data_3LMG
# 
_entry.id   3LMG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LMG         
RCSB  RCSB057458   
WWPDB D_1000057458 
# 
_pdbx_database_status.entry_id                        3LMG 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-30 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shi, F.'      1 
'Lemmon, M.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'ErbB3/HER3 intracellular domain is competent to bind ATP and catalyze autophosphorylation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            107 
_citation.page_first                7692 
_citation.page_last                 7697 
_citation.year                      2010 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20351256 
_citation.pdbx_database_id_DOI      10.1073/pnas.1002753107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shi, F.'           1 
primary 'Telesco, S.E.'     2 
primary 'Liu, Y.'           3 
primary 'Radhakrishnan, R.' 4 
primary 'Lemmon, M.A.'      5 
# 
_cell.length_a           193.348 
_cell.length_b           47.981 
_cell.length_c           82.224 
_cell.angle_alpha        90.000 
_cell.angle_beta         108.110 
_cell.angle_gamma        90.000 
_cell.entry_id           3LMG 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         3LMG 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Receptor tyrosine-protein kinase erbB-3'     38733.570 2 2.7.10.1 ? 
'Tyrosine Kinase Domain (UNP residues 684-1020)' ? 
2 non-polymer syn 'MAGNESIUM ION'                               24.305    2 ?        ? ? ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   2 ?        ? ? ? 
4 water       nat water                                         18.015    7 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'c-erbB3, Tyrosine kinase-type cell surface receptor HER3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAV
TDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLA
ARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLR
LAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLT
NKKLEEVELEPELDLDLDLEAEED
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAV
TDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLA
ARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLR
LAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLT
NKKLEEVELEPELDLDLDLEAEED
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   GLY n 
1 9   GLU n 
1 10  SER n 
1 11  ILE n 
1 12  GLU n 
1 13  PRO n 
1 14  LEU n 
1 15  ASP n 
1 16  PRO n 
1 17  SER n 
1 18  GLU n 
1 19  LYS n 
1 20  ALA n 
1 21  ASN n 
1 22  LYS n 
1 23  VAL n 
1 24  LEU n 
1 25  ALA n 
1 26  ARG n 
1 27  ILE n 
1 28  PHE n 
1 29  LYS n 
1 30  GLU n 
1 31  THR n 
1 32  GLU n 
1 33  LEU n 
1 34  ARG n 
1 35  LYS n 
1 36  LEU n 
1 37  LYS n 
1 38  VAL n 
1 39  LEU n 
1 40  GLY n 
1 41  SER n 
1 42  GLY n 
1 43  VAL n 
1 44  PHE n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  HIS n 
1 49  LYS n 
1 50  GLY n 
1 51  VAL n 
1 52  TRP n 
1 53  ILE n 
1 54  PRO n 
1 55  GLU n 
1 56  GLY n 
1 57  GLU n 
1 58  SER n 
1 59  ILE n 
1 60  LYS n 
1 61  ILE n 
1 62  PRO n 
1 63  VAL n 
1 64  CYS n 
1 65  ILE n 
1 66  LYS n 
1 67  VAL n 
1 68  ILE n 
1 69  GLU n 
1 70  ASP n 
1 71  LYS n 
1 72  SER n 
1 73  GLY n 
1 74  ARG n 
1 75  GLN n 
1 76  SER n 
1 77  PHE n 
1 78  GLN n 
1 79  ALA n 
1 80  VAL n 
1 81  THR n 
1 82  ASP n 
1 83  HIS n 
1 84  MET n 
1 85  LEU n 
1 86  ALA n 
1 87  ILE n 
1 88  GLY n 
1 89  SER n 
1 90  LEU n 
1 91  ASP n 
1 92  HIS n 
1 93  ALA n 
1 94  HIS n 
1 95  ILE n 
1 96  VAL n 
1 97  ARG n 
1 98  LEU n 
1 99  LEU n 
1 100 GLY n 
1 101 LEU n 
1 102 CYS n 
1 103 PRO n 
1 104 GLY n 
1 105 SER n 
1 106 SER n 
1 107 LEU n 
1 108 GLN n 
1 109 LEU n 
1 110 VAL n 
1 111 THR n 
1 112 GLN n 
1 113 TYR n 
1 114 LEU n 
1 115 PRO n 
1 116 LEU n 
1 117 GLY n 
1 118 SER n 
1 119 LEU n 
1 120 LEU n 
1 121 ASP n 
1 122 HIS n 
1 123 VAL n 
1 124 ARG n 
1 125 GLN n 
1 126 HIS n 
1 127 ARG n 
1 128 GLY n 
1 129 ALA n 
1 130 LEU n 
1 131 GLY n 
1 132 PRO n 
1 133 GLN n 
1 134 LEU n 
1 135 LEU n 
1 136 LEU n 
1 137 ASN n 
1 138 TRP n 
1 139 GLY n 
1 140 VAL n 
1 141 GLN n 
1 142 ILE n 
1 143 ALA n 
1 144 LYS n 
1 145 GLY n 
1 146 MET n 
1 147 TYR n 
1 148 TYR n 
1 149 LEU n 
1 150 GLU n 
1 151 GLU n 
1 152 HIS n 
1 153 GLY n 
1 154 MET n 
1 155 VAL n 
1 156 HIS n 
1 157 ARG n 
1 158 ASN n 
1 159 LEU n 
1 160 ALA n 
1 161 ALA n 
1 162 ARG n 
1 163 ASN n 
1 164 VAL n 
1 165 LEU n 
1 166 LEU n 
1 167 LYS n 
1 168 SER n 
1 169 PRO n 
1 170 SER n 
1 171 GLN n 
1 172 VAL n 
1 173 GLN n 
1 174 VAL n 
1 175 ALA n 
1 176 ASP n 
1 177 PHE n 
1 178 GLY n 
1 179 VAL n 
1 180 ALA n 
1 181 ASP n 
1 182 LEU n 
1 183 LEU n 
1 184 PRO n 
1 185 PRO n 
1 186 ASP n 
1 187 ASP n 
1 188 LYS n 
1 189 GLN n 
1 190 LEU n 
1 191 LEU n 
1 192 TYR n 
1 193 SER n 
1 194 GLU n 
1 195 ALA n 
1 196 LYS n 
1 197 THR n 
1 198 PRO n 
1 199 ILE n 
1 200 LYS n 
1 201 TRP n 
1 202 MET n 
1 203 ALA n 
1 204 LEU n 
1 205 GLU n 
1 206 SER n 
1 207 ILE n 
1 208 HIS n 
1 209 PHE n 
1 210 GLY n 
1 211 LYS n 
1 212 TYR n 
1 213 THR n 
1 214 HIS n 
1 215 GLN n 
1 216 SER n 
1 217 ASP n 
1 218 VAL n 
1 219 TRP n 
1 220 SER n 
1 221 TYR n 
1 222 GLY n 
1 223 VAL n 
1 224 THR n 
1 225 VAL n 
1 226 TRP n 
1 227 GLU n 
1 228 LEU n 
1 229 MET n 
1 230 THR n 
1 231 PHE n 
1 232 GLY n 
1 233 ALA n 
1 234 GLU n 
1 235 PRO n 
1 236 TYR n 
1 237 ALA n 
1 238 GLY n 
1 239 LEU n 
1 240 ARG n 
1 241 LEU n 
1 242 ALA n 
1 243 GLU n 
1 244 VAL n 
1 245 PRO n 
1 246 ASP n 
1 247 LEU n 
1 248 LEU n 
1 249 GLU n 
1 250 LYS n 
1 251 GLY n 
1 252 GLU n 
1 253 ARG n 
1 254 LEU n 
1 255 ALA n 
1 256 GLN n 
1 257 PRO n 
1 258 GLN n 
1 259 ILE n 
1 260 CYS n 
1 261 THR n 
1 262 ILE n 
1 263 ASP n 
1 264 VAL n 
1 265 TYR n 
1 266 MET n 
1 267 VAL n 
1 268 MET n 
1 269 VAL n 
1 270 LYS n 
1 271 CYS n 
1 272 TRP n 
1 273 MET n 
1 274 ILE n 
1 275 ASP n 
1 276 GLU n 
1 277 ASN n 
1 278 ILE n 
1 279 ARG n 
1 280 PRO n 
1 281 THR n 
1 282 PHE n 
1 283 LYS n 
1 284 GLU n 
1 285 LEU n 
1 286 ALA n 
1 287 ASN n 
1 288 GLU n 
1 289 PHE n 
1 290 THR n 
1 291 ARG n 
1 292 MET n 
1 293 ALA n 
1 294 ARG n 
1 295 ASP n 
1 296 PRO n 
1 297 PRO n 
1 298 ARG n 
1 299 TYR n 
1 300 LEU n 
1 301 VAL n 
1 302 ILE n 
1 303 LYS n 
1 304 ARG n 
1 305 GLU n 
1 306 SER n 
1 307 GLY n 
1 308 PRO n 
1 309 GLY n 
1 310 ILE n 
1 311 ALA n 
1 312 PRO n 
1 313 GLY n 
1 314 PRO n 
1 315 GLU n 
1 316 PRO n 
1 317 HIS n 
1 318 GLY n 
1 319 LEU n 
1 320 THR n 
1 321 ASN n 
1 322 LYS n 
1 323 LYS n 
1 324 LEU n 
1 325 GLU n 
1 326 GLU n 
1 327 VAL n 
1 328 GLU n 
1 329 LEU n 
1 330 GLU n 
1 331 PRO n 
1 332 GLU n 
1 333 LEU n 
1 334 ASP n 
1 335 LEU n 
1 336 ASP n 
1 337 LEU n 
1 338 ASP n 
1 339 LEU n 
1 340 GLU n 
1 341 ALA n 
1 342 GLU n 
1 343 GLU n 
1 344 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ERBB3, HER3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFastBac1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERBB3_HUMAN 
_struct_ref.pdbx_db_accession          P21860 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAI
GSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLK
SPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDL
LEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEV
ELEPELDLDLDLEAEED
;
_struct_ref.pdbx_align_begin           684 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LMG A 8 ? 344 ? P21860 684 ? 1020 ? 665 1001 
2 1 3LMG B 8 ? 344 ? P21860 684 ? 1020 ? 665 1001 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LMG MET A 1 ? UNP P21860 ? ? 'EXPRESSION TAG' 658 1  
1 3LMG HIS A 2 ? UNP P21860 ? ? 'EXPRESSION TAG' 659 2  
1 3LMG HIS A 3 ? UNP P21860 ? ? 'EXPRESSION TAG' 660 3  
1 3LMG HIS A 4 ? UNP P21860 ? ? 'EXPRESSION TAG' 661 4  
1 3LMG HIS A 5 ? UNP P21860 ? ? 'EXPRESSION TAG' 662 5  
1 3LMG HIS A 6 ? UNP P21860 ? ? 'EXPRESSION TAG' 663 6  
1 3LMG HIS A 7 ? UNP P21860 ? ? 'EXPRESSION TAG' 664 7  
2 3LMG MET B 1 ? UNP P21860 ? ? 'EXPRESSION TAG' 658 8  
2 3LMG HIS B 2 ? UNP P21860 ? ? 'EXPRESSION TAG' 659 9  
2 3LMG HIS B 3 ? UNP P21860 ? ? 'EXPRESSION TAG' 660 10 
2 3LMG HIS B 4 ? UNP P21860 ? ? 'EXPRESSION TAG' 661 11 
2 3LMG HIS B 5 ? UNP P21860 ? ? 'EXPRESSION TAG' 662 12 
2 3LMG HIS B 6 ? UNP P21860 ? ? 'EXPRESSION TAG' 663 13 
2 3LMG HIS B 7 ? UNP P21860 ? ? 'EXPRESSION TAG' 664 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3LMG 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;50 mM MOPS pH7.4, 27% (w/v) PEG8000, 0.17 M ammonium sulfate and 15%(v/v) glycerol in well solution and 5mM MgCl2 and 1mM AMP-PNP in protein solution, VAPOR DIFFUSION, HANGING DROP, temperature 294K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-03-13 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97949 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97949 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     3LMG 
_reflns.d_resolution_high            2.800 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   16021 
_reflns.pdbx_Rmerge_I_obs            0.114 
_reflns.pdbx_netI_over_sigmaI        8.800 
_reflns.pdbx_chi_squared             1.444 
_reflns.pdbx_redundancy              6.300 
_reflns.percent_possible_obs         90.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   3 
_reflns.number_all                   17805 
_reflns.pdbx_Rsym_value              0.114 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.85 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.499 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_Rsym_value        0.499 
_reflns_shell.pdbx_chi_squared       1.390 
_reflns_shell.pdbx_redundancy        3.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      484 
_reflns_shell.percent_possible_all   55.30 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3LMG 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    89.140 
_refine.ls_number_reflns_obs                     16018 
_refine.ls_number_reflns_all                     17805 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.255 
_refine.ls_R_factor_R_work                       0.252 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 10.100 
_refine.ls_number_reflns_R_free                  1612 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               30.947 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.aniso_B[1][1]                            0.970 
_refine.aniso_B[2][2]                            -1.870 
_refine.aniso_B[3][3]                            1.640 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            1.190 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.912 
_refine.correlation_coeff_Fo_to_Fc_free          0.894 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.469 
_refine.overall_SU_ML                            0.371 
_refine.overall_SU_B                             38.690 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2GS7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                57.55 
_refine.B_iso_min                                2.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4217 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               4288 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       4382 0.006  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    5960 1.099  1.984  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 529  4.684  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 177  34.083 23.559 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 744  15.009 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 25   11.599 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         674  0.068  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   3211 0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2663 0.206  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4299 0.384  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            1719 0.307  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           1661 0.572  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.804 
_refine_ls_shell.d_res_low                        2.877 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               50.160 
_refine_ls_shell.number_reflns_R_work             589 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.333 
_refine_ls_shell.R_factor_R_free                  0.429 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                646 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LMG 
_struct.title                     'Crystal structure of the ERBB3 kinase domain in complex with AMP-PNP' 
_struct.pdbx_descriptor           'Receptor tyrosine-protein kinase erbB-3 (E.C.2.7.10.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LMG 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'ERBB3, HER3, tyrosine kinase domain, AMP-PNP, Nucleotide binding, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 29  ? THR A 31  ? LYS A 686 THR A 688 5 ? 3  
HELX_P HELX_P2  2  THR A 81  ? LEU A 90  ? THR A 738 LEU A 747 1 ? 10 
HELX_P HELX_P3  3  SER A 118 ? ARG A 127 ? SER A 775 ARG A 784 1 ? 10 
HELX_P HELX_P4  4  GLY A 128 ? LEU A 130 ? GLY A 785 LEU A 787 5 ? 3  
HELX_P HELX_P5  5  GLY A 131 ? HIS A 152 ? GLY A 788 HIS A 809 1 ? 22 
HELX_P HELX_P6  6  VAL A 179 ? LEU A 183 ? VAL A 836 LEU A 840 5 ? 5  
HELX_P HELX_P7  7  THR A 197 ? MET A 202 ? THR A 854 MET A 859 5 ? 6  
HELX_P HELX_P8  8  ALA A 203 ? GLY A 210 ? ALA A 860 GLY A 867 1 ? 8  
HELX_P HELX_P9  9  THR A 213 ? THR A 230 ? THR A 870 THR A 887 1 ? 18 
HELX_P HELX_P10 10 GLU A 243 ? LYS A 250 ? GLU A 900 LYS A 907 1 ? 8  
HELX_P HELX_P11 11 THR A 261 ? TRP A 272 ? THR A 918 TRP A 929 1 ? 12 
HELX_P HELX_P12 12 ASP A 275 ? ARG A 279 ? ASP A 932 ARG A 936 5 ? 5  
HELX_P HELX_P13 13 THR A 281 ? ARG A 294 ? THR A 938 ARG A 951 1 ? 14 
HELX_P HELX_P14 14 ASP A 295 ? LEU A 300 ? ASP A 952 LEU A 957 1 ? 6  
HELX_P HELX_P15 15 LYS B 29  ? THR B 31  ? LYS B 686 THR B 688 5 ? 3  
HELX_P HELX_P16 16 THR B 81  ? GLY B 88  ? THR B 738 GLY B 745 1 ? 8  
HELX_P HELX_P17 17 SER B 118 ? ARG B 127 ? SER B 775 ARG B 784 1 ? 10 
HELX_P HELX_P18 18 GLY B 128 ? LEU B 130 ? GLY B 785 LEU B 787 5 ? 3  
HELX_P HELX_P19 19 GLY B 131 ? HIS B 152 ? GLY B 788 HIS B 809 1 ? 22 
HELX_P HELX_P20 20 ALA B 160 ? ARG B 162 ? ALA B 817 ARG B 819 5 ? 3  
HELX_P HELX_P21 21 GLY B 178 ? LEU B 183 ? GLY B 835 LEU B 840 5 ? 6  
HELX_P HELX_P22 22 PRO B 198 ? MET B 202 ? PRO B 855 MET B 859 5 ? 5  
HELX_P HELX_P23 23 ALA B 203 ? GLY B 210 ? ALA B 860 GLY B 867 1 ? 8  
HELX_P HELX_P24 24 THR B 213 ? THR B 230 ? THR B 870 THR B 887 1 ? 18 
HELX_P HELX_P25 25 ALA B 242 ? LYS B 250 ? ALA B 899 LYS B 907 1 ? 9  
HELX_P HELX_P26 26 THR B 261 ? TRP B 272 ? THR B 918 TRP B 929 1 ? 12 
HELX_P HELX_P27 27 THR B 281 ? ARG B 294 ? THR B 938 ARG B 951 1 ? 14 
HELX_P HELX_P28 28 ASP B 295 ? LEU B 300 ? ASP B 952 LEU B 957 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C MG  .   MG  ? ? ? 1_555 D ANP . O2B ? ? A MG  202 A ANP 301 1_555 ? ? ? ? ? ? ? 1.845 ? 
metalc2  metalc ? ? E MG  .   MG  ? ? ? 1_555 F ANP . O2B ? ? B MG  202 B ANP 301 1_555 ? ? ? ? ? ? ? 1.862 ? 
metalc3  metalc ? ? C MG  .   MG  ? ? ? 1_555 D ANP . O2A ? ? A MG  202 A ANP 301 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc4  metalc ? ? B ASP 176 OD2 ? ? ? 1_555 E MG  . MG  ? ? B ASP 833 B MG  202 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc5  metalc ? ? C MG  .   MG  ? ? ? 1_555 D ANP . O1G ? ? A MG  202 A ANP 301 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc6  metalc ? ? A ASP 176 OD2 ? ? ? 1_555 C MG  . MG  ? ? A ASP 833 A MG  202 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc7  metalc ? ? E MG  .   MG  ? ? ? 1_555 F ANP . O2A ? ? B MG  202 B ANP 301 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc8  metalc ? ? B ASN 163 OD1 ? ? ? 1_555 E MG  . MG  ? ? B ASN 820 B MG  202 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc9  metalc ? ? E MG  .   MG  ? ? ? 1_555 F ANP . O1G ? ? B MG  202 B ANP 301 1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc10 metalc ? ? A ASN 163 OD1 ? ? ? 1_555 C MG  . MG  ? ? A ASN 820 A MG  202 1_555 ? ? ? ? ? ? ? 2.592 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           23 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            680 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LEU 
_struct_mon_prot_cis.pdbx_label_seq_id_2    24 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LEU 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     681 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       8.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 33  ? SER A 41  ? LEU A 690 SER A 698 
A 2 GLY A 45  ? TRP A 52  ? GLY A 702 TRP A 709 
A 3 ILE A 61  ? ILE A 68  ? ILE A 718 ILE A 725 
A 4 LEU A 107 ? GLN A 112 ? LEU A 764 GLN A 769 
A 5 LEU A 98  ? CYS A 102 ? LEU A 755 CYS A 759 
B 1 VAL A 164 ? SER A 168 ? VAL A 821 SER A 825 
B 2 GLN A 171 ? VAL A 174 ? GLN A 828 VAL A 831 
C 1 LEU B 33  ? SER B 41  ? LEU B 690 SER B 698 
C 2 GLY B 45  ? TRP B 52  ? GLY B 702 TRP B 709 
C 3 ILE B 61  ? ILE B 68  ? ILE B 718 ILE B 725 
C 4 LEU B 107 ? GLN B 112 ? LEU B 764 GLN B 769 
C 5 LEU B 98  ? CYS B 102 ? LEU B 755 CYS B 759 
D 1 VAL B 164 ? LEU B 166 ? VAL B 821 LEU B 823 
D 2 VAL B 172 ? VAL B 174 ? VAL B 829 VAL B 831 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 34  ? N ARG A 691 O VAL A 51  ? O VAL A 708 
A 2 3 N HIS A 48  ? N HIS A 705 O ILE A 65  ? O ILE A 722 
A 3 4 N CYS A 64  ? N CYS A 721 O THR A 111 ? O THR A 768 
A 4 5 O VAL A 110 ? O VAL A 767 N GLY A 100 ? N GLY A 757 
B 1 2 N LEU A 165 ? N LEU A 822 O GLN A 173 ? O GLN A 830 
C 1 2 N LYS B 37  ? N LYS B 694 O LYS B 49  ? O LYS B 706 
C 2 3 N THR B 46  ? N THR B 703 O VAL B 67  ? O VAL B 724 
C 3 4 N CYS B 64  ? N CYS B 721 O THR B 111 ? O THR B 768 
C 4 5 O GLN B 108 ? O GLN B 765 N CYS B 102 ? N CYS B 759 
D 1 2 N LEU B 165 ? N LEU B 822 O GLN B 173 ? O GLN B 830 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 202'  
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE ANP A 301' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 202'  
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  ANP D .   ? ANP A 301 . ? 1_555 ? 
2  AC1 3  ASN A 163 ? ASN A 820 . ? 1_555 ? 
3  AC1 3  ASP A 176 ? ASP A 833 . ? 1_555 ? 
4  AC2 19 MG  C .   ? MG  A 202 . ? 1_555 ? 
5  AC2 19 LEU A 39  ? LEU A 696 . ? 1_555 ? 
6  AC2 19 SER A 41  ? SER A 698 . ? 1_555 ? 
7  AC2 19 GLY A 42  ? GLY A 699 . ? 1_555 ? 
8  AC2 19 VAL A 43  ? VAL A 700 . ? 1_555 ? 
9  AC2 19 GLY A 45  ? GLY A 702 . ? 1_555 ? 
10 AC2 19 VAL A 47  ? VAL A 704 . ? 1_555 ? 
11 AC2 19 CYS A 64  ? CYS A 721 . ? 1_555 ? 
12 AC2 19 LYS A 66  ? LYS A 723 . ? 1_555 ? 
13 AC2 19 THR A 111 ? THR A 768 . ? 1_555 ? 
14 AC2 19 GLN A 112 ? GLN A 769 . ? 1_555 ? 
15 AC2 19 TYR A 113 ? TYR A 770 . ? 1_555 ? 
16 AC2 19 LEU A 114 ? LEU A 771 . ? 1_555 ? 
17 AC2 19 SER A 118 ? SER A 775 . ? 1_555 ? 
18 AC2 19 ASN A 158 ? ASN A 815 . ? 1_555 ? 
19 AC2 19 ARG A 162 ? ARG A 819 . ? 1_555 ? 
20 AC2 19 ASN A 163 ? ASN A 820 . ? 1_555 ? 
21 AC2 19 LEU A 165 ? LEU A 822 . ? 1_555 ? 
22 AC2 19 ASP A 176 ? ASP A 833 . ? 1_555 ? 
23 AC3 3  ANP F .   ? ANP B 301 . ? 1_555 ? 
24 AC3 3  ASN B 163 ? ASN B 820 . ? 1_555 ? 
25 AC3 3  ASP B 176 ? ASP B 833 . ? 1_555 ? 
26 AC4 18 MG  E .   ? MG  B 202 . ? 1_555 ? 
27 AC4 18 LEU B 39  ? LEU B 696 . ? 1_555 ? 
28 AC4 18 GLY B 40  ? GLY B 697 . ? 1_555 ? 
29 AC4 18 SER B 41  ? SER B 698 . ? 1_555 ? 
30 AC4 18 GLY B 42  ? GLY B 699 . ? 1_555 ? 
31 AC4 18 VAL B 43  ? VAL B 700 . ? 1_555 ? 
32 AC4 18 GLY B 45  ? GLY B 702 . ? 1_555 ? 
33 AC4 18 VAL B 47  ? VAL B 704 . ? 1_555 ? 
34 AC4 18 CYS B 64  ? CYS B 721 . ? 1_555 ? 
35 AC4 18 LYS B 66  ? LYS B 723 . ? 1_555 ? 
36 AC4 18 GLN B 112 ? GLN B 769 . ? 1_555 ? 
37 AC4 18 TYR B 113 ? TYR B 770 . ? 1_555 ? 
38 AC4 18 LEU B 114 ? LEU B 771 . ? 1_555 ? 
39 AC4 18 ASN B 158 ? ASN B 815 . ? 1_555 ? 
40 AC4 18 ARG B 162 ? ARG B 819 . ? 1_555 ? 
41 AC4 18 ASN B 163 ? ASN B 820 . ? 1_555 ? 
42 AC4 18 LEU B 165 ? LEU B 822 . ? 1_555 ? 
43 AC4 18 ASP B 176 ? ASP B 833 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3LMG 
_atom_sites.fract_transf_matrix[1][1]   0.005172 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001691 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020842 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012796 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 23  ? 31.080  -44.706 58.946 1.00 29.63 ? 680  VAL A N     1 
ATOM   2    C  CA    . VAL A 1 23  ? 31.477  -43.265 58.890 1.00 29.62 ? 680  VAL A CA    1 
ATOM   3    C  C     . VAL A 1 23  ? 32.251  -42.954 57.593 1.00 29.61 ? 680  VAL A C     1 
ATOM   4    O  O     . VAL A 1 23  ? 33.443  -42.624 57.605 1.00 29.59 ? 680  VAL A O     1 
ATOM   5    C  CB    . VAL A 1 23  ? 32.215  -42.820 60.193 1.00 29.63 ? 680  VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 23  ? 33.456  -43.683 60.461 1.00 29.73 ? 680  VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 23  ? 32.539  -41.326 60.172 1.00 29.54 ? 680  VAL A CG2   1 
ATOM   8    N  N     . LEU A 1 24  ? 31.538  -43.079 56.475 1.00 29.57 ? 681  LEU A N     1 
ATOM   9    C  CA    . LEU A 1 24  ? 32.077  -42.800 55.143 1.00 29.52 ? 681  LEU A CA    1 
ATOM   10   C  C     . LEU A 1 24  ? 30.972  -42.356 54.178 1.00 29.46 ? 681  LEU A C     1 
ATOM   11   O  O     . LEU A 1 24  ? 29.800  -42.697 54.364 1.00 29.55 ? 681  LEU A O     1 
ATOM   12   C  CB    . LEU A 1 24  ? 32.852  -44.012 54.587 1.00 29.52 ? 681  LEU A CB    1 
ATOM   13   C  CG    . LEU A 1 24  ? 32.259  -45.412 54.314 1.00 29.54 ? 681  LEU A CG    1 
ATOM   14   C  CD1   . LEU A 1 24  ? 31.593  -46.043 55.542 1.00 29.48 ? 681  LEU A CD1   1 
ATOM   15   C  CD2   . LEU A 1 24  ? 31.320  -45.442 53.100 1.00 29.53 ? 681  LEU A CD2   1 
ATOM   16   N  N     . ALA A 1 25  ? 31.350  -41.591 53.157 1.00 29.29 ? 682  ALA A N     1 
ATOM   17   C  CA    . ALA A 1 25  ? 30.405  -41.142 52.133 1.00 29.08 ? 682  ALA A CA    1 
ATOM   18   C  C     . ALA A 1 25  ? 30.988  -41.341 50.741 1.00 29.00 ? 682  ALA A C     1 
ATOM   19   O  O     . ALA A 1 25  ? 32.165  -41.054 50.511 1.00 28.94 ? 682  ALA A O     1 
ATOM   20   C  CB    . ALA A 1 25  ? 30.041  -39.680 52.347 1.00 29.07 ? 682  ALA A CB    1 
ATOM   21   N  N     . ARG A 1 26  ? 30.153  -41.821 49.821 1.00 28.93 ? 683  ARG A N     1 
ATOM   22   C  CA    . ARG A 1 26  ? 30.555  -42.025 48.430 1.00 28.90 ? 683  ARG A CA    1 
ATOM   23   C  C     . ARG A 1 26  ? 30.760  -40.710 47.679 1.00 28.89 ? 683  ARG A C     1 
ATOM   24   O  O     . ARG A 1 26  ? 29.985  -39.765 47.837 1.00 28.85 ? 683  ARG A O     1 
ATOM   25   C  CB    . ARG A 1 26  ? 29.537  -42.897 47.692 1.00 28.92 ? 683  ARG A CB    1 
ATOM   26   C  CG    . ARG A 1 26  ? 29.455  -42.609 46.202 1.00 28.97 ? 683  ARG A CG    1 
ATOM   27   C  CD    . ARG A 1 26  ? 28.494  -43.523 45.503 1.00 29.13 ? 683  ARG A CD    1 
ATOM   28   N  NE    . ARG A 1 26  ? 29.130  -44.754 45.057 1.00 29.58 ? 683  ARG A NE    1 
ATOM   29   C  CZ    . ARG A 1 26  ? 29.764  -44.913 43.898 1.00 29.67 ? 683  ARG A CZ    1 
ATOM   30   N  NH1   . ARG A 1 26  ? 29.862  -43.907 43.038 1.00 29.58 ? 683  ARG A NH1   1 
ATOM   31   N  NH2   . ARG A 1 26  ? 30.305  -46.087 43.595 1.00 29.71 ? 683  ARG A NH2   1 
ATOM   32   N  N     . ILE A 1 27  ? 31.807  -40.668 46.859 1.00 28.96 ? 684  ILE A N     1 
ATOM   33   C  CA    . ILE A 1 27  ? 32.058  -39.532 45.980 1.00 29.09 ? 684  ILE A CA    1 
ATOM   34   C  C     . ILE A 1 27  ? 31.656  -39.895 44.556 1.00 29.30 ? 684  ILE A C     1 
ATOM   35   O  O     . ILE A 1 27  ? 32.075  -40.927 44.028 1.00 29.28 ? 684  ILE A O     1 
ATOM   36   C  CB    . ILE A 1 27  ? 33.546  -39.083 46.021 1.00 29.06 ? 684  ILE A CB    1 
ATOM   37   C  CG1   . ILE A 1 27  ? 33.960  -38.684 47.446 1.00 28.91 ? 684  ILE A CG1   1 
ATOM   38   C  CG2   . ILE A 1 27  ? 33.818  -37.949 45.020 1.00 29.00 ? 684  ILE A CG2   1 
ATOM   39   C  CD1   . ILE A 1 27  ? 33.115  -37.584 48.092 1.00 28.65 ? 684  ILE A CD1   1 
ATOM   40   N  N     . PHE A 1 28  ? 30.835  -39.048 43.944 1.00 29.64 ? 685  PHE A N     1 
ATOM   41   C  CA    . PHE A 1 28  ? 30.396  -39.278 42.577 1.00 30.03 ? 685  PHE A CA    1 
ATOM   42   C  C     . PHE A 1 28  ? 31.176  -38.413 41.603 1.00 30.19 ? 685  PHE A C     1 
ATOM   43   O  O     . PHE A 1 28  ? 31.191  -37.181 41.726 1.00 30.21 ? 685  PHE A O     1 
ATOM   44   C  CB    . PHE A 1 28  ? 28.903  -38.983 42.427 1.00 30.09 ? 685  PHE A CB    1 
ATOM   45   C  CG    . PHE A 1 28  ? 28.009  -39.974 43.109 1.00 30.54 ? 685  PHE A CG    1 
ATOM   46   C  CD1   . PHE A 1 28  ? 27.649  -41.161 42.483 1.00 30.97 ? 685  PHE A CD1   1 
ATOM   47   C  CD2   . PHE A 1 28  ? 27.495  -39.706 44.360 1.00 31.03 ? 685  PHE A CD2   1 
ATOM   48   C  CE1   . PHE A 1 28  ? 26.802  -42.070 43.109 1.00 31.29 ? 685  PHE A CE1   1 
ATOM   49   C  CE2   . PHE A 1 28  ? 26.651  -40.612 44.987 1.00 31.41 ? 685  PHE A CE2   1 
ATOM   50   C  CZ    . PHE A 1 28  ? 26.302  -41.791 44.364 1.00 31.50 ? 685  PHE A CZ    1 
ATOM   51   N  N     . LYS A 1 29  ? 31.828  -39.065 40.642 1.00 30.43 ? 686  LYS A N     1 
ATOM   52   C  CA    . LYS A 1 29  ? 32.439  -38.368 39.515 1.00 30.73 ? 686  LYS A CA    1 
ATOM   53   C  C     . LYS A 1 29  ? 31.373  -37.532 38.805 1.00 30.84 ? 686  LYS A C     1 
ATOM   54   O  O     . LYS A 1 29  ? 30.206  -37.932 38.726 1.00 30.84 ? 686  LYS A O     1 
ATOM   55   C  CB    . LYS A 1 29  ? 33.043  -39.364 38.522 1.00 30.79 ? 686  LYS A CB    1 
ATOM   56   C  CG    . LYS A 1 29  ? 33.968  -40.423 39.118 1.00 31.07 ? 686  LYS A CG    1 
ATOM   57   C  CD    . LYS A 1 29  ? 34.353  -41.447 38.055 1.00 31.46 ? 686  LYS A CD    1 
ATOM   58   C  CE    . LYS A 1 29  ? 35.378  -42.448 38.568 1.00 31.68 ? 686  LYS A CE    1 
ATOM   59   N  NZ    . LYS A 1 29  ? 35.875  -43.333 37.472 1.00 31.69 ? 686  LYS A NZ    1 
ATOM   60   N  N     . GLU A 1 30  ? 31.781  -36.372 38.294 1.00 30.93 ? 687  GLU A N     1 
ATOM   61   C  CA    . GLU A 1 30  ? 30.876  -35.444 37.612 1.00 30.98 ? 687  GLU A CA    1 
ATOM   62   C  C     . GLU A 1 30  ? 30.195  -36.106 36.407 1.00 30.74 ? 687  GLU A C     1 
ATOM   63   O  O     . GLU A 1 30  ? 29.033  -35.826 36.109 1.00 30.69 ? 687  GLU A O     1 
ATOM   64   C  CB    . GLU A 1 30  ? 31.650  -34.195 37.171 1.00 31.14 ? 687  GLU A CB    1 
ATOM   65   C  CG    . GLU A 1 30  ? 30.790  -32.968 36.865 1.00 32.02 ? 687  GLU A CG    1 
ATOM   66   C  CD    . GLU A 1 30  ? 30.636  -32.023 38.052 1.00 33.13 ? 687  GLU A CD    1 
ATOM   67   O  OE1   . GLU A 1 30  ? 31.663  -31.649 38.663 1.00 33.36 ? 687  GLU A OE1   1 
ATOM   68   O  OE2   . GLU A 1 30  ? 29.486  -31.637 38.359 1.00 33.39 ? 687  GLU A OE2   1 
ATOM   69   N  N     . THR A 1 31  ? 30.934  -36.997 35.743 1.00 30.53 ? 688  THR A N     1 
ATOM   70   C  CA    . THR A 1 31  ? 30.494  -37.697 34.527 1.00 30.29 ? 688  THR A CA    1 
ATOM   71   C  C     . THR A 1 31  ? 29.544  -38.874 34.787 1.00 30.19 ? 688  THR A C     1 
ATOM   72   O  O     . THR A 1 31  ? 29.121  -39.562 33.852 1.00 30.15 ? 688  THR A O     1 
ATOM   73   C  CB    . THR A 1 31  ? 31.707  -38.213 33.712 1.00 30.29 ? 688  THR A CB    1 
ATOM   74   O  OG1   . THR A 1 31  ? 32.436  -39.175 34.487 1.00 30.18 ? 688  THR A OG1   1 
ATOM   75   C  CG2   . THR A 1 31  ? 32.636  -37.065 33.326 1.00 30.25 ? 688  THR A CG2   1 
ATOM   76   N  N     . GLU A 1 32  ? 29.226  -39.104 36.057 1.00 30.09 ? 689  GLU A N     1 
ATOM   77   C  CA    . GLU A 1 32  ? 28.262  -40.127 36.456 1.00 29.98 ? 689  GLU A CA    1 
ATOM   78   C  C     . GLU A 1 32  ? 26.854  -39.546 36.558 1.00 29.79 ? 689  GLU A C     1 
ATOM   79   O  O     . GLU A 1 32  ? 25.867  -40.247 36.333 1.00 29.77 ? 689  GLU A O     1 
ATOM   80   C  CB    . GLU A 1 32  ? 28.652  -40.723 37.807 1.00 30.07 ? 689  GLU A CB    1 
ATOM   81   C  CG    . GLU A 1 32  ? 29.845  -41.660 37.787 1.00 30.35 ? 689  GLU A CG    1 
ATOM   82   C  CD    . GLU A 1 32  ? 30.051  -42.362 39.120 1.00 30.78 ? 689  GLU A CD    1 
ATOM   83   O  OE1   . GLU A 1 32  ? 30.396  -43.563 39.107 1.00 31.13 ? 689  GLU A OE1   1 
ATOM   84   O  OE2   . GLU A 1 32  ? 29.868  -41.721 40.178 1.00 30.73 ? 689  GLU A OE2   1 
ATOM   85   N  N     . LEU A 1 33  ? 26.774  -38.263 36.900 1.00 29.57 ? 690  LEU A N     1 
ATOM   86   C  CA    . LEU A 1 33  ? 25.499  -37.592 37.128 1.00 29.45 ? 690  LEU A CA    1 
ATOM   87   C  C     . LEU A 1 33  ? 25.057  -36.759 35.939 1.00 29.34 ? 690  LEU A C     1 
ATOM   88   O  O     . LEU A 1 33  ? 25.867  -36.070 35.313 1.00 29.42 ? 690  LEU A O     1 
ATOM   89   C  CB    . LEU A 1 33  ? 25.585  -36.692 38.359 1.00 29.47 ? 690  LEU A CB    1 
ATOM   90   C  CG    . LEU A 1 33  ? 25.994  -37.358 39.671 1.00 29.65 ? 690  LEU A CG    1 
ATOM   91   C  CD1   . LEU A 1 33  ? 26.375  -36.303 40.699 1.00 29.66 ? 690  LEU A CD1   1 
ATOM   92   C  CD2   . LEU A 1 33  ? 24.901  -38.290 40.199 1.00 29.64 ? 690  LEU A CD2   1 
ATOM   93   N  N     . ARG A 1 34  ? 23.763  -36.822 35.642 1.00 29.07 ? 691  ARG A N     1 
ATOM   94   C  CA    . ARG A 1 34  ? 23.170  -35.997 34.602 1.00 28.88 ? 691  ARG A CA    1 
ATOM   95   C  C     . ARG A 1 34  ? 21.836  -35.436 35.090 1.00 28.49 ? 691  ARG A C     1 
ATOM   96   O  O     . ARG A 1 34  ? 21.005  -36.177 35.614 1.00 28.49 ? 691  ARG A O     1 
ATOM   97   C  CB    . ARG A 1 34  ? 22.981  -36.816 33.324 1.00 29.05 ? 691  ARG A CB    1 
ATOM   98   C  CG    . ARG A 1 34  ? 22.996  -35.994 32.049 1.00 29.89 ? 691  ARG A CG    1 
ATOM   99   C  CD    . ARG A 1 34  ? 23.051  -36.890 30.823 1.00 31.51 ? 691  ARG A CD    1 
ATOM   100  N  NE    . ARG A 1 34  ? 23.337  -36.132 29.606 1.00 32.86 ? 691  ARG A NE    1 
ATOM   101  C  CZ    . ARG A 1 34  ? 22.413  -35.619 28.795 1.00 33.69 ? 691  ARG A CZ    1 
ATOM   102  N  NH1   . ARG A 1 34  ? 21.120  -35.774 29.058 1.00 34.17 ? 691  ARG A NH1   1 
ATOM   103  N  NH2   . ARG A 1 34  ? 22.786  -34.947 27.714 1.00 33.98 ? 691  ARG A NH2   1 
ATOM   104  N  N     . LYS A 1 35  ? 21.639  -34.131 34.923 1.00 28.05 ? 692  LYS A N     1 
ATOM   105  C  CA    . LYS A 1 35  ? 20.396  -33.477 35.342 1.00 27.66 ? 692  LYS A CA    1 
ATOM   106  C  C     . LYS A 1 35  ? 19.389  -33.397 34.201 1.00 27.40 ? 692  LYS A C     1 
ATOM   107  O  O     . LYS A 1 35  ? 19.714  -32.912 33.113 1.00 27.36 ? 692  LYS A O     1 
ATOM   108  C  CB    . LYS A 1 35  ? 20.673  -32.066 35.851 1.00 27.66 ? 692  LYS A CB    1 
ATOM   109  C  CG    . LYS A 1 35  ? 21.561  -31.993 37.066 1.00 27.75 ? 692  LYS A CG    1 
ATOM   110  C  CD    . LYS A 1 35  ? 21.785  -30.543 37.435 1.00 27.97 ? 692  LYS A CD    1 
ATOM   111  C  CE    . LYS A 1 35  ? 22.975  -30.398 38.345 1.00 27.97 ? 692  LYS A CE    1 
ATOM   112  N  NZ    . LYS A 1 35  ? 23.523  -29.018 38.302 1.00 28.07 ? 692  LYS A NZ    1 
ATOM   113  N  N     . LEU A 1 36  ? 18.166  -33.859 34.453 1.00 27.10 ? 693  LEU A N     1 
ATOM   114  C  CA    . LEU A 1 36  ? 17.114  -33.820 33.432 1.00 26.82 ? 693  LEU A CA    1 
ATOM   115  C  C     . LEU A 1 36  ? 16.202  -32.603 33.552 1.00 26.61 ? 693  LEU A C     1 
ATOM   116  O  O     . LEU A 1 36  ? 16.006  -31.867 32.582 1.00 26.53 ? 693  LEU A O     1 
ATOM   117  C  CB    . LEU A 1 36  ? 16.267  -35.099 33.443 1.00 26.83 ? 693  LEU A CB    1 
ATOM   118  C  CG    . LEU A 1 36  ? 16.743  -36.394 32.771 1.00 26.81 ? 693  LEU A CG    1 
ATOM   119  C  CD1   . LEU A 1 36  ? 17.703  -36.169 31.597 1.00 26.96 ? 693  LEU A CD1   1 
ATOM   120  C  CD2   . LEU A 1 36  ? 17.350  -37.318 33.793 1.00 26.81 ? 693  LEU A CD2   1 
ATOM   121  N  N     . LYS A 1 37  ? 15.640  -32.408 34.740 1.00 26.40 ? 694  LYS A N     1 
ATOM   122  C  CA    . LYS A 1 37  ? 14.668  -31.351 34.980 1.00 26.24 ? 694  LYS A CA    1 
ATOM   123  C  C     . LYS A 1 37  ? 14.872  -30.774 36.372 1.00 25.82 ? 694  LYS A C     1 
ATOM   124  O  O     . LYS A 1 37  ? 15.254  -31.492 37.293 1.00 25.79 ? 694  LYS A O     1 
ATOM   125  C  CB    . LYS A 1 37  ? 13.254  -31.921 34.862 1.00 26.39 ? 694  LYS A CB    1 
ATOM   126  C  CG    . LYS A 1 37  ? 12.121  -30.907 35.028 1.00 27.15 ? 694  LYS A CG    1 
ATOM   127  C  CD    . LYS A 1 37  ? 10.875  -31.558 35.638 1.00 28.51 ? 694  LYS A CD    1 
ATOM   128  C  CE    . LYS A 1 37  ? 10.176  -32.524 34.667 1.00 29.08 ? 694  LYS A CE    1 
ATOM   129  N  NZ    . LYS A 1 37  ? 10.871  -33.851 34.536 1.00 29.67 ? 694  LYS A NZ    1 
ATOM   130  N  N     . VAL A 1 38  ? 14.614  -29.478 36.519 1.00 25.33 ? 695  VAL A N     1 
ATOM   131  C  CA    . VAL A 1 38  ? 14.625  -28.845 37.835 1.00 24.89 ? 695  VAL A CA    1 
ATOM   132  C  C     . VAL A 1 38  ? 13.264  -29.044 38.510 1.00 24.74 ? 695  VAL A C     1 
ATOM   133  O  O     . VAL A 1 38  ? 12.227  -28.991 37.847 1.00 24.73 ? 695  VAL A O     1 
ATOM   134  C  CB    . VAL A 1 38  ? 15.011  -27.336 37.749 1.00 24.83 ? 695  VAL A CB    1 
ATOM   135  C  CG1   . VAL A 1 38  ? 13.896  -26.502 37.120 1.00 24.82 ? 695  VAL A CG1   1 
ATOM   136  C  CG2   . VAL A 1 38  ? 15.375  -26.786 39.128 1.00 24.63 ? 695  VAL A CG2   1 
ATOM   137  N  N     . LEU A 1 39  ? 13.267  -29.296 39.815 1.00 24.55 ? 696  LEU A N     1 
ATOM   138  C  CA    . LEU A 1 39  ? 12.015  -29.455 40.553 1.00 24.48 ? 696  LEU A CA    1 
ATOM   139  C  C     . LEU A 1 39  ? 11.646  -28.179 41.299 1.00 24.60 ? 696  LEU A C     1 
ATOM   140  O  O     . LEU A 1 39  ? 10.469  -27.825 41.399 1.00 24.58 ? 696  LEU A O     1 
ATOM   141  C  CB    . LEU A 1 39  ? 12.087  -30.637 41.526 1.00 24.39 ? 696  LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 39  ? 12.336  -32.042 40.963 1.00 24.22 ? 696  LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 39  ? 12.369  -33.067 42.088 1.00 24.07 ? 696  LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 39  ? 11.289  -32.429 39.924 1.00 24.18 ? 696  LEU A CD2   1 
ATOM   145  N  N     . GLY A 1 40  ? 12.662  -27.493 41.815 1.00 24.74 ? 697  GLY A N     1 
ATOM   146  C  CA    . GLY A 1 40  ? 12.465  -26.277 42.598 1.00 24.96 ? 697  GLY A CA    1 
ATOM   147  C  C     . GLY A 1 40  ? 13.694  -25.931 43.416 1.00 25.11 ? 697  GLY A C     1 
ATOM   148  O  O     . GLY A 1 40  ? 14.745  -26.559 43.269 1.00 25.12 ? 697  GLY A O     1 
ATOM   149  N  N     . SER A 1 41  ? 13.558  -24.931 44.282 1.00 25.30 ? 698  SER A N     1 
ATOM   150  C  CA    . SER A 1 41  ? 14.669  -24.474 45.109 1.00 25.51 ? 698  SER A CA    1 
ATOM   151  C  C     . SER A 1 41  ? 14.186  -23.896 46.429 1.00 25.93 ? 698  SER A C     1 
ATOM   152  O  O     . SER A 1 41  ? 13.200  -23.156 46.471 1.00 25.95 ? 698  SER A O     1 
ATOM   153  C  CB    . SER A 1 41  ? 15.492  -23.425 44.364 1.00 25.38 ? 698  SER A CB    1 
ATOM   154  O  OG    . SER A 1 41  ? 14.786  -22.201 44.265 1.00 25.03 ? 698  SER A OG    1 
ATOM   155  N  N     . GLY A 1 42  ? 14.896  -24.229 47.502 1.00 26.47 ? 699  GLY A N     1 
ATOM   156  C  CA    . GLY A 1 42  ? 14.590  -23.698 48.821 1.00 27.14 ? 699  GLY A CA    1 
ATOM   157  C  C     . GLY A 1 42  ? 15.618  -22.706 49.322 1.00 27.65 ? 699  GLY A C     1 
ATOM   158  O  O     . GLY A 1 42  ? 16.180  -21.927 48.547 1.00 27.61 ? 699  GLY A O     1 
ATOM   159  N  N     . VAL A 1 43  ? 15.866  -22.752 50.629 1.00 28.20 ? 700  VAL A N     1 
ATOM   160  C  CA    . VAL A 1 43  ? 16.679  -21.750 51.316 1.00 28.73 ? 700  VAL A CA    1 
ATOM   161  C  C     . VAL A 1 43  ? 18.158  -21.855 50.965 1.00 29.07 ? 700  VAL A C     1 
ATOM   162  O  O     . VAL A 1 43  ? 18.855  -20.841 50.893 1.00 29.18 ? 700  VAL A O     1 
ATOM   163  C  CB    . VAL A 1 43  ? 16.541  -21.849 52.855 1.00 28.72 ? 700  VAL A CB    1 
ATOM   164  C  CG1   . VAL A 1 43  ? 16.743  -20.483 53.498 1.00 28.71 ? 700  VAL A CG1   1 
ATOM   165  C  CG2   . VAL A 1 43  ? 15.193  -22.426 53.250 1.00 28.87 ? 700  VAL A CG2   1 
ATOM   166  N  N     . PHE A 1 44  ? 18.631  -23.075 50.740 1.00 29.42 ? 701  PHE A N     1 
ATOM   167  C  CA    . PHE A 1 44  ? 20.060  -23.307 50.587 1.00 29.75 ? 701  PHE A CA    1 
ATOM   168  C  C     . PHE A 1 44  ? 20.458  -23.780 49.201 1.00 30.04 ? 701  PHE A C     1 
ATOM   169  O  O     . PHE A 1 44  ? 21.540  -23.443 48.715 1.00 30.19 ? 701  PHE A O     1 
ATOM   170  C  CB    . PHE A 1 44  ? 20.545  -24.303 51.639 1.00 29.70 ? 701  PHE A CB    1 
ATOM   171  C  CG    . PHE A 1 44  ? 20.158  -23.933 53.044 1.00 29.60 ? 701  PHE A CG    1 
ATOM   172  C  CD1   . PHE A 1 44  ? 20.478  -22.679 53.562 1.00 29.35 ? 701  PHE A CD1   1 
ATOM   173  C  CD2   . PHE A 1 44  ? 19.477  -24.838 53.851 1.00 29.39 ? 701  PHE A CD2   1 
ATOM   174  C  CE1   . PHE A 1 44  ? 20.123  -22.332 54.859 1.00 29.18 ? 701  PHE A CE1   1 
ATOM   175  C  CE2   . PHE A 1 44  ? 19.119  -24.500 55.152 1.00 29.25 ? 701  PHE A CE2   1 
ATOM   176  C  CZ    . PHE A 1 44  ? 19.443  -23.244 55.656 1.00 29.18 ? 701  PHE A CZ    1 
ATOM   177  N  N     . GLY A 1 45  ? 19.585  -24.556 48.567 1.00 30.29 ? 702  GLY A N     1 
ATOM   178  C  CA    . GLY A 1 45  ? 19.923  -25.187 47.303 1.00 30.46 ? 702  GLY A CA    1 
ATOM   179  C  C     . GLY A 1 45  ? 18.835  -25.198 46.252 1.00 30.58 ? 702  GLY A C     1 
