data_3LK1
# 
_entry.id   3LK1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LK1         
RCSB  RCSB057372   
WWPDB D_1000057372 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3LK0 
_pdbx_database_related.details        'X-ray structure of bovine SC0067,Ca(2+)-S100B' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3LK1 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Charpentier, T.H.' 1 
'Weber, D.J.'       2 
'Wilder, P.W.'      3 
# 
_citation.id                        primary 
_citation.title                     
'In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.' 
_citation.journal_abbrev            'Int J High Throughput Screen' 
_citation.journal_volume            2010 
_citation.page_first                109 
_citation.page_last                 126 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1179-1381 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21132089 
_citation.pdbx_database_id_DOI      10.2147/IJHTS.S8210 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilder, P.T.'      1  
primary 'Charpentier, T.H.' 2  
primary 'Liriano, M.A.'     3  
primary 'Gianni, K.'        4  
primary 'Varney, K.M.'      5  
primary 'Pozharski, E.'     6  
primary 'Coop, A.'          7  
primary 'Toth, E.A.'        8  
primary 'Mackerell, A.D.'   9  
primary 'Weber, D.J.'       10 
# 
_cell.entry_id           3LK1 
_cell.length_a           35.194 
_cell.length_b           88.792 
_cell.length_c           58.996 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LK1 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-B'         10414.713 1  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'            40.078    2  ? ? ? ? 
3 non-polymer syn 'ETHYL MERCURY ION'      229.651   1  ? ? ? ? 
4 non-polymer syn '2-sulfanylbenzoic acid' 154.186   1  ? ? ? ? 
5 water       nat water                    18.015    47 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  VAL n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 SER n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 ALA n 
1 80 MET n 
1 81 ILE n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               bovine 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 S100B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_BOVIN 
_struct_ref.pdbx_db_accession          P02638 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3LK1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 90 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02638 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  90 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       89 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'            ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'   121.158 
EMC non-polymer         . 'ETHYL MERCURY ION'      ? 'C2 H5 Hg 1'     229.651 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
JKE non-polymer         . '2-sulfanylbenzoic acid' ? 'C7 H6 O2 S'     154.186 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3LK1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   44.41 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'PEGMME550, CaCl2, MgCl2, SC0322, HEPES buffer, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2008-08-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97607 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_wavelength_list        0.97607 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
# 
_reflns.entry_id                     3LK1 
_reflns.d_resolution_high            1.79 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   7607 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_netI_over_sigmaI        16.800 
_reflns.pdbx_chi_squared             1.220 
_reflns.pdbx_redundancy              5.900 
_reflns.percent_possible_obs         84.600 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.80 1.86  ? ? ? 0.308 ? ? 0.853 3.40 ? 297 33.40 ? 1  
1.86 1.94  ? ? ? 0.270 ? ? 0.870 3.80 ? 477 54.80 ? 2  
1.94 2.03  ? ? ? 0.244 ? ? 1.048 4.30 ? 674 76.40 ? 3  
2.03 2.13  ? ? ? 0.201 ? ? 1.191 5.10 ? 785 89.50 ? 4  
2.13 2.27  ? ? ? 0.151 ? ? 1.333 5.80 ? 859 96.80 ? 5  
2.27 2.44  ? ? ? 0.130 ? ? 1.339 6.50 ? 890 99.90 ? 6  
2.44 2.69  ? ? ? 0.102 ? ? 1.173 6.90 ? 905 99.90 ? 7  
2.69 3.08  ? ? ? 0.078 ? ? 1.187 6.80 ? 888 99.90 ? 8  
3.08 3.88  ? ? ? 0.053 ? ? 1.281 6.50 ? 921 99.90 ? 9  
3.88 50.00 ? ? ? 0.044 ? ? 1.275 6.40 ? 911 93.30 ? 10 
# 
_refine.entry_id                                 3LK1 
_refine.ls_d_res_high                            1.790 
_refine.ls_d_res_low                             29.50 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    84.360 
_refine.ls_number_reflns_obs                     7593 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.198 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_wR_factor_R_work                      0.231 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_wR_factor_R_free                      0.277 
_refine.ls_percent_reflns_R_free                 4.800 
_refine.ls_number_reflns_R_free                  364 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               49.817 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.330 
_refine.aniso_B[2][2]                            -2.440 
_refine.aniso_B[3][3]                            2.770 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.947 
_refine.overall_SU_R_Cruickshank_DPI             0.174 
_refine.overall_SU_R_free                        0.165 
_refine.pdbx_overall_ESU_R                       0.161 
_refine.pdbx_overall_ESU_R_Free                  0.151 
_refine.overall_SU_ML                            0.106 
_refine.overall_SU_B                             6.640 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.833 
_refine.B_iso_max                                447.11 
_refine.B_iso_min                                37.95 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.25 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        694 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               756 
_refine_hist.d_res_high                       1.790 
_refine_hist.d_res_low                        29.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         716 0.012  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      958 1.427  1.965  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   87  8.772  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   36  31.557 26.389 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   133 14.211 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   1   21.691 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           106 0.108  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     535 0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            334 0.223  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          495 0.298  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    38  0.174  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      9   0.187  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   33  0.165  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6   0.164  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              451 0.558  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             697 0.806  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              295 1.497  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             261 2.285  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.79 
_refine_ls_shell.d_res_low                        1.84 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               30.400 
_refine_ls_shell.number_reflns_R_work             188 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.R_factor_R_free                  0.288 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             12 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                200 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LK1 
_struct.title                     'X-ray structure of bovine SC0322,Ca(2+)-S100B' 
_struct.pdbx_descriptor           'Protein S100-B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LK1 
_struct_keywords.text            'EF hand, Alpha helical, Metal-binding, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? GLY A 20 ? SER A 1  GLY A 19 1 ? 19 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 
HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 
HELX_P HELX_P4 4 PHE A 71 ? ALA A 84 ? PHE A 70 ALA A 83 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B CA  .  CA  ? ? ? 1_555 F HOH . O  ? ? A CA  90 A HOH 105 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc2  metalc ? ? A ASP 62 OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 61 A CA  90  1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc3  metalc ? ? A ASP 66 OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 65 A CA  90  1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc4  metalc ? ? A GLU 32 OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 31 A CA  91  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc5  metalc ? ? A SER 19 O   ? ? ? 1_555 C CA  . CA ? ? A SER 18 A CA  91  1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc6  metalc ? ? A GLU 68 O   ? ? ? 1_555 B CA  . CA ? ? A GLU 67 A CA  90  1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc7  metalc ? ? A GLU 22 O   ? ? ? 1_555 C CA  . CA ? ? A GLU 21 A CA  91  1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc8  metalc ? ? A ASP 24 O   ? ? ? 1_555 C CA  . CA ? ? A ASP 23 A CA  91  1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc9  metalc ? ? C CA  .  CA  ? ? ? 1_555 F HOH . O  ? ? A CA  91 A HOH 120 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc10 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 72 A CA  90  1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc11 metalc ? ? A LYS 27 O   ? ? ? 1_555 C CA  . CA ? ? A LYS 26 A CA  91  1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc12 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 63 A CA  90  1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc13 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 72 A CA  90  1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc14 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 31 A CA  91  1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc15 metalc ? ? A CYS 85 SG  ? ? ? 1_555 D EMC . HG ? ? A CYS 84 A EMC 92  1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc16 metalc ? ? D EMC .  HG  ? ? ? 1_555 F HOH . O  ? ? A EMC 92 A HOH 126 1_555 ? ? ? ? ? ? ? 2.791 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 27 ? LEU A 28 ? LYS A 26 LEU A 27 
A 2 CYS A 69 ? ASP A 70 ? CYS A 68 ASP A 69 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    28 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     27 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   CYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    69 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    CYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     68 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 90'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 91'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EMC A 92' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE JKE A 93' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 62 ? ASP A 61  . ? 1_555 ? 
2  AC1 6 ASP A 64 ? ASP A 63  . ? 1_555 ? 
3  AC1 6 ASP A 66 ? ASP A 65  . ? 1_555 ? 
4  AC1 6 GLU A 68 ? GLU A 67  . ? 1_555 ? 
5  AC1 6 GLU A 73 ? GLU A 72  . ? 1_555 ? 
6  AC1 6 HOH F .  ? HOH A 105 . ? 1_555 ? 
7  AC2 6 SER A 19 ? SER A 18  . ? 1_555 ? 
8  AC2 6 GLU A 22 ? GLU A 21  . ? 1_555 ? 
9  AC2 6 ASP A 24 ? ASP A 23  . ? 1_555 ? 
10 AC2 6 LYS A 27 ? LYS A 26  . ? 1_555 ? 
11 AC2 6 GLU A 32 ? GLU A 31  . ? 1_555 ? 
12 AC2 6 HOH F .  ? HOH A 120 . ? 1_555 ? 
13 AC3 3 CYS A 85 ? CYS A 84  . ? 1_555 ? 
14 AC3 3 PHE A 88 ? PHE A 87  . ? 1_555 ? 
15 AC3 3 HOH F .  ? HOH A 126 . ? 1_555 ? 
16 AC4 1 THR A 60 ? THR A 59  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3LK1 
_atom_sites.fract_transf_matrix[1][1]   0.028414 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011262 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016950 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
HG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . MET A 1 1  ? 5.829   -6.993 6.954   1.00 54.62  ? 0   MET A N   1 
ATOM   2   C  CA  . MET A 1 1  ? 6.936   -7.654 6.186   1.00 53.89  ? 0   MET A CA  1 
ATOM   3   C  C   . MET A 1 1  ? 6.614   -7.909 4.716   1.00 53.12  ? 0   MET A C   1 
ATOM   4   O  O   . MET A 1 1  ? 7.470   -7.675 3.856   1.00 53.83  ? 0   MET A O   1 
ATOM   5   C  CB  . MET A 1 1  ? 7.402   -8.957 6.880   1.00 54.49  ? 0   MET A CB  1 
ATOM   6   N  N   . SER A 1 2  ? 5.410   -8.399 4.412   1.00 55.43  ? 1   SER A N   1 
ATOM   7   C  CA  . SER A 1 2  ? 5.038   -8.634 3.012   1.00 52.24  ? 1   SER A CA  1 
ATOM   8   C  C   . SER A 1 2  ? 4.772   -7.302 2.324   1.00 50.24  ? 1   SER A C   1 
ATOM   9   O  O   . SER A 1 2  ? 4.488   -6.303 2.993   1.00 47.74  ? 1   SER A O   1 
ATOM   10  C  CB  . SER A 1 2  ? 3.819   -9.552 2.903   1.00 48.62  ? 1   SER A CB  1 
ATOM   11  O  OG  . SER A 1 2  ? 2.599   -8.816 2.881   1.00 42.63  ? 1   SER A OG  1 
ATOM   12  N  N   . GLU A 1 3  ? 4.836   -7.274 0.997   1.00 53.19  ? 2   GLU A N   1 
ATOM   13  C  CA  . GLU A 1 3  ? 4.566   -6.022 0.273   1.00 54.20  ? 2   GLU A CA  1 
ATOM   14  C  C   . GLU A 1 3  ? 3.123   -5.527 0.459   1.00 48.03  ? 2   GLU A C   1 
ATOM   15  O  O   . GLU A 1 3  ? 2.887   -4.315 0.487   1.00 47.84  ? 2   GLU A O   1 
ATOM   16  C  CB  . GLU A 1 3  ? 4.943   -6.140 -1.207  1.00 63.24  ? 2   GLU A CB  1 
ATOM   17  C  CG  . GLU A 1 3  ? 6.437   -6.354 -1.446  1.00 75.50  ? 2   GLU A CG  1 
ATOM   18  C  CD  . GLU A 1 3  ? 7.294   -5.163 -1.026  1.00 82.51  ? 2   GLU A CD  1 
ATOM   19  O  OE1 . GLU A 1 3  ? 6.872   -4.007 -1.240  1.00 82.14  ? 2   GLU A OE1 1 
ATOM   20  O  OE2 . GLU A 1 3  ? 8.405   -5.384 -0.495  1.00 91.37  ? 2   GLU A OE2 1 
ATOM   21  N  N   . LEU A 1 4  ? 2.178   -6.461 0.614   1.00 45.06  ? 3   LEU A N   1 
ATOM   22  C  CA  . LEU A 1 4  ? 0.784   -6.129 0.948   1.00 43.22  ? 3   LEU A CA  1 
ATOM   23  C  C   . LEU A 1 4  ? 0.684   -5.516 2.345   1.00 40.89  ? 3   LEU A C   1 
ATOM   24  O  O   . LEU A 1 4  ? -0.012  -4.523 2.552   1.00 41.96  ? 3   LEU A O   1 
ATOM   25  C  CB  . LEU A 1 4  ? -0.107  -7.379 0.891   1.00 45.30  ? 3   LEU A CB  1 
ATOM   26  C  CG  . LEU A 1 4  ? -1.518  -7.434 0.298   1.00 52.00  ? 3   LEU A CG  1 
ATOM   27  C  CD1 . LEU A 1 4  ? -2.272  -8.663 0.797   1.00 53.87  ? 3   LEU A CD1 1 
ATOM   28  C  CD2 . LEU A 1 4  ? -2.377  -6.154 0.454   1.00 53.97  ? 3   LEU A CD2 1 
ATOM   29  N  N   . GLU A 1 5  ? 1.367   -6.114 3.315   1.00 40.03  ? 4   GLU A N   1 
ATOM   30  C  CA  . GLU A 1 5  ? 1.337   -5.604 4.688   1.00 41.15  ? 4   GLU A CA  1 
ATOM   31  C  C   . GLU A 1 5  ? 1.967   -4.216 4.797   1.00 42.90  ? 4   GLU A C   1 
ATOM   32  O  O   . GLU A 1 5  ? 1.476   -3.365 5.545   1.00 45.25  ? 4   GLU A O   1 
ATOM   33  C  CB  . GLU A 1 5  ? 1.992   -6.605 5.640   1.00 43.47  ? 4   GLU A CB  1 
ATOM   34  C  CG  . GLU A 1 5  ? 1.138   -7.857 5.805   1.00 44.13  ? 4   GLU A CG  1 
ATOM   35  C  CD  . GLU A 1 5  ? 1.845   -9.008 6.497   1.00 47.58  ? 4   GLU A CD  1 
ATOM   36  O  OE1 . GLU A 1 5  ? 3.053   -9.218 6.264   1.00 48.18  ? 4   GLU A OE1 1 
ATOM   37  O  OE2 . GLU A 1 5  ? 1.171   -9.719 7.270   1.00 50.81  ? 4   GLU A OE2 1 
ATOM   38  N  N   . LYS A 1 6  ? 3.035   -3.985 4.034   1.00 43.45  ? 5   LYS A N   1 
ATOM   39  C  CA  . LYS A 1 6  ? 3.632   -2.649 3.931   1.00 47.37  ? 5   LYS A CA  1 
ATOM   40  C  C   . LYS A 1 6  ? 2.666   -1.618 3.341   1.00 45.92  ? 5   LYS A C   1 
ATOM   41  O  O   . LYS A 1 6  ? 2.687   -0.455 3.733   1.00 49.36  ? 5   LYS A O   1 
ATOM   42  C  CB  . LYS A 1 6  ? 4.909   -2.683 3.093   1.00 52.94  ? 5   LYS A CB  1 
ATOM   43  C  CG  . LYS A 1 6  ? 6.086   -3.356 3.767   1.00 60.06  ? 5   LYS A CG  1 
ATOM   44  C  CD  . LYS A 1 6  ? 7.267   -3.381 2.818   1.00 71.83  ? 5   LYS A CD  1 
ATOM   45  C  CE  . LYS A 1 6  ? 8.253   -4.480 3.170   1.00 79.94  ? 5   LYS A CE  1 
ATOM   46  N  N   . ALA A 1 7  ? 1.831   -2.044 2.397   1.00 45.81  ? 6   ALA A N   1 
ATOM   47  C  CA  . ALA A 1 7  ? 0.822   -1.165 1.790   1.00 45.33  ? 6   ALA A CA  1 
ATOM   48  C  C   . ALA A 1 7  ? -0.284  -0.823 2.769   1.00 43.12  ? 6   ALA A C   1 
ATOM   49  O  O   . ALA A 1 7  ? -0.738  0.322  2.818   1.00 43.42  ? 6   ALA A O   1 
ATOM   50  C  CB  . ALA A 1 7  ? 0.232   -1.812 0.544   1.00 47.19  ? 6   ALA A CB  1 
ATOM   51  N  N   . VAL A 1 8  ? -0.716  -1.821 3.544   1.00 43.25  ? 7   VAL A N   1 
ATOM   52  C  CA  . VAL A 1 8  ? -1.752  -1.618 4.547   1.00 43.06  ? 7   VAL A CA  1 
ATOM   53  C  C   . VAL A 1 8  ? -1.308  -0.570 5.568   1.00 43.85  ? 7   VAL A C   1 
ATOM   54  O  O   . VAL A 1 8  ? -2.054  0.369  5.855   1.00 43.35  ? 7   VAL A O   1 
ATOM   55  C  CB  . VAL A 1 8  ? -2.152  -2.934 5.230   1.00 46.00  ? 7   VAL A CB  1 
ATOM   56  C  CG1 . VAL A 1 8  ? -3.021  -2.657 6.448   1.00 49.15  ? 7   VAL A CG1 1 
ATOM   57  C  CG2 . VAL A 1 8  ? -2.889  -3.852 4.232   1.00 45.90  ? 7   VAL A CG2 1 
ATOM   58  N  N   . VAL A 1 9  ? -0.092  -0.712 6.094   1.00 45.33  ? 8   VAL A N   1 
ATOM   59  C  CA  . VAL A 1 9  ? 0.441   0.275  7.044   1.00 47.90  ? 8   VAL A CA  1 
ATOM   60  C  C   . VAL A 1 9  ? 0.662   1.669  6.428   1.00 46.36  ? 8   VAL A C   1 
ATOM   61  O  O   . VAL A 1 9  ? 0.432   2.681  7.091   1.00 47.62  ? 8   VAL A O   1 
ATOM   62  C  CB  . VAL A 1 9  ? 1.710   -0.227 7.779   1.00 53.89  ? 8   VAL A CB  1 
ATOM   63  C  CG1 . VAL A 1 9  ? 1.480   -1.620 8.416   1.00 56.07  ? 8   VAL A CG1 1 
ATOM   64  C  CG2 . VAL A 1 9  ? 2.905   -0.258 6.856   1.00 57.05  ? 8   VAL A CG2 1 
ATOM   65  N  N   . ALA A 1 10 ? 1.111   1.722  5.176   1.00 44.66  ? 9   ALA A N   1 
ATOM   66  C  CA  . ALA A 1 10 ? 1.279   3.001  4.469   1.00 45.12  ? 9   ALA A CA  1 
ATOM   67  C  C   . ALA A 1 10 ? -0.040  3.756  4.292   1.00 42.25  ? 9   ALA A C   1 
ATOM   68  O  O   . ALA A 1 10 ? -0.077  4.978  4.438   1.00 42.12  ? 9   ALA A O   1 
ATOM   69  C  CB  . ALA A 1 10 ? 1.957   2.800  3.124   1.00 47.35  ? 9   ALA A CB  1 
ATOM   70  N  N   . LEU A 1 11 ? -1.113  3.037  3.971   1.00 40.44  ? 10  LEU A N   1 
ATOM   71  C  CA  . LEU A 1 11 ? -2.442  3.661  3.886   1.00 40.61  ? 10  LEU A CA  1 
