 0.0098  -0.0025 47   LEU A CB  
478  C  CG  . LEU A 50  ? 0.1483 0.1612 0.1402 -0.0074 0.0328  0.0089  47   LEU A CG  
479  C  CD1 . LEU A 50  ? 0.1842 0.2174 0.2117 0.0268  0.0687  -0.0058 47   LEU A CD1 
480  C  CD2 . LEU A 50  ? 0.2187 0.2248 0.0963 0.0037  0.0196  -0.0312 47   LEU A CD2 
481  N  N   . ILE A 51  ? 0.1442 0.1366 0.1390 -0.0293 -0.0103 0.0000  48   ILE A N   
482  C  CA  . ILE A 51  ? 0.1460 0.1489 0.1495 -0.0225 -0.0175 0.0078  48   ILE A CA  
483  C  C   . ILE A 51  ? 0.1513 0.1759 0.1561 -0.0287 -0.0165 -0.0050 48   ILE A C   
484  O  O   . ILE A 51  ? 0.1522 0.1641 0.1677 -0.0357 -0.0280 0.0129  48   ILE A O   
485  C  CB  . ILE A 51  ? 0.1543 0.1635 0.1617 -0.0213 -0.0316 0.0039  48   ILE A CB  
486  C  CG1 . ILE A 51  ? 0.1753 0.1571 0.1986 0.0015  -0.0214 0.0241  48   ILE A CG1 
487  C  CG2 . ILE A 51  ? 0.1905 0.1731 0.1974 0.0011  0.0069  0.0334  48   ILE A CG2 
488  C  CD1 . ILE A 51  ? 0.2114 0.1494 0.2215 0.0005  -0.0720 0.0238  48   ILE A CD1 
489  N  N   . ASN A 52  ? 0.1551 0.1856 0.1451 -0.0276 -0.0154 -0.0084 49   ASN A N   
490  C  CA  . ASN A 52  ? 0.1466 0.1842 0.1560 -0.0207 -0.0225 -0.0055 49   ASN A CA  
491  C  C   . ASN A 52  ? 0.1541 0.1746 0.1608 -0.0214 -0.0129 0.0053  49   ASN A C   
492  O  O   . ASN A 52  ? 0.1555 0.1824 0.1346 -0.0288 0.0082  -0.0024 49   ASN A O   
493  C  CB  . ASN A 52  ? 0.1723 0.1842 0.1428 -0.0321 -0.0225 -0.0057 49   ASN A CB  
494  C  CG  . ASN A 52  ? 0.1555 0.1787 0.1614 -0.0273 -0.0317 -0.0039 49   ASN A CG  
495  O  OD1 . ASN A 52  ? 0.2205 0.1877 0.1487 -0.0797 -0.0504 0.0137  49   ASN A OD1 
496  N  ND2 . ASN A 52  ? 0.1474 0.2000 0.1580 -0.0410 -0.0233 0.0313  49   ASN A ND2 
497  N  N   . ASP A 53  ? 0.1625 0.1957 0.1686 -0.0046 0.0008  0.0027  50   ASP A N   
498  C  CA  . ASP A 53  ? 0.1627 0.2124 0.1649 -0.0080 0.0044  0.0123  50   ASP A CA  
499  C  C   . ASP A 53  ? 0.1627 0.2198 0.1744 -0.0183 0.0067  0.0204  50   ASP A C   
500  O  O   . ASP A 53  ? 0.1462 0.2759 0.1598 -0.0161 0.0011  0.0373  50   ASP A O   
501  C  CB  . ASP A 53  ? 0.1631 0.2378 0.2040 -0.0018 0.0117  -0.0054 50   ASP A CB  
502  C  CG  . ASP A 53  ? 0.2630 0.2484 0.2692 -0.0134 0.0323  -0.0196 50   ASP A CG  
503  O  OD1 . ASP A 53  ? 0.3567 0.3349 0.4116 -0.0203 0.0711  -0.0350 50   ASP A OD1 
504  O  OD2 . ASP A 53  ? 0.4451 0.3008 0.3433 -0.0160 0.0456  -0.0486 50   ASP A OD2 
505  N  N   . TYR A 54  ? 0.1659 0.2329 0.1434 -0.0224 -0.0021 0.0126  51   TYR A N   
506  C  CA  . TYR A 54  ? 0.1649 0.2293 0.1626 -0.0362 0.0039  0.0085  51   TYR A CA  
507  C  C   . TYR A 54  ? 0.1577 0.2340 0.1429 -0.0263 -0.0040 0.0151  51   TYR A C   
508  O  O   . TYR A 54  ? 0.1484 0.2554 0.1176 -0.0436 -0.0045 0.0386  51   TYR A O   
509  C  CB  . TYR A 54  ? 0.1887 0.2429 0.1765 -0.0495 0.0050  0.0036  51   TYR A CB  
510  C  CG  . TYR A 54  ? 0.1624 0.2615 0.1907 -0.0952 0.0345  -0.0210 51   TYR A CG  
511  C  CD1 . TYR A 54  ? 0.1863 0.3905 0.3004 -0.0819 0.0530  -0.0688 51   TYR A CD1 
512  C  CD2 . TYR A 54  ? 0.2028 0.2571 0.2438 -0.0743 0.0010  0.0068  51   TYR A CD2 
513  C  CE1 . TYR A 54  ? 0.1986 0.4287 0.3010 -0.0874 0.0569  -0.0959 51   TYR A CE1 
514  C  CE2 . TYR A 54  ? 0.2247 0.3524 0.2719 -0.0744 0.0432  -0.0569 51   TYR A CE2 
515  C  CZ  . TYR A 54  ? 0.2369 0.4145 0.3048 -0.0579 0.0216  -0.0825 51   TYR A CZ  
516  O  OH  . TYR A 54  ? 0.2857 0.4674 0.3109 -0.1090 0.0935  -0.1087 51   TYR A OH  
517  N  N   . ILE A 55  ? 0.1285 0.2063 0.1379 -0.0162 -0.0045 0.0137  52   ILE A N   
518  C  CA  . ILE A 55  ? 0.1219 0.1880 0.1368 -0.0188 -0.0092 0.0132  52   ILE A CA  
519  C  C   . ILE A 55  ? 0.1391 0.2024 0.1513 -0.0077 -0.0083 0.0088  52   ILE A C   
520  O  O   . ILE A 55  ? 0.1235 0.2231 0.1223 -0.0188 0.0032  0.0297  52   ILE A O   
521  C  CB  . ILE A 55  ? 0.1352 0.1833 0.1598 -0.0144 -0.0178 0.0112  52   ILE A CB  
522  C  CG1 . ILE A 55  ? 0.1498 0.1805 0.1388 -0.0142 -0.0274 0.0087  52   ILE A CG1 
523  C  CG2 . ILE A 55  ? 0.1066 0.2016 0.1612 -0.0058 -0.0089 0.0101  52   ILE A CG2 
524  C  CD1 . ILE A 55  ? 0.1403 0.1578 0.1551 0.0036  -0.0428 0.0287  52   ILE A CD1 
525  N  N   . LEU A 56  ? 0.1362 0.1837 0.1400 -0.0039 0.0008  0.0164  53   LEU A N   
526  C  CA  . LEU A 56  ? 0.1566 0.1897 0.1692 -0.0088 -0.0036 0.0132  53   LEU A CA  
527  C  C   . LEU A 56  ? 0.1441 0.1928 0.1578 -0.0109 -0.0009 0.0263  53   LEU A C   
528  O  O   . LEU A 56  ? 0.1573 0.1982 0.1425 -0.0143 -0.0056 0.0445  53   LEU A O   
529  C  CB  . LEU A 56  ? 0.1901 0.2143 0.1823 -0.0113 -0.0015 0.0114  53   LEU A CB  
530  C  CG  . LEU A 56  ? 0.2838 0.2211 0.2300 -0.0322 -0.0086 0.0053  53   LEU A CG  
531  C  CD1 . LEU A 56  ? 0.3040 0.2416 0.2316 -0.0705 -0.0133 0.0472  53   LEU A CD1 
532  C  CD2 . LEU A 56  ? 0.3640 0.2838 0.1837 -0.0437 -0.0124 -0.0168 53   LEU A CD2 
533  N  N   . LYS A 57  ? 0.1435 0.2189 0.1536 -0.0048 0.0004  0.0258  54   LYS A N   
534  C  CA  A LYS A 57  ? 0.1429 0.2116 0.1748 -0.0117 -0.0055 0.0256  54   LYS A CA  
535  C  CA  B LYS A 57  ? 0.1551 0.2156 0.1786 -0.0076 0.0000  0.0217  54   LYS A CA  
536  C  C   . LYS A 57  ? 0.1448 0.2088 0.1683 -0.0095 0.0065  0.0273  54   LYS A C   
537  O  O   . LYS A 57  ? 0.1706 0.2442 0.1975 -0.0071 -0.0035 0.0415  54   LYS A O   
538  C  CB  A LYS A 57  ? 0.1467 0.2274 0.1787 -0.0031 0.0025  0.0180  54   LYS A CB  
539  C  CB  B LYS A 57  ? 0.1643 0.2312 0.1823 0.0000  0.0064  0.0166  54   LYS A CB  
540  C  CG  A LYS A 57  ? 0.1600 0.2099 0.1864 0.0001  -0.0258 0.0262  54   LYS A CG  
541  C  CG  B LYS A 57  ? 0.2255 0.2419 0.2255 0.0143  0.0023  0.0028  54   LYS A CG  
542  C  CD  A LYS A 57  ? 0.1699 0.2271 0.2021 -0.0064 0.0053  -0.0037 54   LYS A CD  
543  C  CD  B LYS A 57  ? 0.2552 0.2567 0.2318 0.0120  0.0082  -0.0023 54   LYS A CD  
544  C  CE  A LYS A 57  ? 0.2294 0.2602 0.2681 0.0175  0.0005  -0.0033 54   LYS A CE  
545  C  CE  B LYS A 57  ? 0.2636 0.2458 0.2441 0.0220  0.0016  0.0039  54   LYS A CE  
546  N  NZ  A LYS A 57  ? 0.2728 0.2636 0.3186 0.0314  0.0099  -0.0333 54   LYS A NZ  
547  N  NZ  B LYS A 57  ? 0.2739 0.2506 0.2138 0.0047  0.0195  0.0155  54   LYS A NZ  
548  N  N   . SER A 58  ? 0.1559 0.1938 0.1704 -0.0284 0.0156  0.0285  55   SER A N   
549  C  CA  A SER A 58  ? 0.1623 0.1844 0.1668 -0.0193 -0.0050 0.0225  55   SER A CA  
550  C  CA  B SER A 58  ? 0.1447 0.1812 0.1642 -0.0208 0.0049  0.0238  55   SER A CA  
551  C  C   . SER A 58  ? 0.1666 0.1901 0.1671 -0.0115 0.0000  0.0246  55   SER A C   
552  O  O   . SER A 58  ? 0.1747 0.1904 0.1530 -0.0052 -0.0180 0.0372  55   SER A O   
553  C  CB  A SER A 58  ? 0.1744 0.2023 0.1782 -0.0194 -0.0081 0.0112  55   SER A CB  
554  C  CB  B SER A 58  ? 0.1456 0.1908 0.1651 -0.0213 0.0092  0.0172  55   SER A CB  
555  O  OG  A SER A 58  ? 0.2122 0.1800 0.1796 -0.0001 -0.0369 0.0195  55   SER A OG  
556  O  OG  B SER A 58  ? 0.0752 0.1503 0.1744 -0.0267 0.0341  0.0322  55   SER A OG  
557  N  N   . LEU A 59  ? 0.1420 0.1503 0.1505 -0.0073 -0.0223 0.0406  56   LEU A N   
558  C  CA  . LEU A 59  ? 0.1380 0.1598 0.1446 -0.0034 -0.0025 0.0221  56   LEU A CA  
559  C  C   . LEU A 59  ? 0.1476 0.1707 0.1533 0.0058  -0.0004 0.0157  56   LEU A C   
560  O  O   . LEU A 59  ? 0.1482 0.1596 0.1503 0.0013  0.0049  0.0205  56   LEU A O   
561  C  CB  . LEU A 59  ? 0.1314 0.1474 0.1506 -0.0093 0.0037  0.0224  56   LEU A CB  
562  C  CG  . LEU A 59  ? 0.1388 0.1872 0.1246 0.0108  -0.0018 0.0219  56   LEU A CG  
563  C  CD1 . LEU A 59  ? 0.1184 0.2121 0.1703 -0.0141 -0.0212 0.0195  56   LEU A CD1 
564  C  CD2 . LEU A 59  ? 0.1777 0.1827 0.1692 0.0303  -0.0250 -0.0276 56   LEU A CD2 
565  N  N   . LEU A 60  ? 0.1469 0.1683 0.1418 0.0049  -0.0054 0.0180  57   LEU A N   
566  C  CA  . LEU A 60  ? 0.1409 0.1791 0.1525 0.0099  -0.0043 0.0125  57   LEU A CA  
567  C  C   . LEU A 60  ? 0.1435 0.1719 0.1484 -0.0019 -0.0087 0.0230  57   LEU A C   
568  O  O   . LEU A 60  ? 0.1555 0.1797 0.1571 0.0207  -0.0124 0.0420  57   LEU A O   
569  C  CB  . LEU A 60  ? 0.1509 0.1693 0.1421 0.0085  0.0092  0.0287  57   LEU A CB  
570  C  CG  . LEU A 60  ? 0.1657 0.1806 0.1333 0.0111  0.0028  -0.0060 57   LEU A CG  
571  C  CD1 . LEU A 60  ? 0.1972 0.2365 0.1209 -0.0343 0.0105  0.0054  57   LEU A CD1 
572  C  CD2 . LEU A 60  ? 0.1755 0.1841 0.1922 -0.0016 0.0232  0.0096  57   LEU A CD2 
573  N  N   . GLU A 61  ? 0.1441 0.1841 0.1659 -0.0008 -0.0218 0.0082  58   GLU A N   
574  C  CA  . GLU A 61  ? 0.1680 0.2065 0.1785 0.0053  -0.0249 0.0107  58   GLU A CA  
575  C  C   . GLU A 61  ? 0.1576 0.1916 0.1772 0.0100  -0.0215 0.0122  58   GLU A C   
576  O  O   . GLU A 61  ? 0.1681 0.1964 0.1858 0.0043  -0.0326 0.0239  58   GLU A O   
577  C  CB  . GLU A 61  ? 0.1913 0.2237 0.1785 0.0060  -0.0345 0.0212  58   GLU A CB  
578  C  CG  . GLU A 61  ? 0.2527 0.2990 0.2586 0.0171  -0.0181 0.0034  58   GLU A CG  
579  C  CD  . GLU A 61  ? 0.3551 0.3671 0.3398 -0.0156 0.0285  0.0293  58   GLU A CD  
580  O  OE1 . GLU A 61  ? 0.4460 0.3760 0.4457 -0.0457 0.0375  0.0299  58   GLU A OE1 
581  O  OE2 . GLU A 61  ? 0.3713 0.4597 0.4331 -0.0011 0.0817  0.0255  58   GLU A OE2 
582  N  N   . SER A 62  ? 0.1564 0.1861 0.1783 0.0172  -0.0170 0.0199  59   SER A N   
583  C  CA  . SER A 62  ? 0.1688 0.1875 0.1736 0.0254  -0.0262 0.0012  59   SER A CA  
584  C  C   . SER A 62  ? 0.1696 0.1707 0.1627 0.0225  -0.0275 0.0008  59   SER A C   
585  O  O   . SER A 62  ? 0.1715 0.1835 0.1628 0.0301  -0.0351 0.0047  59   SER A O   
586  C  CB  . SER A 62  ? 0.1911 0.1851 0.1968 0.0320  -0.0247 0.0006  59   SER A CB  
587  O  OG  . SER A 62  ? 0.2814 0.2408 0.2507 0.0551  -0.0083 0.0091  59   SER A OG  
588  N  N   . ALA A 63  ? 0.1606 0.1549 0.1577 0.0219  -0.0209 0.0123  60   ALA A N   
589  C  CA  . ALA A 63  ? 0.1475 0.1462 0.1519 0.0213  -0.0022 0.0044  60   ALA A CA  
590  C  C   . ALA A 63  ? 0.1461 0.1535 0.1369 0.0072  -0.0052 0.0173  60   ALA A C   
591  O  O   . ALA A 63  ? 0.1588 0.1746 0.1214 0.0163  -0.0355 0.0143  60   ALA A O   
592  C  CB  . ALA A 63  ? 0.1374 0.1502 0.1824 0.0081  -0.0023 -0.0043 60   ALA A CB  
593  N  N   . GLU A 64  ? 0.1299 0.1649 0.1473 0.0224  -0.0015 0.0160  61   GLU A N   
594  C  CA  . GLU A 64  ? 0.1435 0.1622 0.1477 0.0189  0.0000  0.0196  61   GLU A CA  
595  C  C   . GLU A 64  ? 0.1254 0.1613 0.1594 0.0094  -0.0149 0.0086  61   GLU A C   
596  O  O   . GLU A 64  ? 0.1642 0.1475 0.1557 0.0063  -0.0216 0.0309  61   GLU A O   
597  C  CB  . GLU A 64  ? 0.1279 0.1685 0.1526 0.0073  -0.0005 0.0277  61   GLU A CB  
598  C  CG  . GLU A 64  ? 0.1494 0.1937 0.1547 0.0334  0.0071  0.0246  61   GLU A CG  
599  C  CD  . GLU A 64  ? 0.1992 0.2055 0.2015 0.0271  -0.0174 0.0045  61   GLU A CD  
600  O  OE1 . GLU A 64  ? 0.2302 0.2537 0.2340 0.0252  -0.0215 0.0352  61   GLU A OE1 
601  O  OE2 . GLU A 64  ? 0.2159 0.2255 0.2683 0.0305  -0.0406 0.0025  61   GLU A OE2 
602  N  N   . LYS A 65  ? 0.1517 0.1649 0.1454 0.0059  -0.0097 0.0161  62   LYS A N   
603  C  CA  A LYS A 65  ? 0.1487 0.1684 0.1585 0.0038  -0.0099 0.0036  62   LYS A CA  
604  C  CA  B LYS A 65  ? 0.1501 0.1693 0.1596 0.0034  -0.0111 0.0020  62   LYS A CA  
605  C  C   . LYS A 65  ? 0.1581 0.1719 0.1593 0.0058  -0.0166 -0.0018 62   LYS A C   
606  O  O   . LYS A 65  ? 0.1796 0.2130 0.1389 -0.0041 -0.0241 -0.0096 62   LYS A O   
607  C  CB  A LYS A 65  ? 0.1778 0.1783 0.1764 0.0173  -0.0089 0.0044  62   LYS A CB  
608  C  CB  B LYS A 65  ? 0.1679 0.1757 0.1752 0.0105  -0.0106 0.0002  62   LYS A CB  
609  C  CG  A LYS A 65  ? 0.2259 0.2197 0.2259 0.0049  -0.0011 -0.0008 62   LYS A CG  
610  C  CG  B LYS A 65  ? 0.1983 0.2049 0.2164 0.0004  -0.0074 -0.0090 62   LYS A CG  
611  C  CD  A LYS A 65  ? 0.2895 0.2482 0.2636 0.0020  0.0042  0.0187  62   LYS A CD  
612  C  CD  B LYS A 65  ? 0.2462 0.2444 0.2732 0.0098  0.0030  -0.0184 62   LYS A CD  
613  C  CE  A LYS A 65  ? 0.3452 0.2970 0.2961 0.0130  0.0230  0.0098  62   LYS A CE  
614  C  CE  B LYS A 65  ? 0.2418 0.2619 0.2846 0.0017  -0.0197 -0.0133 62   LYS A CE  
615  N  NZ  A LYS A 65  ? 0.3859 0.3155 0.3187 0.0118  0.0084  0.0050  62   LYS A NZ  
616  N  NZ  B LYS A 65  ? 0.2745 0.2494 0.3272 -0.0271 0.0006  -0.0168 62   LYS A NZ  
617  N  N   . SER A 66  ? 0.1535 0.1666 0.1577 0.0143  -0.0164 -0.0033 63   SER A N   
618  C  CA  . SER A 66  ? 0.1588 0.1566 0.1534 0.0029  -0.0175 0.0035  63   SER A CA  
619  C  C   . SER A 66  ? 0.1564 0.1553 0.1353 0.0040  -0.0175 0.0023  63   SER A C   
620  O  O   . SER A 66  ? 0.1586 0.1545 0.1388 0.0139  -0.0203 0.0014  63   SER A O   
621  C  CB  . SER A 66  ? 0.1614 0.1534 0.1509 -0.0066 -0.0174 0.0071  63   SER A CB  
622  O  OG  . SER A 66  ? 0.1615 0.1519 0.1460 0.0029  -0.0370 0.0025  63   SER A OG  
623  N  N   . SER A 67  ? 0.1709 0.1484 0.1377 0.0044  -0.0137 -0.0063 64   SER A N   
624  C  CA  A SER A 67  ? 0.1726 0.1422 0.1529 -0.0092 -0.0050 -0.0015 64   SER A CA  
625  C  CA  B SER A 67  ? 0.1674 0.1489 0.1433 -0.0078 -0.0123 -0.0023 64   SER A CA  
626  C  C   . SER A 67  ? 0.1572 0.1458 0.1405 -0.0020 -0.0163 -0.0024 64   SER A C   
627  O  O   . SER A 67  ? 0.1528 0.1410 0.1394 -0.0172 -0.0093 -0.0080 64   SER A O   
628  C  CB  A SER A 67  ? 0.1942 0.1369 0.1602 -0.0039 -0.0067 -0.0080 64   SER A CB  
629  C  CB  B SER A 67  ? 0.1751 0.1499 0.1472 -0.0046 -0.0132 -0.0045 64   SER A CB  
630  O  OG  A SER A 67  ? 0.2134 0.1677 0.2281 -0.0048 0.0304  0.0000  64   SER A OG  
631  O  OG  B SER A 67  ? 0.2134 0.1837 0.1499 -0.0283 -0.0159 -0.0027 64   SER A OG  
632  N  N   . LEU A 68  ? 0.1393 0.1405 0.1470 -0.0035 -0.0199 -0.0039 65   LEU A N   
633  C  CA  . LEU A 68  ? 0.1425 0.1411 0.1347 -0.0083 -0.0048 0.0025  65   LEU A CA  
634  C  C   . LEU A 68  ? 0.1242 0.1271 0.1218 -0.0031 -0.0020 -0.0021 65   LEU A C   
635  O  O   . LEU A 68  ? 0.1476 0.1374 0.1079 -0.0169 -0.0136 0.0166  65   LEU A O   
636  C  CB  . LEU A 68  ? 0.1250 0.1464 0.1314 -0.0118 0.0005  0.0082  65   LEU A CB  
637  C  CG  . LEU A 68  ? 0.1508 0.1474 0.1179 -0.0179 -0.0005 -0.0105 65   LEU A CG  
638  C  CD1 . LEU A 68  ? 0.1438 0.1776 0.1253 -0.0449 0.0063  0.0044  65   LEU A CD1 
639  C  CD2 . LEU A 68  ? 0.1517 0.2046 0.1274 -0.0023 -0.0290 0.0316  65   LEU A CD2 
640  N  N   . LYS A 69  ? 0.1339 0.1427 0.1518 0.0021  -0.0073 0.0140  66   LYS A N   
641  C  CA  . LYS A 69  ? 0.1340 0.1420 0.1327 0.0023  -0.0026 0.0110  66   LYS A CA  
642  C  C   . LYS A 69  ? 0.1453 0.1495 0.1446 -0.0031 0.0033  0.0095  66   LYS A C   
643  O  O   . LYS A 69  ? 0.1383 0.1509 0.1497 -0.0248 -0.0010 0.0107  66   LYS A O   
644  C  CB  . LYS A 69  ? 0.1500 0.1615 0.1316 0.0198  0.0075  0.0214  66   LYS A CB  
645  C  CG  . LYS A 69  ? 0.1662 0.1748 0.1495 0.0224  0.0077  0.0263  66   LYS A CG  
646  C  CD  . LYS A 69  ? 0.1701 0.2114 0.2200 -0.0043 0.0202  0.0339  66   LYS A CD  
647  C  CE  . LYS A 69  ? 0.2329 0.2587 0.2411 -0.0281 -0.0253 0.0626  66   LYS A CE  
648  N  NZ  . LYS A 69  ? 0.2129 0.2653 0.2926 -0.0530 -0.0602 0.0746  66   LYS A NZ  
649  N  N   . ASP A 70  ? 0.1466 0.1416 0.1456 0.0082  -0.0076 0.0104  67   ASP A N   
650  C  CA  A ASP A 70  ? 0.1388 0.1417 0.1328 0.0006  -0.0005 0.0103  67   ASP A CA  
651  C  CA  B ASP A 70  ? 0.1458 0.1417 0.1331 0.0007  -0.0050 0.0107  67   ASP A CA  
652  C  C   . ASP A 70  ? 0.1342 0.1356 0.1309 -0.0077 -0.0128 0.0075  67   ASP A C   
653  O  O   . ASP A 70  ? 0.1453 0.1464 0.1277 -0.0125 -0.0163 0.0122  67   ASP A O   
654  C  CB  A ASP A 70  ? 0.1340 0.1587 0.1413 0.0032  -0.0005 0.0135  67   ASP A CB  
655  C  CB  B ASP A 70  ? 0.1521 0.1517 0.1434 0.0028  -0.0033 0.0111  67   ASP A CB  
656  C  CG  A ASP A 70  ? 0.1647 0.2065 0.2048 -0.0148 0.0246  -0.0174 67   ASP A CG  
657  C  CG  B ASP A 70  ? 0.1835 0.1957 0.1578 -0.0041 -0.0139 0.0059  67   ASP A CG  
658  O  OD1 A ASP A 70  ? 0.1420 0.2166 0.2413 0.0378  0.0039  0.0086  67   ASP A OD1 
659  O  OD1 B ASP A 70  ? 0.2235 0.2579 0.2404 0.0429  -0.0264 -0.0177 67   ASP A OD1 
660  O  OD2 A ASP A 70  ? 0.2176 0.2728 0.3440 -0.0505 0.0813  -0.0644 67   ASP A OD2 
661  O  OD2 B ASP A 70  ? 0.2021 0.2882 0.1976 -0.0660 0.0601  -0.0211 67   ASP A OD2 
662  N  N   . LYS A 71  ? 0.1340 0.1383 0.1233 -0.0071 -0.0074 0.0080  68   LYS A N   
663  C  CA  A LYS A 71  ? 0.1384 0.1460 0.1354 -0.0106 -0.0043 -0.0059 68   LYS A CA  
664  C  CA  B LYS A 71  ? 0.1356 0.1383 0.1280 -0.0082 -0.0044 0.0000  68   LYS A CA  
665  C  C   . LYS A 71  ? 0.1363 0.1254 0.1263 -0.0045 -0.0061 0.0033  68   LYS A C   
666  O  O   . LYS A 71  ? 0.1456 0.1520 0.1272 0.0063  -0.0074 0.0179  68   LYS A O   
667  C  CB  A LYS A 71  ? 0.1515 0.1543 0.1601 -0.0147 -0.0012 -0.0054 68   LYS A CB  
668  C  CB  B LYS A 71  ? 0.1392 0.1390 0.1372 -0.0119 -0.0013 -0.0010 68   LYS A CB  
669  C  CG  A LYS A 71  ? 0.1853 0.1786 0.2224 -0.0201 -0.0025 -0.0163 68   LYS A CG  
670  C  CG  B LYS A 71  ? 0.1438 0.1483 0.1441 -0.0173 -0.0038 -0.0027 68   LYS A CG  
671  C  CD  A LYS A 71  ? 0.2710 0.2525 0.2667 -0.0077 -0.0086 -0.0199 68   LYS A CD  
672  C  CD  B LYS A 71  ? 0.1929 0.1661 0.1310 -0.0121 0.0004  0.0040  68   LYS A CD  
673  C  CE  A LYS A 71  ? 0.3518 0.2880 0.3418 -0.0110 0.0185  -0.0337 68   LYS A CE  
674  C  CE  B LYS A 71  ? 0.2138 0.1786 0.1374 -0.0099 0.0190  0.0160  68   LYS A CE  
675  N  NZ  A LYS A 71  ? 0.3824 0.2871 0.3963 -0.0589 0.0572  -0.0349 68   LYS A NZ  
676  N  NZ  B LYS A 71  ? 0.2187 0.2171 0.1061 -0.0158 0.0250  0.0240  68   LYS A NZ  
677  N  N   . ILE A 72  ? 0.1535 0.1368 0.1340 -0.0008 0.0066  0.0028  69   ILE A N   
678  C  CA  . ILE A 72  ? 0.1467 0.1286 0.1239 -0.0004 -0.0109 -0.0003 69   ILE A CA  
679  C  C   . ILE A 72  ? 0.1349 0.1374 0.1458 -0.0028 -0.0052 0.0064  69   ILE A C   
680  O  O   . ILE A 72  ? 0.1189 0.1520 0.1630 -0.0165 -0.0065 -0.0002 69   ILE A O   
681  C  CB  . ILE A 72  ? 0.1463 0.1326 0.1319 0.0067  0.0015  -0.0008 69   ILE A CB  
682  C  CG1 . ILE A 72  ? 0.1429 0.1538 0.1342 -0.0145 -0.0252 0.0083  69   ILE A CG1 
683  C  CG2 . ILE A 72  ? 0.2217 0.1532 0.1411 -0.0155 -0.0044 -0.0365 69   ILE A CG2 
684  C  CD1 . ILE A 72  ? 0.1727 0.2200 0.1300 -0.0379 -0.0129 0.0394  69   ILE A CD1 
685  N  N   . LYS A 73  ? 0.1240 0.1445 0.1474 -0.0092 -0.0094 0.0002  70   LYS A N   
686  C  CA  A LYS A 73  ? 0.1444 0.1496 0.1620 -0.0067 -0.0095 -0.0016 70   LYS A CA  
687  C  CA  B LYS A 73  ? 0.1307 0.1454 0.1550 -0.0053 -0.0131 0.0000  70   LYS A CA  
688  C  C   . LYS A 73  ? 0.1270 0.1496 0.1661 -0.0027 -0.0171 0.0071  70   LYS A C   
689  O  O   . LYS A 73  ? 0.1532 0.1461 0.1843 -0.0095 -0.0161 0.0173  70   LYS A O   
690  C  CB  A LYS A 73  ? 0.1602 0.1717 0.1703 -0.0099 -0.0082 -0.0079 70   LYS A CB  
691  C  CB  B LYS A 73  ? 0.1356 0.1609 0.1536 -0.0066 -0.0143 -0.0044 70   LYS A CB  
692  C  CG  A LYS A 73  ? 0.2081 0.2004 0.2046 -0.0173 0.0141  -0.0139 70   LYS A CG  
693  C  CG  B LYS A 73  ? 0.1182 0.1730 0.1625 0.0000  -0.0208 -0.0091 70   LYS A CG  
694  C  CD  A LYS A 73  ? 0.2145 0.2630 0.2562 0.0074  0.0283  -0.0201 70   LYS A CD  
695  C  CD  B LYS A 73  ? 0.1389 0.1919 0.2055 0.0001  -0.0169 0.0142  70   LYS A CD  
696  C  CE  A LYS A 73  ? 0.2605 0.3125 0.2780 0.0080  0.0295  -0.0209 70   LYS A CE  
697  C  CE  B LYS A 73  ? 0.1956 0.1838 0.2452 0.0077  -0.0273 0.0185  70   LYS A CE  
698  N  NZ  A LYS A 73  ? 0.1852 0.2263 0.3125 0.0466  0.0443  -0.0115 70   LYS A NZ  
699  N  NZ  B LYS A 73  ? 0.2395 0.2321 0.2570 0.0005  0.0006  0.0188  70   LYS A NZ  
700  N  N   . GLN A 74  ? 0.1557 0.1331 0.1648 -0.0088 -0.0070 0.0100  71   GLN A N   
701  C  CA  . GLN A 74  ? 0.1327 0.1506 0.1533 -0.0121 -0.0180 0.0060  71   GLN A CA  
702  C  C   . GLN A 74  ? 0.1217 0.1290 0.1614 -0.0171 -0.0146 0.0170  71   GLN A C   
703  O  O   . GLN A 74  ? 0.1660 0.1313 0.1460 -0.0352 -0.0206 0.0180  71   GLN A O   
704  C  CB  . GLN A 74  ? 0.1664 0.1685 0.1819 -0.0284 -0.0199 -0.0014 71   GLN A CB  
705  C  CG  . GLN A 74  ? 0.1963 0.2052 0.1654 -0.0505 -0.0540 -0.0075 71   GLN A CG  
706  C  CD  . GLN A 74  ? 0.2618 0.2790 0.3292 -0.0618 -0.0470 -0.0874 71   GLN A CD  
707  O  OE1 . GLN A 74  ? 0.3441 0.3272 0.4183 -0.0514 -0.0713 -0.1036 71   GLN A OE1 
708  N  NE2 . GLN A 74  ? 0.3423 0.3342 0.4386 -0.1045 -0.0396 -0.0756 71   GLN A NE2 
709  N  N   . MSE A 75  ? 0.1464 0.1150 0.1340 -0.0145 -0.0156 0.0205  72   MSE A N   
710  C  CA  A MSE A 75  ? 0.1406 0.1302 0.1379 -0.0076 -0.0097 0.0199  72   MSE A CA  
711  C  CA  B MSE A 75  ? 0.1390 0.1312 0.1361 -0.0040 -0.0100 0.0163  72   MSE A CA  
712  C  C   . MSE A 75  ? 0.1398 0.1322 0.1388 0.0003  -0.0085 0.0074  72   MSE A C   
713  O  O   . MSE A 75  ? 0.1481 0.1416 0.1341 -0.0126 -0.0105 0.0115  72   MSE A O   
714  C  CB  A MSE A 75  ? 0.1306 0.1284 0.1535 0.0070  -0.0114 0.0124  72   MSE A CB  
715  C  CB  B MSE A 75  ? 0.1316 0.1308 0.1626 0.0158  -0.0134 0.0100  72   MSE A CB  
716  C  CG  A MSE A 75  ? 0.1249 0.1354 0.1325 0.0018  0.0077  0.0343  72   MSE A CG  
717  C  CG  B MSE A 75  ? 0.1289 0.1426 0.1217 0.0102  0.0105  -0.0037 72   MSE A CG  
718  SE SE  A MSE A 75  ? 0.1616 0.1372 0.1403 0.0002  0.0067  -0.0022 72   MSE A SE  
719  SE SE  B MSE A 75  ? 0.1925 0.2066 0.2230 -0.0141 -0.0029 0.0184  72   MSE A SE  
720  C  CE  A MSE A 75  ? 0.0995 0.1129 0.0677 -0.0047 0.0089  -0.0513 72   MSE A CE  
721  C  CE  B MSE A 75  ? 0.2384 0.2398 0.1125 -0.0454 -0.0029 0.0804  72   MSE A CE  
722  N  N   . PHE A 76  ? 0.1384 0.1382 0.1443 -0.0058 -0.0077 0.0057  73   PHE A N   
723  C  CA  . PHE A 76  ? 0.1325 0.1309 0.1233 -0.0038 -0.0105 0.0026  73   PHE A CA  
724  C  C   . PHE A 76  ? 0.1519 0.1354 0.1360 -0.0079 -0.0040 -0.0032 73   PHE A C   
725  O  O   . PHE A 76  ? 0.1981 0.1369 0.1491 -0.0368 -0.0243 -0.0015 73   PHE A O   
726  C  CB  . PHE A 76  ? 0.1350 0.1653 0.1369 -0.0080 0.0005  0.0067  73   PHE A CB  
727  C  CG  . PHE A 76  ? 0.1538 0.1392 0.1417 -0.0094 -0.0236 -0.0010 73   PHE A CG  
728  C  CD1 . PHE A 76  ? 0.1843 0.1294 0.1588 -0.0247 -0.0165 -0.0040 73   PHE A CD1 
729  C  CD2 . PHE A 76  ? 0.1570 0.1543 0.1155 -0.0100 -0.0388 -0.0063 73   PHE A CD2 
730  C  CE1 . PHE A 76  ? 0.2042 0.1652 0.1361 -0.0425 -0.0120 0.0173  73   PHE A CE1 
731  C  CE2 . PHE A 76  ? 0.1599 0.1642 0.1230 -0.0118 -0.0320 0.0087  73   PHE A CE2 
732  C  CZ  . PHE A 76  ? 0.1682 0.1658 0.1403 -0.0335 -0.0154 0.0162  73   PHE A CZ  
733  N  N   . ASN A 77  ? 0.1636 0.1343 0.1338 -0.0051 -0.0128 -0.0011 74   ASN A N   
734  C  CA  . ASN A 77  ? 0.1449 0.1431 0.1521 0.0071  -0.0114 0.0093  74   ASN A CA  
735  C  C   . ASN A 77  ? 0.1343 0.1348 0.1436 0.0104  -0.0137 -0.0079 74   ASN A C   
736  O  O   . ASN A 77  ? 0.1673 0.1646 0.1304 0.0117  -0.0104 -0.0064 74   ASN A O   
737  C  CB  . ASN A 77  ? 0.1542 0.1884 0.1604 0.0064  -0.0125 0.0158  74   ASN A CB  
738  C  CG  . ASN A 77  ? 0.2254 0.2329 0.2492 -0.0089 0.0164  -0.0085 74   ASN A CG  
739  O  OD1 . ASN A 77  ? 0.3144 0.3544 0.3536 -0.0609 0.0574  -0.0637 74   ASN A OD1 
740  N  ND2 . ASN A 77  ? 0.2475 0.3197 0.3503 -0.0256 -0.0132 0.0610  74   ASN A ND2 
741  N  N   . GLY A 78  ? 0.1437 0.1262 0.1432 0.0123  -0.0089 -0.0036 75   GLY A N   
742  C  CA  . GLY A 78  ? 0.1531 0.1209 0.1252 0.0087  -0.0063 0.0091  75   GLY A CA  
743  C  C   . GLY A 78  ? 0.1499 0.1228 0.1338 0.0109  0.0028  0.0105  75   GLY A C   
744  O  O   . GLY A 78  ? 0.1640 0.1503 0.1342 -0.0079 0.0066  -0.0003 75   GLY A O   
745  N  N   . ALA A 79  ? 0.1497 0.1390 0.1264 0.0043  -0.0025 0.0007  76   ALA A N   
746  C  CA  . ALA A 79  ? 0.1455 0.1410 0.1488 -0.0051 -0.0107 0.0032  76   ALA A CA  
747  C  C   . ALA A 79  ? 0.1437 0.1359 0.1282 0.0018  -0.0087 -0.0019 76   ALA A C   
748  O  O   . ALA A 79  ? 0.1525 0.1386 0.1254 0.0022  -0.0187 -0.0023 76   ALA A O   
749  C  CB  . ALA A 79  ? 0.1789 0.1726 0.1539 -0.0236 0.0212  0.0108  76   ALA A CB  
750  N  N   . LYS A 80  ? 0.1484 0.1479 0.1321 0.0117  -0.0147 0.0051  77   LYS A N   
751  C  CA  . LYS A 80  ? 0.1553 0.1663 0.1387 0.0133  -0.0159 0.0003  77   LYS A CA  
752  C  C   . LYS A 80  ? 0.1724 0.1502 0.1470 0.0194  -0.0198 -0.0081 77   LYS A C   
753  O  O   . LYS A 80  ? 0.2104 0.1635 0.2035 0.0120  -0.0083 -0.0126 77   LYS A O   
754  C  CB  . LYS A 80  ? 0.1631 0.1840 0.1472 0.0317  -0.0299 -0.0084 77   LYS A CB  
755  C  CG  . LYS A 80  ? 0.2146 0.2351 0.2053 0.0490  0.0048  0.0043  77   LYS A CG  
756  C  CD  . LYS A 80  ? 0.3061 0.2613 0.2475 0.0755  -0.0031 -0.0063 77   LYS A CD  
757  C  CE  . LYS A 80  ? 0.4096 0.3167 0.3216 0.0799  0.0060  0.0218  77   LYS A CE  
758  N  NZ  . LYS A 80  ? 0.4809 0.3466 0.3726 0.0916  0.0402  0.0216  77   LYS A NZ  
759  N  N   . ILE A 81  ? 0.1684 0.1469 0.1465 0.0180  -0.0228 -0.0042 78   ILE A N   
760  C  CA  . ILE A 81  ? 0.1622 0.1406 0.1637 0.0128  0.0015  0.0084  78   ILE A CA  
761  C  C   . ILE A 81  ? 0.1780 0.1503 0.1643 0.0118  0.0057  0.0093  78   ILE A C   
762  O  O   . ILE A 81  ? 0.1940 0.1624 0.2052 0.0214  0.0286  0.0297  78   ILE A O   
763  C  CB  . ILE A 81  ? 0.1846 0.1383 0.1744 0.0200  0.0005  0.0134  78   ILE A CB  
764  C  CG1 . ILE A 81  ? 0.1819 0.1686 0.1749 0.0210  0.0157  0.0162  78   ILE A CG1 
765  C  CG2 . ILE A 81  ? 0.1728 0.1811 0.2237 0.0303  0.0091  0.0009  78   ILE A CG2 
766  C  CD1 . ILE A 81  ? 0.2238 0.2093 0.1329 0.0249  0.0050  0.0074  78   ILE A CD1 
767  N  N   . ASN A 82  ? 0.1551 0.1330 0.1599 -0.0011 0.0101  -0.0030 79   ASN A N   
768  C  CA  . ASN A 82  ? 0.1579 0.1481 0.1552 0.0129  -0.0023 0.0014  79   ASN A CA  
769  C  C   . ASN A 82  ? 0.1565 0.1522 0.1580 0.0094  0.0007  -0.0024 79   ASN A C   
770  O  O   . ASN A 82  ? 0.1856 0.1603 0.1419 0.0230  0.0017  -0.0203 79   ASN A O   
771  C  CB  . ASN A 82  ? 0.1470 0.1531 0.1221 0.0080  -0.0076 0.0098  79   ASN A CB  
772  C  CG  . ASN A 82  ? 0.1678 0.1485 0.1162 -0.0072 -0.0131 0.0007  79   ASN A CG  
773  O  OD1 . ASN A 82  ? 0.1733 0.1302 0.1773 0.0336  0.0219  0.0112  79   ASN A OD1 
774  N  ND2 . ASN A 82  ? 0.1497 0.1433 0.1311 -0.0039 -0.0182 0.0005  79   ASN A ND2 
775  N  N   . SER A 83  ? 0.1753 0.1627 0.1723 0.0226  0.0070  0.0000  80   SER A N   
776  C  CA  . SER A 83  ? 0.1966 0.1850 0.2026 -0.0084 0.0130  -0.0003 80   SER A CA  
777  C  C   . SER A 83  ? 0.1872 0.1885 0.1834 0.0035  -0.0090 -0.0131 80   SER A C   
778  O  O   . SER A 83  ? 0.2001 0.3075 0.1925 0.0217  -0.0224 -0.0099 80   SER A O   
779  C  CB  . SER A 83  ? 0.2335 0.2274 0.2420 -0.0204 0.0333  -0.0156 80   SER A CB  
780  O  OG  . SER A 83  ? 0.3063 0.2189 0.2420 -0.0745 0.0244  0.0110  80   SER A OG  
781  N  N   . THR A 84  ? 0.1576 0.1602 0.1572 0.0033  -0.0146 -0.0152 81   THR A N   
782  C  CA  . THR A 84  ? 0.1620 0.1496 0.1406 0.0091  -0.0250 -0.0106 81   THR A CA  
783  C  C   . THR A 84  ? 0.1829 0.1578 0.1320 0.0208  -0.0201 -0.0034 81   THR A C   
784  O  O   . THR A 84  ? 0.2409 0.1604 0.1519 0.0211  -0.0071 -0.0202 81   THR A O   
785  C  CB  . THR A 84  ? 0.1625 0.1336 0.1166 0.0242  -0.0151 -0.0093 81   THR A CB  
786  O  OG1 . THR A 84  ? 0.1523 0.1543 0.1496 -0.0114 -0.0286 -0.0145 81   THR A OG1 
787  C  CG2 . THR A 84  ? 0.1444 0.1225 0.1614 -0.0071 -0.0105 0.0068  81   THR A CG2 
788  N  N   . GLU A 85  ? 0.1998 0.1403 0.1105 0.0088  -0.0167 0.0017  82   GLU A N   
789  C  CA  . GLU A 85  ? 0.1977 0.1428 0.1374 0.0162  -0.0123 -0.0060 82   GLU A CA  
790  C  C   . GLU A 85  ? 0.1984 0.1600 0.1455 0.0076  -0.0211 -0.0074 82   GLU A C   
791  O  O   . GLU A 85  ? 0.2378 0.1619 0.1704 0.0255  -0.0116 0.0169  82   GLU A O   
792  C  CB  . GLU A 85  ? 0.2029 0.1644 0.1339 0.0021  -0.0051 -0.0135 82   GLU A CB  
793  C  CG  . GLU A 85  ? 0.2237 0.1868 0.1985 0.0050  -0.0131 0.0259  82   GLU A CG  
794  C  CD  . GLU A 85  ? 0.2124 0.2622 0.2682 -0.0489 0.0477  -0.0176 82   GLU A CD  
795  O  OE1 . GLU A 85  ? 0.2558 0.3170 0.2974 -0.0722 0.0211  -0.0357 82   GLU A OE1 
796  O  OE2 . GLU A 85  ? 0.2861 0.3367 0.3086 -0.0551 0.0818  -0.0278 82   GLU A OE2 
797  N  N   . HIS A 86  ? 0.2071 0.1531 0.1500 0.0252  -0.0156 -0.0042 83   HIS A N   
798  C  CA  . HIS A 86  ? 0.2152 0.1699 0.1592 0.0189  -0.0181 -0.0139 83   HIS A CA  
799  C  C   . HIS A 86  ? 0.2085 0.1546 0.1504 0.0176  -0.0312 -0.0059 83   HIS A C   
800  O  O   . HIS A 86  ? 0.2551 0.1402 0.1610 0.0323  -0.0375 -0.0118 83   HIS A O   
801  C  CB  . HIS A 86  ? 0.2221 0.1834 0.1625 0.0206  -0.0269 -0.0227 83   HIS A CB  
802  C  CG  . HIS A 86  ? 0.3223 0.2419 0.2198 0.0042  -0.0160 -0.0635 83   HIS A CG  
803  N  ND1 . HIS A 86  ? 0.3905 0.3070 0.3075 0.0184  -0.0088 -0.0899 83   HIS A ND1 
804  C  CD2 . HIS A 86  ? 0.4208 0.2510 0.3098 -0.0129 0.0130  -0.0833 83   HIS A CD2 
805  C  CE1 . HIS A 86  ? 0.4258 0.3043 0.3428 0.0001  0.0041  -0.0933 83   HIS A CE1 
806  N  NE2 . HIS A 86  ? 0.4514 0.2788 0.2899 0.0045  0.0150  -0.1022 83   HIS A NE2 
807  N  N   . ARG A 87  ? 0.1860 0.1266 0.1178 0.0138  -0.0224 -0.0109 84   ARG A N   
808  C  CA  . ARG A 87  ? 0.1680 0.1107 0.1366 0.0135  -0.0142 -0.0041 84   ARG A CA  
809  C  C   . ARG A 87  ? 0.1551 0.1202 0.1331 0.0047  -0.0179 -0.0062 84   ARG A C   
810  O  O   . ARG A 87  ? 0.1515 0.1110 0.1526 0.0021  -0.0015 -0.0028 84   ARG A O   
811  C  CB  . ARG A 87  ? 0.1637 0.1188 0.1292 -0.0003 0.0041  -0.0135 84   ARG A CB  
812  C  CG  . ARG A 87  ? 0.1916 0.1377 0.1349 0.0050  0.0066  0.0007  84   ARG A CG  
813  C  CD  . ARG A 87  ? 0.1787 0.1659 0.1797 -0.0140 0.0279  -0.0017 84   ARG A CD  
814  N  NE  . ARG A 87  ? 0.2311 0.1887 0.1959 -0.0230 0.0479  0.0100  84   ARG A NE  
815  C  CZ  . ARG A 87  ? 0.2483 0.3741 0.2162 -0.0190 0.0357  0.0134  84   ARG A CZ  
816  N  NH1 . ARG A 87  ? 0.2036 0.3993 0.2402 -0.0151 0.0410  0.0170  84   ARG A NH1 
817  N  NH2 . ARG A 87  ? 0.3029 0.4387 0.2764 -0.0330 0.0733  -0.0110 84   ARG A NH2 
818  N  N   . ALA A 88  ? 0.1677 0.1083 0.1452 0.0150  -0.0210 -0.0061 85   ALA A N   
819  C  CA  . ALA A 88  ? 0.1401 0.1173 0.1493 0.0160  -0.0070 0.0016  85   ALA A CA  
820  C  C   . ALA A 88  ? 0.1387 0.1235 0.1485 0.0075  0.0016  -0.0003 85   ALA A C   
821  O  O   . ALA A 88  ? 0.1387 0.1352 0.1270 0.0013  0.0029  -0.0025 85   ALA A O   
822  C  CB  . ALA A 88  ? 0.1503 0.0969 0.1828 0.0220  -0.0020 -0.0214 85   ALA A CB  
823  N  N   . VAL A 89  ? 0.1341 0.1267 0.1303 0.0046  -0.0001 0.0000  86   VAL A N   
824  C  CA  . VAL A 89  ? 0.1211 0.1063 0.1170 -0.0019 -0.0036 -0.0048 86   VAL A CA  
825  C  C   . VAL A 89  ? 0.1198 0.1306 0.1202 -0.0005 -0.0026 0.0007  86   VAL A C   
826  O  O   . VAL A 89  ? 0.1311 0.1366 0.1330 0.0000  0.0055  0.0039  86   VAL A O   
827  C  CB  . VAL A 89  ? 0.1286 0.1247 0.1040 0.0066  0.0006  -0.0045 86   VAL A CB  
828  C  CG1 . VAL A 89  ? 0.1400 0.1479 0.1361 0.0348  -0.0390 -0.0076 86   VAL A CG1 
829  C  CG2 . VAL A 89  ? 0.1673 0.1224 0.1078 0.0334  -0.0074 -0.0170 86   VAL A CG2 
830  N  N   . LEU A 90  ? 0.1366 0.1311 0.1244 -0.0026 -0.0093 0.0019  87   LEU A N   
831  C  CA  . LEU A 90  ? 0.1417 0.1183 0.1290 -0.0032 -0.0053 0.0033  87   LEU A CA  
832  C  C   . LEU A 90  ? 0.1258 0.1159 0.1185 0.0109  -0.0143 0.0085  87   LEU A C   
833  O  O   . LEU A 90  ? 0.1359 0.1271 0.1293 0.0012  -0.0032 -0.0015 87   LEU A O   
834  C  CB  . LEU A 90  ? 0.1326 0.1288 0.1408 -0.0069 -0.0089 -0.0015 87   LEU A CB  
835  C  CG  . LEU A 90  ? 0.1510 0.1021 0.1444 0.0095  -0.0184 -0.0182 87   LEU A CG  
836  C  CD1 . LEU A 90  ? 0.1528 0.1617 0.1718 0.0098  -0.0297 0.0418  87   LEU A CD1 
837  C  CD2 . LEU A 90  ? 0.1451 0.1661 0.1620 -0.0165 0.0045  -0.0228 87   LEU A CD2 
838  N  N   . HIS A 91  ? 0.1180 0.1081 0.1352 0.0056  -0.0005 0.0040  88   HIS A N   
839  C  CA  . HIS A 91  ? 0.1224 0.1255 0.1262 0.0013  -0.0082 0.0008  88   HIS A CA  
840  C  C   . HIS A 91  ? 0.1208 0.1174 0.1135 -0.0151 -0.0026 0.0058  88   HIS A C   
841  O  O   . HIS A 91  ? 0.1257 0.1252 0.1174 -0.0037 -0.0059 -0.0020 88   HIS A O   
842  C  CB  . HIS A 91  ? 0.1214 0.1284 0.1250 -0.0021 -0.0098 0.0120  88   HIS A CB  
843  C  CG  . HIS A 91  ? 0.1273 0.1019 0.1206 -0.0011 -0.0107 -0.0075 88   HIS A CG  
844  N  ND1 . HIS A 91  ? 0.1177 0.1037 0.1220 -0.0034 -0.0270 -0.0158 88   HIS A ND1 
845  C  CD2 . HIS A 91  ? 0.1415 0.1379 0.1378 0.0044  -0.0313 -0.0155 88   HIS A CD2 
846  C  CE1 . HIS A 91  ? 0.1803 0.0967 0.1491 0.0208  -0.0007 0.0054  88   HIS A CE1 
847  N  NE2 . HIS A 91  ? 0.1545 0.1336 0.1534 0.0278  -0.0185 -0.0276 88   HIS A NE2 
848  N  N   . THR A 92  ? 0.1176 0.1170 0.1147 -0.0098 -0.0081 -0.0022 89   THR A N   
849  C  CA  . THR A 92  ? 0.1205 0.1321 0.1035 -0.0088 -0.0066 -0.0010 89   THR A CA  
850  C  C   . THR A 92  ? 0.1070 0.1309 0.1222 -0.0087 0.0005  -0.0066 89   THR A C   
851  O  O   . THR A 92  ? 0.1430 0.1224 0.1178 -0.0067 -0.0184 -0.0039 89   THR A O   
852  C  CB  . THR A 92  ? 0.1425 0.1474 0.0960 -0.0134 0.0092  -0.0004 89   THR A CB  
853  O  OG1 . THR A 92  ? 0.1042 0.1507 0.1284 -0.0205 -0.0069 0.0009  89   THR A OG1 
854  C  CG2 . THR A 92  ? 0.1757 0.1184 0.0969 -0.0025 -0.0021 0.0258  89   THR A CG2 
855  N  N   . ALA A 93  ? 0.1342 0.1080 0.1064 0.0018  -0.0081 -0.0070 90   ALA A N   
856  C  CA  . ALA A 93  ? 0.1075 0.1109 0.1123 0.0082  -0.0129 0.0011  90   ALA A CA  
857  C  C   . ALA A 93  ? 0.1022 0.0961 0.1167 0.0074  -0.0022 0.0016  90   ALA A C   
858  O  O   . ALA A 93  ? 0.1253 0.1143 0.1207 0.0135  -0.0015 -0.0149 90   ALA A O   
859  C  CB  . ALA A 93  ? 0.1482 0.1322 0.0748 -0.0009 -0.0306 -0.0113 90   ALA A CB  
860  N  N   . LEU A 94  ? 0.1047 0.0964 0.1269 0.0125  -0.0068 -0.0136 91   LEU A N   
861  C  CA  . LEU A 94  ? 0.1059 0.1065 0.1152 0.0048  -0.0065 0.0013  91   LEU A CA  
862  C  C   . LEU A 94  ? 0.1025 0.1135 0.1107 0.0008  0.0043  0.0005  91   LEU A C   
863  O  O   . LEU A 94  ? 0.1254 0.1213 0.1239 -0.0067 0.0094  -0.0059 91   LEU A O   
864  C  CB  . LEU A 94  ? 0.1061 0.1305 0.0943 0.0082  0.0028  -0.0040 91   LEU A CB  
865  C  CG  . LEU A 94  ? 0.1063 0.1232 0.1056 -0.0034 -0.0060 -0.0116 91   LEU A CG  
866  C  CD1 . LEU A 94  ? 0.1174 0.1354 0.1265 0.0256  -0.0028 -0.0263 91   LEU A CD1 
867  C  CD2 . LEU A 94  ? 0.1415 0.1187 0.1212 0.0121  0.0041  -0.0066 91   LEU A CD2 
868  N  N   . ARG A 95  ? 0.1094 0.1155 0.1024 -0.0010 0.0002  -0.0060 92   ARG A N   
869  C  CA  . ARG A 95  ? 0.1163 0.1246 0.1052 -0.0008 -0.0152 -0.0018 92   ARG A CA  
870  C  C   . ARG A 95  ? 0.1214 0.1136 0.0944 0.0056  -0.0045 -0.0084 92   ARG A C   
871  O  O   . ARG A 95  ? 0.1221 0.1463 0.0997 0.0103  -0.0008 -0.0151 92   ARG A O   
872  C  CB  . ARG A 95  ? 0.1220 0.1338 0.1057 -0.0019 -0.0031 0.0002  92   ARG A CB  
873  C  CG  . ARG A 95  ? 0.1194 0.1140 0.1118 0.0082  -0.0176 0.0046  92   ARG A CG  
874  C  CD  . ARG A 95  ? 0.1473 0.1127 0.1247 -0.0210 -0.0147 -0.0001 92   ARG A CD  
875  N  NE  . ARG A 95  ? 0.0988 0.1036 0.1326 -0.0165 0.0006  0.0049  92   ARG A NE  
876  C  CZ  . ARG A 95  ? 0.1146 0.1243 0.1296 0.0053  -0.0122 -0.0032 92   ARG A CZ  
877  N  NH1 . ARG A 95  ? 0.1376 0.1297 0.1304 -0.0032 0.0234  0.0012  92   ARG A NH1 
878  N  NH2 . ARG A 95  ? 0.1345 0.1226 0.1423 0.0094  0.0159  -0.0080 92   ARG A NH2 
879  N  N   . ASP A 96  ? 0.1199 0.1108 0.1035 0.0142  -0.0195 -0.0025 93   ASP A N   
880  C  CA  . ASP A 96  ? 0.1217 0.1135 0.0953 -0.0048 -0.0165 -0.0075 93   ASP A CA  
881  C  C   . ASP A 96  ? 0.1167 0.1259 0.1254 0.0007  -0.0117 -0.0111 93   ASP A C   
882  O  O   . ASP A 96  ? 0.1510 0.1419 0.1354 0.0053  -0.0088 -0.0087 93   ASP A O   
883  C  CB  . ASP A 96  ? 0.1278 0.1227 0.1279 -0.0040 -0.0257 -0.0125 93   ASP A CB  
884  C  CG  . ASP A 96  ? 0.1242 0.1452 0.1384 0.0020  -0.0059 0.0029  93   ASP A CG  
885  O  OD1 . ASP A 96  ? 0.1316 0.1646 0.1230 -0.0098 -0.0156 0.0037  93   ASP A OD1 
886  O  OD2 . ASP A 96  ? 0.1416 0.1458 0.1199 0.0056  -0.0113 -0.0232 93   ASP A OD2 
887  N  N   . LEU A 97  ? 0.1239 0.1417 0.1219 -0.0053 -0.0147 -0.0296 94   LEU A N   
888  C  CA  . LEU A 97  ? 0.1305 0.1333 0.1284 0.0139  -0.0150 -0.0275 94   LEU A CA  
889  C  C   . LEU A 97  ? 0.1344 0.1503 0.1485 0.0048  -0.0166 -0.0426 94   LEU A C   
890  O  O   . LEU A 97  ? 0.1549 0.1912 0.2183 0.0010  -0.0272 -0.0746 94   LEU A O   
891  C  CB  . LEU A 97  ? 0.1476 0.1300 0.1344 0.0069  -0.0249 -0.0412 94   LEU A CB  
892  C  CG  . LEU A 97  ? 0.1496 0.1416 0.1594 0.0185  -0.0235 -0.0140 94   LEU A CG  
893  C  CD1 . LEU A 97  ? 0.2258 0.1865 0.1959 -0.0343 -0.1008 0.0125  94   LEU A CD1 
894  C  CD2 . LEU A 97  ? 0.1588 0.1868 0.1924 -0.0387 -0.0509 0.0337  94   LEU A CD2 
895  N  N   . SER A 98  ? 0.1278 0.1600 0.1491 -0.0052 -0.0091 -0.0243 95   SER A N   
896  C  CA  . SER A 98  ? 0.1358 0.1760 0.1389 -0.0055 -0.0036 -0.0251 95   SER A CA  
897  C  C   . SER A 98  ? 0.1410 0.1682 0.1729 -0.0001 -0.0115 -0.0290 95   SER A C   
898  O  O   . SER A 98  ? 0.1387 0.2131 0.2054 0.0089  -0.0064 -0.0610 95   SER A O   
899  C  CB  . SER A 98  ? 0.1331 0.1902 0.1176 -0.0134 -0.0051 -0.0061 95   SER A CB  
900  O  OG  . SER A 98  ? 0.1384 0.1703 0.1079 -0.0245 -0.0198 0.0051  95   SER A OG  
901  N  N   . SER A 99  ? 0.1299 0.1676 0.1518 0.0006  -0.0234 -0.0180 96   SER A N   
902  C  CA  A SER A 99  ? 0.1519 0.1667 0.1897 -0.0088 -0.0304 -0.0096 96   SER A CA  
903  C  CA  B SER A 99  ? 0.1535 0.1724 0.1762 -0.0091 -0.0278 -0.0040 96   SER A CA  
904  C  C   . SER A 99  ? 0.1488 0.1728 0.1925 -0.0119 -0.0233 0.0029  96   SER A C   
905  O  O   . SER A 99  ? 0.1831 0.1874 0.1786 -0.0115 -0.0346 0.0196  96   SER A O   
906  C  CB  A SER A 99  ? 0.1663 0.1743 0.2202 -0.0134 -0.0390 -0.0026 96   SER A CB  
907  C  CB  B SER A 99  ? 0.1647 0.1799 0.2003 -0.0127 -0.0356 0.0000  96   SER A CB  
908  O  OG  A SER A 99  ? 0.2219 0.1911 0.3238 -0.0596 -0.0629 -0.0505 96   SER A OG  
909  O  OG  B SER A 99  ? 0.2318 0.2214 0.2124 -0.0525 -0.0565 -0.0043 96   SER A OG  
910  N  N   . THR A 100 ? 0.1087 0.1574 0.1417 -0.0062 -0.0178 0.0108  97   THR A N   
911  C  CA  . THR A 100 ? 0.1189 0.1635 0.1399 -0.0107 -0.0113 -0.0006 97   THR A CA  
912  C  C   . THR A 100 ? 0.1095 0.1817 0.1341 -0.0092 -0.0053 -0.0014 97   THR A C   
913  O  O   . THR A 100 ? 0.1062 0.1999 0.1292 -0.0087 -0.0012 0.0086  97   THR A O   
914  C  CB  . THR A 100 ? 0.1072 0.1619 0.1314 -0.0061 0.0019  0.0183  97   THR A CB  
915  O  OG1 . THR A 100 ? 0.1447 0.1700 0.1554 0.0136  -0.0058 0.0168  97   THR A OG1 
916  C  CG2 . THR A 100 ? 0.1316 0.1899 0.1337 -0.0284 -0.0051 -0.0017 97   THR A CG2 
917  N  N   . PRO A 101 ? 0.1250 0.1851 0.1231 -0.0040 -0.0039 0.0060  98   PRO A N   
918  C  CA  . PRO A 101 ? 0.1254 0.1523 0.1226 -0.0163 0.0032  0.0095  98   PRO A CA  
919  C  C   . PRO A 101 ? 0.1308 0.1642 0.1295 -0.0133 -0.0090 0.0091  98   PRO A C   
920  O  O   . PRO A 101 ? 0.1735 0.1602 0.1423 -0.0214 -0.0236 0.0211  98   PRO A O   
921  C  CB  . PRO A 101 ? 0.1319 0.1714 0.1225 -0.0010 -0.0050 0.0009  98   PRO A CB  
922  C  CG  . PRO A 101 ? 0.1394 0.2107 0.1423 -0.0228 0.0000  0.0056  98   PRO A CG  
923  C  CD  . PRO A 101 ? 0.1072 0.1849 0.1343 -0.0071 -0.0086 0.0136  98   PRO A CD  
924  N  N   . LEU A 102 ? 0.1189 0.1335 0.1157 -0.0211 -0.0114 0.0186  99   LEU A N   
925  C  CA  . LEU A 102 ? 0.1314 0.1365 0.1104 -0.0253 -0.0118 0.0151  99   LEU A CA  
926  C  C   . LEU A 102 ? 0.1480 0.1505 0.1040 -0.0362 -0.0101 0.0056  99   LEU A C   
927  O  O   . LEU A 102 ? 0.1362 0.1461 0.1067 -0.0230 -0.0066 0.0054  99   LEU A O   
928  C  CB  . LEU A 102 ? 0.1379 0.1498 0.1336 -0.0224 -0.0083 0.0015  99   LEU A CB  
929  C  CG  . LEU A 102 ? 0.1660 0.1184 0.1406 -0.0172 -0.0126 0.0322  99   LEU A CG  
930  C  CD1 . LEU A 102 ? 0.2263 0.1593 0.1379 -0.0834 -0.0543 0.0197  99   LEU A CD1 
931  C  CD2 . LEU A 102 ? 0.1927 0.1442 0.1283 0.0264  -0.0394 -0.0036 99   LEU A CD2 
932  N  N   . ILE A 103 ? 0.1808 0.1630 0.1271 -0.0704 -0.0068 0.0108  100  ILE A N   
933  C  CA  A ILE A 103 ? 0.2027 0.1673 0.1437 -0.0557 0.0059  0.0129  100  ILE A CA  
934  C  CA  B ILE A 103 ? 0.1959 0.1708 0.1426 -0.0522 -0.0010 0.0133  100  ILE A CA  
935  C  C   . ILE A 103 ? 0.2175 0.1723 0.1394 -0.0520 -0.0039 0.0097  100  ILE A C   
936  O  O   . ILE A 103 ? 0.2597 0.1904 0.1690 -0.0846 0.0107  -0.0047 100  ILE A O   
937  C  CB  A ILE A 103 ? 0.1995 0.1540 0.1334 -0.0613 0.0023  0.0142  100  ILE A CB  
938  C  CB  B ILE A 103 ? 0.1802 0.1652 0.1400 -0.0582 -0.0037 0.0192  100  ILE A CB  
939  C  CG1 A ILE A 103 ? 0.1908 0.1550 0.1528 -0.0581 0.0230  0.0249  100  ILE A CG1 
940  C  CG1 B ILE A 103 ? 0.1830 0.1685 0.1474 -0.0449 -0.0007 0.0293  100  ILE A CG1 
941  C  CG2 A ILE A 103 ? 0.2025 0.1404 0.1265 -0.0761 0.0145  0.0302  100  ILE A CG2 
942  C  CG2 B ILE A 103 ? 0.1721 0.1837 0.1193 -0.0606 -0.0155 0.0341  100  ILE A CG2 
943  C  CD1 A ILE A 103 ? 0.1701 0.1329 0.1945 -0.0423 0.0079  0.0113  100  ILE A CD1 
944  C  CD1 B ILE A 103 ? 0.1567 0.1284 0.1691 -0.0266 -0.0200 0.0898  100  ILE A CD1 
945  N  N   . VAL A 104 ? 0.2426 0.1562 0.1577 -0.0125 -0.0129 0.0105  101  VAL A N   
946  C  CA  . VAL A 104 ? 0.2475 0.1828 0.1960 0.0201  -0.0233 0.0077  101  VAL A CA  
947  C  C   . VAL A 104 ? 0.2477 0.1985 0.2138 0.0344  -0.0187 -0.0002 101  VAL A C   
948  O  O   . VAL A 104 ? 0.2338 0.1818 0.1941 0.0587  -0.0524 0.0157  101  VAL A O   
949  C  CB  . VAL A 104 ? 0.2568 0.1861 0.1980 0.0252  -0.0211 -0.0047 101  VAL A CB  
950  C  CG1 . VAL A 104 ? 0.3289 0.1754 0.2626 0.0508  -0.0408 -0.0073 101  VAL A CG1 
951  C  CG2 . VAL A 104 ? 0.2690 0.2044 0.1834 0.0091  -0.0396 0.0185  101  VAL A CG2 
952  N  N   . ASP A 105 ? 0.2502 0.1966 0.2287 0.0252  -0.0089 -0.0056 102  ASP A N   
953  C  CA  A ASP A 105 ? 0.2457 0.2132 0.2427 0.0358  0.0095  -0.0088 102  ASP A CA  
954  C  CA  B ASP A 105 ? 0.2311 0.2120 0.2244 0.0215  0.0075  -0.0123 102  ASP A CA  
955  C  C   . ASP A 105 ? 0.2159 0.1974 0.2077 0.0136  0.0197  -0.0211 102  ASP A C   
956  O  O   . ASP A 105 ? 0.1890 0.2217 0.1972 0.0209  0.0178  -0.0680 102  ASP A O   
957  C  CB  A ASP A 105 ? 0.2710 0.2372 0.2816 0.0419  0.0128  -0.0117 102  ASP A CB  
958  C  CB  B ASP A 105 ? 0.2424 0.2271 0.2416 0.0174  0.0037  -0.0169 102  ASP A CB  
959  C  CG  A ASP A 105 ? 0.3237 0.2403 0.3571 0.0453  -0.0053 -0.0004 102  ASP A CG  
960  C  CG  B ASP A 105 ? 0.2561 0.2661 0.2552 0.0051  0.0125  -0.0024 102  ASP A CG  
961  O  OD1 A ASP A 105 ? 0.3480 0.2439 0.4151 0.0825  -0.0181 -0.0246 102  ASP A OD1 
962  O  OD1 B ASP A 105 ? 0.2931 0.3237 0.2703 0.0101  0.0030  -0.0164 102  ASP A OD1 
963  O  OD2 A ASP A 105 ? 0.3742 0.3436 0.4855 0.0985  0.0070  -0.0272 102  ASP A OD2 
964  O  OD2 B ASP A 105 ? 0.2655 0.3268 0.3112 0.0033  0.0244  -0.0208 102  ASP A OD2 
965  N  N   . GLY A 106 ? 0.1619 0.1420 0.1547 0.0174  0.0382  -0.0089 103  GLY A N   
966  C  CA  . GLY A 106 ? 0.1503 0.1230 0.0919 0.0115  0.0264  -0.0021 103  GLY A CA  
967  C  C   . GLY A 106 ? 0.1204 0.1313 0.1066 0.0062  0.0317  0.0050  103  GLY A C   
968  O  O   . GLY A 106 ? 0.1832 0.1314 0.0923 -0.0311 -0.0074 -0.0216 103  GLY A O   
969  N  N   . GLN A 107 ? 0.1185 0.1363 0.1281 0.0030  0.0149  -0.0007 104  GLN A N   
970  C  CA  A GLN A 107 ? 0.1412 0.1602 0.1438 0.0011  0.0090  0.0009  104  GLN A CA  
971  C  CA  B GLN A 107 ? 0.1302 0.1415 0.1377 0.0033  0.0083  0.0045  104  GLN A CA  
972  C  C   . GLN A 107 ? 0.1218 0.1496 0.1318 -0.0040 0.0008  -0.0044 104  GLN A C   
973  O  O   . GLN A 107 ? 0.1444 0.1488 0.1277 -0.0089 -0.0041 0.0010  104  GLN A O   
974  C  CB  A GLN A 107 ? 0.1535 0.1947 0.1646 -0.0002 0.0043  -0.0118 104  GLN A CB  
975  C  CB  B GLN A 107 ? 0.1356 0.1386 0.1497 0.0073  0.0052  0.0022  104  GLN A CB  
976  C  CG  A GLN A 107 ? 0.1973 0.2205 0.2126 0.0178  0.0207  -0.0011 104  GLN A CG  
977  C  CG  B GLN A 107 ? 0.1538 0.1487 0.1797 0.0091  0.0219  0.0084  104  GLN A CG  
978  C  CD  A GLN A 107 ? 0.2147 0.2842 0.2498 0.0106  0.0100  -0.0003 104  GLN A CD  
979  C  CD  B GLN A 107 ? 0.1766 0.1588 0.1879 0.0236  -0.0093 0.0130  104  GLN A CD  
980  O  OE1 A GLN A 107 ? 0.2661 0.3037 0.3411 0.0440  0.0261  -0.0263 104  GLN A OE1 
981  O  OE1 B GLN A 107 ? 0.1730 0.2058 0.1287 0.0377  -0.0523 0.0214  104  GLN A OE1 
982  N  NE2 A GLN A 107 ? 0.3040 0.3008 0.3915 -0.0238 0.0009  -0.0115 104  GLN A NE2 
983  N  NE2 B GLN A 107 ? 0.2192 0.2240 0.2495 0.0099  0.0369  -0.0445 104  GLN A NE2 
984  N  N   . ASP A 108 ? 0.1221 0.1396 0.1364 -0.0098 0.0133  0.0156  105  ASP A N   
985  C  CA  . ASP A 108 ? 0.1178 0.1476 0.1190 -0.0146 -0.0039 0.0155  105  ASP A CA  
986  C  C   . ASP A 108 ? 0.1129 0.1276 0.1382 -0.0030 -0.0085 0.0266  105  ASP A C   
987  O  O   . ASP A 108 ? 0.1231 0.1589 0.1268 -0.0082 -0.0179 0.0150  105  ASP A O   
988  C  CB  . ASP A 108 ? 0.1212 0.1515 0.1216 -0.0162 0.0189  0.0068  105  ASP A CB  
989  C  CG  . ASP A 108 ? 0.1113 0.1540 0.0941 0.0228  -0.0160 0.0062  105  ASP A CG  
990  O  OD1 . ASP A 108 ? 0.1315 0.1779 0.1038 0.0168  -0.0255 0.0202  105  ASP A OD1 
991  O  OD2 . ASP A 108 ? 0.1826 0.1896 0.1770 0.0460  0.0111  -0.0015 105  ASP A OD2 
992  N  N   . ILE A 109 ? 0.1143 0.1351 0.1111 -0.0150 -0.0056 0.0271  106  ILE A N   
993  C  CA  . ILE A 109 ? 0.1157 0.1267 0.1375 0.0054  -0.0196 0.0046  106  ILE A CA  
994  C  C   . ILE A 109 ? 0.1133 0.1335 0.1055 -0.0027 -0.0089 0.0047  106  ILE A C   
995  O  O   . ILE A 109 ? 0.1159 0.1492 0.1329 -0.0112 -0.0087 -0.0023 106  ILE A O   
996  C  CB  . ILE A 109 ? 0.1367 0.1381 0.1243 0.0035  -0.0210 -0.0005 106  ILE A CB  
997  C  CG1 . ILE A 109 ? 0.1402 0.1681 0.1399 -0.0088 -0.0286 -0.0276 106  ILE A CG1 
998  C  CG2 . ILE A 109 ? 0.1334 0.1853 0.1736 0.0292  -0.0699 0.0066  106  ILE A CG2 
999  C  CD1 . ILE A 109 ? 0.1475 0.2187 0.1554 -0.0091 0.0006  -0.0709 106  ILE A CD1 
1000 N  N   . ARG A 110 ? 0.1059 0.1137 0.1338 0.0006  -0.0156 0.0027  107  ARG A N   
1001 C  CA  . ARG A 110 ? 0.1227 0.1294 0.1299 -0.0087 -0.0037 -0.0062 107  ARG A CA  
1002 C  C   . ARG A 110 ? 0.1191 0.1203 0.1040 -0.0196 -0.0168 0.0005  107  ARG A C   
1003 O  O   . ARG A 110 ? 0.1205 0.1588 0.1356 -0.0079 -0.0234 -0.0051 107  ARG A O   
1004 C  CB  . ARG A 110 ? 0.1227 0.1278 0.1156 -0.0120 -0.0086 -0.0198 107  ARG A CB  
1005 C  CG  . ARG A 110 ? 0.1483 0.1477 0.1245 -0.0043 0.0148  -0.0131 107  ARG A CG  
1006 C  CD  . ARG A 110 ? 0.1466 0.1451 0.1395 -0.0186 -0.0041 0.0047  107  ARG A CD  
1007 N  NE  . ARG A 110 ? 0.1157 0.1495 0.1155 0.0016  0.0092  0.0132  107  ARG A NE  
1008 C  CZ  . ARG A 110 ? 0.1150 0.1371 0.1148 -0.0027 -0.0089 -0.0053 107  ARG A CZ  
1009 N  NH1 . ARG A 110 ? 0.1186 0.1342 0.1478 0.0040  -0.0191 0.0057  107  ARG A NH1 
1010 N  NH2 . ARG A 110 ? 0.1323 0.1784 0.1278 -0.0019 -0.0039 -0.0070 107  ARG A NH2 
1011 N  N   . GLN A 111 ? 0.1198 0.1329 0.1189 -0.0159 -0.0151 0.0152  108  GLN A N   
1012 C  CA  . GLN A 111 ? 0.1567 0.1416 0.1401 -0.0239 -0.0155 0.0067  108  GLN A CA  
1013 C  C   . GLN A 111 ? 0.1621 0.1572 0.1447 -0.0196 -0.0197 0.0160  108  GLN A C   
1014 O  O   . GLN A 111 ? 0.1536 0.1629 0.1676 -0.0314 -0.0301 0.0162  108  GLN A O   
1015 C  CB  . GLN A 111 ? 0.1839 0.1848 0.1903 -0.0203 -0.0156 0.0159  108  GLN A CB  
1016 C  CG  . GLN A 111 ? 0.2402 0.2041 0.2024 -0.0081 -0.0116 0.0229  108  GLN A CG  
1017 C  CD  . GLN A 111 ? 0.2679 0.3036 0.2761 0.0244  -0.0160 0.0845  108  GLN A CD  
1018 O  OE1 . GLN A 111 ? 0.3333 0.3767 0.3567 0.0123  0.0034  0.1016  108  GLN A OE1 
1019 N  NE2 . GLN A 111 ? 0.2816 0.3709 0.3692 -0.0188 -0.0460 0.0485  108  GLN A NE2 
1020 N  N   . GLU A 112 ? 0.1353 0.1504 0.1203 -0.0085 -0.0144 0.0160  109  GLU A N   
1021 C  CA  A GLU A 112 ? 0.1263 0.1608 0.1331 -0.0090 -0.0120 0.0175  109  GLU A CA  
1022 C  CA  B GLU A 112 ? 0.1219 0.1527 0.1244 -0.0102 -0.0154 0.0140  109  GLU A CA  
1023 C  C   . GLU A 112 ? 0.1206 0.1415 0.1164 -0.0039 -0.0135 0.0133  109  GLU A C   
1024 O  O   . GLU A 112 ? 0.1181 0.1379 0.1374 -0.0179 -0.0194 0.0179  109  GLU A O   
1025 C  CB  A GLU A 112 ? 0.1293 0.1721 0.1332 -0.0072 -0.0049 0.0201  109  GLU A CB  
1026 C  CB  B GLU A 112 ? 0.1115 0.1744 0.1134 -0.0059 -0.0186 0.0137  109  GLU A CB  
1027 C  CG  A GLU A 112 ? 0.1617 0.2207 0.1407 -0.0104 -0.0068 0.0256  109  GLU A CG  
1028 C  CG  B GLU A 112 ? 0.1361 0.1774 0.0929 -0.0137 -0.0195 0.0153  109  GLU A CG  
1029 C  CD  A GLU A 112 ? 0.2234 0.2681 0.2137 0.0158  0.0056  0.0772  109  GLU A CD  
1030 C  CD  B GLU A 112 ? 0.1261 0.2653 0.1089 -0.0559 -0.0288 0.0190  109  GLU A CD  
1031 O  OE1 A GLU A 112 ? 0.2036 0.2515 0.1761 -0.0022 -0.0505 0.1029  109  GLU A OE1 
1032 O  OE1 B GLU A 112 ? 0.2260 0.3741 0.0355 -0.0635 0.0045  0.0488  109  GLU A OE1 
1033 O  OE2 A GLU A 112 ? 0.2746 0.3518 0.2932 0.0461  0.0167  0.1192  109  GLU A OE2 
1034 O  OE2 B GLU A 112 ? 0.1628 0.3739 0.1320 -0.0689 0.0343  0.0307  109  GLU A OE2 
1035 N  N   . VAL A 113 ? 0.1124 0.1473 0.1243 -0.0251 -0.0135 0.0047  110  VAL A N   
1036 C  CA  . VAL A 113 ? 0.1214 0.1359 0.1337 -0.0185 -0.0122 0.0007  110  VAL A CA  
1037 C  C   . VAL A 113 ? 0.1193 0.1258 0.1285 -0.0104 -0.0070 -0.0098 110  VAL A C   
1038 O  O   . VAL A 113 ? 0.1093 0.1555 0.1450 -0.0168 -0.0038 -0.0010 110  VAL A O   
1039 C  CB  . VAL A 113 ? 0.1159 0.1225 0.1092 -0.0047 -0.0107 -0.0031 110  VAL A CB  
1040 C  CG1 . VAL A 113 ? 0.1321 0.1727 0.0667 -0.0138 -0.0184 0.0040  110  VAL A CG1 
1041 C  CG2 . VAL A 113 ? 0.1623 0.1146 0.1461 0.0046  0.0003  -0.0267 110  VAL A CG2 
1042 N  N   . THR A 114 ? 0.1205 0.1282 0.1403 -0.0125 -0.0016 -0.0167 111  THR A N   
1043 C  CA  . THR A 114 ? 0.1296 0.1272 0.1306 -0.0190 0.0070  -0.0214 111  THR A CA  
1044 C  C   . THR A 114 ? 0.1198 0.1345 0.1172 -0.0159 0.0006  -0.0131 111  THR A C   
1045 O  O   . THR A 114 ? 0.1161 0.1427 0.1506 -0.0101 0.0083  -0.0043 111  THR A O   
1046 C  CB  . THR A 114 ? 0.1549 0.1415 0.1417 -0.0243 0.0142  -0.0214 111  THR A CB  
1047 O  OG1 . THR A 114 ? 0.1861 0.1441 0.1767 -0.0314 0.0229  -0.0120 111  THR A OG1 
1048 C  CG2 . THR A 114 ? 0.1908 0.1733 0.1863 -0.0041 0.0481  -0.0522 111  THR A CG2 
1049 N  N   . LYS A 115 ? 0.1099 0.1481 0.1132 -0.0145 -0.0035 -0.0035 112  LYS A N   
1050 C  CA  A LYS A 115 ? 0.1231 0.1335 0.1377 -0.0158 -0.0021 -0.0032 112  LYS A CA  
1051 C  CA  B LYS A 115 ? 0.1239 0.1360 0.1324 -0.0153 -0.0023 -0.0001 112  LYS A CA  
1052 C  C   . LYS A 115 ? 0.1263 0.1374 0.1283 -0.0118 -0.0070 0.0012  112  LYS A C   
1053 O  O   . LYS A 115 ? 0.1358 0.1283 0.1343 -0.0202 0.0048  -0.0033 112  LYS A O   
1054 C  CB  A LYS A 115 ? 0.1406 0.1608 0.1560 -0.0150 -0.0056 -0.0009 112  LYS A CB  
1055 C  CB  B LYS A 115 ? 0.1334 0.1564 0.1470 -0.0129 -0.0066 0.0027  112  LYS A CB  
1056 C  CG  A LYS A 115 ? 0.1737 0.2149 0.2057 0.0009  0.0006  -0.0191 112  LYS A CG  
1057 C  CG  B LYS A 115 ? 0.1800 0.1950 0.1578 -0.0095 0.0014  0.0042  112  LYS A CG  
1058 C  CD  A LYS A 115 ? 0.2170 0.2526 0.2624 0.0015  -0.0374 0.0027  112  LYS A CD  
1059 C  CD  B LYS A 115 ? 0.2209 0.2488 0.1742 -0.0117 -0.0263 0.0091  112  LYS A CD  
1060 C  CE  A LYS A 115 ? 0.2343 0.2402 0.2860 0.0133  -0.0402 0.0210  112  LYS A CE  
1061 C  CE  B LYS A 115 ? 0.2442 0.3010 0.2270 -0.0243 -0.0062 -0.0105 112  LYS A CE  
1062 N  NZ  A LYS A 115 ? 0.2721 0.2941 0.2827 -0.0046 -0.0330 0.0347  112  LYS A NZ  
1063 N  NZ  B LYS A 115 ? 0.2846 0.3498 0.2864 -0.0136 -0.0444 -0.0367 112  LYS A NZ  
1064 N  N   . GLU A 116 ? 0.1100 0.1101 0.1280 -0.0163 -0.0003 -0.0063 113  GLU A N   
1065 C  CA  . GLU A 116 ? 0.1220 0.1154 0.1282 -0.0084 0.0001  0.0019  113  GLU A CA  
1066 C  C   . GLU A 116 ? 0.1090 0.1323 0.1288 -0.0039 0.0011  -0.0067 113  GLU A C   
1067 O  O   . GLU A 116 ? 0.1158 0.1310 0.1388 -0.0111 0.0038  -0.0059 113  GLU A O   
1068 C  CB  . GLU A 116 ? 0.1291 0.1346 0.1314 0.0036  -0.0060 -0.0030 113  GLU A CB  
1069 C  CG  . GLU A 116 ? 0.1355 0.1446 0.1529 -0.0181 -0.0032 -0.0177 113  GLU A CG  
1070 C  CD  . GLU A 116 ? 0.1431 0.1712 0.1946 -0.0272 0.0029  0.0192  113  GLU A CD  
1071 O  OE1 . GLU A 116 ? 0.1908 0.1979 0.1339 -0.0155 0.0416  0.0187  113  GLU A OE1 
1072 O  OE2 . GLU A 116 ? 0.1657 0.2071 0.1743 0.0018  -0.0042 0.0016  113  GLU A OE2 
1073 N  N   . LYS A 117 ? 0.1204 0.1283 0.1163 -0.0093 -0.0091 0.0055  114  LYS A N   
1074 C  CA  A LYS A 117 ? 0.1114 0.1374 0.1116 -0.0092 -0.0149 0.0058  114  LYS A CA  
1075 C  CA  B LYS A 117 ? 0.1187 0.1363 0.1192 -0.0072 -0.0127 0.0027  114  LYS A CA  
1076 C  C   . LYS A 117 ? 0.1265 0.1323 0.1305 -0.0021 -0.0186 0.0034  114  LYS A C   
1077 O  O   . LYS A 117 ? 0.1339 0.1650 0.1189 -0.0151 -0.0246 -0.0158 114  LYS A O   
1078 C  CB  A LYS A 117 ? 0.1230 0.1402 0.1237 -0.0021 -0.0142 0.0063  114  LYS A CB  
1079 C  CB  B LYS A 117 ? 0.1275 0.1377 0.1244 -0.0058 -0.0127 0.0054  114  LYS A CB  
1080 C  CG  A LYS A 117 ? 0.1458 0.1484 0.1029 -0.0371 -0.0240 0.0000  114  LYS A CG  
1081 C  CG  B LYS A 117 ? 0.1373 0.1400 0.1177 -0.0177 -0.0141 -0.0008 114  LYS A CG  
1082 C  CD  A LYS A 117 ? 0.1751 0.1693 0.1685 -0.0166 0.0101  0.0185  114  LYS A CD  
1083 C  CD  B LYS A 117 ? 0.1538 0.1654 0.1497 -0.0122 0.0023  -0.0036 114  LYS A CD  
1084 C  CE  A LYS A 117 ? 0.1727 0.1741 0.1579 0.0005  0.0044  0.0272  114  LYS A CE  
1085 C  CE  B LYS A 117 ? 0.1460 0.1750 0.1670 -0.0165 0.0090  -0.0146 114  LYS A CE  
1086 N  NZ  A LYS A 117 ? 0.1694 0.1741 0.1241 -0.0296 0.0134  0.0069  114  LYS A NZ  
1087 N  NZ  B LYS A 117 ? 0.1046 0.1361 0.1225 -0.0054 0.0072  -0.0121 114  LYS A NZ  
1088 N  N   . GLN A 118 ? 0.1120 0.1369 0.1432 0.0002  -0.0069 -0.0055 115  GLN A N   
1089 C  CA  . GLN A 118 ? 0.1406 0.1383 0.1515 -0.0029 0.0036  -0.0008 115  GLN A CA  
1090 C  C   . GLN A 118 ? 0.1331 0.1347 0.1541 -0.0015 0.0117  -0.0086 115  GLN A C   
1091 O  O   . GLN A 118 ? 0.1353 0.1229 0.1480 -0.0117 -0.0072 -0.0055 115  GLN A O   
1092 C  CB  . GLN A 118 ? 0.1676 0.1380 0.1858 0.0152  0.0175  0.0079  115  GLN A CB  
1093 C  CG  . GLN A 118 ? 0.2046 0.1538 0.2470 -0.0137 0.0228  0.0232  115  GLN A CG  
1094 C  CD  . GLN A 118 ? 0.2567 0.1952 0.2737 -0.0163 0.0672  -0.0201 115  GLN A CD  
1095 O  OE1 . GLN A 118 ? 0.3951 0.2213 0.3204 -0.0623 0.1137  -0.0151 115  GLN A OE1 
1096 N  NE2 . GLN A 118 ? 0.2993 0.2599 0.3903 -0.0714 0.0549  -0.0310 115  GLN A NE2 
1097 N  N   . ARG A 119 ? 0.1318 0.1351 0.1376 -0.0039 0.0049  -0.0053 116  ARG A N   
1098 C  CA  . ARG A 119 ? 0.1358 0.1303 0.1307 -0.0067 0.0100  0.0005  116  ARG A CA  
1099 C  C   . ARG A 119 ? 0.1437 0.1229 0.1166 -0.0124 -0.0022 -0.0018 116  ARG A C   
1100 O  O   . ARG A 119 ? 0.1294 0.1318 0.1496 -0.0082 0.0085  0.0017  116  ARG A O   
1101 C  CB  . ARG A 119 ? 0.1536 0.1339 0.1430 0.0048  -0.0012 0.0020  116  ARG A CB  
1102 C  CG  . ARG A 119 ? 0.1596 0.1640 0.1341 0.0005  0.0063  0.0105  116  ARG A CG  
1103 C  CD  . ARG A 119 ? 0.1565 0.1980 0.1538 -0.0204 0.0090  -0.0109 116  ARG A CD  
1104 N  NE  . ARG A 119 ? 0.1290 0.2025 0.1417 -0.0189 0.0077  -0.0150 116  ARG A NE  
1105 C  CZ  . ARG A 119 ? 0.1294 0.1934 0.1544 -0.0016 0.0212  -0.0004 116  ARG A CZ  
1106 N  NH1 . ARG A 119 ? 0.1691 0.1787 0.1646 0.0212  0.0268  0.0074  116  ARG A NH1 
1107 N  NH2 . ARG A 119 ? 0.1328 0.2193 0.2145 -0.0004 0.0293  0.0164  116  ARG A NH2 
1108 N  N   . VAL A 120 ? 0.1265 0.1149 0.1087 -0.0093 -0.0058 -0.0041 117  VAL A N   
1109 C  CA  . VAL A 120 ? 0.1280 0.1267 0.1142 -0.0045 0.0039  -0.0012 117  VAL A CA  
1110 C  C   . VAL A 120 ? 0.1177 0.1267 0.1218 -0.0086 0.0001  -0.0040 117  VAL A C   
1111 O  O   . VAL A 120 ? 0.1183 0.1381 0.1336 -0.0008 -0.0240 0.0047  117  VAL A O   
1112 C  CB  . VAL A 120 ? 0.1109 0.1131 0.1217 -0.0140 -0.0008 -0.0002 117  VAL A CB  
1113 C  CG1 . VAL A 120 ? 0.1047 0.1162 0.1594 0.0200  -0.0186 0.0079  117  VAL A CG1 
1114 C  CG2 . VAL A 120 ? 0.1460 0.1374 0.1968 0.0028  0.0008  -0.0606 117  VAL A CG2 
1115 N  N   . LYS A 121 ? 0.1193 0.1288 0.1256 -0.0128 -0.0066 -0.0030 118  LYS A N   
1116 C  CA  . LYS A 121 ? 0.1349 0.1294 0.1142 -0.0116 -0.0052 -0.0076 118  LYS A CA  
1117 C  C   . LYS A 121 ? 0.1275 0.1228 0.1073 -0.0111 -0.0044 -0.0143 118  LYS A C   
1118 O  O   . LYS A 121 ? 0.1309 0.1450 0.1389 -0.0203 -0.0094 -0.0172 118  LYS A O   
1119 C  CB  . LYS A 121 ? 0.1368 0.1297 0.1134 -0.0182 -0.0082 -0.0080 118  LYS A CB  
1120 C  CG  . LYS A 121 ? 0.1668 0.1560 0.1373 -0.0159 -0.0201 -0.0032 118  LYS A CG  
1121 C  CD  . LYS A 121 ? 0.2221 0.2185 0.2108 -0.0117 0.0372  -0.0114 118  LYS A CD  
1122 C  CE  . LYS A 121 ? 0.3109 0.3345 0.3116 -0.0212 0.0651  -0.0498 118  LYS A CE  
1123 N  NZ  . LYS A 121 ? 0.4338 0.4552 0.3167 -0.0059 0.1018  -0.0420 118  LYS A NZ  
1124 N  N   . GLU A 122 ? 0.1397 0.1184 0.1133 -0.0149 -0.0041 -0.0111 119  GLU A N   
1125 C  CA  . GLU A 122 ? 0.1385 0.1459 0.1115 -0.0254 0.0050  -0.0020 119  GLU A CA  
1126 C  C   . GLU A 122 ? 0.1329 0.1246 0.1276 0.0001  -0.0034 -0.0088 119  GLU A C   
1127 O  O   . GLU A 122 ? 0.1386 0.1224 0.1201 -0.0082 -0.0046 -0.0056 119  GLU A O   
1128 C  CB  . GLU A 122 ? 0.1613 0.1539 0.1507 -0.0220 0.0038  0.0287  119  GLU A CB  
1129 C  CG  . GLU A 122 ? 0.1890 0.2212 0.2518 -0.0225 0.0000  0.0003  119  GLU A CG  
1130 C  CD  . GLU A 122 ? 0.2734 0.3735 0.3009 0.0276  0.0018  0.0272  119  GLU A CD  
1131 O  OE1 . GLU A 122 ? 0.3586 0.5722 0.3371 0.0662  0.0082  0.0166  119  GLU A OE1 
1132 O  OE2 . GLU A 122 ? 0.2933 0.3360 0.4234 0.0660  0.0038  0.0526  119  GLU A OE2 
1133 N  N   . LEU A 123 ? 0.1269 0.1289 0.1074 0.0057  -0.0049 -0.0110 120  LEU A N   
1134 C  CA  . LEU A 123 ? 0.1243 0.1339 0.1032 0.0006  -0.0055 -0.0059 120  LEU A CA  
1135 C  C   . LEU A 123 ? 0.1235 0.1339 0.1174 -0.0030 -0.0021 -0.0094 120  LEU A C   
1136 O  O   . LEU A 123 ? 0.1252 0.1175 0.1343 0.0001  -0.0027 0.0054  120  LEU A O   
1137 C  CB  . LEU A 123 ? 0.1405 0.1447 0.1086 -0.0015 -0.0093 -0.0056 120  LEU A CB  
1138 C  CG  . LEU A 123 ? 0.1348 0.1394 0.1109 -0.0097 -0.0253 -0.0386 120  LEU A CG  
1139 C  CD1 . LEU A 123 ? 0.1215 0.1691 0.1354 -0.0023 0.0121  -0.0237 120  LEU A CD1 
1140 C  CD2 . LEU A 123 ? 0.1643 0.1239 0.1736 -0.0061 -0.0097 -0.0497 120  LEU A CD2 
1141 N  N   . VAL A 124 ? 0.1266 0.1259 0.1178 -0.0116 -0.0033 0.0017  121  VAL A N   
1142 C  CA  . VAL A 124 ? 0.1215 0.1236 0.1177 -0.0044 -0.0056 0.0016  121  VAL A CA  
1143 C  C   . VAL A 124 ? 0.1363 0.1357 0.1244 -0.0133 0.0095  0.0033  121  VAL A C   
1144 O  O   . VAL A 124 ? 0.1375 0.1604 0.1288 -0.0134 -0.0091 -0.0031 121  VAL A O   
1145 C  CB  . VAL A 124 ? 0.1326 0.1289 0.1073 -0.0025 -0.0048 0.0098  121  VAL A CB  
1146 C  CG1 . VAL A 124 ? 0.1593 0.1835 0.1020 -0.0120 -0.0232 0.0263  121  VAL A CG1 
1147 C  CG2 . VAL A 124 ? 0.1751 0.1315 0.1500 -0.0167 0.0127  -0.0020 121  VAL A CG2 
1148 N  N   . GLU A 125 ? 0.1358 0.1525 0.1456 -0.0235 0.0093  0.0002  122  GLU A N   
1149 C  CA  A GLU A 125 ? 0.1490 0.1468 0.1588 -0.0193 0.0093  -0.0081 122  GLU A CA  
1150 C  CA  B GLU A 125 ? 0.1481 0.1432 0.1488 -0.0160 0.0066  -0.0053 122  GLU A CA  
1151 C  C   . GLU A 125 ? 0.1360 0.1484 0.1403 -0.0102 0.0073  -0.0078 122  GLU A C   
1152 O  O   . GLU A 125 ? 0.1574 0.1554 0.1729 -0.0224 0.0065  -0.0194 122  GLU A O   
1153 C  CB  A GLU A 125 ? 0.1634 0.1562 0.1816 -0.0188 0.0249  -0.0209 122  GLU A CB  
1154 C  CB  B GLU A 125 ? 0.1608 0.1485 0.1642 -0.0135 0.0136  -0.0143 122  GLU A CB  
1155 C  CG  A GLU A 125 ? 0.2105 0.2029 0.2626 -0.0350 0.0233  -0.0339 122  GLU A CG  
1156 C  CG  B GLU A 125 ? 0.2077 0.1618 0.1838 -0.0179 0.0079  -0.0031 122  GLU A CG  
1157 C  CD  A GLU A 125 ? 0.2372 0.2532 0.2956 -0.0564 0.0143  -0.0245 122  GLU A CD  
1158 C  CD  B GLU A 125 ? 0.2310 0.2062 0.2586 -0.0028 0.0256  -0.0055 122  GLU A CD  
1159 O  OE1 A GLU A 125 ? 0.3319 0.3635 0.3656 -0.0504 0.0118  0.0102  122  GLU A OE1 
1160 O  OE1 B GLU A 125 ? 0.3136 0.3085 0.3019 0.0043  0.0022  0.0110  122  GLU A OE1 