ATOM   180  O  O     . GLY A 1 45  ? 17.814  -24.519 46.382 1.00 30.62 ? 702  GLY A O     1 
ATOM   181  N  N     . THR A 1 46  ? 19.083  -25.983 45.207 1.00 30.63 ? 703  THR A N     1 
ATOM   182  C  CA    . THR A 1 46  ? 18.200  -26.121 44.058 1.00 30.61 ? 703  THR A CA    1 
ATOM   183  C  C     . THR A 1 46  ? 18.155  -27.596 43.688 1.00 30.65 ? 703  THR A C     1 
ATOM   184  O  O     . THR A 1 46  ? 19.183  -28.184 43.332 1.00 30.62 ? 703  THR A O     1 
ATOM   185  C  CB    . THR A 1 46  ? 18.741  -25.330 42.855 1.00 30.61 ? 703  THR A CB    1 
ATOM   186  O  OG1   . THR A 1 46  ? 19.182  -24.037 43.287 1.00 30.68 ? 703  THR A OG1   1 
ATOM   187  C  CG2   . THR A 1 46  ? 17.668  -25.170 41.782 1.00 30.61 ? 703  THR A CG2   1 
ATOM   188  N  N     . VAL A 1 47  ? 16.969  -28.194 43.767 1.00 30.67 ? 704  VAL A N     1 
ATOM   189  C  CA    . VAL A 1 47  ? 16.831  -29.637 43.567 1.00 30.74 ? 704  VAL A CA    1 
ATOM   190  C  C     . VAL A 1 47  ? 16.457  -29.979 42.121 1.00 30.87 ? 704  VAL A C     1 
ATOM   191  O  O     . VAL A 1 47  ? 15.516  -29.412 41.563 1.00 30.94 ? 704  VAL A O     1 
ATOM   192  C  CB    . VAL A 1 47  ? 15.823  -30.253 44.573 1.00 30.73 ? 704  VAL A CB    1 
ATOM   193  C  CG1   . VAL A 1 47  ? 15.685  -31.743 44.362 1.00 30.68 ? 704  VAL A CG1   1 
ATOM   194  C  CG2   . VAL A 1 47  ? 16.262  -29.977 46.000 1.00 30.52 ? 704  VAL A CG2   1 
ATOM   195  N  N     . HIS A 1 48  ? 17.209  -30.902 41.526 1.00 31.02 ? 705  HIS A N     1 
ATOM   196  C  CA    . HIS A 1 48  ? 17.003  -31.305 40.138 1.00 31.26 ? 705  HIS A CA    1 
ATOM   197  C  C     . HIS A 1 48  ? 16.742  -32.803 40.009 1.00 31.58 ? 705  HIS A C     1 
ATOM   198  O  O     . HIS A 1 48  ? 17.439  -33.621 40.616 1.00 31.56 ? 705  HIS A O     1 
ATOM   199  C  CB    . HIS A 1 48  ? 18.214  -30.924 39.279 1.00 31.16 ? 705  HIS A CB    1 
ATOM   200  C  CG    . HIS A 1 48  ? 18.418  -29.449 39.129 1.00 31.27 ? 705  HIS A CG    1 
ATOM   201  N  ND1   . HIS A 1 48  ? 18.022  -28.752 38.007 1.00 31.48 ? 705  HIS A ND1   1 
ATOM   202  C  CD2   . HIS A 1 48  ? 18.996  -28.540 39.950 1.00 31.70 ? 705  HIS A CD2   1 
ATOM   203  C  CE1   . HIS A 1 48  ? 18.337  -27.477 38.148 1.00 31.71 ? 705  HIS A CE1   1 
ATOM   204  N  NE2   . HIS A 1 48  ? 18.927  -27.321 39.319 1.00 31.95 ? 705  HIS A NE2   1 
ATOM   205  N  N     . LYS A 1 49  ? 15.724  -33.149 39.225 1.00 32.12 ? 706  LYS A N     1 
ATOM   206  C  CA    . LYS A 1 49  ? 15.478  -34.532 38.844 1.00 32.69 ? 706  LYS A CA    1 
ATOM   207  C  C     . LYS A 1 49  ? 16.547  -34.912 37.832 1.00 32.97 ? 706  LYS A C     1 
ATOM   208  O  O     . LYS A 1 49  ? 16.782  -34.191 36.858 1.00 32.97 ? 706  LYS A O     1 
ATOM   209  C  CB    . LYS A 1 49  ? 14.083  -34.681 38.236 1.00 32.76 ? 706  LYS A CB    1 
ATOM   210  C  CG    . LYS A 1 49  ? 13.433  -36.045 38.443 1.00 33.41 ? 706  LYS A CG    1 
ATOM   211  C  CD    . LYS A 1 49  ? 13.818  -37.052 37.364 1.00 34.46 ? 706  LYS A CD    1 
ATOM   212  C  CE    . LYS A 1 49  ? 12.716  -38.096 37.183 1.00 34.94 ? 706  LYS A CE    1 
ATOM   213  N  NZ    . LYS A 1 49  ? 13.203  -39.277 36.407 1.00 35.30 ? 706  LYS A NZ    1 
ATOM   214  N  N     . GLY A 1 50  ? 17.205  -36.037 38.078 1.00 33.39 ? 707  GLY A N     1 
ATOM   215  C  CA    . GLY A 1 50  ? 18.333  -36.435 37.260 1.00 33.97 ? 707  GLY A CA    1 
ATOM   216  C  C     . GLY A 1 50  ? 18.501  -37.931 37.156 1.00 34.44 ? 707  GLY A C     1 
ATOM   217  O  O     . GLY A 1 50  ? 17.680  -38.701 37.657 1.00 34.41 ? 707  GLY A O     1 
ATOM   218  N  N     . VAL A 1 51  ? 19.577  -38.334 36.492 1.00 34.97 ? 708  VAL A N     1 
ATOM   219  C  CA    . VAL A 1 51  ? 19.893  -39.737 36.292 1.00 35.59 ? 708  VAL A CA    1 
ATOM   220  C  C     . VAL A 1 51  ? 21.316  -40.003 36.771 1.00 36.10 ? 708  VAL A C     1 
ATOM   221  O  O     . VAL A 1 51  ? 22.147  -39.092 36.808 1.00 36.16 ? 708  VAL A O     1 
ATOM   222  C  CB    . VAL A 1 51  ? 19.707  -40.140 34.801 1.00 35.52 ? 708  VAL A CB    1 
ATOM   223  C  CG1   . VAL A 1 51  ? 20.513  -41.380 34.443 1.00 35.57 ? 708  VAL A CG1   1 
ATOM   224  C  CG2   . VAL A 1 51  ? 18.237  -40.378 34.502 1.00 35.61 ? 708  VAL A CG2   1 
ATOM   225  N  N     . TRP A 1 52  ? 21.586  -41.248 37.151 1.00 36.79 ? 709  TRP A N     1 
ATOM   226  C  CA    . TRP A 1 52  ? 22.936  -41.661 37.487 1.00 37.53 ? 709  TRP A CA    1 
ATOM   227  C  C     . TRP A 1 52  ? 23.415  -42.794 36.576 1.00 37.69 ? 709  TRP A C     1 
ATOM   228  O  O     . TRP A 1 52  ? 22.774  -43.843 36.500 1.00 37.72 ? 709  TRP A O     1 
ATOM   229  C  CB    . TRP A 1 52  ? 23.030  -42.058 38.963 1.00 37.75 ? 709  TRP A CB    1 
ATOM   230  C  CG    . TRP A 1 52  ? 24.406  -42.475 39.342 1.00 39.08 ? 709  TRP A CG    1 
ATOM   231  C  CD1   . TRP A 1 52  ? 25.567  -41.857 38.985 1.00 39.93 ? 709  TRP A CD1   1 
ATOM   232  C  CD2   . TRP A 1 52  ? 24.780  -43.602 40.142 1.00 40.32 ? 709  TRP A CD2   1 
ATOM   233  N  NE1   . TRP A 1 52  ? 26.642  -42.528 39.505 1.00 40.50 ? 709  TRP A NE1   1 
ATOM   234  C  CE2   . TRP A 1 52  ? 26.190  -43.604 40.220 1.00 40.68 ? 709  TRP A CE2   1 
ATOM   235  C  CE3   . TRP A 1 52  ? 24.064  -44.610 40.801 1.00 40.94 ? 709  TRP A CE3   1 
ATOM   236  C  CZ2   . TRP A 1 52  ? 26.902  -44.572 40.935 1.00 41.17 ? 709  TRP A CZ2   1 
ATOM   237  C  CZ3   . TRP A 1 52  ? 24.774  -45.578 41.511 1.00 41.36 ? 709  TRP A CZ3   1 
ATOM   238  C  CH2   . TRP A 1 52  ? 26.179  -45.548 41.571 1.00 41.41 ? 709  TRP A CH2   1 
ATOM   239  N  N     . ILE A 1 53  ? 24.533  -42.565 35.882 1.00 38.05 ? 710  ILE A N     1 
ATOM   240  C  CA    . ILE A 1 53  ? 25.144  -43.576 34.998 1.00 38.41 ? 710  ILE A CA    1 
ATOM   241  C  C     . ILE A 1 53  ? 26.556  -43.967 35.464 1.00 38.73 ? 710  ILE A C     1 
ATOM   242  O  O     . ILE A 1 53  ? 27.541  -43.308 35.110 1.00 38.76 ? 710  ILE A O     1 
ATOM   243  C  CB    . ILE A 1 53  ? 25.210  -43.125 33.506 1.00 38.36 ? 710  ILE A CB    1 
ATOM   244  C  CG1   . ILE A 1 53  ? 23.858  -42.595 33.015 1.00 38.34 ? 710  ILE A CG1   1 
ATOM   245  C  CG2   . ILE A 1 53  ? 25.665  -44.276 32.608 1.00 38.39 ? 710  ILE A CG2   1 
ATOM   246  C  CD1   . ILE A 1 53  ? 23.799  -41.088 32.905 1.00 38.37 ? 710  ILE A CD1   1 
ATOM   247  N  N     . PRO A 1 54  ? 26.652  -45.028 36.286 1.00 39.03 ? 711  PRO A N     1 
ATOM   248  C  CA    . PRO A 1 54  ? 27.945  -45.543 36.743 1.00 39.27 ? 711  PRO A CA    1 
ATOM   249  C  C     . PRO A 1 54  ? 28.701  -46.445 35.762 1.00 39.52 ? 711  PRO A C     1 
ATOM   250  O  O     . PRO A 1 54  ? 28.096  -47.096 34.907 1.00 39.58 ? 711  PRO A O     1 
ATOM   251  C  CB    . PRO A 1 54  ? 27.589  -46.334 38.012 1.00 39.26 ? 711  PRO A CB    1 
ATOM   252  C  CG    . PRO A 1 54  ? 26.134  -46.544 37.972 1.00 39.15 ? 711  PRO A CG    1 
ATOM   253  C  CD    . PRO A 1 54  ? 25.556  -45.418 37.191 1.00 39.06 ? 711  PRO A CD    1 
ATOM   254  N  N     . GLU A 1 55  ? 30.027  -46.446 35.905 1.00 39.79 ? 712  GLU A N     1 
ATOM   255  C  CA    . GLU A 1 55  ? 30.944  -47.406 35.265 1.00 40.02 ? 712  GLU A CA    1 
ATOM   256  C  C     . GLU A 1 55  ? 30.936  -47.467 33.731 1.00 40.22 ? 712  GLU A C     1 
ATOM   257  O  O     . GLU A 1 55  ? 31.091  -48.548 33.154 1.00 40.24 ? 712  GLU A O     1 
ATOM   258  C  CB    . GLU A 1 55  ? 30.757  -48.810 35.862 1.00 40.00 ? 712  GLU A CB    1 
ATOM   259  N  N     . GLY A 1 56  ? 30.774  -46.320 33.078 1.00 40.43 ? 713  GLY A N     1 
ATOM   260  C  CA    . GLY A 1 56  ? 30.886  -46.243 31.619 1.00 40.65 ? 713  GLY A CA    1 
ATOM   261  C  C     . GLY A 1 56  ? 29.735  -46.875 30.856 1.00 40.78 ? 713  GLY A C     1 
ATOM   262  O  O     . GLY A 1 56  ? 29.108  -46.215 30.024 1.00 40.80 ? 713  GLY A O     1 
ATOM   263  N  N     . GLU A 1 57  ? 29.468  -48.153 31.127 1.00 40.85 ? 714  GLU A N     1 
ATOM   264  C  CA    . GLU A 1 57  ? 28.372  -48.864 30.474 1.00 40.83 ? 714  GLU A CA    1 
ATOM   265  C  C     . GLU A 1 57  ? 27.036  -48.240 30.851 1.00 40.78 ? 714  GLU A C     1 
ATOM   266  O  O     . GLU A 1 57  ? 26.827  -47.835 31.999 1.00 40.75 ? 714  GLU A O     1 
ATOM   267  C  CB    . GLU A 1 57  ? 28.390  -50.348 30.833 1.00 40.86 ? 714  GLU A CB    1 
ATOM   268  N  N     . SER A 1 58  ? 26.144  -48.163 29.868 1.00 40.64 ? 715  SER A N     1 
ATOM   269  C  CA    . SER A 1 58  ? 24.863  -47.492 30.033 1.00 40.47 ? 715  SER A CA    1 
ATOM   270  C  C     . SER A 1 58  ? 23.974  -48.165 31.067 1.00 40.28 ? 715  SER A C     1 
ATOM   271  O  O     . SER A 1 58  ? 23.826  -49.391 31.088 1.00 40.25 ? 715  SER A O     1 
ATOM   272  C  CB    . SER A 1 58  ? 24.126  -47.396 28.695 1.00 40.51 ? 715  SER A CB    1 
ATOM   273  O  OG    . SER A 1 58  ? 22.830  -46.813 28.859 1.00 40.57 ? 715  SER A OG    1 
ATOM   274  N  N     . ILE A 1 59  ? 23.394  -47.324 31.915 1.00 39.97 ? 716  ILE A N     1 
ATOM   275  C  CA    . ILE A 1 59  ? 22.386  -47.693 32.901 1.00 39.64 ? 716  ILE A CA    1 
ATOM   276  C  C     . ILE A 1 59  ? 21.682  -46.388 33.224 1.00 39.33 ? 716  ILE A C     1 
ATOM   277  O  O     . ILE A 1 59  ? 22.237  -45.314 32.992 1.00 39.37 ? 716  ILE A O     1 
ATOM   278  C  CB    . ILE A 1 59  ? 23.003  -48.262 34.197 1.00 39.69 ? 716  ILE A CB    1 
ATOM   279  C  CG1   . ILE A 1 59  ? 24.247  -47.451 34.610 1.00 39.71 ? 716  ILE A CG1   1 
ATOM   280  C  CG2   . ILE A 1 59  ? 23.309  -49.775 34.044 1.00 39.69 ? 716  ILE A CG2   1 
ATOM   281  C  CD1   . ILE A 1 59  ? 25.171  -48.200 35.551 1.00 39.81 ? 716  ILE A CD1   1 
ATOM   282  N  N     . LYS A 1 60  ? 20.472  -46.461 33.760 1.00 38.85 ? 717  LYS A N     1 
ATOM   283  C  CA    . LYS A 1 60  ? 19.722  -45.242 34.035 1.00 38.34 ? 717  LYS A CA    1 
ATOM   284  C  C     . LYS A 1 60  ? 19.026  -45.322 35.391 1.00 37.85 ? 717  LYS A C     1 
ATOM   285  O  O     . LYS A 1 60  ? 17.901  -45.819 35.494 1.00 37.85 ? 717  LYS A O     1 
ATOM   286  C  CB    . LYS A 1 60  ? 18.720  -44.980 32.898 1.00 38.43 ? 717  LYS A CB    1 
ATOM   287  C  CG    . LYS A 1 60  ? 17.925  -43.683 33.020 1.00 38.66 ? 717  LYS A CG    1 
ATOM   288  C  CD    . LYS A 1 60  ? 16.785  -43.614 32.007 1.00 39.04 ? 717  LYS A CD    1 
ATOM   289  C  CE    . LYS A 1 60  ? 17.271  -43.182 30.629 1.00 39.12 ? 717  LYS A CE    1 
ATOM   290  N  NZ    . LYS A 1 60  ? 16.147  -43.081 29.654 1.00 39.17 ? 717  LYS A NZ    1 
ATOM   291  N  N     . ILE A 1 61  ? 19.702  -44.847 36.434 1.00 37.19 ? 718  ILE A N     1 
ATOM   292  C  CA    . ILE A 1 61  ? 19.109  -44.813 37.769 1.00 36.56 ? 718  ILE A CA    1 
ATOM   293  C  C     . ILE A 1 61  ? 18.539  -43.427 38.055 1.00 36.13 ? 718  ILE A C     1 
ATOM   294  O  O     . ILE A 1 61  ? 19.276  -42.441 38.034 1.00 36.13 ? 718  ILE A O     1 
ATOM   295  C  CB    . ILE A 1 61  ? 20.117  -45.222 38.875 1.00 36.58 ? 718  ILE A CB    1 
ATOM   296  C  CG1   . ILE A 1 61  ? 20.582  -46.666 38.657 1.00 36.49 ? 718  ILE A CG1   1 
ATOM   297  C  CG2   . ILE A 1 61  ? 19.487  -45.078 40.265 1.00 36.49 ? 718  ILE A CG2   1 
ATOM   298  C  CD1   . ILE A 1 61  ? 21.831  -47.052 39.426 1.00 36.47 ? 718  ILE A CD1   1 
ATOM   299  N  N     . PRO A 1 62  ? 17.221  -43.350 38.317 1.00 35.69 ? 719  PRO A N     1 
ATOM   300  C  CA    . PRO A 1 62  ? 16.594  -42.080 38.674 1.00 35.35 ? 719  PRO A CA    1 
ATOM   301  C  C     . PRO A 1 62  ? 17.108  -41.587 40.021 1.00 34.98 ? 719  PRO A C     1 
ATOM   302  O  O     . PRO A 1 62  ? 17.034  -42.317 41.014 1.00 34.99 ? 719  PRO A O     1 
ATOM   303  C  CB    . PRO A 1 62  ? 15.103  -42.434 38.772 1.00 35.37 ? 719  PRO A CB    1 
ATOM   304  C  CG    . PRO A 1 62  ? 14.954  -43.734 38.056 1.00 35.50 ? 719  PRO A CG    1 
ATOM   305  C  CD    . PRO A 1 62  ? 16.241  -44.449 38.274 1.00 35.66 ? 719  PRO A CD    1 
ATOM   306  N  N     . VAL A 1 63  ? 17.642  -40.367 40.043 1.00 34.56 ? 720  VAL A N     1 
ATOM   307  C  CA    . VAL A 1 63  ? 18.142  -39.754 41.277 1.00 34.18 ? 720  VAL A CA    1 
ATOM   308  C  C     . VAL A 1 63  ? 17.710  -38.296 41.389 1.00 33.99 ? 720  VAL A C     1 
ATOM   309  O  O     . VAL A 1 63  ? 17.253  -37.692 40.415 1.00 33.95 ? 720  VAL A O     1 
ATOM   310  C  CB    . VAL A 1 63  ? 19.696  -39.840 41.411 1.00 34.15 ? 720  VAL A CB    1 
ATOM   311  C  CG1   . VAL A 1 63  ? 20.162  -41.288 41.529 1.00 34.10 ? 720  VAL A CG1   1 
ATOM   312  C  CG2   . VAL A 1 63  ? 20.402  -39.120 40.254 1.00 34.03 ? 720  VAL A CG2   1 
ATOM   313  N  N     . CYS A 1 64  ? 17.864  -37.741 42.585 1.00 33.74 ? 721  CYS A N     1 
ATOM   314  C  CA    . CYS A 1 64  ? 17.586  -36.339 42.829 1.00 33.55 ? 721  CYS A CA    1 
ATOM   315  C  C     . CYS A 1 64  ? 18.897  -35.646 43.181 1.00 33.17 ? 721  CYS A C     1 
ATOM   316  O  O     . CYS A 1 64  ? 19.599  -36.065 44.105 1.00 33.24 ? 721  CYS A O     1 
ATOM   317  C  CB    . CYS A 1 64  ? 16.575  -36.198 43.964 1.00 33.64 ? 721  CYS A CB    1 
ATOM   318  S  SG    . CYS A 1 64  ? 15.360  -34.895 43.709 1.00 34.41 ? 721  CYS A SG    1 
ATOM   319  N  N     . ILE A 1 65  ? 19.229  -34.598 42.431 1.00 32.60 ? 722  ILE A N     1 
ATOM   320  C  CA    . ILE A 1 65  ? 20.479  -33.869 42.620 1.00 31.98 ? 722  ILE A CA    1 
ATOM   321  C  C     . ILE A 1 65  ? 20.199  -32.455 43.121 1.00 31.70 ? 722  ILE A C     1 
ATOM   322  O  O     . ILE A 1 65  ? 19.548  -31.664 42.438 1.00 31.60 ? 722  ILE A O     1 
ATOM   323  C  CB    . ILE A 1 65  ? 21.313  -33.810 41.315 1.00 31.99 ? 722  ILE A CB    1 
ATOM   324  C  CG1   . ILE A 1 65  ? 21.473  -35.212 40.714 1.00 31.81 ? 722  ILE A CG1   1 
ATOM   325  C  CG2   . ILE A 1 65  ? 22.680  -33.175 41.581 1.00 31.95 ? 722  ILE A CG2   1 
ATOM   326  C  CD1   . ILE A 1 65  ? 21.842  -35.225 39.241 1.00 31.80 ? 722  ILE A CD1   1 
ATOM   327  N  N     . LYS A 1 66  ? 20.697  -32.149 44.318 1.00 31.40 ? 723  LYS A N     1 
ATOM   328  C  CA    . LYS A 1 66  ? 20.517  -30.831 44.928 1.00 31.10 ? 723  LYS A CA    1 
ATOM   329  C  C     . LYS A 1 66  ? 21.802  -30.019 44.828 1.00 30.96 ? 723  LYS A C     1 
ATOM   330  O  O     . LYS A 1 66  ? 22.871  -30.489 45.217 1.00 31.06 ? 723  LYS A O     1 
ATOM   331  C  CB    . LYS A 1 66  ? 20.076  -30.961 46.390 1.00 31.00 ? 723  LYS A CB    1 
ATOM   332  C  CG    . LYS A 1 66  ? 19.838  -29.625 47.083 1.00 30.82 ? 723  LYS A CG    1 
ATOM   333  C  CD    . LYS A 1 66  ? 19.130  -29.787 48.417 1.00 30.49 ? 723  LYS A CD    1 
ATOM   334  C  CE    . LYS A 1 66  ? 18.597  -28.446 48.901 1.00 30.35 ? 723  LYS A CE    1 
ATOM   335  N  NZ    . LYS A 1 66  ? 17.744  -28.585 50.111 1.00 30.25 ? 723  LYS A NZ    1 
ATOM   336  N  N     . VAL A 1 67  ? 21.689  -28.800 44.311 1.00 30.77 ? 724  VAL A N     1 
ATOM   337  C  CA    . VAL A 1 67  ? 22.858  -27.967 44.055 1.00 30.59 ? 724  VAL A CA    1 
ATOM   338  C  C     . VAL A 1 67  ? 22.983  -26.873 45.106 1.00 30.65 ? 724  VAL A C     1 
ATOM   339  O  O     . VAL A 1 67  ? 22.083  -26.050 45.277 1.00 30.64 ? 724  VAL A O     1 
ATOM   340  C  CB    . VAL A 1 67  ? 22.830  -27.364 42.628 1.00 30.53 ? 724  VAL A CB    1 
ATOM   341  C  CG1   . VAL A 1 67  ? 23.966  -26.365 42.428 1.00 30.43 ? 724  VAL A CG1   1 
ATOM   342  C  CG2   . VAL A 1 67  ? 22.911  -28.468 41.588 1.00 30.29 ? 724  VAL A CG2   1 
ATOM   343  N  N     . ILE A 1 68  ? 24.116  -26.882 45.803 1.00 30.71 ? 725  ILE A N     1 
ATOM   344  C  CA    . ILE A 1 68  ? 24.389  -25.929 46.870 1.00 30.78 ? 725  ILE A CA    1 
ATOM   345  C  C     . ILE A 1 68  ? 25.648  -25.136 46.537 1.00 30.86 ? 725  ILE A C     1 
ATOM   346  O  O     . ILE A 1 68  ? 26.678  -25.712 46.188 1.00 30.82 ? 725  ILE A O     1 
ATOM   347  C  CB    . ILE A 1 68  ? 24.553  -26.648 48.228 1.00 30.79 ? 725  ILE A CB    1 
ATOM   348  C  CG1   . ILE A 1 68  ? 23.337  -27.536 48.507 1.00 30.88 ? 725  ILE A CG1   1 
ATOM   349  C  CG2   . ILE A 1 68  ? 24.754  -25.638 49.360 1.00 30.71 ? 725  ILE A CG2   1 
ATOM   350  C  CD1   . ILE A 1 68  ? 23.567  -28.579 49.568 1.00 31.20 ? 725  ILE A CD1   1 
ATOM   351  N  N     . GLU A 1 69  ? 25.552  -23.814 46.650 1.00 31.00 ? 726  GLU A N     1 
ATOM   352  C  CA    . GLU A 1 69  ? 26.658  -22.911 46.333 1.00 31.23 ? 726  GLU A CA    1 
ATOM   353  C  C     . GLU A 1 69  ? 26.881  -21.889 47.454 1.00 31.32 ? 726  GLU A C     1 
ATOM   354  O  O     . GLU A 1 69  ? 25.987  -21.654 48.270 1.00 31.34 ? 726  GLU A O     1 
ATOM   355  C  CB    . GLU A 1 69  ? 26.402  -22.205 44.997 1.00 31.29 ? 726  GLU A CB    1 
ATOM   356  C  CG    . GLU A 1 69  ? 25.002  -21.602 44.865 1.00 31.69 ? 726  GLU A CG    1 
ATOM   357  C  CD    . GLU A 1 69  ? 24.821  -20.770 43.607 1.00 32.08 ? 726  GLU A CD    1 
ATOM   358  O  OE1   . GLU A 1 69  ? 24.226  -19.675 43.706 1.00 32.23 ? 726  GLU A OE1   1 
ATOM   359  O  OE2   . GLU A 1 69  ? 25.270  -21.202 42.523 1.00 32.16 ? 726  GLU A OE2   1 
ATOM   360  N  N     . ASP A 1 70  ? 28.069  -21.280 47.476 1.00 31.48 ? 727  ASP A N     1 
ATOM   361  C  CA    . ASP A 1 70  ? 28.484  -20.371 48.558 1.00 31.60 ? 727  ASP A CA    1 
ATOM   362  C  C     . ASP A 1 70  ? 27.652  -19.094 48.692 1.00 31.56 ? 727  ASP A C     1 
ATOM   363  O  O     . ASP A 1 70  ? 27.151  -18.802 49.780 1.00 31.63 ? 727  ASP A O     1 
ATOM   364  C  CB    . ASP A 1 70  ? 29.971  -20.014 48.429 1.00 31.69 ? 727  ASP A CB    1 
ATOM   365  C  CG    . ASP A 1 70  ? 30.446  -19.045 49.514 1.00 32.11 ? 727  ASP A CG    1 
ATOM   366  O  OD1   . ASP A 1 70  ? 29.999  -17.874 49.529 1.00 32.47 ? 727  ASP A OD1   1 
ATOM   367  O  OD2   . ASP A 1 70  ? 31.289  -19.451 50.346 1.00 32.53 ? 727  ASP A OD2   1 
ATOM   368  N  N     . LYS A 1 71  ? 27.530  -18.337 47.599 1.00 31.45 ? 728  LYS A N     1 
ATOM   369  C  CA    . LYS A 1 71  ? 26.885  -17.010 47.590 1.00 31.31 ? 728  LYS A CA    1 
ATOM   370  C  C     . LYS A 1 71  ? 27.790  -15.940 48.196 1.00 31.21 ? 728  LYS A C     1 
ATOM   371  O  O     . LYS A 1 71  ? 28.711  -15.451 47.543 1.00 31.12 ? 728  LYS A O     1 
ATOM   372  C  CB    . LYS A 1 71  ? 25.523  -17.022 48.303 1.00 31.30 ? 728  LYS A CB    1 
ATOM   373  C  CG    . LYS A 1 71  ? 24.490  -17.935 47.657 1.00 31.33 ? 728  LYS A CG    1 
ATOM   374  C  CD    . LYS A 1 71  ? 23.212  -18.027 48.481 1.00 31.44 ? 728  LYS A CD    1 
ATOM   375  C  CE    . LYS A 1 71  ? 22.116  -18.712 47.676 1.00 31.51 ? 728  LYS A CE    1 
ATOM   376  N  NZ    . LYS A 1 71  ? 21.056  -19.321 48.540 1.00 31.58 ? 728  LYS A NZ    1 
ATOM   377  N  N     . GLN A 1 75  ? 34.998  -20.690 50.114 1.00 39.85 ? 732  GLN A N     1 
ATOM   378  C  CA    . GLN A 1 75  ? 34.042  -20.271 49.087 1.00 39.82 ? 732  GLN A CA    1 
ATOM   379  C  C     . GLN A 1 75  ? 33.643  -21.396 48.129 1.00 39.63 ? 732  GLN A C     1 
ATOM   380  O  O     . GLN A 1 75  ? 32.458  -21.604 47.871 1.00 39.66 ? 732  GLN A O     1 
ATOM   381  C  CB    . GLN A 1 75  ? 34.563  -19.060 48.306 1.00 39.89 ? 732  GLN A CB    1 
ATOM   382  C  CG    . GLN A 1 75  ? 34.288  -17.727 48.985 1.00 40.04 ? 732  GLN A CG    1 
ATOM   383  C  CD    . GLN A 1 75  ? 33.582  -16.741 48.069 1.00 40.19 ? 732  GLN A CD    1 
ATOM   384  O  OE1   . GLN A 1 75  ? 32.634  -17.096 47.365 1.00 40.10 ? 732  GLN A OE1   1 
ATOM   385  N  NE2   . GLN A 1 75  ? 34.031  -15.491 48.086 1.00 40.19 ? 732  GLN A NE2   1 
ATOM   386  N  N     . SER A 1 76  ? 34.630  -22.113 47.599 1.00 39.29 ? 733  SER A N     1 
ATOM   387  C  CA    . SER A 1 76  ? 34.360  -23.250 46.726 1.00 38.83 ? 733  SER A CA    1 
ATOM   388  C  C     . SER A 1 76  ? 34.047  -24.482 47.567 1.00 38.37 ? 733  SER A C     1 
ATOM   389  O  O     . SER A 1 76  ? 34.450  -24.566 48.731 1.00 38.33 ? 733  SER A O     1 
ATOM   390  C  CB    . SER A 1 76  ? 35.555  -23.530 45.811 1.00 38.92 ? 733  SER A CB    1 
ATOM   391  O  OG    . SER A 1 76  ? 36.062  -22.321 45.244 1.00 39.04 ? 733  SER A OG    1 
ATOM   392  N  N     . PHE A 1 77  ? 33.328  -25.430 46.977 1.00 37.71 ? 734  PHE A N     1 
ATOM   393  C  CA    . PHE A 1 77  ? 33.007  -26.677 47.662 1.00 37.05 ? 734  PHE A CA    1 
ATOM   394  C  C     . PHE A 1 77  ? 33.981  -27.801 47.348 1.00 36.50 ? 734  PHE A C     1 
ATOM   395  O  O     . PHE A 1 77  ? 33.829  -28.909 47.871 1.00 36.54 ? 734  PHE A O     1 
ATOM   396  C  CB    . PHE A 1 77  ? 31.572  -27.113 47.372 1.00 37.11 ? 734  PHE A CB    1 
ATOM   397  C  CG    . PHE A 1 77  ? 30.556  -26.413 48.215 1.00 37.17 ? 734  PHE A CG    1 
ATOM   398  C  CD1   . PHE A 1 77  ? 30.158  -26.950 49.434 1.00 37.22 ? 734  PHE A CD1   1 
ATOM   399  C  CD2   . PHE A 1 77  ? 30.007  -25.205 47.802 1.00 37.39 ? 734  PHE A CD2   1 
ATOM   400  C  CE1   . PHE A 1 77  ? 29.216  -26.303 50.222 1.00 37.47 ? 734  PHE A CE1   1 
ATOM   401  C  CE2   . PHE A 1 77  ? 29.066  -24.548 48.584 1.00 37.62 ? 734  PHE A CE2   1 
ATOM   402  C  CZ    . PHE A 1 77  ? 28.669  -25.098 49.797 1.00 37.65 ? 734  PHE A CZ    1 
ATOM   403  N  N     . GLN A 1 78  ? 34.967  -27.532 46.494 1.00 35.73 ? 735  GLN A N     1 
ATOM   404  C  CA    . GLN A 1 78  ? 36.059  -28.481 46.293 1.00 34.92 ? 735  GLN A CA    1 
ATOM   405  C  C     . GLN A 1 78  ? 36.566  -28.820 47.685 1.00 34.12 ? 735  GLN A C     1 
ATOM   406  O  O     . GLN A 1 78  ? 36.735  -27.919 48.516 1.00 34.12 ? 735  GLN A O     1 
ATOM   407  C  CB    . GLN A 1 78  ? 37.183  -27.866 45.453 1.00 35.07 ? 735  GLN A CB    1 
ATOM   408  C  CG    . GLN A 1 78  ? 36.793  -27.504 44.017 1.00 35.51 ? 735  GLN A CG    1 
ATOM   409  C  CD    . GLN A 1 78  ? 36.787  -28.696 43.062 1.00 36.07 ? 735  GLN A CD    1 
ATOM   410  O  OE1   . GLN A 1 78  ? 36.773  -29.856 43.481 1.00 36.16 ? 735  GLN A OE1   1 
ATOM   411  N  NE2   . GLN A 1 78  ? 36.797  -28.405 41.764 1.00 36.16 ? 735  GLN A NE2   1 
ATOM   412  N  N     . ALA A 1 79  ? 36.777  -30.105 47.952 1.00 33.02 ? 736  ALA A N     1 
ATOM   413  C  CA    . ALA A 1 79  ? 37.154  -30.581 49.288 1.00 32.00 ? 736  ALA A CA    1 
ATOM   414  C  C     . ALA A 1 79  ? 35.955  -30.977 50.136 1.00 31.25 ? 736  ALA A C     1 
ATOM   415  O  O     . ALA A 1 79  ? 34.994  -30.219 50.282 1.00 31.15 ? 736  ALA A O     1 
ATOM   416  C  CB    . ALA A 1 79  ? 38.033  -29.559 50.038 1.00 32.05 ? 736  ALA A CB    1 
ATOM   417  N  N     . VAL A 1 80  ? 36.041  -32.178 50.696 1.00 30.37 ? 737  VAL A N     1 
ATOM   418  C  CA    . VAL A 1 80  ? 35.013  -32.721 51.569 1.00 29.59 ? 737  VAL A CA    1 
ATOM   419  C  C     . VAL A 1 80  ? 35.311  -32.360 53.019 1.00 29.06 ? 737  VAL A C     1 
ATOM   420  O  O     . VAL A 1 80  ? 36.423  -32.570 53.507 1.00 28.96 ? 737  VAL A O     1 
ATOM   421  C  CB    . VAL A 1 80  ? 34.885  -34.254 51.389 1.00 29.60 ? 737  VAL A CB    1 
ATOM   422  C  CG1   . VAL A 1 80  ? 34.140  -34.895 52.553 1.00 29.56 ? 737  VAL A CG1   1 
ATOM   423  C  CG2   . VAL A 1 80  ? 34.174  -34.565 50.084 1.00 29.68 ? 737  VAL A CG2   1 
ATOM   424  N  N     . THR A 1 81  ? 34.310  -31.798 53.692 1.00 28.47 ? 738  THR A N     1 
ATOM   425  C  CA    . THR A 1 81  ? 34.418  -31.462 55.107 1.00 27.98 ? 738  THR A CA    1 
ATOM   426  C  C     . THR A 1 81  ? 34.023  -32.669 55.953 1.00 27.69 ? 738  THR A C     1 
ATOM   427  O  O     . THR A 1 81  ? 33.467  -33.641 55.437 1.00 27.55 ? 738  THR A O     1 
ATOM   428  C  CB    . THR A 1 81  ? 33.549  -30.234 55.483 1.00 27.96 ? 738  THR A CB    1 
ATOM   429  O  OG1   . THR A 1 81  ? 32.158  -30.590 55.451 1.00 28.07 ? 738  THR A OG1   1 
ATOM   430  C  CG2   . THR A 1 81  ? 33.803  -29.074 54.521 1.00 27.93 ? 738  THR A CG2   1 
ATOM   431  N  N     . ASP A 1 82  ? 34.321  -32.607 57.248 1.00 27.44 ? 739  ASP A N     1 
ATOM   432  C  CA    . ASP A 1 82  ? 33.990  -33.697 58.161 1.00 27.21 ? 739  ASP A CA    1 
ATOM   433  C  C     . ASP A 1 82  ? 32.478  -33.815 58.339 1.00 26.82 ? 739  ASP A C     1 
ATOM   434  O  O     . ASP A 1 82  ? 31.955  -34.910 58.557 1.00 26.76 ? 739  ASP A O     1 
ATOM   435  C  CB    . ASP A 1 82  ? 34.683  -33.511 59.515 1.00 27.35 ? 739  ASP A CB    1 
ATOM   436  C  CG    . ASP A 1 82  ? 34.939  -34.835 60.235 1.00 27.93 ? 739  ASP A CG    1 
ATOM   437  O  OD1   . ASP A 1 82  ? 34.163  -35.798 60.046 1.00 28.40 ? 739  ASP A OD1   1 
ATOM   438  O  OD2   . ASP A 1 82  ? 35.922  -34.914 61.005 1.00 28.42 ? 739  ASP A OD2   1 
ATOM   439  N  N     . HIS A 1 83  ? 31.783  -32.685 58.233 1.00 26.35 ? 740  HIS A N     1 
ATOM   440  C  CA    . HIS A 1 83  ? 30.327  -32.663 58.335 1.00 25.94 ? 740  HIS A CA    1 
ATOM   441  C  C     . HIS A 1 83  ? 29.646  -33.317 57.128 1.00 25.57 ? 740  HIS A C     1 
ATOM   442  O  O     . HIS A 1 83  ? 28.580  -33.923 57.271 1.00 25.53 ? 740  HIS A O     1 
ATOM   443  C  CB    . HIS A 1 83  ? 29.816  -31.235 58.545 1.00 26.02 ? 740  HIS A CB    1 
ATOM   444  C  CG    . HIS A 1 83  ? 28.327  -31.138 58.657 1.00 26.16 ? 740  HIS A CG    1 
ATOM   445  N  ND1   . HIS A 1 83  ? 27.614  -31.749 59.667 1.00 26.30 ? 740  HIS A ND1   1 
ATOM   446  C  CD2   . HIS A 1 83  ? 27.415  -30.505 57.883 1.00 26.38 ? 740  HIS A CD2   1 
ATOM   447  C  CE1   . HIS A 1 83  ? 26.327  -31.496 59.510 1.00 26.38 ? 740  HIS A CE1   1 
ATOM   448  N  NE2   . HIS A 1 83  ? 26.179  -30.742 58.435 1.00 26.58 ? 740  HIS A NE2   1 
ATOM   449  N  N     . MET A 1 84  ? 30.263  -33.198 55.953 1.00 25.06 ? 741  MET A N     1 
ATOM   450  C  CA    . MET A 1 84  ? 29.762  -33.855 54.745 1.00 24.72 ? 741  MET A CA    1 
ATOM   451  C  C     . MET A 1 84  ? 29.731  -35.374 54.892 1.00 24.62 ? 741  MET A C     1 
ATOM   452  O  O     . MET A 1 84  ? 28.812  -36.030 54.396 1.00 24.67 ? 741  MET A O     1 
ATOM   453  C  CB    . MET A 1 84  ? 30.588  -33.453 53.522 1.00 24.62 ? 741  MET A CB    1 
ATOM   454  C  CG    . MET A 1 84  ? 30.275  -32.059 53.020 1.00 24.60 ? 741  MET A CG    1 
ATOM   455  S  SD    . MET A 1 84  ? 31.586  -31.321 52.022 1.00 24.53 ? 741  MET A SD    1 
ATOM   456  C  CE    . MET A 1 84  ? 31.254  -32.029 50.415 1.00 25.26 ? 741  MET A CE    1 
ATOM   457  N  N     . LEU A 1 85  ? 30.731  -35.924 55.575 1.00 24.48 ? 742  LEU A N     1 
ATOM   458  C  CA    . LEU A 1 85  ? 30.778  -37.357 55.844 1.00 24.41 ? 742  LEU A CA    1 
ATOM   459  C  C     . LEU A 1 85  ? 29.720  -37.758 56.861 1.00 24.43 ? 742  LEU A C     1 
ATOM   460  O  O     . LEU A 1 85  ? 29.113  -38.826 56.744 1.00 24.36 ? 742  LEU A O     1 
ATOM   461  C  CB    . LEU A 1 85  ? 32.165  -37.776 56.338 1.00 24.42 ? 742  LEU A CB    1 
ATOM   462  C  CG    . LEU A 1 85  ? 33.357  -37.641 55.387 1.00 24.37 ? 742  LEU A CG    1 
ATOM   463  C  CD1   . LEU A 1 85  ? 34.553  -38.328 55.997 1.00 24.20 ? 742  LEU A CD1   1 
ATOM   464  C  CD2   . LEU A 1 85  ? 33.062  -38.224 54.010 1.00 24.36 ? 742  LEU A CD2   1 
ATOM   465  N  N     . ALA A 1 86  ? 29.515  -36.897 57.857 1.00 24.60 ? 743  ALA A N     1 
ATOM   466  C  CA    . ALA A 1 86  ? 28.515  -37.116 58.900 1.00 24.80 ? 743  ALA A CA    1 
ATOM   467  C  C     . ALA A 1 86  ? 27.129  -37.280 58.285 1.00 24.93 ? 743  ALA A C     1 
ATOM   468  O  O     . ALA A 1 86  ? 26.388  -38.194 58.653 1.00 24.99 ? 743  ALA A O     1 
ATOM   469  C  CB    . ALA A 1 86  ? 28.529  -35.972 59.909 1.00 24.78 ? 743  ALA A CB    1 
ATOM   470  N  N     . ILE A 1 87  ? 26.797  -36.398 57.344 1.00 25.05 ? 744  ILE A N     1 
ATOM   471  C  CA    . ILE A 1 87  ? 25.567  -36.516 56.570 1.00 25.21 ? 744  ILE A CA    1 
ATOM   472  C  C     . ILE A 1 87  ? 25.564  -37.820 55.764 1.00 25.48 ? 744  ILE A C     1 
ATOM   473  O  O     . ILE A 1 87  ? 24.566  -38.541 55.749 1.00 25.54 ? 744  ILE A O     1 
ATOM   474  C  CB    . ILE A 1 87  ? 25.354  -35.289 55.644 1.00 25.18 ? 744  ILE A CB    1 
ATOM   475  C  CG1   . ILE A 1 87  ? 25.106  -34.030 56.486 1.00 25.05 ? 744  ILE A CG1   1 
ATOM   476  C  CG2   . ILE A 1 87  ? 24.207  -35.536 54.657 1.00 25.00 ? 744  ILE A CG2   1 
ATOM   477  C  CD1   . ILE A 1 87  ? 25.127  -32.718 55.712 1.00 24.94 ? 744  ILE A CD1   1 
ATOM   478  N  N     . GLY A 1 88  ? 26.691  -38.123 55.124 1.00 25.79 ? 745  GLY A N     1 
ATOM   479  C  CA    . GLY A 1 88  ? 26.811  -39.294 54.257 1.00 26.32 ? 745  GLY A CA    1 
ATOM   480  C  C     . GLY A 1 88  ? 26.622  -40.641 54.933 1.00 26.74 ? 745  GLY A C     1 
ATOM   481  O  O     . GLY A 1 88  ? 26.095  -41.574 54.326 1.00 26.82 ? 745  GLY A O     1 
ATOM   482  N  N     . SER A 1 89  ? 27.051  -40.741 56.189 1.00 27.22 ? 746  SER A N     1 
ATOM   483  C  CA    . SER A 1 89  ? 27.046  -42.013 56.919 1.00 27.62 ? 746  SER A CA    1 
ATOM   484  C  C     . SER A 1 89  ? 25.650  -42.540 57.256 1.00 27.82 ? 746  SER A C     1 
ATOM   485  O  O     . SER A 1 89  ? 25.428  -43.754 57.278 1.00 27.86 ? 746  SER A O     1 
ATOM   486  C  CB    . SER A 1 89  ? 27.873  -41.886 58.200 1.00 27.61 ? 746  SER A CB    1 
ATOM   487  O  OG    . SER A 1 89  ? 29.160  -41.352 57.913 1.00 27.72 ? 746  SER A OG    1 
ATOM   488  N  N     . LEU A 1 90  ? 24.718  -41.621 57.509 1.00 28.07 ? 747  LEU A N     1 
ATOM   489  C  CA    . LEU A 1 90  ? 23.403  -41.971 58.057 1.00 28.28 ? 747  LEU A CA    1 
ATOM   490  C  C     . LEU A 1 90  ? 22.526  -42.835 57.148 1.00 28.41 ? 747  LEU A C     1 
ATOM   491  O  O     . LEU A 1 90  ? 22.497  -42.648 55.929 1.00 28.40 ? 747  LEU A O     1 
ATOM   492  C  CB    . LEU A 1 90  ? 22.655  -40.703 58.477 1.00 28.27 ? 747  LEU A CB    1 
ATOM   493  C  CG    . LEU A 1 90  ? 23.348  -39.865 59.557 1.00 28.15 ? 747  LEU A CG    1 
ATOM   494  C  CD1   . LEU A 1 90  ? 22.743  -38.474 59.660 1.00 28.22 ? 747  LEU A CD1   1 
ATOM   495  C  CD2   . LEU A 1 90  ? 23.338  -40.573 60.906 1.00 27.95 ? 747  LEU A CD2   1 
ATOM   496  N  N     . ASP A 1 91  ? 21.819  -43.779 57.773 1.00 28.60 ? 748  ASP A N     1 
ATOM   497  C  CA    . ASP A 1 91  ? 20.933  -44.719 57.084 1.00 28.83 ? 748  ASP A CA    1 
ATOM   498  C  C     . ASP A 1 91  ? 19.844  -45.256 58.024 1.00 28.86 ? 748  ASP A C     1 
ATOM   499  O  O     . ASP A 1 91  ? 20.143  -45.952 58.997 1.00 28.89 ? 748  ASP A O     1 
ATOM   500  C  CB    . ASP A 1 91  ? 21.748  -45.885 56.508 1.00 28.88 ? 748  ASP A CB    1 
ATOM   501  C  CG    . ASP A 1 91  ? 21.003  -46.648 55.424 1.00 29.26 ? 748  ASP A CG    1 
ATOM   502  O  OD1   . ASP A 1 91  ? 21.424  -47.781 55.110 1.00 29.46 ? 748  ASP A OD1   1 
ATOM   503  O  OD2   . ASP A 1 91  ? 20.002  -46.123 54.882 1.00 29.63 ? 748  ASP A OD2   1 
ATOM   504  N  N     . HIS A 1 92  ? 18.586  -44.932 57.721 1.00 28.90 ? 749  HIS A N     1 
ATOM   505  C  CA    . HIS A 1 92  ? 17.436  -45.392 58.508 1.00 28.96 ? 749  HIS A CA    1 
ATOM   506  C  C     . HIS A 1 92  ? 16.194  -45.517 57.633 1.00 29.02 ? 749  HIS A C     1 
ATOM   507  O  O     . HIS A 1 92  ? 16.028  -44.761 56.671 1.00 28.99 ? 749  HIS A O     1 
ATOM   508  C  CB    . HIS A 1 92  ? 17.157  -44.431 59.668 1.00 28.94 ? 749  HIS A CB    1 
ATOM   509  C  CG    . HIS A 1 92  ? 16.246  -44.992 60.718 1.00 29.05 ? 749  HIS A CG    1 
ATOM   510  N  ND1   . HIS A 1 92  ? 14.919  -44.633 60.823 1.00 29.14 ? 749  HIS A ND1   1 
ATOM   511  C  CD2   . HIS A 1 92  ? 16.473  -45.886 61.709 1.00 29.13 ? 749  HIS A CD2   1 
ATOM   512  C  CE1   . HIS A 1 92  ? 14.369  -45.280 61.835 1.00 29.24 ? 749  HIS A CE1   1 
ATOM   513  N  NE2   . HIS A 1 92  ? 15.290  -46.047 62.389 1.00 29.18 ? 749  HIS A NE2   1 
ATOM   514  N  N     . ALA A 1 93  ? 15.321  -46.460 57.979 1.00 29.11 ? 750  ALA A N     1 
ATOM   515  C  CA    . ALA A 1 93  ? 14.078  -46.688 57.239 1.00 29.24 ? 750  ALA A CA    1 
ATOM   516  C  C     . ALA A 1 93  ? 13.208  -45.431 57.091 1.00 29.34 ? 750  ALA A C     1 
ATOM   517  O  O     . ALA A 1 93  ? 12.403  -45.339 56.159 1.00 29.34 ? 750  ALA A O     1 
ATOM   518  C  CB    . ALA A 1 93  ? 13.279  -47.815 57.883 1.00 29.25 ? 750  ALA A CB    1 
ATOM   519  N  N     . HIS A 1 94  ? 13.382  -44.467 57.998 1.00 29.41 ? 751  HIS A N     1 
ATOM   520  C  CA    . HIS A 1 94  ? 12.563  -43.249 57.993 1.00 29.47 ? 751  HIS A CA    1 
ATOM   521  C  C     . HIS A 1 94  ? 13.289  -41.944 57.647 1.00 29.54 ? 751  HIS A C     1 
ATOM   522  O  O     . HIS A 1 94  ? 12.710  -40.862 57.797 1.00 29.60 ? 751  HIS A O     1 
ATOM   523  C  CB    . HIS A 1 94  ? 11.827  -43.089 59.323 1.00 29.46 ? 751  HIS A CB    1 
ATOM   524  C  CG    . HIS A 1 94  ? 10.785  -44.133 59.559 1.00 29.46 ? 751  HIS A CG    1 
ATOM   525  N  ND1   . HIS A 1 94  ? 9.545   -44.096 58.958 1.00 29.34 ? 751  HIS A ND1   1 
ATOM   526  C  CD2   . HIS A 1 94  ? 10.802  -45.253 60.320 1.00 29.54 ? 751  HIS A CD2   1 
ATOM   527  C  CE1   . HIS A 1 94  ? 8.843   -45.147 59.341 1.00 29.45 ? 751  HIS A CE1   1 
ATOM   528  N  NE2   . HIS A 1 94  ? 9.580   -45.862 60.172 1.00 29.58 ? 751  HIS A NE2   1 
ATOM   529  N  N     . ILE A 1 95  ? 14.544  -42.032 57.206 1.00 29.59 ? 752  ILE A N     1 
ATOM   530  C  CA    . ILE A 1 95  ? 15.271  -40.849 56.719 1.00 29.66 ? 752  ILE A CA    1 
ATOM   531  C  C     . ILE A 1 95  ? 15.584  -41.008 55.234 1.00 29.78 ? 752  ILE A C     1 
ATOM   532  O  O     . ILE A 1 95  ? 15.625  -42.133 54.726 1.00 29.72 ? 752  ILE A O     1 
ATOM   533  C  CB    . ILE A 1 95  ? 16.586  -40.572 57.514 1.00 29.66 ? 752  ILE A CB    1 
ATOM   534  C  CG1   . ILE A 1 95  ? 17.655  -41.634 57.219 1.00 29.60 ? 752  ILE A CG1   1 
ATOM   535  C  CG2   . ILE A 1 95  ? 16.305  -40.429 59.012 1.00 29.62 ? 752  ILE A CG2   1 
ATOM   536  C  CD1   . ILE A 1 95  ? 19.070  -41.208 57.567 1.00 29.57 ? 752  ILE A CD1   1 
ATOM   537  N  N     . VAL A 1 96  ? 15.800  -39.894 54.537 1.00 30.08 ? 753  VAL A N     1 
ATOM   538  C  CA    . VAL A 1 96  ? 16.216  -39.963 53.135 1.00 30.48 ? 753  VAL A CA    1 
ATOM   539  C  C     . VAL A 1 96  ? 17.736  -40.039 53.082 1.00 30.81 ? 753  VAL A C     1 
ATOM   540  O  O     . VAL A 1 96  ? 18.423  -39.053 53.356 1.00 30.84 ? 753  VAL A O     1 
ATOM   541  C  CB    . VAL A 1 96  ? 15.710  -38.760 52.294 1.00 30.43 ? 753  VAL A CB    1 
ATOM   542  C  CG1   . VAL A 1 96  ? 16.147  -38.899 50.840 1.00 30.40 ? 753  VAL A CG1   1 
ATOM   543  C  CG2   . VAL A 1 96  ? 14.201  -38.650 52.365 1.00 30.48 ? 753  VAL A CG2   1 
ATOM   544  N  N     . ARG A 1 97  ? 18.255  -41.211 52.732 1.00 31.26 ? 754  ARG A N     1 
ATOM   545  C  CA    . ARG A 1 97  ? 19.696  -41.426 52.723 1.00 31.77 ? 754  ARG A CA    1 
ATOM   546  C  C     . ARG A 1 97  ? 20.391  -40.682 51.589 1.00 31.70 ? 754  ARG A C     1 
ATOM   547  O  O     . ARG A 1 97  ? 19.923  -40.682 50.450 1.00 31.72 ? 754  ARG A O     1 
ATOM   548  C  CB    . ARG A 1 97  ? 20.026  -42.919 52.648 1.00 32.00 ? 754  ARG A CB    1 
ATOM   549  C  CG    . ARG A 1 97  ? 21.521  -43.214 52.616 1.00 33.48 ? 754  ARG A CG    1 
ATOM   550  C  CD    . ARG A 1 97  ? 21.808  -44.697 52.682 1.00 36.12 ? 754  ARG A CD    1 
ATOM   551  N  NE    . ARG A 1 97  ? 21.437  -45.405 51.457 1.00 38.08 ? 754  ARG A NE    1 
ATOM   552  C  CZ    . ARG A 1 97  ? 22.286  -45.709 50.479 1.00 39.19 ? 754  ARG A CZ    1 
ATOM   553  N  NH1   . ARG A 1 97  ? 23.566  -45.363 50.568 1.00 39.49 ? 754  ARG A NH1   1 
ATOM   554  N  NH2   . ARG A 1 97  ? 21.855  -46.368 49.409 1.00 39.51 ? 754  ARG A NH2   1 
ATOM   555  N  N     . LEU A 1 98  ? 21.509  -40.043 51.924 1.00 31.74 ? 755  LEU A N     1 
ATOM   556  C  CA    . LEU A 1 98  ? 22.407  -39.477 50.931 1.00 31.70 ? 755  LEU A CA    1 
ATOM   557  C  C     . LEU A 1 98  ? 23.218  -40.613 50.317 1.00 31.60 ? 755  LEU A C     1 
ATOM   558  O  O     . LEU A 1 98  ? 24.063  -41.220 50.982 1.00 31.65 ? 755  LEU A O     1 
ATOM   559  C  CB    . LEU A 1 98  ? 23.334  -38.439 51.569 1.00 31.77 ? 755  LEU A CB    1 
ATOM   560  C  CG    . LEU A 1 98  ? 24.170  -37.562 50.630 1.00 31.99 ? 755  LEU A CG    1 
ATOM   561  C  CD1   . LEU A 1 98  ? 23.341  -36.398 50.097 1.00 32.22 ? 755  LEU A CD1   1 
ATOM   562  C  CD2   . LEU A 1 98  ? 25.408  -37.045 51.348 1.00 31.97 ? 755  LEU A CD2   1 
ATOM   563  N  N     . LEU A 1 99  ? 22.931  -40.910 49.054 1.00 31.45 ? 756  LEU A N     1 
ATOM   564  C  CA    . LEU A 1 99  ? 23.631  -41.965 48.326 1.00 31.27 ? 756  LEU A CA    1 
ATOM   565  C  C     . LEU A 1 99  ? 25.062  -41.555 48.030 1.00 31.23 ? 756  LEU A C     1 
ATOM   566  O  O     . LEU A 1 99  ? 25.971  -42.387 48.070 1.00 31.24 ? 756  LEU A O     1 
ATOM   567  C  CB    . LEU A 1 99  ? 22.901  -42.301 47.021 1.00 31.23 ? 756  LEU A CB    1 
ATOM   568  C  CG    . LEU A 1 99  ? 21.416  -42.691 47.084 1.00 31.01 ? 756  LEU A CG    1 
ATOM   569  C  CD1   . LEU A 1 99  ? 20.859  -42.847 45.680 1.00 31.03 ? 756  LEU A CD1   1 
ATOM   570  C  CD2   . LEU A 1 99  ? 21.187  -43.964 47.879 1.00 30.87 ? 756  LEU A CD2   1 
ATOM   571  N  N     . GLY A 1 100 ? 25.261  -40.263 47.746 1.00 31.24 ? 757  GLY A N     1 
ATOM   572  C  CA    . GLY A 1 100 ? 26.592  -39.784 47.424 1.00 31.26 ? 757  GLY A CA    1 
ATOM   573  C  C     . GLY A 1 100 ? 26.772  -38.282 47.316 1.00 31.24 ? 757  GLY A C     1 
ATOM   574  O  O     . GLY A 1 100 ? 25.818  -37.514 47.456 1.00 31.28 ? 757  GLY A O     1 
ATOM   575  N  N     . LEU A 1 101 ? 28.026  -37.881 47.046 1.00 31.22 ? 758  LEU A N     1 
ATOM   576  C  CA    . LEU A 1 101 ? 28.418  -36.488 47.063 1.00 31.19 ? 758  LEU A CA    1 
ATOM   577  C  C     . LEU A 1 101 ? 29.337  -36.159 45.891 1.00 31.11 ? 758  LEU A C     1 
ATOM   578  O  O     . LEU A 1 101 ? 30.205  -36.956 45.532 1.00 31.06 ? 758  LEU A O     1 