ATOM   72  C  C   . LEU A 1 11 ? -2.835  4.310  5.235   1.00 40.90  ? 10  LEU A C   1 
ATOM   73  O  O   . LEU A 1 11 ? -3.266  5.477  5.276   1.00 41.46  ? 10  LEU A O   1 
ATOM   74  C  CB  . LEU A 1 11 ? -3.498  2.654  3.405   1.00 41.88  ? 10  LEU A CB  1 
ATOM   75  C  CG  . LEU A 1 11 ? -3.426  2.089  1.978   1.00 44.56  ? 10  LEU A CG  1 
ATOM   76  C  CD1 . LEU A 1 11 ? -4.271  0.809  1.837   1.00 46.58  ? 10  LEU A CD1 1 
ATOM   77  C  CD2 . LEU A 1 11 ? -3.832  3.088  0.904   1.00 48.74  ? 10  LEU A CD2 1 
ATOM   78  N  N   . ILE A 1 12 ? -2.636  3.577  6.333   1.00 41.28  ? 11  ILE A N   1 
ATOM   79  C  CA  . ILE A 1 12 ? -2.929  4.080  7.682   1.00 43.21  ? 11  ILE A CA  1 
ATOM   80  C  C   . ILE A 1 12 ? -2.043  5.294  8.010   1.00 43.37  ? 11  ILE A C   1 
ATOM   81  O  O   . ILE A 1 12 ? -2.535  6.340  8.445   1.00 43.74  ? 11  ILE A O   1 
ATOM   82  C  CB  . ILE A 1 12 ? -2.768  2.957  8.758   1.00 47.59  ? 11  ILE A CB  1 
ATOM   83  C  CG1 . ILE A 1 12 ? -3.760  1.815  8.494   1.00 47.29  ? 11  ILE A CG1 1 
ATOM   84  C  CG2 . ILE A 1 12 ? -2.927  3.520  10.183  1.00 51.99  ? 11  ILE A CG2 1 
ATOM   85  C  CD1 . ILE A 1 12 ? -3.539  0.600  9.352   1.00 54.28  ? 11  ILE A CD1 1 
ATOM   86  N  N   . ASP A 1 13 ? -0.746  5.147  7.758   1.00 45.14  ? 12  ASP A N   1 
ATOM   87  C  CA  . ASP A 1 13 ? 0.258   6.173  8.044   1.00 48.18  ? 12  ASP A CA  1 
ATOM   88  C  C   . ASP A 1 13 ? -0.059  7.485  7.320   1.00 45.82  ? 12  ASP A C   1 
ATOM   89  O  O   . ASP A 1 13 ? -0.092  8.555  7.943   1.00 46.51  ? 12  ASP A O   1 
ATOM   90  C  CB  . ASP A 1 13 ? 1.648   5.647  7.647   1.00 52.34  ? 12  ASP A CB  1 
ATOM   91  C  CG  . ASP A 1 13 ? 2.781   6.546  8.102   1.00 61.73  ? 12  ASP A CG  1 
ATOM   92  O  OD1 . ASP A 1 13 ? 2.611   7.308  9.079   1.00 65.21  ? 12  ASP A OD1 1 
ATOM   93  O  OD2 . ASP A 1 13 ? 3.868   6.470  7.488   1.00 69.43  ? 12  ASP A OD2 1 
ATOM   94  N  N   . VAL A 1 14 ? -0.305  7.416  6.014   1.00 43.35  ? 13  VAL A N   1 
ATOM   95  C  CA  . VAL A 1 14 ? -0.462  8.654  5.243   1.00 44.29  ? 13  VAL A CA  1 
ATOM   96  C  C   . VAL A 1 14 ? -1.789  9.339  5.548   1.00 41.43  ? 13  VAL A C   1 
ATOM   97  O  O   . VAL A 1 14 ? -1.834  10.555 5.660   1.00 42.05  ? 13  VAL A O   1 
ATOM   98  C  CB  . VAL A 1 14 ? -0.278  8.459  3.729   1.00 46.18  ? 13  VAL A CB  1 
ATOM   99  C  CG1 . VAL A 1 14 ? -0.403  9.794  3.001   1.00 48.28  ? 13  VAL A CG1 1 
ATOM   100 C  CG2 . VAL A 1 14 ? 1.081   7.829  3.447   1.00 52.07  ? 13  VAL A CG2 1 
ATOM   101 N  N   . PHE A 1 15 ? -2.858  8.566  5.715   1.00 40.33  ? 14  PHE A N   1 
ATOM   102 C  CA  . PHE A 1 15 ? -4.127  9.167  6.128   1.00 40.17  ? 14  PHE A CA  1 
ATOM   103 C  C   . PHE A 1 15 ? -3.950  10.032 7.381   1.00 40.59  ? 14  PHE A C   1 
ATOM   104 O  O   . PHE A 1 15 ? -4.337  11.205 7.400   1.00 39.07  ? 14  PHE A O   1 
ATOM   105 C  CB  . PHE A 1 15 ? -5.210  8.120  6.388   1.00 41.37  ? 14  PHE A CB  1 
ATOM   106 C  CG  . PHE A 1 15 ? -6.500  8.719  6.894   1.00 44.68  ? 14  PHE A CG  1 
ATOM   107 C  CD1 . PHE A 1 15 ? -7.434  9.244  6.002   1.00 46.18  ? 14  PHE A CD1 1 
ATOM   108 C  CD2 . PHE A 1 15 ? -6.776  8.769  8.265   1.00 45.19  ? 14  PHE A CD2 1 
ATOM   109 C  CE1 . PHE A 1 15 ? -8.625  9.797  6.456   1.00 49.50  ? 14  PHE A CE1 1 
ATOM   110 C  CE2 . PHE A 1 15 ? -7.960  9.330  8.733   1.00 50.39  ? 14  PHE A CE2 1 
ATOM   111 C  CZ  . PHE A 1 15 ? -8.885  9.853  7.825   1.00 53.06  ? 14  PHE A CZ  1 
ATOM   112 N  N   . HIS A 1 16 ? -3.371  9.437  8.424   1.00 42.31  ? 15  HIS A N   1 
ATOM   113 C  CA  . HIS A 1 16 ? -3.237  10.107 9.708   1.00 45.30  ? 15  HIS A CA  1 
ATOM   114 C  C   . HIS A 1 16 ? -2.224  11.249 9.725   1.00 46.11  ? 15  HIS A C   1 
ATOM   115 O  O   . HIS A 1 16 ? -2.326  12.156 10.552  1.00 47.80  ? 15  HIS A O   1 
ATOM   116 C  CB  . HIS A 1 16 ? -2.946  9.080  10.817  1.00 50.51  ? 15  HIS A CB  1 
ATOM   117 C  CG  . HIS A 1 16 ? -4.106  8.184  11.101  1.00 53.44  ? 15  HIS A CG  1 
ATOM   118 N  ND1 . HIS A 1 16 ? -4.328  7.015  10.404  1.00 54.10  ? 15  HIS A ND1 1 
ATOM   119 C  CD2 . HIS A 1 16 ? -5.143  8.313  11.959  1.00 59.61  ? 15  HIS A CD2 1 
ATOM   120 C  CE1 . HIS A 1 16 ? -5.434  6.444  10.846  1.00 58.45  ? 15  HIS A CE1 1 
ATOM   121 N  NE2 . HIS A 1 16 ? -5.947  7.212  11.791  1.00 63.77  ? 15  HIS A NE2 1 
ATOM   122 N  N   . GLN A 1 17 ? -1.250  11.208 8.821   1.00 46.16  ? 16  GLN A N   1 
ATOM   123 C  CA  . GLN A 1 17 ? -0.288  12.293 8.692   1.00 49.75  ? 16  GLN A CA  1 
ATOM   124 C  C   . GLN A 1 17 ? -1.022  13.568 8.293   1.00 46.89  ? 16  GLN A C   1 
ATOM   125 O  O   . GLN A 1 17 ? -0.622  14.665 8.650   1.00 48.58  ? 16  GLN A O   1 
ATOM   126 C  CB  . GLN A 1 17 ? 0.768   11.949 7.640   1.00 52.67  ? 16  GLN A CB  1 
ATOM   127 C  CG  . GLN A 1 17 ? 1.914   11.101 8.178   1.00 59.57  ? 16  GLN A CG  1 
ATOM   128 C  CD  . GLN A 1 17 ? 2.883   10.634 7.098   0.80 64.11  ? 16  GLN A CD  1 
ATOM   129 O  OE1 . GLN A 1 17 ? 2.853   11.110 5.958   0.80 67.50  ? 16  GLN A OE1 1 
ATOM   130 N  NE2 . GLN A 1 17 ? 3.748   9.690  7.458   0.80 70.39  ? 16  GLN A NE2 1 
ATOM   131 N  N   . TYR A 1 18 ? -2.096  13.392 7.529   1.00 40.06  ? 17  TYR A N   1 
ATOM   132 C  CA  . TYR A 1 18 ? -2.888  14.503 7.018   1.00 37.87  ? 17  TYR A CA  1 
ATOM   133 C  C   . TYR A 1 18 ? -4.091  14.783 7.900   1.00 38.51  ? 17  TYR A C   1 
ATOM   134 O  O   . TYR A 1 18 ? -4.367  15.944 8.210   1.00 39.66  ? 17  TYR A O   1 
ATOM   135 C  CB  . TYR A 1 18 ? -3.283  14.234 5.564   1.00 35.34  ? 17  TYR A CB  1 
ATOM   136 C  CG  . TYR A 1 18 ? -2.112  14.499 4.632   1.00 35.02  ? 17  TYR A CG  1 
ATOM   137 C  CD1 . TYR A 1 18 ? -1.215  13.490 4.298   1.00 35.34  ? 17  TYR A CD1 1 
ATOM   138 C  CD2 . TYR A 1 18 ? -1.881  15.783 4.134   1.00 34.56  ? 17  TYR A CD2 1 
ATOM   139 C  CE1 . TYR A 1 18 ? -0.117  13.761 3.459   1.00 38.01  ? 17  TYR A CE1 1 
ATOM   140 C  CE2 . TYR A 1 18 ? -0.804  16.057 3.318   1.00 36.08  ? 17  TYR A CE2 1 
ATOM   141 C  CZ  . TYR A 1 18 ? 0.074   15.047 2.987   1.00 36.69  ? 17  TYR A CZ  1 
ATOM   142 O  OH  . TYR A 1 18 ? 1.145   15.343 2.183   1.00 38.00  ? 17  TYR A OH  1 
ATOM   143 N  N   . SER A 1 19 ? -4.797  13.735 8.320   1.00 38.23  ? 18  SER A N   1 
ATOM   144 C  CA  . SER A 1 19 ? -6.022  13.930 9.116   1.00 39.36  ? 18  SER A CA  1 
ATOM   145 C  C   . SER A 1 19 ? -5.731  14.547 10.483  1.00 42.16  ? 18  SER A C   1 
ATOM   146 O  O   . SER A 1 19 ? -6.595  15.229 11.063  1.00 43.51  ? 18  SER A O   1 
ATOM   147 C  CB  . SER A 1 19 ? -6.766  12.606 9.311   1.00 39.06  ? 18  SER A CB  1 
ATOM   148 O  OG  . SER A 1 19 ? -6.107  11.816 10.282  1.00 41.86  ? 18  SER A OG  1 
ATOM   149 N  N   . GLY A 1 20 ? -4.528  14.294 10.993  1.00 43.99  ? 19  GLY A N   1 
ATOM   150 C  CA  . GLY A 1 20 ? -4.125  14.758 12.319  1.00 47.51  ? 19  GLY A CA  1 
ATOM   151 C  C   . GLY A 1 20 ? -3.637  16.194 12.373  1.00 48.96  ? 19  GLY A C   1 
ATOM   152 O  O   . GLY A 1 20 ? -3.271  16.696 13.436  1.00 52.43  ? 19  GLY A O   1 
ATOM   153 N  N   . ARG A 1 21 ? -3.645  16.874 11.236  1.00 46.52  ? 20  ARG A N   1 
ATOM   154 C  CA  . ARG A 1 21 ? -3.148  18.238 11.177  1.00 48.56  ? 20  ARG A CA  1 
ATOM   155 C  C   . ARG A 1 21 ? -4.041  19.218 11.938  1.00 51.00  ? 20  ARG A C   1 
ATOM   156 O  O   . ARG A 1 21 ? -3.565  19.966 12.773  1.00 54.60  ? 20  ARG A O   1 
ATOM   157 C  CB  . ARG A 1 21 ? -2.989  18.668 9.717   1.00 46.05  ? 20  ARG A CB  1 
ATOM   158 C  CG  . ARG A 1 21 ? -1.734  18.101 9.078   1.00 44.89  ? 20  ARG A CG  1 
ATOM   159 C  CD  . ARG A 1 21 ? -1.735  18.368 7.605   1.00 41.03  ? 20  ARG A CD  1 
ATOM   160 N  NE  . ARG A 1 21 ? -0.513  17.871 7.001   1.00 41.86  ? 20  ARG A NE  1 
ATOM   161 C  CZ  . ARG A 1 21 ? -0.030  18.302 5.839   1.00 43.99  ? 20  ARG A CZ  1 
ATOM   162 N  NH1 . ARG A 1 21 ? -0.659  19.258 5.161   1.00 42.05  ? 20  ARG A NH1 1 
ATOM   163 N  NH2 . ARG A 1 21 ? 1.092   17.786 5.360   1.00 43.31  ? 20  ARG A NH2 1 
ATOM   164 N  N   . GLU A 1 22 ? -5.338  19.195 11.654  1.00 49.78  ? 21  GLU A N   1 
ATOM   165 C  CA  . GLU A 1 22 ? -6.257  20.221 12.159  1.00 53.24  ? 21  GLU A CA  1 
ATOM   166 C  C   . GLU A 1 22 ? -7.588  19.606 12.571  1.00 52.21  ? 21  GLU A C   1 
ATOM   167 O  O   . GLU A 1 22 ? -8.006  18.569 12.027  1.00 49.13  ? 21  GLU A O   1 
ATOM   168 C  CB  . GLU A 1 22 ? -6.502  21.312 11.101  1.00 52.87  ? 21  GLU A CB  1 
ATOM   169 C  CG  . GLU A 1 22 ? -5.230  22.037 10.586  1.00 56.34  ? 21  GLU A CG  1 
ATOM   170 C  CD  . GLU A 1 22 ? -5.523  23.325 9.797   1.00 57.99  ? 21  GLU A CD  1 
ATOM   171 O  OE1 . GLU A 1 22 ? -4.718  24.282 9.905   1.00 66.37  ? 21  GLU A OE1 1 
ATOM   172 O  OE2 . GLU A 1 22 ? -6.546  23.387 9.072   1.00 59.73  ? 21  GLU A OE2 1 
ATOM   173 N  N   . GLY A 1 23 ? -8.252  20.247 13.532  1.00 54.86  ? 22  GLY A N   1 
ATOM   174 C  CA  . GLY A 1 23 ? -9.558  19.795 14.013  1.00 55.58  ? 22  GLY A CA  1 
ATOM   175 C  C   . GLY A 1 23 ? -9.562  18.328 14.422  1.00 54.53  ? 22  GLY A C   1 
ATOM   176 O  O   . GLY A 1 23 ? -8.638  17.855 15.091  1.00 55.86  ? 22  GLY A O   1 
ATOM   177 N  N   . ASP A 1 24 ? -10.602 17.609 14.012  1.00 52.89  ? 23  ASP A N   1 
ATOM   178 C  CA  . ASP A 1 24 ? -10.700 16.187 14.276  1.00 52.95  ? 23  ASP A CA  1 
ATOM   179 C  C   . ASP A 1 24 ? -9.447  15.510 13.740  1.00 50.90  ? 23  ASP A C   1 
ATOM   180 O  O   . ASP A 1 24 ? -9.129  15.641 12.568  1.00 47.14  ? 23  ASP A O   1 
ATOM   181 C  CB  . ASP A 1 24 ? -11.934 15.603 13.583  1.00 51.73  ? 23  ASP A CB  1 
ATOM   182 C  CG  . ASP A 1 24 ? -12.237 14.185 14.031  1.00 53.86  ? 23  ASP A CG  1 
ATOM   183 O  OD1 . ASP A 1 24 ? -11.289 13.396 14.245  1.00 53.04  ? 23  ASP A OD1 1 
ATOM   184 O  OD2 . ASP A 1 24 ? -13.435 13.860 14.176  1.00 57.57  ? 23  ASP A OD2 1 
ATOM   185 N  N   . LYS A 1 25 ? -8.722  14.809 14.601  1.00 53.16  ? 24  LYS A N   1 
ATOM   186 C  CA  . LYS A 1 25 ? -7.450  14.213 14.181  1.00 52.00  ? 24  LYS A CA  1 
ATOM   187 C  C   . LYS A 1 25 ? -7.640  12.907 13.436  1.00 50.21  ? 24  LYS A C   1 
ATOM   188 O  O   . LYS A 1 25 ? -6.669  12.312 12.959  1.00 49.85  ? 24  LYS A O   1 
ATOM   189 C  CB  . LYS A 1 25 ? -6.519  14.033 15.383  1.00 56.14  ? 24  LYS A CB  1 
ATOM   190 C  CG  . LYS A 1 25 ? -6.004  15.359 15.892  1.00 58.21  ? 24  LYS A CG  1 
ATOM   191 C  CD  . LYS A 1 25 ? -4.867  15.208 16.880  1.00 63.21  ? 24  LYS A CD  1 
ATOM   192 C  CE  . LYS A 1 25 ? -4.361  16.585 17.290  1.00 65.90  ? 24  LYS A CE  1 
ATOM   193 N  NZ  . LYS A 1 25 ? -4.044  17.408 16.073  1.00 63.56  ? 24  LYS A NZ  1 
ATOM   194 N  N   . HIS A 1 26 ? -8.895  12.483 13.307  1.00 49.77  ? 25  HIS A N   1 
ATOM   195 C  CA  . HIS A 1 26 ? -9.225  11.218 12.637  1.00 48.87  ? 25  HIS A CA  1 
ATOM   196 C  C   . HIS A 1 26 ? -10.021 11.407 11.352  1.00 45.78  ? 25  HIS A C   1 
ATOM   197 O  O   . HIS A 1 26 ? -10.461 10.433 10.742  1.00 44.99  ? 25  HIS A O   1 
ATOM   198 C  CB  . HIS A 1 26 ? -10.001 10.305 13.592  1.00 52.28  ? 25  HIS A CB  1 
ATOM   199 C  CG  . HIS A 1 26 ? -9.215  9.884  14.795  1.00 55.90  ? 25  HIS A CG  1 
ATOM   200 N  ND1 . HIS A 1 26 ? -8.157  9.002  14.720  1.00 57.56  ? 25  HIS A ND1 1 
ATOM   201 C  CD2 . HIS A 1 26 ? -9.326  10.229 16.099  1.00 60.20  ? 25  HIS A CD2 1 
ATOM   202 C  CE1 . HIS A 1 26 ? -7.652  8.821  15.928  1.00 62.19  ? 25  HIS A CE1 1 
ATOM   203 N  NE2 . HIS A 1 26 ? -8.344  9.554  16.782  1.00 62.66  ? 25  HIS A NE2 1 
ATOM   204 N  N   . LYS A 1 27 ? -10.222 12.658 10.948  1.00 44.64  ? 26  LYS A N   1 
ATOM   205 C  CA  . LYS A 1 27 ? -10.929 12.950 9.700   1.00 42.22  ? 26  LYS A CA  1 
ATOM   206 C  C   . LYS A 1 27 ? -10.171 14.004 8.898   1.00 40.92  ? 26  LYS A C   1 
ATOM   207 O  O   . LYS A 1 27 ? -9.462  14.836 9.480   1.00 40.98  ? 26  LYS A O   1 
ATOM   208 C  CB  . LYS A 1 27 ? -12.338 13.484 9.985   1.00 44.55  ? 26  LYS A CB  1 
ATOM   209 C  CG  . LYS A 1 27 ? -13.307 12.488 10.628  1.00 46.11  ? 26  LYS A CG  1 
ATOM   210 C  CD  . LYS A 1 27 ? -14.590 13.186 11.058  1.00 49.09  ? 26  LYS A CD  1 
ATOM   211 N  N   . LEU A 1 28 ? -10.330 13.961 7.568   1.00 37.54  ? 27  LEU A N   1 
ATOM   212 C  CA  . LEU A 1 28 ? -9.732  14.962 6.684   1.00 36.71  ? 27  LEU A CA  1 
ATOM   213 C  C   . LEU A 1 28 ? -10.734 16.074 6.407   1.00 37.32  ? 27  LEU A C   1 
ATOM   214 O  O   . LEU A 1 28 ? -11.796 15.821 5.820   1.00 38.65  ? 27  LEU A O   1 
ATOM   215 C  CB  . LEU A 1 28 ? -9.310  14.323 5.349   1.00 34.68  ? 27  LEU A CB  1 
ATOM   216 C  CG  . LEU A 1 28 ? -8.288  13.183 5.381   1.00 34.65  ? 27  LEU A CG  1 
ATOM   217 C  CD1 . LEU A 1 28 ? -8.297  12.362 4.071   1.00 35.29  ? 27  LEU A CD1 1 
ATOM   218 C  CD2 . LEU A 1 28 ? -6.929  13.745 5.670   1.00 33.42  ? 27  LEU A CD2 1 
ATOM   219 N  N   . LYS A 1 29 ? -10.412 17.297 6.813   1.00 37.75  ? 28  LYS A N   1 
ATOM   220 C  CA  . LYS A 1 29 ? -11.187 18.455 6.361   1.00 39.80  ? 28  LYS A CA  1 
ATOM   221 C  C   . LYS A 1 29 ? -10.745 18.735 4.934   1.00 38.32  ? 28  LYS A C   1 
ATOM   222 O  O   . LYS A 1 29 ? -9.806  18.097 4.439   1.00 36.43  ? 28  LYS A O   1 
ATOM   223 C  CB  . LYS A 1 29 ? -10.969 19.681 7.274   1.00 42.09  ? 28  LYS A CB  1 
ATOM   224 C  CG  . LYS A 1 29 ? -9.538  20.202 7.308   1.00 42.43  ? 28  LYS A CG  1 
ATOM   225 C  CD  . LYS A 1 29 ? -9.373  21.372 8.288   1.00 46.40  ? 28  LYS A CD  1 
ATOM   226 N  N   . LYS A 1 30 ? -11.410 19.670 4.265   1.00 40.01  ? 29  LYS A N   1 
ATOM   227 C  CA  . LYS A 1 30 ? -11.084 19.990 2.869   1.00 39.26  ? 29  LYS A CA  1 
ATOM   228 C  C   . LYS A 1 30 ? -9.599  20.323 2.597   1.00 38.81  ? 29  LYS A C   1 
ATOM   229 O  O   . LYS A 1 30 ? -9.033  19.855 1.600   1.00 36.41  ? 29  LYS A O   1 
ATOM   230 C  CB  . LYS A 1 30 ? -11.963 21.124 2.365   1.00 42.09  ? 29  LYS A CB  1 
ATOM   231 C  CG  . LYS A 1 30 ? -13.371 20.738 2.011   1.00 41.91  ? 29  LYS A CG  1 
ATOM   232 C  CD  . LYS A 1 30 ? -14.058 21.938 1.361   1.00 43.74  ? 29  LYS A CD  1 
ATOM   233 C  CE  . LYS A 1 30 ? -15.540 21.887 1.523   1.00 46.30  ? 29  LYS A CE  1 
ATOM   234 N  NZ  . LYS A 1 30 ? -16.197 23.043 0.845   1.00 48.95  ? 29  LYS A NZ  1 
ATOM   235 N  N   . SER A 1 31 ? -8.988  21.150 3.447   1.00 39.87  ? 30  SER A N   1 
ATOM   236 C  CA  . SER A 1 31 ? -7.593  21.556 3.250   1.00 40.71  ? 30  SER A CA  1 
ATOM   237 C  C   . SER A 1 31 ? -6.641  20.379 3.443   1.00 38.50  ? 30  SER A C   1 
ATOM   238 O  O   . SER A 1 31 ? -5.662  20.255 2.717   1.00 38.66  ? 30  SER A O   1 
ATOM   239 C  CB  . SER A 1 31 ? -7.201  22.715 4.179   1.00 43.82  ? 30  SER A CB  1 
ATOM   240 O  OG  . SER A 1 31 ? -7.329  22.311 5.526   1.00 45.80  ? 30  SER A OG  1 
ATOM   241 N  N   . GLU A 1 32 ? -6.945  19.495 4.391   1.00 38.21  ? 31  GLU A N   1 
ATOM   242 C  CA  . GLU A 1 32 ? -6.157  18.262 4.587   1.00 36.34  ? 31  GLU A CA  1 
ATOM   243 C  C   . GLU A 1 32 ? -6.244  17.310 3.390   1.00 34.93  ? 31  GLU A C   1 
ATOM   244 O  O   . GLU A 1 32 ? -5.228  16.723 2.972   1.00 34.16  ? 31  GLU A O   1 
ATOM   245 C  CB  . GLU A 1 32 ? -6.588  17.535 5.873   1.00 36.69  ? 31  GLU A CB  1 
ATOM   246 C  CG  . GLU A 1 32 ? -6.194  18.289 7.157   1.00 38.57  ? 31  GLU A CG  1 
ATOM   247 C  CD  . GLU A 1 32 ? -6.863  17.753 8.418   1.00 39.79  ? 31  GLU A CD  1 
ATOM   248 O  OE1 . GLU A 1 32 ? -7.936  17.120 8.351   1.00 40.65  ? 31  GLU A OE1 1 
ATOM   249 O  OE2 . GLU A 1 32 ? -6.345  18.003 9.512   1.00 44.94  ? 31  GLU A OE2 1 
ATOM   250 N  N   . LEU A 1 33 ? -7.462  17.137 2.867   1.00 34.53  ? 32  LEU A N   1 
ATOM   251 C  CA  . LEU A 1 33 ? -7.717  16.276 1.716   1.00 34.30  ? 32  LEU A CA  1 
ATOM   252 C  C   . LEU A 1 33 ? -6.967  16.835 0.520   1.00 33.51  ? 32  LEU A C   1 
ATOM   253 O  O   . LEU A 1 33 ? -6.307  16.073 -0.199  1.00 33.61  ? 32  LEU A O   1 
ATOM   254 C  CB  . LEU A 1 33 ? -9.219  16.277 1.361   1.00 35.68  ? 32  LEU A CB  1 
ATOM   255 C  CG  . LEU A 1 33 ? -9.976  15.057 0.827   1.00 37.53  ? 32  LEU A CG  1 
ATOM   256 C  CD1 . LEU A 1 33 ? -11.185 15.483 -0.022  1.00 37.24  ? 32  LEU A CD1 1 
ATOM   257 C  CD2 . LEU A 1 33 ? -9.133  13.943 0.159   1.00 36.30  ? 32  LEU A CD2 1 
ATOM   258 N  N   . LYS A 1 34 ? -7.060  18.153 0.312   1.00 35.05  ? 33  LYS A N   1 
ATOM   259 C  CA  . LYS A 1 34 ? -6.429  18.803 -0.840  1.00 36.17  ? 33  LYS A CA  1 
ATOM   260 C  C   . LYS A 1 34 ? -4.902  18.574 -0.816  1.00 35.54  ? 33  LYS A C   1 
ATOM   261 O  O   . LYS A 1 34 ? -4.318  18.199 -1.833  1.00 35.16  ? 33  LYS A O   1 
ATOM   262 C  CB  . LYS A 1 34 ? -6.758  20.305 -0.893  1.00 38.40  ? 33  LYS A CB  1 
ATOM   263 C  CG  . LYS A 1 34 ? -6.208  21.004 -2.124  1.00 40.70  ? 33  LYS A CG  1 
ATOM   264 C  CD  . LYS A 1 34 ? -6.380  22.522 -2.047  1.00 45.73  ? 33  LYS A CD  1 
ATOM   265 C  CE  . LYS A 1 34 ? -5.394  23.159 -1.066  1.00 51.84  ? 33  LYS A CE  1 
ATOM   266 N  NZ  . LYS A 1 34 ? -5.238  24.621 -1.339  1.00 58.59  ? 33  LYS A NZ  1 
ATOM   267 N  N   . GLU A 1 35 ? -4.285  18.765 0.353   1.00 35.91  ? 34  GLU A N   1 
ATOM   268 C  CA  . GLU A 1 35 ? -2.841  18.589 0.511   1.00 36.17  ? 34  GLU A CA  1 
ATOM   269 C  C   . GLU A 1 35 ? -2.435  17.137 0.281   1.00 35.61  ? 34  GLU A C   1 
ATOM   270 O  O   . GLU A 1 35 ? -1.425  16.866 -0.406  1.00 36.19  ? 34  GLU A O   1 
ATOM   271 C  CB  . GLU A 1 35 ? -2.345  19.110 1.874   1.00 38.05  ? 34  GLU A CB  1 
ATOM   272 C  CG  . GLU A 1 35 ? -2.648  20.608 2.161   1.00 40.01  ? 34  GLU A CG  1 
ATOM   273 C  CD  . GLU A 1 35 ? -1.981  21.594 1.176   1.00 44.54  ? 34  GLU A CD  1 
ATOM   274 O  OE1 . GLU A 1 35 ? -1.337  21.160 0.189   1.00 43.45  ? 34  GLU A OE1 1 
ATOM   275 O  OE2 . GLU A 1 35 ? -2.115  22.829 1.378   1.00 46.13  ? 34  GLU A OE2 1 
ATOM   276 N  N   . LEU A 1 36 ? -3.213  16.198 0.838   1.00 34.81  ? 35  LEU A N   1 
ATOM   277 C  CA  . LEU A 1 36 ? -2.975  14.767 0.597   1.00 33.61  ? 35  LEU A CA  1 
ATOM   278 C  C   . LEU A 1 36 ? -2.927  14.452 -0.917  1.00 33.14  ? 35  LEU A C   1 
ATOM   279 O  O   . LEU A 1 36 ? -1.970  13.832 -1.408  1.00 33.75  ? 35  LEU A O   1 
ATOM   280 C  CB  . LEU A 1 36 ? -4.011  13.897 1.307   1.00 33.12  ? 35  LEU A CB  1 
ATOM   281 C  CG  . LEU A 1 36 ? -3.736  12.393 1.304   1.00 33.49  ? 35  LEU A CG  1 
ATOM   282 C  CD1 . LEU A 1 36 ? -4.374  11.736 2.558   1.00 34.14  ? 35  LEU A CD1 1 
ATOM   283 C  CD2 . LEU A 1 36 ? -4.254  11.734 0.010   1.00 34.86  ? 35  LEU A CD2 1 
ATOM   284 N  N   . ILE A 1 37 ? -3.942  14.897 -1.648  1.00 31.88  ? 36  ILE A N   1 