1161 O  OE2 A GLU A 125 ? 0.2474 0.3331 0.3725 -0.0959 0.0015  -0.0820 122  GLU A OE2 
1162 O  OE2 B GLU A 125 ? 0.2579 0.2382 0.2866 0.0278  0.0399  0.0119  122  GLU A OE2 
1163 N  N   . LYS A 126 ? 0.1200 0.1380 0.1296 -0.0103 0.0013  -0.0155 123  LYS A N   
1164 C  CA  . LYS A 126 ? 0.1179 0.1319 0.1315 0.0098  -0.0008 -0.0091 123  LYS A CA  
1165 C  C   . LYS A 126 ? 0.1145 0.1276 0.1105 -0.0033 -0.0020 -0.0139 123  LYS A C   
1166 O  O   . LYS A 126 ? 0.1177 0.1431 0.1291 -0.0136 0.0027  -0.0086 123  LYS A O   
1167 C  CB  . LYS A 126 ? 0.1391 0.1412 0.1217 0.0007  -0.0043 -0.0037 123  LYS A CB  
1168 C  CG  . LYS A 126 ? 0.1467 0.1814 0.1647 0.0113  0.0172  -0.0036 123  LYS A CG  
1169 C  CD  . LYS A 126 ? 0.1822 0.2223 0.2069 -0.0079 -0.0266 -0.0036 123  LYS A CD  
1170 C  CE  . LYS A 126 ? 0.2338 0.3233 0.1834 -0.0202 -0.0432 0.0026  123  LYS A CE  
1171 N  NZ  . LYS A 126 ? 0.2675 0.3068 0.1623 -0.0141 -0.0789 0.0110  123  LYS A NZ  
1172 N  N   . VAL A 127 ? 0.1093 0.1198 0.1079 0.0018  0.0072  -0.0102 124  VAL A N   
1173 C  CA  . VAL A 127 ? 0.1290 0.1414 0.1135 -0.0066 -0.0074 -0.0046 124  VAL A CA  
1174 C  C   . VAL A 127 ? 0.1323 0.1642 0.1313 -0.0118 -0.0078 -0.0065 124  VAL A C   
1175 O  O   . VAL A 127 ? 0.1326 0.1735 0.1118 -0.0277 -0.0047 0.0107  124  VAL A O   
1176 C  CB  . VAL A 127 ? 0.1102 0.1274 0.1165 -0.0064 0.0062  0.0043  124  VAL A CB  
1177 C  CG1 . VAL A 127 ? 0.1268 0.1921 0.1614 0.0054  -0.0468 0.0247  124  VAL A CG1 
1178 C  CG2 . VAL A 127 ? 0.1556 0.1604 0.1032 -0.0072 -0.0435 -0.0087 124  VAL A CG2 
1179 N  N   . VAL A 128 ? 0.1294 0.1811 0.1006 -0.0173 -0.0122 0.0070  125  VAL A N   
1180 C  CA  . VAL A 128 ? 0.1339 0.1953 0.1192 -0.0245 -0.0070 -0.0090 125  VAL A CA  
1181 C  C   . VAL A 128 ? 0.1530 0.2009 0.1224 -0.0240 -0.0013 -0.0191 125  VAL A C   
1182 O  O   . VAL A 128 ? 0.1596 0.2557 0.1523 -0.0416 -0.0220 -0.0302 125  VAL A O   
1183 C  CB  . VAL A 128 ? 0.1370 0.2140 0.1078 -0.0181 -0.0118 -0.0038 125  VAL A CB  
1184 C  CG1 . VAL A 128 ? 0.1916 0.2545 0.0775 -0.0094 -0.0135 -0.0268 125  VAL A CG1 
1185 C  CG2 . VAL A 128 ? 0.1477 0.1812 0.1193 0.0068  -0.0018 0.0252  125  VAL A CG2 
1186 N  N   . SER A 129 ? 0.1627 0.1731 0.1373 -0.0265 -0.0102 -0.0296 126  SER A N   
1187 C  CA  . SER A 129 ? 0.1840 0.1633 0.1625 -0.0227 0.0050  -0.0268 126  SER A CA  
1188 C  C   . SER A 129 ? 0.1863 0.1711 0.1863 -0.0229 0.0161  -0.0333 126  SER A C   
1189 O  O   . SER A 129 ? 0.2322 0.1949 0.2340 -0.0487 0.0339  -0.0444 126  SER A O   
1190 C  CB  . SER A 129 ? 0.1873 0.1830 0.1709 -0.0268 0.0158  -0.0226 126  SER A CB  
1191 O  OG  . SER A 129 ? 0.2101 0.1726 0.1648 -0.0055 0.0000  -0.0461 126  SER A OG  
1192 N  N   . GLY A 130 ? 0.1948 0.1713 0.1929 -0.0294 0.0202  -0.0338 127  GLY A N   
1193 C  CA  . GLY A 130 ? 0.1801 0.1704 0.1934 -0.0306 0.0154  -0.0261 127  GLY A CA  
1194 C  C   . GLY A 130 ? 0.1867 0.1643 0.1956 -0.0282 0.0233  -0.0244 127  GLY A C   
1195 O  O   . GLY A 130 ? 0.1897 0.2011 0.2327 -0.0465 0.0461  -0.0227 127  GLY A O   
1196 N  N   . ARG A 131 ? 0.1924 0.1694 0.1954 -0.0245 0.0262  -0.0264 128  ARG A N   
1197 C  CA  A ARG A 131 ? 0.2093 0.1533 0.2005 -0.0200 0.0314  -0.0196 128  ARG A CA  
1198 C  CA  B ARG A 131 ? 0.2051 0.1619 0.1965 -0.0161 0.0279  -0.0172 128  ARG A CA  
1199 C  C   . ARG A 131 ? 0.2146 0.1506 0.1881 -0.0117 0.0340  -0.0127 128  ARG A C   
1200 O  O   . ARG A 131 ? 0.2412 0.1789 0.2181 -0.0045 0.0473  -0.0031 128  ARG A O   
1201 C  CB  A ARG A 131 ? 0.2161 0.1622 0.1982 -0.0165 0.0281  -0.0213 128  ARG A CB  
1202 C  CB  B ARG A 131 ? 0.2076 0.1684 0.1955 -0.0137 0.0244  -0.0170 128  ARG A CB  
1203 C  CG  A ARG A 131 ? 0.2656 0.1977 0.2549 0.0115  0.0351  -0.0128 128  ARG A CG  
1204 C  CG  B ARG A 131 ? 0.2271 0.1942 0.2150 0.0055  0.0245  -0.0144 128  ARG A CG  
1205 C  CD  A ARG A 131 ? 0.3093 0.2740 0.3380 0.0192  0.0299  -0.0144 128  ARG A CD  
1206 C  CD  B ARG A 131 ? 0.2399 0.2433 0.2574 0.0097  0.0261  -0.0157 128  ARG A CD  
1207 N  NE  A ARG A 131 ? 0.3309 0.2978 0.3833 0.0092  0.0352  -0.0103 128  ARG A NE  
1208 N  NE  B ARG A 131 ? 0.2413 0.2538 0.2927 0.0180  0.0292  -0.0198 128  ARG A NE  
1209 C  CZ  A ARG A 131 ? 0.3519 0.3189 0.4161 0.0355  0.0082  -0.0372 128  ARG A CZ  
1210 C  CZ  B ARG A 131 ? 0.2561 0.2703 0.2929 0.0231  0.0257  -0.0275 128  ARG A CZ  
1211 N  NH1 A ARG A 131 ? 0.3660 0.3666 0.4411 0.0616  -0.0055 -0.0401 128  ARG A NH1 
1212 N  NH1 B ARG A 131 ? 0.2728 0.2577 0.2916 0.0293  0.0071  -0.0352 128  ARG A NH1 
1213 N  NH2 A ARG A 131 ? 0.3013 0.3332 0.4523 0.0243  0.0255  -0.0640 128  ARG A NH2 
1214 N  NH2 B ARG A 131 ? 0.2197 0.2859 0.3278 0.0320  0.0192  -0.0593 128  ARG A NH2 
1215 N  N   . TRP A 132 ? 0.1939 0.1306 0.1840 -0.0171 0.0340  -0.0087 129  TRP A N   
1216 C  CA  . TRP A 132 ? 0.1750 0.1559 0.1610 -0.0031 0.0197  -0.0080 129  TRP A CA  
1217 C  C   . TRP A 132 ? 0.1685 0.1502 0.1609 0.0012  0.0123  -0.0031 129  TRP A C   
1218 O  O   . TRP A 132 ? 0.1976 0.2149 0.1621 0.0022  0.0055  0.0196  129  TRP A O   
1219 C  CB  . TRP A 132 ? 0.1715 0.1377 0.1562 0.0103  0.0224  -0.0154 129  TRP A CB  
1220 C  CG  . TRP A 132 ? 0.1588 0.1466 0.1371 0.0073  0.0031  -0.0176 129  TRP A CG  
1221 C  CD1 . TRP A 132 ? 0.1675 0.1282 0.1652 0.0125  -0.0065 -0.0114 129  TRP A CD1 
1222 C  CD2 . TRP A 132 ? 0.1574 0.1450 0.1159 -0.0144 0.0009  0.0134  129  TRP A CD2 
1223 N  NE1 . TRP A 132 ? 0.1780 0.1583 0.1540 0.0076  -0.0057 -0.0089 129  TRP A NE1 
1224 C  CE2 . TRP A 132 ? 0.1748 0.1604 0.1225 -0.0152 0.0024  -0.0017 129  TRP A CE2 
1225 C  CE3 . TRP A 132 ? 0.1981 0.1710 0.1661 -0.0205 -0.0138 -0.0005 129  TRP A CE3 
1226 C  CZ2 . TRP A 132 ? 0.1956 0.1805 0.1449 -0.0305 0.0051  0.0081  129  TRP A CZ2 
1227 C  CZ3 . TRP A 132 ? 0.1691 0.1996 0.1751 -0.0260 -0.0134 -0.0018 129  TRP A CZ3 
1228 C  CH2 . TRP A 132 ? 0.1869 0.1822 0.1802 -0.0246 -0.0385 -0.0282 129  TRP A CH2 
1229 N  N   . ARG A 133 ? 0.1384 0.1407 0.1440 0.0101  0.0126  0.0005  130  ARG A N   
1230 C  CA  . ARG A 133 ? 0.1396 0.1380 0.1655 0.0085  0.0008  -0.0117 130  ARG A CA  
1231 C  C   . ARG A 133 ? 0.1416 0.1612 0.1628 0.0085  0.0054  -0.0092 130  ARG A C   
1232 O  O   . ARG A 133 ? 0.1418 0.1547 0.1823 0.0083  0.0076  -0.0359 130  ARG A O   
1233 C  CB  . ARG A 133 ? 0.1415 0.1631 0.1768 0.0034  0.0074  -0.0214 130  ARG A CB  
1234 C  CG  . ARG A 133 ? 0.1671 0.1657 0.2031 -0.0086 0.0325  -0.0251 130  ARG A CG  
1235 C  CD  . ARG A 133 ? 0.2207 0.2233 0.2205 -0.0259 0.0420  -0.0365 130  ARG A CD  
1236 N  NE  . ARG A 133 ? 0.2343 0.2022 0.3055 -0.0581 0.0457  -0.0559 130  ARG A NE  
1237 C  CZ  . ARG A 133 ? 0.2922 0.2459 0.3600 -0.0751 0.0713  -0.0891 130  ARG A CZ  
1238 N  NH1 . ARG A 133 ? 0.2962 0.2905 0.4117 -0.1015 0.0938  -0.1253 130  ARG A NH1 
1239 N  NH2 . ARG A 133 ? 0.3442 0.2796 0.4118 -0.0433 0.0806  -0.1140 130  ARG A NH2 
1240 N  N   . GLY A 134 ? 0.1487 0.1489 0.1437 0.0014  0.0073  -0.0055 131  GLY A N   
1241 C  CA  . GLY A 134 ? 0.1578 0.1551 0.1592 0.0043  0.0031  -0.0103 131  GLY A CA  
1242 C  C   . GLY A 134 ? 0.1371 0.1426 0.1598 -0.0017 0.0002  0.0000  131  GLY A C   
1243 O  O   . GLY A 134 ? 0.1407 0.1377 0.1724 0.0049  0.0251  0.0040  131  GLY A O   
1244 N  N   . PHE A 135 ? 0.1398 0.1415 0.1521 0.0031  -0.0010 0.0084  132  PHE A N   
1245 C  CA  . PHE A 135 ? 0.1410 0.1461 0.1610 -0.0029 -0.0050 0.0116  132  PHE A CA  
1246 C  C   . PHE A 135 ? 0.1704 0.1456 0.1711 -0.0075 -0.0060 0.0113  132  PHE A C   
1247 O  O   . PHE A 135 ? 0.2252 0.1713 0.1804 -0.0336 -0.0151 0.0261  132  PHE A O   
1248 C  CB  . PHE A 135 ? 0.1309 0.1581 0.1554 0.0018  -0.0003 0.0041  132  PHE A CB  
1249 C  CG  . PHE A 135 ? 0.1487 0.1492 0.1636 0.0052  0.0160  0.0075  132  PHE A CG  
1250 C  CD1 . PHE A 135 ? 0.1499 0.2075 0.1470 -0.0263 0.0065  0.0099  132  PHE A CD1 
1251 C  CD2 . PHE A 135 ? 0.1754 0.2532 0.1383 0.0294  0.0142  0.0268  132  PHE A CD2 
1252 C  CE1 . PHE A 135 ? 0.2430 0.1946 0.1740 -0.0080 -0.0128 0.0182  132  PHE A CE1 
1253 C  CE2 . PHE A 135 ? 0.2001 0.2249 0.1782 -0.0096 0.0459  0.0183  132  PHE A CE2 
1254 C  CZ  . PHE A 135 ? 0.2413 0.2187 0.1836 -0.0172 -0.0025 0.0189  132  PHE A CZ  
1255 N  N   . SER A 136 ? 0.1687 0.1442 0.1736 -0.0179 -0.0048 -0.0016 133  SER A N   
1256 C  CA  . SER A 136 ? 0.1633 0.1528 0.1708 -0.0200 0.0092  0.0069  133  SER A CA  
1257 C  C   . SER A 136 ? 0.1700 0.1533 0.1829 -0.0265 0.0094  -0.0070 133  SER A C   
1258 O  O   . SER A 136 ? 0.1969 0.1639 0.2135 -0.0278 0.0191  -0.0350 133  SER A O   
1259 C  CB  . SER A 136 ? 0.1624 0.1575 0.1837 -0.0128 0.0028  0.0046  133  SER A CB  
1260 O  OG  . SER A 136 ? 0.1605 0.1446 0.1909 -0.0072 -0.0053 0.0068  133  SER A OG  
1261 N  N   . GLY A 137 ? 0.1603 0.1370 0.1787 -0.0122 0.0173  -0.0047 134  GLY A N   
1262 C  CA  . GLY A 137 ? 0.1606 0.1607 0.1681 -0.0116 0.0151  -0.0050 134  GLY A CA  
1263 C  C   . GLY A 137 ? 0.1582 0.1513 0.1589 -0.0080 0.0096  -0.0096 134  GLY A C   
1264 O  O   . GLY A 137 ? 0.1852 0.1617 0.1982 -0.0056 0.0155  -0.0215 134  GLY A O   
1265 N  N   . LYS A 138 ? 0.1587 0.1370 0.1626 -0.0122 0.0085  -0.0162 135  LYS A N   
1266 C  CA  . LYS A 138 ? 0.1448 0.1284 0.1665 -0.0103 0.0008  -0.0143 135  LYS A CA  
1267 C  C   . LYS A 138 ? 0.1488 0.1343 0.1590 0.0017  0.0006  -0.0084 135  LYS A C   
1268 O  O   . LYS A 138 ? 0.1421 0.1474 0.1448 0.0061  0.0009  -0.0166 135  LYS A O   
1269 C  CB  . LYS A 138 ? 0.1338 0.1380 0.1893 -0.0172 -0.0034 -0.0144 135  LYS A CB  
1270 C  CG  . LYS A 138 ? 0.1556 0.1713 0.2189 -0.0055 0.0326  0.0009  135  LYS A CG  
1271 C  CD  . LYS A 138 ? 0.1926 0.1687 0.2874 0.0012  0.0176  -0.0026 135  LYS A CD  
1272 C  CE  . LYS A 138 ? 0.2153 0.2610 0.3416 -0.0068 -0.0091 -0.0267 135  LYS A CE  
1273 N  NZ  . LYS A 138 ? 0.2632 0.3015 0.4607 0.0251  -0.0228 -0.0638 135  LYS A NZ  
1274 N  N   . LYS A 139 ? 0.1399 0.1368 0.1575 -0.0010 -0.0068 -0.0114 136  LYS A N   
1275 C  CA  . LYS A 139 ? 0.1547 0.1490 0.1482 -0.0083 0.0000  -0.0140 136  LYS A CA  
1276 C  C   . LYS A 139 ? 0.1418 0.1508 0.1470 -0.0130 -0.0017 -0.0186 136  LYS A C   
1277 O  O   . LYS A 139 ? 0.1331 0.1568 0.1581 -0.0231 -0.0104 -0.0334 136  LYS A O   
1278 C  CB  . LYS A 139 ? 0.1552 0.1568 0.1537 -0.0154 0.0013  -0.0197 136  LYS A CB  
1279 C  CG  . LYS A 139 ? 0.2104 0.2007 0.1643 -0.0241 -0.0057 -0.0106 136  LYS A CG  
1280 C  CD  . LYS A 139 ? 0.2363 0.2432 0.2017 -0.0141 -0.0016 -0.0573 136  LYS A CD  
1281 C  CE  . LYS A 139 ? 0.3020 0.2594 0.2233 -0.0093 -0.0141 -0.0636 136  LYS A CE  
1282 N  NZ  . LYS A 139 ? 0.3291 0.3523 0.2350 -0.0281 -0.0222 -0.1224 136  LYS A NZ  
1283 N  N   . ILE A 140 ? 0.1138 0.1311 0.1367 -0.0218 -0.0116 -0.0263 137  ILE A N   
1284 C  CA  . ILE A 140 ? 0.1295 0.1259 0.1144 -0.0089 -0.0028 -0.0080 137  ILE A CA  
1285 C  C   . ILE A 140 ? 0.1348 0.1313 0.1257 -0.0044 -0.0074 -0.0128 137  ILE A C   
1286 O  O   . ILE A 140 ? 0.1310 0.1486 0.1353 0.0040  0.0039  -0.0062 137  ILE A O   
1287 C  CB  . ILE A 140 ? 0.1360 0.1494 0.1358 -0.0090 -0.0075 -0.0066 137  ILE A CB  
1288 C  CG1 . ILE A 140 ? 0.1353 0.1239 0.1142 -0.0240 0.0089  -0.0292 137  ILE A CG1 
1289 C  CG2 . ILE A 140 ? 0.1528 0.1098 0.1371 -0.0433 -0.0038 -0.0043 137  ILE A CG2 
1290 C  CD1 . ILE A 140 ? 0.1260 0.1888 0.1161 0.0136  0.0158  -0.0170 137  ILE A CD1 
1291 N  N   . THR A 141 ? 0.1387 0.1184 0.1267 -0.0088 -0.0057 -0.0164 138  THR A N   
1292 C  CA  . THR A 141 ? 0.1362 0.1465 0.1213 -0.0060 0.0055  -0.0034 138  THR A CA  
1293 C  C   . THR A 141 ? 0.1402 0.1437 0.1303 0.0024  -0.0063 -0.0050 138  THR A C   
1294 O  O   . THR A 141 ? 0.1532 0.1574 0.1261 -0.0083 -0.0060 -0.0083 138  THR A O   
1295 C  CB  . THR A 141 ? 0.1536 0.1590 0.1442 -0.0029 0.0016  -0.0082 138  THR A CB  
1296 O  OG1 . THR A 141 ? 0.1497 0.1770 0.1043 0.0088  -0.0218 -0.0095 138  THR A OG1 
1297 C  CG2 . THR A 141 ? 0.1829 0.1508 0.1613 -0.0131 0.0152  -0.0073 138  THR A CG2 
1298 N  N   . ASP A 142 ? 0.1275 0.1323 0.1283 -0.0059 -0.0049 -0.0091 139  ASP A N   
1299 C  CA  . ASP A 142 ? 0.1264 0.1436 0.1190 -0.0040 -0.0022 0.0019  139  ASP A CA  
1300 C  C   . ASP A 142 ? 0.1068 0.1183 0.1106 -0.0051 -0.0049 0.0118  139  ASP A C   
1301 O  O   . ASP A 142 ? 0.1378 0.1539 0.1141 -0.0143 -0.0141 0.0107  139  ASP A O   
1302 C  CB  . ASP A 142 ? 0.1306 0.1453 0.1167 0.0111  -0.0249 0.0001  139  ASP A CB  
1303 C  CG  . ASP A 142 ? 0.1411 0.1592 0.1605 -0.0013 -0.0265 -0.0035 139  ASP A CG  
1304 O  OD1 . ASP A 142 ? 0.1874 0.1391 0.1357 -0.0042 -0.0089 -0.0135 139  ASP A OD1 
1305 O  OD2 . ASP A 142 ? 0.1754 0.1718 0.2004 -0.0258 -0.0437 -0.0058 139  ASP A OD2 
1306 N  N   . ILE A 143 ? 0.1237 0.1187 0.1166 -0.0222 -0.0099 0.0081  140  ILE A N   
1307 C  CA  . ILE A 143 ? 0.1159 0.1176 0.1070 -0.0149 0.0006  -0.0003 140  ILE A CA  
1308 C  C   . ILE A 143 ? 0.1271 0.1123 0.1148 -0.0035 -0.0165 -0.0011 140  ILE A C   
1309 O  O   . ILE A 143 ? 0.1548 0.1304 0.1196 0.0007  -0.0226 -0.0148 140  ILE A O   
1310 C  CB  . ILE A 143 ? 0.1188 0.1246 0.0942 -0.0177 0.0110  0.0017  140  ILE A CB  
1311 C  CG1 . ILE A 143 ? 0.1106 0.1507 0.1282 0.0028  0.0123  -0.0122 140  ILE A CG1 
1312 C  CG2 . ILE A 143 ? 0.1166 0.1608 0.1551 -0.0317 -0.0017 -0.0163 140  ILE A CG2 
1313 C  CD1 . ILE A 143 ? 0.1578 0.1354 0.1526 0.0086  -0.0007 0.0109  140  ILE A CD1 
1314 N  N   . VAL A 144 ? 0.1233 0.1130 0.1228 0.0055  -0.0108 -0.0022 141  VAL A N   
1315 C  CA  . VAL A 144 ? 0.1268 0.1224 0.1338 0.0031  -0.0117 0.0037  141  VAL A CA  
1316 C  C   . VAL A 144 ? 0.1182 0.1210 0.1128 0.0024  -0.0105 -0.0035 141  VAL A C   
1317 O  O   . VAL A 144 ? 0.1300 0.1527 0.1295 -0.0022 -0.0181 0.0092  141  VAL A O   
1318 C  CB  . VAL A 144 ? 0.1309 0.1235 0.1231 0.0179  -0.0149 -0.0036 141  VAL A CB  
1319 C  CG1 . VAL A 144 ? 0.1296 0.1102 0.1978 0.0134  -0.0104 -0.0260 141  VAL A CG1 
1320 C  CG2 . VAL A 144 ? 0.1224 0.1531 0.1447 -0.0064 -0.0224 0.0024  141  VAL A CG2 
1321 N  N   . ASN A 145 ? 0.1073 0.1193 0.1151 0.0103  -0.0017 -0.0060 142  ASN A N   
1322 C  CA  . ASN A 145 ? 0.1224 0.1276 0.1324 0.0092  -0.0086 0.0039  142  ASN A CA  
1323 C  C   . ASN A 145 ? 0.1386 0.1275 0.1266 0.0095  -0.0011 -0.0023 142  ASN A C   
1324 O  O   . ASN A 145 ? 0.1572 0.1421 0.1262 0.0250  -0.0276 -0.0192 142  ASN A O   
1325 C  CB  . ASN A 145 ? 0.1241 0.1398 0.1406 -0.0059 -0.0071 -0.0038 142  ASN A CB  
1326 C  CG  . ASN A 145 ? 0.1179 0.1482 0.1829 -0.0012 -0.0087 0.0169  142  ASN A CG  
1327 O  OD1 . ASN A 145 ? 0.1351 0.1853 0.2200 0.0164  -0.0111 0.0105  142  ASN A OD1 
1328 N  ND2 . ASN A 145 ? 0.1504 0.1293 0.2215 -0.0335 -0.0171 0.0167  142  ASN A ND2 
1329 N  N   . ILE A 146 ? 0.1140 0.1164 0.1201 0.0070  -0.0249 -0.0199 143  ILE A N   
1330 C  CA  . ILE A 146 ? 0.1256 0.1152 0.1284 0.0194  -0.0123 -0.0119 143  ILE A CA  
1331 C  C   . ILE A 146 ? 0.1264 0.1112 0.1238 0.0087  -0.0155 -0.0088 143  ILE A C   
1332 O  O   . ILE A 146 ? 0.1297 0.1286 0.1391 0.0080  -0.0265 -0.0088 143  ILE A O   
1333 C  CB  . ILE A 146 ? 0.1206 0.1189 0.1293 0.0040  -0.0159 -0.0119 143  ILE A CB  
1334 C  CG1 . ILE A 146 ? 0.1316 0.1364 0.1610 -0.0095 0.0048  -0.0001 143  ILE A CG1 
1335 C  CG2 . ILE A 146 ? 0.1644 0.1080 0.1702 0.0079  0.0047  -0.0423 143  ILE A CG2 
1336 C  CD1 . ILE A 146 ? 0.1688 0.1687 0.1468 -0.0453 0.0182  -0.0015 143  ILE A CD1 
1337 N  N   . GLY A 147 ? 0.1162 0.1094 0.1425 -0.0007 -0.0179 -0.0032 144  GLY A N   
1338 C  CA  . GLY A 147 ? 0.1300 0.1217 0.1552 -0.0129 -0.0013 0.0001  144  GLY A CA  
1339 C  C   . GLY A 147 ? 0.1155 0.1210 0.1503 0.0023  0.0012  -0.0090 144  GLY A C   
1340 O  O   . GLY A 147 ? 0.1192 0.1276 0.1496 0.0023  0.0006  0.0050  144  GLY A O   
1341 N  N   . ILE A 148 ? 0.1138 0.1355 0.1513 0.0046  -0.0127 -0.0104 145  ILE A N   
1342 C  CA  . ILE A 148 ? 0.1382 0.1224 0.1378 -0.0011 -0.0074 -0.0035 145  ILE A CA  
1343 C  C   . ILE A 148 ? 0.1488 0.1442 0.1712 0.0112  0.0000  0.0071  145  ILE A C   
1344 O  O   . ILE A 148 ? 0.1417 0.1583 0.1959 0.0098  -0.0113 0.0278  145  ILE A O   
1345 C  CB  . ILE A 148 ? 0.1235 0.1338 0.1447 0.0115  0.0017  0.0000  145  ILE A CB  
1346 C  CG1 . ILE A 148 ? 0.1648 0.1391 0.1354 0.0080  0.0108  -0.0003 145  ILE A CG1 
1347 C  CG2 . ILE A 148 ? 0.1746 0.1541 0.1415 0.0022  -0.0279 -0.0079 145  ILE A CG2 
1348 C  CD1 . ILE A 148 ? 0.1254 0.1401 0.1574 0.0269  -0.0009 -0.0252 145  ILE A CD1 
1349 N  N   . GLY A 149 ? 0.1334 0.1454 0.1458 0.0056  -0.0007 -0.0004 146  GLY A N   
1350 C  CA  . GLY A 149 ? 0.1506 0.1453 0.1521 -0.0164 0.0077  -0.0170 146  GLY A CA  
1351 C  C   . GLY A 149 ? 0.1335 0.1487 0.1439 -0.0172 -0.0017 0.0030  146  GLY A C   
1352 O  O   . GLY A 149 ? 0.1533 0.1407 0.1714 -0.0108 0.0070  -0.0127 146  GLY A O   
1353 N  N   A GLY A 150 ? 0.1206 0.1443 0.1704 -0.0224 -0.0042 0.0003  147  GLY A N   
1354 N  N   B GLY A 150 ? 0.1510 0.1613 0.1895 -0.0180 0.0095  -0.0013 147  GLY A N   
1355 C  CA  A GLY A 150 ? 0.1263 0.1373 0.1642 -0.0084 0.0063  -0.0005 147  GLY A CA  
1356 C  CA  B GLY A 150 ? 0.1654 0.1765 0.2092 -0.0117 0.0246  0.0005  147  GLY A CA  
1357 C  C   A GLY A 150 ? 0.1401 0.1278 0.1527 0.0034  0.0037  0.0039  147  GLY A C   
1358 C  C   B GLY A 150 ? 0.1822 0.1807 0.2136 -0.0033 0.0343  -0.0015 147  GLY A C   
1359 O  O   A GLY A 150 ? 0.1899 0.1533 0.1038 0.0146  0.0160  0.0108  147  GLY A O   
1360 O  O   B GLY A 150 ? 0.2253 0.1905 0.2474 -0.0250 0.0650  -0.0064 147  GLY A O   
1361 N  N   A SER A 151 ? 0.1433 0.1193 0.1577 -0.0033 0.0082  -0.0099 148  SER A N   
1362 N  N   B SER A 151 ? 0.1791 0.1822 0.2145 0.0029  0.0244  0.0073  148  SER A N   
1363 C  CA  A SER A 151 ? 0.1283 0.1195 0.1508 0.0027  0.0083  0.0031  148  SER A CA  
1364 C  CA  B SER A 151 ? 0.1642 0.1783 0.2040 0.0127  0.0063  0.0052  148  SER A CA  
1365 C  C   A SER A 151 ? 0.1254 0.1382 0.1555 -0.0027 0.0113  -0.0076 148  SER A C   
1366 C  C   B SER A 151 ? 0.1685 0.1733 0.2020 0.0055  0.0139  0.0013  148  SER A C   
1367 O  O   A SER A 151 ? 0.1549 0.1455 0.1625 -0.0311 0.0064  0.0064  148  SER A O   
1368 O  O   B SER A 151 ? 0.1323 0.1629 0.2018 0.0083  -0.0033 0.0027  148  SER A O   
1369 C  CB  A SER A 151 ? 0.1000 0.1122 0.1613 -0.0034 0.0002  -0.0117 148  SER A CB  
1370 C  CB  B SER A 151 ? 0.1814 0.1955 0.1986 0.0097  0.0139  0.0039  148  SER A CB  
1371 O  OG  A SER A 151 ? 0.1429 0.1445 0.1749 0.0172  -0.0006 0.0237  148  SER A OG  
1372 O  OG  B SER A 151 ? 0.2128 0.1719 0.2031 0.0504  -0.0040 0.0194  148  SER A OG  
1373 N  N   . ASP A 152 ? 0.1608 0.1466 0.1738 0.0002  0.0147  0.0134  149  ASP A N   
1374 C  CA  . ASP A 152 ? 0.1585 0.1446 0.1676 0.0007  0.0177  -0.0147 149  ASP A CA  
1375 C  C   . ASP A 152 ? 0.1592 0.1621 0.1654 -0.0041 0.0217  -0.0192 149  ASP A C   
1376 O  O   . ASP A 152 ? 0.1728 0.1567 0.2050 -0.0096 0.0278  -0.0484 149  ASP A O   
1377 C  CB  . ASP A 152 ? 0.1370 0.1752 0.1764 0.0171  0.0198  -0.0181 149  ASP A CB  
1378 C  CG  . ASP A 152 ? 0.1541 0.1510 0.1783 -0.0087 0.0132  0.0015  149  ASP A CG  
1379 O  OD1 . ASP A 152 ? 0.1500 0.1689 0.1848 -0.0150 -0.0028 -0.0213 149  ASP A OD1 
1380 O  OD2 . ASP A 152 ? 0.1943 0.1866 0.2466 -0.0148 0.0095  0.0174  149  ASP A OD2 
1381 N  N   . LEU A 153 ? 0.1530 0.1555 0.1498 0.0001  0.0222  -0.0158 150  LEU A N   
1382 C  CA  A LEU A 153 ? 0.1504 0.1533 0.1501 0.0041  0.0033  -0.0078 150  LEU A CA  
1383 C  CA  B LEU A 153 ? 0.1641 0.1641 0.1629 0.0006  0.0062  -0.0060 150  LEU A CA  
1384 C  C   . LEU A 153 ? 0.1485 0.1483 0.1358 0.0081  -0.0014 -0.0029 150  LEU A C   
1385 O  O   . LEU A 153 ? 0.1358 0.1559 0.1511 0.0002  -0.0198 -0.0199 150  LEU A O   
1386 C  CB  A LEU A 153 ? 0.1687 0.1526 0.1579 0.0081  0.0130  -0.0084 150  LEU A CB  
1387 C  CB  B LEU A 153 ? 0.1918 0.1714 0.1798 0.0022  0.0096  -0.0064 150  LEU A CB  
1388 C  CG  A LEU A 153 ? 0.1297 0.1130 0.1164 0.0283  0.0046  -0.0053 150  LEU A CG  
1389 C  CG  B LEU A 153 ? 0.2177 0.1821 0.2226 -0.0139 0.0165  0.0218  150  LEU A CG  
1390 C  CD1 A LEU A 153 ? 0.1360 0.1189 0.1656 0.0110  -0.0167 0.0176  150  LEU A CD1 
1391 C  CD1 B LEU A 153 ? 0.2275 0.2410 0.2705 0.0466  -0.0156 0.0121  150  LEU A CD1 
1392 C  CD2 A LEU A 153 ? 0.1735 0.1544 0.1399 0.0619  -0.0187 -0.0189 150  LEU A CD2 
1393 C  CD2 B LEU A 153 ? 0.2796 0.1641 0.2629 0.0249  0.0283  -0.0219 150  LEU A CD2 
1394 N  N   . GLY A 154 ? 0.1390 0.1614 0.1452 0.0143  0.0164  -0.0200 151  GLY A N   
1395 C  CA  . GLY A 154 ? 0.1208 0.1449 0.1250 0.0143  0.0000  -0.0264 151  GLY A CA  
1396 C  C   . GLY A 154 ? 0.1480 0.1358 0.1360 0.0069  0.0000  -0.0065 151  GLY A C   
1397 O  O   . GLY A 154 ? 0.1399 0.1582 0.1375 0.0072  0.0097  -0.0210 151  GLY A O   
1398 N  N   . PRO A 155 ? 0.1441 0.1461 0.1443 0.0093  -0.0102 -0.0017 152  PRO A N   
1399 C  CA  . PRO A 155 ? 0.1514 0.1442 0.1402 0.0051  -0.0067 -0.0051 152  PRO A CA  
1400 C  C   . PRO A 155 ? 0.1406 0.1248 0.1177 0.0044  0.0064  0.0029  152  PRO A C   
1401 O  O   . PRO A 155 ? 0.1528 0.1315 0.1390 -0.0040 -0.0046 -0.0214 152  PRO A O   
1402 C  CB  . PRO A 155 ? 0.1872 0.1372 0.1786 -0.0143 -0.0006 0.0121  152  PRO A CB  
1403 C  CG  . PRO A 155 ? 0.1983 0.1527 0.1764 0.0337  -0.0240 -0.0035 152  PRO A CG  
1404 C  CD  . PRO A 155 ? 0.1581 0.1550 0.1251 0.0101  0.0138  -0.0040 152  PRO A CD  
1405 N  N   . LYS A 156 ? 0.1375 0.1417 0.1405 0.0050  0.0042  -0.0048 153  LYS A N   
1406 C  CA  . LYS A 156 ? 0.1383 0.1328 0.1435 0.0069  -0.0002 -0.0102 153  LYS A CA  
1407 C  C   . LYS A 156 ? 0.1272 0.1248 0.1372 0.0022  0.0076  -0.0167 153  LYS A C   
1408 O  O   . LYS A 156 ? 0.1332 0.1475 0.1576 -0.0107 -0.0073 -0.0278 153  LYS A O   
1409 C  CB  . LYS A 156 ? 0.1507 0.1583 0.1646 0.0083  0.0082  -0.0076 153  LYS A CB  
1410 C  CG  . LYS A 156 ? 0.1926 0.1993 0.1842 0.0107  0.0117  -0.0195 153  LYS A CG  
1411 C  CD  . LYS A 156 ? 0.2506 0.2223 0.3024 0.0450  0.0277  -0.0299 153  LYS A CD  
1412 C  CE  . LYS A 156 ? 0.2921 0.2630 0.4143 0.0446  0.0534  -0.0261 153  LYS A CE  
1413 N  NZ  . LYS A 156 ? 0.3847 0.2594 0.4109 0.0805  0.0126  -0.0317 153  LYS A NZ  
1414 N  N   . MSE A 157 ? 0.1292 0.1159 0.1310 0.0010  0.0027  -0.0125 154  MSE A N   
1415 C  CA  . MSE A 157 ? 0.1146 0.1154 0.1342 0.0024  -0.0028 -0.0129 154  MSE A CA  
1416 C  C   . MSE A 157 ? 0.1046 0.1153 0.1224 -0.0016 -0.0119 -0.0028 154  MSE A C   
1417 O  O   . MSE A 157 ? 0.1510 0.1340 0.1277 0.0134  -0.0255 -0.0070 154  MSE A O   
1418 C  CB  . MSE A 157 ? 0.1446 0.1151 0.1496 0.0102  -0.0028 -0.0080 154  MSE A CB  
1419 C  CG  . MSE A 157 ? 0.1562 0.1416 0.1589 -0.0053 0.0116  -0.0032 154  MSE A CG  
1420 SE SE  . MSE A 157 ? 0.1904 0.1583 0.1679 -0.0044 0.0180  -0.0034 154  MSE A SE  
1421 C  CE  . MSE A 157 ? 0.1150 0.2209 0.2473 0.0082  0.0020  -0.0486 154  MSE A CE  
1422 N  N   . VAL A 158 ? 0.1212 0.1025 0.1184 0.0076  -0.0141 0.0072  155  VAL A N   
1423 C  CA  . VAL A 158 ? 0.1202 0.1181 0.1274 0.0189  -0.0095 0.0012  155  VAL A CA  
1424 C  C   . VAL A 158 ? 0.1194 0.1152 0.1271 0.0218  0.0000  0.0047  155  VAL A C   
1425 O  O   . VAL A 158 ? 0.1287 0.1400 0.1199 0.0023  -0.0031 -0.0161 155  VAL A O   
1426 C  CB  . VAL A 158 ? 0.1222 0.1387 0.1065 0.0107  0.0029  0.0116  155  VAL A CB  
1427 C  CG1 . VAL A 158 ? 0.1338 0.1152 0.1331 0.0085  0.0075  -0.0110 155  VAL A CG1 
1428 C  CG2 . VAL A 158 ? 0.1259 0.1372 0.1558 -0.0062 0.0073  0.0034  155  VAL A CG2 
1429 N  N   . VAL A 159 ? 0.1045 0.1145 0.1198 0.0000  -0.0012 0.0021  156  VAL A N   
1430 C  CA  . VAL A 159 ? 0.1169 0.1149 0.1136 0.0046  -0.0127 0.0025  156  VAL A CA  
1431 C  C   . VAL A 159 ? 0.1100 0.1156 0.1291 0.0160  -0.0068 0.0000  156  VAL A C   
1432 O  O   . VAL A 159 ? 0.1493 0.1196 0.1462 0.0157  -0.0288 -0.0048 156  VAL A O   
1433 C  CB  . VAL A 159 ? 0.1315 0.1165 0.1291 0.0032  -0.0072 0.0151  156  VAL A CB  
1434 C  CG1 . VAL A 159 ? 0.1177 0.1691 0.1538 -0.0162 -0.0438 0.0089  156  VAL A CG1 
1435 C  CG2 . VAL A 159 ? 0.1186 0.1393 0.1358 0.0178  -0.0223 0.0072  156  VAL A CG2 
1436 N  N   . ARG A 160 ? 0.1405 0.1126 0.1331 0.0034  -0.0146 -0.0030 157  ARG A N   
1437 C  CA  . ARG A 160 ? 0.1143 0.1216 0.1241 0.0084  0.0000  0.0012  157  ARG A CA  
1438 C  C   . ARG A 160 ? 0.1097 0.1201 0.1092 0.0033  -0.0069 -0.0030 157  ARG A C   
1439 O  O   . ARG A 160 ? 0.1303 0.1363 0.1161 0.0110  -0.0151 -0.0236 157  ARG A O   
1440 C  CB  . ARG A 160 ? 0.1212 0.1450 0.1309 0.0014  -0.0056 -0.0023 157  ARG A CB  
1441 C  CG  . ARG A 160 ? 0.1469 0.1557 0.1259 0.0134  -0.0191 0.0222  157  ARG A CG  
1442 C  CD  . ARG A 160 ? 0.1531 0.1703 0.1092 0.0266  -0.0194 0.0018  157  ARG A CD  
1443 N  NE  . ARG A 160 ? 0.1679 0.1884 0.1429 0.0486  -0.0240 0.0057  157  ARG A NE  
1444 C  CZ  . ARG A 160 ? 0.1532 0.1585 0.1402 0.0209  -0.0120 0.0000  157  ARG A CZ  
1445 N  NH1 . ARG A 160 ? 0.1229 0.1827 0.1412 0.0173  -0.0058 -0.0012 157  ARG A NH1 
1446 N  NH2 . ARG A 160 ? 0.1595 0.2090 0.1556 0.0433  -0.0316 -0.0094 157  ARG A NH2 
1447 N  N   . ALA A 161 ? 0.1102 0.1222 0.1091 0.0012  -0.0141 -0.0003 158  ALA A N   
1448 C  CA  . ALA A 161 ? 0.1140 0.1259 0.1165 0.0088  -0.0135 -0.0031 158  ALA A CA  
1449 C  C   . ALA A 161 ? 0.1380 0.1159 0.1209 0.0094  -0.0032 0.0039  158  ALA A C   
1450 O  O   . ALA A 161 ? 0.1530 0.1430 0.1300 0.0110  -0.0040 0.0046  158  ALA A O   
1451 C  CB  . ALA A 161 ? 0.1126 0.1393 0.1263 -0.0047 -0.0032 -0.0051 158  ALA A CB  
1452 N  N   . LEU A 162 ? 0.1388 0.1281 0.1002 0.0297  0.0113  0.0071  159  LEU A N   
1453 C  CA  . LEU A 162 ? 0.1365 0.1258 0.1168 0.0135  -0.0065 0.0048  159  LEU A CA  
1454 C  C   . LEU A 162 ? 0.1163 0.1188 0.0958 0.0147  -0.0093 0.0025  159  LEU A C   
1455 O  O   . LEU A 162 ? 0.1274 0.1243 0.1371 0.0117  -0.0125 0.0073  159  LEU A O   
1456 C  CB  . LEU A 162 ? 0.1222 0.1397 0.1048 0.0127  -0.0108 -0.0059 159  LEU A CB  
1457 C  CG  . LEU A 162 ? 0.1010 0.1317 0.1212 0.0248  0.0052  -0.0034 159  LEU A CG  
1458 C  CD1 . LEU A 162 ? 0.1100 0.1771 0.1111 0.0216  -0.0125 0.0116  159  LEU A CD1 
1459 C  CD2 . LEU A 162 ? 0.1343 0.1713 0.1183 0.0190  -0.0060 -0.0044 159  LEU A CD2 
1460 N  N   . GLN A 163 ? 0.1180 0.1241 0.1359 -0.0017 -0.0071 0.0181  160  GLN A N   
1461 C  CA  . GLN A 163 ? 0.1089 0.1283 0.1314 0.0055  -0.0123 0.0015  160  GLN A CA  
1462 C  C   . GLN A 163 ? 0.0960 0.1225 0.1243 -0.0059 0.0008  -0.0036 160  GLN A C   
1463 O  O   . GLN A 163 ? 0.1266 0.1338 0.1211 0.0018  -0.0020 0.0115  160  GLN A O   
1464 C  CB  . GLN A 163 ? 0.1143 0.1418 0.1292 0.0076  -0.0103 0.0025  160  GLN A CB  
1465 C  CG  . GLN A 163 ? 0.1428 0.2016 0.1749 0.0173  -0.0260 -0.0101 160  GLN A CG  
1466 C  CD  . GLN A 163 ? 0.1829 0.2193 0.2294 0.0271  -0.0160 0.0092  160  GLN A CD  
1467 O  OE1 . GLN A 163 ? 0.2874 0.2946 0.2591 0.0494  0.0250  0.0274  160  GLN A OE1 
1468 N  NE2 . GLN A 163 ? 0.2308 0.2919 0.1894 0.0347  -0.0149 0.0346  160  GLN A NE2 
1469 N  N   . PRO A 164 ? 0.1341 0.1178 0.1153 -0.0028 -0.0063 0.0016  161  PRO A N   
1470 C  CA  . PRO A 164 ? 0.1260 0.1205 0.1124 -0.0071 -0.0035 0.0017  161  PRO A CA  
1471 C  C   . PRO A 164 ? 0.1191 0.1303 0.1082 0.0000  -0.0004 0.0093  161  PRO A C   
1472 O  O   . PRO A 164 ? 0.1482 0.1347 0.1157 -0.0014 0.0014  -0.0086 161  PRO A O   
1473 C  CB  . PRO A 164 ? 0.1381 0.1424 0.1054 -0.0082 0.0033  0.0112  161  PRO A CB  
1474 C  CG  . PRO A 164 ? 0.1591 0.1526 0.1064 -0.0261 -0.0126 0.0102  161  PRO A CG  
1475 C  CD  . PRO A 164 ? 0.1333 0.1150 0.1098 -0.0008 -0.0116 0.0001  161  PRO A CD  
1476 N  N   . TYR A 165 ? 0.1243 0.1311 0.1042 0.0000  -0.0069 -0.0027 162  TYR A N   
1477 C  CA  . TYR A 165 ? 0.1342 0.1201 0.0987 0.0073  0.0091  0.0024  162  TYR A CA  
1478 C  C   . TYR A 165 ? 0.1288 0.1288 0.0990 0.0085  -0.0043 0.0131  162  TYR A C   
1479 O  O   . TYR A 165 ? 0.1637 0.1404 0.1219 0.0187  0.0094  0.0109  162  TYR A O   
1480 C  CB  . TYR A 165 ? 0.1353 0.1258 0.1008 0.0177  0.0038  0.0165  162  TYR A CB  
1481 C  CG  . TYR A 165 ? 0.1257 0.1268 0.0908 -0.0059 -0.0167 -0.0104 162  TYR A CG  
1482 C  CD1 . TYR A 165 ? 0.1407 0.1188 0.1378 -0.0047 0.0169  -0.0041 162  TYR A CD1 
1483 C  CD2 . TYR A 165 ? 0.1412 0.1183 0.1211 0.0042  0.0145  0.0022  162  TYR A CD2 
1484 C  CE1 . TYR A 165 ? 0.1659 0.1291 0.1219 -0.0127 0.0349  -0.0346 162  TYR A CE1 
1485 C  CE2 . TYR A 165 ? 0.1265 0.1571 0.1525 -0.0070 -0.0001 0.0011  162  TYR A CE2 
1486 C  CZ  . TYR A 165 ? 0.1487 0.1588 0.1517 -0.0171 0.0094  -0.0054 162  TYR A CZ  
1487 O  OH  . TYR A 165 ? 0.1793 0.1605 0.1279 -0.0505 0.0190  -0.0057 162  TYR A OH  
1488 N  N   . HIS A 166 ? 0.1451 0.1175 0.1048 0.0151  0.0051  0.0165  163  HIS A N   
1489 C  CA  . HIS A 166 ? 0.1390 0.1348 0.1142 0.0058  0.0157  0.0145  163  HIS A CA  
1490 C  C   . HIS A 166 ? 0.1594 0.1326 0.1133 -0.0086 0.0105  0.0063  163  HIS A C   
1491 O  O   . HIS A 166 ? 0.1800 0.1464 0.1212 -0.0072 0.0022  0.0084  163  HIS A O   
1492 C  CB  . HIS A 166 ? 0.1565 0.1326 0.1208 0.0174  0.0071  0.0203  163  HIS A CB  
1493 C  CG  . HIS A 166 ? 0.1504 0.1518 0.1616 0.0121  0.0242  -0.0036 163  HIS A CG  
1494 N  ND1 . HIS A 166 ? 0.1572 0.2383 0.2184 -0.0049 0.0433  -0.0604 163  HIS A ND1 
1495 C  CD2 . HIS A 166 ? 0.1891 0.2006 0.1421 0.0220  0.0312  -0.0116 163  HIS A CD2 
1496 C  CE1 . HIS A 166 ? 0.2224 0.1941 0.2018 -0.0095 0.0023  -0.0552 163  HIS A CE1 
1497 N  NE2 . HIS A 166 ? 0.2180 0.2055 0.1153 0.0252  -0.0006 -0.0014 163  HIS A NE2 
1498 N  N   . CYS A 167 ? 0.1751 0.1367 0.1320 0.0010  0.0056  -0.0031 164  CYS A N   
1499 C  CA  . CYS A 167 ? 0.1859 0.1330 0.1235 0.0164  0.0131  -0.0166 164  CYS A CA  
1500 C  C   . CYS A 167 ? 0.1959 0.1365 0.1406 0.0282  0.0265  -0.0090 164  CYS A C   
1501 O  O   . CYS A 167 ? 0.2899 0.1844 0.1707 0.0278  0.0581  -0.0054 164  CYS A O   
1502 C  CB  . CYS A 167 ? 0.1700 0.1371 0.1313 -0.0053 0.0099  -0.0032 164  CYS A CB  
1503 S  SG  . CYS A 167 ? 0.1889 0.1805 0.1324 0.0055  0.0003  -0.0095 164  CYS A SG  
1504 N  N   . THR A 168 ? 0.1795 0.1498 0.1222 0.0277  0.0313  -0.0005 165  THR A N   
1505 C  CA  . THR A 168 ? 0.1946 0.1546 0.1416 0.0064  0.0124  -0.0001 165  THR A CA  
1506 C  C   . THR A 168 ? 0.2069 0.1605 0.1582 0.0015  0.0077  -0.0079 165  THR A C   
1507 O  O   . THR A 168 ? 0.2394 0.1759 0.1678 -0.0194 0.0043  0.0052  165  THR A O   
1508 C  CB  . THR A 168 ? 0.1759 0.1605 0.1170 -0.0133 0.0136  0.0057  165  THR A CB  
1509 O  OG1 . THR A 168 ? 0.1772 0.1714 0.1092 0.0158  -0.0003 0.0012  165  THR A OG1 
1510 C  CG2 . THR A 168 ? 0.1542 0.2147 0.1735 -0.0052 0.0184  0.0007  165  THR A CG2 
1511 N  N   . ASP A 169 ? 0.2003 0.1870 0.1647 -0.0147 -0.0056 -0.0132 166  ASP A N   
1512 C  CA  A ASP A 169 ? 0.2235 0.1987 0.1983 -0.0063 0.0078  -0.0198 166  ASP A CA  
1513 C  CA  B ASP A 169 ? 0.2135 0.2029 0.1909 -0.0128 0.0046  -0.0179 166  ASP A CA  
1514 C  C   . ASP A 169 ? 0.1979 0.2013 0.1897 -0.0172 0.0073  -0.0243 166  ASP A C   
1515 O  O   . ASP A 169 ? 0.2408 0.2539 0.2209 -0.0367 0.0285  -0.0672 166  ASP A O   
1516 C  CB  A ASP A 169 ? 0.2373 0.2268 0.2126 -0.0185 -0.0046 -0.0161 166  ASP A CB  
1517 C  CB  B ASP A 169 ? 0.2195 0.2187 0.2010 -0.0215 -0.0001 -0.0136 166  ASP A CB  
1518 C  CG  A ASP A 169 ? 0.3219 0.2718 0.2640 0.0007  0.0054  -0.0353 166  ASP A CG  
1519 C  CG  B ASP A 169 ? 0.2701 0.2672 0.2259 -0.0316 -0.0061 -0.0146 166  ASP A CG  
1520 O  OD1 A ASP A 169 ? 0.4474 0.3887 0.2894 -0.0208 -0.0178 -0.0132 166  ASP A OD1 
1521 O  OD1 B ASP A 169 ? 0.3261 0.3163 0.2611 -0.0667 0.0079  -0.0060 166  ASP A OD1 
1522 O  OD2 A ASP A 169 ? 0.4400 0.2916 0.3686 0.0118  0.0178  -0.0542 166  ASP A OD2 
1523 O  OD2 B ASP A 169 ? 0.3028 0.3350 0.2975 -0.0628 -0.0036 0.0079  166  ASP A OD2 
1524 N  N   . LEU A 170 ? 0.1656 0.1803 0.1599 0.0017  -0.0027 -0.0226 167  LEU A N   
1525 C  CA  . LEU A 170 ? 0.1583 0.1636 0.1477 0.0014  0.0128  -0.0010 167  LEU A CA  
1526 C  C   . LEU A 170 ? 0.1765 0.1660 0.1600 0.0017  0.0144  0.0073  167  LEU A C   
1527 O  O   . LEU A 170 ? 0.2187 0.2134 0.2080 0.0052  0.0389  0.0181  167  LEU A O   
1528 C  CB  . LEU A 170 ? 0.1476 0.1696 0.1484 -0.0049 0.0215  0.0060  167  LEU A CB  
1529 C  CG  . LEU A 170 ? 0.1571 0.1649 0.1495 -0.0195 0.0061  0.0076  167  LEU A CG  
1530 C  CD1 . LEU A 170 ? 0.1243 0.1855 0.1457 -0.0295 -0.0086 -0.0062 167  LEU A CD1 
1531 C  CD2 . LEU A 170 ? 0.1268 0.1998 0.1836 -0.0074 0.0276  0.0265  167  LEU A CD2 
1532 N  N   . LYS A 171 ? 0.1652 0.1408 0.1523 0.0027  -0.0105 0.0005  168  LYS A N   
1533 C  CA  . LYS A 171 ? 0.1737 0.1521 0.1499 0.0047  -0.0135 0.0004  168  LYS A CA  
1534 C  C   . LYS A 171 ? 0.1483 0.1516 0.1453 -0.0044 -0.0060 0.0062  168  LYS A C   
1535 O  O   . LYS A 171 ? 0.1872 0.1641 0.1213 -0.0165 -0.0324 -0.0031 168  LYS A O   
1536 C  CB  . LYS A 171 ? 0.1777 0.1861 0.1610 0.0154  -0.0165 -0.0108 168  LYS A CB  
1537 C  CG  . LYS A 171 ? 0.2259 0.2390 0.2156 0.0170  -0.0230 -0.0406 168  LYS A CG  
1538 C  CD  . LYS A 171 ? 0.2719 0.3486 0.3056 0.0161  -0.0192 -0.0217 168  LYS A CD  
1539 C  CE  . LYS A 171 ? 0.3240 0.4181 0.3587 0.0115  -0.0196 -0.0399 168  LYS A CE  
1540 N  NZ  . LYS A 171 ? 0.3842 0.4528 0.4221 0.0425  -0.0163 0.0004  168  LYS A NZ  
1541 N  N   . VAL A 172 ? 0.1641 0.1420 0.1361 -0.0089 -0.0003 0.0063  169  VAL A N   
1542 C  CA  . VAL A 172 ? 0.1555 0.1404 0.1255 -0.0082 -0.0041 0.0044  169  VAL A CA  
1543 C  C   . VAL A 172 ? 0.1667 0.1576 0.1327 0.0015  -0.0159 0.0102  169  VAL A C   
1544 O  O   . VAL A 172 ? 0.2626 0.1761 0.1401 0.0134  -0.0320 0.0227  169  VAL A O   
1545 C  CB  . VAL A 172 ? 0.1694 0.1767 0.1357 -0.0204 0.0155  -0.0007 169  VAL A CB  
1546 C  CG1 . VAL A 172 ? 0.2052 0.1985 0.1307 -0.0453 0.0095  -0.0083 169  VAL A CG1 
1547 C  CG2 . VAL A 172 ? 0.1757 0.1880 0.1601 0.0179  0.0016  0.0162  169  VAL A CG2 
1548 N  N   . HIS A 173 ? 0.1435 0.1458 0.1251 0.0007  -0.0196 0.0095  170  HIS A N   
1549 C  CA  . HIS A 173 ? 0.1531 0.1315 0.1356 -0.0047 -0.0269 0.0081  170  HIS A CA  
1550 C  C   . HIS A 173 ? 0.1519 0.1312 0.1300 -0.0084 -0.0197 0.0101  170  HIS A C   
1551 O  O   . HIS A 173 ? 0.1839 0.1514 0.1559 0.0018  -0.0490 0.0054  170  HIS A O   
1552 C  CB  . HIS A 173 ? 0.1449 0.1292 0.1354 0.0094  -0.0255 -0.0122 170  HIS A CB  
1553 C  CG  . HIS A 173 ? 0.1433 0.1529 0.1292 0.0027  -0.0223 0.0074  170  HIS A CG  
1554 N  ND1 . HIS A 173 ? 0.1721 0.2137 0.2205 0.0181  -0.0675 -0.0151 170  HIS A ND1 
1555 C  CD2 . HIS A 173 ? 0.1435 0.1492 0.1609 -0.0030 -0.0161 -0.0005 170  HIS A CD2 
1556 C  CE1 . HIS A 173 ? 0.2064 0.2087 0.2170 -0.0157 -0.0583 0.0213  170  HIS A CE1 
1557 N  NE2 . HIS A 173 ? 0.1784 0.1842 0.1357 -0.0031 -0.0177 -0.0032 170  HIS A NE2 
1558 N  N   . PHE A 174 ? 0.1424 0.1262 0.1334 0.0051  -0.0132 -0.0006 171  PHE A N   
1559 C  CA  . PHE A 174 ? 0.1305 0.1392 0.1149 0.0113  -0.0087 -0.0010 171  PHE A CA  
1560 C  C   . PHE A 174 ? 0.1384 0.1187 0.1299 0.0239  -0.0088 -0.0003 171  PHE A C   
1561 O  O   . PHE A 174 ? 0.1736 0.1589 0.1588 0.0654  -0.0135 0.0012  171  PHE A O   
1562 C  CB  . PHE A 174 ? 0.1526 0.1352 0.1574 -0.0030 0.0016  0.0051  171  PHE A CB  
1563 C  CG  . PHE A 174 ? 0.1422 0.1465 0.1553 -0.0007 -0.0021 0.0134  171  PHE A CG  
1564 C  CD1 . PHE A 174 ? 0.1564 0.1570 0.2038 0.0037  0.0199  0.0083  171  PHE A CD1 
1565 C  CD2 . PHE A 174 ? 0.1881 0.1770 0.1899 -0.0178 0.0563  0.0065  171  PHE A CD2 
1566 C  CE1 . PHE A 174 ? 0.1842 0.2003 0.2021 0.0174  0.0552  0.0293  171  PHE A CE1 
1567 C  CE2 . PHE A 174 ? 0.2020 0.1929 0.1820 -0.0109 0.0429  -0.0076 171  PHE A CE2 
1568 C  CZ  . PHE A 174 ? 0.1746 0.1667 0.2041 0.0086  0.0628  -0.0073 171  PHE A CZ  
1569 N  N   . VAL A 175 ? 0.1145 0.1251 0.1281 0.0225  -0.0202 -0.0074 172  VAL A N   
1570 C  CA  . VAL A 175 ? 0.1203 0.1198 0.1389 0.0157  -0.0129 -0.0058 172  VAL A CA  
1571 C  C   . VAL A 175 ? 0.1234 0.1166 0.1375 0.0102  -0.0133 0.0041  172  VAL A C   
1572 O  O   . VAL A 175 ? 0.1219 0.1229 0.1930 -0.0019 -0.0306 -0.0103 172  VAL A O   
1573 C  CB  . VAL A 175 ? 0.0965 0.1336 0.1305 0.0162  -0.0037 -0.0096 172  VAL A CB  
1574 C  CG1 . VAL A 175 ? 0.1057 0.1295 0.1142 0.0154  -0.0057 -0.0383 172  VAL A CG1 
1575 C  CG2 . VAL A 175 ? 0.1310 0.1150 0.1586 -0.0016 -0.0294 -0.0274 172  VAL A CG2 
1576 N  N   . SER A 176 ? 0.1152 0.1188 0.1371 0.0197  0.0029  0.0042  173  SER A N   
1577 C  CA  . SER A 176 ? 0.1211 0.1174 0.1285 0.0206  -0.0064 0.0020  173  SER A CA  
1578 C  C   . SER A 176 ? 0.1102 0.1181 0.1303 0.0108  -0.0027 0.0074  173  SER A C   
1579 O  O   . SER A 176 ? 0.1152 0.1361 0.1335 0.0127  -0.0198 -0.0084 173  SER A O   
1580 C  CB  . SER A 176 ? 0.1220 0.1412 0.1365 0.0077  -0.0149 -0.0033 173  SER A CB  
1581 O  OG  . SER A 176 ? 0.1547 0.1522 0.1543 0.0012  -0.0115 0.0152  173  SER A OG  
1582 N  N   . ASN A 177 ? 0.1100 0.1240 0.1382 0.0064  -0.0093 0.0129  174  ASN A N   
1583 C  CA  . ASN A 177 ? 0.1110 0.1145 0.1013 -0.0067 -0.0053 -0.0017 174  ASN A CA  
1584 C  C   . ASN A 177 ? 0.1018 0.0993 0.1077 0.0077  0.0030  -0.0012 174  ASN A C   
1585 O  O   . ASN A 177 ? 0.1178 0.1080 0.1130 0.0003  -0.0049 0.0064  174  ASN A O   
1586 C  CB  . ASN A 177 ? 0.1348 0.1183 0.1025 0.0086  -0.0146 0.0089  174  ASN A CB  
1587 C  CG  . ASN A 177 ? 0.1114 0.1140 0.1158 -0.0045 -0.0091 0.0088  174  ASN A CG  
1588 O  OD1 . ASN A 177 ? 0.1247 0.1206 0.1345 -0.0038 -0.0098 0.0071  174  ASN A OD1 
1589 N  ND2 . ASN A 177 ? 0.1282 0.1176 0.1150 -0.0012 -0.0117 0.0212  174  ASN A ND2 
1590 N  N   . VAL A 178 ? 0.1105 0.1194 0.1134 -0.0036 -0.0172 -0.0002 175  VAL A N   
1591 C  CA  . VAL A 178 ? 0.1205 0.1162 0.1153 0.0023  -0.0016 0.0137  175  VAL A CA  
1592 C  C   . VAL A 178 ? 0.1131 0.1098 0.1048 -0.0014 -0.0031 0.0045  175  VAL A C   
1593 O  O   . VAL A 178 ? 0.1230 0.1299 0.0921 -0.0024 -0.0123 0.0223  175  VAL A O   
1594 C  CB  . VAL A 178 ? 0.1119 0.1295 0.1160 -0.0006 -0.0104 0.0168  175  VAL A CB  
1595 C  CG1 . VAL A 178 ? 0.1661 0.1112 0.1478 -0.0078 -0.0170 -0.0133 175  VAL A CG1 
1596 C  CG2 . VAL A 178 ? 0.1460 0.1672 0.0980 -0.0108 0.0059  0.0346  175  VAL A CG2 
1597 N  N   . ASP A 179 ? 0.1109 0.1116 0.1155 -0.0033 -0.0047 -0.0001 176  ASP A N   
1598 C  CA  . ASP A 179 ? 0.1138 0.1141 0.0959 -0.0030 0.0026  -0.0012 176  ASP A CA  
1599 C  C   . ASP A 179 ? 0.1210 0.0972 0.0947 -0.0009 -0.0007 0.0084  176  ASP A C   
1600 O  O   . ASP A 179 ? 0.1203 0.1168 0.1203 0.0084  -0.0135 -0.0092 176  ASP A O   
1601 C  CB  . ASP A 179 ? 0.1101 0.0902 0.0972 -0.0071 -0.0067 0.0123  176  ASP A CB  
1602 C  CG  . ASP A 179 ? 0.1169 0.1272 0.1270 0.0223  0.0148  0.0118  176  ASP A CG  
1603 O  OD1 . ASP A 179 ? 0.1048 0.1517 0.1381 -0.0086 -0.0047 0.0024  176  ASP A OD1 
1604 O  OD2 . ASP A 179 ? 0.1274 0.1465 0.1562 0.0015  -0.0177 0.0354  176  ASP A OD2 
1605 N  N   . ALA A 180 ? 0.1076 0.1132 0.1199 0.0059  0.0076  -0.0044 177  ALA A N   
1606 C  CA  . ALA A 180 ? 0.1148 0.1038 0.1166 0.0023  -0.0025 -0.0029 177  ALA A CA  
1607 C  C   . ALA A 180 ? 0.1176 0.1014 0.1055 0.0082  0.0024  0.0016  177  ALA A C   
1608 O  O   . ALA A 180 ? 0.1511 0.1201 0.1310 -0.0243 -0.0131 0.0038  177  ALA A O   
1609 C  CB  . ALA A 180 ? 0.1281 0.1066 0.1147 -0.0051 0.0090  -0.0013 177  ALA A CB  
1610 N  N   . ASP A 181 ? 0.1341 0.1171 0.1092 0.0070  -0.0068 -0.0039 178  ASP A N   
1611 C  CA  . ASP A 181 ? 0.1406 0.1190 0.1084 0.0086  -0.0067 -0.0077 178  ASP A CA  
1612 C  C   . ASP A 181 ? 0.1358 0.1131 0.1354 0.0021  -0.0078 0.0013  178  ASP A C   
1613 O  O   . ASP A 181 ? 0.1441 0.1443 0.1265 -0.0173 -0.0121 -0.0091 178  ASP A O   
1614 C  CB  . ASP A 181 ? 0.1358 0.1300 0.1136 0.0015  -0.0179 0.0026  178  ASP A CB  
1615 C  CG  . ASP A 181 ? 0.1626 0.1366 0.1382 0.0028  0.0008  -0.0150 178  ASP A CG  
1616 O  OD1 . ASP A 181 ? 0.1534 0.2240 0.1412 0.0159  -0.0120 0.0193  178  ASP A OD1 
1617 O  OD2 . ASP A 181 ? 0.1681 0.1602 0.1499 -0.0009 -0.0233 -0.0065 178  ASP A OD2 
1618 N  N   . SER A 182 ? 0.1333 0.1134 0.1196 0.0097  -0.0124 -0.0054 179  SER A N   
1619 C  CA  . SER A 182 ? 0.1275 0.1179 0.1119 0.0112  -0.0094 0.0169  179  SER A CA  
1620 C  C   . SER A 182 ? 0.1172 0.1180 0.1113 0.0053  0.0044  0.0049  179  SER A C   
1621 O  O   . SER A 182 ? 0.1657 0.1275 0.1045 0.0007  -0.0212 -0.0027 179  SER A O   
1622 C  CB  . SER A 182 ? 0.1342 0.1144 0.1137 0.0096  -0.0020 0.0177  179  SER A CB  
1623 O  OG  . SER A 182 ? 0.1214 0.1313 0.1438 0.0202  -0.0039 0.0084  179  SER A OG  
1624 N  N   . LEU A 183 ? 0.1245 0.1296 0.1143 -0.0064 -0.0063 0.0109  180  LEU A N   
1625 C  CA  . LEU A 183 ? 0.1448 0.1260 0.1322 -0.0018 -0.0029 0.0062  180  LEU A CA  
1626 C  C   . LEU A 183 ? 0.1405 0.1252 0.1200 0.0064  -0.0068 0.0073  180  LEU A C   
1627 O  O   . LEU A 183 ? 0.1479 0.1209 0.1212 0.0130  -0.0125 0.0014  180  LEU A O   
1628 C  CB  . LEU A 183 ? 0.1557 0.1415 0.1302 -0.0273 -0.0153 0.0076  180  LEU A CB  
1629 C  CG  . LEU A 183 ? 0.2054 0.1339 0.1387 -0.0107 0.0096  0.0135  180  LEU A CG  
1630 C  CD1 . LEU A 183 ? 0.1937 0.1993 0.2018 0.0226  -0.0236 0.0366  180  LEU A CD1 
1631 C  CD2 . LEU A 183 ? 0.3272 0.1610 0.0795 -0.0493 -0.0246 0.0252  180  LEU A CD2 
1632 N  N   . LEU A 184 ? 0.1287 0.1225 0.1398 0.0065  -0.0047 0.0004  181  LEU A N   
1633 C  CA  . LEU A 184 ? 0.1419 0.1196 0.1504 0.0041  -0.0060 0.0031  181  LEU A CA  
1634 C  C   . LEU A 184 ? 0.1266 0.1086 0.1409 0.0155  -0.0213 0.0082  181  LEU A C   
1635 O  O   . LEU A 184 ? 0.1605 0.1138 0.1591 0.0193  -0.0136 -0.0219 181  LEU A O   
1636 C  CB  . LEU A 184 ? 0.1262 0.1576 0.1728 -0.0075 -0.0128 -0.0092 181  LEU A CB  
1637 C  CG  . LEU A 184 ? 0.1990 0.1503 0.2046 0.0057  0.0076  0.0055  181  LEU A CG  
1638 C  CD1 . LEU A 184 ? 0.1812 0.1705 0.3311 0.0228  0.0543  -0.0067 181  LEU A CD1 
1639 C  CD2 . LEU A 184 ? 0.2567 0.1769 0.2746 -0.0461 0.0264  0.0131  181  LEU A CD2 
1640 N  N   . GLN A 185 ? 0.1454 0.1375 0.1507 0.0085  -0.0231 -0.0053 182  GLN A N   
1641 C  CA  . GLN A 185 ? 0.1629 0.1583 0.1356 0.0195  -0.0309 0.0016  182  GLN A CA  
1642 C  C   . GLN A 185 ? 0.1612 0.1553 0.1394 0.0089  -0.0256 -0.0075 182  GLN A C   
1643 O  O   . GLN A 185 ? 0.2372 0.1579 0.1568 0.0246  -0.0594 -0.0282 182  GLN A O   
1644 C  CB  . GLN A 185 ? 0.1716 0.1704 0.1616 0.0079  -0.0326 0.0095  182  GLN A CB  
1645 C  CG  . GLN A 185 ? 0.2278 0.1772 0.1479 0.0136  -0.0086 -0.0086 182  GLN A CG  
1646 C  CD  . GLN A 185 ? 0.2495 0.1675 0.2001 0.0245  -0.0175 -0.0039 182  GLN A CD  
1647 O  OE1 . GLN A 185 ? 0.2867 0.2246 0.2266 0.0273  -0.1122 -0.0030 182  GLN A OE1 
1648 N  NE2 . GLN A 185 ? 0.3108 0.2185 0.2270 0.0150  0.0069  0.0085  182  GLN A NE2 
1649 N  N   . ALA A 186 ? 0.1422 0.1403 0.1342 0.0067  -0.0310 0.0025  183  ALA A N   
1650 C  CA  . ALA A 186 ? 0.1425 0.1595 0.1386 0.0074  -0.0257 -0.0024 183  ALA A CA  
1651 C  C   . ALA A 186 ? 0.1440 0.1348 0.1554 0.0023  -0.0190 -0.0029 183  ALA A C   
1652 O  O   . ALA A 186 ? 0.1744 0.1327 0.1584 0.0090  -0.0444 -0.0039 183  ALA A O   
1653 C  CB  . ALA A 186 ? 0.1436 0.1886 0.1327 0.0247  -0.0435 -0.0070 183  ALA A CB  
1654 N  N   . LEU A 187 ? 0.1585 0.1129 0.1458 -0.0090 -0.0143 -0.0014 184  LEU A N   
1655 C  CA  . LEU A 187 ? 0.1854 0.1348 0.1691 -0.0121 -0.0107 0.0094  184  LEU A CA  
1656 C  C   . LEU A 187 ? 0.1755 0.1536 0.1734 -0.0075 -0.0110 0.0120  184  LEU A C   
1657 O  O   . LEU A 187 ? 0.2339 0.1619 0.2200 -0.0275 -0.0309 0.0053  184  LEU A O   
1658 C  CB  . LEU A 187 ? 0.1978 0.1510 0.1843 -0.0268 0.0044  0.0202  184  LEU A CB  
1659 C  CG  . LEU A 187 ? 0.2222 0.1490 0.1648 -0.0266 -0.0083 0.0032  184  LEU A CG  
1660 C  CD1 . LEU A 187 ? 0.3001 0.1675 0.1460 -0.0604 0.0415  0.0294  184  LEU A CD1 
1661 C  CD2 . LEU A 187 ? 0.2490 0.1729 0.1619 -0.0269 -0.0298 0.0568  184  LEU A CD2 
1662 N  N   . HIS A 188 ? 0.1578 0.1349 0.1901 0.0002  -0.0146 -0.0014 185  HIS A N   
1663 C  CA  . HIS A 188 ? 0.1521 0.1578 0.2147 -0.0119 -0.0227 -0.0100 185  HIS A CA  
1664 C  C   . HIS A 188 ? 0.1580 0.1687 0.2233 -0.0044 -0.0386 -0.0118 185  HIS A C   
1665 O  O   . HIS A 188 ? 0.1815 0.2014 0.2999 -0.0128 -0.0699 -0.0427 185  HIS A O   
1666 C  CB  . HIS A 188 ? 0.1509 0.1623 0.2364 -0.0004 -0.0280 -0.0154 185  HIS A CB  
1667 C  CG  . HIS A 188 ? 0.1589 0.2078 0.2228 0.0009  -0.0420 -0.0140 185  HIS A CG  
1668 N  ND1 . HIS A 188 ? 0.2137 0.2156 0.2640 0.0147  -0.0494 0.0071  185  HIS A ND1 
1669 C  CD2 . HIS A 188 ? 0.2198 0.2142 0.2782 0.0163  -0.0310 0.0109  185  HIS A CD2 
1670 C  CE1 . HIS A 188 ? 0.2724 0.2285 0.2816 0.0247  -0.0290 -0.0019 185  HIS A CE1 
1671 N  NE2 . HIS A 188 ? 0.1882 0.2240 0.2831 0.0239  -0.0443 -0.0025 185  HIS A NE2 
1672 N  N   . VAL A 189 ? 0.1702 0.1461 0.1751 0.0166  -0.0388 -0.0158 186  VAL A N   
1673 C  CA  . VAL A 189 ? 0.1858 0.1735 0.1812 0.0274  -0.0446 -0.0090 186  VAL A CA  
1674 C  C   . VAL A 189 ? 0.1762 0.1569 0.1715 0.0240  -0.0313 -0.0111 186  VAL A C   
1675 O  O   . VAL A 189 ? 0.2334 0.1751 0.1804 0.0414  -0.0470 -0.0168 186  VAL A O   
1676 C  CB  . VAL A 189 ? 0.2044 0.1776 0.1855 0.0308  -0.0345 -0.0042 186  VAL A CB  
1677 C  CG1 . VAL A 189 ? 0.2444 0.2196 0.2340 0.0490  -0.1057 0.0393  186  VAL A CG1 
1678 C  CG2 . VAL A 189 ? 0.2176 0.2140 0.1563 0.0009  -0.0361 0.0091  186  VAL A CG2 
1679 N  N   . VAL A 190 ? 0.1672 0.1476 0.1548 0.0218  -0.0157 -0.0069 187  VAL A N   
1680 C  CA  . VAL A 190 ? 0.1490 0.1444 0.1456 0.0240  -0.0079 -0.0005 187  VAL A CA  
1681 C  C   . VAL A 190 ? 0.1340 0.1518 0.1758 0.0103  0.0006  0.0044  187  VAL A C   
1682 O  O   . VAL A 190 ? 0.1987 0.1683 0.1919 0.0203  0.0185  -0.0191 187  VAL A O   
1683 C  CB  . VAL A 190 ? 0.1357 0.1495 0.1413 0.0308  -0.0118 -0.0010 187  VAL A CB  
1684 C  CG1 . VAL A 190 ? 0.1659 0.1765 0.1164 0.0137  -0.0097 -0.0100 187  VAL A CG1 
1685 C  CG2 . VAL A 190 ? 0.1768 0.1968 0.1216 0.0259  0.0086  -0.0082 187  VAL A CG2 
1686 N  N   . ASP A 191 ? 0.1441 0.1610 0.1792 0.0216  -0.0048 0.0147  188  ASP A N   
1687 C  CA  . ASP A 191 ? 0.1499 0.1911 0.2054 0.0029  -0.0110 0.0165  188  ASP A CA  
1688 C  C   . ASP A 191 ? 0.1350 0.1483 0.1824 -0.0165 -0.0016 0.0134  188  ASP A C   
1689 O  O   . ASP A 191 ? 0.1240 0.1586 0.2012 -0.0024 0.0013  0.0165  188  ASP A O   
1690 C  CB  . ASP A 191 ? 0.1489 0.1973 0.2056 -0.0173 -0.0337 0.0190  188  ASP A CB  
1691 C  CG  . ASP A 191 ? 0.2204 0.2442 0.2583 -0.0360 -0.0489 0.0172  188  ASP A CG  
1692 O  OD1 . ASP A 191 ? 0.1649 0.2682 0.2511 0.0104  -0.0550 -0.0150 188  ASP A OD1 
1693 O  OD2 . ASP A 191 ? 0.3672 0.3063 0.3509 -0.0901 -0.0787 -0.0177 188  ASP A OD2 
1694 N  N   . PRO A 192 ? 0.1469 0.1585 0.1739 0.0028  -0.0039 -0.0071 189  PRO A N   
1695 C  CA  . PRO A 192 ? 0.1456 0.1586 0.1758 -0.0032 -0.0059 -0.0146 189  PRO A CA  
1696 C  C   . PRO A 192 ? 0.1278 0.1391 0.1656 -0.0035 -0.0067 -0.0146 189  PRO A C   
1697 O  O   . PRO A 192 ? 0.1530 0.1382 0.1967 0.0197  -0.0413 -0.0262 189  PRO A O   
1698 C  CB  . PRO A 192 ? 0.1769 0.1896 0.1881 -0.0219 -0.0116 -0.0249 189  PRO A CB  
1699 C  CG  . PRO A 192 ? 0.1785 0.2096 0.1852 0.0393  0.0261  -0.0154 189  PRO A CG  
1700 C  CD  . PRO A 192 ? 0.1549 0.1661 0.1730 -0.0086 0.0025  0.0088  189  PRO A CD  
1701 N  N   . GLU A 193 ? 0.1300 0.1342 0.1556 0.0036  0.0004  -0.0112 190  GLU A N   
1702 C  CA  A GLU A 193 ? 0.1268 0.1383 0.1425 0.0043  0.0000  -0.0021 190  GLU A CA  
1703 C  CA  B GLU A 193 ? 0.1304 0.1407 0.1487 0.0050  -0.0006 -0.0028 190  GLU A CA  
1704 C  C   . GLU A 193 ? 0.1260 0.1305 0.1382 0.0041  -0.0044 -0.0041 190  GLU A C   
1705 O  O   . GLU A 193 ? 0.1291 0.1232 0.1463 0.0162  0.0042  -0.0043 190  GLU A O   
1706 C  CB  A GLU A 193 ? 0.1325 0.1378 0.1415 -0.0015 0.0037  -0.0123 190  GLU A CB  
1707 C  CB  B GLU A 193 ? 0.1376 0.1431 0.1555 0.0005  0.0018  -0.0076 190  GLU A CB  
1708 C  CG  A GLU A 193 ? 0.1070 0.1557 0.1478 0.0166  0.0135  -0.0044 190  GLU A CG  
1709 C  CG  B GLU A 193 ? 0.1272 0.1724 0.1745 0.0194  0.0077  0.0040  190  GLU A CG  
1710 C  CD  A GLU A 193 ? 0.1465 0.1726 0.1569 -0.0047 0.0216  -0.0127 190  GLU A CD  
1711 C  CD  B GLU A 193 ? 0.1408 0.2075 0.2215 0.0157  0.0054  0.0107  190  GLU A CD  
1712 O  OE1 A GLU A 193 ? 0.1899 0.2041 0.2145 -0.0233 0.0288  -0.0341 190  GLU A OE1 
1713 O  OE1 B GLU A 193 ? 0.1633 0.2041 0.2555 -0.0007 -0.0136 0.0175  190  GLU A OE1 
1714 O  OE2 A GLU A 193 ? 0.1694 0.2001 0.1904 -0.0329 0.0270  -0.0396 190  GLU A OE2 
1715 O  OE2 B GLU A 193 ? 0.1342 0.2917 0.2257 0.0388  0.0268  0.0108  190  GLU A OE2 
1716 N  N   . THR A 194 ? 0.1185 0.1334 0.1340 -0.0061 -0.0154 -0.0136 191  THR A N   
1717 C  CA  . THR A 194 ? 0.1296 0.1375 0.1245 -0.0074 -0.0221 -0.0137 191  THR A CA  
1718 C  C   . THR A 194 ? 0.1393 0.1283 0.1172 0.0010  -0.0114 -0.0075 191  THR A C   
1719 O  O   . THR A 194 ? 0.1324 0.1541 0.1266 -0.0243 -0.0127 -0.0200 191  THR A O   
1720 C  CB  . THR A 194 ? 0.1440 0.1236 0.1364 -0.0191 -0.0199 0.0039  191  THR A CB  
1721 O  OG1 . THR A 194 ? 0.2046 0.1224 0.1618 -0.0005 -0.0413 0.0143  191  THR A OG1 
1722 C  CG2 . THR A 194 ? 0.1719 0.0949 0.1761 -0.0299 -0.0175 -0.0097 191  THR A CG2 
1723 N  N   . THR A 195 ? 0.1204 0.1217 0.1198 -0.0074 -0.0138 -0.0100 192  THR A N   
1724 C  CA  . THR A 195 ? 0.1194 0.1215 0.1151 -0.0001 -0.0001 0.0064  192  THR A CA  
1725 C  C   . THR A 195 ? 0.1169 0.1236 0.1172 -0.0040 -0.0061 0.0048  192  THR A C   
1726 O  O   . THR A 195 ? 0.1252 0.1448 0.1163 -0.0263 -0.0182 0.0129  192  THR A O   
1727 C  CB  . THR A 195 ? 0.1239 0.1258 0.1340 0.0044  -0.0127 -0.0092 192  THR A CB  
1728 O  OG1 . THR A 195 ? 0.1248 0.1605 0.1537 0.0156  -0.0382 0.0243  192  THR A OG1 
1729 C  CG2 . THR A 195 ? 0.1555 0.0978 0.1650 -0.0092 0.0191  0.0004  192  THR A CG2 
1730 N  N   . LEU A 196 ? 0.1090 0.1248 0.1098 -0.0135 -0.0053 -0.0082 193  LEU A N   
1731 C  CA  . LEU A 196 ? 0.1098 0.1176 0.1095 0.0087  -0.0031 -0.0100 193  LEU A CA  
1732 C  C   . LEU A 196 ? 0.1272 0.1276 0.1241 -0.0058 -0.0008 -0.0004 193  LEU A C   
1733 O  O   . LEU A 196 ? 0.1414 0.1150 0.1066 0.0000  0.0005  -0.0123 193  LEU A O   
1734 C  CB  . LEU A 196 ? 0.1099 0.1482 0.1260 0.0327  -0.0065 -0.0105 193  LEU A CB  
1735 C  CG  . LEU A 196 ? 0.1364 0.1730 0.1124 0.0155  -0.0097 -0.0201 193  LEU A CG  
1736 C  CD1 . LEU A 196 ? 0.1503 0.2151 0.0891 0.0180  -0.0245 0.0130  193  LEU A CD1 
1737 C  CD2 . LEU A 196 ? 0.1191 0.2730 0.1558 0.0487  0.0138  -0.0498 193  LEU A CD2 
1738 N  N   . LEU A 197 ? 0.1126 0.1230 0.1119 -0.0081 -0.0076 -0.0022 194  LEU A N   
1739 C  CA  . LEU A 197 ? 0.1215 0.1399 0.1233 -0.0002 -0.0050 -0.0045 194  LEU A CA  
1740 C  C   . LEU A 197 ? 0.0983 0.1281 0.1310 0.0132  -0.0046 0.0033  194  LEU A C   
1741 O  O   . LEU A 197 ? 0.1295 0.1419 0.1161 -0.0118 -0.0240 -0.0047 194  LEU A O   
1742 C  CB  . LEU A 197 ? 0.1167 0.1342 0.1269 0.0096  -0.0066 -0.0192 194  LEU A CB  
1743 C  CG  . LEU A 197 ? 0.0922 0.1347 0.1474 0.0010  0.0137  -0.0165 194  LEU A CG  
1744 C  CD1 . LEU A 197 ? 0.1377 0.1537 0.1750 -0.0211 -0.0092 -0.0085 194  LEU A CD1 
1745 C  CD2 . LEU A 197 ? 0.1457 0.1669 0.2025 0.0481  0.0453  0.0032  194  LEU A CD2 
1746 N  N   . ILE A 198 ? 0.0913 0.1134 0.1413 0.0063  -0.0180 -0.0007 195  ILE A N   
1747 C  CA  . ILE A 198 ? 0.1021 0.1130 0.1354 0.0043  -0.0190 0.0076  195  ILE A CA  
1748 C  C   . ILE A 198 ? 0.1330 0.1217 0.1359 0.0152  -0.0110 0.0016  195  ILE A C   
1749 O  O   . ILE A 198 ? 0.1430 0.1293 0.1546 0.0111  -0.0271 -0.0033 195  ILE A O   
1750 C  CB  . ILE A 198 ? 0.1045 0.1208 0.1384 0.0032  -0.0130 0.0012  195  ILE A CB  
1751 C  CG1 . ILE A 198 ? 0.0939 0.1419 0.1547 -0.0006 -0.0331 0.0063  195  ILE A CG1 
1752 C  CG2 . ILE A 198 ? 0.1148 0.1473 0.1690 -0.0351 -0.0383 0.0279  195  ILE A CG2 
1753 C  CD1 . ILE A 198 ? 0.1509 0.2072 0.1405 -0.0069 -0.0168 0.0104  195  ILE A CD1 
1754 N  N   . ILE A 199 ? 0.1317 0.1224 0.1303 0.0146  -0.0159 -0.0047 196  ILE A N   
1755 C  CA  . ILE A 199 ? 0.1315 0.1361 0.1526 0.0173  -0.0208 -0.0091 196  ILE A CA  
1756 C  C   . ILE A 199 ? 0.1289 0.1410 0.1549 0.0111  -0.0165 -0.0021 196  ILE A C   
1757 O  O   . ILE A 199 ? 0.1209 0.1280 0.2011 0.0061  -0.0438 0.0081  196  ILE A O   
1758 C  CB  . ILE A 199 ? 0.1424 0.1266 0.1448 0.0101  -0.0183 -0.0068 196  ILE A CB  
1759 C  CG1 . ILE A 199 ? 0.1992 0.1451 0.1471 -0.0016 0.0324  -0.0570 196  ILE A CG1 
1760 C  CG2 . ILE A 199 ? 0.2053 0.1368 0.1669 0.0284  -0.0368 -0.0491 196  ILE A CG2 
1761 C  CD1 . ILE A 199 ? 0.2424 0.1603 0.1955 -0.0285 0.0566  -0.0055 196  ILE A CD1 
1762 N  N   . ALA A 200 ? 0.1185 0.1441 0.1613 0.0145  -0.0160 -0.0033 197  ALA A N   
1763 C  CA  . ALA A 200 ? 0.1412 0.1408 0.1812 0.0143  -0.0057 0.0045  197  ALA A CA  
1764 C  C   . ALA A 200 ? 0.1603 0.1475 0.1678 -0.0002 -0.0041 0.0037  197  ALA A C   
1765 O  O   . ALA A 200 ? 0.1780 0.1405 0.2031 0.0124  -0.0326 -0.0034 197  ALA A O   
1766 C  CB  . ALA A 200 ? 0.1742 0.1847 0.1699 0.0193  0.0145  0.0167  197  ALA A CB  
1767 N  N   . SER A 201 ? 0.1775 0.1551 0.2003 0.0106  -0.0258 -0.0022 198  SER A N   
1768 C  CA  . SER A 201 ? 0.1869 0.1874 0.2000 0.0088  0.0010  -0.0044 198  SER A CA  
1769 C  C   . SER A 201 ? 0.1766 0.1817 0.2115 0.0018  -0.0014 0.0037  198  SER A C   
1770 O  O   . SER A 201 ? 0.1592 0.2076 0.1938 0.0096  0.0000  -0.0097 198  SER A O   
1771 C  CB  . SER A 201 ? 0.1988 0.1751 0.1890 0.0114  -0.0051 0.0039  198  SER A CB  
1772 O  OG  . SER A 201 ? 0.2195 0.1971 0.1994 0.0372  -0.0157 -0.0264 198  SER A OG  
1773 N  N   . LYS A 202 ? 0.1840 0.2022 0.2556 0.0068  0.0006  0.0050  199  LYS A N   
1774 C  CA  . LYS A 202 ? 0.2111 0.2277 0.2564 -0.0149 -0.0084 0.0028  199  LYS A CA  
1775 C  C   . LYS A 202 ? 0.1939 0.1994 0.2334 -0.0108 -0.0359 -0.0153 199  LYS A C   
1776 O  O   . LYS A 202 ? 0.1985 0.1894 0.2674 -0.0004 -0.0359 -0.0340 199  LYS A O   
1777 C  CB  . LYS A 202 ? 0.2082 0.2450 0.2553 -0.0281 -0.0039 0.0214  199  LYS A CB  
1778 C  CG  . LYS A 202 ? 0.2546 0.3040 0.3034 -0.0179 -0.0033 0.0009  199  LYS A CG  
1779 C  CD  . LYS A 202 ? 0.2621 0.3280 0.2970 0.0056  0.0077  -0.0135 199  LYS A CD  
1780 C  CE  . LYS A 202 ? 0.3119 0.3852 0.3675 0.0169  -0.0006 -0.0250 199  LYS A CE  
1781 N  NZ  . LYS A 202 ? 0.3105 0.3479 0.4725 0.0420  -0.0097 -0.0895 199  LYS A NZ  
1782 N  N   . SER A 203 ? 0.1985 0.2138 0.2639 0.0056  -0.0332 -0.0039 200  SER A N   
1783 C  CA  . SER A 203 ? 0.2020 0.2146 0.2526 0.0043  -0.0332 -0.0209 200  SER A CA  
1784 C  C   . SER A 203 ? 0.2153 0.2177 0.2230 0.0110  -0.0279 -0.0115 200  SER A C   
1785 O  O   . SER A 203 ? 0.1958 0.2348 0.2206 0.0426  -0.0483 0.0083  200  SER A O   
1786 C  CB  . SER A 203 ? 0.2347 0.2583 0.2866 -0.0222 -0.0288 -0.0354 200  SER A CB  
1787 O  OG  . SER A 203 ? 0.2738 0.3279 0.3919 -0.0091 -0.0149 -0.0548 200  SER A OG  
1788 N  N   . PHE A 204 ? 0.2055 0.2136 0.2022 -0.0008 -0.0313 -0.0046 201  PHE A N   
1789 C  CA  A PHE A 204 ? 0.2194 0.2061 0.1892 0.0083  -0.0123 0.0159  201  PHE A CA  
1790 C  CA  B PHE A 204 ? 0.2250 0.2160 0.2002 0.0081  -0.0137 0.0154  201  PHE A CA  
1791 C  C   . PHE A 204 ? 0.2441 0.2252 0.2027 0.0045  -0.0066 0.0109  201  PHE A C   
1792 O  O   . PHE A 204 ? 0.2673 0.2754 0.2364 0.0049  0.0019  0.0098  201  PHE A O   
1793 C  CB  A PHE A 204 ? 0.2169 0.2083 0.1729 0.0071  -0.0208 0.0198  201  PHE A CB  
1794 C  CB  B PHE A 204 ? 0.2277 0.2263 0.1891 0.0077  -0.0214 0.0209  201  PHE A CB  
1795 C  CG  A PHE A 204 ? 0.2005 0.1757 0.1427 0.0202  -0.0075 0.0277  201  PHE A CG  
1796 C  CG  B PHE A 204 ? 0.2406 0.2304 0.2070 0.0133  -0.0223 0.0283  201  PHE A CG  
1797 C  CD1 A PHE A 204 ? 0.1737 0.1477 0.1672 0.0142  0.0164  0.0098  201  PHE A CD1 
1798 C  CD1 B PHE A 204 ? 0.2354 0.2467 0.2406 0.0305  -0.0065 -0.0008 201  PHE A CD1 
1799 C  CD2 A PHE A 204 ? 0.1864 0.1821 0.1865 0.0182  -0.0016 0.0152  201  PHE A CD2 
1800 C  CD2 B PHE A 204 ? 0.2385 0.2515 0.1998 0.0147  -0.0082 0.0252  201  PHE A CD2 
1801 C  CE1 A PHE A 204 ? 0.1573 0.1695 0.1509 0.0132  -0.0036 0.0039  201  PHE A CE1 
1802 C  CE1 B PHE A 204 ? 0.2326 0.2297 0.2162 0.0311  -0.0379 -0.0015 201  PHE A CE1 
1803 C  CE2 A PHE A 204 ? 0.1204 0.1961 0.1536 0.0172  -0.0212 0.0021  201  PHE A CE2 
1804 C  CE2 B PHE A 204 ? 0.2397 0.2650 0.2187 0.0135  -0.0206 0.0125  201  PHE A CE2 
1805 C  CZ  A PHE A 204 ? 0.1295 0.1801 0.1791 0.0329  -0.0204 0.0144  201  PHE A CZ  
1806 C  CZ  B PHE A 204 ? 0.2293 0.2488 0.2252 0.0271  -0.0214 0.0042  201  PHE A CZ  
1807 N  N   . SER A 205 ? 0.2457 0.2187 0.2047 0.0196  -0.0278 0.0125  202  SER A N   
1808 C  CA  . SER A 205 ? 0.2419 0.2194 0.2209 0.0319  -0.0380 0.0044  202  SER A CA  
1809 C  C   . SER A 205 ? 0.2208 0.2049 0.1921 0.0370  -0.0309 -0.0028 202  SER A C   
1810 O  O   . SER A 205 ? 0.2711 0.2398 0.2042 0.0831  -0.0474 -0.0085 202  SER A O   
1811 C  CB  . SER A 205 ? 0.2404 0.2320 0.2457 0.0295  -0.0393 0.0029  202  SER A CB  
1812 O  OG  . SER A 205 ? 0.2415 0.2252 0.2962 0.0326  -0.0569 -0.0263 202  SER A OG  
1813 N  N   . THR A 206 ? 0.1660 0.1742 0.1743 0.0174  -0.0197 -0.0067 203  THR A N   
1814 C  CA  . THR A 206 ? 0.1441 0.1583 0.1560 0.0062  -0.0136 -0.0091 203  THR A CA  
1815 C  C   . THR A 206 ? 0.1495 0.1441 0.1531 0.0044  -0.0154 -0.0137 203  THR A C   
1816 O  O   . THR A 206 ? 0.1483 0.1256 0.1509 -0.0002 -0.0085 0.0055  203  THR A O   
1817 C  CB  . THR A 206 ? 0.1309 0.1778 0.1869 0.0051  0.0025  -0.0085 203  THR A CB  
1818 O  OG1 . THR A 206 ? 0.1421 0.2494 0.2313 0.0064  -0.0102 0.0073  203  THR A OG1 
1819 C  CG2 . THR A 206 ? 0.1961 0.1925 0.2010 -0.0010 -0.0116 0.0044  203  THR A CG2 
1820 N  N   . GLU A 207 ? 0.1537 0.1202 0.1522 0.0122  -0.0057 0.0003  204  GLU A N   
1821 C  CA  . GLU A 207 ? 0.1483 0.1367 0.1549 0.0144  -0.0179 0.0052  204  GLU A CA  
1822 C  C   . GLU A 207 ? 0.1396 0.1215 0.1449 0.0069  -0.0008 0.0105  204  GLU A C   
1823 O  O   . GLU A 207 ? 0.1272 0.1431 0.1628 0.0011  -0.0056 0.0263  204  GLU A O   
1824 C  CB  . GLU A 207 ? 0.1756 0.1528 0.1801 0.0065  -0.0177 -0.0197 204  GLU A CB  
1825 C  CG  . GLU A 207 ? 0.2112 0.1942 0.2208 0.0056  0.0161  -0.0226 204  GLU A CG  
1826 C  CD  . GLU A 207 ? 0.2612 0.2368 0.2747 0.0082  0.0249  0.0126  204  GLU A CD  
1827 O  OE1 . GLU A 207 ? 0.2453 0.2311 0.3701 0.0120  -0.0158 0.1005  204  GLU A OE1 
1828 O  OE2 . GLU A 207 ? 0.2875 0.2945 0.3467 0.0133  0.0697  0.0196  204  GLU A OE2 
1829 N  N   . GLU A 208 ? 0.1227 0.1359 0.1370 0.0075  -0.0155 0.0026  205  GLU A N   
1830 C  CA  . GLU A 208 ? 0.1274 0.1358 0.1498 0.0018  -0.0244 0.0066  205  GLU A CA  
1831 C  C   . GLU A 208 ? 0.1215 0.1313 0.1446 0.0013  -0.0260 -0.0028 205  GLU A C   
1832 O  O   . GLU A 208 ? 0.1163 0.1362 0.1412 -0.0003 -0.0140 0.0080  205  GLU A O   
1833 C  CB  . GLU A 208 ? 0.1280 0.1579 0.1443 0.0039  -0.0313 0.0045  205  GLU A CB  
1834 C  CG  . GLU A 208 ? 0.1237 0.1693 0.1473 -0.0111 -0.0026 0.0034  205  GLU A CG  
1835 C  CD  . GLU A 208 ? 0.1390 0.1706 0.1670 -0.0029 0.0040  0.0395  205  GLU A CD  
1836 O  OE1 . GLU A 208 ? 0.1509 0.1744 0.1841 -0.0162 -0.0331 0.0315  205  GLU A OE1 
1837 O  OE2 . GLU A 208 ? 0.1536 0.1481 0.1667 -0.0074 -0.0280 0.0272  205  GLU A OE2 
1838 N  N   . THR A 209 ? 0.1371 0.1345 0.1412 -0.0025 -0.0050 0.0008  206  THR A N   
1839 C  CA  . THR A 209 ? 0.1170 0.1199 0.1287 -0.0023 -0.0025 0.0048  206  THR A CA  
1840 C  C   . THR A 209 ? 0.1294 0.1270 0.1361 -0.0018 -0.0055 0.0059  206  THR A C   
1841 O  O   . THR A 209 ? 0.1295 0.1301 0.1475 0.0116  -0.0016 -0.0112 206  THR A O   
1842 C  CB  . THR A 209 ? 0.1186 0.1399 0.1293 0.0057  0.0011  0.0108  206  THR A CB  
1843 O  OG1 . THR A 209 ? 0.1520 0.1456 0.1521 0.0160  -0.0030 0.0264  206  THR A OG1 