ATOM   579  C  CB    . LEU A 1 101 ? 29.126  -36.203 48.384 1.00 31.28 ? 758  LEU A CB    1 
ATOM   580  C  CG    . LEU A 1 101 ? 29.674  -34.808 48.630 1.00 31.62 ? 758  LEU A CG    1 
ATOM   581  C  CD1   . LEU A 1 101 ? 28.517  -33.837 48.703 1.00 32.05 ? 758  LEU A CD1   1 
ATOM   582  C  CD2   . LEU A 1 101 ? 30.438  -34.855 49.941 1.00 31.97 ? 758  LEU A CD2   1 
ATOM   583  N  N     . CYS A 1 102 ? 29.143  -34.986 45.296 1.00 31.08 ? 759  CYS A N     1 
ATOM   584  C  CA    . CYS A 1 102 ? 29.976  -34.549 44.178 1.00 31.09 ? 759  CYS A CA    1 
ATOM   585  C  C     . CYS A 1 102 ? 30.523  -33.138 44.408 1.00 30.98 ? 759  CYS A C     1 
ATOM   586  O  O     . CYS A 1 102 ? 29.799  -32.153 44.225 1.00 31.03 ? 759  CYS A O     1 
ATOM   587  C  CB    . CYS A 1 102 ? 29.200  -34.625 42.859 1.00 31.09 ? 759  CYS A CB    1 
ATOM   588  S  SG    . CYS A 1 102 ? 30.182  -34.216 41.388 1.00 31.38 ? 759  CYS A SG    1 
ATOM   589  N  N     . PRO A 1 103 ? 31.801  -33.035 44.822 1.00 30.82 ? 760  PRO A N     1 
ATOM   590  C  CA    . PRO A 1 103 ? 32.406  -31.718 45.019 1.00 30.72 ? 760  PRO A CA    1 
ATOM   591  C  C     . PRO A 1 103 ? 32.690  -30.994 43.705 1.00 30.64 ? 760  PRO A C     1 
ATOM   592  O  O     . PRO A 1 103 ? 32.732  -31.615 42.641 1.00 30.61 ? 760  PRO A O     1 
ATOM   593  C  CB    . PRO A 1 103 ? 33.714  -32.035 45.752 1.00 30.65 ? 760  PRO A CB    1 
ATOM   594  C  CG    . PRO A 1 103 ? 34.027  -33.435 45.383 1.00 30.73 ? 760  PRO A CG    1 
ATOM   595  C  CD    . PRO A 1 103 ? 32.706  -34.124 45.232 1.00 30.79 ? 760  PRO A CD    1 
ATOM   596  N  N     . GLY A 1 104 ? 32.886  -29.684 43.802 1.00 30.60 ? 761  GLY A N     1 
ATOM   597  C  CA    . GLY A 1 104 ? 33.138  -28.819 42.656 1.00 30.62 ? 761  GLY A CA    1 
ATOM   598  C  C     . GLY A 1 104 ? 32.893  -27.395 43.106 1.00 30.64 ? 761  GLY A C     1 
ATOM   599  O  O     . GLY A 1 104 ? 32.845  -27.132 44.309 1.00 30.66 ? 761  GLY A O     1 
ATOM   600  N  N     . SER A 1 105 ? 32.737  -26.474 42.154 1.00 30.65 ? 762  SER A N     1 
ATOM   601  C  CA    . SER A 1 105 ? 32.401  -25.080 42.472 1.00 30.60 ? 762  SER A CA    1 
ATOM   602  C  C     . SER A 1 105 ? 31.144  -25.016 43.330 1.00 30.48 ? 762  SER A C     1 
ATOM   603  O  O     . SER A 1 105 ? 31.054  -24.218 44.265 1.00 30.52 ? 762  SER A O     1 
ATOM   604  C  CB    . SER A 1 105 ? 32.211  -24.261 41.197 1.00 30.63 ? 762  SER A CB    1 
ATOM   605  O  OG    . SER A 1 105 ? 33.454  -24.035 40.553 1.00 30.90 ? 762  SER A OG    1 
ATOM   606  N  N     . SER A 1 106 ? 30.182  -25.869 42.993 1.00 30.28 ? 763  SER A N     1 
ATOM   607  C  CA    . SER A 1 106 ? 29.007  -26.093 43.815 1.00 30.05 ? 763  SER A CA    1 
ATOM   608  C  C     . SER A 1 106 ? 29.058  -27.509 44.366 1.00 29.89 ? 763  SER A C     1 
ATOM   609  O  O     . SER A 1 106 ? 29.651  -28.402 43.756 1.00 29.93 ? 763  SER A O     1 
ATOM   610  C  CB    . SER A 1 106 ? 27.733  -25.902 42.990 1.00 30.06 ? 763  SER A CB    1 
ATOM   611  O  OG    . SER A 1 106 ? 27.564  -24.546 42.617 1.00 29.98 ? 763  SER A OG    1 
ATOM   612  N  N     . LEU A 1 107 ? 28.440  -27.707 45.523 1.00 29.70 ? 764  LEU A N     1 
ATOM   613  C  CA    . LEU A 1 107 ? 28.290  -29.032 46.085 1.00 29.60 ? 764  LEU A CA    1 
ATOM   614  C  C     . LEU A 1 107 ? 27.017  -29.657 45.549 1.00 29.79 ? 764  LEU A C     1 
ATOM   615  O  O     . LEU A 1 107 ? 25.956  -29.026 45.551 1.00 29.80 ? 764  LEU A O     1 
ATOM   616  C  CB    . LEU A 1 107 ? 28.215  -28.956 47.603 1.00 29.46 ? 764  LEU A CB    1 
ATOM   617  C  CG    . LEU A 1 107 ? 28.288  -30.305 48.316 1.00 29.17 ? 764  LEU A CG    1 
ATOM   618  C  CD1   . LEU A 1 107 ? 29.683  -30.878 48.143 1.00 28.78 ? 764  LEU A CD1   1 
ATOM   619  C  CD2   . LEU A 1 107 ? 27.932  -30.148 49.779 1.00 29.00 ? 764  LEU A CD2   1 
ATOM   620  N  N     . GLN A 1 108 ? 27.124  -30.899 45.094 1.00 29.99 ? 765  GLN A N     1 
ATOM   621  C  CA    . GLN A 1 108 ? 25.981  -31.610 44.546 1.00 30.19 ? 765  GLN A CA    1 
ATOM   622  C  C     . GLN A 1 108 ? 25.609  -32.770 45.451 1.00 30.31 ? 765  GLN A C     1 
ATOM   623  O  O     . GLN A 1 108 ? 26.349  -33.751 45.547 1.00 30.45 ? 765  GLN A O     1 
ATOM   624  C  CB    . GLN A 1 108 ? 26.294  -32.119 43.141 1.00 30.19 ? 765  GLN A CB    1 
ATOM   625  C  CG    . GLN A 1 108 ? 26.407  -31.029 42.097 1.00 30.65 ? 765  GLN A CG    1 
ATOM   626  C  CD    . GLN A 1 108 ? 26.317  -31.579 40.694 1.00 31.36 ? 765  GLN A CD    1 
ATOM   627  O  OE1   . GLN A 1 108 ? 27.259  -32.185 40.186 1.00 31.81 ? 765  GLN A OE1   1 
ATOM   628  N  NE2   . GLN A 1 108 ? 25.178  -31.372 40.057 1.00 31.75 ? 765  GLN A NE2   1 
ATOM   629  N  N     . LEU A 1 109 ? 24.472  -32.651 46.128 1.00 30.43 ? 766  LEU A N     1 
ATOM   630  C  CA    . LEU A 1 109 ? 23.988  -33.723 46.991 1.00 30.59 ? 766  LEU A CA    1 
ATOM   631  C  C     . LEU A 1 109 ? 23.038  -34.628 46.215 1.00 30.72 ? 766  LEU A C     1 
ATOM   632  O  O     . LEU A 1 109 ? 22.070  -34.155 45.617 1.00 30.81 ? 766  LEU A O     1 
ATOM   633  C  CB    . LEU A 1 109 ? 23.302  -33.162 48.244 1.00 30.59 ? 766  LEU A CB    1 
ATOM   634  C  CG    . LEU A 1 109 ? 24.086  -32.311 49.255 1.00 30.45 ? 766  LEU A CG    1 
ATOM   635  C  CD1   . LEU A 1 109 ? 23.223  -32.068 50.486 1.00 30.20 ? 766  LEU A CD1   1 
ATOM   636  C  CD2   . LEU A 1 109 ? 25.393  -32.967 49.674 1.00 30.19 ? 766  LEU A CD2   1 
ATOM   637  N  N     . VAL A 1 110 ? 23.324  -35.927 46.233 1.00 30.82 ? 767  VAL A N     1 
ATOM   638  C  CA    . VAL A 1 110 ? 22.597  -36.896 45.418 1.00 30.93 ? 767  VAL A CA    1 
ATOM   639  C  C     . VAL A 1 110 ? 21.814  -37.873 46.286 1.00 31.11 ? 767  VAL A C     1 
ATOM   640  O  O     . VAL A 1 110 ? 22.396  -38.647 47.053 1.00 31.18 ? 767  VAL A O     1 
ATOM   641  C  CB    . VAL A 1 110 ? 23.554  -37.664 44.470 1.00 30.94 ? 767  VAL A CB    1 
ATOM   642  C  CG1   . VAL A 1 110 ? 22.821  -38.783 43.725 1.00 30.83 ? 767  VAL A CG1   1 
ATOM   643  C  CG2   . VAL A 1 110 ? 24.201  -36.703 43.487 1.00 30.90 ? 767  VAL A CG2   1 
ATOM   644  N  N     . THR A 1 111 ? 20.491  -37.821 46.162 1.00 31.22 ? 768  THR A N     1 
ATOM   645  C  CA    . THR A 1 111 ? 19.609  -38.729 46.887 1.00 31.31 ? 768  THR A CA    1 
ATOM   646  C  C     . THR A 1 111 ? 18.719  -39.476 45.898 1.00 31.42 ? 768  THR A C     1 
ATOM   647  O  O     . THR A 1 111 ? 18.726  -39.178 44.701 1.00 31.39 ? 768  THR A O     1 
ATOM   648  C  CB    . THR A 1 111 ? 18.743  -37.981 47.933 1.00 31.32 ? 768  THR A CB    1 
ATOM   649  O  OG1   . THR A 1 111 ? 17.942  -36.987 47.283 1.00 31.30 ? 768  THR A OG1   1 
ATOM   650  C  CG2   . THR A 1 111 ? 19.619  -37.314 48.993 1.00 31.31 ? 768  THR A CG2   1 
ATOM   651  N  N     . GLN A 1 112 ? 17.973  -40.459 46.396 1.00 31.60 ? 769  GLN A N     1 
ATOM   652  C  CA    . GLN A 1 112 ? 17.007  -41.177 45.570 1.00 31.86 ? 769  GLN A CA    1 
ATOM   653  C  C     . GLN A 1 112 ? 15.798  -40.286 45.297 1.00 31.79 ? 769  GLN A C     1 
ATOM   654  O  O     . GLN A 1 112 ? 15.467  -39.415 46.107 1.00 31.73 ? 769  GLN A O     1 
ATOM   655  C  CB    . GLN A 1 112 ? 16.595  -42.517 46.206 1.00 32.00 ? 769  GLN A CB    1 
ATOM   656  C  CG    . GLN A 1 112 ? 16.141  -42.461 47.673 1.00 32.75 ? 769  GLN A CG    1 
ATOM   657  C  CD    . GLN A 1 112 ? 17.285  -42.632 48.672 1.00 33.62 ? 769  GLN A CD    1 
ATOM   658  O  OE1   . GLN A 1 112 ? 18.303  -41.942 48.599 1.00 33.71 ? 769  GLN A OE1   1 
ATOM   659  N  NE2   . GLN A 1 112 ? 17.110  -43.547 49.620 1.00 33.92 ? 769  GLN A NE2   1 
ATOM   660  N  N     . TYR A 1 113 ? 15.159  -40.493 44.148 1.00 31.79 ? 770  TYR A N     1 
ATOM   661  C  CA    . TYR A 1 113 ? 14.023  -39.669 43.735 1.00 31.83 ? 770  TYR A CA    1 
ATOM   662  C  C     . TYR A 1 113 ? 12.708  -40.298 44.175 1.00 31.74 ? 770  TYR A C     1 
ATOM   663  O  O     . TYR A 1 113 ? 12.453  -41.475 43.910 1.00 31.70 ? 770  TYR A O     1 
ATOM   664  C  CB    . TYR A 1 113 ? 14.047  -39.444 42.218 1.00 31.91 ? 770  TYR A CB    1 
ATOM   665  C  CG    . TYR A 1 113 ? 12.836  -38.728 41.649 1.00 32.33 ? 770  TYR A CG    1 
ATOM   666  C  CD1   . TYR A 1 113 ? 12.579  -37.390 41.952 1.00 32.67 ? 770  TYR A CD1   1 
ATOM   667  C  CD2   . TYR A 1 113 ? 11.960  -39.385 40.785 1.00 32.69 ? 770  TYR A CD2   1 
ATOM   668  C  CE1   . TYR A 1 113 ? 11.471  -36.731 41.424 1.00 32.74 ? 770  TYR A CE1   1 
ATOM   669  C  CE2   . TYR A 1 113 ? 10.850  -38.735 40.250 1.00 32.85 ? 770  TYR A CE2   1 
ATOM   670  C  CZ    . TYR A 1 113 ? 10.613  -37.409 40.572 1.00 32.95 ? 770  TYR A CZ    1 
ATOM   671  O  OH    . TYR A 1 113 ? 9.517   -36.762 40.046 1.00 33.16 ? 770  TYR A OH    1 
ATOM   672  N  N     . LEU A 1 114 ? 11.883  -39.506 44.854 1.00 31.70 ? 771  LEU A N     1 
ATOM   673  C  CA    . LEU A 1 114 ? 10.621  -39.992 45.402 1.00 31.74 ? 771  LEU A CA    1 
ATOM   674  C  C     . LEU A 1 114 ? 9.426   -39.321 44.711 1.00 31.79 ? 771  LEU A C     1 
ATOM   675  O  O     . LEU A 1 114 ? 9.010   -38.229 45.113 1.00 31.80 ? 771  LEU A O     1 
ATOM   676  C  CB    . LEU A 1 114 ? 10.585  -39.779 46.920 1.00 31.70 ? 771  LEU A CB    1 
ATOM   677  C  CG    . LEU A 1 114 ? 11.783  -40.307 47.724 1.00 31.68 ? 771  LEU A CG    1 
ATOM   678  C  CD1   . LEU A 1 114 ? 11.774  -39.745 49.137 1.00 31.54 ? 771  LEU A CD1   1 
ATOM   679  C  CD2   . LEU A 1 114 ? 11.817  -41.833 47.754 1.00 31.73 ? 771  LEU A CD2   1 
ATOM   680  N  N     . PRO A 1 115 ? 8.868   -39.979 43.669 1.00 31.84 ? 772  PRO A N     1 
ATOM   681  C  CA    . PRO A 1 115 ? 7.856   -39.356 42.805 1.00 31.93 ? 772  PRO A CA    1 
ATOM   682  C  C     . PRO A 1 115 ? 6.640   -38.840 43.573 1.00 32.07 ? 772  PRO A C     1 
ATOM   683  O  O     . PRO A 1 115 ? 6.016   -37.864 43.152 1.00 32.03 ? 772  PRO A O     1 
ATOM   684  C  CB    . PRO A 1 115 ? 7.442   -40.495 41.863 1.00 31.89 ? 772  PRO A CB    1 
ATOM   685  C  CG    . PRO A 1 115 ? 8.577   -41.456 41.899 1.00 31.83 ? 772  PRO A CG    1 
ATOM   686  C  CD    . PRO A 1 115 ? 9.099   -41.389 43.300 1.00 31.81 ? 772  PRO A CD    1 
ATOM   687  N  N     . LEU A 1 116 ? 6.325   -39.487 44.692 1.00 32.29 ? 773  LEU A N     1 
ATOM   688  C  CA    . LEU A 1 116 ? 5.184   -39.103 45.520 1.00 32.54 ? 773  LEU A CA    1 
ATOM   689  C  C     . LEU A 1 116 ? 5.371   -37.744 46.197 1.00 32.78 ? 773  LEU A C     1 
ATOM   690  O  O     . LEU A 1 116 ? 4.392   -37.104 46.587 1.00 32.76 ? 773  LEU A O     1 
ATOM   691  C  CB    . LEU A 1 116 ? 4.872   -40.192 46.551 1.00 32.50 ? 773  LEU A CB    1 
ATOM   692  C  CG    . LEU A 1 116 ? 4.393   -41.551 46.023 1.00 32.55 ? 773  LEU A CG    1 
ATOM   693  C  CD1   . LEU A 1 116 ? 4.378   -42.577 47.145 1.00 32.56 ? 773  LEU A CD1   1 
ATOM   694  C  CD2   . LEU A 1 116 ? 3.017   -41.461 45.356 1.00 32.31 ? 773  LEU A CD2   1 
ATOM   695  N  N     . GLY A 1 117 ? 6.623   -37.312 46.334 1.00 33.09 ? 774  GLY A N     1 
ATOM   696  C  CA    . GLY A 1 117 ? 6.935   -35.954 46.775 1.00 33.52 ? 774  GLY A CA    1 
ATOM   697  C  C     . GLY A 1 117 ? 6.666   -35.644 48.236 1.00 33.86 ? 774  GLY A C     1 
ATOM   698  O  O     . GLY A 1 117 ? 6.670   -36.538 49.086 1.00 33.81 ? 774  GLY A O     1 
ATOM   699  N  N     . SER A 1 118 ? 6.418   -34.363 48.509 1.00 34.28 ? 775  SER A N     1 
ATOM   700  C  CA    . SER A 1 118 ? 6.333   -33.820 49.870 1.00 34.76 ? 775  SER A CA    1 
ATOM   701  C  C     . SER A 1 118 ? 5.099   -34.251 50.647 1.00 34.92 ? 775  SER A C     1 
ATOM   702  O  O     . SER A 1 118 ? 4.024   -34.451 50.074 1.00 35.02 ? 775  SER A O     1 
ATOM   703  C  CB    . SER A 1 118 ? 6.367   -32.288 49.830 1.00 34.79 ? 775  SER A CB    1 
ATOM   704  O  OG    . SER A 1 118 ? 7.530   -31.812 49.178 1.00 35.21 ? 775  SER A OG    1 
ATOM   705  N  N     . LEU A 1 119 ? 5.271   -34.375 51.961 1.00 35.04 ? 776  LEU A N     1 
ATOM   706  C  CA    . LEU A 1 119 ? 4.176   -34.647 52.881 1.00 35.09 ? 776  LEU A CA    1 
ATOM   707  C  C     . LEU A 1 119 ? 3.253   -33.435 52.977 1.00 35.15 ? 776  LEU A C     1 
ATOM   708  O  O     . LEU A 1 119 ? 2.036   -33.580 53.119 1.00 35.17 ? 776  LEU A O     1 
ATOM   709  C  CB    . LEU A 1 119 ? 4.736   -35.000 54.260 1.00 35.06 ? 776  LEU A CB    1 
ATOM   710  C  CG    . LEU A 1 119 ? 3.777   -35.415 55.373 1.00 35.06 ? 776  LEU A CG    1 
ATOM   711  C  CD1   . LEU A 1 119 ? 3.343   -36.858 55.219 1.00 35.13 ? 776  LEU A CD1   1 
ATOM   712  C  CD2   . LEU A 1 119 ? 4.446   -35.204 56.713 1.00 35.05 ? 776  LEU A CD2   1 
ATOM   713  N  N     . LEU A 1 120 ? 3.849   -32.247 52.893 1.00 35.21 ? 777  LEU A N     1 
ATOM   714  C  CA    . LEU A 1 120 ? 3.123   -30.980 52.931 1.00 35.28 ? 777  LEU A CA    1 
ATOM   715  C  C     . LEU A 1 120 ? 2.125   -30.860 51.780 1.00 35.34 ? 777  LEU A C     1 
ATOM   716  O  O     . LEU A 1 120 ? 0.938   -30.627 52.007 1.00 35.35 ? 777  LEU A O     1 
ATOM   717  C  CB    . LEU A 1 120 ? 4.114   -29.808 52.908 1.00 35.26 ? 777  LEU A CB    1 
ATOM   718  C  CG    . LEU A 1 120 ? 3.614   -28.368 52.741 1.00 35.21 ? 777  LEU A CG    1 
ATOM   719  C  CD1   . LEU A 1 120 ? 2.902   -27.865 53.995 1.00 35.14 ? 777  LEU A CD1   1 
ATOM   720  C  CD2   . LEU A 1 120 ? 4.778   -27.455 52.384 1.00 35.16 ? 777  LEU A CD2   1 
ATOM   721  N  N     . ASP A 1 121 ? 2.609   -31.023 50.549 1.00 35.39 ? 778  ASP A N     1 
ATOM   722  C  CA    . ASP A 1 121 ? 1.751   -30.957 49.366 1.00 35.44 ? 778  ASP A CA    1 
ATOM   723  C  C     . ASP A 1 121 ? 0.791   -32.147 49.291 1.00 35.53 ? 778  ASP A C     1 
ATOM   724  O  O     . ASP A 1 121 ? -0.211  -32.101 48.572 1.00 35.57 ? 778  ASP A O     1 
ATOM   725  C  CB    . ASP A 1 121 ? 2.587   -30.863 48.082 1.00 35.42 ? 778  ASP A CB    1 
ATOM   726  C  CG    . ASP A 1 121 ? 3.451   -29.607 48.024 1.00 35.33 ? 778  ASP A CG    1 
ATOM   727  O  OD1   . ASP A 1 121 ? 3.012   -28.533 48.494 1.00 35.06 ? 778  ASP A OD1   1 
ATOM   728  O  OD2   . ASP A 1 121 ? 4.576   -29.696 47.491 1.00 35.37 ? 778  ASP A OD2   1 
ATOM   729  N  N     . HIS A 1 122 ? 1.102   -33.206 50.037 1.00 35.60 ? 779  HIS A N     1 
ATOM   730  C  CA    . HIS A 1 122 ? 0.261   -34.398 50.079 1.00 35.66 ? 779  HIS A CA    1 
ATOM   731  C  C     . HIS A 1 122 ? -0.982  -34.172 50.926 1.00 35.65 ? 779  HIS A C     1 
ATOM   732  O  O     . HIS A 1 122 ? -2.099  -34.441 50.477 1.00 35.68 ? 779  HIS A O     1 
ATOM   733  C  CB    . HIS A 1 122 ? 1.040   -35.596 50.616 1.00 35.71 ? 779  HIS A CB    1 
ATOM   734  C  CG    . HIS A 1 122 ? 0.339   -36.903 50.425 1.00 35.95 ? 779  HIS A CG    1 
ATOM   735  N  ND1   . HIS A 1 122 ? 0.242   -37.519 49.196 1.00 36.13 ? 779  HIS A ND1   1 
ATOM   736  C  CD2   . HIS A 1 122 ? -0.295  -37.714 51.305 1.00 36.14 ? 779  HIS A CD2   1 
ATOM   737  C  CE1   . HIS A 1 122 ? -0.423  -38.653 49.327 1.00 36.27 ? 779  HIS A CE1   1 
ATOM   738  N  NE2   . HIS A 1 122 ? -0.760  -38.795 50.596 1.00 36.27 ? 779  HIS A NE2   1 
ATOM   739  N  N     . VAL A 1 123 ? -0.782  -33.681 52.149 1.00 35.63 ? 780  VAL A N     1 
ATOM   740  C  CA    . VAL A 1 123 ? -1.896  -33.413 53.061 1.00 35.63 ? 780  VAL A CA    1 
ATOM   741  C  C     . VAL A 1 123 ? -2.841  -32.348 52.505 1.00 35.69 ? 780  VAL A C     1 
ATOM   742  O  O     . VAL A 1 123 ? -4.051  -32.441 52.690 1.00 35.70 ? 780  VAL A O     1 
ATOM   743  C  CB    . VAL A 1 123 ? -1.438  -33.046 54.506 1.00 35.59 ? 780  VAL A CB    1 
ATOM   744  C  CG1   . VAL A 1 123 ? -0.864  -34.266 55.214 1.00 35.53 ? 780  VAL A CG1   1 
ATOM   745  C  CG2   . VAL A 1 123 ? -0.435  -31.901 54.508 1.00 35.63 ? 780  VAL A CG2   1 
ATOM   746  N  N     . ARG A 1 124 ? -2.281  -31.350 51.820 1.00 35.75 ? 781  ARG A N     1 
ATOM   747  C  CA    . ARG A 1 124 ? -3.075  -30.317 51.154 1.00 35.81 ? 781  ARG A CA    1 
ATOM   748  C  C     . ARG A 1 124 ? -4.039  -30.928 50.138 1.00 35.85 ? 781  ARG A C     1 
ATOM   749  O  O     . ARG A 1 124 ? -5.225  -30.591 50.109 1.00 35.84 ? 781  ARG A O     1 
ATOM   750  C  CB    . ARG A 1 124 ? -2.168  -29.326 50.418 1.00 35.83 ? 781  ARG A CB    1 
ATOM   751  C  CG    . ARG A 1 124 ? -1.290  -28.431 51.278 1.00 35.82 ? 781  ARG A CG    1 
ATOM   752  C  CD    . ARG A 1 124 ? -0.618  -27.388 50.386 1.00 35.81 ? 781  ARG A CD    1 
ATOM   753  N  NE    . ARG A 1 124 ? 0.528   -26.729 51.012 1.00 35.79 ? 781  ARG A NE    1 
ATOM   754  C  CZ    . ARG A 1 124 ? 0.448   -25.663 51.805 1.00 35.79 ? 781  ARG A CZ    1 
ATOM   755  N  NH1   . ARG A 1 124 ? -0.732  -25.122 52.095 1.00 35.91 ? 781  ARG A NH1   1 
ATOM   756  N  NH2   . ARG A 1 124 ? 1.552   -25.137 52.316 1.00 35.81 ? 781  ARG A NH2   1 
ATOM   757  N  N     . GLN A 1 125 ? -3.509  -31.821 49.304 1.00 35.90 ? 782  GLN A N     1 
ATOM   758  C  CA    . GLN A 1 125 ? -4.245  -32.379 48.173 1.00 35.95 ? 782  GLN A CA    1 
ATOM   759  C  C     . GLN A 1 125 ? -5.320  -33.379 48.586 1.00 35.96 ? 782  GLN A C     1 
ATOM   760  O  O     . GLN A 1 125 ? -6.389  -33.427 47.976 1.00 36.00 ? 782  GLN A O     1 
ATOM   761  C  CB    . GLN A 1 125 ? -3.284  -33.022 47.169 1.00 35.95 ? 782  GLN A CB    1 
ATOM   762  N  N     . HIS A 1 126 ? -5.039  -34.171 49.618 1.00 35.96 ? 783  HIS A N     1 
ATOM   763  C  CA    . HIS A 1 126 ? -5.973  -35.205 50.067 1.00 35.95 ? 783  HIS A CA    1 
ATOM   764  C  C     . HIS A 1 126 ? -6.711  -34.833 51.354 1.00 35.91 ? 783  HIS A C     1 
ATOM   765  O  O     . HIS A 1 126 ? -7.855  -35.243 51.557 1.00 35.91 ? 783  HIS A O     1 
ATOM   766  C  CB    . HIS A 1 126 ? -5.257  -36.550 50.211 1.00 35.97 ? 783  HIS A CB    1 
ATOM   767  C  CG    . HIS A 1 126 ? -4.645  -37.041 48.936 1.00 36.08 ? 783  HIS A CG    1 
ATOM   768  N  ND1   . HIS A 1 126 ? -5.397  -37.545 47.896 1.00 36.13 ? 783  HIS A ND1   1 
ATOM   769  C  CD2   . HIS A 1 126 ? -3.355  -37.096 48.529 1.00 36.17 ? 783  HIS A CD2   1 
ATOM   770  C  CE1   . HIS A 1 126 ? -4.596  -37.893 46.905 1.00 36.22 ? 783  HIS A CE1   1 
ATOM   771  N  NE2   . HIS A 1 126 ? -3.352  -37.631 47.264 1.00 36.23 ? 783  HIS A NE2   1 
ATOM   772  N  N     . ARG A 1 127 ? -6.046  -34.057 52.209 1.00 35.84 ? 784  ARG A N     1 
ATOM   773  C  CA    . ARG A 1 127 ? -6.637  -33.472 53.426 1.00 35.75 ? 784  ARG A CA    1 
ATOM   774  C  C     . ARG A 1 127 ? -7.210  -34.478 54.422 1.00 35.59 ? 784  ARG A C     1 
ATOM   775  O  O     . ARG A 1 127 ? -6.531  -35.429 54.812 1.00 35.57 ? 784  ARG A O     1 
ATOM   776  C  CB    . ARG A 1 127 ? -7.683  -32.399 53.080 1.00 35.83 ? 784  ARG A CB    1 
ATOM   777  C  CG    . ARG A 1 127 ? -7.120  -31.168 52.383 1.00 36.14 ? 784  ARG A CG    1 
ATOM   778  C  CD    . ARG A 1 127 ? -8.055  -29.984 52.548 1.00 36.82 ? 784  ARG A CD    1 
ATOM   779  N  NE    . ARG A 1 127 ? -7.501  -28.968 53.444 1.00 37.38 ? 784  ARG A NE    1 
ATOM   780  C  CZ    . ARG A 1 127 ? -8.226  -28.073 54.111 1.00 37.80 ? 784  ARG A CZ    1 
ATOM   781  N  NH1   . ARG A 1 127 ? -9.555  -28.063 54.009 1.00 37.96 ? 784  ARG A NH1   1 
ATOM   782  N  NH2   . ARG A 1 127 ? -7.618  -27.189 54.893 1.00 37.91 ? 784  ARG A NH2   1 
ATOM   783  N  N     . GLY A 1 128 ? -8.458  -34.251 54.832 1.00 35.45 ? 785  GLY A N     1 
ATOM   784  C  CA    . GLY A 1 128 ? -9.150  -35.089 55.814 1.00 35.22 ? 785  GLY A CA    1 
ATOM   785  C  C     . GLY A 1 128 ? -9.490  -36.487 55.338 1.00 35.07 ? 785  GLY A C     1 
ATOM   786  O  O     . GLY A 1 128 ? -9.746  -37.379 56.152 1.00 35.02 ? 785  GLY A O     1 
ATOM   787  N  N     . ALA A 1 129 ? -9.494  -36.670 54.017 1.00 34.94 ? 786  ALA A N     1 
ATOM   788  C  CA    . ALA A 1 129 ? -9.749  -37.971 53.395 1.00 34.83 ? 786  ALA A CA    1 
ATOM   789  C  C     . ALA A 1 129 ? -8.769  -39.036 53.881 1.00 34.75 ? 786  ALA A C     1 
ATOM   790  O  O     . ALA A 1 129 ? -9.096  -40.224 53.894 1.00 34.78 ? 786  ALA A O     1 
ATOM   791  C  CB    . ALA A 1 129 ? -9.700  -37.856 51.878 1.00 34.82 ? 786  ALA A CB    1 
ATOM   792  N  N     . LEU A 1 130 ? -7.575  -38.594 54.278 1.00 34.65 ? 787  LEU A N     1 
ATOM   793  C  CA    . LEU A 1 130 ? -6.533  -39.464 54.831 1.00 34.54 ? 787  LEU A CA    1 
ATOM   794  C  C     . LEU A 1 130 ? -6.993  -40.192 56.091 1.00 34.46 ? 787  LEU A C     1 
ATOM   795  O  O     . LEU A 1 130 ? -7.817  -39.677 56.852 1.00 34.44 ? 787  LEU A O     1 
ATOM   796  C  CB    . LEU A 1 130 ? -5.274  -38.650 55.149 1.00 34.54 ? 787  LEU A CB    1 
ATOM   797  C  CG    . LEU A 1 130 ? -4.491  -38.004 54.001 1.00 34.62 ? 787  LEU A CG    1 
ATOM   798  C  CD1   . LEU A 1 130 ? -3.520  -36.968 54.546 1.00 34.72 ? 787  LEU A CD1   1 
ATOM   799  C  CD2   . LEU A 1 130 ? -3.754  -39.043 53.159 1.00 34.66 ? 787  LEU A CD2   1 
ATOM   800  N  N     . GLY A 1 131 ? -6.449  -41.387 56.304 1.00 34.38 ? 788  GLY A N     1 
ATOM   801  C  CA    . GLY A 1 131 ? -6.786  -42.192 57.473 1.00 34.32 ? 788  GLY A CA    1 
ATOM   802  C  C     . GLY A 1 131 ? -6.312  -41.546 58.762 1.00 34.26 ? 788  GLY A C     1 
ATOM   803  O  O     . GLY A 1 131 ? -5.157  -41.132 58.852 1.00 34.27 ? 788  GLY A O     1 
ATOM   804  N  N     . PRO A 1 132 ? -7.207  -41.446 59.767 1.00 34.24 ? 789  PRO A N     1 
ATOM   805  C  CA    . PRO A 1 132 ? -6.819  -40.941 61.088 1.00 34.23 ? 789  PRO A CA    1 
ATOM   806  C  C     . PRO A 1 132 ? -5.751  -41.842 61.702 1.00 34.26 ? 789  PRO A C     1 
ATOM   807  O  O     . PRO A 1 132 ? -4.931  -41.388 62.501 1.00 34.26 ? 789  PRO A O     1 
ATOM   808  C  CB    . PRO A 1 132 ? -8.120  -41.025 61.895 1.00 34.21 ? 789  PRO A CB    1 
ATOM   809  C  CG    . PRO A 1 132 ? -8.963  -42.026 61.177 1.00 34.21 ? 789  PRO A CG    1 
ATOM   810  C  CD    . PRO A 1 132 ? -8.622  -41.862 59.731 1.00 34.22 ? 789  PRO A CD    1 
ATOM   811  N  N     . GLN A 1 133 ? -5.784  -43.114 61.309 1.00 34.32 ? 790  GLN A N     1 
ATOM   812  C  CA    . GLN A 1 133 ? -4.772  -44.100 61.652 1.00 34.43 ? 790  GLN A CA    1 
ATOM   813  C  C     . GLN A 1 133 ? -3.488  -43.812 60.883 1.00 34.48 ? 790  GLN A C     1 
ATOM   814  O  O     . GLN A 1 133 ? -2.401  -43.755 61.463 1.00 34.47 ? 790  GLN A O     1 
ATOM   815  C  CB    . GLN A 1 133 ? -5.299  -45.503 61.317 1.00 34.44 ? 790  GLN A CB    1 
ATOM   816  C  CG    . GLN A 1 133 ? -4.237  -46.593 61.159 1.00 34.65 ? 790  GLN A CG    1 
ATOM   817  C  CD    . GLN A 1 133 ? -3.526  -46.929 62.458 1.00 34.89 ? 790  GLN A CD    1 
ATOM   818  O  OE1   . GLN A 1 133 ? -4.089  -46.791 63.544 1.00 34.99 ? 790  GLN A OE1   1 
ATOM   819  N  NE2   . GLN A 1 133 ? -2.284  -47.389 62.350 1.00 34.92 ? 790  GLN A NE2   1 
ATOM   820  N  N     . LEU A 1 134 ? -3.641  -43.625 59.574 1.00 34.56 ? 791  LEU A N     1 
ATOM   821  C  CA    . LEU A 1 134 ? -2.540  -43.376 58.649 1.00 34.58 ? 791  LEU A CA    1 
ATOM   822  C  C     . LEU A 1 134 ? -1.809  -42.071 58.964 1.00 34.62 ? 791  LEU A C     1 
ATOM   823  O  O     . LEU A 1 134 ? -0.596  -41.967 58.768 1.00 34.61 ? 791  LEU A O     1 
ATOM   824  C  CB    . LEU A 1 134 ? -3.095  -43.354 57.216 1.00 34.59 ? 791  LEU A CB    1 
ATOM   825  C  CG    . LEU A 1 134 ? -2.230  -43.349 55.947 1.00 34.50 ? 791  LEU A CG    1 
ATOM   826  C  CD1   . LEU A 1 134 ? -1.749  -41.945 55.618 1.00 34.31 ? 791  LEU A CD1   1 
ATOM   827  C  CD2   . LEU A 1 134 ? -1.063  -44.349 56.026 1.00 34.50 ? 791  LEU A CD2   1 
ATOM   828  N  N     . LEU A 1 135 ? -2.558  -41.087 59.453 1.00 34.69 ? 792  LEU A N     1 
ATOM   829  C  CA    . LEU A 1 135 ? -2.003  -39.776 59.764 1.00 34.77 ? 792  LEU A CA    1 
ATOM   830  C  C     . LEU A 1 135 ? -1.224  -39.790 61.078 1.00 34.87 ? 792  LEU A C     1 
ATOM   831  O  O     . LEU A 1 135 ? -0.263  -39.035 61.240 1.00 34.88 ? 792  LEU A O     1 
ATOM   832  C  CB    . LEU A 1 135 ? -3.105  -38.711 59.774 1.00 34.73 ? 792  LEU A CB    1 
ATOM   833  C  CG    . LEU A 1 135 ? -2.670  -37.244 59.828 1.00 34.64 ? 792  LEU A CG    1 
ATOM   834  C  CD1   . LEU A 1 135 ? -3.480  -36.391 58.863 1.00 34.64 ? 792  LEU A CD1   1 
ATOM   835  C  CD2   . LEU A 1 135 ? -2.774  -36.713 61.243 1.00 34.56 ? 792  LEU A CD2   1 
ATOM   836  N  N     . LEU A 1 136 ? -1.635  -40.651 62.007 1.00 35.02 ? 793  LEU A N     1 
ATOM   837  C  CA    . LEU A 1 136 ? -0.898  -40.837 63.257 1.00 35.16 ? 793  LEU A CA    1 
ATOM   838  C  C     . LEU A 1 136 ? 0.427   -41.561 63.040 1.00 35.24 ? 793  LEU A C     1 
ATOM   839  O  O     . LEU A 1 136 ? 1.456   -41.145 63.577 1.00 35.26 ? 793  LEU A O     1 
ATOM   840  C  CB    . LEU A 1 136 ? -1.745  -41.572 64.296 1.00 35.15 ? 793  LEU A CB    1 
ATOM   841  C  CG    . LEU A 1 136 ? -2.714  -40.695 65.089 1.00 35.22 ? 793  LEU A CG    1 
ATOM   842  C  CD1   . LEU A 1 136 ? -3.598  -41.550 65.983 1.00 35.28 ? 793  LEU A CD1   1 
ATOM   843  C  CD2   . LEU A 1 136 ? -1.972  -39.642 65.915 1.00 35.28 ? 793  LEU A CD2   1 
ATOM   844  N  N     . ASN A 1 137 ? 0.390   -42.634 62.249 1.00 35.35 ? 794  ASN A N     1 
ATOM   845  C  CA    . ASN A 1 137 ? 1.585   -43.397 61.889 1.00 35.46 ? 794  ASN A CA    1 
ATOM   846  C  C     . ASN A 1 137 ? 2.732   -42.520 61.398 1.00 35.54 ? 794  ASN A C     1 
ATOM   847  O  O     . ASN A 1 137 ? 3.896   -42.805 61.674 1.00 35.55 ? 794  ASN A O     1 
ATOM   848  C  CB    . ASN A 1 137 ? 1.251   -44.449 60.828 1.00 35.45 ? 794  ASN A CB    1 
ATOM   849  C  CG    . ASN A 1 137 ? 0.348   -45.546 61.354 1.00 35.51 ? 794  ASN A CG    1 
ATOM   850  O  OD1   . ASN A 1 137 ? 0.638   -46.176 62.373 1.00 35.55 ? 794  ASN A OD1   1 
ATOM   851  N  ND2   . ASN A 1 137 ? -0.750  -45.790 60.649 1.00 35.54 ? 794  ASN A ND2   1 
ATOM   852  N  N     . TRP A 1 138 ? 2.393   -41.453 60.677 1.00 35.61 ? 795  TRP A N     1 
ATOM   853  C  CA    . TRP A 1 138 ? 3.394   -40.525 60.159 1.00 35.69 ? 795  TRP A CA    1 
ATOM   854  C  C     . TRP A 1 138 ? 4.069   -39.698 61.243 1.00 35.48 ? 795  TRP A C     1 
ATOM   855  O  O     . TRP A 1 138 ? 5.253   -39.383 61.132 1.00 35.52 ? 795  TRP A O     1 
ATOM   856  C  CB    . TRP A 1 138 ? 2.799   -39.618 59.087 1.00 35.83 ? 795  TRP A CB    1 
ATOM   857  C  CG    . TRP A 1 138 ? 2.638   -40.304 57.772 1.00 36.55 ? 795  TRP A CG    1 
ATOM   858  C  CD1   . TRP A 1 138 ? 3.311   -41.412 57.334 1.00 36.99 ? 795  TRP A CD1   1 
ATOM   859  C  CD2   . TRP A 1 138 ? 1.768   -39.917 56.708 1.00 37.25 ? 795  TRP A CD2   1 
ATOM   860  N  NE1   . TRP A 1 138 ? 2.903   -41.745 56.068 1.00 37.30 ? 795  TRP A NE1   1 
ATOM   861  C  CE2   . TRP A 1 138 ? 1.958   -40.843 55.657 1.00 37.48 ? 795  TRP A CE2   1 
ATOM   862  C  CE3   . TRP A 1 138 ? 0.838   -38.883 56.541 1.00 37.50 ? 795  TRP A CE3   1 
ATOM   863  C  CZ2   . TRP A 1 138 ? 1.255   -40.762 54.453 1.00 37.75 ? 795  TRP A CZ2   1 
ATOM   864  C  CZ3   . TRP A 1 138 ? 0.141   -38.801 55.344 1.00 37.83 ? 795  TRP A CZ3   1 
ATOM   865  C  CH2   . TRP A 1 138 ? 0.354   -39.736 54.314 1.00 37.92 ? 795  TRP A CH2   1 
ATOM   866  N  N     . GLY A 1 139 ? 3.317   -39.351 62.285 1.00 35.21 ? 796  GLY A N     1 
ATOM   867  C  CA    . GLY A 1 139 ? 3.893   -38.702 63.459 1.00 34.81 ? 796  GLY A CA    1 
ATOM   868  C  C     . GLY A 1 139 ? 4.939   -39.607 64.084 1.00 34.52 ? 796  GLY A C     1 
ATOM   869  O  O     . GLY A 1 139 ? 6.015   -39.150 64.481 1.00 34.48 ? 796  GLY A O     1 
ATOM   870  N  N     . VAL A 1 140 ? 4.615   -40.898 64.150 1.00 34.23 ? 797  VAL A N     1 
ATOM   871  C  CA    . VAL A 1 140 ? 5.506   -41.916 64.704 1.00 33.96 ? 797  VAL A CA    1 
ATOM   872  C  C     . VAL A 1 140 ? 6.729   -42.107 63.812 1.00 33.72 ? 797  VAL A C     1 
ATOM   873  O  O     . VAL A 1 140 ? 7.859   -42.160 64.301 1.00 33.75 ? 797  VAL A O     1 
ATOM   874  C  CB    . VAL A 1 140 ? 4.796   -43.289 64.875 1.00 33.99 ? 797  VAL A CB    1 
ATOM   875  C  CG1   . VAL A 1 140 ? 5.611   -44.206 65.780 1.00 34.00 ? 797  VAL A CG1   1 
ATOM   876  C  CG2   . VAL A 1 140 ? 3.388   -43.120 65.430 1.00 33.99 ? 797  VAL A CG2   1 
ATOM   877  N  N     . GLN A 1 141 ? 6.489   -42.202 62.507 1.00 33.36 ? 798  GLN A N     1 
ATOM   878  C  CA    . GLN A 1 141 ? 7.539   -42.474 61.534 1.00 32.98 ? 798  GLN A CA    1 
ATOM   879  C  C     . GLN A 1 141 ? 8.567   -41.349 61.458 1.00 32.83 ? 798  GLN A C     1 
ATOM   880  O  O     . GLN A 1 141 ? 9.761   -41.605 61.295 1.00 32.84 ? 798  GLN A O     1 
ATOM   881  C  CB    . GLN A 1 141 ? 6.917   -42.749 60.166 1.00 32.95 ? 798  GLN A CB    1 
ATOM   882  C  CG    . GLN A 1 141 ? 6.278   -44.129 60.072 1.00 32.71 ? 798  GLN A CG    1 
ATOM   883  C  CD    . GLN A 1 141 ? 5.527   -44.356 58.779 1.00 32.51 ? 798  GLN A CD    1 
ATOM   884  O  OE1   . GLN A 1 141 ? 5.916   -43.868 57.716 1.00 32.49 ? 798  GLN A OE1   1 
ATOM   885  N  NE2   . GLN A 1 141 ? 4.439   -45.113 58.862 1.00 32.51 ? 798  GLN A NE2   1 
ATOM   886  N  N     . ILE A 1 142 ? 8.098   -40.110 61.588 1.00 32.60 ? 799  ILE A N     1 
ATOM   887  C  CA    . ILE A 1 142 ? 8.975   -38.940 61.604 1.00 32.41 ? 799  ILE A CA    1 
ATOM   888  C  C     . ILE A 1 142 ? 9.853   -38.935 62.861 1.00 32.42 ? 799  ILE A C     1 
ATOM   889  O  O     . ILE A 1 142 ? 11.071  -38.740 62.775 1.00 32.39 ? 799  ILE A O     1 
ATOM   890  C  CB    . ILE A 1 142 ? 8.168   -37.618 61.472 1.00 32.35 ? 799  ILE A CB    1 
ATOM   891  C  CG1   . ILE A 1 142 ? 7.580   -37.494 60.062 1.00 32.25 ? 799  ILE A CG1   1 
ATOM   892  C  CG2   . ILE A 1 142 ? 9.045   -36.404 61.776 1.00 32.27 ? 799  ILE A CG2   1 
ATOM   893  C  CD1   . ILE A 1 142 ? 6.449   -36.481 59.935 1.00 31.99 ? 799  ILE A CD1   1 
ATOM   894  N  N     . ALA A 1 143 ? 9.226   -39.170 64.015 1.00 32.44 ? 800  ALA A N     1 
ATOM   895  C  CA    . ALA A 1 143 ? 9.913   -39.195 65.311 1.00 32.45 ? 800  ALA A CA    1 
ATOM   896  C  C     . ALA A 1 143 ? 10.999  -40.267 65.393 1.00 32.50 ? 800  ALA A C     1 
ATOM   897  O  O     . ALA A 1 143 ? 12.049  -40.041 65.995 1.00 32.54 ? 800  ALA A O     1 
ATOM   898  C  CB    . ALA A 1 143 ? 8.907   -39.372 66.443 1.00 32.43 ? 800  ALA A CB    1 
ATOM   899  N  N     . LYS A 1 144 ? 10.735  -41.426 64.788 1.00 32.56 ? 801  LYS A N     1 
ATOM   900  C  CA    . LYS A 1 144 ? 11.700  -42.527 64.722 1.00 32.62 ? 801  LYS A CA    1 
ATOM   901  C  C     . LYS A 1 144 ? 12.958  -42.126 63.958 1.00 32.76 ? 801  LYS A C     1 
ATOM   902  O  O     . LYS A 1 144 ? 14.075  -42.462 64.361 1.00 32.77 ? 801  LYS A O     1 
ATOM   903  C  CB    . LYS A 1 144 ? 11.073  -43.758 64.065 1.00 32.55 ? 801  LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 144 ? 10.110  -44.522 64.951 1.00 32.42 ? 801  LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 144 ? 9.553   -45.730 64.223 1.00 32.28 ? 801  LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 144 ? 8.576   -46.495 65.093 1.00 32.27 ? 801  LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 144 ? 8.025   -47.684 64.387 1.00 32.29 ? 801  LYS A NZ    1 
ATOM   908  N  N     . GLY A 1 145 ? 12.760  -41.412 62.851 1.00 32.93 ? 802  GLY A N     1 
ATOM   909  C  CA    . GLY A 1 145 ? 13.858  -40.907 62.034 1.00 33.21 ? 802  GLY A CA    1 
ATOM   910  C  C     . GLY A 1 145 ? 14.679  -39.863 62.764 1.00 33.41 ? 802  GLY A C     1 
ATOM   911  O  O     . GLY A 1 145 ? 15.904  -39.972 62.836 1.00 33.44 ? 802  GLY A O     1 
ATOM   912  N  N     . MET A 1 146 ? 14.001  -38.852 63.307 1.00 33.62 ? 803  MET A N     1 
ATOM   913  C  CA    . MET A 1 146 ? 14.654  -37.806 64.096 1.00 33.85 ? 803  MET A CA    1 
ATOM   914  C  C     . MET A 1 146 ? 15.377  -38.385 65.308 1.00 33.95 ? 803  MET A C     1 
ATOM   915  O  O     . MET A 1 146 ? 16.385  -37.835 65.760 1.00 33.99 ? 803  MET A O     1 
ATOM   916  C  CB    . MET A 1 146 ? 13.645  -36.753 64.549 1.00 33.86 ? 803  MET A CB    1 
ATOM   917  C  CG    . MET A 1 146 ? 13.111  -35.848 63.444 1.00 34.13 ? 803  MET A CG    1 
ATOM   918  S  SD    . MET A 1 146 ? 14.352  -34.842 62.590 1.00 34.73 ? 803  MET A SD    1 
ATOM   919  C  CE    . MET A 1 146 ? 15.181  -34.015 63.954 1.00 34.72 ? 803  MET A CE    1 
ATOM   920  N  N     . TYR A 1 147 ? 14.851  -39.491 65.830 1.00 34.07 ? 804  TYR A N     1 
ATOM   921  C  CA    . TYR A 1 147 ? 15.536  -40.245 66.869 1.00 34.20 ? 804  TYR A CA    1 
ATOM   922  C  C     . TYR A 1 147 ? 16.854  -40.799 66.330 1.00 34.04 ? 804  TYR A C     1 
ATOM   923  O  O     . TYR A 1 147 ? 17.897  -40.643 66.969 1.00 34.08 ? 804  TYR A O     1 
ATOM   924  C  CB    . TYR A 1 147 ? 14.650  -41.371 67.411 1.00 34.35 ? 804  TYR A CB    1 
ATOM   925  C  CG    . TYR A 1 147 ? 15.321  -42.236 68.455 1.00 34.91 ? 804  TYR A CG    1 
ATOM   926  C  CD1   . TYR A 1 147 ? 15.600  -43.578 68.200 1.00 35.41 ? 804  TYR A CD1   1 
ATOM   927  C  CD2   . TYR A 1 147 ? 15.684  -41.711 69.695 1.00 35.32 ? 804  TYR A CD2   1 
ATOM   928  C  CE1   . TYR A 1 147 ? 16.218  -44.379 69.157 1.00 35.69 ? 804  TYR A CE1   1 
ATOM   929  C  CE2   . TYR A 1 147 ? 16.306  -42.501 70.653 1.00 35.64 ? 804  TYR A CE2   1 
ATOM   930  C  CZ    . TYR A 1 147 ? 16.566  -43.833 70.381 1.00 35.78 ? 804  TYR A CZ    1 
ATOM   931  O  OH    . TYR A 1 147 ? 17.178  -44.616 71.333 1.00 35.96 ? 804  TYR A OH    1 
ATOM   932  N  N     . TYR A 1 148 ? 16.804  -41.428 65.154 1.00 33.85 ? 805  TYR A N     1 
ATOM   933  C  CA    . TYR A 1 148 ? 18.006  -41.968 64.514 1.00 33.62 ? 805  TYR A CA    1 
ATOM   934  C  C     . TYR A 1 148 ? 19.057  -40.881 64.327 1.00 33.60 ? 805  TYR A C     1 
ATOM   935  O  O     . TYR A 1 148 ? 20.248  -41.115 64.537 1.00 33.57 ? 805  TYR A O     1 
ATOM   936  C  CB    . TYR A 1 148 ? 17.678  -42.618 63.167 1.00 33.50 ? 805  TYR A CB    1 
ATOM   937  C  CG    . TYR A 1 148 ? 18.886  -43.201 62.465 1.00 33.20 ? 805  TYR A CG    1 
ATOM   938  C  CD1   . TYR A 1 148 ? 19.366  -44.463 62.804 1.00 32.85 ? 805  TYR A CD1   1 
ATOM   939  C  CD2   . TYR A 1 148 ? 19.550  -42.489 61.464 1.00 32.94 ? 805  TYR A CD2   1 
ATOM   940  C  CE1   . TYR A 1 148 ? 20.470  -45.004 62.167 1.00 32.68 ? 805  TYR A CE1   1 
ATOM   941  C  CE2   . TYR A 1 148 ? 20.657  -43.022 60.821 1.00 32.59 ? 805  TYR A CE2   1 
ATOM   942  C  CZ    . TYR A 1 148 ? 21.112  -44.277 61.180 1.00 32.70 ? 805  TYR A CZ    1 
ATOM   943  O  OH    . TYR A 1 148 ? 22.208  -44.814 60.546 1.00 33.12 ? 805  TYR A OH    1 
ATOM   944  N  N     . LEU A 1 149 ? 18.602  -39.695 63.933 1.00 33.61 ? 806  LEU A N     1 
ATOM   945  C  CA    . LEU A 1 149 ? 19.482  -38.547 63.765 1.00 33.65 ? 806  LEU A CA    1 
ATOM   946  C  C     . LEU A 1 149 ? 20.043  -38.087 65.101 1.00 33.78 ? 806  LEU A C     1 
ATOM   947  O  O     . LEU A 1 149 ? 21.239  -37.793 65.205 1.00 33.83 ? 806  LEU A O     1 
ATOM   948  C  CB    . LEU A 1 149 ? 18.755  -37.398 63.064 1.00 33.55 ? 806  LEU A CB    1 
ATOM   949  C  CG    . LEU A 1 149 ? 18.291  -37.675 61.630 1.00 33.32 ? 806  LEU A CG    1 
ATOM   950  C  CD1   . LEU A 1 149 ? 17.590  -36.458 61.055 1.00 33.24 ? 806  LEU A CD1   1 
ATOM   951  C  CD2   . LEU A 1 149 ? 19.450  -38.098 60.736 1.00 33.09 ? 806  LEU A CD2   1 
ATOM   952  N  N     . GLU A 1 150 ? 19.181  -38.037 66.118 1.00 33.91 ? 807  GLU A N     1 
ATOM   953  C  CA    . GLU A 1 150 ? 19.604  -37.655 67.460 1.00 34.08 ? 807  GLU A CA    1 
ATOM   954  C  C     . GLU A 1 150 ? 20.667  -38.612 67.992 1.00 34.06 ? 807  GLU A C     1 
ATOM   955  O  O     . GLU A 1 150 ? 21.652  -38.182 68.597 1.00 34.07 ? 807  GLU A O     1 
ATOM   956  C  CB    . GLU A 1 150 ? 18.422  -37.584 68.434 1.00 34.14 ? 807  GLU A CB    1 
ATOM   957  C  CG    . GLU A 1 150 ? 18.720  -36.729 69.664 1.00 34.52 ? 807  GLU A CG    1 
ATOM   958  C  CD    . GLU A 1 150 ? 17.893  -37.082 70.881 1.00 35.02 ? 807  GLU A CD    1 
ATOM   959  O  OE1   . GLU A 1 150 ? 18.497  -37.392 71.929 1.00 35.29 ? 807  GLU A OE1   1 
ATOM   960  O  OE2   . GLU A 1 150 ? 16.645  -37.046 70.802 1.00 35.27 ? 807  GLU A OE2   1 
ATOM   961  N  N     . GLU A 1 151 ? 20.458  -39.904 67.747 1.00 34.06 ? 808  GLU A N     1 
ATOM   962  C  CA    . GLU A 1 151 ? 21.363  -40.953 68.211 1.00 34.11 ? 808  GLU A CA    1 
ATOM   963  C  C     . GLU A 1 151 ? 22.781  -40.803 67.675 1.00 33.95 ? 808  GLU A C     1 
ATOM   964  O  O     . GLU A 1 151 ? 23.747  -40.979 68.416 1.00 33.93 ? 808  GLU A O     1 
ATOM   965  C  CB    . GLU A 1 151 ? 20.817  -42.338 67.861 1.00 34.18 ? 808  GLU A CB    1 
ATOM   966  C  CG    . GLU A 1 151 ? 19.894  -42.920 68.917 1.00 34.77 ? 808  GLU A CG    1 
ATOM   967  C  CD    . GLU A 1 151 ? 19.792  -44.432 68.833 1.00 35.54 ? 808  GLU A CD    1 
ATOM   968  O  OE1   . GLU A 1 151 ? 19.315  -44.946 67.797 1.00 35.73 ? 808  GLU A OE1   1 
ATOM   969  O  OE2   . GLU A 1 151 ? 20.185  -45.108 69.808 1.00 35.77 ? 808  GLU A OE2   1 
ATOM   970  N  N     . HIS A 1 152 ? 22.902  -40.476 66.393 1.00 33.85 ? 809  HIS A N     1 
ATOM   971  C  CA    . HIS A 1 152 ? 24.213  -40.294 65.780 1.00 33.74 ? 809  HIS A CA    1 
ATOM   972  C  C     . HIS A 1 152 ? 24.677  -38.837 65.871 1.00 33.56 ? 809  HIS A C     1 
ATOM   973  O  O     . HIS A 1 152 ? 25.620  -38.425 65.190 1.00 33.53 ? 809  HIS A O     1 
ATOM   974  C  CB    . HIS A 1 152 ? 24.208  -40.824 64.346 1.00 33.82 ? 809  HIS A CB    1 
ATOM   975  C  CG    . HIS A 1 152 ? 23.928  -42.293 64.254 1.00 34.07 ? 809  HIS A CG    1 
ATOM   976  N  ND1   . HIS A 1 152 ? 24.928  -43.237 64.165 1.00 34.36 ? 809  HIS A ND1   1 