ATOM   285 C  CA  . ILE A 1 37 ? -4.018  14.651 -3.088  1.00 32.80  ? 36  ILE A CA  1 
ATOM   286 C  C   . ILE A 1 37 ? -2.855  15.311 -3.812  1.00 33.79  ? 36  ILE A C   1 
ATOM   287 O  O   . ILE A 1 37 ? -2.179  14.669 -4.606  1.00 35.54  ? 36  ILE A O   1 
ATOM   288 C  CB  . ILE A 1 37 ? -5.377  15.107 -3.674  1.00 33.64  ? 36  ILE A CB  1 
ATOM   289 C  CG1 . ILE A 1 37 ? -6.502  14.237 -3.067  1.00 33.38  ? 36  ILE A CG1 1 
ATOM   290 C  CG2 . ILE A 1 37 ? -5.385  15.008 -5.213  1.00 35.94  ? 36  ILE A CG2 1 
ATOM   291 C  CD1 . ILE A 1 37 ? -7.921  14.718 -3.357  1.00 33.90  ? 36  ILE A CD1 1 
ATOM   292 N  N   . ASN A 1 38 ? -2.624  16.583 -3.525  1.00 33.79  ? 37  ASN A N   1 
ATOM   293 C  CA  . ASN A 1 38 ? -1.571  17.343 -4.203  1.00 36.71  ? 37  ASN A CA  1 
ATOM   294 C  C   . ASN A 1 38 ? -0.146  16.819 -3.964  1.00 37.40  ? 37  ASN A C   1 
ATOM   295 O  O   . ASN A 1 38 ? 0.698   16.834 -4.876  1.00 39.85  ? 37  ASN A O   1 
ATOM   296 C  CB  . ASN A 1 38 ? -1.680  18.823 -3.825  1.00 37.16  ? 37  ASN A CB  1 
ATOM   297 C  CG  . ASN A 1 38 ? -2.837  19.536 -4.521  1.00 38.37  ? 37  ASN A CG  1 
ATOM   298 O  OD1 . ASN A 1 38 ? -3.084  20.730 -4.274  1.00 41.36  ? 37  ASN A OD1 1 
ATOM   299 N  ND2 . ASN A 1 38 ? -3.532  18.832 -5.412  1.00 32.17  ? 37  ASN A ND2 1 
ATOM   300 N  N   . ASN A 1 39 ? 0.132   16.413 -2.724  1.00 36.93  ? 38  ASN A N   1 
ATOM   301 C  CA  . ASN A 1 39 ? 1.478   15.983 -2.326  1.00 38.54  ? 38  ASN A CA  1 
ATOM   302 C  C   . ASN A 1 39 ? 1.744   14.506 -2.565  1.00 38.71  ? 38  ASN A C   1 
ATOM   303 O  O   . ASN A 1 39 ? 2.865   14.126 -2.902  1.00 40.55  ? 38  ASN A O   1 
ATOM   304 C  CB  . ASN A 1 39 ? 1.717   16.207 -0.831  1.00 39.20  ? 38  ASN A CB  1 
ATOM   305 C  CG  . ASN A 1 39 ? 1.714   17.657 -0.434  1.00 39.10  ? 38  ASN A CG  1 
ATOM   306 O  OD1 . ASN A 1 39 ? 2.021   18.549 -1.233  1.00 41.23  ? 38  ASN A OD1 1 
ATOM   307 N  ND2 . ASN A 1 39 ? 1.412   17.902 0.839   1.00 41.04  ? 38  ASN A ND2 1 
ATOM   308 N  N   . GLU A 1 40 ? 0.718   13.687 -2.354  1.00 38.10  ? 39  GLU A N   1 
ATOM   309 C  CA  . GLU A 1 40 ? 0.888   12.226 -2.313  1.00 38.56  ? 39  GLU A CA  1 
ATOM   310 C  C   . GLU A 1 40 ? 0.310   11.473 -3.513  1.00 38.83  ? 39  GLU A C   1 
ATOM   311 O  O   . GLU A 1 40 ? 0.586   10.274 -3.686  1.00 40.18  ? 39  GLU A O   1 
ATOM   312 C  CB  . GLU A 1 40 ? 0.313   11.644 -1.017  1.00 38.56  ? 39  GLU A CB  1 
ATOM   313 C  CG  . GLU A 1 40 ? 0.723   12.368 0.301   1.00 39.54  ? 39  GLU A CG  1 
ATOM   314 C  CD  . GLU A 1 40 ? 2.216   12.525 0.510   1.00 40.98  ? 39  GLU A CD  1 
ATOM   315 O  OE1 . GLU A 1 40 ? 3.006   11.685 0.024   1.00 41.74  ? 39  GLU A OE1 1 
ATOM   316 O  OE2 . GLU A 1 40 ? 2.601   13.496 1.195   1.00 39.82  ? 39  GLU A OE2 1 
ATOM   317 N  N   . LEU A 1 41 ? -0.498  12.142 -4.331  1.00 37.78  ? 40  LEU A N   1 
ATOM   318 C  CA  . LEU A 1 41 ? -1.115  11.470 -5.500  1.00 37.84  ? 40  LEU A CA  1 
ATOM   319 C  C   . LEU A 1 41 ? -0.816  12.149 -6.836  1.00 39.38  ? 40  LEU A C   1 
ATOM   320 O  O   . LEU A 1 41 ? -1.580  12.022 -7.801  1.00 39.64  ? 40  LEU A O   1 
ATOM   321 C  CB  . LEU A 1 41 ? -2.630  11.279 -5.298  1.00 36.94  ? 40  LEU A CB  1 
ATOM   322 C  CG  . LEU A 1 41 ? -3.036  10.280 -4.203  1.00 35.05  ? 40  LEU A CG  1 
ATOM   323 C  CD1 . LEU A 1 41 ? -4.511  10.408 -3.782  1.00 34.68  ? 40  LEU A CD1 1 
ATOM   324 C  CD2 . LEU A 1 41 ? -2.733  8.824  -4.594  1.00 37.32  ? 40  LEU A CD2 1 
ATOM   325 N  N   . SER A 1 42 ? 0.326   12.833 -6.894  1.00 43.54  ? 41  SER A N   1 
ATOM   326 C  CA  . SER A 1 42 ? 0.677   13.643 -8.057  1.00 44.53  ? 41  SER A CA  1 
ATOM   327 C  C   . SER A 1 42 ? 0.872   12.858 -9.371  1.00 46.55  ? 41  SER A C   1 
ATOM   328 O  O   . SER A 1 42 ? 0.762   13.439 -10.448 1.00 47.72  ? 41  SER A O   1 
ATOM   329 C  CB  . SER A 1 42 ? 1.912   14.506 -7.759  1.00 45.89  ? 41  SER A CB  1 
ATOM   330 O  OG  . SER A 1 42 ? 3.035   13.683 -7.504  1.00 46.73  ? 41  SER A OG  1 
ATOM   331 N  N   . HIS A 1 43 ? 1.150   11.554 -9.286  1.00 48.02  ? 42  HIS A N   1 
ATOM   332 C  CA  . HIS A 1 43 ? 1.266   10.709 -10.491 1.00 50.57  ? 42  HIS A CA  1 
ATOM   333 C  C   . HIS A 1 43 ? -0.080  10.201 -11.025 1.00 49.79  ? 42  HIS A C   1 
ATOM   334 O  O   . HIS A 1 43 ? -0.169  9.743  -12.173 1.00 52.53  ? 42  HIS A O   1 
ATOM   335 C  CB  . HIS A 1 43 ? 2.205   9.519  -10.246 1.00 53.01  ? 42  HIS A CB  1 
ATOM   336 C  CG  . HIS A 1 43 ? 3.630   9.913  -10.025 1.00 55.46  ? 42  HIS A CG  1 
ATOM   337 N  ND1 . HIS A 1 43 ? 4.136   10.213 -8.779  1.00 55.37  ? 42  HIS A ND1 1 
ATOM   338 C  CD2 . HIS A 1 43 ? 4.655   10.069 -10.895 1.00 59.94  ? 42  HIS A CD2 1 
ATOM   339 C  CE1 . HIS A 1 43 ? 5.410   10.541 -8.890  1.00 58.00  ? 42  HIS A CE1 1 
ATOM   340 N  NE2 . HIS A 1 43 ? 5.751   10.456 -10.163 1.00 61.67  ? 42  HIS A NE2 1 
ATOM   341 N  N   . PHE A 1 44 ? -1.106  10.267 -10.187 1.00 47.23  ? 43  PHE A N   1 
ATOM   342 C  CA  . PHE A 1 44 ? -2.414  9.643  -10.457 1.00 47.00  ? 43  PHE A CA  1 
ATOM   343 C  C   . PHE A 1 44 ? -3.518  10.649 -10.760 1.00 45.28  ? 43  PHE A C   1 
ATOM   344 O  O   . PHE A 1 44 ? -4.420  10.378 -11.567 1.00 45.72  ? 43  PHE A O   1 
ATOM   345 C  CB  . PHE A 1 44 ? -2.839  8.758  -9.261  1.00 45.92  ? 43  PHE A CB  1 
ATOM   346 C  CG  . PHE A 1 44 ? -1.991  7.517  -9.088  1.00 49.44  ? 43  PHE A CG  1 
ATOM   347 C  CD1 . PHE A 1 44 ? -1.226  7.024  -10.140 1.00 54.10  ? 43  PHE A CD1 1 
ATOM   348 C  CD2 . PHE A 1 44 ? -1.971  6.833  -7.894  1.00 49.84  ? 43  PHE A CD2 1 
ATOM   349 C  CE1 . PHE A 1 44 ? -0.450  5.873  -9.986  1.00 58.25  ? 43  PHE A CE1 1 
ATOM   350 C  CE2 . PHE A 1 44 ? -1.200  5.683  -7.743  1.00 53.11  ? 43  PHE A CE2 1 
ATOM   351 C  CZ  . PHE A 1 44 ? -0.449  5.207  -8.779  1.00 55.86  ? 43  PHE A CZ  1 
ATOM   352 N  N   . LEU A 1 45 ? -3.435  11.804 -10.102 1.00 43.51  ? 44  LEU A N   1 
ATOM   353 C  CA  . LEU A 1 45 ? -4.475  12.814 -10.139 1.00 42.54  ? 44  LEU A CA  1 
ATOM   354 C  C   . LEU A 1 45 ? -3.857  14.173 -10.413 1.00 42.79  ? 44  LEU A C   1 
ATOM   355 O  O   . LEU A 1 45 ? -2.828  14.524 -9.817  1.00 41.96  ? 44  LEU A O   1 
ATOM   356 C  CB  . LEU A 1 45 ? -5.227  12.871 -8.792  1.00 39.66  ? 44  LEU A CB  1 
ATOM   357 C  CG  . LEU A 1 45 ? -5.979  11.614 -8.300  1.00 42.63  ? 44  LEU A CG  1 
ATOM   358 C  CD1 . LEU A 1 45 ? -6.682  11.841 -6.962  1.00 38.72  ? 44  LEU A CD1 1 
ATOM   359 C  CD2 . LEU A 1 45 ? -6.970  11.088 -9.362  1.00 45.49  ? 44  LEU A CD2 1 
ATOM   360 N  N   . GLU A 1 46 ? -4.502  14.935 -11.296 1.00 44.07  ? 45  GLU A N   1 
ATOM   361 C  CA  . GLU A 1 46 ? -4.128  16.332 -11.561 1.00 44.60  ? 45  GLU A CA  1 
ATOM   362 C  C   . GLU A 1 46 ? -4.152  17.142 -10.276 1.00 42.40  ? 45  GLU A C   1 
ATOM   363 O  O   . GLU A 1 46 ? -5.075  17.001 -9.450  1.00 41.15  ? 45  GLU A O   1 
ATOM   364 C  CB  . GLU A 1 46 ? -5.090  16.986 -12.562 1.00 46.36  ? 45  GLU A CB  1 
ATOM   365 C  CG  . GLU A 1 46 ? -4.577  17.043 -13.998 1.00 51.16  ? 45  GLU A CG  1 
ATOM   366 N  N   . GLU A 1 47 ? -3.148  17.994 -10.113 1.00 42.32  ? 46  GLU A N   1 
ATOM   367 C  CA  . GLU A 1 47 ? -3.067  18.877 -8.958  1.00 40.96  ? 46  GLU A CA  1 
ATOM   368 C  C   . GLU A 1 47 ? -4.366  19.678 -8.792  1.00 39.85  ? 46  GLU A C   1 
ATOM   369 O  O   . GLU A 1 47 ? -4.922  20.165 -9.776  1.00 40.40  ? 46  GLU A O   1 
ATOM   370 C  CB  . GLU A 1 47 ? -1.866  19.835 -9.096  1.00 43.25  ? 46  GLU A CB  1 
ATOM   371 C  CG  . GLU A 1 47 ? -1.599  20.640 -7.808  1.00 43.32  ? 46  GLU A CG  1 
ATOM   372 C  CD  . GLU A 1 47 ? -0.564  21.743 -7.959  1.00 46.44  ? 46  GLU A CD  1 
ATOM   373 O  OE1 . GLU A 1 47 ? 0.240   21.683 -8.903  1.00 50.98  ? 46  GLU A OE1 1 
ATOM   374 O  OE2 . GLU A 1 47 ? -0.562  22.684 -7.131  1.00 48.94  ? 46  GLU A OE2 1 
ATOM   375 N  N   . ILE A 1 48 ? -4.856  19.784 -7.556  1.00 37.24  ? 47  ILE A N   1 
ATOM   376 C  CA  . ILE A 1 48 ? -6.031  20.608 -7.281  1.00 37.58  ? 47  ILE A CA  1 
ATOM   377 C  C   . ILE A 1 48 ? -5.653  22.065 -7.036  1.00 38.67  ? 47  ILE A C   1 
ATOM   378 O  O   . ILE A 1 48 ? -4.898  22.373 -6.110  1.00 38.48  ? 47  ILE A O   1 
ATOM   379 C  CB  . ILE A 1 48 ? -6.880  20.068 -6.106  1.00 36.05  ? 47  ILE A CB  1 
ATOM   380 C  CG1 . ILE A 1 48 ? -7.275  18.610 -6.349  1.00 35.60  ? 47  ILE A CG1 1 
ATOM   381 C  CG2 . ILE A 1 48 ? -8.120  20.913 -5.962  1.00 37.53  ? 47  ILE A CG2 1 
ATOM   382 C  CD1 . ILE A 1 48 ? -7.939  17.915 -5.111  1.00 35.15  ? 47  ILE A CD1 1 
ATOM   383 N  N   . LYS A 1 49 ? -6.169  22.950 -7.886  1.00 39.82  ? 48  LYS A N   1 
ATOM   384 C  CA  . LYS A 1 49 ? -5.910  24.380 -7.746  1.00 43.11  ? 48  LYS A CA  1 
ATOM   385 C  C   . LYS A 1 49 ? -7.171  25.230 -7.560  1.00 44.06  ? 48  LYS A C   1 
ATOM   386 O  O   . LYS A 1 49 ? -7.082  26.395 -7.162  1.00 46.93  ? 48  LYS A O   1 
ATOM   387 C  CB  . LYS A 1 49 ? -5.106  24.904 -8.952  1.00 45.36  ? 48  LYS A CB  1 
ATOM   388 C  CG  . LYS A 1 49 ? -3.680  24.408 -9.022  1.00 45.40  ? 48  LYS A CG  1 
ATOM   389 C  CD  . LYS A 1 49 ? -3.030  24.811 -10.347 1.00 51.19  ? 48  LYS A CD  1 
ATOM   390 C  CE  . LYS A 1 49 ? -1.511  24.653 -10.299 1.00 54.78  ? 48  LYS A CE  1 
ATOM   391 N  NZ  . LYS A 1 49 ? -0.899  24.685 -11.660 1.00 60.35  ? 48  LYS A NZ  1 
ATOM   392 N  N   . GLU A 1 50 ? -8.338  24.681 -7.873  1.00 43.32  ? 49  GLU A N   1 
ATOM   393 C  CA  . GLU A 1 50 ? -9.566  25.480 -7.813  1.00 44.90  ? 49  GLU A CA  1 
ATOM   394 C  C   . GLU A 1 50 ? -10.442 24.981 -6.664  1.00 42.52  ? 49  GLU A C   1 
ATOM   395 O  O   . GLU A 1 50 ? -10.527 23.784 -6.427  1.00 40.10  ? 49  GLU A O   1 
ATOM   396 C  CB  . GLU A 1 50 ? -10.354 25.396 -9.129  1.00 46.90  ? 49  GLU A CB  1 
ATOM   397 C  CG  . GLU A 1 50 ? -9.678  25.951 -10.400 1.00 52.24  ? 49  GLU A CG  1 
ATOM   398 C  CD  . GLU A 1 50 ? -9.319  27.439 -10.353 1.00 59.48  ? 49  GLU A CD  1 
ATOM   399 O  OE1 . GLU A 1 50 ? -10.130 28.285 -9.894  1.00 62.95  ? 49  GLU A OE1 1 
ATOM   400 O  OE2 . GLU A 1 50 ? -8.210  27.770 -10.823 1.00 63.10  ? 49  GLU A OE2 1 
ATOM   401 N  N   . GLN A 1 51 ? -11.102 25.909 -5.975  1.00 42.99  ? 50  GLN A N   1 
ATOM   402 C  CA  . GLN A 1 51 ? -11.996 25.578 -4.867  1.00 42.21  ? 50  GLN A CA  1 
ATOM   403 C  C   . GLN A 1 51 ? -13.130 24.639 -5.291  1.00 40.81  ? 50  GLN A C   1 
ATOM   404 O  O   . GLN A 1 51 ? -13.519 23.752 -4.542  1.00 39.83  ? 50  GLN A O   1 
ATOM   405 C  CB  . GLN A 1 51 ? -12.594 26.860 -4.275  1.00 44.67  ? 50  GLN A CB  1 
ATOM   406 C  CG  . GLN A 1 51 ? -13.377 26.637 -3.002  1.00 45.71  ? 50  GLN A CG  1 
ATOM   407 C  CD  . GLN A 1 51 ? -12.498 26.174 -1.856  1.00 45.59  ? 50  GLN A CD  1 
ATOM   408 O  OE1 . GLN A 1 51 ? -11.572 26.870 -1.467  1.00 50.67  ? 50  GLN A OE1 1 
ATOM   409 N  NE2 . GLN A 1 51 ? -12.803 25.018 -1.293  1.00 41.69  ? 50  GLN A NE2 1 
ATOM   410 N  N   . GLU A 1 52 ? -13.687 24.838 -6.476  1.00 42.54  ? 51  GLU A N   1 
ATOM   411 C  CA  . GLU A 1 52 ? -14.805 23.989 -6.879  1.00 42.67  ? 51  GLU A CA  1 
ATOM   412 C  C   . GLU A 1 52 ? -14.417 22.525 -7.043  1.00 40.53  ? 51  GLU A C   1 
ATOM   413 O  O   . GLU A 1 52 ? -15.266 21.642 -6.885  1.00 40.02  ? 51  GLU A O   1 
ATOM   414 C  CB  . GLU A 1 52 ? -15.529 24.531 -8.109  1.00 46.73  ? 51  GLU A CB  1 
ATOM   415 C  CG  . GLU A 1 52 ? -14.734 24.625 -9.379  1.00 50.06  ? 51  GLU A CG  1 
ATOM   416 C  CD  . GLU A 1 52 ? -15.638 25.068 -10.504 1.00 56.77  ? 51  GLU A CD  1 
ATOM   417 O  OE1 . GLU A 1 52 ? -15.567 26.246 -10.896 1.00 59.97  ? 51  GLU A OE1 1 
ATOM   418 O  OE2 . GLU A 1 52 ? -16.478 24.250 -10.938 1.00 60.01  ? 51  GLU A OE2 1 
ATOM   419 N  N   . VAL A 1 53 ? -13.131 22.279 -7.321  1.00 38.95  ? 52  VAL A N   1 
ATOM   420 C  CA  . VAL A 1 53 ? -12.616 20.915 -7.454  1.00 37.90  ? 52  VAL A CA  1 
ATOM   421 C  C   . VAL A 1 53 ? -12.461 20.299 -6.075  1.00 36.88  ? 52  VAL A C   1 
ATOM   422 O  O   . VAL A 1 53 ? -12.924 19.177 -5.866  1.00 36.00  ? 52  VAL A O   1 
ATOM   423 C  CB  . VAL A 1 53 ? -11.305 20.824 -8.311  1.00 37.50  ? 52  VAL A CB  1 
ATOM   424 C  CG1 . VAL A 1 53 ? -10.751 19.385 -8.313  1.00 35.23  ? 52  VAL A CG1 1 
ATOM   425 C  CG2 . VAL A 1 53 ? -11.582 21.279 -9.740  1.00 40.18  ? 52  VAL A CG2 1 
ATOM   426 N  N   . VAL A 1 54 ? -11.891 21.052 -5.122  1.00 37.11  ? 53  VAL A N   1 
ATOM   427 C  CA  . VAL A 1 54 ? -11.870 20.635 -3.698  1.00 37.55  ? 53  VAL A CA  1 
ATOM   428 C  C   . VAL A 1 54 ? -13.279 20.220 -3.235  1.00 37.44  ? 53  VAL A C   1 
ATOM   429 O  O   . VAL A 1 54 ? -13.489 19.140 -2.684  1.00 36.73  ? 53  VAL A O   1 
ATOM   430 C  CB  . VAL A 1 54 ? -11.379 21.808 -2.769  1.00 38.73  ? 53  VAL A CB  1 
ATOM   431 C  CG1 . VAL A 1 54 ? -11.439 21.418 -1.279  1.00 41.69  ? 53  VAL A CG1 1 
ATOM   432 C  CG2 . VAL A 1 54 ? -9.976  22.243 -3.137  1.00 40.67  ? 53  VAL A CG2 1 
ATOM   433 N  N   . ASP A 1 55 ? -14.223 21.131 -3.450  1.00 38.53  ? 54  ASP A N   1 
ATOM   434 C  CA  . ASP A 1 55 ? -15.599 20.987 -3.021  1.00 39.09  ? 54  ASP A CA  1 
ATOM   435 C  C   . ASP A 1 55 ? -16.229 19.728 -3.612  1.00 39.43  ? 54  ASP A C   1 
ATOM   436 O  O   . ASP A 1 55 ? -16.834 18.925 -2.882  1.00 39.49  ? 54  ASP A O   1 
ATOM   437 C  CB  . ASP A 1 55 ? -16.387 22.232 -3.434  1.00 40.78  ? 54  ASP A CB  1 
ATOM   438 C  CG  . ASP A 1 55 ? -15.994 23.469 -2.641  1.00 40.87  ? 54  ASP A CG  1 
ATOM   439 O  OD1 . ASP A 1 55 ? -15.197 23.366 -1.674  1.00 38.31  ? 54  ASP A OD1 1 
ATOM   440 O  OD2 . ASP A 1 55 ? -16.488 24.557 -2.991  1.00 42.28  ? 54  ASP A OD2 1 
ATOM   441 N  N   . LYS A 1 56 ? -16.058 19.537 -4.921  1.00 39.91  ? 55  LYS A N   1 
ATOM   442 C  CA  . LYS A 1 56 ? -16.616 18.374 -5.602  1.00 41.66  ? 55  LYS A CA  1 
ATOM   443 C  C   . LYS A 1 56 ? -16.018 17.060 -5.084  1.00 40.17  ? 55  LYS A C   1 
ATOM   444 O  O   . LYS A 1 56 ? -16.756 16.092 -4.872  1.00 41.21  ? 55  LYS A O   1 
ATOM   445 C  CB  . LYS A 1 56 ? -16.432 18.480 -7.117  1.00 43.43  ? 55  LYS A CB  1 
ATOM   446 C  CG  . LYS A 1 56 ? -17.300 17.517 -7.911  1.00 48.79  ? 55  LYS A CG  1 
ATOM   447 C  CD  . LYS A 1 56 ? -18.711 18.089 -8.099  1.00 54.30  ? 55  LYS A CD  1 
ATOM   448 C  CE  . LYS A 1 56 ? -19.777 17.019 -8.130  1.00 57.59  ? 55  LYS A CE  1 
ATOM   449 N  NZ  . LYS A 1 56 ? -21.135 17.648 -8.305  1.00 62.02  ? 55  LYS A NZ  1 
ATOM   450 N  N   . VAL A 1 57 ? -14.696 17.019 -4.901  1.00 38.35  ? 56  VAL A N   1 
ATOM   451 C  CA  . VAL A 1 57 ? -14.040 15.787 -4.446  1.00 38.03  ? 56  VAL A CA  1 
ATOM   452 C  C   . VAL A 1 57 ? -14.595 15.431 -3.087  1.00 37.75  ? 56  VAL A C   1 
ATOM   453 O  O   . VAL A 1 57 ? -15.049 14.313 -2.905  1.00 38.36  ? 56  VAL A O   1 
ATOM   454 C  CB  . VAL A 1 57 ? -12.513 15.899 -4.411  1.00 36.91  ? 56  VAL A CB  1 
ATOM   455 C  CG1 . VAL A 1 57 ? -11.877 14.676 -3.708  1.00 36.79  ? 56  VAL A CG1 1 
ATOM   456 C  CG2 . VAL A 1 57 ? -11.987 16.014 -5.834  1.00 38.45  ? 56  VAL A CG2 1 
ATOM   457 N  N   . MET A 1 58 ? -14.599 16.394 -2.158  1.00 37.02  ? 57  MET A N   1 
ATOM   458 C  CA  . MET A 1 58 ? -15.193 16.165 -0.827  1.00 37.71  ? 57  MET A CA  1 
ATOM   459 C  C   . MET A 1 58 ? -16.628 15.709 -0.923  1.00 39.74  ? 57  MET A C   1 
ATOM   460 O  O   . MET A 1 58 ? -17.012 14.775 -0.236  1.00 39.56  ? 57  MET A O   1 
ATOM   461 C  CB  . MET A 1 58 ? -15.101 17.400 0.080   1.00 38.22  ? 57  MET A CB  1 
ATOM   462 C  CG  . MET A 1 58 ? -15.593 17.134 1.516   1.00 40.28  ? 57  MET A CG  1 
ATOM   463 S  SD  . MET A 1 58 ? -14.627 15.864 2.405   1.00 40.13  ? 57  MET A SD  1 
ATOM   464 C  CE  . MET A 1 58 ? -13.187 16.816 2.947   1.00 37.76  ? 57  MET A CE  1 
ATOM   465 N  N   . GLU A 1 59 ? -17.419 16.356 -1.782  1.00 40.62  ? 58  GLU A N   1 
ATOM   466 C  CA  . GLU A 1 59 ? -18.828 15.986 -1.945  1.00 44.57  ? 58  GLU A CA  1 
ATOM   467 C  C   . GLU A 1 59 ? -18.945 14.511 -2.345  1.00 44.83  ? 58  GLU A C   1 
ATOM   468 O  O   . GLU A 1 59 ? -19.787 13.778 -1.837  1.00 46.73  ? 58  GLU A O   1 
ATOM   469 C  CB  . GLU A 1 59 ? -19.497 16.920 -2.962  1.00 46.14  ? 58  GLU A CB  1 
ATOM   470 C  CG  . GLU A 1 59 ? -20.938 16.591 -3.310  1.00 51.35  ? 58  GLU A CG  1 
ATOM   471 C  CD  . GLU A 1 59 ? -21.497 17.483 -4.421  1.00 54.10  ? 58  GLU A CD  1 
ATOM   472 O  OE1 . GLU A 1 59 ? -22.045 16.941 -5.410  1.00 59.97  ? 58  GLU A OE1 1 
ATOM   473 O  OE2 . GLU A 1 59 ? -21.401 18.725 -4.310  1.00 57.25  ? 58  GLU A OE2 1 
ATOM   474 N  N   . THR A 1 60 ? -18.049 14.078 -3.222  1.00 43.54  ? 59  THR A N   1 
ATOM   475 C  CA  . THR A 1 60 ? -18.045 12.698 -3.701  1.00 45.56  ? 59  THR A CA  1 
ATOM   476 C  C   . THR A 1 60 ? -17.647 11.697 -2.599  1.00 44.89  ? 59  THR A C   1 
ATOM   477 O  O   . THR A 1 60 ? -18.271 10.624 -2.473  1.00 47.15  ? 59  THR A O   1 
ATOM   478 C  CB  . THR A 1 60 ? -17.145 12.572 -4.950  1.00 45.39  ? 59  THR A CB  1 
ATOM   479 O  OG1 . THR A 1 60 ? -17.622 13.488 -5.950  1.00 48.65  ? 59  THR A OG1 1 
ATOM   480 C  CG2 . THR A 1 60 ? -17.167 11.167 -5.502  1.00 46.95  ? 59  THR A CG2 1 
ATOM   481 N  N   . LEU A 1 61 ? -16.643 12.051 -1.794  1.00 42.32  ? 60  LEU A N   1 
ATOM   482 C  CA  . LEU A 1 61 ? -16.068 11.111 -0.816  1.00 42.53  ? 60  LEU A CA  1 
ATOM   483 C  C   . LEU A 1 61 ? -16.805 11.068 0.513   1.00 43.85  ? 60  LEU A C   1 
ATOM   484 O  O   . LEU A 1 61 ? -16.705 10.082 1.252   1.00 44.76  ? 60  LEU A O   1 
ATOM   485 C  CB  . LEU A 1 61 ? -14.598 11.457 -0.548  1.00 39.84  ? 60  LEU A CB  1 
ATOM   486 C  CG  . LEU A 1 61 ? -13.663 11.403 -1.752  1.00 39.78  ? 60  LEU A CG  1 
ATOM   487 C  CD1 . LEU A 1 61 ? -12.240 11.591 -1.256  1.00 39.96  ? 60  LEU A CD1 1 
ATOM   488 C  CD2 . LEU A 1 61 ? -13.828 10.093 -2.546  1.00 42.59  ? 60  LEU A CD2 1 
ATOM   489 N  N   . ASP A 1 62 ? -17.529 12.139 0.827   1.00 43.54  ? 61  ASP A N   1 
ATOM   490 C  CA  . ASP A 1 62 ? -18.170 12.265 2.136   1.00 45.58  ? 61  ASP A CA  1 
ATOM   491 C  C   . ASP A 1 62 ? -19.561 11.606 2.214   1.00 48.92  ? 61  ASP A C   1 
ATOM   492 O  O   . ASP A 1 62 ? -20.588 12.292 2.263   1.00 50.43  ? 61  ASP A O   1 
ATOM   493 C  CB  . ASP A 1 62 ? -18.217 13.745 2.562   1.00 44.74  ? 61  ASP A CB  1 
ATOM   494 C  CG  . ASP A 1 62 ? -18.959 13.950 3.862   1.00 47.56  ? 61  ASP A CG  1 
ATOM   495 O  OD1 . ASP A 1 62 ? -18.881 13.053 4.736   1.00 50.60  ? 61  ASP A OD1 1 
ATOM   496 O  OD2 . ASP A 1 62 ? -19.622 15.000 4.001   1.00 51.05  ? 61  ASP A OD2 1 
ATOM   497 N  N   . SER A 1 63 ? -19.574 10.273 2.251   1.00 50.47  ? 62  SER A N   1 