1844 C  CG2 . THR A 209 ? 0.1426 0.1367 0.1648 0.0139  -0.0165 0.0000  206  THR A CG2 
1845 N  N   . LEU A 210 ? 0.1234 0.1307 0.1365 -0.0131 -0.0161 0.0016  207  LEU A N   
1846 C  CA  . LEU A 210 ? 0.1508 0.1224 0.1329 -0.0106 -0.0099 -0.0051 207  LEU A CA  
1847 C  C   . LEU A 210 ? 0.1413 0.1201 0.1147 0.0042  -0.0131 -0.0002 207  LEU A C   
1848 O  O   . LEU A 210 ? 0.1412 0.1197 0.1293 0.0004  -0.0107 -0.0050 207  LEU A O   
1849 C  CB  . LEU A 210 ? 0.1623 0.1482 0.1210 -0.0122 -0.0083 -0.0049 207  LEU A CB  
1850 C  CG  . LEU A 210 ? 0.2173 0.2241 0.1910 -0.0147 0.0046  -0.0003 207  LEU A CG  
1851 C  CD1 . LEU A 210 ? 0.2742 0.2461 0.2712 0.0367  -0.0223 0.0286  207  LEU A CD1 
1852 C  CD2 . LEU A 210 ? 0.2516 0.2815 0.2711 -0.0338 -0.0551 -0.0603 207  LEU A CD2 
1853 N  N   . LEU A 211 ? 0.1297 0.1081 0.1211 0.0065  -0.0111 0.0061  208  LEU A N   
1854 C  CA  . LEU A 211 ? 0.1312 0.1138 0.1191 0.0066  -0.0018 0.0109  208  LEU A CA  
1855 C  C   . LEU A 211 ? 0.1211 0.1029 0.0982 0.0039  -0.0111 0.0111  208  LEU A C   
1856 O  O   . LEU A 211 ? 0.1151 0.1214 0.1253 -0.0072 0.0064  0.0068  208  LEU A O   
1857 C  CB  . LEU A 211 ? 0.1490 0.0994 0.1388 0.0115  0.0006  0.0116  208  LEU A CB  
1858 C  CG  . LEU A 211 ? 0.1912 0.1531 0.1959 0.0226  0.0062  0.0093  208  LEU A CG  
1859 C  CD1 . LEU A 211 ? 0.2517 0.2042 0.2401 0.0161  -0.0482 -0.0023 208  LEU A CD1 
1860 C  CD2 . LEU A 211 ? 0.2515 0.1695 0.2099 0.0972  -0.0025 0.0219  208  LEU A CD2 
1861 N  N   . ASN A 212 ? 0.1120 0.1066 0.1318 0.0033  -0.0049 0.0008  209  ASN A N   
1862 C  CA  . ASN A 212 ? 0.1265 0.1133 0.1111 0.0086  -0.0076 0.0049  209  ASN A CA  
1863 C  C   . ASN A 212 ? 0.1207 0.1106 0.1175 0.0079  -0.0049 -0.0021 209  ASN A C   
1864 O  O   . ASN A 212 ? 0.1078 0.1051 0.1288 0.0082  -0.0079 0.0010  209  ASN A O   
1865 C  CB  . ASN A 212 ? 0.1294 0.1174 0.1168 0.0272  -0.0013 0.0035  209  ASN A CB  
1866 C  CG  . ASN A 212 ? 0.1069 0.1262 0.1029 0.0107  -0.0091 -0.0057 209  ASN A CG  
1867 O  OD1 . ASN A 212 ? 0.1220 0.1480 0.1383 0.0189  0.0097  0.0253  209  ASN A OD1 
1868 N  ND2 . ASN A 212 ? 0.1390 0.1113 0.1064 -0.0104 -0.0068 0.0119  209  ASN A ND2 
1869 N  N   . SER A 213 ? 0.1189 0.1065 0.1220 -0.0017 -0.0133 0.0075  210  SER A N   
1870 C  CA  A SER A 213 ? 0.1095 0.1111 0.1346 0.0082  -0.0122 0.0075  210  SER A CA  
1871 C  CA  B SER A 213 ? 0.1093 0.1127 0.1250 0.0076  -0.0124 0.0064  210  SER A CA  
1872 C  C   . SER A 213 ? 0.1177 0.1201 0.1179 0.0065  -0.0125 0.0082  210  SER A C   
1873 O  O   . SER A 213 ? 0.1207 0.1096 0.1453 0.0101  -0.0113 0.0009  210  SER A O   
1874 C  CB  A SER A 213 ? 0.1184 0.1101 0.1415 0.0156  -0.0180 0.0129  210  SER A CB  
1875 C  CB  B SER A 213 ? 0.1101 0.1136 0.1362 0.0038  -0.0152 0.0134  210  SER A CB  
1876 O  OG  A SER A 213 ? 0.1378 0.1721 0.2019 -0.0016 0.0097  0.0234  210  SER A OG  
1877 O  OG  B SER A 213 ? 0.1331 0.1434 0.1452 0.0092  -0.0073 -0.0010 210  SER A OG  
1878 N  N   . ILE A 214 ? 0.1226 0.1237 0.1345 0.0051  -0.0151 0.0136  211  ILE A N   
1879 C  CA  . ILE A 214 ? 0.1298 0.1336 0.1203 0.0020  -0.0147 0.0167  211  ILE A CA  
1880 C  C   . ILE A 214 ? 0.1146 0.1166 0.1359 0.0081  -0.0104 0.0191  211  ILE A C   
1881 O  O   . ILE A 214 ? 0.1243 0.1149 0.1469 0.0015  -0.0064 0.0084  211  ILE A O   
1882 C  CB  . ILE A 214 ? 0.1326 0.1224 0.1209 -0.0012 -0.0014 0.0193  211  ILE A CB  
1883 C  CG1 . ILE A 214 ? 0.1674 0.1583 0.1494 -0.0119 -0.0114 0.0220  211  ILE A CG1 
1884 C  CG2 . ILE A 214 ? 0.1920 0.1652 0.1178 -0.0227 0.0425  0.0116  211  ILE A CG2 
1885 C  CD1 . ILE A 214 ? 0.2185 0.2187 0.1980 -0.0336 -0.0046 -0.0251 211  ILE A CD1 
1886 N  N   . SER A 215 ? 0.1246 0.1226 0.1040 -0.0024 -0.0052 0.0096  212  SER A N   
1887 C  CA  . SER A 215 ? 0.1208 0.1121 0.1049 0.0123  -0.0129 -0.0019 212  SER A CA  
1888 C  C   . SER A 215 ? 0.1151 0.1132 0.1270 0.0154  -0.0166 -0.0059 212  SER A C   
1889 O  O   . SER A 215 ? 0.1277 0.1260 0.1394 0.0065  0.0041  -0.0180 212  SER A O   
1890 C  CB  . SER A 215 ? 0.1028 0.1245 0.1328 0.0095  -0.0125 0.0011  212  SER A CB  
1891 O  OG  . SER A 215 ? 0.1199 0.1227 0.1254 0.0229  -0.0102 -0.0005 212  SER A OG  
1892 N  N   . ALA A 216 ? 0.1180 0.1166 0.1243 -0.0106 -0.0099 -0.0129 213  ALA A N   
1893 C  CA  . ALA A 216 ? 0.1017 0.1135 0.1027 0.0020  -0.0062 0.0022  213  ALA A CA  
1894 C  C   . ALA A 216 ? 0.0933 0.1062 0.1229 0.0048  -0.0012 -0.0037 213  ALA A C   
1895 O  O   . ALA A 216 ? 0.0949 0.1201 0.1362 0.0054  -0.0053 -0.0053 213  ALA A O   
1896 C  CB  . ALA A 216 ? 0.1132 0.1388 0.1086 -0.0098 0.0239  -0.0091 213  ALA A CB  
1897 N  N   . ARG A 217 ? 0.1059 0.1298 0.1334 -0.0008 -0.0039 -0.0071 214  ARG A N   
1898 C  CA  . ARG A 217 ? 0.1098 0.1074 0.1350 0.0093  -0.0027 -0.0069 214  ARG A CA  
1899 C  C   . ARG A 217 ? 0.1308 0.1200 0.1352 0.0044  0.0114  0.0007  214  ARG A C   
1900 O  O   . ARG A 217 ? 0.1221 0.1296 0.1322 -0.0071 -0.0015 0.0272  214  ARG A O   
1901 C  CB  . ARG A 217 ? 0.1142 0.1294 0.1299 0.0064  0.0019  0.0056  214  ARG A CB  
1902 C  CG  . ARG A 217 ? 0.1193 0.1341 0.1466 0.0160  -0.0170 0.0099  214  ARG A CG  
1903 C  CD  . ARG A 217 ? 0.1381 0.1708 0.1560 -0.0100 -0.0182 0.0395  214  ARG A CD  
1904 N  NE  . ARG A 217 ? 0.1759 0.2002 0.1898 -0.0194 0.0030  0.0178  214  ARG A NE  
1905 C  CZ  . ARG A 217 ? 0.2354 0.2773 0.1949 0.0179  0.0082  0.0563  214  ARG A CZ  
1906 N  NH1 . ARG A 217 ? 0.2479 0.3393 0.1961 0.0450  0.0075  0.0483  214  ARG A NH1 
1907 N  NH2 . ARG A 217 ? 0.2492 0.2621 0.2207 0.0238  0.0003  0.0757  214  ARG A NH2 
1908 N  N   . GLU A 218 ? 0.1161 0.1250 0.1368 0.0038  0.0009  0.0034  215  GLU A N   
1909 C  CA  A GLU A 218 ? 0.1319 0.1408 0.1367 0.0023  0.0054  -0.0038 215  GLU A CA  
1910 C  CA  B GLU A 218 ? 0.1255 0.1326 0.1400 0.0059  0.0053  0.0015  215  GLU A CA  
1911 C  C   . GLU A 218 ? 0.1168 0.1385 0.1487 0.0072  -0.0014 0.0119  215  GLU A C   
1912 O  O   . GLU A 218 ? 0.1149 0.1554 0.1515 0.0005  0.0017  0.0238  215  GLU A O   
1913 C  CB  A GLU A 218 ? 0.1518 0.1617 0.1548 0.0046  -0.0063 -0.0075 215  GLU A CB  
1914 C  CB  B GLU A 218 ? 0.1347 0.1417 0.1484 0.0070  -0.0002 -0.0013 215  GLU A CB  
1915 C  CG  A GLU A 218 ? 0.1800 0.2053 0.1722 -0.0207 0.0081  -0.0195 215  GLU A CG  
1916 C  CG  B GLU A 218 ? 0.1462 0.1439 0.1638 0.0098  0.0232  -0.0030 215  GLU A CG  
1917 C  CD  A GLU A 218 ? 0.2244 0.2354 0.2176 0.0256  0.0139  -0.0265 215  GLU A CD  
1918 C  CD  B GLU A 218 ? 0.1751 0.1672 0.2221 0.0160  0.0188  0.0021  215  GLU A CD  
1919 O  OE1 A GLU A 218 ? 0.3659 0.2216 0.3059 0.0495  0.0413  -0.0104 215  GLU A OE1 
1920 O  OE1 B GLU A 218 ? 0.2483 0.1665 0.2157 -0.0014 0.0472  -0.0011 215  GLU A OE1 
1921 O  OE2 A GLU A 218 ? 0.2767 0.2719 0.2251 0.0203  0.0278  -0.0740 215  GLU A OE2 
1922 O  OE2 B GLU A 218 ? 0.2104 0.2251 0.2720 0.0638  0.0143  0.0193  215  GLU A OE2 
1923 N  N   . TRP A 219 ? 0.1253 0.1101 0.1420 0.0148  0.0026  0.0035  216  TRP A N   
1924 C  CA  . TRP A 219 ? 0.0976 0.1208 0.1441 0.0158  -0.0078 0.0124  216  TRP A CA  
1925 C  C   . TRP A 219 ? 0.1096 0.1164 0.1447 0.0001  -0.0001 0.0055  216  TRP A C   
1926 O  O   . TRP A 219 ? 0.1283 0.1247 0.1716 -0.0045 -0.0077 0.0129  216  TRP A O   
1927 C  CB  . TRP A 219 ? 0.0845 0.1486 0.1408 0.0119  -0.0095 0.0004  216  TRP A CB  
1928 C  CG  . TRP A 219 ? 0.0985 0.1421 0.1290 0.0001  -0.0044 0.0048  216  TRP A CG  
1929 C  CD1 . TRP A 219 ? 0.1144 0.1570 0.1652 -0.0008 0.0309  -0.0222 216  TRP A CD1 
1930 C  CD2 . TRP A 219 ? 0.1385 0.1393 0.1127 -0.0007 0.0014  0.0088  216  TRP A CD2 
1931 N  NE1 . TRP A 219 ? 0.1611 0.1497 0.1656 -0.0187 0.0110  -0.0024 216  TRP A NE1 
1932 C  CE2 . TRP A 219 ? 0.1505 0.1440 0.1539 -0.0025 0.0001  -0.0181 216  TRP A CE2 
1933 C  CE3 . TRP A 219 ? 0.1582 0.1431 0.1415 0.0207  -0.0182 0.0173  216  TRP A CE3 
1934 C  CZ2 . TRP A 219 ? 0.1896 0.1286 0.1482 -0.0212 -0.0237 -0.0111 216  TRP A CZ2 
1935 C  CZ3 . TRP A 219 ? 0.1568 0.1576 0.1443 0.0250  -0.0053 -0.0092 216  TRP A CZ3 
1936 C  CH2 . TRP A 219 ? 0.1900 0.1241 0.1445 0.0165  -0.0034 -0.0079 216  TRP A CH2 
1937 N  N   . LEU A 220 ? 0.0973 0.1143 0.1480 0.0005  -0.0023 -0.0066 217  LEU A N   
1938 C  CA  . LEU A 220 ? 0.1076 0.1151 0.1364 0.0010  -0.0063 0.0024  217  LEU A CA  
1939 C  C   . LEU A 220 ? 0.1183 0.1125 0.1468 0.0037  -0.0065 0.0023  217  LEU A C   
1940 O  O   . LEU A 220 ? 0.1061 0.1287 0.1701 -0.0031 -0.0098 -0.0059 217  LEU A O   
1941 C  CB  . LEU A 220 ? 0.1095 0.1052 0.1433 0.0038  -0.0020 -0.0005 217  LEU A CB  
1942 C  CG  . LEU A 220 ? 0.1608 0.1351 0.1838 0.0177  0.0018  0.0041  217  LEU A CG  
1943 C  CD1 . LEU A 220 ? 0.2251 0.1886 0.1630 0.0238  -0.0598 -0.0363 217  LEU A CD1 
1944 C  CD2 . LEU A 220 ? 0.1797 0.1524 0.1697 0.0376  -0.0005 0.0204  217  LEU A CD2 
1945 N  N   . LEU A 221 ? 0.1350 0.1358 0.1516 0.0051  0.0121  -0.0007 218  LEU A N   
1946 C  CA  . LEU A 221 ? 0.1524 0.1334 0.1640 -0.0016 0.0085  0.0115  218  LEU A CA  
1947 C  C   . LEU A 221 ? 0.1562 0.1591 0.1693 0.0063  0.0137  0.0118  218  LEU A C   
1948 O  O   . LEU A 221 ? 0.1574 0.1451 0.1729 -0.0053 0.0242  0.0089  218  LEU A O   
1949 C  CB  . LEU A 221 ? 0.1427 0.1397 0.1552 -0.0063 0.0219  0.0126  218  LEU A CB  
1950 C  CG  . LEU A 221 ? 0.1852 0.1639 0.2297 -0.0131 -0.0130 0.0035  218  LEU A CG  
1951 C  CD1 . LEU A 221 ? 0.2195 0.2096 0.2469 -0.0059 -0.0641 0.0023  218  LEU A CD1 
1952 C  CD2 . LEU A 221 ? 0.2191 0.1963 0.2415 0.0437  -0.0129 -0.0173 218  LEU A CD2 
1953 N  N   . ASP A 222 ? 0.1353 0.1383 0.1801 0.0025  0.0125  0.0093  219  ASP A N   
1954 C  CA  A ASP A 222 ? 0.1401 0.1579 0.1786 -0.0053 0.0140  0.0034  219  ASP A CA  
1955 C  CA  B ASP A 222 ? 0.1488 0.1606 0.1800 0.0013  0.0123  0.0036  219  ASP A CA  
1956 C  C   . ASP A 222 ? 0.1338 0.1633 0.1812 0.0002  0.0135  -0.0033 219  ASP A C   
1957 O  O   . ASP A 222 ? 0.1501 0.1762 0.1983 0.0059  0.0390  0.0107  219  ASP A O   
1958 C  CB  A ASP A 222 ? 0.1352 0.1750 0.2066 0.0053  -0.0009 -0.0122 219  ASP A CB  
1959 C  CB  B ASP A 222 ? 0.1544 0.1720 0.1969 0.0075  0.0055  -0.0009 219  ASP A CB  
1960 C  CG  A ASP A 222 ? 0.1245 0.1841 0.2177 -0.0134 -0.0028 -0.0014 219  ASP A CG  
1961 C  CG  B ASP A 222 ? 0.1963 0.1930 0.2102 0.0145  0.0017  -0.0038 219  ASP A CG  
1962 O  OD1 A ASP A 222 ? 0.1235 0.2475 0.2899 0.0343  -0.0130 -0.0530 219  ASP A OD1 
1963 O  OD1 B ASP A 222 ? 0.2473 0.2419 0.2128 0.0290  0.0004  -0.0001 219  ASP A OD1 
1964 O  OD2 A ASP A 222 ? 0.1731 0.2478 0.2446 -0.0268 -0.0211 0.0274  219  ASP A OD2 
1965 O  OD2 B ASP A 222 ? 0.2331 0.2261 0.2685 0.0264  0.0013  0.0184  219  ASP A OD2 
1966 N  N   . HIS A 223 ? 0.1205 0.1650 0.1591 0.0080  0.0087  0.0049  220  HIS A N   
1967 C  CA  . HIS A 223 ? 0.1199 0.1684 0.1495 0.0057  0.0087  0.0048  220  HIS A CA  
1968 C  C   . HIS A 223 ? 0.1174 0.1536 0.1535 0.0022  0.0061  0.0083  220  HIS A C   
1969 O  O   . HIS A 223 ? 0.1173 0.1566 0.1782 0.0010  -0.0006 0.0152  220  HIS A O   
1970 C  CB  . HIS A 223 ? 0.1397 0.1930 0.1589 0.0148  0.0072  0.0071  220  HIS A CB  
1971 C  CG  . HIS A 223 ? 0.1279 0.2336 0.1803 -0.0028 0.0101  -0.0304 220  HIS A CG  
1972 N  ND1 . HIS A 223 ? 0.1531 0.3215 0.2462 0.0221  0.0023  -0.0591 220  HIS A ND1 
1973 C  CD2 . HIS A 223 ? 0.1378 0.2350 0.2294 -0.0053 0.0102  -0.0457 220  HIS A CD2 
1974 C  CE1 . HIS A 223 ? 0.1839 0.3181 0.2633 -0.0040 -0.0084 -0.0531 220  HIS A CE1 
1975 N  NE2 . HIS A 223 ? 0.1922 0.3239 0.2475 -0.0142 -0.0151 -0.0673 220  HIS A NE2 
1976 N  N   . TYR A 224 ? 0.1014 0.1406 0.1450 -0.0089 -0.0023 0.0071  221  TYR A N   
1977 C  CA  . TYR A 224 ? 0.0991 0.1397 0.1360 -0.0073 0.0055  0.0125  221  TYR A CA  
1978 C  C   . TYR A 224 ? 0.1242 0.1500 0.1525 -0.0044 0.0084  0.0147  221  TYR A C   
1979 O  O   . TYR A 224 ? 0.1448 0.1485 0.1582 -0.0041 0.0167  0.0311  221  TYR A O   
1980 C  CB  . TYR A 224 ? 0.1260 0.1452 0.1549 -0.0085 -0.0021 0.0197  221  TYR A CB  
1981 C  CG  . TYR A 224 ? 0.1035 0.1641 0.1470 0.0106  -0.0163 0.0144  221  TYR A CG  
1982 C  CD1 . TYR A 224 ? 0.1645 0.1452 0.1309 0.0012  0.0168  0.0174  221  TYR A CD1 
1983 C  CD2 . TYR A 224 ? 0.1125 0.1567 0.1772 0.0168  0.0018  0.0037  221  TYR A CD2 
1984 C  CE1 . TYR A 224 ? 0.1663 0.1365 0.1605 0.0201  0.0075  -0.0224 221  TYR A CE1 
1985 C  CE2 . TYR A 224 ? 0.1471 0.1282 0.1718 0.0023  0.0386  0.0248  221  TYR A CE2 
1986 C  CZ  . TYR A 224 ? 0.1696 0.1376 0.1014 0.0153  -0.0028 -0.0152 221  TYR A CZ  
1987 O  OH  . TYR A 224 ? 0.1490 0.1727 0.1213 -0.0160 0.0077  -0.0133 221  TYR A OH  
1988 N  N   . GLU A 225 ? 0.1180 0.1430 0.1554 -0.0060 0.0070  0.0173  222  GLU A N   
1989 C  CA  . GLU A 225 ? 0.1269 0.1595 0.1433 0.0012  0.0009  0.0132  222  GLU A CA  
1990 C  C   . GLU A 225 ? 0.1255 0.1575 0.1372 -0.0063 0.0039  0.0200  222  GLU A C   
1991 O  O   . GLU A 225 ? 0.1552 0.1879 0.1527 -0.0175 -0.0107 0.0288  222  GLU A O   
1992 C  CB  . GLU A 225 ? 0.1332 0.1695 0.1473 0.0260  0.0125  0.0013  222  GLU A CB  
1993 C  CG  . GLU A 225 ? 0.1588 0.1957 0.1650 0.0100  -0.0074 0.0082  222  GLU A CG  
1994 C  CD  . GLU A 225 ? 0.1648 0.2183 0.2001 0.0439  0.0347  0.0145  222  GLU A CD  
1995 O  OE1 . GLU A 225 ? 0.1775 0.1916 0.3009 0.0289  0.0173  -0.0002 222  GLU A OE1 
1996 O  OE2 . GLU A 225 ? 0.1607 0.3033 0.2247 0.0298  0.0267  0.0560  222  GLU A OE2 
1997 N  N   . ASP A 226 ? 0.1457 0.1681 0.1635 0.0126  -0.0087 0.0136  223  ASP A N   
1998 C  CA  . ASP A 226 ? 0.1557 0.1881 0.1695 0.0036  -0.0120 0.0201  223  ASP A CA  
1999 C  C   . ASP A 226 ? 0.1578 0.2054 0.1761 -0.0025 -0.0034 0.0084  223  ASP A C   
2000 O  O   . ASP A 226 ? 0.1444 0.2031 0.1519 0.0000  -0.0018 0.0116  223  ASP A O   
2001 C  CB  . ASP A 226 ? 0.1617 0.1984 0.1728 0.0138  -0.0089 0.0193  223  ASP A CB  
2002 C  CG  . ASP A 226 ? 0.1781 0.1862 0.2178 0.0177  -0.0111 0.0162  223  ASP A CG  
2003 O  OD1 . ASP A 226 ? 0.1642 0.1886 0.2399 -0.0012 -0.0274 0.0282  223  ASP A OD1 
2004 O  OD2 . ASP A 226 ? 0.1956 0.1674 0.2787 0.0376  0.0092  0.0638  223  ASP A OD2 
2005 N  N   . GLU A 227 ? 0.1709 0.2266 0.1913 -0.0065 -0.0029 0.0064  224  GLU A N   
2006 C  CA  A GLU A 227 ? 0.1971 0.2365 0.2146 -0.0068 -0.0060 0.0038  224  GLU A CA  
2007 C  CA  B GLU A 227 ? 0.1915 0.2272 0.2006 -0.0015 -0.0066 0.0055  224  GLU A CA  
2008 C  C   . GLU A 227 ? 0.1873 0.2214 0.1919 -0.0044 -0.0025 0.0038  224  GLU A C   
2009 O  O   . GLU A 227 ? 0.1780 0.2192 0.1872 0.0001  0.0012  0.0178  224  GLU A O   
2010 C  CB  A GLU A 227 ? 0.2087 0.2544 0.2311 -0.0207 -0.0070 -0.0013 224  GLU A CB  
2011 C  CB  B GLU A 227 ? 0.2071 0.2374 0.2105 -0.0030 -0.0084 -0.0033 224  GLU A CB  
2012 C  CG  A GLU A 227 ? 0.2684 0.2966 0.2802 -0.0100 -0.0115 -0.0065 224  GLU A CG  
2013 C  CG  B GLU A 227 ? 0.2429 0.2725 0.2480 0.0057  -0.0127 -0.0086 224  GLU A CG  
2014 C  CD  A GLU A 227 ? 0.3130 0.3410 0.3393 -0.0359 -0.0168 0.0288  224  GLU A CD  
2015 C  CD  B GLU A 227 ? 0.2878 0.3200 0.2659 0.0043  -0.0076 -0.0274 224  GLU A CD  
2016 O  OE1 A GLU A 227 ? 0.2945 0.4264 0.3323 -0.0302 0.0034  0.0341  224  GLU A OE1 
2017 O  OE1 B GLU A 227 ? 0.2839 0.3391 0.2428 -0.0190 -0.0175 -0.0147 224  GLU A OE1 
2018 O  OE2 A GLU A 227 ? 0.3504 0.4344 0.3923 -0.0039 -0.0450 0.0083  224  GLU A OE2 
2019 O  OE2 B GLU A 227 ? 0.3373 0.3405 0.3460 0.0076  -0.0106 -0.0494 224  GLU A OE2 
2020 N  N   . LYS A 228 ? 0.1669 0.2143 0.1770 0.0058  -0.0039 0.0051  225  LYS A N   
2021 C  CA  A LYS A 228 ? 0.1691 0.2092 0.1980 0.0091  0.0000  0.0000  225  LYS A CA  
2022 C  CA  B LYS A 228 ? 0.1682 0.2052 0.1921 0.0068  -0.0014 0.0015  225  LYS A CA  
2023 C  C   . LYS A 228 ? 0.1428 0.1900 0.1873 0.0072  -0.0093 0.0006  225  LYS A C   
2024 O  O   . LYS A 228 ? 0.1356 0.1811 0.1948 0.0033  -0.0052 0.0054  225  LYS A O   
2025 C  CB  A LYS A 228 ? 0.1794 0.2218 0.2108 0.0126  -0.0036 0.0010  225  LYS A CB  
2026 C  CB  B LYS A 228 ? 0.1763 0.2134 0.1983 0.0098  -0.0035 0.0026  225  LYS A CB  
2027 C  CG  A LYS A 228 ? 0.2265 0.2693 0.2355 0.0151  0.0121  -0.0105 225  LYS A CG  
2028 C  CG  B LYS A 228 ? 0.2201 0.2463 0.2057 0.0087  0.0090  -0.0029 225  LYS A CG  
2029 C  CD  A LYS A 228 ? 0.2824 0.2994 0.3075 0.0187  -0.0047 -0.0105 225  LYS A CD  
2030 C  CD  B LYS A 228 ? 0.2616 0.2655 0.2462 0.0223  0.0023  0.0022  225  LYS A CD  
2031 C  CE  A LYS A 228 ? 0.3216 0.3225 0.3305 0.0184  -0.0189 -0.0088 225  LYS A CE  
2032 C  CE  B LYS A 228 ? 0.2832 0.2823 0.2385 0.0161  0.0138  0.0117  225  LYS A CE  
2033 N  NZ  A LYS A 228 ? 0.3695 0.3493 0.3572 0.0174  -0.0484 -0.0357 225  LYS A NZ  
2034 N  NZ  B LYS A 228 ? 0.3070 0.2780 0.2716 0.0271  0.0074  0.0084  225  LYS A NZ  
2035 N  N   . ALA A 229 ? 0.1191 0.1680 0.1841 -0.0066 -0.0136 0.0142  226  ALA A N   
2036 C  CA  . ALA A 229 ? 0.1038 0.1547 0.1764 0.0014  -0.0087 -0.0056 226  ALA A CA  
2037 C  C   . ALA A 229 ? 0.1138 0.1454 0.1564 0.0114  -0.0039 -0.0011 226  ALA A C   
2038 O  O   . ALA A 229 ? 0.1097 0.1578 0.1343 0.0213  0.0027  -0.0087 226  ALA A O   
2039 C  CB  . ALA A 229 ? 0.0897 0.1500 0.1720 0.0107  -0.0227 -0.0073 226  ALA A CB  
2040 N  N   . VAL A 230 ? 0.1238 0.1454 0.1516 0.0047  0.0075  0.0002  227  VAL A N   
2041 C  CA  . VAL A 230 ? 0.1313 0.1479 0.1508 0.0012  0.0091  0.0016  227  VAL A CA  
2042 C  C   . VAL A 230 ? 0.1181 0.1428 0.1351 -0.0096 0.0058  0.0074  227  VAL A C   
2043 O  O   . VAL A 230 ? 0.1566 0.1473 0.1389 -0.0180 0.0121  0.0094  227  VAL A O   
2044 C  CB  . VAL A 230 ? 0.1301 0.1620 0.1415 -0.0054 0.0129  0.0007  227  VAL A CB  
2045 C  CG1 . VAL A 230 ? 0.1875 0.1599 0.1530 -0.0243 0.0295  0.0053  227  VAL A CG1 
2046 C  CG2 . VAL A 230 ? 0.1536 0.1627 0.1896 0.0157  0.0104  -0.0177 227  VAL A CG2 
2047 N  N   . ALA A 231 ? 0.1228 0.1586 0.1457 0.0153  0.0062  0.0020  228  ALA A N   
2048 C  CA  . ALA A 231 ? 0.1322 0.1608 0.1613 0.0279  0.0011  0.0004  228  ALA A CA  
2049 C  C   . ALA A 231 ? 0.1279 0.1553 0.1568 0.0223  -0.0019 0.0030  228  ALA A C   
2050 O  O   . ALA A 231 ? 0.1323 0.1938 0.1925 0.0150  0.0034  -0.0098 228  ALA A O   
2051 C  CB  . ALA A 231 ? 0.1478 0.2086 0.1568 0.0600  -0.0063 0.0043  228  ALA A CB  
2052 N  N   . ASN A 232 ? 0.1246 0.1444 0.1682 0.0183  -0.0106 0.0021  229  ASN A N   
2053 C  CA  . ASN A 232 ? 0.1382 0.1401 0.1494 0.0074  -0.0020 -0.0020 229  ASN A CA  
2054 C  C   . ASN A 232 ? 0.1458 0.1454 0.1438 0.0106  -0.0138 -0.0144 229  ASN A C   
2055 O  O   . ASN A 232 ? 0.1577 0.1652 0.1329 0.0201  0.0078  -0.0168 229  ASN A O   
2056 C  CB  . ASN A 232 ? 0.1808 0.1440 0.1736 0.0080  -0.0136 -0.0076 229  ASN A CB  
2057 C  CG  . ASN A 232 ? 0.2375 0.1566 0.1697 -0.0055 0.0144  0.0184  229  ASN A CG  
2058 O  OD1 . ASN A 232 ? 0.2972 0.2059 0.1889 -0.0214 0.0185  0.0307  229  ASN A OD1 
2059 N  ND2 . ASN A 232 ? 0.2782 0.1926 0.2149 0.0146  0.0485  -0.0074 229  ASN A ND2 
2060 N  N   . HIS A 233 ? 0.1414 0.1169 0.1119 0.0051  0.0007  -0.0063 230  HIS A N   
2061 C  CA  . HIS A 233 ? 0.1047 0.1266 0.1121 0.0007  0.0033  0.0021  230  HIS A CA  
2062 C  C   . HIS A 233 ? 0.1225 0.1289 0.1181 0.0042  -0.0068 0.0017  230  HIS A C   
2063 O  O   . HIS A 233 ? 0.1401 0.1546 0.1376 0.0075  -0.0083 0.0097  230  HIS A O   
2064 C  CB  . HIS A 233 ? 0.1203 0.1308 0.1296 0.0123  0.0040  -0.0111 230  HIS A CB  
2065 C  CG  . HIS A 233 ? 0.1036 0.1470 0.1174 -0.0166 -0.0001 -0.0202 230  HIS A CG  
2066 N  ND1 . HIS A 233 ? 0.1125 0.1386 0.1227 0.0186  -0.0201 -0.0244 230  HIS A ND1 
2067 C  CD2 . HIS A 233 ? 0.1219 0.1441 0.0991 0.0042  -0.0184 0.0022  230  HIS A CD2 
2068 C  CE1 . HIS A 233 ? 0.1338 0.1575 0.1234 -0.0020 -0.0292 -0.0190 230  HIS A CE1 
2069 N  NE2 . HIS A 233 ? 0.1205 0.1440 0.1355 0.0060  -0.0016 -0.0157 230  HIS A NE2 
2070 N  N   . PHE A 234 ? 0.1234 0.1464 0.1069 -0.0071 -0.0056 0.0041  231  PHE A N   
2071 C  CA  . PHE A 234 ? 0.1257 0.1341 0.1079 0.0055  -0.0045 0.0070  231  PHE A CA  
2072 C  C   . PHE A 234 ? 0.1174 0.1145 0.1062 0.0059  -0.0095 0.0031  231  PHE A C   
2073 O  O   . PHE A 234 ? 0.1255 0.1328 0.1387 0.0057  -0.0079 0.0030  231  PHE A O   
2074 C  CB  . PHE A 234 ? 0.1252 0.1394 0.1209 0.0115  -0.0140 0.0017  231  PHE A CB  
2075 C  CG  . PHE A 234 ? 0.1437 0.1309 0.1112 0.0138  0.0085  0.0048  231  PHE A CG  
2076 C  CD1 . PHE A 234 ? 0.1431 0.1435 0.1034 0.0369  0.0097  -0.0055 231  PHE A CD1 
2077 C  CD2 . PHE A 234 ? 0.1525 0.1345 0.1197 0.0324  -0.0062 0.0202  231  PHE A CD2 
2078 C  CE1 . PHE A 234 ? 0.1959 0.1683 0.1774 0.0449  0.0083  0.0176  231  PHE A CE1 
2079 C  CE2 . PHE A 234 ? 0.1485 0.1892 0.1677 0.0297  -0.0028 0.0213  231  PHE A CE2 
2080 C  CZ  . PHE A 234 ? 0.1742 0.2060 0.1566 0.0337  -0.0017 0.0068  231  PHE A CZ  
2081 N  N   . VAL A 235 ? 0.0973 0.1098 0.1222 0.0033  -0.0122 0.0082  232  VAL A N   
2082 C  CA  . VAL A 235 ? 0.1288 0.1224 0.1290 0.0053  -0.0236 0.0044  232  VAL A CA  
2083 C  C   . VAL A 235 ? 0.1112 0.1146 0.1375 0.0102  -0.0205 -0.0054 232  VAL A C   
2084 O  O   . VAL A 235 ? 0.1260 0.1217 0.1319 0.0142  -0.0330 0.0019  232  VAL A O   
2085 C  CB  . VAL A 235 ? 0.1074 0.1401 0.1401 0.0024  -0.0119 0.0004  232  VAL A CB  
2086 C  CG1 . VAL A 235 ? 0.1897 0.1104 0.1608 -0.0141 0.0177  -0.0070 232  VAL A CG1 
2087 C  CG2 . VAL A 235 ? 0.1347 0.1362 0.1174 0.0080  -0.0184 0.0087  232  VAL A CG2 
2088 N  N   . ALA A 236 ? 0.0996 0.1189 0.1621 0.0144  -0.0256 -0.0057 233  ALA A N   
2089 C  CA  . ALA A 236 ? 0.1028 0.1293 0.1379 0.0134  -0.0165 -0.0065 233  ALA A CA  
2090 C  C   . ALA A 236 ? 0.1107 0.1386 0.1264 0.0047  -0.0176 0.0091  233  ALA A C   
2091 O  O   . ALA A 236 ? 0.1325 0.1274 0.1498 0.0023  -0.0035 -0.0012 233  ALA A O   
2092 C  CB  . ALA A 236 ? 0.1623 0.1674 0.1494 0.0011  -0.0111 -0.0337 233  ALA A CB  
2093 N  N   . ILE A 237 ? 0.1164 0.1355 0.1634 0.0201  -0.0176 0.0025  234  ILE A N   
2094 C  CA  . ILE A 237 ? 0.1394 0.1329 0.1540 0.0189  -0.0065 0.0009  234  ILE A CA  
2095 C  C   . ILE A 237 ? 0.1452 0.1463 0.1503 0.0164  -0.0093 0.0036  234  ILE A C   
2096 O  O   . ILE A 237 ? 0.1663 0.1277 0.1616 0.0002  -0.0254 -0.0045 234  ILE A O   
2097 C  CB  . ILE A 237 ? 0.1617 0.1522 0.1453 0.0110  0.0084  -0.0084 234  ILE A CB  
2098 C  CG1 . ILE A 237 ? 0.2313 0.1556 0.1773 -0.0079 -0.0081 0.0060  234  ILE A CG1 
2099 C  CG2 . ILE A 237 ? 0.1766 0.1832 0.2122 0.0465  0.0305  -0.0045 234  ILE A CG2 
2100 C  CD1 . ILE A 237 ? 0.1434 0.1943 0.1996 0.0161  -0.0458 0.0350  234  ILE A CD1 
2101 N  N   . SER A 238 ? 0.1523 0.1498 0.1531 0.0106  -0.0243 -0.0150 235  SER A N   
2102 C  CA  . SER A 238 ? 0.1595 0.1677 0.1483 0.0026  -0.0199 -0.0252 235  SER A CA  
2103 C  C   . SER A 238 ? 0.1675 0.1722 0.1744 0.0173  -0.0253 -0.0259 235  SER A C   
2104 O  O   . SER A 238 ? 0.1712 0.1791 0.1978 0.0269  -0.0244 -0.0552 235  SER A O   
2105 C  CB  . SER A 238 ? 0.1771 0.1804 0.1328 0.0128  -0.0237 -0.0198 235  SER A CB  
2106 O  OG  . SER A 238 ? 0.1796 0.2070 0.1534 0.0300  -0.0170 -0.0557 235  SER A OG  
2107 N  N   . SER A 239 ? 0.1909 0.1815 0.2094 0.0219  -0.0406 -0.0243 236  SER A N   
2108 C  CA  . SER A 239 ? 0.1780 0.2167 0.2051 0.0127  -0.0397 -0.0224 236  SER A CA  
2109 C  C   . SER A 239 ? 0.1716 0.2276 0.1938 0.0086  -0.0444 -0.0234 236  SER A C   
2110 O  O   . SER A 239 ? 0.1922 0.2505 0.2172 0.0089  -0.0715 -0.0055 236  SER A O   
2111 C  CB  . SER A 239 ? 0.2117 0.2675 0.2409 0.0063  -0.0324 -0.0231 236  SER A CB  
2112 O  OG  . SER A 239 ? 0.2234 0.3205 0.2876 -0.0164 -0.0262 -0.0358 236  SER A OG  
2113 N  N   . LYS A 240 ? 0.1768 0.2042 0.1797 0.0192  -0.0434 -0.0183 237  LYS A N   
2114 C  CA  . LYS A 240 ? 0.1933 0.2252 0.1990 0.0199  -0.0292 -0.0156 237  LYS A CA  
2115 C  C   . LYS A 240 ? 0.1901 0.2110 0.1924 0.0215  -0.0316 -0.0055 237  LYS A C   
2116 O  O   . LYS A 240 ? 0.1992 0.2274 0.1941 0.0108  -0.0272 -0.0159 237  LYS A O   
2117 C  CB  . LYS A 240 ? 0.2234 0.2199 0.2038 0.0257  -0.0140 -0.0180 237  LYS A CB  
2118 C  CG  . LYS A 240 ? 0.2329 0.2411 0.2121 0.0445  -0.0043 -0.0157 237  LYS A CG  
2119 C  CD  . LYS A 240 ? 0.3195 0.2734 0.3058 0.0238  -0.0057 -0.0172 237  LYS A CD  
2120 C  CE  . LYS A 240 ? 0.3985 0.3389 0.3350 0.0287  0.0014  -0.0281 237  LYS A CE  
2121 N  NZ  . LYS A 240 ? 0.4395 0.3673 0.3625 -0.0165 -0.0513 -0.0235 237  LYS A NZ  
2122 N  N   . LEU A 241 ? 0.2032 0.2315 0.2127 0.0196  -0.0428 -0.0026 238  LEU A N   
2123 C  CA  . LEU A 241 ? 0.1962 0.2250 0.2198 0.0244  -0.0361 0.0079  238  LEU A CA  
2124 C  C   . LEU A 241 ? 0.2071 0.2314 0.2148 0.0251  -0.0402 0.0053  238  LEU A C   
2125 O  O   . LEU A 241 ? 0.2069 0.2300 0.2246 0.0148  -0.0254 0.0083  238  LEU A O   
2126 C  CB  . LEU A 241 ? 0.2294 0.2470 0.2380 0.0403  -0.0242 0.0059  238  LEU A CB  
2127 C  CG  . LEU A 241 ? 0.2119 0.2626 0.2448 0.0576  -0.0254 0.0090  238  LEU A CG  
2128 C  CD1 . LEU A 241 ? 0.2387 0.3405 0.3480 0.1018  -0.0381 0.0115  238  LEU A CD1 
2129 C  CD2 . LEU A 241 ? 0.2640 0.3841 0.2304 0.0723  -0.0180 -0.0299 238  LEU A CD2 
2130 N  N   . ASP A 242 ? 0.2094 0.2440 0.2057 0.0147  -0.0340 0.0013  239  ASP A N   
2131 C  CA  . ASP A 242 ? 0.2342 0.2459 0.1895 0.0043  -0.0359 -0.0046 239  ASP A CA  
2132 C  C   . ASP A 242 ? 0.2150 0.2251 0.1772 0.0025  -0.0375 -0.0044 239  ASP A C   
2133 O  O   . ASP A 242 ? 0.2096 0.2167 0.1562 -0.0010 -0.0516 0.0018  239  ASP A O   
2134 C  CB  . ASP A 242 ? 0.2579 0.2553 0.1881 0.0068  -0.0480 -0.0133 239  ASP A CB  
2135 C  CG  . ASP A 242 ? 0.3472 0.2923 0.2329 -0.0217 -0.0417 -0.0241 239  ASP A CG  
2136 O  OD1 . ASP A 242 ? 0.3636 0.3677 0.2504 0.0048  -0.0934 -0.0170 239  ASP A OD1 
2137 O  OD2 . ASP A 242 ? 0.4559 0.3206 0.3159 -0.0307 -0.0119 -0.0796 239  ASP A OD2 
2138 N  N   . LYS A 243 ? 0.2027 0.2187 0.1858 0.0104  -0.0292 -0.0048 240  LYS A N   
2139 C  CA  A LYS A 243 ? 0.1898 0.2207 0.1936 0.0083  -0.0225 -0.0038 240  LYS A CA  
2140 C  CA  B LYS A 243 ? 0.1935 0.2192 0.1936 0.0096  -0.0223 -0.0029 240  LYS A CA  
2141 C  C   . LYS A 243 ? 0.1852 0.2061 0.1826 0.0120  -0.0163 0.0001  240  LYS A C   
2142 O  O   . LYS A 243 ? 0.1642 0.2178 0.1778 0.0382  -0.0197 -0.0012 240  LYS A O   
2143 C  CB  A LYS A 243 ? 0.1931 0.2200 0.2100 -0.0026 -0.0219 -0.0063 240  LYS A CB  
2144 C  CB  B LYS A 243 ? 0.1981 0.2222 0.2088 0.0021  -0.0213 -0.0036 240  LYS A CB  
2145 C  CG  A LYS A 243 ? 0.2253 0.2574 0.1928 -0.0052 -0.0066 -0.0062 240  LYS A CG  
2146 C  CG  B LYS A 243 ? 0.2357 0.2486 0.2053 -0.0001 -0.0146 -0.0045 240  LYS A CG  
2147 C  CD  A LYS A 243 ? 0.2577 0.2449 0.2205 0.0024  0.0142  -0.0416 240  LYS A CD  
2148 C  CD  B LYS A 243 ? 0.2613 0.2598 0.2528 -0.0008 0.0061  -0.0171 240  LYS A CD  
2149 C  CE  A LYS A 243 ? 0.2595 0.2835 0.2216 -0.0069 0.0003  -0.0383 240  LYS A CE  
2150 C  CE  B LYS A 243 ? 0.3020 0.2810 0.2650 -0.0122 -0.0023 -0.0162 240  LYS A CE  
2151 N  NZ  A LYS A 243 ? 0.3205 0.2809 0.2332 0.0087  -0.0075 -0.0251 240  LYS A NZ  
2152 N  NZ  B LYS A 243 ? 0.3203 0.2860 0.2450 -0.0137 0.0027  -0.0613 240  LYS A NZ  
2153 N  N   . VAL A 244 ? 0.1625 0.1875 0.1669 0.0273  -0.0346 0.0073  241  VAL A N   
2154 C  CA  . VAL A 244 ? 0.1649 0.1885 0.1627 0.0134  -0.0188 -0.0052 241  VAL A CA  
2155 C  C   . VAL A 244 ? 0.1726 0.1935 0.1636 0.0159  -0.0315 0.0047  241  VAL A C   
2156 O  O   . VAL A 244 ? 0.1592 0.1944 0.1502 0.0072  -0.0136 -0.0119 241  VAL A O   
2157 C  CB  . VAL A 244 ? 0.1416 0.1981 0.1648 0.0001  -0.0126 -0.0063 241  VAL A CB  
2158 C  CG1 . VAL A 244 ? 0.1598 0.2058 0.1810 0.0000  -0.0229 -0.0507 241  VAL A CG1 
2159 C  CG2 . VAL A 244 ? 0.1617 0.2133 0.1652 0.0029  0.0045  -0.0116 241  VAL A CG2 
2160 N  N   . LYS A 245 ? 0.1894 0.2088 0.1614 0.0188  -0.0233 0.0098  242  LYS A N   
2161 C  CA  . LYS A 245 ? 0.2031 0.2180 0.1822 0.0140  -0.0163 0.0159  242  LYS A CA  
2162 C  C   . LYS A 245 ? 0.1973 0.2107 0.1851 0.0107  -0.0226 0.0214  242  LYS A C   
2163 O  O   . LYS A 245 ? 0.2098 0.2220 0.1782 -0.0021 -0.0311 0.0132  242  LYS A O   
2164 C  CB  . LYS A 245 ? 0.2202 0.2315 0.2274 0.0142  -0.0275 0.0185  242  LYS A CB  
2165 C  CG  . LYS A 245 ? 0.2836 0.2947 0.2722 0.0202  -0.0217 0.0434  242  LYS A CG  
2166 C  CD  . LYS A 245 ? 0.3523 0.3806 0.3373 0.0347  -0.0440 0.0420  242  LYS A CD  
2167 C  CE  . LYS A 245 ? 0.4024 0.3937 0.4061 0.0264  -0.0308 0.0502  242  LYS A CE  
2168 N  NZ  . LYS A 245 ? 0.4557 0.4712 0.4277 0.0226  -0.0733 0.0165  242  LYS A NZ  
2169 N  N   . GLU A 246 ? 0.1973 0.2157 0.1639 0.0109  -0.0217 0.0104  243  GLU A N   
2170 C  CA  A GLU A 246 ? 0.2079 0.2382 0.1818 0.0121  -0.0138 0.0047  243  GLU A CA  
2171 C  CA  B GLU A 246 ? 0.1987 0.2283 0.1757 0.0066  -0.0126 0.0058  243  GLU A CA  
2172 C  C   . GLU A 246 ? 0.1922 0.2380 0.1795 0.0048  -0.0083 0.0045  243  GLU A C   
2173 O  O   . GLU A 246 ? 0.2041 0.2660 0.1971 0.0049  -0.0134 0.0023  243  GLU A O   
2174 C  CB  A GLU A 246 ? 0.2303 0.2571 0.1993 0.0146  -0.0203 -0.0048 243  GLU A CB  
2175 C  CB  B GLU A 246 ? 0.2064 0.2363 0.1818 0.0061  -0.0138 0.0002  243  GLU A CB  
2176 C  CG  A GLU A 246 ? 0.2728 0.3025 0.2401 0.0167  0.0099  -0.0081 243  GLU A CG  
2177 C  CG  B GLU A 246 ? 0.2126 0.2524 0.1646 -0.0043 0.0013  0.0018  243  GLU A CG  
2178 C  CD  A GLU A 246 ? 0.3813 0.3316 0.2918 0.0175  0.0365  -0.0203 243  GLU A CD  
2179 C  CD  B GLU A 246 ? 0.2587 0.2854 0.2170 -0.0218 0.0171  -0.0304 243  GLU A CD  
2180 O  OE1 A GLU A 246 ? 0.4446 0.4034 0.3152 0.0068  0.0905  -0.0208 243  GLU A OE1 
2181 O  OE1 B GLU A 246 ? 0.3170 0.3149 0.2711 -0.0135 0.0307  -0.0499 243  GLU A OE1 
2182 O  OE2 A GLU A 246 ? 0.4827 0.3745 0.3574 0.0591  0.0417  -0.0723 243  GLU A OE2 
2183 O  OE2 B GLU A 246 ? 0.2791 0.3283 0.1855 -0.0307 0.0197  -0.0238 243  GLU A OE2 
2184 N  N   . PHE A 247 ? 0.1764 0.2222 0.1644 0.0031  -0.0052 -0.0007 244  PHE A N   
2185 C  CA  . PHE A 247 ? 0.1733 0.2001 0.1534 0.0107  -0.0039 0.0145  244  PHE A CA  
2186 C  C   . PHE A 247 ? 0.1671 0.2197 0.1566 0.0099  0.0004  0.0005  244  PHE A C   
2187 O  O   . PHE A 247 ? 0.1505 0.2352 0.1809 0.0068  -0.0112 0.0099  244  PHE A O   
2188 C  CB  . PHE A 247 ? 0.1498 0.1982 0.1522 0.0110  -0.0067 0.0182  244  PHE A CB  
2189 C  CG  . PHE A 247 ? 0.1613 0.1732 0.1457 0.0205  -0.0099 0.0015  244  PHE A CG  
2190 C  CD1 . PHE A 247 ? 0.1843 0.1969 0.1483 0.0193  0.0072  0.0130  244  PHE A CD1 
2191 C  CD2 . PHE A 247 ? 0.1500 0.1745 0.1572 0.0467  -0.0151 -0.0023 244  PHE A CD2 
2192 C  CE1 . PHE A 247 ? 0.1616 0.1605 0.1852 0.0229  -0.0107 0.0268  244  PHE A CE1 
2193 C  CE2 . PHE A 247 ? 0.1757 0.1906 0.1321 0.0054  -0.0315 -0.0169 244  PHE A CE2 
2194 C  CZ  . PHE A 247 ? 0.1485 0.2063 0.1414 0.0087  0.0051  0.0111  244  PHE A CZ  
2195 N  N   . GLY A 248 ? 0.1678 0.2038 0.1541 0.0136  0.0033  0.0074  245  GLY A N   
2196 C  CA  . GLY A 248 ? 0.1809 0.2092 0.1566 0.0047  0.0025  -0.0005 245  GLY A CA  
2197 C  C   . GLY A 248 ? 0.1779 0.1922 0.1635 0.0026  0.0078  -0.0032 245  GLY A C   
2198 O  O   . GLY A 248 ? 0.1957 0.2150 0.1813 -0.0153 -0.0039 -0.0106 245  GLY A O   
2199 N  N   . ILE A 249 ? 0.1924 0.2030 0.1820 0.0120  0.0128  0.0058  246  ILE A N   
2200 C  CA  . ILE A 249 ? 0.1748 0.1967 0.1624 0.0222  0.0032  0.0000  246  ILE A CA  
2201 C  C   . ILE A 249 ? 0.2092 0.2180 0.2013 0.0205  0.0105  0.0057  246  ILE A C   
2202 O  O   . ILE A 249 ? 0.2207 0.2584 0.1815 0.0488  -0.0119 0.0102  246  ILE A O   
2203 C  CB  . ILE A 249 ? 0.1577 0.2026 0.1587 0.0226  0.0139  0.0143  246  ILE A CB  
2204 C  CG1 . ILE A 249 ? 0.1147 0.1981 0.1888 0.0026  -0.0091 -0.0019 246  ILE A CG1 
2205 C  CG2 . ILE A 249 ? 0.1243 0.2103 0.1567 0.0275  0.0288  -0.0007 246  ILE A CG2 
2206 C  CD1 . ILE A 249 ? 0.1444 0.2220 0.2013 0.0229  -0.0503 0.0425  246  ILE A CD1 
2207 N  N   . ASP A 250 ? 0.2278 0.2164 0.2313 0.0197  0.0126  -0.0062 247  ASP A N   
2208 C  CA  A ASP A 250 ? 0.2242 0.2382 0.2345 0.0126  0.0045  0.0014  247  ASP A CA  
2209 C  CA  B ASP A 250 ? 0.2235 0.2227 0.2308 0.0147  0.0060  0.0049  247  ASP A CA  
2210 C  C   . ASP A 250 ? 0.2135 0.2295 0.2297 0.0163  0.0063  0.0029  247  ASP A C   
2211 O  O   . ASP A 250 ? 0.1997 0.2303 0.2215 0.0380  0.0119  0.0226  247  ASP A O   
2212 C  CB  A ASP A 250 ? 0.2263 0.2453 0.2523 0.0176  0.0049  -0.0100 247  ASP A CB  
2213 C  CB  B ASP A 250 ? 0.2259 0.2207 0.2419 0.0149  0.0064  0.0003  247  ASP A CB  
2214 C  CG  A ASP A 250 ? 0.2271 0.2973 0.2922 0.0086  -0.0084 -0.0222 247  ASP A CG  
2215 C  CG  B ASP A 250 ? 0.2413 0.2143 0.2788 0.0144  0.0013  0.0112  247  ASP A CG  
2216 O  OD1 A ASP A 250 ? 0.2553 0.3252 0.3255 0.0018  0.0203  0.0228  247  ASP A OD1 
2217 O  OD1 B ASP A 250 ? 0.2830 0.2222 0.3476 -0.0149 0.0007  -0.0110 247  ASP A OD1 
2218 O  OD2 A ASP A 250 ? 0.2534 0.3526 0.4135 -0.0113 -0.0223 -0.1033 247  ASP A OD2 
2219 O  OD2 B ASP A 250 ? 0.2511 0.2074 0.2919 0.0017  0.0183  0.0127  247  ASP A OD2 
2220 N  N   . LEU A 251 ? 0.2264 0.2217 0.2019 0.0227  -0.0002 0.0201  248  LEU A N   
2221 C  CA  A LEU A 251 ? 0.2252 0.2122 0.2153 0.0247  -0.0170 0.0140  248  LEU A CA  
2222 C  CA  B LEU A 251 ? 0.2102 0.2123 0.1993 0.0179  -0.0167 0.0148  248  LEU A CA  
2223 C  C   . LEU A 251 ? 0.1965 0.1973 0.1813 0.0227  -0.0183 0.0242  248  LEU A C   
2224 O  O   . LEU A 251 ? 0.1730 0.1956 0.1916 0.0040  -0.0313 0.0092  248  LEU A O   
2225 C  CB  A LEU A 251 ? 0.2572 0.2254 0.2186 0.0284  -0.0147 0.0062  248  LEU A CB  
2226 C  CB  B LEU A 251 ? 0.2200 0.2162 0.1973 0.0190  -0.0148 0.0160  248  LEU A CB  
2227 C  CG  A LEU A 251 ? 0.2537 0.2393 0.2515 0.0418  -0.0162 -0.0053 248  LEU A CG  
2228 C  CG  B LEU A 251 ? 0.2195 0.2420 0.1907 0.0119  -0.0224 0.0071  248  LEU A CG  
2229 C  CD1 A LEU A 251 ? 0.3089 0.2875 0.2677 0.0163  -0.0293 -0.0423 248  LEU A CD1 
2230 C  CD1 B LEU A 251 ? 0.2263 0.2502 0.1908 0.0082  -0.0193 0.0024  248  LEU A CD1 
2231 C  CD2 A LEU A 251 ? 0.2913 0.2063 0.3026 0.0535  -0.0106 0.0035  248  LEU A CD2 
2232 C  CD2 B LEU A 251 ? 0.2230 0.2413 0.2345 0.0234  -0.0272 -0.0039 248  LEU A CD2 
2233 N  N   . GLU A 252 ? 0.1770 0.1778 0.1703 0.0203  -0.0170 0.0265  249  GLU A N   
2234 C  CA  A GLU A 252 ? 0.1914 0.1910 0.1865 0.0149  -0.0133 0.0170  249  GLU A CA  
2235 C  CA  B GLU A 252 ? 0.1811 0.1871 0.1795 0.0111  -0.0120 0.0156  249  GLU A CA  
2236 C  C   . GLU A 252 ? 0.1690 0.1774 0.1682 0.0065  0.0001  0.0194  249  GLU A C   
2237 O  O   . GLU A 252 ? 0.1575 0.1814 0.1929 0.0061  -0.0084 0.0018  249  GLU A O   
2238 C  CB  A GLU A 252 ? 0.2175 0.1929 0.1981 0.0250  -0.0113 0.0245  249  GLU A CB  
2239 C  CB  B GLU A 252 ? 0.2088 0.1879 0.1826 0.0174  -0.0114 0.0161  249  GLU A CB  
2240 C  CG  A GLU A 252 ? 0.3034 0.2365 0.2619 0.0155  -0.0027 -0.0059 249  GLU A CG  
2241 C  CG  B GLU A 252 ? 0.2176 0.2323 0.2212 0.0006  -0.0118 -0.0029 249  GLU A CG  
2242 C  CD  A GLU A 252 ? 0.4281 0.2880 0.3437 -0.0083 0.0104  -0.0133 249  GLU A CD  
2243 C  CD  B GLU A 252 ? 0.2829 0.2668 0.2758 0.0177  -0.0063 -0.0094 249  GLU A CD  
2244 O  OE1 A GLU A 252 ? 0.5307 0.3381 0.3907 0.0073  0.0124  -0.0073 249  GLU A OE1 
2245 O  OE1 B GLU A 252 ? 0.2688 0.3337 0.3262 0.0382  0.0005  -0.0589 249  GLU A OE1 
2246 O  OE2 A GLU A 252 ? 0.4577 0.3534 0.3648 0.0156  0.0247  -0.0396 249  GLU A OE2 
2247 O  OE2 B GLU A 252 ? 0.2973 0.3456 0.2977 -0.0037 0.0111  -0.0222 249  GLU A OE2 
2248 N  N   . HIS A 253 ? 0.1478 0.1487 0.1667 0.0038  0.0009  0.0209  250  HIS A N   
2249 C  CA  . HIS A 253 ? 0.1153 0.1524 0.1592 -0.0097 -0.0059 0.0070  250  HIS A CA  
2250 C  C   . HIS A 253 ? 0.1209 0.1527 0.1663 0.0006  -0.0003 0.0049  250  HIS A C   
2251 O  O   . HIS A 253 ? 0.1263 0.1469 0.1647 -0.0009 -0.0072 0.0093  250  HIS A O   
2252 C  CB  . HIS A 253 ? 0.1395 0.1799 0.1709 -0.0161 -0.0070 0.0107  250  HIS A CB  
2253 C  CG  . HIS A 253 ? 0.1691 0.1785 0.2003 -0.0271 -0.0240 -0.0181 250  HIS A CG  
2254 N  ND1 . HIS A 253 ? 0.2793 0.2119 0.2124 -0.0635 -0.0204 0.0006  250  HIS A ND1 
2255 C  CD2 . HIS A 253 ? 0.1834 0.2205 0.2188 -0.0285 -0.0281 -0.0399 250  HIS A CD2 
2256 C  CE1 . HIS A 253 ? 0.2575 0.1894 0.2389 -0.0392 -0.0398 0.0185  250  HIS A CE1 
2257 N  NE2 . HIS A 253 ? 0.2091 0.2369 0.2297 -0.0475 -0.0611 -0.0177 250  HIS A NE2 
2258 N  N   . CYS A 254 ? 0.1345 0.1484 0.1453 0.0000  -0.0098 0.0120  251  CYS A N   
2259 C  CA  . CYS A 254 ? 0.1337 0.1547 0.1358 0.0065  0.0016  0.0034  251  CYS A CA  
2260 C  C   . CYS A 254 ? 0.1204 0.1526 0.1315 -0.0030 -0.0069 0.0135  251  CYS A C   
2261 O  O   . CYS A 254 ? 0.1303 0.1902 0.1543 0.0075  -0.0047 0.0399  251  CYS A O   
2262 C  CB  . CYS A 254 ? 0.1430 0.1468 0.1386 0.0000  -0.0013 0.0052  251  CYS A CB  
2263 S  SG  . CYS A 254 ? 0.1883 0.1793 0.2130 0.0056  -0.0054 -0.0163 251  CYS A SG  
2264 N  N   . TYR A 255 ? 0.1191 0.1364 0.1143 -0.0036 0.0004  0.0167  252  TYR A N   
2265 C  CA  . TYR A 255 ? 0.1341 0.1333 0.1295 0.0055  0.0103  -0.0055 252  TYR A CA  
2266 C  C   . TYR A 255 ? 0.1434 0.1584 0.1645 0.0010  0.0152  -0.0075 252  TYR A C   
2267 O  O   . TYR A 255 ? 0.1473 0.1532 0.1674 0.0047  0.0172  -0.0053 252  TYR A O   
2268 C  CB  . TYR A 255 ? 0.1448 0.1677 0.1221 -0.0002 0.0140  -0.0003 252  TYR A CB  
2269 C  CG  . TYR A 255 ? 0.1272 0.1540 0.1037 0.0027  -0.0060 -0.0008 252  TYR A CG  
2270 C  CD1 . TYR A 255 ? 0.1152 0.1533 0.1334 -0.0011 0.0058  -0.0071 252  TYR A CD1 
2271 C  CD2 . TYR A 255 ? 0.1381 0.1529 0.1001 0.0200  -0.0037 -0.0285 252  TYR A CD2 
2272 C  CE1 . TYR A 255 ? 0.1246 0.1602 0.1508 0.0177  0.0050  -0.0006 252  TYR A CE1 
2273 C  CE2 . TYR A 255 ? 0.1259 0.1562 0.1363 0.0030  -0.0148 -0.0237 252  TYR A CE2 
2274 C  CZ  . TYR A 255 ? 0.1394 0.1501 0.1051 -0.0026 -0.0167 -0.0155 252  TYR A CZ  
2275 O  OH  . TYR A 255 ? 0.1497 0.1734 0.1464 -0.0268 -0.0037 -0.0122 252  TYR A OH  
2276 N  N   . LYS A 256 ? 0.1583 0.1760 0.2173 -0.0073 0.0255  -0.0222 253  LYS A N   
2277 C  CA  . LYS A 256 ? 0.1681 0.1968 0.2312 -0.0112 0.0211  -0.0324 253  LYS A CA  
2278 C  C   . LYS A 256 ? 0.1705 0.2114 0.2121 -0.0102 0.0080  -0.0262 253  LYS A C   
2279 O  O   . LYS A 256 ? 0.2346 0.2107 0.2475 -0.0555 -0.0060 -0.0061 253  LYS A O   
2280 C  CB  . LYS A 256 ? 0.1702 0.2334 0.2446 -0.0015 0.0136  -0.0290 253  LYS A CB  
2281 C  CG  . LYS A 256 ? 0.2360 0.2706 0.2950 0.0048  0.0251  0.0022  253  LYS A CG  
2282 C  CD  . LYS A 256 ? 0.2546 0.3448 0.3459 0.0242  -0.0121 0.0199  253  LYS A CD  
2283 C  CE  . LYS A 256 ? 0.3521 0.3700 0.4161 0.0229  -0.0029 0.0440  253  LYS A CE  
2284 N  NZ  . LYS A 256 ? 0.3501 0.3693 0.4595 0.0342  0.0117  0.0685  253  LYS A NZ  
2285 N  N   . MSE A 257 ? 0.1897 0.2060 0.2476 -0.0261 0.0104  -0.0211 254  MSE A N   
2286 C  CA  A MSE A 257 ? 0.1921 0.2109 0.2343 -0.0272 0.0020  -0.0143 254  MSE A CA  
2287 C  CA  B MSE A 257 ? 0.2054 0.2250 0.2400 -0.0203 0.0027  -0.0198 254  MSE A CA  
2288 C  C   . MSE A 257 ? 0.2008 0.2185 0.2117 -0.0351 0.0033  -0.0153 254  MSE A C   
2289 O  O   . MSE A 257 ? 0.2443 0.2856 0.2458 -0.0583 0.0435  -0.0491 254  MSE A O   
2290 C  CB  A MSE A 257 ? 0.1896 0.1928 0.2385 -0.0362 0.0021  -0.0123 254  MSE A CB  
2291 C  CB  B MSE A 257 ? 0.2138 0.2409 0.2584 -0.0148 -0.0039 -0.0205 254  MSE A CB  
2292 C  CG  A MSE A 257 ? 0.1642 0.2149 0.2429 -0.0447 0.0014  0.0156  254  MSE A CG  
2293 C  CG  B MSE A 257 ? 0.2521 0.2665 0.2924 0.0112  -0.0186 -0.0269 254  MSE A CG  
2294 SE SE  A MSE A 257 ? 0.2037 0.2282 0.2438 -0.0271 0.0240  0.0161  254  MSE A SE  
2295 SE SE  B MSE A 257 ? 0.3451 0.4407 0.4427 0.0534  -0.0694 -0.0164 254  MSE A SE  
2296 C  CE  A MSE A 257 ? 0.3071 0.1996 0.1741 0.0485  0.0719  0.0214  254  MSE A CE  
2297 C  CE  B MSE A 257 ? 0.2824 0.1262 0.0594 0.1587  -0.0936 -0.0576 254  MSE A CE  
2298 N  N   . TRP A 258 ? 0.1706 0.1607 0.2000 -0.0210 0.0042  -0.0018 255  TRP A N   
2299 C  CA  . TRP A 258 ? 0.1681 0.1509 0.1868 -0.0083 0.0031  0.0016  255  TRP A CA  
2300 C  C   . TRP A 258 ? 0.1491 0.1412 0.1487 -0.0067 -0.0045 -0.0057 255  TRP A C   
2301 O  O   . TRP A 258 ? 0.1540 0.1364 0.1652 -0.0054 -0.0014 -0.0087 255  TRP A O   
2302 C  CB  . TRP A 258 ? 0.1715 0.1604 0.1959 -0.0131 0.0269  0.0004  255  TRP A CB  
2303 C  CG  . TRP A 258 ? 0.1489 0.1488 0.1481 -0.0076 -0.0121 0.0139  255  TRP A CG  
2304 C  CD1 . TRP A 258 ? 0.2262 0.1650 0.1862 -0.0212 -0.0159 0.0323  255  TRP A CD1 
2305 C  CD2 . TRP A 258 ? 0.1728 0.1400 0.1789 -0.0341 0.0050  0.0144  255  TRP A CD2 
2306 N  NE1 . TRP A 258 ? 0.2131 0.1549 0.1980 0.0137  -0.0165 -0.0009 255  TRP A NE1 
2307 C  CE2 . TRP A 258 ? 0.1449 0.1681 0.1906 -0.0327 0.0108  0.0031  255  TRP A CE2 
2308 C  CE3 . TRP A 258 ? 0.2282 0.1487 0.2052 -0.0166 0.0118  0.0209  255  TRP A CE3 
2309 C  CZ2 . TRP A 258 ? 0.1530 0.1544 0.2064 -0.0053 0.0043  -0.0064 255  TRP A CZ2 
2310 C  CZ3 . TRP A 258 ? 0.1799 0.1942 0.2064 -0.0193 0.0379  0.0150  255  TRP A CZ3 
2311 C  CH2 . TRP A 258 ? 0.1751 0.1770 0.2354 -0.0396 0.0318  0.0162  255  TRP A CH2 
2312 N  N   . ASP A 259 ? 0.1531 0.1582 0.1556 -0.0059 -0.0106 -0.0016 256  ASP A N   
2313 C  CA  A ASP A 259 ? 0.1621 0.1559 0.1439 -0.0119 -0.0015 -0.0128 256  ASP A CA  
2314 C  CA  B ASP A 259 ? 0.1667 0.1560 0.1490 -0.0061 -0.0020 -0.0058 256  ASP A CA  
2315 C  C   . ASP A 259 ? 0.1765 0.1482 0.1365 0.0023  0.0067  -0.0052 256  ASP A C   
2316 O  O   . ASP A 259 ? 0.2258 0.1573 0.1757 0.0162  0.0187  -0.0089 256  ASP A O   
2317 C  CB  A ASP A 259 ? 0.1750 0.1701 0.1377 -0.0162 -0.0083 -0.0239 256  ASP A CB  
2318 C  CB  B ASP A 259 ? 0.1729 0.1655 0.1511 -0.0082 -0.0053 -0.0096 256  ASP A CB  
2319 C  CG  A ASP A 259 ? 0.1916 0.2184 0.1436 -0.0196 -0.0085 -0.0276 256  ASP A CG  
2320 C  CG  B ASP A 259 ? 0.1959 0.1897 0.1612 -0.0100 -0.0183 -0.0108 256  ASP A CG  
2321 O  OD1 A ASP A 259 ? 0.2420 0.3316 0.2185 -0.0566 0.0307  -0.0699 256  ASP A OD1 
2322 O  OD1 B ASP A 259 ? 0.2602 0.2367 0.2145 -0.0126 -0.0054 0.0072  256  ASP A OD1 
2323 O  OD2 A ASP A 259 ? 0.3128 0.3427 0.1616 -0.0157 -0.0318 -0.0064 256  ASP A OD2 
2324 O  OD2 B ASP A 259 ? 0.3130 0.2378 0.1838 -0.0147 -0.0243 -0.0302 256  ASP A OD2 
2325 N  N   . TRP A 260 ? 0.1508 0.1342 0.1353 0.0000  0.0012  0.0057  257  TRP A N   
2326 C  CA  . TRP A 260 ? 0.1318 0.1401 0.1313 0.0022  -0.0022 -0.0014 257  TRP A CA  
2327 C  C   . TRP A 260 ? 0.1349 0.1278 0.1228 -0.0056 0.0049  -0.0090 257  TRP A C   
2328 O  O   . TRP A 260 ? 0.1467 0.1390 0.1127 -0.0060 -0.0022 0.0011  257  TRP A O   
2329 C  CB  . TRP A 260 ? 0.1250 0.1564 0.1162 -0.0021 -0.0025 -0.0031 257  TRP A CB  
2330 C  CG  . TRP A 260 ? 0.1342 0.1412 0.1199 0.0144  -0.0160 0.0029  257  TRP A CG  
2331 C  CD1 . TRP A 260 ? 0.1550 0.1803 0.1393 0.0118  -0.0212 -0.0036 257  TRP A CD1 
2332 C  CD2 . TRP A 260 ? 0.1231 0.1532 0.1329 0.0117  0.0081  0.0009  257  TRP A CD2 
2333 N  NE1 . TRP A 260 ? 0.1713 0.1653 0.1835 0.0313  -0.0074 -0.0091 257  TRP A NE1 
2334 C  CE2 . TRP A 260 ? 0.1433 0.1755 0.1651 0.0069  0.0001  -0.0091 257  TRP A CE2 
2335 C  CE3 . TRP A 260 ? 0.1259 0.1526 0.1298 -0.0087 -0.0105 0.0129  257  TRP A CE3 
2336 C  CZ2 . TRP A 260 ? 0.1309 0.1728 0.1705 0.0188  -0.0085 0.0062  257  TRP A CZ2 
2337 C  CZ3 . TRP A 260 ? 0.1646 0.1674 0.1625 -0.0064 0.0030  -0.0085 257  TRP A CZ3 
2338 C  CH2 . TRP A 260 ? 0.1234 0.1678 0.1775 0.0036  0.0180  -0.0100 257  TRP A CH2 
2339 N  N   . VAL A 261 ? 0.1420 0.1374 0.1184 -0.0100 -0.0119 0.0089  258  VAL A N   
2340 C  CA  . VAL A 261 ? 0.1260 0.1349 0.1214 0.0042  -0.0191 0.0003  258  VAL A CA  
2341 C  C   . VAL A 261 ? 0.1333 0.1235 0.1422 -0.0041 -0.0049 -0.0077 258  VAL A C   
2342 O  O   . VAL A 261 ? 0.1386 0.1389 0.1585 -0.0064 0.0097  -0.0057 258  VAL A O   
2343 C  CB  . VAL A 261 ? 0.1495 0.1187 0.1173 0.0003  -0.0192 -0.0165 258  VAL A CB  
2344 C  CG1 . VAL A 261 ? 0.1628 0.1632 0.1347 0.0123  -0.0521 -0.0372 258  VAL A CG1 
2345 C  CG2 . VAL A 261 ? 0.1448 0.1378 0.1889 0.0291  -0.0179 -0.0156 258  VAL A CG2 
2346 N  N   . GLY A 262 ? 0.1397 0.1351 0.1369 0.0072  0.0015  0.0021  259  GLY A N   
2347 C  CA  . GLY A 262 ? 0.1356 0.1353 0.1588 0.0066  -0.0013 -0.0044 259  GLY A CA  
2348 C  C   . GLY A 262 ? 0.1300 0.1305 0.1277 0.0129  -0.0125 -0.0135 259  GLY A C   
2349 O  O   . GLY A 262 ? 0.1376 0.1356 0.1263 -0.0012 -0.0050 -0.0222 259  GLY A O   
2350 N  N   . GLY A 263 ? 0.1402 0.1451 0.1401 0.0032  -0.0094 -0.0125 260  GLY A N   
2351 C  CA  . GLY A 263 ? 0.1288 0.1352 0.1569 0.0135  0.0020  -0.0163 260  GLY A CA  
2352 C  C   . GLY A 263 ? 0.1467 0.1381 0.1513 0.0023  0.0045  -0.0127 260  GLY A C   
2353 O  O   . GLY A 263 ? 0.1358 0.1391 0.1738 0.0025  -0.0084 0.0023  260  GLY A O   
2354 N  N   . ARG A 264 ? 0.1435 0.1317 0.1546 0.0057  -0.0077 -0.0008 261  ARG A N   
2355 C  CA  . ARG A 264 ? 0.1454 0.1387 0.1447 0.0044  -0.0057 -0.0016 261  ARG A CA  
2356 C  C   . ARG A 264 ? 0.1624 0.1290 0.1268 0.0077  0.0021  0.0084  261  ARG A C   
2357 O  O   . ARG A 264 ? 0.1431 0.1540 0.1305 0.0074  -0.0071 0.0000  261  ARG A O   
2358 C  CB  . ARG A 264 ? 0.1463 0.1436 0.1561 0.0030  -0.0070 -0.0086 261  ARG A CB  
2359 C  CG  . ARG A 264 ? 0.1357 0.1402 0.1639 -0.0005 -0.0139 -0.0025 261  ARG A CG  
2360 C  CD  . ARG A 264 ? 0.1512 0.1079 0.1527 -0.0020 -0.0225 -0.0050 261  ARG A CD  
2361 N  NE  . ARG A 264 ? 0.1383 0.1177 0.1218 -0.0113 0.0129  -0.0013 261  ARG A NE  
2362 C  CZ  . ARG A 264 ? 0.1274 0.0972 0.1272 0.0191  0.0023  -0.0057 261  ARG A CZ  
2363 N  NH1 . ARG A 264 ? 0.1412 0.1299 0.1389 0.0059  -0.0118 0.0065  261  ARG A NH1 
2364 N  NH2 . ARG A 264 ? 0.1621 0.1558 0.1314 -0.0142 0.0151  -0.0060 261  ARG A NH2 
2365 N  N   . TYR A 265 ? 0.1180 0.1327 0.1428 0.0067  -0.0015 -0.0195 262  TYR A N   
2366 C  CA  . TYR A 265 ? 0.1324 0.1289 0.1337 0.0072  0.0150  -0.0062 262  TYR A CA  
2367 C  C   . TYR A 265 ? 0.1292 0.1323 0.1199 -0.0046 -0.0031 -0.0147 262  TYR A C   
2368 O  O   . TYR A 265 ? 0.1405 0.1215 0.1383 -0.0008 0.0037  0.0107  262  TYR A O   
2369 C  CB  . TYR A 265 ? 0.1449 0.1267 0.1463 -0.0017 0.0090  -0.0057 262  TYR A CB  
2370 C  CG  . TYR A 265 ? 0.1285 0.1134 0.1266 0.0082  -0.0035 -0.0127 262  TYR A CG  
2371 C  CD1 . TYR A 265 ? 0.1368 0.1196 0.1362 0.0072  0.0184  -0.0124 262  TYR A CD1 
2372 C  CD2 . TYR A 265 ? 0.1416 0.1362 0.1233 0.0139  0.0014  -0.0047 262  TYR A CD2 
2373 C  CE1 . TYR A 265 ? 0.1506 0.1264 0.1141 -0.0058 -0.0037 0.0077  262  TYR A CE1 
2374 C  CE2 . TYR A 265 ? 0.1118 0.1324 0.1507 0.0045  -0.0153 -0.0104 262  TYR A CE2 
2375 C  CZ  . TYR A 265 ? 0.1274 0.1351 0.1453 0.0101  0.0054  -0.0099 262  TYR A CZ  
2376 O  OH  . TYR A 265 ? 0.1663 0.1426 0.1530 -0.0136 0.0170  -0.0037 262  TYR A OH  
2377 N  N   . SER A 266 ? 0.1293 0.1290 0.1244 0.0011  0.0041  0.0000  263  SER A N   
2378 C  CA  . SER A 266 ? 0.1358 0.1187 0.1258 -0.0114 0.0058  -0.0108 263  SER A CA  
2379 C  C   . SER A 266 ? 0.1289 0.1191 0.1139 -0.0012 -0.0119 -0.0059 263  SER A C   
2380 O  O   . SER A 266 ? 0.1364 0.1068 0.1249 -0.0006 -0.0013 -0.0098 263  SER A O   
2381 C  CB  . SER A 266 ? 0.1538 0.1435 0.1241 -0.0067 0.0062  0.0011  263  SER A CB  
2382 O  OG  . SER A 266 ? 0.1517 0.1516 0.1489 -0.0019 0.0123  -0.0038 263  SER A OG  
2383 N  N   . LEU A 267 ? 0.1386 0.1192 0.1280 0.0130  -0.0052 -0.0062 264  LEU A N   
2384 C  CA  . LEU A 267 ? 0.1266 0.1127 0.1215 0.0041  0.0009  0.0005  264  LEU A CA  
2385 C  C   . LEU A 267 ? 0.1181 0.1213 0.1167 -0.0027 0.0039  0.0014  264  LEU A C   
2386 O  O   . LEU A 267 ? 0.1367 0.1233 0.1273 -0.0071 -0.0044 -0.0028 264  LEU A O   
2387 C  CB  . LEU A 267 ? 0.1290 0.1431 0.1383 0.0152  0.0016  0.0000  264  LEU A CB  
2388 C  CG  . LEU A 267 ? 0.1295 0.1312 0.1214 -0.0091 -0.0001 -0.0079 264  LEU A CG  
2389 C  CD1 . LEU A 267 ? 0.1478 0.1283 0.1457 0.0184  0.0022  -0.0372 264  LEU A CD1 
2390 C  CD2 . LEU A 267 ? 0.1733 0.1390 0.1464 0.0149  -0.0330 0.0105  264  LEU A CD2 
2391 N  N   . TRP A 268 ? 0.1100 0.1109 0.1330 -0.0025 0.0033  -0.0062 265  TRP A N   
2392 C  CA  . TRP A 268 ? 0.1125 0.1134 0.1144 0.0042  -0.0034 -0.0046 265  TRP A CA  
2393 C  C   . TRP A 268 ? 0.1290 0.1174 0.1167 0.0065  0.0009  0.0014  265  TRP A C   
2394 O  O   . TRP A 268 ? 0.1328 0.1347 0.1097 0.0252  0.0166  0.0077  265  TRP A O   
2395 C  CB  . TRP A 268 ? 0.1197 0.1160 0.1036 0.0011  0.0038  -0.0027 265  TRP A CB  
2396 C  CG  . TRP A 268 ? 0.1060 0.1228 0.1170 0.0006  -0.0063 -0.0063 265  TRP A CG  
2397 C  CD1 . TRP A 268 ? 0.1087 0.1323 0.1339 -0.0024 0.0070  -0.0099 265  TRP A CD1 
2398 C  CD2 . TRP A 268 ? 0.1124 0.1245 0.1027 -0.0146 0.0072  -0.0020 265  TRP A CD2 
2399 N  NE1 . TRP A 268 ? 0.1420 0.1138 0.1205 0.0040  0.0048  -0.0011 265  TRP A NE1 
2400 C  CE2 . TRP A 268 ? 0.1132 0.1342 0.1018 -0.0024 -0.0126 -0.0056 265  TRP A CE2 
2401 C  CE3 . TRP A 268 ? 0.1293 0.1284 0.1024 0.0036  -0.0010 0.0088  265  TRP A CE3 
2402 C  CZ2 . TRP A 268 ? 0.1301 0.1244 0.1200 0.0012  -0.0148 0.0093  265  TRP A CZ2 
2403 C  CZ3 . TRP A 268 ? 0.1464 0.1387 0.0883 -0.0104 0.0065  -0.0146 265  TRP A CZ3 
2404 C  CH2 . TRP A 268 ? 0.1514 0.1327 0.1083 0.0045  -0.0073 0.0022  265  TRP A CH2 
2405 N  N   . SER A 269 ? 0.1244 0.1362 0.1182 0.0049  -0.0025 0.0099  266  SER A N   
2406 C  CA  . SER A 269 ? 0.1075 0.1365 0.1187 0.0070  -0.0064 0.0034  266  SER A CA  
2407 C  C   . SER A 269 ? 0.1161 0.1315 0.1221 0.0047  0.0040  0.0103  266  SER A C   
2408 O  O   . SER A 269 ? 0.1348 0.1300 0.1106 -0.0071 -0.0088 -0.0069 266  SER A O   
2409 C  CB  . SER A 269 ? 0.1027 0.1272 0.1067 0.0099  -0.0090 0.0036  266  SER A CB  
2410 O  OG  . SER A 269 ? 0.1119 0.1388 0.1416 -0.0050 0.0070  -0.0082 266  SER A OG  
2411 N  N   . SER A 270 ? 0.1154 0.1213 0.1213 0.0004  -0.0022 0.0026  267  SER A N   
2412 C  CA  . SER A 270 ? 0.1171 0.1204 0.1320 0.0004  0.0096  0.0081  267  SER A CA  
2413 C  C   . SER A 270 ? 0.1192 0.1292 0.1358 -0.0053 -0.0069 0.0139  267  SER A C   
2414 O  O   . SER A 270 ? 0.1171 0.1213 0.1433 0.0027  0.0003  0.0200  267  SER A O   
2415 C  CB  . SER A 270 ? 0.1187 0.1399 0.1312 -0.0043 0.0029  0.0143  267  SER A CB  
2416 O  OG  . SER A 270 ? 0.1373 0.1321 0.1707 0.0181  -0.0101 -0.0003 267  SER A OG  
2417 N  N   . ILE A 271 ? 0.1161 0.1215 0.1588 -0.0019 -0.0014 0.0061  268  ILE A N   
2418 C  CA  . ILE A 271 ? 0.1431 0.1221 0.1880 0.0047  0.0187  0.0140  268  ILE A CA  
2419 C  C   . ILE A 271 ? 0.1469 0.1453 0.2027 -0.0067 -0.0044 0.0238  268  ILE A C   
2420 O  O   . ILE A 271 ? 0.1397 0.1772 0.2459 -0.0107 -0.0120 0.0444  268  ILE A O   
2421 C  CB  . ILE A 271 ? 0.1392 0.1246 0.2072 0.0098  0.0233  0.0120  268  ILE A CB  
2422 C  CG1 . ILE A 271 ? 0.1818 0.1277 0.2169 -0.0245 0.0695  0.0016  268  ILE A CG1 
2423 C  CG2 . ILE A 271 ? 0.1470 0.1159 0.2398 0.0134  0.0082  0.0181  268  ILE A CG2 
2424 C  CD1 . ILE A 271 ? 0.1787 0.2027 0.2449 0.0003  0.0859  0.0032  268  ILE A CD1 
2425 N  N   . GLY A 272 ? 0.1320 0.1565 0.1733 -0.0274 -0.0114 0.0238  269  GLY A N   
2426 C  CA  . GLY A 272 ? 0.1489 0.1818 0.1493 -0.0244 0.0025  0.0142  269  GLY A CA  
2427 C  C   . GLY A 272 ? 0.1413 0.1843 0.1399 -0.0275 -0.0016 0.0103  269  GLY A C   
2428 O  O   . GLY A 272 ? 0.1493 0.2271 0.1317 -0.0317 -0.0009 0.0033  269  GLY A O   
2429 N  N   . MSE A 273 ? 0.1166 0.1539 0.1296 -0.0134 -0.0067 0.0111  270  MSE A N   
2430 C  CA  . MSE A 273 ? 0.1305 0.1588 0.1375 0.0014  -0.0026 0.0005  270  MSE A CA  
2431 C  C   . MSE A 273 ? 0.1227 0.1309 0.1117 -0.0063 -0.0004 -0.0038 270  MSE A C   
2432 O  O   . MSE A 273 ? 0.1181 0.1222 0.1152 0.0060  -0.0038 -0.0069 270  MSE A O   
2433 C  CB  . MSE A 273 ? 0.1282 0.1579 0.1532 -0.0188 -0.0094 -0.0015 270  MSE A CB  
2434 C  CG  . MSE A 273 ? 0.1607 0.1817 0.1149 0.0213  -0.0152 0.0212  270  MSE A CG  
2435 SE SE  . MSE A 273 ? 0.1705 0.1981 0.1506 0.0062  -0.0059 0.0088  270  MSE A SE  
2436 C  CE  . MSE A 273 ? 0.1793 0.2237 0.1496 0.0664  -0.0320 0.0286  270  MSE A CE  
2437 N  N   . SER A 274 ? 0.1117 0.1397 0.1082 0.0045  -0.0128 -0.0017 271  SER A N   
2438 C  CA  . SER A 274 ? 0.1121 0.1374 0.1399 -0.0041 -0.0048 0.0048  271  SER A CA  
2439 C  C   . SER A 274 ? 0.1220 0.1367 0.1354 -0.0051 0.0017  0.0088  271  SER A C   
2440 O  O   . SER A 274 ? 0.1266 0.1511 0.1084 -0.0095 -0.0023 0.0010  271  SER A O   
2441 C  CB  . SER A 274 ? 0.1232 0.1484 0.1532 -0.0093 0.0071  0.0046  271  SER A CB  
2442 O  OG  . SER A 274 ? 0.1783 0.1380 0.1685 0.0165  0.0134  -0.0031 271  SER A OG  
2443 N  N   . ILE A 275 ? 0.1226 0.1262 0.1345 -0.0025 0.0068  0.0070  272  ILE A N   
2444 C  CA  . ILE A 275 ? 0.1324 0.1348 0.1249 -0.0044 -0.0037 0.0073  272  ILE A CA  
2445 C  C   . ILE A 275 ? 0.1092 0.1325 0.1188 0.0011  0.0085  0.0037  272  ILE A C   
2446 O  O   . ILE A 275 ? 0.1305 0.1426 0.1211 -0.0052 -0.0002 0.0061  272  ILE A O   
2447 C  CB  . ILE A 275 ? 0.1327 0.1224 0.1267 0.0137  -0.0024 0.0020  272  ILE A CB  
2448 C  CG1 . ILE A 275 ? 0.1488 0.1320 0.1008 -0.0022 -0.0006 0.0162  272  ILE A CG1 
2449 C  CG2 . ILE A 275 ? 0.1450 0.1849 0.1089 -0.0094 0.0079  0.0118  272  ILE A CG2 
2450 C  CD1 . ILE A 275 ? 0.1335 0.1260 0.1467 -0.0249 -0.0197 0.0186  272  ILE A CD1 
2451 N  N   . ALA A 276 ? 0.1091 0.1245 0.1179 -0.0039 0.0052  0.0065  273  ALA A N   
2452 C  CA  . ALA A 276 ? 0.1261 0.1339 0.1035 0.0020  0.0042  0.0096  273  ALA A CA  
2453 C  C   . ALA A 276 ? 0.1353 0.1224 0.1042 0.0020  -0.0014 0.0157  273  ALA A C   
2454 O  O   . ALA A 276 ? 0.1581 0.1510 0.1117 0.0030  0.0132  0.0077  273  ALA A O   
2455 C  CB  . ALA A 276 ? 0.1304 0.1491 0.1212 0.0141  -0.0107 0.0341  273  ALA A CB  
2456 N  N   . PHE A 277 ? 0.1333 0.1375 0.1179 0.0010  0.0080  -0.0117 274  PHE A N   
2457 C  CA  . PHE A 277 ? 0.1297 0.1255 0.1122 0.0015  0.0082  -0.0011 274  PHE A CA  
2458 C  C   . PHE A 277 ? 0.1356 0.1389 0.1333 -0.0106 -0.0029 -0.0001 274  PHE A C   
2459 O  O   . PHE A 277 ? 0.1676 0.1679 0.1618 -0.0332 -0.0239 0.0148  274  PHE A O   
2460 C  CB  . PHE A 277 ? 0.1223 0.1478 0.0904 0.0052  -0.0016 -0.0002 274  PHE A CB  
2461 C  CG  . PHE A 277 ? 0.1025 0.1057 0.1024 0.0086  -0.0015 -0.0068 274  PHE A CG  
2462 C  CD1 . PHE A 277 ? 0.1155 0.1309 0.1285 0.0166  -0.0068 0.0029  274  PHE A CD1 
2463 C  CD2 . PHE A 277 ? 0.1332 0.1459 0.1039 -0.0199 0.0070  0.0037  274  PHE A CD2 
2464 C  CE1 . PHE A 277 ? 0.1445 0.1176 0.1173 0.0020  0.0019  0.0037  274  PHE A CE1 
2465 C  CE2 . PHE A 277 ? 0.1377 0.1650 0.1108 -0.0014 0.0180  0.0103  274  PHE A CE2 
2466 C  CZ  . PHE A 277 ? 0.1310 0.1662 0.1317 0.0067  0.0160  -0.0131 274  PHE A CZ  
2467 N  N   . ALA A 278 ? 0.1270 0.1375 0.1302 0.0074  -0.0119 0.0032  275  ALA A N   
2468 C  CA  . ALA A 278 ? 0.1389 0.1433 0.1147 0.0033  -0.0038 0.0043  275  ALA A CA  
2469 C  C   . ALA A 278 ? 0.1359 0.1521 0.1137 -0.0075 -0.0032 -0.0076 275  ALA A C   
2470 O  O   . ALA A 278 ? 0.1418 0.1633 0.1127 0.0021  -0.0173 -0.0008 275  ALA A O   
2471 C  CB  . ALA A 278 ? 0.1418 0.1283 0.1310 0.0073  -0.0226 0.0119  275  ALA A CB  
2472 N  N   . ILE A 279 ? 0.1200 0.1654 0.0825 0.0002  -0.0046 -0.0073 276  ILE A N   
2473 C  CA  . ILE A 279 ? 0.1285 0.1471 0.0966 0.0072  0.0116  -0.0054 276  ILE A CA  
2474 C  C   . ILE A 279 ? 0.1295 0.1351 0.1141 0.0028  0.0128  -0.0022 276  ILE A C   
2475 O  O   . ILE A 279 ? 0.1264 0.1501 0.1099 0.0187  -0.0004 -0.0195 276  ILE A O   
2476 C  CB  . ILE A 279 ? 0.1291 0.1523 0.1028 0.0072  0.0198  0.0029  276  ILE A CB  
2477 C  CG1 . ILE A 279 ? 0.1328 0.1511 0.1334 0.0051  0.0161  -0.0054 276  ILE A CG1 
2478 C  CG2 . ILE A 279 ? 0.1754 0.1940 0.1409 0.0435  0.0306  0.0298  276  ILE A CG2 
2479 C  CD1 . ILE A 279 ? 0.1832 0.1430 0.1737 -0.0215 0.0642  -0.0102 276  ILE A CD1 
2480 N  N   . GLY A 280 ? 0.1220 0.1404 0.1161 -0.0008 0.0174  0.0068  277  GLY A N   
2481 C  CA  . GLY A 280 ? 0.1195 0.1488 0.1105 -0.0017 0.0053  0.0012  277  GLY A CA  
2482 C  C   . GLY A 280 ? 0.1301 0.1429 0.1066 -0.0088 -0.0013 0.0036  277  GLY A C   
2483 O  O   . GLY A 280 ? 0.1399 0.1384 0.1067 0.0046  -0.0013 0.0154  277  GLY A O   
2484 N  N   . TYR A 281 ? 0.1273 0.1377 0.1122 -0.0068 -0.0066 0.0085  278  TYR A N   
2485 C  CA  . TYR A 281 ? 0.1409 0.1407 0.1093 -0.0137 -0.0123 0.0070  278  TYR A CA  
2486 C  C   . TYR A 281 ? 0.1284 0.1337 0.1197 -0.0043 -0.0192 0.0132  278  TYR A C   
2487 O  O   . TYR A 281 ? 0.1422 0.1521 0.1370 -0.0185 -0.0166 0.0065  278  TYR A O   
2488 C  CB  . TYR A 281 ? 0.1482 0.1320 0.1116 -0.0132 -0.0054 0.0124  278  TYR A CB  
2489 C  CG  . TYR A 281 ? 0.1293 0.1389 0.1086 0.0029  -0.0147 -0.0011 278  TYR A CG  
2490 C  CD1 . TYR A 281 ? 0.1267 0.1427 0.1339 0.0214  -0.0064 0.0038  278  TYR A CD1 
2491 C  CD2 . TYR A 281 ? 0.1342 0.1309 0.0973 -0.0013 0.0018  -0.0002 278  TYR A CD2 
2492 C  CE1 . TYR A 281 ? 0.1419 0.1588 0.1354 0.0057  -0.0132 0.0141  278  TYR A CE1 
2493 C  CE2 . TYR A 281 ? 0.1151 0.1502 0.1513 -0.0022 -0.0029 -0.0040 278  TYR A CE2 
2494 C  CZ  . TYR A 281 ? 0.1162 0.1399 0.1247 -0.0015 -0.0205 -0.0090 278  TYR A CZ  
2495 O  OH  . TYR A 281 ? 0.1533 0.1502 0.1283 -0.0079 -0.0346 -0.0053 278  TYR A OH  
2496 N  N   . ASP A 282 ? 0.1455 0.1413 0.1272 -0.0023 -0.0102 0.0013  279  ASP A N   
2497 C  CA  A ASP A 282 ? 0.1272 0.1441 0.1257 -0.0026 -0.0081 0.0019  279  ASP A CA  
2498 C  CA  B ASP A 282 ? 0.1307 0.1498 0.1257 -0.0048 -0.0082 0.0018  279  ASP A CA  
2499 C  C   . ASP A 282 ? 0.1259 0.1390 0.1177 -0.0008 -0.0098 -0.0104 279  ASP A C   
2500 O  O   . ASP A 282 ? 0.1259 0.1545 0.1110 -0.0057 -0.0108 0.0071  279  ASP A O   
2501 C  CB  A ASP A 282 ? 0.1553 0.1425 0.1554 0.0022  0.0040  -0.0062 279  ASP A CB  
2502 C  CB  B ASP A 282 ? 0.1433 0.1528 0.1374 -0.0036 -0.0037 -0.0017 279  ASP A CB  
2503 C  CG  A ASP A 282 ? 0.2446 0.1686 0.1932 0.0161  -0.0055 -0.0205 279  ASP A CG  
2504 C  CG  B ASP A 282 ? 0.1736 0.2170 0.1576 -0.0132 0.0019  -0.0051 279  ASP A CG  
2505 O  OD1 A ASP A 282 ? 0.3537 0.1714 0.2479 0.0321  -0.0176 0.0288  279  ASP A OD1 
2506 O  OD1 B ASP A 282 ? 0.1862 0.2494 0.1755 0.0046  0.0159  -0.0485 279  ASP A OD1 
2507 O  OD2 A ASP A 282 ? 0.3223 0.2252 0.3203 -0.0270 -0.0170 -0.0282 279  ASP A OD2 
2508 O  OD2 B ASP A 282 ? 0.2434 0.2487 0.1812 -0.0231 -0.0071 0.0312  279  ASP A OD2 
2509 N  N   . ASN A 283 ? 0.1186 0.1415 0.1276 -0.0030 -0.0186 -0.0003 280  ASN A N   
2510 C  CA  . ASN A 283 ? 0.1157 0.1309 0.1242 -0.0100 -0.0105 -0.0119 280  ASN A CA  
2511 C  C   . ASN A 283 ? 0.1280 0.1267 0.1126 0.0052  -0.0096 0.0014  280  ASN A C   
2512 O  O   . ASN A 283 ? 0.1281 0.1442 0.1059 -0.0062 -0.0150 -0.0019 280  ASN A O   
2513 C  CB  . ASN A 283 ? 0.1327 0.1302 0.1118 -0.0169 -0.0240 -0.0185 280  ASN A CB  
2514 C  CG  . ASN A 283 ? 0.1147 0.1381 0.0888 -0.0222 0.0152  -0.0149 280  ASN A CG  
2515 O  OD1 . ASN A 283 ? 0.1300 0.1791 0.1093 -0.0183 0.0121  -0.0121 280  ASN A OD1 
2516 N  ND2 . ASN A 283 ? 0.1230 0.1337 0.1188 -0.0194 -0.0192 -0.0011 280  ASN A ND2 
2517 N  N   . PHE A 284 ? 0.1275 0.1418 0.1100 -0.0055 -0.0115 -0.0071 281  PHE A N   
2518 C  CA  . PHE A 284 ? 0.1373 0.1343 0.1096 -0.0026 -0.0034 -0.0082 281  PHE A CA  
2519 C  C   . PHE A 284 ? 0.1377 0.1367 0.1191 -0.0097 -0.0095 -0.0088 281  PHE A C   
2520 O  O   . PHE A 284 ? 0.1269 0.1253 0.0998 -0.0209 -0.0032 -0.0035 281  PHE A O   
2521 C  CB  . PHE A 284 ? 0.1477 0.1302 0.1160 0.0050  0.0050  -0.0113 281  PHE A CB  
2522 C  CG  . PHE A 284 ? 0.1299 0.1195 0.1007 0.0070  -0.0100 -0.0065 281  PHE A CG  
2523 C  CD1 . PHE A 284 ? 0.1400 0.1396 0.1426 0.0149  -0.0186 0.0022  281  PHE A CD1 
2524 C  CD2 . PHE A 284 ? 0.1635 0.1270 0.1295 0.0208  0.0079  -0.0155 281  PHE A CD2 
2525 C  CE1 . PHE A 284 ? 0.1629 0.1333 0.1752 0.0155  -0.0051 -0.0061 281  PHE A CE1 
2526 C  CE2 . PHE A 284 ? 0.1507 0.1824 0.1274 -0.0013 -0.0028 -0.0082 281  PHE A CE2 
2527 C  CZ  . PHE A 284 ? 0.1492 0.1609 0.1146 -0.0173 0.0160  -0.0054 281  PHE A CZ  