ATOM   977  C  CD2   . HIS A 1 152 ? 22.762  -42.982 64.258 1.00 34.32 ? 809  HIS A CD2   1 
ATOM   978  C  CE1   . HIS A 1 152 ? 24.390  -44.443 64.108 1.00 34.44 ? 809  HIS A CE1   1 
ATOM   979  N  NE2   . HIS A 1 152 ? 23.077  -44.316 64.164 1.00 34.47 ? 809  HIS A NE2   1 
ATOM   980  N  N     . GLY A 1 153 ? 24.005  -38.076 66.733 1.00 33.37 ? 810  GLY A N     1 
ATOM   981  C  CA    . GLY A 1 153 ? 24.417  -36.720 67.087 1.00 33.17 ? 810  GLY A CA    1 
ATOM   982  C  C     . GLY A 1 153 ? 24.268  -35.716 65.966 1.00 33.05 ? 810  GLY A C     1 
ATOM   983  O  O     . GLY A 1 153 ? 25.016  -34.740 65.900 1.00 33.05 ? 810  GLY A O     1 
ATOM   984  N  N     . MET A 1 154 ? 23.293  -35.960 65.093 1.00 32.97 ? 811  MET A N     1 
ATOM   985  C  CA    . MET A 1 154 ? 23.051  -35.126 63.921 1.00 32.84 ? 811  MET A CA    1 
ATOM   986  C  C     . MET A 1 154 ? 21.861  -34.191 64.131 1.00 32.84 ? 811  MET A C     1 
ATOM   987  O  O     . MET A 1 154 ? 20.729  -34.641 64.330 1.00 32.85 ? 811  MET A O     1 
ATOM   988  C  CB    . MET A 1 154 ? 22.830  -36.011 62.689 1.00 32.85 ? 811  MET A CB    1 
ATOM   989  C  CG    . MET A 1 154 ? 22.405  -35.269 61.432 1.00 32.68 ? 811  MET A CG    1 
ATOM   990  S  SD    . MET A 1 154 ? 23.679  -34.156 60.830 1.00 32.40 ? 811  MET A SD    1 
ATOM   991  C  CE    . MET A 1 154 ? 22.979  -33.724 59.255 1.00 32.62 ? 811  MET A CE    1 
ATOM   992  N  N     . VAL A 1 155 ? 22.135  -32.889 64.084 1.00 32.84 ? 812  VAL A N     1 
ATOM   993  C  CA    . VAL A 1 155 ? 21.104  -31.862 64.194 1.00 32.86 ? 812  VAL A CA    1 
ATOM   994  C  C     . VAL A 1 155 ? 20.600  -31.516 62.799 1.00 33.03 ? 812  VAL A C     1 
ATOM   995  O  O     . VAL A 1 155 ? 21.375  -31.066 61.948 1.00 33.07 ? 812  VAL A O     1 
ATOM   996  C  CB    . VAL A 1 155 ? 21.644  -30.585 64.885 1.00 32.79 ? 812  VAL A CB    1 
ATOM   997  C  CG1   . VAL A 1 155 ? 20.595  -29.480 64.893 1.00 32.68 ? 812  VAL A CG1   1 
ATOM   998  C  CG2   . VAL A 1 155 ? 22.098  -30.896 66.303 1.00 32.85 ? 812  VAL A CG2   1 
ATOM   999  N  N     . HIS A 1 156 ? 19.306  -31.734 62.570 1.00 33.23 ? 813  HIS A N     1 
ATOM   1000 C  CA    . HIS A 1 156 ? 18.688  -31.467 61.271 1.00 33.46 ? 813  HIS A CA    1 
ATOM   1001 C  C     . HIS A 1 156 ? 18.711  -29.977 60.914 1.00 33.50 ? 813  HIS A C     1 
ATOM   1002 O  O     . HIS A 1 156 ? 19.146  -29.601 59.823 1.00 33.51 ? 813  HIS A O     1 
ATOM   1003 C  CB    . HIS A 1 156 ? 17.254  -32.006 61.229 1.00 33.54 ? 813  HIS A CB    1 
ATOM   1004 C  CG    . HIS A 1 156 ? 16.597  -31.846 59.895 1.00 33.87 ? 813  HIS A CG    1 
ATOM   1005 N  ND1   . HIS A 1 156 ? 16.138  -30.632 59.438 1.00 33.97 ? 813  HIS A ND1   1 
ATOM   1006 C  CD2   . HIS A 1 156 ? 16.333  -32.742 58.915 1.00 34.22 ? 813  HIS A CD2   1 
ATOM   1007 C  CE1   . HIS A 1 156 ? 15.624  -30.785 58.231 1.00 34.40 ? 813  HIS A CE1   1 
ATOM   1008 N  NE2   . HIS A 1 156 ? 15.729  -32.056 57.890 1.00 34.47 ? 813  HIS A NE2   1 
ATOM   1009 N  N     . ARG A 1 157 ? 18.216  -29.151 61.836 1.00 33.55 ? 814  ARG A N     1 
ATOM   1010 C  CA    . ARG A 1 157 ? 18.284  -27.689 61.743 1.00 33.61 ? 814  ARG A CA    1 
ATOM   1011 C  C     . ARG A 1 157 ? 17.311  -27.049 60.731 1.00 33.56 ? 814  ARG A C     1 
ATOM   1012 O  O     . ARG A 1 157 ? 17.287  -25.824 60.577 1.00 33.58 ? 814  ARG A O     1 
ATOM   1013 C  CB    . ARG A 1 157 ? 19.733  -27.227 61.507 1.00 33.65 ? 814  ARG A CB    1 
ATOM   1014 C  CG    . ARG A 1 157 ? 20.006  -25.811 61.964 1.00 34.11 ? 814  ARG A CG    1 
ATOM   1015 C  CD    . ARG A 1 157 ? 21.446  -25.403 61.762 1.00 34.74 ? 814  ARG A CD    1 
ATOM   1016 N  NE    . ARG A 1 157 ? 21.548  -23.959 61.554 1.00 35.29 ? 814  ARG A NE    1 
ATOM   1017 C  CZ    . ARG A 1 157 ? 22.680  -23.308 61.303 1.00 35.77 ? 814  ARG A CZ    1 
ATOM   1018 N  NH1   . ARG A 1 157 ? 23.835  -23.961 61.227 1.00 35.90 ? 814  ARG A NH1   1 
ATOM   1019 N  NH2   . ARG A 1 157 ? 22.656  -21.993 61.125 1.00 35.97 ? 814  ARG A NH2   1 
ATOM   1020 N  N     . ASN A 1 158 ? 16.500  -27.869 60.065 1.00 33.47 ? 815  ASN A N     1 
ATOM   1021 C  CA    . ASN A 1 158 ? 15.506  -27.374 59.106 1.00 33.39 ? 815  ASN A CA    1 
ATOM   1022 C  C     . ASN A 1 158 ? 14.312  -28.322 58.972 1.00 33.39 ? 815  ASN A C     1 
ATOM   1023 O  O     . ASN A 1 158 ? 13.789  -28.515 57.877 1.00 33.39 ? 815  ASN A O     1 
ATOM   1024 C  CB    . ASN A 1 158 ? 16.157  -27.139 57.730 1.00 33.40 ? 815  ASN A CB    1 
ATOM   1025 C  CG    . ASN A 1 158 ? 15.267  -26.344 56.765 1.00 33.51 ? 815  ASN A CG    1 
ATOM   1026 O  OD1   . ASN A 1 158 ? 14.143  -25.954 57.091 1.00 33.70 ? 815  ASN A OD1   1 
ATOM   1027 N  ND2   . ASN A 1 158 ? 15.784  -26.103 55.565 1.00 33.69 ? 815  ASN A ND2   1 
ATOM   1028 N  N     . LEU A 1 159 ? 13.882  -28.929 60.074 1.00 33.38 ? 816  LEU A N     1 
ATOM   1029 C  CA    . LEU A 1 159 ? 12.749  -29.844 60.000 1.00 33.37 ? 816  LEU A CA    1 
ATOM   1030 C  C     . LEU A 1 159 ? 11.468  -29.068 59.687 1.00 33.43 ? 816  LEU A C     1 
ATOM   1031 O  O     . LEU A 1 159 ? 11.242  -27.980 60.229 1.00 33.48 ? 816  LEU A O     1 
ATOM   1032 C  CB    . LEU A 1 159 ? 12.612  -30.673 61.281 1.00 33.32 ? 816  LEU A CB    1 
ATOM   1033 C  CG    . LEU A 1 159 ? 11.514  -31.747 61.344 1.00 33.39 ? 816  LEU A CG    1 
ATOM   1034 C  CD1   . LEU A 1 159 ? 11.566  -32.716 60.150 1.00 33.34 ? 816  LEU A CD1   1 
ATOM   1035 C  CD2   . LEU A 1 159 ? 11.599  -32.513 62.664 1.00 33.53 ? 816  LEU A CD2   1 
ATOM   1036 N  N     . ALA A 1 160 ? 10.657  -29.629 58.791 1.00 33.43 ? 817  ALA A N     1 
ATOM   1037 C  CA    . ALA A 1 160 ? 9.390   -29.037 58.360 1.00 33.46 ? 817  ALA A CA    1 
ATOM   1038 C  C     . ALA A 1 160 ? 8.631   -30.059 57.521 1.00 33.51 ? 817  ALA A C     1 
ATOM   1039 O  O     . ALA A 1 160 ? 9.161   -31.132 57.224 1.00 33.51 ? 817  ALA A O     1 
ATOM   1040 C  CB    . ALA A 1 160 ? 9.632   -27.762 57.560 1.00 33.44 ? 817  ALA A CB    1 
ATOM   1041 N  N     . ALA A 1 161 ? 7.397   -29.731 57.139 1.00 33.56 ? 818  ALA A N     1 
ATOM   1042 C  CA    . ALA A 1 161 ? 6.577   -30.644 56.337 1.00 33.57 ? 818  ALA A CA    1 
ATOM   1043 C  C     . ALA A 1 161 ? 7.062   -30.734 54.891 1.00 33.55 ? 818  ALA A C     1 
ATOM   1044 O  O     . ALA A 1 161 ? 6.966   -31.794 54.265 1.00 33.53 ? 818  ALA A O     1 
ATOM   1045 C  CB    . ALA A 1 161 ? 5.112   -30.250 56.392 1.00 33.60 ? 818  ALA A CB    1 
ATOM   1046 N  N     . ARG A 1 162 ? 7.581   -29.618 54.374 1.00 33.52 ? 819  ARG A N     1 
ATOM   1047 C  CA    . ARG A 1 162 ? 8.248   -29.585 53.067 1.00 33.50 ? 819  ARG A CA    1 
ATOM   1048 C  C     . ARG A 1 162 ? 9.418   -30.570 53.014 1.00 33.57 ? 819  ARG A C     1 
ATOM   1049 O  O     . ARG A 1 162 ? 9.720   -31.133 51.959 1.00 33.62 ? 819  ARG A O     1 
ATOM   1050 C  CB    . ARG A 1 162 ? 8.732   -28.163 52.733 1.00 33.42 ? 819  ARG A CB    1 
ATOM   1051 C  CG    . ARG A 1 162 ? 9.637   -27.518 53.791 1.00 33.21 ? 819  ARG A CG    1 
ATOM   1052 C  CD    . ARG A 1 162 ? 9.955   -26.063 53.465 1.00 32.91 ? 819  ARG A CD    1 
ATOM   1053 N  NE    . ARG A 1 162 ? 10.829  -25.441 54.464 1.00 32.81 ? 819  ARG A NE    1 
ATOM   1054 C  CZ    . ARG A 1 162 ? 10.401  -24.834 55.569 1.00 32.83 ? 819  ARG A CZ    1 
ATOM   1055 N  NH1   . ARG A 1 162 ? 9.106   -24.764 55.832 1.00 33.00 ? 819  ARG A NH1   1 
ATOM   1056 N  NH2   . ARG A 1 162 ? 11.269  -24.298 56.417 1.00 32.87 ? 819  ARG A NH2   1 
ATOM   1057 N  N     . ASN A 1 163 ? 10.057  -30.776 54.165 1.00 33.57 ? 820  ASN A N     1 
ATOM   1058 C  CA    . ASN A 1 163 ? 11.225  -31.642 54.267 1.00 33.53 ? 820  ASN A CA    1 
ATOM   1059 C  C     . ASN A 1 163 ? 10.913  -33.114 54.536 1.00 33.49 ? 820  ASN A C     1 
ATOM   1060 O  O     . ASN A 1 163 ? 11.769  -33.971 54.323 1.00 33.62 ? 820  ASN A O     1 
ATOM   1061 C  CB    . ASN A 1 163 ? 12.218  -31.088 55.292 1.00 33.51 ? 820  ASN A CB    1 
ATOM   1062 C  CG    . ASN A 1 163 ? 12.893  -29.810 54.816 1.00 33.49 ? 820  ASN A CG    1 
ATOM   1063 O  OD1   . ASN A 1 163 ? 12.939  -29.523 53.618 1.00 32.95 ? 820  ASN A OD1   1 
ATOM   1064 N  ND2   . ASN A 1 163 ? 13.424  -29.040 55.753 1.00 33.68 ? 820  ASN A ND2   1 
ATOM   1065 N  N     . VAL A 1 164 ? 9.700   -33.414 54.997 1.00 33.32 ? 821  VAL A N     1 
ATOM   1066 C  CA    . VAL A 1 164 ? 9.257   -34.810 55.093 1.00 33.04 ? 821  VAL A CA    1 
ATOM   1067 C  C     . VAL A 1 164 ? 8.736   -35.262 53.722 1.00 32.93 ? 821  VAL A C     1 
ATOM   1068 O  O     . VAL A 1 164 ? 7.907   -34.580 53.115 1.00 32.92 ? 821  VAL A O     1 
ATOM   1069 C  CB    . VAL A 1 164 ? 8.172   -35.015 56.181 1.00 33.01 ? 821  VAL A CB    1 
ATOM   1070 C  CG1   . VAL A 1 164 ? 7.878   -36.500 56.365 1.00 32.97 ? 821  VAL A CG1   1 
ATOM   1071 C  CG2   . VAL A 1 164 ? 8.617   -34.411 57.505 1.00 32.85 ? 821  VAL A CG2   1 
ATOM   1072 N  N     . LEU A 1 165 ? 9.233   -36.403 53.239 1.00 32.75 ? 822  LEU A N     1 
ATOM   1073 C  CA    . LEU A 1 165 ? 8.884   -36.913 51.903 1.00 32.58 ? 822  LEU A CA    1 
ATOM   1074 C  C     . LEU A 1 165 ? 8.288   -38.320 51.922 1.00 32.52 ? 822  LEU A C     1 
ATOM   1075 O  O     . LEU A 1 165 ? 8.576   -39.113 52.819 1.00 32.52 ? 822  LEU A O     1 
ATOM   1076 C  CB    . LEU A 1 165 ? 10.109  -36.907 50.981 1.00 32.52 ? 822  LEU A CB    1 
ATOM   1077 C  CG    . LEU A 1 165 ? 10.782  -35.597 50.565 1.00 32.45 ? 822  LEU A CG    1 
ATOM   1078 C  CD1   . LEU A 1 165 ? 12.119  -35.898 49.908 1.00 32.59 ? 822  LEU A CD1   1 
ATOM   1079 C  CD2   . LEU A 1 165 ? 9.911   -34.777 49.629 1.00 32.30 ? 822  LEU A CD2   1 
ATOM   1080 N  N     . LEU A 1 166 ? 7.477   -38.623 50.911 1.00 32.44 ? 823  LEU A N     1 
ATOM   1081 C  CA    . LEU A 1 166 ? 6.832   -39.928 50.779 1.00 32.38 ? 823  LEU A CA    1 
ATOM   1082 C  C     . LEU A 1 166 ? 7.687   -40.908 49.979 1.00 32.38 ? 823  LEU A C     1 
ATOM   1083 O  O     . LEU A 1 166 ? 7.917   -40.714 48.783 1.00 32.39 ? 823  LEU A O     1 
ATOM   1084 C  CB    . LEU A 1 166 ? 5.455   -39.780 50.116 1.00 32.39 ? 823  LEU A CB    1 
ATOM   1085 C  CG    . LEU A 1 166 ? 4.182   -39.420 50.901 1.00 32.42 ? 823  LEU A CG    1 
ATOM   1086 C  CD1   . LEU A 1 166 ? 3.666   -40.607 51.711 1.00 32.49 ? 823  LEU A CD1   1 
ATOM   1087 C  CD2   . LEU A 1 166 ? 4.345   -38.188 51.790 1.00 32.32 ? 823  LEU A CD2   1 
ATOM   1088 N  N     . LYS A 1 167 ? 8.160   -41.954 50.650 1.00 32.39 ? 824  LYS A N     1 
ATOM   1089 C  CA    . LYS A 1 167 ? 8.868   -43.049 49.990 1.00 32.40 ? 824  LYS A CA    1 
ATOM   1090 C  C     . LYS A 1 167 ? 7.845   -44.030 49.416 1.00 32.34 ? 824  LYS A C     1 
ATOM   1091 O  O     . LYS A 1 167 ? 8.058   -44.628 48.357 1.00 32.35 ? 824  LYS A O     1 
ATOM   1092 C  CB    . LYS A 1 167 ? 9.822   -43.737 50.983 1.00 32.40 ? 824  LYS A CB    1 
ATOM   1093 C  CG    . LYS A 1 167 ? 10.162  -45.208 50.700 1.00 32.62 ? 824  LYS A CG    1 
ATOM   1094 C  CD    . LYS A 1 167 ? 11.305  -45.386 49.706 1.00 32.88 ? 824  LYS A CD    1 
ATOM   1095 C  CE    . LYS A 1 167 ? 11.580  -46.868 49.463 1.00 33.08 ? 824  LYS A CE    1 
ATOM   1096 N  NZ    . LYS A 1 167 ? 12.828  -47.104 48.673 1.00 33.27 ? 824  LYS A NZ    1 
ATOM   1097 N  N     . SER A 1 168 ? 6.724   -44.159 50.122 1.00 32.23 ? 825  SER A N     1 
ATOM   1098 C  CA    . SER A 1 168 ? 5.673   -45.115 49.800 1.00 32.11 ? 825  SER A CA    1 
ATOM   1099 C  C     . SER A 1 168 ? 4.341   -44.496 50.226 1.00 31.99 ? 825  SER A C     1 
ATOM   1100 O  O     . SER A 1 168 ? 4.334   -43.620 51.091 1.00 32.01 ? 825  SER A O     1 
ATOM   1101 C  CB    . SER A 1 168 ? 5.930   -46.418 50.560 1.00 32.13 ? 825  SER A CB    1 
ATOM   1102 O  OG    . SER A 1 168 ? 5.211   -47.505 50.011 1.00 32.23 ? 825  SER A OG    1 
ATOM   1103 N  N     . PRO A 1 169 ? 3.209   -44.935 49.628 1.00 31.87 ? 826  PRO A N     1 
ATOM   1104 C  CA    . PRO A 1 169 ? 1.915   -44.348 50.001 1.00 31.75 ? 826  PRO A CA    1 
ATOM   1105 C  C     . PRO A 1 169 ? 1.697   -44.264 51.514 1.00 31.65 ? 826  PRO A C     1 
ATOM   1106 O  O     . PRO A 1 169 ? 1.073   -43.315 51.993 1.00 31.64 ? 826  PRO A O     1 
ATOM   1107 C  CB    . PRO A 1 169 ? 0.904   -45.307 49.372 1.00 31.74 ? 826  PRO A CB    1 
ATOM   1108 C  CG    . PRO A 1 169 ? 1.602   -45.847 48.187 1.00 31.79 ? 826  PRO A CG    1 
ATOM   1109 C  CD    . PRO A 1 169 ? 3.058   -45.941 48.557 1.00 31.88 ? 826  PRO A CD    1 
ATOM   1110 N  N     . SER A 1 170 ? 2.220   -45.243 52.249 1.00 31.54 ? 827  SER A N     1 
ATOM   1111 C  CA    . SER A 1 170 ? 2.122   -45.259 53.707 1.00 31.45 ? 827  SER A CA    1 
ATOM   1112 C  C     . SER A 1 170 ? 3.436   -44.904 54.415 1.00 31.43 ? 827  SER A C     1 
ATOM   1113 O  O     . SER A 1 170 ? 3.455   -44.746 55.638 1.00 31.39 ? 827  SER A O     1 
ATOM   1114 C  CB    . SER A 1 170 ? 1.616   -46.622 54.188 1.00 31.42 ? 827  SER A CB    1 
ATOM   1115 O  OG    . SER A 1 170 ? 2.436   -47.671 53.700 1.00 31.33 ? 827  SER A OG    1 
ATOM   1116 N  N     . GLN A 1 171 ? 4.523   -44.763 53.656 1.00 31.41 ? 828  GLN A N     1 
ATOM   1117 C  CA    . GLN A 1 171 ? 5.849   -44.576 54.262 1.00 31.42 ? 828  GLN A CA    1 
ATOM   1118 C  C     . GLN A 1 171 ? 6.495   -43.221 53.994 1.00 31.31 ? 828  GLN A C     1 
ATOM   1119 O  O     . GLN A 1 171 ? 6.576   -42.773 52.847 1.00 31.37 ? 828  GLN A O     1 
ATOM   1120 C  CB    . GLN A 1 171 ? 6.804   -45.709 53.859 1.00 31.45 ? 828  GLN A CB    1 
ATOM   1121 C  CG    . GLN A 1 171 ? 6.314   -47.120 54.199 1.00 31.69 ? 828  GLN A CG    1 
ATOM   1122 C  CD    . GLN A 1 171 ? 5.946   -47.300 55.667 1.00 31.95 ? 828  GLN A CD    1 
ATOM   1123 O  OE1   . GLN A 1 171 ? 6.414   -46.566 56.541 1.00 32.06 ? 828  GLN A OE1   1 
ATOM   1124 N  NE2   . GLN A 1 171 ? 5.105   -48.290 55.941 1.00 32.00 ? 828  GLN A NE2   1 
ATOM   1125 N  N     . VAL A 1 172 ? 6.960   -42.581 55.067 1.00 31.09 ? 829  VAL A N     1 
ATOM   1126 C  CA    . VAL A 1 172 ? 7.608   -41.269 54.978 1.00 30.86 ? 829  VAL A CA    1 
ATOM   1127 C  C     . VAL A 1 172 ? 9.050   -41.278 55.475 1.00 30.73 ? 829  VAL A C     1 
ATOM   1128 O  O     . VAL A 1 172 ? 9.432   -42.115 56.296 1.00 30.75 ? 829  VAL A O     1 
ATOM   1129 C  CB    . VAL A 1 172 ? 6.820   -40.155 55.721 1.00 30.84 ? 829  VAL A CB    1 
ATOM   1130 C  CG1   . VAL A 1 172 ? 5.509   -39.862 55.015 1.00 30.84 ? 829  VAL A CG1   1 
ATOM   1131 C  CG2   . VAL A 1 172 ? 6.600   -40.509 57.191 1.00 30.78 ? 829  VAL A CG2   1 
ATOM   1132 N  N     . GLN A 1 173 ? 9.837   -40.332 54.968 1.00 30.58 ? 830  GLN A N     1 
ATOM   1133 C  CA    . GLN A 1 173 ? 11.245  -40.199 55.324 1.00 30.46 ? 830  GLN A CA    1 
ATOM   1134 C  C     . GLN A 1 173 ? 11.636  -38.737 55.505 1.00 30.50 ? 830  GLN A C     1 
ATOM   1135 O  O     . GLN A 1 173 ? 11.267  -37.885 54.691 1.00 30.54 ? 830  GLN A O     1 
ATOM   1136 C  CB    . GLN A 1 173 ? 12.136  -40.823 54.251 1.00 30.38 ? 830  GLN A CB    1 
ATOM   1137 C  CG    . GLN A 1 173 ? 12.127  -42.341 54.192 1.00 30.23 ? 830  GLN A CG    1 
ATOM   1138 C  CD    . GLN A 1 173 ? 13.043  -42.879 53.111 1.00 30.05 ? 830  GLN A CD    1 
ATOM   1139 O  OE1   . GLN A 1 173 ? 13.372  -42.180 52.151 1.00 29.99 ? 830  GLN A OE1   1 
ATOM   1140 N  NE2   . GLN A 1 173 ? 13.462  -44.129 53.262 1.00 30.11 ? 830  GLN A NE2   1 
ATOM   1141 N  N     . VAL A 1 174 ? 12.388  -38.454 56.568 1.00 30.54 ? 831  VAL A N     1 
ATOM   1142 C  CA    . VAL A 1 174 ? 12.900  -37.107 56.830 1.00 30.64 ? 831  VAL A CA    1 
ATOM   1143 C  C     . VAL A 1 174 ? 14.029  -36.771 55.851 1.00 30.74 ? 831  VAL A C     1 
ATOM   1144 O  O     . VAL A 1 174 ? 14.965  -37.555 55.675 1.00 30.82 ? 831  VAL A O     1 
ATOM   1145 C  CB    . VAL A 1 174 ? 13.401  -36.948 58.295 1.00 30.63 ? 831  VAL A CB    1 
ATOM   1146 C  CG1   . VAL A 1 174 ? 13.862  -35.515 58.563 1.00 30.69 ? 831  VAL A CG1   1 
ATOM   1147 C  CG2   . VAL A 1 174 ? 12.307  -37.332 59.285 1.00 30.67 ? 831  VAL A CG2   1 
ATOM   1148 N  N     . ALA A 1 175 ? 13.929  -35.607 55.215 1.00 30.84 ? 832  ALA A N     1 
ATOM   1149 C  CA    . ALA A 1 175 ? 14.934  -35.166 54.251 1.00 30.98 ? 832  ALA A CA    1 
ATOM   1150 C  C     . ALA A 1 175 ? 15.617  -33.879 54.704 1.00 31.11 ? 832  ALA A C     1 
ATOM   1151 O  O     . ALA A 1 175 ? 15.203  -33.262 55.687 1.00 31.11 ? 832  ALA A O     1 
ATOM   1152 C  CB    . ALA A 1 175 ? 14.306  -34.982 52.873 1.00 30.95 ? 832  ALA A CB    1 
ATOM   1153 N  N     . ASP A 1 176 ? 16.677  -33.503 53.986 1.00 31.30 ? 833  ASP A N     1 
ATOM   1154 C  CA    . ASP A 1 176 ? 17.374  -32.215 54.155 1.00 31.45 ? 833  ASP A CA    1 
ATOM   1155 C  C     . ASP A 1 176 ? 18.060  -31.957 55.504 1.00 31.35 ? 833  ASP A C     1 
ATOM   1156 O  O     . ASP A 1 176 ? 18.268  -30.798 55.884 1.00 31.37 ? 833  ASP A O     1 
ATOM   1157 C  CB    . ASP A 1 176 ? 16.447  -31.040 53.802 1.00 31.57 ? 833  ASP A CB    1 
ATOM   1158 C  CG    . ASP A 1 176 ? 16.571  -30.610 52.354 1.00 31.97 ? 833  ASP A CG    1 
ATOM   1159 O  OD1   . ASP A 1 176 ? 17.647  -30.808 51.745 1.00 32.30 ? 833  ASP A OD1   1 
ATOM   1160 O  OD2   . ASP A 1 176 ? 15.585  -30.058 51.824 1.00 32.49 ? 833  ASP A OD2   1 
ATOM   1161 N  N     . PHE A 1 177 ? 18.424  -33.022 56.214 1.00 31.22 ? 834  PHE A N     1 
ATOM   1162 C  CA    . PHE A 1 177 ? 19.125  -32.882 57.493 1.00 31.08 ? 834  PHE A CA    1 
ATOM   1163 C  C     . PHE A 1 177 ? 20.544  -32.357 57.336 1.00 31.05 ? 834  PHE A C     1 
ATOM   1164 O  O     . PHE A 1 177 ? 21.308  -32.824 56.487 1.00 30.96 ? 834  PHE A O     1 
ATOM   1165 C  CB    . PHE A 1 177 ? 19.123  -34.195 58.287 1.00 31.01 ? 834  PHE A CB    1 
ATOM   1166 C  CG    . PHE A 1 177 ? 19.428  -35.408 57.461 1.00 30.98 ? 834  PHE A CG    1 
ATOM   1167 C  CD1   . PHE A 1 177 ? 20.709  -35.950 57.446 1.00 30.84 ? 834  PHE A CD1   1 
ATOM   1168 C  CD2   . PHE A 1 177 ? 18.430  -36.017 56.703 1.00 30.88 ? 834  PHE A CD2   1 
ATOM   1169 C  CE1   . PHE A 1 177 ? 20.997  -37.078 56.683 1.00 30.79 ? 834  PHE A CE1   1 
ATOM   1170 C  CE2   . PHE A 1 177 ? 18.706  -37.141 55.935 1.00 30.94 ? 834  PHE A CE2   1 
ATOM   1171 C  CZ    . PHE A 1 177 ? 19.994  -37.674 55.926 1.00 30.88 ? 834  PHE A CZ    1 
ATOM   1172 N  N     . GLY A 1 178 ? 20.863  -31.357 58.154 1.00 31.11 ? 835  GLY A N     1 
ATOM   1173 C  CA    . GLY A 1 178 ? 22.214  -30.819 58.278 1.00 31.21 ? 835  GLY A CA    1 
ATOM   1174 C  C     . GLY A 1 178 ? 22.756  -30.017 57.116 1.00 31.30 ? 835  GLY A C     1 
ATOM   1175 O  O     . GLY A 1 178 ? 23.934  -29.655 57.117 1.00 31.36 ? 835  GLY A O     1 
ATOM   1176 N  N     . VAL A 1 179 ? 21.913  -29.735 56.125 1.00 31.38 ? 836  VAL A N     1 
ATOM   1177 C  CA    . VAL A 1 179 ? 22.323  -28.913 54.985 1.00 31.51 ? 836  VAL A CA    1 
ATOM   1178 C  C     . VAL A 1 179 ? 22.764  -27.525 55.454 1.00 31.61 ? 836  VAL A C     1 
ATOM   1179 O  O     . VAL A 1 179 ? 23.754  -26.985 54.960 1.00 31.63 ? 836  VAL A O     1 
ATOM   1180 C  CB    . VAL A 1 179 ? 21.200  -28.786 53.923 1.00 31.52 ? 836  VAL A CB    1 
ATOM   1181 C  CG1   . VAL A 1 179 ? 21.650  -27.915 52.753 1.00 31.51 ? 836  VAL A CG1   1 
ATOM   1182 C  CG2   . VAL A 1 179 ? 20.778  -30.160 53.421 1.00 31.62 ? 836  VAL A CG2   1 
ATOM   1183 N  N     . ALA A 1 180 ? 22.031  -26.967 56.416 1.00 31.80 ? 837  ALA A N     1 
ATOM   1184 C  CA    . ALA A 1 180 ? 22.315  -25.637 56.958 1.00 32.05 ? 837  ALA A CA    1 
ATOM   1185 C  C     . ALA A 1 180 ? 23.754  -25.483 57.455 1.00 32.27 ? 837  ALA A C     1 
ATOM   1186 O  O     . ALA A 1 180 ? 24.379  -24.443 57.243 1.00 32.25 ? 837  ALA A O     1 
ATOM   1187 C  CB    . ALA A 1 180 ? 21.330  -25.296 58.066 1.00 32.02 ? 837  ALA A CB    1 
ATOM   1188 N  N     . ASP A 1 181 ? 24.276  -26.521 58.102 1.00 32.60 ? 838  ASP A N     1 
ATOM   1189 C  CA    . ASP A 1 181 ? 25.634  -26.477 58.639 1.00 32.98 ? 838  ASP A CA    1 
ATOM   1190 C  C     . ASP A 1 181 ? 26.738  -26.658 57.581 1.00 33.22 ? 838  ASP A C     1 
ATOM   1191 O  O     . ASP A 1 181 ? 27.917  -26.744 57.928 1.00 33.30 ? 838  ASP A O     1 
ATOM   1192 C  CB    . ASP A 1 181 ? 25.795  -27.473 59.799 1.00 32.98 ? 838  ASP A CB    1 
ATOM   1193 C  CG    . ASP A 1 181 ? 25.363  -26.888 61.143 1.00 33.18 ? 838  ASP A CG    1 
ATOM   1194 O  OD1   . ASP A 1 181 ? 25.828  -25.783 61.499 1.00 33.19 ? 838  ASP A OD1   1 
ATOM   1195 O  OD2   . ASP A 1 181 ? 24.567  -27.542 61.851 1.00 33.41 ? 838  ASP A OD2   1 
ATOM   1196 N  N     . LEU A 1 182 ? 26.363  -26.702 56.302 1.00 33.53 ? 839  LEU A N     1 
ATOM   1197 C  CA    . LEU A 1 182 ? 27.344  -26.748 55.209 1.00 33.87 ? 839  LEU A CA    1 
ATOM   1198 C  C     . LEU A 1 182 ? 27.823  -25.352 54.811 1.00 34.28 ? 839  LEU A C     1 
ATOM   1199 O  O     . LEU A 1 182 ? 28.868  -25.204 54.172 1.00 34.29 ? 839  LEU A O     1 
ATOM   1200 C  CB    . LEU A 1 182 ? 26.769  -27.459 53.975 1.00 33.75 ? 839  LEU A CB    1 
ATOM   1201 C  CG    . LEU A 1 182 ? 26.555  -28.976 53.988 1.00 33.66 ? 839  LEU A CG    1 
ATOM   1202 C  CD1   . LEU A 1 182 ? 25.683  -29.405 52.814 1.00 33.53 ? 839  LEU A CD1   1 
ATOM   1203 C  CD2   . LEU A 1 182 ? 27.878  -29.721 53.970 1.00 33.47 ? 839  LEU A CD2   1 
ATOM   1204 N  N     . LEU A 1 183 ? 27.057  -24.337 55.202 1.00 34.92 ? 840  LEU A N     1 
ATOM   1205 C  CA    . LEU A 1 183 ? 27.263  -22.965 54.744 1.00 35.61 ? 840  LEU A CA    1 
ATOM   1206 C  C     . LEU A 1 183 ? 27.608  -22.039 55.905 1.00 36.36 ? 840  LEU A C     1 
ATOM   1207 O  O     . LEU A 1 183 ? 27.080  -22.215 57.006 1.00 36.38 ? 840  LEU A O     1 
ATOM   1208 C  CB    . LEU A 1 183 ? 25.992  -22.453 54.062 1.00 35.48 ? 840  LEU A CB    1 
ATOM   1209 C  CG    . LEU A 1 183 ? 25.398  -23.310 52.944 1.00 35.18 ? 840  LEU A CG    1 
ATOM   1210 C  CD1   . LEU A 1 183 ? 23.901  -23.432 53.121 1.00 35.02 ? 840  LEU A CD1   1 
ATOM   1211 C  CD2   . LEU A 1 183 ? 25.751  -22.745 51.575 1.00 35.01 ? 840  LEU A CD2   1 
ATOM   1212 N  N     . PRO A 1 184 ? 28.490  -21.045 55.666 1.00 37.19 ? 841  PRO A N     1 
ATOM   1213 C  CA    . PRO A 1 184 ? 28.842  -20.056 56.696 1.00 37.91 ? 841  PRO A CA    1 
ATOM   1214 C  C     . PRO A 1 184 ? 27.619  -19.311 57.249 1.00 38.70 ? 841  PRO A C     1 
ATOM   1215 O  O     . PRO A 1 184 ? 26.658  -19.092 56.507 1.00 38.71 ? 841  PRO A O     1 
ATOM   1216 C  CB    . PRO A 1 184 ? 29.759  -19.085 55.946 1.00 37.87 ? 841  PRO A CB    1 
ATOM   1217 C  CG    . PRO A 1 184 ? 30.365  -19.909 54.866 1.00 37.59 ? 841  PRO A CG    1 
ATOM   1218 C  CD    . PRO A 1 184 ? 29.285  -20.857 54.436 1.00 37.22 ? 841  PRO A CD    1 
ATOM   1219 N  N     . PRO A 1 185 ? 27.649  -18.931 58.547 1.00 39.44 ? 842  PRO A N     1 
ATOM   1220 C  CA    . PRO A 1 185 ? 26.529  -18.211 59.170 1.00 40.05 ? 842  PRO A CA    1 
ATOM   1221 C  C     . PRO A 1 185 ? 26.101  -16.984 58.353 1.00 40.66 ? 842  PRO A C     1 
ATOM   1222 O  O     . PRO A 1 185 ? 26.819  -15.980 58.318 1.00 40.74 ? 842  PRO A O     1 
ATOM   1223 C  CB    . PRO A 1 185 ? 27.098  -17.793 60.530 1.00 40.03 ? 842  PRO A CB    1 
ATOM   1224 C  CG    . PRO A 1 185 ? 28.132  -18.817 60.831 1.00 39.75 ? 842  PRO A CG    1 
ATOM   1225 C  CD    . PRO A 1 185 ? 28.742  -19.178 59.508 1.00 39.49 ? 842  PRO A CD    1 
ATOM   1226 N  N     . ASP A 1 186 ? 24.942  -17.082 57.697 1.00 41.33 ? 843  ASP A N     1 
ATOM   1227 C  CA    . ASP A 1 186 ? 24.461  -16.052 56.763 1.00 41.94 ? 843  ASP A CA    1 
ATOM   1228 C  C     . ASP A 1 186 ? 22.945  -15.849 56.808 1.00 42.20 ? 843  ASP A C     1 
ATOM   1229 O  O     . ASP A 1 186 ? 22.190  -16.796 57.041 1.00 42.24 ? 843  ASP A O     1 
ATOM   1230 C  CB    . ASP A 1 186 ? 24.874  -16.397 55.324 1.00 42.02 ? 843  ASP A CB    1 
ATOM   1231 C  CG    . ASP A 1 186 ? 26.265  -15.888 54.966 1.00 42.33 ? 843  ASP A CG    1 
ATOM   1232 O  OD1   . ASP A 1 186 ? 26.659  -14.805 55.451 1.00 42.52 ? 843  ASP A OD1   1 
ATOM   1233 O  OD2   . ASP A 1 186 ? 26.961  -16.570 54.182 1.00 42.56 ? 843  ASP A OD2   1 
ATOM   1234 N  N     . ASP A 1 187 ? 22.515  -14.608 56.571 1.00 42.50 ? 844  ASP A N     1 
ATOM   1235 C  CA    . ASP A 1 187 ? 21.095  -14.256 56.461 1.00 42.72 ? 844  ASP A CA    1 
ATOM   1236 C  C     . ASP A 1 187 ? 20.918  -12.849 55.886 1.00 42.74 ? 844  ASP A C     1 
ATOM   1237 O  O     . ASP A 1 187 ? 19.835  -12.483 55.418 1.00 42.74 ? 844  ASP A O     1 
ATOM   1238 C  CB    . ASP A 1 187 ? 20.392  -14.361 57.820 1.00 42.78 ? 844  ASP A CB    1 
ATOM   1239 C  CG    . ASP A 1 187 ? 18.880  -14.244 57.708 1.00 43.02 ? 844  ASP A CG    1 
ATOM   1240 O  OD1   . ASP A 1 187 ? 18.302  -14.767 56.728 1.00 43.19 ? 844  ASP A OD1   1 
ATOM   1241 O  OD2   . ASP A 1 187 ? 18.267  -13.628 58.604 1.00 43.26 ? 844  ASP A OD2   1 
ATOM   1242 N  N     . THR A 1 197 ? 10.256  -19.177 55.046 1.00 34.89 ? 854  THR A N     1 
ATOM   1243 C  CA    . THR A 1 197 ? 11.223  -18.633 55.994 1.00 34.88 ? 854  THR A CA    1 
ATOM   1244 C  C     . THR A 1 197 ? 11.302  -19.533 57.231 1.00 34.79 ? 854  THR A C     1 
ATOM   1245 O  O     . THR A 1 197 ? 10.393  -19.512 58.067 1.00 34.83 ? 854  THR A O     1 
ATOM   1246 C  CB    . THR A 1 197 ? 10.868  -17.186 56.420 1.00 34.89 ? 854  THR A CB    1 
ATOM   1247 O  OG1   . THR A 1 197 ? 9.663   -17.193 57.199 1.00 34.93 ? 854  THR A OG1   1 
ATOM   1248 C  CG2   . THR A 1 197 ? 10.682  -16.280 55.199 1.00 34.93 ? 854  THR A CG2   1 
ATOM   1249 N  N     . PRO A 1 198 ? 12.386  -20.333 57.344 1.00 34.62 ? 855  PRO A N     1 
ATOM   1250 C  CA    . PRO A 1 198 ? 12.610  -21.279 58.443 1.00 34.38 ? 855  PRO A CA    1 
ATOM   1251 C  C     . PRO A 1 198 ? 12.326  -20.714 59.830 1.00 34.08 ? 855  PRO A C     1 
ATOM   1252 O  O     . PRO A 1 198 ? 12.154  -21.481 60.774 1.00 34.11 ? 855  PRO A O     1 
ATOM   1253 C  CB    . PRO A 1 198 ? 14.099  -21.602 58.324 1.00 34.42 ? 855  PRO A CB    1 
ATOM   1254 C  CG    . PRO A 1 198 ? 14.393  -21.466 56.884 1.00 34.60 ? 855  PRO A CG    1 
ATOM   1255 C  CD    . PRO A 1 198 ? 13.453  -20.422 56.328 1.00 34.64 ? 855  PRO A CD    1 
ATOM   1256 N  N     . ILE A 1 199 ? 12.276  -19.388 59.944 1.00 33.68 ? 856  ILE A N     1 
ATOM   1257 C  CA    . ILE A 1 199 ? 12.020  -18.719 61.219 1.00 33.32 ? 856  ILE A CA    1 
ATOM   1258 C  C     . ILE A 1 199 ? 10.696  -19.140 61.878 1.00 32.97 ? 856  ILE A C     1 
ATOM   1259 O  O     . ILE A 1 199 ? 10.602  -19.179 63.109 1.00 33.03 ? 856  ILE A O     1 
ATOM   1260 C  CB    . ILE A 1 199 ? 12.139  -17.167 61.094 1.00 33.36 ? 856  ILE A CB    1 
ATOM   1261 C  CG1   . ILE A 1 199 ? 12.134  -16.500 62.479 1.00 33.43 ? 856  ILE A CG1   1 
ATOM   1262 C  CG2   . ILE A 1 199 ? 11.054  -16.596 60.176 1.00 33.48 ? 856  ILE A CG2   1 
ATOM   1263 C  CD1   . ILE A 1 199 ? 12.670  -15.073 62.496 1.00 33.61 ? 856  ILE A CD1   1 
ATOM   1264 N  N     . LYS A 1 200 ? 9.695   -19.477 61.065 1.00 32.48 ? 857  LYS A N     1 
ATOM   1265 C  CA    . LYS A 1 200 ? 8.417   -19.978 61.577 1.00 31.96 ? 857  LYS A CA    1 
ATOM   1266 C  C     . LYS A 1 200 ? 8.552   -21.399 62.136 1.00 31.55 ? 857  LYS A C     1 
ATOM   1267 O  O     . LYS A 1 200 ? 7.617   -21.926 62.743 1.00 31.52 ? 857  LYS A O     1 
ATOM   1268 C  CB    . LYS A 1 200 ? 7.336   -19.936 60.491 1.00 32.02 ? 857  LYS A CB    1 
ATOM   1269 C  CG    . LYS A 1 200 ? 7.232   -18.611 59.749 1.00 32.12 ? 857  LYS A CG    1 
ATOM   1270 C  CD    . LYS A 1 200 ? 6.120   -18.647 58.718 1.00 32.37 ? 857  LYS A CD    1 
ATOM   1271 C  CE    . LYS A 1 200 ? 6.000   -17.316 57.992 1.00 32.55 ? 857  LYS A CE    1 
ATOM   1272 N  NZ    . LYS A 1 200 ? 4.742   -17.197 57.204 1.00 32.55 ? 857  LYS A NZ    1 
ATOM   1273 N  N     . TRP A 1 201 ? 9.720   -22.007 61.936 1.00 31.06 ? 858  TRP A N     1 
ATOM   1274 C  CA    . TRP A 1 201 ? 9.982   -23.372 62.392 1.00 30.59 ? 858  TRP A CA    1 
ATOM   1275 C  C     . TRP A 1 201 ? 11.075  -23.448 63.452 1.00 30.53 ? 858  TRP A C     1 
ATOM   1276 O  O     . TRP A 1 201 ? 11.392  -24.532 63.950 1.00 30.52 ? 858  TRP A O     1 
ATOM   1277 C  CB    . TRP A 1 201 ? 10.332  -24.273 61.204 1.00 30.40 ? 858  TRP A CB    1 
ATOM   1278 C  CG    . TRP A 1 201 ? 9.156   -24.527 60.341 1.00 29.71 ? 858  TRP A CG    1 
ATOM   1279 C  CD1   . TRP A 1 201 ? 8.293   -25.578 60.428 1.00 29.34 ? 858  TRP A CD1   1 
ATOM   1280 C  CD2   . TRP A 1 201 ? 8.679   -23.699 59.275 1.00 28.98 ? 858  TRP A CD2   1 
ATOM   1281 N  NE1   . TRP A 1 201 ? 7.312   -25.466 59.474 1.00 28.93 ? 858  TRP A NE1   1 
ATOM   1282 C  CE2   . TRP A 1 201 ? 7.523   -24.321 58.752 1.00 28.70 ? 858  TRP A CE2   1 
ATOM   1283 C  CE3   . TRP A 1 201 ? 9.119   -22.498 58.703 1.00 28.61 ? 858  TRP A CE3   1 
ATOM   1284 C  CZ2   . TRP A 1 201 ? 6.798   -23.782 57.686 1.00 28.18 ? 858  TRP A CZ2   1 
ATOM   1285 C  CZ3   . TRP A 1 201 ? 8.398   -21.963 57.641 1.00 28.29 ? 858  TRP A CZ3   1 
ATOM   1286 C  CH2   . TRP A 1 201 ? 7.250   -22.606 57.145 1.00 28.09 ? 858  TRP A CH2   1 
ATOM   1287 N  N     . MET A 1 202 ? 11.637  -22.297 63.807 1.00 30.40 ? 859  MET A N     1 
ATOM   1288 C  CA    . MET A 1 202 ? 12.748  -22.259 64.750 1.00 30.34 ? 859  MET A CA    1 
ATOM   1289 C  C     . MET A 1 202 ? 12.299  -22.074 66.193 1.00 30.23 ? 859  MET A C     1 
ATOM   1290 O  O     . MET A 1 202 ? 11.328  -21.366 66.474 1.00 30.23 ? 859  MET A O     1 
ATOM   1291 C  CB    . MET A 1 202 ? 13.752  -21.171 64.362 1.00 30.38 ? 859  MET A CB    1 
ATOM   1292 C  CG    . MET A 1 202 ? 14.337  -21.352 62.971 1.00 30.66 ? 859  MET A CG    1 
ATOM   1293 S  SD    . MET A 1 202 ? 15.844  -20.419 62.645 1.00 31.08 ? 859  MET A SD    1 
ATOM   1294 C  CE    . MET A 1 202 ? 15.323  -18.734 63.010 1.00 30.97 ? 859  MET A CE    1 
ATOM   1295 N  N     . ALA A 1 203 ? 13.019  -22.734 67.097 1.00 30.08 ? 860  ALA A N     1 
ATOM   1296 C  CA    . ALA A 1 203 ? 12.872  -22.517 68.528 1.00 29.91 ? 860  ALA A CA    1 
ATOM   1297 C  C     . ALA A 1 203 ? 13.339  -21.108 68.863 1.00 29.83 ? 860  ALA A C     1 
ATOM   1298 O  O     . ALA A 1 203 ? 14.208  -20.558 68.184 1.00 29.78 ? 860  ALA A O     1 
ATOM   1299 C  CB    . ALA A 1 203 ? 13.675  -23.545 69.303 1.00 29.90 ? 860  ALA A CB    1 
ATOM   1300 N  N     . LEU A 1 204 ? 12.758  -20.531 69.908 1.00 29.79 ? 861  LEU A N     1 
ATOM   1301 C  CA    . LEU A 1 204 ? 13.027  -19.145 70.275 1.00 29.77 ? 861  LEU A CA    1 
ATOM   1302 C  C     . LEU A 1 204 ? 14.515  -18.858 70.515 1.00 29.79 ? 861  LEU A C     1 
ATOM   1303 O  O     . LEU A 1 204 ? 15.013  -17.808 70.109 1.00 29.80 ? 861  LEU A O     1 
ATOM   1304 C  CB    . LEU A 1 204 ? 12.178  -18.738 71.484 1.00 29.73 ? 861  LEU A CB    1 
ATOM   1305 C  CG    . LEU A 1 204 ? 11.980  -17.241 71.761 1.00 29.73 ? 861  LEU A CG    1 
ATOM   1306 C  CD1   . LEU A 1 204 ? 11.442  -16.492 70.522 1.00 29.64 ? 861  LEU A CD1   1 
ATOM   1307 C  CD2   . LEU A 1 204 ? 11.056  -17.035 72.956 1.00 29.70 ? 861  LEU A CD2   1 
ATOM   1308 N  N     . GLU A 1 205 ? 15.222  -19.800 71.142 1.00 29.84 ? 862  GLU A N     1 
ATOM   1309 C  CA    . GLU A 1 205 ? 16.661  -19.641 71.393 1.00 29.89 ? 862  GLU A CA    1 
ATOM   1310 C  C     . GLU A 1 205 ? 17.494  -19.714 70.109 1.00 29.96 ? 862  GLU A C     1 
ATOM   1311 O  O     . GLU A 1 205 ? 18.580  -19.137 70.039 1.00 29.98 ? 862  GLU A O     1 
ATOM   1312 C  CB    . GLU A 1 205 ? 17.169  -20.639 72.448 1.00 29.85 ? 862  GLU A CB    1 
ATOM   1313 C  CG    . GLU A 1 205 ? 17.585  -22.016 71.922 1.00 29.78 ? 862  GLU A CG    1 
ATOM   1314 C  CD    . GLU A 1 205 ? 16.430  -22.996 71.794 1.00 29.73 ? 862  GLU A CD    1 
ATOM   1315 O  OE1   . GLU A 1 205 ? 15.266  -22.604 72.029 1.00 29.70 ? 862  GLU A OE1   1 
ATOM   1316 O  OE2   . GLU A 1 205 ? 16.692  -24.173 71.460 1.00 29.75 ? 862  GLU A OE2   1 
ATOM   1317 N  N     . SER A 1 206 ? 16.980  -20.422 69.103 1.00 30.04 ? 863  SER A N     1 
ATOM   1318 C  CA    . SER A 1 206 ? 17.604  -20.470 67.781 1.00 30.08 ? 863  SER A CA    1 
ATOM   1319 C  C     . SER A 1 206 ? 17.482  -19.118 67.090 1.00 30.14 ? 863  SER A C     1 
ATOM   1320 O  O     . SER A 1 206 ? 18.394  -18.687 66.385 1.00 30.17 ? 863  SER A O     1 
ATOM   1321 C  CB    . SER A 1 206 ? 16.963  -21.554 66.910 1.00 30.07 ? 863  SER A CB    1 
ATOM   1322 O  OG    . SER A 1 206 ? 17.136  -22.844 67.472 1.00 30.04 ? 863  SER A OG    1 
ATOM   1323 N  N     . ILE A 1 207 ? 16.343  -18.461 67.296 1.00 30.20 ? 864  ILE A N     1 
ATOM   1324 C  CA    . ILE A 1 207 ? 16.093  -17.139 66.731 1.00 30.23 ? 864  ILE A CA    1 
ATOM   1325 C  C     . ILE A 1 207 ? 16.956  -16.101 67.450 1.00 30.30 ? 864  ILE A C     1 
ATOM   1326 O  O     . ILE A 1 207 ? 17.592  -15.258 66.813 1.00 30.29 ? 864  ILE A O     1 
ATOM   1327 C  CB    . ILE A 1 207 ? 14.590  -16.751 66.814 1.00 30.20 ? 864  ILE A CB    1 
ATOM   1328 C  CG1   . ILE A 1 207 ? 13.710  -17.874 66.246 1.00 30.18 ? 864  ILE A CG1   1 
ATOM   1329 C  CG2   . ILE A 1 207 ? 14.331  -15.426 66.090 1.00 30.19 ? 864  ILE A CG2   1 
ATOM   1330 C  CD1   . ILE A 1 207 ? 12.190  -17.674 66.475 1.00 30.16 ? 864  ILE A CD1   1 
ATOM   1331 N  N     . HIS A 1 208 ? 16.983  -16.192 68.781 1.00 30.44 ? 865  HIS A N     1 
ATOM   1332 C  CA    . HIS A 1 208 ? 17.721  -15.247 69.625 1.00 30.57 ? 865  HIS A CA    1 
ATOM   1333 C  C     . HIS A 1 208 ? 19.241  -15.433 69.613 1.00 30.63 ? 865  HIS A C     1 
ATOM   1334 O  O     . HIS A 1 208 ? 19.987  -14.450 69.478 1.00 30.65 ? 865  HIS A O     1 
ATOM   1335 C  CB    . HIS A 1 208 ? 17.202  -15.303 71.066 1.00 30.58 ? 865  HIS A CB    1 
ATOM   1336 C  CG    . HIS A 1 208 ? 15.792  -14.824 71.221 1.00 30.71 ? 865  HIS A CG    1 
ATOM   1337 N  ND1   . HIS A 1 208 ? 15.463  -13.487 71.277 1.00 30.84 ? 865  HIS A ND1   1 
ATOM   1338 C  CD2   . HIS A 1 208 ? 14.628  -15.503 71.343 1.00 30.83 ? 865  HIS A CD2   1 
ATOM   1339 C  CE1   . HIS A 1 208 ? 14.155  -13.363 71.419 1.00 30.84 ? 865  HIS A CE1   1 
ATOM   1340 N  NE2   . HIS A 1 208 ? 13.625  -14.572 71.461 1.00 30.90 ? 865  HIS A NE2   1 
ATOM   1341 N  N     . PHE A 1 209 ? 19.707  -16.672 69.747 1.00 30.73 ? 866  PHE A N     1 
ATOM   1342 C  CA    . PHE A 1 209 ? 21.140  -16.926 69.915 1.00 30.87 ? 866  PHE A CA    1 
ATOM   1343 C  C     . PHE A 1 209 ? 21.796  -17.586 68.707 1.00 31.01 ? 866  PHE A C     1 
ATOM   1344 O  O     . PHE A 1 209 ? 23.004  -17.835 68.718 1.00 31.02 ? 866  PHE A O     1 
ATOM   1345 C  CB    . PHE A 1 209 ? 21.396  -17.764 71.175 1.00 30.86 ? 866  PHE A CB    1 
ATOM   1346 C  CG    . PHE A 1 209 ? 20.767  -17.199 72.415 1.00 30.85 ? 866  PHE A CG    1 
ATOM   1347 C  CD1   . PHE A 1 209 ? 21.432  -16.241 73.174 1.00 30.81 ? 866  PHE A CD1   1 
ATOM   1348 C  CD2   . PHE A 1 209 ? 19.505  -17.621 72.822 1.00 30.83 ? 866  PHE A CD2   1 
ATOM   1349 C  CE1   . PHE A 1 209 ? 20.849  -15.712 74.322 1.00 30.77 ? 866  PHE A CE1   1 
ATOM   1350 C  CE2   . PHE A 1 209 ? 18.914  -17.098 73.967 1.00 30.81 ? 866  PHE A CE2   1 
ATOM   1351 C  CZ    . PHE A 1 209 ? 19.587  -16.142 74.719 1.00 30.77 ? 866  PHE A CZ    1 
ATOM   1352 N  N     . GLY A 1 210 ? 21.012  -17.855 67.666 1.00 31.20 ? 867  GLY A N     1 
ATOM   1353 C  CA    . GLY A 1 210 ? 21.519  -18.591 66.510 1.00 31.46 ? 867  GLY A CA    1 
ATOM   1354 C  C     . GLY A 1 210 ? 22.108  -19.911 66.968 1.00 31.65 ? 867  GLY A C     1 
ATOM   1355 O  O     . GLY A 1 210 ? 23.143  -20.352 66.466 1.00 31.72 ? 867  GLY A O     1 
ATOM   1356 N  N     . LYS A 1 211 ? 21.443  -20.528 67.942 1.00 31.83 ? 868  LYS A N     1 
ATOM   1357 C  CA    . LYS A 1 211 ? 21.905  -21.764 68.558 1.00 32.05 ? 868  LYS A CA    1 
ATOM   1358 C  C     . LYS A 1 211 ? 20.952  -22.909 68.241 1.00 32.16 ? 868  LYS A C     1 
ATOM   1359 O  O     . LYS A 1 211 ? 19.746  -22.809 68.469 1.00 32.22 ? 868  LYS A O     1 
ATOM   1360 C  CB    . LYS A 1 211 ? 22.031  -21.582 70.074 1.00 32.09 ? 868  LYS A CB    1 
ATOM   1361 C  CG    . LYS A 1 211 ? 22.307  -22.863 70.859 1.00 32.36 ? 868  LYS A CG    1 
ATOM   1362 C  CD    . LYS A 1 211 ? 22.464  -22.569 72.345 1.00 32.59 ? 868  LYS A CD    1 
ATOM   1363 C  CE    . LYS A 1 211 ? 22.620  -23.843 73.168 1.00 32.76 ? 868  LYS A CE    1 
ATOM   1364 N  NZ    . LYS A 1 211 ? 21.281  -24.541 73.422 1.00 32.89 ? 868  LYS A NZ    1 
ATOM   1365 N  N     . TYR A 1 212 ? 21.506  -24.002 67.730 1.00 32.29 ? 869  TYR A N     1 
ATOM   1366 C  CA    . TYR A 1 212 ? 20.704  -25.147 67.327 1.00 32.42 ? 869  TYR A CA    1 
ATOM   1367 C  C     . TYR A 1 212 ? 21.152  -26.407 68.047 1.00 32.51 ? 869  TYR A C     1 
ATOM   1368 O  O     . TYR A 1 212 ? 22.344  -26.719 68.103 1.00 32.57 ? 869  TYR A O     1 
ATOM   1369 C  CB    . TYR A 1 212 ? 20.770  -25.339 65.812 1.00 32.43 ? 869  TYR A CB    1 
ATOM   1370 C  CG    . TYR A 1 212 ? 20.389  -24.100 65.035 1.00 32.61 ? 869  TYR A CG    1 
ATOM   1371 C  CD1   . TYR A 1 212 ? 21.315  -23.076 64.821 1.00 32.73 ? 869  TYR A CD1   1 
ATOM   1372 C  CD2   . TYR A 1 212 ? 19.103  -23.946 64.518 1.00 32.66 ? 869  TYR A CD2   1 
ATOM   1373 C  CE1   . TYR A 1 212 ? 20.971  -21.933 64.113 1.00 32.91 ? 869  TYR A CE1   1 
ATOM   1374 C  CE2   . TYR A 1 212 ? 18.750  -22.808 63.800 1.00 32.74 ? 869  TYR A CE2   1 
ATOM   1375 C  CZ    . TYR A 1 212 ? 19.689  -21.807 63.602 1.00 32.93 ? 869  TYR A CZ    1 