ATOM   498 C  CA  . SER A 1 63 ? -20.806 9.455  2.271   1.00 54.55  ? 62  SER A CA  1 
ATOM   499 C  C   . SER A 1 63 ? -21.752 9.672  3.449   1.00 57.21  ? 62  SER A C   1 
ATOM   500 O  O   . SER A 1 63 ? -22.983 9.564  3.289   1.00 60.73  ? 62  SER A O   1 
ATOM   501 C  CB  . SER A 1 63 ? -20.449 7.965  2.234   1.00 55.97  ? 62  SER A CB  1 
ATOM   502 O  OG  . SER A 1 63 ? -19.540 7.714  1.197   1.00 55.89  ? 62  SER A OG  1 
ATOM   503 N  N   . ASP A 1 64 ? -21.208 9.911  4.641   1.00 56.80  ? 63  ASP A N   1 
ATOM   504 C  CA  . ASP A 1 64 ? -22.081 10.067 5.818   1.00 60.52  ? 63  ASP A CA  1 
ATOM   505 C  C   . ASP A 1 64 ? -22.485 11.531 6.043   1.00 59.47  ? 63  ASP A C   1 
ATOM   506 O  O   . ASP A 1 64 ? -23.132 11.846 7.030   1.00 62.76  ? 63  ASP A O   1 
ATOM   507 C  CB  . ASP A 1 64 ? -21.471 9.432  7.086   1.00 61.78  ? 63  ASP A CB  1 
ATOM   508 C  CG  . ASP A 1 64 ? -20.146 10.061 7.489   1.00 59.69  ? 63  ASP A CG  1 
ATOM   509 O  OD1 . ASP A 1 64 ? -19.838 11.176 7.027   1.00 53.18  ? 63  ASP A OD1 1 
ATOM   510 O  OD2 . ASP A 1 64 ? -19.403 9.436  8.275   1.00 63.55  ? 63  ASP A OD2 1 
ATOM   511 N  N   . GLY A 1 65 ? -22.086 12.410 5.124   1.00 59.92  ? 64  GLY A N   1 
ATOM   512 C  CA  . GLY A 1 65 ? -22.535 13.801 5.101   1.00 61.20  ? 64  GLY A CA  1 
ATOM   513 C  C   . GLY A 1 65 ? -22.153 14.710 6.261   1.00 61.11  ? 64  GLY A C   1 
ATOM   514 O  O   . GLY A 1 65 ? -22.900 15.638 6.586   1.00 64.86  ? 64  GLY A O   1 
ATOM   515 N  N   . ASP A 1 66 ? -21.002 14.464 6.881   1.00 57.60  ? 65  ASP A N   1 
ATOM   516 C  CA  . ASP A 1 66 ? -20.512 15.316 7.971   1.00 58.29  ? 65  ASP A CA  1 
ATOM   517 C  C   . ASP A 1 66 ? -19.506 16.372 7.488   1.00 55.78  ? 65  ASP A C   1 
ATOM   518 O  O   . ASP A 1 66 ? -18.904 17.090 8.288   1.00 56.62  ? 65  ASP A O   1 
ATOM   519 C  CB  . ASP A 1 66 ? -19.913 14.471 9.114   1.00 58.49  ? 65  ASP A CB  1 
ATOM   520 C  CG  . ASP A 1 66 ? -18.630 13.734 8.713   1.00 54.83  ? 65  ASP A CG  1 
ATOM   521 O  OD1 . ASP A 1 66 ? -18.200 13.835 7.542   1.00 51.87  ? 65  ASP A OD1 1 
ATOM   522 O  OD2 . ASP A 1 66 ? -18.044 13.045 9.574   1.00 55.71  ? 65  ASP A OD2 1 
ATOM   523 N  N   . GLY A 1 67 ? -19.310 16.459 6.179   1.00 53.66  ? 66  GLY A N   1 
ATOM   524 C  CA  . GLY A 1 67 ? -18.418 17.470 5.629   1.00 52.30  ? 66  GLY A CA  1 
ATOM   525 C  C   . GLY A 1 67 ? -16.930 17.141 5.667   1.00 49.36  ? 66  GLY A C   1 
ATOM   526 O  O   . GLY A 1 67 ? -16.104 17.972 5.264   1.00 48.69  ? 66  GLY A O   1 
ATOM   527 N  N   . GLU A 1 68 ? -16.572 15.953 6.163   1.00 47.44  ? 67  GLU A N   1 
ATOM   528 C  CA  . GLU A 1 68 ? -15.162 15.557 6.231   1.00 45.79  ? 67  GLU A CA  1 
ATOM   529 C  C   . GLU A 1 68 ? -14.984 14.165 5.672   1.00 44.13  ? 67  GLU A C   1 
ATOM   530 O  O   . GLU A 1 68 ? -15.976 13.445 5.488   1.00 44.89  ? 67  GLU A O   1 
ATOM   531 C  CB  . GLU A 1 68 ? -14.626 15.619 7.659   1.00 47.44  ? 67  GLU A CB  1 
ATOM   532 C  CG  . GLU A 1 68 ? -14.586 17.032 8.267   1.00 50.94  ? 67  GLU A CG  1 
ATOM   533 C  CD  . GLU A 1 68 ? -13.588 17.143 9.402   1.00 53.68  ? 67  GLU A CD  1 
ATOM   534 O  OE1 . GLU A 1 68 ? -12.442 16.675 9.246   1.00 54.47  ? 67  GLU A OE1 1 
ATOM   535 O  OE2 . GLU A 1 68 ? -13.948 17.699 10.453  1.00 58.54  ? 67  GLU A OE2 1 
ATOM   536 N  N   . CYS A 1 69 ? -13.732 13.795 5.395   1.00 42.52  ? 68  CYS A N   1 
ATOM   537 C  CA  . CYS A 1 69 ? -13.408 12.460 4.898   1.00 40.79  ? 68  CYS A CA  1 
ATOM   538 C  C   . CYS A 1 69 ? -12.766 11.628 6.009   1.00 41.82  ? 68  CYS A C   1 
ATOM   539 O  O   . CYS A 1 69 ? -11.633 11.885 6.410   1.00 42.27  ? 68  CYS A O   1 
ATOM   540 C  CB  . CYS A 1 69 ? -12.477 12.519 3.665   1.00 39.62  ? 68  CYS A CB  1 
ATOM   541 S  SG  . CYS A 1 69 ? -12.193 10.878 2.925   1.00 38.67  ? 68  CYS A SG  1 
ATOM   542 N  N   . ASP A 1 70 ? -13.498 10.630 6.502   1.00 42.77  ? 69  ASP A N   1 
ATOM   543 C  CA  . ASP A 1 70 ? -12.984 9.749  7.547   1.00 44.56  ? 69  ASP A CA  1 
ATOM   544 C  C   . ASP A 1 70 ? -12.237 8.567  6.939   1.00 43.23  ? 69  ASP A C   1 
ATOM   545 O  O   . ASP A 1 70 ? -12.141 8.458  5.713   1.00 41.02  ? 69  ASP A O   1 
ATOM   546 C  CB  . ASP A 1 70 ? -14.081 9.342  8.559   1.00 47.89  ? 69  ASP A CB  1 
ATOM   547 C  CG  . ASP A 1 70 ? -15.159 8.428  7.971   1.00 50.09  ? 69  ASP A CG  1 
ATOM   548 O  OD1 . ASP A 1 70 ? -14.919 7.695  6.990   1.00 49.54  ? 69  ASP A OD1 1 
ATOM   549 O  OD2 . ASP A 1 70 ? -16.270 8.416  8.540   1.00 52.86  ? 69  ASP A OD2 1 
ATOM   550 N  N   . PHE A 1 71 ? -11.679 7.700  7.777   1.00 45.11  ? 70  PHE A N   1 
ATOM   551 C  CA  . PHE A 1 71 ? -10.784 6.672  7.251   1.00 44.66  ? 70  PHE A CA  1 
ATOM   552 C  C   . PHE A 1 71 ? -11.470 5.669  6.327   1.00 43.84  ? 70  PHE A C   1 
ATOM   553 O  O   . PHE A 1 71 ? -10.869 5.202  5.362   1.00 41.64  ? 70  PHE A O   1 
ATOM   554 C  CB  . PHE A 1 71 ? -10.011 5.948  8.351   1.00 48.72  ? 70  PHE A CB  1 
ATOM   555 C  CG  . PHE A 1 71 ? -8.978  5.015  7.812   1.00 48.88  ? 70  PHE A CG  1 
ATOM   556 C  CD1 . PHE A 1 71 ? -7.852  5.510  7.177   1.00 46.71  ? 70  PHE A CD1 1 
ATOM   557 C  CD2 . PHE A 1 71 ? -9.143  3.636  7.909   1.00 53.00  ? 70  PHE A CD2 1 
ATOM   558 C  CE1 . PHE A 1 71 ? -6.900  4.655  6.649   1.00 48.69  ? 70  PHE A CE1 1 
ATOM   559 C  CE2 . PHE A 1 71 ? -8.195  2.772  7.391   1.00 53.00  ? 70  PHE A CE2 1 
ATOM   560 C  CZ  . PHE A 1 71 ? -7.069  3.282  6.763   1.00 51.99  ? 70  PHE A CZ  1 
ATOM   561 N  N   . GLN A 1 72 ? -12.726 5.341  6.625   1.00 46.04  ? 71  GLN A N   1 
ATOM   562 C  CA  . GLN A 1 72 ? -13.498 4.450  5.766   1.00 46.39  ? 71  GLN A CA  1 
ATOM   563 C  C   . GLN A 1 72 ? -13.814 5.109  4.425   1.00 43.74  ? 71  GLN A C   1 
ATOM   564 O  O   . GLN A 1 72 ? -13.738 4.465  3.374   1.00 43.75  ? 71  GLN A O   1 
ATOM   565 C  CB  . GLN A 1 72 ? -14.792 4.009  6.464   1.00 50.75  ? 71  GLN A CB  1 
ATOM   566 C  CG  . GLN A 1 72 ? -14.558 3.191  7.718   1.00 55.21  ? 71  GLN A CG  1 
ATOM   567 C  CD  . GLN A 1 72 ? -13.965 1.824  7.428   1.00 58.63  ? 71  GLN A CD  1 
ATOM   568 N  N   . GLU A 1 73 ? -14.154 6.394  4.465   1.00 42.30  ? 72  GLU A N   1 
ATOM   569 C  CA  . GLU A 1 73 ? -14.359 7.167  3.243   1.00 40.50  ? 72  GLU A CA  1 
ATOM   570 C  C   . GLU A 1 73 ? -13.068 7.283  2.437   1.00 38.72  ? 72  GLU A C   1 
ATOM   571 O  O   . GLU A 1 73 ? -13.102 7.215  1.206   1.00 38.26  ? 72  GLU A O   1 
ATOM   572 C  CB  . GLU A 1 73 ? -14.985 8.525  3.552   1.00 40.66  ? 72  GLU A CB  1 
ATOM   573 C  CG  . GLU A 1 73 ? -16.451 8.425  3.997   1.00 42.72  ? 72  GLU A CG  1 
ATOM   574 C  CD  . GLU A 1 73 ? -16.895 9.632  4.803   1.00 45.08  ? 72  GLU A CD  1 
ATOM   575 O  OE1 . GLU A 1 73 ? -16.041 10.470 5.166   1.00 43.23  ? 72  GLU A OE1 1 
ATOM   576 O  OE2 . GLU A 1 73 ? -18.100 9.744  5.099   1.00 48.90  ? 72  GLU A OE2 1 
ATOM   577 N  N   . PHE A 1 74 ? -11.934 7.424  3.128   1.00 38.06  ? 73  PHE A N   1 
ATOM   578 C  CA  . PHE A 1 74 ? -10.630 7.441  2.459   1.00 37.79  ? 73  PHE A CA  1 
ATOM   579 C  C   . PHE A 1 74 ? -10.342 6.116  1.745   1.00 37.88  ? 73  PHE A C   1 
ATOM   580 O  O   . PHE A 1 74 ? -9.817  6.101  0.632   1.00 38.23  ? 73  PHE A O   1 
ATOM   581 C  CB  . PHE A 1 74 ? -9.504  7.769  3.469   1.00 39.22  ? 73  PHE A CB  1 
ATOM   582 C  CG  . PHE A 1 74 ? -8.124  7.727  2.883   1.00 39.02  ? 73  PHE A CG  1 
ATOM   583 C  CD1 . PHE A 1 74 ? -7.698  8.711  1.987   1.00 38.49  ? 73  PHE A CD1 1 
ATOM   584 C  CD2 . PHE A 1 74 ? -7.235  6.712  3.239   1.00 39.04  ? 73  PHE A CD2 1 
ATOM   585 C  CE1 . PHE A 1 74 ? -6.411  8.669  1.440   1.00 40.79  ? 73  PHE A CE1 1 
ATOM   586 C  CE2 . PHE A 1 74 ? -5.964  6.662  2.700   1.00 42.05  ? 73  PHE A CE2 1 
ATOM   587 C  CZ  . PHE A 1 74 ? -5.541  7.648  1.802   1.00 43.11  ? 73  PHE A CZ  1 
ATOM   588 N  N   . MET A 1 75 ? -10.659 5.004  2.392   1.00 39.40  ? 74  MET A N   1 
ATOM   589 C  CA  . MET A 1 75 ? -10.450 3.686  1.784   1.00 40.21  ? 74  MET A CA  1 
ATOM   590 C  C   . MET A 1 75 ? -11.300 3.507  0.521   1.00 39.37  ? 74  MET A C   1 
ATOM   591 O  O   . MET A 1 75 ? -10.849 2.907  -0.457  1.00 39.72  ? 74  MET A O   1 
ATOM   592 C  CB  . MET A 1 75 ? -10.719 2.552  2.778   1.00 42.78  ? 74  MET A CB  1 
ATOM   593 C  CG  . MET A 1 75 ? -9.600  2.283  3.801   1.00 45.45  ? 74  MET A CG  1 
ATOM   594 S  SD  . MET A 1 75 ? -7.993  1.974  3.048   1.00 49.17  ? 74  MET A SD  1 
ATOM   595 C  CE  . MET A 1 75 ? -8.313  0.529  2.018   1.00 48.16  ? 74  MET A CE  1 
ATOM   596 N  N   . ALA A 1 76 ? -12.522 4.024  0.539   1.00 39.43  ? 75  ALA A N   1 
ATOM   597 C  CA  . ALA A 1 76 ? -13.358 4.039  -0.669  1.00 40.08  ? 75  ALA A CA  1 
ATOM   598 C  C   . ALA A 1 76 ? -12.702 4.865  -1.792  1.00 38.99  ? 75  ALA A C   1 
ATOM   599 O  O   . ALA A 1 76 ? -12.794 4.499  -2.973  1.00 40.38  ? 75  ALA A O   1 
ATOM   600 C  CB  . ALA A 1 76 ? -14.728 4.595  -0.337  1.00 42.18  ? 75  ALA A CB  1 
ATOM   601 N  N   . PHE A 1 77 ? -12.069 5.982  -1.415  1.00 37.23  ? 76  PHE A N   1 
ATOM   602 C  CA  . PHE A 1 77 ? -11.311 6.829  -2.343  1.00 37.38  ? 76  PHE A CA  1 
ATOM   603 C  C   . PHE A 1 77 ? -10.155 6.029  -2.951  1.00 37.70  ? 76  PHE A C   1 
ATOM   604 O  O   . PHE A 1 77 ? -9.984  5.991  -4.185  1.00 39.14  ? 76  PHE A O   1 
ATOM   605 C  CB  . PHE A 1 77 ? -10.801 8.067  -1.581  1.00 36.32  ? 76  PHE A CB  1 
ATOM   606 C  CG  . PHE A 1 77 ? -10.011 9.047  -2.402  1.00 38.45  ? 76  PHE A CG  1 
ATOM   607 C  CD1 . PHE A 1 77 ? -10.383 9.382  -3.707  1.00 40.31  ? 76  PHE A CD1 1 
ATOM   608 C  CD2 . PHE A 1 77 ? -8.941  9.731  -1.823  1.00 39.09  ? 76  PHE A CD2 1 
ATOM   609 C  CE1 . PHE A 1 77 ? -9.665  10.318 -4.430  1.00 39.67  ? 76  PHE A CE1 1 
ATOM   610 C  CE2 . PHE A 1 77 ? -8.200  10.684 -2.557  1.00 39.67  ? 76  PHE A CE2 1 
ATOM   611 C  CZ  . PHE A 1 77 ? -8.571  10.979 -3.852  1.00 39.91  ? 76  PHE A CZ  1 
ATOM   612 N  N   . VAL A 1 78 ? -9.373  5.373  -2.098  1.00 37.00  ? 77  VAL A N   1 
ATOM   613 C  CA  . VAL A 1 78 ? -8.288  4.498  -2.571  1.00 38.21  ? 77  VAL A CA  1 
ATOM   614 C  C   . VAL A 1 78 ? -8.811  3.409  -3.523  1.00 39.61  ? 77  VAL A C   1 
ATOM   615 O  O   . VAL A 1 78 ? -8.201  3.156  -4.568  1.00 41.18  ? 77  VAL A O   1 
ATOM   616 C  CB  . VAL A 1 78 ? -7.539  3.835  -1.397  1.00 39.06  ? 77  VAL A CB  1 
ATOM   617 C  CG1 . VAL A 1 78 ? -6.451  2.889  -1.897  1.00 41.95  ? 77  VAL A CG1 1 
ATOM   618 C  CG2 . VAL A 1 78 ? -6.946  4.896  -0.490  1.00 38.96  ? 77  VAL A CG2 1 
ATOM   619 N  N   . ALA A 1 79 ? -9.922  2.767  -3.158  1.00 38.55  ? 78  ALA A N   1 
ATOM   620 C  CA  . ALA A 1 79 ? -10.582 1.794  -4.048  1.00 40.51  ? 78  ALA A CA  1 
ATOM   621 C  C   . ALA A 1 79 ? -10.904 2.401  -5.417  1.00 40.73  ? 78  ALA A C   1 
ATOM   622 O  O   . ALA A 1 79 ? -10.661 1.765  -6.443  1.00 43.25  ? 78  ALA A O   1 
ATOM   623 C  CB  . ALA A 1 79 ? -11.836 1.229  -3.400  1.00 41.37  ? 78  ALA A CB  1 
ATOM   624 N  N   . MET A 1 80 ? -11.409 3.634  -5.428  1.00 44.40  ? 79  MET A N   1 
ATOM   625 C  CA  . MET A 1 80 ? -11.720 4.357  -6.683  1.00 47.84  ? 79  MET A CA  1 
ATOM   626 C  C   . MET A 1 80 ? -10.488 4.534  -7.556  1.00 48.34  ? 79  MET A C   1 
ATOM   627 O  O   . MET A 1 80 ? -10.530 4.307  -8.763  1.00 51.40  ? 79  MET A O   1 
ATOM   628 C  CB  . MET A 1 80 ? -12.325 5.736  -6.408  1.00 50.23  ? 79  MET A CB  1 
ATOM   629 C  CG  . MET A 1 80 ? -13.722 5.735  -5.807  1.00 52.22  ? 79  MET A CG  1 
ATOM   630 S  SD  . MET A 1 80 ? -14.231 7.401  -5.338  1.00 58.82  ? 79  MET A SD  1 
ATOM   631 C  CE  . MET A 1 80 ? -15.506 7.032  -4.126  1.00 58.50  ? 79  MET A CE  1 
ATOM   632 N  N   . ILE A 1 81 ? -9.389  4.947  -6.933  1.00 46.99  ? 80  ILE A N   1 
ATOM   633 C  CA  . ILE A 1 81 ? -8.147  5.231  -7.653  1.00 48.09  ? 80  ILE A CA  1 
ATOM   634 C  C   . ILE A 1 81 ? -7.580  3.929  -8.222  1.00 48.98  ? 80  ILE A C   1 
ATOM   635 O  O   . ILE A 1 81 ? -7.184  3.874  -9.390  1.00 52.02  ? 80  ILE A O   1 
ATOM   636 C  CB  . ILE A 1 81 ? -7.113  5.876  -6.715  1.00 48.09  ? 80  ILE A CB  1 
ATOM   637 C  CG1 . ILE A 1 81 ? -7.615  7.244  -6.241  1.00 49.35  ? 80  ILE A CG1 1 
ATOM   638 C  CG2 . ILE A 1 81 ? -5.742  5.988  -7.397  1.00 49.87  ? 80  ILE A CG2 1 
ATOM   639 C  CD1 . ILE A 1 81 ? -6.839  7.811  -5.050  1.00 49.59  ? 80  ILE A CD1 1 
ATOM   640 N  N   . THR A 1 82 ? -7.552  2.890  -7.393  1.00 47.80  ? 81  THR A N   1 
ATOM   641 C  CA  . THR A 1 82 ? -6.928  1.615  -7.758  1.00 50.94  ? 81  THR A CA  1 
ATOM   642 C  C   . THR A 1 82 ? -7.674  0.953  -8.902  1.00 54.20  ? 81  THR A C   1 
ATOM   643 O  O   . THR A 1 82 ? -7.063  0.336  -9.788  1.00 58.63  ? 81  THR A O   1 
ATOM   644 C  CB  . THR A 1 82 ? -6.889  0.640  -6.574  1.00 52.05  ? 81  THR A CB  1 
ATOM   645 O  OG1 . THR A 1 82 ? -8.229  0.368  -6.137  1.00 51.57  ? 81  THR A OG1 1 
ATOM   646 C  CG2 . THR A 1 82 ? -6.094  1.222  -5.428  1.00 51.24  ? 81  THR A CG2 1 
ATOM   647 N  N   . THR A 1 83 ? -8.997  1.069  -8.871  1.00 54.06  ? 82  THR A N   1 
ATOM   648 C  CA  . THR A 1 83 ? -9.848  0.525  -9.925  1.00 59.23  ? 82  THR A CA  1 
ATOM   649 C  C   . THR A 1 83 ? -9.670  1.282  -11.248 1.00 62.26  ? 82  THR A C   1 
ATOM   650 O  O   . THR A 1 83 ? -9.686  0.685  -12.309 1.00 67.84  ? 82  THR A O   1 
ATOM   651 C  CB  . THR A 1 83 ? -11.319 0.484  -9.484  1.00 59.68  ? 82  THR A CB  1 
ATOM   652 O  OG1 . THR A 1 83 ? -11.414 -0.311 -8.295  1.00 58.01  ? 82  THR A OG1 1 
ATOM   653 C  CG2 . THR A 1 83 ? -12.203 -0.135 -10.566 1.00 68.04  ? 82  THR A CG2 1 
ATOM   654 N  N   . ALA A 1 84 ? -9.475  2.591  -11.191 1.00 61.06  ? 83  ALA A N   1 
ATOM   655 C  CA  . ALA A 1 84 ? -9.252  3.349  -12.425 1.00 66.00  ? 83  ALA A CA  1 
ATOM   656 C  C   . ALA A 1 84 ? -7.942  2.970  -13.151 1.00 67.67  ? 83  ALA A C   1 
ATOM   657 O  O   . ALA A 1 84 ? -7.638  3.539  -14.199 1.00 72.01  ? 83  ALA A O   1 
ATOM   658 C  CB  . ALA A 1 84 ? -9.312  4.841  -12.149 1.00 65.98  ? 83  ALA A CB  1 
ATOM   659 N  N   . CYS A 1 85 ? -7.217  1.961  -12.644 1.00 67.08  ? 84  CYS A N   1 
ATOM   660 C  CA  . CYS A 1 85 ? -5.800  1.783  -12.991 1.00 67.85  ? 84  CYS A CA  1 
ATOM   661 C  C   . CYS A 1 85 ? -5.049  0.458  -12.668 1.00 69.95  ? 84  CYS A C   1 
ATOM   662 O  O   . CYS A 1 85 ? -3.835  0.415  -12.876 1.00 69.74  ? 84  CYS A O   1 
ATOM   663 C  CB  . CYS A 1 85 ? -5.059  2.900  -12.241 1.00 64.19  ? 84  CYS A CB  1 
ATOM   664 S  SG  . CYS A 1 85 ? -3.324  2.613  -11.798 1.00 66.39  ? 84  CYS A SG  1 
ATOM   665 N  N   . HIS A 1 86 ? -5.677  -0.659 -12.290 1.00 72.77  ? 85  HIS A N   1 
ATOM   666 C  CA  . HIS A 1 86 ? -6.617  -1.510 -13.046 1.00 79.34  ? 85  HIS A CA  1 
ATOM   667 C  C   . HIS A 1 86 ? -7.861  -1.054 -13.827 1.00 81.36  ? 85  HIS A C   1 
ATOM   668 O  O   . HIS A 1 86 ? -8.988  -1.344 -13.417 1.00 82.77  ? 85  HIS A O   1 
ATOM   669 C  CB  . HIS A 1 86 ? -6.961  -2.746 -12.188 1.00 82.74  ? 85  HIS A CB  1 
ATOM   670 C  CG  . HIS A 1 86 ? -7.106  -4.003 -12.984 1.00 94.16  ? 85  HIS A CG  1 
ATOM   671 N  ND1 . HIS A 1 86 ? -6.100  -4.490 -13.794 1.00 101.49 ? 85  HIS A ND1 1 
ATOM   672 C  CD2 . HIS A 1 86 ? -8.137  -4.873 -13.102 1.00 101.65 ? 85  HIS A CD2 1 
ATOM   673 C  CE1 . HIS A 1 86 ? -6.509  -5.600 -14.382 1.00 111.71 ? 85  HIS A CE1 1 
ATOM   674 N  NE2 . HIS A 1 86 ? -7.740  -5.856 -13.977 1.00 113.05 ? 85  HIS A NE2 1 
ATOM   675 N  N   . GLU A 1 87 ? -7.634  -0.448 -14.989 1.00 83.98  ? 86  GLU A N   1 
ATOM   676 C  CA  . GLU A 1 87 ? -8.651  -0.233 -16.036 1.00 90.71  ? 86  GLU A CA  1 
ATOM   677 C  C   . GLU A 1 87 ? -7.988  0.457  -17.219 1.00 94.00  ? 86  GLU A C   1 
ATOM   678 O  O   . GLU A 1 87 ? -8.133  0.025  -18.376 1.00 102.86 ? 86  GLU A O   1 
ATOM   679 C  CB  . GLU A 1 87 ? -9.837  0.609  -15.549 1.00 88.63  ? 86  GLU A CB  1 
ATOM   680 C  CG  . GLU A 1 87 ? -11.149 -0.161 -15.451 1.00 94.54  ? 86  GLU A CG  1 
ATOM   681 C  CD  . GLU A 1 87 ? -12.262 0.633  -14.780 1.00 92.78  ? 86  GLU A CD  1 
ATOM   682 O  OE1 . GLU A 1 87 ? -12.152 1.877  -14.690 1.00 90.91  ? 86  GLU A OE1 1 
ATOM   683 O  OE2 . GLU A 1 87 ? -13.253 0.009  -14.343 1.00 95.97  ? 86  GLU A OE2 1 
ATOM   684 N  N   . PHE A 1 88 ? -7.259  1.531  -16.899 1.00 88.09  ? 87  PHE A N   1 
ATOM   685 C  CA  . PHE A 1 88 ? -6.472  2.308  -17.851 1.00 90.78  ? 87  PHE A CA  1 
ATOM   686 C  C   . PHE A 1 88 ? -5.530  1.427  -18.678 1.00 95.17  ? 87  PHE A C   1 
ATOM   687 O  O   . PHE A 1 88 ? -5.241  0.163  -18.163 1.00 94.46  ? 87  PHE A O   1 
ATOM   688 C  CB  . PHE A 1 88 ? -5.670  3.374  -17.089 1.00 84.68  ? 87  PHE A CB  1 
ATOM   689 C  CG  . PHE A 1 88 ? -4.980  4.373  -17.976 1.00 89.02  ? 87  PHE A CG  1 
ATOM   690 C  CD1 . PHE A 1 88 ? -5.682  5.447  -18.519 1.00 95.00  ? 87  PHE A CD1 1 
ATOM   691 C  CD2 . PHE A 1 88 ? -3.624  4.245  -18.265 1.00 89.40  ? 87  PHE A CD2 1 
ATOM   692 C  CE1 . PHE A 1 88 ? -5.044  6.375  -19.346 1.00 100.96 ? 87  PHE A CE1 1 
ATOM   693 C  CE2 . PHE A 1 88 ? -2.978  5.169  -19.089 1.00 94.30  ? 87  PHE A CE2 1 
ATOM   694 C  CZ  . PHE A 1 88 ? -3.690  6.234  -19.630 1.00 99.75  ? 87  PHE A CZ  1 
HETATM 695 CA CA  . CA  B 2 .  ? -17.642 11.991 6.248   1.00 45.36  ? 90  CA  A CA  1 
HETATM 696 CA CA  . CA  C 2 .  ? -8.335  16.719 10.605  1.00 41.80  ? 91  CA  A CA  1 
HETATM 697 HG HG  . EMC D 3 .  ? -1.879  0.460  -12.613 0.25 55.80  ? 92  EMC A HG  1 
HETATM 698 C  C1  . EMC D 3 .  ? -1.957  0.941  -14.940 1.00 57.61  ? 92  EMC A C1  1 
HETATM 699 C  C2  . EMC D 3 .  ? -2.963  2.052  -15.185 1.00 55.71  ? 92  EMC A C2  1 
HETATM 700 S  SD  . JKE E 4 .  ? -14.479 9.468  -9.193  0.25 91.45  ? 93  JKE A SD  1 
HETATM 701 C  CG  . JKE E 4 .  ? -11.350 9.602  -9.485  1.00 91.12  ? 93  JKE A CG  1 
HETATM 702 C  CZ  . JKE E 4 .  ? -12.009 10.554 -8.537  1.00 91.23  ? 93  JKE A CZ  1 
HETATM 703 C  CD1 . JKE E 4 .  ? -14.048 11.449 -7.446  1.00 91.39  ? 93  JKE A CD1 1 
HETATM 704 O  OD1 . JKE E 4 .  ? -11.538 9.738  -10.711 1.00 91.56  ? 93  JKE A OD1 1 
HETATM 705 C  CD2 . JKE E 4 .  ? -11.852 12.342 -6.930  1.00 91.20  ? 93  JKE A CD2 1 
HETATM 706 O  OD2 . JKE E 4 .  ? -10.630 8.694  -9.019  1.00 90.98  ? 93  JKE A OD2 1 
HETATM 707 C  CE1 . JKE E 4 .  ? -13.485 10.549 -8.344  1.00 91.33  ? 93  JKE A CE1 1 
HETATM 708 C  CE2 . JKE E 4 .  ? -11.239 11.460 -7.816  1.00 91.41  ? 93  JKE A CE2 1 
HETATM 709 C  CG1 . JKE E 4 .  ? -13.234 12.336 -6.746  1.00 91.35  ? 93  JKE A CG1 1 
HETATM 710 O  O   . HOH F 5 .  ? -17.735 19.854 -0.381  1.00 42.24  ? 94  HOH A O   1 