2528 N  N   . GLU A 285 ? 0.1317 0.1355 0.1216 -0.0125 -0.0061 -0.0091 282  GLU A N   
2529 C  CA  A GLU A 285 ? 0.1257 0.1457 0.1297 -0.0065 -0.0131 -0.0022 282  GLU A CA  
2530 C  CA  B GLU A 285 ? 0.1323 0.1512 0.1339 -0.0064 -0.0105 -0.0020 282  GLU A CA  
2531 C  C   . GLU A 285 ? 0.1243 0.1408 0.1294 -0.0070 -0.0088 -0.0008 282  GLU A C   
2532 O  O   . GLU A 285 ? 0.1289 0.1545 0.1262 -0.0151 -0.0186 0.0002  282  GLU A O   
2533 C  CB  A GLU A 285 ? 0.1278 0.1510 0.1356 -0.0097 -0.0101 -0.0090 282  GLU A CB  
2534 C  CB  B GLU A 285 ? 0.1393 0.1625 0.1462 -0.0055 -0.0077 -0.0075 282  GLU A CB  
2535 C  CG  A GLU A 285 ? 0.1641 0.1682 0.1718 -0.0127 -0.0310 0.0073  282  GLU A CG  
2536 C  CG  B GLU A 285 ? 0.1923 0.2026 0.1895 -0.0017 -0.0168 0.0066  282  GLU A CG  
2537 C  CD  A GLU A 285 ? 0.1559 0.2043 0.1834 0.0050  -0.0247 0.0130  282  GLU A CD  
2538 C  CD  B GLU A 285 ? 0.2336 0.2477 0.2553 0.0370  0.0042  0.0025  282  GLU A CD  
2539 O  OE1 A GLU A 285 ? 0.2101 0.2233 0.1823 -0.0134 -0.0149 0.0494  282  GLU A OE1 
2540 O  OE1 B GLU A 285 ? 0.3294 0.2930 0.3047 0.0412  -0.0152 -0.0075 282  GLU A OE1 
2541 O  OE2 A GLU A 285 ? 0.1510 0.1619 0.1944 0.0262  -0.0135 0.0138  282  GLU A OE2 
2542 O  OE2 B GLU A 285 ? 0.2399 0.3331 0.2800 0.0616  0.0074  0.0081  282  GLU A OE2 
2543 N  N   . LYS A 286 ? 0.1098 0.1320 0.1177 -0.0041 -0.0060 0.0095  283  LYS A N   
2544 C  CA  . LYS A 286 ? 0.0985 0.1157 0.1123 -0.0020 0.0004  0.0047  283  LYS A CA  
2545 C  C   . LYS A 286 ? 0.1096 0.1182 0.1118 0.0002  -0.0174 -0.0049 283  LYS A C   
2546 O  O   . LYS A 286 ? 0.1244 0.1382 0.0892 -0.0042 -0.0179 -0.0061 283  LYS A O   
2547 C  CB  . LYS A 286 ? 0.1004 0.1352 0.0996 -0.0055 0.0093  -0.0089 283  LYS A CB  
2548 C  CG  . LYS A 286 ? 0.1357 0.1436 0.1456 0.0060  0.0033  0.0036  283  LYS A CG  
2549 C  CD  . LYS A 286 ? 0.1756 0.1962 0.1563 0.0020  -0.0047 -0.0229 283  LYS A CD  
2550 C  CE  . LYS A 286 ? 0.3017 0.2601 0.2644 -0.0262 -0.0004 -0.0299 283  LYS A CE  
2551 N  NZ  . LYS A 286 ? 0.3432 0.2851 0.3572 0.0090  0.0070  -0.0774 283  LYS A NZ  
2552 N  N   . LEU A 287 ? 0.1212 0.1069 0.1089 -0.0177 -0.0024 -0.0066 284  LEU A N   
2553 C  CA  . LEU A 287 ? 0.1176 0.1289 0.1166 -0.0050 -0.0105 -0.0205 284  LEU A CA  
2554 C  C   . LEU A 287 ? 0.1060 0.1134 0.1105 0.0046  0.0008  0.0035  284  LEU A C   
2555 O  O   . LEU A 287 ? 0.1219 0.1256 0.1261 -0.0013 -0.0163 -0.0034 284  LEU A O   
2556 C  CB  . LEU A 287 ? 0.1115 0.1317 0.1158 -0.0051 -0.0030 -0.0208 284  LEU A CB  
2557 C  CG  . LEU A 287 ? 0.1250 0.1548 0.1029 0.0128  0.0045  -0.0213 284  LEU A CG  
2558 C  CD1 . LEU A 287 ? 0.1992 0.1419 0.1069 0.0143  0.0182  0.0207  284  LEU A CD1 
2559 C  CD2 . LEU A 287 ? 0.1627 0.1764 0.1061 0.0368  0.0327  0.0085  284  LEU A CD2 
2560 N  N   . LEU A 288 ? 0.1201 0.1256 0.1069 0.0005  -0.0108 0.0054  285  LEU A N   
2561 C  CA  A LEU A 288 ? 0.1198 0.1220 0.1162 0.0021  -0.0109 -0.0119 285  LEU A CA  
2562 C  CA  B LEU A 288 ? 0.1137 0.1233 0.1104 0.0006  -0.0076 -0.0085 285  LEU A CA  
2563 C  C   . LEU A 288 ? 0.1203 0.1144 0.1149 -0.0061 -0.0107 -0.0051 285  LEU A C   
2564 O  O   . LEU A 288 ? 0.1121 0.1281 0.1215 -0.0101 -0.0183 0.0075  285  LEU A O   
2565 C  CB  A LEU A 288 ? 0.1380 0.1330 0.1047 -0.0163 -0.0154 -0.0042 285  LEU A CB  
2566 C  CB  B LEU A 288 ? 0.1059 0.1202 0.0989 -0.0061 -0.0009 -0.0034 285  LEU A CB  
2567 C  CG  A LEU A 288 ? 0.1026 0.1301 0.1147 -0.0023 -0.0105 -0.0103 285  LEU A CG  
2568 C  CG  B LEU A 288 ? 0.0939 0.1256 0.1033 -0.0089 -0.0076 -0.0134 285  LEU A CG  
2569 C  CD1 A LEU A 288 ? 0.1786 0.1262 0.1229 0.0114  -0.0278 0.0076  285  LEU A CD1 
2570 C  CD1 B LEU A 288 ? 0.0860 0.0956 0.1355 -0.0024 -0.0005 0.0039  285  LEU A CD1 
2571 C  CD2 A LEU A 288 ? 0.1958 0.1404 0.2043 0.0142  -0.0066 -0.0339 285  LEU A CD2 
2572 C  CD2 B LEU A 288 ? 0.1130 0.1128 0.1150 -0.0278 -0.0268 -0.0076 285  LEU A CD2 
2573 N  N   . ALA A 289 ? 0.1207 0.1189 0.0914 -0.0070 -0.0028 -0.0153 286  ALA A N   
2574 C  CA  . ALA A 289 ? 0.1084 0.1144 0.0978 0.0105  -0.0035 -0.0060 286  ALA A CA  
2575 C  C   . ALA A 289 ? 0.1159 0.1257 0.1151 0.0077  -0.0068 -0.0112 286  ALA A C   
2576 O  O   . ALA A 289 ? 0.1159 0.1404 0.1184 -0.0036 -0.0026 -0.0051 286  ALA A O   
2577 C  CB  . ALA A 289 ? 0.1368 0.0998 0.1177 0.0000  -0.0104 -0.0093 286  ALA A CB  
2578 N  N   . GLY A 290 ? 0.1037 0.1321 0.1330 -0.0001 -0.0161 -0.0014 287  GLY A N   
2579 C  CA  . GLY A 290 ? 0.1199 0.1332 0.1151 -0.0137 -0.0168 -0.0042 287  GLY A CA  
2580 C  C   . GLY A 290 ? 0.1016 0.1132 0.1056 -0.0025 -0.0100 0.0028  287  GLY A C   
2581 O  O   . GLY A 290 ? 0.1048 0.1339 0.1037 -0.0124 -0.0021 0.0016  287  GLY A O   
2582 N  N   . ALA A 291 ? 0.1205 0.1321 0.1118 -0.0066 -0.0094 0.0124  288  ALA A N   
2583 C  CA  . ALA A 291 ? 0.1154 0.1235 0.1109 -0.0050 -0.0219 0.0120  288  ALA A CA  
2584 C  C   . ALA A 291 ? 0.1230 0.1301 0.1165 0.0006  -0.0115 -0.0001 288  ALA A C   
2585 O  O   . ALA A 291 ? 0.1174 0.1184 0.1132 0.0017  -0.0035 -0.0134 288  ALA A O   
2586 C  CB  . ALA A 291 ? 0.1161 0.1532 0.1231 -0.0120 0.0084  0.0052  288  ALA A CB  
2587 N  N   . TYR A 292 ? 0.1195 0.1296 0.1107 -0.0051 -0.0228 -0.0038 289  TYR A N   
2588 C  CA  . TYR A 292 ? 0.1212 0.1197 0.1221 0.0051  -0.0108 -0.0035 289  TYR A CA  
2589 C  C   . TYR A 292 ? 0.1136 0.1141 0.1167 0.0032  -0.0105 -0.0073 289  TYR A C   
2590 O  O   . TYR A 292 ? 0.1166 0.1414 0.1268 -0.0010 -0.0143 -0.0029 289  TYR A O   
2591 C  CB  . TYR A 292 ? 0.1349 0.1190 0.1041 0.0041  -0.0051 0.0151  289  TYR A CB  
2592 C  CG  . TYR A 292 ? 0.1132 0.1105 0.1187 0.0026  0.0030  -0.0031 289  TYR A CG  
2593 C  CD1 . TYR A 292 ? 0.1353 0.1633 0.1393 -0.0005 -0.0069 0.0106  289  TYR A CD1 
2594 C  CD2 . TYR A 292 ? 0.1506 0.1402 0.1225 0.0139  -0.0012 0.0048  289  TYR A CD2 
2595 C  CE1 . TYR A 292 ? 0.1494 0.1866 0.1314 0.0046  0.0060  0.0116  289  TYR A CE1 
2596 C  CE2 . TYR A 292 ? 0.1476 0.1665 0.1538 -0.0059 0.0255  0.0014  289  TYR A CE2 
2597 C  CZ  . TYR A 292 ? 0.1106 0.1798 0.1540 0.0361  -0.0096 -0.0052 289  TYR A CZ  
2598 O  OH  . TYR A 292 ? 0.1071 0.2620 0.1611 0.0262  -0.0306 0.0262  289  TYR A OH  
2599 N  N   . SER A 293 ? 0.1173 0.1271 0.1020 -0.0077 -0.0090 -0.0014 290  SER A N   
2600 C  CA  . SER A 293 ? 0.1204 0.1417 0.1051 -0.0069 -0.0034 0.0016  290  SER A CA  
2601 C  C   . SER A 293 ? 0.1358 0.1421 0.1055 0.0005  -0.0010 -0.0080 290  SER A C   
2602 O  O   . SER A 293 ? 0.1274 0.1419 0.1340 -0.0003 -0.0061 -0.0111 290  SER A O   
2603 C  CB  . SER A 293 ? 0.1431 0.1474 0.1166 -0.0090 0.0036  -0.0026 290  SER A CB  
2604 O  OG  . SER A 293 ? 0.1518 0.1503 0.1305 0.0011  -0.0082 -0.0048 290  SER A OG  
2605 N  N   . VAL A 294 ? 0.1204 0.1221 0.1169 0.0053  0.0095  -0.0072 291  VAL A N   
2606 C  CA  . VAL A 294 ? 0.1131 0.1061 0.1060 0.0089  0.0062  0.0088  291  VAL A CA  
2607 C  C   . VAL A 294 ? 0.1262 0.1053 0.1192 -0.0024 0.0006  0.0087  291  VAL A C   
2608 O  O   . VAL A 294 ? 0.1282 0.1169 0.1285 -0.0090 -0.0025 -0.0029 291  VAL A O   
2609 C  CB  . VAL A 294 ? 0.1002 0.1146 0.1086 -0.0036 0.0110  0.0128  291  VAL A CB  
2610 C  CG1 . VAL A 294 ? 0.1252 0.1101 0.1245 -0.0130 -0.0045 -0.0116 291  VAL A CG1 
2611 C  CG2 . VAL A 294 ? 0.1381 0.1631 0.1093 -0.0089 -0.0315 0.0159  291  VAL A CG2 
2612 N  N   . ASP A 295 ? 0.1103 0.1238 0.1230 -0.0088 0.0071  0.0097  292  ASP A N   
2613 C  CA  . ASP A 295 ? 0.1148 0.1157 0.1110 -0.0070 0.0059  -0.0044 292  ASP A CA  
2614 C  C   . ASP A 295 ? 0.1208 0.1240 0.1220 0.0007  -0.0044 -0.0057 292  ASP A C   
2615 O  O   . ASP A 295 ? 0.1347 0.1206 0.1283 -0.0176 -0.0054 -0.0040 292  ASP A O   
2616 C  CB  . ASP A 295 ? 0.1197 0.1312 0.0937 0.0019  0.0000  0.0000  292  ASP A CB  
2617 C  CG  . ASP A 295 ? 0.1250 0.1146 0.1162 0.0002  0.0015  0.0010  292  ASP A CG  
2618 O  OD1 . ASP A 295 ? 0.1321 0.1269 0.1267 0.0238  0.0172  0.0072  292  ASP A OD1 
2619 O  OD2 . ASP A 295 ? 0.1576 0.1104 0.1477 -0.0071 0.0114  0.0016  292  ASP A OD2 
2620 N  N   . LYS A 296 ? 0.1315 0.1294 0.1154 0.0020  0.0022  -0.0110 293  LYS A N   
2621 C  CA  . LYS A 296 ? 0.1322 0.1299 0.1320 -0.0009 -0.0047 -0.0095 293  LYS A CA  
2622 C  C   . LYS A 296 ? 0.1342 0.1465 0.1303 0.0052  0.0102  -0.0054 293  LYS A C   
2623 O  O   . LYS A 296 ? 0.1256 0.1433 0.1429 -0.0165 0.0012  0.0135  293  LYS A O   
2624 C  CB  . LYS A 296 ? 0.1585 0.1267 0.1382 0.0181  0.0015  -0.0135 293  LYS A CB  
2625 C  CG  . LYS A 296 ? 0.1675 0.1748 0.1894 0.0162  0.0116  -0.0083 293  LYS A CG  
2626 C  CD  . LYS A 296 ? 0.1882 0.1679 0.2414 0.0254  0.0433  -0.0238 293  LYS A CD  
2627 C  CE  . LYS A 296 ? 0.2800 0.2592 0.3406 0.0200  0.0405  -0.0637 293  LYS A CE  
2628 N  NZ  . LYS A 296 ? 0.3803 0.3474 0.3898 0.0224  0.0149  -0.0616 293  LYS A NZ  
2629 N  N   . HIS A 297 ? 0.1255 0.1363 0.1163 -0.0074 0.0129  -0.0034 294  HIS A N   
2630 C  CA  . HIS A 297 ? 0.1272 0.1326 0.1343 -0.0030 0.0117  -0.0017 294  HIS A CA  
2631 C  C   . HIS A 297 ? 0.1205 0.1262 0.1289 -0.0027 0.0138  -0.0014 294  HIS A C   
2632 O  O   . HIS A 297 ? 0.1207 0.1379 0.1609 -0.0231 0.0187  -0.0092 294  HIS A O   
2633 C  CB  . HIS A 297 ? 0.1273 0.1411 0.1214 -0.0073 0.0103  -0.0059 294  HIS A CB  
2634 C  CG  . HIS A 297 ? 0.1384 0.1512 0.1568 -0.0023 0.0071  0.0078  294  HIS A CG  
2635 N  ND1 . HIS A 297 ? 0.1895 0.1931 0.1776 0.0102  0.0065  0.0298  294  HIS A ND1 
2636 C  CD2 . HIS A 297 ? 0.1553 0.1476 0.0959 0.0070  0.0439  0.0128  294  HIS A CD2 
2637 C  CE1 . HIS A 297 ? 0.1234 0.0675 0.1231 0.0102  -0.0092 -0.0080 294  HIS A CE1 
2638 N  NE2 . HIS A 297 ? 0.2212 0.1827 0.1858 0.0068  -0.0099 -0.0044 294  HIS A NE2 
2639 N  N   . PHE A 298 ? 0.1138 0.1156 0.1172 -0.0068 0.0203  0.0016  295  PHE A N   
2640 C  CA  . PHE A 298 ? 0.1272 0.1314 0.1351 -0.0040 0.0013  -0.0087 295  PHE A CA  
2641 C  C   . PHE A 298 ? 0.1281 0.1355 0.1280 -0.0139 -0.0046 -0.0037 295  PHE A C   
2642 O  O   . PHE A 298 ? 0.1430 0.1412 0.1344 -0.0093 -0.0045 -0.0055 295  PHE A O   
2643 C  CB  . PHE A 298 ? 0.1215 0.1153 0.1145 0.0017  0.0052  0.0024  295  PHE A CB  
2644 C  CG  . PHE A 298 ? 0.1113 0.1252 0.1282 -0.0115 -0.0195 -0.0008 295  PHE A CG  
2645 C  CD1 . PHE A 298 ? 0.1429 0.1245 0.1260 0.0099  0.0058  0.0013  295  PHE A CD1 
2646 C  CD2 . PHE A 298 ? 0.1489 0.1426 0.1383 -0.0042 0.0076  0.0217  295  PHE A CD2 
2647 C  CE1 . PHE A 298 ? 0.1340 0.1165 0.1326 0.0048  0.0032  0.0076  295  PHE A CE1 
2648 C  CE2 . PHE A 298 ? 0.1479 0.1410 0.1387 0.0209  -0.0202 0.0108  295  PHE A CE2 
2649 C  CZ  . PHE A 298 ? 0.1451 0.1439 0.1407 -0.0025 -0.0199 0.0040  295  PHE A CZ  
2650 N  N   . LYS A 299 ? 0.1310 0.1312 0.1367 -0.0139 -0.0193 -0.0071 296  LYS A N   
2651 C  CA  . LYS A 299 ? 0.1353 0.1552 0.1498 0.0012  -0.0150 0.0017  296  LYS A CA  
2652 C  C   . LYS A 299 ? 0.1401 0.1636 0.1369 -0.0128 -0.0132 0.0075  296  LYS A C   
2653 O  O   . LYS A 299 ? 0.1620 0.1846 0.1782 -0.0189 -0.0303 -0.0003 296  LYS A O   
2654 C  CB  . LYS A 299 ? 0.1578 0.1851 0.1418 -0.0174 -0.0047 0.0178  296  LYS A CB  
2655 C  CG  . LYS A 299 ? 0.1842 0.2367 0.2244 -0.0225 0.0011  -0.0006 296  LYS A CG  
2656 C  CD  . LYS A 299 ? 0.2976 0.2537 0.3033 0.0143  0.0076  0.0360  296  LYS A CD  
2657 C  CE  . LYS A 299 ? 0.3141 0.3208 0.3616 0.0211  0.0017  0.0330  296  LYS A CE  
2658 N  NZ  . LYS A 299 ? 0.3336 0.3389 0.4256 0.0519  0.0080  0.0412  296  LYS A NZ  
2659 N  N   . GLU A 300 ? 0.1186 0.1558 0.1492 -0.0049 -0.0199 -0.0020 297  GLU A N   
2660 C  CA  . GLU A 300 ? 0.1340 0.1706 0.1439 -0.0061 0.0006  0.0049  297  GLU A CA  
2661 C  C   . GLU A 300 ? 0.1322 0.1680 0.1679 -0.0110 -0.0041 0.0121  297  GLU A C   
2662 O  O   . GLU A 300 ? 0.1399 0.2112 0.1885 -0.0033 0.0233  0.0284  297  GLU A O   
2663 C  CB  . GLU A 300 ? 0.1354 0.1695 0.1700 -0.0116 0.0049  0.0101  297  GLU A CB  
2664 C  CG  . GLU A 300 ? 0.1474 0.1535 0.2094 0.0042  0.0032  0.0118  297  GLU A CG  
2665 C  CD  . GLU A 300 ? 0.2575 0.1839 0.2670 -0.0073 0.0295  -0.0045 297  GLU A CD  
2666 O  OE1 . GLU A 300 ? 0.3017 0.1866 0.3001 -0.0154 0.0411  -0.0405 297  GLU A OE1 
2667 O  OE2 . GLU A 300 ? 0.3275 0.2630 0.4180 0.0279  -0.0314 0.0252  297  GLU A OE2 
2668 N  N   . THR A 301 ? 0.1357 0.1403 0.1481 0.0025  0.0148  0.0074  298  THR A N   
2669 C  CA  . THR A 301 ? 0.1514 0.1333 0.1314 -0.0090 0.0131  0.0006  298  THR A CA  
2670 C  C   . THR A 301 ? 0.1463 0.1354 0.1470 -0.0092 0.0162  0.0071  298  THR A C   
2671 O  O   . THR A 301 ? 0.1502 0.1341 0.1499 -0.0068 0.0106  0.0118  298  THR A O   
2672 C  CB  . THR A 301 ? 0.1384 0.1330 0.1390 -0.0050 0.0230  -0.0028 298  THR A CB  
2673 O  OG1 . THR A 301 ? 0.1754 0.1470 0.1754 -0.0060 -0.0096 -0.0027 298  THR A OG1 
2674 C  CG2 . THR A 301 ? 0.1957 0.1248 0.1057 0.0017  0.0101  -0.0224 298  THR A CG2 
2675 N  N   . GLU A 302 ? 0.1279 0.1554 0.1461 0.0014  0.0118  0.0053  299  GLU A N   
2676 C  CA  . GLU A 302 ? 0.1443 0.1651 0.1614 -0.0158 0.0120  0.0053  299  GLU A CA  
2677 C  C   . GLU A 302 ? 0.1440 0.1470 0.1444 -0.0263 0.0075  0.0079  299  GLU A C   
2678 O  O   . GLU A 302 ? 0.1474 0.1829 0.1442 -0.0440 -0.0033 0.0102  299  GLU A O   
2679 C  CB  . GLU A 302 ? 0.1527 0.1768 0.1764 -0.0151 0.0207  0.0070  299  GLU A CB  
2680 C  CG  . GLU A 302 ? 0.2094 0.2442 0.2023 -0.0152 0.0190  0.0025  299  GLU A CG  
2681 C  CD  . GLU A 302 ? 0.2858 0.3483 0.2803 -0.0127 0.0323  -0.0189 299  GLU A CD  
2682 O  OE1 . GLU A 302 ? 0.3388 0.3663 0.3535 -0.0375 0.0393  0.0049  299  GLU A OE1 
2683 O  OE2 . GLU A 302 ? 0.3652 0.4455 0.3100 0.0277  0.0487  -0.0715 299  GLU A OE2 
2684 N  N   . PHE A 303 ? 0.1326 0.1436 0.1435 -0.0113 0.0111  0.0067  300  PHE A N   
2685 C  CA  . PHE A 303 ? 0.1172 0.1442 0.1218 -0.0023 -0.0005 0.0108  300  PHE A CA  
2686 C  C   . PHE A 303 ? 0.1077 0.1552 0.1144 0.0015  0.0041  0.0131  300  PHE A C   
2687 O  O   . PHE A 303 ? 0.1255 0.1679 0.1257 -0.0005 -0.0027 0.0084  300  PHE A O   
2688 C  CB  . PHE A 303 ? 0.1255 0.1362 0.1328 -0.0099 0.0035  0.0172  300  PHE A CB  
2689 C  CG  . PHE A 303 ? 0.1290 0.1343 0.1324 0.0013  -0.0247 -0.0014 300  PHE A CG  
2690 C  CD1 . PHE A 303 ? 0.1291 0.1522 0.1353 -0.0045 -0.0169 0.0108  300  PHE A CD1 
2691 C  CD2 . PHE A 303 ? 0.1439 0.1125 0.1674 -0.0051 -0.0348 0.0044  300  PHE A CD2 
2692 C  CE1 . PHE A 303 ? 0.1602 0.1302 0.1485 0.0094  -0.0042 -0.0121 300  PHE A CE1 
2693 C  CE2 . PHE A 303 ? 0.1553 0.1361 0.1353 0.0017  -0.0116 -0.0220 300  PHE A CE2 
2694 C  CZ  . PHE A 303 ? 0.1789 0.1494 0.1183 0.0057  -0.0184 -0.0096 300  PHE A CZ  
2695 N  N   . SER A 304 ? 0.1274 0.1722 0.1287 -0.0062 -0.0037 0.0198  301  SER A N   
2696 C  CA  . SER A 304 ? 0.1515 0.1666 0.1492 -0.0059 0.0003  0.0242  301  SER A CA  
2697 C  C   . SER A 304 ? 0.1486 0.1863 0.1368 0.0097  0.0058  0.0100  301  SER A C   
2698 O  O   . SER A 304 ? 0.1769 0.2168 0.1666 0.0151  -0.0336 0.0061  301  SER A O   
2699 C  CB  . SER A 304 ? 0.1586 0.1794 0.1329 0.0000  0.0093  0.0251  301  SER A CB  
2700 O  OG  . SER A 304 ? 0.1749 0.2008 0.2323 -0.0192 0.0377  -0.0164 301  SER A OG  
2701 N  N   . LYS A 305 ? 0.1477 0.1817 0.1628 -0.0016 -0.0044 0.0074  302  LYS A N   
2702 C  CA  A LYS A 305 ? 0.1535 0.1774 0.1508 -0.0009 -0.0001 0.0005  302  LYS A CA  
2703 C  CA  B LYS A 305 ? 0.1484 0.1732 0.1465 -0.0024 0.0015  -0.0007 302  LYS A CA  
2704 C  C   . LYS A 305 ? 0.1441 0.1687 0.1395 -0.0012 -0.0037 0.0040  302  LYS A C   
2705 O  O   . LYS A 305 ? 0.1633 0.1669 0.1417 -0.0051 0.0021  0.0052  302  LYS A O   
2706 C  CB  A LYS A 305 ? 0.1676 0.2014 0.1643 -0.0027 0.0040  0.0011  302  LYS A CB  
2707 C  CB  B LYS A 305 ? 0.1551 0.1883 0.1512 -0.0062 0.0063  -0.0011 302  LYS A CB  
2708 C  CG  A LYS A 305 ? 0.2104 0.1986 0.2036 -0.0190 0.0118  0.0125  302  LYS A CG  
2709 C  CG  B LYS A 305 ? 0.1706 0.1783 0.1626 -0.0265 0.0184  -0.0091 302  LYS A CG  
2710 C  CD  A LYS A 305 ? 0.2633 0.2658 0.2952 0.0020  0.0254  -0.0132 302  LYS A CD  
2711 C  CD  B LYS A 305 ? 0.2030 0.2007 0.1609 -0.0383 0.0307  -0.0184 302  LYS A CD  
2712 C  CE  A LYS A 305 ? 0.3355 0.3019 0.2993 0.0036  0.0233  0.0111  302  LYS A CE  
2713 C  CE  B LYS A 305 ? 0.2138 0.2252 0.1853 -0.0283 0.0358  -0.0316 302  LYS A CE  
2714 N  NZ  A LYS A 305 ? 0.4005 0.3636 0.3611 0.0140  -0.0044 -0.0145 302  LYS A NZ  
2715 N  NZ  B LYS A 305 ? 0.2438 0.2463 0.1907 -0.0164 0.0406  -0.0305 302  LYS A NZ  
2716 N  N   . ASN A 306 ? 0.1185 0.1344 0.1342 -0.0074 0.0027  -0.0052 303  ASN A N   
2717 C  CA  . ASN A 306 ? 0.1119 0.1321 0.1224 0.0074  0.0071  -0.0032 303  ASN A CA  
2718 C  C   . ASN A 306 ? 0.1186 0.1292 0.1249 -0.0018 0.0003  -0.0086 303  ASN A C   
2719 O  O   . ASN A 306 ? 0.1371 0.1360 0.1570 -0.0121 0.0143  0.0025  303  ASN A O   
2720 C  CB  . ASN A 306 ? 0.1097 0.1554 0.1366 0.0039  0.0065  -0.0094 303  ASN A CB  
2721 C  CG  . ASN A 306 ? 0.1125 0.1802 0.1364 0.0022  -0.0090 0.0026  303  ASN A CG  
2722 O  OD1 . ASN A 306 ? 0.1189 0.2086 0.1278 -0.0186 -0.0104 -0.0238 303  ASN A OD1 
2723 N  ND2 . ASN A 306 ? 0.1403 0.1442 0.1511 0.0000  -0.0201 0.0182  303  ASN A ND2 
2724 N  N   . ILE A 307 ? 0.1102 0.1135 0.1060 0.0034  -0.0049 -0.0040 304  ILE A N   
2725 C  CA  . ILE A 307 ? 0.1109 0.1271 0.1212 -0.0034 0.0058  0.0049  304  ILE A CA  
2726 C  C   . ILE A 307 ? 0.1250 0.1170 0.1318 -0.0101 0.0060  0.0010  304  ILE A C   
2727 O  O   . ILE A 307 ? 0.1288 0.1309 0.1298 0.0075  0.0117  0.0075  304  ILE A O   
2728 C  CB  . ILE A 307 ? 0.1355 0.1196 0.1011 -0.0049 -0.0044 0.0058  304  ILE A CB  
2729 C  CG1 . ILE A 307 ? 0.1320 0.1541 0.1322 0.0117  -0.0024 -0.0080 304  ILE A CG1 
2730 C  CG2 . ILE A 307 ? 0.1123 0.1386 0.1341 0.0114  -0.0076 -0.0091 304  ILE A CG2 
2731 C  CD1 . ILE A 307 ? 0.1795 0.1656 0.1561 -0.0187 -0.0384 -0.0070 304  ILE A CD1 
2732 N  N   . PRO A 308 ? 0.1132 0.1346 0.1267 0.0002  0.0020  0.0042  305  PRO A N   
2733 C  CA  . PRO A 308 ? 0.1328 0.1337 0.1465 0.0069  -0.0003 -0.0025 305  PRO A CA  
2734 C  C   . PRO A 308 ? 0.1099 0.1336 0.1362 0.0019  0.0031  -0.0021 305  PRO A C   
2735 O  O   . PRO A 308 ? 0.1143 0.1390 0.1163 0.0092  -0.0059 -0.0141 305  PRO A O   
2736 C  CB  . PRO A 308 ? 0.1551 0.1557 0.1415 0.0058  0.0009  -0.0013 305  PRO A CB  
2737 C  CG  . PRO A 308 ? 0.1497 0.1404 0.1459 0.0030  0.0052  0.0154  305  PRO A CG  
2738 C  CD  . PRO A 308 ? 0.1147 0.1355 0.1148 -0.0029 -0.0037 0.0170  305  PRO A CD  
2739 N  N   . VAL A 309 ? 0.1025 0.1247 0.1314 0.0010  -0.0040 -0.0074 306  VAL A N   
2740 C  CA  . VAL A 309 ? 0.0968 0.1276 0.1333 -0.0070 -0.0069 0.0045  306  VAL A CA  
2741 C  C   . VAL A 309 ? 0.1062 0.1211 0.1287 0.0046  0.0009  -0.0016 306  VAL A C   
2742 O  O   . VAL A 309 ? 0.1189 0.1238 0.1551 0.0031  0.0005  -0.0065 306  VAL A O   
2743 C  CB  . VAL A 309 ? 0.1091 0.1231 0.1423 0.0078  -0.0165 -0.0041 306  VAL A CB  
2744 C  CG1 . VAL A 309 ? 0.1130 0.1272 0.2061 -0.0257 -0.0064 0.0341  306  VAL A CG1 
2745 C  CG2 . VAL A 309 ? 0.0989 0.1482 0.1525 0.0394  -0.0520 0.0279  306  VAL A CG2 
2746 N  N   . ILE A 310 ? 0.1209 0.1241 0.1234 0.0096  -0.0048 -0.0019 307  ILE A N   
2747 C  CA  . ILE A 310 ? 0.1278 0.1281 0.1295 0.0050  -0.0090 0.0011  307  ILE A CA  
2748 C  C   . ILE A 310 ? 0.1282 0.1231 0.1262 0.0108  -0.0063 -0.0026 307  ILE A C   
2749 O  O   . ILE A 310 ? 0.1252 0.1226 0.1343 0.0023  -0.0059 0.0080  307  ILE A O   
2750 C  CB  . ILE A 310 ? 0.1484 0.1385 0.1494 -0.0046 -0.0253 -0.0046 307  ILE A CB  
2751 C  CG1 . ILE A 310 ? 0.1964 0.1663 0.1755 0.0237  -0.0270 0.0205  307  ILE A CG1 
2752 C  CG2 . ILE A 310 ? 0.1390 0.1559 0.1422 0.0207  -0.0140 0.0207  307  ILE A CG2 
2753 C  CD1 . ILE A 310 ? 0.1903 0.2264 0.2668 0.0143  0.0146  -0.0192 307  ILE A CD1 
2754 N  N   . MSE A 311 ? 0.1264 0.1394 0.1193 0.0067  -0.0045 -0.0016 308  MSE A N   
2755 C  CA  . MSE A 311 ? 0.1291 0.1515 0.1224 0.0026  0.0014  0.0081  308  MSE A CA  
2756 C  C   . MSE A 311 ? 0.1094 0.1406 0.1121 0.0002  0.0028  0.0037  308  MSE A C   
2757 O  O   . MSE A 311 ? 0.1435 0.1377 0.1425 0.0055  0.0226  0.0182  308  MSE A O   
2758 C  CB  . MSE A 311 ? 0.1198 0.1724 0.1246 0.0004  0.0034  0.0098  308  MSE A CB  
2759 C  CG  . MSE A 311 ? 0.1252 0.1202 0.1552 -0.0175 0.0059  0.0010  308  MSE A CG  
2760 SE SE  . MSE A 311 ? 0.1653 0.1703 0.2070 -0.0117 0.0001  0.0053  308  MSE A SE  
2761 C  CE  . MSE A 311 ? 0.1783 0.1832 0.2235 0.0139  0.0824  -0.0176 308  MSE A CE  
2762 N  N   . ALA A 312 ? 0.1029 0.1137 0.1133 0.0094  0.0005  0.0169  309  ALA A N   
2763 C  CA  . ALA A 312 ? 0.1065 0.1135 0.1196 0.0038  0.0036  0.0050  309  ALA A CA  
2764 C  C   . ALA A 312 ? 0.1106 0.1166 0.1359 0.0011  0.0000  0.0048  309  ALA A C   
2765 O  O   . ALA A 312 ? 0.1357 0.1040 0.1428 0.0021  -0.0012 0.0013  309  ALA A O   
2766 C  CB  . ALA A 312 ? 0.1178 0.1260 0.1124 0.0142  -0.0010 0.0178  309  ALA A CB  
2767 N  N   . LEU A 313 ? 0.1310 0.1085 0.1344 -0.0001 0.0009  -0.0084 310  LEU A N   
2768 C  CA  . LEU A 313 ? 0.1241 0.1197 0.1064 -0.0100 -0.0050 -0.0015 310  LEU A CA  
2769 C  C   . LEU A 313 ? 0.1205 0.1037 0.1165 -0.0135 -0.0029 0.0043  310  LEU A C   
2770 O  O   . LEU A 313 ? 0.1286 0.1109 0.1495 -0.0058 0.0049  -0.0150 310  LEU A O   
2771 C  CB  . LEU A 313 ? 0.1019 0.1328 0.1103 -0.0149 -0.0089 -0.0041 310  LEU A CB  
2772 C  CG  . LEU A 313 ? 0.0999 0.1514 0.1188 -0.0057 -0.0120 0.0028  310  LEU A CG  
2773 C  CD1 . LEU A 313 ? 0.1053 0.1815 0.1300 -0.0020 0.0223  -0.0017 310  LEU A CD1 
2774 C  CD2 . LEU A 313 ? 0.1327 0.1533 0.0905 -0.0212 -0.0043 -0.0205 310  LEU A CD2 
2775 N  N   . LEU A 314 ? 0.1453 0.1131 0.1190 0.0093  -0.0084 -0.0160 311  LEU A N   
2776 C  CA  . LEU A 314 ? 0.1384 0.1178 0.1321 0.0121  -0.0039 0.0017  311  LEU A CA  
2777 C  C   . LEU A 314 ? 0.1216 0.1248 0.1256 0.0189  -0.0074 0.0153  311  LEU A C   
2778 O  O   . LEU A 314 ? 0.1297 0.1221 0.1462 -0.0029 0.0031  0.0150  311  LEU A O   
2779 C  CB  . LEU A 314 ? 0.1459 0.1155 0.1475 0.0180  -0.0090 0.0028  311  LEU A CB  
2780 C  CG  . LEU A 314 ? 0.1540 0.1506 0.1404 0.0021  -0.0061 -0.0039 311  LEU A CG  
2781 C  CD1 . LEU A 314 ? 0.2563 0.1460 0.1865 -0.0074 -0.0644 -0.0506 311  LEU A CD1 
2782 C  CD2 . LEU A 314 ? 0.2581 0.1742 0.1209 -0.0315 0.0410  0.0260  311  LEU A CD2 
2783 N  N   . ALA A 315 ? 0.1247 0.1299 0.1400 0.0021  0.0046  0.0101  312  ALA A N   
2784 C  CA  . ALA A 315 ? 0.1200 0.1384 0.1234 -0.0026 -0.0065 0.0138  312  ALA A CA  
2785 C  C   . ALA A 315 ? 0.1277 0.1179 0.1270 0.0067  -0.0093 0.0162  312  ALA A C   
2786 O  O   . ALA A 315 ? 0.1347 0.1287 0.1420 -0.0019 -0.0214 0.0039  312  ALA A O   
2787 C  CB  . ALA A 315 ? 0.1378 0.1160 0.1267 -0.0037 0.0000  0.0255  312  ALA A CB  
2788 N  N   . SER A 316 ? 0.1165 0.1156 0.1239 0.0008  -0.0227 0.0106  313  SER A N   
2789 C  CA  . SER A 316 ? 0.1226 0.1361 0.1251 0.0041  -0.0149 0.0076  313  SER A CA  
2790 C  C   . SER A 316 ? 0.1229 0.1268 0.1273 0.0044  -0.0076 0.0053  313  SER A C   
2791 O  O   . SER A 316 ? 0.1408 0.1262 0.1423 0.0058  -0.0200 0.0031  313  SER A O   
2792 C  CB  . SER A 316 ? 0.1157 0.1342 0.1573 -0.0027 -0.0111 0.0065  313  SER A CB  
2793 O  OG  . SER A 316 ? 0.1602 0.1480 0.1456 -0.0081 -0.0152 0.0151  313  SER A OG  
2794 N  N   . TYR A 317 ? 0.1300 0.1461 0.1344 0.0081  -0.0140 0.0015  314  TYR A N   
2795 C  CA  . TYR A 317 ? 0.1222 0.1367 0.1265 -0.0072 0.0005  0.0062  314  TYR A CA  
2796 C  C   . TYR A 317 ? 0.1267 0.1306 0.1433 -0.0067 0.0036  0.0001  314  TYR A C   
2797 O  O   . TYR A 317 ? 0.1108 0.1321 0.1581 0.0000  -0.0038 0.0159  314  TYR A O   
2798 C  CB  . TYR A 317 ? 0.1481 0.1243 0.1284 -0.0044 0.0085  -0.0007 314  TYR A CB  
2799 C  CG  . TYR A 317 ? 0.1183 0.1207 0.1553 0.0044  -0.0006 0.0110  314  TYR A CG  
2800 C  CD1 . TYR A 317 ? 0.1481 0.1242 0.1236 -0.0255 0.0044  0.0078  314  TYR A CD1 
2801 C  CD2 . TYR A 317 ? 0.1641 0.1277 0.1242 -0.0113 -0.0052 -0.0149 314  TYR A CD2 
2802 C  CE1 . TYR A 317 ? 0.1608 0.1317 0.1528 -0.0055 -0.0049 0.0240  314  TYR A CE1 
2803 C  CE2 . TYR A 317 ? 0.1866 0.1421 0.1566 -0.0086 -0.0115 0.0231  314  TYR A CE2 
2804 C  CZ  . TYR A 317 ? 0.1677 0.1601 0.1192 -0.0150 0.0102  0.0196  314  TYR A CZ  
2805 O  OH  . TYR A 317 ? 0.2310 0.1503 0.1561 -0.0286 -0.0032 0.0308  314  TYR A OH  
2806 N  N   . TYR A 318 ? 0.1314 0.1280 0.1174 -0.0064 -0.0168 0.0047  315  TYR A N   
2807 C  CA  . TYR A 318 ? 0.1208 0.1310 0.1134 -0.0011 -0.0123 -0.0125 315  TYR A CA  
2808 C  C   . TYR A 318 ? 0.1261 0.1228 0.1153 0.0140  -0.0002 -0.0079 315  TYR A C   
2809 O  O   . TYR A 318 ? 0.1674 0.1345 0.1343 -0.0025 -0.0115 0.0002  315  TYR A O   
2810 C  CB  . TYR A 318 ? 0.1311 0.1184 0.1078 -0.0100 -0.0067 0.0054  315  TYR A CB  
2811 C  CG  . TYR A 318 ? 0.1177 0.1517 0.1110 -0.0110 -0.0154 0.0048  315  TYR A CG  
2812 C  CD1 . TYR A 318 ? 0.1216 0.1263 0.1414 -0.0072 0.0013  -0.0088 315  TYR A CD1 
2813 C  CD2 . TYR A 318 ? 0.1237 0.1433 0.1548 0.0066  -0.0078 -0.0020 315  TYR A CD2 
2814 C  CE1 . TYR A 318 ? 0.1577 0.1339 0.1447 -0.0005 0.0063  0.0094  315  TYR A CE1 
2815 C  CE2 . TYR A 318 ? 0.1503 0.1211 0.1246 0.0166  0.0107  0.0054  315  TYR A CE2 
2816 C  CZ  . TYR A 318 ? 0.1186 0.1179 0.1346 -0.0056 0.0244  -0.0053 315  TYR A CZ  
2817 O  OH  . TYR A 318 ? 0.1515 0.1691 0.1240 0.0134  0.0101  -0.0014 315  TYR A OH  
2818 N  N   . SER A 319 ? 0.1456 0.1328 0.1337 0.0219  -0.0050 -0.0080 316  SER A N   
2819 C  CA  . SER A 319 ? 0.1436 0.1555 0.1497 0.0128  -0.0081 -0.0029 316  SER A CA  
2820 C  C   . SER A 319 ? 0.1507 0.1606 0.1567 0.0127  -0.0084 -0.0071 316  SER A C   
2821 O  O   . SER A 319 ? 0.1666 0.1803 0.1864 0.0139  -0.0221 -0.0324 316  SER A O   
2822 C  CB  . SER A 319 ? 0.1561 0.1523 0.1491 0.0123  -0.0052 0.0039  316  SER A CB  
2823 O  OG  . SER A 319 ? 0.1520 0.1521 0.1752 0.0273  -0.0061 0.0080  316  SER A OG  
2824 N  N   . CYS A 320 ? 0.1423 0.1435 0.1393 0.0178  -0.0107 -0.0089 317  CYS A N   
2825 C  CA  . CYS A 320 ? 0.1699 0.1405 0.1530 0.0077  -0.0135 -0.0037 317  CYS A CA  
2826 C  C   . CYS A 320 ? 0.1757 0.1434 0.1507 -0.0072 -0.0057 0.0011  317  CYS A C   
2827 O  O   . CYS A 320 ? 0.2636 0.1741 0.1931 -0.0019 -0.0120 -0.0069 317  CYS A O   
2828 C  CB  . CYS A 320 ? 0.1643 0.1228 0.1571 -0.0051 -0.0180 -0.0057 317  CYS A CB  
2829 S  SG  . CYS A 320 ? 0.1987 0.1711 0.1886 -0.0059 -0.0269 -0.0018 317  CYS A SG  
2830 N  N   . THR A 321 ? 0.1530 0.1370 0.1496 -0.0181 -0.0056 -0.0064 318  THR A N   
2831 C  CA  A THR A 321 ? 0.1555 0.1385 0.1613 -0.0245 -0.0045 0.0046  318  THR A CA  
2832 C  CA  B THR A 321 ? 0.1473 0.1395 0.1562 -0.0169 0.0050  0.0087  318  THR A CA  
2833 C  C   . THR A 321 ? 0.1528 0.1417 0.1669 -0.0154 0.0086  0.0106  318  THR A C   
2834 O  O   . THR A 321 ? 0.1587 0.1677 0.1756 -0.0012 0.0065  0.0180  318  THR A O   
2835 C  CB  A THR A 321 ? 0.1625 0.1429 0.1926 -0.0011 -0.0031 -0.0016 318  THR A CB  
2836 C  CB  B THR A 321 ? 0.1442 0.1330 0.1658 -0.0138 0.0054  0.0035  318  THR A CB  
2837 O  OG1 A THR A 321 ? 0.2230 0.2253 0.1803 -0.0048 0.0157  -0.0193 318  THR A OG1 
2838 O  OG1 B THR A 321 ? 0.1281 0.1712 0.1895 -0.0066 0.0320  0.0248  318  THR A OG1 
2839 C  CG2 A THR A 321 ? 0.1456 0.1372 0.2160 -0.0374 -0.0335 -0.0100 318  THR A CG2 
2840 C  CG2 B THR A 321 ? 0.1352 0.1521 0.1466 0.0010  0.0237  0.0230  318  THR A CG2 
2841 N  N   . TYR A 322 ? 0.1515 0.1312 0.1562 -0.0185 -0.0034 0.0171  319  TYR A N   
2842 C  CA  . TYR A 322 ? 0.1348 0.1514 0.1578 -0.0148 0.0007  0.0236  319  TYR A CA  
2843 C  C   . TYR A 322 ? 0.1580 0.1700 0.1801 -0.0144 0.0067  0.0203  319  TYR A C   
2844 O  O   . TYR A 322 ? 0.1896 0.1766 0.2473 0.0042  0.0379  0.0560  319  TYR A O   
2845 C  CB  . TYR A 322 ? 0.1476 0.1609 0.1323 -0.0049 -0.0266 0.0319  319  TYR A CB  
2846 C  CG  . TYR A 322 ? 0.1670 0.1917 0.1491 0.0066  -0.0240 0.0301  319  TYR A CG  
2847 C  CD1 . TYR A 322 ? 0.2294 0.2848 0.1872 0.0526  -0.0516 0.0378  319  TYR A CD1 
2848 C  CD2 . TYR A 322 ? 0.2069 0.1253 0.1468 0.0064  -0.0126 0.0277  319  TYR A CD2 
2849 C  CE1 . TYR A 322 ? 0.2286 0.3166 0.2060 0.0162  -0.0413 0.0033  319  TYR A CE1 
2850 C  CE2 . TYR A 322 ? 0.2184 0.1787 0.1520 -0.0075 -0.0288 0.0237  319  TYR A CE2 
2851 C  CZ  . TYR A 322 ? 0.2508 0.2281 0.1877 0.0113  -0.0221 0.0192  319  TYR A CZ  
2852 O  OH  . TYR A 322 ? 0.3127 0.2444 0.1745 0.0121  0.0010  -0.0415 319  TYR A OH  
2853 N  N   . ASN A 323 ? 0.1742 0.1953 0.1760 -0.0123 0.0296  0.0029  320  ASN A N   
2854 C  CA  . ASN A 323 ? 0.1828 0.1957 0.1922 -0.0208 0.0266  0.0014  320  ASN A CA  
2855 C  C   . ASN A 323 ? 0.1653 0.1832 0.1900 -0.0068 0.0159  -0.0042 320  ASN A C   
2856 O  O   . ASN A 323 ? 0.1633 0.1865 0.2317 -0.0159 0.0189  -0.0089 320  ASN A O   
2857 C  CB  . ASN A 323 ? 0.1980 0.2130 0.2141 -0.0226 0.0372  -0.0063 320  ASN A CB  
2858 C  CG  . ASN A 323 ? 0.2338 0.2468 0.2891 -0.0365 -0.0219 0.0136  320  ASN A CG  
2859 O  OD1 . ASN A 323 ? 0.2369 0.2565 0.3836 -0.0245 -0.0534 0.0409  320  ASN A OD1 
2860 N  ND2 . ASN A 323 ? 0.3225 0.2550 0.3701 -0.0067 -0.0425 0.0362  320  ASN A ND2 
2861 N  N   . SER A 324 ? 0.1414 0.1656 0.1641 -0.0079 0.0005  -0.0084 321  SER A N   
2862 C  CA  . SER A 324 ? 0.1253 0.1327 0.1487 -0.0094 -0.0108 -0.0087 321  SER A CA  
2863 C  C   . SER A 324 ? 0.1139 0.1238 0.1328 0.0017  -0.0239 -0.0150 321  SER A C   
2864 O  O   . SER A 324 ? 0.1315 0.1673 0.1503 -0.0097 -0.0350 0.0066  321  SER A O   
2865 C  CB  . SER A 324 ? 0.1387 0.1652 0.1123 0.0137  -0.0150 0.0113  321  SER A CB  
2866 O  OG  . SER A 324 ? 0.1361 0.1830 0.1612 -0.0060 -0.0138 -0.0075 321  SER A OG  
2867 N  N   . GLN A 325 ? 0.1077 0.1291 0.1251 -0.0021 -0.0018 0.0005  322  GLN A N   
2868 C  CA  . GLN A 325 ? 0.1340 0.1271 0.1307 0.0142  -0.0104 0.0004  322  GLN A CA  
2869 C  C   . GLN A 325 ? 0.1202 0.1251 0.1210 0.0118  0.0001  0.0070  322  GLN A C   
2870 O  O   . GLN A 325 ? 0.1214 0.1586 0.1030 -0.0045 0.0043  0.0095  322  GLN A O   
2871 C  CB  . GLN A 325 ? 0.1446 0.1580 0.1556 0.0193  0.0033  0.0070  322  GLN A CB  
2872 C  CG  . GLN A 325 ? 0.1733 0.1503 0.1593 0.0434  -0.0359 -0.0058 322  GLN A CG  
2873 C  CD  . GLN A 325 ? 0.1450 0.1850 0.2454 0.0434  -0.0089 0.0294  322  GLN A CD  
2874 O  OE1 . GLN A 325 ? 0.3857 0.1950 0.3103 0.0886  0.1434  0.0855  322  GLN A OE1 
2875 N  NE2 . GLN A 325 ? 0.2667 0.2232 0.3517 0.0281  0.0031  -0.0463 322  GLN A NE2 
2876 N  N   . SER A 326 ? 0.1308 0.1267 0.1238 0.0001  -0.0123 -0.0089 323  SER A N   
2877 C  CA  . SER A 326 ? 0.1190 0.1364 0.1278 0.0039  0.0044  -0.0019 323  SER A CA  
2878 C  C   . SER A 326 ? 0.1166 0.1385 0.1201 -0.0008 0.0070  -0.0036 323  SER A C   
2879 O  O   . SER A 326 ? 0.1422 0.1270 0.1340 -0.0161 0.0013  0.0076  323  SER A O   
2880 C  CB  . SER A 326 ? 0.1281 0.1685 0.1454 -0.0002 0.0031  -0.0083 323  SER A CB  
2881 O  OG  . SER A 326 ? 0.1295 0.1714 0.1365 0.0146  -0.0155 -0.0207 323  SER A OG  
2882 N  N   . GLN A 327 ? 0.1275 0.1405 0.1220 -0.0107 0.0167  -0.0038 324  GLN A N   
2883 C  CA  . GLN A 327 ? 0.1461 0.1425 0.1359 0.0059  0.0024  -0.0082 324  GLN A CA  
2884 C  C   . GLN A 327 ? 0.1345 0.1407 0.1207 -0.0022 -0.0097 -0.0004 324  GLN A C   
2885 O  O   . GLN A 327 ? 0.1198 0.1379 0.1503 -0.0071 -0.0016 -0.0069 324  GLN A O   
2886 C  CB  . GLN A 327 ? 0.1114 0.1733 0.1635 0.0190  0.0127  -0.0304 324  GLN A CB  
2887 C  CG  . GLN A 327 ? 0.1658 0.1970 0.1945 0.0153  0.0000  -0.0080 324  GLN A CG  
2888 C  CD  . GLN A 327 ? 0.1650 0.2154 0.1898 0.0327  -0.0059 0.0244  324  GLN A CD  
2889 O  OE1 . GLN A 327 ? 0.2065 0.1727 0.2033 0.0128  0.0118  -0.0069 324  GLN A OE1 
2890 N  NE2 . GLN A 327 ? 0.1621 0.2247 0.1445 0.0212  -0.0239 -0.0087 324  GLN A NE2 
2891 N  N   . ALA A 328 ? 0.1418 0.1354 0.1165 -0.0220 -0.0045 0.0016  325  ALA A N   
2892 C  CA  . ALA A 328 ? 0.1195 0.1215 0.1301 -0.0109 -0.0122 -0.0080 325  ALA A CA  
2893 C  C   . ALA A 328 ? 0.1281 0.1267 0.1300 -0.0022 0.0083  -0.0064 325  ALA A C   
2894 O  O   . ALA A 328 ? 0.1331 0.1386 0.1409 0.0022  0.0155  -0.0112 325  ALA A O   
2895 C  CB  . ALA A 328 ? 0.1615 0.1598 0.1247 0.0121  -0.0291 0.0051  325  ALA A CB  
2896 N  N   . LEU A 329 ? 0.1057 0.1143 0.1359 0.0016  0.0110  -0.0113 326  LEU A N   
2897 C  CA  . LEU A 329 ? 0.1260 0.1334 0.1307 0.0097  0.0009  -0.0108 326  LEU A CA  
2898 C  C   . LEU A 329 ? 0.1235 0.1219 0.1341 0.0074  0.0045  -0.0047 326  LEU A C   
2899 O  O   . LEU A 329 ? 0.1416 0.1362 0.1309 -0.0070 0.0124  -0.0018 326  LEU A O   
2900 C  CB  . LEU A 329 ? 0.1433 0.1615 0.1560 0.0252  0.0064  0.0024  326  LEU A CB  
2901 C  CG  . LEU A 329 ? 0.1591 0.1887 0.1865 0.0111  -0.0101 0.0197  326  LEU A CG  
2902 C  CD1 . LEU A 329 ? 0.2337 0.1563 0.2231 0.0358  0.0557  0.0186  326  LEU A CD1 
2903 C  CD2 . LEU A 329 ? 0.2699 0.2010 0.2164 0.0423  -0.0357 0.0348  326  LEU A CD2 
2904 N  N   . LEU A 330 ? 0.1287 0.1160 0.1322 0.0115  0.0010  -0.0166 327  LEU A N   
2905 C  CA  . LEU A 330 ? 0.1207 0.1146 0.1287 0.0067  0.0068  -0.0097 327  LEU A CA  
2906 C  C   . LEU A 330 ? 0.1228 0.1132 0.1293 0.0086  0.0115  -0.0020 327  LEU A C   
2907 O  O   . LEU A 330 ? 0.1394 0.1147 0.1241 0.0245  0.0026  -0.0074 327  LEU A O   
2908 C  CB  . LEU A 330 ? 0.1193 0.1116 0.1370 0.0012  -0.0134 -0.0128 327  LEU A CB  
2909 C  CG  . LEU A 330 ? 0.1449 0.1156 0.1370 0.0195  -0.0172 -0.0073 327  LEU A CG  
2910 C  CD1 . LEU A 330 ? 0.1531 0.1424 0.1279 0.0171  -0.0150 0.0208  327  LEU A CD1 
2911 C  CD2 . LEU A 330 ? 0.1573 0.1142 0.1365 0.0355  0.0074  -0.0261 327  LEU A CD2 
2912 N  N   . PRO A 331 ? 0.1355 0.1189 0.1070 0.0038  0.0026  0.0014  328  PRO A N   
2913 C  CA  . PRO A 331 ? 0.1263 0.1248 0.1151 0.0083  -0.0004 0.0015  328  PRO A CA  
2914 C  C   . PRO A 331 ? 0.1302 0.1246 0.1358 0.0066  -0.0037 0.0007  328  PRO A C   
2915 O  O   . PRO A 331 ? 0.1296 0.1299 0.1447 0.0144  0.0008  -0.0162 328  PRO A O   
2916 C  CB  . PRO A 331 ? 0.1548 0.1328 0.1563 -0.0087 0.0011  0.0000  328  PRO A CB  
2917 C  CG  . PRO A 331 ? 0.2177 0.1631 0.1630 0.0239  0.0174  0.0099  328  PRO A CG  
2918 C  CD  . PRO A 331 ? 0.1349 0.1209 0.1113 0.0099  0.0151  -0.0016 328  PRO A CD  
2919 N  N   . TYR A 332 ? 0.1083 0.1253 0.1280 -0.0006 0.0058  -0.0010 329  TYR A N   
2920 C  CA  . TYR A 332 ? 0.1217 0.1276 0.1191 0.0040  0.0103  0.0053  329  TYR A CA  
2921 C  C   . TYR A 332 ? 0.1006 0.1147 0.1137 -0.0045 0.0123  0.0021  329  TYR A C   
2922 O  O   . TYR A 332 ? 0.1434 0.1231 0.1126 -0.0003 0.0105  -0.0122 329  TYR A O   
2923 C  CB  . TYR A 332 ? 0.1351 0.1373 0.1146 -0.0069 0.0031  0.0070  329  TYR A CB  
2924 C  CG  . TYR A 332 ? 0.1205 0.1238 0.1179 -0.0027 0.0147  0.0027  329  TYR A CG  
2925 C  CD1 . TYR A 332 ? 0.1141 0.1298 0.1216 -0.0060 -0.0102 0.0071  329  TYR A CD1 
2926 C  CD2 . TYR A 332 ? 0.1347 0.1301 0.1029 0.0177  0.0085  -0.0036 329  TYR A CD2 
2927 C  CE1 . TYR A 332 ? 0.1006 0.1319 0.1173 0.0067  -0.0113 0.0066  329  TYR A CE1 
2928 C  CE2 . TYR A 332 ? 0.1312 0.1324 0.1180 0.0059  -0.0061 0.0110  329  TYR A CE2 
2929 C  CZ  . TYR A 332 ? 0.1107 0.1210 0.1051 0.0044  0.0275  -0.0024 329  TYR A CZ  
2930 O  OH  . TYR A 332 ? 0.1527 0.1063 0.1545 0.0093  -0.0004 0.0182  329  TYR A OH  
2931 N  N   . ASP A 333 ? 0.1245 0.1205 0.1197 -0.0037 0.0181  -0.0019 330  ASP A N   
2932 C  CA  . ASP A 333 ? 0.1265 0.1136 0.1218 0.0011  0.0127  -0.0044 330  ASP A CA  
2933 C  C   . ASP A 333 ? 0.1241 0.1088 0.1321 0.0027  0.0091  -0.0079 330  ASP A C   
2934 O  O   . ASP A 333 ? 0.1479 0.1199 0.1196 -0.0090 -0.0082 -0.0071 330  ASP A O   
2935 C  CB  . ASP A 333 ? 0.1189 0.1120 0.1316 0.0061  0.0019  0.0040  330  ASP A CB  
2936 C  CG  . ASP A 333 ? 0.1144 0.1295 0.1355 0.0171  0.0001  0.0011  330  ASP A CG  
2937 O  OD1 . ASP A 333 ? 0.1651 0.1303 0.1432 0.0095  0.0195  0.0087  330  ASP A OD1 
2938 O  OD2 . ASP A 333 ? 0.1742 0.1351 0.1530 0.0201  0.0360  -0.0109 330  ASP A OD2 
2939 N  N   . GLU A 334 ? 0.1261 0.1218 0.1138 -0.0047 -0.0031 0.0004  331  GLU A N   
2940 C  CA  . GLU A 334 ? 0.1169 0.1441 0.1194 0.0013  0.0001  -0.0020 331  GLU A CA  
2941 C  C   . GLU A 334 ? 0.1187 0.1173 0.1244 -0.0059 -0.0009 -0.0050 331  GLU A C   
2942 O  O   . GLU A 334 ? 0.1504 0.1422 0.1081 -0.0035 -0.0072 -0.0017 331  GLU A O   
2943 C  CB  . GLU A 334 ? 0.1502 0.1603 0.1348 -0.0071 -0.0020 0.0111  331  GLU A CB  
2944 C  CG  . GLU A 334 ? 0.1359 0.1435 0.1605 0.0040  -0.0104 0.0150  331  GLU A CG  
2945 C  CD  . GLU A 334 ? 0.1295 0.1840 0.1540 0.0169  0.0037  0.0095  331  GLU A CD  
2946 O  OE1 . GLU A 334 ? 0.1684 0.1766 0.2265 -0.0177 0.0186  0.0198  331  GLU A OE1 
2947 O  OE2 . GLU A 334 ? 0.1881 0.2020 0.1509 -0.0332 0.0159  0.0270  331  GLU A OE2 
2948 N  N   . ARG A 335 ? 0.1148 0.1330 0.1110 0.0179  -0.0020 0.0053  332  ARG A N   
2949 C  CA  . ARG A 335 ? 0.1226 0.1352 0.1182 0.0008  -0.0111 0.0024  332  ARG A CA  
2950 C  C   . ARG A 335 ? 0.1441 0.1391 0.1278 0.0078  -0.0027 -0.0080 332  ARG A C   
2951 O  O   . ARG A 335 ? 0.1582 0.1325 0.1360 -0.0019 -0.0193 -0.0016 332  ARG A O   
2952 C  CB  . ARG A 335 ? 0.1305 0.1389 0.1002 0.0137  -0.0067 0.0118  332  ARG A CB  
2953 C  CG  . ARG A 335 ? 0.1587 0.1259 0.1065 0.0116  -0.0159 0.0125  332  ARG A CG  
2954 C  CD  . ARG A 335 ? 0.1616 0.1423 0.1275 -0.0116 0.0071  -0.0021 332  ARG A CD  
2955 N  NE  . ARG A 335 ? 0.1574 0.1137 0.1205 0.0058  -0.0085 0.0081  332  ARG A NE  
2956 C  CZ  . ARG A 335 ? 0.1356 0.1263 0.1465 -0.0142 0.0174  0.0028  332  ARG A CZ  
2957 N  NH1 . ARG A 335 ? 0.1491 0.1305 0.1259 -0.0007 0.0108  0.0050  332  ARG A NH1 
2958 N  NH2 . ARG A 335 ? 0.1620 0.1010 0.1256 0.0033  -0.0065 -0.0007 332  ARG A NH2 
2959 N  N   . LEU A 336 ? 0.1382 0.1281 0.1206 -0.0050 -0.0142 0.0040  333  LEU A N   
2960 C  CA  . LEU A 336 ? 0.1235 0.1366 0.1171 0.0030  -0.0217 -0.0033 333  LEU A CA  
2961 C  C   . LEU A 336 ? 0.1332 0.1215 0.1267 -0.0031 -0.0080 0.0008  333  LEU A C   
2962 O  O   . LEU A 336 ? 0.1419 0.1473 0.1376 -0.0087 -0.0131 0.0140  333  LEU A O   
2963 C  CB  . LEU A 336 ? 0.1372 0.1250 0.1270 0.0080  -0.0160 -0.0008 333  LEU A CB  
2964 C  CG  . LEU A 336 ? 0.1319 0.1287 0.1262 0.0150  -0.0052 -0.0059 333  LEU A CG  
2965 C  CD1 . LEU A 336 ? 0.1345 0.1552 0.1689 -0.0034 0.0275  0.0127  333  LEU A CD1 
2966 C  CD2 . LEU A 336 ? 0.1695 0.1564 0.1558 0.0335  -0.0106 0.0303  333  LEU A CD2 
2967 N  N   . CYS A 337 ? 0.1429 0.1329 0.1446 0.0000  -0.0034 -0.0131 334  CYS A N   
2968 C  CA  A CYS A 337 ? 0.1406 0.1551 0.1502 0.0088  -0.0018 -0.0186 334  CYS A CA  
2969 C  CA  B CYS A 337 ? 0.1611 0.1754 0.1719 -0.0011 -0.0030 -0.0179 334  CYS A CA  
2970 C  C   . CYS A 337 ? 0.1328 0.1610 0.1556 0.0076  -0.0074 -0.0091 334  CYS A C   
2971 O  O   . CYS A 337 ? 0.1670 0.1620 0.1748 0.0121  -0.0151 -0.0082 334  CYS A O   
2972 C  CB  A CYS A 337 ? 0.1502 0.1459 0.1519 0.0038  -0.0009 -0.0280 334  CYS A CB  
2973 C  CB  B CYS A 337 ? 0.1793 0.1877 0.1926 -0.0009 -0.0073 -0.0276 334  CYS A CB  
2974 S  SG  A CYS A 337 ? 0.1357 0.1138 0.1225 0.0039  0.0151  -0.0020 334  CYS A SG  
2975 S  SG  B CYS A 337 ? 0.2753 0.3208 0.2970 -0.0790 0.0107  -0.0136 334  CYS A SG  
2976 N  N   . TYR A 338 ? 0.1242 0.1486 0.1351 0.0113  0.0005  -0.0032 335  TYR A N   
2977 C  CA  . TYR A 338 ? 0.1253 0.1255 0.1276 0.0025  0.0064  -0.0092 335  TYR A CA  
2978 C  C   . TYR A 338 ? 0.1436 0.1396 0.1348 0.0016  -0.0039 -0.0086 335  TYR A C   
2979 O  O   . TYR A 338 ? 0.1441 0.1486 0.1361 0.0126  -0.0102 -0.0051 335  TYR A O   
2980 C  CB  . TYR A 338 ? 0.1450 0.1446 0.1600 0.0054  0.0075  -0.0028 335  TYR A CB  
2981 C  CG  . TYR A 338 ? 0.1453 0.1530 0.1884 0.0068  0.0327  0.0131  335  TYR A CG  
2982 C  CD1 . TYR A 338 ? 0.1836 0.1751 0.3455 0.0056  0.1117  -0.0153 335  TYR A CD1 
2983 C  CD2 . TYR A 338 ? 0.1650 0.1874 0.1867 0.0035  -0.0031 -0.0133 335  TYR A CD2 
2984 C  CE1 . TYR A 338 ? 0.1956 0.2155 0.4258 -0.0186 0.1388  -0.0408 335  TYR A CE1 
2985 C  CE2 . TYR A 338 ? 0.1783 0.2339 0.3336 -0.0154 0.0693  -0.0011 335  TYR A CE2 
2986 C  CZ  . TYR A 338 ? 0.1886 0.2170 0.3855 -0.0487 0.1234  -0.0222 335  TYR A CZ  
2987 O  OH  . TYR A 338 ? 0.2063 0.2900 0.5645 -0.0377 0.1146  -0.0396 335  TYR A OH  
2988 N  N   . PHE A 339 ? 0.1345 0.1445 0.1161 0.0012  -0.0172 -0.0010 336  PHE A N   
2989 C  CA  . PHE A 339 ? 0.1246 0.1386 0.1216 0.0018  -0.0042 0.0019  336  PHE A CA  
2990 C  C   . PHE A 339 ? 0.1344 0.1431 0.1218 0.0080  -0.0055 -0.0057 336  PHE A C   
2991 O  O   . PHE A 339 ? 0.1398 0.1498 0.1320 -0.0026 -0.0143 -0.0114 336  PHE A O   
2992 C  CB  . PHE A 339 ? 0.1354 0.1532 0.1297 0.0019  -0.0027 0.0059  336  PHE A CB  
2993 C  CG  . PHE A 339 ? 0.1295 0.1390 0.1503 0.0157  0.0019  -0.0091 336  PHE A CG  
2994 C  CD1 . PHE A 339 ? 0.1510 0.1644 0.1756 0.0115  0.0071  0.0319  336  PHE A CD1 
2995 C  CD2 . PHE A 339 ? 0.1560 0.1712 0.2582 -0.0038 -0.0052 0.0201  336  PHE A CD2 
2996 C  CE1 . PHE A 339 ? 0.1521 0.1862 0.2517 0.0358  -0.0026 0.0369  336  PHE A CE1 
2997 C  CE2 . PHE A 339 ? 0.1532 0.1687 0.3044 -0.0122 0.0242  0.0534  336  PHE A CE2 
2998 C  CZ  . PHE A 339 ? 0.1403 0.2097 0.2991 0.0102  0.0104  0.0263  336  PHE A CZ  
2999 N  N   . VAL A 340 ? 0.1484 0.1409 0.1324 0.0043  -0.0242 0.0030  337  VAL A N   
3000 C  CA  . VAL A 340 ? 0.1565 0.1471 0.1611 0.0068  -0.0110 0.0016  337  VAL A CA  
3001 C  C   . VAL A 340 ? 0.1499 0.1468 0.1492 0.0072  -0.0244 -0.0088 337  VAL A C   
3002 O  O   . VAL A 340 ? 0.1570 0.1355 0.1542 0.0013  -0.0211 -0.0165 337  VAL A O   
3003 C  CB  . VAL A 340 ? 0.1844 0.1272 0.1406 0.0080  -0.0219 0.0030  337  VAL A CB  
3004 C  CG1 . VAL A 340 ? 0.2521 0.1520 0.2088 0.0189  -0.0476 -0.0227 337  VAL A CG1 
3005 C  CG2 . VAL A 340 ? 0.2213 0.2041 0.1461 -0.0027 -0.0102 0.0560  337  VAL A CG2 
3006 N  N   . ASP A 341 ? 0.1511 0.1442 0.1349 0.0014  -0.0175 -0.0046 338  ASP A N   
3007 C  CA  . ASP A 341 ? 0.1444 0.1520 0.1483 0.0110  -0.0031 0.0051  338  ASP A CA  
3008 C  C   . ASP A 341 ? 0.1523 0.1330 0.1370 0.0130  -0.0066 -0.0096 338  ASP A C   
3009 O  O   . ASP A 341 ? 0.1559 0.1442 0.1507 0.0081  -0.0192 0.0003  338  ASP A O   
3010 C  CB  . ASP A 341 ? 0.1347 0.1932 0.1713 0.0076  -0.0061 0.0063  338  ASP A CB  
3011 C  CG  . ASP A 341 ? 0.2109 0.2644 0.3138 -0.0183 -0.0780 0.0542  338  ASP A CG  
3012 O  OD1 . ASP A 341 ? 0.3065 0.3731 0.4037 0.0527  -0.0834 0.0942  338  ASP A OD1 
3013 O  OD2 . ASP A 341 ? 0.2197 0.4273 0.3593 -0.0185 0.0172  0.0934  338  ASP A OD2 
3014 N  N   . TYR A 342 ? 0.1315 0.1180 0.1234 0.0164  -0.0176 -0.0216 339  TYR A N   
3015 C  CA  A TYR A 342 ? 0.1286 0.1238 0.1318 0.0053  -0.0075 -0.0117 339  TYR A CA  
3016 C  CA  B TYR A 342 ? 0.1355 0.1364 0.1381 0.0041  -0.0093 -0.0113 339  TYR A CA  
3017 C  C   . TYR A 342 ? 0.1341 0.1445 0.1315 -0.0007 -0.0047 -0.0110 339  TYR A C   
3018 O  O   . TYR A 342 ? 0.1358 0.1351 0.1476 0.0067  -0.0192 0.0009  339  TYR A O   
3019 C  CB  A TYR A 342 ? 0.1108 0.1321 0.1250 0.0070  -0.0010 -0.0110 339  TYR A CB  
3020 C  CB  B TYR A 342 ? 0.1311 0.1461 0.1378 0.0042  -0.0046 -0.0124 339  TYR A CB  
3021 C  CG  A TYR A 342 ? 0.1004 0.1017 0.0973 0.0284  0.0044  -0.0043 339  TYR A CG  
3022 C  CG  B TYR A 342 ? 0.1373 0.1740 0.1452 0.0123  -0.0063 -0.0102 339  TYR A CG  
3023 C  CD1 A TYR A 342 ? 0.1170 0.1036 0.1191 -0.0066 -0.0014 0.0174  339  TYR A CD1 
3024 C  CD1 B TYR A 342 ? 0.1708 0.1604 0.1595 0.0115  -0.0070 -0.0282 339  TYR A CD1 
3025 C  CD2 A TYR A 342 ? 0.1002 0.1121 0.0995 0.0011  -0.0028 0.0177  339  TYR A CD2 
3026 C  CD2 B TYR A 342 ? 0.1503 0.1807 0.1637 0.0273  -0.0070 0.0113  339  TYR A CD2 
3027 C  CE1 A TYR A 342 ? 0.1148 0.1208 0.1252 -0.0040 -0.0089 0.0372  339  TYR A CE1 
3028 C  CE1 B TYR A 342 ? 0.1827 0.2038 0.1895 0.0103  -0.0071 -0.0123 339  TYR A CE1 
3029 C  CE2 A TYR A 342 ? 0.1144 0.1136 0.1065 0.0186  0.0102  -0.0172 339  TYR A CE2 
3030 C  CE2 B TYR A 342 ? 0.2049 0.2196 0.1753 0.0425  -0.0016 -0.0067 339  TYR A CE2 
3031 C  CZ  A TYR A 342 ? 0.1176 0.0778 0.1669 0.0075  -0.0181 0.0071  339  TYR A CZ  
3032 C  CZ  B TYR A 342 ? 0.2002 0.1918 0.1412 0.0441  0.0039  -0.0448 339  TYR A CZ  
3033 O  OH  A TYR A 342 ? 0.1201 0.1270 0.1923 0.0227  -0.0297 0.0314  339  TYR A OH  
3034 O  OH  B TYR A 342 ? 0.2120 0.2586 0.1819 0.0345  0.0165  -0.0312 339  TYR A OH  
3035 N  N   . LEU A 343 ? 0.1473 0.1487 0.1486 -0.0156 -0.0057 -0.0054 340  LEU A N   
3036 C  CA  A LEU A 343 ? 0.1474 0.1540 0.1354 -0.0112 -0.0030 -0.0057 340  LEU A CA  
3037 C  CA  B LEU A 343 ? 0.1488 0.1548 0.1484 -0.0139 -0.0050 -0.0059 340  LEU A CA  
3038 C  C   . LEU A 343 ? 0.1349 0.1464 0.1495 -0.0061 0.0021  -0.0041 340  LEU A C   
3039 O  O   . LEU A 343 ? 0.1325 0.1468 0.1661 -0.0166 -0.0132 -0.0089 340  LEU A O   
3040 C  CB  A LEU A 343 ? 0.1278 0.1621 0.1473 -0.0072 0.0078  -0.0033 340  LEU A CB  
3041 C  CB  B LEU A 343 ? 0.1446 0.1696 0.1572 -0.0137 0.0023  -0.0093 340  LEU A CB  
3042 C  CG  A LEU A 343 ? 0.1361 0.1936 0.1524 0.0243  0.0169  0.0042  340  LEU A CG  
3043 C  CG  B LEU A 343 ? 0.1756 0.1745 0.1669 -0.0268 -0.0079 0.0059  340  LEU A CG  
3044 C  CD1 A LEU A 343 ? 0.2019 0.2602 0.1449 -0.0116 0.0187  0.0026  340  LEU A CD1 
3045 C  CD1 B LEU A 343 ? 0.0918 0.1749 0.2037 -0.0069 0.0302  -0.0167 340  LEU A CD1 
3046 C  CD2 A LEU A 343 ? 0.1315 0.2174 0.1974 0.0402  -0.0002 0.0301  340  LEU A CD2 
3047 C  CD2 B LEU A 343 ? 0.1555 0.2232 0.1524 -0.0108 -0.0307 0.0100  340  LEU A CD2 
3048 N  N   . GLN A 344 ? 0.1362 0.1491 0.1638 0.0018  -0.0180 -0.0187 341  GLN A N   
3049 C  CA  . GLN A 344 ? 0.1424 0.1309 0.1802 -0.0106 0.0083  -0.0058 341  GLN A CA  
3050 C  C   . GLN A 344 ? 0.1475 0.1457 0.1703 -0.0032 0.0028  -0.0131 341  GLN A C   
3051 O  O   . GLN A 344 ? 0.1598 0.1424 0.1733 -0.0151 0.0081  -0.0160 341  GLN A O   
3052 C  CB  . GLN A 344 ? 0.1686 0.1445 0.2187 -0.0113 0.0052  -0.0019 341  GLN A CB  
3053 C  CG  . GLN A 344 ? 0.1928 0.1842 0.2630 -0.0308 -0.0014 0.0239  341  GLN A CG  
3054 C  CD  . GLN A 344 ? 0.2014 0.2011 0.2889 0.0155  0.0210  0.0513  341  GLN A CD  
3055 O  OE1 . GLN A 344 ? 0.1807 0.2261 0.3328 0.0355  0.0189  0.0718  341  GLN A OE1 
3056 N  NE2 . GLN A 344 ? 0.1799 0.1652 0.2272 0.0106  0.0156  0.0270  341  GLN A NE2 
3057 N  N   . GLN A 345 ? 0.1470 0.1321 0.1579 0.0051  0.0146  -0.0145 342  GLN A N   
3058 C  CA  . GLN A 345 ? 0.1362 0.1459 0.1439 -0.0036 0.0209  -0.0104 342  GLN A CA  
3059 C  C   . GLN A 345 ? 0.1468 0.1398 0.1487 -0.0012 0.0110  -0.0143 342  GLN A C   
3060 O  O   . GLN A 345 ? 0.1613 0.1661 0.1500 -0.0006 0.0083  -0.0136 342  GLN A O   
3061 C  CB  . GLN A 345 ? 0.1483 0.1555 0.1780 -0.0013 0.0420  -0.0234 342  GLN A CB  
3062 C  CG  . GLN A 345 ? 0.1587 0.1809 0.2009 -0.0043 0.0355  0.0230  342  GLN A CG  
3063 C  CD  . GLN A 345 ? 0.1964 0.1622 0.2231 0.0079  0.0294  0.0225  342  GLN A CD  
3064 O  OE1 . GLN A 345 ? 0.3050 0.1978 0.2712 -0.0473 0.0006  -0.0049 342  GLN A OE1 
3065 N  NE2 . GLN A 345 ? 0.1812 0.1940 0.2545 0.0127  -0.0108 0.0202  342  GLN A NE2 
3066 N  N   . ALA A 346 ? 0.1278 0.1299 0.1273 0.0006  0.0151  -0.0093 343  ALA A N   
3067 C  CA  . ALA A 346 ? 0.1234 0.1345 0.1211 0.0103  -0.0089 0.0077  343  ALA A CA  
3068 C  C   . ALA A 346 ? 0.1253 0.1538 0.1314 -0.0049 0.0028  -0.0050 343  ALA A C   
3069 O  O   . ALA A 346 ? 0.1237 0.1593 0.1514 -0.0044 -0.0196 0.0030  343  ALA A O   
3070 C  CB  . ALA A 346 ? 0.1320 0.1439 0.1423 0.0101  0.0143  -0.0011 343  ALA A CB  
3071 N  N   . ASP A 347 ? 0.1130 0.1234 0.1294 0.0031  0.0034  -0.0052 344  ASP A N   
3072 C  CA  . ASP A 347 ? 0.1101 0.1227 0.1381 -0.0053 0.0019  -0.0029 344  ASP A CA  
3073 C  C   . ASP A 347 ? 0.1166 0.1204 0.1372 -0.0114 0.0130  -0.0012 344  ASP A C   
3074 O  O   . ASP A 347 ? 0.1212 0.1379 0.1319 0.0003  -0.0001 -0.0047 344  ASP A O   
3075 C  CB  . ASP A 347 ? 0.1321 0.1140 0.1287 0.0136  0.0032  -0.0051 344  ASP A CB  
3076 C  CG  . ASP A 347 ? 0.1660 0.1449 0.1498 0.0115  0.0154  -0.0110 344  ASP A CG  
3077 O  OD1 . ASP A 347 ? 0.1767 0.1710 0.1404 -0.0048 -0.0007 0.0186  344  ASP A OD1 
3078 O  OD2 . ASP A 347 ? 0.1821 0.1601 0.1747 -0.0104 0.0058  0.0073  344  ASP A OD2 
3079 N  N   . MSE A 348 ? 0.1078 0.1278 0.1368 -0.0042 0.0011  -0.0206 345  MSE A N   
3080 C  CA  . MSE A 348 ? 0.0959 0.1222 0.1166 -0.0032 0.0132  -0.0125 345  MSE A CA  
3081 C  C   . MSE A 348 ? 0.1013 0.1138 0.1332 0.0021  0.0040  -0.0052 345  MSE A C   
3082 O  O   . MSE A 348 ? 0.1076 0.1261 0.1335 0.0010  -0.0004 -0.0158 345  MSE A O   
3083 C  CB  . MSE A 348 ? 0.1170 0.1227 0.1076 0.0007  0.0125  -0.0003 345  MSE A CB  
3084 C  CG  . MSE A 348 ? 0.1195 0.1638 0.1193 0.0387  -0.0117 0.0126  345  MSE A CG  
3085 SE SE  . MSE A 348 ? 0.1861 0.2460 0.1772 0.0150  -0.0015 0.0328  345  MSE A SE  
3086 C  CE  . MSE A 348 ? 0.0804 0.0928 0.1077 -0.0064 -0.0492 0.0411  345  MSE A CE  
3087 N  N   . GLU A 349 ? 0.1166 0.1166 0.1312 0.0086  0.0010  -0.0001 346  GLU A N   
3088 C  CA  . GLU A 349 ? 0.1215 0.1214 0.1136 0.0061  0.0023  -0.0117 346  GLU A CA  
3089 C  C   . GLU A 349 ? 0.1382 0.1284 0.1384 0.0041  0.0060  0.0056  346  GLU A C   
3090 O  O   . GLU A 349 ? 0.1462 0.1450 0.1297 0.0075  0.0088  -0.0066 346  GLU A O   
3091 C  CB  . GLU A 349 ? 0.1452 0.1338 0.1413 0.0119  0.0002  -0.0058 346  GLU A CB  
3092 C  CG  . GLU A 349 ? 0.1645 0.1222 0.1549 0.0136  0.0125  -0.0227 346  GLU A CG  
3093 C  CD  . GLU A 349 ? 0.1654 0.1651 0.1851 0.0024  0.0376  0.0257  346  GLU A CD  
3094 O  OE1 . GLU A 349 ? 0.1680 0.1789 0.2084 0.0000  0.0195  0.0080  346  GLU A OE1 
3095 O  OE2 . GLU A 349 ? 0.2022 0.1920 0.2602 0.0005  0.0545  0.0191  346  GLU A OE2 
3096 N  N   . SER A 350 ? 0.1233 0.1181 0.0959 0.0038  -0.0057 -0.0024 347  SER A N   
3097 C  CA  . SER A 350 ? 0.1124 0.1151 0.0976 -0.0021 -0.0033 0.0168  347  SER A CA  
3098 C  C   . SER A 350 ? 0.1152 0.1208 0.1103 -0.0048 -0.0042 0.0028  347  SER A C   
3099 O  O   . SER A 350 ? 0.1339 0.1297 0.1093 -0.0055 -0.0151 -0.0027 347  SER A O   
3100 C  CB  . SER A 350 ? 0.0950 0.1093 0.1265 0.0033  -0.0161 -0.0002 347  SER A CB  
3101 O  OG  . SER A 350 ? 0.1489 0.1147 0.1500 -0.0042 0.0079  0.0051  347  SER A OG  
3102 N  N   . ASN A 351 ? 0.1188 0.1190 0.1272 0.0027  -0.0195 0.0078  348  ASN A N   
3103 C  CA  A ASN A 351 ? 0.1111 0.1099 0.1268 0.0045  0.0007  0.0106  348  ASN A CA  
3104 C  CA  B ASN A 351 ? 0.1116 0.1113 0.1240 0.0033  -0.0024 0.0081  348  ASN A CA  
3105 C  C   . ASN A 351 ? 0.0947 0.1129 0.1202 0.0047  -0.0155 0.0008  348  ASN A C   
3106 O  O   . ASN A 351 ? 0.1239 0.1223 0.1298 0.0015  -0.0030 0.0043  348  ASN A O   
3107 C  CB  A ASN A 351 ? 0.1234 0.1181 0.1227 0.0158  0.0051  0.0124  348  ASN A CB  
3108 C  CB  B ASN A 351 ? 0.1195 0.1161 0.1180 0.0105  -0.0017 0.0082  348  ASN A CB  
3109 C  CG  A ASN A 351 ? 0.1170 0.1239 0.1112 0.0207  0.0129  0.0065  348  ASN A CG  
3110 C  CG  B ASN A 351 ? 0.1150 0.1171 0.0959 0.0095  0.0076  0.0005  348  ASN A CG  
3111 O  OD1 A ASN A 351 ? 0.1632 0.1347 0.1297 0.0075  0.0154  -0.0087 348  ASN A OD1 
3112 O  OD1 B ASN A 351 ? 0.1119 0.1116 0.1361 0.0217  0.0204  0.0136  348  ASN A OD1 
3113 N  ND2 A ASN A 351 ? 0.1184 0.1045 0.1358 0.0136  0.0071  0.0023  348  ASN A ND2 
3114 N  ND2 B ASN A 351 ? 0.1550 0.1246 0.1123 0.0048  0.0061  -0.0212 348  ASN A ND2 
3115 N  N   . GLY A 352 ? 0.1147 0.1065 0.1386 -0.0014 -0.0007 -0.0009 349  GLY A N   
3116 C  CA  . GLY A 352 ? 0.1306 0.1131 0.1392 0.0013  0.0004  0.0019  349  GLY A CA  
3117 C  C   . GLY A 352 ? 0.1199 0.1098 0.1344 -0.0069 0.0052  -0.0036 349  GLY A C   
3118 O  O   . GLY A 352 ? 0.1299 0.1281 0.1241 -0.0025 -0.0025 0.0021  349  GLY A O   
3119 N  N   . LYS A 353 ? 0.1152 0.1202 0.1226 -0.0213 -0.0140 0.0031  350  LYS A N   
3120 C  CA  . LYS A 353 ? 0.1335 0.1275 0.1055 -0.0055 -0.0077 -0.0050 350  LYS A CA  
3121 C  C   . LYS A 353 ? 0.1354 0.1151 0.1188 -0.0039 -0.0143 0.0079  350  LYS A C   
3122 O  O   . LYS A 353 ? 0.1543 0.1332 0.1416 -0.0196 -0.0171 0.0090  350  LYS A O   
3123 C  CB  . LYS A 353 ? 0.1272 0.1340 0.1008 -0.0107 -0.0044 0.0042  350  LYS A CB  
3124 C  CG  . LYS A 353 ? 0.1478 0.1191 0.1316 0.0007  -0.0071 0.0145  350  LYS A CG  
3125 C  CD  . LYS A 353 ? 0.1233 0.1153 0.1151 0.0162  -0.0260 0.0134  350  LYS A CD  
3126 C  CE  . LYS A 353 ? 0.1331 0.1058 0.1095 0.0042  -0.0017 0.0019  350  LYS A CE  
3127 N  NZ  . LYS A 353 ? 0.1102 0.1128 0.1277 0.0267  0.0026  0.0034  350  LYS A NZ  
3128 N  N   . SER A 354 ? 0.1436 0.1079 0.0929 0.0081  -0.0126 0.0125  351  SER A N   
3129 C  CA  . SER A 354 ? 0.1404 0.1162 0.1280 -0.0057 -0.0257 -0.0020 351  SER A CA  
3130 C  C   . SER A 354 ? 0.1283 0.1058 0.1453 -0.0001 -0.0260 0.0095  351  SER A C   
3131 O  O   . SER A 354 ? 0.1462 0.1158 0.1579 -0.0306 -0.0131 0.0151  351  SER A O   
3132 C  CB  . SER A 354 ? 0.1319 0.1096 0.1457 0.0098  -0.0437 -0.0106 351  SER A CB  
3133 O  OG  . SER A 354 ? 0.1512 0.1608 0.2288 0.0290  -0.0569 -0.0109 351  SER A OG  
3134 N  N   . VAL A 355 ? 0.1243 0.1123 0.1409 -0.0032 -0.0212 0.0183  352  VAL A N   
3135 C  CA  . VAL A 355 ? 0.1214 0.1293 0.1484 0.0139  -0.0202 -0.0014 352  VAL A CA  
3136 C  C   . VAL A 355 ? 0.1224 0.1445 0.1465 0.0088  -0.0163 -0.0033 352  VAL A C   
3137 O  O   . VAL A 355 ? 0.1222 0.1550 0.1601 0.0111  -0.0061 -0.0028 352  VAL A O   
3138 C  CB  . VAL A 355 ? 0.1205 0.1451 0.1493 0.0064  -0.0061 -0.0134 352  VAL A CB  
3139 C  CG1 . VAL A 355 ? 0.1364 0.1674 0.1808 0.0216  -0.0100 -0.0214 352  VAL A CG1 
3140 C  CG2 . VAL A 355 ? 0.1399 0.1408 0.1437 0.0186  -0.0055 0.0280  352  VAL A CG2 
3141 N  N   . ASN A 356 ? 0.1106 0.1369 0.1286 0.0165  -0.0125 0.0178  353  ASN A N   
3142 C  CA  . ASN A 356 ? 0.1331 0.1348 0.1169 0.0026  -0.0140 -0.0050 353  ASN A CA  
3143 C  C   . ASN A 356 ? 0.1475 0.1520 0.1279 0.0095  -0.0067 0.0009  353  ASN A C   
3144 O  O   . ASN A 356 ? 0.1538 0.1530 0.1092 0.0144  0.0010  -0.0191 353  ASN A O   
3145 C  CB  . ASN A 356 ? 0.1490 0.1515 0.1073 0.0010  -0.0171 0.0068  353  ASN A CB  
3146 C  CG  . ASN A 356 ? 0.1509 0.1465 0.1389 -0.0055 -0.0159 -0.0012 353  ASN A CG  
3147 O  OD1 . ASN A 356 ? 0.1416 0.1573 0.1477 -0.0102 -0.0086 -0.0008 353  ASN A OD1 
3148 N  ND2 . ASN A 356 ? 0.1269 0.1460 0.1783 0.0034  -0.0217 -0.0298 353  ASN A ND2 
3149 N  N   . ILE A 357 ? 0.1573 0.1713 0.1333 0.0184  -0.0014 0.0013  354  ILE A N   
3150 C  CA  . ILE A 357 ? 0.1606 0.1714 0.1498 0.0136  -0.0086 0.0017  354  ILE A CA  
3151 C  C   . ILE A 357 ? 0.1333 0.1615 0.1500 0.0200  -0.0133 0.0072  354  ILE A C   
3152 O  O   . ILE A 357 ? 0.1487 0.2036 0.1535 0.0114  0.0011  0.0130  354  ILE A O   
3153 C  CB  . ILE A 357 ? 0.1953 0.1516 0.1639 0.0244  -0.0166 -0.0141 354  ILE A CB  
3154 C  CG1 . ILE A 357 ? 0.2343 0.2364 0.2247 0.0335  -0.0298 0.0109  354  ILE A CG1 
3155 C  CG2 . ILE A 357 ? 0.2274 0.1821 0.1626 0.0377  0.0006  -0.0191 354  ILE A CG2 
3156 C  CD1 . ILE A 357 ? 0.2068 0.3143 0.2556 0.0058  0.0118  0.0163  354  ILE A CD1 
3157 N  N   . ALA A 358 ? 0.1394 0.1855 0.1490 0.0086  -0.0125 0.0094  355  ALA A N   
3158 C  CA  . ALA A 358 ? 0.1603 0.1685 0.1392 0.0076  -0.0139 0.0007  355  ALA A CA  
3159 C  C   . ALA A 358 ? 0.1456 0.1851 0.1332 -0.0019 -0.0100 -0.0113 355  ALA A C   
3160 O  O   . ALA A 358 ? 0.1937 0.2239 0.1376 0.0128  0.0057  -0.0290 355  ALA A O   
3161 C  CB  . ALA A 358 ? 0.1640 0.2102 0.1690 -0.0010 -0.0016 0.0014  355  ALA A CB  
3162 N  N   . GLY A 359 ? 0.1490 0.1732 0.1413 0.0094  -0.0087 -0.0023 356  GLY A N   
3163 C  CA  . GLY A 359 ? 0.1631 0.1678 0.1566 -0.0095 0.0073  -0.0080 356  GLY A CA  
3164 C  C   . GLY A 359 ? 0.1722 0.1616 0.1592 0.0007  0.0139  -0.0040 356  GLY A C   
3165 O  O   . GLY A 359 ? 0.1914 0.1527 0.1844 0.0059  0.0235  0.0080  356  GLY A O   
3166 N  N   . GLU A 360 ? 0.1635 0.1554 0.1422 -0.0025 -0.0033 -0.0072 357  GLU A N   
3167 C  CA  . GLU A 360 ? 0.1707 0.1577 0.1589 0.0004  -0.0036 -0.0222 357  GLU A CA  
3168 C  C   . GLU A 360 ? 0.1500 0.1426 0.1561 -0.0019 -0.0046 -0.0133 357  GLU A C   
3169 O  O   . GLU A 360 ? 0.1474 0.1441 0.1424 -0.0044 0.0011  -0.0181 357  GLU A O   
3170 C  CB  . GLU A 360 ? 0.1562 0.1806 0.1728 0.0039  -0.0034 -0.0320 357  GLU A CB  
3171 C  CG  . GLU A 360 ? 0.1686 0.1930 0.2021 -0.0063 -0.0201 -0.0222 357  GLU A CG  
3172 C  CD  . GLU A 360 ? 0.2174 0.2981 0.2641 -0.0326 -0.0053 -0.0216 357  GLU A CD  
3173 O  OE1 . GLU A 360 ? 0.1911 0.3005 0.2877 -0.0627 -0.0285 -0.0533 357  GLU A OE1 
3174 O  OE2 . GLU A 360 ? 0.2357 0.4497 0.3831 -0.0589 -0.0268 -0.0881 357  GLU A OE2 
3175 N  N   . THR A 361 ? 0.1555 0.1354 0.1441 -0.0053 -0.0124 -0.0111 358  THR A N   
3176 C  CA  . THR A 361 ? 0.1611 0.1482 0.1577 0.0016  -0.0032 0.0013  358  THR A CA  
3177 C  C   . THR A 361 ? 0.1649 0.1488 0.1516 -0.0152 -0.0052 -0.0043 358  THR A C   
3178 O  O   . THR A 361 ? 0.2179 0.1984 0.1898 -0.0583 -0.0002 0.0034  358  THR A O   
3179 C  CB  . THR A 361 ? 0.1730 0.1539 0.1509 0.0010  0.0038  0.0028  358  THR A CB  
3180 O  OG1 . THR A 361 ? 0.1957 0.2520 0.1638 0.0358  0.0247  0.0223  358  THR A OG1 
3181 C  CG2 . THR A 361 ? 0.1686 0.2433 0.1800 0.0374  -0.0254 -0.0347 358  THR A CG2 
3182 N  N   . VAL A 362 ? 0.1460 0.1652 0.1448 -0.0068 -0.0039 0.0021  359  VAL A N   
3183 C  CA  . VAL A 362 ? 0.1430 0.1670 0.1685 -0.0086 -0.0038 0.0082  359  VAL A CA  
3184 C  C   . VAL A 362 ? 0.1814 0.1790 0.1692 -0.0109 -0.0001 0.0087  359  VAL A C   
3185 O  O   . VAL A 362 ? 0.1831 0.1745 0.1713 -0.0036 0.0027  0.0192  359  VAL A O   
3186 C  CB  . VAL A 362 ? 0.1497 0.1627 0.1651 0.0173  0.0039  0.0252  359  VAL A CB  
3187 C  CG1 . VAL A 362 ? 0.1930 0.1791 0.1406 0.0528  -0.0057 0.0267  359  VAL A CG1 
3188 C  CG2 . VAL A 362 ? 0.1427 0.1340 0.1769 0.0052  -0.0073 -0.0201 359  VAL A CG2 
3189 N  N   . ASN A 363 ? 0.2088 0.1794 0.1841 -0.0248 0.0009  -0.0011 360  ASN A N   
3190 C  CA  A ASN A 363 ? 0.2341 0.1723 0.1928 -0.0220 0.0051  -0.0037 360  ASN A CA  
3191 C  CA  B ASN A 363 ? 0.2287 0.1768 0.1856 -0.0173 0.0034  0.0030  360  ASN A CA  
3192 C  C   . ASN A 363 ? 0.2461 0.1651 0.1839 -0.0074 -0.0004 0.0080  360  ASN A C   
3193 O  O   . ASN A 363 ? 0.3509 0.1936 0.1862 -0.0022 0.0129  0.0163  360  ASN A O   
3194 C  CB  A ASN A 363 ? 0.2451 0.1863 0.2112 -0.0349 -0.0017 -0.0153 360  ASN A CB  
3195 C  CB  B ASN A 363 ? 0.2330 0.1881 0.1911 -0.0251 0.0017  -0.0023 360  ASN A CB  
3196 C  CG  A ASN A 363 ? 0.3035 0.2715 0.2773 -0.0234 0.0275  -0.0371 360  ASN A CG  
3197 C  CG  B ASN A 363 ? 0.2543 0.2108 0.2141 -0.0205 0.0133  0.0036  360  ASN A CG  
3198 O  OD1 A ASN A 363 ? 0.3655 0.3635 0.3746 -0.0122 0.0638  -0.0746 360  ASN A OD1 
3199 O  OD1 B ASN A 363 ? 0.3243 0.2576 0.2634 -0.0396 0.0653  0.0210  360  ASN A OD1 
3200 N  ND2 A ASN A 363 ? 0.2941 0.3626 0.3650 -0.0253 0.0472  -0.0408 360  ASN A ND2 
3201 N  ND2 B ASN A 363 ? 0.2704 0.2468 0.2058 -0.0104 0.0325  -0.0200 360  ASN A ND2 
3202 N  N   . TYR A 364 ? 0.1679 0.1318 0.1464 -0.0194 0.0065  0.0119  361  TYR A N   
3203 C  CA  . TYR A 364 ? 0.1506 0.1378 0.1538 0.0031  0.0055  0.0210  361  TYR A CA  
3204 C  C   . TYR A 364 ? 0.1314 0.1279 0.1421 -0.0031 0.0044  0.0170  361  TYR A C   
3205 O  O   . TYR A 364 ? 0.1269 0.1392 0.1075 -0.0085 -0.0008 0.0188  361  TYR A O   
3206 C  CB  . TYR A 364 ? 0.1100 0.1301 0.1517 -0.0155 0.0120  0.0241  361  TYR A CB  
3207 C  CG  . TYR A 364 ? 0.1438 0.1313 0.1474 -0.0025 -0.0034 0.0370  361  TYR A CG  
3208 C  CD1 . TYR A 364 ? 0.1137 0.1638 0.1435 -0.0137 -0.0104 0.0286  361  TYR A CD1 
3209 C  CD2 . TYR A 364 ? 0.1420 0.1318 0.1514 -0.0005 0.0220  0.0183  361  TYR A CD2 
3210 C  CE1 . TYR A 364 ? 0.1201 0.1404 0.1617 0.0004  -0.0232 0.0147  361  TYR A CE1 