ATOM   1376 O  OH    . TYR A 1 212 ? 19.346  -20.676 62.897 1.00 32.93 ? 869  TYR A OH    1 
ATOM   1377 N  N     . THR A 1 213 ? 20.180  -27.119 68.605 1.00 32.62 ? 870  THR A N     1 
ATOM   1378 C  CA    . THR A 1 213 ? 20.431  -28.346 69.347 1.00 32.75 ? 870  THR A CA    1 
ATOM   1379 C  C     . THR A 1 213 ? 19.500  -29.439 68.838 1.00 32.84 ? 870  THR A C     1 
ATOM   1380 O  O     . THR A 1 213 ? 18.742  -29.223 67.892 1.00 32.85 ? 870  THR A O     1 
ATOM   1381 C  CB    . THR A 1 213 ? 20.194  -28.139 70.854 1.00 32.76 ? 870  THR A CB    1 
ATOM   1382 O  OG1   . THR A 1 213 ? 18.903  -27.548 71.068 1.00 32.67 ? 870  THR A OG1   1 
ATOM   1383 C  CG2   . THR A 1 213 ? 21.274  -27.258 71.465 1.00 32.78 ? 870  THR A CG2   1 
ATOM   1384 N  N     . HIS A 1 214 ? 19.567  -30.616 69.457 1.00 32.98 ? 871  HIS A N     1 
ATOM   1385 C  CA    . HIS A 1 214 ? 18.596  -31.675 69.196 1.00 33.09 ? 871  HIS A CA    1 
ATOM   1386 C  C     . HIS A 1 214 ? 17.225  -31.218 69.677 1.00 33.09 ? 871  HIS A C     1 
ATOM   1387 O  O     . HIS A 1 214 ? 16.201  -31.519 69.060 1.00 33.11 ? 871  HIS A O     1 
ATOM   1388 C  CB    . HIS A 1 214 ? 18.997  -32.960 69.919 1.00 33.14 ? 871  HIS A CB    1 
ATOM   1389 C  CG    . HIS A 1 214 ? 20.234  -33.600 69.373 1.00 33.43 ? 871  HIS A CG    1 
ATOM   1390 N  ND1   . HIS A 1 214 ? 20.201  -34.542 68.367 1.00 33.64 ? 871  HIS A ND1   1 
ATOM   1391 C  CD2   . HIS A 1 214 ? 21.540  -33.431 69.687 1.00 33.52 ? 871  HIS A CD2   1 
ATOM   1392 C  CE1   . HIS A 1 214 ? 21.431  -34.931 68.090 1.00 33.65 ? 871  HIS A CE1   1 
ATOM   1393 N  NE2   . HIS A 1 214 ? 22.263  -34.271 68.876 1.00 33.75 ? 871  HIS A NE2   1 
ATOM   1394 N  N     . GLN A 1 215 ? 17.234  -30.477 70.783 1.00 33.10 ? 872  GLN A N     1 
ATOM   1395 C  CA    . GLN A 1 215 ? 16.035  -29.943 71.421 1.00 33.10 ? 872  GLN A CA    1 
ATOM   1396 C  C     . GLN A 1 215 ? 15.355  -28.896 70.549 1.00 33.09 ? 872  GLN A C     1 
ATOM   1397 O  O     . GLN A 1 215 ? 14.127  -28.810 70.522 1.00 33.13 ? 872  GLN A O     1 
ATOM   1398 C  CB    . GLN A 1 215 ? 16.387  -29.324 72.780 1.00 33.12 ? 872  GLN A CB    1 
ATOM   1399 C  CG    . GLN A 1 215 ? 17.148  -30.245 73.741 1.00 33.18 ? 872  GLN A CG    1 
ATOM   1400 C  CD    . GLN A 1 215 ? 18.562  -30.584 73.273 1.00 33.36 ? 872  GLN A CD    1 
ATOM   1401 O  OE1   . GLN A 1 215 ? 19.086  -29.987 72.335 1.00 33.56 ? 872  GLN A OE1   1 
ATOM   1402 N  NE2   . GLN A 1 215 ? 19.180  -31.554 73.931 1.00 33.39 ? 872  GLN A NE2   1 
ATOM   1403 N  N     . SER A 1 216 ? 16.156  -28.094 69.850 1.00 33.05 ? 873  SER A N     1 
ATOM   1404 C  CA    . SER A 1 216 ? 15.628  -27.055 68.970 1.00 33.05 ? 873  SER A CA    1 
ATOM   1405 C  C     . SER A 1 216 ? 14.825  -27.667 67.826 1.00 33.03 ? 873  SER A C     1 
ATOM   1406 O  O     . SER A 1 216 ? 13.795  -27.123 67.423 1.00 33.11 ? 873  SER A O     1 
ATOM   1407 C  CB    . SER A 1 216 ? 16.754  -26.179 68.421 1.00 33.02 ? 873  SER A CB    1 
ATOM   1408 O  OG    . SER A 1 216 ? 17.640  -26.936 67.615 1.00 33.28 ? 873  SER A OG    1 
ATOM   1409 N  N     . ASP A 1 217 ? 15.304  -28.796 67.307 1.00 32.94 ? 874  ASP A N     1 
ATOM   1410 C  CA    . ASP A 1 217 ? 14.587  -29.540 66.275 1.00 32.85 ? 874  ASP A CA    1 
ATOM   1411 C  C     . ASP A 1 217 ? 13.250  -30.051 66.802 1.00 32.64 ? 874  ASP A C     1 
ATOM   1412 O  O     . ASP A 1 217 ? 12.261  -30.086 66.065 1.00 32.68 ? 874  ASP A O     1 
ATOM   1413 C  CB    . ASP A 1 217 ? 15.425  -30.720 65.778 1.00 32.97 ? 874  ASP A CB    1 
ATOM   1414 C  CG    . ASP A 1 217 ? 16.590  -30.291 64.898 1.00 33.33 ? 874  ASP A CG    1 
ATOM   1415 O  OD1   . ASP A 1 217 ? 16.695  -29.092 64.555 1.00 33.78 ? 874  ASP A OD1   1 
ATOM   1416 O  OD2   . ASP A 1 217 ? 17.404  -31.168 64.538 1.00 33.60 ? 874  ASP A OD2   1 
ATOM   1417 N  N     . VAL A 1 218 ? 13.230  -30.457 68.073 1.00 32.31 ? 875  VAL A N     1 
ATOM   1418 C  CA    . VAL A 1 218 ? 12.001  -30.908 68.727 1.00 31.96 ? 875  VAL A CA    1 
ATOM   1419 C  C     . VAL A 1 218 ? 10.883  -29.875 68.543 1.00 31.71 ? 875  VAL A C     1 
ATOM   1420 O  O     . VAL A 1 218 ? 9.743   -30.234 68.236 1.00 31.70 ? 875  VAL A O     1 
ATOM   1421 C  CB    . VAL A 1 218 ? 12.227  -31.216 70.231 1.00 31.96 ? 875  VAL A CB    1 
ATOM   1422 C  CG1   . VAL A 1 218 ? 10.908  -31.485 70.942 1.00 32.01 ? 875  VAL A CG1   1 
ATOM   1423 C  CG2   . VAL A 1 218 ? 13.171  -32.397 70.402 1.00 31.97 ? 875  VAL A CG2   1 
ATOM   1424 N  N     . TRP A 1 219 ? 11.224  -28.598 68.721 1.00 31.37 ? 876  TRP A N     1 
ATOM   1425 C  CA    . TRP A 1 219 ? 10.311  -27.489 68.450 1.00 31.12 ? 876  TRP A CA    1 
ATOM   1426 C  C     . TRP A 1 219 ? 9.785   -27.565 67.016 1.00 31.00 ? 876  TRP A C     1 
ATOM   1427 O  O     . TRP A 1 219 ? 8.583   -27.429 66.775 1.00 30.92 ? 876  TRP A O     1 
ATOM   1428 C  CB    . TRP A 1 219 ? 11.033  -26.156 68.677 1.00 31.08 ? 876  TRP A CB    1 
ATOM   1429 C  CG    . TRP A 1 219 ? 10.181  -24.925 68.506 1.00 30.93 ? 876  TRP A CG    1 
ATOM   1430 C  CD1   . TRP A 1 219 ? 9.541   -24.517 67.369 1.00 30.85 ? 876  TRP A CD1   1 
ATOM   1431 C  CD2   . TRP A 1 219 ? 9.906   -23.929 69.499 1.00 30.71 ? 876  TRP A CD2   1 
ATOM   1432 N  NE1   . TRP A 1 219 ? 8.870   -23.341 67.597 1.00 30.79 ? 876  TRP A NE1   1 
ATOM   1433 C  CE2   . TRP A 1 219 ? 9.081   -22.954 68.894 1.00 30.68 ? 876  TRP A CE2   1 
ATOM   1434 C  CE3   . TRP A 1 219 ? 10.276  -23.764 70.840 1.00 30.62 ? 876  TRP A CE3   1 
ATOM   1435 C  CZ2   . TRP A 1 219 ? 8.612   -21.832 69.586 1.00 30.69 ? 876  TRP A CZ2   1 
ATOM   1436 C  CZ3   . TRP A 1 219 ? 9.811   -22.645 71.529 1.00 30.70 ? 876  TRP A CZ3   1 
ATOM   1437 C  CH2   . TRP A 1 219 ? 8.988   -21.695 70.898 1.00 30.68 ? 876  TRP A CH2   1 
ATOM   1438 N  N     . SER A 1 220 ? 10.705  -27.792 66.080 1.00 30.88 ? 877  SER A N     1 
ATOM   1439 C  CA    . SER A 1 220 ? 10.402  -27.849 64.651 1.00 30.82 ? 877  SER A CA    1 
ATOM   1440 C  C     . SER A 1 220 ? 9.506   -29.039 64.325 1.00 30.80 ? 877  SER A C     1 
ATOM   1441 O  O     . SER A 1 220 ? 8.615   -28.938 63.478 1.00 30.81 ? 877  SER A O     1 
ATOM   1442 C  CB    . SER A 1 220 ? 11.700  -27.932 63.846 1.00 30.82 ? 877  SER A CB    1 
ATOM   1443 O  OG    . SER A 1 220 ? 12.679  -27.049 64.369 1.00 30.83 ? 877  SER A OG    1 
ATOM   1444 N  N     . TYR A 1 221 ? 9.754   -30.157 65.005 1.00 30.74 ? 878  TYR A N     1 
ATOM   1445 C  CA    . TYR A 1 221 ? 8.881   -31.325 64.954 1.00 30.69 ? 878  TYR A CA    1 
ATOM   1446 C  C     . TYR A 1 221 ? 7.454   -30.941 65.342 1.00 30.50 ? 878  TYR A C     1 
ATOM   1447 O  O     . TYR A 1 221 ? 6.492   -31.439 64.756 1.00 30.50 ? 878  TYR A O     1 
ATOM   1448 C  CB    . TYR A 1 221 ? 9.409   -32.418 65.891 1.00 30.77 ? 878  TYR A CB    1 
ATOM   1449 C  CG    . TYR A 1 221 ? 8.545   -33.658 65.963 1.00 31.12 ? 878  TYR A CG    1 
ATOM   1450 C  CD1   . TYR A 1 221 ? 8.743   -34.718 65.081 1.00 31.53 ? 878  TYR A CD1   1 
ATOM   1451 C  CD2   . TYR A 1 221 ? 7.534   -33.775 66.919 1.00 31.42 ? 878  TYR A CD2   1 
ATOM   1452 C  CE1   . TYR A 1 221 ? 7.953   -35.862 65.143 1.00 31.81 ? 878  TYR A CE1   1 
ATOM   1453 C  CE2   . TYR A 1 221 ? 6.739   -34.915 66.989 1.00 31.70 ? 878  TYR A CE2   1 
ATOM   1454 C  CZ    . TYR A 1 221 ? 6.954   -35.953 66.096 1.00 31.87 ? 878  TYR A CZ    1 
ATOM   1455 O  OH    . TYR A 1 221 ? 6.174   -37.084 66.157 1.00 32.05 ? 878  TYR A OH    1 
ATOM   1456 N  N     . GLY A 1 222 ? 7.329   -30.060 66.334 1.00 30.28 ? 879  GLY A N     1 
ATOM   1457 C  CA    . GLY A 1 222 ? 6.029   -29.600 66.812 1.00 30.07 ? 879  GLY A CA    1 
ATOM   1458 C  C     . GLY A 1 222 ? 5.235   -28.899 65.728 1.00 29.91 ? 879  GLY A C     1 
ATOM   1459 O  O     . GLY A 1 222 ? 4.109   -29.297 65.417 1.00 29.92 ? 879  GLY A O     1 
ATOM   1460 N  N     . VAL A 1 223 ? 5.832   -27.854 65.156 1.00 29.70 ? 880  VAL A N     1 
ATOM   1461 C  CA    . VAL A 1 223 ? 5.234   -27.097 64.059 1.00 29.50 ? 880  VAL A CA    1 
ATOM   1462 C  C     . VAL A 1 223 ? 4.919   -28.021 62.881 1.00 29.49 ? 880  VAL A C     1 
ATOM   1463 O  O     . VAL A 1 223 ? 3.911   -27.838 62.199 1.00 29.49 ? 880  VAL A O     1 
ATOM   1464 C  CB    . VAL A 1 223 ? 6.158   -25.943 63.595 1.00 29.48 ? 880  VAL A CB    1 
ATOM   1465 C  CG1   . VAL A 1 223 ? 5.465   -25.071 62.556 1.00 29.41 ? 880  VAL A CG1   1 
ATOM   1466 C  CG2   . VAL A 1 223 ? 6.594   -25.092 64.780 1.00 29.40 ? 880  VAL A CG2   1 
ATOM   1467 N  N     . THR A 1 224 ? 5.780   -29.014 62.661 1.00 29.42 ? 881  THR A N     1 
ATOM   1468 C  CA    . THR A 1 224 ? 5.568   -30.009 61.612 1.00 29.43 ? 881  THR A CA    1 
ATOM   1469 C  C     . THR A 1 224 ? 4.266   -30.769 61.845 1.00 29.43 ? 881  THR A C     1 
ATOM   1470 O  O     . THR A 1 224 ? 3.349   -30.689 61.030 1.00 29.40 ? 881  THR A O     1 
ATOM   1471 C  CB    . THR A 1 224 ? 6.756   -30.993 61.505 1.00 29.43 ? 881  THR A CB    1 
ATOM   1472 O  OG1   . THR A 1 224 ? 7.968   -30.256 61.305 1.00 29.62 ? 881  THR A OG1   1 
ATOM   1473 C  CG2   . THR A 1 224 ? 6.565   -31.960 60.340 1.00 29.35 ? 881  THR A CG2   1 
ATOM   1474 N  N     . VAL A 1 225 ? 4.194   -31.494 62.961 1.00 29.52 ? 882  VAL A N     1 
ATOM   1475 C  CA    . VAL A 1 225 ? 2.989   -32.227 63.355 1.00 29.67 ? 882  VAL A CA    1 
ATOM   1476 C  C     . VAL A 1 225 ? 1.752   -31.334 63.214 1.00 29.86 ? 882  VAL A C     1 
ATOM   1477 O  O     . VAL A 1 225 ? 0.733   -31.752 62.661 1.00 29.89 ? 882  VAL A O     1 
ATOM   1478 C  CB    . VAL A 1 225 ? 3.127   -32.793 64.793 1.00 29.64 ? 882  VAL A CB    1 
ATOM   1479 C  CG1   . VAL A 1 225 ? 1.784   -33.264 65.339 1.00 29.64 ? 882  VAL A CG1   1 
ATOM   1480 C  CG2   . VAL A 1 225 ? 4.135   -33.932 64.815 1.00 29.60 ? 882  VAL A CG2   1 
ATOM   1481 N  N     . TRP A 1 226 ? 1.872   -30.100 63.697 1.00 30.07 ? 883  TRP A N     1 
ATOM   1482 C  CA    . TRP A 1 226 ? 0.852   -29.074 63.527 1.00 30.32 ? 883  TRP A CA    1 
ATOM   1483 C  C     . TRP A 1 226 ? 0.432   -28.920 62.064 1.00 30.59 ? 883  TRP A C     1 
ATOM   1484 O  O     . TRP A 1 226 ? -0.759  -29.004 61.749 1.00 30.56 ? 883  TRP A O     1 
ATOM   1485 C  CB    . TRP A 1 226 ? 1.373   -27.744 64.068 1.00 30.26 ? 883  TRP A CB    1 
ATOM   1486 C  CG    . TRP A 1 226 ? 0.347   -26.667 64.156 1.00 30.13 ? 883  TRP A CG    1 
ATOM   1487 C  CD1   . TRP A 1 226 ? -0.468  -26.402 65.217 1.00 30.08 ? 883  TRP A CD1   1 
ATOM   1488 C  CD2   . TRP A 1 226 ? 0.032   -25.693 63.153 1.00 29.82 ? 883  TRP A CD2   1 
ATOM   1489 N  NE1   . TRP A 1 226 ? -1.276  -25.327 64.938 1.00 30.05 ? 883  TRP A NE1   1 
ATOM   1490 C  CE2   . TRP A 1 226 ? -0.990  -24.871 63.678 1.00 29.85 ? 883  TRP A CE2   1 
ATOM   1491 C  CE3   . TRP A 1 226 ? 0.512   -25.434 61.862 1.00 29.67 ? 883  TRP A CE3   1 
ATOM   1492 C  CZ2   . TRP A 1 226 ? -1.542  -23.809 62.958 1.00 29.73 ? 883  TRP A CZ2   1 
ATOM   1493 C  CZ3   . TRP A 1 226 ? -0.038  -24.378 61.147 1.00 29.67 ? 883  TRP A CZ3   1 
ATOM   1494 C  CH2   . TRP A 1 226 ? -1.054  -23.578 61.698 1.00 29.75 ? 883  TRP A CH2   1 
ATOM   1495 N  N     . GLU A 1 227 ? 1.408   -28.700 61.182 1.00 31.01 ? 884  GLU A N     1 
ATOM   1496 C  CA    . GLU A 1 227 ? 1.142   -28.559 59.749 1.00 31.46 ? 884  GLU A CA    1 
ATOM   1497 C  C     . GLU A 1 227 ? 0.266   -29.705 59.268 1.00 31.73 ? 884  GLU A C     1 
ATOM   1498 O  O     . GLU A 1 227 ? -0.728  -29.483 58.573 1.00 31.78 ? 884  GLU A O     1 
ATOM   1499 C  CB    . GLU A 1 227 ? 2.439   -28.548 58.933 1.00 31.50 ? 884  GLU A CB    1 
ATOM   1500 C  CG    . GLU A 1 227 ? 3.432   -27.461 59.293 1.00 31.78 ? 884  GLU A CG    1 
ATOM   1501 C  CD    . GLU A 1 227 ? 4.698   -27.543 58.465 1.00 32.12 ? 884  GLU A CD    1 
ATOM   1502 O  OE1   . GLU A 1 227 ? 4.670   -27.108 57.294 1.00 32.14 ? 884  GLU A OE1   1 
ATOM   1503 O  OE2   . GLU A 1 227 ? 5.724   -28.034 58.983 1.00 32.29 ? 884  GLU A OE2   1 
ATOM   1504 N  N     . LEU A 1 228 ? 0.637   -30.925 59.654 1.00 32.04 ? 885  LEU A N     1 
ATOM   1505 C  CA    . LEU A 1 228 ? -0.102  -32.119 59.253 1.00 32.36 ? 885  LEU A CA    1 
ATOM   1506 C  C     . LEU A 1 228 ? -1.538  -32.079 59.738 1.00 32.45 ? 885  LEU A C     1 
ATOM   1507 O  O     . LEU A 1 228 ? -2.473  -32.207 58.936 1.00 32.48 ? 885  LEU A O     1 
ATOM   1508 C  CB    . LEU A 1 228 ? 0.577   -33.397 59.757 1.00 32.41 ? 885  LEU A CB    1 
ATOM   1509 C  CG    . LEU A 1 228 ? 1.845   -33.857 59.035 1.00 32.82 ? 885  LEU A CG    1 
ATOM   1510 C  CD1   . LEU A 1 228 ? 1.964   -33.230 57.644 1.00 33.03 ? 885  LEU A CD1   1 
ATOM   1511 C  CD2   . LEU A 1 228 ? 3.088   -33.594 59.867 1.00 33.13 ? 885  LEU A CD2   1 
ATOM   1512 N  N     . MET A 1 229 ? -1.704  -31.892 61.046 1.00 32.52 ? 886  MET A N     1 
ATOM   1513 C  CA    . MET A 1 229 ? -3.022  -31.891 61.667 1.00 32.63 ? 886  MET A CA    1 
ATOM   1514 C  C     . MET A 1 229 ? -3.939  -30.823 61.069 1.00 32.69 ? 886  MET A C     1 
ATOM   1515 O  O     . MET A 1 229 ? -5.162  -30.963 61.101 1.00 32.71 ? 886  MET A O     1 
ATOM   1516 C  CB    . MET A 1 229 ? -2.897  -31.720 63.184 1.00 32.64 ? 886  MET A CB    1 
ATOM   1517 C  CG    . MET A 1 229 ? -1.978  -32.743 63.866 1.00 32.64 ? 886  MET A CG    1 
ATOM   1518 S  SD    . MET A 1 229 ? -2.503  -34.458 63.649 1.00 32.61 ? 886  MET A SD    1 
ATOM   1519 C  CE    . MET A 1 229 ? -1.172  -35.343 64.460 1.00 32.71 ? 886  MET A CE    1 
ATOM   1520 N  N     . THR A 1 230 ? -3.344  -29.770 60.511 1.00 32.73 ? 887  THR A N     1 
ATOM   1521 C  CA    . THR A 1 230 ? -4.104  -28.707 59.850 1.00 32.78 ? 887  THR A CA    1 
ATOM   1522 C  C     . THR A 1 230 ? -4.274  -28.948 58.345 1.00 32.87 ? 887  THR A C     1 
ATOM   1523 O  O     . THR A 1 230 ? -4.719  -28.057 57.614 1.00 32.90 ? 887  THR A O     1 
ATOM   1524 C  CB    . THR A 1 230 ? -3.454  -27.326 60.071 1.00 32.73 ? 887  THR A CB    1 
ATOM   1525 O  OG1   . THR A 1 230 ? -2.074  -27.377 59.689 1.00 32.84 ? 887  THR A OG1   1 
ATOM   1526 C  CG2   . THR A 1 230 ? -3.564  -26.900 61.528 1.00 32.72 ? 887  THR A CG2   1 
ATOM   1527 N  N     . PHE A 1 231 ? -3.930  -30.157 57.899 1.00 32.97 ? 888  PHE A N     1 
ATOM   1528 C  CA    . PHE A 1 231 ? -3.942  -30.526 56.479 1.00 33.08 ? 888  PHE A CA    1 
ATOM   1529 C  C     . PHE A 1 231 ? -3.137  -29.545 55.632 1.00 33.19 ? 888  PHE A C     1 
ATOM   1530 O  O     . PHE A 1 231 ? -3.550  -29.155 54.536 1.00 33.20 ? 888  PHE A O     1 
ATOM   1531 C  CB    . PHE A 1 231 ? -5.373  -30.693 55.948 1.00 33.07 ? 888  PHE A CB    1 
ATOM   1532 C  CG    . PHE A 1 231 ? -6.241  -31.556 56.815 1.00 33.06 ? 888  PHE A CG    1 
ATOM   1533 C  CD1   . PHE A 1 231 ? -5.897  -32.880 57.068 1.00 33.10 ? 888  PHE A CD1   1 
ATOM   1534 C  CD2   . PHE A 1 231 ? -7.401  -31.044 57.383 1.00 33.13 ? 888  PHE A CD2   1 
ATOM   1535 C  CE1   . PHE A 1 231 ? -6.695  -33.681 57.876 1.00 33.16 ? 888  PHE A CE1   1 
ATOM   1536 C  CE2   . PHE A 1 231 ? -8.210  -31.838 58.192 1.00 33.16 ? 888  PHE A CE2   1 
ATOM   1537 C  CZ    . PHE A 1 231 ? -7.857  -33.159 58.437 1.00 33.10 ? 888  PHE A CZ    1 
ATOM   1538 N  N     . GLY A 1 232 ? -1.989  -29.144 56.171 1.00 33.32 ? 889  GLY A N     1 
ATOM   1539 C  CA    . GLY A 1 232 ? -1.026  -28.325 55.449 1.00 33.48 ? 889  GLY A CA    1 
ATOM   1540 C  C     . GLY A 1 232 ? -1.219  -26.828 55.558 1.00 33.62 ? 889  GLY A C     1 
ATOM   1541 O  O     . GLY A 1 232 ? -0.825  -26.094 54.653 1.00 33.64 ? 889  GLY A O     1 
ATOM   1542 N  N     . ALA A 1 233 ? -1.818  -26.363 56.653 1.00 33.80 ? 890  ALA A N     1 
ATOM   1543 C  CA    . ALA A 1 233 ? -1.993  -24.925 56.856 1.00 34.05 ? 890  ALA A CA    1 
ATOM   1544 C  C     . ALA A 1 233 ? -0.648  -24.243 57.075 1.00 34.27 ? 890  ALA A C     1 
ATOM   1545 O  O     . ALA A 1 233 ? 0.288   -24.843 57.612 1.00 34.29 ? 890  ALA A O     1 
ATOM   1546 C  CB    . ALA A 1 233 ? -2.931  -24.644 58.016 1.00 33.97 ? 890  ALA A CB    1 
ATOM   1547 N  N     . GLU A 1 234 ? -0.564  -22.989 56.642 1.00 34.55 ? 891  GLU A N     1 
ATOM   1548 C  CA    . GLU A 1 234 ? 0.644   -22.190 56.788 1.00 34.83 ? 891  GLU A CA    1 
ATOM   1549 C  C     . GLU A 1 234 ? 0.755   -21.684 58.233 1.00 34.88 ? 891  GLU A C     1 
ATOM   1550 O  O     . GLU A 1 234 ? -0.154  -21.009 58.722 1.00 34.87 ? 891  GLU A O     1 
ATOM   1551 C  CB    . GLU A 1 234 ? 0.613   -21.025 55.792 1.00 34.91 ? 891  GLU A CB    1 
ATOM   1552 C  CG    . GLU A 1 234 ? 1.971   -20.420 55.460 1.00 35.54 ? 891  GLU A CG    1 
ATOM   1553 C  CD    . GLU A 1 234 ? 2.568   -19.627 56.609 1.00 36.29 ? 891  GLU A CD    1 
ATOM   1554 O  OE1   . GLU A 1 234 ? 1.802   -18.981 57.365 1.00 36.56 ? 891  GLU A OE1   1 
ATOM   1555 O  OE2   . GLU A 1 234 ? 3.809   -19.653 56.751 1.00 36.46 ? 891  GLU A OE2   1 
ATOM   1556 N  N     . PRO A 1 235 ? 1.867   -22.015 58.923 1.00 34.99 ? 892  PRO A N     1 
ATOM   1557 C  CA    . PRO A 1 235 ? 2.075   -21.595 60.314 1.00 35.09 ? 892  PRO A CA    1 
ATOM   1558 C  C     . PRO A 1 235 ? 2.236   -20.084 60.469 1.00 35.24 ? 892  PRO A C     1 
ATOM   1559 O  O     . PRO A 1 235 ? 3.018   -19.470 59.740 1.00 35.29 ? 892  PRO A O     1 
ATOM   1560 C  CB    . PRO A 1 235 ? 3.377   -22.305 60.707 1.00 35.05 ? 892  PRO A CB    1 
ATOM   1561 C  CG    . PRO A 1 235 ? 3.506   -23.431 59.746 1.00 35.04 ? 892  PRO A CG    1 
ATOM   1562 C  CD    . PRO A 1 235 ? 2.941   -22.914 58.465 1.00 35.00 ? 892  PRO A CD    1 
ATOM   1563 N  N     . TYR A 1 236 ? 1.507   -19.509 61.426 1.00 35.42 ? 893  TYR A N     1 
ATOM   1564 C  CA    . TYR A 1 236 ? 1.506   -18.061 61.694 1.00 35.62 ? 893  TYR A CA    1 
ATOM   1565 C  C     . TYR A 1 236 ? 1.066   -17.252 60.471 1.00 35.82 ? 893  TYR A C     1 
ATOM   1566 O  O     . TYR A 1 236 ? 1.670   -16.228 60.133 1.00 35.83 ? 893  TYR A O     1 
ATOM   1567 C  CB    . TYR A 1 236 ? 2.876   -17.583 62.197 1.00 35.58 ? 893  TYR A CB    1 
ATOM   1568 C  CG    . TYR A 1 236 ? 3.442   -18.379 63.352 1.00 35.53 ? 893  TYR A CG    1 
ATOM   1569 C  CD1   . TYR A 1 236 ? 4.422   -19.349 63.139 1.00 35.49 ? 893  TYR A CD1   1 
ATOM   1570 C  CD2   . TYR A 1 236 ? 3.008   -18.156 64.658 1.00 35.46 ? 893  TYR A CD2   1 
ATOM   1571 C  CE1   . TYR A 1 236 ? 4.951   -20.080 64.198 1.00 35.47 ? 893  TYR A CE1   1 
ATOM   1572 C  CE2   . TYR A 1 236 ? 3.531   -18.882 65.724 1.00 35.44 ? 893  TYR A CE2   1 
ATOM   1573 C  CZ    . TYR A 1 236 ? 4.503   -19.840 65.486 1.00 35.46 ? 893  TYR A CZ    1 
ATOM   1574 O  OH    . TYR A 1 236 ? 5.026   -20.560 66.535 1.00 35.54 ? 893  TYR A OH    1 
ATOM   1575 N  N     . ALA A 1 237 ? 0.001   -17.725 59.827 1.00 36.10 ? 894  ALA A N     1 
ATOM   1576 C  CA    . ALA A 1 237 ? -0.499  -17.156 58.576 1.00 36.38 ? 894  ALA A CA    1 
ATOM   1577 C  C     . ALA A 1 237 ? -0.862  -15.681 58.689 1.00 36.60 ? 894  ALA A C     1 
ATOM   1578 O  O     . ALA A 1 237 ? -1.472  -15.255 59.673 1.00 36.62 ? 894  ALA A O     1 
ATOM   1579 C  CB    . ALA A 1 237 ? -1.692  -17.960 58.072 1.00 36.36 ? 894  ALA A CB    1 
ATOM   1580 N  N     . GLY A 1 238 ? -0.468  -14.913 57.674 1.00 36.89 ? 895  GLY A N     1 
ATOM   1581 C  CA    . GLY A 1 238 ? -0.818  -13.497 57.562 1.00 37.26 ? 895  GLY A CA    1 
ATOM   1582 C  C     . GLY A 1 238 ? -0.341  -12.626 58.709 1.00 37.53 ? 895  GLY A C     1 
ATOM   1583 O  O     . GLY A 1 238 ? -1.056  -11.724 59.148 1.00 37.51 ? 895  GLY A O     1 
ATOM   1584 N  N     . LEU A 1 239 ? 0.864   -12.904 59.197 1.00 37.86 ? 896  LEU A N     1 
ATOM   1585 C  CA    . LEU A 1 239 ? 1.478   -12.113 60.260 1.00 38.20 ? 896  LEU A CA    1 
ATOM   1586 C  C     . LEU A 1 239 ? 2.877   -11.681 59.841 1.00 38.43 ? 896  LEU A C     1 
ATOM   1587 O  O     . LEU A 1 239 ? 3.529   -12.363 59.047 1.00 38.46 ? 896  LEU A O     1 
ATOM   1588 C  CB    . LEU A 1 239 ? 1.537   -12.915 61.566 1.00 38.18 ? 896  LEU A CB    1 
ATOM   1589 C  CG    . LEU A 1 239 ? 0.222   -13.155 62.319 1.00 38.20 ? 896  LEU A CG    1 
ATOM   1590 C  CD1   . LEU A 1 239 ? 0.296   -14.436 63.139 1.00 38.21 ? 896  LEU A CD1   1 
ATOM   1591 C  CD2   . LEU A 1 239 ? -0.142  -11.968 63.205 1.00 38.20 ? 896  LEU A CD2   1 
ATOM   1592 N  N     . ARG A 1 240 ? 3.331   -10.545 60.367 1.00 38.74 ? 897  ARG A N     1 
ATOM   1593 C  CA    . ARG A 1 240 ? 4.680   -10.052 60.088 1.00 39.04 ? 897  ARG A CA    1 
ATOM   1594 C  C     . ARG A 1 240 ? 5.737   -10.876 60.820 1.00 39.28 ? 897  ARG A C     1 
ATOM   1595 O  O     . ARG A 1 240 ? 5.551   -11.253 61.984 1.00 39.31 ? 897  ARG A O     1 
ATOM   1596 C  CB    . ARG A 1 240 ? 4.814   -8.571  60.450 1.00 39.02 ? 897  ARG A CB    1 
ATOM   1597 C  CG    . ARG A 1 240 ? 4.216   -7.621  59.425 1.00 38.98 ? 897  ARG A CG    1 
ATOM   1598 C  CD    . ARG A 1 240 ? 4.799   -6.222  59.573 1.00 38.86 ? 897  ARG A CD    1 
ATOM   1599 N  NE    . ARG A 1 240 ? 4.128   -5.248  58.714 1.00 38.81 ? 897  ARG A NE    1 
ATOM   1600 C  CZ    . ARG A 1 240 ? 3.028   -4.578  59.049 1.00 38.81 ? 897  ARG A CZ    1 
ATOM   1601 N  NH1   . ARG A 1 240 ? 2.454   -4.769  60.231 1.00 38.82 ? 897  ARG A NH1   1 
ATOM   1602 N  NH2   . ARG A 1 240 ? 2.495   -3.712  58.197 1.00 38.77 ? 897  ARG A NH2   1 
ATOM   1603 N  N     . LEU A 1 241 ? 6.843   -11.149 60.131 1.00 39.57 ? 898  LEU A N     1 
ATOM   1604 C  CA    . LEU A 1 241 ? 7.926   -11.980 60.665 1.00 39.85 ? 898  LEU A CA    1 
ATOM   1605 C  C     . LEU A 1 241 ? 8.597   -11.392 61.903 1.00 39.96 ? 898  LEU A C     1 
ATOM   1606 O  O     . LEU A 1 241 ? 8.968   -12.130 62.818 1.00 40.02 ? 898  LEU A O     1 
ATOM   1607 C  CB    . LEU A 1 241 ? 8.978   -12.257 59.586 1.00 39.89 ? 898  LEU A CB    1 
ATOM   1608 C  CG    . LEU A 1 241 ? 8.575   -13.144 58.404 1.00 40.07 ? 898  LEU A CG    1 
ATOM   1609 C  CD1   . LEU A 1 241 ? 9.703   -13.194 57.377 1.00 40.21 ? 898  LEU A CD1   1 
ATOM   1610 C  CD2   . LEU A 1 241 ? 8.220   -14.554 58.872 1.00 40.06 ? 898  LEU A CD2   1 
ATOM   1611 N  N     . ALA A 1 242 ? 8.754   -10.069 61.920 1.00 40.05 ? 899  ALA A N     1 
ATOM   1612 C  CA    . ALA A 1 242 ? 9.324   -9.366  63.066 1.00 40.07 ? 899  ALA A CA    1 
ATOM   1613 C  C     . ALA A 1 242 ? 8.479   -9.602  64.312 1.00 40.01 ? 899  ALA A C     1 
ATOM   1614 O  O     . ALA A 1 242 ? 9.007   -9.697  65.425 1.00 40.06 ? 899  ALA A O     1 
ATOM   1615 C  CB    . ALA A 1 242 ? 9.442   -7.879  62.771 1.00 40.12 ? 899  ALA A CB    1 
ATOM   1616 N  N     . GLU A 1 243 ? 7.166   -9.700  64.105 1.00 39.75 ? 900  GLU A N     1 
ATOM   1617 C  CA    . GLU A 1 243 ? 6.214   -9.923  65.185 1.00 39.43 ? 900  GLU A CA    1 
ATOM   1618 C  C     . GLU A 1 243 ? 6.316   -11.317 65.802 1.00 40.09 ? 900  GLU A C     1 
ATOM   1619 O  O     . GLU A 1 243 ? 6.120   -11.478 67.006 1.00 40.20 ? 900  GLU A O     1 
ATOM   1620 C  CB    . GLU A 1 243 ? 4.782   -9.665  64.691 1.00 39.02 ? 900  GLU A CB    1 
ATOM   1621 C  CG    . GLU A 1 243 ? 3.675   -9.987  65.700 1.00 37.27 ? 900  GLU A CG    1 
ATOM   1622 C  CD    . GLU A 1 243 ? 3.700   -9.095  66.938 1.00 35.41 ? 900  GLU A CD    1 
ATOM   1623 O  OE1   . GLU A 1 243 ? 2.860   -9.314  67.836 1.00 34.90 ? 900  GLU A OE1   1 
ATOM   1624 O  OE2   . GLU A 1 243 ? 4.544   -8.174  67.023 1.00 35.14 ? 900  GLU A OE2   1 
ATOM   1625 N  N     . VAL A 1 244 ? 6.626   -12.314 64.975 1.00 40.78 ? 901  VAL A N     1 
ATOM   1626 C  CA    . VAL A 1 244 ? 6.583   -13.725 65.389 1.00 41.39 ? 901  VAL A CA    1 
ATOM   1627 C  C     . VAL A 1 244 ? 7.320   -14.051 66.705 1.00 41.77 ? 901  VAL A C     1 
ATOM   1628 O  O     . VAL A 1 244 ? 6.755   -14.746 67.552 1.00 41.81 ? 901  VAL A O     1 
ATOM   1629 C  CB    . VAL A 1 244 ? 7.030   -14.687 64.251 1.00 41.40 ? 901  VAL A CB    1 
ATOM   1630 C  CG1   . VAL A 1 244 ? 6.983   -16.144 64.709 1.00 41.36 ? 901  VAL A CG1   1 
ATOM   1631 C  CG2   . VAL A 1 244 ? 6.163   -14.496 63.013 1.00 41.44 ? 901  VAL A CG2   1 
ATOM   1632 N  N     . PRO A 1 245 ? 8.568   -13.560 66.884 1.00 42.11 ? 902  PRO A N     1 
ATOM   1633 C  CA    . PRO A 1 245 ? 9.187   -13.787 68.192 1.00 42.33 ? 902  PRO A CA    1 
ATOM   1634 C  C     . PRO A 1 245 ? 8.334   -13.298 69.366 1.00 42.52 ? 902  PRO A C     1 
ATOM   1635 O  O     . PRO A 1 245 ? 8.251   -13.991 70.379 1.00 42.54 ? 902  PRO A O     1 
ATOM   1636 C  CB    . PRO A 1 245 ? 10.488  -12.988 68.104 1.00 42.34 ? 902  PRO A CB    1 
ATOM   1637 C  CG    . PRO A 1 245 ? 10.843  -13.041 66.670 1.00 42.29 ? 902  PRO A CG    1 
ATOM   1638 C  CD    . PRO A 1 245 ? 9.534   -12.982 65.927 1.00 42.15 ? 902  PRO A CD    1 
ATOM   1639 N  N     . ASP A 1 246 ? 7.702   -12.133 69.218 1.00 42.72 ? 903  ASP A N     1 
ATOM   1640 C  CA    . ASP A 1 246 ? 6.868   -11.547 70.275 1.00 42.91 ? 903  ASP A CA    1 
ATOM   1641 C  C     . ASP A 1 246 ? 5.695   -12.439 70.682 1.00 42.99 ? 903  ASP A C     1 
ATOM   1642 O  O     . ASP A 1 246 ? 5.530   -12.739 71.861 1.00 43.02 ? 903  ASP A O     1 
ATOM   1643 C  CB    . ASP A 1 246 ? 6.341   -10.166 69.860 1.00 42.94 ? 903  ASP A CB    1 
ATOM   1644 C  CG    . ASP A 1 246 ? 7.441   -9.127  69.737 1.00 43.03 ? 903  ASP A CG    1 
ATOM   1645 O  OD1   . ASP A 1 246 ? 8.494   -9.427  69.134 1.00 43.09 ? 903  ASP A OD1   1 
ATOM   1646 O  OD2   . ASP A 1 246 ? 7.244   -7.998  70.236 1.00 43.12 ? 903  ASP A OD2   1 
ATOM   1647 N  N     . LEU A 1 247 ? 4.901   -12.863 69.699 1.00 43.09 ? 904  LEU A N     1 
ATOM   1648 C  CA    . LEU A 1 247 ? 3.665   -13.618 69.939 1.00 43.16 ? 904  LEU A CA    1 
ATOM   1649 C  C     . LEU A 1 247 ? 3.862   -14.879 70.784 1.00 43.20 ? 904  LEU A C     1 
ATOM   1650 O  O     . LEU A 1 247 ? 3.170   -15.076 71.786 1.00 43.23 ? 904  LEU A O     1 
ATOM   1651 C  CB    . LEU A 1 247 ? 2.991   -13.971 68.609 1.00 43.16 ? 904  LEU A CB    1 
ATOM   1652 N  N     . LEU A 1 248 ? 4.808   -15.720 70.375 1.00 43.24 ? 905  LEU A N     1 
ATOM   1653 C  CA    . LEU A 1 248 ? 5.102   -16.973 71.074 1.00 43.28 ? 905  LEU A CA    1 
ATOM   1654 C  C     . LEU A 1 248 ? 5.869   -16.735 72.373 1.00 43.30 ? 905  LEU A C     1 
ATOM   1655 O  O     . LEU A 1 248 ? 5.860   -17.578 73.274 1.00 43.29 ? 905  LEU A O     1 
ATOM   1656 C  CB    . LEU A 1 248 ? 5.864   -17.936 70.153 1.00 43.27 ? 905  LEU A CB    1 
ATOM   1657 C  CG    . LEU A 1 248 ? 7.125   -17.433 69.443 1.00 43.26 ? 905  LEU A CG    1 
ATOM   1658 C  CD1   . LEU A 1 248 ? 8.351   -17.727 70.282 1.00 43.39 ? 905  LEU A CD1   1 
ATOM   1659 C  CD2   . LEU A 1 248 ? 7.259   -18.094 68.084 1.00 43.29 ? 905  LEU A CD2   1 
ATOM   1660 N  N     . GLU A 1 249 ? 6.539   -15.587 72.449 1.00 43.34 ? 906  GLU A N     1 
ATOM   1661 C  CA    . GLU A 1 249 ? 7.205   -15.148 73.668 1.00 43.41 ? 906  GLU A CA    1 
ATOM   1662 C  C     . GLU A 1 249 ? 6.153   -14.720 74.689 1.00 43.41 ? 906  GLU A C     1 
ATOM   1663 O  O     . GLU A 1 249 ? 6.293   -15.000 75.881 1.00 43.42 ? 906  GLU A O     1 
ATOM   1664 C  CB    . GLU A 1 249 ? 8.172   -13.999 73.368 1.00 43.44 ? 906  GLU A CB    1 
ATOM   1665 C  CG    . GLU A 1 249 ? 9.303   -13.826 74.375 1.00 43.63 ? 906  GLU A CG    1 
ATOM   1666 C  CD    . GLU A 1 249 ? 8.862   -13.166 75.672 1.00 43.96 ? 906  GLU A CD    1 
ATOM   1667 O  OE1   . GLU A 1 249 ? 9.499   -13.432 76.712 1.00 44.07 ? 906  GLU A OE1   1 
ATOM   1668 O  OE2   . GLU A 1 249 ? 7.883   -12.386 75.659 1.00 44.01 ? 906  GLU A OE2   1 
ATOM   1669 N  N     . LYS A 1 250 ? 5.103   -14.046 74.213 1.00 43.42 ? 907  LYS A N     1 
ATOM   1670 C  CA    . LYS A 1 250 ? 3.941   -13.716 75.044 1.00 43.42 ? 907  LYS A CA    1 
ATOM   1671 C  C     . LYS A 1 250 ? 3.211   -15.002 75.429 1.00 43.41 ? 907  LYS A C     1 
ATOM   1672 O  O     . LYS A 1 250 ? 2.350   -15.002 76.313 1.00 43.40 ? 907  LYS A O     1 
ATOM   1673 C  CB    . LYS A 1 250 ? 2.973   -12.772 74.315 1.00 43.43 ? 907  LYS A CB    1 
ATOM   1674 C  CG    . LYS A 1 250 ? 3.599   -11.549 73.645 1.00 43.46 ? 907  LYS A CG    1 
ATOM   1675 C  CD    . LYS A 1 250 ? 4.142   -10.530 74.634 1.00 43.48 ? 907  LYS A CD    1 
ATOM   1676 C  CE    . LYS A 1 250 ? 4.867   -9.410  73.903 1.00 43.50 ? 907  LYS A CE    1 
ATOM   1677 N  NZ    . LYS A 1 250 ? 5.434   -8.401  74.838 1.00 43.51 ? 907  LYS A NZ    1 
ATOM   1678 N  N     . GLY A 1 251 ? 3.560   -16.089 74.745 1.00 43.41 ? 908  GLY A N     1 
ATOM   1679 C  CA    . GLY A 1 251 ? 3.040   -17.412 75.050 1.00 43.40 ? 908  GLY A CA    1 
ATOM   1680 C  C     . GLY A 1 251 ? 1.640   -17.665 74.532 1.00 43.40 ? 908  GLY A C     1 
ATOM   1681 O  O     . GLY A 1 251 ? 0.889   -18.436 75.134 1.00 43.42 ? 908  GLY A O     1 
ATOM   1682 N  N     . GLU A 1 252 ? 1.277   -17.018 73.425 1.00 43.36 ? 909  GLU A N     1 
ATOM   1683 C  CA    . GLU A 1 252 ? -0.013  -17.287 72.793 1.00 43.30 ? 909  GLU A CA    1 
ATOM   1684 C  C     . GLU A 1 252 ? 0.072   -18.572 71.969 1.00 43.19 ? 909  GLU A C     1 
ATOM   1685 O  O     . GLU A 1 252 ? -0.874  -19.364 71.953 1.00 43.23 ? 909  GLU A O     1 
ATOM   1686 C  CB    . GLU A 1 252 ? -0.487  -16.111 71.931 1.00 43.32 ? 909  GLU A CB    1 
ATOM   1687 C  CG    . GLU A 1 252 ? -2.014  -15.934 71.895 1.00 43.49 ? 909  GLU A CG    1 
ATOM   1688 C  CD    . GLU A 1 252 ? -2.758  -17.128 71.304 1.00 43.64 ? 909  GLU A CD    1 
ATOM   1689 O  OE1   . GLU A 1 252 ? -2.458  -17.517 70.155 1.00 43.65 ? 909  GLU A OE1   1 
ATOM   1690 O  OE2   . GLU A 1 252 ? -3.646  -17.676 71.991 1.00 43.69 ? 909  GLU A OE2   1 
ATOM   1691 N  N     . ARG A 1 253 ? 1.213   -18.765 71.300 1.00 42.94 ? 910  ARG A N     1 
ATOM   1692 C  CA    . ARG A 1 253 ? 1.534   -19.994 70.550 1.00 42.71 ? 910  ARG A CA    1 
ATOM   1693 C  C     . ARG A 1 253 ? 0.539   -20.331 69.427 1.00 42.39 ? 910  ARG A C     1 
ATOM   1694 O  O     . ARG A 1 253 ? -0.391  -19.567 69.150 1.00 42.35 ? 910  ARG A O     1 
ATOM   1695 C  CB    . ARG A 1 253 ? 1.717   -21.190 71.504 1.00 42.81 ? 910  ARG A CB    1 
ATOM   1696 C  CG    . ARG A 1 253 ? 2.828   -21.017 72.545 1.00 43.26 ? 910  ARG A CG    1 
ATOM   1697 C  CD    . ARG A 1 253 ? 2.480   -21.757 73.836 1.00 44.08 ? 910  ARG A CD    1 
ATOM   1698 N  NE    . ARG A 1 253 ? 3.208   -21.239 74.998 1.00 44.55 ? 910  ARG A NE    1 
ATOM   1699 C  CZ    . ARG A 1 253 ? 2.778   -21.312 76.258 1.00 44.65 ? 910  ARG A CZ    1 
ATOM   1700 N  NH1   . ARG A 1 253 ? 1.612   -21.878 76.545 1.00 44.77 ? 910  ARG A NH1   1 
ATOM   1701 N  NH2   . ARG A 1 253 ? 3.519   -20.809 77.236 1.00 44.61 ? 910  ARG A NH2   1 
ATOM   1702 N  N     . LEU A 1 254 ? 0.759   -21.475 68.780 1.00 42.00 ? 911  LEU A N     1 
ATOM   1703 C  CA    . LEU A 1 254 ? -0.080  -21.948 67.680 1.00 41.61 ? 911  LEU A CA    1 
ATOM   1704 C  C     . LEU A 1 254 ? -1.479  -22.303 68.165 1.00 41.32 ? 911  LEU A C     1 
ATOM   1705 O  O     . LEU A 1 254 ? -1.654  -22.734 69.305 1.00 41.31 ? 911  LEU A O     1 
ATOM   1706 C  CB    . LEU A 1 254 ? 0.541   -23.189 67.023 1.00 41.64 ? 911  LEU A CB    1 
ATOM   1707 C  CG    . LEU A 1 254 ? 1.909   -23.196 66.318 1.00 41.65 ? 911  LEU A CG    1 
ATOM   1708 C  CD1   . LEU A 1 254 ? 1.934   -22.241 65.118 1.00 41.59 ? 911  LEU A CD1   1 
ATOM   1709 C  CD2   . LEU A 1 254 ? 3.073   -22.924 67.285 1.00 41.64 ? 911  LEU A CD2   1 
ATOM   1710 N  N     . ALA A 1 255 ? -2.468  -22.123 67.293 1.00 40.90 ? 912  ALA A N     1 
ATOM   1711 C  CA    . ALA A 1 255 ? -3.848  -22.493 67.597 1.00 40.49 ? 912  ALA A CA    1 
ATOM   1712 C  C     . ALA A 1 255 ? -4.004  -24.012 67.670 1.00 40.20 ? 912  ALA A C     1 
ATOM   1713 O  O     . ALA A 1 255 ? -3.174  -24.757 67.140 1.00 40.12 ? 912  ALA A O     1 
ATOM   1714 C  CB    . ALA A 1 255 ? -4.796  -21.906 66.556 1.00 40.51 ? 912  ALA A CB    1 
ATOM   1715 N  N     . GLN A 1 256 ? -5.064  -24.462 68.338 1.00 39.85 ? 913  GLN A N     1 
ATOM   1716 C  CA    . GLN A 1 256 ? -5.404  -25.881 68.389 1.00 39.54 ? 913  GLN A CA    1 
ATOM   1717 C  C     . GLN A 1 256 ? -6.007  -26.289 67.049 1.00 39.33 ? 913  GLN A C     1 
ATOM   1718 O  O     . GLN A 1 256 ? -6.993  -25.692 66.611 1.00 39.32 ? 913  GLN A O     1 
ATOM   1719 C  CB    . GLN A 1 256 ? -6.398  -26.171 69.517 1.00 39.53 ? 913  GLN A CB    1 
ATOM   1720 C  CG    . GLN A 1 256 ? -6.039  -25.555 70.861 1.00 39.47 ? 913  GLN A CG    1 
ATOM   1721 C  CD    . GLN A 1 256 ? -6.948  -26.019 71.983 1.00 39.42 ? 913  GLN A CD    1 
ATOM   1722 O  OE1   . GLN A 1 256 ? -8.171  -26.030 71.844 1.00 39.50 ? 913  GLN A OE1   1 
ATOM   1723 N  NE2   . GLN A 1 256 ? -6.353  -26.395 73.109 1.00 39.37 ? 913  GLN A NE2   1 
ATOM   1724 N  N     . PRO A 1 257 ? -5.407  -27.294 66.384 1.00 39.13 ? 914  PRO A N     1 
ATOM   1725 C  CA    . PRO A 1 257 ? -5.901  -27.759 65.092 1.00 38.99 ? 914  PRO A CA    1 
ATOM   1726 C  C     . PRO A 1 257 ? -7.263  -28.423 65.210 1.00 38.88 ? 914  PRO A C     1 
ATOM   1727 O  O     . PRO A 1 257 ? -7.519  -29.170 66.159 1.00 38.84 ? 914  PRO A O     1 
ATOM   1728 C  CB    . PRO A 1 257 ? -4.843  -28.777 64.649 1.00 39.00 ? 914  PRO A CB    1 
ATOM   1729 C  CG    . PRO A 1 257 ? -3.635  -28.441 65.439 1.00 39.07 ? 914  PRO A CG    1 
ATOM   1730 C  CD    . PRO A 1 257 ? -4.162  -27.983 66.759 1.00 39.12 ? 914  PRO A CD    1 
ATOM   1731 N  N     . GLN A 1 258 ? -8.113  -28.141 64.228 1.00 38.80 ? 915  GLN A N     1 
ATOM   1732 C  CA    . GLN A 1 258 ? -9.521  -28.527 64.221 1.00 38.74 ? 915  GLN A CA    1 
ATOM   1733 C  C     . GLN A 1 258 ? -9.778  -30.000 64.561 1.00 38.73 ? 915  GLN A C     1 
ATOM   1734 O  O     . GLN A 1 258 ? -10.745 -30.318 65.257 1.00 38.72 ? 915  GLN A O     1 
ATOM   1735 C  CB    . GLN A 1 258 ? -10.114 -28.184 62.853 1.00 38.73 ? 915  GLN A CB    1 
ATOM   1736 C  CG    . GLN A 1 258 ? -11.607 -28.397 62.709 1.00 38.77 ? 915  GLN A CG    1 
ATOM   1737 C  CD    . GLN A 1 258 ? -12.045 -28.370 61.259 1.00 38.83 ? 915  GLN A CD    1 
ATOM   1738 O  OE1   . GLN A 1 258 ? -11.456 -29.037 60.405 1.00 38.75 ? 915  GLN A OE1   1 
ATOM   1739 N  NE2   . GLN A 1 258 ? -13.088 -27.601 60.971 1.00 38.98 ? 915  GLN A NE2   1 
ATOM   1740 N  N     . ILE A 1 259 ? -8.906  -30.884 64.084 1.00 38.72 ? 916  ILE A N     1 
ATOM   1741 C  CA    . ILE A 1 259 ? -9.113  -32.331 64.217 1.00 38.72 ? 916  ILE A CA    1 
ATOM   1742 C  C     . ILE A 1 259 ? -8.421  -32.975 65.429 1.00 38.69 ? 916  ILE A C     1 
ATOM   1743 O  O     . ILE A 1 259 ? -8.484  -34.196 65.603 1.00 38.68 ? 916  ILE A O     1 
ATOM   1744 C  CB    . ILE A 1 259 ? -8.701  -33.088 62.921 1.00 38.72 ? 916  ILE A CB    1 
ATOM   1745 C  CG1   . ILE A 1 259 ? -7.183  -33.017 62.705 1.00 38.77 ? 916  ILE A CG1   1 
ATOM   1746 C  CG2   . ILE A 1 259 ? -9.481  -32.555 61.717 1.00 38.76 ? 916  ILE A CG2   1 
ATOM   1747 C  CD1   . ILE A 1 259 ? -6.641  -34.046 61.679 1.00 38.87 ? 916  ILE A CD1   1 
ATOM   1748 N  N     . CYS A 1 260 ? -7.785  -32.161 66.269 1.00 38.67 ? 917  CYS A N     1 
ATOM   1749 C  CA    . CYS A 1 260 ? -6.997  -32.684 67.389 1.00 38.70 ? 917  CYS A CA    1 
ATOM   1750 C  C     . CYS A 1 260 ? -7.659  -32.536 68.758 1.00 38.63 ? 917  CYS A C     1 
ATOM   1751 O  O     . CYS A 1 260 ? -8.126  -31.452 69.128 1.00 38.60 ? 917  CYS A O     1 
ATOM   1752 C  CB    . CYS A 1 260 ? -5.608  -32.040 67.419 1.00 38.70 ? 917  CYS A CB    1 
ATOM   1753 S  SG    . CYS A 1 260 ? -4.552  -32.534 66.063 1.00 39.11 ? 917  CYS A SG    1 
ATOM   1754 N  N     . THR A 1 261 ? -7.688  -33.642 69.500 1.00 38.58 ? 918  THR A N     1 
ATOM   1755 C  CA    . THR A 1 261 ? -8.122  -33.642 70.895 1.00 38.56 ? 918  THR A CA    1 
ATOM   1756 C  C     . THR A 1 261 ? -7.026  -33.012 71.747 1.00 38.51 ? 918  THR A C     1 
ATOM   1757 O  O     . THR A 1 261 ? -5.852  -33.040 71.366 1.00 38.50 ? 918  THR A O     1 
ATOM   1758 C  CB    . THR A 1 261 ? -8.400  -35.073 71.408 1.00 38.58 ? 918  THR A CB    1 
ATOM   1759 O  OG1   . THR A 1 261 ? -7.188  -35.845 71.363 1.00 38.61 ? 918  THR A OG1   1 
ATOM   1760 C  CG2   . THR A 1 261 ? -9.479  -35.758 70.562 1.00 38.62 ? 918  THR A CG2   1 
ATOM   1761 N  N     . ILE A 1 262 ? -7.402  -32.453 72.895 1.00 38.46 ? 919  ILE A N     1 
ATOM   1762 C  CA    . ILE A 1 262 ? -6.441  -31.775 73.771 1.00 38.42 ? 919  ILE A CA    1 
ATOM   1763 C  C     . ILE A 1 262 ? -5.201  -32.633 74.086 1.00 38.38 ? 919  ILE A C     1 
ATOM   1764 O  O     . ILE A 1 262 ? -4.111  -32.097 74.291 1.00 38.40 ? 919  ILE A O     1 
ATOM   1765 C  CB    . ILE A 1 262 ? -7.114  -31.218 75.065 1.00 38.43 ? 919  ILE A CB    1 
ATOM   1766 C  CG1   . ILE A 1 262 ? -6.174  -30.249 75.799 1.00 38.43 ? 919  ILE A CG1   1 
ATOM   1767 C  CG2   . ILE A 1 262 ? -7.610  -32.354 75.972 1.00 38.44 ? 919  ILE A CG2   1 
ATOM   1768 C  CD1   . ILE A 1 262 ? -6.881  -29.243 76.694 1.00 38.51 ? 919  ILE A CD1   1 
ATOM   1769 N  N     . ASP A 1 263 ? -5.370  -33.956 74.091 1.00 38.29 ? 920  ASP A N     1 
ATOM   1770 C  CA    . ASP A 1 263 ? -4.262  -34.887 74.329 1.00 38.17 ? 920  ASP A CA    1 
ATOM   1771 C  C     . ASP A 1 263 ? -3.182  -34.848 73.246 1.00 38.03 ? 920  ASP A C     1 
ATOM   1772 O  O     . ASP A 1 263 ? -1.992  -34.862 73.562 1.00 38.01 ? 920  ASP A O     1 
ATOM   1773 C  CB    . ASP A 1 263 ? -4.777  -36.318 74.517 1.00 38.20 ? 920  ASP A CB    1 