HETATM 711 O  O   . HOH F 5 .  ? -18.864 7.004  5.583   1.00 59.68  ? 95  HOH A O   1 
HETATM 712 O  O   . HOH F 5 .  ? 2.541   9.076  0.794   1.00 45.77  ? 96  HOH A O   1 
HETATM 713 O  O   . HOH F 5 .  ? -15.639 7.869  0.136   1.00 38.81  ? 97  HOH A O   1 
HETATM 714 O  O   . HOH F 5 .  ? -7.958  16.449 -9.698  1.00 55.45  ? 98  HOH A O   1 
HETATM 715 O  O   . HOH F 5 .  ? -1.942  15.531 -7.418  1.00 37.95  ? 99  HOH A O   1 
HETATM 716 O  O   . HOH F 5 .  ? -5.186  5.672  -11.026 1.00 50.37  ? 100 HOH A O   1 
HETATM 717 O  O   . HOH F 5 .  ? 2.871   12.203 -5.587  1.00 41.36  ? 101 HOH A O   1 
HETATM 718 O  O   . HOH F 5 .  ? -8.157  22.355 -9.832  1.00 42.71  ? 102 HOH A O   1 
HETATM 719 O  O   . HOH F 5 .  ? -10.399 28.716 -6.187  1.00 47.46  ? 103 HOH A O   1 
HETATM 720 O  O   . HOH F 5 .  ? 2.322   15.671 6.427   1.00 51.24  ? 104 HOH A O   1 
HETATM 721 O  O   . HOH F 5 .  ? -16.772 11.358 8.112   1.00 44.93  ? 105 HOH A O   1 
HETATM 722 O  O   . HOH F 5 .  ? -2.828  23.914 -5.560  1.00 46.42  ? 106 HOH A O   1 
HETATM 723 O  O   . HOH F 5 .  ? 4.351   4.991  5.074   1.00 72.74  ? 107 HOH A O   1 
HETATM 724 O  O   . HOH F 5 .  ? -1.656  22.084 -2.321  1.00 51.94  ? 108 HOH A O   1 
HETATM 725 O  O   . HOH F 5 .  ? -11.493 7.971  10.486  1.00 48.57  ? 109 HOH A O   1 
HETATM 726 O  O   . HOH F 5 .  ? -3.029  21.273 5.418   1.00 65.11  ? 110 HOH A O   1 
HETATM 727 O  O   . HOH F 5 .  ? -10.672 23.258 4.968   1.00 44.08  ? 111 HOH A O   1 
HETATM 728 O  O   . HOH F 5 .  ? -21.473 14.439 0.056   1.00 48.50  ? 112 HOH A O   1 
HETATM 729 O  O   . HOH F 5 .  ? 0.054   17.365 -7.350  1.00 45.25  ? 113 HOH A O   1 
HETATM 730 O  O   . HOH F 5 .  ? -8.621  4.547  -16.480 1.00 79.21  ? 114 HOH A O   1 
HETATM 731 O  O   . HOH F 5 .  ? -7.514  19.555 -10.712 1.00 44.91  ? 115 HOH A O   1 
HETATM 732 O  O   . HOH F 5 .  ? -11.417 24.427 1.373   1.00 50.39  ? 116 HOH A O   1 
HETATM 733 O  O   . HOH F 5 .  ? -13.401 27.372 -8.079  1.00 49.32  ? 117 HOH A O   1 
HETATM 734 O  O   . HOH F 5 .  ? -17.655 6.025  0.849   1.00 50.63  ? 118 HOH A O   1 
HETATM 735 O  O   . HOH F 5 .  ? -19.510 20.741 -4.638  1.00 56.73  ? 119 HOH A O   1 
HETATM 736 O  O   . HOH F 5 .  ? -10.413 17.958 10.204  1.00 47.98  ? 120 HOH A O   1 
HETATM 737 O  O   . HOH F 5 .  ? -12.330 19.191 11.883  1.00 57.94  ? 121 HOH A O   1 
HETATM 738 O  O   . HOH F 5 .  ? -14.483 1.845  3.271   1.00 53.54  ? 122 HOH A O   1 
HETATM 739 O  O   . HOH F 5 .  ? -14.966 2.973  -3.999  1.00 52.98  ? 123 HOH A O   1 
HETATM 740 O  O   . HOH F 5 .  ? -20.238 7.226  9.521   1.00 67.91  ? 124 HOH A O   1 
HETATM 741 O  O   . HOH F 5 .  ? -6.594  26.442 -11.919 1.00 70.67  ? 125 HOH A O   1 
HETATM 742 O  O   . HOH F 5 .  ? -2.834  -1.964 -13.613 1.00 78.29  ? 126 HOH A O   1 
HETATM 743 O  O   . HOH F 5 .  ? -4.882  -0.644 -15.900 1.00 447.11 ? 127 HOH A O   1 
HETATM 744 O  O   . HOH F 5 .  ? -15.336 14.189 -8.546  1.00 81.55  ? 128 HOH A O   1 
HETATM 745 O  O   . HOH F 5 .  ? -8.917  24.169 0.599   1.00 52.14  ? 129 HOH A O   1 
HETATM 746 O  O   . HOH F 5 .  ? -0.195  17.884 14.235  0.50 52.11  ? 130 HOH A O   1 
HETATM 747 O  O   . HOH F 5 .  ? 5.376   12.309 -4.236  1.00 53.84  ? 131 HOH A O   1 
HETATM 748 O  O   . HOH F 5 .  ? -18.251 7.202  8.071   1.00 55.02  ? 132 HOH A O   1 
HETATM 749 O  O   . HOH F 5 .  ? -2.710  -0.844 -17.524 1.00 69.28  ? 133 HOH A O   1 
HETATM 750 O  O   . HOH F 5 .  ? -9.010  23.516 -11.814 1.00 64.23  ? 134 HOH A O   1 
HETATM 751 O  O   . HOH F 5 .  ? -9.367  14.369 17.623  1.00 56.70  ? 135 HOH A O   1 
HETATM 752 O  O   . HOH F 5 .  ? -6.906  -2.067 -20.567 1.00 60.39  ? 136 HOH A O   1 
HETATM 753 O  O   . HOH F 5 .  ? -18.723 18.883 1.630   1.00 52.95  ? 137 HOH A O   1 
HETATM 754 O  O   . HOH F 5 .  ? 0.055   19.657 14.762  0.50 72.33  ? 138 HOH A O   1 
HETATM 755 O  O   . HOH F 5 .  ? -14.955 0.545  1.177   1.00 67.13  ? 139 HOH A O   1 
HETATM 756 O  O   . HOH F 5 .  ? -20.762 16.443 1.852   1.00 56.92  ? 140 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
6   N N   . SER A 2  ? 0.5756 0.6136 0.9170 0.1266  -0.1386 -0.0711 1  SER A N   
7   C CA  . SER A 2  ? 0.5766 0.5649 0.8435 0.1111  -0.0504 -0.0486 1  SER A CA  
8   C C   . SER A 2  ? 0.5299 0.5429 0.8359 0.0563  0.0006  -0.0346 1  SER A C   
9   O O   . SER A 2  ? 0.4633 0.5215 0.8292 0.0262  -0.0371 -0.0395 1  SER A O   
10  C CB  . SER A 2  ? 0.6429 0.4939 0.7106 0.0948  -0.0818 -0.0207 1  SER A CB  
11  O OG  . SER A 2  ? 0.5678 0.4214 0.6307 0.0371  -0.0910 0.0073  1  SER A OG  
12  N N   . GLU A 3  ? 0.6302 0.5522 0.8385 0.0525  0.0832  -0.0176 2  GLU A N   
13  C CA  . GLU A 3  ? 0.6689 0.5445 0.8461 0.0023  0.1232  0.0053  2  GLU A CA  
14  C C   . GLU A 3  ? 0.6337 0.4572 0.7342 -0.0313 0.0274  0.0202  2  GLU A C   
15  O O   . GLU A 3  ? 0.6127 0.4449 0.7602 -0.0613 0.0188  0.0270  2  GLU A O   
16  C CB  . GLU A 3  ? 0.9092 0.6053 0.8885 0.0180  0.2434  0.0268  2  GLU A CB  
17  C CG  . GLU A 3  ? 0.9746 0.7652 1.1288 0.0585  0.4042  0.0235  2  GLU A CG  
18  C CD  . GLU A 3  ? 0.8826 0.8693 1.3830 0.0015  0.4509  0.0358  2  GLU A CD  
19  O OE1 . GLU A 3  ? 0.9176 0.8397 1.3637 -0.0661 0.4386  0.0606  2  GLU A OE1 
20  O OE2 . GLU A 3  ? 0.8116 1.0015 1.6585 0.0239  0.4787  0.0215  2  GLU A OE2 
21  N N   . LEU A 4  ? 0.6367 0.4113 0.6639 -0.0251 -0.0427 0.0289  3  LEU A N   
22  C CA  . LEU A 4  ? 0.5881 0.3790 0.6749 -0.0502 -0.1161 0.0513  3  LEU A CA  
23  C C   . LEU A 4  ? 0.4675 0.3940 0.6921 -0.0379 -0.0930 0.0374  3  LEU A C   
24  O O   . LEU A 4  ? 0.4498 0.3997 0.7449 -0.0375 -0.0993 0.0425  3  LEU A O   
25  C CB  . LEU A 4  ? 0.6434 0.3730 0.7048 -0.0647 -0.1854 0.0759  3  LEU A CB  
26  C CG  . LEU A 4  ? 0.7303 0.3929 0.8526 -0.1036 -0.3014 0.1138  3  LEU A CG  
27  C CD1 . LEU A 4  ? 0.7141 0.3923 0.9403 -0.1391 -0.3443 0.1470  3  LEU A CD1 
28  C CD2 . LEU A 4  ? 0.6585 0.4186 0.9737 -0.1039 -0.3204 0.1289  3  LEU A CD2 
29  N N   . GLU A 5  ? 0.4457 0.4113 0.6640 -0.0128 -0.0768 0.0168  4  GLU A N   
30  C CA  . GLU A 5  ? 0.4517 0.4388 0.6728 0.0136  -0.0701 -0.0025 4  GLU A CA  
31  C C   . GLU A 5  ? 0.4569 0.4510 0.7220 0.0113  -0.0873 -0.0364 4  GLU A C   
32  O O   . GLU A 5  ? 0.5137 0.4645 0.7411 0.0340  -0.0848 -0.0508 4  GLU A O   
33  C CB  . GLU A 5  ? 0.5258 0.4704 0.6554 0.0471  -0.0929 -0.0163 4  GLU A CB  
34  C CG  . GLU A 5  ? 0.5747 0.4664 0.6356 0.0384  -0.0677 0.0289  4  GLU A CG  
35  C CD  . GLU A 5  ? 0.6956 0.4910 0.6212 0.0733  -0.1068 0.0226  4  GLU A CD  
36  O OE1 . GLU A 5  ? 0.6855 0.4992 0.6459 0.1060  -0.1648 -0.0147 4  GLU A OE1 
37  O OE2 . GLU A 5  ? 0.8111 0.5054 0.6141 0.0707  -0.0711 0.0624  4  GLU A OE2 
38  N N   . LYS A 6  ? 0.4263 0.4531 0.7717 -0.0149 -0.0893 -0.0445 5  LYS A N   
39  C CA  . LYS A 6  ? 0.4482 0.4722 0.8795 -0.0475 -0.1035 -0.0593 5  LYS A CA  
40  C C   . LYS A 6  ? 0.4719 0.4230 0.8497 -0.0634 -0.0904 -0.0389 5  LYS A C   
41  O O   . LYS A 6  ? 0.5327 0.4267 0.9159 -0.0700 -0.1239 -0.0580 5  LYS A O   
42  C CB  . LYS A 6  ? 0.4459 0.5349 1.0308 -0.0824 -0.0544 -0.0485 5  LYS A CB  
43  C CG  . LYS A 6  ? 0.4454 0.6342 1.2024 -0.0585 -0.1006 -0.0756 5  LYS A CG  
44  C CD  . LYS A 6  ? 0.4805 0.7729 1.4757 -0.0826 0.0037  -0.0522 5  LYS A CD  
45  C CE  . LYS A 6  ? 0.4801 0.8886 1.6686 -0.0234 -0.0182 -0.0717 5  LYS A CE  
46  N N   . ALA A 7  ? 0.5448 0.4704 0.7252 0.0063  -0.0613 0.0045  6  ALA A N   
47  C CA  . ALA A 7  ? 0.6050 0.4490 0.6685 0.0120  -0.0559 0.0146  6  ALA A CA  
48  C C   . ALA A 7  ? 0.5578 0.4457 0.6347 0.0141  -0.0982 0.0258  6  ALA A C   
49  O O   . ALA A 7  ? 0.5834 0.4451 0.6214 0.0095  -0.0954 0.0222  6  ALA A O   
50  C CB  . ALA A 7  ? 0.7036 0.4331 0.6562 0.0436  -0.0738 0.0173  6  ALA A CB  
51  N N   . VAL A 8  ? 0.5307 0.4568 0.6558 0.0223  -0.1149 0.0394  7  VAL A N   
52  C CA  . VAL A 8  ? 0.5262 0.4438 0.6661 0.0248  -0.1014 0.0515  7  VAL A CA  
53  C C   . VAL A 8  ? 0.5614 0.4691 0.6356 0.0233  -0.0963 0.0531  7  VAL A C   
54  O O   . VAL A 8  ? 0.5649 0.4540 0.6282 0.0170  -0.0795 0.0548  7  VAL A O   
55  C CB  . VAL A 8  ? 0.5614 0.4555 0.7310 0.0381  -0.0709 0.0690  7  VAL A CB  
56  C CG1 . VAL A 8  ? 0.6363 0.4514 0.7798 0.0442  0.0011  0.0857  7  VAL A CG1 
57  C CG2 . VAL A 8  ? 0.5144 0.4229 0.8069 0.0408  -0.0873 0.0530  7  VAL A CG2 
58  N N   . VAL A 9  ? 0.5861 0.4984 0.6376 0.0363  -0.1286 0.0397  8  VAL A N   
59  C CA  . VAL A 9  ? 0.6437 0.5280 0.6481 0.0510  -0.1636 0.0199  8  VAL A CA  
60  C C   . VAL A 9  ? 0.5869 0.5184 0.6561 0.0188  -0.1493 -0.0013 8  VAL A C   
61  O O   . VAL A 9  ? 0.6270 0.5332 0.6490 0.0227  -0.1584 -0.0048 8  VAL A O   
62  C CB  . VAL A 9  ? 0.7287 0.5836 0.7352 0.0934  -0.2498 -0.0200 8  VAL A CB  
63  C CG1 . VAL A 9  ? 0.8364 0.5866 0.7076 0.1380  -0.2574 0.0059  8  VAL A CG1 
64  C CG2 . VAL A 9  ? 0.6649 0.6208 0.8818 0.0676  -0.2605 -0.0685 8  VAL A CG2 
65  N N   . ALA A 10 ? 0.5318 0.4908 0.6742 -0.0066 -0.1113 -0.0134 9  ALA A N   
66  C CA  . ALA A 10 ? 0.5428 0.4783 0.6932 -0.0308 -0.0602 -0.0273 9  ALA A CA  
67  C C   . ALA A 10 ? 0.5596 0.4494 0.5964 -0.0296 -0.0577 -0.0023 9  ALA A C   
68  O O   . ALA A 10 ? 0.5689 0.4438 0.5876 -0.0404 -0.0432 -0.0106 9  ALA A O   
69  C CB  . ALA A 10 ? 0.5850 0.4615 0.7527 -0.0433 0.0195  -0.0379 9  ALA A CB  
70  N N   . LEU A 11 ? 0.5556 0.4241 0.5569 -0.0142 -0.0795 0.0156  10 LEU A N   
71  C CA  . LEU A 11 ? 0.5770 0.4107 0.5551 -0.0056 -0.1005 0.0151  10 LEU A CA  
72  C C   . LEU A 11 ? 0.5630 0.4298 0.5613 -0.0145 -0.0866 0.0249  10 LEU A C   
73  O O   . LEU A 11 ? 0.5849 0.4331 0.5574 -0.0200 -0.0859 0.0185  10 LEU A O   
74  C CB  . LEU A 11 ? 0.5774 0.3932 0.6205 0.0170  -0.1409 0.0051  10 LEU A CB  
75  C CG  . LEU A 11 ? 0.6686 0.3888 0.6357 0.0496  -0.1861 -0.0134 10 LEU A CG  
76  C CD1 . LEU A 11 ? 0.6408 0.3816 0.7472 0.0702  -0.2371 -0.0331 10 LEU A CD1 
77  C CD2 . LEU A 11 ? 0.8304 0.3865 0.6350 0.0890  -0.2344 -0.0402 10 LEU A CD2 
78  N N   . ILE A 12 ? 0.5668 0.4386 0.5631 -0.0057 -0.0728 0.0406  11 ILE A N   
79  C CA  . ILE A 12 ? 0.6346 0.4502 0.5572 0.0067  -0.0478 0.0535  11 ILE A CA  
80  C C   . ILE A 12 ? 0.6489 0.4739 0.5249 0.0055  -0.0864 0.0340  11 ILE A C   
81  O O   . ILE A 12 ? 0.6756 0.4744 0.5120 0.0022  -0.0729 0.0361  11 ILE A O   
82  C CB  . ILE A 12 ? 0.7559 0.4736 0.5789 0.0426  -0.0247 0.0736  11 ILE A CB  
83  C CG1 . ILE A 12 ? 0.7255 0.4275 0.6438 0.0368  0.0451  0.0881  11 ILE A CG1 
84  C CG2 . ILE A 12 ? 0.9276 0.4872 0.5605 0.0805  0.0026  0.0872  11 ILE A CG2 
85  C CD1 . ILE A 12 ? 0.8986 0.4715 0.6924 0.0737  0.0888  0.1117  11 ILE A CD1 
86  N N   . ASP A 13 ? 0.6407 0.5061 0.5682 0.0064  -0.1295 0.0050  12 ASP A N   
87  C CA  . ASP A 13 ? 0.6545 0.5384 0.6378 0.0055  -0.1695 -0.0383 12 ASP A CA  
88  C C   . ASP A 13 ? 0.6107 0.5132 0.6172 -0.0306 -0.1191 -0.0389 12 ASP A C   
89  O O   . ASP A 13 ? 0.6311 0.5198 0.6164 -0.0284 -0.1359 -0.0513 12 ASP A O   
90  C CB  . ASP A 13 ? 0.6354 0.5703 0.7832 0.0043  -0.1985 -0.0877 12 ASP A CB  
91  C CG  . ASP A 13 ? 0.6925 0.6492 1.0037 0.0112  -0.2558 -0.1626 12 ASP A CG  
92  O OD1 . ASP A 13 ? 0.7800 0.6866 1.0109 0.0409  -0.3205 -0.1762 12 ASP A OD1 
93  O OD2 . ASP A 13 ? 0.6931 0.7041 1.2410 -0.0100 -0.2319 -0.2179 12 ASP A OD2 
94  N N   . VAL A 14 ? 0.5827 0.4754 0.5890 -0.0517 -0.0646 -0.0275 13 VAL A N   
95  C CA  . VAL A 14 ? 0.6267 0.4664 0.5897 -0.0691 -0.0153 -0.0320 13 VAL A CA  
96  C C   . VAL A 14 ? 0.6263 0.4443 0.5034 -0.0613 -0.0389 -0.0128 13 VAL A C   
97  O O   . VAL A 14 ? 0.6493 0.4476 0.5009 -0.0711 -0.0252 -0.0205 13 VAL A O   
98  C CB  . VAL A 14 ? 0.7125 0.4429 0.5991 -0.0677 0.0503  -0.0297 13 VAL A CB  
99  C CG1 . VAL A 14 ? 0.8257 0.4214 0.5873 -0.0689 0.1128  -0.0331 13 VAL A CG1 
100 C CG2 . VAL A 14 ? 0.7377 0.4844 0.7564 -0.0824 0.1082  -0.0546 13 VAL A CG2 
101 N N   . PHE A 15 ? 0.6115 0.4336 0.4871 -0.0457 -0.0649 0.0036  14 PHE A N   
102 C CA  . PHE A 15 ? 0.6124 0.4208 0.4932 -0.0412 -0.0720 0.0059  14 PHE A CA  
103 C C   . PHE A 15 ? 0.6261 0.4418 0.4743 -0.0469 -0.0560 0.0130  14 PHE A C   
104 O O   . PHE A 15 ? 0.6198 0.4205 0.4440 -0.0540 -0.0540 0.0068  14 PHE A O   
105 C CB  . PHE A 15 ? 0.5927 0.4059 0.5733 -0.0296 -0.0671 0.0079  14 PHE A CB  
106 C CG  . PHE A 15 ? 0.6107 0.4073 0.6798 -0.0298 -0.0444 -0.0041 14 PHE A CG  
107 C CD1 . PHE A 15 ? 0.6092 0.3841 0.7612 -0.0152 -0.1070 -0.0473 14 PHE A CD1 
108 C CD2 . PHE A 15 ? 0.6353 0.3949 0.6868 -0.0327 0.0384  0.0199  14 PHE A CD2 
109 C CE1 . PHE A 15 ? 0.6016 0.3725 0.9068 -0.0161 -0.0885 -0.0751 14 PHE A CE1 
110 C CE2 . PHE A 15 ? 0.6760 0.4028 0.8358 -0.0371 0.0952  0.0062  14 PHE A CE2 
111 C CZ  . PHE A 15 ? 0.6418 0.4017 0.9726 -0.0354 0.0313  -0.0456 14 PHE A CZ  
112 N N   . HIS A 16 ? 0.6633 0.4672 0.4773 -0.0308 -0.0592 0.0213  15 HIS A N   
113 C CA  . HIS A 16 ? 0.7557 0.4953 0.4701 -0.0093 -0.0676 0.0221  15 HIS A CA  
114 C C   . HIS A 16 ? 0.7461 0.5187 0.4871 -0.0162 -0.1168 -0.0137 15 HIS A C   
115 O O   . HIS A 16 ? 0.8092 0.5307 0.4762 -0.0010 -0.1337 -0.0196 15 HIS A O   
116 C CB  . HIS A 16 ? 0.9026 0.5283 0.4883 0.0398  -0.0774 0.0335  15 HIS A CB  
117 C CG  . HIS A 16 ? 0.9767 0.5196 0.5344 0.0459  0.0220  0.0697  15 HIS A CG  
118 N ND1 . HIS A 16 ? 0.9302 0.5262 0.5994 0.0322  0.0445  0.0754  15 HIS A ND1 
119 C CD2 . HIS A 16 ? 1.1303 0.5315 0.6032 0.0605  0.1278  0.0947  15 HIS A CD2 
120 C CE1 . HIS A 16 ? 1.0095 0.5125 0.6988 0.0363  0.1557  0.0958  15 HIS A CE1 
121 N NE2 . HIS A 16 ? 1.1576 0.5328 0.7327 0.0516  0.2241  0.1087  15 HIS A NE2 
122 N N   . GLN A 17 ? 0.6841 0.5226 0.5470 -0.0384 -0.1229 -0.0428 16 GLN A N   
123 C CA  . GLN A 17 ? 0.6840 0.5501 0.6562 -0.0552 -0.1299 -0.0893 16 GLN A CA  
124 C C   . GLN A 17 ? 0.6737 0.5198 0.5882 -0.0792 -0.0805 -0.0731 16 GLN A C   
125 O O   . GLN A 17 ? 0.6796 0.5276 0.6385 -0.0857 -0.0891 -0.1020 16 GLN A O   
126 C CB  . GLN A 17 ? 0.6556 0.5553 0.7904 -0.0813 -0.0803 -0.1211 16 GLN A CB  
127 C CG  . GLN A 17 ? 0.6780 0.6154 0.9700 -0.0570 -0.1545 -0.1747 16 GLN A CG  
128 C CD  . GLN A 17 ? 0.6620 0.6254 1.1484 -0.0876 -0.0723 -0.2062 16 GLN A CD  
129 O OE1 . GLN A 17 ? 0.7278 0.6374 1.1995 -0.1230 0.0596  -0.1899 16 GLN A OE1 
130 N NE2 . GLN A 17 ? 0.6776 0.6800 1.3167 -0.0641 -0.1435 -0.2539 16 GLN A NE2 
131 N N   . TYR A 18 ? 0.5149 0.5176 0.4895 0.0005  -0.0613 0.0297  17 TYR A N   
132 C CA  . TYR A 18 ? 0.4968 0.4762 0.4660 -0.0128 -0.0540 0.0088  17 TYR A CA  
133 C C   . TYR A 18 ? 0.5270 0.4843 0.4520 -0.0080 -0.0444 0.0004  17 TYR A C   
134 O O   . TYR A 18 ? 0.5538 0.4948 0.4585 -0.0144 -0.0481 -0.0195 17 TYR A O   
135 C CB  . TYR A 18 ? 0.4562 0.4289 0.4576 -0.0147 -0.0360 0.0109  17 TYR A CB  
136 C CG  . TYR A 18 ? 0.4334 0.4249 0.4723 -0.0240 -0.0423 0.0117  17 TYR A CG  
137 C CD1 . TYR A 18 ? 0.4195 0.4343 0.4889 -0.0161 -0.0397 0.0247  17 TYR A CD1 
138 C CD2 . TYR A 18 ? 0.4288 0.4117 0.4727 -0.0397 -0.0470 0.0005  17 TYR A CD2 
139 C CE1 . TYR A 18 ? 0.4318 0.4724 0.5399 -0.0247 -0.0412 0.0245  17 TYR A CE1 
140 C CE2 . TYR A 18 ? 0.4303 0.4322 0.5083 -0.0524 -0.0481 0.0026  17 TYR A CE2 
141 C CZ  . TYR A 18 ? 0.4152 0.4517 0.5270 -0.0454 -0.0452 0.0137  17 TYR A CZ  
142 O OH  . TYR A 18 ? 0.4104 0.4734 0.5600 -0.0581 -0.0421 0.0149  17 TYR A OH  
143 N N   . SER A 19 ? 0.5298 0.4826 0.4400 0.0026  -0.0280 0.0147  18 SER A N   
144 C CA  . SER A 19 ? 0.5610 0.5002 0.4343 0.0065  -0.0118 0.0076  18 SER A CA  
145 C C   . SER A 19 ? 0.6143 0.5528 0.4349 0.0078  -0.0257 -0.0022 18 SER A C   
146 O O   . SER A 19 ? 0.6466 0.5711 0.4355 0.0097  -0.0136 -0.0195 18 SER A O   
147 C CB  . SER A 19 ? 0.5600 0.4943 0.4300 0.0112  0.0130  0.0267  18 SER A CB  
148 O OG  . SER A 19 ? 0.6064 0.5388 0.4455 0.0209  0.0073  0.0493  18 SER A OG  
149 N N   . GLY A 20 ? 0.6338 0.5926 0.4450 0.0081  -0.0504 0.0073  19 GLY A N   
150 C CA  . GLY A 20 ? 0.6935 0.6632 0.4485 0.0066  -0.0697 -0.0027 19 GLY A CA  
151 C C   . GLY A 20 ? 0.7148 0.6810 0.4646 -0.0134 -0.0885 -0.0387 19 GLY A C   
152 O O   . GLY A 20 ? 0.7719 0.7476 0.4725 -0.0213 -0.1064 -0.0567 19 GLY A O   
153 N N   . ARG A 21 ? 0.6746 0.6232 0.4698 -0.0235 -0.0829 -0.0503 20 ARG A N   
154 C CA  . ARG A 21 ? 0.7067 0.6376 0.5008 -0.0459 -0.0949 -0.0819 20 ARG A CA  
155 C C   . ARG A 21 ? 0.7701 0.6565 0.5111 -0.0456 -0.0802 -0.1127 20 ARG A C   
156 O O   . ARG A 21 ? 0.8311 0.7102 0.5332 -0.0633 -0.0948 -0.1422 20 ARG A O   
157 C CB  . ARG A 21 ? 0.6613 0.5770 0.5115 -0.0535 -0.0867 -0.0784 20 ARG A CB  
158 C CG  . ARG A 21 ? 0.6149 0.5757 0.5149 -0.0624 -0.1034 -0.0614 20 ARG A CG  
159 C CD  . ARG A 21 ? 0.5562 0.5019 0.5009 -0.0667 -0.0887 -0.0540 20 ARG A CD  
160 N NE  . ARG A 21 ? 0.5355 0.5265 0.5286 -0.0749 -0.0992 -0.0408 20 ARG A NE  
161 C CZ  . ARG A 21 ? 0.5506 0.5393 0.5814 -0.0887 -0.0909 -0.0382 20 ARG A CZ  
162 N NH1 . ARG A 21 ? 0.5459 0.4844 0.5672 -0.0944 -0.0749 -0.0442 20 ARG A NH1 
163 N NH2 . ARG A 21 ? 0.5101 0.5479 0.5874 -0.0939 -0.0966 -0.0272 20 ARG A NH2 
164 N N   . GLU A 22 ? 0.7631 0.6241 0.5042 -0.0256 -0.0504 -0.1083 21 GLU A N   
165 C CA  . GLU A 22 ? 0.8342 0.6503 0.5383 -0.0182 -0.0293 -0.1371 21 GLU A CA  
166 C C   . GLU A 22 ? 0.8231 0.6488 0.5116 0.0063  -0.0008 -0.1265 21 GLU A C   
167 O O   . GLU A 22 ? 0.7629 0.6181 0.4856 0.0150  0.0073  -0.0975 21 GLU A O   
168 C CB  . GLU A 22 ? 0.8333 0.6041 0.5714 -0.0168 -0.0177 -0.1457 21 GLU A CB  
169 C CG  . GLU A 22 ? 0.8764 0.6299 0.6345 -0.0467 -0.0379 -0.1559 21 GLU A CG  
170 C CD  . GLU A 22 ? 0.9152 0.6016 0.6864 -0.0450 -0.0200 -0.1657 21 GLU A CD  
171 O OE1 . GLU A 22 ? 1.0380 0.6838 0.8000 -0.0737 -0.0263 -0.1901 21 GLU A OE1 
172 O OE2 . GLU A 22 ? 0.9345 0.6095 0.7255 -0.0156 0.0003  -0.1481 21 GLU A OE2 
173 N N   . GLY A 23 ? 0.8821 0.6828 0.5196 0.0146  0.0175  -0.1530 22 GLY A N   
174 C CA  . GLY A 23 ? 0.8912 0.7056 0.5150 0.0362  0.0506  -0.1467 22 GLY A CA  
175 C C   . GLY A 23 ? 0.8670 0.7233 0.4816 0.0346  0.0508  -0.1142 22 GLY A C   
176 O O   . GLY A 23 ? 0.8924 0.7609 0.4691 0.0238  0.0280  -0.1064 22 GLY A O   
177 N N   . ASP A 24 ? 0.8264 0.7057 0.4774 0.0452  0.0769  -0.0942 23 ASP A N   
178 C CA  . ASP A 24 ? 0.8198 0.7242 0.4676 0.0410  0.0850  -0.0618 23 ASP A CA  
179 C C   . ASP A 24 ? 0.7855 0.6943 0.4540 0.0305  0.0533  -0.0402 23 ASP A C   
180 O O   . ASP A 24 ? 0.7193 0.6295 0.4423 0.0263  0.0412  -0.0391 23 ASP A O   
181 C CB  . ASP A 24 ? 0.7773 0.7073 0.4808 0.0444  0.1150  -0.0497 23 ASP A CB  
182 C CG  . ASP A 24 ? 0.8038 0.7461 0.4967 0.0357  0.1354  -0.0202 23 ASP A CG  