3211 C  CE2 . TYR A 364 ? 0.1109 0.1175 0.1433 -0.0213 -0.0165 0.0083  361  TYR A CE2 
3212 C  CZ  . TYR A 364 ? 0.1356 0.1045 0.1261 -0.0021 -0.0205 0.0046  361  TYR A CZ  
3213 O  OH  . TYR A 364 ? 0.1413 0.1432 0.1253 0.0290  -0.0149 0.0043  361  TYR A OH  
3214 N  N   . GLN A 365 ? 0.1296 0.1193 0.1341 -0.0158 0.0099  0.0260  362  GLN A N   
3215 C  CA  . GLN A 365 ? 0.1046 0.1424 0.1304 -0.0019 -0.0096 0.0195  362  GLN A CA  
3216 C  C   . GLN A 365 ? 0.1231 0.1452 0.1423 -0.0050 0.0001  0.0072  362  GLN A C   
3217 O  O   . GLN A 365 ? 0.1140 0.1474 0.1328 0.0195  0.0084  0.0059  362  GLN A O   
3218 C  CB  . GLN A 365 ? 0.1415 0.1338 0.1102 0.0057  -0.0120 0.0138  362  GLN A CB  
3219 C  CG  . GLN A 365 ? 0.1451 0.1332 0.1097 0.0125  0.0078  -0.0030 362  GLN A CG  
3220 C  CD  . GLN A 365 ? 0.1423 0.1227 0.1437 0.0108  -0.0178 0.0146  362  GLN A CD  
3221 O  OE1 . GLN A 365 ? 0.1281 0.1604 0.1448 0.0244  -0.0182 0.0126  362  GLN A OE1 
3222 N  NE2 . GLN A 365 ? 0.1530 0.1554 0.1485 -0.0145 -0.0087 -0.0137 362  GLN A NE2 
3223 N  N   . THR A 366 ? 0.1118 0.1272 0.1171 0.0088  -0.0042 0.0106  363  THR A N   
3224 C  CA  . THR A 366 ? 0.1176 0.1232 0.1199 0.0045  0.0002  0.0097  363  THR A CA  
3225 C  C   . THR A 366 ? 0.1362 0.1224 0.1085 0.0033  -0.0035 0.0040  363  THR A C   
3226 O  O   . THR A 366 ? 0.1410 0.1305 0.1074 0.0046  -0.0069 0.0052  363  THR A O   
3227 C  CB  . THR A 366 ? 0.1232 0.1086 0.1184 0.0039  0.0004  0.0004  363  THR A CB  
3228 O  OG1 . THR A 366 ? 0.1258 0.1170 0.1195 0.0092  0.0003  0.0059  363  THR A OG1 
3229 C  CG2 . THR A 366 ? 0.0956 0.1685 0.1723 -0.0008 -0.0213 -0.0213 363  THR A CG2 
3230 N  N   . GLY A 367 ? 0.1180 0.1238 0.1040 -0.0026 -0.0086 0.0043  364  GLY A N   
3231 C  CA  . GLY A 367 ? 0.1427 0.1334 0.1038 0.0061  -0.0097 -0.0003 364  GLY A CA  
3232 C  C   . GLY A 367 ? 0.1326 0.1255 0.1187 -0.0034 0.0018  0.0061  364  GLY A C   
3233 O  O   . GLY A 367 ? 0.1295 0.1202 0.1288 0.0097  0.0080  0.0106  364  GLY A O   
3234 N  N   . VAL A 368 ? 0.1143 0.1269 0.1284 0.0081  -0.0147 -0.0056 365  VAL A N   
3235 C  CA  . VAL A 368 ? 0.1082 0.1358 0.1378 0.0010  0.0006  0.0046  365  VAL A CA  
3236 C  C   . VAL A 368 ? 0.1175 0.1254 0.1261 0.0027  -0.0148 0.0063  365  VAL A C   
3237 O  O   . VAL A 368 ? 0.1203 0.1337 0.1341 0.0086  -0.0176 0.0130  365  VAL A O   
3238 C  CB  . VAL A 368 ? 0.1173 0.1202 0.1543 0.0022  -0.0184 0.0160  365  VAL A CB  
3239 C  CG1 . VAL A 368 ? 0.1337 0.1397 0.1864 -0.0166 -0.0188 0.0267  365  VAL A CG1 
3240 C  CG2 . VAL A 368 ? 0.1202 0.1744 0.1226 0.0114  -0.0151 -0.0003 365  VAL A CG2 
3241 N  N   . VAL A 369 ? 0.0983 0.1180 0.1300 0.0105  -0.0025 0.0049  366  VAL A N   
3242 C  CA  . VAL A 369 ? 0.1106 0.1248 0.1187 0.0053  -0.0112 0.0020  366  VAL A CA  
3243 C  C   . VAL A 369 ? 0.1304 0.1199 0.1308 -0.0002 -0.0038 0.0060  366  VAL A C   
3244 O  O   . VAL A 369 ? 0.1854 0.1346 0.1315 -0.0218 -0.0004 0.0070  366  VAL A O   
3245 C  CB  . VAL A 369 ? 0.1145 0.1050 0.1288 0.0089  -0.0141 -0.0030 366  VAL A CB  
3246 C  CG1 . VAL A 369 ? 0.1321 0.1551 0.1562 -0.0185 -0.0046 -0.0063 366  VAL A CG1 
3247 C  CG2 . VAL A 369 ? 0.1346 0.1134 0.1337 0.0120  0.0230  -0.0135 366  VAL A CG2 
3248 N  N   . LEU A 370 ? 0.1520 0.1325 0.1193 0.0079  -0.0030 0.0098  367  LEU A N   
3249 C  CA  . LEU A 370 ? 0.1445 0.1434 0.1200 0.0070  -0.0050 -0.0090 367  LEU A CA  
3250 C  C   . LEU A 370 ? 0.1527 0.1392 0.1368 0.0043  0.0001  -0.0089 367  LEU A C   
3251 O  O   . LEU A 370 ? 0.1492 0.1541 0.1288 -0.0090 -0.0026 -0.0098 367  LEU A O   
3252 C  CB  . LEU A 370 ? 0.1362 0.1359 0.1280 0.0011  -0.0069 -0.0162 367  LEU A CB  
3253 C  CG  . LEU A 370 ? 0.1716 0.1459 0.1253 0.0148  0.0070  -0.0054 367  LEU A CG  
3254 C  CD1 . LEU A 370 ? 0.1893 0.1971 0.1456 0.0027  0.0395  -0.0151 367  LEU A CD1 
3255 C  CD2 . LEU A 370 ? 0.2636 0.1786 0.2313 0.0778  -0.0213 -0.0049 367  LEU A CD2 
3256 N  N   . TRP A 371 ? 0.1234 0.1351 0.1068 -0.0093 -0.0001 -0.0105 368  TRP A N   
3257 C  CA  . TRP A 371 ? 0.1366 0.1399 0.1166 -0.0007 -0.0004 -0.0132 368  TRP A CA  
3258 C  C   . TRP A 371 ? 0.1249 0.1297 0.1134 -0.0095 0.0054  -0.0099 368  TRP A C   
3259 O  O   . TRP A 371 ? 0.1280 0.1496 0.1381 -0.0195 0.0111  -0.0162 368  TRP A O   
3260 C  CB  . TRP A 371 ? 0.1272 0.1150 0.1058 0.0000  -0.0088 -0.0104 368  TRP A CB  
3261 C  CG  . TRP A 371 ? 0.1301 0.1076 0.1253 0.0204  -0.0098 -0.0030 368  TRP A CG  
3262 C  CD1 . TRP A 371 ? 0.1274 0.1393 0.1405 0.0188  -0.0130 0.0109  368  TRP A CD1 
3263 C  CD2 . TRP A 371 ? 0.1172 0.1306 0.1268 0.0254  -0.0098 -0.0058 368  TRP A CD2 
3264 N  NE1 . TRP A 371 ? 0.1385 0.1491 0.1565 0.0079  -0.0250 0.0060  368  TRP A NE1 
3265 C  CE2 . TRP A 371 ? 0.1219 0.1629 0.1331 0.0110  -0.0263 -0.0037 368  TRP A CE2 
3266 C  CE3 . TRP A 371 ? 0.1397 0.1365 0.1371 0.0022  -0.0001 0.0122  368  TRP A CE3 
3267 C  CZ2 . TRP A 371 ? 0.1446 0.1150 0.1727 0.0002  -0.0113 0.0132  368  TRP A CZ2 
3268 C  CZ3 . TRP A 371 ? 0.1301 0.1883 0.1619 -0.0195 -0.0572 0.0068  368  TRP A CZ3 
3269 C  CH2 . TRP A 371 ? 0.1595 0.1561 0.1408 0.0039  -0.0193 -0.0109 368  TRP A CH2 
3270 N  N   . GLY A 372 ? 0.1138 0.1501 0.1085 -0.0076 0.0161  -0.0170 369  GLY A N   
3271 C  CA  . GLY A 372 ? 0.1295 0.1538 0.1322 -0.0034 0.0181  -0.0348 369  GLY A CA  
3272 C  C   . GLY A 372 ? 0.1569 0.1936 0.1396 -0.0283 0.0361  -0.0362 369  GLY A C   
3273 O  O   . GLY A 372 ? 0.1832 0.2801 0.2097 -0.0800 0.0469  -0.0755 369  GLY A O   
3274 N  N   . GLY A 373 ? 0.1535 0.1463 0.1580 -0.0259 0.0226  -0.0252 370  GLY A N   
3275 C  CA  . GLY A 373 ? 0.1730 0.1759 0.1754 -0.0262 0.0242  -0.0238 370  GLY A CA  
3276 C  C   . GLY A 373 ? 0.1413 0.1515 0.1395 -0.0191 0.0208  -0.0132 370  GLY A C   
3277 O  O   . GLY A 373 ? 0.1420 0.1525 0.1206 -0.0145 0.0250  -0.0022 370  GLY A O   
3278 N  N   . VAL A 374 ? 0.1507 0.1435 0.1186 -0.0098 0.0059  -0.0034 371  VAL A N   
3279 C  CA  . VAL A 374 ? 0.1335 0.1235 0.1336 0.0010  -0.0009 -0.0164 371  VAL A CA  
3280 C  C   . VAL A 374 ? 0.1201 0.1100 0.1376 -0.0063 0.0102  -0.0077 371  VAL A C   
3281 O  O   . VAL A 374 ? 0.1315 0.1336 0.1391 0.0060  0.0042  -0.0049 371  VAL A O   
3282 C  CB  . VAL A 374 ? 0.1525 0.1266 0.1211 -0.0031 0.0107  -0.0077 371  VAL A CB  
3283 C  CG1 . VAL A 374 ? 0.1904 0.1448 0.1292 -0.0233 -0.0200 -0.0137 371  VAL A CG1 
3284 C  CG2 . VAL A 374 ? 0.2431 0.1693 0.1507 -0.0032 -0.0402 0.0109  371  VAL A CG2 
3285 N  N   . GLY A 375 ? 0.1100 0.1203 0.1081 0.0060  0.0069  -0.0122 372  GLY A N   
3286 C  CA  . GLY A 375 ? 0.1168 0.1166 0.1228 -0.0026 0.0016  -0.0018 372  GLY A CA  
3287 C  C   . GLY A 375 ? 0.1194 0.1237 0.1186 0.0040  0.0029  -0.0073 372  GLY A C   
3288 O  O   . GLY A 375 ? 0.1176 0.1237 0.1216 -0.0003 -0.0045 0.0070  372  GLY A O   
3289 N  N   . THR A 376 ? 0.1116 0.1159 0.1166 -0.0056 -0.0002 -0.0061 373  THR A N   
3290 C  CA  . THR A 376 ? 0.1262 0.1178 0.1278 -0.0044 0.0079  -0.0006 373  THR A CA  
3291 C  C   . THR A 376 ? 0.1385 0.1110 0.1174 -0.0030 0.0000  -0.0028 373  THR A C   
3292 O  O   . THR A 376 ? 0.1380 0.1052 0.1349 0.0042  0.0039  0.0056  373  THR A O   
3293 C  CB  . THR A 376 ? 0.1196 0.1276 0.1273 0.0040  -0.0019 0.0221  373  THR A CB  
3294 O  OG1 . THR A 376 ? 0.1197 0.1389 0.1225 -0.0103 0.0117  -0.0316 373  THR A OG1 
3295 C  CG2 . THR A 376 ? 0.1441 0.1463 0.1166 0.0026  0.0029  -0.0123 373  THR A CG2 
3296 N  N   . ASN A 377 ? 0.1284 0.1098 0.1461 0.0016  0.0120  -0.0008 374  ASN A N   
3297 C  CA  . ASN A 377 ? 0.1318 0.1084 0.1317 0.0073  0.0155  -0.0029 374  ASN A CA  
3298 C  C   . ASN A 377 ? 0.1286 0.1224 0.1426 -0.0010 -0.0033 0.0001  374  ASN A C   
3299 O  O   . ASN A 377 ? 0.1296 0.1171 0.1461 0.0101  -0.0080 0.0014  374  ASN A O   
3300 C  CB  . ASN A 377 ? 0.1341 0.1236 0.1366 -0.0006 0.0221  -0.0029 374  ASN A CB  
3301 C  CG  . ASN A 377 ? 0.1620 0.1393 0.1498 -0.0082 0.0310  0.0070  374  ASN A CG  
3302 O  OD1 . ASN A 377 ? 0.1814 0.1233 0.2352 0.0056  0.0545  -0.0122 374  ASN A OD1 
3303 N  ND2 . ASN A 377 ? 0.1329 0.1678 0.1565 -0.0076 0.0100  -0.0019 374  ASN A ND2 
3304 N  N   . GLY A 378 ? 0.1275 0.1213 0.1498 0.0040  -0.0056 -0.0080 375  GLY A N   
3305 C  CA  . GLY A 378 ? 0.1094 0.1181 0.1335 0.0013  -0.0004 -0.0120 375  GLY A CA  
3306 C  C   . GLY A 378 ? 0.1127 0.1242 0.1456 0.0058  0.0047  -0.0081 375  GLY A C   
3307 O  O   . GLY A 378 ? 0.1377 0.1206 0.1412 -0.0058 0.0251  -0.0088 375  GLY A O   
3308 N  N   . GLN A 379 ? 0.1300 0.1158 0.1309 0.0002  -0.0058 -0.0081 376  GLN A N   
3309 C  CA  . GLN A 379 ? 0.1149 0.1205 0.1383 -0.0126 0.0061  -0.0005 376  GLN A CA  
3310 C  C   . GLN A 379 ? 0.1387 0.1302 0.1522 0.0024  0.0104  0.0002  376  GLN A C   
3311 O  O   . GLN A 379 ? 0.1604 0.1273 0.1515 0.0104  0.0267  0.0138  376  GLN A O   
3312 C  CB  . GLN A 379 ? 0.1236 0.1302 0.1212 -0.0070 0.0097  0.0028  376  GLN A CB  
3313 C  CG  . GLN A 379 ? 0.1094 0.1216 0.1081 -0.0193 -0.0044 0.0055  376  GLN A CG  
3314 C  CD  . GLN A 379 ? 0.1311 0.1002 0.1072 0.0060  0.0064  0.0029  376  GLN A CD  
3315 O  OE1 . GLN A 379 ? 0.1808 0.1626 0.1426 -0.0086 -0.0104 0.0329  376  GLN A OE1 
3316 N  NE2 . GLN A 379 ? 0.0978 0.0948 0.0894 0.0004  0.0032  0.0006  376  GLN A NE2 
3317 N  N   . HIS A 380 ? 0.1251 0.1117 0.1504 -0.0027 0.0154  0.0071  377  HIS A N   
3318 C  CA  . HIS A 380 ? 0.1326 0.1266 0.1496 0.0034  0.0002  0.0009  377  HIS A CA  
3319 C  C   . HIS A 380 ? 0.1479 0.1576 0.1852 0.0062  0.0155  -0.0056 377  HIS A C   
3320 O  O   . HIS A 380 ? 0.1536 0.2164 0.2311 0.0051  0.0260  -0.0362 377  HIS A O   
3321 C  CB  . HIS A 380 ? 0.1060 0.1313 0.1773 -0.0037 0.0013  0.0172  377  HIS A CB  
3322 C  CG  . HIS A 380 ? 0.1312 0.1404 0.1384 -0.0103 -0.0025 0.0213  377  HIS A CG  
3323 N  ND1 . HIS A 380 ? 0.1749 0.1596 0.1479 -0.0272 -0.0135 0.0090  377  HIS A ND1 
3324 C  CD2 . HIS A 380 ? 0.1351 0.1418 0.1583 0.0048  0.0122  0.0392  377  HIS A CD2 
3325 C  CE1 . HIS A 380 ? 0.2099 0.1652 0.1779 -0.0051 -0.0358 -0.0043 377  HIS A CE1 
3326 N  NE2 . HIS A 380 ? 0.1532 0.1607 0.1701 -0.0165 -0.0113 0.0257  377  HIS A NE2 
3327 N  N   . ALA A 381 ? 0.1421 0.1608 0.1553 0.0124  0.0230  -0.0054 378  ALA A N   
3328 C  CA  . ALA A 381 ? 0.1531 0.1698 0.1502 0.0106  0.0200  0.0034  378  ALA A CA  
3329 C  C   . ALA A 381 ? 0.1600 0.1483 0.1713 0.0155  0.0250  0.0090  378  ALA A C   
3330 O  O   . ALA A 381 ? 0.1805 0.1741 0.2071 0.0110  0.0463  -0.0027 378  ALA A O   
3331 C  CB  . ALA A 381 ? 0.1792 0.1760 0.1613 0.0190  0.0240  0.0256  378  ALA A CB  
3332 N  N   . PHE A 382 ? 0.1321 0.1300 0.1565 0.0122  0.0173  0.0032  379  PHE A N   
3333 C  CA  . PHE A 382 ? 0.1566 0.1347 0.1295 0.0094  0.0101  0.0041  379  PHE A CA  
3334 C  C   . PHE A 382 ? 0.1390 0.1230 0.1367 0.0074  0.0043  -0.0008 379  PHE A C   
3335 O  O   . PHE A 382 ? 0.1627 0.1400 0.1433 0.0035  -0.0168 -0.0072 379  PHE A O   
3336 C  CB  . PHE A 382 ? 0.1623 0.1360 0.1292 -0.0027 0.0087  0.0000  379  PHE A CB  
3337 C  CG  . PHE A 382 ? 0.1319 0.1341 0.1395 0.0034  -0.0048 0.0010  379  PHE A CG  
3338 C  CD1 . PHE A 382 ? 0.1416 0.1366 0.0927 -0.0044 0.0049  -0.0031 379  PHE A CD1 
3339 C  CD2 . PHE A 382 ? 0.1632 0.1412 0.1184 0.0037  0.0018  0.0189  379  PHE A CD2 
3340 C  CE1 . PHE A 382 ? 0.1485 0.1931 0.1500 0.0233  -0.0110 -0.0058 379  PHE A CE1 
3341 C  CE2 . PHE A 382 ? 0.1763 0.1666 0.1518 0.0050  -0.0093 0.0272  379  PHE A CE2 
3342 C  CZ  . PHE A 382 ? 0.1723 0.1695 0.1695 0.0267  -0.0217 0.0055  379  PHE A CZ  
3343 N  N   . HIS A 383 ? 0.1316 0.1088 0.1184 0.0004  0.0072  0.0001  380  HIS A N   
3344 C  CA  . HIS A 383 ? 0.1113 0.1007 0.1350 -0.0026 -0.0026 0.0037  380  HIS A CA  
3345 C  C   . HIS A 383 ? 0.1170 0.1079 0.1411 0.0000  0.0012  0.0018  380  HIS A C   
3346 O  O   . HIS A 383 ? 0.1093 0.1158 0.1500 0.0045  0.0081  0.0024  380  HIS A O   
3347 C  CB  . HIS A 383 ? 0.1217 0.1172 0.1403 -0.0047 -0.0035 0.0041  380  HIS A CB  
3348 C  CG  . HIS A 383 ? 0.1368 0.1014 0.1286 -0.0011 0.0054  -0.0074 380  HIS A CG  
3349 N  ND1 . HIS A 383 ? 0.1120 0.1219 0.1362 0.0219  0.0001  -0.0033 380  HIS A ND1 
3350 C  CD2 . HIS A 383 ? 0.1558 0.1082 0.1196 0.0000  -0.0125 -0.0275 380  HIS A CD2 
3351 C  CE1 . HIS A 383 ? 0.1597 0.1456 0.1291 0.0424  -0.0218 -0.0095 380  HIS A CE1 
3352 N  NE2 . HIS A 383 ? 0.1334 0.1106 0.1426 -0.0004 0.0012  -0.0181 380  HIS A NE2 
3353 N  N   . GLN A 384 ? 0.1162 0.0936 0.1273 0.0002  -0.0018 0.0066  381  GLN A N   
3354 C  CA  . GLN A 384 ? 0.1123 0.1001 0.1050 -0.0018 -0.0023 0.0020  381  GLN A CA  
3355 C  C   . GLN A 384 ? 0.1201 0.1108 0.1106 -0.0025 0.0000  0.0059  381  GLN A C   
3356 O  O   . GLN A 384 ? 0.1267 0.1154 0.1133 0.0059  0.0105  0.0111  381  GLN A O   
3357 C  CB  . GLN A 384 ? 0.1251 0.1229 0.1053 0.0106  0.0066  0.0137  381  GLN A CB  
3358 C  CG  . GLN A 384 ? 0.1122 0.1262 0.1074 -0.0048 -0.0015 0.0129  381  GLN A CG  
3359 C  CD  . GLN A 384 ? 0.1427 0.0976 0.0995 0.0043  -0.0087 0.0121  381  GLN A CD  
3360 O  OE1 . GLN A 384 ? 0.1345 0.1371 0.1063 -0.0011 -0.0106 0.0029  381  GLN A OE1 
3361 N  NE2 . GLN A 384 ? 0.1213 0.0929 0.1331 -0.0065 0.0010  -0.0010 381  GLN A NE2 
3362 N  N   . LEU A 385 ? 0.1346 0.1098 0.1125 -0.0002 -0.0087 0.0038  382  LEU A N   
3363 C  CA  . LEU A 385 ? 0.1126 0.0908 0.1169 -0.0003 0.0034  0.0040  382  LEU A CA  
3364 C  C   . LEU A 385 ? 0.1086 0.1038 0.1111 -0.0081 0.0045  0.0042  382  LEU A C   
3365 O  O   . LEU A 385 ? 0.1276 0.1097 0.1347 -0.0068 -0.0026 -0.0001 382  LEU A O   
3366 C  CB  . LEU A 385 ? 0.1084 0.1066 0.1182 -0.0050 -0.0195 0.0111  382  LEU A CB  
3367 C  CG  . LEU A 385 ? 0.1236 0.1206 0.1082 -0.0177 0.0106  -0.0003 382  LEU A CG  
3368 C  CD1 . LEU A 385 ? 0.1523 0.1195 0.1199 -0.0015 0.0322  -0.0088 382  LEU A CD1 
3369 C  CD2 . LEU A 385 ? 0.1065 0.1612 0.1518 0.0009  -0.0131 0.0058  382  LEU A CD2 
3370 N  N   . LEU A 386 ? 0.1154 0.1107 0.1205 -0.0084 0.0093  0.0004  383  LEU A N   
3371 C  CA  . LEU A 386 ? 0.1108 0.1156 0.1167 -0.0039 0.0044  0.0027  383  LEU A CA  
3372 C  C   . LEU A 386 ? 0.1115 0.1338 0.1161 0.0003  0.0035  -0.0059 383  LEU A C   
3373 O  O   . LEU A 386 ? 0.1039 0.1412 0.1523 -0.0083 0.0022  0.0082  383  LEU A O   
3374 C  CB  . LEU A 386 ? 0.1171 0.1143 0.1135 -0.0030 -0.0012 -0.0002 383  LEU A CB  
3375 C  CG  . LEU A 386 ? 0.1117 0.1305 0.1450 -0.0121 0.0154  0.0218  383  LEU A CG  
3376 C  CD1 . LEU A 386 ? 0.1699 0.0877 0.2048 0.0092  -0.0326 -0.0049 383  LEU A CD1 
3377 C  CD2 . LEU A 386 ? 0.1750 0.1667 0.1335 -0.0171 -0.0321 0.0024  383  LEU A CD2 
3378 N  N   . HIS A 387 ? 0.1227 0.1352 0.1197 0.0027  -0.0002 -0.0044 384  HIS A N   
3379 C  CA  . HIS A 387 ? 0.1354 0.1332 0.1195 -0.0049 -0.0008 -0.0007 384  HIS A CA  
3380 C  C   . HIS A 387 ? 0.1359 0.1309 0.1035 -0.0130 -0.0002 0.0007  384  HIS A C   
3381 O  O   . HIS A 387 ? 0.1599 0.1229 0.1275 -0.0258 0.0221  0.0101  384  HIS A O   
3382 C  CB  . HIS A 387 ? 0.1316 0.1295 0.1219 -0.0001 0.0004  0.0016  384  HIS A CB  
3383 C  CG  . HIS A 387 ? 0.1306 0.1161 0.1192 -0.0081 -0.0043 -0.0144 384  HIS A CG  
3384 N  ND1 . HIS A 387 ? 0.1479 0.1507 0.1629 0.0059  -0.0090 0.0079  384  HIS A ND1 
3385 C  CD2 . HIS A 387 ? 0.1597 0.1524 0.1291 -0.0200 -0.0011 0.0055  384  HIS A CD2 
3386 C  CE1 . HIS A 387 ? 0.1651 0.1292 0.1850 0.0081  0.0128  -0.0199 384  HIS A CE1 
3387 N  NE2 . HIS A 387 ? 0.1592 0.1462 0.1606 -0.0001 0.0015  -0.0073 384  HIS A NE2 
3388 N  N   . GLN A 388 ? 0.1352 0.1378 0.1024 -0.0135 0.0017  0.0004  385  GLN A N   
3389 C  CA  . GLN A 388 ? 0.1200 0.1299 0.1219 -0.0151 -0.0010 0.0035  385  GLN A CA  
3390 C  C   . GLN A 388 ? 0.1199 0.1259 0.1266 -0.0078 0.0002  0.0074  385  GLN A C   
3391 O  O   . GLN A 388 ? 0.1389 0.1363 0.1497 -0.0109 -0.0270 0.0004  385  GLN A O   
3392 C  CB  . GLN A 388 ? 0.1341 0.1522 0.1336 -0.0160 -0.0028 0.0022  385  GLN A CB  
3393 C  CG  . GLN A 388 ? 0.1269 0.1958 0.1399 -0.0074 0.0104  0.0077  385  GLN A CG  
3394 C  CD  . GLN A 388 ? 0.0879 0.1425 0.1145 0.0008  0.0094  0.0294  385  GLN A CD  
3395 O  OE1 . GLN A 388 ? 0.1111 0.1401 0.1150 -0.0128 0.0056  0.0127  385  GLN A OE1 
3396 N  NE2 . GLN A 388 ? 0.1356 0.1466 0.0977 -0.0053 0.0111  0.0246  385  GLN A NE2 
3397 N  N   . GLY A 389 ? 0.1320 0.1263 0.1242 0.0049  -0.0091 0.0071  386  GLY A N   
3398 C  CA  . GLY A 389 ? 0.1199 0.1324 0.1193 0.0015  -0.0042 0.0085  386  GLY A CA  
3399 C  C   . GLY A 389 ? 0.1211 0.1184 0.1154 0.0043  -0.0051 0.0131  386  GLY A C   
3400 O  O   . GLY A 389 ? 0.1334 0.1404 0.1151 -0.0015 0.0012  -0.0137 386  GLY A O   
3401 N  N   . ASN A 390 ? 0.1081 0.1194 0.1311 -0.0098 -0.0050 0.0010  387  ASN A N   
3402 C  CA  . ASN A 390 ? 0.1143 0.1311 0.1262 0.0003  -0.0081 -0.0108 387  ASN A CA  
3403 C  C   . ASN A 390 ? 0.1141 0.1404 0.1243 0.0060  -0.0107 -0.0057 387  ASN A C   
3404 O  O   . ASN A 390 ? 0.1532 0.1519 0.1407 0.0029  -0.0341 -0.0253 387  ASN A O   
3405 C  CB  . ASN A 390 ? 0.1133 0.1192 0.1431 -0.0116 0.0000  -0.0090 387  ASN A CB  
3406 C  CG  . ASN A 390 ? 0.1112 0.0955 0.1449 -0.0071 0.0186  0.0061  387  ASN A CG  
3407 O  OD1 . ASN A 390 ? 0.1362 0.1188 0.1356 0.0074  0.0000  0.0171  387  ASN A OD1 
3408 N  ND2 . ASN A 390 ? 0.1756 0.1004 0.1458 -0.0057 -0.0075 0.0215  387  ASN A ND2 
3409 N  N   . ILE A 391 ? 0.1287 0.1339 0.1375 0.0088  -0.0263 -0.0131 388  ILE A N   
3410 C  CA  . ILE A 391 ? 0.1368 0.1425 0.1397 0.0222  -0.0221 0.0020  388  ILE A CA  
3411 C  C   . ILE A 391 ? 0.1276 0.1557 0.1446 0.0075  -0.0189 -0.0094 388  ILE A C   
3412 O  O   . ILE A 391 ? 0.1172 0.1684 0.1431 -0.0011 -0.0213 -0.0038 388  ILE A O   
3413 C  CB  . ILE A 391 ? 0.1585 0.1743 0.1511 0.0375  -0.0108 0.0080  388  ILE A CB  
3414 C  CG1 . ILE A 391 ? 0.2171 0.1846 0.2090 0.0279  -0.0108 0.0202  388  ILE A CG1 
3415 C  CG2 . ILE A 391 ? 0.2041 0.2077 0.0964 0.0707  -0.0425 -0.0123 388  ILE A CG2 
3416 C  CD1 . ILE A 391 ? 0.2513 0.1905 0.2028 -0.0404 -0.0359 -0.0423 388  ILE A CD1 
3417 N  N   . PHE A 392 ? 0.1313 0.1508 0.1444 -0.0004 -0.0173 -0.0158 389  PHE A N   
3418 C  CA  . PHE A 392 ? 0.1279 0.1386 0.1408 -0.0050 -0.0092 -0.0034 389  PHE A CA  
3419 C  C   . PHE A 392 ? 0.1277 0.1322 0.1390 -0.0062 -0.0130 -0.0042 389  PHE A C   
3420 O  O   . PHE A 392 ? 0.1285 0.1368 0.1329 -0.0041 -0.0174 0.0088  389  PHE A O   
3421 C  CB  . PHE A 392 ? 0.1390 0.1310 0.1519 -0.0132 0.0080  -0.0058 389  PHE A CB  
3422 C  CG  . PHE A 392 ? 0.1367 0.1435 0.1461 0.0111  0.0119  0.0078  389  PHE A CG  
3423 C  CD1 . PHE A 392 ? 0.2052 0.2177 0.1655 0.0368  0.0177  0.0521  389  PHE A CD1 
3424 C  CD2 . PHE A 392 ? 0.1472 0.1525 0.1443 0.0093  0.0045  -0.0012 389  PHE A CD2 
3425 C  CE1 . PHE A 392 ? 0.2126 0.2243 0.1548 0.0327  0.0269  0.0570  389  PHE A CE1 
3426 C  CE2 . PHE A 392 ? 0.1629 0.1522 0.1493 0.0108  0.0198  0.0153  389  PHE A CE2 
3427 C  CZ  . PHE A 392 ? 0.1272 0.1928 0.1473 0.0075  0.0062  0.0232  389  PHE A CZ  
3428 N  N   . ILE A 393 ? 0.1323 0.1191 0.1288 -0.0052 -0.0104 0.0102  390  ILE A N   
3429 C  CA  . ILE A 393 ? 0.1323 0.1307 0.1437 -0.0026 -0.0110 0.0106  390  ILE A CA  
3430 C  C   . ILE A 393 ? 0.1206 0.1275 0.1252 -0.0020 -0.0015 0.0053  390  ILE A C   
3431 O  O   . ILE A 393 ? 0.1382 0.1392 0.1361 0.0108  -0.0135 -0.0155 390  ILE A O   
3432 C  CB  . ILE A 393 ? 0.1325 0.1310 0.1614 -0.0046 0.0036  -0.0037 390  ILE A CB  
3433 C  CG1 . ILE A 393 ? 0.1235 0.1505 0.1791 0.0070  0.0096  -0.0030 390  ILE A CG1 
3434 C  CG2 . ILE A 393 ? 0.1710 0.1289 0.1662 0.0027  0.0051  0.0236  390  ILE A CG2 
3435 C  CD1 . ILE A 393 ? 0.1215 0.1781 0.2236 -0.0215 0.0269  -0.0194 390  ILE A CD1 
3436 N  N   . PRO A 394 ? 0.1242 0.1314 0.1287 0.0045  -0.0119 -0.0055 391  PRO A N   
3437 C  CA  . PRO A 394 ? 0.1303 0.1448 0.1457 0.0002  0.0023  0.0050  391  PRO A CA  
3438 C  C   . PRO A 394 ? 0.1221 0.1385 0.1342 -0.0009 0.0041  -0.0004 391  PRO A C   
3439 O  O   . PRO A 394 ? 0.1249 0.1485 0.1426 -0.0062 0.0231  0.0110  391  PRO A O   
3440 C  CB  . PRO A 394 ? 0.1231 0.1468 0.1595 0.0094  0.0029  -0.0014 391  PRO A CB  
3441 C  CG  . PRO A 394 ? 0.1263 0.1632 0.1413 0.0056  0.0063  -0.0077 391  PRO A CG  
3442 C  CD  . PRO A 394 ? 0.1374 0.1341 0.1027 -0.0047 0.0136  -0.0005 391  PRO A CD  
3443 N  N   . VAL A 395 ? 0.1200 0.1375 0.1407 -0.0028 0.0144  0.0084  392  VAL A N   
3444 C  CA  . VAL A 395 ? 0.1134 0.1357 0.1009 -0.0104 0.0049  0.0032  392  VAL A CA  
3445 C  C   . VAL A 395 ? 0.1230 0.1342 0.1224 -0.0109 0.0025  0.0089  392  VAL A C   
3446 O  O   . VAL A 395 ? 0.1548 0.1428 0.1416 -0.0145 0.0377  0.0059  392  VAL A O   
3447 C  CB  . VAL A 395 ? 0.1341 0.1464 0.1317 -0.0025 -0.0024 0.0114  392  VAL A CB  
3448 C  CG1 . VAL A 395 ? 0.2053 0.1421 0.1679 -0.0209 -0.0196 -0.0488 392  VAL A CG1 
3449 C  CG2 . VAL A 395 ? 0.1385 0.1521 0.1504 0.0285  -0.0022 -0.0207 392  VAL A CG2 
3450 N  N   . ASP A 396 ? 0.1270 0.1350 0.1354 -0.0122 0.0105  0.0007  393  ASP A N   
3451 C  CA  . ASP A 396 ? 0.1262 0.1493 0.1463 -0.0045 0.0062  0.0028  393  ASP A CA  
3452 C  C   . ASP A 396 ? 0.1373 0.1356 0.1366 0.0015  0.0029  0.0073  393  ASP A C   
3453 O  O   . ASP A 396 ? 0.1287 0.1648 0.1367 -0.0166 0.0086  -0.0330 393  ASP A O   
3454 C  CB  . ASP A 396 ? 0.1127 0.1547 0.1431 -0.0060 -0.0155 0.0114  393  ASP A CB  
3455 C  CG  . ASP A 396 ? 0.1705 0.1477 0.1636 -0.0121 -0.0271 0.0207  393  ASP A CG  
3456 O  OD1 . ASP A 396 ? 0.1757 0.1914 0.1699 -0.0290 -0.0016 0.0067  393  ASP A OD1 
3457 O  OD2 . ASP A 396 ? 0.1831 0.1799 0.1493 -0.0019 -0.0198 0.0134  393  ASP A OD2 
3458 N  N   . PHE A 397 ? 0.1162 0.1217 0.1220 0.0036  0.0001  -0.0017 394  PHE A N   
3459 C  CA  . PHE A 397 ? 0.1064 0.1163 0.1193 -0.0025 0.0117  0.0043  394  PHE A CA  
3460 C  C   . PHE A 397 ? 0.1082 0.1102 0.1256 -0.0006 0.0057  0.0000  394  PHE A C   
3461 O  O   . PHE A 397 ? 0.1355 0.1282 0.1422 0.0011  0.0163  -0.0057 394  PHE A O   
3462 C  CB  . PHE A 397 ? 0.1031 0.1164 0.1273 0.0027  0.0028  -0.0092 394  PHE A CB  
3463 C  CG  . PHE A 397 ? 0.1067 0.1046 0.1045 0.0143  0.0125  0.0105  394  PHE A CG  
3464 C  CD1 . PHE A 397 ? 0.1249 0.1062 0.1568 -0.0179 -0.0148 0.0108  394  PHE A CD1 
3465 C  CD2 . PHE A 397 ? 0.1300 0.1456 0.1422 -0.0103 -0.0208 0.0234  394  PHE A CD2 
3466 C  CE1 . PHE A 397 ? 0.1268 0.1398 0.1603 0.0061  -0.0036 0.0199  394  PHE A CE1 
3467 C  CE2 . PHE A 397 ? 0.1267 0.1335 0.1263 -0.0113 0.0089  0.0052  394  PHE A CE2 
3468 C  CZ  . PHE A 397 ? 0.1167 0.1212 0.1439 0.0170  -0.0147 0.0319  394  PHE A CZ  
3469 N  N   . ILE A 398 ? 0.1095 0.1135 0.1247 0.0023  0.0106  -0.0089 395  ILE A N   
3470 C  CA  A ILE A 398 ? 0.1136 0.1122 0.1268 0.0011  0.0042  0.0009  395  ILE A CA  
3471 C  CA  B ILE A 398 ? 0.1160 0.1223 0.1361 0.0050  0.0092  -0.0077 395  ILE A CA  
3472 C  C   . ILE A 398 ? 0.1183 0.1322 0.1340 0.0000  0.0025  -0.0112 395  ILE A C   
3473 O  O   . ILE A 398 ? 0.1318 0.1344 0.1539 0.0114  0.0087  -0.0193 395  ILE A O   
3474 C  CB  A ILE A 398 ? 0.1214 0.1103 0.1245 -0.0009 -0.0094 0.0128  395  ILE A CB  
3475 C  CB  B ILE A 398 ? 0.1302 0.1286 0.1390 0.0100  0.0055  -0.0042 395  ILE A CB  
3476 C  CG1 A ILE A 398 ? 0.1141 0.1063 0.1285 -0.0051 -0.0243 0.0271  395  ILE A CG1 
3477 C  CG1 B ILE A 398 ? 0.1539 0.1471 0.1584 0.0274  0.0121  -0.0224 395  ILE A CG1 
3478 C  CG2 A ILE A 398 ? 0.1600 0.0900 0.1474 0.0284  -0.0308 0.0057  395  ILE A CG2 
3479 C  CG2 B ILE A 398 ? 0.0916 0.1307 0.1699 0.0120  0.0022  -0.0094 395  ILE A CG2 
3480 C  CD1 A ILE A 398 ? 0.0910 0.1564 0.1200 -0.0378 -0.0252 -0.0080 395  ILE A CD1 
3481 C  CD1 B ILE A 398 ? 0.1902 0.2116 0.1595 0.0764  0.0463  -0.0593 395  ILE A CD1 
3482 N  N   . ALA A 399 ? 0.1211 0.1268 0.1382 0.0062  -0.0064 -0.0177 396  ALA A N   
3483 C  CA  . ALA A 399 ? 0.1425 0.1256 0.1223 0.0054  -0.0116 -0.0135 396  ALA A CA  
3484 C  C   . ALA A 399 ? 0.1270 0.1299 0.1311 0.0047  -0.0051 -0.0105 396  ALA A C   
3485 O  O   . ALA A 399 ? 0.1153 0.1196 0.1439 0.0090  -0.0035 0.0084  396  ALA A O   
3486 C  CB  . ALA A 399 ? 0.2103 0.1292 0.1335 0.0170  -0.0002 0.0041  396  ALA A CB  
3487 N  N   . ILE A 400 ? 0.1139 0.1283 0.1334 0.0059  -0.0168 -0.0031 397  ILE A N   
3488 C  CA  . ILE A 400 ? 0.1342 0.1307 0.1318 -0.0049 0.0019  -0.0015 397  ILE A CA  
3489 C  C   . ILE A 400 ? 0.1275 0.1412 0.1137 -0.0030 -0.0049 0.0052  397  ILE A C   
3490 O  O   . ILE A 400 ? 0.1474 0.1595 0.1254 -0.0051 -0.0214 0.0081  397  ILE A O   
3491 C  CB  . ILE A 400 ? 0.1500 0.1447 0.1411 -0.0051 -0.0092 0.0076  397  ILE A CB  
3492 C  CG1 . ILE A 400 ? 0.1422 0.1436 0.1609 -0.0038 0.0066  0.0166  397  ILE A CG1 
3493 C  CG2 . ILE A 400 ? 0.1844 0.1124 0.1643 -0.0049 0.0168  0.0305  397  ILE A CG2 
3494 C  CD1 . ILE A 400 ? 0.1358 0.1373 0.1326 -0.0093 -0.0408 -0.0099 397  ILE A CD1 
3495 N  N   . ALA A 401 ? 0.1391 0.1548 0.1200 0.0096  -0.0187 -0.0031 398  ALA A N   
3496 C  CA  . ALA A 401 ? 0.1547 0.1635 0.1363 0.0056  0.0026  0.0050  398  ALA A CA  
3497 C  C   . ALA A 401 ? 0.1458 0.1493 0.1370 -0.0013 -0.0150 0.0030  398  ALA A C   
3498 O  O   . ALA A 401 ? 0.1330 0.1484 0.1477 0.0000  -0.0146 0.0107  398  ALA A O   
3499 C  CB  . ALA A 401 ? 0.1312 0.1561 0.1299 0.0060  0.0317  0.0020  398  ALA A CB  
3500 N  N   . THR A 402 ? 0.1456 0.1505 0.1361 0.0066  -0.0120 -0.0013 399  THR A N   
3501 C  CA  A THR A 402 ? 0.1506 0.1583 0.1281 0.0065  -0.0180 0.0027  399  THR A CA  
3502 C  CA  B THR A 402 ? 0.1545 0.1607 0.1391 0.0003  -0.0158 -0.0064 399  THR A CA  
3503 C  C   . THR A 402 ? 0.1367 0.1622 0.1449 0.0041  -0.0100 -0.0111 399  THR A C   
3504 O  O   . THR A 402 ? 0.1606 0.1681 0.1410 -0.0165 -0.0276 0.0118  399  THR A O   
3505 C  CB  A THR A 402 ? 0.1547 0.1736 0.1590 -0.0046 -0.0143 0.0013  399  THR A CB  
3506 C  CB  B THR A 402 ? 0.1547 0.1709 0.1576 -0.0088 -0.0180 -0.0112 399  THR A CB  
3507 O  OG1 A THR A 402 ? 0.1567 0.1837 0.1709 0.0104  -0.0076 0.0332  399  THR A OG1 
3508 O  OG1 B THR A 402 ? 0.2080 0.2064 0.1866 0.0138  0.0018  -0.0211 399  THR A OG1 
3509 C  CG2 A THR A 402 ? 0.2201 0.1898 0.1472 0.0305  0.0013  -0.0108 399  THR A CG2 
3510 C  CG2 B THR A 402 ? 0.1995 0.1685 0.2033 -0.0263 -0.0081 -0.0298 399  THR A CG2 
3511 N  N   . SER A 403 ? 0.1476 0.1649 0.1317 0.0161  -0.0195 -0.0120 400  SER A N   
3512 C  CA  . SER A 403 ? 0.1361 0.1491 0.1483 0.0130  -0.0168 -0.0048 400  SER A CA  
3513 C  C   . SER A 403 ? 0.1469 0.1535 0.1535 0.0222  -0.0057 -0.0017 400  SER A C   
3514 O  O   . SER A 403 ? 0.1743 0.1428 0.2423 0.0181  0.0263  -0.0122 400  SER A O   
3515 C  CB  . SER A 403 ? 0.1557 0.1533 0.1821 0.0160  -0.0122 -0.0099 400  SER A CB  
3516 O  OG  . SER A 403 ? 0.1604 0.1439 0.2087 0.0108  0.0002  -0.0059 400  SER A OG  
3517 N  N   . HIS A 404 ? 0.1369 0.1426 0.1550 0.0250  0.0067  0.0031  401  HIS A N   
3518 C  CA  . HIS A 404 ? 0.1650 0.1405 0.1445 0.0125  0.0033  0.0149  401  HIS A CA  
3519 C  C   . HIS A 404 ? 0.1651 0.1564 0.1567 -0.0021 -0.0025 0.0265  401  HIS A C   
3520 O  O   . HIS A 404 ? 0.2496 0.2294 0.2012 -0.0475 -0.0555 0.0558  401  HIS A O   
3521 C  CB  . HIS A 404 ? 0.1909 0.1382 0.1503 0.0163  0.0075  0.0242  401  HIS A CB  
3522 C  CG  . HIS A 404 ? 0.1667 0.1879 0.1157 0.0111  0.0005  0.0164  401  HIS A CG  
3523 N  ND1 . HIS A 404 ? 0.1796 0.2241 0.3164 0.0194  0.0588  -0.0219 401  HIS A ND1 
3524 C  CD2 . HIS A 404 ? 0.1687 0.1972 0.1720 0.0032  -0.0177 0.0012  401  HIS A CD2 
3525 C  CE1 . HIS A 404 ? 0.1896 0.2222 0.3195 0.0052  0.0678  -0.0448 401  HIS A CE1 
3526 N  NE2 . HIS A 404 ? 0.1996 0.1762 0.1516 0.0150  0.0088  0.0005  401  HIS A NE2 
3527 N  N   . HIS A 405 ? 0.1313 0.1407 0.1388 0.0110  0.0106  0.0237  402  HIS A N   
3528 C  CA  . HIS A 405 ? 0.1377 0.1429 0.1394 0.0151  0.0022  0.0078  402  HIS A CA  
3529 C  C   . HIS A 405 ? 0.1296 0.1329 0.1392 0.0167  -0.0025 0.0108  402  HIS A C   
3530 O  O   . HIS A 405 ? 0.1240 0.1545 0.1459 0.0144  -0.0092 0.0044  402  HIS A O   
3531 C  CB  . HIS A 405 ? 0.1331 0.1505 0.1115 0.0106  -0.0003 0.0004  402  HIS A CB  
3532 C  CG  . HIS A 405 ? 0.1216 0.1299 0.1139 0.0122  -0.0163 0.0149  402  HIS A CG  
3533 N  ND1 . HIS A 405 ? 0.1362 0.1433 0.1161 0.0297  -0.0049 0.0263  402  HIS A ND1 
3534 C  CD2 . HIS A 405 ? 0.1420 0.1506 0.1110 0.0079  -0.0113 0.0085  402  HIS A CD2 
3535 C  CE1 . HIS A 405 ? 0.1476 0.1367 0.1526 0.0174  0.0128  0.0190  402  HIS A CE1 
3536 N  NE2 . HIS A 405 ? 0.1198 0.1638 0.1509 0.0367  0.0028  -0.0026 402  HIS A NE2 
3537 N  N   . ASN A 406 ? 0.1162 0.1303 0.1353 0.0099  -0.0005 0.0056  403  ASN A N   
3538 C  CA  . ASN A 406 ? 0.1198 0.1236 0.1293 0.0061  0.0105  -0.0071 403  ASN A CA  
3539 C  C   . ASN A 406 ? 0.0990 0.1121 0.1235 0.0064  0.0069  -0.0040 403  ASN A C   
3540 O  O   . ASN A 406 ? 0.1456 0.1282 0.1543 0.0240  -0.0015 0.0167  403  ASN A O   
3541 C  CB  . ASN A 406 ? 0.1358 0.1239 0.1253 0.0149  0.0067  -0.0036 403  ASN A CB  
3542 C  CG  . ASN A 406 ? 0.1612 0.1243 0.1788 0.0200  -0.0080 -0.0115 403  ASN A CG  
3543 O  OD1 . ASN A 406 ? 0.1791 0.1322 0.2459 0.0564  0.0097  0.0095  403  ASN A OD1 
3544 N  ND2 . ASN A 406 ? 0.2597 0.1413 0.2073 0.0023  -0.0059 0.0241  403  ASN A ND2 
3545 N  N   . TYR A 407 ? 0.1340 0.1202 0.1163 0.0258  -0.0038 -0.0008 404  TYR A N   
3546 C  CA  . TYR A 407 ? 0.1179 0.1215 0.1210 0.0214  -0.0075 -0.0007 404  TYR A CA  
3547 C  C   . TYR A 407 ? 0.1345 0.1274 0.1304 0.0079  -0.0095 0.0008  404  TYR A C   
3548 O  O   . TYR A 407 ? 0.1441 0.1400 0.1220 0.0138  -0.0123 -0.0061 404  TYR A O   
3549 C  CB  . TYR A 407 ? 0.1293 0.1310 0.1216 0.0143  0.0032  -0.0008 404  TYR A CB  
3550 C  CG  . TYR A 407 ? 0.1250 0.1369 0.1443 0.0233  -0.0167 0.0005  404  TYR A CG  
3551 C  CD1 . TYR A 407 ? 0.1227 0.1492 0.2044 0.0378  -0.0109 0.0085  404  TYR A CD1 
3552 C  CD2 . TYR A 407 ? 0.1419 0.2186 0.1739 -0.0291 0.0160  0.0601  404  TYR A CD2 
3553 C  CE1 . TYR A 407 ? 0.1527 0.1784 0.2785 0.0123  0.0036  0.0022  404  TYR A CE1 
3554 C  CE2 . TYR A 407 ? 0.2043 0.2801 0.3009 -0.0303 0.0163  0.0525  404  TYR A CE2 
3555 C  CZ  . TYR A 407 ? 0.1786 0.2260 0.2490 -0.0299 0.0068  0.0232  404  TYR A CZ  
3556 O  OH  . TYR A 407 ? 0.1723 0.2700 0.3559 -0.0303 -0.0046 0.0415  404  TYR A OH  
3557 N  N   . ASP A 408 ? 0.1203 0.1033 0.1445 0.0119  0.0039  0.0039  405  ASP A N   
3558 C  CA  . ASP A 408 ? 0.1266 0.1251 0.1279 0.0149  0.0187  -0.0027 405  ASP A CA  
3559 C  C   . ASP A 408 ? 0.1198 0.1177 0.1242 0.0082  0.0186  -0.0036 405  ASP A C   
3560 O  O   . ASP A 408 ? 0.1410 0.1166 0.1414 0.0120  0.0053  -0.0056 405  ASP A O   
3561 C  CB  . ASP A 408 ? 0.1309 0.1399 0.1402 0.0307  0.0415  0.0022  405  ASP A CB  
3562 C  CG  . ASP A 408 ? 0.2033 0.1554 0.1887 0.0459  0.0398  0.0063  405  ASP A CG  
3563 O  OD1 . ASP A 408 ? 0.2131 0.2256 0.2168 0.0678  0.0273  0.0215  405  ASP A OD1 
3564 O  OD2 . ASP A 408 ? 0.3347 0.2169 0.2330 0.1082  0.0450  -0.0305 405  ASP A OD2 
3565 N  N   . ASN A 409 ? 0.1240 0.0976 0.1262 0.0014  0.0059  0.0020  406  ASN A N   
3566 C  CA  . ASN A 409 ? 0.1122 0.1103 0.1165 0.0099  0.0168  -0.0049 406  ASN A CA  
3567 C  C   . ASN A 409 ? 0.1219 0.0906 0.1208 0.0023  0.0130  -0.0060 406  ASN A C   
3568 O  O   . ASN A 409 ? 0.1304 0.0908 0.1258 -0.0058 -0.0005 -0.0106 406  ASN A O   
3569 C  CB  . ASN A 409 ? 0.1336 0.0929 0.1257 0.0122  0.0011  -0.0091 406  ASN A CB  
3570 C  CG  . ASN A 409 ? 0.1609 0.1881 0.1240 0.0131  -0.0068 0.0125  406  ASN A CG  
3571 O  OD1 . ASN A 409 ? 0.1510 0.1276 0.1553 0.0048  0.0102  -0.0031 406  ASN A OD1 
3572 N  ND2 . ASN A 409 ? 0.1674 0.3035 0.1894 0.0206  -0.0253 0.0426  406  ASN A ND2 
3573 N  N   . HIS A 410 ? 0.1061 0.0853 0.1134 0.0065  0.0024  0.0024  407  HIS A N   
3574 C  CA  . HIS A 410 ? 0.0960 0.0919 0.1084 0.0090  0.0070  -0.0032 407  HIS A CA  
3575 C  C   . HIS A 410 ? 0.1030 0.1112 0.1183 0.0102  0.0047  0.0029  407  HIS A C   
3576 O  O   . HIS A 410 ? 0.1196 0.1284 0.1181 -0.0011 0.0052  -0.0156 407  HIS A O   
3577 C  CB  . HIS A 410 ? 0.1099 0.0892 0.0937 0.0197  0.0019  -0.0140 407  HIS A CB  
3578 C  CG  . HIS A 410 ? 0.1012 0.0848 0.1182 -0.0043 0.0235  -0.0080 407  HIS A CG  
3579 N  ND1 . HIS A 410 ? 0.1101 0.1224 0.1136 0.0186  0.0178  -0.0183 407  HIS A ND1 
3580 C  CD2 . HIS A 410 ? 0.1066 0.1250 0.1295 0.0242  0.0092  -0.0035 407  HIS A CD2 
3581 C  CE1 . HIS A 410 ? 0.1221 0.1120 0.1324 0.0287  0.0093  0.0139  407  HIS A CE1 
3582 N  NE2 . HIS A 410 ? 0.1175 0.1213 0.1283 -0.0041 0.0025  0.0281  407  HIS A NE2 
3583 N  N   . GLN A 411 ? 0.1107 0.1066 0.1327 0.0124  0.0005  -0.0093 408  GLN A N   
3584 C  CA  . GLN A 411 ? 0.1082 0.1105 0.1459 0.0153  0.0109  -0.0075 408  GLN A CA  
3585 C  C   . GLN A 411 ? 0.1153 0.1216 0.1295 0.0176  0.0056  0.0006  408  GLN A C   
3586 O  O   . GLN A 411 ? 0.1294 0.1096 0.1265 0.0058  -0.0034 -0.0009 408  GLN A O   
3587 C  CB  . GLN A 411 ? 0.1294 0.1329 0.1395 0.0222  0.0115  -0.0033 408  GLN A CB  
3588 C  CG  . GLN A 411 ? 0.1014 0.1425 0.1581 0.0301  0.0031  -0.0167 408  GLN A CG  
3589 C  CD  . GLN A 411 ? 0.1531 0.1589 0.1465 0.0207  -0.0127 0.0066  408  GLN A CD  
3590 O  OE1 . GLN A 411 ? 0.1328 0.1648 0.1622 0.0106  -0.0038 0.0190  408  GLN A OE1 
3591 N  NE2 . GLN A 411 ? 0.1781 0.1450 0.1693 0.0124  -0.0441 -0.0150 408  GLN A NE2 
3592 N  N   . GLN A 412 ? 0.1279 0.1114 0.1185 0.0124  0.0017  0.0017  409  GLN A N   
3593 C  CA  . GLN A 412 ? 0.1397 0.1191 0.1382 0.0057  0.0140  -0.0082 409  GLN A CA  
3594 C  C   . GLN A 412 ? 0.1299 0.1172 0.1318 0.0008  0.0045  0.0040  409  GLN A C   
3595 O  O   . GLN A 412 ? 0.1194 0.1399 0.1322 -0.0080 0.0178  0.0017  409  GLN A O   
3596 C  CB  . GLN A 412 ? 0.1478 0.1289 0.1612 0.0130  0.0143  -0.0138 409  GLN A CB  
3597 C  CG  . GLN A 412 ? 0.2532 0.1757 0.2070 -0.0169 0.0244  0.0202  409  GLN A CG  
3598 C  CD  . GLN A 412 ? 0.3253 0.2547 0.2596 -0.0904 0.0160  -0.0296 409  GLN A CD  
3599 O  OE1 . GLN A 412 ? 0.4719 0.3231 0.1915 -0.1002 -0.0551 0.0258  409  GLN A OE1 
3600 N  NE2 . GLN A 412 ? 0.4465 0.3219 0.2755 -0.1313 0.0520  -0.0632 409  GLN A NE2 
3601 N  N   . ALA A 413 ? 0.1233 0.1111 0.1330 -0.0108 0.0040  -0.0054 410  ALA A N   
3602 C  CA  . ALA A 413 ? 0.1118 0.1117 0.1151 -0.0043 0.0035  -0.0009 410  ALA A CA  
3603 C  C   . ALA A 413 ? 0.1090 0.1122 0.1134 -0.0033 0.0015  0.0036  410  ALA A C   
3604 O  O   . ALA A 413 ? 0.1122 0.1002 0.1454 -0.0093 0.0087  -0.0018 410  ALA A O   
3605 C  CB  . ALA A 413 ? 0.0941 0.1207 0.1185 0.0036  0.0045  -0.0088 410  ALA A CB  
3606 N  N   . LEU A 414 ? 0.1069 0.1050 0.1045 -0.0056 0.0070  0.0040  411  LEU A N   
3607 C  CA  . LEU A 414 ? 0.1043 0.1137 0.1083 -0.0034 0.0028  0.0024  411  LEU A CA  
3608 C  C   . LEU A 414 ? 0.1112 0.0934 0.1042 -0.0018 -0.0008 -0.0059 411  LEU A C   
3609 O  O   . LEU A 414 ? 0.1173 0.1100 0.1273 -0.0102 0.0156  -0.0131 411  LEU A O   
3610 C  CB  . LEU A 414 ? 0.1102 0.1098 0.1145 0.0081  0.0045  0.0049  411  LEU A CB  
3611 C  CG  . LEU A 414 ? 0.1187 0.1179 0.1178 -0.0095 0.0162  0.0111  411  LEU A CG  
3612 C  CD1 . LEU A 414 ? 0.1613 0.1380 0.1227 0.0076  0.0210  -0.0387 411  LEU A CD1 
3613 C  CD2 . LEU A 414 ? 0.1526 0.1149 0.1219 0.0125  -0.0080 0.0192  411  LEU A CD2 
3614 N  N   . LEU A 415 ? 0.1091 0.1039 0.1211 -0.0018 0.0143  -0.0168 412  LEU A N   
3615 C  CA  . LEU A 415 ? 0.1141 0.1080 0.0961 0.0050  0.0082  -0.0094 412  LEU A CA  
3616 C  C   . LEU A 415 ? 0.1194 0.1103 0.1134 0.0130  0.0059  -0.0141 412  LEU A C   
3617 O  O   . LEU A 415 ? 0.1162 0.1212 0.1112 -0.0026 0.0089  -0.0078 412  LEU A O   
3618 C  CB  . LEU A 415 ? 0.1306 0.1160 0.1108 0.0114  0.0048  -0.0032 412  LEU A CB  
3619 C  CG  . LEU A 415 ? 0.1168 0.0912 0.1345 -0.0042 -0.0056 0.0183  412  LEU A CG  
3620 C  CD1 . LEU A 415 ? 0.1247 0.0931 0.1805 0.0069  -0.0039 0.0039  412  LEU A CD1 
3621 C  CD2 . LEU A 415 ? 0.1387 0.1691 0.1529 0.0082  -0.0347 0.0161  412  LEU A CD2 
3622 N  N   . ALA A 416 ? 0.1178 0.1139 0.1124 0.0055  -0.0076 0.0022  413  ALA A N   
3623 C  CA  . ALA A 416 ? 0.1145 0.1249 0.1154 0.0110  0.0059  0.0085  413  ALA A CA  
3624 C  C   . ALA A 416 ? 0.1188 0.1317 0.1055 0.0065  0.0047  -0.0013 413  ALA A C   
3625 O  O   . ALA A 416 ? 0.1248 0.1443 0.1296 -0.0083 0.0071  0.0001  413  ALA A O   
3626 C  CB  . ALA A 416 ? 0.1300 0.1356 0.0897 0.0091  0.0043  -0.0115 413  ALA A CB  
3627 N  N   . ASN A 417 ? 0.1245 0.1090 0.1294 -0.0107 0.0181  0.0085  414  ASN A N   
3628 C  CA  . ASN A 417 ? 0.1112 0.1095 0.1247 0.0160  0.0016  0.0078  414  ASN A CA  
3629 C  C   . ASN A 417 ? 0.1109 0.1029 0.1105 -0.0037 0.0074  -0.0001 414  ASN A C   
3630 O  O   . ASN A 417 ? 0.1252 0.1104 0.1344 0.0040  0.0049  0.0054  414  ASN A O   
3631 C  CB  . ASN A 417 ? 0.0965 0.1077 0.1339 -0.0025 -0.0009 0.0036  414  ASN A CB  
3632 C  CG  . ASN A 417 ? 0.1205 0.1182 0.1446 0.0180  -0.0219 -0.0182 414  ASN A CG  
3633 O  OD1 . ASN A 417 ? 0.1373 0.1259 0.1658 0.0211  -0.0111 -0.0134 414  ASN A OD1 
3634 N  ND2 . ASN A 417 ? 0.1677 0.1538 0.2209 -0.0065 -0.0434 -0.0573 414  ASN A ND2 
3635 N  N   . CYS A 418 ? 0.1127 0.1053 0.1143 -0.0080 0.0034  -0.0059 415  CYS A N   
3636 C  CA  . CYS A 418 ? 0.1277 0.1236 0.1123 0.0029  0.0018  0.0022  415  CYS A CA  
3637 C  C   . CYS A 418 ? 0.1314 0.1168 0.1308 -0.0004 0.0053  -0.0079 415  CYS A C   
3638 O  O   . CYS A 418 ? 0.1144 0.1166 0.1293 -0.0128 0.0007  -0.0169 415  CYS A O   
3639 C  CB  . CYS A 418 ? 0.1351 0.1092 0.0994 0.0024  -0.0077 -0.0242 415  CYS A CB  
3640 S  SG  . CYS A 418 ? 0.1438 0.1517 0.1419 0.0074  -0.0109 -0.0096 415  CYS A SG  
3641 N  N   . PHE A 419 ? 0.1302 0.1177 0.1189 -0.0076 0.0129  0.0010  416  PHE A N   
3642 C  CA  . PHE A 419 ? 0.1229 0.1205 0.1155 -0.0005 0.0039  -0.0037 416  PHE A CA  
3643 C  C   . PHE A 419 ? 0.1227 0.1337 0.1157 -0.0089 0.0128  -0.0012 416  PHE A C   
3644 O  O   . PHE A 419 ? 0.1177 0.1267 0.1405 -0.0227 0.0005  0.0098  416  PHE A O   
3645 C  CB  . PHE A 419 ? 0.1302 0.1085 0.1166 -0.0048 0.0097  -0.0071 416  PHE A CB  
3646 C  CG  . PHE A 419 ? 0.1332 0.1275 0.1569 -0.0022 0.0191  0.0016  416  PHE A CG  
3647 C  CD1 . PHE A 419 ? 0.1499 0.1153 0.1796 -0.0196 0.0146  -0.0081 416  PHE A CD1 
3648 C  CD2 . PHE A 419 ? 0.1578 0.1375 0.1470 -0.0095 -0.0138 -0.0019 416  PHE A CD2 
3649 C  CE1 . PHE A 419 ? 0.1460 0.1602 0.1777 -0.0078 0.0171  0.0032  416  PHE A CE1 
3650 C  CE2 . PHE A 419 ? 0.1203 0.1467 0.1844 0.0026  -0.0053 -0.0147 416  PHE A CE2 
3651 C  CZ  . PHE A 419 ? 0.1450 0.1503 0.2100 0.0106  0.0014  0.0038  416  PHE A CZ  
3652 N  N   . ALA A 420 ? 0.1000 0.1249 0.1114 -0.0141 -0.0085 0.0010  417  ALA A N   
3653 C  CA  . ALA A 420 ? 0.1201 0.1394 0.1056 -0.0090 0.0006  0.0081  417  ALA A CA  
3654 C  C   . ALA A 420 ? 0.1225 0.1242 0.1237 0.0003  -0.0046 -0.0011 417  ALA A C   
3655 O  O   . ALA A 420 ? 0.1277 0.1395 0.1360 -0.0162 0.0029  0.0130  417  ALA A O   
3656 C  CB  . ALA A 420 ? 0.1209 0.1400 0.1253 -0.0096 -0.0289 0.0070  417  ALA A CB  
3657 N  N   . GLN A 421 ? 0.1339 0.1216 0.1175 0.0000  0.0130  0.0031  418  GLN A N   
3658 C  CA  . GLN A 421 ? 0.1168 0.1326 0.1177 -0.0037 -0.0040 0.0030  418  GLN A CA  
3659 C  C   . GLN A 421 ? 0.1075 0.1238 0.1057 0.0002  -0.0051 0.0033  418  GLN A C   
3660 O  O   . GLN A 421 ? 0.1218 0.1131 0.1149 -0.0084 0.0093  -0.0006 418  GLN A O   
3661 C  CB  . GLN A 421 ? 0.1276 0.1209 0.1077 0.0071  0.0001  -0.0084 418  GLN A CB  
3662 C  CG  . GLN A 421 ? 0.1310 0.1354 0.1182 -0.0088 0.0126  0.0081  418  GLN A CG  
3663 C  CD  . GLN A 421 ? 0.1413 0.1171 0.1402 -0.0099 0.0121  0.0116  418  GLN A CD  
3664 O  OE1 . GLN A 421 ? 0.1424 0.1356 0.1528 0.0045  -0.0163 -0.0125 418  GLN A OE1 
3665 N  NE2 . GLN A 421 ? 0.1474 0.1325 0.1405 -0.0215 0.0015  -0.0103 418  GLN A NE2 
3666 N  N   . SER A 422 ? 0.1117 0.1258 0.1307 0.0042  0.0004  -0.0046 419  SER A N   
3667 C  CA  . SER A 422 ? 0.1295 0.1206 0.1256 -0.0008 -0.0021 0.0018  419  SER A CA  
3668 C  C   . SER A 422 ? 0.1215 0.1338 0.1275 -0.0033 0.0040  -0.0047 419  SER A C   
3669 O  O   . SER A 422 ? 0.1283 0.1395 0.1245 -0.0111 0.0015  -0.0197 419  SER A O   
3670 C  CB  . SER A 422 ? 0.1552 0.1275 0.1370 0.0081  0.0123  0.0042  419  SER A CB  
3671 O  OG  . SER A 422 ? 0.1492 0.1462 0.1519 0.0164  -0.0033 -0.0017 419  SER A OG  
3672 N  N   . GLN A 423 ? 0.1330 0.1233 0.1375 -0.0109 -0.0019 0.0001  420  GLN A N   
3673 C  CA  . GLN A 423 ? 0.1410 0.1385 0.1183 -0.0119 0.0119  -0.0004 420  GLN A CA  
3674 C  C   . GLN A 423 ? 0.1273 0.1312 0.1093 -0.0148 0.0137  0.0035  420  GLN A C   
3675 O  O   . GLN A 423 ? 0.1563 0.1227 0.1319 -0.0293 0.0212  0.0041  420  GLN A O   
3676 C  CB  . GLN A 423 ? 0.1482 0.1397 0.1323 -0.0085 0.0039  -0.0079 420  GLN A CB  
3677 C  CG  . GLN A 423 ? 0.1677 0.1560 0.1381 -0.0073 0.0148  -0.0066 420  GLN A CG  
3678 C  CD  . GLN A 423 ? 0.1334 0.1926 0.1488 -0.0099 -0.0119 0.0008  420  GLN A CD  
3679 O  OE1 . GLN A 423 ? 0.1269 0.2015 0.1584 -0.0253 0.0062  -0.0456 420  GLN A OE1 
3680 N  NE2 . GLN A 423 ? 0.1515 0.1899 0.1879 0.0086  0.0321  -0.0427 420  GLN A NE2 
3681 N  N   . ALA A 424 ? 0.1158 0.1244 0.1128 -0.0030 0.0081  0.0026  421  ALA A N   
3682 C  CA  . ALA A 424 ? 0.1085 0.1245 0.1254 -0.0021 0.0117  0.0006  421  ALA A CA  
3683 C  C   . ALA A 424 ? 0.1131 0.1187 0.1299 0.0052  0.0141  0.0030  421  ALA A C   
3684 O  O   . ALA A 424 ? 0.1491 0.1244 0.1469 0.0102  0.0046  0.0022  421  ALA A O   
3685 C  CB  . ALA A 424 ? 0.0975 0.1274 0.1449 -0.0157 0.0086  0.0014  421  ALA A CB  
3686 N  N   . LEU A 425 ? 0.1257 0.1159 0.1238 -0.0139 -0.0015 0.0083  422  LEU A N   
3687 C  CA  . LEU A 425 ? 0.1275 0.1305 0.1205 0.0138  0.0036  0.0037  422  LEU A CA  
3688 C  C   . LEU A 425 ? 0.1313 0.1141 0.1170 0.0007  -0.0024 0.0060  422  LEU A C   
3689 O  O   . LEU A 425 ? 0.1541 0.1429 0.1207 -0.0078 -0.0133 0.0086  422  LEU A O   
3690 C  CB  . LEU A 425 ? 0.1214 0.1213 0.1145 0.0105  -0.0051 -0.0061 422  LEU A CB  
3691 C  CG  . LEU A 425 ? 0.1165 0.1348 0.1192 0.0133  0.0087  -0.0031 422  LEU A CG  
3692 C  CD1 . LEU A 425 ? 0.1639 0.1410 0.1564 0.0171  -0.0062 0.0403  422  LEU A CD1 
3693 C  CD2 . LEU A 425 ? 0.1655 0.1333 0.1114 0.0057  0.0094  0.0043  422  LEU A CD2 
3694 N  N   . MSE A 426 ? 0.1263 0.1286 0.1367 -0.0048 0.0077  0.0106  423  MSE A N   
3695 C  CA  A MSE A 426 ? 0.1447 0.1349 0.1338 -0.0086 0.0077  0.0101  423  MSE A CA  
3696 C  CA  B MSE A 426 ? 0.1406 0.1359 0.1310 -0.0080 0.0055  0.0076  423  MSE A CA  
3697 C  C   . MSE A 426 ? 0.1566 0.1456 0.1297 -0.0121 0.0038  0.0047  423  MSE A C   
3698 O  O   . MSE A 426 ? 0.1645 0.1405 0.1582 -0.0127 0.0208  -0.0091 423  MSE A O   
3699 C  CB  A MSE A 426 ? 0.1531 0.1405 0.1646 -0.0073 0.0036  0.0076  423  MSE A CB  
3700 C  CB  B MSE A 426 ? 0.1457 0.1406 0.1470 -0.0063 0.0003  0.0074  423  MSE A CB  
3701 C  CG  A MSE A 426 ? 0.1892 0.1575 0.1805 0.0036  -0.0090 -0.0039 423  MSE A CG  
3702 C  CG  B MSE A 426 ? 0.1526 0.1528 0.1505 -0.0051 -0.0105 -0.0082 423  MSE A CG  
3703 SE SE  A MSE A 426 ? 0.1957 0.2154 0.2479 0.0114  0.0316  -0.0138 423  MSE A SE  
3704 SE SE  B MSE A 426 ? 0.1372 0.1650 0.1300 -0.0037 -0.0212 -0.0004 423  MSE A SE  
3705 C  CE  A MSE A 426 ? 0.2814 0.2299 0.2607 -0.0345 0.0202  -0.0322 423  MSE A CE  
3706 C  CE  B MSE A 426 ? 0.1252 0.0794 0.0908 -0.0248 -0.0544 0.0322  423  MSE A CE  
3707 N  N   . PHE A 427 ? 0.1541 0.1464 0.1361 -0.0172 -0.0043 0.0157  424  PHE A N   
3708 C  CA  A PHE A 427 ? 0.1497 0.1331 0.1312 -0.0123 -0.0036 0.0143  424  PHE A CA  
3709 C  CA  B PHE A 427 ? 0.1693 0.1496 0.1477 -0.0078 -0.0026 0.0137  424  PHE A CA  
3710 C  C   . PHE A 427 ? 0.1551 0.1412 0.1445 -0.0087 -0.0088 0.0127  424  PHE A C   
3711 O  O   . PHE A 427 ? 0.1557 0.1368 0.1668 -0.0139 0.0234  0.0145  424  PHE A O   
3712 C  CB  A PHE A 427 ? 0.1382 0.1314 0.1117 -0.0001 -0.0169 0.0170  424  PHE A CB  
3713 C  CB  B PHE A 427 ? 0.1845 0.1629 0.1478 -0.0052 -0.0128 0.0150  424  PHE A CB  
3714 C  CG  A PHE A 427 ? 0.1280 0.1417 0.1009 -0.0104 -0.0157 0.0021  424  PHE A CG  
3715 C  CG  B PHE A 427 ? 0.2316 0.2119 0.1750 0.0173  -0.0124 0.0011  424  PHE A CG  
3716 C  CD1 A PHE A 427 ? 0.1066 0.1269 0.1145 -0.0008 -0.0047 -0.0205 424  PHE A CD1 
3717 C  CD1 B PHE A 427 ? 0.2387 0.2579 0.2394 0.0208  -0.0065 -0.0241 424  PHE A CD1 
3718 C  CD2 A PHE A 427 ? 0.1761 0.1538 0.1581 0.0064  0.0622  0.0148  424  PHE A CD2 
3719 C  CD2 B PHE A 427 ? 0.2830 0.2460 0.2382 0.0310  -0.0149 -0.0269 424  PHE A CD2 
3720 C  CE1 A PHE A 427 ? 0.1673 0.1253 0.1575 -0.0059 0.0303  -0.0272 424  PHE A CE1 
3721 C  CE1 B PHE A 427 ? 0.2680 0.2535 0.2579 0.0267  -0.0069 -0.0304 424  PHE A CE1 
3722 C  CE2 A PHE A 427 ? 0.2036 0.1418 0.1959 -0.0064 0.0719  -0.0129 424  PHE A CE2 
3723 C  CE2 B PHE A 427 ? 0.2920 0.2577 0.2623 0.0400  -0.0080 -0.0207 424  PHE A CE2 
3724 C  CZ  A PHE A 427 ? 0.1473 0.1560 0.1575 0.0033  0.0333  0.0114  424  PHE A CZ  
3725 C  CZ  B PHE A 427 ? 0.2885 0.2765 0.2511 0.0246  -0.0147 -0.0175 424  PHE A CZ  
3726 N  N   . GLY A 428 ? 0.1486 0.1225 0.1436 0.0050  -0.0007 0.0118  425  GLY A N   
3727 C  CA  . GLY A 428 ? 0.1440 0.1311 0.1455 0.0060  -0.0004 0.0117  425  GLY A CA  
3728 C  C   . GLY A 428 ? 0.1543 0.1499 0.1419 0.0056  0.0046  0.0064  425  GLY A C   
3729 O  O   . GLY A 428 ? 0.1581 0.1681 0.1437 0.0061  -0.0017 0.0054  425  GLY A O   
3730 N  N   . GLN A 429 ? 0.1372 0.1609 0.1454 0.0043  0.0120  0.0135  426  GLN A N   
3731 C  CA  A GLN A 429 ? 0.1438 0.1506 0.1437 -0.0025 0.0105  0.0153  426  GLN A CA  
3732 C  CA  B GLN A 429 ? 0.1546 0.1565 0.1536 0.0001  0.0079  0.0136  426  GLN A CA  
3733 C  C   . GLN A 429 ? 0.1517 0.1545 0.1577 0.0014  0.0059  0.0177  426  GLN A C   
3734 O  O   . GLN A 429 ? 0.1790 0.1370 0.1569 -0.0015 0.0074  0.0247  426  GLN A O   
3735 C  CB  A GLN A 429 ? 0.1613 0.1531 0.1628 0.0022  -0.0025 0.0140  426  GLN A CB  
3736 C  CB  B GLN A 429 ? 0.1700 0.1619 0.1746 0.0025  -0.0014 0.0115  426  GLN A CB  
3737 C  CG  A GLN A 429 ? 0.1502 0.1543 0.1236 -0.0136 0.0036  0.0092  426  GLN A CG  
3738 C  CG  B GLN A 429 ? 0.2001 0.1867 0.1769 -0.0003 0.0033  0.0025  426  GLN A CG  
3739 C  CD  A GLN A 429 ? 0.1686 0.1557 0.1696 0.0075  -0.0369 -0.0076 426  GLN A CD  
3740 C  CD  B GLN A 429 ? 0.2136 0.2307 0.1735 -0.0109 -0.0002 0.0244  426  GLN A CD  
3741 O  OE1 A GLN A 429 ? 0.1946 0.2250 0.2288 -0.0211 -0.0517 -0.0481 426  GLN A OE1 
3742 O  OE1 B GLN A 429 ? 0.2425 0.2631 0.1707 -0.0144 0.0226  0.0398  426  GLN A OE1 
3743 N  NE2 A GLN A 429 ? 0.1062 0.1284 0.1915 -0.0098 -0.0493 -0.0079 426  GLN A NE2 
3744 N  NE2 B GLN A 429 ? 0.2869 0.2646 0.1451 -0.0125 0.0031  -0.0232 426  GLN A NE2 
3745 N  N   . SER A 430 ? 0.1651 0.1697 0.1582 -0.0012 0.0071  0.0247  427  SER A N   
3746 C  CA  . SER A 430 ? 0.1735 0.1789 0.1819 -0.0033 0.0147  0.0193  427  SER A CA  
3747 C  C   . SER A 430 ? 0.1709 0.1683 0.1806 -0.0058 -0.0050 0.0224  427  SER A C   
3748 O  O   . SER A 430 ? 0.1954 0.1704 0.1727 0.0036  -0.0052 0.0273  427  SER A O   
3749 C  CB  . SER A 430 ? 0.1828 0.1999 0.1931 -0.0204 0.0158  0.0178  427  SER A CB  
3750 O  OG  . SER A 430 ? 0.2266 0.2689 0.1964 -0.0037 0.0478  0.0283  427  SER A OG  
3751 N  N   . TYR A 431 ? 0.1736 0.1825 0.2047 0.0021  -0.0036 0.0191  428  TYR A N   
3752 C  CA  . TYR A 431 ? 0.1836 0.1827 0.1969 0.0025  -0.0032 0.0230  428  TYR A CA  
3753 C  C   . TYR A 431 ? 0.1960 0.2027 0.1967 0.0002  0.0009  0.0206  428  TYR A C   
3754 O  O   . TYR A 431 ? 0.2034 0.1866 0.2085 0.0162  0.0010  0.0318  428  TYR A O   
3755 C  CB  . TYR A 431 ? 0.1811 0.1890 0.2093 0.0045  0.0038  0.0169  428  TYR A CB  
3756 C  CG  . TYR A 431 ? 0.2196 0.2014 0.2339 0.0120  0.0062  0.0402  428  TYR A CG  
3757 C  CD1 . TYR A 431 ? 0.2512 0.2264 0.2448 0.0168  0.0148  0.0064  428  TYR A CD1 
3758 C  CD2 . TYR A 431 ? 0.2372 0.2339 0.2576 0.0174  -0.0021 0.0443  428  TYR A CD2 
3759 C  CE1 . TYR A 431 ? 0.2535 0.2295 0.2500 0.0135  0.0039  0.0129  428  TYR A CE1 
3760 C  CE2 . TYR A 431 ? 0.2607 0.1989 0.2634 0.0137  -0.0122 0.0592  428  TYR A CE2 
3761 C  CZ  . TYR A 431 ? 0.2632 0.2200 0.2747 0.0215  -0.0210 0.0539  428  TYR A CZ  
3762 O  OH  . TYR A 431 ? 0.2624 0.2393 0.3685 0.0218  -0.0704 0.0507  428  TYR A OH  
3763 N  N   . ASP A 432 ? 0.2063 0.2179 0.2197 0.0043  -0.0056 0.0155  429  ASP A N   
3764 C  CA  A ASP A 432 ? 0.2198 0.2358 0.2157 -0.0041 0.0108  0.0139  429  ASP A CA  
3765 C  CA  B ASP A 432 ? 0.2253 0.2390 0.2141 0.0041  0.0016  0.0132  429  ASP A CA  
3766 C  C   . ASP A 432 ? 0.2224 0.2371 0.2057 0.0026  0.0057  0.0174  429  ASP A C   
3767 O  O   . ASP A 432 ? 0.2130 0.2761 0.1932 0.0041  0.0035  0.0121  429  ASP A O   
3768 C  CB  A ASP A 432 ? 0.2224 0.2349 0.2296 -0.0108 0.0128  0.0176  429  ASP A CB  
3769 C  CB  B ASP A 432 ? 0.2309 0.2424 0.2274 0.0046  -0.0004 0.0147  429  ASP A CB  
3770 C  CG  A ASP A 432 ? 0.2458 0.2426 0.2891 -0.0278 0.0383  0.0034  429  ASP A CG  
3771 C  CG  B ASP A 432 ? 0.2784 0.2769 0.2478 0.0202  -0.0064 0.0073  429  ASP A CG  
3772 O  OD1 A ASP A 432 ? 0.2912 0.2108 0.3139 -0.0566 0.1127  0.0120  429  ASP A OD1 
3773 O  OD1 B ASP A 432 ? 0.3303 0.2794 0.2645 0.0467  -0.0094 0.0311  429  ASP A OD1 
3774 O  OD2 A ASP A 432 ? 0.2683 0.2661 0.3179 -0.0666 0.0738  0.0197  429  ASP A OD2 
3775 O  OD2 B ASP A 432 ? 0.3420 0.3245 0.3094 0.0349  0.0064  -0.0301 429  ASP A OD2 
3776 N  N   . MSE A 433 ? 0.2246 0.2400 0.2013 0.0153  -0.0009 0.0093  430  MSE A N   
3777 C  CA  A MSE A 433 ? 0.2204 0.2383 0.1929 0.0115  0.0069  0.0092  430  MSE A CA  
3778 C  CA  B MSE A 433 ? 0.2219 0.2370 0.2002 0.0084  0.0024  0.0068  430  MSE A CA  
3779 C  C   . MSE A 433 ? 0.2166 0.2309 0.1974 0.0089  -0.0041 0.0033  430  MSE A C   
3780 O  O   . MSE A 433 ? 0.2329 0.2410 0.1993 0.0110  0.0021  -0.0050 430  MSE A O   
3781 C  CB  A MSE A 433 ? 0.2338 0.2513 0.2157 0.0237  0.0042  0.0020  430  MSE A CB  
3782 C  CB  B MSE A 433 ? 0.2315 0.2448 0.2142 0.0122  0.0006  0.0017  430  MSE A CB  
3783 C  CG  A MSE A 433 ? 0.2649 0.3151 0.2814 0.0307  0.0229  0.0029  430  MSE A CG  
3784 C  CG  B MSE A 433 ? 0.2458 0.2799 0.2373 0.0125  0.0116  0.0004  430  MSE A CG  
3785 SE SE  A MSE A 433 ? 0.3668 0.4320 0.3488 0.0841  0.0326  0.0024  430  MSE A SE  
3786 SE SE  B MSE A 433 ? 0.3068 0.3604 0.3004 0.0249  0.0488  -0.0337 430  MSE A SE  
3787 C  CE  A MSE A 433 ? 0.2794 0.3959 0.2989 0.1247  0.0815  -0.0420 430  MSE A CE  
3788 C  CE  B MSE A 433 ? 0.3206 0.3694 0.2412 0.0152  0.0399  0.0017  430  MSE A CE  
3789 N  N   . VAL A 434 ? 0.1942 0.2173 0.1758 0.0008  0.0033  0.0169  431  VAL A N   
3790 C  CA  . VAL A 434 ? 0.1909 0.2081 0.1820 0.0029  0.0005  0.0124  431  VAL A CA  
3791 C  C   . VAL A 434 ? 0.1955 0.2203 0.1873 -0.0021 0.0028  0.0125  431  VAL A C   
3792 O  O   . VAL A 434 ? 0.2211 0.2392 0.2066 0.0070  -0.0021 0.0113  431  VAL A O   
3793 C  CB  . VAL A 434 ? 0.1749 0.2051 0.1785 0.0006  0.0135  0.0277  431  VAL A CB  
3794 C  CG1 . VAL A 434 ? 0.2080 0.2279 0.2419 -0.0018 0.0197  -0.0160 431  VAL A CG1 
3795 C  CG2 . VAL A 434 ? 0.1968 0.1963 0.1733 0.0341  -0.0085 0.0251  431  VAL A CG2 
3796 N  N   . TYR A 435 ? 0.1743 0.2093 0.1823 0.0093  -0.0025 0.0145  432  TYR A N   
3797 C  CA  . TYR A 435 ? 0.2040 0.2252 0.1876 0.0112  -0.0032 0.0200  432  TYR A CA  
3798 C  C   . TYR A 435 ? 0.2168 0.2531 0.1816 0.0134  -0.0162 0.0130  432  TYR A C   
3799 O  O   . TYR A 435 ? 0.2352 0.2764 0.1561 0.0195  -0.0320 0.0190  432  TYR A O   
3800 C  CB  . TYR A 435 ? 0.2013 0.2263 0.1947 0.0087  -0.0023 0.0183  432  TYR A CB  
3801 C  CG  . TYR A 435 ? 0.2258 0.2500 0.2016 0.0248  0.0039  0.0392  432  TYR A CG  
3802 C  CD1 . TYR A 435 ? 0.2396 0.2372 0.2310 0.0326  0.0068  0.0465  432  TYR A CD1 
3803 C  CD2 . TYR A 435 ? 0.3037 0.2640 0.2341 0.0428  0.0221  0.0792  432  TYR A CD2 
3804 C  CE1 . TYR A 435 ? 0.2652 0.2524 0.2519 0.0518  -0.0145 0.0490  432  TYR A CE1 
3805 C  CE2 . TYR A 435 ? 0.3462 0.2668 0.2378 0.0514  0.0072  0.0783  432  TYR A CE2 
3806 C  CZ  . TYR A 435 ? 0.3302 0.2704 0.2439 0.0652  -0.0104 0.0701  432  TYR A CZ  
3807 O  OH  . TYR A 435 ? 0.4118 0.3116 0.2857 0.0715  -0.0125 0.1073  432  TYR A OH  
3808 N  N   . ASN A 436 ? 0.2424 0.2810 0.2052 0.0167  -0.0182 0.0097  433  ASN A N   
3809 C  CA  . ASN A 436 ? 0.2685 0.3100 0.2452 0.0113  -0.0086 -0.0102 433  ASN A CA  
3810 C  C   . ASN A 436 ? 0.2855 0.3141 0.2597 0.0060  -0.0145 -0.0146 433  ASN A C   
3811 O  O   . ASN A 436 ? 0.2994 0.3546 0.2245 0.0067  -0.0179 -0.0426 433  ASN A O   
3812 C  CB  . ASN A 436 ? 0.2747 0.3321 0.2621 0.0107  -0.0078 -0.0092 433  ASN A CB  
3813 C  CG  . ASN A 436 ? 0.3118 0.3575 0.2931 0.0066  0.0004  -0.0007 433  ASN A CG  
3814 O  OD1 . ASN A 436 ? 0.3823 0.3862 0.4100 0.0133  0.0659  -0.0143 433  ASN A OD1 
3815 N  ND2 . ASN A 436 ? 0.3338 0.4789 0.3520 -0.0220 0.0246  -0.0321 433  ASN A ND2 
3816 N  N   . GLU A 437 ? 0.2905 0.3064 0.2582 0.0024  -0.0081 -0.0137 434  GLU A N   
3817 C  CA  A GLU A 437 ? 0.2969 0.3093 0.2788 0.0016  -0.0058 -0.0128 434  GLU A CA  
3818 C  CA  B GLU A 437 ? 0.2897 0.3076 0.2749 0.0024  -0.0080 -0.0123 434  GLU A CA  
3819 C  C   . GLU A 437 ? 0.2897 0.3066 0.2802 0.0003  -0.0135 -0.0126 434  GLU A C   
3820 O  O   . GLU A 437 ? 0.3040 0.3203 0.2952 -0.0111 -0.0205 -0.0259 434  GLU A O   
3821 C  CB  A GLU A 437 ? 0.3091 0.3152 0.2931 0.0037  -0.0064 -0.0118 434  GLU A CB  
3822 C  CB  B GLU A 437 ? 0.2937 0.3088 0.2843 0.0043  -0.0078 -0.0119 434  GLU A CB  
3823 C  CG  A GLU A 437 ? 0.3530 0.3184 0.3358 -0.0007 0.0097  -0.0053 434  GLU A CG  
3824 C  CG  B GLU A 437 ? 0.2990 0.3236 0.3051 0.0095  -0.0036 -0.0098 434  GLU A CG  
3825 C  CD  A GLU A 437 ? 0.4188 0.3450 0.4021 0.0108  -0.0005 0.0155  434  GLU A CD  
3826 C  CD  B GLU A 437 ? 0.3195 0.3285 0.3327 0.0223  -0.0043 -0.0061 434  GLU A CD  
3827 O  OE1 A GLU A 437 ? 0.4426 0.3405 0.3943 -0.0070 -0.0083 0.0523  434  GLU A OE1 
3828 O  OE1 B GLU A 437 ? 0.2974 0.3546 0.3030 0.0213  -0.0169 0.0059  434  GLU A OE1 
3829 O  OE2 A GLU A 437 ? 0.4598 0.3649 0.4659 0.0128  0.0128  -0.0041 434  GLU A OE2 
3830 O  OE2 B GLU A 437 ? 0.3327 0.3416 0.3844 0.0477  -0.0171 -0.0004 434  GLU A OE2 
3831 N  N   . LEU A 438 ? 0.2677 0.2990 0.2585 0.0047  -0.0207 -0.0078 435  LEU A N   
3832 C  CA  . LEU A 438 ? 0.2596 0.2954 0.2493 0.0069  -0.0251 0.0070  435  LEU A CA  
3833 C  C   . LEU A 438 ? 0.2791 0.3117 0.2647 0.0105  -0.0291 0.0023  435  LEU A C   
3834 O  O   . LEU A 438 ? 0.2749 0.3394 0.2772 0.0138  -0.0331 -0.0080 435  LEU A O   
3835 C  CB  . LEU A 438 ? 0.2433 0.2855 0.2372 0.0095  -0.0291 0.0159  435  LEU A CB  
3836 C  CG  . LEU A 438 ? 0.2197 0.2365 0.2220 0.0035  -0.0314 0.0395  435  LEU A CG  
3837 C  CD1 . LEU A 438 ? 0.2585 0.3185 0.1902 0.0001  -0.0118 -0.0062 435  LEU A CD1 
3838 C  CD2 . LEU A 438 ? 0.2363 0.2203 0.2207 -0.0252 -0.0535 0.0061  435  LEU A CD2 
3839 N  N   . LEU A 439 ? 0.2989 0.3251 0.2637 0.0099  -0.0350 0.0048  436  LEU A N   
3840 C  CA  . LEU A 439 ? 0.3148 0.3354 0.2876 0.0116  -0.0300 0.0111  436  LEU A CA  
3841 C  C   . LEU A 439 ? 0.3426 0.3554 0.3089 0.0093  -0.0297 -0.0015 436  LEU A C   
3842 O  O   . LEU A 439 ? 0.3478 0.3795 0.3247 0.0107  -0.0548 -0.0089 436  LEU A O   
3843 C  CB  . LEU A 439 ? 0.3095 0.3246 0.2542 0.0084  -0.0244 0.0273  436  LEU A CB  
3844 C  CG  . LEU A 439 ? 0.3146 0.3348 0.2766 0.0050  -0.0151 0.0310  436  LEU A CG  
3845 C  CD1 . LEU A 439 ? 0.3301 0.3679 0.3064 -0.0186 -0.0065 0.0334  436  LEU A CD1 
3846 C  CD2 . LEU A 439 ? 0.3159 0.3670 0.3514 0.0111  -0.0187 0.0284  436  LEU A CD2 
3847 N  N   . LYS A 440 ? 0.3624 0.3726 0.3338 0.0115  -0.0186 -0.0030 437  LYS A N   
3848 C  CA  A LYS A 440 ? 0.3820 0.3839 0.3682 0.0069  -0.0128 -0.0057 437  LYS A CA  
3849 C  CA  B LYS A 440 ? 0.3761 0.3814 0.3638 0.0069  -0.0124 -0.0059 437  LYS A CA  
3850 C  C   . LYS A 440 ? 0.3862 0.3933 0.3813 0.0062  -0.0137 -0.0109 437  LYS A C   
3851 O  O   . LYS A 440 ? 0.4158 0.4162 0.4104 0.0014  -0.0109 -0.0254 437  LYS A O   
3852 C  CB  A LYS A 440 ? 0.3874 0.3911 0.3767 0.0068  -0.0081 -0.0065 437  LYS A CB  
3853 C  CB  B LYS A 440 ? 0.3766 0.3839 0.3669 0.0061  -0.0080 -0.0060 437  LYS A CB  
3854 C  CG  A LYS A 440 ? 0.4055 0.3926 0.4027 0.0001  -0.0018 -0.0085 437  LYS A CG  
3855 C  CG  B LYS A 440 ? 0.3681 0.3809 0.3746 0.0006  -0.0023 -0.0046 437  LYS A CG  
3856 C  CD  A LYS A 440 ? 0.4193 0.4147 0.4301 0.0054  0.0082  -0.0118 437  LYS A CD  
3857 C  CD  B LYS A 440 ? 0.3576 0.3795 0.3697 0.0016  0.0029  -0.0057 437  LYS A CD  
3858 C  CE  A LYS A 440 ? 0.4301 0.4364 0.4503 0.0124  0.0042  -0.0166 437  LYS A CE  
3859 C  CE  B LYS A 440 ? 0.3454 0.3702 0.3504 -0.0074 0.0072  -0.0024 437  LYS A CE  
3860 N  NZ  A LYS A 440 ? 0.4520 0.4431 0.4813 0.0164  0.0071  -0.0362 437  LYS A NZ  
3861 N  NZ  B LYS A 440 ? 0.3322 0.3611 0.3277 0.0000  0.0072  -0.0092 437  LYS A NZ  
3862 N  N   . SER A 441 ? 0.3894 0.3960 0.3872 0.0057  -0.0083 -0.0129 438  SER A N   
3863 C  CA  . SER A 441 ? 0.3931 0.4042 0.4069 0.0057  -0.0121 -0.0149 438  SER A CA  
3864 C  C   . SER A 441 ? 0.3863 0.4064 0.4023 0.0029  -0.0164 -0.0153 438  SER A C   
3865 O  O   . SER A 441 ? 0.3893 0.4312 0.4252 -0.0020 -0.0237 -0.0258 438  SER A O   
3866 C  CB  . SER A 441 ? 0.3984 0.4112 0.4120 0.0046  -0.0088 -0.0172 438  SER A CB  
3867 O  OG  . SER A 441 ? 0.4295 0.4288 0.4633 0.0153  -0.0032 -0.0362 438  SER A OG  
3868 N  N   . GLY A 442 ? 0.3749 0.3944 0.3969 0.0087  -0.0321 -0.0161 439  GLY A N   
3869 C  CA  . GLY A 442 ? 0.3663 0.3956 0.3854 0.0077  -0.0356 -0.0157 439  GLY A CA  
3870 C  C   . GLY A 442 ? 0.3565 0.3833 0.3757 0.0103  -0.0431 -0.0098 439  GLY A C   
3871 O  O   . GLY A 442 ? 0.3473 0.3899 0.3794 0.0062  -0.0553 -0.0098 439  GLY A O   
3872 N  N   . LEU A 443 ? 0.3393 0.3698 0.3423 0.0051  -0.0430 -0.0098 440  LEU A N   
3873 C  CA  . LEU A 443 ? 0.3226 0.3639 0.3148 0.0108  -0.0406 -0.0024 440  LEU A CA  
3874 C  C   . LEU A 443 ? 0.3190 0.3588 0.3062 0.0117  -0.0459 -0.0043 440  LEU A C   
3875 O  O   . LEU A 443 ? 0.3234 0.3918 0.2868 0.0170  -0.0678 -0.0147 440  LEU A O   
3876 C  CB  . LEU A 443 ? 0.3121 0.3503 0.3046 0.0122  -0.0509 0.0061  440  LEU A CB  
3877 C  CG  . LEU A 443 ? 0.3128 0.3842 0.3350 0.0105  -0.0242 -0.0046 440  LEU A CG  
3878 C  CD1 . LEU A 443 ? 0.3207 0.3930 0.3376 0.0350  -0.0604 0.0113  440  LEU A CD1 
3879 C  CD2 . LEU A 443 ? 0.3286 0.4098 0.3944 -0.0193 -0.0307 -0.0327 440  LEU A CD2 
3880 N  N   . ASN A 444 ? 0.3165 0.3603 0.2890 0.0135  -0.0469 0.0036  441  ASN A N   
3881 C  CA  . ASN A 444 ? 0.3115 0.3444 0.2947 0.0116  -0.0392 0.0109  441  ASN A CA  
3882 C  C   . ASN A 444 ? 0.3121 0.3239 0.2753 0.0106  -0.0335 0.0201  441  ASN A C   
3883 O  O   . ASN A 444 ? 0.2997 0.3183 0.2186 0.0076  -0.0541 0.0409  441  ASN A O   
3884 C  CB  . ASN A 444 ? 0.3151 0.3660 0.3018 0.0142  -0.0470 0.0083  441  ASN A CB  
3885 C  CG  . ASN A 444 ? 0.2977 0.4157 0.2992 0.0144  -0.0441 0.0022  441  ASN A CG  
3886 O  OD1 . ASN A 444 ? 0.3638 0.4642 0.2407 0.0082  -0.0561 0.0578  441  ASN A OD1 
3887 N  ND2 . ASN A 444 ? 0.3078 0.4669 0.3194 0.0299  -0.0987 0.0007  441  ASN A ND2 
3888 N  N   . GLU A 445 ? 0.3182 0.2959 0.2827 0.0147  -0.0179 0.0225  442  GLU A N   
3889 C  CA  A GLU A 445 ? 0.3218 0.2979 0.2874 0.0140  -0.0169 0.0210  442  GLU A CA  
3890 C  CA  B GLU A 445 ? 0.3182 0.2966 0.2883 0.0113  -0.0159 0.0185  442  GLU A CA  
3891 C  C   . GLU A 445 ? 0.3190 0.2925 0.2831 0.0154  -0.0120 0.0230  442  GLU A C   
3892 O  O   . GLU A 445 ? 0.3341 0.2865 0.2678 0.0155  -0.0219 0.0305  442  GLU A O   
3893 C  CB  A GLU A 445 ? 0.3284 0.3083 0.3076 0.0097  -0.0068 0.0144  442  GLU A CB  
3894 C  CB  B GLU A 445 ? 0.3204 0.3021 0.3016 0.0067  -0.0075 0.0129  442  GLU A CB  