ATOM   1774 C  CG    . ASP A 1 263 ? -5.221  -36.596 75.940 1.00 38.26 ? 920  ASP A CG    1 
ATOM   1775 O  OD1   . ASP A 1 263 ? -6.128  -35.893 76.437 1.00 38.34 ? 920  ASP A OD1   1 
ATOM   1776 O  OD2   . ASP A 1 263 ? -4.666  -37.525 76.563 1.00 38.32 ? 920  ASP A OD2   1 
ATOM   1777 N  N     . VAL A 1 264 ? -3.597  -34.800 71.981 1.00 37.85 ? 921  VAL A N     1 
ATOM   1778 C  CA    . VAL A 1 264 ? -2.653  -34.706 70.864 1.00 37.69 ? 921  VAL A CA    1 
ATOM   1779 C  C     . VAL A 1 264 ? -2.096  -33.288 70.751 1.00 37.58 ? 921  VAL A C     1 
ATOM   1780 O  O     . VAL A 1 264 ? -0.940  -33.100 70.363 1.00 37.59 ? 921  VAL A O     1 
ATOM   1781 C  CB    . VAL A 1 264 ? -3.290  -35.139 69.517 1.00 37.69 ? 921  VAL A CB    1 
ATOM   1782 C  CG1   . VAL A 1 264 ? -2.260  -35.120 68.390 1.00 37.63 ? 921  VAL A CG1   1 
ATOM   1783 C  CG2   . VAL A 1 264 ? -3.886  -36.524 69.636 1.00 37.71 ? 921  VAL A CG2   1 
ATOM   1784 N  N     . TYR A 1 265 ? -2.917  -32.297 71.096 1.00 37.40 ? 922  TYR A N     1 
ATOM   1785 C  CA    . TYR A 1 265 ? -2.488  -30.901 71.045 1.00 37.25 ? 922  TYR A CA    1 
ATOM   1786 C  C     . TYR A 1 265 ? -1.404  -30.577 72.072 1.00 37.11 ? 922  TYR A C     1 
ATOM   1787 O  O     . TYR A 1 265 ? -0.471  -29.833 71.769 1.00 37.08 ? 922  TYR A O     1 
ATOM   1788 C  CB    . TYR A 1 265 ? -3.673  -29.940 71.188 1.00 37.28 ? 922  TYR A CB    1 
ATOM   1789 C  CG    . TYR A 1 265 ? -3.270  -28.478 71.180 1.00 37.40 ? 922  TYR A CG    1 
ATOM   1790 C  CD1   . TYR A 1 265 ? -2.711  -27.895 70.043 1.00 37.51 ? 922  TYR A CD1   1 
ATOM   1791 C  CD2   . TYR A 1 265 ? -3.438  -27.682 72.310 1.00 37.58 ? 922  TYR A CD2   1 
ATOM   1792 C  CE1   . TYR A 1 265 ? -2.330  -26.560 70.029 1.00 37.66 ? 922  TYR A CE1   1 
ATOM   1793 C  CE2   . TYR A 1 265 ? -3.064  -26.341 72.307 1.00 37.73 ? 922  TYR A CE2   1 
ATOM   1794 C  CZ    . TYR A 1 265 ? -2.512  -25.788 71.162 1.00 37.80 ? 922  TYR A CZ    1 
ATOM   1795 O  OH    . TYR A 1 265 ? -2.142  -24.464 71.156 1.00 37.90 ? 922  TYR A OH    1 
ATOM   1796 N  N     . MET A 1 266 ? -1.524  -31.139 73.274 1.00 36.94 ? 923  MET A N     1 
ATOM   1797 C  CA    . MET A 1 266 ? -0.547  -30.895 74.339 1.00 36.77 ? 923  MET A CA    1 
ATOM   1798 C  C     . MET A 1 266 ? 0.831   -31.467 74.009 1.00 36.66 ? 923  MET A C     1 
ATOM   1799 O  O     . MET A 1 266 ? 1.849   -30.923 74.443 1.00 36.69 ? 923  MET A O     1 
ATOM   1800 C  CB    . MET A 1 266 ? -1.042  -31.427 75.687 1.00 36.76 ? 923  MET A CB    1 
ATOM   1801 C  CG    . MET A 1 266 ? -2.172  -30.613 76.319 1.00 36.73 ? 923  MET A CG    1 
ATOM   1802 S  SD    . MET A 1 266 ? -1.829  -28.848 76.490 1.00 36.65 ? 923  MET A SD    1 
ATOM   1803 C  CE    . MET A 1 266 ? -3.213  -28.336 77.512 1.00 36.76 ? 923  MET A CE    1 
ATOM   1804 N  N     . VAL A 1 267 ? 0.851   -32.558 73.242 1.00 36.45 ? 924  VAL A N     1 
ATOM   1805 C  CA    . VAL A 1 267 ? 2.089   -33.134 72.713 1.00 36.22 ? 924  VAL A CA    1 
ATOM   1806 C  C     . VAL A 1 267 ? 2.901   -32.046 72.020 1.00 36.04 ? 924  VAL A C     1 
ATOM   1807 O  O     . VAL A 1 267 ? 4.091   -31.871 72.292 1.00 36.04 ? 924  VAL A O     1 
ATOM   1808 C  CB    . VAL A 1 267 ? 1.800   -34.272 71.702 1.00 36.22 ? 924  VAL A CB    1 
ATOM   1809 C  CG1   . VAL A 1 267 ? 3.086   -34.786 71.074 1.00 36.20 ? 924  VAL A CG1   1 
ATOM   1810 C  CG2   . VAL A 1 267 ? 1.042   -35.407 72.367 1.00 36.25 ? 924  VAL A CG2   1 
ATOM   1811 N  N     . MET A 1 268 ? 2.230   -31.316 71.133 1.00 35.82 ? 925  MET A N     1 
ATOM   1812 C  CA    . MET A 1 268 ? 2.823   -30.211 70.390 1.00 35.58 ? 925  MET A CA    1 
ATOM   1813 C  C     . MET A 1 268 ? 3.236   -29.059 71.310 1.00 35.33 ? 925  MET A C     1 
ATOM   1814 O  O     . MET A 1 268 ? 4.308   -28.478 71.134 1.00 35.32 ? 925  MET A O     1 
ATOM   1815 C  CB    . MET A 1 268 ? 1.842   -29.712 69.322 1.00 35.65 ? 925  MET A CB    1 
ATOM   1816 C  CG    . MET A 1 268 ? 1.340   -30.800 68.372 1.00 35.86 ? 925  MET A CG    1 
ATOM   1817 S  SD    . MET A 1 268 ? 0.332   -30.188 67.005 1.00 36.31 ? 925  MET A SD    1 
ATOM   1818 C  CE    . MET A 1 268 ? -1.225  -29.869 67.829 1.00 36.13 ? 925  MET A CE    1 
ATOM   1819 N  N     . VAL A 1 269 ? 2.387   -28.745 72.289 1.00 35.02 ? 926  VAL A N     1 
ATOM   1820 C  CA    . VAL A 1 269 ? 2.608   -27.613 73.202 1.00 34.71 ? 926  VAL A CA    1 
ATOM   1821 C  C     . VAL A 1 269 ? 3.896   -27.772 74.009 1.00 34.54 ? 926  VAL A C     1 
ATOM   1822 O  O     . VAL A 1 269 ? 4.597   -26.791 74.276 1.00 34.52 ? 926  VAL A O     1 
ATOM   1823 C  CB    . VAL A 1 269 ? 1.405   -27.401 74.161 1.00 34.69 ? 926  VAL A CB    1 
ATOM   1824 C  CG1   . VAL A 1 269 ? 1.632   -26.200 75.078 1.00 34.61 ? 926  VAL A CG1   1 
ATOM   1825 C  CG2   . VAL A 1 269 ? 0.128   -27.208 73.375 1.00 34.64 ? 926  VAL A CG2   1 
ATOM   1826 N  N     . LYS A 1 270 ? 4.202   -29.012 74.382 1.00 34.33 ? 927  LYS A N     1 
ATOM   1827 C  CA    . LYS A 1 270 ? 5.426   -29.328 75.113 1.00 34.14 ? 927  LYS A CA    1 
ATOM   1828 C  C     . LYS A 1 270 ? 6.682   -29.113 74.262 1.00 34.02 ? 927  LYS A C     1 
ATOM   1829 O  O     . LYS A 1 270 ? 7.755   -28.833 74.801 1.00 34.02 ? 927  LYS A O     1 
ATOM   1830 C  CB    . LYS A 1 270 ? 5.371   -30.758 75.664 1.00 34.13 ? 927  LYS A CB    1 
ATOM   1831 C  CG    . LYS A 1 270 ? 4.242   -30.983 76.665 1.00 34.08 ? 927  LYS A CG    1 
ATOM   1832 C  CD    . LYS A 1 270 ? 4.258   -32.384 77.247 1.00 34.02 ? 927  LYS A CD    1 
ATOM   1833 C  CE    . LYS A 1 270 ? 3.147   -32.549 78.274 1.00 33.97 ? 927  LYS A CE    1 
ATOM   1834 N  NZ    . LYS A 1 270 ? 3.330   -33.770 79.108 1.00 33.97 ? 927  LYS A NZ    1 
ATOM   1835 N  N     . CYS A 1 271 ? 6.540   -29.232 72.941 1.00 33.85 ? 928  CYS A N     1 
ATOM   1836 C  CA    . CYS A 1 271 ? 7.640   -28.973 72.007 1.00 33.73 ? 928  CYS A CA    1 
ATOM   1837 C  C     . CYS A 1 271 ? 8.030   -27.499 71.963 1.00 33.66 ? 928  CYS A C     1 
ATOM   1838 O  O     . CYS A 1 271 ? 9.158   -27.162 71.594 1.00 33.64 ? 928  CYS A O     1 
ATOM   1839 C  CB    . CYS A 1 271 ? 7.281   -29.440 70.595 1.00 33.72 ? 928  CYS A CB    1 
ATOM   1840 S  SG    . CYS A 1 271 ? 7.087   -31.221 70.417 1.00 33.79 ? 928  CYS A SG    1 
ATOM   1841 N  N     . TRP A 1 272 ? 7.097   -26.627 72.336 1.00 33.55 ? 929  TRP A N     1 
ATOM   1842 C  CA    . TRP A 1 272 ? 7.317   -25.188 72.244 1.00 33.54 ? 929  TRP A CA    1 
ATOM   1843 C  C     . TRP A 1 272 ? 7.544   -24.516 73.596 1.00 33.57 ? 929  TRP A C     1 
ATOM   1844 O  O     . TRP A 1 272 ? 7.418   -23.293 73.723 1.00 33.55 ? 929  TRP A O     1 
ATOM   1845 C  CB    . TRP A 1 272 ? 6.169   -24.518 71.485 1.00 33.54 ? 929  TRP A CB    1 
ATOM   1846 C  CG    . TRP A 1 272 ? 5.911   -25.132 70.146 1.00 33.55 ? 929  TRP A CG    1 
ATOM   1847 C  CD1   . TRP A 1 272 ? 6.831   -25.397 69.174 1.00 33.61 ? 929  TRP A CD1   1 
ATOM   1848 C  CD2   . TRP A 1 272 ? 4.647   -25.555 69.626 1.00 33.58 ? 929  TRP A CD2   1 
ATOM   1849 N  NE1   . TRP A 1 272 ? 6.221   -25.963 68.083 1.00 33.61 ? 929  TRP A NE1   1 
ATOM   1850 C  CE2   . TRP A 1 272 ? 4.879   -26.069 68.332 1.00 33.52 ? 929  TRP A CE2   1 
ATOM   1851 C  CE3   . TRP A 1 272 ? 3.338   -25.549 70.127 1.00 33.68 ? 929  TRP A CE3   1 
ATOM   1852 C  CZ2   . TRP A 1 272 ? 3.851   -26.573 67.530 1.00 33.56 ? 929  TRP A CZ2   1 
ATOM   1853 C  CZ3   . TRP A 1 272 ? 2.315   -26.052 69.327 1.00 33.67 ? 929  TRP A CZ3   1 
ATOM   1854 C  CH2   . TRP A 1 272 ? 2.580   -26.555 68.042 1.00 33.53 ? 929  TRP A CH2   1 
ATOM   1855 N  N     . MET A 1 273 ? 7.885   -25.320 74.599 1.00 33.66 ? 930  MET A N     1 
ATOM   1856 C  CA    . MET A 1 273 ? 8.216   -24.807 75.923 1.00 33.75 ? 930  MET A CA    1 
ATOM   1857 C  C     . MET A 1 273 ? 9.552   -24.076 75.882 1.00 33.75 ? 930  MET A C     1 
ATOM   1858 O  O     . MET A 1 273 ? 10.531  -24.601 75.347 1.00 33.73 ? 930  MET A O     1 
ATOM   1859 C  CB    . MET A 1 273 ? 8.257   -25.944 76.947 1.00 33.79 ? 930  MET A CB    1 
ATOM   1860 C  CG    . MET A 1 273 ? 6.890   -26.519 77.299 1.00 34.00 ? 930  MET A CG    1 
ATOM   1861 S  SD    . MET A 1 273 ? 5.675   -25.258 77.751 1.00 34.55 ? 930  MET A SD    1 
ATOM   1862 C  CE    . MET A 1 273 ? 6.333   -24.659 79.308 1.00 34.39 ? 930  MET A CE    1 
ATOM   1863 N  N     . ILE A 1 274 ? 9.585   -22.866 76.440 1.00 33.77 ? 931  ILE A N     1 
ATOM   1864 C  CA    . ILE A 1 274 ? 10.788  -22.027 76.401 1.00 33.77 ? 931  ILE A CA    1 
ATOM   1865 C  C     . ILE A 1 274 ? 12.021  -22.774 76.922 1.00 33.77 ? 931  ILE A C     1 
ATOM   1866 O  O     . ILE A 1 274 ? 13.076  -22.739 76.286 1.00 33.79 ? 931  ILE A O     1 
ATOM   1867 C  CB    . ILE A 1 274 ? 10.586  -20.665 77.125 1.00 33.79 ? 931  ILE A CB    1 
ATOM   1868 C  CG1   . ILE A 1 274 ? 9.541   -19.822 76.384 1.00 33.85 ? 931  ILE A CG1   1 
ATOM   1869 C  CG2   . ILE A 1 274 ? 11.904  -19.887 77.216 1.00 33.81 ? 931  ILE A CG2   1 
ATOM   1870 C  CD1   . ILE A 1 274 ? 8.928   -18.702 77.217 1.00 34.06 ? 931  ILE A CD1   1 
ATOM   1871 N  N     . ASP A 1 275 ? 11.886  -23.459 78.058 1.00 33.75 ? 932  ASP A N     1 
ATOM   1872 C  CA    . ASP A 1 275 ? 12.971  -24.306 78.554 1.00 33.74 ? 932  ASP A CA    1 
ATOM   1873 C  C     . ASP A 1 275 ? 13.061  -25.590 77.731 1.00 33.74 ? 932  ASP A C     1 
ATOM   1874 O  O     . ASP A 1 275 ? 12.079  -26.318 77.576 1.00 33.73 ? 932  ASP A O     1 
ATOM   1875 C  CB    . ASP A 1 275 ? 12.813  -24.619 80.046 1.00 33.73 ? 932  ASP A CB    1 
ATOM   1876 C  CG    . ASP A 1 275 ? 14.065  -25.255 80.655 1.00 33.74 ? 932  ASP A CG    1 
ATOM   1877 O  OD1   . ASP A 1 275 ? 14.958  -25.714 79.906 1.00 33.75 ? 932  ASP A OD1   1 
ATOM   1878 O  OD2   . ASP A 1 275 ? 14.152  -25.297 81.899 1.00 33.65 ? 932  ASP A OD2   1 
ATOM   1879 N  N     . GLU A 1 276 ? 14.255  -25.844 77.204 1.00 33.75 ? 933  GLU A N     1 
ATOM   1880 C  CA    . GLU A 1 276 ? 14.515  -26.976 76.316 1.00 33.78 ? 933  GLU A CA    1 
ATOM   1881 C  C     . GLU A 1 276 ? 14.604  -28.285 77.089 1.00 33.80 ? 933  GLU A C     1 
ATOM   1882 O  O     . GLU A 1 276 ? 14.283  -29.352 76.562 1.00 33.77 ? 933  GLU A O     1 
ATOM   1883 C  CB    . GLU A 1 276 ? 15.819  -26.763 75.538 1.00 33.79 ? 933  GLU A CB    1 
ATOM   1884 C  CG    . GLU A 1 276 ? 15.993  -25.378 74.912 1.00 33.90 ? 933  GLU A CG    1 
ATOM   1885 C  CD    . GLU A 1 276 ? 16.725  -24.390 75.814 1.00 34.10 ? 933  GLU A CD    1 
ATOM   1886 O  OE1   . GLU A 1 276 ? 16.410  -24.309 77.022 1.00 34.26 ? 933  GLU A OE1   1 
ATOM   1887 O  OE2   . GLU A 1 276 ? 17.617  -23.682 75.303 1.00 34.10 ? 933  GLU A OE2   1 
ATOM   1888 N  N     . ASN A 1 277 ? 15.048  -28.194 78.339 1.00 33.88 ? 934  ASN A N     1 
ATOM   1889 C  CA    . ASN A 1 277 ? 15.234  -29.366 79.187 1.00 34.00 ? 934  ASN A CA    1 
ATOM   1890 C  C     . ASN A 1 277 ? 13.916  -29.930 79.725 1.00 34.04 ? 934  ASN A C     1 
ATOM   1891 O  O     . ASN A 1 277 ? 13.910  -30.903 80.484 1.00 34.06 ? 934  ASN A O     1 
ATOM   1892 C  CB    . ASN A 1 277 ? 16.207  -29.044 80.327 1.00 34.01 ? 934  ASN A CB    1 
ATOM   1893 C  CG    . ASN A 1 277 ? 17.567  -28.571 79.823 1.00 34.17 ? 934  ASN A CG    1 
ATOM   1894 O  OD1   . ASN A 1 277 ? 17.806  -28.475 78.616 1.00 34.18 ? 934  ASN A OD1   1 
ATOM   1895 N  ND2   . ASN A 1 277 ? 18.465  -28.273 80.754 1.00 34.28 ? 934  ASN A ND2   1 
ATOM   1896 N  N     . ILE A 1 278 ? 12.808  -29.309 79.323 1.00 34.09 ? 935  ILE A N     1 
ATOM   1897 C  CA    . ILE A 1 278 ? 11.464  -29.790 79.651 1.00 34.12 ? 935  ILE A CA    1 
ATOM   1898 C  C     . ILE A 1 278 ? 10.684  -30.171 78.388 1.00 34.15 ? 935  ILE A C     1 
ATOM   1899 O  O     . ILE A 1 278 ? 9.635   -30.816 78.467 1.00 34.18 ? 935  ILE A O     1 
ATOM   1900 C  CB    . ILE A 1 278 ? 10.662  -28.773 80.515 1.00 34.14 ? 935  ILE A CB    1 
ATOM   1901 C  CG1   . ILE A 1 278 ? 10.434  -27.458 79.757 1.00 34.14 ? 935  ILE A CG1   1 
ATOM   1902 C  CG2   . ILE A 1 278 ? 11.355  -28.553 81.867 1.00 34.09 ? 935  ILE A CG2   1 
ATOM   1903 C  CD1   . ILE A 1 278 ? 9.484   -26.488 80.443 1.00 34.21 ? 935  ILE A CD1   1 
ATOM   1904 N  N     . ARG A 1 279 ? 11.206  -29.762 77.230 1.00 34.18 ? 936  ARG A N     1 
ATOM   1905 C  CA    . ARG A 1 279 ? 10.699  -30.210 75.933 1.00 34.20 ? 936  ARG A CA    1 
ATOM   1906 C  C     . ARG A 1 279 ? 10.914  -31.718 75.808 1.00 34.42 ? 936  ARG A C     1 
ATOM   1907 O  O     . ARG A 1 279 ? 11.925  -32.236 76.291 1.00 34.42 ? 936  ARG A O     1 
ATOM   1908 C  CB    . ARG A 1 279 ? 11.426  -29.499 74.789 1.00 34.08 ? 936  ARG A CB    1 
ATOM   1909 C  CG    . ARG A 1 279 ? 11.157  -28.008 74.667 1.00 33.58 ? 936  ARG A CG    1 
ATOM   1910 C  CD    . ARG A 1 279 ? 11.945  -27.433 73.502 1.00 32.71 ? 936  ARG A CD    1 
ATOM   1911 N  NE    . ARG A 1 279 ? 12.065  -25.979 73.566 1.00 31.93 ? 936  ARG A NE    1 
ATOM   1912 C  CZ    . ARG A 1 279 ? 13.004  -25.274 72.940 1.00 31.43 ? 936  ARG A CZ    1 
ATOM   1913 N  NH1   . ARG A 1 279 ? 13.921  -25.883 72.197 1.00 31.33 ? 936  ARG A NH1   1 
ATOM   1914 N  NH2   . ARG A 1 279 ? 13.031  -23.954 73.061 1.00 31.15 ? 936  ARG A NH2   1 
ATOM   1915 N  N     . PRO A 1 280 ? 9.972   -32.428 75.158 1.00 34.66 ? 937  PRO A N     1 
ATOM   1916 C  CA    . PRO A 1 280 ? 10.087  -33.880 75.090 1.00 34.90 ? 937  PRO A CA    1 
ATOM   1917 C  C     . PRO A 1 280 ? 11.211  -34.332 74.167 1.00 35.22 ? 937  PRO A C     1 
ATOM   1918 O  O     . PRO A 1 280 ? 11.566  -33.631 73.220 1.00 35.23 ? 937  PRO A O     1 
ATOM   1919 C  CB    . PRO A 1 280 ? 8.732   -34.310 74.526 1.00 34.85 ? 937  PRO A CB    1 
ATOM   1920 C  CG    . PRO A 1 280 ? 8.288   -33.159 73.710 1.00 34.75 ? 937  PRO A CG    1 
ATOM   1921 C  CD    . PRO A 1 280 ? 8.809   -31.933 74.397 1.00 34.67 ? 937  PRO A CD    1 
ATOM   1922 N  N     . THR A 1 281 ? 11.771  -35.496 74.467 1.00 35.66 ? 938  THR A N     1 
ATOM   1923 C  CA    . THR A 1 281 ? 12.754  -36.122 73.601 1.00 36.14 ? 938  THR A CA    1 
ATOM   1924 C  C     . THR A 1 281 ? 12.010  -36.822 72.466 1.00 36.51 ? 938  THR A C     1 
ATOM   1925 O  O     . THR A 1 281 ? 10.810  -37.085 72.579 1.00 36.56 ? 938  THR A O     1 
ATOM   1926 C  CB    . THR A 1 281 ? 13.597  -37.154 74.375 1.00 36.10 ? 938  THR A CB    1 
ATOM   1927 O  OG1   . THR A 1 281 ? 12.741  -38.182 74.890 1.00 36.12 ? 938  THR A OG1   1 
ATOM   1928 C  CG2   . THR A 1 281 ? 14.344  -36.491 75.533 1.00 36.04 ? 938  THR A CG2   1 
ATOM   1929 N  N     . PHE A 1 282 ? 12.715  -37.120 71.378 1.00 37.03 ? 939  PHE A N     1 
ATOM   1930 C  CA    . PHE A 1 282 ? 12.124  -37.867 70.267 1.00 37.52 ? 939  PHE A CA    1 
ATOM   1931 C  C     . PHE A 1 282 ? 11.747  -39.291 70.675 1.00 37.90 ? 939  PHE A C     1 
ATOM   1932 O  O     . PHE A 1 282 ? 10.857  -39.895 70.072 1.00 37.94 ? 939  PHE A O     1 
ATOM   1933 C  CB    . PHE A 1 282 ? 13.053  -37.879 69.048 1.00 37.51 ? 939  PHE A CB    1 
ATOM   1934 C  CG    . PHE A 1 282 ? 13.153  -36.551 68.351 1.00 37.59 ? 939  PHE A CG    1 
ATOM   1935 C  CD1   . PHE A 1 282 ? 14.335  -35.818 68.392 1.00 37.59 ? 939  PHE A CD1   1 
ATOM   1936 C  CD2   . PHE A 1 282 ? 12.061  -36.025 67.661 1.00 37.57 ? 939  PHE A CD2   1 
ATOM   1937 C  CE1   . PHE A 1 282 ? 14.432  -34.586 67.750 1.00 37.60 ? 939  PHE A CE1   1 
ATOM   1938 C  CE2   . PHE A 1 282 ? 12.146  -34.792 67.019 1.00 37.52 ? 939  PHE A CE2   1 
ATOM   1939 C  CZ    . PHE A 1 282 ? 13.333  -34.071 67.064 1.00 37.62 ? 939  PHE A CZ    1 
ATOM   1940 N  N     . LYS A 1 283 ? 12.431  -39.818 71.693 1.00 38.40 ? 940  LYS A N     1 
ATOM   1941 C  CA    . LYS A 1 283 ? 12.074  -41.099 72.305 1.00 38.92 ? 940  LYS A CA    1 
ATOM   1942 C  C     . LYS A 1 283 ? 10.615  -41.068 72.749 1.00 39.19 ? 940  LYS A C     1 
ATOM   1943 O  O     . LYS A 1 283 ? 9.798   -41.871 72.292 1.00 39.24 ? 940  LYS A O     1 
ATOM   1944 C  CB    . LYS A 1 283 ? 12.959  -41.394 73.524 1.00 38.96 ? 940  LYS A CB    1 
ATOM   1945 C  CG    . LYS A 1 283 ? 14.414  -41.724 73.221 1.00 39.26 ? 940  LYS A CG    1 
ATOM   1946 C  CD    . LYS A 1 283 ? 15.168  -42.119 74.491 1.00 39.53 ? 940  LYS A CD    1 
ATOM   1947 C  CE    . LYS A 1 283 ? 16.595  -42.563 74.185 1.00 39.72 ? 940  LYS A CE    1 
ATOM   1948 N  NZ    . LYS A 1 283 ? 17.308  -43.065 75.394 1.00 39.71 ? 940  LYS A NZ    1 
ATOM   1949 N  N     . GLU A 1 284 ? 10.306  -40.120 73.631 1.00 39.53 ? 941  GLU A N     1 
ATOM   1950 C  CA    . GLU A 1 284 ? 8.980   -39.982 74.230 1.00 39.84 ? 941  GLU A CA    1 
ATOM   1951 C  C     . GLU A 1 284 ? 7.916   -39.639 73.197 1.00 39.93 ? 941  GLU A C     1 
ATOM   1952 O  O     . GLU A 1 284 ? 6.764   -40.058 73.321 1.00 39.97 ? 941  GLU A O     1 
ATOM   1953 C  CB    . GLU A 1 284 ? 9.002   -38.911 75.321 1.00 39.88 ? 941  GLU A CB    1 
ATOM   1954 C  CG    . GLU A 1 284 ? 9.945   -39.217 76.477 1.00 40.20 ? 941  GLU A CG    1 
ATOM   1955 C  CD    . GLU A 1 284 ? 10.345  -37.978 77.259 1.00 40.59 ? 941  GLU A CD    1 
ATOM   1956 O  OE1   . GLU A 1 284 ? 10.509  -36.901 76.644 1.00 40.77 ? 941  GLU A OE1   1 
ATOM   1957 O  OE2   . GLU A 1 284 ? 10.506  -38.084 78.493 1.00 40.65 ? 941  GLU A OE2   1 
ATOM   1958 N  N     . LEU A 1 285 ? 8.310   -38.869 72.185 1.00 40.06 ? 942  LEU A N     1 
ATOM   1959 C  CA    . LEU A 1 285 ? 7.405   -38.469 71.111 1.00 40.21 ? 942  LEU A CA    1 
ATOM   1960 C  C     . LEU A 1 285 ? 6.992   -39.662 70.256 1.00 40.34 ? 942  LEU A C     1 
ATOM   1961 O  O     . LEU A 1 285 ? 5.853   -39.734 69.789 1.00 40.37 ? 942  LEU A O     1 
ATOM   1962 C  CB    . LEU A 1 285 ? 8.041   -37.382 70.241 1.00 40.18 ? 942  LEU A CB    1 
ATOM   1963 C  CG    . LEU A 1 285 ? 8.192   -35.991 70.867 1.00 40.14 ? 942  LEU A CG    1 
ATOM   1964 C  CD1   . LEU A 1 285 ? 9.083   -35.111 70.005 1.00 40.14 ? 942  LEU A CD1   1 
ATOM   1965 C  CD2   . LEU A 1 285 ? 6.837   -35.327 71.088 1.00 40.15 ? 942  LEU A CD2   1 
ATOM   1966 N  N     . ALA A 1 286 ? 7.924   -40.592 70.060 1.00 40.49 ? 943  ALA A N     1 
ATOM   1967 C  CA    . ALA A 1 286 ? 7.641   -41.847 69.373 1.00 40.62 ? 943  ALA A CA    1 
ATOM   1968 C  C     . ALA A 1 286 ? 6.706   -42.717 70.208 1.00 40.74 ? 943  ALA A C     1 
ATOM   1969 O  O     . ALA A 1 286 ? 5.923   -43.493 69.661 1.00 40.73 ? 943  ALA A O     1 
ATOM   1970 C  CB    . ALA A 1 286 ? 8.932   -42.591 69.070 1.00 40.62 ? 943  ALA A CB    1 
ATOM   1971 N  N     . ASN A 1 287 ? 6.793   -42.573 71.530 1.00 40.93 ? 944  ASN A N     1 
ATOM   1972 C  CA    . ASN A 1 287 ? 5.945   -43.318 72.461 1.00 41.13 ? 944  ASN A CA    1 
ATOM   1973 C  C     . ASN A 1 287 ? 4.500   -42.827 72.464 1.00 41.16 ? 944  ASN A C     1 
ATOM   1974 O  O     . ASN A 1 287 ? 3.573   -43.622 72.309 1.00 41.17 ? 944  ASN A O     1 
ATOM   1975 C  CB    . ASN A 1 287 ? 6.501   -43.261 73.892 1.00 41.18 ? 944  ASN A CB    1 
ATOM   1976 C  CG    . ASN A 1 287 ? 7.932   -43.771 74.002 1.00 41.36 ? 944  ASN A CG    1 
ATOM   1977 O  OD1   . ASN A 1 287 ? 8.671   -43.366 74.900 1.00 41.50 ? 944  ASN A OD1   1 
ATOM   1978 N  ND2   . ASN A 1 287 ? 8.328   -44.663 73.096 1.00 41.47 ? 944  ASN A ND2   1 
ATOM   1979 N  N     . GLU A 1 288 ? 4.320   -41.520 72.644 1.00 41.20 ? 945  GLU A N     1 
ATOM   1980 C  CA    . GLU A 1 288 ? 2.989   -40.926 72.771 1.00 41.23 ? 945  GLU A CA    1 
ATOM   1981 C  C     . GLU A 1 288 ? 2.133   -41.141 71.525 1.00 41.22 ? 945  GLU A C     1 
ATOM   1982 O  O     . GLU A 1 288 ? 0.939   -41.421 71.630 1.00 41.23 ? 945  GLU A O     1 
ATOM   1983 C  CB    . GLU A 1 288 ? 3.091   -39.432 73.100 1.00 41.25 ? 945  GLU A CB    1 
ATOM   1984 C  CG    . GLU A 1 288 ? 1.765   -38.778 73.472 1.00 41.36 ? 945  GLU A CG    1 
ATOM   1985 C  CD    . GLU A 1 288 ? 1.264   -39.195 74.840 1.00 41.53 ? 945  GLU A CD    1 
ATOM   1986 O  OE1   . GLU A 1 288 ? 1.767   -38.656 75.849 1.00 41.64 ? 945  GLU A OE1   1 
ATOM   1987 O  OE2   . GLU A 1 288 ? 0.360   -40.054 74.905 1.00 41.53 ? 945  GLU A OE2   1 
ATOM   1988 N  N     . PHE A 1 289 ? 2.752   -41.018 70.354 1.00 41.23 ? 946  PHE A N     1 
ATOM   1989 C  CA    . PHE A 1 289 ? 2.041   -41.201 69.094 1.00 41.27 ? 946  PHE A CA    1 
ATOM   1990 C  C     . PHE A 1 289 ? 1.693   -42.659 68.808 1.00 41.32 ? 946  PHE A C     1 
ATOM   1991 O  O     . PHE A 1 289 ? 0.586   -42.949 68.348 1.00 41.32 ? 946  PHE A O     1 
ATOM   1992 C  CB    . PHE A 1 289 ? 2.825   -40.594 67.931 1.00 41.27 ? 946  PHE A CB    1 
ATOM   1993 C  CG    . PHE A 1 289 ? 2.547   -39.137 67.713 1.00 41.33 ? 946  PHE A CG    1 
ATOM   1994 C  CD1   . PHE A 1 289 ? 1.460   -38.732 66.945 1.00 41.36 ? 946  PHE A CD1   1 
ATOM   1995 C  CD2   . PHE A 1 289 ? 3.368   -38.167 68.276 1.00 41.39 ? 946  PHE A CD2   1 
ATOM   1996 C  CE1   . PHE A 1 289 ? 1.194   -37.381 66.740 1.00 41.39 ? 946  PHE A CE1   1 
ATOM   1997 C  CE2   . PHE A 1 289 ? 3.113   -36.815 68.076 1.00 41.41 ? 946  PHE A CE2   1 
ATOM   1998 C  CZ    . PHE A 1 289 ? 2.023   -36.421 67.307 1.00 41.43 ? 946  PHE A CZ    1 
ATOM   1999 N  N     . THR A 1 290 ? 2.628   -43.569 69.082 1.00 41.40 ? 947  THR A N     1 
ATOM   2000 C  CA    . THR A 1 290 ? 2.381   -44.999 68.881 1.00 41.52 ? 947  THR A CA    1 
ATOM   2001 C  C     . THR A 1 290 ? 1.310   -45.515 69.850 1.00 41.61 ? 947  THR A C     1 
ATOM   2002 O  O     . THR A 1 290 ? 0.561   -46.438 69.523 1.00 41.62 ? 947  THR A O     1 
ATOM   2003 C  CB    . THR A 1 290 ? 3.686   -45.851 68.953 1.00 41.50 ? 947  THR A CB    1 
ATOM   2004 O  OG1   . THR A 1 290 ? 3.496   -47.084 68.249 1.00 41.53 ? 947  THR A OG1   1 
ATOM   2005 C  CG2   . THR A 1 290 ? 4.104   -46.150 70.393 1.00 41.52 ? 947  THR A CG2   1 
ATOM   2006 N  N     . ARG A 1 291 ? 1.244   -44.894 71.028 1.00 41.74 ? 948  ARG A N     1 
ATOM   2007 C  CA    . ARG A 1 291 ? 0.244   -45.199 72.050 1.00 41.87 ? 948  ARG A CA    1 
ATOM   2008 C  C     . ARG A 1 291 ? -1.146  -44.787 71.576 1.00 41.91 ? 948  ARG A C     1 
ATOM   2009 O  O     . ARG A 1 291 ? -2.134  -45.476 71.838 1.00 41.93 ? 948  ARG A O     1 
ATOM   2010 C  CB    . ARG A 1 291 ? 0.595   -44.467 73.349 1.00 41.91 ? 948  ARG A CB    1 
ATOM   2011 C  CG    . ARG A 1 291 ? -0.135  -44.957 74.593 1.00 42.09 ? 948  ARG A CG    1 
ATOM   2012 C  CD    . ARG A 1 291 ? 0.355   -44.216 75.833 1.00 42.45 ? 948  ARG A CD    1 
ATOM   2013 N  NE    . ARG A 1 291 ? -0.100  -42.825 75.868 1.00 42.69 ? 948  ARG A NE    1 
ATOM   2014 C  CZ    . ARG A 1 291 ? -0.997  -42.344 76.726 1.00 42.78 ? 948  ARG A CZ    1 
ATOM   2015 N  NH1   . ARG A 1 291 ? -1.544  -43.132 77.644 1.00 42.80 ? 948  ARG A NH1   1 
ATOM   2016 N  NH2   . ARG A 1 291 ? -1.344  -41.065 76.673 1.00 42.80 ? 948  ARG A NH2   1 
ATOM   2017 N  N     . MET A 1 292 ? -1.205  -43.655 70.878 1.00 41.93 ? 949  MET A N     1 
ATOM   2018 C  CA    . MET A 1 292 ? -2.444  -43.143 70.310 1.00 41.95 ? 949  MET A CA    1 
ATOM   2019 C  C     . MET A 1 292 ? -2.844  -43.925 69.061 1.00 41.98 ? 949  MET A C     1 
ATOM   2020 O  O     . MET A 1 292 ? -4.032  -44.061 68.756 1.00 41.98 ? 949  MET A O     1 
ATOM   2021 C  CB    . MET A 1 292 ? -2.294  -41.655 69.982 1.00 41.94 ? 949  MET A CB    1 
ATOM   2022 C  CG    . MET A 1 292 ? -2.145  -40.765 71.209 1.00 41.94 ? 949  MET A CG    1 
ATOM   2023 S  SD    . MET A 1 292 ? -1.546  -39.112 70.817 1.00 41.97 ? 949  MET A SD    1 
ATOM   2024 C  CE    . MET A 1 292 ? -1.819  -38.276 72.378 1.00 41.93 ? 949  MET A CE    1 
ATOM   2025 N  N     . ALA A 1 293 ? -1.837  -44.441 68.355 1.00 42.02 ? 950  ALA A N     1 
ATOM   2026 C  CA    . ALA A 1 293 ? -2.025  -45.202 67.117 1.00 42.04 ? 950  ALA A CA    1 
ATOM   2027 C  C     . ALA A 1 293 ? -2.774  -46.519 67.325 1.00 42.06 ? 950  ALA A C     1 
ATOM   2028 O  O     . ALA A 1 293 ? -3.341  -47.070 66.379 1.00 42.06 ? 950  ALA A O     1 
ATOM   2029 C  CB    . ALA A 1 293 ? -0.680  -45.459 66.447 1.00 42.03 ? 950  ALA A CB    1 
ATOM   2030 N  N     . ARG A 1 294 ? -2.767  -47.015 68.561 1.00 42.10 ? 951  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 294 ? -3.460  -48.254 68.915 1.00 42.16 ? 951  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 294 ? -4.975  -48.104 68.749 1.00 42.07 ? 951  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 294 ? -5.629  -48.973 68.168 1.00 42.09 ? 951  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 294 ? -3.119  -48.682 70.349 1.00 42.24 ? 951  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 294 ? -1.638  -48.595 70.722 1.00 42.65 ? 951  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 294 ? -0.811  -49.738 70.141 1.00 43.41 ? 951  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 294 ? 0.605   -49.618 70.492 1.00 43.94 ? 951  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 294 ? 1.146   -50.059 71.627 1.00 44.29 ? 951  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 294 ? 2.444   -49.898 71.844 1.00 44.37 ? 951  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 294 ? 0.397   -50.659 72.546 1.00 44.36 ? 951  ARG A NH2   1 
ATOM   2041 N  N     . ASP A 1 295 ? -5.521  -47.004 69.265 1.00 41.95 ? 952  ASP A N     1 
ATOM   2042 C  CA    . ASP A 1 295 ? -6.923  -46.647 69.051 1.00 41.82 ? 952  ASP A CA    1 
ATOM   2043 C  C     . ASP A 1 295 ? -6.992  -45.281 68.359 1.00 41.71 ? 952  ASP A C     1 
ATOM   2044 O  O     . ASP A 1 295 ? -7.097  -44.248 69.027 1.00 41.72 ? 952  ASP A O     1 
ATOM   2045 C  CB    . ASP A 1 295 ? -7.694  -46.641 70.378 1.00 41.84 ? 952  ASP A CB    1 
ATOM   2046 C  CG    . ASP A 1 295 ? -9.191  -46.407 70.195 1.00 41.81 ? 952  ASP A CG    1 
ATOM   2047 O  OD1   . ASP A 1 295 ? -9.727  -46.688 69.101 1.00 41.81 ? 952  ASP A OD1   1 
ATOM   2048 O  OD2   . ASP A 1 295 ? -9.837  -45.948 71.161 1.00 41.76 ? 952  ASP A OD2   1 
ATOM   2049 N  N     . PRO A 1 296 ? -6.917  -45.277 67.012 1.00 41.58 ? 953  PRO A N     1 
ATOM   2050 C  CA    . PRO A 1 296 ? -6.818  -44.040 66.224 1.00 41.46 ? 953  PRO A CA    1 
ATOM   2051 C  C     . PRO A 1 296 ? -7.903  -42.963 66.444 1.00 41.32 ? 953  PRO A C     1 
ATOM   2052 O  O     . PRO A 1 296 ? -7.544  -41.818 66.726 1.00 41.32 ? 953  PRO A O     1 
ATOM   2053 C  CB    . PRO A 1 296 ? -6.806  -44.531 64.765 1.00 41.48 ? 953  PRO A CB    1 
ATOM   2054 C  CG    . PRO A 1 296 ? -7.138  -45.987 64.811 1.00 41.53 ? 953  PRO A CG    1 
ATOM   2055 C  CD    . PRO A 1 296 ? -6.762  -46.475 66.165 1.00 41.58 ? 953  PRO A CD    1 
ATOM   2056 N  N     . PRO A 1 297 ? -9.209  -43.311 66.331 1.00 41.19 ? 954  PRO A N     1 
ATOM   2057 C  CA    . PRO A 1 297 ? -10.195 -42.225 66.323 1.00 41.09 ? 954  PRO A CA    1 
ATOM   2058 C  C     . PRO A 1 297 ? -10.490 -41.620 67.701 1.00 40.98 ? 954  PRO A C     1 
ATOM   2059 O  O     . PRO A 1 297 ? -11.241 -40.646 67.792 1.00 40.96 ? 954  PRO A O     1 
ATOM   2060 C  CB    . PRO A 1 297 ? -11.460 -42.895 65.755 1.00 41.08 ? 954  PRO A CB    1 
ATOM   2061 C  CG    . PRO A 1 297 ? -11.090 -44.337 65.480 1.00 41.13 ? 954  PRO A CG    1 
ATOM   2062 C  CD    . PRO A 1 297 ? -9.883  -44.619 66.302 1.00 41.19 ? 954  PRO A CD    1 
ATOM   2063 N  N     . ARG A 1 298 ? -9.907  -42.192 68.756 1.00 40.88 ? 955  ARG A N     1 
ATOM   2064 C  CA    . ARG A 1 298 ? -10.035 -41.651 70.113 1.00 40.81 ? 955  ARG A CA    1 
ATOM   2065 C  C     . ARG A 1 298 ? -9.279  -40.330 70.255 1.00 40.73 ? 955  ARG A C     1 
ATOM   2066 O  O     . ARG A 1 298 ? -9.694  -39.444 71.009 1.00 40.73 ? 955  ARG A O     1 
ATOM   2067 C  CB    . ARG A 1 298 ? -9.522  -42.654 71.158 1.00 40.83 ? 955  ARG A CB    1 
ATOM   2068 C  CG    . ARG A 1 298 ? -9.537  -42.120 72.600 1.00 40.94 ? 955  ARG A CG    1 
ATOM   2069 C  CD    . ARG A 1 298 ? -8.688  -42.952 73.556 1.00 41.23 ? 955  ARG A CD    1 
ATOM   2070 N  NE    . ARG A 1 298 ? -8.244  -42.161 74.707 1.00 41.42 ? 955  ARG A NE    1 
ATOM   2071 C  CZ    . ARG A 1 298 ? -7.777  -42.669 75.847 1.00 41.52 ? 955  ARG A CZ    1 
ATOM   2072 N  NH1   . ARG A 1 298 ? -7.684  -43.985 76.016 1.00 41.55 ? 955  ARG A NH1   1 
ATOM   2073 N  NH2   . ARG A 1 298 ? -7.403  -41.856 76.826 1.00 41.53 ? 955  ARG A NH2   1 
ATOM   2074 N  N     . TYR A 1 299 ? -8.176  -40.205 69.522 1.00 40.65 ? 956  TYR A N     1 
ATOM   2075 C  CA    . TYR A 1 299 ? -7.280  -39.062 69.666 1.00 40.57 ? 956  TYR A CA    1 
ATOM   2076 C  C     . TYR A 1 299 ? -7.386  -38.039 68.525 1.00 40.49 ? 956  TYR A C     1 
ATOM   2077 O  O     . TYR A 1 299 ? -6.941  -36.901 68.673 1.00 40.47 ? 956  TYR A O     1 
ATOM   2078 C  CB    . TYR A 1 299 ? -5.838  -39.546 69.855 1.00 40.59 ? 956  TYR A CB    1 
ATOM   2079 C  CG    . TYR A 1 299 ? -5.635  -40.435 71.069 1.00 40.69 ? 956  TYR A CG    1 
ATOM   2080 C  CD1   . TYR A 1 299 ? -5.666  -41.825 70.953 1.00 40.76 ? 956  TYR A CD1   1 
ATOM   2081 C  CD2   . TYR A 1 299 ? -5.411  -39.885 72.336 1.00 40.76 ? 956  TYR A CD2   1 
ATOM   2082 C  CE1   . TYR A 1 299 ? -5.472  -42.647 72.061 1.00 40.81 ? 956  TYR A CE1   1 
ATOM   2083 C  CE2   . TYR A 1 299 ? -5.218  -40.699 73.453 1.00 40.81 ? 956  TYR A CE2   1 
ATOM   2084 C  CZ    . TYR A 1 299 ? -5.250  -42.080 73.307 1.00 40.85 ? 956  TYR A CZ    1 
ATOM   2085 O  OH    . TYR A 1 299 ? -5.062  -42.890 74.403 1.00 40.87 ? 956  TYR A OH    1 
ATOM   2086 N  N     . LEU A 1 300 ? -7.983  -38.443 67.403 1.00 40.43 ? 957  LEU A N     1 
ATOM   2087 C  CA    . LEU A 1 300 ? -8.249  -37.536 66.275 1.00 40.37 ? 957  LEU A CA    1 
ATOM   2088 C  C     . LEU A 1 300 ? -9.639  -37.778 65.678 1.00 40.33 ? 957  LEU A C     1 
ATOM   2089 O  O     . LEU A 1 300 ? -10.151 -38.898 65.729 1.00 40.36 ? 957  LEU A O     1 
ATOM   2090 C  CB    . LEU A 1 300 ? -7.181  -37.685 65.183 1.00 40.37 ? 957  LEU A CB    1 
ATOM   2091 C  CG    . LEU A 1 300 ? -5.700  -37.422 65.484 1.00 40.32 ? 957  LEU A CG    1 
ATOM   2092 C  CD1   . LEU A 1 300 ? -4.862  -37.813 64.282 1.00 40.33 ? 957  LEU A CD1   1 
ATOM   2093 C  CD2   . LEU A 1 300 ? -5.436  -35.972 65.860 1.00 40.24 ? 957  LEU A CD2   1 
ATOM   2094 N  N     . VAL A 1 301 ? -10.239 -36.733 65.107 1.00 40.26 ? 958  VAL A N     1 
ATOM   2095 C  CA    . VAL A 1 301 ? -11.597 -36.832 64.554 1.00 40.18 ? 958  VAL A CA    1 
ATOM   2096 C  C     . VAL A 1 301 ? -11.850 -35.873 63.377 1.00 40.17 ? 958  VAL A C     1 
ATOM   2097 O  O     . VAL A 1 301 ? -11.505 -34.692 63.443 1.00 40.14 ? 958  VAL A O     1 
ATOM   2098 C  CB    . VAL A 1 301 ? -12.692 -36.688 65.675 1.00 40.18 ? 958  VAL A CB    1 
ATOM   2099 C  CG1   . VAL A 1 301 ? -12.584 -35.346 66.407 1.00 40.13 ? 958  VAL A CG1   1 
ATOM   2100 C  CG2   . VAL A 1 301 ? -14.100 -36.908 65.122 1.00 40.14 ? 958  VAL A CG2   1 
ATOM   2101 N  N     . ILE A 1 302 ? -12.442 -36.409 62.307 1.00 40.19 ? 959  ILE A N     1 
ATOM   2102 C  CA    . ILE A 1 302 ? -12.866 -35.629 61.134 1.00 40.24 ? 959  ILE A CA    1 
ATOM   2103 C  C     . ILE A 1 302 ? -13.769 -34.441 61.504 1.00 40.24 ? 959  ILE A C     1 
ATOM   2104 O  O     . ILE A 1 302 ? -14.890 -34.623 62.031 1.00 40.23 ? 959  ILE A O     1 
ATOM   2105 C  CB    . ILE A 1 302 ? -13.552 -36.535 60.054 1.00 40.26 ? 959  ILE A CB    1 
ATOM   2106 C  CG1   . ILE A 1 302 ? -14.218 -35.685 58.959 1.00 40.28 ? 959  ILE A CG1   1 
ATOM   2107 C  CG2   . ILE A 1 302 ? -14.546 -37.515 60.701 1.00 40.27 ? 959  ILE A CG2   1 
ATOM   2108 C  CD1   . ILE A 1 302 ? -14.724 -36.473 57.753 1.00 40.28 ? 959  ILE A CD1   1 
ATOM   2109 N  N     . VAL B 1 23  ? 33.025  -8.479  20.825 1.00 34.48 ? 680  VAL B N     1 
ATOM   2110 C  CA    . VAL B 1 23  ? 32.677  -7.513  19.740 1.00 34.39 ? 680  VAL B CA    1 
ATOM   2111 C  C     . VAL B 1 23  ? 31.670  -6.426  20.175 1.00 34.33 ? 680  VAL B C     1 
ATOM   2112 O  O     . VAL B 1 23  ? 31.178  -5.683  19.321 1.00 34.29 ? 680  VAL B O     1 
ATOM   2113 C  CB    . VAL B 1 23  ? 32.114  -8.244  18.479 1.00 34.37 ? 680  VAL B CB    1 
ATOM   2114 C  CG1   . VAL B 1 23  ? 32.442  -7.460  17.207 1.00 34.33 ? 680  VAL B CG1   1 
ATOM   2115 C  CG2   . VAL B 1 23  ? 32.661  -9.657  18.373 1.00 34.32 ? 680  VAL B CG2   1 
ATOM   2116 N  N     . LEU B 1 24  ? 31.363  -6.282  21.472 1.00 34.20 ? 681  LEU B N     1 
ATOM   2117 C  CA    . LEU B 1 24  ? 32.007  -6.953  22.614 1.00 34.03 ? 681  LEU B CA    1 
ATOM   2118 C  C     . LEU B 1 24  ? 30.978  -7.419  23.656 1.00 33.90 ? 681  LEU B C     1 
ATOM   2119 O  O     . LEU B 1 24  ? 29.817  -7.008  23.603 1.00 34.00 ? 681  LEU B O     1 
ATOM   2120 C  CB    . LEU B 1 24  ? 33.007  -5.994  23.273 1.00 34.03 ? 681  LEU B CB    1 
ATOM   2121 C  CG    . LEU B 1 24  ? 32.596  -4.521  23.454 1.00 34.01 ? 681  LEU B CG    1 
ATOM   2122 C  CD1   . LEU B 1 24  ? 31.562  -4.314  24.566 1.00 33.96 ? 681  LEU B CD1   1 
ATOM   2123 C  CD2   . LEU B 1 24  ? 33.822  -3.659  23.714 1.00 34.04 ? 681  LEU B CD2   1 
ATOM   2124 N  N     . ALA B 1 25  ? 31.399  -8.260  24.604 1.00 33.64 ? 682  ALA B N     1 
ATOM   2125 C  CA    . ALA B 1 25  ? 30.508  -8.708  25.688 1.00 33.34 ? 682  ALA B CA    1 
ATOM   2126 C  C     . ALA B 1 25  ? 31.088  -8.487  27.088 1.00 33.18 ? 682  ALA B C     1 
ATOM   2127 O  O     . ALA B 1 25  ? 32.280  -8.721  27.320 1.00 33.16 ? 682  ALA B O     1 
ATOM   2128 C  CB    . ALA B 1 25  ? 30.115  -10.165 25.498 1.00 33.33 ? 682  ALA B CB    1 
ATOM   2129 N  N     . ARG B 1 26  ? 30.232  -8.052  28.015 1.00 32.91 ? 683  ARG B N     1 
ATOM   2130 C  CA    . ARG B 1 26  ? 30.630  -7.780  29.400 1.00 32.62 ? 683  ARG B CA    1 
ATOM   2131 C  C     . ARG B 1 26  ? 30.799  -9.050  30.226 1.00 32.33 ? 683  ARG B C     1 
ATOM   2132 O  O     . ARG B 1 26  ? 30.130  -10.055 29.979 1.00 32.26 ? 683  ARG B O     1 
ATOM   2133 C  CB    . ARG B 1 26  ? 29.626  -6.843  30.082 1.00 32.72 ? 683  ARG B CB    1 
ATOM   2134 C  CG    . ARG B 1 26  ? 29.928  -6.594  31.554 1.00 33.28 ? 683  ARG B CG    1 
ATOM   2135 C  CD    . ARG B 1 26  ? 29.060  -5.518  32.155 1.00 34.56 ? 683  ARG B CD    1 
ATOM   2136 N  NE    . ARG B 1 26  ? 29.486  -5.203  33.518 1.00 35.90 ? 683  ARG B NE    1 
ATOM   2137 C  CZ    . ARG B 1 26  ? 29.012  -4.197  34.250 1.00 36.65 ? 683  ARG B CZ    1 
ATOM   2138 N  NH1   . ARG B 1 26  ? 28.081  -3.383  33.766 1.00 37.05 ? 683  ARG B NH1   1 
ATOM   2139 N  NH2   . ARG B 1 26  ? 29.472  -4.005  35.479 1.00 36.83 ? 683  ARG B NH2   1 
ATOM   2140 N  N     . ILE B 1 27  ? 31.685  -8.993  31.219 1.00 32.06 ? 684  ILE B N     1 
ATOM   2141 C  CA    . ILE B 1 27  ? 31.904  -10.137 32.101 1.00 31.80 ? 684  ILE B CA    1 
ATOM   2142 C  C     . ILE B 1 27  ? 31.660  -9.846  33.586 1.00 31.71 ? 684  ILE B C     1 
ATOM   2143 O  O     . ILE B 1 27  ? 32.101  -8.825  34.115 1.00 31.64 ? 684  ILE B O     1 
ATOM   2144 C  CB    . ILE B 1 27  ? 33.267  -10.815 31.819 1.00 31.76 ? 684  ILE B CB    1 
ATOM   2145 C  CG1   . ILE B 1 27  ? 33.096  -11.785 30.651 1.00 31.65 ? 684  ILE B CG1   1 
ATOM   2146 C  CG2   . ILE B 1 27  ? 33.786  -11.577 33.036 1.00 31.72 ? 684  ILE B CG2   1 
ATOM   2147 C  CD1   . ILE B 1 27  ? 34.228  -11.776 29.678 1.00 31.70 ? 684  ILE B CD1   1 
ATOM   2148 N  N     . PHE B 1 28  ? 30.925  -10.754 34.226 1.00 31.70 ? 685  PHE B N     1 
ATOM   2149 C  CA    . PHE B 1 28  ? 30.519  -10.624 35.623 1.00 31.73 ? 685  PHE B CA    1 
ATOM   2150 C  C     . PHE B 1 28  ? 31.409  -11.427 36.563 1.00 31.72 ? 685  PHE B C     1 
ATOM   2151 O  O     . PHE B 1 28  ? 31.901  -12.498 36.203 1.00 31.75 ? 685  PHE B O     1 
ATOM   2152 C  CB    . PHE B 1 28  ? 29.074  -11.108 35.802 1.00 31.76 ? 685  PHE B CB    1 
ATOM   2153 C  CG    . PHE B 1 28  ? 28.030  -10.116 35.368 1.00 31.77 ? 685  PHE B CG    1 
ATOM   2154 C  CD1   . PHE B 1 28  ? 28.094  -8.788  35.774 1.00 31.92 ? 685  PHE B CD1   1 
ATOM   2155 C  CD2   . PHE B 1 28  ? 26.960  -10.520 34.579 1.00 31.74 ? 685  PHE B CD2   1 
ATOM   2156 C  CE1   . PHE B 1 28  ? 27.122  -7.872  35.381 1.00 31.95 ? 685  PHE B CE1   1 
ATOM   2157 C  CE2   . PHE B 1 28  ? 25.982  -9.611  34.184 1.00 31.78 ? 685  PHE B CE2   1 
ATOM   2158 C  CZ    . PHE B 1 28  ? 26.063  -8.286  34.586 1.00 31.77 ? 685  PHE B CZ    1 
ATOM   2159 N  N     . LYS B 1 29  ? 31.600  -10.907 37.772 1.00 31.67 ? 686  LYS B N     1 
ATOM   2160 C  CA    . LYS B 1 29  ? 32.256  -11.656 38.840 1.00 31.60 ? 686  LYS B CA    1 
ATOM   2161 C  C     . LYS B 1 29  ? 31.207  -12.513 39.549 1.00 31.42 ? 686  LYS B C     1 
ATOM   2162 O  O     . LYS B 1 29  ? 30.029  -12.143 39.592 1.00 31.43 ? 686  LYS B O     1 
ATOM   2163 C  CB    . LYS B 1 29  ? 32.934  -10.703 39.830 1.00 31.67 ? 686  LYS B CB    1 
ATOM   2164 C  CG    . LYS B 1 29  ? 33.929  -9.730  39.191 1.00 31.91 ? 686  LYS B CG    1 
ATOM   2165 C  CD    . LYS B 1 29  ? 34.445  -8.703  40.195 1.00 32.16 ? 686  LYS B CD    1 
ATOM   2166 C  CE    . LYS B 1 29  ? 35.144  -7.548  39.483 1.00 32.30 ? 686  LYS B CE    1 
ATOM   2167 N  NZ    . LYS B 1 29  ? 35.853  -6.642  40.447 1.00 32.39 ? 686  LYS B NZ    1 
ATOM   2168 N  N     . GLU B 1 30  ? 31.630  -13.656 40.092 1.00 31.09 ? 687  GLU B N     1 
ATOM   2169 C  CA    . GLU B 1 30  ? 30.733  -14.534 40.850 1.00 30.79 ? 687  GLU B CA    1 
ATOM   2170 C  C     . GLU B 1 30  ? 30.043  -13.733 41.955 1.00 30.26 ? 687  GLU B C     1 
ATOM   2171 O  O     . GLU B 1 30  ? 28.847  -13.898 42.209 1.00 30.25 ? 687  GLU B O     1 