183 O OD1 . ASP A 24 ? 0.8047 0.7346 0.4759 0.0303  0.1187  0.0027  23 ASP A OD1 
184 O OD2 . ASP A 24 ? 0.8378 0.8026 0.5468 0.0350  0.1708  -0.0186 23 ASP A OD2 
185 N N   . LYS A 25 ? 0.8275 0.7416 0.4507 0.0295  0.0407  -0.0215 24 LYS A N   
186 C CA  . LYS A 25 ? 0.8015 0.7267 0.4476 0.0264  0.0105  -0.0006 24 LYS A CA  
187 C C   . LYS A 25 ? 0.7644 0.6889 0.4547 0.0287  0.0265  0.0310  24 LYS A C   
188 O O   . LYS A 25 ? 0.7487 0.6792 0.4661 0.0310  0.0089  0.0490  24 LYS A O   
189 C CB  . LYS A 25 ? 0.8699 0.8103 0.4528 0.0301  -0.0147 0.0090  24 LYS A CB  
190 C CG  . LYS A 25 ? 0.9066 0.8497 0.4555 0.0182  -0.0392 -0.0308 24 LYS A CG  
191 C CD  . LYS A 25 ? 0.9751 0.9528 0.4736 0.0170  -0.0762 -0.0244 24 LYS A CD  
192 C CE  . LYS A 25 ? 1.0186 0.9972 0.4883 -0.0051 -0.0999 -0.0739 24 LYS A CE  
193 N NZ  . LYS A 25 ? 0.9705 0.9322 0.5125 -0.0217 -0.1046 -0.0954 24 LYS A NZ  
194 N N   . HIS A 26 ? 0.7568 0.6757 0.4585 0.0266  0.0619  0.0341  25 HIS A N   
195 C CA  . HIS A 26 ? 0.7351 0.6465 0.4753 0.0208  0.0828  0.0570  25 HIS A CA  
196 C C   . HIS A 26 ? 0.6703 0.5952 0.4740 0.0096  0.0938  0.0392  25 HIS A C   
197 O O   . HIS A 26 ? 0.6505 0.5723 0.4867 -0.0022 0.1131  0.0484  25 HIS A O   
198 C CB  . HIS A 26 ? 0.7956 0.6939 0.4967 0.0197  0.1177  0.0798  25 HIS A CB  
199 C CG  . HIS A 26 ? 0.8686 0.7542 0.5010 0.0343  0.1073  0.1078  25 HIS A CG  
200 N ND1 . HIS A 26 ? 0.8939 0.7654 0.5276 0.0462  0.0918  0.1396  25 HIS A ND1 
201 C CD2 . HIS A 26 ? 0.9467 0.8365 0.5043 0.0420  0.1093  0.1098  25 HIS A CD2 
202 C CE1 . HIS A 26 ? 0.9754 0.8480 0.5397 0.0624  0.0811  0.1639  25 HIS A CE1 
203 N NE2 . HIS A 26 ? 0.9949 0.8782 0.5076 0.0577  0.0910  0.1451  25 HIS A NE2 
204 N N   . LYS A 27 ? 0.6466 0.5847 0.4647 0.0130  0.0820  0.0136  26 LYS A N   
205 C CA  . LYS A 27 ? 0.5906 0.5496 0.4641 0.0084  0.0864  0.0009  26 LYS A CA  
206 C C   . LYS A 27 ? 0.5706 0.5244 0.4596 0.0129  0.0593  -0.0110 26 LYS A C   
207 O O   . LYS A 27 ? 0.5877 0.5237 0.4459 0.0177  0.0431  -0.0196 26 LYS A O   
208 C CB  . LYS A 27 ? 0.6092 0.5937 0.4896 0.0145  0.1099  -0.0129 26 LYS A CB  
209 C CG  . LYS A 27 ? 0.6251 0.6246 0.5024 0.0038  0.1447  -0.0028 26 LYS A CG  
210 C CD  . LYS A 27 ? 0.6484 0.6828 0.5339 0.0146  0.1688  -0.0184 26 LYS A CD  
211 N N   . LEU A 28 ? 0.5079 0.4772 0.4412 0.0080  0.0558  -0.0124 27 LEU A N   
212 C CA  . LEU A 28 ? 0.4951 0.4575 0.4422 0.0115  0.0364  -0.0187 27 LEU A CA  
213 C C   . LEU A 28 ? 0.4969 0.4679 0.4533 0.0271  0.0421  -0.0293 27 LEU A C   
214 O O   . LEU A 28 ? 0.4912 0.4997 0.4776 0.0302  0.0524  -0.0287 27 LEU A O   
215 C CB  . LEU A 28 ? 0.4544 0.4287 0.4346 0.0007  0.0310  -0.0120 27 LEU A CB  
216 C CG  . LEU A 28 ? 0.4573 0.4208 0.4384 -0.0080 0.0293  -0.0006 27 LEU A CG  
217 C CD1 . LEU A 28 ? 0.4517 0.4263 0.4630 -0.0193 0.0359  -0.0012 27 LEU A CD1 
218 C CD2 . LEU A 28 ? 0.4491 0.4005 0.4204 -0.0057 0.0091  0.0019  27 LEU A CD2 
219 N N   . LYS A 29 ? 0.5209 0.4592 0.4544 0.0371  0.0359  -0.0396 28 LYS A N   
220 C CA  . LYS A 29 ? 0.5451 0.4777 0.4897 0.0586  0.0418  -0.0450 28 LYS A CA  
221 C C   . LYS A 29 ? 0.5182 0.4509 0.4870 0.0563  0.0282  -0.0327 28 LYS A C   
222 O O   . LYS A 29 ? 0.4913 0.4268 0.4661 0.0367  0.0170  -0.0258 28 LYS A O   
223 C CB  . LYS A 29 ? 0.6042 0.4843 0.5108 0.0684  0.0456  -0.0635 28 LYS A CB  
224 C CG  . LYS A 29 ? 0.6294 0.4664 0.5161 0.0483  0.0269  -0.0698 28 LYS A CG  
225 C CD  . LYS A 29 ? 0.7123 0.4940 0.5567 0.0502  0.0323  -0.0968 28 LYS A CD  
226 N N   . LYS A 30 ? 0.5361 0.4669 0.5172 0.0794  0.0311  -0.0276 29 LYS A N   
227 C CA  . LYS A 30 ? 0.5217 0.4536 0.5165 0.0803  0.0201  -0.0108 29 LYS A CA  
228 C C   . LYS A 30 ? 0.5364 0.4220 0.5162 0.0583  0.0105  -0.0085 29 LYS A C   
229 O O   . LYS A 30 ? 0.4963 0.3998 0.4872 0.0446  0.0033  0.0027  29 LYS A O   
230 C CB  . LYS A 30 ? 0.5575 0.4828 0.5588 0.1162  0.0253  0.0000  29 LYS A CB  
231 C CG  . LYS A 30 ? 0.5187 0.5206 0.5533 0.1377  0.0279  0.0057  29 LYS A CG  
232 C CD  . LYS A 30 ? 0.5414 0.5374 0.5832 0.1809  0.0290  0.0247  29 LYS A CD  
233 C CE  . LYS A 30 ? 0.5366 0.6067 0.6157 0.2125  0.0364  0.0247  29 LYS A CE  
234 N NZ  . LYS A 30 ? 0.5672 0.6363 0.6563 0.2638  0.0359  0.0496  29 LYS A NZ  
235 N N   . SER A 31 ? 0.5760 0.4068 0.5319 0.0529  0.0122  -0.0219 30 SER A N   
236 C CA  . SER A 31 ? 0.6002 0.3962 0.5503 0.0269  0.0040  -0.0229 30 SER A CA  
237 C C   . SER A 31 ? 0.5559 0.3899 0.5171 0.0027  -0.0079 -0.0241 30 SER A C   
238 O O   . SER A 31 ? 0.5507 0.3908 0.5274 -0.0145 -0.0132 -0.0158 30 SER A O   
239 C CB  . SER A 31 ? 0.6703 0.4018 0.5927 0.0201  0.0081  -0.0442 30 SER A CB  
240 O OG  . SER A 31 ? 0.6989 0.4413 0.5999 0.0172  0.0061  -0.0656 30 SER A OG  
241 N N   . GLU A 32 ? 0.5461 0.4056 0.5000 0.0044  -0.0086 -0.0315 31 GLU A N   
242 C CA  . GLU A 32 ? 0.5083 0.4000 0.4725 -0.0091 -0.0169 -0.0262 31 GLU A CA  
243 C C   . GLU A 32 ? 0.4710 0.3930 0.4630 -0.0099 -0.0123 -0.0123 31 GLU A C   
244 O O   . GLU A 32 ? 0.4514 0.3865 0.4602 -0.0209 -0.0167 -0.0064 31 GLU A O   
245 C CB  . GLU A 32 ? 0.5167 0.4193 0.4582 -0.0035 -0.0141 -0.0308 31 GLU A CB  
246 C CG  . GLU A 32 ? 0.5607 0.4402 0.4645 -0.0081 -0.0223 -0.0487 31 GLU A CG  
247 C CD  . GLU A 32 ? 0.5856 0.4723 0.4538 0.0013  -0.0139 -0.0520 31 GLU A CD  
248 O OE1 . GLU A 32 ? 0.5894 0.4908 0.4644 0.0124  0.0045  -0.0438 31 GLU A OE1 
249 O OE2 . GLU A 32 ? 0.6655 0.5462 0.4960 -0.0049 -0.0247 -0.0641 31 GLU A OE2 
250 N N   . LEU A 33 ? 0.4585 0.3971 0.4566 0.0015  -0.0029 -0.0099 32 LEU A N   
251 C CA  . LEU A 33 ? 0.4387 0.4083 0.4564 -0.0033 0.0011  -0.0042 32 LEU A CA  
252 C C   . LEU A 33 ? 0.4293 0.3928 0.4513 -0.0083 -0.0032 0.0041  32 LEU A C   
253 O O   . LEU A 33 ? 0.4224 0.3995 0.4550 -0.0196 -0.0005 0.0057  32 LEU A O   
254 C CB  . LEU A 33 ? 0.4428 0.4442 0.4686 0.0081  0.0068  -0.0058 32 LEU A CB  
255 C CG  . LEU A 33 ? 0.4460 0.4901 0.4898 -0.0034 0.0138  -0.0114 32 LEU A CG  
256 C CD1 . LEU A 33 ? 0.4218 0.5137 0.4795 0.0075  0.0095  -0.0107 32 LEU A CD1 
257 C CD2 . LEU A 33 ? 0.4300 0.4710 0.4783 -0.0229 0.0173  -0.0142 32 LEU A CD2 
258 N N   . LYS A 34 ? 0.4611 0.3984 0.4723 0.0008  -0.0053 0.0100  33 LYS A N   
259 C CA  . LYS A 34 ? 0.4802 0.4049 0.4892 -0.0041 -0.0046 0.0235  33 LYS A CA  
260 C C   . LYS A 34 ? 0.4702 0.3893 0.4909 -0.0270 -0.0047 0.0216  33 LYS A C   
261 O O   . LYS A 34 ? 0.4570 0.3934 0.4854 -0.0359 0.0010  0.0286  33 LYS A O   
262 C CB  . LYS A 34 ? 0.5290 0.4085 0.5215 0.0109  -0.0020 0.0333  33 LYS A CB  
263 C CG  . LYS A 34 ? 0.5677 0.4275 0.5512 0.0068  0.0033  0.0545  33 LYS A CG  
264 C CD  . LYS A 34 ? 0.6597 0.4529 0.6247 0.0205  0.0111  0.0664  33 LYS A CD  
265 C CE  . LYS A 34 ? 0.7547 0.4953 0.7198 -0.0045 0.0147  0.0485  33 LYS A CE  
266 N NZ  . LYS A 34 ? 0.8731 0.5339 0.8193 -0.0028 0.0294  0.0617  33 LYS A NZ  
267 N N   . GLU A 35 ? 0.4792 0.3832 0.5019 -0.0355 -0.0111 0.0108  34 GLU A N   
268 C CA  . GLU A 35 ? 0.4717 0.3875 0.5150 -0.0557 -0.0154 0.0085  34 GLU A CA  
269 C C   . GLU A 35 ? 0.4442 0.4002 0.5085 -0.0536 -0.0129 0.0108  34 GLU A C   
270 O O   . GLU A 35 ? 0.4368 0.4133 0.5249 -0.0631 -0.0070 0.0155  34 GLU A O   
271 C CB  . GLU A 35 ? 0.5021 0.4046 0.5392 -0.0659 -0.0283 -0.0064 34 GLU A CB  
272 C CG  . GLU A 35 ? 0.5534 0.3997 0.5671 -0.0710 -0.0256 -0.0154 34 GLU A CG  
273 C CD  . GLU A 35 ? 0.6177 0.4343 0.6405 -0.0896 -0.0150 -0.0060 34 GLU A CD  
274 O OE1 . GLU A 35 ? 0.5862 0.4326 0.6319 -0.0979 -0.0089 0.0081  34 GLU A OE1 
275 O OE2 . GLU A 35 ? 0.6640 0.4207 0.6679 -0.0960 -0.0084 -0.0124 34 GLU A OE2 
276 N N   . LEU A 36 ? 0.4340 0.3978 0.4906 -0.0411 -0.0125 0.0076  35 LEU A N   
277 C CA  . LEU A 36 ? 0.4069 0.3909 0.4790 -0.0374 -0.0040 0.0096  35 LEU A CA  
278 C C   . LEU A 36 ? 0.3952 0.3897 0.4743 -0.0421 0.0101  0.0100  35 LEU A C   
279 O O   . LEU A 36 ? 0.3915 0.3998 0.4912 -0.0441 0.0194  0.0110  35 LEU A O   
280 C CB  . LEU A 36 ? 0.4069 0.3860 0.4655 -0.0286 0.0007  0.0070  35 LEU A CB  
281 C CG  . LEU A 36 ? 0.4072 0.3877 0.4778 -0.0248 0.0136  0.0101  35 LEU A CG  
282 C CD1 . LEU A 36 ? 0.4258 0.3926 0.4790 -0.0176 0.0166  0.0149  35 LEU A CD1 
283 C CD2 . LEU A 36 ? 0.4221 0.4054 0.4970 -0.0327 0.0304  0.0004  35 LEU A CD2 
284 N N   . ILE A 37 ? 0.3858 0.3788 0.4465 -0.0413 0.0117  0.0093  36 ILE A N   
285 C CA  . ILE A 37 ? 0.3945 0.4028 0.4489 -0.0464 0.0219  0.0085  36 ILE A CA  
286 C C   . ILE A 37 ? 0.4056 0.4130 0.4652 -0.0544 0.0281  0.0183  36 ILE A C   
287 O O   . ILE A 37 ? 0.4204 0.4425 0.4875 -0.0598 0.0427  0.0147  36 ILE A O   
288 C CB  . ILE A 37 ? 0.4083 0.4288 0.4411 -0.0404 0.0161  0.0097  36 ILE A CB  
289 C CG1 . ILE A 37 ? 0.3985 0.4333 0.4365 -0.0395 0.0156  -0.0037 36 ILE A CG1 
290 C CG2 . ILE A 37 ? 0.4362 0.4785 0.4509 -0.0462 0.0223  0.0107  36 ILE A CG2 
291 C CD1 . ILE A 37 ? 0.3977 0.4618 0.4286 -0.0306 0.0067  -0.0029 36 ILE A CD1 
292 N N   . ASN A 38 ? 0.4138 0.4005 0.4697 -0.0569 0.0212  0.0290  37 ASN A N   
293 C CA  . ASN A 38 ? 0.4504 0.4321 0.5122 -0.0708 0.0311  0.0402  37 ASN A CA  
294 C C   . ASN A 38 ? 0.4372 0.4448 0.5392 -0.0822 0.0375  0.0353  37 ASN A C   
295 O O   . ASN A 38 ? 0.4587 0.4832 0.5722 -0.0924 0.0550  0.0408  37 ASN A O   
296 C CB  . ASN A 38 ? 0.4741 0.4143 0.5235 -0.0746 0.0257  0.0499  37 ASN A CB  
297 C CG  . ASN A 38 ? 0.5090 0.4271 0.5218 -0.0576 0.0261  0.0654  37 ASN A CG  
298 O OD1 . ASN A 38 ? 0.5667 0.4391 0.5655 -0.0533 0.0260  0.0755  37 ASN A OD1 
299 N ND2 . ASN A 38 ? 0.4249 0.3756 0.4220 -0.0473 0.0268  0.0671  37 ASN A ND2 
300 N N   . ASN A 39 ? 0.4211 0.4374 0.5445 -0.0785 0.0239  0.0272  38 ASN A N   
301 C CA  . ASN A 39 ? 0.4144 0.4677 0.5824 -0.0834 0.0236  0.0259  38 ASN A CA  
302 C C   . ASN A 39 ? 0.4024 0.4793 0.5890 -0.0658 0.0360  0.0234  38 ASN A C   
303 O O   . ASN A 39 ? 0.4010 0.5134 0.6263 -0.0652 0.0479  0.0253  38 ASN A O   
304 C CB  . ASN A 39 ? 0.4177 0.4767 0.5950 -0.0844 -0.0007 0.0208  38 ASN A CB  
305 C CG  . ASN A 39 ? 0.4300 0.4614 0.5944 -0.1057 -0.0105 0.0160  38 ASN A CG  
306 O OD1 . ASN A 39 ? 0.4617 0.4773 0.6276 -0.1243 0.0021  0.0210  38 ASN A OD1 
307 N ND2 . ASN A 39 ? 0.4637 0.4841 0.6117 -0.1044 -0.0302 0.0058  38 ASN A ND2 
308 N N   . GLU A 40 ? 0.4101 0.4656 0.5721 -0.0520 0.0362  0.0183  39 GLU A N   
309 C CA  . GLU A 40 ? 0.4104 0.4687 0.5862 -0.0349 0.0497  0.0151  39 GLU A CA  
310 C C   . GLU A 40 ? 0.4253 0.4691 0.5808 -0.0365 0.0733  0.0021  39 GLU A C   
311 O O   . GLU A 40 ? 0.4411 0.4772 0.6083 -0.0249 0.0925  -0.0048 39 GLU A O   
312 C CB  . GLU A 40 ? 0.4197 0.4604 0.5852 -0.0218 0.0372  0.0186  39 GLU A CB  
313 C CG  . GLU A 40 ? 0.4255 0.4812 0.5958 -0.0215 0.0103  0.0268  39 GLU A CG  
314 C CD  . GLU A 40 ? 0.4129 0.5163 0.6280 -0.0201 0.0018  0.0337  39 GLU A CD  
315 O OE1 . GLU A 40 ? 0.4035 0.5292 0.6530 -0.0055 0.0176  0.0386  39 GLU A OE1 
316 O OE2 . GLU A 40 ? 0.3910 0.5127 0.6095 -0.0341 -0.0202 0.0318  39 GLU A OE2 
317 N N   . LEU A 41 ? 0.4246 0.4634 0.5474 -0.0496 0.0721  -0.0020 40 LEU A N   
318 C CA  . LEU A 41 ? 0.4353 0.4710 0.5315 -0.0556 0.0893  -0.0187 40 LEU A CA  
319 C C   . LEU A 41 ? 0.4561 0.5086 0.5315 -0.0658 0.0994  -0.0162 40 LEU A C   
320 O O   . LEU A 41 ? 0.4700 0.5278 0.5082 -0.0733 0.1031  -0.0270 40 LEU A O   
321 C CB  . LEU A 41 ? 0.4355 0.4620 0.5059 -0.0603 0.0782  -0.0280 40 LEU A CB  
322 C CG  . LEU A 41 ? 0.4150 0.4192 0.4975 -0.0548 0.0800  -0.0330 40 LEU A CG  
323 C CD1 . LEU A 41 ? 0.4148 0.4215 0.4816 -0.0617 0.0679  -0.0376 40 LEU A CD1 
324 C CD2 . LEU A 41 ? 0.4493 0.4312 0.5375 -0.0550 0.1075  -0.0504 40 LEU A CD2 
325 N N   . SER A 42 ? 0.4946 0.6004 0.5592 0.0304  0.0969  0.0185  41 SER A N   
326 C CA  . SER A 42 ? 0.5158 0.6148 0.5612 0.0208  0.1135  0.0167  41 SER A CA  
327 C C   . SER A 42 ? 0.5604 0.6329 0.5754 0.0378  0.1386  0.0091  41 SER A C   
328 O O   . SER A 42 ? 0.5954 0.6472 0.5704 0.0326  0.1502  0.0070  41 SER A O   
329 C CB  . SER A 42 ? 0.5001 0.6520 0.5917 0.0079  0.1214  0.0268  41 SER A CB  
330 O OG  . SER A 42 ? 0.4798 0.6775 0.6181 0.0256  0.1333  0.0339  41 SER A OG  
331 N N   . HIS A 43 ? 0.5754 0.6446 0.6046 0.0597  0.1488  0.0052  42 HIS A N   
332 C CA  . HIS A 43 ? 0.6298 0.6658 0.6257 0.0767  0.1739  -0.0096 42 HIS A CA  
333 C C   . HIS A 43 ? 0.6563 0.6355 0.5999 0.0743  0.1600  -0.0328 42 HIS A C   
334 O O   . HIS A 43 ? 0.7165 0.6643 0.6151 0.0825  0.1749  -0.0524 42 HIS A O   
335 C CB  . HIS A 43 ? 0.6416 0.6927 0.6797 0.1038  0.1959  -0.0058 42 HIS A CB  
336 C CG  . HIS A 43 ? 0.6326 0.7485 0.7262 0.1095  0.2129  0.0132  42 HIS A CG  
337 N ND1 . HIS A 43 ? 0.5934 0.7658 0.7446 0.1062  0.1942  0.0317  42 HIS A ND1 
338 C CD2 . HIS A 43 ? 0.6785 0.8173 0.7817 0.1173  0.2471  0.0154  42 HIS A CD2 
339 C CE1 . HIS A 43 ? 0.5902 0.8220 0.7918 0.1096  0.2123  0.0428  42 HIS A CE1 
340 N NE2 . HIS A 43 ? 0.6513 0.8635 0.8284 0.1164  0.2475  0.0349  42 HIS A NE2 
341 N N   . PHE A 44 ? 0.6244 0.5944 0.5758 0.0628  0.1321  -0.0328 43 PHE A N   
342 C CA  . PHE A 44 ? 0.6448 0.5714 0.5697 0.0582  0.1167  -0.0550 43 PHE A CA  
343 C C   . PHE A 44 ? 0.6356 0.5565 0.5285 0.0408  0.0909  -0.0593 43 PHE A C   
344 O O   . PHE A 44 ? 0.6620 0.5562 0.5189 0.0376  0.0790  -0.0815 43 PHE A O   
345 C CB  . PHE A 44 ? 0.6197 0.5387 0.5863 0.0609  0.1104  -0.0498 43 PHE A CB  
346 C CG  . PHE A 44 ? 0.6582 0.5678 0.6525 0.0839  0.1358  -0.0465 43 PHE A CG  
347 C CD1 . PHE A 44 ? 0.7276 0.6235 0.7047 0.0993  0.1618  -0.0606 43 PHE A CD1 
348 C CD2 . PHE A 44 ? 0.6492 0.5609 0.6837 0.0936  0.1366  -0.0276 43 PHE A CD2 
349 C CE1 . PHE A 44 ? 0.7740 0.6578 0.7815 0.1250  0.1884  -0.0571 43 PHE A CE1 
350 C CE2 . PHE A 44 ? 0.6856 0.5848 0.7474 0.1201  0.1612  -0.0197 43 PHE A CE2 
351 C CZ  . PHE A 44 ? 0.7285 0.6132 0.7807 0.1360  0.1870  -0.0352 43 PHE A CZ  
352 N N   . LEU A 45 ? 0.5991 0.5465 0.5077 0.0305  0.0815  -0.0395 44 LEU A N   
353 C CA  . LEU A 45 ? 0.5944 0.5368 0.4852 0.0181  0.0589  -0.0382 44 LEU A CA  
354 C C   . LEU A 45 ? 0.5966 0.5523 0.4768 0.0121  0.0664  -0.0206 44 LEU A C   
355 O O   . LEU A 45 ? 0.5662 0.5486 0.4794 0.0083  0.0790  -0.0078 44 LEU A O   
356 C CB  . LEU A 45 ? 0.5427 0.4935 0.4706 0.0102  0.0424  -0.0334 44 LEU A CB  
357 C CG  . LEU A 45 ? 0.5786 0.5137 0.5274 0.0121  0.0383  -0.0448 44 LEU A CG  
358 C CD1 . LEU A 45 ? 0.5152 0.4614 0.4944 0.0053  0.0284  -0.0348 44 LEU A CD1 
359 C CD2 . LEU A 45 ? 0.6319 0.5409 0.5558 0.0094  0.0271  -0.0701 44 LEU A CD2 
360 N N   . GLU A 46 ? 0.6329 0.5711 0.4705 0.0112  0.0579  -0.0193 45 GLU A N   
361 C CA  . GLU A 46 ? 0.6432 0.5814 0.4700 0.0049  0.0666  0.0013  45 GLU A CA  
362 C C   . GLU A 46 ? 0.5955 0.5469 0.4684 -0.0091 0.0592  0.0094  45 GLU A C   
363 O O   . GLU A 46 ? 0.5740 0.5252 0.4644 -0.0111 0.0393  0.0019  45 GLU A O   
364 C CB  . GLU A 46 ? 0.6911 0.6055 0.4647 0.0115  0.0528  0.0059  45 GLU A CB  
365 C CG  . GLU A 46 ? 0.7768 0.6784 0.4886 0.0228  0.0720  0.0124  45 GLU A CG  
366 N N   . GLU A 47 ? 0.5840 0.5470 0.4769 -0.0203 0.0770  0.0224  46 GLU A N   
367 C CA  . GLU A 47 ? 0.5505 0.5237 0.4821 -0.0367 0.0707  0.0240  46 GLU A CA  
368 C C   . GLU A 47 ? 0.5512 0.4951 0.4679 -0.0365 0.0536  0.0246  46 GLU A C   
369 O O   . GLU A 47 ? 0.5797 0.4961 0.4594 -0.0279 0.0538  0.0350  46 GLU A O   
370 C CB  . GLU A 47 ? 0.5684 0.5520 0.5231 -0.0533 0.0940  0.0354  46 GLU A CB  
371 C CG  . GLU A 47 ? 0.5488 0.5486 0.5485 -0.0745 0.0859  0.0277  46 GLU A CG  
372 C CD  . GLU A 47 ? 0.5768 0.5807 0.6072 -0.0978 0.1079  0.0348  46 GLU A CD  
373 O OE1 . GLU A 47 ? 0.6325 0.6425 0.6621 -0.0973 0.1335  0.0484  46 GLU A OE1 
374 O OE2 . GLU A 47 ? 0.6013 0.6005 0.6578 -0.1181 0.1021  0.0251  46 GLU A OE2 
375 N N   . ILE A 48 ? 0.5067 0.4586 0.4498 -0.0423 0.0397  0.0148  47 ILE A N   
376 C CA  . ILE A 48 ? 0.5207 0.4480 0.4593 -0.0404 0.0283  0.0145  47 ILE A CA  
377 C C   . ILE A 48 ? 0.5375 0.4443 0.4875 -0.0547 0.0402  0.0197  47 ILE A C   
378 O O   . ILE A 48 ? 0.5199 0.4434 0.4987 -0.0721 0.0444  0.0094  47 ILE A O   
379 C CB  . ILE A 48 ? 0.4906 0.4310 0.4481 -0.0380 0.0136  0.0012  47 ILE A CB  
380 C CG1 . ILE A 48 ? 0.4820 0.4347 0.4359 -0.0274 0.0059  -0.0039 47 ILE A CG1 
381 C CG2 . ILE A 48 ? 0.5170 0.4348 0.4742 -0.0321 0.0060  0.0015  47 ILE A CG2 
382 C CD1 . ILE A 48 ? 0.4641 0.4306 0.4408 -0.0265 -0.0005 -0.0118 47 ILE A CD1 
383 N N   . LYS A 49 ? 0.5718 0.4419 0.4992 -0.0468 0.0451  0.0356  48 LYS A N   
384 C CA  . LYS A 49 ? 0.6209 0.4570 0.5601 -0.0592 0.0611  0.0428  48 LYS A CA  
385 C C   . LYS A 49 ? 0.6458 0.4463 0.5821 -0.0456 0.0541  0.0463  48 LYS A C   
386 O O   . LYS A 49 ? 0.6882 0.4541 0.6408 -0.0557 0.0678  0.0457  48 LYS A O   
387 C CB  . LYS A 49 ? 0.6629 0.4777 0.5827 -0.0618 0.0856  0.0676  48 LYS A CB  
388 C CG  . LYS A 49 ? 0.6454 0.4947 0.5849 -0.0790 0.1018  0.0644  48 LYS A CG  
389 C CD  . LYS A 49 ? 0.7343 0.5630 0.6477 -0.0771 0.1312  0.0924  48 LYS A CD  
390 C CE  . LYS A 49 ? 0.7548 0.6187 0.7078 -0.0992 0.1552  0.0901  48 LYS A CE  
391 N NZ  . LYS A 49 ? 0.8397 0.6929 0.7604 -0.0920 0.1874  0.1171  48 LYS A NZ  
392 N N   . GLU A 50 ? 0.6387 0.4474 0.5599 -0.0229 0.0343  0.0489  49 GLU A N   
393 C CA  . GLU A 50 ? 0.6659 0.4486 0.5914 -0.0046 0.0279  0.0560  49 GLU A CA  
394 C C   . GLU A 50 ? 0.6179 0.4257 0.5720 -0.0024 0.0147  0.0333  49 GLU A C   
395 O O   . GLU A 50 ? 0.5738 0.4182 0.5316 -0.0046 0.0028  0.0216  49 GLU A O   
396 C CB  . GLU A 50 ? 0.7035 0.4830 0.5954 0.0226  0.0135  0.0793  49 GLU A CB  
397 C CG  . GLU A 50 ? 0.7950 0.5453 0.6444 0.0281  0.0292  0.1095  49 GLU A CG  
398 C CD  . GLU A 50 ? 0.9027 0.5970 0.7601 0.0240  0.0571  0.1297  49 GLU A CD  
399 O OE1 . GLU A 50 ? 0.9489 0.6153 0.8275 0.0360  0.0570  0.1326  49 GLU A OE1 
400 O OE2 . GLU A 50 ? 0.9589 0.6344 0.8041 0.0089  0.0828  0.1433  49 GLU A OE2 
401 N N   . GLN A 51 ? 0.6253 0.4088 0.5993 0.0033  0.0212  0.0286  50 GLN A N   
402 C CA  . GLN A 51 ? 0.6000 0.4044 0.5995 0.0078  0.0160  0.0093  50 GLN A CA  
403 C C   . GLN A 51 ? 0.5670 0.4073 0.5762 0.0259  -0.0048 0.0137  50 GLN A C   
404 O O   . GLN A 51 ? 0.5382 0.4098 0.5655 0.0217  -0.0087 -0.0006 50 GLN A O   
405 C CB  . GLN A 51 ? 0.6385 0.4038 0.6551 0.0168  0.0308  0.0050  50 GLN A CB  
406 C CG  . GLN A 51 ? 0.6381 0.4220 0.6769 0.0201  0.0341  -0.0173 50 GLN A CG  
407 C CD  . GLN A 51 ? 0.6337 0.4353 0.6631 -0.0048 0.0392  -0.0420 50 GLN A CD  
408 O OE1 . GLN A 51 ? 0.7087 0.4869 0.7298 -0.0238 0.0494  -0.0554 50 GLN A OE1 
409 N NE2 . GLN A 51 ? 0.5691 0.4129 0.6020 -0.0045 0.0321  -0.0477 50 GLN A NE2 