3895 C  CG  A GLU A 445 ? 0.3420 0.3354 0.3171 0.0186  -0.0009 0.0090  442  GLU A CG  
3896 C  CG  B GLU A 445 ? 0.3218 0.3187 0.3261 0.0028  -0.0074 -0.0022 442  GLU A CG  
3897 C  CD  A GLU A 445 ? 0.3640 0.3728 0.3792 0.0215  0.0087  0.0195  442  GLU A CD  
3898 C  CD  B GLU A 445 ? 0.3326 0.3290 0.3538 -0.0032 0.0028  -0.0055 442  GLU A CD  
3899 O  OE1 A GLU A 445 ? 0.3980 0.3828 0.4206 0.0331  0.0052  0.0331  442  GLU A OE1 
3900 O  OE1 B GLU A 445 ? 0.3492 0.3433 0.3820 0.0130  0.0055  -0.0224 442  GLU A OE1 
3901 O  OE2 A GLU A 445 ? 0.3606 0.4282 0.3971 0.0410  0.0008  0.0279  442  GLU A OE2 
3902 O  OE2 B GLU A 445 ? 0.3475 0.3340 0.3902 -0.0253 0.0145  -0.0029 442  GLU A OE2 
3903 N  N   . THR A 446 ? 0.3372 0.2896 0.2776 0.0150  -0.0164 0.0319  443  THR A N   
3904 C  CA  . THR A 446 ? 0.3386 0.2989 0.2930 0.0192  -0.0124 0.0176  443  THR A CA  
3905 C  C   . THR A 446 ? 0.3146 0.2917 0.2655 0.0210  -0.0273 0.0179  443  THR A C   
3906 O  O   . THR A 446 ? 0.3401 0.3238 0.2657 0.0376  -0.0284 0.0026  443  THR A O   
3907 C  CB  . THR A 446 ? 0.3504 0.3052 0.3066 0.0146  -0.0072 0.0164  443  THR A CB  
3908 O  OG1 . THR A 446 ? 0.4037 0.3299 0.3623 0.0278  -0.0145 0.0354  443  THR A OG1 
3909 C  CG2 . THR A 446 ? 0.3836 0.3295 0.2981 0.0227  -0.0075 0.0027  443  THR A CG2 
3910 N  N   . GLN A 447 ? 0.2946 0.2825 0.2498 0.0249  -0.0300 0.0166  444  GLN A N   
3911 C  CA  . GLN A 447 ? 0.2592 0.2785 0.2543 0.0172  -0.0300 0.0089  444  GLN A CA  
3912 C  C   . GLN A 447 ? 0.2526 0.2650 0.2281 0.0181  -0.0239 0.0074  444  GLN A C   
3913 O  O   . GLN A 447 ? 0.2430 0.2595 0.1740 -0.0122 -0.0267 0.0168  444  GLN A O   
3914 C  CB  . GLN A 447 ? 0.2580 0.2714 0.2709 0.0236  -0.0353 0.0029  444  GLN A CB  
3915 C  CG  . GLN A 447 ? 0.2520 0.3563 0.3305 0.0039  -0.0510 -0.0226 444  GLN A CG  
3916 C  CD  . GLN A 447 ? 0.2607 0.4251 0.3637 -0.0212 -0.0462 -0.0587 444  GLN A CD  
3917 O  OE1 . GLN A 447 ? 0.2462 0.4529 0.3461 -0.0085 -0.0489 -0.0447 444  GLN A OE1 
3918 N  NE2 . GLN A 447 ? 0.2687 0.4772 0.4409 -0.0492 -0.0338 -0.0642 444  GLN A NE2 
3919 N  N   . ALA A 448 ? 0.2402 0.2631 0.2148 0.0045  -0.0130 0.0123  445  ALA A N   
3920 C  CA  . ALA A 448 ? 0.2414 0.2447 0.1994 0.0114  -0.0161 0.0219  445  ALA A CA  
3921 C  C   . ALA A 448 ? 0.2397 0.2456 0.2139 0.0057  -0.0110 0.0165  445  ALA A C   
3922 O  O   . ALA A 448 ? 0.2423 0.2585 0.1723 0.0018  -0.0226 0.0294  445  ALA A O   
3923 C  CB  . ALA A 448 ? 0.2426 0.2689 0.2232 0.0088  -0.0094 0.0068  445  ALA A CB  
3924 N  N   . LYS A 449 ? 0.2754 0.2552 0.2373 -0.0086 -0.0058 0.0113  446  LYS A N   
3925 C  CA  A LYS A 449 ? 0.2870 0.2714 0.2555 -0.0085 -0.0086 0.0049  446  LYS A CA  
3926 C  CA  B LYS A 449 ? 0.2776 0.2624 0.2473 -0.0093 -0.0073 0.0075  446  LYS A CA  
3927 C  C   . LYS A 449 ? 0.2817 0.2636 0.2477 -0.0106 -0.0065 0.0076  446  LYS A C   
3928 O  O   . LYS A 449 ? 0.2981 0.3027 0.2488 -0.0382 -0.0037 -0.0023 446  LYS A O   
3929 C  CB  A LYS A 449 ? 0.3063 0.2737 0.2742 -0.0098 -0.0076 -0.0011 446  LYS A CB  
3930 C  CB  B LYS A 449 ? 0.2853 0.2600 0.2572 -0.0103 -0.0045 0.0044  446  LYS A CB  
3931 C  CG  A LYS A 449 ? 0.3206 0.3308 0.3308 -0.0010 -0.0039 -0.0157 446  LYS A CG  
3932 C  CG  B LYS A 449 ? 0.2776 0.2736 0.2747 -0.0093 -0.0020 0.0026  446  LYS A CG  
3933 C  CD  A LYS A 449 ? 0.3642 0.3765 0.3639 -0.0009 -0.0201 -0.0283 446  LYS A CD  
3934 C  CD  B LYS A 449 ? 0.2877 0.2620 0.2888 -0.0071 -0.0066 0.0068  446  LYS A CD  
3935 C  CE  A LYS A 449 ? 0.3747 0.3869 0.3790 -0.0044 -0.0206 -0.0306 446  LYS A CE  
3936 C  CE  B LYS A 449 ? 0.2966 0.2829 0.3039 0.0039  -0.0021 -0.0068 446  LYS A CE  
3937 N  NZ  A LYS A 449 ? 0.3398 0.3925 0.3891 -0.0065 -0.0440 -0.0431 446  LYS A NZ  
3938 N  NZ  B LYS A 449 ? 0.2999 0.2771 0.3154 0.0107  0.0000  -0.0066 446  LYS A NZ  
3939 N  N   . GLU A 450 ? 0.2801 0.2474 0.2370 -0.0020 -0.0113 0.0089  447  GLU A N   
3940 C  CA  A GLU A 450 ? 0.2801 0.2536 0.2366 -0.0037 -0.0079 0.0068  447  GLU A CA  
3941 C  CA  B GLU A 450 ? 0.2637 0.2439 0.2300 -0.0006 -0.0116 0.0081  447  GLU A CA  
3942 C  C   . GLU A 450 ? 0.2607 0.2382 0.2062 0.0003  -0.0171 0.0110  447  GLU A C   
3943 O  O   . GLU A 450 ? 0.3192 0.2389 0.1953 -0.0305 -0.0252 0.0085  447  GLU A O   
3944 C  CB  A GLU A 450 ? 0.2951 0.2682 0.2547 0.0040  -0.0103 0.0054  447  GLU A CB  
3945 C  CB  B GLU A 450 ? 0.2693 0.2480 0.2436 0.0106  -0.0139 0.0041  447  GLU A CB  
3946 C  CG  A GLU A 450 ? 0.3501 0.3002 0.3209 -0.0051 0.0149  -0.0047 447  GLU A CG  
3947 C  CG  B GLU A 450 ? 0.2407 0.2453 0.2687 0.0160  -0.0165 0.0112  447  GLU A CG  
3948 C  CD  A GLU A 450 ? 0.4053 0.3695 0.3445 -0.0070 0.0149  -0.0092 447  GLU A CD  
3949 C  CD  B GLU A 450 ? 0.2412 0.2396 0.3268 0.0438  -0.0417 -0.0126 447  GLU A CD  
3950 O  OE1 A GLU A 450 ? 0.4516 0.4201 0.4305 -0.0287 0.0251  -0.0278 447  GLU A OE1 
3951 O  OE1 B GLU A 450 ? 0.1801 0.2116 0.3221 0.0772  -0.0377 -0.0068 447  GLU A OE1 
3952 O  OE2 A GLU A 450 ? 0.4400 0.3894 0.4249 0.0158  0.0388  0.0161  447  GLU A OE2 
3953 O  OE2 B GLU A 450 ? 0.2244 0.2361 0.3386 0.0406  -0.0658 -0.0308 447  GLU A OE2 
3954 N  N   . LEU A 451 ? 0.2036 0.2106 0.1739 0.0057  -0.0168 0.0243  448  LEU A N   
3955 C  CA  . LEU A 451 ? 0.1695 0.1954 0.1701 -0.0027 -0.0041 0.0206  448  LEU A CA  
3956 C  C   . LEU A 451 ? 0.1546 0.1967 0.1532 -0.0118 -0.0002 0.0257  448  LEU A C   
3957 O  O   . LEU A 451 ? 0.1368 0.2154 0.1371 -0.0151 -0.0102 0.0357  448  LEU A O   
3958 C  CB  . LEU A 451 ? 0.1691 0.2041 0.1606 0.0099  -0.0073 0.0179  448  LEU A CB  
3959 C  CG  . LEU A 451 ? 0.1521 0.2116 0.1688 -0.0156 -0.0154 0.0079  448  LEU A CG  
3960 C  CD1 . LEU A 451 ? 0.1368 0.2640 0.1563 0.0301  0.0383  0.0251  448  LEU A CD1 
3961 C  CD2 . LEU A 451 ? 0.1853 0.2422 0.1735 -0.0507 -0.0342 0.0001  448  LEU A CD2 
3962 N  N   . ALA A 452 ? 0.1542 0.2026 0.1548 -0.0105 0.0116  0.0325  449  ALA A N   
3963 C  CA  . ALA A 452 ? 0.1592 0.1939 0.1544 -0.0058 0.0085  0.0258  449  ALA A CA  
3964 C  C   . ALA A 452 ? 0.1464 0.1839 0.1473 -0.0129 0.0122  0.0157  449  ALA A C   
3965 O  O   . ALA A 452 ? 0.1280 0.1806 0.1410 -0.0172 0.0240  0.0138  449  ALA A O   
3966 C  CB  . ALA A 452 ? 0.1495 0.2188 0.1564 0.0017  0.0281  0.0236  449  ALA A CB  
3967 N  N   . ALA A 453 ? 0.1440 0.1713 0.1579 -0.0085 0.0134  0.0235  450  ALA A N   
3968 C  CA  . ALA A 453 ? 0.1711 0.1767 0.1754 -0.0147 0.0186  0.0064  450  ALA A CA  
3969 C  C   . ALA A 453 ? 0.1436 0.1693 0.1696 -0.0139 0.0170  0.0044  450  ALA A C   
3970 O  O   . ALA A 453 ? 0.1622 0.2096 0.1939 -0.0328 0.0103  -0.0060 450  ALA A O   
3971 C  CB  . ALA A 453 ? 0.2062 0.1533 0.1992 -0.0353 0.0297  -0.0051 450  ALA A CB  
3972 N  N   . HIS A 454 ? 0.1404 0.1431 0.1648 -0.0025 0.0191  -0.0006 451  HIS A N   
3973 C  CA  . HIS A 454 ? 0.1378 0.1517 0.1296 -0.0078 -0.0021 0.0056  451  HIS A CA  
3974 C  C   . HIS A 454 ? 0.1383 0.1380 0.1300 -0.0097 -0.0083 0.0015  451  HIS A C   
3975 O  O   . HIS A 454 ? 0.1434 0.1379 0.1221 -0.0112 -0.0080 0.0054  451  HIS A O   
3976 C  CB  . HIS A 454 ? 0.1384 0.1458 0.1254 -0.0074 0.0096  0.0111  451  HIS A CB  
3977 C  CG  . HIS A 454 ? 0.1178 0.1276 0.1215 -0.0162 0.0025  -0.0025 451  HIS A CG  
3978 N  ND1 . HIS A 454 ? 0.0948 0.1312 0.1140 -0.0031 0.0040  -0.0010 451  HIS A ND1 
3979 C  CD2 . HIS A 454 ? 0.1572 0.1628 0.1384 -0.0001 0.0185  0.0047  451  HIS A CD2 
3980 C  CE1 . HIS A 454 ? 0.1520 0.1328 0.1252 -0.0108 -0.0025 -0.0024 451  HIS A CE1 
3981 N  NE2 . HIS A 454 ? 0.1361 0.1475 0.1316 -0.0135 0.0065  -0.0095 451  HIS A NE2 
3982 N  N   . LYS A 455 ? 0.1353 0.1489 0.1316 -0.0096 0.0017  0.0155  452  LYS A N   
3983 C  CA  A LYS A 455 ? 0.1397 0.1536 0.1424 -0.0064 -0.0021 0.0081  452  LYS A CA  
3984 C  CA  B LYS A 455 ? 0.1380 0.1505 0.1382 -0.0034 -0.0019 0.0063  452  LYS A CA  
3985 C  C   . LYS A 455 ? 0.1352 0.1478 0.1447 -0.0045 0.0099  0.0021  452  LYS A C   
3986 O  O   . LYS A 455 ? 0.1730 0.1828 0.1557 0.0124  -0.0124 -0.0133 452  LYS A O   
3987 C  CB  A LYS A 455 ? 0.1435 0.1515 0.1526 -0.0147 -0.0040 0.0151  452  LYS A CB  
3988 C  CB  B LYS A 455 ? 0.1383 0.1479 0.1420 -0.0073 -0.0030 0.0103  452  LYS A CB  
3989 C  CG  A LYS A 455 ? 0.1542 0.1862 0.1533 -0.0185 -0.0030 0.0196  452  LYS A CG  
3990 C  CG  B LYS A 455 ? 0.1390 0.1498 0.1227 0.0069  -0.0115 0.0101  452  LYS A CG  
3991 C  CD  A LYS A 455 ? 0.2010 0.2013 0.1933 -0.0506 -0.0055 0.0043  452  LYS A CD  
3992 C  CD  B LYS A 455 ? 0.1476 0.1334 0.1403 0.0079  -0.0224 -0.0137 452  LYS A CD  
3993 C  CE  A LYS A 455 ? 0.2145 0.2139 0.2412 -0.0585 0.0034  -0.0101 452  LYS A CE  
3994 C  CE  B LYS A 455 ? 0.1611 0.1430 0.1382 0.0363  -0.0278 -0.0232 452  LYS A CE  
3995 N  NZ  A LYS A 455 ? 0.2400 0.2004 0.2658 -0.0884 0.0040  -0.0296 452  LYS A NZ  
3996 N  NZ  B LYS A 455 ? 0.1854 0.1815 0.1649 0.0165  -0.0193 -0.0575 452  LYS A NZ  
3997 N  N   . VAL A 456 ? 0.1395 0.1574 0.1790 0.0012  0.0046  0.0129  453  VAL A N   
3998 C  CA  . VAL A 456 ? 0.1368 0.1408 0.1741 -0.0002 0.0159  0.0143  453  VAL A CA  
3999 C  C   . VAL A 456 ? 0.1269 0.1494 0.1348 0.0030  0.0076  0.0055  453  VAL A C   
4000 O  O   . VAL A 456 ? 0.1455 0.1515 0.1584 -0.0127 0.0226  0.0165  453  VAL A O   
4001 C  CB  . VAL A 456 ? 0.1536 0.1520 0.1931 -0.0148 0.0100  0.0152  453  VAL A CB  
4002 C  CG1 . VAL A 456 ? 0.1278 0.1561 0.2376 -0.0534 0.0079  0.0172  453  VAL A CG1 
4003 C  CG2 . VAL A 456 ? 0.1800 0.1478 0.2036 0.0054  0.0395  0.0597  453  VAL A CG2 
4004 N  N   . ILE A 457 ? 0.1287 0.1378 0.1338 -0.0038 0.0101  0.0156  454  ILE A N   
4005 C  CA  . ILE A 457 ? 0.1463 0.1525 0.1399 -0.0005 -0.0025 0.0170  454  ILE A CA  
4006 C  C   . ILE A 457 ? 0.1481 0.1515 0.1422 0.0031  0.0004  0.0149  454  ILE A C   
4007 O  O   . ILE A 457 ? 0.1557 0.1503 0.1196 -0.0050 0.0012  0.0199  454  ILE A O   
4008 C  CB  . ILE A 457 ? 0.1610 0.1498 0.1520 0.0008  -0.0048 0.0184  454  ILE A CB  
4009 C  CG1 . ILE A 457 ? 0.1666 0.1733 0.2068 0.0134  -0.0700 0.0102  454  ILE A CG1 
4010 C  CG2 . ILE A 457 ? 0.1983 0.1283 0.1417 0.0101  -0.0187 0.0269  454  ILE A CG2 
4011 C  CD1 . ILE A 457 ? 0.1968 0.2114 0.2927 -0.0505 0.0066  -0.0051 454  ILE A CD1 
4012 N  N   . PRO A 458 ? 0.1671 0.1548 0.1475 0.0036  0.0054  0.0138  455  PRO A N   
4013 C  CA  . PRO A 458 ? 0.1771 0.1714 0.1472 -0.0021 -0.0013 0.0166  455  PRO A CA  
4014 C  C   . PRO A 458 ? 0.1465 0.1487 0.1335 -0.0009 -0.0011 0.0168  455  PRO A C   
4015 O  O   . PRO A 458 ? 0.1553 0.1647 0.1680 -0.0083 -0.0081 0.0300  455  PRO A O   
4016 C  CB  . PRO A 458 ? 0.1917 0.1750 0.1785 0.0089  0.0003  0.0087  455  PRO A CB  
4017 C  CG  . PRO A 458 ? 0.2349 0.2053 0.1665 -0.0204 0.0062  -0.0026 455  PRO A CG  
4018 C  CD  . PRO A 458 ? 0.2007 0.1767 0.1605 0.0102  -0.0109 0.0097  455  PRO A CD  
4019 N  N   . GLY A 459 ? 0.1158 0.1322 0.1412 0.0004  -0.0006 0.0087  456  GLY A N   
4020 C  CA  . GLY A 459 ? 0.1242 0.1294 0.1294 -0.0060 0.0022  0.0009  456  GLY A CA  
4021 C  C   . GLY A 459 ? 0.1189 0.1173 0.1357 -0.0067 -0.0038 -0.0159 456  GLY A C   
4022 O  O   . GLY A 459 ? 0.1358 0.1292 0.1382 -0.0062 -0.0095 -0.0163 456  GLY A O   
4023 N  N   . ASN A 460 ? 0.0965 0.1311 0.1292 -0.0206 -0.0045 -0.0166 457  ASN A N   
4024 C  CA  . ASN A 460 ? 0.1023 0.1268 0.1232 -0.0163 -0.0201 -0.0064 457  ASN A CA  
4025 C  C   . ASN A 460 ? 0.1200 0.1343 0.1255 -0.0184 -0.0067 -0.0064 457  ASN A C   
4026 O  O   . ASN A 460 ? 0.1300 0.1415 0.1617 -0.0288 -0.0219 0.0000  457  ASN A O   
4027 C  CB  . ASN A 460 ? 0.1287 0.1393 0.1396 -0.0102 -0.0113 -0.0044 457  ASN A CB  
4028 C  CG  . ASN A 460 ? 0.1295 0.1387 0.1176 -0.0176 0.0039  -0.0069 457  ASN A CG  
4029 O  OD1 . ASN A 460 ? 0.1406 0.1350 0.2028 -0.0142 0.0289  -0.0186 457  ASN A OD1 
4030 N  ND2 . ASN A 460 ? 0.1576 0.1620 0.1380 -0.0360 -0.0017 -0.0015 457  ASN A ND2 
4031 N  N   . ARG A 461 ? 0.1200 0.1370 0.1433 -0.0091 -0.0099 -0.0009 458  ARG A N   
4032 C  CA  . ARG A 461 ? 0.1309 0.1208 0.1405 -0.0058 -0.0073 0.0010  458  ARG A CA  
4033 C  C   . ARG A 461 ? 0.1334 0.1322 0.1376 -0.0055 -0.0115 0.0052  458  ARG A C   
4034 O  O   . ARG A 461 ? 0.1574 0.1360 0.1420 -0.0150 -0.0216 0.0029  458  ARG A O   
4035 C  CB  . ARG A 461 ? 0.1448 0.1217 0.1261 -0.0016 -0.0056 0.0037  458  ARG A CB  
4036 C  CG  . ARG A 461 ? 0.1283 0.1466 0.1345 0.0130  0.0175  -0.0057 458  ARG A CG  
4037 C  CD  . ARG A 461 ? 0.1203 0.1215 0.1457 0.0103  0.0235  0.0152  458  ARG A CD  
4038 N  NE  . ARG A 461 ? 0.1462 0.1343 0.1492 0.0056  0.0385  0.0091  458  ARG A NE  
4039 C  CZ  . ARG A 461 ? 0.1428 0.1628 0.1484 0.0167  0.0127  0.0279  458  ARG A CZ  
4040 N  NH1 . ARG A 461 ? 0.1682 0.1328 0.1736 0.0214  0.0288  -0.0003 458  ARG A NH1 
4041 N  NH2 . ARG A 461 ? 0.1705 0.1646 0.1714 0.0165  0.0122  0.0007  458  ARG A NH2 
4042 N  N   . PRO A 462 ? 0.1238 0.1266 0.1379 -0.0066 -0.0043 0.0057  459  PRO A N   
4043 C  CA  . PRO A 462 ? 0.1414 0.1288 0.1356 -0.0001 -0.0060 0.0023  459  PRO A CA  
4044 C  C   . PRO A 462 ? 0.1348 0.1218 0.1349 0.0088  0.0089  0.0117  459  PRO A C   
4045 O  O   . PRO A 462 ? 0.1365 0.1263 0.1529 -0.0007 0.0219  0.0000  459  PRO A O   
4046 C  CB  . PRO A 462 ? 0.1470 0.1291 0.1496 -0.0029 -0.0043 0.0015  459  PRO A CB  
4047 C  CG  . PRO A 462 ? 0.1336 0.1511 0.1565 0.0057  -0.0194 -0.0023 459  PRO A CG  
4048 C  CD  . PRO A 462 ? 0.1408 0.1249 0.1318 -0.0145 -0.0213 0.0027  459  PRO A CD  
4049 N  N   . SER A 463 ? 0.1303 0.1202 0.1125 0.0152  0.0069  -0.0024 460  SER A N   
4050 C  CA  . SER A 463 ? 0.1179 0.1224 0.1293 0.0026  0.0016  0.0024  460  SER A CA  
4051 C  C   . SER A 463 ? 0.1099 0.1353 0.1186 -0.0078 -0.0054 0.0010  460  SER A C   
4052 O  O   . SER A 463 ? 0.1120 0.1177 0.1350 -0.0131 0.0013  0.0029  460  SER A O   
4053 C  CB  . SER A 463 ? 0.1286 0.1290 0.1255 -0.0053 0.0177  0.0013  460  SER A CB  
4054 O  OG  . SER A 463 ? 0.1343 0.1678 0.1237 0.0131  -0.0097 -0.0109 460  SER A OG  
4055 N  N   . THR A 464 ? 0.1068 0.1177 0.1135 0.0001  0.0151  0.0054  461  THR A N   
4056 C  CA  . THR A 464 ? 0.1161 0.1216 0.1307 0.0062  -0.0059 0.0076  461  THR A CA  
4057 C  C   . THR A 464 ? 0.1023 0.1167 0.1172 0.0011  0.0040  0.0108  461  THR A C   
4058 O  O   . THR A 464 ? 0.1099 0.1301 0.1469 0.0012  0.0074  -0.0146 461  THR A O   
4059 C  CB  . THR A 464 ? 0.1285 0.1305 0.1376 -0.0048 0.0094  -0.0013 461  THR A CB  
4060 O  OG1 . THR A 464 ? 0.1273 0.1617 0.1648 -0.0405 -0.0161 0.0086  461  THR A OG1 
4061 C  CG2 . THR A 464 ? 0.1519 0.1473 0.1764 0.0346  -0.0048 0.0108  461  THR A CG2 
4062 N  N   . THR A 465 ? 0.1101 0.1202 0.1338 -0.0026 0.0045  0.0074  462  THR A N   
4063 C  CA  . THR A 465 ? 0.0840 0.1246 0.1386 0.0005  0.0089  -0.0063 462  THR A CA  
4064 C  C   . THR A 465 ? 0.1123 0.1071 0.1271 -0.0069 0.0063  0.0042  462  THR A C   
4065 O  O   . THR A 465 ? 0.1229 0.1446 0.1493 -0.0086 0.0242  0.0133  462  THR A O   
4066 C  CB  . THR A 465 ? 0.1219 0.1246 0.1318 0.0020  0.0084  -0.0030 462  THR A CB  
4067 O  OG1 . THR A 465 ? 0.1159 0.1305 0.1505 -0.0067 0.0054  -0.0039 462  THR A OG1 
4068 C  CG2 . THR A 465 ? 0.1381 0.1115 0.1813 -0.0057 -0.0041 0.0017  462  THR A CG2 
4069 N  N   . ILE A 466 ? 0.1127 0.1246 0.1323 0.0004  0.0094  0.0070  463  ILE A N   
4070 C  CA  . ILE A 466 ? 0.1170 0.1328 0.1366 0.0069  0.0000  -0.0041 463  ILE A CA  
4071 C  C   . ILE A 466 ? 0.1138 0.1239 0.1483 0.0001  0.0106  0.0030  463  ILE A C   
4072 O  O   . ILE A 466 ? 0.1175 0.1350 0.1991 -0.0117 0.0238  -0.0254 463  ILE A O   
4073 C  CB  . ILE A 466 ? 0.1420 0.1365 0.1422 -0.0006 0.0034  -0.0077 463  ILE A CB  
4074 C  CG1 . ILE A 466 ? 0.1773 0.1750 0.1644 -0.0223 0.0033  -0.0103 463  ILE A CG1 
4075 C  CG2 . ILE A 466 ? 0.2019 0.1732 0.1593 0.0422  -0.0150 0.0048  463  ILE A CG2 
4076 C  CD1 . ILE A 466 ? 0.2216 0.2578 0.1359 -0.0381 -0.0059 -0.0003 463  ILE A CD1 
4077 N  N   . LEU A 467 ? 0.1059 0.1247 0.1414 0.0074  -0.0034 -0.0156 464  LEU A N   
4078 C  CA  . LEU A 467 ? 0.1268 0.1141 0.1429 0.0021  -0.0013 -0.0032 464  LEU A CA  
4079 C  C   . LEU A 467 ? 0.1227 0.1239 0.1447 0.0143  -0.0011 -0.0025 464  LEU A C   
4080 O  O   . LEU A 467 ? 0.1207 0.1305 0.1820 0.0087  0.0065  0.0109  464  LEU A O   
4081 C  CB  . LEU A 467 ? 0.1379 0.1122 0.1384 0.0086  0.0052  -0.0076 464  LEU A CB  
4082 C  CG  . LEU A 467 ? 0.1355 0.1475 0.1347 -0.0061 0.0214  -0.0089 464  LEU A CG  
4083 C  CD1 . LEU A 467 ? 0.1503 0.1773 0.1511 -0.0269 0.0238  -0.0213 464  LEU A CD1 
4084 C  CD2 . LEU A 467 ? 0.1468 0.2044 0.1286 -0.0150 0.0487  -0.0220 464  LEU A CD2 
4085 N  N   . LEU A 468 ? 0.1143 0.1190 0.1430 0.0070  -0.0052 0.0001  465  LEU A N   
4086 C  CA  . LEU A 468 ? 0.1419 0.1264 0.1423 0.0146  -0.0015 0.0057  465  LEU A CA  
4087 C  C   . LEU A 468 ? 0.1321 0.1317 0.1520 0.0050  -0.0062 0.0086  465  LEU A C   
4088 O  O   . LEU A 468 ? 0.1436 0.1392 0.1559 0.0174  -0.0242 0.0111  465  LEU A O   
4089 C  CB  . LEU A 468 ? 0.1335 0.1152 0.1407 0.0214  -0.0085 -0.0035 465  LEU A CB  
4090 C  CG  . LEU A 468 ? 0.1725 0.1233 0.1367 -0.0021 -0.0019 0.0065  465  LEU A CG  
4091 C  CD1 . LEU A 468 ? 0.2083 0.0940 0.1889 -0.0410 0.0070  0.0046  465  LEU A CD1 
4092 C  CD2 . LEU A 468 ? 0.1676 0.1573 0.1353 0.0060  0.0139  0.0112  465  LEU A CD2 
4093 N  N   . ASP A 469 ? 0.1416 0.1351 0.1418 -0.0001 0.0065  -0.0056 466  ASP A N   
4094 C  CA  . ASP A 469 ? 0.1223 0.1197 0.1375 0.0035  0.0018  0.0021  466  ASP A CA  
4095 C  C   . ASP A 469 ? 0.1188 0.1164 0.1188 -0.0034 -0.0025 -0.0104 466  ASP A C   
4096 O  O   . ASP A 469 ? 0.1313 0.1482 0.1298 -0.0205 -0.0151 0.0161  466  ASP A O   
4097 C  CB  . ASP A 469 ? 0.1455 0.1429 0.1711 0.0054  0.0076  -0.0183 466  ASP A CB  
4098 C  CG  . ASP A 469 ? 0.1920 0.1662 0.2328 0.0261  0.0055  -0.0120 466  ASP A CG  
4099 O  OD1 . ASP A 469 ? 0.1753 0.2145 0.2466 -0.0084 0.0057  -0.0076 466  ASP A OD1 
4100 O  OD2 . ASP A 469 ? 0.2674 0.2106 0.3566 0.0287  0.0202  -0.0500 466  ASP A OD2 
4101 N  N   . GLU A 470 ? 0.1364 0.1254 0.1254 0.0024  -0.0039 -0.0110 467  GLU A N   
4102 C  CA  . GLU A 470 ? 0.1442 0.1397 0.1211 -0.0030 -0.0063 -0.0101 467  GLU A CA  
4103 C  C   . GLU A 470 ? 0.1391 0.1341 0.1165 -0.0066 -0.0104 -0.0033 467  GLU A C   
4104 O  O   . GLU A 470 ? 0.1383 0.1470 0.1440 -0.0331 -0.0019 -0.0165 467  GLU A O   
4105 C  CB  . GLU A 470 ? 0.1674 0.1466 0.1446 0.0008  0.0098  -0.0163 467  GLU A CB  
4106 C  CG  . GLU A 470 ? 0.2113 0.1643 0.1896 -0.0059 -0.0058 -0.0120 467  GLU A CG  
4107 C  CD  . GLU A 470 ? 0.3629 0.1692 0.2204 0.0146  -0.0447 -0.0212 467  GLU A CD  
4108 O  OE1 . GLU A 470 ? 0.4049 0.2194 0.3207 -0.0169 -0.1169 -0.0327 467  GLU A OE1 
4109 O  OE2 . GLU A 470 ? 0.4007 0.2127 0.2742 0.0023  -0.0598 -0.0300 467  GLU A OE2 
4110 N  N   . LEU A 471 ? 0.1397 0.1373 0.1085 -0.0042 -0.0137 0.0002  468  LEU A N   
4111 C  CA  . LEU A 471 ? 0.1378 0.1229 0.1120 -0.0049 -0.0115 -0.0079 468  LEU A CA  
4112 C  C   . LEU A 471 ? 0.1247 0.1224 0.1288 -0.0067 -0.0106 0.0032  468  LEU A C   
4113 O  O   . LEU A 471 ? 0.1418 0.1143 0.1891 -0.0083 0.0013  0.0196  468  LEU A O   
4114 C  CB  . LEU A 471 ? 0.1392 0.1158 0.1332 0.0074  -0.0032 -0.0129 468  LEU A CB  
4115 C  CG  . LEU A 471 ? 0.1337 0.1148 0.1303 0.0045  -0.0081 -0.0053 468  LEU A CG  
4116 C  CD1 . LEU A 471 ? 0.1496 0.1552 0.1529 -0.0207 -0.0226 -0.0239 468  LEU A CD1 
4117 C  CD2 . LEU A 471 ? 0.1332 0.1265 0.1824 0.0266  0.0058  -0.0433 468  LEU A CD2 
4118 N  N   . SER A 472 ? 0.1254 0.1256 0.1132 -0.0148 -0.0120 0.0107  469  SER A N   
4119 C  CA  . SER A 472 ? 0.1161 0.1147 0.1220 -0.0152 -0.0061 0.0077  469  SER A CA  
4120 C  C   . SER A 472 ? 0.1417 0.1074 0.1178 -0.0040 -0.0022 -0.0045 469  SER A C   
4121 O  O   . SER A 472 ? 0.1316 0.1013 0.1306 -0.0014 -0.0143 -0.0002 469  SER A O   
4122 C  CB  . SER A 472 ? 0.1507 0.1223 0.1139 -0.0075 0.0034  -0.0018 469  SER A CB  
4123 O  OG  . SER A 472 ? 0.1503 0.1412 0.1433 0.0048  -0.0219 -0.0044 469  SER A OG  
4124 N  N   . PRO A 473 ? 0.1366 0.1169 0.1013 -0.0081 -0.0053 -0.0040 470  PRO A N   
4125 C  CA  . PRO A 473 ? 0.1288 0.1215 0.1025 -0.0062 -0.0059 0.0069  470  PRO A CA  
4126 C  C   . PRO A 473 ? 0.1223 0.1165 0.1172 0.0113  -0.0144 0.0150  470  PRO A C   
4127 O  O   . PRO A 473 ? 0.1160 0.1324 0.1190 0.0185  -0.0175 -0.0067 470  PRO A O   
4128 C  CB  . PRO A 473 ? 0.1284 0.1461 0.1168 -0.0032 -0.0028 0.0079  470  PRO A CB  
4129 C  CG  . PRO A 473 ? 0.1231 0.1096 0.1245 -0.0073 0.0040  0.0140  470  PRO A CG  
4130 C  CD  . PRO A 473 ? 0.1285 0.1029 0.1207 -0.0101 -0.0135 0.0137  470  PRO A CD  
4131 N  N   . TYR A 474 ? 0.1260 0.1201 0.1247 -0.0033 -0.0154 -0.0032 471  TYR A N   
4132 C  CA  . TYR A 474 ? 0.1167 0.1221 0.1040 0.0039  -0.0001 -0.0021 471  TYR A CA  
4133 C  C   . TYR A 474 ? 0.1152 0.1201 0.1104 0.0048  -0.0081 -0.0033 471  TYR A C   
4134 O  O   . TYR A 474 ? 0.1209 0.1264 0.1350 0.0071  -0.0032 0.0065  471  TYR A O   
4135 C  CB  . TYR A 474 ? 0.1203 0.1230 0.1244 0.0028  0.0086  0.0018  471  TYR A CB  
4136 C  CG  . TYR A 474 ? 0.1105 0.1389 0.1222 0.0185  -0.0011 0.0031  471  TYR A CG  
4137 C  CD1 . TYR A 474 ? 0.1308 0.0994 0.1371 0.0197  -0.0093 0.0154  471  TYR A CD1 
4138 C  CD2 . TYR A 474 ? 0.1159 0.1420 0.1555 0.0271  -0.0143 0.0220  471  TYR A CD2 
4139 C  CE1 . TYR A 474 ? 0.1176 0.1270 0.1198 0.0080  0.0055  0.0113  471  TYR A CE1 
4140 C  CE2 . TYR A 474 ? 0.1487 0.1624 0.1326 -0.0009 0.0065  0.0282  471  TYR A CE2 
4141 C  CZ  . TYR A 474 ? 0.1366 0.1385 0.1309 -0.0032 0.0003  0.0075  471  TYR A CZ  
4142 O  OH  . TYR A 474 ? 0.1514 0.1855 0.1823 0.0032  0.0016  -0.0179 471  TYR A OH  
4143 N  N   . SER A 475 ? 0.1285 0.1083 0.0996 -0.0089 -0.0134 -0.0012 472  SER A N   
4144 C  CA  . SER A 475 ? 0.1210 0.1088 0.1105 -0.0122 -0.0037 0.0038  472  SER A CA  
4145 C  C   . SER A 475 ? 0.1186 0.1209 0.1033 0.0091  -0.0166 0.0240  472  SER A C   
4146 O  O   . SER A 475 ? 0.1357 0.1317 0.1240 -0.0023 0.0015  -0.0013 472  SER A O   
4147 C  CB  . SER A 475 ? 0.1237 0.1150 0.1144 -0.0079 -0.0006 0.0038  472  SER A CB  
4148 O  OG  . SER A 475 ? 0.1462 0.1530 0.1299 -0.0146 -0.0130 0.0104  472  SER A OG  
4149 N  N   . LEU A 476 ? 0.1121 0.1238 0.1134 -0.0048 -0.0101 0.0032  473  LEU A N   
4150 C  CA  . LEU A 476 ? 0.1164 0.1314 0.1133 -0.0013 0.0053  0.0077  473  LEU A CA  
4151 C  C   . LEU A 476 ? 0.1182 0.1168 0.1133 0.0012  0.0015  0.0039  473  LEU A C   
4152 O  O   . LEU A 476 ? 0.1229 0.1117 0.1295 -0.0004 0.0015  -0.0004 473  LEU A O   
4153 C  CB  . LEU A 476 ? 0.1141 0.1364 0.1206 -0.0050 -0.0053 0.0002  473  LEU A CB  
4154 C  CG  . LEU A 476 ? 0.1310 0.1340 0.1117 0.0007  -0.0151 -0.0040 473  LEU A CG  
4155 C  CD1 . LEU A 476 ? 0.1561 0.1107 0.1389 0.0088  -0.0041 0.0289  473  LEU A CD1 
4156 C  CD2 . LEU A 476 ? 0.1270 0.1496 0.1538 -0.0180 0.0084  0.0149  473  LEU A CD2 
4157 N  N   . GLY A 477 ? 0.1247 0.1168 0.1221 -0.0033 -0.0091 -0.0066 474  GLY A N   
4158 C  CA  . GLY A 477 ? 0.1210 0.1207 0.1123 -0.0124 -0.0069 -0.0051 474  GLY A CA  
4159 C  C   . GLY A 477 ? 0.1249 0.1177 0.1102 -0.0126 -0.0010 -0.0059 474  GLY A C   
4160 O  O   . GLY A 477 ? 0.1262 0.1240 0.1125 0.0049  -0.0077 -0.0175 474  GLY A O   
4161 N  N   . ALA A 478 ? 0.1335 0.1164 0.1148 -0.0046 -0.0025 -0.0083 475  ALA A N   
4162 C  CA  . ALA A 478 ? 0.1127 0.1197 0.0893 -0.0081 0.0003  -0.0064 475  ALA A CA  
4163 C  C   . ALA A 478 ? 0.1226 0.1291 0.1168 -0.0057 0.0047  0.0005  475  ALA A C   
4164 O  O   . ALA A 478 ? 0.1222 0.1403 0.1124 -0.0102 -0.0111 -0.0185 475  ALA A O   
4165 C  CB  . ALA A 478 ? 0.1352 0.1586 0.0932 0.0169  0.0151  -0.0327 475  ALA A CB  
4166 N  N   . LEU A 479 ? 0.1185 0.1050 0.1113 -0.0028 0.0045  -0.0014 476  LEU A N   
4167 C  CA  . LEU A 479 ? 0.1183 0.1226 0.1135 0.0079  0.0019  0.0000  476  LEU A CA  
4168 C  C   . LEU A 479 ? 0.1199 0.1166 0.1183 0.0020  0.0077  -0.0002 476  LEU A C   
4169 O  O   . LEU A 479 ? 0.1375 0.1337 0.1174 -0.0084 0.0050  0.0054  476  LEU A O   
4170 C  CB  . LEU A 479 ? 0.1216 0.1207 0.0989 0.0120  -0.0041 0.0007  476  LEU A CB  
4171 C  CG  . LEU A 479 ? 0.1483 0.1418 0.1299 0.0248  -0.0258 0.0190  476  LEU A CG  
4172 C  CD1 . LEU A 479 ? 0.2208 0.1479 0.1489 -0.0134 -0.0398 0.0345  476  LEU A CD1 
4173 C  CD2 . LEU A 479 ? 0.1285 0.1787 0.2093 0.0084  -0.0416 0.0143  476  LEU A CD2 
4174 N  N   . ILE A 480 ? 0.1126 0.0959 0.0996 -0.0132 0.0078  -0.0027 477  ILE A N   
4175 C  CA  . ILE A 480 ? 0.1097 0.1220 0.1074 -0.0070 -0.0045 -0.0053 477  ILE A CA  
4176 C  C   . ILE A 480 ? 0.1066 0.1185 0.1101 -0.0054 0.0071  -0.0051 477  ILE A C   
4177 O  O   . ILE A 480 ? 0.1252 0.1020 0.1184 0.0020  -0.0081 -0.0045 477  ILE A O   
4178 C  CB  . ILE A 480 ? 0.1203 0.1228 0.1238 0.0106  0.0073  -0.0047 477  ILE A CB  
4179 C  CG1 . ILE A 480 ? 0.1363 0.1313 0.1432 -0.0048 0.0087  -0.0054 477  ILE A CG1 
4180 C  CG2 . ILE A 480 ? 0.1410 0.1368 0.1257 0.0046  0.0084  -0.0184 477  ILE A CG2 
4181 C  CD1 . ILE A 480 ? 0.1376 0.1388 0.1576 -0.0378 0.0144  0.0017  477  ILE A CD1 
4182 N  N   . ALA A 481 ? 0.1148 0.1295 0.1087 0.0075  -0.0002 -0.0200 478  ALA A N   
4183 C  CA  . ALA A 481 ? 0.1166 0.1338 0.1029 0.0070  0.0000  -0.0170 478  ALA A CA  
4184 C  C   . ALA A 481 ? 0.1268 0.1280 0.1293 0.0047  0.0066  -0.0055 478  ALA A C   
4185 O  O   . ALA A 481 ? 0.1360 0.1391 0.1299 -0.0184 0.0044  0.0104  478  ALA A O   
4186 C  CB  . ALA A 481 ? 0.1238 0.1296 0.1300 0.0094  -0.0112 -0.0151 478  ALA A CB  
4187 N  N   . LEU A 482 ? 0.1068 0.1281 0.1330 -0.0135 -0.0057 -0.0026 479  LEU A N   
4188 C  CA  . LEU A 482 ? 0.1238 0.1239 0.1284 -0.0043 -0.0014 0.0014  479  LEU A CA  
4189 C  C   . LEU A 482 ? 0.1102 0.1194 0.1127 0.0079  -0.0107 0.0107  479  LEU A C   
4190 O  O   . LEU A 482 ? 0.1115 0.1497 0.1377 -0.0128 -0.0093 -0.0163 479  LEU A O   
4191 C  CB  . LEU A 482 ? 0.1379 0.1216 0.1129 0.0054  -0.0066 0.0173  479  LEU A CB  
4192 C  CG  . LEU A 482 ? 0.1417 0.1316 0.1266 -0.0024 0.0007  0.0044  479  LEU A CG  
4193 C  CD1 . LEU A 482 ? 0.2024 0.2250 0.1154 -0.0370 -0.0089 -0.0126 479  LEU A CD1 
4194 C  CD2 . LEU A 482 ? 0.1243 0.1747 0.1385 -0.0010 0.0337  -0.0103 479  LEU A CD2 
4195 N  N   . TYR A 483 ? 0.1039 0.1145 0.1140 0.0048  0.0070  -0.0093 480  TYR A N   
4196 C  CA  . TYR A 483 ? 0.1191 0.1083 0.1202 0.0038  0.0038  0.0020  480  TYR A CA  
4197 C  C   . TYR A 483 ? 0.1075 0.1167 0.1242 0.0056  -0.0007 0.0017  480  TYR A C   
4198 O  O   . TYR A 483 ? 0.1321 0.1226 0.1320 0.0065  -0.0002 0.0073  480  TYR A O   
4199 C  CB  . TYR A 483 ? 0.1176 0.1400 0.1449 0.0047  0.0105  0.0032  480  TYR A CB  
4200 C  CG  . TYR A 483 ? 0.1163 0.1119 0.1300 0.0089  -0.0056 -0.0068 480  TYR A CG  
4201 C  CD1 . TYR A 483 ? 0.1515 0.1083 0.1466 -0.0168 -0.0181 -0.0125 480  TYR A CD1 
4202 C  CD2 . TYR A 483 ? 0.1610 0.1423 0.1515 0.0144  -0.0324 -0.0100 480  TYR A CD2 
4203 C  CE1 . TYR A 483 ? 0.1550 0.1280 0.1324 -0.0026 -0.0325 -0.0135 480  TYR A CE1 
4204 C  CE2 . TYR A 483 ? 0.1550 0.1456 0.1451 0.0189  0.0093  0.0102  480  TYR A CE2 
4205 C  CZ  . TYR A 483 ? 0.1239 0.1310 0.1271 -0.0164 -0.0259 -0.0030 480  TYR A CZ  
4206 O  OH  . TYR A 483 ? 0.1387 0.1610 0.1758 0.0019  -0.0244 0.0157  480  TYR A OH  
4207 N  N   . GLU A 484 ? 0.1204 0.0955 0.1173 -0.0037 -0.0018 -0.0140 481  GLU A N   
4208 C  CA  . GLU A 484 ? 0.1218 0.1113 0.1236 0.0017  -0.0092 -0.0078 481  GLU A CA  
4209 C  C   . GLU A 484 ? 0.1064 0.1129 0.1222 0.0070  -0.0001 -0.0150 481  GLU A C   
4210 O  O   . GLU A 484 ? 0.1371 0.1227 0.1440 0.0036  -0.0004 -0.0236 481  GLU A O   
4211 C  CB  . GLU A 484 ? 0.1410 0.1230 0.0952 0.0018  -0.0114 -0.0059 481  GLU A CB  
4212 C  CG  . GLU A 484 ? 0.1378 0.1127 0.1297 -0.0022 -0.0105 -0.0010 481  GLU A CG  
4213 C  CD  . GLU A 484 ? 0.1471 0.1424 0.1230 0.0014  0.0018  -0.0019 481  GLU A CD  
4214 O  OE1 . GLU A 484 ? 0.1344 0.1527 0.1734 -0.0069 0.0104  0.0028  481  GLU A OE1 
4215 O  OE2 . GLU A 484 ? 0.1420 0.1411 0.1258 -0.0111 -0.0016 -0.0078 481  GLU A OE2 
4216 N  N   . HIS A 485 ? 0.1149 0.1130 0.1116 0.0045  0.0039  0.0014  482  HIS A N   
4217 C  CA  . HIS A 485 ? 0.1143 0.1152 0.1158 -0.0052 0.0031  -0.0045 482  HIS A CA  
4218 C  C   . HIS A 485 ? 0.1043 0.1168 0.1085 -0.0057 -0.0073 0.0046  482  HIS A C   
4219 O  O   . HIS A 485 ? 0.1061 0.1204 0.1239 -0.0146 -0.0009 -0.0007 482  HIS A O   
4220 C  CB  . HIS A 485 ? 0.1178 0.1267 0.1362 -0.0012 -0.0096 0.0038  482  HIS A CB  
4221 C  CG  . HIS A 485 ? 0.1035 0.1261 0.1045 0.0085  0.0001  0.0045  482  HIS A CG  
4222 N  ND1 . HIS A 485 ? 0.1564 0.1527 0.1451 0.0108  -0.0035 0.0237  482  HIS A ND1 
4223 C  CD2 . HIS A 485 ? 0.1604 0.1379 0.1195 0.0194  -0.0084 -0.0015 482  HIS A CD2 
4224 C  CE1 . HIS A 485 ? 0.1985 0.1226 0.1587 0.0269  0.0029  0.0342  482  HIS A CE1 
4225 N  NE2 . HIS A 485 ? 0.1228 0.1486 0.1278 0.0048  -0.0045 0.0301  482  HIS A NE2 
4226 N  N   . LYS A 486 ? 0.1223 0.1151 0.1245 0.0004  -0.0218 -0.0033 483  LYS A N   
4227 C  CA  . LYS A 486 ? 0.1229 0.1184 0.1204 0.0079  -0.0113 0.0028  483  LYS A CA  
4228 C  C   . LYS A 486 ? 0.1139 0.1212 0.1185 0.0048  -0.0144 0.0110  483  LYS A C   
4229 O  O   . LYS A 486 ? 0.1198 0.1043 0.1210 0.0047  -0.0035 -0.0061 483  LYS A O   
4230 C  CB  . LYS A 486 ? 0.1100 0.1312 0.1136 0.0038  -0.0035 0.0098  483  LYS A CB  
4231 C  CG  . LYS A 486 ? 0.1295 0.1274 0.1239 0.0079  -0.0020 0.0070  483  LYS A CG  
4232 C  CD  . LYS A 486 ? 0.1340 0.1166 0.1265 -0.0013 -0.0142 -0.0018 483  LYS A CD  
4233 C  CE  . LYS A 486 ? 0.1430 0.1397 0.1437 -0.0110 -0.0244 -0.0070 483  LYS A CE  
4234 N  NZ  . LYS A 486 ? 0.1295 0.1743 0.1842 -0.0049 -0.0286 0.0017  483  LYS A NZ  
4235 N  N   . ILE A 487 ? 0.1120 0.1112 0.0923 0.0076  -0.0005 -0.0015 484  ILE A N   
4236 C  CA  . ILE A 487 ? 0.1136 0.1081 0.1060 0.0023  -0.0077 -0.0127 484  ILE A CA  
4237 C  C   . ILE A 487 ? 0.1173 0.1275 0.1098 0.0000  0.0030  0.0036  484  ILE A C   
4238 O  O   . ILE A 487 ? 0.1198 0.1185 0.1352 -0.0013 -0.0086 -0.0022 484  ILE A O   
4239 C  CB  . ILE A 487 ? 0.1162 0.1169 0.0964 -0.0003 -0.0124 -0.0174 484  ILE A CB  
4240 C  CG1 . ILE A 487 ? 0.1259 0.1286 0.1411 0.0127  0.0145  -0.0209 484  ILE A CG1 
4241 C  CG2 . ILE A 487 ? 0.1493 0.1407 0.1020 -0.0255 0.0243  0.0051  484  ILE A CG2 
4242 C  CD1 . ILE A 487 ? 0.1341 0.1635 0.1903 -0.0072 0.0073  -0.0243 484  ILE A CD1 
4243 N  N   . PHE A 488 ? 0.1283 0.1206 0.1078 -0.0061 0.0087  0.0074  485  PHE A N   
4244 C  CA  . PHE A 488 ? 0.1168 0.1182 0.1083 -0.0058 0.0003  0.0005  485  PHE A CA  
4245 C  C   . PHE A 488 ? 0.1095 0.1189 0.1154 -0.0021 -0.0034 -0.0043 485  PHE A C   
4246 O  O   . PHE A 488 ? 0.1271 0.1162 0.1323 -0.0110 -0.0121 -0.0076 485  PHE A O   
4247 C  CB  . PHE A 488 ? 0.1239 0.1240 0.0995 0.0042  -0.0002 -0.0072 485  PHE A CB  
4248 C  CG  . PHE A 488 ? 0.1299 0.1507 0.1313 0.0086  -0.0134 -0.0048 485  PHE A CG  
4249 C  CD1 . PHE A 488 ? 0.1228 0.2014 0.1593 0.0120  -0.0160 -0.0033 485  PHE A CD1 
4250 C  CD2 . PHE A 488 ? 0.1574 0.3055 0.1521 0.0543  -0.0178 -0.0771 485  PHE A CD2 
4251 C  CE1 . PHE A 488 ? 0.1504 0.2015 0.1386 0.0068  -0.0343 0.0152  485  PHE A CE1 
4252 C  CE2 . PHE A 488 ? 0.1548 0.3420 0.1887 0.0601  -0.0217 -0.0678 485  PHE A CE2 
4253 C  CZ  . PHE A 488 ? 0.1396 0.2313 0.1666 0.0286  -0.0610 -0.0173 485  PHE A CZ  
4254 N  N   . VAL A 489 ? 0.1027 0.1246 0.1172 -0.0045 0.0039  -0.0049 486  VAL A N   
4255 C  CA  . VAL A 489 ? 0.0998 0.1159 0.1174 0.0045  -0.0066 -0.0003 486  VAL A CA  
4256 C  C   . VAL A 489 ? 0.1064 0.1286 0.1326 0.0018  -0.0078 0.0017  486  VAL A C   
4257 O  O   . VAL A 489 ? 0.1007 0.1253 0.1198 -0.0095 -0.0022 -0.0108 486  VAL A O   
4258 C  CB  . VAL A 489 ? 0.1033 0.1315 0.1341 0.0115  -0.0048 -0.0043 486  VAL A CB  
4259 C  CG1 . VAL A 489 ? 0.1266 0.1347 0.1435 -0.0013 0.0117  0.0118  486  VAL A CG1 
4260 C  CG2 . VAL A 489 ? 0.1277 0.0828 0.1524 0.0205  -0.0035 -0.0052 486  VAL A CG2 
4261 N  N   . GLN A 490 ? 0.1055 0.1184 0.1258 -0.0031 -0.0079 0.0114  487  GLN A N   
4262 C  CA  . GLN A 490 ? 0.1063 0.1239 0.1178 0.0112  -0.0032 -0.0074 487  GLN A CA  
4263 C  C   . GLN A 490 ? 0.1186 0.1225 0.1215 0.0127  -0.0101 0.0008  487  GLN A C   
4264 O  O   . GLN A 490 ? 0.1277 0.1251 0.1371 0.0123  -0.0160 -0.0090 487  GLN A O   
4265 C  CB  . GLN A 490 ? 0.1222 0.1254 0.1123 0.0119  -0.0034 -0.0019 487  GLN A CB  
4266 C  CG  . GLN A 490 ? 0.1168 0.1525 0.1221 0.0169  0.0044  -0.0033 487  GLN A CG  
4267 C  CD  . GLN A 490 ? 0.1483 0.1518 0.1513 0.0043  0.0012  -0.0118 487  GLN A CD  
4268 O  OE1 . GLN A 490 ? 0.1761 0.1704 0.2012 0.0276  -0.0241 0.0039  487  GLN A OE1 
4269 N  NE2 . GLN A 490 ? 0.1023 0.1109 0.1242 0.0060  -0.0087 -0.0036 487  GLN A NE2 
4270 N  N   . GLY A 491 ? 0.1290 0.1088 0.1013 -0.0146 0.0010  -0.0073 488  GLY A N   
4271 C  CA  . GLY A 491 ? 0.1259 0.1247 0.1008 0.0003  -0.0004 -0.0032 488  GLY A CA  
4272 C  C   . GLY A 491 ? 0.1301 0.1031 0.0973 0.0070  -0.0066 0.0108  488  GLY A C   
4273 O  O   . GLY A 491 ? 0.1440 0.1262 0.1327 -0.0080 -0.0147 -0.0091 488  GLY A O   
4274 N  N   . VAL A 492 ? 0.1208 0.1215 0.1605 0.0041  0.0001  -0.0014 489  VAL A N   
4275 C  CA  . VAL A 492 ? 0.1207 0.1302 0.1508 0.0093  -0.0152 0.0040  489  VAL A CA  
4276 C  C   . VAL A 492 ? 0.1219 0.1395 0.1387 -0.0031 -0.0073 0.0064  489  VAL A C   
4277 O  O   . VAL A 492 ? 0.1240 0.1314 0.1481 -0.0019 -0.0054 -0.0027 489  VAL A O   
4278 C  CB  . VAL A 492 ? 0.1297 0.1366 0.1567 0.0142  -0.0113 0.0049  489  VAL A CB  
4279 C  CG1 . VAL A 492 ? 0.1215 0.1635 0.2074 -0.0050 0.0243  -0.0063 489  VAL A CG1 
4280 C  CG2 . VAL A 492 ? 0.1288 0.1180 0.2002 0.0069  0.0227  0.0379  489  VAL A CG2 
4281 N  N   . LEU A 493 ? 0.1097 0.1242 0.1380 -0.0114 -0.0091 0.0023  490  LEU A N   
4282 C  CA  . LEU A 493 ? 0.1187 0.1223 0.1582 -0.0080 -0.0001 0.0030  490  LEU A CA  
4283 C  C   . LEU A 493 ? 0.1139 0.1314 0.1261 -0.0114 -0.0027 0.0020  490  LEU A C   
4284 O  O   . LEU A 493 ? 0.1296 0.1286 0.1265 -0.0131 0.0108  -0.0007 490  LEU A O   
4285 C  CB  . LEU A 493 ? 0.1598 0.1479 0.1599 -0.0082 0.0180  0.0084  490  LEU A CB  
4286 C  CG  . LEU A 493 ? 0.1806 0.1644 0.1389 -0.0084 0.0122  -0.0217 490  LEU A CG  
4287 C  CD1 . LEU A 493 ? 0.2352 0.1985 0.1111 -0.0093 0.0133  0.0170  490  LEU A CD1 
4288 C  CD2 . LEU A 493 ? 0.1713 0.2655 0.1850 -0.0121 0.0361  -0.0260 490  LEU A CD2 
4289 N  N   . TRP A 494 ? 0.1281 0.1150 0.1189 0.0044  0.0053  0.0131  491  TRP A N   
4290 C  CA  . TRP A 494 ? 0.1269 0.1122 0.1230 0.0125  0.0045  0.0081  491  TRP A CA  
4291 C  C   . TRP A 494 ? 0.1231 0.1207 0.1234 0.0015  0.0083  0.0038  491  TRP A C   
4292 O  O   . TRP A 494 ? 0.1425 0.1213 0.1259 0.0103  -0.0018 0.0019  491  TRP A O   
4293 C  CB  . TRP A 494 ? 0.1408 0.1089 0.1389 0.0081  0.0075  -0.0078 491  TRP A CB  
4294 C  CG  . TRP A 494 ? 0.1206 0.1235 0.1597 0.0156  -0.0070 -0.0014 491  TRP A CG  
4295 C  CD1 . TRP A 494 ? 0.1514 0.1406 0.1484 -0.0139 -0.0077 0.0093  491  TRP A CD1 
4296 C  CD2 . TRP A 494 ? 0.1270 0.1111 0.1317 -0.0086 -0.0191 -0.0006 491  TRP A CD2 
4297 N  NE1 . TRP A 494 ? 0.1336 0.1223 0.1339 -0.0093 -0.0087 0.0161  491  TRP A NE1 
4298 C  CE2 . TRP A 494 ? 0.1397 0.1369 0.1277 -0.0187 -0.0065 -0.0048 491  TRP A CE2 
4299 C  CE3 . TRP A 494 ? 0.1101 0.0979 0.1297 -0.0006 -0.0016 0.0075  491  TRP A CE3 
4300 C  CZ2 . TRP A 494 ? 0.1218 0.1615 0.1225 -0.0063 0.0067  0.0177  491  TRP A CZ2 
4301 C  CZ3 . TRP A 494 ? 0.1210 0.1374 0.1010 -0.0239 0.0025  0.0070  491  TRP A CZ3 
4302 C  CH2 . TRP A 494 ? 0.1080 0.1566 0.1362 -0.0078 -0.0188 -0.0037 491  TRP A CH2 
4303 N  N   . ASP A 495 ? 0.1023 0.1269 0.1350 -0.0019 0.0000  0.0048  492  ASP A N   
4304 C  CA  . ASP A 495 ? 0.1232 0.1358 0.1232 0.0032  -0.0043 0.0120  492  ASP A CA  
4305 C  C   . ASP A 495 ? 0.1230 0.1258 0.1164 0.0038  -0.0140 0.0044  492  ASP A C   
4306 O  O   . ASP A 495 ? 0.1546 0.1504 0.1241 -0.0023 -0.0056 -0.0041 492  ASP A O   
4307 C  CB  . ASP A 495 ? 0.1304 0.1707 0.1492 -0.0046 -0.0041 0.0127  492  ASP A CB  
4308 C  CG  . ASP A 495 ? 0.1367 0.1903 0.1818 -0.0117 -0.0101 0.0090  492  ASP A CG  
4309 O  OD1 . ASP A 495 ? 0.2077 0.2551 0.1994 0.0236  -0.0319 0.0741  492  ASP A OD1 
4310 O  OD2 . ASP A 495 ? 0.1733 0.3056 0.2354 -0.0691 0.0023  -0.0318 492  ASP A OD2 
4311 N  N   . ILE A 496 ? 0.1261 0.1350 0.1160 -0.0113 -0.0068 0.0138  493  ILE A N   
4312 C  CA  . ILE A 496 ? 0.1113 0.1227 0.1273 -0.0001 -0.0062 0.0047  493  ILE A CA  
4313 C  C   . ILE A 496 ? 0.1199 0.1187 0.1214 0.0057  0.0072  -0.0011 493  ILE A C   
4314 O  O   . ILE A 496 ? 0.1395 0.1415 0.1292 0.0060  0.0242  0.0077  493  ILE A O   
4315 C  CB  . ILE A 496 ? 0.1105 0.1299 0.1295 0.0076  -0.0018 -0.0018 493  ILE A CB  
4316 C  CG1 . ILE A 496 ? 0.1266 0.1218 0.1301 -0.0129 0.0109  0.0000  493  ILE A CG1 
4317 C  CG2 . ILE A 496 ? 0.1481 0.1227 0.1745 0.0258  0.0146  0.0405  493  ILE A CG2 
4318 C  CD1 . ILE A 496 ? 0.1034 0.2033 0.1370 -0.0071 0.0006  -0.0146 493  ILE A CD1 
4319 N  N   . ASN A 497 ? 0.1261 0.1108 0.1420 -0.0010 0.0059  -0.0052 494  ASN A N   
4320 C  CA  . ASN A 497 ? 0.1142 0.1209 0.1247 0.0084  -0.0155 0.0043  494  ASN A CA  
4321 C  C   . ASN A 497 ? 0.1166 0.1249 0.1263 0.0057  -0.0079 0.0026  494  ASN A C   
4322 O  O   . ASN A 497 ? 0.1255 0.1417 0.1550 0.0012  -0.0053 0.0068  494  ASN A O   
4323 C  CB  . ASN A 497 ? 0.1160 0.1129 0.1213 0.0086  -0.0062 -0.0001 494  ASN A CB  
4324 C  CG  . ASN A 497 ? 0.1424 0.1163 0.1046 -0.0016 0.0009  0.0006  494  ASN A CG  
4325 O  OD1 . ASN A 497 ? 0.1909 0.1409 0.1469 0.0250  0.0066  -0.0003 494  ASN A OD1 
4326 N  ND2 . ASN A 497 ? 0.1234 0.1472 0.1129 0.0130  0.0280  0.0270  494  ASN A ND2 
4327 N  N   . SER A 498 ? 0.1138 0.1208 0.1267 0.0044  -0.0133 -0.0081 495  SER A N   
4328 C  CA  . SER A 498 ? 0.1249 0.1372 0.1393 0.0014  -0.0080 0.0079  495  SER A CA  
4329 C  C   . SER A 498 ? 0.1113 0.1340 0.1466 -0.0040 -0.0164 0.0106  495  SER A C   
4330 O  O   . SER A 498 ? 0.1320 0.1353 0.1620 -0.0054 -0.0259 0.0153  495  SER A O   
4331 C  CB  . SER A 498 ? 0.1358 0.1367 0.1522 0.0053  -0.0042 0.0015  495  SER A CB  
4332 O  OG  . SER A 498 ? 0.1458 0.1503 0.1251 -0.0121 0.0115  0.0320  495  SER A OG  
4333 N  N   . TYR A 499 ? 0.1250 0.1160 0.1389 -0.0098 -0.0128 0.0098  496  TYR A N   
4334 C  CA  . TYR A 499 ? 0.1060 0.1147 0.1255 -0.0121 0.0021  0.0045  496  TYR A CA  
4335 C  C   . TYR A 499 ? 0.1081 0.1226 0.1382 -0.0029 0.0025  -0.0031 496  TYR A C   
4336 O  O   . TYR A 499 ? 0.1403 0.1233 0.1142 -0.0045 0.0123  0.0035  496  TYR A O   
4337 C  CB  . TYR A 499 ? 0.1144 0.1029 0.1233 0.0000  -0.0070 0.0060  496  TYR A CB  
4338 C  CG  . TYR A 499 ? 0.1149 0.1487 0.1332 0.0006  0.0110  0.0092  496  TYR A CG  
4339 C  CD1 . TYR A 499 ? 0.1026 0.1485 0.1347 0.0069  0.0073  -0.0078 496  TYR A CD1 
4340 C  CD2 . TYR A 499 ? 0.1202 0.1203 0.1445 0.0063  0.0004  0.0079  496  TYR A CD2 
4341 C  CE1 . TYR A 499 ? 0.1460 0.1487 0.1339 0.0172  -0.0197 -0.0138 496  TYR A CE1 
4342 C  CE2 . TYR A 499 ? 0.1572 0.1634 0.1524 -0.0165 0.0102  0.0055  496  TYR A CE2 
4343 C  CZ  . TYR A 499 ? 0.1424 0.1562 0.1210 0.0117  0.0016  -0.0089 496  TYR A CZ  
4344 O  OH  . TYR A 499 ? 0.1664 0.2107 0.1406 -0.0145 0.0089  0.0000  496  TYR A OH  
4345 N  N   . ASP A 500 ? 0.1180 0.1191 0.1337 -0.0022 0.0156  0.0010  497  ASP A N   
4346 C  CA  . ASP A 500 ? 0.1194 0.1093 0.1130 0.0031  0.0077  0.0046  497  ASP A CA  
4347 C  C   . ASP A 500 ? 0.1098 0.1221 0.1107 -0.0093 0.0012  0.0100  497  ASP A C   
4348 O  O   . ASP A 500 ? 0.1432 0.1290 0.1167 0.0012  -0.0068 0.0112  497  ASP A O   
4349 C  CB  . ASP A 500 ? 0.1250 0.1148 0.1259 0.0034  0.0067  -0.0046 497  ASP A CB  
4350 C  CG  . ASP A 500 ? 0.1202 0.1123 0.1254 0.0100  -0.0097 -0.0162 497  ASP A CG  
4351 O  OD1 . ASP A 500 ? 0.1418 0.1313 0.1240 -0.0072 -0.0092 0.0173  497  ASP A OD1 
4352 O  OD2 . ASP A 500 ? 0.1294 0.1253 0.1275 0.0032  -0.0106 -0.0147 497  ASP A OD2 
4353 N  N   . GLN A 501 ? 0.1369 0.1363 0.1234 0.0059  0.0079  0.0026  498  GLN A N   
4354 C  CA  . GLN A 501 ? 0.1207 0.1345 0.1276 -0.0004 0.0050  -0.0128 498  GLN A CA  
4355 C  C   . GLN A 501 ? 0.1280 0.1403 0.1362 0.0046  -0.0017 -0.0008 498  GLN A C   
4356 O  O   . GLN A 501 ? 0.1294 0.1415 0.1666 -0.0009 0.0048  -0.0042 498  GLN A O   
4357 C  CB  . GLN A 501 ? 0.1432 0.1478 0.1406 0.0066  -0.0092 -0.0195 498  GLN A CB  
4358 C  CG  . GLN A 501 ? 0.1590 0.1582 0.1575 -0.0177 0.0178  -0.0177 498  GLN A CG  
4359 C  CD  . GLN A 501 ? 0.1575 0.1515 0.1321 -0.0159 -0.0126 0.0070  498  GLN A CD  
4360 O  OE1 . GLN A 501 ? 0.1732 0.1487 0.1460 -0.0054 0.0146  -0.0040 498  GLN A OE1 
4361 N  NE2 . GLN A 501 ? 0.2042 0.1849 0.1504 -0.0444 -0.0416 0.0201  498  GLN A NE2 
4362 N  N   . TRP A 502 ? 0.1106 0.1306 0.1394 -0.0019 0.0112  -0.0010 499  TRP A N   
4363 C  CA  . TRP A 502 ? 0.1324 0.1363 0.1376 0.0163  0.0042  -0.0082 499  TRP A CA  
4364 C  C   . TRP A 502 ? 0.1311 0.1397 0.1256 0.0080  -0.0049 -0.0028 499  TRP A C   
4365 O  O   . TRP A 502 ? 0.1277 0.1863 0.1610 0.0154  0.0042  -0.0175 499  TRP A O   
4366 C  CB  . TRP A 502 ? 0.1451 0.1359 0.1288 0.0175  -0.0006 -0.0150 499  TRP A CB  
4367 C  CG  . TRP A 502 ? 0.1089 0.1380 0.1460 0.0021  -0.0093 -0.0188 499  TRP A CG  
4368 C  CD1 . TRP A 502 ? 0.1516 0.1608 0.1428 0.0176  -0.0065 -0.0196 499  TRP A CD1 
4369 C  CD2 . TRP A 502 ? 0.1246 0.1336 0.1637 0.0289  0.0064  -0.0128 499  TRP A CD2 
4370 N  NE1 . TRP A 502 ? 0.1296 0.2171 0.1449 0.0276  -0.0192 -0.0280 499  TRP A NE1 
4371 C  CE2 . TRP A 502 ? 0.1705 0.1654 0.1497 0.0247  -0.0369 -0.0081 499  TRP A CE2 
4372 C  CE3 . TRP A 502 ? 0.1668 0.1768 0.1767 0.0284  -0.0209 0.0133  499  TRP A CE3 
4373 C  CZ2 . TRP A 502 ? 0.1944 0.1729 0.1984 0.0643  -0.0318 -0.0090 499  TRP A CZ2 
4374 C  CZ3 . TRP A 502 ? 0.2114 0.2618 0.2181 0.0128  -0.0003 0.0727  499  TRP A CZ3 
4375 C  CH2 . TRP A 502 ? 0.2344 0.2193 0.2174 0.0675  -0.0189 0.0541  499  TRP A CH2 
4376 N  N   . GLY A 503 ? 0.1330 0.1427 0.1506 0.0083  -0.0116 -0.0037 500  GLY A N   
4377 C  CA  . GLY A 503 ? 0.1324 0.1172 0.1440 -0.0003 -0.0179 0.0052  500  GLY A CA  
4378 C  C   . GLY A 503 ? 0.1291 0.1438 0.1708 -0.0031 -0.0178 0.0018  500  GLY A C   
4379 O  O   . GLY A 503 ? 0.1589 0.1413 0.2120 0.0029  -0.0244 0.0164  500  GLY A O   
4380 N  N   . VAL A 504 ? 0.1201 0.1581 0.1524 -0.0080 -0.0144 0.0042  501  VAL A N   
4381 C  CA  . VAL A 504 ? 0.1334 0.1609 0.1716 -0.0184 -0.0153 0.0062  501  VAL A CA  
4382 C  C   . VAL A 504 ? 0.1242 0.1708 0.1559 -0.0061 -0.0130 0.0035  501  VAL A C   
4383 O  O   . VAL A 504 ? 0.1221 0.2000 0.1756 -0.0173 -0.0117 0.0146  501  VAL A O   
4384 C  CB  . VAL A 504 ? 0.1398 0.1520 0.1619 -0.0372 -0.0304 0.0035  501  VAL A CB  
4385 C  CG1 . VAL A 504 ? 0.2080 0.2125 0.1849 -0.0527 0.0088  -0.0264 501  VAL A CG1 
4386 C  CG2 . VAL A 504 ? 0.1528 0.1649 0.2483 -0.0261 -0.0306 -0.0068 501  VAL A CG2 
4387 N  N   . GLU A 505 ? 0.1310 0.1752 0.1600 0.0050  -0.0109 0.0145  502  GLU A N   
4388 C  CA  A GLU A 505 ? 0.1593 0.1853 0.1755 0.0024  -0.0065 0.0158  502  GLU A CA  
4389 C  CA  B GLU A 505 ? 0.1484 0.1758 0.1669 0.0032  -0.0088 0.0116  502  GLU A CA  
4390 C  C   . GLU A 505 ? 0.1555 0.1770 0.1653 0.0008  -0.0063 0.0146  502  GLU A C   
4391 O  O   . GLU A 505 ? 0.1524 0.1661 0.1744 -0.0095 -0.0195 0.0314  502  GLU A O   
4392 C  CB  A GLU A 505 ? 0.1729 0.2153 0.2056 0.0063  -0.0117 0.0228  502  GLU A CB  
4393 C  CB  B GLU A 505 ? 0.1501 0.1782 0.1814 0.0069  -0.0112 0.0067  502  GLU A CB  
4394 C  CG  A GLU A 505 ? 0.2254 0.2176 0.2748 -0.0008 -0.0167 0.0226  502  GLU A CG  
4395 C  CG  B GLU A 505 ? 0.1772 0.2124 0.2103 0.0214  -0.0172 0.0013  502  GLU A CG  
4396 C  CD  A GLU A 505 ? 0.2888 0.2367 0.3336 0.0045  -0.0510 0.0482  502  GLU A CD  
4397 C  CD  B GLU A 505 ? 0.1814 0.1886 0.2292 0.0486  -0.0263 -0.0047 502  GLU A CD  
4398 O  OE1 A GLU A 505 ? 0.2850 0.2503 0.3279 0.0158  -0.0715 0.0576  502  GLU A OE1 
4399 O  OE1 B GLU A 505 ? 0.2362 0.2677 0.2657 0.0653  0.0094  -0.0439 502  GLU A OE1 
4400 O  OE2 A GLU A 505 ? 0.3024 0.3091 0.4816 0.0574  -0.0556 0.0381  502  GLU A OE2 
4401 O  OE2 B GLU A 505 ? 0.1618 0.2650 0.2192 0.0850  -0.0188 -0.0408 502  GLU A OE2 
4402 N  N   . LEU A 506 ? 0.1420 0.1567 0.1422 0.0018  -0.0017 0.0156  503  LEU A N   
4403 C  CA  . LEU A 506 ? 0.1405 0.1588 0.1382 0.0031  -0.0052 0.0040  503  LEU A CA  
4404 C  C   . LEU A 506 ? 0.1279 0.1471 0.1446 0.0086  0.0008  -0.0026 503  LEU A C   
4405 O  O   . LEU A 506 ? 0.1255 0.1563 0.1331 -0.0001 0.0148  0.0000  503  LEU A O   
4406 C  CB  . LEU A 506 ? 0.1451 0.1669 0.1376 0.0073  -0.0124 -0.0092 503  LEU A CB  
4407 C  CG  . LEU A 506 ? 0.1317 0.1544 0.1182 0.0072  0.0117  0.0001  503  LEU A CG  
4408 C  CD1 . LEU A 506 ? 0.1966 0.1664 0.1461 -0.0131 -0.0234 -0.0351 503  LEU A CD1 
4409 C  CD2 . LEU A 506 ? 0.1735 0.1579 0.1597 -0.0309 -0.0137 0.0271  503  LEU A CD2 
4410 N  N   . GLY A 507 ? 0.1139 0.1553 0.1261 0.0011  0.0141  -0.0049 504  GLY A N   
4411 C  CA  . GLY A 507 ? 0.1229 0.1512 0.1313 -0.0109 -0.0133 0.0114  504  GLY A CA  
4412 C  C   . GLY A 507 ? 0.1240 0.1457 0.1350 -0.0111 -0.0143 0.0028  504  GLY A C   
4413 O  O   . GLY A 507 ? 0.1135 0.1602 0.1267 -0.0010 -0.0168 0.0125  504  GLY A O   
4414 N  N   . LYS A 508 ? 0.1309 0.1643 0.1603 0.0016  -0.0041 0.0077  505  LYS A N   
4415 C  CA  . LYS A 508 ? 0.1349 0.1588 0.1635 0.0015  -0.0025 -0.0028 505  LYS A CA  
4416 C  C   . LYS A 508 ? 0.1411 0.1670 0.1684 0.0004  0.0052  0.0075  505  LYS A C   
4417 O  O   . LYS A 508 ? 0.1291 0.1743 0.1684 -0.0039 0.0122  0.0128  505  LYS A O   
4418 C  CB  . LYS A 508 ? 0.1369 0.1656 0.1765 -0.0063 -0.0056 -0.0032 505  LYS A CB  
4419 C  CG  . LYS A 508 ? 0.1606 0.1904 0.1759 0.0101  -0.0085 0.0038  505  LYS A CG  
4420 C  CD  . LYS A 508 ? 0.1852 0.1632 0.2443 -0.0036 -0.0110 0.0040  505  LYS A CD  
4421 C  CE  . LYS A 508 ? 0.1861 0.1565 0.2656 0.0408  0.0056  -0.0024 505  LYS A CE  
4422 N  NZ  . LYS A 508 ? 0.1705 0.2114 0.3400 0.0380  0.0597  -0.0094 505  LYS A NZ  
4423 N  N   . LYS A 509 ? 0.1424 0.1772 0.1512 0.0020  -0.0029 -0.0010 506  LYS A N   
4424 C  CA  . LYS A 509 ? 0.1671 0.1869 0.1502 0.0096  -0.0059 0.0062  506  LYS A CA  
4425 C  C   . LYS A 509 ? 0.1597 0.1776 0.1357 0.0144  -0.0039 0.0092  506  LYS A C   
4426 O  O   . LYS A 509 ? 0.1606 0.1684 0.1523 -0.0014 0.0097  0.0163  506  LYS A O   
4427 C  CB  . LYS A 509 ? 0.1941 0.2162 0.1897 0.0069  -0.0147 0.0012  506  LYS A CB  
4428 C  CG  . LYS A 509 ? 0.2309 0.2678 0.2426 -0.0066 -0.0219 -0.0188 506  LYS A CG  
4429 C  CD  . LYS A 509 ? 0.3007 0.3388 0.3652 -0.0515 -0.0525 -0.0132 506  LYS A CD  
4430 C  CE  . LYS A 509 ? 0.3428 0.3557 0.4062 -0.0685 -0.0537 0.0124  506  LYS A CE  
4431 N  NZ  . LYS A 509 ? 0.3757 0.4149 0.4581 -0.0808 -0.0936 -0.0423 506  LYS A NZ  
4432 N  N   . LEU A 510 ? 0.1496 0.1626 0.1234 0.0271  0.0042  0.0095  507  LEU A N   
4433 C  CA  . LEU A 510 ? 0.1268 0.1502 0.1254 0.0151  0.0011  0.0222  507  LEU A CA  
4434 C  C   . LEU A 510 ? 0.1359 0.1394 0.1308 0.0050  0.0038  0.0198  507  LEU A C   
4435 O  O   . LEU A 510 ? 0.1314 0.1668 0.1610 0.0172  0.0059  0.0233  507  LEU A O   
4436 C  CB  . LEU A 510 ? 0.1283 0.1401 0.1451 0.0186  0.0001  0.0145  507  LEU A CB  
4437 C  CG  . LEU A 510 ? 0.1411 0.1614 0.1038 0.0106  -0.0104 0.0190  507  LEU A CG  
4438 C  CD1 . LEU A 510 ? 0.1402 0.1768 0.1369 -0.0234 0.0059  0.0663  507  LEU A CD1 
4439 C  CD2 . LEU A 510 ? 0.1964 0.1830 0.0754 -0.0183 -0.0175 0.0027  507  LEU A CD2 
4440 N  N   . GLY A 511 ? 0.1159 0.1345 0.1354 0.0082  0.0051  0.0233  508  GLY A N   
4441 C  CA  . GLY A 511 ? 0.1416 0.1544 0.1507 -0.0023 -0.0049 0.0274  508  GLY A CA  
4442 C  C   . GLY A 511 ? 0.1463 0.1459 0.1508 -0.0051 -0.0137 0.0315  508  GLY A C   
4443 O  O   . GLY A 511 ? 0.1559 0.1431 0.1748 0.0099  0.0079  0.0356  508  GLY A O   
4444 N  N   . LYS A 512 ? 0.1362 0.1534 0.1608 0.0014  -0.0154 0.0362  509  LYS A N   
4445 C  CA  A LYS A 512 ? 0.1537 0.1572 0.1609 -0.0083 -0.0196 0.0291  509  LYS A CA  
4446 C  CA  B LYS A 512 ? 0.1541 0.1587 0.1626 -0.0069 -0.0178 0.0298  509  LYS A CA  
4447 C  C   . LYS A 512 ? 0.1468 0.1604 0.1563 -0.0053 -0.0150 0.0357  509  LYS A C   
4448 O  O   . LYS A 512 ? 0.1685 0.1683 0.1624 -0.0128 -0.0146 0.0362  509  LYS A O   
4449 C  CB  A LYS A 512 ? 0.1558 0.1661 0.1642 -0.0106 -0.0123 0.0368  509  LYS A CB  
4450 C  CB  B LYS A 512 ? 0.1567 0.1660 0.1636 -0.0089 -0.0142 0.0355  509  LYS A CB  
4451 C  CG  A LYS A 512 ? 0.2039 0.2106 0.1949 0.0052  -0.0361 0.0149  509  LYS A CG  
4452 C  CG  B LYS A 512 ? 0.2035 0.2028 0.2015 -0.0024 -0.0266 0.0240  509  LYS A CG  
4453 C  CD  A LYS A 512 ? 0.2457 0.2454 0.2538 0.0327  -0.0364 0.0111  509  LYS A CD  
4454 C  CD  B LYS A 512 ? 0.2342 0.2468 0.2521 0.0067  -0.0271 0.0325  509  LYS A CD  
4455 C  CE  A LYS A 512 ? 0.2869 0.2445 0.2658 0.0420  -0.0138 -0.0093 509  LYS A CE  
4456 C  CE  B LYS A 512 ? 0.2673 0.2662 0.2513 -0.0022 -0.0130 0.0368  509  LYS A CE  
4457 N  NZ  A LYS A 512 ? 0.3089 0.3450 0.3539 0.0211  -0.0263 -0.0165 509  LYS A NZ  
4458 N  NZ  B LYS A 512 ? 0.2846 0.3155 0.3342 -0.0037 -0.0223 0.0484  509  LYS A NZ  
4459 N  N   . ASN A 513 ? 0.1509 0.1461 0.1614 0.0042  -0.0257 0.0209  510  ASN A N   
4460 C  CA  . ASN A 513 ? 0.1717 0.1670 0.1495 0.0047  -0.0160 0.0133  510  ASN A CA  
4461 C  C   . ASN A 513 ? 0.1644 0.1523 0.1395 0.0000  -0.0104 0.0073  510  ASN A C   
4462 O  O   . ASN A 513 ? 0.1591 0.1539 0.1402 -0.0138 -0.0138 0.0007  510  ASN A O   
4463 C  CB  . ASN A 513 ? 0.1848 0.1644 0.1811 0.0008  -0.0158 0.0251  510  ASN A CB  
4464 C  CG  . ASN A 513 ? 0.2601 0.2515 0.3001 -0.0035 -0.0137 0.0221  510  ASN A CG  
4465 O  OD1 . ASN A 513 ? 0.3459 0.3152 0.3350 0.0492  -0.0677 0.0509  510  ASN A OD1 
4466 N  ND2 . ASN A 513 ? 0.3180 0.3453 0.4012 -0.0604 0.0213  -0.0331 510  ASN A ND2 
4467 N  N   . ILE A 514 ? 0.1559 0.1344 0.1323 0.0000  -0.0201 -0.0023 511  ILE A N   
4468 C  CA  . ILE A 514 ? 0.1437 0.1429 0.1285 -0.0033 -0.0147 0.0011  511  ILE A CA  
4469 C  C   . ILE A 514 ? 0.1554 0.1520 0.1491 0.0010  -0.0079 0.0019  511  ILE A C   
4470 O  O   . ILE A 514 ? 0.1347 0.1499 0.1371 -0.0265 -0.0209 0.0102  511  ILE A O   
4471 C  CB  . ILE A 514 ? 0.1362 0.1377 0.1183 0.0029  -0.0002 -0.0076 511  ILE A CB  
4472 C  CG1 . ILE A 514 ? 0.1543 0.1656 0.1263 0.0111  0.0037  0.0198  511  ILE A CG1 
4473 C  CG2 . ILE A 514 ? 0.1257 0.1609 0.1561 0.0161  -0.0378 -0.0089 511  ILE A CG2 
4474 C  CD1 . ILE A 514 ? 0.1735 0.2067 0.0943 0.0054  0.0114  0.0254  511  ILE A CD1 
4475 N  N   . LEU A 515 ? 0.1617 0.1612 0.1803 0.0063  -0.0059 0.0080  512  LEU A N   
4476 C  CA  A LEU A 515 ? 0.1849 0.1781 0.2255 0.0083  -0.0055 0.0088  512  LEU A CA  
4477 C  CA  B LEU A 515 ? 0.1774 0.1667 0.2127 0.0078  -0.0051 0.0069  512  LEU A CA  
4478 C  C   . LEU A 515 ? 0.1888 0.1790 0.2245 0.0093  0.0044  0.0183  512  LEU A C   
4479 O  O   . LEU A 515 ? 0.1902 0.1951 0.2674 -0.0043 0.0088  0.0229  512  LEU A O   
4480 C  CB  A LEU A 515 ? 0.1835 0.1813 0.2570 0.0105  -0.0088 0.0113  512  LEU A CB  
4481 C  CB  B LEU A 515 ? 0.1742 0.1625 0.2223 0.0068  -0.0060 0.0037  512  LEU A CB  
4482 C  CG  A LEU A 515 ? 0.2061 0.2220 0.2529 0.0238  -0.0146 0.0170  512  LEU A CG  
4483 C  CG  B LEU A 515 ? 0.1719 0.1469 0.2179 0.0215  -0.0163 -0.0048 512  LEU A CG  
4484 C  CD1 A LEU A 515 ? 0.1756 0.2719 0.3151 0.0542  -0.0002 0.0050  512  LEU A CD1 
4485 C  CD1 B LEU A 515 ? 0.1889 0.2037 0.2149 -0.0037 -0.0327 -0.0282 512  LEU A CD1 
4486 C  CD2 A LEU A 515 ? 0.2010 0.2844 0.2825 0.0189  -0.0309 -0.0003 512  LEU A CD2 
4487 C  CD2 B LEU A 515 ? 0.1620 0.1031 0.2038 0.0131  0.0306  -0.0424 512  LEU A CD2 
4488 N  N   . LYS A 516 ? 0.1898 0.1894 0.2082 0.0043  0.0076  0.0209  513  LYS A N   
4489 C  CA  A LYS A 516 ? 0.2074 0.2053 0.1934 -0.0014 0.0052  0.0245  513  LYS A CA  
4490 C  CA  B LYS A 516 ? 0.2032 0.2095 0.1980 -0.0007 0.0063  0.0233  513  LYS A CA  
4491 C  C   . LYS A 516 ? 0.1989 0.2154 0.1855 -0.0002 0.0125  0.0252  513  LYS A C   
4492 O  O   . LYS A 516 ? 0.2097 0.2244 0.2187 0.0061  0.0344  0.0503  513  LYS A O   
4493 C  CB  A LYS A 516 ? 0.2146 0.2248 0.2086 -0.0053 0.0078  0.0248  513  LYS A CB  
4494 C  CB  B LYS A 516 ? 0.2074 0.2246 0.2132 -0.0025 0.0061  0.0236  513  LYS A CB  
4495 C  CG  A LYS A 516 ? 0.2694 0.2276 0.2383 -0.0005 -0.0037 0.0282  513  LYS A CG  
4496 C  CG  B LYS A 516 ? 0.2425 0.2573 0.2265 -0.0067 -0.0002 0.0251  513  LYS A CG  
4497 C  CD  A LYS A 516 ? 0.2823 0.2446 0.2945 0.0016  -0.0141 0.0312  513  LYS A CD  
4498 C  CD  B LYS A 516 ? 0.2740 0.2773 0.2763 -0.0019 -0.0143 0.0221  513  LYS A CD  
4499 C  CE  A LYS A 516 ? 0.3133 0.2765 0.3395 0.0200  -0.0055 0.0276  513  LYS A CE  
4500 C  CE  B LYS A 516 ? 0.3121 0.2988 0.2895 -0.0084 -0.0082 0.0252  513  LYS A CE  
4501 N  NZ  A LYS A 516 ? 0.3430 0.2932 0.3443 0.0362  -0.0174 0.0339  513  LYS A NZ  
4502 N  NZ  B LYS A 516 ? 0.3163 0.2970 0.3227 0.0039  -0.0176 0.0115  513  LYS A NZ  
4503 N  N   . ALA A 517 ? 0.1795 0.2023 0.1749 -0.0020 0.0130  0.0240  514  ALA A N   
4504 C  CA  . ALA A 517 ? 0.1877 0.1890 0.1692 0.0006  0.0057  0.0088  514  ALA A CA  
4505 C  C   . ALA A 517 ? 0.1936 0.1929 0.1939 0.0026  0.0149  0.0145  514  ALA A C   
4506 O  O   . ALA A 517 ? 0.1951 0.2039 0.2249 0.0011  0.0216  0.0167  514  ALA A O   
4507 C  CB  . ALA A 517 ? 0.1750 0.2028 0.1750 -0.0148 0.0193  0.0138  514  ALA A CB  
4508 N  N   . MSE A 518 ? 0.1850 0.1910 0.1938 0.0100  0.0095  0.0074  515  MSE A N   
4509 C  CA  . MSE A 518 ? 0.1963 0.2131 0.2145 0.0003  0.0111  0.0180  515  MSE A CA  
4510 C  C   . MSE A 518 ? 0.2149 0.2419 0.2325 -0.0098 0.0182  0.0257  515  MSE A C   
4511 O  O   . MSE A 518 ? 0.2282 0.2739 0.2533 -0.0266 0.0275  0.0592  515  MSE A O   
4512 C  CB  . MSE A 518 ? 0.1851 0.2047 0.2220 0.0139  0.0036  0.0093  515  MSE A CB  
4513 C  CG  . MSE A 518 ? 0.1581 0.2051 0.2278 0.0041  0.0111  -0.0021 515  MSE A CG  
4514 SE SE  . MSE A 518 ? 0.2034 0.2513 0.2915 -0.0067 0.0158  -0.0809 515  MSE A SE  
4515 C  CE  . MSE A 518 ? 0.2142 0.2976 0.3288 -0.0329 -0.0293 -0.0466 515  MSE A CE  
4516 N  N   . ASN A 519 ? 0.2428 0.2653 0.2397 -0.0200 0.0272  0.0286  516  ASN A N   
4517 C  CA  . ASN A 519 ? 0.2797 0.2735 0.2477 -0.0268 0.0294  0.0169  516  ASN A CA  
4518 C  C   . ASN A 519 ? 0.2992 0.2884 0.2557 -0.0219 0.0358  0.0111  516  ASN A C   
4519 O  O   . ASN A 519 ? 0.3169 0.2885 0.2921 -0.0321 0.0540  0.0193  516  ASN A O   
4520 C  CB  . ASN A 519 ? 0.2885 0.2804 0.2513 -0.0298 0.0326  0.0211  516  ASN A CB  
4521 C  CG  . ASN A 519 ? 0.3093 0.2949 0.2825 -0.0422 0.0476  -0.0070 516  ASN A CG  
4522 O  OD1 . ASN A 519 ? 0.4065 0.3907 0.3073 -0.0674 0.0106  -0.0487 516  ASN A OD1 
4523 N  ND2 . ASN A 519 ? 0.3552 0.3149 0.4157 -0.0257 0.0647  -0.0491 516  ASN A ND2 
4524 N  N   . ASP A 520 ? 0.3190 0.2930 0.2537 -0.0253 0.0374  0.0109  517  ASP A N   
4525 C  CA  . ASP A 520 ? 0.3401 0.3101 0.2898 -0.0157 0.0254  -0.0002 517  ASP A CA  
4526 C  C   . ASP A 520 ? 0.3526 0.3152 0.3003 -0.0104 0.0225  0.0005  517  ASP A C   
4527 O  O   . ASP A 520 ? 0.3717 0.2820 0.2612 -0.0128 0.0067  -0.0004 517  ASP A O   
4528 C  CB  . ASP A 520 ? 0.3495 0.3133 0.2915 -0.0153 0.0275  0.0038  517  ASP A CB  
4529 C  CG  . ASP A 520 ? 0.3888 0.3440 0.3014 -0.0133 0.0229  0.0033  517  ASP A CG  
4530 O  OD1 . ASP A 520 ? 0.4910 0.3811 0.3090 -0.0213 -0.0014 0.0030  517  ASP A OD1 
4531 O  OD2 . ASP A 520 ? 0.4169 0.3451 0.3419 -0.0155 0.0588  0.0111  517  ASP A OD2 
4532 N  N   . ASP A 521 ? 0.3680 0.3303 0.3173 -0.0045 0.0200  0.0011  518  ASP A N   
4533 C  CA  . ASP A 521 ? 0.3852 0.3549 0.3462 -0.0080 0.0224  -0.0030 518  ASP A CA  
4534 C  C   . ASP A 521 ? 0.3937 0.3521 0.3456 -0.0059 0.0211  -0.0049 518  ASP A C   
4535 O  O   . ASP A 521 ? 0.4155 0.3589 0.3643 -0.0062 0.0391  -0.0115 518  ASP A O   
4536 C  CB  . ASP A 521 ? 0.3888 0.3662 0.3629 -0.0053 0.0220  -0.0047 518  ASP A CB  
4537 C  CG  . ASP A 521 ? 0.4066 0.4207 0.4182 -0.0141 0.0211  0.0009  518  ASP A CG  
4538 O  OD1 . ASP A 521 ? 0.4355 0.4394 0.4107 -0.0084 0.0590  -0.0114 518  ASP A OD1 
4539 O  OD2 . ASP A 521 ? 0.4164 0.4864 0.5051 -0.0188 -0.0100 0.0187  518  ASP A OD2 
4540 N  N   . SER A 522 ? 0.3912 0.3543 0.3239 -0.0105 0.0204  -0.0072 519  SER A N   
4541 C  CA  . SER A 522 ? 0.3833 0.3522 0.3148 -0.0070 0.0198  -0.0037 519  SER A CA  
4542 C  C   . SER A 522 ? 0.3723 0.3414 0.2955 -0.0075 0.0185  -0.0045 519  SER A C   
4543 O  O   . SER A 522 ? 0.3783 0.3491 0.2821 -0.0007 0.0288  -0.0249 519  SER A O   
4544 C  CB  . SER A 522 ? 0.3913 0.3599 0.3278 -0.0106 0.0191  0.0003  519  SER A CB  
4545 O  OG  . SER A 522 ? 0.4474 0.3771 0.3371 -0.0039 0.0321  0.0081  519  SER A OG  
4546 N  N   . SER A 523 ? 0.3579 0.3226 0.2671 -0.0066 0.0238  0.0002  520  SER A N   
4547 C  CA  . SER A 523 ? 0.3584 0.3100 0.2550 -0.0088 0.0072  0.0126  520  SER A CA  
4548 C  C   . SER A 523 ? 0.3555 0.3094 0.2674 -0.0075 -0.0068 0.0020  520  SER A C   
4549 O  O   . SER A 523 ? 0.3854 0.2942 0.2821 -0.0047 -0.0042 -0.0063 520  SER A O   
4550 C  CB  . SER A 523 ? 0.3691 0.3079 0.2567 -0.0115 0.0063  0.0210  520  SER A CB  
4551 O  OG  . SER A 523 ? 0.3909 0.2767 0.2031 -0.0136 0.0187  0.0687  520  SER A OG  
4552 N  N   . ASP A 524 ? 0.3540 0.3144 0.2682 -0.0121 -0.0097 0.0066  521  ASP A N   
4553 C  CA  . ASP A 524 ? 0.3479 0.3162 0.2649 -0.0126 -0.0191 0.0029  521  ASP A CA  
4554 C  C   . ASP A 524 ? 0.3484 0.2962 0.2596 -0.0135 -0.0213 0.0059  521  ASP A C   
4555 O  O   . ASP A 524 ? 0.3613 0.2906 0.2558 -0.0170 -0.0499 0.0025  521  ASP A O   
4556 C  CB  . ASP A 524 ? 0.3541 0.3247 0.2620 -0.0098 -0.0177 0.0080  521  ASP A CB  
4557 C  CG  . ASP A 524 ? 0.3991 0.3964 0.2725 -0.0088 -0.0236 -0.0077 521  ASP A CG  
4558 O  OD1 . ASP A 524 ? 0.4313 0.4604 0.3029 -0.0012 -0.0666 -0.0790 521  ASP A OD1 
4559 O  OD2 . ASP A 524 ? 0.4289 0.4708 0.2877 -0.0154 -0.0552 -0.0167 521  ASP A OD2 
4560 N  N   . GLU A 525 ? 0.3330 0.2746 0.2431 -0.0072 -0.0229 -0.0004 522  GLU A N   
4561 C  CA  . GLU A 525 ? 0.3064 0.2662 0.2310 -0.0006 -0.0219 0.0066  522  GLU A CA  
4562 C  C   . GLU A 525 ? 0.2863 0.2571 0.2270 -0.0056 -0.0154 0.0037  522  GLU A C   
4563 O  O   . GLU A 525 ? 0.3064 0.2544 0.1894 -0.0094 -0.0373 0.0082  522  GLU A O   
4564 C  CB  . GLU A 525 ? 0.3116 0.2747 0.2510 -0.0014 -0.0265 0.0048  522  GLU A CB  
4565 C  CG  . GLU A 525 ? 0.3275 0.2751 0.2875 0.0045  -0.0376 -0.0020 522  GLU A CG  
4566 C  CD  . GLU A 525 ? 0.3539 0.3327 0.3199 -0.0005 -0.0287 0.0125  522  GLU A CD  
4567 O  OE1 . GLU A 525 ? 0.3425 0.2846 0.2893 -0.0374 -0.0101 0.0251  522  GLU A OE1 
4568 O  OE2 . GLU A 525 ? 0.3951 0.3901 0.4034 0.0154  -0.0697 0.0358  522  GLU A OE2 
4569 N  N   . TYR A 526 ? 0.2710 0.2408 0.1992 -0.0030 -0.0093 -0.0033 523  TYR A N   
4570 C  CA  . TYR A 526 ? 0.2627 0.2406 0.2081 -0.0043 0.0076  -0.0034 523  TYR A CA  
4571 C  C   . TYR A 526 ? 0.2670 0.2424 0.2041 -0.0079 -0.0009 -0.0067 523  TYR A C   
4572 O  O   . TYR A 526 ? 0.2627 0.2292 0.1753 -0.0014 0.0245  -0.0188 523  TYR A O   
4573 C  CB  . TYR A 526 ? 0.2647 0.2442 0.2195 -0.0082 0.0121  0.0070  523  TYR A CB  
4574 C  CG  . TYR A 526 ? 0.2450 0.2494 0.2346 -0.0007 0.0183  -0.0025 523  TYR A CG  
4575 C  CD1 . TYR A 526 ? 0.2706 0.2591 0.2102 0.0145  0.0226  0.0008  523  TYR A CD1 
4576 C  CD2 . TYR A 526 ? 0.2902 0.2787 0.2512 -0.0015 0.0132  0.0015  523  TYR A CD2 
4577 C  CE1 . TYR A 526 ? 0.2535 0.2653 0.3077 0.0189  0.0484  0.0020  523  TYR A CE1 