ATOM   2172 C  CB    . GLU B 1 30  ? 31.500  -15.709 41.474 1.00 30.94 ? 687  GLU B CB    1 
ATOM   2173 C  CG    . GLU B 1 30  ? 32.420  -16.492 40.526 1.00 31.74 ? 687  GLU B CG    1 
ATOM   2174 C  CD    . GLU B 1 30  ? 31.739  -17.664 39.823 1.00 32.78 ? 687  GLU B CD    1 
ATOM   2175 O  OE1   . GLU B 1 30  ? 30.580  -17.998 40.160 1.00 33.33 ? 687  GLU B OE1   1 
ATOM   2176 O  OE2   . GLU B 1 30  ? 32.376  -18.260 38.927 1.00 33.01 ? 687  GLU B OE2   1 
ATOM   2177 N  N     . THR B 1 31  ? 30.817  -12.852 42.587 1.00 29.57 ? 688  THR B N     1 
ATOM   2178 C  CA    . THR B 1 31  ? 30.386  -12.078 43.753 1.00 28.84 ? 688  THR B CA    1 
ATOM   2179 C  C     . THR B 1 31  ? 29.365  -10.978 43.436 1.00 28.35 ? 688  THR B C     1 
ATOM   2180 O  O     . THR B 1 31  ? 28.756  -10.413 44.346 1.00 28.29 ? 688  THR B O     1 
ATOM   2181 C  CB    . THR B 1 31  ? 31.602  -11.466 44.501 1.00 28.85 ? 688  THR B CB    1 
ATOM   2182 O  OG1   . THR B 1 31  ? 32.410  -10.715 43.585 1.00 28.69 ? 688  THR B OG1   1 
ATOM   2183 C  CG2   . THR B 1 31  ? 32.450  -12.562 45.137 1.00 28.77 ? 688  THR B CG2   1 
ATOM   2184 N  N     . GLU B 1 32  ? 29.182  -10.680 42.153 1.00 27.71 ? 689  GLU B N     1 
ATOM   2185 C  CA    . GLU B 1 32  ? 28.205  -9.682  41.724 1.00 27.12 ? 689  GLU B CA    1 
ATOM   2186 C  C     . GLU B 1 32  ? 26.796  -10.271 41.639 1.00 26.58 ? 689  GLU B C     1 
ATOM   2187 O  O     . GLU B 1 32  ? 25.810  -9.558  41.818 1.00 26.49 ? 689  GLU B O     1 
ATOM   2188 C  CB    . GLU B 1 32  ? 28.607  -9.082  40.374 1.00 27.23 ? 689  GLU B CB    1 
ATOM   2189 C  CG    . GLU B 1 32  ? 29.796  -8.128  40.437 1.00 27.55 ? 689  GLU B CG    1 
ATOM   2190 C  CD    . GLU B 1 32  ? 30.284  -7.683  39.063 1.00 28.10 ? 689  GLU B CD    1 
ATOM   2191 O  OE1   . GLU B 1 32  ? 29.447  -7.371  38.189 1.00 28.28 ? 689  GLU B OE1   1 
ATOM   2192 O  OE2   . GLU B 1 32  ? 31.514  -7.626  38.861 1.00 28.41 ? 689  GLU B OE2   1 
ATOM   2193 N  N     . LEU B 1 33  ? 26.715  -11.573 41.376 1.00 25.93 ? 690  LEU B N     1 
ATOM   2194 C  CA    . LEU B 1 33  ? 25.439  -12.251 41.165 1.00 25.35 ? 690  LEU B CA    1 
ATOM   2195 C  C     . LEU B 1 33  ? 24.990  -13.062 42.368 1.00 24.96 ? 690  LEU B C     1 
ATOM   2196 O  O     . LEU B 1 33  ? 25.801  -13.705 43.035 1.00 24.97 ? 690  LEU B O     1 
ATOM   2197 C  CB    . LEU B 1 33  ? 25.523  -13.175 39.950 1.00 25.36 ? 690  LEU B CB    1 
ATOM   2198 C  CG    . LEU B 1 33  ? 25.815  -12.522 38.599 1.00 25.45 ? 690  LEU B CG    1 
ATOM   2199 C  CD1   . LEU B 1 33  ? 26.325  -13.560 37.611 1.00 25.59 ? 690  LEU B CD1   1 
ATOM   2200 C  CD2   . LEU B 1 33  ? 24.588  -11.791 38.059 1.00 25.48 ? 690  LEU B CD2   1 
ATOM   2201 N  N     . ARG B 1 34  ? 23.689  -13.033 42.630 1.00 24.48 ? 691  ARG B N     1 
ATOM   2202 C  CA    . ARG B 1 34  ? 23.091  -13.898 43.632 1.00 24.09 ? 691  ARG B CA    1 
ATOM   2203 C  C     . ARG B 1 34  ? 21.792  -14.496 43.101 1.00 23.66 ? 691  ARG B C     1 
ATOM   2204 O  O     . ARG B 1 34  ? 21.026  -13.824 42.410 1.00 23.52 ? 691  ARG B O     1 
ATOM   2205 C  CB    . ARG B 1 34  ? 22.832  -13.128 44.923 1.00 24.22 ? 691  ARG B CB    1 
ATOM   2206 C  CG    . ARG B 1 34  ? 22.647  -14.016 46.135 1.00 24.96 ? 691  ARG B CG    1 
ATOM   2207 C  CD    . ARG B 1 34  ? 22.170  -13.206 47.319 1.00 26.44 ? 691  ARG B CD    1 
ATOM   2208 N  NE    . ARG B 1 34  ? 22.575  -13.803 48.589 1.00 27.71 ? 691  ARG B NE    1 
ATOM   2209 C  CZ    . ARG B 1 34  ? 23.766  -13.629 49.160 1.00 28.30 ? 691  ARG B CZ    1 
ATOM   2210 N  NH1   . ARG B 1 34  ? 24.694  -12.878 48.576 1.00 28.46 ? 691  ARG B NH1   1 
ATOM   2211 N  NH2   . ARG B 1 34  ? 24.033  -14.213 50.321 1.00 28.51 ? 691  ARG B NH2   1 
ATOM   2212 N  N     . LYS B 1 35  ? 21.560  -15.762 43.433 1.00 23.19 ? 692  LYS B N     1 
ATOM   2213 C  CA    . LYS B 1 35  ? 20.370  -16.484 42.998 1.00 22.68 ? 692  LYS B CA    1 
ATOM   2214 C  C     . LYS B 1 35  ? 19.346  -16.551 44.124 1.00 22.59 ? 692  LYS B C     1 
ATOM   2215 O  O     . LYS B 1 35  ? 19.676  -16.930 45.251 1.00 22.58 ? 692  LYS B O     1 
ATOM   2216 C  CB    . LYS B 1 35  ? 20.741  -17.897 42.544 1.00 22.57 ? 692  LYS B CB    1 
ATOM   2217 C  CG    . LYS B 1 35  ? 21.596  -17.949 41.289 1.00 22.04 ? 692  LYS B CG    1 
ATOM   2218 C  CD    . LYS B 1 35  ? 21.979  -19.382 40.955 1.00 21.46 ? 692  LYS B CD    1 
ATOM   2219 C  CE    . LYS B 1 35  ? 22.963  -19.438 39.798 1.00 21.35 ? 692  LYS B CE    1 
ATOM   2220 N  NZ    . LYS B 1 35  ? 24.273  -18.796 40.117 1.00 21.59 ? 692  LYS B NZ    1 
ATOM   2221 N  N     . LEU B 1 36  ? 18.103  -16.189 43.814 1.00 22.47 ? 693  LEU B N     1 
ATOM   2222 C  CA    . LEU B 1 36  ? 17.049  -16.118 44.826 1.00 22.36 ? 693  LEU B CA    1 
ATOM   2223 C  C     . LEU B 1 36  ? 16.060  -17.276 44.743 1.00 22.24 ? 693  LEU B C     1 
ATOM   2224 O  O     . LEU B 1 36  ? 15.800  -17.952 45.741 1.00 22.23 ? 693  LEU B O     1 
ATOM   2225 C  CB    . LEU B 1 36  ? 16.303  -14.780 44.741 1.00 22.41 ? 693  LEU B CB    1 
ATOM   2226 C  CG    . LEU B 1 36  ? 17.081  -13.470 44.911 1.00 22.60 ? 693  LEU B CG    1 
ATOM   2227 C  CD1   . LEU B 1 36  ? 16.130  -12.295 44.765 1.00 22.67 ? 693  LEU B CD1   1 
ATOM   2228 C  CD2   . LEU B 1 36  ? 17.811  -13.402 46.250 1.00 22.75 ? 693  LEU B CD2   1 
ATOM   2229 N  N     . LYS B 1 37  ? 15.515  -17.494 43.550 1.00 22.10 ? 694  LYS B N     1 
ATOM   2230 C  CA    . LYS B 1 37  ? 14.498  -18.513 43.323 1.00 21.97 ? 694  LYS B CA    1 
ATOM   2231 C  C     . LYS B 1 37  ? 14.689  -19.085 41.926 1.00 21.84 ? 694  LYS B C     1 
ATOM   2232 O  O     . LYS B 1 37  ? 14.972  -18.344 40.985 1.00 21.77 ? 694  LYS B O     1 
ATOM   2233 C  CB    . LYS B 1 37  ? 13.099  -17.891 43.456 1.00 22.04 ? 694  LYS B CB    1 
ATOM   2234 C  CG    . LYS B 1 37  ? 11.931  -18.874 43.349 1.00 21.95 ? 694  LYS B CG    1 
ATOM   2235 N  N     . VAL B 1 38  ? 14.546  -20.399 41.789 1.00 21.69 ? 695  VAL B N     1 
ATOM   2236 C  CA    . VAL B 1 38  ? 14.554  -21.006 40.465 1.00 21.59 ? 695  VAL B CA    1 
ATOM   2237 C  C     . VAL B 1 38  ? 13.189  -20.798 39.796 1.00 21.58 ? 695  VAL B C     1 
ATOM   2238 O  O     . VAL B 1 38  ? 12.145  -20.940 40.437 1.00 21.52 ? 695  VAL B O     1 
ATOM   2239 C  CB    . VAL B 1 38  ? 14.977  -22.499 40.497 1.00 21.58 ? 695  VAL B CB    1 
ATOM   2240 C  CG1   . VAL B 1 38  ? 13.847  -23.388 40.994 1.00 21.53 ? 695  VAL B CG1   1 
ATOM   2241 C  CG2   . VAL B 1 38  ? 15.434  -22.952 39.117 1.00 21.56 ? 695  VAL B CG2   1 
ATOM   2242 N  N     . LEU B 1 39  ? 13.212  -20.432 38.518 1.00 21.57 ? 696  LEU B N     1 
ATOM   2243 C  CA    . LEU B 1 39  ? 11.993  -20.226 37.746 1.00 21.57 ? 696  LEU B CA    1 
ATOM   2244 C  C     . LEU B 1 39  ? 11.605  -21.503 37.009 1.00 21.82 ? 696  LEU B C     1 
ATOM   2245 O  O     . LEU B 1 39  ? 10.439  -21.906 37.014 1.00 21.78 ? 696  LEU B O     1 
ATOM   2246 C  CB    . LEU B 1 39  ? 12.171  -19.074 36.752 1.00 21.41 ? 696  LEU B CB    1 
ATOM   2247 C  CG    . LEU B 1 39  ? 12.434  -17.668 37.301 1.00 21.08 ? 696  LEU B CG    1 
ATOM   2248 C  CD1   . LEU B 1 39  ? 12.731  -16.705 36.166 1.00 20.66 ? 696  LEU B CD1   1 
ATOM   2249 C  CD2   . LEU B 1 39  ? 11.271  -17.157 38.140 1.00 20.95 ? 696  LEU B CD2   1 
ATOM   2250 N  N     . GLY B 1 40  ? 12.596  -22.132 36.382 1.00 22.12 ? 697  GLY B N     1 
ATOM   2251 C  CA    . GLY B 1 40  ? 12.406  -23.368 35.631 1.00 22.46 ? 697  GLY B CA    1 
ATOM   2252 C  C     . GLY B 1 40  ? 13.630  -23.709 34.804 1.00 22.74 ? 697  GLY B C     1 
ATOM   2253 O  O     . GLY B 1 40  ? 14.662  -23.038 34.903 1.00 22.82 ? 697  GLY B O     1 
ATOM   2254 N  N     . SER B 1 41  ? 13.521  -24.751 33.984 1.00 22.96 ? 698  SER B N     1 
ATOM   2255 C  CA    . SER B 1 41  ? 14.626  -25.166 33.118 1.00 23.14 ? 698  SER B CA    1 
ATOM   2256 C  C     . SER B 1 41  ? 14.107  -25.695 31.783 1.00 23.33 ? 698  SER B C     1 
ATOM   2257 O  O     . SER B 1 41  ? 12.955  -26.124 31.686 1.00 23.43 ? 698  SER B O     1 
ATOM   2258 C  CB    . SER B 1 41  ? 15.489  -26.224 33.813 1.00 23.06 ? 698  SER B CB    1 
ATOM   2259 O  OG    . SER B 1 41  ? 14.788  -27.446 33.966 1.00 22.99 ? 698  SER B OG    1 
ATOM   2260 N  N     . GLY B 1 42  ? 14.960  -25.659 30.761 1.00 23.54 ? 699  GLY B N     1 
ATOM   2261 C  CA    . GLY B 1 42  ? 14.609  -26.171 29.437 1.00 23.82 ? 699  GLY B CA    1 
ATOM   2262 C  C     . GLY B 1 42  ? 15.499  -27.321 29.007 1.00 24.03 ? 699  GLY B C     1 
ATOM   2263 O  O     . GLY B 1 42  ? 15.864  -28.167 29.827 1.00 23.97 ? 699  GLY B O     1 
ATOM   2264 N  N     . VAL B 1 43  ? 15.848  -27.353 27.721 1.00 24.25 ? 700  VAL B N     1 
ATOM   2265 C  CA    . VAL B 1 43  ? 16.732  -28.394 27.185 1.00 24.54 ? 700  VAL B CA    1 
ATOM   2266 C  C     . VAL B 1 43  ? 18.215  -28.095 27.396 1.00 24.70 ? 700  VAL B C     1 
ATOM   2267 O  O     . VAL B 1 43  ? 19.036  -29.015 27.427 1.00 24.77 ? 700  VAL B O     1 
ATOM   2268 C  CB    . VAL B 1 43  ? 16.491  -28.674 25.674 1.00 24.53 ? 700  VAL B CB    1 
ATOM   2269 C  CG1   . VAL B 1 43  ? 15.268  -29.561 25.478 1.00 24.70 ? 700  VAL B CG1   1 
ATOM   2270 C  CG2   . VAL B 1 43  ? 16.377  -27.372 24.873 1.00 24.52 ? 700  VAL B CG2   1 
ATOM   2271 N  N     . PHE B 1 44  ? 18.553  -26.815 27.545 1.00 24.81 ? 701  PHE B N     1 
ATOM   2272 C  CA    . PHE B 1 44  ? 19.953  -26.397 27.594 1.00 24.87 ? 701  PHE B CA    1 
ATOM   2273 C  C     . PHE B 1 44  ? 20.463  -25.962 28.961 1.00 24.86 ? 701  PHE B C     1 
ATOM   2274 O  O     . PHE B 1 44  ? 21.642  -26.158 29.271 1.00 24.99 ? 701  PHE B O     1 
ATOM   2275 C  CB    . PHE B 1 44  ? 20.221  -25.291 26.573 1.00 24.88 ? 701  PHE B CB    1 
ATOM   2276 C  CG    . PHE B 1 44  ? 20.035  -25.727 25.155 1.00 24.99 ? 701  PHE B CG    1 
ATOM   2277 C  CD1   . PHE B 1 44  ? 20.649  -26.886 24.686 1.00 25.05 ? 701  PHE B CD1   1 
ATOM   2278 C  CD2   . PHE B 1 44  ? 19.251  -24.982 24.283 1.00 25.11 ? 701  PHE B CD2   1 
ATOM   2279 C  CE1   . PHE B 1 44  ? 20.479  -27.301 23.374 1.00 25.13 ? 701  PHE B CE1   1 
ATOM   2280 C  CE2   . PHE B 1 44  ? 19.078  -25.389 22.966 1.00 25.21 ? 701  PHE B CE2   1 
ATOM   2281 C  CZ    . PHE B 1 44  ? 19.691  -26.552 22.512 1.00 25.20 ? 701  PHE B CZ    1 
ATOM   2282 N  N     . GLY B 1 45  ? 19.591  -25.368 29.770 1.00 24.73 ? 702  GLY B N     1 
ATOM   2283 C  CA    . GLY B 1 45  ? 20.025  -24.798 31.039 1.00 24.46 ? 702  GLY B CA    1 
ATOM   2284 C  C     . GLY B 1 45  ? 18.949  -24.632 32.089 1.00 24.24 ? 702  GLY B C     1 
ATOM   2285 O  O     . GLY B 1 45  ? 17.879  -25.234 31.998 1.00 24.23 ? 702  GLY B O     1 
ATOM   2286 N  N     . THR B 1 46  ? 19.251  -23.805 33.087 1.00 24.00 ? 703  THR B N     1 
ATOM   2287 C  CA    . THR B 1 46  ? 18.365  -23.578 34.224 1.00 23.78 ? 703  THR B CA    1 
ATOM   2288 C  C     . THR B 1 46  ? 18.309  -22.091 34.541 1.00 23.76 ? 703  THR B C     1 
ATOM   2289 O  O     . THR B 1 46  ? 19.348  -21.445 34.689 1.00 23.82 ? 703  THR B O     1 
ATOM   2290 C  CB    . THR B 1 46  ? 18.854  -24.337 35.471 1.00 23.69 ? 703  THR B CB    1 
ATOM   2291 O  OG1   . THR B 1 46  ? 19.136  -25.697 35.126 1.00 23.61 ? 703  THR B OG1   1 
ATOM   2292 C  CG2   . THR B 1 46  ? 17.802  -24.311 36.565 1.00 23.51 ? 703  THR B CG2   1 
ATOM   2293 N  N     . VAL B 1 47  ? 17.098  -21.554 34.657 1.00 23.60 ? 704  VAL B N     1 
ATOM   2294 C  CA    . VAL B 1 47  ? 16.922  -20.118 34.859 1.00 23.44 ? 704  VAL B CA    1 
ATOM   2295 C  C     . VAL B 1 47  ? 16.482  -19.796 36.287 1.00 23.42 ? 704  VAL B C     1 
ATOM   2296 O  O     . VAL B 1 47  ? 15.475  -20.317 36.770 1.00 23.47 ? 704  VAL B O     1 
ATOM   2297 C  CB    . VAL B 1 47  ? 15.938  -19.518 33.824 1.00 23.44 ? 704  VAL B CB    1 
ATOM   2298 C  CG1   . VAL B 1 47  ? 15.763  -18.032 34.047 1.00 23.17 ? 704  VAL B CG1   1 
ATOM   2299 C  CG2   . VAL B 1 47  ? 16.437  -19.775 32.406 1.00 23.38 ? 704  VAL B CG2   1 
ATOM   2300 N  N     . HIS B 1 48  ? 17.251  -18.938 36.951 1.00 23.43 ? 705  HIS B N     1 
ATOM   2301 C  CA    . HIS B 1 48  ? 16.969  -18.535 38.323 1.00 23.53 ? 705  HIS B CA    1 
ATOM   2302 C  C     . HIS B 1 48  ? 16.655  -17.042 38.389 1.00 23.78 ? 705  HIS B C     1 
ATOM   2303 O  O     . HIS B 1 48  ? 17.358  -16.219 37.777 1.00 23.82 ? 705  HIS B O     1 
ATOM   2304 C  CB    . HIS B 1 48  ? 18.161  -18.847 39.242 1.00 23.39 ? 705  HIS B CB    1 
ATOM   2305 C  CG    . HIS B 1 48  ? 18.581  -20.286 39.237 1.00 23.12 ? 705  HIS B CG    1 
ATOM   2306 N  ND1   . HIS B 1 48  ? 18.189  -21.181 40.210 1.00 23.12 ? 705  HIS B ND1   1 
ATOM   2307 C  CD2   . HIS B 1 48  ? 19.374  -20.980 38.387 1.00 22.96 ? 705  HIS B CD2   1 
ATOM   2308 C  CE1   . HIS B 1 48  ? 18.712  -22.367 39.951 1.00 22.98 ? 705  HIS B CE1   1 
ATOM   2309 N  NE2   . HIS B 1 48  ? 19.436  -22.271 38.851 1.00 22.99 ? 705  HIS B NE2   1 
ATOM   2310 N  N     . LYS B 1 49  ? 15.588  -16.700 39.111 1.00 24.14 ? 706  LYS B N     1 
ATOM   2311 C  CA    . LYS B 1 49  ? 15.312  -15.314 39.470 1.00 24.62 ? 706  LYS B CA    1 
ATOM   2312 C  C     . LYS B 1 49  ? 16.392  -14.884 40.450 1.00 24.98 ? 706  LYS B C     1 
ATOM   2313 O  O     . LYS B 1 49  ? 16.575  -15.499 41.504 1.00 25.01 ? 706  LYS B O     1 
ATOM   2314 C  CB    . LYS B 1 49  ? 13.931  -15.187 40.117 1.00 24.64 ? 706  LYS B CB    1 
ATOM   2315 C  CG    . LYS B 1 49  ? 13.249  -13.836 39.915 1.00 24.83 ? 706  LYS B CG    1 
ATOM   2316 C  CD    . LYS B 1 49  ? 13.576  -12.822 41.007 1.00 25.04 ? 706  LYS B CD    1 
ATOM   2317 C  CE    . LYS B 1 49  ? 12.614  -11.642 40.943 1.00 25.18 ? 706  LYS B CE    1 
ATOM   2318 N  NZ    . LYS B 1 49  ? 13.079  -10.474 41.747 1.00 25.40 ? 706  LYS B NZ    1 
ATOM   2319 N  N     . GLY B 1 50  ? 17.122  -13.838 40.089 1.00 25.39 ? 707  GLY B N     1 
ATOM   2320 C  CA    . GLY B 1 50  ? 18.237  -13.401 40.903 1.00 25.96 ? 707  GLY B CA    1 
ATOM   2321 C  C     . GLY B 1 50  ? 18.332  -11.904 41.061 1.00 26.37 ? 707  GLY B C     1 
ATOM   2322 O  O     . GLY B 1 50  ? 17.421  -11.159 40.686 1.00 26.40 ? 707  GLY B O     1 
ATOM   2323 N  N     . VAL B 1 51  ? 19.447  -11.476 41.638 1.00 26.78 ? 708  VAL B N     1 
ATOM   2324 C  CA    . VAL B 1 51  ? 19.750  -10.070 41.817 1.00 27.24 ? 708  VAL B CA    1 
ATOM   2325 C  C     . VAL B 1 51  ? 21.223  -9.861  41.513 1.00 27.52 ? 708  VAL B C     1 
ATOM   2326 O  O     . VAL B 1 51  ? 22.068  -10.667 41.911 1.00 27.62 ? 708  VAL B O     1 
ATOM   2327 C  CB    . VAL B 1 51  ? 19.458  -9.606  43.261 1.00 27.23 ? 708  VAL B CB    1 
ATOM   2328 C  CG1   . VAL B 1 51  ? 20.126  -8.267  43.558 1.00 27.31 ? 708  VAL B CG1   1 
ATOM   2329 C  CG2   . VAL B 1 51  ? 17.958  -9.546  43.522 1.00 27.40 ? 708  VAL B CG2   1 
ATOM   2330 N  N     . TRP B 1 52  ? 21.527  -8.785  40.799 1.00 27.85 ? 709  TRP B N     1 
ATOM   2331 C  CA    . TRP B 1 52  ? 22.905  -8.392  40.584 1.00 28.20 ? 709  TRP B CA    1 
ATOM   2332 C  C     . TRP B 1 52  ? 23.262  -7.223  41.505 1.00 28.36 ? 709  TRP B C     1 
ATOM   2333 O  O     . TRP B 1 52  ? 22.590  -6.191  41.493 1.00 28.41 ? 709  TRP B O     1 
ATOM   2334 C  CB    . TRP B 1 52  ? 23.147  -8.065  39.105 1.00 28.26 ? 709  TRP B CB    1 
ATOM   2335 C  CG    . TRP B 1 52  ? 24.375  -7.251  38.845 1.00 28.76 ? 709  TRP B CG    1 
ATOM   2336 C  CD1   . TRP B 1 52  ? 25.557  -7.301  39.532 1.00 29.08 ? 709  TRP B CD1   1 
ATOM   2337 C  CD2   . TRP B 1 52  ? 24.554  -6.278  37.813 1.00 29.23 ? 709  TRP B CD2   1 
ATOM   2338 N  NE1   . TRP B 1 52  ? 26.451  -6.407  39.005 1.00 29.23 ? 709  TRP B NE1   1 
ATOM   2339 C  CE2   . TRP B 1 52  ? 25.864  -5.766  37.946 1.00 29.34 ? 709  TRP B CE2   1 
ATOM   2340 C  CE3   . TRP B 1 52  ? 23.734  -5.783  36.788 1.00 29.46 ? 709  TRP B CE3   1 
ATOM   2341 C  CZ2   . TRP B 1 52  ? 26.377  -4.784  37.093 1.00 29.57 ? 709  TRP B CZ2   1 
ATOM   2342 C  CZ3   . TRP B 1 52  ? 24.245  -4.804  35.938 1.00 29.61 ? 709  TRP B CZ3   1 
ATOM   2343 C  CH2   . TRP B 1 52  ? 25.556  -4.317  36.098 1.00 29.67 ? 709  TRP B CH2   1 
ATOM   2344 N  N     . ILE B 1 53  ? 24.308  -7.410  42.312 1.00 28.62 ? 710  ILE B N     1 
ATOM   2345 C  CA    . ILE B 1 53  ? 24.800  -6.378  43.233 1.00 28.89 ? 710  ILE B CA    1 
ATOM   2346 C  C     . ILE B 1 53  ? 26.227  -5.941  42.867 1.00 29.13 ? 710  ILE B C     1 
ATOM   2347 O  O     . ILE B 1 53  ? 27.206  -6.509  43.375 1.00 29.17 ? 710  ILE B O     1 
ATOM   2348 C  CB    . ILE B 1 53  ? 24.751  -6.837  44.723 1.00 28.84 ? 710  ILE B CB    1 
ATOM   2349 C  CG1   . ILE B 1 53  ? 23.355  -7.357  45.096 1.00 28.82 ? 710  ILE B CG1   1 
ATOM   2350 C  CG2   . ILE B 1 53  ? 25.153  -5.687  45.654 1.00 28.84 ? 710  ILE B CG2   1 
ATOM   2351 C  CD1   . ILE B 1 53  ? 23.308  -8.178  46.379 1.00 28.63 ? 710  ILE B CD1   1 
ATOM   2352 N  N     . PRO B 1 54  ? 26.351  -4.933  41.977 1.00 29.31 ? 711  PRO B N     1 
ATOM   2353 C  CA    . PRO B 1 54  ? 27.666  -4.429  41.577 1.00 29.36 ? 711  PRO B CA    1 
ATOM   2354 C  C     . PRO B 1 54  ? 28.441  -3.855  42.762 1.00 29.35 ? 711  PRO B C     1 
ATOM   2355 O  O     . PRO B 1 54  ? 28.585  -2.629  42.862 1.00 29.36 ? 711  PRO B O     1 
ATOM   2356 C  CB    . PRO B 1 54  ? 27.328  -3.325  40.563 1.00 29.40 ? 711  PRO B CB    1 
ATOM   2357 C  CG    . PRO B 1 54  ? 25.919  -2.947  40.854 1.00 29.41 ? 711  PRO B CG    1 
ATOM   2358 C  CD    . PRO B 1 54  ? 25.259  -4.209  41.301 1.00 29.33 ? 711  PRO B CD    1 
ATOM   2359 N  N     . GLY B 1 56  ? 32.186  -2.993  43.620 1.00 40.80 ? 713  GLY B N     1 
ATOM   2360 C  CA    . GLY B 1 56  ? 31.367  -1.783  43.671 1.00 40.82 ? 713  GLY B CA    1 
ATOM   2361 C  C     . GLY B 1 56  ? 30.672  -1.600  45.008 1.00 40.82 ? 713  GLY B C     1 
ATOM   2362 O  O     . GLY B 1 56  ? 31.254  -1.877  46.060 1.00 40.85 ? 713  GLY B O     1 
ATOM   2363 N  N     . GLU B 1 57  ? 29.427  -1.128  44.970 1.00 40.76 ? 714  GLU B N     1 
ATOM   2364 C  CA    . GLU B 1 57  ? 28.663  -0.884  46.195 1.00 40.67 ? 714  GLU B CA    1 
ATOM   2365 C  C     . GLU B 1 57  ? 27.329  -1.623  46.247 1.00 40.42 ? 714  GLU B C     1 
ATOM   2366 O  O     . GLU B 1 57  ? 27.002  -2.406  45.351 1.00 40.42 ? 714  GLU B O     1 
ATOM   2367 C  CB    . GLU B 1 57  ? 28.459  0.613   46.425 1.00 40.76 ? 714  GLU B CB    1 
ATOM   2368 C  CG    . GLU B 1 57  ? 29.742  1.360   46.765 1.00 41.12 ? 714  GLU B CG    1 
ATOM   2369 C  CD    . GLU B 1 57  ? 30.170  1.216   48.204 1.00 41.62 ? 714  GLU B CD    1 
ATOM   2370 O  OE1   . GLU B 1 57  ? 29.302  0.992   49.075 1.00 41.81 ? 714  GLU B OE1   1 
ATOM   2371 O  OE2   . GLU B 1 57  ? 31.384  1.336   48.468 1.00 41.73 ? 714  GLU B OE2   1 
ATOM   2372 N  N     . SER B 1 58  ? 26.570  -1.366  47.310 1.00 40.06 ? 715  SER B N     1 
ATOM   2373 C  CA    . SER B 1 58  ? 25.341  -2.097  47.594 1.00 39.67 ? 715  SER B CA    1 
ATOM   2374 C  C     . SER B 1 58  ? 24.118  -1.509  46.900 1.00 39.34 ? 715  SER B C     1 
ATOM   2375 O  O     . SER B 1 58  ? 23.693  -0.386  47.191 1.00 39.31 ? 715  SER B O     1 
ATOM   2376 C  CB    . SER B 1 58  ? 25.106  -2.184  49.104 1.00 39.72 ? 715  SER B CB    1 
ATOM   2377 O  OG    . SER B 1 58  ? 26.145  -2.910  49.735 1.00 39.79 ? 715  SER B OG    1 
ATOM   2378 N  N     . ILE B 1 59  ? 23.572  -2.294  45.973 1.00 38.87 ? 716  ILE B N     1 
ATOM   2379 C  CA    . ILE B 1 59  ? 22.324  -1.988  45.275 1.00 38.39 ? 716  ILE B CA    1 
ATOM   2380 C  C     . ILE B 1 59  ? 21.803  -3.257  44.600 1.00 37.96 ? 716  ILE B C     1 
ATOM   2381 O  O     . ILE B 1 59  ? 22.583  -4.094  44.139 1.00 37.91 ? 716  ILE B O     1 
ATOM   2382 C  CB    . ILE B 1 59  ? 22.479  -0.823  44.250 1.00 38.44 ? 716  ILE B CB    1 
ATOM   2383 C  CG1   . ILE B 1 59  ? 21.105  -0.310  43.799 1.00 38.49 ? 716  ILE B CG1   1 
ATOM   2384 C  CG2   . ILE B 1 59  ? 23.379  -1.220  43.070 1.00 38.41 ? 716  ILE B CG2   1 
ATOM   2385 C  CD1   . ILE B 1 59  ? 21.125  1.087   43.203 1.00 38.68 ? 716  ILE B CD1   1 
ATOM   2386 N  N     . LYS B 1 60  ? 20.484  -3.396  44.557 1.00 37.41 ? 717  LYS B N     1 
ATOM   2387 C  CA    . LYS B 1 60  ? 19.859  -4.579  43.991 1.00 36.85 ? 717  LYS B CA    1 
ATOM   2388 C  C     . LYS B 1 60  ? 19.242  -4.296  42.624 1.00 36.28 ? 717  LYS B C     1 
ATOM   2389 O  O     . LYS B 1 60  ? 18.341  -3.462  42.494 1.00 36.23 ? 717  LYS B O     1 
ATOM   2390 C  CB    . LYS B 1 60  ? 18.808  -5.127  44.959 1.00 36.97 ? 717  LYS B CB    1 
ATOM   2391 C  CG    . LYS B 1 60  ? 17.785  -6.068  44.331 1.00 37.33 ? 717  LYS B CG    1 
ATOM   2392 C  CD    . LYS B 1 60  ? 16.600  -6.305  45.250 1.00 38.01 ? 717  LYS B CD    1 
ATOM   2393 C  CE    . LYS B 1 60  ? 15.799  -5.019  45.449 1.00 38.30 ? 717  LYS B CE    1 
ATOM   2394 N  NZ    . LYS B 1 60  ? 14.680  -5.207  46.415 1.00 38.48 ? 717  LYS B NZ    1 
ATOM   2395 N  N     . ILE B 1 61  ? 19.746  -4.994  41.613 1.00 35.55 ? 718  ILE B N     1 
ATOM   2396 C  CA    . ILE B 1 61  ? 19.176  -4.949  40.276 1.00 34.87 ? 718  ILE B CA    1 
ATOM   2397 C  C     . ILE B 1 61  ? 18.576  -6.319  39.986 1.00 34.39 ? 718  ILE B C     1 
ATOM   2398 O  O     . ILE B 1 61  ? 19.288  -7.326  40.022 1.00 34.41 ? 718  ILE B O     1 
ATOM   2399 C  CB    . ILE B 1 61  ? 20.232  -4.597  39.203 1.00 34.86 ? 718  ILE B CB    1 
ATOM   2400 C  CG1   . ILE B 1 61  ? 20.885  -3.247  39.521 1.00 34.78 ? 718  ILE B CG1   1 
ATOM   2401 C  CG2   . ILE B 1 61  ? 19.601  -4.585  37.808 1.00 34.80 ? 718  ILE B CG2   1 
ATOM   2402 C  CD1   . ILE B 1 61  ? 22.090  -2.907  38.640 1.00 34.84 ? 718  ILE B CD1   1 
ATOM   2403 N  N     . PRO B 1 62  ? 17.264  -6.364  39.705 1.00 33.85 ? 719  PRO B N     1 
ATOM   2404 C  CA    . PRO B 1 62  ? 16.614  -7.642  39.454 1.00 33.43 ? 719  PRO B CA    1 
ATOM   2405 C  C     . PRO B 1 62  ? 17.050  -8.200  38.108 1.00 32.99 ? 719  PRO B C     1 
ATOM   2406 O  O     . PRO B 1 62  ? 16.785  -7.591  37.069 1.00 33.00 ? 719  PRO B O     1 
ATOM   2407 C  CB    . PRO B 1 62  ? 15.119  -7.287  39.434 1.00 33.44 ? 719  PRO B CB    1 
ATOM   2408 C  CG    . PRO B 1 62  ? 15.025  -5.867  39.914 1.00 33.66 ? 719  PRO B CG    1 
ATOM   2409 C  CD    . PRO B 1 62  ? 16.325  -5.240  39.566 1.00 33.83 ? 719  PRO B CD    1 
ATOM   2410 N  N     . VAL B 1 63  ? 17.733  -9.341  38.138 1.00 32.46 ? 720  VAL B N     1 
ATOM   2411 C  CA    . VAL B 1 63  ? 18.227  -9.980  36.919 1.00 31.98 ? 720  VAL B CA    1 
ATOM   2412 C  C     . VAL B 1 63  ? 17.812  -11.447 36.837 1.00 31.64 ? 720  VAL B C     1 
ATOM   2413 O  O     . VAL B 1 63  ? 17.429  -12.055 37.839 1.00 31.60 ? 720  VAL B O     1 
ATOM   2414 C  CB    . VAL B 1 63  ? 19.776  -9.862  36.772 1.00 32.03 ? 720  VAL B CB    1 
ATOM   2415 C  CG1   . VAL B 1 63  ? 20.207  -8.401  36.648 1.00 31.96 ? 720  VAL B CG1   1 
ATOM   2416 C  CG2   . VAL B 1 63  ? 20.501  -10.555 37.930 1.00 32.00 ? 720  VAL B CG2   1 
ATOM   2417 N  N     . CYS B 1 64  ? 17.896  -12.001 35.633 1.00 31.17 ? 721  CYS B N     1 
ATOM   2418 C  CA    . CYS B 1 64  ? 17.584  -13.399 35.386 1.00 30.78 ? 721  CYS B CA    1 
ATOM   2419 C  C     . CYS B 1 64  ? 18.882  -14.116 35.037 1.00 30.32 ? 721  CYS B C     1 
ATOM   2420 O  O     . CYS B 1 64  ? 19.636  -13.655 34.177 1.00 30.41 ? 721  CYS B O     1 
ATOM   2421 C  CB    . CYS B 1 64  ? 16.583  -13.505 34.234 1.00 30.90 ? 721  CYS B CB    1 
ATOM   2422 S  SG    . CYS B 1 64  ? 15.408  -14.870 34.361 1.00 31.33 ? 721  CYS B SG    1 
ATOM   2423 N  N     . ILE B 1 65  ? 19.149  -15.231 35.711 1.00 29.68 ? 722  ILE B N     1 
ATOM   2424 C  CA    . ILE B 1 65  ? 20.418  -15.944 35.552 1.00 29.05 ? 722  ILE B CA    1 
ATOM   2425 C  C     . ILE B 1 65  ? 20.180  -17.354 35.019 1.00 28.82 ? 722  ILE B C     1 
ATOM   2426 O  O     . ILE B 1 65  ? 19.462  -18.141 35.635 1.00 28.79 ? 722  ILE B O     1 
ATOM   2427 C  CB    . ILE B 1 65  ? 21.214  -15.992 36.888 1.00 29.01 ? 722  ILE B CB    1 
ATOM   2428 C  CG1   . ILE B 1 65  ? 21.491  -14.573 37.398 1.00 28.74 ? 722  ILE B CG1   1 
ATOM   2429 C  CG2   . ILE B 1 65  ? 22.524  -16.770 36.719 1.00 28.77 ? 722  ILE B CG2   1 
ATOM   2430 C  CD1   . ILE B 1 65  ? 21.736  -14.486 38.890 1.00 28.83 ? 722  ILE B CD1   1 
ATOM   2431 N  N     . LYS B 1 66  ? 20.785  -17.663 33.875 1.00 28.53 ? 723  LYS B N     1 
ATOM   2432 C  CA    . LYS B 1 66  ? 20.642  -18.975 33.247 1.00 28.37 ? 723  LYS B CA    1 
ATOM   2433 C  C     . LYS B 1 66  ? 21.926  -19.791 33.402 1.00 28.35 ? 723  LYS B C     1 
ATOM   2434 O  O     . LYS B 1 66  ? 22.997  -19.355 32.982 1.00 28.24 ? 723  LYS B O     1 
ATOM   2435 C  CB    . LYS B 1 66  ? 20.259  -18.825 31.766 1.00 28.36 ? 723  LYS B CB    1 
ATOM   2436 C  CG    . LYS B 1 66  ? 20.120  -20.146 31.018 1.00 28.34 ? 723  LYS B CG    1 
ATOM   2437 C  CD    . LYS B 1 66  ? 19.217  -20.023 29.802 1.00 28.56 ? 723  LYS B CD    1 
ATOM   2438 C  CE    . LYS B 1 66  ? 18.619  -21.381 29.445 1.00 28.60 ? 723  LYS B CE    1 
ATOM   2439 N  NZ    . LYS B 1 66  ? 17.707  -21.310 28.269 1.00 28.77 ? 723  LYS B NZ    1 
ATOM   2440 N  N     . VAL B 1 67  ? 21.810  -20.970 34.007 1.00 28.46 ? 724  VAL B N     1 
ATOM   2441 C  CA    . VAL B 1 67  ? 22.972  -21.822 34.263 1.00 28.66 ? 724  VAL B CA    1 
ATOM   2442 C  C     . VAL B 1 67  ? 23.079  -22.934 33.222 1.00 28.98 ? 724  VAL B C     1 
ATOM   2443 O  O     . VAL B 1 67  ? 22.181  -23.767 33.093 1.00 29.03 ? 724  VAL B O     1 
ATOM   2444 C  CB    . VAL B 1 67  ? 22.955  -22.414 35.696 1.00 28.58 ? 724  VAL B CB    1 
ATOM   2445 C  CG1   . VAL B 1 67  ? 24.152  -23.335 35.922 1.00 28.43 ? 724  VAL B CG1   1 
ATOM   2446 C  CG2   . VAL B 1 67  ? 22.951  -21.301 36.727 1.00 28.48 ? 724  VAL B CG2   1 
ATOM   2447 N  N     . ILE B 1 68  ? 24.195  -22.931 32.495 1.00 29.38 ? 725  ILE B N     1 
ATOM   2448 C  CA    . ILE B 1 68  ? 24.449  -23.876 31.409 1.00 29.82 ? 725  ILE B CA    1 
ATOM   2449 C  C     . ILE B 1 68  ? 25.693  -24.708 31.718 1.00 30.18 ? 725  ILE B C     1 
ATOM   2450 O  O     . ILE B 1 68  ? 26.751  -24.163 32.044 1.00 30.19 ? 725  ILE B O     1 
ATOM   2451 C  CB    . ILE B 1 68  ? 24.628  -23.140 30.052 1.00 29.76 ? 725  ILE B CB    1 
ATOM   2452 C  CG1   . ILE B 1 68  ? 23.404  -22.271 29.749 1.00 29.82 ? 725  ILE B CG1   1 
ATOM   2453 C  CG2   . ILE B 1 68  ? 24.852  -24.137 28.914 1.00 29.80 ? 725  ILE B CG2   1 
ATOM   2454 C  CD1   . ILE B 1 68  ? 23.639  -21.209 28.697 1.00 29.92 ? 725  ILE B CD1   1 
ATOM   2455 N  N     . GLU B 1 69  ? 25.552  -26.028 31.613 1.00 30.68 ? 726  GLU B N     1 
ATOM   2456 C  CA    . GLU B 1 69  ? 26.629  -26.965 31.927 1.00 31.24 ? 726  GLU B CA    1 
ATOM   2457 C  C     . GLU B 1 69  ? 26.865  -27.926 30.766 1.00 31.46 ? 726  GLU B C     1 
ATOM   2458 O  O     . GLU B 1 69  ? 25.942  -28.224 30.004 1.00 31.54 ? 726  GLU B O     1 
ATOM   2459 C  CB    . GLU B 1 69  ? 26.284  -27.770 33.183 1.00 31.29 ? 726  GLU B CB    1 
ATOM   2460 C  CG    . GLU B 1 69  ? 25.630  -26.961 34.301 1.00 32.00 ? 726  GLU B CG    1 
ATOM   2461 C  CD    . GLU B 1 69  ? 25.203  -27.810 35.487 1.00 32.96 ? 726  GLU B CD    1 
ATOM   2462 O  OE1   . GLU B 1 69  ? 24.821  -28.984 35.286 1.00 33.08 ? 726  GLU B OE1   1 
ATOM   2463 O  OE2   . GLU B 1 69  ? 25.240  -27.293 36.626 1.00 33.49 ? 726  GLU B OE2   1 
ATOM   2464 N  N     . ASP B 1 70  ? 28.099  -28.405 30.629 1.00 31.80 ? 727  ASP B N     1 
ATOM   2465 C  CA    . ASP B 1 70  ? 28.395  -29.494 29.705 1.00 32.12 ? 727  ASP B CA    1 
ATOM   2466 C  C     . ASP B 1 70  ? 27.949  -30.798 30.361 1.00 32.32 ? 727  ASP B C     1 
ATOM   2467 O  O     . ASP B 1 70  ? 28.577  -31.268 31.315 1.00 32.38 ? 727  ASP B O     1 
ATOM   2468 C  CB    . ASP B 1 70  ? 29.887  -29.526 29.359 1.00 32.15 ? 727  ASP B CB    1 
ATOM   2469 C  CG    . ASP B 1 70  ? 30.327  -30.853 28.759 1.00 32.36 ? 727  ASP B CG    1 
ATOM   2470 O  OD1   . ASP B 1 70  ? 29.723  -31.297 27.757 1.00 32.69 ? 727  ASP B OD1   1 
ATOM   2471 O  OD2   . ASP B 1 70  ? 31.282  -31.455 29.294 1.00 32.41 ? 727  ASP B OD2   1 
ATOM   2472 N  N     . LYS B 1 71  ? 26.864  -31.374 29.849 1.00 32.55 ? 728  LYS B N     1 
ATOM   2473 C  CA    . LYS B 1 71  ? 26.204  -32.520 30.490 1.00 32.72 ? 728  LYS B CA    1 
ATOM   2474 C  C     . LYS B 1 71  ? 27.013  -33.827 30.493 1.00 32.84 ? 728  LYS B C     1 
ATOM   2475 O  O     . LYS B 1 71  ? 26.586  -34.815 31.096 1.00 32.88 ? 728  LYS B O     1 
ATOM   2476 C  CB    . LYS B 1 71  ? 24.809  -32.747 29.890 1.00 32.68 ? 728  LYS B CB    1 
ATOM   2477 C  CG    . LYS B 1 71  ? 23.919  -31.513 29.932 1.00 32.82 ? 728  LYS B CG    1 
ATOM   2478 C  CD    . LYS B 1 71  ? 22.449  -31.871 30.055 1.00 32.91 ? 728  LYS B CD    1 
ATOM   2479 C  CE    . LYS B 1 71  ? 21.601  -30.614 30.188 1.00 32.92 ? 728  LYS B CE    1 
ATOM   2480 N  NZ    . LYS B 1 71  ? 20.283  -30.906 30.835 1.00 32.95 ? 728  LYS B NZ    1 
ATOM   2481 N  N     . SER B 1 72  ? 28.176  -33.826 29.842 1.00 32.95 ? 729  SER B N     1 
ATOM   2482 C  CA    . SER B 1 72  ? 29.010  -35.030 29.740 1.00 33.07 ? 729  SER B CA    1 
ATOM   2483 C  C     . SER B 1 72  ? 29.914  -35.263 30.957 1.00 33.07 ? 729  SER B C     1 
ATOM   2484 O  O     . SER B 1 72  ? 30.472  -34.325 31.527 1.00 33.07 ? 729  SER B O     1 
ATOM   2485 C  CB    . SER B 1 72  ? 29.833  -35.026 28.444 1.00 33.10 ? 729  SER B CB    1 
ATOM   2486 O  OG    . SER B 1 72  ? 30.533  -33.803 28.266 1.00 33.14 ? 729  SER B OG    1 
ATOM   2487 N  N     . GLN B 1 75  ? 33.877  -30.776 30.033 1.00 32.82 ? 732  GLN B N     1 
ATOM   2488 C  CA    . GLN B 1 75  ? 34.174  -29.440 29.500 1.00 32.84 ? 732  GLN B CA    1 
ATOM   2489 C  C     . GLN B 1 75  ? 33.687  -28.365 30.463 1.00 32.57 ? 732  GLN B C     1 
ATOM   2490 O  O     . GLN B 1 75  ? 32.492  -28.279 30.761 1.00 32.56 ? 732  GLN B O     1 
ATOM   2491 C  CB    . GLN B 1 75  ? 33.525  -29.227 28.120 1.00 33.00 ? 732  GLN B CB    1 
ATOM   2492 C  CG    . GLN B 1 75  ? 33.615  -30.412 27.157 1.00 33.53 ? 732  GLN B CG    1 
ATOM   2493 C  CD    . GLN B 1 75  ? 34.992  -31.045 27.121 1.00 34.18 ? 732  GLN B CD    1 
ATOM   2494 O  OE1   . GLN B 1 75  ? 35.973  -30.411 26.733 1.00 34.47 ? 732  GLN B OE1   1 
ATOM   2495 N  NE2   . GLN B 1 75  ? 35.070  -32.308 27.529 1.00 34.35 ? 732  GLN B NE2   1 
ATOM   2496 N  N     . SER B 1 76  ? 34.620  -27.558 30.956 1.00 32.15 ? 733  SER B N     1 
ATOM   2497 C  CA    . SER B 1 76  ? 34.286  -26.426 31.810 1.00 31.64 ? 733  SER B CA    1 
ATOM   2498 C  C     . SER B 1 76  ? 34.072  -25.201 30.937 1.00 31.19 ? 733  SER B C     1 
ATOM   2499 O  O     . SER B 1 76  ? 34.624  -25.109 29.837 1.00 31.14 ? 733  SER B O     1 
ATOM   2500 C  CB    . SER B 1 76  ? 35.405  -26.162 32.819 1.00 31.69 ? 733  SER B CB    1 
ATOM   2501 O  OG    . SER B 1 76  ? 36.546  -25.607 32.182 1.00 31.63 ? 733  SER B OG    1 
ATOM   2502 N  N     . PHE B 1 77  ? 33.277  -24.259 31.430 1.00 30.59 ? 734  PHE B N     1 
ATOM   2503 C  CA    . PHE B 1 77  ? 33.004  -23.044 30.678 1.00 30.01 ? 734  PHE B CA    1 
ATOM   2504 C  C     . PHE B 1 77  ? 34.007  -21.934 30.924 1.00 29.62 ? 734  PHE B C     1 
ATOM   2505 O  O     . PHE B 1 77  ? 33.880  -20.855 30.331 1.00 29.68 ? 734  PHE B O     1 
ATOM   2506 C  CB    . PHE B 1 77  ? 31.585  -22.552 30.937 1.00 30.04 ? 734  PHE B CB    1 
ATOM   2507 C  CG    . PHE B 1 77  ? 30.551  -23.299 30.161 1.00 29.95 ? 734  PHE B CG    1 
ATOM   2508 C  CD1   . PHE B 1 77  ? 30.176  -22.876 28.892 1.00 29.94 ? 734  PHE B CD1   1 
ATOM   2509 C  CD2   . PHE B 1 77  ? 29.967  -24.443 30.687 1.00 30.06 ? 734  PHE B CD2   1 
ATOM   2510 C  CE1   . PHE B 1 77  ? 29.217  -23.565 28.169 1.00 30.16 ? 734  PHE B CE1   1 
ATOM   2511 C  CE2   . PHE B 1 77  ? 29.014  -25.144 29.968 1.00 30.18 ? 734  PHE B CE2   1 
ATOM   2512 C  CZ    . PHE B 1 77  ? 28.636  -24.704 28.709 1.00 30.29 ? 734  PHE B CZ    1 
ATOM   2513 N  N     . GLN B 1 78  ? 34.988  -22.176 31.797 1.00 29.04 ? 735  GLN B N     1 
ATOM   2514 C  CA    . GLN B 1 78  ? 36.096  -21.239 31.960 1.00 28.45 ? 735  GLN B CA    1 
ATOM   2515 C  C     . GLN B 1 78  ? 36.526  -20.856 30.555 1.00 27.82 ? 735  GLN B C     1 
ATOM   2516 O  O     . GLN B 1 78  ? 36.541  -21.712 29.656 1.00 27.78 ? 735  GLN B O     1 
ATOM   2517 C  CB    . GLN B 1 78  ? 37.277  -21.888 32.689 1.00 28.61 ? 735  GLN B CB    1 
ATOM   2518 C  CG    . GLN B 1 78  ? 36.914  -22.751 33.898 1.00 29.08 ? 735  GLN B CG    1 
ATOM   2519 C  CD    . GLN B 1 78  ? 36.620  -21.951 35.159 1.00 29.65 ? 735  GLN B CD    1 
ATOM   2520 O  OE1   . GLN B 1 78  ? 36.435  -20.731 35.122 1.00 29.78 ? 735  GLN B OE1   1 
ATOM   2521 N  NE2   . GLN B 1 78  ? 36.572  -22.646 36.290 1.00 29.82 ? 735  GLN B NE2   1 
ATOM   2522 N  N     . ALA B 1 79  ? 36.868  -19.588 30.353 1.00 27.02 ? 736  ALA B N     1 
ATOM   2523 C  CA    . ALA B 1 79  ? 37.246  -19.103 29.025 1.00 26.33 ? 736  ALA B CA    1 
ATOM   2524 C  C     . ALA B 1 79  ? 36.059  -18.645 28.190 1.00 25.86 ? 736  ALA B C     1 
ATOM   2525 O  O     . ALA B 1 79  ? 35.025  -19.313 28.114 1.00 25.76 ? 736  ALA B O     1 
ATOM   2526 C  CB    . ALA B 1 79  ? 38.078  -20.142 28.252 1.00 26.36 ? 736  ALA B CB    1 
ATOM   2527 N  N     . VAL B 1 80  ? 36.245  -17.495 27.556 1.00 25.26 ? 737  VAL B N     1 
ATOM   2528 C  CA    . VAL B 1 80  ? 35.247  -16.892 26.698 1.00 24.63 ? 737  VAL B CA    1 
ATOM   2529 C  C     . VAL B 1 80  ? 35.555  -17.251 25.250 1.00 24.36 ? 737  VAL B C     1 
ATOM   2530 O  O     . VAL B 1 80  ? 36.708  -17.178 24.822 1.00 24.24 ? 737  VAL B O     1 
ATOM   2531 C  CB    . VAL B 1 80  ? 35.205  -15.356 26.905 1.00 24.61 ? 737  VAL B CB    1 
ATOM   2532 C  CG1   . VAL B 1 80  ? 34.426  -14.659 25.798 1.00 24.57 ? 737  VAL B CG1   1 
ATOM   2533 C  CG2   . VAL B 1 80  ? 34.607  -15.026 28.263 1.00 24.44 ? 737  VAL B CG2   1 
ATOM   2534 N  N     . THR B 1 81  ? 34.526  -17.665 24.513 1.00 24.09 ? 738  THR B N     1 
ATOM   2535 C  CA    . THR B 1 81  ? 34.661  -17.951 23.086 1.00 23.84 ? 738  THR B CA    1 
ATOM   2536 C  C     . THR B 1 81  ? 34.047  -16.820 22.267 1.00 23.65 ? 738  THR B C     1 
ATOM   2537 O  O     . THR B 1 81  ? 33.282  -16.008 22.792 1.00 23.61 ? 738  THR B O     1 
ATOM   2538 C  CB    . THR B 1 81  ? 34.015  -19.307 22.686 1.00 23.84 ? 738  THR B CB    1 
ATOM   2539 O  OG1   . THR B 1 81  ? 32.587  -19.193 22.694 1.00 23.99 ? 738  THR B OG1   1 
ATOM   2540 C  CG2   . THR B 1 81  ? 34.449  -20.427 23.631 1.00 23.76 ? 738  THR B CG2   1 
ATOM   2541 N  N     . ASP B 1 82  ? 34.397  -16.775 20.984 1.00 23.49 ? 739  ASP B N     1 
ATOM   2542 C  CA    . ASP B 1 82  ? 33.913  -15.754 20.050 1.00 23.41 ? 739  ASP B CA    1 
ATOM   2543 C  C     . ASP B 1 82  ? 32.401  -15.788 19.842 1.00 23.19 ? 739  ASP B C     1 
ATOM   2544 O  O     . ASP B 1 82  ? 31.796  -14.779 19.474 1.00 23.15 ? 739  ASP B O     1 
ATOM   2545 C  CB    . ASP B 1 82  ? 34.622  -15.900 18.703 1.00 23.53 ? 739  ASP B CB    1 
ATOM   2546 C  CG    . ASP B 1 82  ? 34.624  -17.337 18.188 1.00 24.00 ? 739  ASP B CG    1 
ATOM   2547 O  OD1   . ASP B 1 82  ? 33.959  -18.211 18.791 1.00 24.46 ? 739  ASP B OD1   1 
ATOM   2548 O  OD2   . ASP B 1 82  ? 35.297  -17.590 17.167 1.00 24.28 ? 739  ASP B OD2   1 
ATOM   2549 N  N     . HIS B 1 83  ? 31.800  -16.952 20.070 1.00 22.90 ? 740  HIS B N     1 
ATOM   2550 C  CA    . HIS B 1 83  ? 30.354  -17.079 19.988 1.00 22.66 ? 740  HIS B CA    1 
ATOM   2551 C  C     . HIS B 1 83  ? 29.655  -16.458 21.197 1.00 22.43 ? 740  HIS B C     1 
ATOM   2552 O  O     . HIS B 1 83  ? 28.508  -16.015 21.094 1.00 22.46 ? 740  HIS B O     1 
ATOM   2553 C  CB    . HIS B 1 83  ? 29.934  -18.539 19.812 1.00 22.73 ? 740  HIS B CB    1 
ATOM   2554 C  CG    . HIS B 1 83  ? 28.460  -18.715 19.622 1.00 22.87 ? 740  HIS B CG    1 
ATOM   2555 N  ND1   . HIS B 1 83  ? 27.784  -18.199 18.537 1.00 22.93 ? 740  HIS B ND1   1 
ATOM   2556 C  CD2   . HIS B 1 83  ? 27.531  -19.336 20.385 1.00 23.05 ? 740  HIS B CD2   1 
ATOM   2557 C  CE1   . HIS B 1 83  ? 26.502  -18.499 18.638 1.00 23.05 ? 740  HIS B CE1   1 
ATOM   2558 N  NE2   . HIS B 1 83  ? 26.322  -19.189 19.750 1.00 23.18 ? 740  HIS B NE2   1 
ATOM   2559 N  N     . MET B 1 84  ? 30.339  -16.428 22.337 1.00 22.10 ? 741  MET B N     1 
ATOM   2560 C  CA    . MET B 1 84  ? 29.781  -15.801 23.532 1.00 21.84 ? 741  MET B CA    1 
ATOM   2561 C  C     . MET B 1 84  ? 29.746  -14.291 23.343 1.00 21.59 ? 741  MET B C     1 
ATOM   2562 O  O     . MET B 1 84  ? 28.777  -13.634 23.729 1.00 21.59 ? 741  MET B O     1 
ATOM   2563 C  CB    . MET B 1 84  ? 30.570  -16.186 24.788 1.00 21.87 ? 741  MET B CB    1 
ATOM   2564 C  CG    . MET B 1 84  ? 30.989  -17.650 24.815 1.00 22.01 ? 741  MET B CG    1 
ATOM   2565 S  SD    . MET B 1 84  ? 31.131  -18.426 26.439 1.00 21.87 ? 741  MET B SD    1 
ATOM   2566 C  CE    . MET B 1 84  ? 32.259  -17.331 27.288 1.00 22.51 ? 741  MET B CE    1 
ATOM   2567 N  N     . LEU B 1 85  ? 30.799  -13.751 22.733 1.00 21.24 ? 742  LEU B N     1 
ATOM   2568 C  CA    . LEU B 1 85  ? 30.826  -12.341 22.371 1.00 20.92 ? 742  LEU B CA    1 
ATOM   2569 C  C     . LEU B 1 85  ? 29.770  -12.060 21.312 1.00 20.82 ? 742  LEU B C     1 
ATOM   2570 O  O     . LEU B 1 85  ? 29.096  -11.034 21.369 1.00 20.71 ? 742  LEU B O     1 