410 N N   . GLU A 52 ? 0.5936 0.4307 0.5920 0.0455  -0.0183 0.0338  51 GLU A N   
411 C CA  . GLU A 52 ? 0.5760 0.4540 0.5914 0.0593  -0.0426 0.0323  51 GLU A CA  
412 C C   . GLU A 52 ? 0.5413 0.4502 0.5483 0.0438  -0.0528 0.0187  51 GLU A C   
413 O O   . GLU A 52 ? 0.5141 0.4566 0.5501 0.0443  -0.0661 0.0073  51 GLU A O   
414 C CB  . GLU A 52 ? 0.6320 0.5084 0.6351 0.0865  -0.0613 0.0555  51 GLU A CB  
415 C CG  . GLU A 52 ? 0.6990 0.5573 0.6457 0.0891  -0.0646 0.0743  51 GLU A CG  
416 C CD  . GLU A 52 ? 0.7867 0.6529 0.7175 0.1211  -0.0884 0.0983  51 GLU A CD  
417 O OE1 . GLU A 52 ? 0.8464 0.6724 0.7596 0.1395  -0.0767 0.1273  51 GLU A OE1 
418 O OE2 . GLU A 52 ? 0.8084 0.7224 0.7494 0.1284  -0.1196 0.0879  51 GLU A OE2 
419 N N   . VAL A 53 ? 0.5364 0.4326 0.5107 0.0297  -0.0431 0.0195  52 VAL A N   
420 C CA  . VAL A 53 ? 0.5187 0.4362 0.4851 0.0179  -0.0470 0.0072  52 VAL A CA  
421 C C   . VAL A 53 ? 0.4917 0.4229 0.4868 0.0049  -0.0362 -0.0067 52 VAL A C   
422 O O   . VAL A 53 ? 0.4675 0.4193 0.4810 0.0021  -0.0421 -0.0164 52 VAL A O   
423 C CB  . VAL A 53 ? 0.5318 0.4360 0.4570 0.0123  -0.0375 0.0147  52 VAL A CB  
424 C CG1 . VAL A 53 ? 0.4975 0.4201 0.4211 0.0035  -0.0369 0.0002  52 VAL A CG1 
425 C CG2 . VAL A 53 ? 0.5830 0.4756 0.4680 0.0289  -0.0480 0.0310  52 VAL A CG2 
426 N N   . VAL A 54 ? 0.4975 0.4164 0.4960 -0.0029 -0.0205 -0.0079 53 VAL A N   
427 C CA  . VAL A 54 ? 0.4923 0.4260 0.5085 -0.0107 -0.0115 -0.0193 53 VAL A CA  
428 C C   . VAL A 54 ? 0.4753 0.4248 0.5223 -0.0021 -0.0143 -0.0233 53 VAL A C   
429 O O   . VAL A 54 ? 0.4555 0.4235 0.5165 -0.0059 -0.0113 -0.0268 53 VAL A O   
430 C CB  . VAL A 54 ? 0.5141 0.4306 0.5268 -0.0183 0.0016  -0.0263 53 VAL A CB  
431 C CG1 . VAL A 54 ? 0.5439 0.4785 0.5616 -0.0228 0.0091  -0.0387 53 VAL A CG1 
432 C CG2 . VAL A 54 ? 0.5470 0.4542 0.5440 -0.0322 0.0064  -0.0241 53 VAL A CG2 
433 N N   . ASP A 55 ? 0.4869 0.4283 0.5488 0.0107  -0.0169 -0.0203 54 ASP A N   
434 C CA  . ASP A 55 ? 0.4738 0.4354 0.5762 0.0207  -0.0166 -0.0234 54 ASP A CA  
435 C C   . ASP A 55 ? 0.4601 0.4516 0.5866 0.0181  -0.0321 -0.0255 54 ASP A C   
436 O O   . ASP A 55 ? 0.4432 0.4550 0.6024 0.0127  -0.0232 -0.0307 54 ASP A O   
437 C CB  . ASP A 55 ? 0.4947 0.4436 0.6111 0.0403  -0.0196 -0.0159 54 ASP A CB  
438 C CG  . ASP A 55 ? 0.5122 0.4249 0.6159 0.0415  0.0016  -0.0203 54 ASP A CG  
439 O OD1 . ASP A 55 ? 0.4882 0.3943 0.5730 0.0258  0.0153  -0.0329 54 ASP A OD1 
440 O OD2 . ASP A 55 ? 0.5345 0.4247 0.6472 0.0591  0.0037  -0.0120 54 ASP A OD2 
441 N N   . LYS A 56 ? 0.4723 0.4639 0.5803 0.0203  -0.0530 -0.0226 55 LYS A N   
442 C CA  . LYS A 56 ? 0.4797 0.4963 0.6067 0.0149  -0.0711 -0.0323 55 LYS A CA  
443 C C   . LYS A 56 ? 0.4616 0.4756 0.5890 -0.0020 -0.0580 -0.0405 55 LYS A C   
444 O O   . LYS A 56 ? 0.4555 0.4871 0.6233 -0.0105 -0.0581 -0.0496 55 LYS A O   
445 C CB  . LYS A 56 ? 0.5151 0.5294 0.6054 0.0223  -0.0956 -0.0305 55 LYS A CB  
446 C CG  . LYS A 56 ? 0.5650 0.6106 0.6781 0.0183  -0.1221 -0.0472 55 LYS A CG  
447 C CD  . LYS A 56 ? 0.6068 0.6895 0.7669 0.0331  -0.1432 -0.0445 55 LYS A CD  
448 C CE  . LYS A 56 ? 0.6135 0.7390 0.8357 0.0192  -0.1592 -0.0664 55 LYS A CE  
449 N NZ  . LYS A 56 ? 0.6349 0.8082 0.9134 0.0360  -0.1811 -0.0623 55 LYS A NZ  
450 N N   . VAL A 57 ? 0.4585 0.4515 0.5472 -0.0062 -0.0460 -0.0359 56 VAL A N   
451 C CA  . VAL A 57 ? 0.4558 0.4452 0.5441 -0.0158 -0.0334 -0.0386 56 VAL A CA  
452 C C   . VAL A 57 ? 0.4385 0.4372 0.5588 -0.0187 -0.0155 -0.0350 56 VAL A C   
453 O O   . VAL A 57 ? 0.4355 0.4377 0.5843 -0.0256 -0.0092 -0.0379 56 VAL A O   
454 C CB  . VAL A 57 ? 0.4584 0.4349 0.5091 -0.0163 -0.0244 -0.0321 56 VAL A CB  
455 C CG1 . VAL A 57 ? 0.4550 0.4314 0.5114 -0.0194 -0.0099 -0.0291 56 VAL A CG1 
456 C CG2 . VAL A 57 ? 0.4918 0.4586 0.5105 -0.0135 -0.0351 -0.0345 56 VAL A CG2 
457 N N   . MET A 58 ? 0.4310 0.4305 0.5453 -0.0138 -0.0048 -0.0296 57 MET A N   
458 C CA  . MET A 58 ? 0.4297 0.4387 0.5646 -0.0135 0.0159  -0.0256 57 MET A CA  
459 C C   . MET A 58 ? 0.4309 0.4582 0.6208 -0.0153 0.0176  -0.0289 57 MET A C   
460 O O   . MET A 58 ? 0.4187 0.4511 0.6332 -0.0211 0.0360  -0.0236 57 MET A O   
461 C CB  . MET A 58 ? 0.4438 0.4489 0.5594 -0.0071 0.0263  -0.0270 57 MET A CB  
462 C CG  . MET A 58 ? 0.4650 0.4794 0.5859 -0.0045 0.0516  -0.0231 57 MET A CG  
463 S SD  . MET A 58 ? 0.4722 0.4882 0.5645 -0.0072 0.0640  -0.0083 57 MET A SD  
464 C CE  . MET A 58 ? 0.4611 0.4759 0.4975 -0.0067 0.0551  -0.0154 57 MET A CE  
465 N N   . GLU A 59 ? 0.4302 0.4699 0.6432 -0.0099 -0.0011 -0.0355 58 GLU A N   
466 C CA  . GLU A 59 ? 0.4484 0.5187 0.7265 -0.0121 -0.0046 -0.0410 58 GLU A CA  
467 C C   . GLU A 59 ? 0.4419 0.5153 0.7460 -0.0300 -0.0079 -0.0489 58 GLU A C   
468 O O   . GLU A 59 ? 0.4424 0.5319 0.8013 -0.0403 0.0078  -0.0496 58 GLU A O   
469 C CB  . GLU A 59 ? 0.4574 0.5454 0.7503 0.0010  -0.0320 -0.0445 58 GLU A CB  
470 C CG  . GLU A 59 ? 0.4830 0.6168 0.8514 -0.0004 -0.0450 -0.0524 58 GLU A CG  
471 C CD  . GLU A 59 ? 0.5081 0.6640 0.8835 0.0182  -0.0789 -0.0518 58 GLU A CD  
472 O OE1 . GLU A 59 ? 0.5634 0.7509 0.9644 0.0125  -0.1103 -0.0640 58 GLU A OE1 
473 O OE2 . GLU A 59 ? 0.5599 0.7009 0.9144 0.0393  -0.0747 -0.0395 58 GLU A OE2 
474 N N   . THR A 60 ? 0.4453 0.4988 0.7104 -0.0341 -0.0235 -0.0552 59 THR A N   
475 C CA  . THR A 60 ? 0.4675 0.5129 0.7508 -0.0502 -0.0257 -0.0679 59 THR A CA  
476 C C   . THR A 60 ? 0.4641 0.4875 0.7538 -0.0568 0.0083  -0.0547 59 THR A C   
477 O O   . THR A 60 ? 0.4772 0.4985 0.8158 -0.0722 0.0201  -0.0601 59 THR A O   
478 C CB  . THR A 60 ? 0.4885 0.5156 0.7205 -0.0485 -0.0470 -0.0793 59 THR A CB  
479 O OG1 . THR A 60 ? 0.5262 0.5742 0.7483 -0.0393 -0.0774 -0.0858 59 THR A OG1 
480 C CG2 . THR A 60 ? 0.5077 0.5200 0.7563 -0.0646 -0.0483 -0.0993 59 THR A CG2 
481 N N   . LEU A 61 ? 0.4520 0.4605 0.6953 -0.0453 0.0237  -0.0367 60 LEU A N   
482 C CA  . LEU A 61 ? 0.4639 0.4526 0.6995 -0.0447 0.0518  -0.0187 60 LEU A CA  
483 C C   . LEU A 61 ? 0.4694 0.4681 0.7285 -0.0436 0.0809  -0.0017 60 LEU A C   
484 O O   . LEU A 61 ? 0.4844 0.4664 0.7500 -0.0445 0.1074  0.0163  60 LEU A O   
485 C CB  . LEU A 61 ? 0.4527 0.4317 0.6292 -0.0317 0.0508  -0.0074 60 LEU A CB  
486 C CG  . LEU A 61 ? 0.4647 0.4324 0.6146 -0.0306 0.0321  -0.0190 60 LEU A CG  
487 C CD1 . LEU A 61 ? 0.4803 0.4479 0.5902 -0.0191 0.0369  -0.0046 60 LEU A CD1 
488 C CD2 . LEU A 61 ? 0.4998 0.4456 0.6728 -0.0394 0.0334  -0.0317 60 LEU A CD2 
489 N N   . ASP A 62 ? 0.4542 0.4768 0.7232 -0.0389 0.0798  -0.0051 61 ASP A N   
490 C CA  . ASP A 62 ? 0.4727 0.5059 0.7532 -0.0341 0.1117  0.0097  61 ASP A CA  
491 C C   . ASP A 62 ? 0.4829 0.5332 0.8426 -0.0476 0.1304  0.0094  61 ASP A C   
492 O O   . ASP A 62 ? 0.4781 0.5585 0.8794 -0.0457 0.1321  0.0021  61 ASP A O   
493 C CB  . ASP A 62 ? 0.4674 0.5130 0.7193 -0.0205 0.1086  0.0041  61 ASP A CB  
494 C CG  . ASP A 62 ? 0.4968 0.5540 0.7562 -0.0134 0.1441  0.0143  61 ASP A CG  
495 O OD1 . ASP A 62 ? 0.5409 0.5903 0.7915 -0.0140 0.1723  0.0343  61 ASP A OD1 
496 O OD2 . ASP A 62 ? 0.5319 0.6035 0.8042 -0.0048 0.1466  0.0042  61 ASP A OD2 
497 N N   . SER A 63 ? 0.5003 0.5310 0.8863 -0.0608 0.1470  0.0179  62 SER A N   
498 C CA  . SER A 63 ? 0.5193 0.5621 0.9914 -0.0810 0.1673  0.0162  62 SER A CA  
499 C C   . SER A 63 ? 0.5348 0.5998 1.0391 -0.0777 0.2080  0.0343  62 SER A C   
500 O O   . SER A 63 ? 0.5399 0.6380 1.1294 -0.0924 0.2161  0.0252  62 SER A O   
501 C CB  . SER A 63 ? 0.5465 0.5480 1.0321 -0.0949 0.1855  0.0255  62 SER A CB  
502 O OG  . SER A 63 ? 0.5640 0.5426 1.0169 -0.0953 0.1543  0.0081  62 SER A OG  
503 N N   . ASP A 64 ? 0.5557 0.6069 0.9956 -0.0589 0.2352  0.0593  63 ASP A N   
504 C CA  . ASP A 64 ? 0.5904 0.6594 1.0495 -0.0534 0.2808  0.0775  63 ASP A CA  
505 C C   . ASP A 64 ? 0.5711 0.6711 1.0173 -0.0367 0.2744  0.0625  63 ASP A C   
506 O O   . ASP A 64 ? 0.6064 0.7214 1.0569 -0.0272 0.3127  0.0733  63 ASP A O   
507 C CB  . ASP A 64 ? 0.6375 0.6764 1.0335 -0.0407 0.3202  0.1148  63 ASP A CB  
508 C CG  . ASP A 64 ? 0.6501 0.6769 0.9410 -0.0181 0.2996  0.1176  63 ASP A CG  
509 O OD1 . ASP A 64 ? 0.5709 0.6115 0.8382 -0.0125 0.2661  0.0917  63 ASP A OD1 
510 O OD2 . ASP A 64 ? 0.7251 0.7299 0.9597 -0.0057 0.3170  0.1471  63 ASP A OD2 
511 N N   . GLY A 65 ? 0.5127 0.6189 1.1451 0.0464  0.2296  -0.0029 64 GLY A N   
512 C CA  . GLY A 65 ? 0.5273 0.6300 1.1681 0.0813  0.2234  -0.0107 64 GLY A CA  
513 C C   . GLY A 65 ? 0.5789 0.6168 1.1262 0.0892  0.2679  -0.0049 64 GLY A C   
514 O O   . GLY A 65 ? 0.6136 0.6526 1.1982 0.1163  0.2904  -0.0166 64 GLY A O   
515 N N   . ASP A 66 ? 0.5921 0.5754 1.0209 0.0696  0.2769  0.0081  65 ASP A N   
516 C CA  . ASP A 66 ? 0.6560 0.5758 0.9828 0.0758  0.3075  0.0056  65 ASP A CA  
517 C C   . ASP A 66 ? 0.6632 0.5415 0.9148 0.0787  0.2668  0.0022  65 ASP A C   
518 O O   . ASP A 66 ? 0.7198 0.5457 0.8859 0.0774  0.2815  -0.0078 65 ASP A O   
519 C CB  . ASP A 66 ? 0.7015 0.5831 0.9379 0.0594  0.3405  0.0152  65 ASP A CB  
520 C CG  . ASP A 66 ? 0.6764 0.5532 0.8536 0.0424  0.2945  0.0260  65 ASP A CG  
521 O OD1 . ASP A 66 ? 0.6204 0.5230 0.8273 0.0371  0.2458  0.0255  65 ASP A OD1 
522 O OD2 . ASP A 66 ? 0.7265 0.5688 0.8213 0.0389  0.3083  0.0350  65 ASP A OD2 
523 N N   . GLY A 67 ? 0.6218 0.5169 0.9002 0.0806  0.2191  0.0074  66 GLY A N   
524 C CA  . GLY A 67 ? 0.6443 0.4880 0.8550 0.0796  0.1947  0.0059  66 GLY A CA  
525 C C   . GLY A 67 ? 0.6360 0.4636 0.7759 0.0482  0.1791  0.0043  66 GLY A C   
526 O O   . GLY A 67 ? 0.6571 0.4424 0.7506 0.0382  0.1695  -0.0024 66 GLY A O   
527 N N   . GLU A 68 ? 0.6033 0.4607 0.7387 0.0336  0.1801  0.0084  67 GLU A N   
528 C CA  . GLU A 68 ? 0.6000 0.4557 0.6840 0.0121  0.1594  0.0029  67 GLU A CA  
529 C C   . GLU A 68 ? 0.5558 0.4505 0.6703 0.0049  0.1413  0.0168  67 GLU A C   
530 O O   . GLU A 68 ? 0.5390 0.4578 0.7088 0.0114  0.1504  0.0278  67 GLU A O   
531 C CB  . GLU A 68 ? 0.6509 0.4849 0.6666 0.0113  0.1731  -0.0116 67 GLU A CB  
532 C CG  . GLU A 68 ? 0.7248 0.5120 0.6987 0.0133  0.1891  -0.0355 67 GLU A CG  
533 C CD  . GLU A 68 ? 0.7907 0.5615 0.6875 0.0068  0.1794  -0.0623 67 GLU A CD  
534 O OE1 . GLU A 68 ? 0.7930 0.5924 0.6843 -0.0067 0.1450  -0.0724 67 GLU A OE1 
535 O OE2 . GLU A 68 ? 0.8835 0.6149 0.7260 0.0184  0.2037  -0.0773 67 GLU A OE2 
536 N N   . CYS A 69 ? 0.5411 0.4438 0.6306 -0.0095 0.1183  0.0112  68 CYS A N   
537 C CA  . CYS A 69 ? 0.5028 0.4337 0.6134 -0.0139 0.1027  0.0215  68 CYS A CA  
538 C C   . CYS A 69 ? 0.5309 0.4597 0.5982 -0.0073 0.1031  0.0224  68 CYS A C   
539 O O   . CYS A 69 ? 0.5469 0.4798 0.5795 -0.0088 0.0845  0.0048  68 CYS A O   
540 C CB  . CYS A 69 ? 0.4829 0.4228 0.5999 -0.0281 0.0803  0.0149  68 CYS A CB  
541 S SG  . CYS A 69 ? 0.4527 0.4197 0.5968 -0.0302 0.0648  0.0238  68 CYS A SG  
542 N N   . ASP A 70 ? 0.5453 0.4645 0.6151 0.0017  0.1245  0.0407  69 ASP A N   
543 C CA  . ASP A 70 ? 0.5982 0.4919 0.6031 0.0173  0.1279  0.0500  69 ASP A CA  
544 C C   . ASP A 70 ? 0.5720 0.4795 0.5912 0.0186  0.1049  0.0566  69 ASP A C   
545 O O   . ASP A 70 ? 0.5148 0.4520 0.5920 0.0035  0.0902  0.0512  69 ASP A O   
546 C CB  . ASP A 70 ? 0.6645 0.5145 0.6408 0.0270  0.1786  0.0687  69 ASP A CB  
547 C CG  . ASP A 70 ? 0.6631 0.5207 0.7195 0.0132  0.2084  0.0830  69 ASP A CG  
548 O OD1 . ASP A 70 ? 0.6322 0.5134 0.7365 0.0029  0.1858  0.0834  69 ASP A OD1 
549 O OD2 . ASP A 70 ? 0.6981 0.5373 0.7732 0.0111  0.2592  0.0892  69 ASP A OD2 
550 N N   . PHE A 71 ? 0.6270 0.5046 0.5825 0.0417  0.1010  0.0676  70 PHE A N   
551 C CA  . PHE A 71 ? 0.6134 0.5031 0.5806 0.0508  0.0750  0.0695  70 PHE A CA  
552 C C   . PHE A 71 ? 0.5859 0.4686 0.6114 0.0353  0.0950  0.0834  70 PHE A C   
553 O O   . PHE A 71 ? 0.5368 0.4446 0.6005 0.0304  0.0741  0.0745  70 PHE A O   
554 C CB  . PHE A 71 ? 0.7071 0.5589 0.5853 0.0908  0.0590  0.0793  70 PHE A CB  
555 C CG  . PHE A 71 ? 0.6952 0.5668 0.5952 0.1077  0.0276  0.0759  70 PHE A CG  
556 C CD1 . PHE A 71 ? 0.6251 0.5685 0.5812 0.1020  -0.0113 0.0424  70 PHE A CD1 
557 C CD2 . PHE A 71 ? 0.7766 0.5899 0.6474 0.1278  0.0453  0.1042  70 PHE A CD2 
558 C CE1 . PHE A 71 ? 0.6309 0.5989 0.6203 0.1195  -0.0343 0.0351  70 PHE A CE1 
559 C CE2 . PHE A 71 ? 0.7642 0.5917 0.6579 0.1482  0.0184  0.0993  70 PHE A CE2 
560 C CZ  . PHE A 71 ? 0.7030 0.6134 0.6592 0.1460  -0.0225 0.0638  70 PHE A CZ  
561 N N   . GLN A 72 ? 0.6207 0.4704 0.6583 0.0256  0.1383  0.0995  71 GLN A N   
562 C CA  . GLN A 72 ? 0.6011 0.4509 0.7107 0.0042  0.1559  0.1018  71 GLN A CA  
563 C C   . GLN A 72 ? 0.5217 0.4305 0.7095 -0.0171 0.1298  0.0793  71 GLN A C   
564 O O   . GLN A 72 ? 0.5047 0.4258 0.7319 -0.0278 0.1141  0.0699  71 GLN A O   
565 C CB  . GLN A 72 ? 0.6651 0.4738 0.7893 -0.0065 0.2153  0.1165  71 GLN A CB  
566 C CG  . GLN A 72 ? 0.7852 0.5057 0.8069 0.0171  0.2519  0.1460  71 GLN A CG  
567 C CD  . GLN A 72 ? 0.8503 0.5254 0.8521 0.0267  0.2476  0.1586  71 GLN A CD  
568 N N   . GLU A 73 ? 0.4926 0.4260 0.6886 -0.0188 0.1252  0.0707  72 GLU A N   
569 C CA  . GLU A 73 ? 0.4431 0.4131 0.6826 -0.0281 0.0978  0.0545  72 GLU A CA  
570 C C   . GLU A 73 ? 0.4273 0.4054 0.6387 -0.0284 0.0677  0.0455  72 GLU A C   
571 O O   . GLU A 73 ? 0.4113 0.3997 0.6428 -0.0357 0.0495  0.0363  72 GLU A O   
572 C CB  . GLU A 73 ? 0.4412 0.4183 0.6855 -0.0231 0.1047  0.0506  72 GLU A CB  
573 C CG  . GLU A 73 ? 0.4434 0.4296 0.7502 -0.0243 0.1370  0.0514  72 GLU A CG  
574 C CD  . GLU A 73 ? 0.4811 0.4592 0.7727 -0.0122 0.1584  0.0501  72 GLU A CD  
575 O OE1 . GLU A 73 ? 0.4876 0.4445 0.7106 -0.0056 0.1491  0.0484  72 GLU A OE1 
576 O OE2 . GLU A 73 ? 0.5027 0.4969 0.8586 -0.0104 0.1876  0.0458  72 GLU A OE2 
577 N N   . PHE A 74 ? 0.4352 0.4095 0.6012 -0.0193 0.0632  0.0443  73 PHE A N   
578 C CA  . PHE A 74 ? 0.4273 0.4199 0.5887 -0.0217 0.0435  0.0298  73 PHE A CA  
579 C C   . PHE A 74 ? 0.4234 0.4137 0.6021 -0.0198 0.0390  0.0305  73 PHE A C   
580 O O   . PHE A 74 ? 0.4209 0.4214 0.6101 -0.0283 0.0317  0.0177  73 PHE A O   
581 C CB  . PHE A 74 ? 0.4514 0.4563 0.5827 -0.0096 0.0327  0.0188  73 PHE A CB  
582 C CG  . PHE A 74 ? 0.4296 0.4692 0.5838 -0.0130 0.0172  -0.0037 73 PHE A CG  
583 C CD1 . PHE A 74 ? 0.4124 0.4640 0.5860 -0.0371 0.0244  -0.0216 73 PHE A CD1 
584 C CD2 . PHE A 74 ? 0.4237 0.4790 0.5807 0.0105  0.0007  -0.0077 73 PHE A CD2 
585 C CE1 . PHE A 74 ? 0.4186 0.5045 0.6265 -0.0454 0.0237  -0.0465 73 PHE A CE1 
586 C CE2 . PHE A 74 ? 0.4327 0.5327 0.6324 0.0090  -0.0098 -0.0345 73 PHE A CE2 
587 C CZ  . PHE A 74 ? 0.4288 0.5486 0.6605 -0.0227 0.0056  -0.0560 73 PHE A CZ  
588 N N   . MET A 75 ? 0.4533 0.4180 0.6257 -0.0081 0.0498  0.0453  74 MET A N   
589 C CA  . MET A 75 ? 0.4644 0.4123 0.6511 -0.0056 0.0504  0.0450  74 MET A CA  
590 C C   . MET A 75 ? 0.4395 0.3905 0.6661 -0.0281 0.0484  0.0333  74 MET A C   
591 O O   . MET A 75 ? 0.4431 0.3912 0.6749 -0.0308 0.0402  0.0198  74 MET A O   
592 C CB  . MET A 75 ? 0.5227 0.4192 0.6835 0.0110  0.0716  0.0669  74 MET A CB  
593 C CG  . MET A 75 ? 0.5807 0.4625 0.6837 0.0489  0.0589  0.0762  74 MET A CG  
594 S SD  . MET A 75 ? 0.6053 0.5302 0.7326 0.0671  0.0267  0.0522  74 MET A SD  
595 C CE  . MET A 75 ? 0.5984 0.4799 0.7515 0.0597  0.0452  0.0532  74 MET A CE  
596 N N   . ALA A 76 ? 0.4283 0.3869 0.6830 -0.0403 0.0531  0.0340  75 ALA A N   
597 C CA  . ALA A 76 ? 0.4192 0.3917 0.7118 -0.0542 0.0355  0.0161  75 ALA A CA  
598 C C   . ALA A 76 ? 0.4159 0.3950 0.6704 -0.0515 0.0122  0.0053  75 ALA A C   
599 O O   . ALA A 76 ? 0.4380 0.4099 0.6862 -0.0553 -0.0055 -0.0109 75 ALA A O   
600 C CB  . ALA A 76 ? 0.4224 0.4154 0.7650 -0.0594 0.0404  0.0153  75 ALA A CB  
601 N N   . PHE A 77 ? 0.4029 0.3862 0.6254 -0.0463 0.0166  0.0124  76 PHE A N   
602 C CA  . PHE A 77 ? 0.4223 0.3957 0.6022 -0.0483 0.0123  0.0052  76 PHE A CA  
603 C C   . PHE A 77 ? 0.4315 0.4014 0.5994 -0.0506 0.0189  -0.0066 76 PHE A C   
604 O O   . PHE A 77 ? 0.4682 0.4162 0.6027 -0.0536 0.0166  -0.0169 76 PHE A O   
605 C CB  . PHE A 77 ? 0.4132 0.3895 0.5772 -0.0494 0.0249  0.0096  76 PHE A CB  
606 C CG  . PHE A 77 ? 0.4609 0.4149 0.5852 -0.0585 0.0358  0.0025  76 PHE A CG  
607 C CD1 . PHE A 77 ? 0.5132 0.4276 0.5909 -0.0558 0.0307  0.0042  76 PHE A CD1 
608 C CD2 . PHE A 77 ? 0.4637 0.4293 0.5922 -0.0697 0.0532  -0.0078 76 PHE A CD2 
609 C CE1 . PHE A 77 ? 0.5375 0.4087 0.5611 -0.0648 0.0545  0.0028  76 PHE A CE1 
610 C CE2 . PHE A 77 ? 0.4902 0.4268 0.5904 -0.0865 0.0780  -0.0167 76 PHE A CE2 
611 C CZ  . PHE A 77 ? 0.5314 0.4126 0.5724 -0.0843 0.0845  -0.0075 76 PHE A CZ  
612 N N   . VAL A 78 ? 0.4104 0.3968 0.5985 -0.0438 0.0268  -0.0059 77 VAL A N   
613 C CA  . VAL A 78 ? 0.4230 0.4127 0.6163 -0.0383 0.0333  -0.0194 77 VAL A CA  
614 C C   . VAL A 78 ? 0.4519 0.4124 0.6406 -0.0402 0.0293  -0.0272 77 VAL A C   
615 O O   . VAL A 78 ? 0.4827 0.4308 0.6511 -0.0421 0.0371  -0.0438 77 VAL A O   
616 C CB  . VAL A 78 ? 0.4205 0.4287 0.6349 -0.0173 0.0314  -0.0156 77 VAL A CB  
617 C CG1 . VAL A 78 ? 0.4490 0.4640 0.6810 -0.0035 0.0365  -0.0318 77 VAL A CG1 
618 C CG2 . VAL A 78 ? 0.4067 0.4485 0.6250 -0.0156 0.0267  -0.0193 77 VAL A CG2 
619 N N   . ALA A 79 ? 0.4360 0.3832 0.6455 -0.0424 0.0223  -0.0199 78 ALA A N   
620 C CA  . ALA A 79 ? 0.4668 0.3888 0.6838 -0.0509 0.0143  -0.0365 78 ALA A CA  
621 C C   . ALA A 79 ? 0.4852 0.3997 0.6627 -0.0568 -0.0057 -0.0539 78 ALA A C   
622 O O   . ALA A 79 ? 0.5353 0.4238 0.6840 -0.0577 -0.0091 -0.0750 78 ALA A O   
623 C CB  . ALA A 79 ? 0.4632 0.3800 0.7285 -0.0611 0.0160  -0.0317 78 ALA A CB  
624 N N   . MET A 80 ? 0.4598 0.4490 0.7783 -0.0623 -0.0566 0.0757  79 MET A N   
625 C CA  . MET A 80 ? 0.5263 0.4887 0.8027 -0.0514 -0.0717 0.0994  79 MET A CA  
626 C C   . MET A 80 ? 0.5759 0.4719 0.7891 -0.0573 -0.0446 0.1027  79 MET A C   
627 O O   . MET A 80 ? 0.6424 0.5253 0.7853 -0.0705 -0.0556 0.1141  79 MET A O   
628 C CB  . MET A 80 ? 0.5366 0.5040 0.8679 -0.0130 -0.0652 0.1238  79 MET A CB  
629 C CG  . MET A 80 ? 0.5082 0.5688 0.9071 0.0045  -0.0938 0.1251  79 MET A CG  
630 S SD  . MET A 80 ? 0.5774 0.5999 1.0577 0.0690  -0.0455 0.1505  79 MET A SD  
631 C CE  . MET A 80 ? 0.4954 0.6542 1.0732 0.0625  -0.0704 0.1127  79 MET A CE  
632 N N   . ILE A 81 ? 0.5529 0.4433 0.7892 -0.0611 -0.0063 0.0840  80 ILE A N   
633 C CA  . ILE A 81 ? 0.5964 0.4509 0.7799 -0.0766 0.0274  0.0755  80 ILE A CA  
634 C C   . ILE A 81 ? 0.6221 0.4748 0.7643 -0.0768 0.0298  0.0666  80 ILE A C   
635 O O   . ILE A 81 ? 0.6980 0.5070 0.7717 -0.0942 0.0387  0.0639  80 ILE A O   