4578 C  CE2 . TYR A 526 ? 0.2907 0.2651 0.2934 0.0169  0.0206  0.0306  523  TYR A CE2 
4579 C  CZ  . TYR A 526 ? 0.2874 0.2704 0.2522 0.0270  0.0581  0.0047  523  TYR A CZ  
4580 O  OH  . TYR A 526 ? 0.2688 0.3352 0.3792 0.0632  0.1071  0.0350  523  TYR A OH  
4581 N  N   . GLN A 527 ? 0.2809 0.2445 0.2021 -0.0084 -0.0028 -0.0115 524  GLN A N   
4582 C  CA  A GLN A 527 ? 0.2824 0.2447 0.2085 -0.0152 -0.0135 -0.0092 524  GLN A CA  
4583 C  CA  B GLN A 527 ? 0.2784 0.2438 0.2098 -0.0143 -0.0124 -0.0075 524  GLN A CA  
4584 C  C   . GLN A 527 ? 0.2786 0.2429 0.1978 -0.0132 -0.0239 -0.0072 524  GLN A C   
4585 O  O   . GLN A 527 ? 0.3186 0.2342 0.2463 -0.0214 -0.0276 -0.0129 524  GLN A O   
4586 C  CB  A GLN A 527 ? 0.2928 0.2522 0.2122 -0.0100 -0.0122 -0.0047 524  GLN A CB  
4587 C  CB  B GLN A 527 ? 0.2845 0.2476 0.2132 -0.0128 -0.0107 -0.0057 524  GLN A CB  
4588 C  CG  A GLN A 527 ? 0.3152 0.2814 0.2560 -0.0186 -0.0113 -0.0027 524  GLN A CG  
4589 C  CG  B GLN A 527 ? 0.2895 0.2752 0.2466 -0.0181 -0.0034 0.0076  524  GLN A CG  
4590 C  CD  A GLN A 527 ? 0.3656 0.3076 0.2765 -0.0166 -0.0011 -0.0140 524  GLN A CD  
4591 C  CD  B GLN A 527 ? 0.3001 0.2912 0.2580 -0.0231 -0.0006 0.0134  524  GLN A CD  
4592 O  OE1 A GLN A 527 ? 0.4301 0.3505 0.2899 -0.0189 -0.0021 0.0134  524  GLN A OE1 
4593 O  OE1 B GLN A 527 ? 0.3010 0.3210 0.2804 -0.0188 0.0180  0.0335  524  GLN A OE1 
4594 N  NE2 A GLN A 527 ? 0.3986 0.3004 0.3593 -0.0320 -0.0134 -0.0165 524  GLN A NE2 
4595 N  NE2 B GLN A 527 ? 0.3275 0.2942 0.2675 -0.0129 0.0162  0.0132  524  GLN A NE2 
4596 N  N   . ASN A 528 ? 0.2713 0.2463 0.1858 -0.0227 -0.0380 -0.0016 525  ASN A N   
4597 C  CA  . ASN A 528 ? 0.2581 0.2655 0.1830 -0.0185 -0.0396 0.0018  525  ASN A CA  
4598 C  C   . ASN A 528 ? 0.2348 0.2573 0.1743 -0.0193 -0.0390 0.0204  525  ASN A C   
4599 O  O   . ASN A 528 ? 0.2121 0.2892 0.1610 -0.0254 -0.0551 0.0205  525  ASN A O   
4600 C  CB  . ASN A 528 ? 0.2705 0.2796 0.1875 -0.0229 -0.0499 0.0033  525  ASN A CB  
4601 C  CG  . ASN A 528 ? 0.3113 0.3619 0.2549 -0.0329 -0.0775 0.0013  525  ASN A CG  
4602 O  OD1 . ASN A 528 ? 0.3753 0.4732 0.2891 -0.0270 -0.1060 -0.0511 525  ASN A OD1 
4603 N  ND2 . ASN A 528 ? 0.3466 0.4057 0.4204 -0.0225 -0.0884 0.0487  525  ASN A ND2 
4604 N  N   . LEU A 529 ? 0.2102 0.2192 0.1690 -0.0083 -0.0288 0.0155  526  LEU A N   
4605 C  CA  . LEU A 529 ? 0.2010 0.2033 0.1456 -0.0103 -0.0208 0.0099  526  LEU A CA  
4606 C  C   . LEU A 529 ? 0.1799 0.1790 0.1382 -0.0004 -0.0256 -0.0026 526  LEU A C   
4607 O  O   . LEU A 529 ? 0.1846 0.1965 0.1350 -0.0108 -0.0161 -0.0122 526  LEU A O   
4608 C  CB  . LEU A 529 ? 0.1969 0.2030 0.1160 -0.0085 -0.0247 0.0161  526  LEU A CB  
4609 C  CG  . LEU A 529 ? 0.1962 0.1966 0.0914 0.0109  -0.0345 0.0066  526  LEU A CG  
4610 C  CD1 . LEU A 529 ? 0.2052 0.2217 0.1342 -0.0118 -0.0859 0.0409  526  LEU A CD1 
4611 C  CD2 . LEU A 529 ? 0.2542 0.2131 0.1192 0.0366  -0.0087 -0.0115 526  LEU A CD2 
4612 N  N   . ASP A 530 ? 0.1565 0.1737 0.1379 0.0063  -0.0188 -0.0098 527  ASP A N   
4613 C  CA  . ASP A 530 ? 0.1333 0.1564 0.1366 0.0007  -0.0300 -0.0106 527  ASP A CA  
4614 C  C   . ASP A 530 ? 0.1280 0.1442 0.1283 0.0002  -0.0316 -0.0099 527  ASP A C   
4615 O  O   . ASP A 530 ? 0.1445 0.1595 0.1395 0.0026  -0.0350 -0.0044 527  ASP A O   
4616 C  CB  . ASP A 530 ? 0.1162 0.1641 0.1464 0.0140  -0.0497 -0.0036 527  ASP A CB  
4617 C  CG  . ASP A 530 ? 0.1550 0.1399 0.1480 0.0020  -0.0384 -0.0054 527  ASP A CG  
4618 O  OD1 . ASP A 530 ? 0.1270 0.1422 0.2038 0.0030  -0.0505 0.0084  527  ASP A OD1 
4619 O  OD2 . ASP A 530 ? 0.1431 0.1494 0.1383 -0.0036 -0.0397 -0.0060 527  ASP A OD2 
4620 N  N   . ASP A 531 ? 0.1335 0.1267 0.1193 -0.0068 -0.0226 -0.0077 528  ASP A N   
4621 C  CA  . ASP A 531 ? 0.1304 0.1136 0.1095 -0.0029 -0.0209 -0.0019 528  ASP A CA  
4622 C  C   . ASP A 531 ? 0.1222 0.1060 0.1027 -0.0027 -0.0167 -0.0140 528  ASP A C   
4623 O  O   . ASP A 531 ? 0.1175 0.1228 0.1084 0.0025  -0.0162 -0.0095 528  ASP A O   
4624 C  CB  . ASP A 531 ? 0.1296 0.1212 0.0992 0.0000  -0.0260 -0.0077 528  ASP A CB  
4625 C  CG  . ASP A 531 ? 0.1433 0.1319 0.1332 -0.0016 -0.0161 -0.0051 528  ASP A CG  
4626 O  OD1 . ASP A 531 ? 0.1243 0.1886 0.1621 -0.0424 -0.0129 -0.0047 528  ASP A OD1 
4627 O  OD2 . ASP A 531 ? 0.1676 0.1432 0.2376 0.0272  -0.0592 0.0038  528  ASP A OD2 
4628 N  N   . SER A 532 ? 0.1210 0.1088 0.1033 -0.0098 -0.0307 0.0038  529  SER A N   
4629 C  CA  . SER A 532 ? 0.1082 0.1237 0.1102 -0.0015 -0.0353 -0.0041 529  SER A CA  
4630 C  C   . SER A 532 ? 0.1099 0.1191 0.1024 -0.0036 -0.0273 -0.0056 529  SER A C   
4631 O  O   . SER A 532 ? 0.1141 0.1024 0.1084 -0.0160 -0.0152 -0.0006 529  SER A O   
4632 C  CB  . SER A 532 ? 0.1139 0.1238 0.0864 -0.0063 -0.0496 -0.0054 529  SER A CB  
4633 O  OG  . SER A 532 ? 0.1304 0.1333 0.0948 0.0044  -0.0377 -0.0099 529  SER A OG  
4634 N  N   . THR A 533 ? 0.1091 0.1129 0.1073 -0.0013 -0.0294 0.0030  530  THR A N   
4635 C  CA  . THR A 533 ? 0.1263 0.1093 0.1032 0.0099  -0.0270 -0.0173 530  THR A CA  
4636 C  C   . THR A 533 ? 0.1335 0.1040 0.1003 -0.0050 -0.0217 -0.0039 530  THR A C   
4637 O  O   . THR A 533 ? 0.1460 0.1214 0.1088 -0.0086 -0.0277 0.0014  530  THR A O   
4638 C  CB  . THR A 533 ? 0.1224 0.1088 0.1120 0.0055  -0.0370 0.0027  530  THR A CB  
4639 O  OG1 . THR A 533 ? 0.1357 0.1531 0.1232 0.0114  -0.0300 0.0054  530  THR A OG1 
4640 C  CG2 . THR A 533 ? 0.1726 0.0984 0.1558 0.0446  -0.0501 0.0012  530  THR A CG2 
4641 N  N   . ARG A 534 ? 0.1382 0.1124 0.0940 0.0010  -0.0187 -0.0093 531  ARG A N   
4642 C  CA  . ARG A 534 ? 0.1380 0.1218 0.0955 -0.0016 -0.0079 0.0089  531  ARG A CA  
4643 C  C   . ARG A 534 ? 0.1363 0.1346 0.1340 -0.0077 -0.0080 0.0009  531  ARG A C   
4644 O  O   . ARG A 534 ? 0.1643 0.1284 0.1363 -0.0066 -0.0045 0.0106  531  ARG A O   
4645 C  CB  . ARG A 534 ? 0.1504 0.1286 0.1203 -0.0100 -0.0176 0.0061  531  ARG A CB  
4646 C  CG  . ARG A 534 ? 0.1688 0.1270 0.1376 -0.0268 -0.0077 -0.0144 531  ARG A CG  
4647 C  CD  . ARG A 534 ? 0.1799 0.1792 0.1356 -0.0289 0.0105  -0.0217 531  ARG A CD  
4648 N  NE  . ARG A 534 ? 0.1922 0.1697 0.1770 -0.0293 -0.0051 -0.0005 531  ARG A NE  
4649 C  CZ  . ARG A 534 ? 0.1668 0.1802 0.1706 -0.0143 0.0006  -0.0129 531  ARG A CZ  
4650 N  NH1 . ARG A 534 ? 0.2004 0.1771 0.1398 -0.0292 -0.0074 -0.0163 531  ARG A NH1 
4651 N  NH2 . ARG A 534 ? 0.1797 0.2089 0.1757 -0.0350 -0.0109 -0.0401 531  ARG A NH2 
4652 N  N   . GLN A 535 ? 0.1253 0.1227 0.1323 -0.0002 -0.0160 -0.0046 532  GLN A N   
4653 C  CA  . GLN A 535 ? 0.1288 0.1321 0.1396 -0.0031 -0.0190 -0.0006 532  GLN A CA  
4654 C  C   . GLN A 535 ? 0.1234 0.1290 0.1338 -0.0027 -0.0049 -0.0073 532  GLN A C   
4655 O  O   . GLN A 535 ? 0.1376 0.1494 0.1692 -0.0275 -0.0113 -0.0228 532  GLN A O   
4656 C  CB  . GLN A 535 ? 0.1103 0.1218 0.1342 -0.0044 -0.0288 -0.0049 532  GLN A CB  
4657 C  CG  . GLN A 535 ? 0.1127 0.1467 0.1298 0.0271  -0.0253 -0.0150 532  GLN A CG  
4658 C  CD  . GLN A 535 ? 0.2054 0.1779 0.1889 0.0015  -0.0179 0.0115  532  GLN A CD  
4659 O  OE1 . GLN A 535 ? 0.2018 0.1739 0.2299 0.0166  0.0166  -0.0493 532  GLN A OE1 
4660 N  NE2 . GLN A 535 ? 0.2759 0.1941 0.1759 0.0116  -0.0036 -0.0003 532  GLN A NE2 
4661 N  N   . LEU A 536 ? 0.1153 0.1175 0.1457 -0.0099 0.0000  -0.0123 533  LEU A N   
4662 C  CA  . LEU A 536 ? 0.1307 0.1315 0.1205 -0.0228 -0.0027 -0.0234 533  LEU A CA  
4663 C  C   . LEU A 536 ? 0.1432 0.1405 0.1409 -0.0152 0.0007  -0.0223 533  LEU A C   
4664 O  O   . LEU A 536 ? 0.1561 0.1466 0.1509 -0.0454 -0.0030 -0.0227 533  LEU A O   
4665 C  CB  . LEU A 536 ? 0.1298 0.1231 0.1051 -0.0204 -0.0146 -0.0259 533  LEU A CB  
4666 C  CG  . LEU A 536 ? 0.1438 0.1031 0.1026 -0.0188 -0.0088 -0.0212 533  LEU A CG  
4667 C  CD1 . LEU A 536 ? 0.1162 0.1765 0.1140 0.0097  -0.0193 -0.0150 533  LEU A CD1 
4668 C  CD2 . LEU A 536 ? 0.1403 0.1510 0.0828 -0.0047 -0.0605 -0.0359 533  LEU A CD2 
4669 N  N   . ILE A 537 ? 0.1551 0.1287 0.1415 -0.0261 0.0067  0.0009  534  ILE A N   
4670 C  CA  . ILE A 537 ? 0.1816 0.1467 0.1614 -0.0137 0.0156  0.0002  534  ILE A CA  
4671 C  C   . ILE A 537 ? 0.1826 0.1543 0.1590 -0.0255 0.0171  -0.0268 534  ILE A C   
4672 O  O   . ILE A 537 ? 0.2078 0.1660 0.2004 -0.0322 0.0377  -0.0311 534  ILE A O   
4673 C  CB  . ILE A 537 ? 0.1757 0.1580 0.1888 -0.0192 0.0130  0.0204  534  ILE A CB  
4674 C  CG1 . ILE A 537 ? 0.1982 0.1457 0.2046 0.0036  -0.0171 0.0375  534  ILE A CG1 
4675 C  CG2 . ILE A 537 ? 0.2470 0.1989 0.2201 -0.0254 0.0373  0.0429  534  ILE A CG2 
4676 C  CD1 . ILE A 537 ? 0.1708 0.2187 0.2475 0.0129  -0.0543 0.0082  534  ILE A CD1 
4677 N  N   . ALA A 538 ? 0.1820 0.1623 0.1698 -0.0104 0.0169  -0.0366 535  ALA A N   
4678 C  CA  . ALA A 538 ? 0.1752 0.1839 0.1751 -0.0098 0.0342  -0.0505 535  ALA A CA  
4679 C  C   . ALA A 538 ? 0.1825 0.2216 0.2089 -0.0176 0.0254  -0.0410 535  ALA A C   
4680 O  O   . ALA A 538 ? 0.2050 0.2405 0.2390 -0.0404 0.0441  -0.0350 535  ALA A O   
4681 C  CB  . ALA A 538 ? 0.1870 0.1867 0.1980 -0.0054 0.0392  -0.0575 535  ALA A CB  
4682 N  N   . LYS A 539 ? 0.1858 0.2395 0.1927 -0.0289 0.0163  -0.0323 536  LYS A N   
4683 C  CA  . LYS A 539 ? 0.1872 0.2488 0.2319 -0.0103 -0.0063 -0.0345 536  LYS A CA  
4684 C  C   . LYS A 539 ? 0.2144 0.2611 0.2629 -0.0172 -0.0154 -0.0344 536  LYS A C   
4685 O  O   . LYS A 539 ? 0.2307 0.2820 0.3435 -0.0244 -0.0381 -0.0540 536  LYS A O   
4686 C  CB  . LYS A 539 ? 0.2051 0.2677 0.2267 -0.0094 -0.0114 -0.0260 536  LYS A CB  
4687 C  CG  . LYS A 539 ? 0.2573 0.3048 0.2260 -0.0235 -0.0104 -0.0229 536  LYS A CG  
4688 C  CD  . LYS A 539 ? 0.3400 0.3385 0.3115 -0.0008 0.0045  0.0126  536  LYS A CD  
4689 C  CE  . LYS A 539 ? 0.3876 0.3568 0.3353 -0.0415 0.0277  0.0244  536  LYS A CE  
4690 N  NZ  . LYS A 539 ? 0.4072 0.3920 0.4387 -0.0403 0.0392  0.0430  536  LYS A NZ  
4691 N  N   . VAL A 540 ? 0.2198 0.2579 0.2839 -0.0137 -0.0091 -0.0455 537  VAL A N   
4692 C  CA  . VAL A 540 ? 0.2524 0.2766 0.3011 -0.0081 0.0079  -0.0372 537  VAL A CA  
4693 C  C   . VAL A 540 ? 0.3281 0.3410 0.3745 -0.0201 0.0070  -0.0194 537  VAL A C   
4694 O  O   . VAL A 540 ? 0.3176 0.3399 0.4265 -0.0211 0.0166  -0.0363 537  VAL A O   
4695 C  CB  . VAL A 540 ? 0.2461 0.2597 0.2723 -0.0138 -0.0130 -0.0301 537  VAL A CB  
4696 C  CG1 . VAL A 540 ? 0.2298 0.2553 0.2913 0.0258  0.0364  -0.0466 537  VAL A CG1 
4697 C  CG2 . VAL A 540 ? 0.1707 0.2327 0.2097 0.0337  -0.0183 -0.0337 537  VAL A CG2 
4698 N  N   . LYS A 541 ? 0.3759 0.3865 0.3895 -0.0171 0.0238  -0.0172 538  LYS A N   
4699 C  CA  A LYS A 541 ? 0.4125 0.4198 0.4269 -0.0145 0.0180  -0.0067 538  LYS A CA  
4700 C  CA  B LYS A 541 ? 0.4075 0.4121 0.4182 -0.0136 0.0167  -0.0083 538  LYS A CA  
4701 C  C   . LYS A 541 ? 0.4299 0.4415 0.4486 -0.0118 0.0185  -0.0082 538  LYS A C   
4702 O  O   . LYS A 541 ? 0.4617 0.4558 0.4825 -0.0244 0.0170  -0.0066 538  LYS A O   
4703 C  CB  A LYS A 541 ? 0.4074 0.4221 0.4173 -0.0124 0.0221  -0.0038 538  LYS A CB  
4704 C  CB  B LYS A 541 ? 0.4005 0.4096 0.4081 -0.0115 0.0201  -0.0068 538  LYS A CB  
4705 C  CG  A LYS A 541 ? 0.4129 0.4300 0.4200 -0.0076 0.0151  0.0025  538  LYS A CG  
4706 C  CG  B LYS A 541 ? 0.3887 0.3935 0.3890 -0.0083 0.0128  -0.0087 538  LYS A CG  
4707 C  CD  A LYS A 541 ? 0.4227 0.4400 0.4316 0.0007  0.0046  0.0073  538  LYS A CD  
4708 C  CD  B LYS A 541 ? 0.3572 0.3686 0.3455 -0.0033 0.0293  -0.0014 538  LYS A CD  
4709 C  CE  A LYS A 541 ? 0.4123 0.4454 0.4227 0.0080  0.0067  0.0057  538  LYS A CE  
4710 C  CE  B LYS A 541 ? 0.3466 0.3515 0.3294 -0.0034 0.0202  -0.0068 538  LYS A CE  
4711 N  NZ  A LYS A 541 ? 0.3878 0.4235 0.4076 0.0272  0.0562  0.0198  538  LYS A NZ  
4712 N  NZ  B LYS A 541 ? 0.3301 0.3380 0.2937 -0.0023 0.0396  -0.0025 538  LYS A NZ  
4713 N  N   . ASN A 542 ? 0.4679 0.4698 0.4840 -0.0033 0.0158  -0.0073 539  ASN A N   
4714 C  CA  . ASN A 542 ? 0.5102 0.5166 0.5263 -0.0022 0.0081  -0.0073 539  ASN A CA  
4715 C  C   . ASN A 542 ? 0.5334 0.5407 0.5471 0.0000  0.0000  -0.0044 539  ASN A C   
4716 O  O   . ASN A 542 ? 0.5371 0.5482 0.5698 0.0037  -0.0049 -0.0028 539  ASN A O   
4717 C  CB  . ASN A 542 ? 0.5135 0.5219 0.5268 0.0019  0.0175  -0.0114 539  ASN A CB  
4718 C  CG  . ASN A 542 ? 0.5263 0.5460 0.5131 -0.0114 0.0430  -0.0165 539  ASN A CG  
4719 O  OD1 . ASN A 542 ? 0.5439 0.5736 0.5663 -0.0265 0.0670  0.0052  539  ASN A OD1 
4720 N  ND2 . ASN A 542 ? 0.4867 0.5927 0.4033 -0.0314 0.1540  -0.0262 539  ASN A ND2 
4721 N  N   . LYS A 543 ? 0.5550 0.5671 0.5703 -0.0013 0.0011  -0.0025 540  LYS A N   
4722 C  CA  . LYS A 543 ? 0.5709 0.5800 0.5817 -0.0051 -0.0040 -0.0002 540  LYS A CA  
4723 C  C   . LYS A 543 ? 0.5738 0.5855 0.5891 -0.0072 -0.0054 0.0025  540  LYS A C   
4724 O  O   . LYS A 543 ? 0.5735 0.5876 0.5938 -0.0100 -0.0071 0.0051  540  LYS A O   
4725 C  CB  . LYS A 543 ? 0.5762 0.5828 0.5862 -0.0044 -0.0058 -0.0008 540  LYS A CB  
4726 C  CG  . LYS A 543 ? 0.5842 0.5901 0.5902 -0.0068 -0.0070 0.0049  540  LYS A CG  
4727 C  CD  . LYS A 543 ? 0.6044 0.6024 0.6018 -0.0116 -0.0160 0.0154  540  LYS A CD  
4728 C  CE  . LYS A 543 ? 0.6061 0.5878 0.6008 -0.0036 -0.0177 0.0237  540  LYS A CE  
4729 N  NZ  . LYS A 543 ? 0.6004 0.5993 0.6117 -0.0231 -0.0135 0.0313  540  LYS A NZ  
4730 O  OXT . LYS A 543 ? 0.5775 0.5920 0.5956 -0.0095 -0.0083 0.0085  540  LYS A OXT 
4731 O  O1  . MES B .   ? 0.4738 0.4274 0.4902 0.0174  -0.0268 0.0308  601  MES A O1  
4732 C  C2  . MES B .   ? 0.4193 0.4076 0.4638 0.0117  -0.0338 0.0461  601  MES A C2  
4733 C  C3  . MES B .   ? 0.3594 0.3846 0.4243 0.0001  -0.0425 0.0304  601  MES A C3  
4734 N  N4  . MES B .   ? 0.3805 0.3782 0.4366 -0.0184 -0.0191 0.0100  601  MES A N4  
4735 C  C5  . MES B .   ? 0.4395 0.4419 0.4809 -0.0009 -0.0136 0.0292  601  MES A C5  
4736 C  C6  . MES B .   ? 0.4529 0.4585 0.4819 0.0140  -0.0310 0.0091  601  MES A C6  
4737 C  C7  . MES B .   ? 0.2896 0.3143 0.3537 -0.0059 -0.0368 0.0084  601  MES A C7  
4738 C  C8  . MES B .   ? 0.2689 0.2650 0.3342 -0.0247 -0.0423 0.0186  601  MES A C8  
4739 S  S   . MES B .   ? 0.2262 0.2162 0.2591 -0.0132 -0.0281 -0.0002 601  MES A S   
4740 O  O1S . MES B .   ? 0.3037 0.2951 0.2906 0.0046  -0.0022 -0.0540 601  MES A O1S 
4741 O  O2S . MES B .   ? 0.2596 0.2365 0.3161 -0.0147 -0.0626 0.0145  601  MES A O2S 
4742 O  O3S . MES B .   ? 0.1702 0.1687 0.2714 -0.0367 -0.0378 -0.0088 601  MES A O3S 
4743 C  C1  . GOL C .   ? 0.4083 0.4456 0.3916 0.0390  -0.0469 0.0885  602  GOL A C1  
4744 O  O1  . GOL C .   ? 0.4019 0.4474 0.2968 0.0904  -0.0320 0.0701  602  GOL A O1  
4745 C  C2  . GOL C .   ? 0.4367 0.4478 0.4828 0.0516  -0.0657 0.0948  602  GOL A C2  
4746 O  O2  . GOL C .   ? 0.4226 0.4288 0.4673 0.0333  -0.0697 0.1333  602  GOL A O2  
4747 C  C3  . GOL C .   ? 0.4386 0.4781 0.4933 0.0309  -0.0669 0.0848  602  GOL A C3  
4748 O  O3  . GOL C .   ? 0.4689 0.5077 0.5634 -0.0152 -0.0721 0.0625  602  GOL A O3  
4749 C  C1  . IPA D .   ? 0.2816 0.3068 0.3070 0.0267  0.0033  0.0812  603  IPA A C1  
4750 C  C2  . IPA D .   ? 0.3179 0.3510 0.4192 0.0348  0.0109  0.0559  603  IPA A C2  
4751 C  C3  . IPA D .   ? 0.2873 0.2828 0.3735 -0.0145 0.0744  0.0114  603  IPA A C3  
4752 O  O2  . IPA D .   ? 0.2766 0.4305 0.3730 0.0461  -0.0416 0.0181  603  IPA A O2  
4753 CA CA  . CA  E .   ? 0.1879 0.3604 0.3590 -0.0400 -0.0508 0.0948  604  CA  A CA  
4754 O  O   . HOH F .   ? 0.2447 1.3486 0.2979 -0.1967 -0.0204 -0.1569 541  HOH A O   
4755 O  O   . HOH F .   ? 0.3787 0.9481 0.3973 -0.0719 0.0902  -0.1527 542  HOH A O   
4756 O  O   . HOH F .   ? 0.4078 0.6109 0.8175 0.0268  -0.0316 -0.0726 543  HOH A O   
4757 O  O   . HOH F .   ? 0.7485 0.5140 0.4450 0.0514  -0.1952 -0.0329 544  HOH A O   
4758 O  O   . HOH F .   ? 0.4184 0.9424 0.4798 0.3458  -0.2122 -0.2983 545  HOH A O   
4759 O  O   . HOH F .   ? 0.3401 0.5021 0.7659 0.0334  0.0709  0.0660  546  HOH A O   
4760 O  O   . HOH F .   ? 0.5685 0.5276 0.6658 0.0902  0.1525  -0.0695 547  HOH A O   
4761 O  O   . HOH F .   ? 0.4074 0.6380 0.4412 0.0352  0.1410  -0.0481 548  HOH A O   
4762 O  O   . HOH F .   ? 0.5866 0.4268 0.5892 0.1669  -0.0557 0.0427  549  HOH A O   
4763 O  O   . HOH F .   ? 0.4210 0.6238 0.6485 0.1316  0.1148  -0.1832 550  HOH A O   
4764 O  O   . HOH F .   ? 0.4777 0.8401 0.1736 -0.0651 -0.0260 -0.0882 551  HOH A O   
4765 O  O   . HOH F .   ? 0.5061 0.5507 0.3131 -0.1914 -0.1044 0.0856  552  HOH A O   
4766 O  O   . HOH F .   ? 1.1073 0.4677 0.5754 -0.2271 -0.1553 -0.2567 553  HOH A O   
4767 O  O   . HOH F .   ? 0.2889 0.7364 0.6832 -0.1013 0.0130  -0.2685 554  HOH A O   
4768 O  O   . HOH F .   ? 0.4508 0.4380 0.5125 0.1000  0.0198  0.0612  555  HOH A O   
4769 O  O   . HOH F .   ? 0.3610 0.5107 0.4434 0.1281  -0.0840 -0.0476 556  HOH A O   
4770 O  O   . HOH F .   ? 0.7411 0.5514 0.4829 -0.3244 0.2165  -0.0738 557  HOH A O   
4771 O  O   . HOH F .   ? 0.3525 0.9722 0.4715 -0.0825 0.0342  -0.3363 558  HOH A O   
4772 O  O   . HOH F .   ? 0.2669 0.5958 0.7643 -0.0975 0.0368  -0.1786 559  HOH A O   
4773 O  O   . HOH F .   ? 0.6389 0.3695 0.6519 -0.0656 -0.2188 0.1832  560  HOH A O   
4774 O  O   . HOH F .   ? 0.4961 0.4718 0.5111 0.0773  0.0341  -0.0003 561  HOH A O   
4775 O  O   . HOH F .   ? 0.5188 0.4209 0.7325 -0.1115 0.0832  0.0537  562  HOH A O   
4776 O  O   . HOH F .   ? 0.5127 0.5902 0.5001 -0.2257 -0.1499 0.1234  563  HOH A O   
4777 O  O   . HOH F .   ? 0.8710 0.4740 0.6637 0.0426  0.0548  0.1831  564  HOH A O   
4778 O  O   . HOH F .   ? 0.2839 0.3805 1.0255 -0.1704 0.2055  -0.1947 565  HOH A O   
4779 O  O   . HOH F .   ? 0.3886 0.6330 0.5676 0.0807  -0.0778 -0.3104 566  HOH A O   
4780 O  O   . HOH F .   ? 0.5296 0.4499 0.5797 0.1984  0.1455  0.0037  567  HOH A O   
4781 O  O   . HOH F .   ? 0.4503 0.3894 0.6854 0.0785  0.0827  -0.0655 568  HOH A O   
4782 O  O   . HOH F .   ? 0.6141 0.4485 0.5317 -0.0164 -0.1458 -0.0690 569  HOH A O   
4783 O  O   . HOH F .   ? 0.4386 0.6242 0.8065 -0.0559 0.1161  0.1154  570  HOH A O   
4784 O  O   . HOH F .   ? 0.3862 0.7001 0.5529 0.1128  0.0082  0.1583  571  HOH A O   
4785 O  O   . HOH F .   ? 0.4219 0.6247 0.4291 -0.1480 0.0448  -0.2730 572  HOH A O   
4786 O  O   . HOH F .   ? 0.1799 0.8198 0.9067 0.0843  0.0347  -0.0718 573  HOH A O   
4787 O  O   . HOH F .   ? 0.5643 0.4152 0.3905 -0.0824 0.0205  -0.0439 574  HOH A O   
4788 O  O   . HOH F .   ? 0.5816 0.6873 0.6610 -0.3276 0.1442  -0.0648 575  HOH A O   
4789 O  O   . HOH F .   ? 0.2232 0.2299 0.1630 -0.0011 -0.0295 -0.0227 576  HOH A O   
4790 O  O   . HOH F .   ? 0.3177 0.1946 0.6382 -0.0678 0.0337  0.0114  577  HOH A O   
4791 O  O   . HOH F .   ? 0.4047 0.1731 0.2516 -0.0489 -0.0639 -0.0119 578  HOH A O   
4792 O  O   . HOH F .   ? 0.4405 0.4146 0.4409 0.0180  -0.1268 0.1127  579  HOH A O   
4793 O  O   . HOH F .   ? 0.2198 0.3953 0.3185 0.0031  -0.0712 -0.0750 580  HOH A O   
4794 O  O   . HOH F .   ? 0.2772 0.9466 0.5085 -0.1996 -0.0015 -0.2509 581  HOH A O   
4795 O  O   . HOH F .   ? 0.2546 0.2919 0.2125 0.0462  -0.0774 -0.0261 582  HOH A O   
4796 O  O   . HOH F .   ? 0.4919 0.2992 0.5925 0.1070  0.1292  0.1389  583  HOH A O   
4797 O  O   . HOH F .   ? 0.3393 0.3001 0.2140 -0.1354 -0.0201 0.0438  584  HOH A O   
4798 O  O   . HOH F .   ? 0.4151 0.2923 0.4297 -0.0852 -0.0252 0.0397  585  HOH A O   
4799 O  O   . HOH F .   ? 0.5145 0.3264 0.2774 -0.0594 -0.0775 -0.0145 586  HOH A O   
4800 O  O   . HOH F .   ? 0.3766 0.3306 0.4369 -0.1350 0.0000  -0.0800 587  HOH A O   
4801 O  O   . HOH F .   ? 0.5385 0.3065 0.3923 -0.0663 -0.1358 -0.0014 588  HOH A O   
4802 O  O   . HOH F .   ? 0.2827 0.3468 0.5850 -0.0465 -0.0507 -0.1213 589  HOH A O   
4803 O  O   . HOH F .   ? 0.8921 0.5063 0.7200 -0.0176 0.1220  -0.2859 590  HOH A O   
4804 O  O   . HOH F .   ? 0.5313 0.8794 0.3407 0.0507  -0.1048 -0.0812 591  HOH A O   
4805 O  O   . HOH F .   ? 0.4765 0.3031 0.3155 -0.1233 0.0746  -0.0032 592  HOH A O   
4806 O  O   . HOH F .   ? 0.8150 0.7176 0.5664 0.1032  0.3223  -0.0240 593  HOH A O   
4807 O  O   . HOH F .   ? 0.2985 0.5894 0.3936 0.0132  0.0157  0.0952  594  HOH A O   
4808 O  O   . HOH F .   ? 0.5061 0.6886 0.3768 -0.1126 -0.0726 0.1892  595  HOH A O   
4809 O  O   . HOH F .   ? 0.3462 0.4126 0.3787 -0.0574 -0.1229 0.0530  596  HOH A O   
4810 O  O   . HOH F .   ? 0.4774 0.5846 0.3983 0.0549  -0.0736 0.1433  597  HOH A O   
4811 O  O   . HOH F .   ? 0.5900 0.4137 0.9480 -0.0714 0.2285  0.1013  598  HOH A O   
4812 O  O   . HOH F .   ? 0.3709 0.8938 0.4504 -0.0931 0.0780  0.0319  599  HOH A O   
4813 O  O   . HOH F .   ? 0.7142 0.3306 1.0431 0.1222  0.1576  -0.0431 600  HOH A O   
4814 O  O   . HOH F .   ? 0.2139 0.4294 0.4784 -0.1891 0.1079  -0.2315 605  HOH A O   
4815 O  O   . HOH F .   ? 0.7673 0.3277 0.6438 0.0416  0.2122  0.1630  606  HOH A O   
4816 O  O   . HOH F .   ? 0.1110 0.1796 0.1532 0.0061  -0.0226 -0.0179 607  HOH A O   
4817 O  O   . HOH F .   ? 0.1118 0.1822 0.1568 -0.0222 -0.0136 0.0281  608  HOH A O   
4818 O  O   . HOH F .   ? 0.1697 0.1352 0.1667 0.0016  0.0051  -0.0037 609  HOH A O   
4819 O  O   . HOH F .   ? 0.2849 0.1818 0.1471 -0.0188 -0.0031 -0.0154 610  HOH A O   
4820 O  O   . HOH F .   ? 0.2202 0.2219 0.1654 0.0160  0.0096  -0.0275 611  HOH A O   
4821 O  O   . HOH F .   ? 0.1568 0.3296 0.2751 -0.0598 -0.0041 -0.1051 612  HOH A O   
4822 O  O   . HOH F .   ? 0.3083 0.1700 0.2176 0.0572  0.0575  0.0174  613  HOH A O   
4823 O  O   . HOH F .   ? 0.3433 0.2726 0.2010 -0.1012 -0.0288 -0.0020 614  HOH A O   
4824 O  O   . HOH F .   ? 0.2722 0.3655 0.2123 0.0390  -0.0348 0.0434  615  HOH A O   
4825 O  O   . HOH F .   ? 0.8867 0.5152 0.3340 -0.2490 0.0562  -0.1091 616  HOH A O   
4826 O  O   . HOH F .   ? 0.2480 0.4671 0.2886 0.1526  0.0775  0.0590  617  HOH A O   
4827 O  O   . HOH F .   ? 0.2950 0.2645 0.2447 -0.0179 -0.0413 0.0372  618  HOH A O   
4828 O  O   . HOH F .   ? 0.3594 0.3942 0.2601 -0.0360 -0.0345 -0.0470 619  HOH A O   
4829 O  O   . HOH F .   ? 0.4281 0.3378 0.2887 -0.1354 0.1601  -0.0854 620  HOH A O   
4830 O  O   . HOH F .   ? 0.2911 0.4156 0.7335 -0.0733 -0.0629 0.1244  621  HOH A O   
4831 O  O   . HOH F .   ? 0.4598 0.5699 0.6829 0.2240  -0.0325 -0.1581 622  HOH A O   
4832 O  O   . HOH F .   ? 0.3957 0.3114 0.2434 0.1150  -0.0062 -0.0367 623  HOH A O   
4833 O  O   . HOH F .   ? 0.3616 0.4117 0.3881 -0.0948 -0.0327 0.1018  624  HOH A O   
4834 O  O   . HOH F .   ? 0.3147 0.4549 0.9054 -0.1371 -0.2378 0.5762  625  HOH A O   
4835 O  O   . HOH F .   ? 0.3607 0.4567 0.4665 0.1092  -0.0688 0.0690  626  HOH A O   
4836 O  O   . HOH F .   ? 0.3845 0.3026 0.4514 0.0814  -0.0346 -0.0357 627  HOH A O   
4837 O  O   . HOH F .   ? 0.3450 0.4359 0.4590 -0.0218 0.0045  -0.0103 628  HOH A O   
4838 O  O   . HOH F .   ? 0.4555 0.3424 0.5882 0.0059  0.2322  -0.0051 629  HOH A O   
4839 O  O   . HOH F .   ? 0.2291 0.5914 0.3837 -0.1245 -0.0061 -0.0108 630  HOH A O   
4840 O  O   . HOH F .   ? 0.1883 0.4902 0.4296 0.0066  0.0230  0.1388  631  HOH A O   
4841 O  O   . HOH F .   ? 0.3962 0.6803 0.3209 0.1480  -0.0393 0.0951  632  HOH A O   
4842 O  O   . HOH F .   ? 0.6892 0.8617 0.4839 -0.1195 -0.3098 0.0528  633  HOH A O   
4843 O  O   . HOH F .   ? 0.3981 0.7448 0.4068 -0.0543 -0.0852 0.1147  634  HOH A O   
4844 O  O   . HOH F .   ? 0.2433 0.4897 0.3231 0.0715  0.0079  -0.0443 635  HOH A O   
4845 O  O   . HOH F .   ? 0.3809 0.5624 0.6575 0.1297  -0.0968 -0.2594 636  HOH A O   
4846 O  O   . HOH F .   ? 0.4286 0.6820 0.6922 -0.0345 -0.1497 -0.0335 637  HOH A O   
4847 O  O   . HOH F .   ? 0.9503 0.5039 0.5020 -0.0628 -0.0180 0.2767  638  HOH A O   
4848 O  O   . HOH F .   ? 0.9087 0.4928 0.6047 -0.1137 -0.1071 0.5141  639  HOH A O   
4849 O  O   . HOH F .   ? 0.5219 0.3825 0.6029 0.0302  -0.0113 0.1068  640  HOH A O   
4850 O  O   . HOH F .   ? 0.6092 0.5271 0.7106 -0.0642 -0.1393 -0.1899 641  HOH A O   
4851 O  O   . HOH F .   ? 0.4641 0.1986 0.5621 -0.0004 0.0924  -0.0306 642  HOH A O   
4852 O  O   . HOH F .   ? 0.3768 0.3947 0.2997 0.0187  -0.0411 0.0751  643  HOH A O   
4853 O  O   . HOH F .   ? 0.2063 0.2687 0.2318 0.0638  -0.0146 0.0689  644  HOH A O   
4854 O  O   . HOH F .   ? 0.4665 0.7642 0.2017 -0.2559 0.0788  -0.0673 645  HOH A O   
4855 O  O   . HOH F .   ? 0.3434 0.3861 0.8865 -0.0042 -0.0923 -0.2397 646  HOH A O   
4856 O  O   . HOH F .   ? 0.6696 0.3855 0.7646 0.1763  -0.0951 0.0393  647  HOH A O   
4857 O  O   . HOH F .   ? 0.3710 0.3102 0.2330 -0.0193 -0.0469 -0.0663 648  HOH A O   
4858 O  O   . HOH F .   ? 0.5001 0.5010 0.4194 0.0792  -0.0288 0.1469  649  HOH A O   
4859 O  O   . HOH F .   ? 0.4433 0.4089 0.5110 -0.0351 0.0887  -0.2210 650  HOH A O   
4860 O  O   . HOH F .   ? 0.7344 0.2740 0.3393 -0.1002 0.0872  -0.0720 651  HOH A O   
4861 O  O   . HOH F .   ? 0.4532 0.3083 0.6537 0.1325  -0.2681 -0.1711 652  HOH A O   
4862 O  O   . HOH F .   ? 0.4086 0.5515 0.5650 0.1622  -0.1678 -0.1280 653  HOH A O   
4863 O  O   . HOH F .   ? 0.5645 0.4674 0.3823 0.0741  0.1283  -0.1512 654  HOH A O   
4864 O  O   . HOH F .   ? 0.4714 0.4529 0.3072 0.0525  -0.1082 -0.0853 655  HOH A O   
4865 O  O   . HOH F .   ? 0.4122 0.4099 0.5880 0.0365  0.1017  0.0718  656  HOH A O   
4866 O  O   . HOH F .   ? 0.3156 0.3910 0.4949 0.0681  -0.1464 -0.1199 657  HOH A O   
4867 O  O   . HOH F .   ? 0.2322 0.3073 0.4749 0.0640  0.0025  -0.0656 658  HOH A O   
4868 O  O   . HOH F .   ? 0.2812 0.3913 0.5678 -0.0315 -0.0196 0.1208  659  HOH A O   
4869 O  O   . HOH F .   ? 0.4162 0.3533 0.5795 -0.1017 -0.0214 -0.0392 660  HOH A O   
4870 O  O   . HOH F .   ? 0.5430 0.4899 0.3140 0.0247  0.1678  -0.0169 661  HOH A O   
4871 O  O   . HOH F .   ? 0.6145 0.8063 0.6853 0.1465  0.1777  0.1529  662  HOH A O   
4872 O  O   . HOH F .   ? 0.5096 0.8043 0.3053 0.0095  -0.1048 -0.0713 663  HOH A O   
4873 O  O   . HOH F .   ? 0.2280 0.3793 0.2943 -0.0391 0.0069  0.0296  664  HOH A O   
4874 O  O   . HOH F .   ? 0.2537 0.4869 0.5378 -0.0233 -0.1263 -0.0353 665  HOH A O   
4875 O  O   . HOH F .   ? 0.4511 0.3025 0.1639 -0.2668 -0.0212 0.0306  666  HOH A O   
4876 O  O   . HOH F .   ? 0.5619 0.5022 0.6276 0.0534  0.4312  -0.0417 667  HOH A O   
4877 O  O   . HOH F .   ? 0.5647 0.5848 0.4144 -0.0901 -0.0157 -0.0675 668  HOH A O   
4878 O  O   . HOH F .   ? 1.2393 0.6337 0.2192 0.2212  -0.0980 0.3071  669  HOH A O   
4879 O  O   . HOH F .   ? 0.5229 0.3737 1.0718 -0.1267 0.1038  0.0210  670  HOH A O   
4880 O  O   . HOH F .   ? 0.3285 0.3824 0.5753 0.1136  0.0887  0.1282  671  HOH A O   
4881 O  O   . HOH F .   ? 0.8207 0.2413 0.6092 0.0325  0.1938  0.0020  672  HOH A O   
4882 O  O   . HOH F .   ? 0.4554 0.7029 0.6181 0.1512  0.0334  0.1965  673  HOH A O   
4883 O  O   . HOH F .   ? 0.8263 0.3820 0.4219 0.0045  -0.0274 -0.0148 674  HOH A O   
4884 O  O   . HOH F .   ? 0.6911 0.4043 0.5755 0.1383  0.0000  -0.3089 675  HOH A O   
4885 O  O   A HOH F .   ? 0.3494 0.2441 0.5038 -0.0447 0.0053  -0.0907 676  HOH A O   
4886 O  O   . HOH F .   ? 0.4522 0.7214 0.5819 0.0001  -0.1783 -0.0145 677  HOH A O   
4887 O  O   . HOH F .   ? 0.5714 0.5218 1.1086 0.1552  -0.1454 -0.4410 678  HOH A O   
4888 O  O   . HOH F .   ? 0.2879 0.7535 0.5429 0.0508  0.0764  -0.0583 679  HOH A O   
4889 O  O   A HOH F .   ? 0.4283 0.8218 0.5610 -0.2430 0.2481  -0.5454 680  HOH A O   
4890 O  O   A HOH F .   ? 0.5547 0.3902 0.3633 0.1059  -0.1102 0.0442  681  HOH A O   
4891 O  O   . HOH F .   ? 0.2449 1.0607 0.7077 -0.0733 -0.0941 0.0966  682  HOH A O   
4892 O  O   . HOH F .   ? 0.6435 0.6831 0.8685 -0.2078 0.4111  0.0364  683  HOH A O   
4893 O  O   . HOH F .   ? 0.5905 0.6731 0.4756 0.2502  -0.1878 0.0492  684  HOH A O   
4894 O  O   . HOH F .   ? 1.1112 0.4569 0.4114 0.2034  0.2274  -0.0968 685  HOH A O   
4895 O  O   . HOH F .   ? 0.7984 0.3910 0.6276 0.1853  0.1130  0.0673  686  HOH A O   
4896 O  O   . HOH F .   ? 0.8296 0.6698 0.3512 0.1471  0.1563  0.0907  687  HOH A O   
4897 O  O   . HOH F .   ? 0.6510 0.5072 0.5240 0.0765  0.1992  -0.1493 688  HOH A O   
4898 O  O   . HOH F .   ? 0.4952 0.5202 0.8272 0.0795  -0.0956 0.3308  689  HOH A O   
4899 O  O   . HOH F .   ? 0.7395 0.7288 0.5291 -0.1048 -0.1489 0.3261  690  HOH A O   
4900 O  O   . HOH F .   ? 0.2462 0.7738 0.7803 -0.0162 -0.0183 0.1668  691  HOH A O   
4901 O  O   . HOH F .   ? 0.5065 0.3880 0.6111 0.1862  -0.1932 -0.1731 692  HOH A O   
4902 O  O   . HOH F .   ? 0.6028 0.4176 0.4569 0.1378  0.1040  -0.1660 693  HOH A O   
4903 O  O   . HOH F .   ? 0.5965 0.5721 0.4608 0.1390  -0.0392 -0.0882 694  HOH A O   
4904 O  O   . HOH F .   ? 0.7703 0.3404 0.5458 0.1509  0.3335  0.1533  695  HOH A O   
4905 O  O   . HOH F .   ? 0.5594 0.3103 0.5900 0.0843  -0.0129 -0.0050 696  HOH A O   
4906 O  O   . HOH F .   ? 0.9312 0.4621 0.6294 -0.0606 -0.0172 0.3468  697  HOH A O   
4907 O  O   . HOH F .   ? 0.5287 0.7183 0.6199 -0.1666 0.0383  -0.1402 698  HOH A O   
4908 O  O   . HOH F .   ? 0.6445 0.4644 0.5219 0.0328  0.0139  -0.1258 699  HOH A O   
4909 O  O   . HOH F .   ? 0.5958 0.9294 0.5268 -0.0766 -0.1817 -0.0938 700  HOH A O   
4910 O  O   . HOH F .   ? 0.8385 0.3255 0.5415 -0.0829 0.2089  0.0787  701  HOH A O   
4911 O  O   A HOH F .   ? 0.6615 0.2640 0.2377 -0.0141 0.1378  0.0773  702  HOH A O   
4912 O  O   . HOH F .   ? 0.6069 0.6247 0.4039 0.1552  -0.1643 0.0608  703  HOH A O   
4913 O  O   . HOH F .   ? 0.4009 0.5531 0.7189 0.1307  -0.0372 -0.0634 704  HOH A O   
4914 O  O   . HOH F .   ? 0.4395 0.8289 0.2511 -0.3019 0.0463  -0.1353 705  HOH A O   
4915 O  O   . HOH F .   ? 0.9619 0.3685 0.4626 -0.1134 0.4506  -0.1302 706  HOH A O   
4916 O  O   . HOH F .   ? 0.7677 0.3385 0.8787 0.0065  0.1417  -0.2838 707  HOH A O   
4917 O  O   . HOH F .   ? 0.8914 0.5942 0.6820 -0.4211 0.1105  -0.1314 708  HOH A O   
4918 O  O   . HOH F .   ? 0.6587 0.3779 0.6145 -0.0573 0.1462  0.0372  709  HOH A O   
4919 O  O   . HOH F .   ? 0.1217 0.1647 0.1708 0.0133  0.0165  0.0104  710  HOH A O   
4920 O  O   . HOH F .   ? 0.9316 0.3991 0.8745 0.1843  -0.1939 -0.1851 711  HOH A O   
4921 O  O   . HOH F .   ? 0.3092 0.6684 0.5592 0.1829  0.0811  0.1088  712  HOH A O   
4922 O  O   . HOH F .   ? 0.7814 0.6465 0.6499 0.2023  -0.3394 -0.2178 713  HOH A O   
4923 O  O   . HOH F .   ? 0.4653 0.4622 0.6099 0.1250  0.0321  -0.1115 714  HOH A O   
4924 O  O   . HOH F .   ? 0.7281 1.0144 0.4889 -0.2874 0.1159  -0.2495 715  HOH A O   
4925 O  O   . HOH F .   ? 0.1987 0.4392 0.2922 -0.0998 0.0325  0.0083  716  HOH A O   
4926 O  O   . HOH F .   ? 0.5472 0.5915 0.7998 -0.2637 0.2390  0.0693  717  HOH A O   
4927 O  O   . HOH F .   ? 0.9049 0.3973 0.4119 -0.0510 0.0415  0.0302  718  HOH A O   
4928 O  O   . HOH F .   ? 0.7551 0.4343 0.7207 0.0812  -0.4046 -0.1534 719  HOH A O   
4929 O  O   . HOH F .   ? 0.4283 0.3523 0.3857 0.0300  -0.0632 0.0377  720  HOH A O   
4930 O  O   . HOH F .   ? 0.7410 0.4946 0.3485 -0.3240 0.1160  -0.0564 721  HOH A O   
4931 O  O   . HOH F .   ? 0.4834 0.6415 0.3803 -0.0859 0.0886  0.0179  722  HOH A O   
4932 O  O   . HOH F .   ? 0.3189 0.4430 0.4686 -0.0702 -0.0449 -0.0134 723  HOH A O   
4933 O  O   . HOH F .   ? 0.2331 0.2881 0.2711 -0.0770 -0.0465 0.0834  724  HOH A O   
4934 O  O   . HOH F .   ? 0.2731 0.1831 0.1330 0.0360  -0.0310 0.0350  725  HOH A O   
4935 O  O   . HOH F .   ? 0.1773 0.1565 0.1681 0.0377  0.0111  0.0247  726  HOH A O   
4936 O  O   . HOH F .   ? 0.1376 0.1723 0.2151 -0.0150 0.0002  -0.0104 727  HOH A O   
4937 O  O   . HOH F .   ? 0.1749 0.1616 0.1870 -0.0145 -0.0214 -0.0189 728  HOH A O   
4938 O  O   . HOH F .   ? 0.1633 0.3566 0.2338 -0.0114 0.0161  -0.0229 729  HOH A O   
4939 O  O   . HOH F .   ? 0.2056 0.7432 0.2752 -0.0813 0.0027  0.0972  730  HOH A O   
4940 O  O   . HOH F .   ? 0.2744 0.3003 0.2014 0.0421  0.0050  0.0672  731  HOH A O   
4941 O  O   . HOH F .   ? 0.1173 0.1258 0.1222 -0.0112 0.0091  -0.0047 732  HOH A O   
4942 O  O   . HOH F .   ? 0.2151 0.1619 0.2066 0.0173  0.0017  0.0364  733  HOH A O   
4943 O  O   . HOH F .   ? 0.1299 0.1410 0.1424 0.0035  -0.0111 0.0168  734  HOH A O   
4944 O  O   . HOH F .   ? 0.1531 0.1264 0.1413 -0.0094 0.0033  -0.0185 735  HOH A O   
4945 O  O   . HOH F .   ? 0.1501 0.1479 0.1464 0.0065  -0.0098 -0.0032 736  HOH A O   
4946 O  O   . HOH F .   ? 0.1894 0.2056 0.2260 -0.0228 -0.0063 -0.0366 737  HOH A O   
4947 O  O   . HOH F .   ? 0.1408 0.1807 0.1525 -0.0002 -0.0351 0.0011  738  HOH A O   
4948 O  O   . HOH F .   ? 0.1428 0.1394 0.1301 -0.0077 -0.0172 0.0055  739  HOH A O   
4949 O  O   . HOH F .   ? 0.1524 0.1878 0.1482 -0.0023 -0.0039 0.0013  740  HOH A O   
4950 O  O   . HOH F .   ? 0.1695 0.1861 0.1654 -0.0088 0.0028  0.0011  741  HOH A O   
4951 O  O   . HOH F .   ? 0.1564 0.1976 0.2384 -0.0115 0.0125  -0.0286 742  HOH A O   
4952 O  O   . HOH F .   ? 0.1567 0.1826 0.2093 -0.0198 -0.0209 -0.0143 743  HOH A O   
4953 O  O   . HOH F .   ? 0.1387 0.1536 0.1465 0.0157  -0.0181 -0.0019 744  HOH A O   
4954 O  O   . HOH F .   ? 0.1226 0.1181 0.1303 0.0000  -0.0082 0.0023  745  HOH A O   
4955 O  O   . HOH F .   ? 0.1389 0.1692 0.1641 -0.0061 -0.0201 0.0216  746  HOH A O   
4956 O  O   . HOH F .   ? 0.1354 0.1223 0.1609 0.0041  -0.0129 0.0114  747  HOH A O   
4957 O  O   . HOH F .   ? 0.1702 0.1580 0.1561 0.0224  0.0031  -0.0093 748  HOH A O   
4958 O  O   . HOH F .   ? 0.1092 0.1405 0.1407 -0.0007 0.0078  0.0054  749  HOH A O   
4959 O  O   . HOH F .   ? 0.1328 0.1258 0.1699 -0.0085 -0.0117 0.0002  750  HOH A O   
4960 O  O   . HOH F .   ? 0.2060 0.1963 0.1480 0.0396  0.0010  -0.0385 751  HOH A O   
4961 O  O   . HOH F .   ? 0.1475 0.1641 0.1532 -0.0027 -0.0069 -0.0165 752  HOH A O   
4962 O  O   . HOH F .   ? 0.0992 0.1406 0.1369 0.0067  -0.0082 0.0232  753  HOH A O   
4963 O  O   . HOH F .   ? 0.1575 0.1649 0.1669 -0.0040 -0.0013 0.0232  754  HOH A O   
4964 O  O   . HOH F .   ? 0.1296 0.1257 0.1034 -0.0281 -0.0163 -0.0055 755  HOH A O   
4965 O  O   . HOH F .   ? 0.1553 0.1438 0.1291 0.0006  -0.0041 -0.0074 756  HOH A O   
4966 O  O   . HOH F .   ? 0.1421 0.1451 0.1175 0.0161  -0.0025 0.0142  757  HOH A O   
4967 O  O   . HOH F .   ? 0.1451 0.1797 0.1666 -0.0014 -0.0017 0.0108  758  HOH A O   
4968 O  O   . HOH F .   ? 0.1779 0.1948 0.1708 0.0308  0.0039  -0.0039 759  HOH A O   
4969 O  O   . HOH F .   ? 0.1550 0.1615 0.1327 0.0162  0.0063  -0.0079 760  HOH A O   
4970 O  O   . HOH F .   ? 0.1350 0.1474 0.1799 0.0069  -0.0094 -0.0143 761  HOH A O   
4971 O  O   . HOH F .   ? 0.1415 0.1342 0.1580 0.0281  -0.0248 -0.0034 762  HOH A O   
4972 O  O   . HOH F .   ? 0.1034 0.1207 0.1542 -0.0160 0.0040  0.0021  763  HOH A O   
4973 O  O   . HOH F .   ? 0.1581 0.1472 0.1928 -0.0117 0.0123  -0.0044 764  HOH A O   
4974 O  O   . HOH F .   ? 0.1951 0.1792 0.1393 0.0012  -0.0011 -0.0104 765  HOH A O   
4975 O  O   . HOH F .   ? 0.1589 0.1576 0.2059 0.0138  -0.0099 -0.0003 766  HOH A O   
4976 O  O   . HOH F .   ? 0.2798 0.4385 0.4510 -0.1463 -0.0287 -0.0875 767  HOH A O   
4977 O  O   . HOH F .   ? 0.1452 0.1578 0.1385 -0.0101 -0.0098 -0.0144 768  HOH A O   
4978 O  O   . HOH F .   ? 0.1595 0.1623 0.1750 0.0298  -0.0091 0.0012  769  HOH A O   
4979 O  O   . HOH F .   ? 0.1533 0.1508 0.1565 -0.0062 -0.0148 -0.0090 770  HOH A O   
4980 O  O   . HOH F .   ? 0.1303 0.1497 0.1495 0.0040  0.0172  0.0237  771  HOH A O   
4981 O  O   . HOH F .   ? 0.1167 0.1305 0.1829 -0.0031 -0.0203 -0.0112 772  HOH A O   
4982 O  O   . HOH F .   ? 0.1444 0.1079 0.1442 0.0083  0.0074  0.0027  773  HOH A O   
4983 O  O   . HOH F .   ? 0.1633 0.1371 0.1537 -0.0056 -0.0019 0.0214  774  HOH A O   
4984 O  O   . HOH F .   ? 0.1965 0.1457 0.1598 0.0078  -0.0150 -0.0023 775  HOH A O   
4985 O  O   . HOH F .   ? 0.1639 0.1526 0.1738 0.0053  0.0044  -0.0027 776  HOH A O   
4986 O  O   . HOH F .   ? 0.1590 0.1485 0.1385 -0.0026 0.0022  -0.0057 777  HOH A O   
4987 O  O   . HOH F .   ? 0.1787 0.1848 0.1427 -0.0184 -0.0065 0.0083  778  HOH A O   
4988 O  O   . HOH F .   ? 0.1787 0.2215 0.1478 0.0350  0.0000  0.0103  779  HOH A O   
4989 O  O   . HOH F .   ? 0.1612 0.1464 0.1875 0.0098  -0.0144 -0.0063 780  HOH A O   
4990 O  O   . HOH F .   ? 0.1550 0.1799 0.1654 0.0322  -0.0163 0.0196  781  HOH A O   
4991 O  O   . HOH F .   ? 0.1347 0.1656 0.1395 -0.0004 -0.0149 0.0149  782  HOH A O   
4992 O  O   . HOH F .   ? 0.1398 0.1746 0.1631 0.0215  -0.0243 0.0063  783  HOH A O   
4993 O  O   . HOH F .   ? 0.1512 0.1486 0.1181 0.0071  -0.0364 0.0045  784  HOH A O   
4994 O  O   . HOH F .   ? 0.3437 0.2646 0.4264 0.0237  -0.0234 0.0142  785  HOH A O   
4995 O  O   . HOH F .   ? 0.2400 0.1888 0.2398 -0.0677 -0.0356 0.0592  786  HOH A O   
4996 O  O   . HOH F .   ? 0.1832 0.1451 0.1862 -0.0060 0.0217  -0.0087 787  HOH A O   
4997 O  O   . HOH F .   ? 0.2259 0.3965 0.5182 0.0068  0.0720  0.1262  788  HOH A O   
4998 O  O   . HOH F .   ? 0.1483 0.1599 0.2598 0.0125  -0.0218 -0.0347 789  HOH A O   
4999 O  O   . HOH F .   ? 0.2427 0.2133 0.2526 0.0173  0.0091  -0.0178 790  HOH A O   
5000 O  O   . HOH F .   ? 0.1270 0.1517 0.1477 0.0305  -0.0104 -0.0114 791  HOH A O   
5001 O  O   . HOH F .   ? 0.2120 0.1826 0.1500 0.0162  -0.0095 -0.0117 792  HOH A O   
5002 O  O   . HOH F .   ? 0.2062 0.1297 0.1438 0.0087  0.0460  -0.0029 793  HOH A O   
5003 O  O   . HOH F .   ? 0.1267 0.1519 0.1277 0.0088  -0.0109 0.0084  794  HOH A O   
5004 O  O   . HOH F .   ? 0.1595 0.1452 0.1476 0.0206  0.0091  0.0029  795  HOH A O   
5005 O  O   . HOH F .   ? 0.2266 0.1377 0.2064 -0.0271 0.0287  -0.0209 796  HOH A O   
5006 O  O   . HOH F .   ? 0.4593 0.2224 0.2937 -0.0637 -0.0836 0.0644  797  HOH A O   
5007 O  O   . HOH F .   ? 0.1491 0.1571 0.1735 0.0018  0.0012  0.0039  798  HOH A O   
5008 O  O   . HOH F .   ? 0.1898 0.1874 0.2232 -0.0015 -0.0131 -0.0084 799  HOH A O   
5009 O  O   . HOH F .   ? 0.1265 0.1503 0.1707 0.0010  0.0210  -0.0145 800  HOH A O   
5010 O  O   . HOH F .   ? 0.4364 0.2828 0.3810 0.0753  0.2157  0.0494  801  HOH A O   
5011 O  O   . HOH F .   ? 0.1714 0.1623 0.1557 -0.0316 0.0083  0.0202  802  HOH A O   
5012 O  O   . HOH F .   ? 0.1337 0.1858 0.1483 0.0102  -0.0070 -0.0196 803  HOH A O   
5013 O  O   . HOH F .   ? 0.1409 0.1544 0.1285 -0.0104 -0.0109 -0.0135 804  HOH A O   
5014 O  O   . HOH F .   ? 0.1595 0.2157 0.1477 0.0266  -0.0051 -0.0119 805  HOH A O   
5015 O  O   . HOH F .   ? 0.3436 0.1693 0.1921 0.0135  0.0094  0.0278  806  HOH A O   
5016 O  O   . HOH F .   ? 0.1498 0.1734 0.1447 -0.0026 -0.0087 -0.0059 807  HOH A O   
5017 O  O   . HOH F .   ? 0.1899 0.2210 0.2380 0.0260  -0.0067 -0.0283 808  HOH A O   
5018 O  O   . HOH F .   ? 0.1533 0.1617 0.1598 -0.0047 0.0147  0.0203  809  HOH A O   
5019 O  O   . HOH F .   ? 0.1576 0.1972 0.1292 0.0037  -0.0110 -0.0121 810  HOH A O   
5020 O  O   . HOH F .   ? 0.1352 0.1684 0.1734 -0.0113 -0.0285 0.0145  811  HOH A O   
5021 O  O   . HOH F .   ? 0.1398 0.1320 0.1125 -0.0195 -0.0240 -0.0036 812  HOH A O   
5022 O  O   . HOH F .   ? 0.2220 0.1723 0.1847 -0.0364 -0.0093 -0.0053 813  HOH A O   
5023 O  O   . HOH F .   ? 0.1349 0.1858 0.1761 0.0072  -0.0078 0.0012  814  HOH A O   
5024 O  O   . HOH F .   ? 0.2318 0.2382 0.3820 0.0477  0.0804  0.0511  815  HOH A O   
5025 O  O   . HOH F .   ? 0.1184 0.1391 0.2903 0.0052  -0.0611 0.0143  816  HOH A O   
5026 O  O   . HOH F .   ? 0.2416 0.2474 0.6198 -0.0149 -0.0142 0.0330  817  HOH A O   
5027 O  O   . HOH F .   ? 0.3043 0.3704 0.2873 -0.1161 -0.1432 0.1966  818  HOH A O   
5028 O  O   . HOH F .   ? 0.1614 0.1594 0.1565 -0.0140 -0.0089 -0.0014 819  HOH A O   
5029 O  O   . HOH F .   ? 0.1686 0.1577 0.2168 0.0256  -0.0359 -0.0190 820  HOH A O   
5030 O  O   . HOH F .   ? 0.1315 0.1418 0.1584 0.0064  -0.0142 0.0126  821  HOH A O   
5031 O  O   . HOH F .   ? 0.1912 0.1797 0.1462 0.0100  -0.0072 -0.0383 822  HOH A O   
5032 O  O   . HOH F .   ? 0.1777 0.1556 0.1790 0.0017  -0.0012 -0.0122 823  HOH A O   
5033 O  O   . HOH F .   ? 0.1999 0.2333 0.2031 0.0252  -0.0455 0.0153  824  HOH A O   
5034 O  O   . HOH F .   ? 0.1721 0.1627 0.1387 0.0063  -0.0419 -0.0229 825  HOH A O   
5035 O  O   . HOH F .   ? 0.2030 0.1570 0.2069 -0.0063 0.0115  -0.0127 826  HOH A O   
5036 O  O   . HOH F .   ? 0.1488 0.1740 0.1446 0.0217  0.0060  0.0262  827  HOH A O   
5037 O  O   . HOH F .   ? 0.1541 0.1302 0.1840 0.0156  -0.0014 0.0223  828  HOH A O   
5038 O  O   . HOH F .   ? 0.2251 0.1245 0.2032 -0.0037 -0.0076 0.0277  829  HOH A O   
5039 O  O   . HOH F .   ? 0.1988 0.1851 0.1996 -0.0111 -0.0152 -0.0087 830  HOH A O   
5040 O  O   . HOH F .   ? 0.1733 0.1989 0.1786 0.0170  0.0136  0.0199  831  HOH A O   
5041 O  O   . HOH F .   ? 0.1706 0.1744 0.1598 -0.0257 0.0141  -0.0152 832  HOH A O   
5042 O  O   . HOH F .   ? 0.2020 0.2263 0.1926 0.0183  0.0197  0.0378  833  HOH A O   
5043 O  O   . HOH F .   ? 0.2907 0.5518 0.1867 0.0478  0.0130  -0.0375 834  HOH A O   
5044 O  O   . HOH F .   ? 0.1887 0.2554 0.1614 -0.0012 -0.0013 -0.0499 835  HOH A O   
5045 O  O   . HOH F .   ? 0.2454 0.2079 0.2163 -0.0446 0.0485  -0.0404 836  HOH A O   
5046 O  O   . HOH F .   ? 0.2083 0.1941 0.1377 -0.0165 0.0238  -0.0178 837  HOH A O   
5047 O  O   . HOH F .   ? 0.2238 0.1856 0.1999 0.0333  -0.0369 -0.0137 838  HOH A O   
5048 O  O   . HOH F .   ? 0.2168 0.3019 0.1590 -0.1080 0.0009  -0.0198 839  HOH A O   
5049 O  O   . HOH F .   ? 0.1654 0.1889 0.1560 -0.0154 0.0080  0.0018  840  HOH A O   
5050 O  O   . HOH F .   ? 0.1661 0.1645 0.1349 -0.0136 0.0358  -0.0142 841  HOH A O   
5051 O  O   . HOH F .   ? 0.2061 0.2077 0.1755 -0.0251 -0.0116 0.0106  842  HOH A O   
5052 O  O   . HOH F .   ? 0.1911 0.3016 0.2105 0.0367  0.0088  0.0239  843  HOH A O   
5053 O  O   . HOH F .   ? 0.1706 0.2253 0.1810 -0.0035 0.0091  0.0109  844  HOH A O   
5054 O  O   . HOH F .   ? 0.1650 0.1501 0.2441 -0.0004 -0.0374 0.0120  845  HOH A O   
5055 O  O   . HOH F .   ? 0.1782 0.1442 0.3379 -0.0086 0.0300  -0.0459 846  HOH A O   
5056 O  O   . HOH F .   ? 0.2450 0.1556 0.1983 0.0030  -0.0891 -0.0161 847  HOH A O   
5057 O  O   . HOH F .   ? 0.1573 0.2072 0.1856 0.0295  0.0191  -0.0183 848  HOH A O   
5058 O  O   . HOH F .   ? 0.1697 0.1296 0.1466 0.0247  0.0596  -0.0109 849  HOH A O   
5059 O  O   . HOH F .   ? 0.1742 0.2099 0.1492 -0.0106 0.0264  0.0286  850  HOH A O   
5060 O  O   . HOH F .   ? 0.1934 0.1769 0.1275 -0.0067 0.0031  -0.0058 851  HOH A O   
5061 O  O   A HOH F .   ? 0.1460 0.1378 0.1727 -0.0219 0.0052  0.0017  852  HOH A O   
5062 O  O   B HOH F .   ? 0.1587 0.2151 0.1673 -0.0463 0.0070  0.0198  852  HOH A O   
5063 O  O   . HOH F .   ? 0.2062 0.1815 0.2757 0.0019  0.0080  0.0259  853  HOH A O   
5064 O  O   . HOH F .   ? 0.1621 0.2148 0.1835 0.0118  -0.0130 -0.0476 854  HOH A O   
5065 O  O   . HOH F .   ? 0.2337 0.6038 0.1892 -0.0858 0.0216  -0.0278 855  HOH A O   
5066 O  O   . HOH F .   ? 0.4736 0.1452 0.3886 0.0080  0.2173  -0.0158 856  HOH A O   
5067 O  O   . HOH F .   ? 0.1792 0.1843 0.1844 -0.0076 -0.0173 0.0062  857  HOH A O   
5068 O  O   . HOH F .   ? 0.2437 0.3047 0.2275 0.0197  -0.0825 -0.0373 858  HOH A O   
5069 O  O   . HOH F .   ? 0.2094 0.2096 0.1806 -0.0093 0.0215  0.0179  859  HOH A O   
5070 O  O   . HOH F .   ? 0.1050 0.4646 0.1811 0.0220  -0.0026 0.1421  860  HOH A O   
5071 O  O   . HOH F .   ? 0.2830 0.2307 0.3023 0.0333  -0.0208 0.0020  861  HOH A O   
5072 O  O   . HOH F .   ? 0.1479 0.2088 0.2276 0.0009  0.0017  0.0558  862  HOH A O   
5073 O  O   . HOH F .   ? 0.2083 0.1931 0.1808 0.0318  0.0049  -0.0186 863  HOH A O   
5074 O  O   . HOH F .   ? 0.1640 0.2613 0.1684 0.0577  0.0084  0.0462  864  HOH A O   
5075 O  O   . HOH F .   ? 0.1752 0.1805 0.2328 -0.0122 0.0111  -0.0099 865  HOH A O   
5076 O  O   . HOH F .   ? 0.1616 0.1597 0.1694 -0.0061 0.0137  0.0094  866  HOH A O   
5077 O  O   . HOH F .   ? 0.2296 0.3487 0.1401 -0.0570 -0.0278 0.0411  867  HOH A O   
5078 O  O   . HOH F .   ? 0.2805 0.3274 0.3274 -0.0409 0.0825  -0.1646 868  HOH A O   
5079 O  O   . HOH F .   ? 0.2554 0.2979 0.2356 -0.0073 0.0582  -0.0402 869  HOH A O   
5080 O  O   . HOH F .   ? 0.1632 0.2625 0.1926 -0.0141 0.0033  -0.0375 870  HOH A O   
5081 O  O   . HOH F .   ? 0.2667 0.1492 0.1307 -0.0291 -0.0203 0.0056  871  HOH A O   
5082 O  O   . HOH F .   ? 0.1842 0.1959 0.2299 0.0069  -0.0147 -0.0072 872  HOH A O   
5083 O  O   . HOH F .   ? 0.2600 0.2201 0.2500 -0.0982 0.0527  0.0011  873  HOH A O   
5084 O  O   . HOH F .   ? 0.2227 0.2587 0.2052 0.0610  0.0000  -0.0253 874  HOH A O   
5085 O  O   . HOH F .   ? 0.2493 0.3331 0.1727 -0.0274 -0.0551 0.0221  875  HOH A O   
5086 O  O   . HOH F .   ? 0.1908 0.2950 0.2467 0.0083  -0.0662 -0.0333 876  HOH A O   
5087 O  O   . HOH F .   ? 0.1727 0.1551 0.2955 0.0256  0.0033  -0.0102 877  HOH A O   
5088 O  O   . HOH F .   ? 0.2197 0.2553 0.4113 -0.0360 0.0648  -0.0354 878  HOH A O   
5089 O  O   . HOH F .   ? 0.1847 0.2049 0.2992 0.0125  0.0312  -0.0122 879  HOH A O   
5090 O  O   . HOH F .   ? 0.2259 0.2056 0.1530 -0.0141 0.0100  0.0037  880  HOH A O   
5091 O  O   . HOH F .   ? 0.2238 0.2340 0.2217 -0.0219 0.0165  -0.0515 881  HOH A O   
5092 O  O   . HOH F .   ? 0.1794 0.2744 0.1945 0.0532  -0.0342 -0.0398 882  HOH A O   
5093 O  O   . HOH F .   ? 0.2859 0.2871 0.2568 0.0586  -0.1039 -0.0329 883  HOH A O   
5094 O  O   . HOH F .   ? 0.2645 0.2261 0.2164 0.0319  0.0862  0.1208  884  HOH A O   
5095 O  O   . HOH F .   ? 0.2302 0.2552 0.2185 0.0981  -0.0319 -0.0075 885  HOH A O   
5096 O  O   . HOH F .   ? 0.1957 0.1914 0.2006 0.0387  -0.0066 0.0028  886  HOH A O   
5097 O  O   . HOH F .   ? 0.3936 0.3201 0.1874 -0.1747 0.0370  0.0069  887  HOH A O   
5098 O  O   . HOH F .   ? 0.2173 0.2045 0.2094 0.0182  -0.0220 -0.0173 888  HOH A O   
5099 O  O   . HOH F .   ? 0.2993 0.2311 0.2868 -0.0280 -0.0615 -0.0134 889  HOH A O   
5100 O  O   . HOH F .   ? 0.6451 0.3604 0.1729 -0.1106 0.0824  0.0198  890  HOH A O   
5101 O  O   . HOH F .   ? 0.2217 0.2656 0.2260 -0.1274 -0.0207 0.0760  891  HOH A O   
5102 O  O   . HOH F .   ? 0.1943 0.2388 0.1869 -0.0319 -0.0202 0.0034  892  HOH A O   
5103 O  O   A HOH F .   ? 0.1595 0.1435 0.1067 0.0177  -0.0439 -0.0344 893  HOH A O   
5104 O  O   . HOH F .   ? 0.2119 0.2363 0.2626 0.0475  0.0674  0.0242  894  HOH A O   
5105 O  O   . HOH F .   ? 0.2933 0.4362 0.5477 -0.0822 -0.0693 0.1205  895  HOH A O   
5106 O  O   . HOH F .   ? 0.1911 0.2915 0.2773 0.0306  -0.0740 -0.1608 896  HOH A O   
5107 O  O   . HOH F .   ? 0.2716 0.2204 0.2095 -0.0119 -0.0989 -0.0100 897  HOH A O   
5108 O  O   . HOH F .   ? 0.2014 0.1845 0.2447 -0.0085 0.0005  0.0040  898  HOH A O   
5109 O  O   . HOH F .   ? 0.3362 0.2271 0.3317 -0.0672 0.0713  -0.0043 899  HOH A O   
5110 O  O   . HOH F .   ? 0.2588 0.2785 0.1938 0.0583  0.0416  0.0185  900  HOH A O   
5111 O  O   . HOH F .   ? 0.2253 0.1790 0.2725 -0.0226 0.0425  0.0243  901  HOH A O   
5112 O  O   . HOH F .   ? 0.1491 0.2197 0.1576 -0.0399 0.0102  -0.0141 902  HOH A O   
5113 O  O   . HOH F .   ? 0.1972 0.2815 0.2976 -0.0632 -0.1003 0.0656  903  HOH A O   
5114 O  O   . HOH F .   ? 0.2548 0.1936 0.2461 -0.0388 0.0604  0.0007  904  HOH A O   
5115 O  O   . HOH F .   ? 0.2212 0.2066 0.2071 0.0088  -0.0290 0.0037  905  HOH A O   
5116 O  O   . HOH F .   ? 0.3610 0.4234 0.4309 -0.0519 0.0539  0.0829  906  HOH A O   
5117 O  O   . HOH F .   ? 0.3087 0.2487 0.2640 -0.0025 0.0115  -0.0199 907  HOH A O   
5118 O  O   . HOH F .   ? 0.4018 0.1624 0.3442 0.0182  0.0684  -0.0981 908  HOH A O   
5119 O  O   . HOH F .   ? 0.2202 0.4346 0.3161 0.1169  0.0456  -0.0500 909  HOH A O   
5120 O  O   . HOH F .   ? 0.2308 0.2430 0.3100 0.0264  -0.0571 -0.0824 910  HOH A O   
5121 O  O   . HOH F .   ? 0.2958 0.2238 0.2053 -0.0400 -0.0033 0.0621  911  HOH A O   
5122 O  O   . HOH F .   ? 0.2763 0.2875 0.2380 0.0361  0.0253  -0.0081 912  HOH A O   
5123 O  O   . HOH F .   ? 0.2492 0.2328 0.4090 0.0479  -0.0273 -0.0201 913  HOH A O   
5124 O  O   . HOH F .   ? 0.4357 0.3969 0.2352 0.0841  0.0293  0.0409  914  HOH A O   
5125 O  O   . HOH F .   ? 0.2608 0.2574 0.2720 -0.0147 -0.0399 0.0610  915  HOH A O   
5126 O  O   . HOH F .   ? 0.2242 0.3110 0.2720 -0.0123 0.0236  -0.0240 916  HOH A O   
5127 O  O   . HOH F .   ? 0.2445 0.2379 0.2771 0.0789  0.0374  0.0343  917  HOH A O   
5128 O  O   . HOH F .   ? 0.3880 0.2825 0.3010 0.0223  0.0573  0.0419  918  HOH A O   
5129 O  O   . HOH F .   ? 0.1887 0.2473 0.2006 -0.0165 0.0282  0.0140  919  HOH A O   
5130 O  O   . HOH F .   ? 0.2116 0.3210 0.0859 -0.0792 -0.0059 -0.0164 920  HOH A O   
5131 O  O   . HOH F .   ? 0.3551 0.3374 0.4267 -0.0559 0.1460  0.1331  921  HOH A O   
5132 O  O   . HOH F .   ? 0.2669 0.3258 0.2563 0.0963  0.0277  0.0777  922  HOH A O   
5133 O  O   . HOH F .   ? 0.2827 0.4107 0.3152 0.1302  0.0725  0.0327  923  HOH A O   
5134 O  O   . HOH F .   ? 0.2625 0.1894 0.2116 -0.0075 -0.0087 -0.0004 924  HOH A O   
5135 O  O   . HOH F .   ? 0.2297 0.2491 0.2455 -0.0629 0.0059  0.0634  925  HOH A O   
5136 O  O   . HOH F .   ? 0.2450 0.2928 0.2759 0.0754  -0.0580 -0.0289 926  HOH A O   
5137 O  O   . HOH F .   ? 0.2310 0.3288 0.4154 0.0922  -0.1296 -0.2063 927  HOH A O   
5138 O  O   . HOH F .   ? 0.2686 0.3296 0.3199 -0.1030 -0.0099 -0.0610 928  HOH A O   
5139 O  O   . HOH F .   ? 0.2505 0.2053 0.2357 -0.0354 -0.0418 0.0063  929  HOH A O   
5140 O  O   . HOH F .   ? 0.3027 0.3009 0.1504 0.0555  -0.0180 -0.0277 930  HOH A O   
5141 O  O   . HOH F .   ? 0.3046 0.2175 0.3238 0.0014  -0.1005 -0.0076 931  HOH A O   
5142 O  O   . HOH F .   ? 0.2379 0.3380 0.2234 0.0103  0.0135  -0.0349 932  HOH A O   
5143 O  O   . HOH F .   ? 0.3255 0.4436 0.2568 -0.1472 -0.0496 0.0838  933  HOH A O   
5144 O  O   . HOH F .   ? 0.3047 0.3328 0.2152 -0.0001 -0.0033 -0.0245 934  HOH A O   
5145 O  O   . HOH F .   ? 0.2806 0.3713 0.2991 -0.0577 0.0967  -0.0022 935  HOH A O   
5146 O  O   . HOH F .   ? 0.2767 0.7044 0.4641 -0.1369 -0.1056 0.2459  936  HOH A O   
5147 O  O   . HOH F .   ? 0.2772 0.2332 0.2213 -0.0615 -0.0200 -0.0051 937  HOH A O   
5148 O  O   . HOH F .   ? 0.1578 0.2216 0.3223 -0.0052 0.0066  -0.0798 938  HOH A O   
5149 O  O   . HOH F .   ? 0.2905 0.2074 0.3236 -0.0132 -0.0051 0.0885  939  HOH A O   
5150 O  O   . HOH F .   ? 0.2182 0.3377 0.2531 -0.0926 0.0057  0.0616  940  HOH A O   
5151 O  O   . HOH F .   ? 0.2750 0.2279 0.1878 -0.0487 -0.0063 0.0272  941  HOH A O   
5152 O  O   . HOH F .   ? 0.2113 0.3030 0.3300 -0.0954 -0.1240 0.1225  942  HOH A O   
5153 O  O   . HOH F .   ? 0.1330 0.2581 0.2188 -0.0211 0.0439  0.0277  943  HOH A O   
5154 O  O   . HOH F .   ? 0.2175 0.2742 0.2024 -0.0076 0.0760  0.0406  944  HOH A O   
5155 O  O   . HOH F .   ? 0.6528 0.2428 0.4101 0.1495  0.1675  0.0562  945  HOH A O   
5156 O  O   . HOH F .   ? 0.2600 0.2005 0.3266 -0.0744 -0.0064 0.0705  946  HOH A O   
5157 O  O   . HOH F .   ? 0.1982 0.2688 0.2674 0.0150  -0.0497 -0.0215 947  HOH A O   
5158 O  O   . HOH F .   ? 0.3093 0.2641 0.1786 0.0069  -0.0316 -0.0216 948  HOH A O   
5159 O  O   . HOH F .   ? 0.3048 0.2385 0.2104 -0.0175 0.0031  0.0180  949  HOH A O   
5160 O  O   . HOH F .   ? 0.2998 0.2750 0.2452 0.0380  -0.0631 0.0055  950  HOH A O   
5161 O  O   . HOH F .   ? 0.2354 0.2541 0.2546 -0.0087 0.0327  -0.0465 951  HOH A O   
5162 O  O   . HOH F .   ? 0.2163 0.3198 0.2486 -0.0128 0.0198  0.0248  952  HOH A O   
5163 O  O   . HOH F .   ? 0.2346 0.2506 0.2281 -0.0077 0.0036  0.0748  953  HOH A O   
5164 O  O   . HOH F .   ? 0.2488 0.2170 0.3533 0.0074  0.1050  -0.0197 954  HOH A O   
5165 O  O   . HOH F .   ? 0.2309 0.2291 0.2871 -0.0089 0.0276  0.0088  955  HOH A O   
5166 O  O   . HOH F .   ? 0.2394 0.3343 0.2988 -0.0143 -0.0953 0.0244  956  HOH A O   
5167 O  O   . HOH F .   ? 0.4309 0.5808 0.3144 -0.1104 -0.1129 -0.1072 957  HOH A O   
5168 O  O   . HOH F .   ? 0.2917 0.2515 0.2967 0.0754  -0.0111 0.0144  958  HOH A O   
5169 O  O   . HOH F .   ? 0.2126 0.3693 0.2558 -0.0072 -0.0429 0.0185  959  HOH A O   
5170 O  O   . HOH F .   ? 0.2690 0.3529 0.3595 0.0531  0.0040  0.0761  960  HOH A O   
5171 O  O   . HOH F .   ? 0.2569 0.3318 0.3864 -0.1143 -0.1101 0.1192  961  HOH A O   
5172 O  O   . HOH F .   ? 0.3390 0.3005 0.2082 -0.1174 -0.0158 0.0471  962  HOH A O   
5173 O  O   . HOH F .   ? 0.3763 0.4468 0.2686 0.0656  -0.0905 -0.0562 963  HOH A O   
5174 O  O   . HOH F .   ? 0.2889 0.2805 0.1944 0.0026  0.0492  -0.0330 964  HOH A O   
5175 O  O   . HOH F .   ? 0.6010 0.4993 0.3659 -0.2596 -0.0897 -0.0214 965  HOH A O   
5176 O  O   . HOH F .   ? 0.2393 0.1811 0.2812 0.0003  -0.0090 -0.0146 966  HOH A O   
5177 O  O   . HOH F .   ? 0.3489 0.2509 0.2283 -0.0222 -0.0141 0.0018  967  HOH A O   
5178 O  O   . HOH F .   ? 0.2183 0.3312 0.2936 -0.0932 0.0028  0.0527  968  HOH A O   
5179 O  O   . HOH F .   ? 0.2432 0.1978 0.3582 -0.0070 0.0048  0.0048  969  HOH A O   
5180 O  O   . HOH F .   ? 0.2558 0.3045 0.2573 0.0240  -0.0139 -0.0612 970  HOH A O   
5181 O  O   . HOH F .   ? 0.2783 0.3535 0.3421 0.0697  0.0435  0.0582  971  HOH A O   
5182 O  O   . HOH F .   ? 0.2998 0.3102 0.2647 -0.0573 -0.0559 0.0638  972  HOH A O   
5183 O  O   . HOH F .   ? 0.6798 0.3352 0.6685 -0.2351 -0.3282 0.2777  973  HOH A O   
5184 O  O   . HOH F .   ? 0.3672 0.2327 0.7446 0.1182  0.1452  0.1126  974  HOH A O   
5185 O  O   . HOH F .   ? 0.4075 0.3248 0.2895 0.0222  0.0473  0.0427  975  HOH A O   
5186 O  O   . HOH F .   ? 0.3120 0.3459 0.3234 -0.0545 -0.0082 0.0563  976  HOH A O   
5187 O  O   . HOH F .   ? 0.2866 0.2914 0.3337 0.0576  0.0520  0.0108  977  HOH A O   
5188 O  O   . HOH F .   ? 0.2840 0.3124 0.2583 0.0165  0.0797  0.0171  978  HOH A O   
5189 O  O   . HOH F .   ? 0.2440 0.2906 0.2667 0.0012  0.0213  -0.0016 979  HOH A O   
5190 O  O   . HOH F .   ? 0.3544 0.2037 0.3283 0.0727  -0.0199 -0.0171 980  HOH A O   
5191 O  O   . HOH F .   ? 0.2554 0.2605 0.3915 -0.0010 0.0936  0.0057  981  HOH A O   
5192 O  O   . HOH F .   ? 0.1493 0.3089 0.4855 0.0555  0.0391  0.0990  982  HOH A O   
5193 O  O   . HOH F .   ? 0.2656 0.2911 0.2668 -0.0488 -0.0240 -0.0136 983  HOH A O   
5194 O  O   . HOH F .   ? 0.2464 0.2492 0.3186 0.0117  0.0039  0.0121  984  HOH A O   
5195 O  O   . HOH F .   ? 1.0751 0.3841 0.4418 -0.2005 -0.3774 0.0331  985  HOH A O   
5196 O  O   A HOH F .   ? 0.3022 0.3395 0.2621 -0.1101 -0.0056 0.0747  986  HOH A O   
5197 O  O   B HOH F .   ? 0.7852 0.9304 0.3872 0.0482  -0.3775 0.3726  986  HOH A O   
5198 O  O   . HOH F .   ? 0.2919 0.2707 0.2244 0.0538  0.0155  0.0922  987  HOH A O   
5199 O  O   . HOH F .   ? 0.2233 0.3543 0.2608 0.0325  0.0068  -0.0221 988  HOH A O   
5200 O  O   . HOH F .   ? 0.1840 0.2803 0.3738 0.0448  -0.0263 -0.0492 989  HOH A O   
5201 O  O   . HOH F .   ? 0.4569 0.3360 0.2381 -0.0258 -0.0186 -0.0171 990  HOH A O   
5202 O  O   . HOH F .   ? 0.1827 0.4696 0.3980 0.0629  -0.0368 -0.0583 991  HOH A O   
5203 O  O   . HOH F .   ? 0.2818 0.3463 0.3947 0.0722  0.0196  0.1430  992  HOH A O   
5204 O  O   . HOH F .   ? 0.4377 0.3442 0.4323 0.0901  -0.1530 -0.2057 993  HOH A O   
5205 O  O   . HOH F .   ? 0.2445 0.3196 0.2454 0.0035  -0.0337 -0.1060 994  HOH A O   
5206 O  O   . HOH F .   ? 0.3211 0.2813 0.2132 -0.0858 0.0254  0.0013  995  HOH A O   
5207 O  O   . HOH F .   ? 0.1751 0.7327 0.3561 -0.1499 -0.1085 0.2813  996  HOH A O   
5208 O  O   . HOH F .   ? 0.3652 0.5079 0.3001 -0.0729 0.0322  0.0761  997  HOH A O   
5209 O  O   . HOH F .   ? 0.2593 0.2621 0.2497 -0.0476 -0.0562 0.0773  998  HOH A O   
5210 O  O   . HOH F .   ? 0.4678 0.3335 0.2825 -0.0021 -0.1442 -0.0022 999  HOH A O   
5211 O  O   . HOH F .   ? 0.3286 0.2890 0.2525 -0.0334 -0.0464 0.0055  1000 HOH A O   
5212 O  O   . HOH F .   ? 0.2376 0.2302 0.2548 0.0488  0.0070  0.0108  1001 HOH A O   
5213 O  O   . HOH F .   ? 0.3832 0.7178 0.3111 0.1414  -0.0894 0.0572  1002 HOH A O   
5214 O  O   . HOH F .   ? 0.3212 0.4190 0.2517 -0.0841 0.0728  -0.0669 1003 HOH A O   
5215 O  O   . HOH F .   ? 0.2507 0.3630 0.1834 0.0436  -0.0047 -0.0250 1004 HOH A O   
5216 O  O   . HOH F .   ? 0.2807 0.2803 0.2656 -0.0640 0.0253  -0.0021 1005 HOH A O   
5217 O  O   . HOH F .   ? 0.2898 0.4858 0.2058 -0.0588 0.0092  0.0902  1006 HOH A O   
5218 O  O   . HOH F .   ? 0.3921 0.3552 0.4309 0.0137  -0.0658 0.1140  1007 HOH A O   
5219 O  O   . HOH F .   ? 0.2151 0.6034 0.5578 0.0283  0.0158  -0.0286 1008 HOH A O   
5220 O  O   . HOH F .   ? 0.1991 0.2936 0.3260 0.0201  0.0208  0.0061  1009 HOH A O   
5221 O  O   . HOH F .   ? 0.2961 0.2995 0.3420 -0.0567 0.0725  -0.0384 1010 HOH A O   
5222 O  O   . HOH F .   ? 0.5215 0.3516 0.3008 -0.0277 -0.1636 -0.0122 1011 HOH A O   
5223 O  O   . HOH F .   ? 0.3821 0.2783 0.4139 -0.0583 0.0815  -0.0121 1012 HOH A O   
5224 O  O   . HOH F .   ? 0.3053 0.5925 0.4965 0.0000  0.1029  -0.2277 1013 HOH A O   
5225 O  O   . HOH F .   ? 0.3693 0.5678 0.4882 0.1374  0.0648  0.0161  1014 HOH A O   
5226 O  O   . HOH F .   ? 0.3416 0.3006 0.4240 0.0942  -0.1223 -0.0528 1015 HOH A O   
5227 O  O   . HOH F .   ? 0.2671 0.2864 0.2886 -0.0428 0.0167  -0.0228 1016 HOH A O   
5228 O  O   . HOH F .   ? 0.4001 0.4701 0.1922 0.1127  -0.0408 0.0639  1017 HOH A O   
5229 O  O   . HOH F .   ? 0.1782 0.3444 0.2596 -0.0510 -0.0310 0.0125  1018 HOH A O   
5230 O  O   . HOH F .   ? 0.1832 0.3920 0.3936 0.0017  -0.0455 -0.0417 1019 HOH A O   
5231 O  O   . HOH F .   ? 0.4488 0.3435 0.3098 0.0361  -0.1849 -0.0322 1020 HOH A O   
5232 O  O   . HOH F .   ? 0.2125 0.2598 0.6781 -0.0374 0.0897  0.0852  1021 HOH A O   
5233 O  O   . HOH F .   ? 0.2938 0.3239 0.3300 0.0684  0.0493  -0.0599 1022 HOH A O   
5234 O  O   . HOH F .   ? 0.3062 0.3501 0.3200 -0.0242 -0.0852 -0.0770 1023 HOH A O   
5235 O  O   . HOH F .   ? 0.3164 0.3564 0.2595 0.1222  0.0319  -0.0499 1024 HOH A O   
5236 O  O   . HOH F .   ? 0.3451 0.2315 0.4445 -0.0776 0.1631  -0.1104 1025 HOH A O   
5237 O  O   . HOH F .   ? 0.2915 0.3152 0.3340 -0.0728 -0.0153 0.1296  1026 HOH A O   
5238 O  O   . HOH F .   ? 0.2257 0.4716 0.3373 0.0337  0.0322  0.0009  1027 HOH A O   
5239 O  O   . HOH F .   ? 0.2707 0.2681 0.4479 -0.0304 -0.0060 0.0831  1028 HOH A O   
5240 O  O   . HOH F .   ? 0.7244 0.3877 0.3930 0.0725  -0.1767 -0.0522 1029 HOH A O   
5241 O  O   . HOH F .   ? 0.9103 0.4520 0.4783 -0.1688 0.0023  -0.0606 1030 HOH A O   
5242 O  O   . HOH F .   ? 0.2926 0.2969 0.5326 0.0163  0.0678  0.0558  1031 HOH A O   
5243 O  O   . HOH F .   ? 0.4025 0.4553 0.4026 -0.1355 0.0112  0.1827  1032 HOH A O   
5244 O  O   . HOH F .   ? 0.3232 0.3088 0.4154 0.0339  -0.0133 -0.0256 1033 HOH A O   
5245 O  O   . HOH F .   ? 0.4353 0.4332 0.4045 0.0912  0.0272  -0.0968 1034 HOH A O   
5246 O  O   . HOH F .   ? 0.4221 0.3242 0.4244 -0.0511 0.0108  0.1147  1035 HOH A O   
5247 O  O   . HOH F .   ? 0.5772 0.3743 0.2912 -0.0069 0.0489  -0.0584 1036 HOH A O   
5248 O  O   . HOH F .   ? 0.4669 0.5353 0.4353 0.0284  0.0506  0.1218  1037 HOH A O   
5249 O  O   . HOH F .   ? 0.3652 0.2884 0.1969 -0.1332 -0.0304 -0.0536 1038 HOH A O   
5250 O  O   . HOH F .   ? 0.6667 0.4103 0.3766 -0.2389 0.1892  -0.1805 1039 HOH A O   
5251 O  O   . HOH F .   ? 0.5092 0.1810 0.4424 -0.0398 0.2062  0.0670  1040 HOH A O   
5252 O  O   . HOH F .   ? 0.2544 0.6258 0.3740 0.1546  -0.0187 0.0000  1041 HOH A O   
5253 O  O   . HOH F .   ? 0.2760 0.2796 0.3592 -0.0637 0.0299  0.0211  1042 HOH A O   
5254 O  O   . HOH F .   ? 0.3571 0.2351 0.4233 0.0079  -0.0224 -0.0208 1043 HOH A O   
5255 O  O   . HOH F .   ? 0.3306 0.3759 0.4454 0.1362  -0.0284 -0.0653 1044 HOH A O   
5256 O  O   . HOH F .   ? 0.3426 0.2135 0.6723 -0.0579 -0.2179 0.0128  1045 HOH A O   
5257 O  O   . HOH F .   ? 0.2622 0.5057 0.4037 -0.0195 -0.0310 -0.1244 1046 HOH A O   
5258 O  O   . HOH F .   ? 0.3985 0.2475 0.3829 -0.0157 0.0379  -0.0833 1047 HOH A O   
5259 O  O   . HOH F .   ? 0.3349 0.4496 0.5116 -0.0557 0.0394  -0.1212 1048 HOH A O   
5260 O  O   . HOH F .   ? 0.3836 0.3302 0.6828 -0.0930 0.0949  -0.0635 1049 HOH A O   
5261 O  O   . HOH F .   ? 0.3441 0.2902 0.3316 0.0248  -0.0030 0.0193  1050 HOH A O   