636 C CB  . ILE A 81 ? 0.5619 0.4796 0.7856 -0.1018 0.0746  0.0377  80 ILE A CB  
637 C CG1 . ILE A 81 ? 0.5845 0.4519 0.8384 -0.1201 0.1113  0.0251  80 ILE A CG1 
638 C CG2 . ILE A 81 ? 0.5983 0.5257 0.7709 -0.1283 0.1118  0.0160  80 ILE A CG2 
639 C CD1 . ILE A 81 ? 0.5367 0.5103 0.8372 -0.1814 0.1691  -0.0434 80 ILE A CD1 
640 N N   . THR A 82 ? 0.5824 0.4707 0.7630 -0.0555 0.0365  0.0656  81 THR A N   
641 C CA  . THR A 82 ? 0.6448 0.4930 0.7975 -0.0360 0.0751  0.0636  81 THR A CA  
642 C C   . THR A 82 ? 0.7420 0.4947 0.8227 -0.0790 0.0786  0.0395  81 THR A C   
643 O O   . THR A 82 ? 0.8345 0.5284 0.8647 -0.0917 0.1232  0.0145  81 THR A O   
644 C CB  . THR A 82 ? 0.6327 0.5106 0.8343 0.0127  0.0999  0.0942  81 THR A CB  
645 O OG1 . THR A 82 ? 0.6369 0.4792 0.8434 -0.0132 0.0761  0.0930  81 THR A OG1 
646 C CG2 . THR A 82 ? 0.5416 0.5950 0.8103 0.0416  0.0961  0.1143  81 THR A CG2 
647 N N   . THR A 83 ? 0.7357 0.5047 0.8138 -0.1106 0.0387  0.0371  82 THR A N   
648 C CA  . THR A 83 ? 0.8274 0.5882 0.8350 -0.1777 0.0375  0.0016  82 THR A CA  
649 C C   . THR A 83 ? 0.8719 0.6773 0.8164 -0.2029 0.0133  0.0078  82 THR A C   
650 O O   . THR A 83 ? 0.9673 0.7737 0.8366 -0.2668 0.0380  -0.0347 82 THR A O   
651 C CB  . THR A 83 ? 0.7995 0.6381 0.8299 -0.2058 -0.0018 -0.0029 82 THR A CB  
652 O OG1 . THR A 83 ? 0.7845 0.5645 0.8551 -0.1926 0.0328  -0.0065 82 THR A OG1 
653 C CG2 . THR A 83 ? 0.9097 0.8129 0.8625 -0.3012 0.0026  -0.0569 82 THR A CG2 
654 N N   . ALA A 84 ? 0.8403 0.6734 0.8063 -0.1609 -0.0188 0.0585  83 ALA A N   
655 C CA  . ALA A 84 ? 0.9201 0.7742 0.8134 -0.1749 -0.0292 0.0873  83 ALA A CA  
656 C C   . ALA A 84 ? 0.9796 0.7749 0.8166 -0.2060 0.0195  0.0485  83 ALA A C   
657 O O   . ALA A 84 ? 1.0541 0.8636 0.8184 -0.2295 0.0183  0.0684  83 ALA A O   
658 C CB  . ALA A 84 ? 0.9167 0.7527 0.8377 -0.1201 -0.0393 0.1545  83 ALA A CB  
659 N N   . CYS A 85 ? 0.9802 0.7201 0.8483 -0.1994 0.0687  0.0017  84 CYS A N   
660 C CA  . CYS A 85 ? 1.0053 0.7139 0.8589 -0.1947 0.1216  -0.0251 84 CYS A CA  
661 C C   . CYS A 85 ? 1.0394 0.6937 0.9246 -0.1626 0.1960  -0.0607 84 CYS A C   
662 O O   . CYS A 85 ? 1.0288 0.6998 0.9213 -0.1389 0.2384  -0.0739 84 CYS A O   
663 C CB  . CYS A 85 ? 0.9307 0.6751 0.8332 -0.1588 0.1153  0.0032  84 CYS A CB  
664 S SG  . CYS A 85 ? 0.9206 0.7327 0.8691 -0.1257 0.1744  -0.0254 84 CYS A SG  
665 N N   . HIS A 86 ? 1.0957 0.6773 0.9918 -0.1602 0.2321  -0.0759 85 HIS A N   
666 C CA  . HIS A 86 ? 1.2228 0.7429 1.0486 -0.2487 0.2651  -0.1363 85 HIS A CA  
667 C C   . HIS A 86 ? 1.2346 0.8607 0.9960 -0.3424 0.2006  -0.1542 85 HIS A C   
668 O O   . HIS A 86 ? 1.2397 0.8967 1.0083 -0.3740 0.1819  -0.1628 85 HIS A O   
669 C CB  . HIS A 86 ? 1.2986 0.6924 1.1529 -0.2247 0.3409  -0.1440 85 HIS A CB  
670 C CG  . HIS A 86 ? 1.5158 0.7644 1.2977 -0.3068 0.4612  -0.2342 85 HIS A CG  
671 N ND1 . HIS A 86 ? 1.6449 0.8119 1.3994 -0.3071 0.5532  -0.2800 85 HIS A ND1 
672 C CD2 . HIS A 86 ? 1.6554 0.8243 1.3827 -0.4089 0.5235  -0.3046 85 HIS A CD2 
673 C CE1 . HIS A 86 ? 1.8457 0.8676 1.5312 -0.4064 0.6758  -0.3781 85 HIS A CE1 
674 N NE2 . HIS A 86 ? 1.8705 0.8918 1.5332 -0.4782 0.6629  -0.3987 85 HIS A NE2 
675 N N   . GLU A 87 ? 1.2640 0.9691 0.9576 -0.3887 0.1761  -0.1592 86 GLU A N   
676 C CA  . GLU A 87 ? 1.3242 1.1859 0.9365 -0.4820 0.1324  -0.1734 86 GLU A CA  
677 C C   . GLU A 87 ? 1.3696 1.2956 0.9064 -0.5082 0.1202  -0.1559 86 GLU A C   
678 O O   . GLU A 87 ? 1.4820 1.4995 0.9267 -0.6159 0.1455  -0.2176 86 GLU A O   
679 C CB  . GLU A 87 ? 1.2401 1.2361 0.8914 -0.4423 0.0402  -0.0964 86 GLU A CB  
680 C CG  . GLU A 87 ? 1.2818 1.3862 0.9239 -0.5209 0.0383  -0.1510 86 GLU A CG  
681 C CD  . GLU A 87 ? 1.1914 1.4343 0.8996 -0.4583 -0.0455 -0.0743 86 GLU A CD  
682 O OE1 . GLU A 87 ? 1.1485 1.4155 0.8900 -0.3615 -0.0977 0.0271  86 GLU A OE1 
683 O OE2 . GLU A 87 ? 1.2015 1.5180 0.9268 -0.5100 -0.0434 -0.1213 86 GLU A OE2 
684 N N   . PHE A 88 ? 1.2985 1.1818 0.8668 -0.4258 0.0927  -0.0808 87 PHE A N   
685 C CA  . PHE A 88 ? 1.3501 1.2530 0.8463 -0.4429 0.0944  -0.0539 87 PHE A CA  
686 C C   . PHE A 88 ? 1.4344 1.3036 0.8782 -0.5163 0.1715  -0.1522 87 PHE A C   
687 O O   . PHE A 88 ? 1.4427 1.2067 0.9395 -0.5131 0.2476  -0.2337 87 PHE A O   
688 C CB  . PHE A 88 ? 1.2841 1.0999 0.8332 -0.3638 0.0937  0.0030  87 PHE A CB  
689 C CG  . PHE A 88 ? 1.3692 1.1797 0.8336 -0.3865 0.1049  0.0425  87 PHE A CG  
690 C CD1 . PHE A 88 ? 1.4530 1.3017 0.8548 -0.3687 0.0682  0.1487  87 PHE A CD1 
691 C CD2 . PHE A 88 ? 1.3928 1.1648 0.8392 -0.4175 0.1622  -0.0167 87 PHE A CD2 
692 C CE1 . PHE A 88 ? 1.5730 1.3838 0.8793 -0.3893 0.0962  0.1997  87 PHE A CE1 
693 C CE2 . PHE A 88 ? 1.4894 1.2487 0.8447 -0.4556 0.1828  0.0132  87 PHE A CE2 
694 C CZ  . PHE A 88 ? 1.5843 1.3438 0.8619 -0.4453 0.1535  0.1237  87 PHE A CZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  SER 2  1  1  SER SER A . n 
A 1 3  GLU 3  2  2  GLU GLU A . n 
A 1 4  LEU 4  3  3  LEU LEU A . n 
A 1 5  GLU 5  4  4  GLU GLU A . n 
A 1 6  LYS 6  5  5  LYS LYS A . n 
A 1 7  ALA 7  6  6  ALA ALA A . n 
A 1 8  VAL 8  7  7  VAL VAL A . n 
A 1 9  VAL 9  8  8  VAL VAL A . n 
A 1 10 ALA 10 9  9  ALA ALA A . n 
A 1 11 LEU 11 10 10 LEU LEU A . n 
A 1 12 ILE 12 11 11 ILE ILE A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 VAL 14 13 13 VAL VAL A . n 
A 1 15 PHE 15 14 14 PHE PHE A . n 
A 1 16 HIS 16 15 15 HIS HIS A . n 
A 1 17 GLN 17 16 16 GLN GLN A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 SER 19 18 18 SER SER A . n 
A 1 20 GLY 20 19 19 GLY GLY A . n 
A 1 21 ARG 21 20 20 ARG ARG A . n 
A 1 22 GLU 22 21 21 GLU GLU A . n 
A 1 23 GLY 23 22 22 GLY GLY A . n 
A 1 24 ASP 24 23 23 ASP ASP A . n 
A 1 25 LYS 25 24 24 LYS LYS A . n 
A 1 26 HIS 26 25 25 HIS HIS A . n 
A 1 27 LYS 27 26 26 LYS LYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LYS 30 29 29 LYS LYS A . n 
A 1 31 SER 31 30 30 SER SER A . n 
A 1 32 GLU 32 31 31 GLU GLU A . n 
A 1 33 LEU 33 32 32 LEU LEU A . n 
A 1 34 LYS 34 33 33 LYS LYS A . n 
A 1 35 GLU 35 34 34 GLU GLU A . n 
A 1 36 LEU 36 35 35 LEU LEU A . n 
A 1 37 ILE 37 36 36 ILE ILE A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 ASN 39 38 38 ASN ASN A . n 
A 1 40 GLU 40 39 39 GLU GLU A . n 
A 1 41 LEU 41 40 40 LEU LEU A . n 
A 1 42 SER 42 41 41 SER SER A . n 
A 1 43 HIS 43 42 42 HIS HIS A . n 
A 1 44 PHE 44 43 43 PHE PHE A . n 
A 1 45 LEU 45 44 44 LEU LEU A . n 
A 1 46 GLU 46 45 45 GLU GLU A . n 
A 1 47 GLU 47 46 46 GLU GLU A . n 
A 1 48 ILE 48 47 47 ILE ILE A . n 
A 1 49 LYS 49 48 48 LYS LYS A . n 
A 1 50 GLU 50 49 49 GLU GLU A . n 
A 1 51 GLN 51 50 50 GLN GLN A . n 
A 1 52 GLU 52 51 51 GLU GLU A . n 
A 1 53 VAL 53 52 52 VAL VAL A . n 
A 1 54 VAL 54 53 53 VAL VAL A . n 
A 1 55 ASP 55 54 54 ASP ASP A . n 
A 1 56 LYS 56 55 55 LYS LYS A . n 
A 1 57 VAL 57 56 56 VAL VAL A . n 
A 1 58 MET 58 57 57 MET MET A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 THR 60 59 59 THR THR A . n 
A 1 61 LEU 61 60 60 LEU LEU A . n 
A 1 62 ASP 62 61 61 ASP ASP A . n 
A 1 63 SER 63 62 62 SER SER A . n 
A 1 64 ASP 64 63 63 ASP ASP A . n 
A 1 65 GLY 65 64 64 GLY GLY A . n 
A 1 66 ASP 66 65 65 ASP ASP A . n 
A 1 67 GLY 67 66 66 GLY GLY A . n 
A 1 68 GLU 68 67 67 GLU GLU A . n 
A 1 69 CYS 69 68 68 CYS CYS A . n 
A 1 70 ASP 70 69 69 ASP ASP A . n 
A 1 71 PHE 71 70 70 PHE PHE A . n 
A 1 72 GLN 72 71 71 GLN GLN A . n 
A 1 73 GLU 73 72 72 GLU GLU A . n 
A 1 74 PHE 74 73 73 PHE PHE A . n 
A 1 75 MET 75 74 74 MET MET A . n 
A 1 76 ALA 76 75 75 ALA ALA A . n 
A 1 77 PHE 77 76 76 PHE PHE A . n 
A 1 78 VAL 78 77 77 VAL VAL A . n 
A 1 79 ALA 79 78 78 ALA ALA A . n 
A 1 80 MET 80 79 79 MET MET A . n 
A 1 81 ILE 81 80 80 ILE ILE A . n 
A 1 82 THR 82 81 81 THR THR A . n 
A 1 83 THR 83 82 82 THR THR A . n 
A 1 84 ALA 84 83 83 ALA ALA A . n 
A 1 85 CYS 85 84 84 CYS CYS A . n 
A 1 86 HIS 86 85 85 HIS HIS A . n 
A 1 87 GLU 87 86 86 GLU GLU A . n 
A 1 88 PHE 88 87 87 PHE PHE A . n 
A 1 89 PHE 89 88 ?  ?   ?   A . n 
A 1 90 GLU 90 89 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  90  90  CA  CA  A . 
C 2 CA  1  91  91  CA  CA  A . 
D 3 EMC 1  92  92  EMC EMC A . 
E 4 JKE 1  93  93  JKE JKE A . 
F 5 HOH 1  94  94  HOH HOH A . 
F 5 HOH 2  95  95  HOH HOH A . 
F 5 HOH 3  96  96  HOH HOH A . 
F 5 HOH 4  97  97  HOH HOH A . 
F 5 HOH 5  98  98  HOH HOH A . 
F 5 HOH 6  99  99  HOH HOH A . 
F 5 HOH 7  100 100 HOH HOH A . 
F 5 HOH 8  101 101 HOH HOH A . 
F 5 HOH 9  102 102 HOH HOH A . 
F 5 HOH 10 103 103 HOH HOH A . 
F 5 HOH 11 104 104 HOH HOH A . 
F 5 HOH 12 105 105 HOH HOH A . 
F 5 HOH 13 106 106 HOH HOH A . 
F 5 HOH 14 107 107 HOH HOH A . 
F 5 HOH 15 108 108 HOH HOH A . 
F 5 HOH 16 109 109 HOH HOH A . 
F 5 HOH 17 110 110 HOH HOH A . 
F 5 HOH 18 111 111 HOH HOH A . 
F 5 HOH 19 112 112 HOH HOH A . 
F 5 HOH 20 113 113 HOH HOH A . 
F 5 HOH 21 114 114 HOH HOH A . 
F 5 HOH 22 115 115 HOH HOH A . 
F 5 HOH 23 116 116 HOH HOH A . 
F 5 HOH 24 117 117 HOH HOH A . 
F 5 HOH 25 118 118 HOH HOH A . 
F 5 HOH 26 119 119 HOH HOH A . 
F 5 HOH 27 120 120 HOH HOH A . 
F 5 HOH 28 121 121 HOH HOH A . 
F 5 HOH 29 122 122 HOH HOH A . 
F 5 HOH 30 123 123 HOH HOH A . 
F 5 HOH 31 124 124 HOH HOH A . 
F 5 HOH 32 125 125 HOH HOH A . 
F 5 HOH 33 126 126 HOH HOH A . 
F 5 HOH 34 127 127 HOH HOH A . 
F 5 HOH 35 128 128 HOH HOH A . 
F 5 HOH 36 129 129 HOH HOH A . 
F 5 HOH 37 130 130 HOH HOH A . 
F 5 HOH 38 131 131 HOH HOH A . 
F 5 HOH 39 132 132 HOH HOH A . 
F 5 HOH 40 133 133 HOH HOH A . 
F 5 HOH 41 134 134 HOH HOH A . 
F 5 HOH 42 135 135 HOH HOH A . 
F 5 HOH 43 136 136 HOH HOH A . 
F 5 HOH 44 137 137 HOH HOH A . 
F 5 HOH 45 138 138 HOH HOH A . 
F 5 HOH 46 139 139 HOH HOH A . 
F 5 HOH 47 140 140 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2640 ? 
1 MORE         -29  ? 
1 'SSA (A^2)'  9400 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     138 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? F HOH .  ? A HOH 105 ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 62 ? A ASP 61  ? 1_555 162.6 ? 
2  O   ? F HOH .  ? A HOH 105 ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 81.3  ? 
3  OD1 ? A ASP 62 ? A ASP 61  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 82.3  ? 
4  O   ? F HOH .  ? A HOH 105 ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 100.2 ? 
5  OD1 ? A ASP 62 ? A ASP 61  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 83.1  ? 
6  OD1 ? A ASP 66 ? A ASP 65  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 81.9  ? 
7  O   ? F HOH .  ? A HOH 105 ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 86.3  ? 
8  OD1 ? A ASP 62 ? A ASP 61  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 111.0 ? 
9  OD1 ? A ASP 66 ? A ASP 65  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 153.3 ? 
10 O   ? A GLU 68 ? A GLU 67  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 77.2  ? 
11 O   ? F HOH .  ? A HOH 105 ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 89.4  ? 
12 OD1 ? A ASP 62 ? A ASP 61  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 82.9  ? 
13 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 82.7  ? 
14 O   ? A GLU 68 ? A GLU 67  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 160.3 ? 
15 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 120.9 ? 
16 O   ? F HOH .  ? A HOH 105 ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 101.7 ? 
17 OD1 ? A ASP 62 ? A ASP 61  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 90.8  ? 
18 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 154.5 ? 
19 O   ? A GLU 68 ? A GLU 67  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 121.8 ? 
20 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 51.5  ? 
21 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 CA ? B CA  . ? A CA  90 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 72.1  ? 
22 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A SER 19 ? A SER 18  ? 1_555 99.9  ? 
23 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A GLU 22 ? A GLU 21  ? 1_555 115.2 ? 
24 O   ? A SER 19 ? A SER 18  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A GLU 22 ? A GLU 21  ? 1_555 106.2 ? 
25 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 159.5 ? 
26 O   ? A SER 19 ? A SER 18  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 78.3  ? 
27 O   ? A GLU 22 ? A GLU 21  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 84.5  ? 
28 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? F HOH .  ? A HOH 120 ? 1_555 84.2  ? 
29 O   ? A SER 19 ? A SER 18  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? F HOH .  ? A HOH 120 ? 1_555 170.2 ? 
30 O   ? A GLU 22 ? A GLU 21  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? F HOH .  ? A HOH 120 ? 1_555 79.6  ? 
31 O   ? A ASP 24 ? A ASP 23  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? F HOH .  ? A HOH 120 ? 1_555 94.7  ? 
32 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 76.6  ? 
33 O   ? A SER 19 ? A SER 18  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 86.7  ? 
34 O   ? A GLU 22 ? A GLU 21  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 159.8 ? 
35 O   ? A ASP 24 ? A ASP 23  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 83.0  ? 
36 O   ? F HOH .  ? A HOH 120 ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 85.6  ? 
37 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 51.5  ? 
38 O   ? A SER 19 ? A SER 18  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 80.1  ? 
39 O   ? A GLU 22 ? A GLU 21  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 76.1  ? 
40 O   ? A ASP 24 ? A ASP 23  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 145.5 ? 
41 O   ? F HOH .  ? A HOH 120 ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 109.2 ? 
42 O   ? A LYS 27 ? A LYS 26  ? 1_555 CA ? C CA  . ? A CA  91 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 122.2 ? 
43 SG  ? A CYS 85 ? A CYS 84  ? 1_555 HG ? D EMC . ? A EMC 92 ? 1_555 C1  ? D EMC .  ? A EMC 92  ? 1_555 96.6  ? 
44 SG  ? A CYS 85 ? A CYS 84  ? 1_555 HG ? D EMC . ? A EMC 92 ? 1_555 O   ? F HOH .  ? A HOH 126 ? 1_555 127.8 ? 
45 C1  ? D EMC .  ? A EMC 92  ? 1_555 HG ? D EMC . ? A EMC 92 ? 1_555 O   ? F HOH .  ? A HOH 126 ? 1_555 79.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-29 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 3.1750   -5.8918 2.5575   -0.1546 -0.1674 0.1036  -0.0056 -0.0391 -0.0122 10.4199 63.1761 24.2491 
-7.0713  7.1293   -4.1961 -0.1393 0.5578  -0.4185 -0.1335 0.8244  -1.8171 -1.2259 0.6508  1.1627  
'X-RAY DIFFRACTION' 2 ? refined -1.6632  5.4507  6.5898   -0.0171 -0.1349 -0.0641 -0.0202 -0.0876 0.0181  3.1629  52.5880 3.7101  
-12.6881 -2.8727  12.8878 -0.1815 0.5415  -0.3600 -0.4643 -0.2821 -0.5451 0.8167  -0.0712 0.5447  
'X-RAY DIFFRACTION' 3 ? refined -5.5622  16.2905 4.8908   -0.1338 -0.2019 -0.1562 -0.0141 -0.0194 -0.0134 7.3057  5.7084  8.4656  
0.0507   -2.8456  0.1655  -0.1109 0.0029  0.1080  -0.4458 0.2407  -0.1921 0.5760  -0.4530 0.0761  
'X-RAY DIFFRACTION' 4 ? refined -10.9824 16.9433 -5.1511  -0.1452 -0.1820 -0.1397 -0.0151 -0.0226 -0.0242 7.0948  6.4506  5.3708  
-1.2560  -2.2138  0.0150  0.0389  -0.1176 0.0787  0.2390  -0.0567 0.4114  -0.4155 -0.1392 -0.0565 
'X-RAY DIFFRACTION' 5 ? refined -12.6618 8.3837  3.4370   -0.1642 -0.1923 0.0041  -0.0208 0.0735  0.0443  6.0901  13.6623 8.5956  
-2.6569  -2.9671  4.3755  -0.1949 0.2616  -0.0667 -0.3747 -0.3042 0.7156  0.7250  0.0859  0.0913  
'X-RAY DIFFRACTION' 6 ? refined -8.0756  1.9937  -11.7932 0.2670  0.0295  0.1874  -0.1781 0.0393  0.0207  25.3815 4.2670  29.9287 
6.3681   -18.7978 1.8202  -1.2537 0.8577  0.3960  2.0040  -0.6077 -0.0382 -1.7978 0.8231  -1.0268 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1  A 5  ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 6  A 16 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 17 A 40 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 A 41 A 63 ? . . . . ? 
'X-RAY DIFFRACTION' 5 5 A 64 A 78 ? . . . . ? 
'X-RAY DIFFRACTION' 6 6 A 79 A 87 ? . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     3LK1 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           29.500 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        29.500 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .     ?                          package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .     ?                          package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 PHASER      1.3.3 'Tue Nov 14 15:28:12 2006' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .     ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.005 'June 11, 2008'            package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 HKL-2000    .     ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
7 HKL-2000    .     ?                          ?       ?                    ?                           'data scaling'    ? ? ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PHE 
_pdbx_validate_rmsd_bond.auth_seq_id_1             87 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            O 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PHE 
_pdbx_validate_rmsd_bond.auth_seq_id_2             87 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.395 
_pdbx_validate_rmsd_bond.bond_target_value         1.229 
_pdbx_validate_rmsd_bond.bond_deviation            0.166 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 83 ? ? -65.05  4.26   
2 1 CYS A 84 ? ? -166.18 12.32  
3 1 HIS A 85 ? ? -49.91  74.58  
4 1 GLU A 86 ? ? -178.46 -49.45 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   CYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    84 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    85 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            65.49 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 0  ? CG  ? A MET 1  CG  
2  1 Y 1 A MET 0  ? SD  ? A MET 1  SD  
3  1 Y 1 A MET 0  ? CE  ? A MET 1  CE  
4  1 Y 1 A LYS 5  ? NZ  ? A LYS 6  NZ  
5  1 Y 1 A LYS 26 ? CE  ? A LYS 27 CE  
6  1 Y 1 A LYS 26 ? NZ  ? A LYS 27 NZ  
7  1 Y 1 A LYS 28 ? CE  ? A LYS 29 CE  
8  1 Y 1 A LYS 28 ? NZ  ? A LYS 29 NZ  
9  1 Y 1 A GLU 45 ? CD  ? A GLU 46 CD  
10 1 Y 1 A GLU 45 ? OE1 ? A GLU 46 OE1 
11 1 Y 1 A GLU 45 ? OE2 ? A GLU 46 OE2 
12 1 Y 1 A GLN 71 ? OE1 ? A GLN 72 OE1 
13 1 Y 1 A GLN 71 ? NE2 ? A GLN 72 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PHE 88 ? A PHE 89 
2 1 Y 1 A GLU 89 ? A GLU 90 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'            CA  
3 'ETHYL MERCURY ION'      EMC 
4 '2-sulfanylbenzoic acid' JKE 
5 water                    HOH 
#