5262 O  O   . HOH F .   ? 0.2287 0.6128 0.2737 0.0026  -0.0374 -0.0088 1051 HOH A O   
5263 O  O   . HOH F .   ? 0.2417 0.1893 0.2277 -0.0268 -0.0091 -0.0335 1052 HOH A O   
5264 O  O   . HOH F .   ? 0.5202 0.2851 0.3188 -0.1659 -0.1024 0.0664  1053 HOH A O   
5265 O  O   . HOH F .   ? 0.6991 0.2684 0.4041 0.2289  0.0630  -0.0737 1054 HOH A O   
5266 O  O   . HOH F .   ? 0.2067 0.4760 0.6151 -0.0725 -0.0596 0.0327  1055 HOH A O   
5267 O  O   . HOH F .   ? 0.2841 0.2946 0.4840 0.0986  0.0188  0.0038  1056 HOH A O   
5268 O  O   . HOH F .   ? 0.3276 0.2151 0.1909 -0.0214 -0.0325 0.0063  1057 HOH A O   
5269 O  O   . HOH F .   ? 0.2693 0.6112 0.3657 0.2243  -0.0579 0.0571  1058 HOH A O   
5270 O  O   . HOH F .   ? 0.3649 0.2532 0.4022 0.0197  -0.0921 -0.0094 1059 HOH A O   
5271 O  O   . HOH F .   ? 0.2656 0.2511 0.4079 -0.0147 0.0209  -0.0012 1060 HOH A O   
5272 O  O   . HOH F .   ? 0.3842 0.1702 0.3608 -0.0209 0.0734  -0.0989 1061 HOH A O   
5273 O  O   . HOH F .   ? 0.3083 0.3387 0.6041 0.0320  0.0402  0.0890  1062 HOH A O   
5274 O  O   . HOH F .   ? 0.3911 0.3787 0.7399 0.0202  -0.1438 -0.0989 1063 HOH A O   
5275 O  O   . HOH F .   ? 0.3860 0.2012 0.3581 0.0043  0.0091  0.0113  1064 HOH A O   
5276 O  O   . HOH F .   ? 0.4066 0.3414 0.2753 -0.1708 -0.0970 0.0863  1065 HOH A O   
5277 O  O   . HOH F .   ? 0.2819 0.3110 0.6913 -0.0465 0.0542  -0.1468 1066 HOH A O   
5278 O  O   . HOH F .   ? 0.8654 0.3141 0.4517 0.0581  0.1704  -0.0705 1067 HOH A O   
5279 O  O   . HOH F .   ? 0.2387 0.4432 0.5540 0.0271  -0.1005 -0.2037 1068 HOH A O   
5280 O  O   . HOH F .   ? 0.3721 0.2378 0.3340 0.0514  -0.0003 0.0059  1069 HOH A O   
5281 O  O   . HOH F .   ? 0.3772 0.3513 0.3795 0.0654  0.0450  0.0423  1070 HOH A O   
5282 O  O   . HOH F .   ? 0.1995 0.3966 0.3413 -0.0223 0.0145  -0.0723 1071 HOH A O   
5283 O  O   . HOH F .   ? 0.3259 0.6120 0.2955 0.0589  0.0304  0.1448  1072 HOH A O   
5284 O  O   . HOH F .   ? 0.4683 0.4758 0.2732 0.0819  -0.0284 -0.0892 1073 HOH A O   
5285 O  O   . HOH F .   ? 0.2096 0.2795 0.4420 0.0067  0.0245  0.0232  1074 HOH A O   
5286 O  O   . HOH F .   ? 0.3306 0.3563 0.8140 -0.0553 0.0025  -0.2264 1075 HOH A O   
5287 O  O   A HOH F .   ? 0.2771 0.3062 0.4439 -0.0080 0.0156  0.1419  1076 HOH A O   
5288 O  O   A HOH F .   ? 0.2889 0.6135 0.3036 -0.1311 -0.0238 -0.0044 1077 HOH A O   
5289 O  O   . HOH F .   ? 0.4883 0.5004 0.1534 -0.1820 0.0588  0.0123  1078 HOH A O   
5290 O  O   . HOH F .   ? 0.3748 0.4506 0.3546 -0.0205 0.0357  0.0813  1079 HOH A O   
5291 O  O   . HOH F .   ? 0.4524 0.4557 0.4233 0.0070  0.1963  0.0080  1080 HOH A O   
5292 O  O   . HOH F .   ? 0.3080 0.4113 0.4597 -0.0673 -0.2086 -0.0453 1081 HOH A O   
5293 O  O   . HOH F .   ? 0.2287 0.3907 0.3515 -0.0286 -0.0189 0.0204  1082 HOH A O   
5294 O  O   . HOH F .   ? 0.6639 0.5295 0.1594 0.0324  -0.0115 -0.0484 1083 HOH A O   
5295 O  O   . HOH F .   ? 0.3102 0.2793 0.3267 -0.0327 -0.0325 0.0137  1084 HOH A O   
5296 O  O   . HOH F .   ? 0.3079 0.3088 0.5338 -0.0140 0.1088  0.0333  1085 HOH A O   
5297 O  O   . HOH F .   ? 0.1902 0.5327 0.5016 -0.0299 0.0189  -0.1394 1086 HOH A O   
5298 O  O   . HOH F .   ? 0.4360 0.2791 0.3755 0.0306  -0.0047 0.0650  1087 HOH A O   
5299 O  O   . HOH F .   ? 0.4079 0.5225 0.3265 0.3289  -0.0290 -0.0044 1088 HOH A O   
5300 O  O   . HOH F .   ? 0.3294 0.4423 0.3425 0.0725  -0.0273 -0.1486 1089 HOH A O   
5301 O  O   . HOH F .   ? 0.3452 0.2717 0.8862 0.0132  0.1756  -0.0268 1090 HOH A O   
5302 O  O   . HOH F .   ? 0.5886 0.4897 0.3636 -0.1194 -0.1731 0.0626  1091 HOH A O   
5303 O  O   . HOH F .   ? 0.4724 0.4455 0.4998 0.1193  0.1373  0.1913  1092 HOH A O   
5304 O  O   . HOH F .   ? 0.3838 0.3337 0.3777 -0.0187 0.1482  0.1352  1093 HOH A O   
5305 O  O   . HOH F .   ? 0.2776 0.2169 0.4192 -0.0675 -0.0353 0.0463  1094 HOH A O   
5306 O  O   . HOH F .   ? 0.3494 0.3262 0.5514 0.0430  -0.1095 -0.0024 1095 HOH A O   
5307 O  O   . HOH F .   ? 0.8804 0.2502 0.3154 0.0534  0.1457  0.0438  1096 HOH A O   
5308 O  O   . HOH F .   ? 0.3778 0.3325 0.2743 0.0506  -0.0035 -0.0176 1097 HOH A O   
5309 O  O   . HOH F .   ? 0.3915 0.4648 0.3268 0.0750  0.0637  -0.0953 1098 HOH A O   
5310 O  O   . HOH F .   ? 0.3323 0.5565 0.2388 -0.0579 -0.0565 -0.0395 1099 HOH A O   
5311 O  O   . HOH F .   ? 0.5742 0.4741 0.3818 0.1337  0.1618  0.0960  1100 HOH A O   
5312 O  O   . HOH F .   ? 0.8201 0.3503 0.2839 -0.0375 0.0323  -0.0142 1101 HOH A O   
5313 O  O   . HOH F .   ? 0.3854 0.4003 0.3820 -0.0482 -0.0754 -0.0181 1102 HOH A O   
5314 O  O   . HOH F .   ? 0.2026 0.4831 0.3920 0.0374  0.0386  0.0873  1103 HOH A O   
5315 O  O   . HOH F .   ? 0.4192 0.4522 0.4093 0.1868  0.0303  0.0330  1104 HOH A O   
5316 O  O   . HOH F .   ? 0.4000 0.2819 0.5293 -0.0130 0.1234  0.0939  1105 HOH A O   
5317 O  O   . HOH F .   ? 0.3725 0.5398 0.4452 -0.0112 0.0797  0.2247  1106 HOH A O   
5318 O  O   . HOH F .   ? 0.3558 0.2357 0.3712 -0.0518 0.0242  -0.0682 1107 HOH A O   
5319 O  O   . HOH F .   ? 0.8309 0.3952 0.3061 0.1697  -0.0346 0.0365  1108 HOH A O   
5320 O  O   . HOH F .   ? 0.4377 0.7147 0.3044 0.1616  0.0305  -0.1801 1109 HOH A O   
5321 O  O   . HOH F .   ? 0.3444 0.3097 0.2563 0.0539  -0.0283 -0.0435 1110 HOH A O   
5322 O  O   . HOH F .   ? 0.2713 0.2912 0.3287 -0.0780 0.0511  -0.1004 1111 HOH A O   
5323 O  O   . HOH F .   ? 0.3568 0.5429 0.2657 -0.0470 -0.0650 0.0939  1112 HOH A O   
5324 O  O   . HOH F .   ? 0.3244 0.3290 0.3317 0.0013  0.0697  0.0001  1113 HOH A O   
5325 O  O   . HOH F .   ? 0.3330 0.3795 0.3755 0.0716  0.0326  0.0012  1114 HOH A O   
5326 O  O   . HOH F .   ? 0.4324 0.7938 0.4585 -0.1852 0.0545  0.1704  1115 HOH A O   
5327 O  O   . HOH F .   ? 0.4557 0.4633 0.3358 0.0552  0.1018  -0.1068 1116 HOH A O   
5328 O  O   . HOH F .   ? 0.3356 0.2352 0.6611 0.0267  0.0722  0.0185  1117 HOH A O   
5329 O  O   . HOH F .   ? 0.3193 0.3885 0.4636 0.0553  0.0215  0.0180  1118 HOH A O   
5330 O  O   . HOH F .   ? 0.3843 0.4952 0.9122 -0.0054 -0.0507 0.2456  1119 HOH A O   
5331 O  O   . HOH F .   ? 0.4520 0.4866 0.3458 -0.0480 -0.0086 0.0360  1120 HOH A O   
5332 O  O   . HOH F .   ? 0.5114 0.5835 0.3761 -0.0145 -0.0094 0.2586  1121 HOH A O   
5333 O  O   . HOH F .   ? 0.4436 0.4899 0.3103 0.0023  -0.0043 -0.1007 1122 HOH A O   
5334 O  O   . HOH F .   ? 0.4448 0.6059 0.3420 0.0696  0.2391  0.2076  1123 HOH A O   
5335 O  O   . HOH F .   ? 0.5573 0.4860 0.2447 0.2854  -0.1031 -0.0993 1124 HOH A O   
5336 O  O   . HOH F .   ? 0.3681 0.6903 0.3254 0.1983  0.1410  0.2626  1125 HOH A O   
5337 O  O   . HOH F .   ? 0.8347 0.3851 0.4308 -0.0111 0.1074  0.0839  1126 HOH A O   
5338 O  O   . HOH F .   ? 0.3375 0.2196 0.5083 -0.1221 0.0598  0.1302  1127 HOH A O   
5339 O  O   . HOH F .   ? 0.6310 0.3768 0.4100 0.2248  -0.0690 -0.0891 1128 HOH A O   
5340 O  O   . HOH F .   ? 0.3663 0.7643 0.3075 -0.1165 0.0000  0.1357  1129 HOH A O   
5341 O  O   . HOH F .   ? 0.3692 0.4610 0.6770 -0.0661 -0.2483 0.1757  1130 HOH A O   
5342 O  O   . HOH F .   ? 0.3329 0.5031 0.5122 -0.0617 0.0411  0.1325  1131 HOH A O   
5343 O  O   . HOH F .   ? 0.8555 0.6821 0.3820 0.3556  -0.0452 0.0356  1132 HOH A O   
5344 O  O   . HOH F .   ? 0.6124 0.4712 0.3571 0.0542  -0.0738 -0.1537 1133 HOH A O   
5345 O  O   . HOH F .   ? 0.3344 0.4652 0.3494 -0.0660 -0.0058 0.1164  1134 HOH A O   
5346 O  O   . HOH F .   ? 0.4630 0.3708 0.4865 -0.1606 0.1196  -0.2291 1135 HOH A O   
5347 O  O   . HOH F .   ? 0.3173 0.2898 0.3534 -0.0050 -0.0401 -0.0463 1136 HOH A O   
5348 O  O   . HOH F .   ? 0.4276 0.3706 0.2935 -0.1343 0.0496  -0.0306 1137 HOH A O   
5349 O  O   . HOH F .   ? 0.7584 1.0816 0.2247 0.0490  0.0015  0.0518  1138 HOH A O   
5350 O  O   . HOH F .   ? 0.4806 0.4431 0.4805 -0.0973 -0.2156 0.1472  1139 HOH A O   
5351 O  O   . HOH F .   ? 0.4620 0.3999 0.6203 -0.1062 0.2542  -0.2307 1140 HOH A O   
5352 O  O   . HOH F .   ? 0.5062 0.6993 0.5485 0.1970  -0.1434 -0.2637 1141 HOH A O   
5353 O  O   . HOH F .   ? 0.7348 0.4343 0.4080 0.1122  -0.2353 0.0317  1142 HOH A O   
5354 O  O   . HOH F .   ? 0.3028 0.6685 0.5357 -0.0111 -0.1153 0.0200  1143 HOH A O   
5355 O  O   . HOH F .   ? 0.3598 0.3535 0.4542 -0.0347 0.0907  0.0807  1144 HOH A O   
5356 O  O   . HOH F .   ? 0.9239 0.2239 0.7072 -0.0723 -0.4846 0.1388  1145 HOH A O   
5357 O  O   . HOH F .   ? 0.3646 0.3219 0.3047 -0.0557 -0.0974 0.0256  1146 HOH A O   
5358 O  O   . HOH F .   ? 0.5269 0.3241 0.3543 0.0321  -0.2121 -0.0439 1147 HOH A O   
5359 O  O   . HOH F .   ? 0.2814 0.4990 0.5389 -0.0175 0.0604  0.0787  1148 HOH A O   
5360 O  O   . HOH F .   ? 0.4689 0.4081 0.4042 0.0026  -0.1421 -0.0642 1149 HOH A O   
5361 O  O   . HOH F .   ? 0.5235 0.3101 0.3989 -0.0828 -0.1276 0.1006  1150 HOH A O   
5362 O  O   . HOH F .   ? 0.2303 0.4403 0.4354 0.0258  0.0681  -0.0796 1151 HOH A O   
5363 O  O   . HOH F .   ? 0.4130 0.2865 0.3071 0.0085  -0.0554 -0.0147 1152 HOH A O   
5364 O  O   . HOH F .   ? 0.4825 0.7524 0.5212 0.1027  0.1786  -0.0222 1153 HOH A O   
5365 O  O   . HOH F .   ? 0.2789 0.5205 0.6448 0.0147  -0.0509 -0.0404 1154 HOH A O   
5366 O  O   . HOH F .   ? 0.5080 0.4960 0.6723 -0.1921 -0.2703 0.3714  1155 HOH A O   
5367 O  O   . HOH F .   ? 0.6145 0.4392 0.2005 0.0319  0.0721  0.1330  1156 HOH A O   
5368 O  O   . HOH F .   ? 0.6304 0.5636 0.2863 0.2439  -0.0158 -0.0938 1157 HOH A O   
5369 O  O   . HOH F .   ? 0.5487 0.2997 0.3289 0.1166  0.1180  0.1562  1158 HOH A O   
5370 O  O   . HOH F .   ? 0.3364 0.3370 0.5139 -0.0066 -0.1148 0.0046  1159 HOH A O   
5371 O  O   . HOH F .   ? 0.3918 0.4495 0.2827 0.0051  -0.0736 0.0673  1160 HOH A O   
5372 O  O   . HOH F .   ? 0.2842 0.7454 0.5778 0.0340  0.0035  -0.1462 1161 HOH A O   
5373 O  O   . HOH F .   ? 0.9464 0.3704 0.5655 -0.0219 -0.2478 0.1627  1162 HOH A O   
5374 O  O   . HOH F .   ? 0.4476 0.4096 0.7392 0.0378  -0.0034 0.0929  1163 HOH A O   
5375 O  O   . HOH F .   ? 0.5332 0.3261 0.8030 0.0342  -0.1318 -0.1999 1164 HOH A O   
5376 O  O   . HOH F .   ? 0.3382 0.4197 0.6203 0.0292  0.0767  -0.1083 1165 HOH A O   
5377 O  O   . HOH F .   ? 0.3744 0.6628 0.3860 -0.1010 -0.1505 0.1079  1166 HOH A O   
5378 O  O   A HOH F .   ? 0.2437 0.3373 0.4743 -0.0900 0.0698  0.1607  1167 HOH A O   
5379 O  O   . HOH F .   ? 0.5741 0.5563 0.4778 0.1530  0.1503  -0.0313 1168 HOH A O   
5380 O  O   . HOH F .   ? 0.8001 0.2377 0.5006 -0.0723 0.2270  -0.1089 1169 HOH A O   
5381 O  O   . HOH F .   ? 0.3552 0.4956 0.4510 0.1110  0.0363  -0.1025 1170 HOH A O   
5382 O  O   . HOH F .   ? 0.4044 0.8385 0.3962 -0.0344 0.1570  0.0914  1171 HOH A O   
5383 O  O   . HOH F .   ? 0.5491 0.5518 0.2671 0.0943  -0.0537 0.0905  1172 HOH A O   
5384 O  O   . HOH F .   ? 0.5525 0.4823 0.2983 0.0181  -0.0049 0.0265  1173 HOH A O   
5385 O  O   . HOH F .   ? 0.7403 0.2185 0.4175 0.0208  -0.3037 0.0380  1174 HOH A O   
5386 O  O   . HOH F .   ? 0.3505 0.2705 0.3324 -0.0408 0.0918  -0.0227 1175 HOH A O   
5387 O  O   . HOH F .   ? 0.3917 0.4468 0.4912 0.0895  0.2006  0.0494  1176 HOH A O   
5388 O  O   . HOH F .   ? 0.1501 1.2179 0.8060 -0.0014 0.2987  0.2767  1177 HOH A O   
5389 O  O   . HOH F .   ? 0.4378 0.5457 0.5696 0.0025  -0.1079 -0.2066 1178 HOH A O   
5390 O  O   . HOH F .   ? 0.3958 0.5085 0.1532 -0.1120 0.0469  -0.0805 1179 HOH A O   
5391 O  O   . HOH F .   ? 0.3151 0.3422 0.5066 0.0868  0.1382  0.0096  1180 HOH A O   
5392 O  O   . HOH F .   ? 0.5187 0.4042 0.3820 -0.0865 -0.0956 -0.0619 1181 HOH A O   
5393 O  O   . HOH F .   ? 0.6479 0.4772 0.2874 -0.1147 -0.0147 0.0018  1182 HOH A O   
5394 O  O   . HOH F .   ? 0.3738 0.5225 0.5534 -0.0203 0.0220  0.1266  1183 HOH A O   
5395 O  O   . HOH F .   ? 0.5688 0.3147 0.3804 -0.0846 0.0766  -0.1153 1184 HOH A O   
5396 O  O   . HOH F .   ? 0.4159 0.3792 0.6839 -0.1141 0.0497  0.0347  1185 HOH A O   
5397 O  O   . HOH F .   ? 0.3048 0.3667 0.4944 -0.0273 0.0804  0.0070  1186 HOH A O   
5398 O  O   . HOH F .   ? 0.3795 0.8466 0.6445 -0.1708 0.0607  -0.1663 1187 HOH A O   
5399 O  O   . HOH F .   ? 0.5997 0.4641 0.3507 -0.0214 -0.0885 0.2505  1188 HOH A O   
5400 O  O   . HOH F .   ? 0.4396 0.3972 0.4119 0.0552  0.0113  0.0513  1189 HOH A O   
5401 O  O   . HOH F .   ? 0.5177 0.7790 0.2944 0.1320  -0.0578 -0.0006 1190 HOH A O   
5402 O  O   . HOH F .   ? 0.3102 0.3971 0.7099 0.0042  0.1349  0.1340  1191 HOH A O   
5403 O  O   . HOH F .   ? 0.6623 0.4827 0.3048 0.0399  0.0659  0.0719  1192 HOH A O   
5404 O  O   . HOH F .   ? 0.5437 0.5187 0.3083 0.3587  -0.0075 -0.0376 1193 HOH A O   
5405 O  O   . HOH F .   ? 0.8295 0.3642 0.3560 0.0131  -0.0098 0.0275  1194 HOH A O   
5406 O  O   . HOH F .   ? 0.4918 0.3771 0.8145 0.1066  0.0388  -0.0636 1195 HOH A O   
5407 O  O   . HOH F .   ? 0.3729 0.5507 0.6374 -0.2401 0.0825  -0.1771 1196 HOH A O   
5408 O  O   . HOH F .   ? 0.4553 0.7503 0.4590 -0.1072 0.1000  -0.0957 1197 HOH A O   
5409 O  O   . HOH F .   ? 0.4393 0.6747 0.3076 0.0063  -0.0397 -0.0249 1198 HOH A O   
5410 O  O   . HOH F .   ? 0.4175 0.3094 0.7228 0.0602  -0.0190 0.0093  1199 HOH A O   
5411 O  O   . HOH F .   ? 0.3692 0.4779 0.5061 0.0139  0.0490  0.0968  1200 HOH A O   
5412 O  O   . HOH F .   ? 0.8328 0.4887 0.6084 -0.1478 0.4840  -0.0388 1201 HOH A O   
5413 O  O   . HOH F .   ? 0.3468 0.3209 0.4400 -0.0098 -0.1660 0.0713  1202 HOH A O   
5414 O  O   . HOH F .   ? 0.5729 0.4030 0.4412 0.0836  0.1545  0.0478  1203 HOH A O   
5415 O  O   . HOH F .   ? 0.3784 0.4147 0.4620 0.0259  -0.0814 0.0514  1204 HOH A O   
5416 O  O   . HOH F .   ? 0.6607 0.3504 0.5226 -0.3052 0.1303  -0.0988 1205 HOH A O   
5417 O  O   . HOH F .   ? 0.4779 0.4512 0.5864 0.0685  0.2253  0.0566  1206 HOH A O   
5418 O  O   . HOH F .   ? 0.4455 0.5173 0.4159 -0.0519 -0.0274 -0.1118 1207 HOH A O   
5419 O  O   . HOH F .   ? 0.7414 0.4021 0.5259 -0.0051 0.0078  -0.1780 1208 HOH A O   
5420 O  O   . HOH F .   ? 0.3691 1.0281 0.3138 -0.0774 -0.0615 0.0750  1209 HOH A O   
5421 O  O   . HOH F .   ? 0.2844 0.3470 0.6617 -0.0291 0.0011  -0.1765 1210 HOH A O   
5422 O  O   . HOH F .   ? 0.4290 0.6959 0.5414 0.1291  0.0448  0.2715  1211 HOH A O   
5423 O  O   . HOH F .   ? 0.7718 0.7293 0.3560 0.2639  0.0705  -0.0512 1212 HOH A O   
5424 O  O   . HOH F .   ? 0.3166 0.3385 0.4081 -0.0377 0.0386  0.0350  1213 HOH A O   
5425 O  O   . HOH F .   ? 0.5539 0.4652 0.3619 -0.0134 0.1525  -0.1051 1214 HOH A O   
5426 O  O   . HOH F .   ? 0.4487 0.6147 0.3666 0.2118  0.1611  0.1184  1215 HOH A O   
5427 O  O   . HOH F .   ? 0.4371 0.5166 0.4864 -0.0318 0.0839  -0.1572 1216 HOH A O   
5428 O  O   . HOH F .   ? 0.7567 0.4149 0.6310 0.2045  -0.0803 -0.1578 1217 HOH A O   
5429 O  O   . HOH F .   ? 0.6317 0.5535 0.6136 0.2815  0.3894  0.1437  1218 HOH A O   
5430 O  O   . HOH F .   ? 0.4029 0.4674 0.5225 0.1828  -0.0100 -0.0472 1219 HOH A O   
5431 O  O   . HOH F .   ? 0.6214 0.5692 0.5901 0.2919  0.0393  -0.0693 1220 HOH A O   
5432 O  O   . HOH F .   ? 0.3463 0.6044 0.5215 -0.0549 0.0916  0.0423  1221 HOH A O   
5433 O  O   . HOH F .   ? 0.3121 0.6772 0.4307 0.0297  -0.1388 -0.1793 1222 HOH A O   
5434 O  O   . HOH F .   ? 0.6127 0.2796 0.5022 -0.0988 -0.0519 0.0500  1223 HOH A O   
5435 O  O   . HOH F .   ? 0.3170 0.4704 0.5191 0.0671  -0.0271 -0.2125 1224 HOH A O   
5436 O  O   . HOH F .   ? 0.9263 0.3232 0.4970 0.0819  -0.0544 -0.1738 1225 HOH A O   
5437 O  O   . HOH F .   ? 0.4802 0.5323 0.3437 -0.2033 -0.0063 0.1424  1226 HOH A O   
5438 O  O   . HOH F .   ? 0.4270 0.3215 0.6306 0.1372  0.0154  -0.2358 1227 HOH A O   
5439 O  O   . HOH F .   ? 0.5269 0.7822 0.5217 -0.1915 -0.1943 0.0745  1228 HOH A O   
5440 O  O   . HOH F .   ? 0.3701 0.4059 0.4106 -0.0143 0.0140  -0.0308 1229 HOH A O   
5441 O  O   . HOH F .   ? 0.8629 0.5957 0.3281 -0.0535 -0.2278 0.1089  1230 HOH A O   
5442 O  O   . HOH F .   ? 0.5282 0.3908 0.4890 0.0173  0.1091  -0.1248 1231 HOH A O   
5443 O  O   . HOH F .   ? 0.4756 0.5371 0.5195 -0.0591 -0.1074 0.1388  1232 HOH A O   
5444 O  O   . HOH F .   ? 0.3835 0.5185 0.5585 0.0405  0.0528  0.2292  1233 HOH A O   
5445 O  O   . HOH F .   ? 0.2526 0.5944 0.6099 -0.0736 0.0966  0.2142  1234 HOH A O   
5446 O  O   . HOH F .   ? 0.4558 0.5124 0.3058 -0.0466 -0.1221 -0.1889 1235 HOH A O   
5447 O  O   . HOH F .   ? 0.2892 0.5311 0.3131 -0.1156 0.0986  -0.0051 1236 HOH A O   
5448 O  O   . HOH F .   ? 0.9227 0.7059 0.3671 0.2536  0.2024  0.1485  1237 HOH A O   
5449 O  O   . HOH F .   ? 0.5693 0.4862 0.3838 0.0694  -0.1800 -0.0663 1238 HOH A O   
5450 O  O   . HOH F .   ? 0.5026 0.7489 0.3826 0.2114  0.0794  -0.2184 1239 HOH A O   
5451 O  O   . HOH F .   ? 0.4659 0.6648 0.4731 -0.1062 -0.0221 -0.0273 1240 HOH A O   
5452 O  O   . HOH F .   ? 0.7091 0.8133 0.7634 0.4443  0.3373  0.3264  1241 HOH A O   
5453 O  O   . HOH F .   ? 0.6515 0.4901 0.7798 0.0757  -0.4096 0.0416  1242 HOH A O   
5454 O  O   . HOH F .   ? 0.4134 0.4324 0.4560 -0.1360 -0.0069 0.0339  1243 HOH A O   
5455 O  O   . HOH F .   ? 0.4721 0.5599 0.4237 0.2769  -0.1246 -0.2010 1244 HOH A O   
5456 O  O   . HOH F .   ? 0.8855 0.4288 0.4289 0.3727  0.1093  0.1055  1245 HOH A O   
5457 O  O   . HOH F .   ? 0.3023 0.7610 0.5523 0.0056  -0.0103 -0.0325 1246 HOH A O   
5458 O  O   A HOH F .   ? 0.9341 0.1510 0.5781 0.1111  0.2579  -0.0988 1247 HOH A O   
5459 O  O   . HOH F .   ? 0.7262 0.4679 0.7977 -0.1426 -0.1587 0.1220  1248 HOH A O   
5460 O  O   . HOH F .   ? 0.2988 0.4196 0.5052 -0.0250 0.1140  -0.1055 1249 HOH A O   
5461 O  O   . HOH F .   ? 0.8312 0.5060 0.4365 -0.2742 0.1576  -0.1123 1250 HOH A O   
5462 O  O   . HOH F .   ? 0.5482 0.8459 0.2926 -0.3321 0.0118  0.0772  1251 HOH A O   
5463 O  O   . HOH F .   ? 0.6449 0.6150 0.3601 -0.1577 -0.1351 -0.0944 1252 HOH A O   
5464 O  O   . HOH F .   ? 0.9347 0.3443 0.5821 0.2036  0.2877  -0.0441 1253 HOH A O   
5465 O  O   . HOH F .   ? 0.3678 0.5774 0.5146 -0.1371 0.1044  0.1280  1254 HOH A O   
5466 O  O   . HOH F .   ? 0.5019 0.5100 0.6726 0.1529  -0.1800 -0.1284 1255 HOH A O   
5467 O  O   . HOH F .   ? 0.3856 0.6578 0.4621 0.0002  0.1326  -0.0309 1256 HOH A O   
5468 O  O   . HOH F .   ? 0.4002 0.4056 0.3792 -0.0072 0.0141  -0.0348 1257 HOH A O   
5469 O  O   . HOH F .   ? 0.7563 0.7190 0.3931 0.0139  0.1475  0.0103  1258 HOH A O   
5470 O  O   . HOH F .   ? 0.5711 0.4065 0.7373 0.0879  -0.0196 -0.3150 1259 HOH A O   
5471 O  O   . HOH F .   ? 0.5320 0.4652 0.4784 -0.2842 0.1323  0.0303  1260 HOH A O   
5472 O  O   . HOH F .   ? 0.4006 0.5931 0.4145 -0.1312 0.0363  0.0677  1261 HOH A O   
5473 O  O   . HOH F .   ? 0.4257 0.5384 0.5748 -0.1773 -0.0305 0.1443  1262 HOH A O   
5474 O  O   . HOH F .   ? 0.6361 0.5842 0.5491 -0.1287 0.0750  -0.2600 1263 HOH A O   
5475 O  O   . HOH F .   ? 0.5647 0.5126 0.5082 -0.0126 0.0406  -0.2241 1264 HOH A O   
5476 O  O   . HOH F .   ? 0.8174 0.4594 0.6553 -0.0860 -0.3037 0.1627  1265 HOH A O   
5477 O  O   . HOH F .   ? 0.4955 0.4196 0.3821 -0.0721 0.0287  -0.1158 1266 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   -2  -2  SER SER A . n 
A 1 2   ASN 2   -1  -1  ASN ASN A . n 
A 1 3   ALA 3   0   0   ALA ALA A . n 
A 1 4   MSE 4   1   1   MSE MSE A . n 
A 1 5   LEU 5   2   2   LEU LEU A . n 
A 1 6   PHE 6   3   3   PHE PHE A . n 
A 1 7   CYS 7   4   4   CYS CYS A . n 
A 1 8   ASP 8   5   5   ASP ASP A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  SER 10  7   7   SER SER A . n 
A 1 11  LYS 11  8   8   LYS LYS A . n 
A 1 12  LYS 12  9   9   LYS LYS A . n 
A 1 13  TYR 13  10  10  TYR TYR A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  LYS 15  12  12  LYS LYS A . n 
A 1 16  GLU 16  13  13  GLU GLU A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  ASN 18  15  15  ASN ASN A . n 
A 1 19  ILE 19  16  16  ILE ILE A . n 
A 1 20  ASN 20  17  17  ASN ASN A . n 
A 1 21  LEU 21  18  18  LEU LEU A . n 
A 1 22  LYS 22  19  19  LYS LYS A . n 
A 1 23  ASN 23  20  20  ASN ASN A . n 
A 1 24  GLU 24  21  21  GLU GLU A . n 
A 1 25  PHE 25  22  22  PHE PHE A . n 
A 1 26  ASP 26  23  23  ASP ASP A . n 
A 1 27  LYS 27  24  24  LYS LYS A . n 
A 1 28  ASP 28  25  25  ASP ASP A . n 
A 1 29  ASP 29  26  26  ASP ASP A . n 
A 1 30  LYS 30  27  27  LYS LYS A . n 
A 1 31  ARG 31  28  28  ARG ARG A . n 
A 1 32  VAL 32  29  29  VAL VAL A . n 
A 1 33  GLU 33  30  30  GLU GLU A . n 
A 1 34  LYS 34  31  31  LYS LYS A . n 
A 1 35  PHE 35  32  32  PHE PHE A . n 
A 1 36  SER 36  33  33  SER SER A . n 
A 1 37  LEU 37  34  34  LEU LEU A . n 
A 1 38  LYS 38  35  35  LYS LYS A . n 
A 1 39  HIS 39  36  36  HIS HIS A . n 
A 1 40  GLN 40  37  37  GLN GLN A . n 
A 1 41  ASN 41  38  38  ASN ASN A . n 
A 1 42  ILE 42  39  39  ILE ILE A . n 
A 1 43  TYR 43  40  40  TYR TYR A . n 
A 1 44  PHE 44  41  41  PHE PHE A . n 
A 1 45  ASP 45  42  42  ASP ASP A . n 
A 1 46  TYR 46  43  43  TYR TYR A . n 
A 1 47  SER 47  44  44  SER SER A . n 
A 1 48  LYS 48  45  45  LYS LYS A . n 
A 1 49  ASN 49  46  46  ASN ASN A . n 
A 1 50  LEU 50  47  47  LEU LEU A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ASN 52  49  49  ASN ASN A . n 
A 1 53  ASP 53  50  50  ASP ASP A . n 
A 1 54  TYR 54  51  51  TYR TYR A . n 
A 1 55  ILE 55  52  52  ILE ILE A . n 
A 1 56  LEU 56  53  53  LEU LEU A . n 
A 1 57  LYS 57  54  54  LYS LYS A . n 
A 1 58  SER 58  55  55  SER SER A . n 
A 1 59  LEU 59  56  56  LEU LEU A . n 
A 1 60  LEU 60  57  57  LEU LEU A . n 
A 1 61  GLU 61  58  58  GLU GLU A . n 
A 1 62  SER 62  59  59  SER SER A . n 
A 1 63  ALA 63  60  60  ALA ALA A . n 
A 1 64  GLU 64  61  61  GLU GLU A . n 
A 1 65  LYS 65  62  62  LYS LYS A . n 
A 1 66  SER 66  63  63  SER SER A . n 
A 1 67  SER 67  64  64  SER SER A . n 
A 1 68  LEU 68  65  65  LEU LEU A . n 
A 1 69  LYS 69  66  66  LYS LYS A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  LYS 71  68  68  LYS LYS A . n 
A 1 72  ILE 72  69  69  ILE ILE A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  GLN 74  71  71  GLN GLN A . n 
A 1 75  MSE 75  72  72  MSE MSE A . n 
A 1 76  PHE 76  73  73  PHE PHE A . n 
A 1 77  ASN 77  74  74  ASN ASN A . n 
A 1 78  GLY 78  75  75  GLY GLY A . n 
A 1 79  ALA 79  76  76  ALA ALA A . n 
A 1 80  LYS 80  77  77  LYS LYS A . n 
A 1 81  ILE 81  78  78  ILE ILE A . n 
A 1 82  ASN 82  79  79  ASN ASN A . n 
A 1 83  SER 83  80  80  SER SER A . n 
A 1 84  THR 84  81  81  THR THR A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  HIS 86  83  83  HIS HIS A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  ALA 88  85  85  ALA ALA A . n 
A 1 89  VAL 89  86  86  VAL VAL A . n 
A 1 90  LEU 90  87  87  LEU LEU A . n 
A 1 91  HIS 91  88  88  HIS HIS A . n 
A 1 92  THR 92  89  89  THR THR A . n 
A 1 93  ALA 93  90  90  ALA ALA A . n 
A 1 94  LEU 94  91  91  LEU LEU A . n 
A 1 95  ARG 95  92  92  ARG ARG A . n 
A 1 96  ASP 96  93  93  ASP ASP A . n 
A 1 97  LEU 97  94  94  LEU LEU A . n 
A 1 98  SER 98  95  95  SER SER A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 THR 100 97  97  THR THR A . n 
A 1 101 PRO 101 98  98  PRO PRO A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 ILE 103 100 100 ILE ILE A . n 
A 1 104 VAL 104 101 101 VAL VAL A . n 
A 1 105 ASP 105 102 102 ASP ASP A . n 
A 1 106 GLY 106 103 103 GLY GLY A . n 
A 1 107 GLN 107 104 104 GLN GLN A . n 
A 1 108 ASP 108 105 105 ASP ASP A . n 
A 1 109 ILE 109 106 106 ILE ILE A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 GLN 111 108 108 GLN GLN A . n 
A 1 112 GLU 112 109 109 GLU GLU A . n 
A 1 113 VAL 113 110 110 VAL VAL A . n 
A 1 114 THR 114 111 111 THR THR A . n 
A 1 115 LYS 115 112 112 LYS LYS A . n 
A 1 116 GLU 116 113 113 GLU GLU A . n 
A 1 117 LYS 117 114 114 LYS LYS A . n 
A 1 118 GLN 118 115 115 GLN GLN A . n 
A 1 119 ARG 119 116 116 ARG ARG A . n 
A 1 120 VAL 120 117 117 VAL VAL A . n 
A 1 121 LYS 121 118 118 LYS LYS A . n 
A 1 122 GLU 122 119 119 GLU GLU A . n 
A 1 123 LEU 123 120 120 LEU LEU A . n 
A 1 124 VAL 124 121 121 VAL VAL A . n 
A 1 125 GLU 125 122 122 GLU GLU A . n 
A 1 126 LYS 126 123 123 LYS LYS A . n 
A 1 127 VAL 127 124 124 VAL VAL A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 SER 129 126 126 SER SER A . n 
A 1 130 GLY 130 127 127 GLY GLY A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 TRP 132 129 129 TRP TRP A . n 
A 1 133 ARG 133 130 130 ARG ARG A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PHE 135 132 132 PHE PHE A . n 
A 1 136 SER 136 133 133 SER SER A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 LYS 138 135 135 LYS LYS A . n 
A 1 139 LYS 139 136 136 LYS LYS A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 THR 141 138 138 THR THR A . n 
A 1 142 ASP 142 139 139 ASP ASP A . n 
A 1 143 ILE 143 140 140 ILE ILE A . n 
A 1 144 VAL 144 141 141 VAL VAL A . n 
A 1 145 ASN 145 142 142 ASN ASN A . n 
A 1 146 ILE 146 143 143 ILE ILE A . n 
A 1 147 GLY 147 144 144 GLY GLY A . n 
A 1 148 ILE 148 145 145 ILE ILE A . n 
A 1 149 GLY 149 146 146 GLY GLY A . n 
A 1 150 GLY 150 147 147 GLY GLY A . n 
A 1 151 SER 151 148 148 SER SER A . n 
A 1 152 ASP 152 149 149 ASP ASP A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PRO 155 152 152 PRO PRO A . n 
A 1 156 LYS 156 153 153 LYS LYS A . n 
A 1 157 MSE 157 154 154 MSE MSE A . n 
A 1 158 VAL 158 155 155 VAL VAL A . n 
A 1 159 VAL 159 156 156 VAL VAL A . n 
A 1 160 ARG 160 157 157 ARG ARG A . n 
A 1 161 ALA 161 158 158 ALA ALA A . n 
A 1 162 LEU 162 159 159 LEU LEU A . n 
A 1 163 GLN 163 160 160 GLN GLN A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 TYR 165 162 162 TYR TYR A . n 
A 1 166 HIS 166 163 163 HIS HIS A . n 
A 1 167 CYS 167 164 164 CYS CYS A . n 
A 1 168 THR 168 165 165 THR THR A . n 
A 1 169 ASP 169 166 166 ASP ASP A . n 
A 1 170 LEU 170 167 167 LEU LEU A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 VAL 172 169 169 VAL VAL A . n 
A 1 173 HIS 173 170 170 HIS HIS A . n 
A 1 174 PHE 174 171 171 PHE PHE A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 SER 176 173 173 SER SER A . n 
A 1 177 ASN 177 174 174 ASN ASN A . n 
A 1 178 VAL 178 175 175 VAL VAL A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ASP 181 178 178 ASP ASP A . n 
A 1 182 SER 182 179 179 SER SER A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 LEU 184 181 181 LEU LEU A . n 
A 1 185 GLN 185 182 182 GLN GLN A . n 
A 1 186 ALA 186 183 183 ALA ALA A . n 
A 1 187 LEU 187 184 184 LEU LEU A . n 
A 1 188 HIS 188 185 185 HIS HIS A . n 
A 1 189 VAL 189 186 186 VAL VAL A . n 
A 1 190 VAL 190 187 187 VAL VAL A . n 
A 1 191 ASP 191 188 188 ASP ASP A . n 
A 1 192 PRO 192 189 189 PRO PRO A . n 
A 1 193 GLU 193 190 190 GLU GLU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 THR 195 192 192 THR THR A . n 
A 1 196 LEU 196 193 193 LEU LEU A . n 
A 1 197 LEU 197 194 194 LEU LEU A . n 
A 1 198 ILE 198 195 195 ILE ILE A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 ALA 200 197 197 ALA ALA A . n 
A 1 201 SER 201 198 198 SER SER A . n 
A 1 202 LYS 202 199 199 LYS LYS A . n 
A 1 203 SER 203 200 200 SER SER A . n 
A 1 204 PHE 204 201 201 PHE PHE A . n 
A 1 205 SER 205 202 202 SER SER A . n 
A 1 206 THR 206 203 203 THR THR A . n 
A 1 207 GLU 207 204 204 GLU GLU A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 THR 209 206 206 THR THR A . n 
A 1 210 LEU 210 207 207 LEU LEU A . n 
A 1 211 LEU 211 208 208 LEU LEU A . n 
A 1 212 ASN 212 209 209 ASN ASN A . n 
A 1 213 SER 213 210 210 SER SER A . n 
A 1 214 ILE 214 211 211 ILE ILE A . n 
A 1 215 SER 215 212 212 SER SER A . n 
A 1 216 ALA 216 213 213 ALA ALA A . n 
A 1 217 ARG 217 214 214 ARG ARG A . n 
A 1 218 GLU 218 215 215 GLU GLU A . n 
A 1 219 TRP 219 216 216 TRP TRP A . n 
A 1 220 LEU 220 217 217 LEU LEU A . n 
A 1 221 LEU 221 218 218 LEU LEU A . n 
A 1 222 ASP 222 219 219 ASP ASP A . n 
A 1 223 HIS 223 220 220 HIS HIS A . n 
A 1 224 TYR 224 221 221 TYR TYR A . n 
A 1 225 GLU 225 222 222 GLU GLU A . n 
A 1 226 ASP 226 223 223 ASP ASP A . n 
A 1 227 GLU 227 224 224 GLU GLU A . n 
A 1 228 LYS 228 225 225 LYS LYS A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 VAL 230 227 227 VAL VAL A . n 
A 1 231 ALA 231 228 228 ALA ALA A . n 
A 1 232 ASN 232 229 229 ASN ASN A . n 
A 1 233 HIS 233 230 230 HIS HIS A . n 
A 1 234 PHE 234 231 231 PHE PHE A . n 
A 1 235 VAL 235 232 232 VAL VAL A . n 
A 1 236 ALA 236 233 233 ALA ALA A . n 
A 1 237 ILE 237 234 234 ILE ILE A . n 
A 1 238 SER 238 235 235 SER SER A . n 
A 1 239 SER 239 236 236 SER SER A . n 
A 1 240 LYS 240 237 237 LYS LYS A . n 
A 1 241 LEU 241 238 238 LEU LEU A . n 
A 1 242 ASP 242 239 239 ASP ASP A . n 
A 1 243 LYS 243 240 240 LYS LYS A . n 
A 1 244 VAL 244 241 241 VAL VAL A . n 
A 1 245 LYS 245 242 242 LYS LYS A . n 
A 1 246 GLU 246 243 243 GLU GLU A . n 
A 1 247 PHE 247 244 244 PHE PHE A . n 
A 1 248 GLY 248 245 245 GLY GLY A . n 
A 1 249 ILE 249 246 246 ILE ILE A . n 
A 1 250 ASP 250 247 247 ASP ASP A . n 
A 1 251 LEU 251 248 248 LEU LEU A . n 
A 1 252 GLU 252 249 249 GLU GLU A . n 
A 1 253 HIS 253 250 250 HIS HIS A . n 
A 1 254 CYS 254 251 251 CYS CYS A . n 
A 1 255 TYR 255 252 252 TYR TYR A . n 
A 1 256 LYS 256 253 253 LYS LYS A . n 
A 1 257 MSE 257 254 254 MSE MSE A . n 
A 1 258 TRP 258 255 255 TRP TRP A . n 
A 1 259 ASP 259 256 256 ASP ASP A . n 
A 1 260 TRP 260 257 257 TRP TRP A . n 
A 1 261 VAL 261 258 258 VAL VAL A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 ARG 264 261 261 ARG ARG A . n 
A 1 265 TYR 265 262 262 TYR TYR A . n 
A 1 266 SER 266 263 263 SER SER A . n 
A 1 267 LEU 267 264 264 LEU LEU A . n 
A 1 268 TRP 268 265 265 TRP TRP A . n 
A 1 269 SER 269 266 266 SER SER A . n 
A 1 270 SER 270 267 267 SER SER A . n 
A 1 271 ILE 271 268 268 ILE ILE A . n 
A 1 272 GLY 272 269 269 GLY GLY A . n 
A 1 273 MSE 273 270 270 MSE MSE A . n 
A 1 274 SER 274 271 271 SER SER A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ALA 276 273 273 ALA ALA A . n 
A 1 277 PHE 277 274 274 PHE PHE A . n 
A 1 278 ALA 278 275 275 ALA ALA A . n 
A 1 279 ILE 279 276 276 ILE ILE A . n 
A 1 280 GLY 280 277 277 GLY GLY A . n 
A 1 281 TYR 281 278 278 TYR TYR A . n 
A 1 282 ASP 282 279 279 ASP ASP A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 GLU 285 282 282 GLU GLU A . n 
A 1 286 LYS 286 283 283 LYS LYS A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 LEU 288 285 285 LEU LEU A . n 
A 1 289 ALA 289 286 286 ALA ALA A . n 
A 1 290 GLY 290 287 287 GLY GLY A . n 
A 1 291 ALA 291 288 288 ALA ALA A . n 
A 1 292 TYR 292 289 289 TYR TYR A . n 
A 1 293 SER 293 290 290 SER SER A . n 
A 1 294 VAL 294 291 291 VAL VAL A . n 
A 1 295 ASP 295 292 292 ASP ASP A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 HIS 297 294 294 HIS HIS A . n 
A 1 298 PHE 298 295 295 PHE PHE A . n 
A 1 299 LYS 299 296 296 LYS LYS A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 THR 301 298 298 THR THR A . n 
A 1 302 GLU 302 299 299 GLU GLU A . n 
A 1 303 PHE 303 300 300 PHE PHE A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LYS 305 302 302 LYS LYS A . n 
A 1 306 ASN 306 303 303 ASN ASN A . n 
A 1 307 ILE 307 304 304 ILE ILE A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 VAL 309 306 306 VAL VAL A . n 
A 1 310 ILE 310 307 307 ILE ILE A . n 
A 1 311 MSE 311 308 308 MSE MSE A . n 
A 1 312 ALA 312 309 309 ALA ALA A . n 
A 1 313 LEU 313 310 310 LEU LEU A . n 
A 1 314 LEU 314 311 311 LEU LEU A . n 
A 1 315 ALA 315 312 312 ALA ALA A . n 
A 1 316 SER 316 313 313 SER SER A . n 
A 1 317 TYR 317 314 314 TYR TYR A . n 
A 1 318 TYR 318 315 315 TYR TYR A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 CYS 320 317 317 CYS CYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 TYR 322 319 319 TYR TYR A . n 
A 1 323 ASN 323 320 320 ASN ASN A . n 
A 1 324 SER 324 321 321 SER SER A . n 
A 1 325 GLN 325 322 322 GLN GLN A . n 
A 1 326 SER 326 323 323 SER SER A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 ALA 328 325 325 ALA ALA A . n 
A 1 329 LEU 329 326 326 LEU LEU A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 PRO 331 328 328 PRO PRO A . n 
A 1 332 TYR 332 329 329 TYR TYR A . n 
A 1 333 ASP 333 330 330 ASP ASP A . n 
A 1 334 GLU 334 331 331 GLU GLU A . n 
A 1 335 ARG 335 332 332 ARG ARG A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 CYS 337 334 334 CYS CYS A . n 
A 1 338 TYR 338 335 335 TYR TYR A . n 
A 1 339 PHE 339 336 336 PHE PHE A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 ASP 341 338 338 ASP ASP A . n 
A 1 342 TYR 342 339 339 TYR TYR A . n 
A 1 343 LEU 343 340 340 LEU LEU A . n 
A 1 344 GLN 344 341 341 GLN GLN A . n 
A 1 345 GLN 345 342 342 GLN GLN A . n 
A 1 346 ALA 346 343 343 ALA ALA A . n 
A 1 347 ASP 347 344 344 ASP ASP A . n 
A 1 348 MSE 348 345 345 MSE MSE A . n 
A 1 349 GLU 349 346 346 GLU GLU A . n 
A 1 350 SER 350 347 347 SER SER A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 GLY 352 349 349 GLY GLY A . n 
A 1 353 LYS 353 350 350 LYS LYS A . n 
A 1 354 SER 354 351 351 SER SER A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 ASN 356 353 353 ASN ASN A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 ALA 358 355 355 ALA ALA A . n 
A 1 359 GLY 359 356 356 GLY GLY A . n 
A 1 360 GLU 360 357 357 GLU GLU A . n 
A 1 361 THR 361 358 358 THR THR A . n 
A 1 362 VAL 362 359 359 VAL VAL A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 TYR 364 361 361 TYR TYR A . n 
A 1 365 GLN 365 362 362 GLN GLN A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 GLY 367 364 364 GLY GLY A . n 
A 1 368 VAL 368 365 365 VAL VAL A . n 
A 1 369 VAL 369 366 366 VAL VAL A . n 
A 1 370 LEU 370 367 367 LEU LEU A . n 
A 1 371 TRP 371 368 368 TRP TRP A . n 
A 1 372 GLY 372 369 369 GLY GLY A . n 
A 1 373 GLY 373 370 370 GLY GLY A . n 
A 1 374 VAL 374 371 371 VAL VAL A . n 
A 1 375 GLY 375 372 372 GLY GLY A . n 
A 1 376 THR 376 373 373 THR THR A . n 
A 1 377 ASN 377 374 374 ASN ASN A . n 
A 1 378 GLY 378 375 375 GLY GLY A . n 
A 1 379 GLN 379 376 376 GLN GLN A . n 
A 1 380 HIS 380 377 377 HIS HIS A . n 
A 1 381 ALA 381 378 378 ALA ALA A . n 
A 1 382 PHE 382 379 379 PHE PHE A . n 
A 1 383 HIS 383 380 380 HIS HIS A . n 
A 1 384 GLN 384 381 381 GLN GLN A . n 
A 1 385 LEU 385 382 382 LEU LEU A . n 
A 1 386 LEU 386 383 383 LEU LEU A . n 
A 1 387 HIS 387 384 384 HIS HIS A . n 
A 1 388 GLN 388 385 385 GLN GLN A . n 
A 1 389 GLY 389 386 386 GLY GLY A . n 
A 1 390 ASN 390 387 387 ASN ASN A . n 
A 1 391 ILE 391 388 388 ILE ILE A . n 
A 1 392 PHE 392 389 389 PHE PHE A . n 
A 1 393 ILE 393 390 390 ILE ILE A . n 
A 1 394 PRO 394 391 391 PRO PRO A . n 
A 1 395 VAL 395 392 392 VAL VAL A . n 
A 1 396 ASP 396 393 393 ASP ASP A . n 
A 1 397 PHE 397 394 394 PHE PHE A . n 
A 1 398 ILE 398 395 395 ILE ILE A . n 
A 1 399 ALA 399 396 396 ALA ALA A . n 
A 1 400 ILE 400 397 397 ILE ILE A . n 
A 1 401 ALA 401 398 398 ALA ALA A . n 
A 1 402 THR 402 399 399 THR THR A . n 
A 1 403 SER 403 400 400 SER SER A . n 
A 1 404 HIS 404 401 401 HIS HIS A . n 
A 1 405 HIS 405 402 402 HIS HIS A . n 
A 1 406 ASN 406 403 403 ASN ASN A . n 
A 1 407 TYR 407 404 404 TYR TYR A . n 
A 1 408 ASP 408 405 405 ASP ASP A . n 
A 1 409 ASN 409 406 406 ASN ASN A . n 
A 1 410 HIS 410 407 407 HIS HIS A . n 
A 1 411 GLN 411 408 408 GLN GLN A . n 
A 1 412 GLN 412 409 409 GLN GLN A . n 
A 1 413 ALA 413 410 410 ALA ALA A . n 
A 1 414 LEU 414 411 411 LEU LEU A . n 
A 1 415 LEU 415 412 412 LEU LEU A . n 
A 1 416 ALA 416 413 413 ALA ALA A . n 
A 1 417 ASN 417 414 414 ASN ASN A . n 
A 1 418 CYS 418 415 415 CYS CYS A . n 
A 1 419 PHE 419 416 416 PHE PHE A . n 
A 1 420 ALA 420 417 417 ALA ALA A . n 
A 1 421 GLN 421 418 418 GLN GLN A . n 
A 1 422 SER 422 419 419 SER SER A . n 
A 1 423 GLN 423 420 420 GLN GLN A . n 
A 1 424 ALA 424 421 421 ALA ALA A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 MSE 426 423 423 MSE MSE A . n 
A 1 427 PHE 427 424 424 PHE PHE A . n 
A 1 428 GLY 428 425 425 GLY GLY A . n 
A 1 429 GLN 429 426 426 GLN GLN A . n 
A 1 430 SER 430 427 427 SER SER A . n 
A 1 431 TYR 431 428 428 TYR TYR A . n 
A 1 432 ASP 432 429 429 ASP ASP A . n 
A 1 433 MSE 433 430 430 MSE MSE A . n 
A 1 434 VAL 434 431 431 VAL VAL A . n 
A 1 435 TYR 435 432 432 TYR TYR A . n 
A 1 436 ASN 436 433 433 ASN ASN A . n 
A 1 437 GLU 437 434 434 GLU GLU A . n 
A 1 438 LEU 438 435 435 LEU LEU A . n 
A 1 439 LEU 439 436 436 LEU LEU A . n 
A 1 440 LYS 440 437 437 LYS LYS A . n 
A 1 441 SER 441 438 438 SER SER A . n 
A 1 442 GLY 442 439 439 GLY GLY A . n 
A 1 443 LEU 443 440 440 LEU LEU A . n 
A 1 444 ASN 444 441 441 ASN ASN A . n 
A 1 445 GLU 445 442 442 GLU GLU A . n 
A 1 446 THR 446 443 443 THR THR A . n 
A 1 447 GLN 447 444 444 GLN GLN A . n 
A 1 448 ALA 448 445 445 ALA ALA A . n 
A 1 449 LYS 449 446 446 LYS LYS A . n 
A 1 450 GLU 450 447 447 GLU GLU A . n 
A 1 451 LEU 451 448 448 LEU LEU A . n 
A 1 452 ALA 452 449 449 ALA ALA A . n 
A 1 453 ALA 453 450 450 ALA ALA A . n 
A 1 454 HIS 454 451 451 HIS HIS A . n 
A 1 455 LYS 455 452 452 LYS LYS A . n 
A 1 456 VAL 456 453 453 VAL VAL A . n 
A 1 457 ILE 457 454 454 ILE ILE A . n 
A 1 458 PRO 458 455 455 PRO PRO A . n 
A 1 459 GLY 459 456 456 GLY GLY A . n 
A 1 460 ASN 460 457 457 ASN ASN A . n 
A 1 461 ARG 461 458 458 ARG ARG A . n 
A 1 462 PRO 462 459 459 PRO PRO A . n 
A 1 463 SER 463 460 460 SER SER A . n 
A 1 464 THR 464 461 461 THR THR A . n 
A 1 465 THR 465 462 462 THR THR A . n 
A 1 466 ILE 466 463 463 ILE ILE A . n 
A 1 467 LEU 467 464 464 LEU LEU A . n 
A 1 468 LEU 468 465 465 LEU LEU A . n 
A 1 469 ASP 469 466 466 ASP ASP A . n 
A 1 470 GLU 470 467 467 GLU GLU A . n 
A 1 471 LEU 471 468 468 LEU LEU A . n 
A 1 472 SER 472 469 469 SER SER A . n 
A 1 473 PRO 473 470 470 PRO PRO A . n 
A 1 474 TYR 474 471 471 TYR TYR A . n 
A 1 475 SER 475 472 472 SER SER A . n 
A 1 476 LEU 476 473 473 LEU LEU A . n 
A 1 477 GLY 477 474 474 GLY GLY A . n 
A 1 478 ALA 478 475 475 ALA ALA A . n 
A 1 479 LEU 479 476 476 LEU LEU A . n 
A 1 480 ILE 480 477 477 ILE ILE A . n 
A 1 481 ALA 481 478 478 ALA ALA A . n 
A 1 482 LEU 482 479 479 LEU LEU A . n 
A 1 483 TYR 483 480 480 TYR TYR A . n 
A 1 484 GLU 484 481 481 GLU GLU A . n 
A 1 485 HIS 485 482 482 HIS HIS A . n 
A 1 486 LYS 486 483 483 LYS LYS A . n 
A 1 487 ILE 487 484 484 ILE ILE A . n 
A 1 488 PHE 488 485 485 PHE PHE A . n 
A 1 489 VAL 489 486 486 VAL VAL A . n 
A 1 490 GLN 490 487 487 GLN GLN A . n 
A 1 491 GLY 491 488 488 GLY GLY A . n 
A 1 492 VAL 492 489 489 VAL VAL A . n 
A 1 493 LEU 493 490 490 LEU LEU A . n 
A 1 494 TRP 494 491 491 TRP TRP A . n 
A 1 495 ASP 495 492 492 ASP ASP A . n 
A 1 496 ILE 496 493 493 ILE ILE A . n 
A 1 497 ASN 497 494 494 ASN ASN A . n 
A 1 498 SER 498 495 495 SER SER A . n 
A 1 499 TYR 499 496 496 TYR TYR A . n 
A 1 500 ASP 500 497 497 ASP ASP A . n 
A 1 501 GLN 501 498 498 GLN GLN A . n 
A 1 502 TRP 502 499 499 TRP TRP A . n 
A 1 503 GLY 503 500 500 GLY GLY A . n 
A 1 504 VAL 504 501 501 VAL VAL A . n 
A 1 505 GLU 505 502 502 GLU GLU A . n 
A 1 506 LEU 506 503 503 LEU LEU A . n 
A 1 507 GLY 507 504 504 GLY GLY A . n 
A 1 508 LYS 508 505 505 LYS LYS A . n 
A 1 509 LYS 509 506 506 LYS LYS A . n 
A 1 510 LEU 510 507 507 LEU LEU A . n 
A 1 511 GLY 511 508 508 GLY GLY A . n 
A 1 512 LYS 512 509 509 LYS LYS A . n 
A 1 513 ASN 513 510 510 ASN ASN A . n 
A 1 514 ILE 514 511 511 ILE ILE A . n 
A 1 515 LEU 515 512 512 LEU LEU A . n 
A 1 516 LYS 516 513 513 LYS LYS A . n 
A 1 517 ALA 517 514 514 ALA ALA A . n 
A 1 518 MSE 518 515 515 MSE MSE A . n 
A 1 519 ASN 519 516 516 ASN ASN A . n 
A 1 520 ASP 520 517 517 ASP ASP A . n 
A 1 521 ASP 521 518 518 ASP ASP A . n 
A 1 522 SER 522 519 519 SER SER A . n 
A 1 523 SER 523 520 520 SER SER A . n 
A 1 524 ASP 524 521 521 ASP ASP A . n 
A 1 525 GLU 525 522 522 GLU GLU A . n 
A 1 526 TYR 526 523 523 TYR TYR A . n 
A 1 527 GLN 527 524 524 GLN GLN A . n 
A 1 528 ASN 528 525 525 ASN ASN A . n 
A 1 529 LEU 529 526 526 LEU LEU A . n 
A 1 530 ASP 530 527 527 ASP ASP A . n 
A 1 531 ASP 531 528 528 ASP ASP A . n 
A 1 532 SER 532 529 529 SER SER A . n 
A 1 533 THR 533 530 530 THR THR A . n 
A 1 534 ARG 534 531 531 ARG ARG A . n 
A 1 535 GLN 535 532 532 GLN GLN A . n 
A 1 536 LEU 536 533 533 LEU LEU A . n 
A 1 537 ILE 537 534 534 ILE ILE A . n 
A 1 538 ALA 538 535 535 ALA ALA A . n 
A 1 539 LYS 539 536 536 LYS LYS A . n 
A 1 540 VAL 540 537 537 VAL VAL A . n 
A 1 541 LYS 541 538 538 LYS LYS A . n 
A 1 542 ASN 542 539 539 ASN ASN A . n 
A 1 543 LYS 543 540 540 LYS LYS A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Center for Structural Genomics of Infectious Diseases' 
_pdbx_SG_project.initial_of_center     CSGID 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MES 1   601  601 MES MES A . 
C 3 GOL 1   602  602 GOL GOL A . 
D 4 IPA 1   603  603 IPA IPA A . 
E 5 CA  1   604  604 CA  CA  A . 
F 6 HOH 1   541  541 HOH HOH A . 
F 6 HOH 2   542  542 HOH HOH A . 
F 6 HOH 3   543  543 HOH HOH A . 
F 6 HOH 4   544  544 HOH HOH A . 
F 6 HOH 5   545  545 HOH HOH A . 
F 6 HOH 6   546  546 HOH HOH A . 
F 6 HOH 7   547  547 HOH HOH A . 
F 6 HOH 8   548  548 HOH HOH A . 
F 6 HOH 9   549  549 HOH HOH A . 
F 6 HOH 10  550  550 HOH HOH A . 
F 6 HOH 11  551  551 HOH HOH A . 
F 6 HOH 12  552  552 HOH HOH A . 
F 6 HOH 13  553  553 HOH HOH A . 
F 6 HOH 14  554  554 HOH HOH A . 
F 6 HOH 15  555  555 HOH HOH A . 
F 6 HOH 16  556  556 HOH HOH A . 
F 6 HOH 17  557  557 HOH HOH A . 
F 6 HOH 18  558  558 HOH HOH A . 
F 6 HOH 19  559  559 HOH HOH A . 
F 6 HOH 20  560  560 HOH HOH A . 
F 6 HOH 21  561  561 HOH HOH A . 
F 6 HOH 22  562  562 HOH HOH A . 
F 6 HOH 23  563  563 HOH HOH A . 
F 6 HOH 24  564  564 HOH HOH A . 
F 6 HOH 25  565  565 HOH HOH A . 
F 6 HOH 26  566  566 HOH HOH A . 
F 6 HOH 27  567  567 HOH HOH A . 
F 6 HOH 28  568  568 HOH HOH A . 
F 6 HOH 29  569  569 HOH HOH A . 
F 6 HOH 30  570  570 HOH HOH A . 
F 6 HOH 31  571  571 HOH HOH A . 
F 6 HOH 32  572  572 HOH HOH A . 
F 6 HOH 33  573  573 HOH HOH A . 
F 6 HOH 34  574  574 HOH HOH A . 
F 6 HOH 35  575  575 HOH HOH A . 
F 6 HOH 36  576  576 HOH HOH A . 
F 6 HOH 37  577  577 HOH HOH A . 
F 6 HOH 38  578  578 HOH HOH A . 
F 6 HOH 39  579  579 HOH HOH A . 
F 6 HOH 40  580  580 HOH HOH A . 
F 6 HOH 41  581  581 HOH HOH A . 
F 6 HOH 42  582  582 HOH HOH A . 
F 6 HOH 43  583  583 HOH HOH A . 
F 6 HOH 44  584  584 HOH HOH A . 
F 6 HOH 45  585  585 HOH HOH A . 
F 6 HOH 46  586  586 HOH HOH A . 
F 6 HOH 47  587  587 HOH HOH A . 
F 6 HOH 48  588  588 HOH HOH A . 
F 6 HOH 49  589  589 HOH HOH A . 
F 6 HOH 50  590  590 HOH HOH A . 
F 6 HOH 51  591  591 HOH HOH A . 
F 6 HOH 52  592  592 HOH HOH A . 
F 6 HOH 53  593  593 HOH HOH A . 
F 6 HOH 54  594  594 HOH HOH A . 
F 6 HOH 55  595  595 HOH HOH A . 
F 6 HOH 56  596  596 HOH HOH A . 
F 6 HOH 57  597  597 HOH HOH A . 
F 6 HOH 58  598  598 HOH HOH A . 
F 6 HOH 59  599  599 HOH HOH A . 
F 6 HOH 60  600  600 HOH HOH A . 
F 6 HOH 61  605  605 HOH HOH A . 
F 6 HOH 62  606  606 HOH HOH A . 
F 6 HOH 63  607  607 HOH HOH A . 
F 6 HOH 64  608  608 HOH HOH A . 
F 6 HOH 65  609  609 HOH HOH A . 
F 6 HOH 66  610  610 HOH HOH A . 
F 6 HOH 67  611  611 HOH HOH A . 
F 6 HOH 68  612  612 HOH HOH A . 
F 6 HOH 69  613  613 HOH HOH A . 
F 6 HOH 70  614  614 HOH HOH A . 
F 6 HOH 71  615  615 HOH HOH A . 
F 6 HOH 72  616  616 HOH HOH A . 
F 6 HOH 73  617  617 HOH HOH A . 
F 6 HOH 74  618  618 HOH HOH A . 
F 6 HOH 75  619  619 HOH HOH A . 
F 6 HOH 76  620  620 HOH HOH A . 
F 6 HOH 77  621  621 HOH HOH A . 
F 6 HOH 78  622  622 HOH HOH A . 
F 6 HOH 79  623  623 HOH HOH A . 
F 6 HOH 80  624  624 HOH HOH A . 
F 6 HOH 81  625  625 HOH HOH A . 
F 6 HOH 82  626  626 HOH HOH A . 
F 6 HOH 83  627  627 HOH HOH A . 
F 6 HOH 84  628  628 HOH HOH A . 
F 6 HOH 85  629  629 HOH HOH A . 
F 6 HOH 86  630  630 HOH HOH A . 
F 6 HOH 87  631  631 HOH HOH A . 
F 6 HOH 88  632  632 HOH HOH A . 
F 6 HOH 89  633  633 HOH HOH A . 
F 6 HOH 90  634  634 HOH HOH A . 
F 6 HOH 91  635  635 HOH HOH A . 
F 6 HOH 92  636  636 HOH HOH A . 
F 6 HOH 93  637  637 HOH HOH A . 
F 6 HOH 94  638  638 HOH HOH A . 
F 6 HOH 95  639  639 HOH HOH A . 
F 6 HOH 96  640  640 HOH HOH A . 
F 6 HOH 97  641  641 HOH HOH A . 
F 6 HOH 98  642  642 HOH HOH A . 
F 6 HOH 99  643  643 HOH HOH A . 
F 6 HOH 100 644  644 HOH HOH A . 
F 6 HOH 101 645  645 HOH HOH A . 
F 6 HOH 102 646  646 HOH HOH A . 
F 6 HOH 103 647  647 HOH HOH A . 
F 6 HOH 104 648  648 HOH HOH A . 
F 6 HOH 105 649  649 HOH HOH A . 
F 6 HOH 106 650  650 HOH HOH A . 
F 6 HOH 107 651  651 HOH HOH A . 
F 6 HOH 108 652  652 HOH HOH A . 
F 6 HOH 109 653  653 HOH HOH A . 
F 6 HOH 110 654  654 HOH HOH A . 
F 6 HOH 111 655  655 HOH HOH A . 
F 6 HOH 112 656  656 HOH HOH A . 
F 6 HOH 113 657  657 HOH HOH A . 
F 6 HOH 114 658  658 HOH HOH A . 
F 6 HOH 115 659  659 HOH HOH A . 
F 6 HOH 116 660  660 HOH HOH A . 
F 6 HOH 117 661  661 HOH HOH A . 
F 6 HOH 118 662  662 HOH HOH A . 
F 6 HOH 119 663  663 HOH HOH A . 
F 6 HOH 120 664  664 HOH HOH A . 
F 6 HOH 121 665  665 HOH HOH A . 
F 6 HOH 122 666  666 HOH HOH A . 
F 6 HOH 123 667  667 HOH HOH A . 
F 6 HOH 124 668  668 HOH HOH A . 
F 6 HOH 125 669  669 HOH HOH A . 
F 6 HOH 126 670  670 HOH HOH A . 
F 6 HOH 127 671  671 HOH HOH A . 
F 6 HOH 128 672  672 HOH HOH A . 
F 6 HOH 129 673  673 HOH HOH A . 
F 6 HOH 130 674  674 HOH HOH A . 
F 6 HOH 131 675  675 HOH HOH A . 
F 6 HOH 132 676  676 HOH HOH A . 
F 6 HOH 133 677  677 HOH HOH A . 
F 6 HOH 134 678  678 HOH HOH A . 
F 6 HOH 135 679  679 HOH HOH A . 
F 6 HOH 136 680  680 HOH HOH A . 
F 6 HOH 137 681  681 HOH HOH A . 
F 6 HOH 138 682  682 HOH HOH A . 
F 6 HOH 139 683  683 HOH HOH A . 
F 6 HOH 140 684  684 HOH HOH A . 
F 6 HOH 141 685  685 HOH HOH A . 
F 6 HOH 142 686  686 HOH HOH A . 
F 6 HOH 143 687  687 HOH HOH A . 
F 6 HOH 144 688  688 HOH HOH A . 
F 6 HOH 145 689  689 HOH HOH A . 
F 6 HOH 146 690  690 HOH HOH A . 
F 6 HOH 147 691  691 HOH HOH A . 
F 6 HOH 148 692  692 HOH HOH A . 
F 6 HOH 149 693  693 HOH HOH A . 
F 6 HOH 150 694  694 HOH HOH A . 
F 6 HOH 151 695  695 HOH HOH A . 
F 6 HOH 152 696  696 HOH HOH A . 
F 6 HOH 153 697  697 HOH HOH A . 
F 6 HOH 154 698  698 HOH HOH A . 
F 6 HOH 155 699  699 HOH HOH A . 
F 6 HOH 156 700  700 HOH HOH A . 
F 6 HOH 157 701  701 HOH HOH A . 
F 6 HOH 158 702  702 HOH HOH A . 
F 6 HOH 159 703  703 HOH HOH A . 
F 6 HOH 160 704  704 HOH HOH A . 
F 6 HOH 161 705  705 HOH HOH A . 
F 6 HOH 162 706  706 HOH HOH A . 
F 6 HOH 163 707  707 HOH HOH A . 
F 6 HOH 164 708  708 HOH HOH A . 
F 6 HOH 165 709  709 HOH HOH A . 
F 6 HOH 166 710  710 HOH HOH A . 
F 6 HOH 167 711  711 HOH HOH A . 
F 6 HOH 168 712  712 HOH HOH A . 
F 6 HOH 169 713  713 HOH HOH A . 
F 6 HOH 170 714  714 HOH HOH A . 
F 6 HOH 171 715  715 HOH HOH A . 
F 6 HOH 172 716  716 HOH HOH A . 
F 6 HOH 173 717  717 HOH HOH A . 
F 6 HOH 174 718  718 HOH HOH A . 
F 6 HOH 175 719  719 HOH HOH A . 
F 6 HOH 176 720  720 HOH HOH A . 
F 6 HOH 177 721  721 HOH HOH A . 
F 6 HOH 178 722  722 HOH HOH A . 
F 6 HOH 179 723  723 HOH HOH A . 
F 6 HOH 180 724  1   HOH HOH A . 
F 6 HOH 181 725  2   HOH HOH A . 
F 6 HOH 182 726  3   HOH HOH A . 
F 6 HOH 183 727  4   HOH HOH A . 
F 6 HOH 184 728  5   HOH HOH A . 
F 6 HOH 185 729  6   HOH HOH A . 
F 6 HOH 186 730  7   HOH HOH A . 
F 6 HOH 187 731  8   HOH HOH A . 
F 6 HOH 188 732  9   HOH HOH A . 
F 6 HOH 189 733  10  HOH HOH A . 
F 6 HOH 190 734  11  HOH HOH A . 
F 6 HOH 191 735  12  HOH HOH A . 
F 6 HOH 192 736  13  HOH HOH A . 
F 6 HOH 193 737  14  HOH HOH A . 
F 6 HOH 194 738  15  HOH HOH A . 
F 6 HOH 195 739  16  HOH HOH A . 
F 6 HOH 196 740  17  HOH HOH A . 
F 6 HOH 197 741  18  HOH HOH A . 
F 6 HOH 198 742  19  HOH HOH A . 
F 6 HOH 199 743  20  HOH HOH A . 
F 6 HOH 200 744  21  HOH HOH A . 
F 6 HOH 201 745  22  HOH HOH A . 
F 6 HOH 202 746  23  HOH HOH A . 
F 6 HOH 203 747  24  HOH HOH A . 
F 6 HOH 204 748  25  HOH HOH A . 
F 6 HOH 205 749  26  HOH HOH A . 
F 6 HOH 206 750  27  HOH HOH A . 
F 6 HOH 207 751  28  HOH HOH A . 
F 6 HOH 208 752  29  HOH HOH A . 
F 6 HOH 209 753  30  HOH HOH A . 
F 6 HOH 210 754  31  HOH HOH A . 
F 6 HOH 211 755  32  HOH HOH A . 
F 6 HOH 212 756  33  HOH HOH A . 
F 6 HOH 213 757  34  HOH HOH A . 
F 6 HOH 214 758  35  HOH HOH A . 
F 6 HOH 215 759  36  HOH HOH A . 
F 6 HOH 216 760  37  HOH HOH A . 
F 6 HOH 217 761  38  HOH HOH A . 
F 6 HOH 218 762  39  HOH HOH A . 
F 6 HOH 219 763  40  HOH HOH A . 
F 6 HOH 220 764  41  HOH HOH A . 
F 6 HOH 221 765  42  HOH HOH A . 
F 6 HOH 222 766  43  HOH HOH A . 
F 6 HOH 223 767  44  HOH HOH A . 
F 6 HOH 224 768  45  HOH HOH A . 
F 6 HOH 225 769  46  HOH HOH A . 
F 6 HOH 226 770  47  HOH HOH A . 
F 6 HOH 227 771  48  HOH HOH A . 
F 6 HOH 228 772  49  HOH HOH A . 
F 6 HOH 229 773  50  HOH HOH A . 
F 6 HOH 230 774  51  HOH HOH A . 
F 6 HOH 231 775  52  HOH HOH A . 
F 6 HOH 232 776  53  HOH HOH A . 
F 6 HOH 233 777  54  HOH HOH A . 
F 6 HOH 234 778  55  HOH HOH A . 
F 6 HOH 235 779  56  HOH HOH A . 
F 6 HOH 236 780  57  HOH HOH A . 
F 6 HOH 237 781  58  HOH HOH A . 
F 6 HOH 238 782  59  HOH HOH A . 
F 6 HOH 239 783  60  HOH HOH A . 
F 6 HOH 240 784  61  HOH HOH A . 
F 6 HOH 241 785  62  HOH HOH A . 
F 6 HOH 242 786  63  HOH HOH A . 
F 6 HOH 243 787  64  HOH HOH A . 
F 6 HOH 244 788  65  HOH HOH A . 
F 6 HOH 245 789  66  HOH HOH A . 
F 6 HOH 246 790  67  HOH HOH A . 
F 6 HOH 247 791  68  HOH HOH A . 
F 6 HOH 248 792  69  HOH HOH A . 
F 6 HOH 249 793  70  HOH HOH A . 
F 6 HOH 250 794  71  HOH HOH A . 
F 6 HOH 251 795  72  HOH HOH A . 
F 6 HOH 252 796  73  HOH HOH A . 
F 6 HOH 253 797  74  HOH HOH A . 
F 6 HOH 254 798  75  HOH HOH A . 
F 6 HOH 255 799  76  HOH HOH A . 
F 6 HOH 256 800  77  HOH HOH A . 
F 6 HOH 257 801  78  HOH HOH A . 
F 6 HOH 258 802  79  HOH HOH A . 
F 6 HOH 259 803  80  HOH HOH A . 
F 6 HOH 260 804  81  HOH HOH A . 
F 6 HOH 261 805  82  HOH HOH A . 
F 6 HOH 262 806  83  HOH HOH A . 
F 6 HOH 263 807  84  HOH HOH A . 
F 6 HOH 264 808  85  HOH HOH A . 
F 6 HOH 265 809  86  HOH HOH A . 
F 6 HOH 266 810  87  HOH HOH A . 
F 6 HOH 267 811  88  HOH HOH A . 
F 6 HOH 268 812  89  HOH HOH A . 
F 6 HOH 269 813  90  HOH HOH A . 
F 6 HOH 270 814  91  HOH HOH A . 
F 6 HOH 271 815  92  HOH HOH A . 
F 6 HOH 272 816  93  HOH HOH A . 
F 6 HOH 273 817  94  HOH HOH A . 
F 6 HOH 274 818  95  HOH HOH A . 
F 6 HOH 275 819  96  HOH HOH A . 
F 6 HOH 276 820  97  HOH HOH A . 
F 6 HOH 277 821  98  HOH HOH A . 
F 6 HOH 278 822  99  HOH HOH A . 
F 6 HOH 279 823  100 HOH HOH A . 
F 6 HOH 280 824  101 HOH HOH A . 
F 6 HOH 281 825  102 HOH HOH A . 
F 6 HOH 282 826  103 HOH HOH A . 
F 6 HOH 283 827  104 HOH HOH A . 
F 6 HOH 284 828  105 HOH HOH A . 
F 6 HOH 285 829  106 HOH HOH A . 
F 6 HOH 286 830  107 HOH HOH A . 
F 6 HOH 287 831  108 HOH HOH A . 
F 6 HOH 288 832  109 HOH HOH A . 
F 6 HOH 289 833  110 HOH HOH A . 
F 6 HOH 290 834  111 HOH HOH A . 
F 6 HOH 291 835  112 HOH HOH A . 
F 6 HOH 292 836  113 HOH HOH A . 
F 6 HOH 293 837  114 HOH HOH A . 
F 6 HOH 294 838  115 HOH HOH A . 
F 6 HOH 295 839  116 HOH HOH A . 
F 6 HOH 296 840  117 HOH HOH A . 
F 6 HOH 297 841  118 HOH HOH A . 
F 6 HOH 298 842  119 HOH HOH A . 
F 6 HOH 299 843  120 HOH HOH A . 
F 6 HOH 300 844  121 HOH HOH A . 
F 6 HOH 301 845  122 HOH HOH A . 
F 6 HOH 302 846  123 HOH HOH A . 
F 6 HOH 303 847  124 HOH HOH A . 
F 6 HOH 304 848  125 HOH HOH A . 
F 6 HOH 305 849  126 HOH HOH A . 
F 6 HOH 306 850  127 HOH HOH A . 
F 6 HOH 307 851  128 HOH HOH A . 
F 6 HOH 308 852  129 HOH HOH A . 
F 6 HOH 309 853  130 HOH HOH A . 
F 6 HOH 310 854  131 HOH HOH A . 
F 6 HOH 311 855  132 HOH HOH A . 
F 6 HOH 312 856  133 HOH HOH A . 
F 6 HOH 313 857  134 HOH HOH A . 
F 6 HOH 314 858  135 HOH HOH A . 
F 6 HOH 315 859  136 HOH HOH A . 
F 6 HOH 316 860  137 HOH HOH A . 
F 6 HOH 317 861  138 HOH HOH A . 
F 6 HOH 318 862  139 HOH HOH A . 
F 6 HOH 319 863  140 HOH HOH A . 
F 6 HOH 320 864  141 HOH HOH A . 
F 6 HOH 321 865  142 HOH HOH A . 
F 6 HOH 322 866  143 HOH HOH A . 
F 6 HOH 323 867  144 HOH HOH A . 
F 6 HOH 324 868  145 HOH HOH A . 
F 6 HOH 325 869  146 HOH HOH A . 
F 6 HOH 326 870  147 HOH HOH A . 
F 6 HOH 327 871  148 HOH HOH A . 
F 6 HOH 328 872  149 HOH HOH A . 
F 6 HOH 329 873  150 HOH HOH A . 
F 6 HOH 330 874  151 HOH HOH A . 
F 6 HOH 331 875  152 HOH HOH A . 
F 6 HOH 332 876  153 HOH HOH A . 
F 6 HOH 333 877  154 HOH HOH A . 
F 6 HOH 334 878  155 HOH HOH A . 
F 6 HOH 335 879  156 HOH HOH A . 
F 6 HOH 336 880  157 HOH HOH A . 
F 6 HOH 337 881  158 HOH HOH A . 
F 6 HOH 338 882  159 HOH HOH A . 
F 6 HOH 339 883  160 HOH HOH A . 
F 6 HOH 340 884  161 HOH HOH A . 
F 6 HOH 341 885  162 HOH HOH A . 
F 6 HOH 342 886  163 HOH HOH A . 
F 6 HOH 343 887  164 HOH HOH A . 
F 6 HOH 344 888  165 HOH HOH A . 
F 6 HOH 345 889  166 HOH HOH A . 
F 6 HOH 346 890  167 HOH HOH A . 
F 6 HOH 347 891  168 HOH HOH A . 
F 6 HOH 348 892  169 HOH HOH A . 
F 6 HOH 349 893  170 HOH HOH A . 
F 6 HOH 350 894  171 HOH HOH A . 
F 6 HOH 351 895  172 HOH HOH A . 
F 6 HOH 352 896  173 HOH HOH A . 
F 6 HOH 353 897  174 HOH HOH A . 
F 6 HOH 354 898  175 HOH HOH A . 
F 6 HOH 355 899  176 HOH HOH A . 
F 6 HOH 356 900  177 HOH HOH A . 
F 6 HOH 357 901  178 HOH HOH A . 
F 6 HOH 358 902  179 HOH HOH A . 
F 6 HOH 359 903  180 HOH HOH A . 
F 6 HOH 360 904  181 HOH HOH A . 
F 6 HOH 361 905  182 HOH HOH A . 
F 6 HOH 362 906  183 HOH HOH A . 
F 6 HOH 363 907  184 HOH HOH A . 
F 6 HOH 364 908  185 HOH HOH A . 
F 6 HOH 365 909  186 HOH HOH A . 
F 6 HOH 366 910  187 HOH HOH A . 
F 6 HOH 367 911  188 HOH HOH A . 
F 6 HOH 368 912  189 HOH HOH A . 
F 6 HOH 369 913  190 HOH HOH A . 
F 6 HOH 370 914  191 HOH HOH A . 
F 6 HOH 371 915  192 HOH HOH A . 
F 6 HOH 372 916  193 HOH HOH A . 
F 6 HOH 373 917  194 HOH HOH A . 
F 6 HOH 374 918  195 HOH HOH A . 
F 6 HOH 375 919  196 HOH HOH A . 
F 6 HOH 376 920  197 HOH HOH A . 
F 6 HOH 377 921  198 HOH HOH A . 
F 6 HOH 378 922  199 HOH HOH A . 
F 6 HOH 379 923  200 HOH HOH A . 
F 6 HOH 380 924  201 HOH HOH A . 
F 6 HOH 381 925  202 HOH HOH A . 
F 6 HOH 382 926  203 HOH HOH A . 
F 6 HOH 383 927  204 HOH HOH A . 
F 6 HOH 384 928  205 HOH HOH A . 
F 6 HOH 385 929  206 HOH HOH A . 
F 6 HOH 386 930  207 HOH HOH A . 
F 6 HOH 387 931  208 HOH HOH A . 
F 6 HOH 388 932  209 HOH HOH A . 
F 6 HOH 389 933  210 HOH HOH A . 
F 6 HOH 390 934  211 HOH HOH A . 
F 6 HOH 391 935  212 HOH HOH A . 
F 6 HOH 392 936  213 HOH HOH A . 
F 6 HOH 393 937  214 HOH HOH A . 
F 6 HOH 394 938  215 HOH HOH A . 
F 6 HOH 395 939  216 HOH HOH A . 
F 6 HOH 396 940  217 HOH HOH A . 
F 6 HOH 397 941  218 HOH HOH A . 
F 6 HOH 398 942  219 HOH HOH A . 
F 6 HOH 399 943  220 HOH HOH A . 
F 6 HOH 400 944  221 HOH HOH A . 
F 6 HOH 401 945  222 HOH HOH A . 
F 6 HOH 402 946  223 HOH HOH A . 
F 6 HOH 403 947  224 HOH HOH A . 
F 6 HOH 404 948  225 HOH HOH A . 
F 6 HOH 405 949  226 HOH HOH A . 
F 6 HOH 406 950  227 HOH HOH A . 
F 6 HOH 407 951  228 HOH HOH A . 
F 6 HOH 408 952  229 HOH HOH A . 
F 6 HOH 409 953  230 HOH HOH A . 
F 6 HOH 410 954  231 HOH HOH A . 
F 6 HOH 411 955  232 HOH HOH A . 
F 6 HOH 412 956  233 HOH HOH A . 
F 6 HOH 413 957  234 HOH HOH A . 
F 6 HOH 414 958  235 HOH HOH A . 
F 6 HOH 415 959  236 HOH HOH A . 
F 6 HOH 416 960  237 HOH HOH A . 
F 6 HOH 417 961  238 HOH HOH A . 
F 6 HOH 418 962  239 HOH HOH A . 
F 6 HOH 419 963  240 HOH HOH A . 
F 6 HOH 420 964  241 HOH HOH A . 
F 6 HOH 421 965  242 HOH HOH A . 
F 6 HOH 422 966  243 HOH HOH A . 
F 6 HOH 423 967  244 HOH HOH A . 
F 6 HOH 424 968  245 HOH HOH A . 
F 6 HOH 425 969  246 HOH HOH A . 
F 6 HOH 426 970  247 HOH HOH A . 
F 6 HOH 427 971  248 HOH HOH A . 
F 6 HOH 428 972  249 HOH HOH A . 
F 6 HOH 429 973  250 HOH HOH A . 
F 6 HOH 430 974  251 HOH HOH A . 
F 6 HOH 431 975  252 HOH HOH A . 
F 6 HOH 432 976  253 HOH HOH A . 
F 6 HOH 433 977  254 HOH HOH A . 
F 6 HOH 434 978  255 HOH HOH A . 
F 6 HOH 435 979  256 HOH HOH A . 
F 6 HOH 436 980  257 HOH HOH A . 
F 6 HOH 437 981  258 HOH HOH A . 
F 6 HOH 438 982  259 HOH HOH A . 
F 6 HOH 439 983  260 HOH HOH A . 
F 6 HOH 440 984  261 HOH HOH A . 
F 6 HOH 441 985  262 HOH HOH A . 
F 6 HOH 442 986  263 HOH HOH A . 
F 6 HOH 443 987  264 HOH HOH A . 
F 6 HOH 444 988  265 HOH HOH A . 
F 6 HOH 445 989  266 HOH HOH A . 
F 6 HOH 446 990  267 HOH HOH A . 
F 6 HOH 447 991  268 HOH HOH A . 
F 6 HOH 448 992  269 HOH HOH A . 
F 6 HOH 449 993  270 HOH HOH A . 
F 6 HOH 450 994  271 HOH HOH A . 
F 6 HOH 451 995  272 HOH HOH A . 
F 6 HOH 452 996  273 HOH HOH A . 
F 6 HOH 453 997  274 HOH HOH A . 
F 6 HOH 454 998  275 HOH HOH A . 
F 6 HOH 455 999  276 HOH HOH A . 
F 6 HOH 456 1000 277 HOH HOH A . 
F 6 HOH 457 1001 278 HOH HOH A . 
F 6 HOH 458 1002 279 HOH HOH A . 
F 6 HOH 459 1003 280 HOH HOH A . 
F 6 HOH 460 1004 281 HOH HOH A . 
F 6 HOH 461 1005 282 HOH HOH A . 
F 6 HOH 462 1006 283 HOH HOH A . 
F 6 HOH 463 1007 284 HOH HOH A . 
F 6 HOH 464 1008 285 HOH HOH A . 
F 6 HOH 465 1009 286 HOH HOH A . 
F 6 HOH 466 1010 287 HOH HOH A . 
F 6 HOH 467 1011 288 HOH HOH A . 
F 6 HOH 468 1012 289 HOH HOH A . 
F 6 HOH 469 1013 290 HOH HOH A . 
F 6 HOH 470 1014 291 HOH HOH A . 
F 6 HOH 471 1015 292 HOH HOH A . 
F 6 HOH 472 1016 293 HOH HOH A . 
F 6 HOH 473 1017 294 HOH HOH A . 
F 6 HOH 474 1018 295 HOH HOH A . 
F 6 HOH 475 1019 296 HOH HOH A . 
F 6 HOH 476 1020 297 HOH HOH A . 
F 6 HOH 477 1021 298 HOH HOH A . 
F 6 HOH 478 1022 299 HOH HOH A . 
F 6 HOH 479 1023 300 HOH HOH A . 
F 6 HOH 480 1024 301 HOH HOH A . 
F 6 HOH 481 1025 302 HOH HOH A . 
F 6 HOH 482 1026 303 HOH HOH A . 
F 6 HOH 483 1027 304 HOH HOH A . 
F 6 HOH 484 1028 305 HOH HOH A . 
F 6 HOH 485 1029 306 HOH HOH A . 
F 6 HOH 486 1030 307 HOH HOH A . 
F 6 HOH 487 1031 308 HOH HOH A . 
F 6 HOH 488 1032 309 HOH HOH A . 
F 6 HOH 489 1033 310 HOH HOH A . 
F 6 HOH 490 1034 311 HOH HOH A . 
F 6 HOH 491 1035 312 HOH HOH A . 
F 6 HOH 492 1036 313 HOH HOH A . 
F 6 HOH 493 1037 314 HOH HOH A . 
F 6 HOH 494 1038 315 HOH HOH A . 
F 6 HOH 495 1039 316 HOH HOH A . 
F 6 HOH 496 1040 317 HOH HOH A . 
F 6 HOH 497 1041 318 HOH HOH A . 
F 6 HOH 498 1042 319 HOH HOH A . 
F 6 HOH 499 1043 320 HOH HOH A . 
F 6 HOH 500 1044 321 HOH HOH A . 
F 6 HOH 501 1045 322 HOH HOH A . 
F 6 HOH 502 1046 323 HOH HOH A . 
F 6 HOH 503 1047 324 HOH HOH A . 
F 6 HOH 504 1048 325 HOH HOH A . 
F 6 HOH 505 1049 326 HOH HOH A . 
F 6 HOH 506 1050 327 HOH HOH A . 
F 6 HOH 507 1051 328 HOH HOH A . 
F 6 HOH 508 1052 329 HOH HOH A . 
F 6 HOH 509 1053 330 HOH HOH A . 
F 6 HOH 510 1054 331 HOH HOH A . 
F 6 HOH 511 1055 332 HOH HOH A . 
F 6 HOH 512 1056 333 HOH HOH A . 
F 6 HOH 513 1057 334 HOH HOH A . 
F 6 HOH 514 1058 335 HOH HOH A . 
F 6 HOH 515 1059 336 HOH HOH A . 
F 6 HOH 516 1060 337 HOH HOH A . 
F 6 HOH 517 1061 338 HOH HOH A . 
F 6 HOH 518 1062 339 HOH HOH A . 
F 6 HOH 519 1063 340 HOH HOH A . 
F 6 HOH 520 1064 341 HOH HOH A . 
F 6 HOH 521 1065 342 HOH HOH A . 
F 6 HOH 522 1066 343 HOH HOH A . 
F 6 HOH 523 1067 344 HOH HOH A . 
F 6 HOH 524 1068 345 HOH HOH A . 
F 6 HOH 525 1069 346 HOH HOH A . 
F 6 HOH 526 1070 347 HOH HOH A . 
F 6 HOH 527 1071 348 HOH HOH A . 
F 6 HOH 528 1072 349 HOH HOH A . 
F 6 HOH 529 1073 350 HOH HOH A . 
F 6 HOH 530 1074 351 HOH HOH A . 
F 6 HOH 531 1075 352 HOH HOH A . 
F 6 HOH 532 1076 353 HOH HOH A . 
F 6 HOH 533 1077 354 HOH HOH A . 
F 6 HOH 534 1078 355 HOH HOH A . 
F 6 HOH 535 1079 356 HOH HOH A . 
F 6 HOH 536 1080 357 HOH HOH A . 
F 6 HOH 537 1081 358 HOH HOH A . 
F 6 HOH 538 1082 359 HOH HOH A . 
F 6 HOH 539 1083 360 HOH HOH A . 
F 6 HOH 540 1084 361 HOH HOH A . 
F 6 HOH 541 1085 362 HOH HOH A . 
F 6 HOH 542 1086 363 HOH HOH A . 
F 6 HOH 543 1087 364 HOH HOH A . 
F 6 HOH 544 1088 365 HOH HOH A . 
F 6 HOH 545 1089 366 HOH HOH A . 
F 6 HOH 546 1090 367 HOH HOH A . 
F 6 HOH 547 1091 368 HOH HOH A . 
F 6 HOH 548 1092 369 HOH HOH A . 
F 6 HOH 549 1093 370 HOH HOH A . 
F 6 HOH 550 1094 371 HOH HOH A . 
F 6 HOH 551 1095 372 HOH HOH A . 
F 6 HOH 552 1096 373 HOH HOH A . 
F 6 HOH 553 1097 374 HOH HOH A . 
F 6 HOH 554 1098 375 HOH HOH A . 
F 6 HOH 555 1099 376 HOH HOH A . 
F 6 HOH 556 1100 377 HOH HOH A . 
F 6 HOH 557 1101 378 HOH HOH A . 
F 6 HOH 558 1102 379 HOH HOH A . 
F 6 HOH 559 1103 380 HOH HOH A . 
F 6 HOH 560 1104 381 HOH HOH A . 
F 6 HOH 561 1105 382 HOH HOH A . 
F 6 HOH 562 1106 383 HOH HOH A . 
F 6 HOH 563 1107 384 HOH HOH A . 
F 6 HOH 564 1108 385 HOH HOH A . 
F 6 HOH 565 1109 386 HOH HOH A