ATOM   2571 C  CB    . LEU B 1 85  ? 32.213  -11.912 21.877 1.00 20.84 ? 742  LEU B CB    1 
ATOM   2572 C  CG    . LEU B 1 85  ? 33.439  -12.043 22.788 1.00 20.48 ? 742  LEU B CG    1 
ATOM   2573 C  CD1   . LEU B 1 85  ? 34.586  -11.279 22.173 1.00 20.32 ? 742  LEU B CD1   1 
ATOM   2574 C  CD2   . LEU B 1 85  ? 33.186  -11.541 24.203 1.00 20.18 ? 742  LEU B CD2   1 
ATOM   2575 N  N     . ALA B 1 86  ? 29.620  -12.983 20.363 1.00 20.85 ? 743  ALA B N     1 
ATOM   2576 C  CA    . ALA B 1 86  ? 28.590  -12.875 19.325 1.00 20.94 ? 743  ALA B CA    1 
ATOM   2577 C  C     . ALA B 1 86  ? 27.194  -12.676 19.924 1.00 20.98 ? 743  ALA B C     1 
ATOM   2578 O  O     . ALA B 1 86  ? 26.467  -11.764 19.520 1.00 20.95 ? 743  ALA B O     1 
ATOM   2579 C  CB    . ALA B 1 86  ? 28.621  -14.091 18.400 1.00 20.86 ? 743  ALA B CB    1 
ATOM   2580 N  N     . ILE B 1 87  ? 26.830  -13.520 20.889 1.00 21.06 ? 744  ILE B N     1 
ATOM   2581 C  CA    . ILE B 1 87  ? 25.576  -13.355 21.620 1.00 21.12 ? 744  ILE B CA    1 
ATOM   2582 C  C     . ILE B 1 87  ? 25.560  -12.004 22.325 1.00 21.34 ? 744  ILE B C     1 
ATOM   2583 O  O     . ILE B 1 87  ? 24.672  -11.185 22.087 1.00 21.40 ? 744  ILE B O     1 
ATOM   2584 C  CB    . ILE B 1 87  ? 25.351  -14.482 22.654 1.00 21.06 ? 744  ILE B CB    1 
ATOM   2585 C  CG1   . ILE B 1 87  ? 25.083  -15.809 21.943 1.00 20.98 ? 744  ILE B CG1   1 
ATOM   2586 C  CG2   . ILE B 1 87  ? 24.192  -14.134 23.594 1.00 20.89 ? 744  ILE B CG2   1 
ATOM   2587 C  CD1   . ILE B 1 87  ? 24.903  -16.982 22.876 1.00 20.94 ? 744  ILE B CD1   1 
ATOM   2588 N  N     . GLY B 1 88  ? 26.566  -11.768 23.165 1.00 21.57 ? 745  GLY B N     1 
ATOM   2589 C  CA    . GLY B 1 88  ? 26.597  -10.602 24.039 1.00 21.79 ? 745  GLY B CA    1 
ATOM   2590 C  C     . GLY B 1 88  ? 26.846  -9.270  23.358 1.00 22.02 ? 745  GLY B C     1 
ATOM   2591 O  O     . GLY B 1 88  ? 27.196  -8.298  24.023 1.00 22.16 ? 745  GLY B O     1 
ATOM   2592 N  N     . SER B 1 89  ? 26.657  -9.215  22.041 1.00 22.20 ? 746  SER B N     1 
ATOM   2593 C  CA    . SER B 1 89  ? 26.884  -7.990  21.272 1.00 22.36 ? 746  SER B CA    1 
ATOM   2594 C  C     . SER B 1 89  ? 25.588  -7.370  20.776 1.00 22.39 ? 746  SER B C     1 
ATOM   2595 O  O     . SER B 1 89  ? 25.515  -6.161  20.537 1.00 22.41 ? 746  SER B O     1 
ATOM   2596 C  CB    . SER B 1 89  ? 27.773  -8.278  20.063 1.00 22.38 ? 746  SER B CB    1 
ATOM   2597 O  OG    . SER B 1 89  ? 29.057  -8.715  20.463 1.00 22.59 ? 746  SER B OG    1 
ATOM   2598 N  N     . LEU B 1 90  ? 24.573  -8.210  20.617 1.00 22.40 ? 747  LEU B N     1 
ATOM   2599 C  CA    . LEU B 1 90  ? 23.339  -7.823  19.948 1.00 22.35 ? 747  LEU B CA    1 
ATOM   2600 C  C     . LEU B 1 90  ? 22.451  -6.978  20.851 1.00 22.41 ? 747  LEU B C     1 
ATOM   2601 O  O     . LEU B 1 90  ? 22.500  -7.102  22.078 1.00 22.43 ? 747  LEU B O     1 
ATOM   2602 C  CB    . LEU B 1 90  ? 22.602  -9.073  19.463 1.00 22.27 ? 747  LEU B CB    1 
ATOM   2603 C  CG    . LEU B 1 90  ? 23.477  -10.084 18.707 1.00 22.04 ? 747  LEU B CG    1 
ATOM   2604 C  CD1   . LEU B 1 90  ? 22.906  -11.490 18.797 1.00 21.94 ? 747  LEU B CD1   1 
ATOM   2605 C  CD2   . LEU B 1 90  ? 23.679  -9.669  17.259 1.00 21.72 ? 747  LEU B CD2   1 
ATOM   2606 N  N     . ASP B 1 91  ? 21.644  -6.120  20.232 1.00 22.43 ? 748  ASP B N     1 
ATOM   2607 C  CA    . ASP B 1 91  ? 20.798  -5.180  20.955 1.00 22.46 ? 748  ASP B CA    1 
ATOM   2608 C  C     . ASP B 1 91  ? 19.746  -4.602  20.011 1.00 22.21 ? 748  ASP B C     1 
ATOM   2609 O  O     . ASP B 1 91  ? 20.081  -3.929  19.032 1.00 22.25 ? 748  ASP B O     1 
ATOM   2610 C  CB    . ASP B 1 91  ? 21.654  -4.060  21.562 1.00 22.63 ? 748  ASP B CB    1 
ATOM   2611 C  CG    . ASP B 1 91  ? 20.888  -3.201  22.554 1.00 23.27 ? 748  ASP B CG    1 
ATOM   2612 O  OD1   . ASP B 1 91  ? 20.023  -3.739  23.282 1.00 23.82 ? 748  ASP B OD1   1 
ATOM   2613 O  OD2   . ASP B 1 91  ? 21.160  -1.981  22.609 1.00 23.60 ? 748  ASP B OD2   1 
ATOM   2614 N  N     . HIS B 1 92  ? 18.477  -4.873  20.315 1.00 21.84 ? 749  HIS B N     1 
ATOM   2615 C  CA    . HIS B 1 92  ? 17.344  -4.466  19.478 1.00 21.39 ? 749  HIS B CA    1 
ATOM   2616 C  C     . HIS B 1 92  ? 16.073  -4.482  20.319 1.00 21.20 ? 749  HIS B C     1 
ATOM   2617 O  O     . HIS B 1 92  ? 15.913  -5.339  21.193 1.00 21.08 ? 749  HIS B O     1 
ATOM   2618 C  CB    . HIS B 1 92  ? 17.200  -5.417  18.285 1.00 21.35 ? 749  HIS B CB    1 
ATOM   2619 C  CG    . HIS B 1 92  ? 16.149  -5.009  17.295 1.00 21.15 ? 749  HIS B CG    1 
ATOM   2620 N  ND1   . HIS B 1 92  ? 14.859  -5.493  17.338 1.00 20.92 ? 749  HIS B ND1   1 
ATOM   2621 C  CD2   . HIS B 1 92  ? 16.202  -4.176  16.229 1.00 20.79 ? 749  HIS B CD2   1 
ATOM   2622 C  CE1   . HIS B 1 92  ? 14.162  -4.972  16.344 1.00 20.59 ? 749  HIS B CE1   1 
ATOM   2623 N  NE2   . HIS B 1 92  ? 14.953  -4.169  15.657 1.00 20.66 ? 749  HIS B NE2   1 
ATOM   2624 N  N     . ALA B 1 93  ? 15.170  -3.542  20.040 1.00 21.03 ? 750  ALA B N     1 
ATOM   2625 C  CA    . ALA B 1 93  ? 13.934  -3.354  20.813 1.00 20.90 ? 750  ALA B CA    1 
ATOM   2626 C  C     . ALA B 1 93  ? 13.090  -4.617  21.021 1.00 20.83 ? 750  ALA B C     1 
ATOM   2627 O  O     . ALA B 1 93  ? 12.284  -4.678  21.953 1.00 20.75 ? 750  ALA B O     1 
ATOM   2628 C  CB    . ALA B 1 93  ? 13.086  -2.248  20.190 1.00 20.90 ? 750  ALA B CB    1 
ATOM   2629 N  N     . HIS B 1 94  ? 13.279  -5.616  20.159 1.00 20.82 ? 751  HIS B N     1 
ATOM   2630 C  CA    . HIS B 1 94  ? 12.517  -6.864  20.245 1.00 20.85 ? 751  HIS B CA    1 
ATOM   2631 C  C     . HIS B 1 94  ? 13.398  -8.097  20.402 1.00 21.14 ? 751  HIS B C     1 
ATOM   2632 O  O     . HIS B 1 94  ? 13.095  -9.176  19.886 1.00 21.14 ? 751  HIS B O     1 
ATOM   2633 C  CB    . HIS B 1 94  ? 11.569  -7.000  19.052 1.00 20.70 ? 751  HIS B CB    1 
ATOM   2634 C  CG    . HIS B 1 94  ? 10.587  -5.879  18.947 1.00 19.93 ? 751  HIS B CG    1 
ATOM   2635 N  ND1   . HIS B 1 94  ? 9.596   -5.672  19.880 1.00 19.30 ? 751  HIS B ND1   1 
ATOM   2636 C  CD2   . HIS B 1 94  ? 10.458  -4.889  18.033 1.00 19.48 ? 751  HIS B CD2   1 
ATOM   2637 C  CE1   . HIS B 1 94  ? 8.893   -4.607  19.542 1.00 19.27 ? 751  HIS B CE1   1 
ATOM   2638 N  NE2   . HIS B 1 94  ? 9.394   -4.114  18.424 1.00 19.35 ? 751  HIS B NE2   1 
ATOM   2639 N  N     . ILE B 1 95  ? 14.487  -7.923  21.139 1.00 21.61 ? 752  ILE B N     1 
ATOM   2640 C  CA    . ILE B 1 95  ? 15.381  -9.014  21.490 1.00 21.98 ? 752  ILE B CA    1 
ATOM   2641 C  C     . ILE B 1 95  ? 15.706  -8.872  22.963 1.00 22.19 ? 752  ILE B C     1 
ATOM   2642 O  O     . ILE B 1 95  ? 15.849  -7.753  23.459 1.00 22.23 ? 752  ILE B O     1 
ATOM   2643 C  CB    . ILE B 1 95  ? 16.663  -8.958  20.636 1.00 21.99 ? 752  ILE B CB    1 
ATOM   2644 C  CG1   . ILE B 1 95  ? 16.417  -9.663  19.302 1.00 22.20 ? 752  ILE B CG1   1 
ATOM   2645 C  CG2   . ILE B 1 95  ? 17.849  -9.585  21.360 1.00 22.02 ? 752  ILE B CG2   1 
ATOM   2646 C  CD1   . ILE B 1 95  ? 17.520  -9.414  18.294 1.00 22.70 ? 752  ILE B CD1   1 
ATOM   2647 N  N     . VAL B 1 96  ? 15.795  -9.993  23.672 1.00 22.50 ? 753  VAL B N     1 
ATOM   2648 C  CA    . VAL B 1 96  ? 16.259  -9.951  25.057 1.00 22.85 ? 753  VAL B CA    1 
ATOM   2649 C  C     . VAL B 1 96  ? 17.782  -9.867  25.051 1.00 23.07 ? 753  VAL B C     1 
ATOM   2650 O  O     . VAL B 1 96  ? 18.458  -10.863 24.784 1.00 23.06 ? 753  VAL B O     1 
ATOM   2651 C  CB    . VAL B 1 96  ? 15.786  -11.176 25.879 1.00 22.86 ? 753  VAL B CB    1 
ATOM   2652 C  CG1   . VAL B 1 96  ? 16.179  -11.022 27.343 1.00 22.74 ? 753  VAL B CG1   1 
ATOM   2653 C  CG2   . VAL B 1 96  ? 14.281  -11.359 25.757 1.00 22.77 ? 753  VAL B CG2   1 
ATOM   2654 N  N     . ARG B 1 97  ? 18.318  -8.679  25.327 1.00 23.45 ? 754  ARG B N     1 
ATOM   2655 C  CA    . ARG B 1 97  ? 19.772  -8.488  25.337 1.00 23.92 ? 754  ARG B CA    1 
ATOM   2656 C  C     . ARG B 1 97  ? 20.439  -9.229  26.493 1.00 23.95 ? 754  ARG B C     1 
ATOM   2657 O  O     . ARG B 1 97  ? 19.845  -9.401  27.561 1.00 23.87 ? 754  ARG B O     1 
ATOM   2658 C  CB    . ARG B 1 97  ? 20.158  -6.999  25.343 1.00 24.04 ? 754  ARG B CB    1 
ATOM   2659 C  CG    . ARG B 1 97  ? 20.039  -6.272  26.688 1.00 24.98 ? 754  ARG B CG    1 
ATOM   2660 C  CD    . ARG B 1 97  ? 20.930  -5.025  26.703 1.00 26.81 ? 754  ARG B CD    1 
ATOM   2661 N  NE    . ARG B 1 97  ? 20.663  -4.135  27.836 1.00 28.11 ? 754  ARG B NE    1 
ATOM   2662 C  CZ    . ARG B 1 97  ? 20.028  -2.966  27.755 1.00 28.75 ? 754  ARG B CZ    1 
ATOM   2663 N  NH1   . ARG B 1 97  ? 19.580  -2.518  26.586 1.00 28.90 ? 754  ARG B NH1   1 
ATOM   2664 N  NH2   . ARG B 1 97  ? 19.843  -2.239  28.849 1.00 28.95 ? 754  ARG B NH2   1 
ATOM   2665 N  N     . LEU B 1 98  ? 21.668  -9.676  26.251 1.00 24.17 ? 755  LEU B N     1 
ATOM   2666 C  CA    . LEU B 1 98  ? 22.500  -10.278 27.282 1.00 24.39 ? 755  LEU B CA    1 
ATOM   2667 C  C     . LEU B 1 98  ? 23.230  -9.147  27.993 1.00 24.43 ? 755  LEU B C     1 
ATOM   2668 O  O     . LEU B 1 98  ? 24.105  -8.504  27.407 1.00 24.45 ? 755  LEU B O     1 
ATOM   2669 C  CB    . LEU B 1 98  ? 23.500  -11.255 26.652 1.00 24.45 ? 755  LEU B CB    1 
ATOM   2670 C  CG    . LEU B 1 98  ? 24.162  -12.327 27.524 1.00 24.80 ? 755  LEU B CG    1 
ATOM   2671 C  CD1   . LEU B 1 98  ? 23.193  -13.461 27.831 1.00 25.18 ? 755  LEU B CD1   1 
ATOM   2672 C  CD2   . LEU B 1 98  ? 25.412  -12.871 26.846 1.00 25.12 ? 755  LEU B CD2   1 
ATOM   2673 N  N     . LEU B 1 99  ? 22.851  -8.887  29.242 1.00 24.58 ? 756  LEU B N     1 
ATOM   2674 C  CA    . LEU B 1 99  ? 23.505  -7.846  30.032 1.00 24.74 ? 756  LEU B CA    1 
ATOM   2675 C  C     . LEU B 1 99  ? 24.961  -8.218  30.264 1.00 24.91 ? 756  LEU B C     1 
ATOM   2676 O  O     . LEU B 1 99  ? 25.832  -7.350  30.346 1.00 24.86 ? 756  LEU B O     1 
ATOM   2677 C  CB    . LEU B 1 99  ? 22.790  -7.627  31.367 1.00 24.67 ? 756  LEU B CB    1 
ATOM   2678 C  CG    . LEU B 1 99  ? 21.409  -6.963  31.346 1.00 24.55 ? 756  LEU B CG    1 
ATOM   2679 C  CD1   . LEU B 1 99  ? 20.859  -6.880  32.759 1.00 24.53 ? 756  LEU B CD1   1 
ATOM   2680 C  CD2   . LEU B 1 99  ? 21.449  -5.573  30.713 1.00 24.37 ? 756  LEU B CD2   1 
ATOM   2681 N  N     . GLY B 1 100 ? 25.213  -9.519  30.356 1.00 25.11 ? 757  GLY B N     1 
ATOM   2682 C  CA    . GLY B 1 100 ? 26.563  -10.027 30.465 1.00 25.52 ? 757  GLY B CA    1 
ATOM   2683 C  C     . GLY B 1 100 ? 26.578  -11.501 30.782 1.00 25.82 ? 757  GLY B C     1 
ATOM   2684 O  O     . GLY B 1 100 ? 25.529  -12.133 30.918 1.00 25.88 ? 757  GLY B O     1 
ATOM   2685 N  N     . LEU B 1 101 ? 27.782  -12.046 30.899 1.00 26.18 ? 758  LEU B N     1 
ATOM   2686 C  CA    . LEU B 1 101 ? 27.954  -13.454 31.218 1.00 26.55 ? 758  LEU B CA    1 
ATOM   2687 C  C     . LEU B 1 101 ? 29.035  -13.672 32.273 1.00 26.84 ? 758  LEU B C     1 
ATOM   2688 O  O     . LEU B 1 101 ? 29.926  -12.839 32.456 1.00 26.82 ? 758  LEU B O     1 
ATOM   2689 C  CB    . LEU B 1 101 ? 28.228  -14.276 29.949 1.00 26.51 ? 758  LEU B CB    1 
ATOM   2690 C  CG    . LEU B 1 101 ? 29.354  -13.875 28.991 1.00 26.51 ? 758  LEU B CG    1 
ATOM   2691 C  CD1   . LEU B 1 101 ? 30.695  -14.433 29.442 1.00 26.61 ? 758  LEU B CD1   1 
ATOM   2692 C  CD2   . LEU B 1 101 ? 29.030  -14.364 27.595 1.00 26.56 ? 758  LEU B CD2   1 
ATOM   2693 N  N     . CYS B 1 102 ? 28.936  -14.799 32.966 1.00 27.21 ? 759  CYS B N     1 
ATOM   2694 C  CA    . CYS B 1 102 ? 29.857  -15.124 34.035 1.00 27.64 ? 759  CYS B CA    1 
ATOM   2695 C  C     . CYS B 1 102 ? 30.480  -16.496 33.797 1.00 27.78 ? 759  CYS B C     1 
ATOM   2696 O  O     . CYS B 1 102 ? 29.823  -17.523 34.007 1.00 27.75 ? 759  CYS B O     1 
ATOM   2697 C  CB    . CYS B 1 102 ? 29.141  -15.077 35.385 1.00 27.64 ? 759  CYS B CB    1 
ATOM   2698 S  SG    . CYS B 1 102 ? 30.240  -15.308 36.794 1.00 28.46 ? 759  CYS B SG    1 
ATOM   2699 N  N     . PRO B 1 103 ? 31.754  -16.517 33.356 1.00 27.95 ? 760  PRO B N     1 
ATOM   2700 C  CA    . PRO B 1 103 ? 32.429  -17.780 33.093 1.00 28.08 ? 760  PRO B CA    1 
ATOM   2701 C  C     . PRO B 1 103 ? 32.654  -18.513 34.402 1.00 28.25 ? 760  PRO B C     1 
ATOM   2702 O  O     . PRO B 1 103 ? 32.608  -17.901 35.471 1.00 28.20 ? 760  PRO B O     1 
ATOM   2703 C  CB    . PRO B 1 103 ? 33.777  -17.352 32.493 1.00 28.04 ? 760  PRO B CB    1 
ATOM   2704 C  CG    . PRO B 1 103 ? 33.696  -15.869 32.293 1.00 27.97 ? 760  PRO B CG    1 
ATOM   2705 C  CD    . PRO B 1 103 ? 32.680  -15.377 33.256 1.00 27.93 ? 760  PRO B CD    1 
ATOM   2706 N  N     . GLY B 1 104 ? 32.888  -19.813 34.322 1.00 28.49 ? 761  GLY B N     1 
ATOM   2707 C  CA    . GLY B 1 104 ? 33.095  -20.615 35.517 1.00 28.83 ? 761  GLY B CA    1 
ATOM   2708 C  C     . GLY B 1 104 ? 33.025  -22.082 35.181 1.00 29.06 ? 761  GLY B C     1 
ATOM   2709 O  O     . GLY B 1 104 ? 33.173  -22.466 34.019 1.00 29.14 ? 761  GLY B O     1 
ATOM   2710 N  N     . SER B 1 105 ? 32.812  -22.905 36.201 1.00 29.22 ? 762  SER B N     1 
ATOM   2711 C  CA    . SER B 1 105 ? 32.638  -24.338 36.002 1.00 29.36 ? 762  SER B CA    1 
ATOM   2712 C  C     . SER B 1 105 ? 31.430  -24.565 35.101 1.00 29.30 ? 762  SER B C     1 
ATOM   2713 O  O     . SER B 1 105 ? 31.476  -25.373 34.170 1.00 29.35 ? 762  SER B O     1 
ATOM   2714 C  CB    . SER B 1 105 ? 32.452  -25.044 37.341 1.00 29.42 ? 762  SER B CB    1 
ATOM   2715 O  OG    . SER B 1 105 ? 32.487  -26.449 37.177 1.00 29.71 ? 762  SER B OG    1 
ATOM   2716 N  N     . SER B 1 106 ? 30.359  -23.833 35.393 1.00 29.16 ? 763  SER B N     1 
ATOM   2717 C  CA    . SER B 1 106 ? 29.202  -23.731 34.521 1.00 28.94 ? 763  SER B CA    1 
ATOM   2718 C  C     . SER B 1 106 ? 29.139  -22.306 34.003 1.00 28.74 ? 763  SER B C     1 
ATOM   2719 O  O     . SER B 1 106 ? 29.583  -21.374 34.678 1.00 28.73 ? 763  SER B O     1 
ATOM   2720 C  CB    . SER B 1 106 ? 27.921  -24.049 35.290 1.00 28.96 ? 763  SER B CB    1 
ATOM   2721 O  OG    . SER B 1 106 ? 27.974  -25.350 35.851 1.00 29.06 ? 763  SER B OG    1 
ATOM   2722 N  N     . LEU B 1 107 ? 28.591  -22.139 32.805 1.00 28.50 ? 764  LEU B N     1 
ATOM   2723 C  CA    . LEU B 1 107 ? 28.381  -20.814 32.246 1.00 28.23 ? 764  LEU B CA    1 
ATOM   2724 C  C     . LEU B 1 107 ? 27.081  -20.234 32.786 1.00 28.05 ? 764  LEU B C     1 
ATOM   2725 O  O     . LEU B 1 107 ? 26.065  -20.928 32.860 1.00 28.02 ? 764  LEU B O     1 
ATOM   2726 C  CB    . LEU B 1 107 ? 28.357  -20.873 30.721 1.00 28.21 ? 764  LEU B CB    1 
ATOM   2727 C  CG    . LEU B 1 107 ? 28.268  -19.575 29.923 1.00 28.27 ? 764  LEU B CG    1 
ATOM   2728 C  CD1   . LEU B 1 107 ? 29.185  -19.617 28.730 1.00 28.47 ? 764  LEU B CD1   1 
ATOM   2729 C  CD2   . LEU B 1 107 ? 26.850  -19.358 29.472 1.00 28.58 ? 764  LEU B CD2   1 
ATOM   2730 N  N     . GLN B 1 108 ? 27.135  -18.961 33.169 1.00 27.82 ? 765  GLN B N     1 
ATOM   2731 C  CA    . GLN B 1 108 ? 25.972  -18.236 33.664 1.00 27.60 ? 765  GLN B CA    1 
ATOM   2732 C  C     . GLN B 1 108 ? 25.645  -17.099 32.714 1.00 27.42 ? 765  GLN B C     1 
ATOM   2733 O  O     . GLN B 1 108 ? 26.461  -16.195 32.517 1.00 27.30 ? 765  GLN B O     1 
ATOM   2734 C  CB    . GLN B 1 108 ? 26.236  -17.657 35.053 1.00 27.63 ? 765  GLN B CB    1 
ATOM   2735 C  CG    . GLN B 1 108 ? 26.427  -18.672 36.158 1.00 27.86 ? 765  GLN B CG    1 
ATOM   2736 C  CD    . GLN B 1 108 ? 26.715  -18.004 37.485 1.00 28.27 ? 765  GLN B CD    1 
ATOM   2737 O  OE1   . GLN B 1 108 ? 25.827  -17.418 38.105 1.00 28.20 ? 765  GLN B OE1   1 
ATOM   2738 N  NE2   . GLN B 1 108 ? 27.964  -18.086 37.930 1.00 28.58 ? 765  GLN B NE2   1 
ATOM   2739 N  N     . LEU B 1 109 ? 24.456  -17.154 32.120 1.00 27.26 ? 766  LEU B N     1 
ATOM   2740 C  CA    . LEU B 1 109 ? 23.979  -16.083 31.252 1.00 27.10 ? 766  LEU B CA    1 
ATOM   2741 C  C     . LEU B 1 109 ? 23.067  -15.163 32.042 1.00 27.04 ? 766  LEU B C     1 
ATOM   2742 O  O     . LEU B 1 109 ? 22.135  -15.623 32.701 1.00 27.05 ? 766  LEU B O     1 
ATOM   2743 C  CB    . LEU B 1 109 ? 23.242  -16.643 30.033 1.00 27.06 ? 766  LEU B CB    1 
ATOM   2744 C  CG    . LEU B 1 109 ? 24.036  -17.313 28.906 1.00 26.92 ? 766  LEU B CG    1 
ATOM   2745 C  CD1   . LEU B 1 109 ? 23.108  -17.643 27.741 1.00 26.69 ? 766  LEU B CD1   1 
ATOM   2746 C  CD2   . LEU B 1 109 ? 25.199  -16.443 28.424 1.00 26.65 ? 766  LEU B CD2   1 
ATOM   2747 N  N     . VAL B 1 110 ? 23.343  -13.865 31.985 1.00 27.02 ? 767  VAL B N     1 
ATOM   2748 C  CA    . VAL B 1 110 ? 22.581  -12.895 32.757 1.00 27.11 ? 767  VAL B CA    1 
ATOM   2749 C  C     . VAL B 1 110 ? 21.834  -11.958 31.825 1.00 27.31 ? 767  VAL B C     1 
ATOM   2750 O  O     . VAL B 1 110 ? 22.441  -11.266 31.001 1.00 27.40 ? 767  VAL B O     1 
ATOM   2751 C  CB    . VAL B 1 110 ? 23.482  -12.076 33.712 1.00 27.11 ? 767  VAL B CB    1 
ATOM   2752 C  CG1   . VAL B 1 110 ? 22.651  -11.074 34.516 1.00 27.05 ? 767  VAL B CG1   1 
ATOM   2753 C  CG2   . VAL B 1 110 ? 24.245  -13.000 34.651 1.00 27.12 ? 767  VAL B CG2   1 
ATOM   2754 N  N     . THR B 1 111 ? 20.513  -11.958 31.954 1.00 27.45 ? 768  THR B N     1 
ATOM   2755 C  CA    . THR B 1 111 ? 19.660  -11.041 31.213 1.00 27.61 ? 768  THR B CA    1 
ATOM   2756 C  C     . THR B 1 111 ? 18.706  -10.359 32.189 1.00 27.75 ? 768  THR B C     1 
ATOM   2757 O  O     . THR B 1 111 ? 18.723  -10.647 33.387 1.00 27.76 ? 768  THR B O     1 
ATOM   2758 C  CB    . THR B 1 111 ? 18.864  -11.767 30.097 1.00 27.64 ? 768  THR B CB    1 
ATOM   2759 O  OG1   . THR B 1 111 ? 18.175  -12.895 30.648 1.00 27.80 ? 768  THR B OG1   1 
ATOM   2760 C  CG2   . THR B 1 111 ? 19.788  -12.248 28.986 1.00 27.56 ? 768  THR B CG2   1 
ATOM   2761 N  N     . GLN B 1 112 ? 17.884  -9.449  31.673 1.00 27.97 ? 769  GLN B N     1 
ATOM   2762 C  CA    . GLN B 1 112 ? 16.897  -8.738  32.486 1.00 28.24 ? 769  GLN B CA    1 
ATOM   2763 C  C     . GLN B 1 112 ? 15.732  -9.651  32.869 1.00 28.07 ? 769  GLN B C     1 
ATOM   2764 O  O     . GLN B 1 112 ? 15.427  -10.606 32.152 1.00 28.03 ? 769  GLN B O     1 
ATOM   2765 C  CB    . GLN B 1 112 ? 16.369  -7.516  31.733 1.00 28.41 ? 769  GLN B CB    1 
ATOM   2766 C  CG    . GLN B 1 112 ? 17.433  -6.489  31.365 1.00 29.49 ? 769  GLN B CG    1 
ATOM   2767 C  CD    . GLN B 1 112 ? 16.852  -5.227  30.748 1.00 30.71 ? 769  GLN B CD    1 
ATOM   2768 O  OE1   . GLN B 1 112 ? 15.637  -5.013  30.757 1.00 31.09 ? 769  GLN B OE1   1 
ATOM   2769 N  NE2   . GLN B 1 112 ? 17.722  -4.379  30.209 1.00 31.10 ? 769  GLN B NE2   1 
ATOM   2770 N  N     . TYR B 1 113 ? 15.090  -9.354  33.999 1.00 27.97 ? 770  TYR B N     1 
ATOM   2771 C  CA    . TYR B 1 113 ? 13.924  -10.117 34.462 1.00 27.83 ? 770  TYR B CA    1 
ATOM   2772 C  C     . TYR B 1 113 ? 12.625  -9.538  33.923 1.00 27.83 ? 770  TYR B C     1 
ATOM   2773 O  O     . TYR B 1 113 ? 12.350  -8.343  34.070 1.00 27.73 ? 770  TYR B O     1 
ATOM   2774 C  CB    . TYR B 1 113 ? 13.871  -10.184 35.993 1.00 27.77 ? 770  TYR B CB    1 
ATOM   2775 C  CG    . TYR B 1 113 ? 12.692  -10.960 36.566 1.00 27.41 ? 770  TYR B CG    1 
ATOM   2776 C  CD1   . TYR B 1 113 ? 12.576  -12.339 36.377 1.00 27.18 ? 770  TYR B CD1   1 
ATOM   2777 C  CD2   . TYR B 1 113 ? 11.710  -10.319 37.321 1.00 27.18 ? 770  TYR B CD2   1 
ATOM   2778 C  CE1   . TYR B 1 113 ? 11.503  -13.056 36.909 1.00 26.81 ? 770  TYR B CE1   1 
ATOM   2779 C  CE2   . TYR B 1 113 ? 10.634  -11.029 37.862 1.00 26.98 ? 770  TYR B CE2   1 
ATOM   2780 C  CZ    . TYR B 1 113 ? 10.538  -12.395 37.652 1.00 26.84 ? 770  TYR B CZ    1 
ATOM   2781 O  OH    . TYR B 1 113 ? 9.479   -13.098 38.182 1.00 26.62 ? 770  TYR B OH    1 
ATOM   2782 N  N     . LEU B 1 114 ? 11.834  -10.405 33.301 1.00 27.85 ? 771  LEU B N     1 
ATOM   2783 C  CA    . LEU B 1 114 ? 10.568  -10.012 32.707 1.00 27.89 ? 771  LEU B CA    1 
ATOM   2784 C  C     . LEU B 1 114 ? 9.431   -10.748 33.414 1.00 27.87 ? 771  LEU B C     1 
ATOM   2785 O  O     . LEU B 1 114 ? 9.065   -11.862 33.023 1.00 27.87 ? 771  LEU B O     1 
ATOM   2786 C  CB    . LEU B 1 114 ? 10.570  -10.283 31.196 1.00 27.94 ? 771  LEU B CB    1 
ATOM   2787 C  CG    . LEU B 1 114 ? 11.769  -9.845  30.338 1.00 28.12 ? 771  LEU B CG    1 
ATOM   2788 C  CD1   . LEU B 1 114 ? 11.424  -9.967  28.865 1.00 28.42 ? 771  LEU B CD1   1 
ATOM   2789 C  CD2   . LEU B 1 114 ? 12.229  -8.420  30.636 1.00 28.36 ? 771  LEU B CD2   1 
ATOM   2790 N  N     . PRO B 1 115 ? 8.870   -10.122 34.465 1.00 27.84 ? 772  PRO B N     1 
ATOM   2791 C  CA    . PRO B 1 115 ? 7.868   -10.760 35.318 1.00 27.83 ? 772  PRO B CA    1 
ATOM   2792 C  C     . PRO B 1 115 ? 6.562   -11.083 34.588 1.00 27.84 ? 772  PRO B C     1 
ATOM   2793 O  O     . PRO B 1 115 ? 5.765   -11.875 35.094 1.00 27.89 ? 772  PRO B O     1 
ATOM   2794 C  CB    . PRO B 1 115 ? 7.621   -9.714  36.409 1.00 27.84 ? 772  PRO B CB    1 
ATOM   2795 C  CG    . PRO B 1 115 ? 7.964   -8.419  35.773 1.00 27.83 ? 772  PRO B CG    1 
ATOM   2796 C  CD    . PRO B 1 115 ? 9.101   -8.716  34.848 1.00 27.81 ? 772  PRO B CD    1 
ATOM   2797 N  N     . LEU B 1 116 ? 6.346   -10.479 33.418 1.00 27.72 ? 773  LEU B N     1 
ATOM   2798 C  CA    . LEU B 1 116 ? 5.165   -10.781 32.606 1.00 27.57 ? 773  LEU B CA    1 
ATOM   2799 C  C     . LEU B 1 116 ? 5.213   -12.196 32.014 1.00 27.36 ? 773  LEU B C     1 
ATOM   2800 O  O     . LEU B 1 116 ? 4.212   -12.684 31.483 1.00 27.39 ? 773  LEU B O     1 
ATOM   2801 C  CB    . LEU B 1 116 ? 4.959   -9.737  31.493 1.00 27.64 ? 773  LEU B CB    1 
ATOM   2802 C  CG    . LEU B 1 116 ? 4.306   -8.367  31.765 1.00 27.74 ? 773  LEU B CG    1 
ATOM   2803 C  CD1   . LEU B 1 116 ? 3.061   -8.465  32.655 1.00 27.78 ? 773  LEU B CD1   1 
ATOM   2804 C  CD2   . LEU B 1 116 ? 5.303   -7.355  32.333 1.00 28.08 ? 773  LEU B CD2   1 
ATOM   2805 N  N     . GLY B 1 117 ? 6.371   -12.847 32.112 1.00 27.00 ? 774  GLY B N     1 
ATOM   2806 C  CA    . GLY B 1 117 ? 6.529   -14.223 31.652 1.00 26.59 ? 774  GLY B CA    1 
ATOM   2807 C  C     . GLY B 1 117 ? 6.563   -14.355 30.140 1.00 26.30 ? 774  GLY B C     1 
ATOM   2808 O  O     . GLY B 1 117 ? 6.706   -13.360 29.420 1.00 26.22 ? 774  GLY B O     1 
ATOM   2809 N  N     . SER B 1 118 ? 6.425   -15.591 29.664 1.00 26.10 ? 775  SER B N     1 
ATOM   2810 C  CA    . SER B 1 118 ? 6.497   -15.889 28.234 1.00 25.99 ? 775  SER B CA    1 
ATOM   2811 C  C     . SER B 1 118 ? 5.194   -15.594 27.484 1.00 25.91 ? 775  SER B C     1 
ATOM   2812 O  O     . SER B 1 118 ? 4.123   -15.469 28.087 1.00 25.87 ? 775  SER B O     1 
ATOM   2813 C  CB    . SER B 1 118 ? 6.928   -17.342 28.008 1.00 25.98 ? 775  SER B CB    1 
ATOM   2814 O  OG    . SER B 1 118 ? 5.949   -18.252 28.484 1.00 26.15 ? 775  SER B OG    1 
ATOM   2815 N  N     . LEU B 1 119 ? 5.310   -15.485 26.164 1.00 25.78 ? 776  LEU B N     1 
ATOM   2816 C  CA    . LEU B 1 119 ? 4.173   -15.268 25.285 1.00 25.75 ? 776  LEU B CA    1 
ATOM   2817 C  C     . LEU B 1 119 ? 3.230   -16.465 25.314 1.00 25.78 ? 776  LEU B C     1 
ATOM   2818 O  O     . LEU B 1 119 ? 2.009   -16.303 25.262 1.00 25.69 ? 776  LEU B O     1 
ATOM   2819 C  CB    . LEU B 1 119 ? 4.664   -15.018 23.858 1.00 25.73 ? 776  LEU B CB    1 
ATOM   2820 C  CG    . LEU B 1 119 ? 3.639   -14.815 22.741 1.00 25.75 ? 776  LEU B CG    1 
ATOM   2821 C  CD1   . LEU B 1 119 ? 2.809   -13.575 23.002 1.00 25.77 ? 776  LEU B CD1   1 
ATOM   2822 C  CD2   . LEU B 1 119 ? 4.346   -14.712 21.403 1.00 25.71 ? 776  LEU B CD2   1 
ATOM   2823 N  N     . LEU B 1 120 ? 3.811   -17.660 25.402 1.00 25.87 ? 777  LEU B N     1 
ATOM   2824 C  CA    . LEU B 1 120 ? 3.050   -18.904 25.419 1.00 26.00 ? 777  LEU B CA    1 
ATOM   2825 C  C     . LEU B 1 120 ? 2.038   -18.931 26.565 1.00 26.10 ? 777  LEU B C     1 
ATOM   2826 O  O     . LEU B 1 120 ? 0.833   -19.034 26.325 1.00 26.12 ? 777  LEU B O     1 
ATOM   2827 C  CB    . LEU B 1 120 ? 3.996   -20.110 25.486 1.00 25.99 ? 777  LEU B CB    1 
ATOM   2828 C  CG    . LEU B 1 120 ? 3.430   -21.528 25.340 1.00 26.02 ? 777  LEU B CG    1 
ATOM   2829 C  CD1   . LEU B 1 120 ? 2.649   -21.700 24.042 1.00 26.25 ? 777  LEU B CD1   1 
ATOM   2830 C  CD2   . LEU B 1 120 ? 4.557   -22.549 25.420 1.00 25.96 ? 777  LEU B CD2   1 
ATOM   2831 N  N     . ASP B 1 121 ? 2.532   -18.820 27.798 1.00 26.24 ? 778  ASP B N     1 
ATOM   2832 C  CA    . ASP B 1 121 ? 1.678   -18.804 28.989 1.00 26.35 ? 778  ASP B CA    1 
ATOM   2833 C  C     . ASP B 1 121 ? 0.640   -17.684 28.947 1.00 26.25 ? 778  ASP B C     1 
ATOM   2834 O  O     . ASP B 1 121 ? -0.464  -17.836 29.471 1.00 26.28 ? 778  ASP B O     1 
ATOM   2835 C  CB    . ASP B 1 121 ? 2.528   -18.680 30.256 1.00 26.48 ? 778  ASP B CB    1 
ATOM   2836 C  CG    . ASP B 1 121 ? 3.307   -19.946 30.564 1.00 26.88 ? 778  ASP B CG    1 
ATOM   2837 O  OD1   . ASP B 1 121 ? 4.546   -19.927 30.423 1.00 27.36 ? 778  ASP B OD1   1 
ATOM   2838 O  OD2   . ASP B 1 121 ? 2.682   -20.961 30.942 1.00 27.30 ? 778  ASP B OD2   1 
ATOM   2839 N  N     . HIS B 1 122 ? 1.007   -16.572 28.313 1.00 26.17 ? 779  HIS B N     1 
ATOM   2840 C  CA    . HIS B 1 122 ? 0.142   -15.399 28.187 1.00 26.13 ? 779  HIS B CA    1 
ATOM   2841 C  C     . HIS B 1 122 ? -1.068  -15.651 27.285 1.00 26.18 ? 779  HIS B C     1 
ATOM   2842 O  O     . HIS B 1 122 ? -2.196  -15.314 27.651 1.00 26.19 ? 779  HIS B O     1 
ATOM   2843 C  CB    . HIS B 1 122 ? 0.949   -14.204 27.675 1.00 26.08 ? 779  HIS B CB    1 
ATOM   2844 C  CG    . HIS B 1 122 ? 0.210   -12.904 27.723 1.00 25.95 ? 779  HIS B CG    1 
ATOM   2845 N  ND1   . HIS B 1 122 ? -0.194  -12.320 28.904 1.00 25.92 ? 779  HIS B ND1   1 
ATOM   2846 C  CD2   . HIS B 1 122 ? -0.177  -12.061 26.736 1.00 25.85 ? 779  HIS B CD2   1 
ATOM   2847 C  CE1   . HIS B 1 122 ? -0.810  -11.181 28.642 1.00 25.86 ? 779  HIS B CE1   1 
ATOM   2848 N  NE2   . HIS B 1 122 ? -0.810  -10.999 27.334 1.00 25.78 ? 779  HIS B NE2   1 
ATOM   2849 N  N     . VAL B 1 123 ? -0.830  -16.244 26.115 1.00 26.24 ? 780  VAL B N     1 
ATOM   2850 C  CA    . VAL B 1 123 ? -1.918  -16.578 25.191 1.00 26.27 ? 780  VAL B CA    1 
ATOM   2851 C  C     . VAL B 1 123 ? -2.754  -17.760 25.693 1.00 26.55 ? 780  VAL B C     1 
ATOM   2852 O  O     . VAL B 1 123 ? -3.944  -17.849 25.389 1.00 26.58 ? 780  VAL B O     1 
ATOM   2853 C  CB    . VAL B 1 123 ? -1.429  -16.815 23.727 1.00 26.16 ? 780  VAL B CB    1 
ATOM   2854 C  CG1   . VAL B 1 123 ? -0.637  -15.616 23.220 1.00 26.03 ? 780  VAL B CG1   1 
ATOM   2855 C  CG2   . VAL B 1 123 ? -0.606  -18.096 23.601 1.00 25.97 ? 780  VAL B CG2   1 
ATOM   2856 N  N     . ARG B 1 124 ? -2.131  -18.660 26.456 1.00 26.85 ? 781  ARG B N     1 
ATOM   2857 C  CA    . ARG B 1 124 ? -2.861  -19.756 27.095 1.00 27.16 ? 781  ARG B CA    1 
ATOM   2858 C  C     . ARG B 1 124 ? -3.854  -19.179 28.099 1.00 27.38 ? 781  ARG B C     1 
ATOM   2859 O  O     . ARG B 1 124 ? -5.018  -19.587 28.140 1.00 27.37 ? 781  ARG B O     1 
ATOM   2860 C  CB    . ARG B 1 124 ? -1.914  -20.729 27.810 1.00 27.15 ? 781  ARG B CB    1 
ATOM   2861 C  CG    . ARG B 1 124 ? -1.074  -21.629 26.908 1.00 27.19 ? 781  ARG B CG    1 
ATOM   2862 C  CD    . ARG B 1 124 ? -0.936  -23.021 27.529 1.00 27.29 ? 781  ARG B CD    1 
ATOM   2863 N  NE    . ARG B 1 124 ? 0.415   -23.585 27.443 1.00 27.41 ? 781  ARG B NE    1 
ATOM   2864 C  CZ    . ARG B 1 124 ? 0.936   -24.179 26.369 1.00 27.34 ? 781  ARG B CZ    1 
ATOM   2865 N  NH1   . ARG B 1 124 ? 0.240   -24.288 25.247 1.00 27.31 ? 781  ARG B NH1   1 
ATOM   2866 N  NH2   . ARG B 1 124 ? 2.168   -24.664 26.419 1.00 27.38 ? 781  ARG B NH2   1 
ATOM   2867 N  N     . GLN B 1 125 ? -3.381  -18.218 28.892 1.00 27.67 ? 782  GLN B N     1 
ATOM   2868 C  CA    . GLN B 1 125 ? -4.177  -17.600 29.951 1.00 27.93 ? 782  GLN B CA    1 
ATOM   2869 C  C     . GLN B 1 125 ? -5.340  -16.762 29.415 1.00 27.87 ? 782  GLN B C     1 
ATOM   2870 O  O     . GLN B 1 125 ? -6.466  -16.888 29.898 1.00 27.92 ? 782  GLN B O     1 
ATOM   2871 C  CB    . GLN B 1 125 ? -3.283  -16.759 30.876 1.00 28.02 ? 782  GLN B CB    1 
ATOM   2872 C  CG    . GLN B 1 125 ? -4.016  -16.034 32.014 1.00 28.58 ? 782  GLN B CG    1 
ATOM   2873 C  CD    . GLN B 1 125 ? -4.553  -16.971 33.085 1.00 29.25 ? 782  GLN B CD    1 
ATOM   2874 O  OE1   . GLN B 1 125 ? -3.862  -17.889 33.530 1.00 29.48 ? 782  GLN B OE1   1 
ATOM   2875 N  NE2   . GLN B 1 125 ? -5.788  -16.732 33.515 1.00 29.41 ? 782  GLN B NE2   1 
ATOM   2876 N  N     . HIS B 1 126 ? -5.071  -15.918 28.417 1.00 27.77 ? 783  HIS B N     1 
ATOM   2877 C  CA    . HIS B 1 126 ? -6.075  -14.959 27.937 1.00 27.60 ? 783  HIS B CA    1 
ATOM   2878 C  C     . HIS B 1 126 ? -6.811  -15.379 26.665 1.00 27.31 ? 783  HIS B C     1 
ATOM   2879 O  O     . HIS B 1 126 ? -8.013  -15.125 26.536 1.00 27.30 ? 783  HIS B O     1 
ATOM   2880 C  CB    . HIS B 1 126 ? -5.457  -13.569 27.780 1.00 27.72 ? 783  HIS B CB    1 
ATOM   2881 C  CG    . HIS B 1 126 ? -5.048  -12.949 29.079 1.00 28.08 ? 783  HIS B CG    1 
ATOM   2882 N  ND1   . HIS B 1 126 ? -5.522  -11.728 29.508 1.00 28.36 ? 783  HIS B ND1   1 
ATOM   2883 C  CD2   . HIS B 1 126 ? -4.223  -13.397 30.055 1.00 28.33 ? 783  HIS B CD2   1 
ATOM   2884 C  CE1   . HIS B 1 126 ? -4.996  -11.445 30.687 1.00 28.47 ? 783  HIS B CE1   1 
ATOM   2885 N  NE2   . HIS B 1 126 ? -4.207  -12.443 31.042 1.00 28.53 ? 783  HIS B NE2   1 
ATOM   2886 N  N     . ARG B 1 127 ? -6.091  -16.011 25.738 1.00 26.83 ? 784  ARG B N     1 
ATOM   2887 C  CA    . ARG B 1 127 ? -6.671  -16.530 24.490 1.00 26.33 ? 784  ARG B CA    1 
ATOM   2888 C  C     . ARG B 1 127 ? -7.222  -15.434 23.572 1.00 26.27 ? 784  ARG B C     1 
ATOM   2889 O  O     . ARG B 1 127 ? -6.568  -14.412 23.359 1.00 26.29 ? 784  ARG B O     1 
ATOM   2890 C  CB    . ARG B 1 127 ? -7.753  -17.579 24.779 1.00 26.21 ? 784  ARG B CB    1 
ATOM   2891 C  CG    . ARG B 1 127 ? -7.305  -18.744 25.645 1.00 25.59 ? 784  ARG B CG    1 
ATOM   2892 C  CD    . ARG B 1 127 ? -8.372  -19.823 25.675 1.00 24.82 ? 784  ARG B CD    1 
ATOM   2893 N  NE    . ARG B 1 127 ? -8.707  -20.287 24.327 1.00 24.63 ? 784  ARG B NE    1 
ATOM   2894 C  CZ    . ARG B 1 127 ? -8.068  -21.264 23.684 1.00 24.48 ? 784  ARG B CZ    1 
ATOM   2895 N  NH1   . ARG B 1 127 ? -7.048  -21.901 24.255 1.00 24.43 ? 784  ARG B NH1   1 
ATOM   2896 N  NH2   . ARG B 1 127 ? -8.453  -21.606 22.460 1.00 24.50 ? 784  ARG B NH2   1 
ATOM   2897 N  N     . GLY B 1 128 ? -8.423  -15.661 23.034 1.00 26.13 ? 785  GLY B N     1 
ATOM   2898 C  CA    . GLY B 1 128 ? -9.076  -14.743 22.096 1.00 25.83 ? 785  GLY B CA    1 
ATOM   2899 C  C     . GLY B 1 128 ? -9.388  -13.364 22.644 1.00 25.63 ? 785  GLY B C     1 
ATOM   2900 O  O     . GLY B 1 128 ? -9.597  -12.421 21.877 1.00 25.57 ? 785  GLY B O     1 
ATOM   2901 N  N     . ALA B 1 129 ? -9.421  -13.256 23.973 1.00 25.47 ? 786  ALA B N     1 
ATOM   2902 C  CA    . ALA B 1 129 ? -9.645  -11.986 24.668 1.00 25.30 ? 786  ALA B CA    1 
ATOM   2903 C  C     . ALA B 1 129 ? -8.588  -10.938 24.320 1.00 25.17 ? 786  ALA B C     1 
ATOM   2904 O  O     . ALA B 1 129 ? -8.814  -9.739  24.491 1.00 25.17 ? 786  ALA B O     1 
ATOM   2905 C  CB    . ALA B 1 129 ? -9.700  -12.210 26.175 1.00 25.29 ? 786  ALA B CB    1 
ATOM   2906 N  N     . LEU B 1 130 ? -7.439  -11.404 23.834 1.00 25.03 ? 787  LEU B N     1 
ATOM   2907 C  CA    . LEU B 1 130 ? -6.384  -10.533 23.319 1.00 24.93 ? 787  LEU B CA    1 
ATOM   2908 C  C     . LEU B 1 130 ? -6.847  -9.800  22.068 1.00 24.97 ? 787  LEU B C     1 
ATOM   2909 O  O     . LEU B 1 130 ? -7.801  -10.219 21.404 1.00 24.96 ? 787  LEU B O     1 
ATOM   2910 C  CB    . LEU B 1 130 ? -5.128  -11.347 22.984 1.00 24.87 ? 787  LEU B CB    1 
ATOM   2911 C  CG    . LEU B 1 130 ? -4.338  -12.015 24.113 1.00 24.67 ? 787  LEU B CG    1 
ATOM   2912 C  CD1   . LEU B 1 130 ? -3.322  -12.977 23.529 1.00 24.55 ? 787  LEU B CD1   1 
ATOM   2913 C  CD2   . LEU B 1 130 ? -3.654  -10.991 25.014 1.00 24.36 ? 787  LEU B CD2   1 
ATOM   2914 N  N     . GLY B 1 131 ? -6.167  -8.704  21.748 1.00 24.99 ? 788  GLY B N     1 
ATOM   2915 C  CA    . GLY B 1 131 ? -6.449  -7.966  20.526 1.00 25.05 ? 788  GLY B CA    1 
ATOM   2916 C  C     . GLY B 1 131 ? -6.096  -8.798  19.307 1.00 25.06 ? 788  GLY B C     1 
ATOM   2917 O  O     . GLY B 1 131 ? -5.025  -9.406  19.267 1.00 25.11 ? 788  GLY B O     1 
ATOM   2918 N  N     . PRO B 1 132 ? -7.003  -8.850  18.311 1.00 25.06 ? 789  PRO B N     1 
ATOM   2919 C  CA    . PRO B 1 132 ? -6.642  -9.487  17.045 1.00 25.09 ? 789  PRO B CA    1 
ATOM   2920 C  C     . PRO B 1 132 ? -5.511  -8.709  16.375 1.00 25.14 ? 789  PRO B C     1 
ATOM   2921 O  O     . PRO B 1 132 ? -4.720  -9.283  15.625 1.00 25.13 ? 789  PRO B O     1 
ATOM   2922 C  CB    . PRO B 1 132 ? -7.928  -9.391  16.216 1.00 25.03 ? 789  PRO B CB    1 
ATOM   2923 C  CG    . PRO B 1 132 ? -8.700  -8.271  16.823 1.00 24.99 ? 789  PRO B CG    1 
ATOM   2924 C  CD    . PRO B 1 132 ? -8.372  -8.300  18.284 1.00 25.06 ? 789  PRO B CD    1 
ATOM   2925 N  N     . GLN B 1 133 ? -5.447  -7.410  16.663 1.00 25.24 ? 790  GLN B N     1 
ATOM   2926 C  CA    . GLN B 1 133 ? -4.375  -6.558  16.181 1.00 25.42 ? 790  GLN B CA    1 
ATOM   2927 C  C     . GLN B 1 133 ? -3.096  -6.858  16.946 1.00 25.46 ? 790  GLN B C     1 
ATOM   2928 O  O     . GLN B 1 133 ? -2.006  -6.798  16.383 1.00 25.47 ? 790  GLN B O     1 
ATOM   2929 C  CB    . GLN B 1 133 ? -4.745  -5.085  16.338 1.00 25.45 ? 790  GLN B CB    1 
ATOM   2930 C  CG    . GLN B 1 133 ? -3.981  -4.172  15.397 1.00 25.85 ? 790  GLN B CG    1 
ATOM   2931 C  CD    . GLN B 1 133 ? -3.875  -2.753  15.911 1.00 26.44 ? 790  GLN B CD    1 
ATOM   2932 O  OE1   . GLN B 1 133 ? -4.878  -2.116  16.240 1.00 26.57 ? 790  GLN B OE1   1 
ATOM   2933 N  NE2   . GLN B 1 133 ? -2.651  -2.243  15.973 1.00 26.73 ? 790  GLN B NE2   1 
ATOM   2934 N  N     . LEU B 1 134 ? -3.247  -7.188  18.227 1.00 25.50 ? 791  LEU B N     1 
ATOM   2935 C  CA    . LEU B 1 134 ? -2.128  -7.530  19.094 1.00 25.51 ? 791  LEU B CA    1 
ATOM   2936 C  C     . LEU B 1 134 ? -1.477  -8.841  18.659 1.00 25.53 ? 791  LEU B C     1 
ATOM   2937 O  O     . LEU B 1 134 ? -0.248  -8.955  18.662 1.00 25.57 ? 791  LEU B O     1 
ATOM   2938 C  CB    . LEU B 1 134 ? -2.605  -7.625  20.545 1.00 25.56 ? 791  LEU B CB    1 
ATOM   2939 C  CG    . LEU B 1 134 ? -1.630  -7.426  21.706 1.00 25.56 ? 791  LEU B CG    1 
ATOM   2940 C  CD1   . LEU B 1 134 ? -1.244  -5.960  21.874 1.00 25.64 ? 791  LEU B CD1   1 
ATOM   2941 C  CD2   . LEU B 1 134 ? -2.265  -7.951  22.981 1.00 25.58 ? 791  LEU B CD2   1 
ATOM   2942 N  N     . LEU B 1 135 ? -2.300  -9.822  18.288 1.00 25.51 ? 792  LEU B N     1 
ATOM   2943 C  CA    . LEU B 1 135 ? -1.790  -11.090 17.771 1.00 25.56 ? 792  LEU B CA    1 
ATOM   2944 C  C     . LEU B 1 135 ? -0.974  -10.848 16.506 1.00 25.71 ? 792  LEU B C     1 
ATOM   2945 O  O     . LEU B 1 135 ? 0.155   -11.333 16.391 1.00 25.78 ? 792  LEU B O     1 
ATOM   2946 C  CB    . LEU B 1 135 ? -2.924  -12.086 17.505 1.00 25.50 ? 792  LEU B CB    1 
ATOM   2947 C  CG    . LEU B 1 135 ? -3.714  -12.627 18.703 1.00 25.49 ? 792  LEU B CG    1 
ATOM   2948 C  CD1   . LEU B 1 135 ? -4.972  -13.338 18.228 1.00 25.44 ? 792  LEU B CD1   1 
ATOM   2949 C  CD2   . LEU B 1 135 ? -2.869  -13.552 19.579 1.00 25.21 ? 792  LEU B CD2   1 
ATOM   2950 N  N     . LEU B 1 136 ? -1.538  -10.080 15.574 1.00 25.87 ? 793  LEU B N     1 
ATOM   2951 C  CA    . LEU B 1 136 ? -0.835  -9.721  14.342 1.00 25.99 ? 793  LEU B CA    1 
ATOM   2952 C  C     . LEU B 1 136 ? 0.389   -8.839  14.594 1.00 26.09 ? 793  LEU B C     1 
ATOM   2953 O  O     . LEU B 1 136 ? 1.405   -8.990  13.914 1.00 26.12 ? 793  LEU B O     1 
ATOM   2954 C  CB    . LEU B 1 136 ? -1.783  -9.067  13.331 1.00 25.96 ? 793  LEU B CB    1 
ATOM   2955 C  CG    . LEU B 1 136 ? -2.773  -9.998  12.618 1.00 26.00 ? 793  LEU B CG    1 
ATOM   2956 C  CD1   . LEU B 1 136 ? -3.729  -9.204  11.742 1.00 25.91 ? 793  LEU B CD1   1 
ATOM   2957 C  CD2   . LEU B 1 136 ? -2.056  -11.069 11.794 1.00 26.04 ? 793  LEU B CD2   1 
ATOM   2958 N  N     . ASN B 1 137 ? 0.285   -7.930  15.568 1.00 26.20 ? 794  ASN B N     1 
ATOM   2959 C  CA    . ASN B 1 137 ? 1.397   -7.058  15.973 1.00 26.31 ? 794  ASN B CA    1 
ATOM   2960 C  C     . ASN B 1 137 ? 2.613   -7.833  16.452 1.00 26.46 ? 794  ASN B C     1 
ATOM   2961 O  O     . ASN B 1 137 ? 3.744   -7.502  16.101 1.00 26.48 ? 794  ASN B O     1 
ATOM   2962 C  CB    . ASN B 1 137 ? 0.969   -6.093  17.082 1.00 26.26 ? 794  ASN B CB    1 
ATOM   2963 C  CG    . ASN B 1 137 ? 0.288   -4.850  16.550 1.00 26.23 ? 794  ASN B CG    1 
ATOM   2964 O  OD1   . ASN B 1 137 ? 0.701   -4.280  15.540 1.00 26.23 ? 794  ASN B OD1   1 
ATOM   2965 N  ND2   . ASN B 1 137 ? -0.760  -4.414  17.239 1.00 26.05 ? 794  ASN B ND2   1 
ATOM   2966 N  N     . TRP B 1 138 ? 2.372   -8.857  17.266 1.00 26.64 ? 795  TRP B N     1 
ATOM   2967 C  CA    . TRP B 1 138 ? 3.443   -9.698  17.781 1.00 26.78 ? 795  TRP B CA    1 
ATOM   2968 C  C     . TRP B 1 138 ? 4.093   -10.516 16.671 1.00 26.79 ? 795  TRP B C     1 
ATOM   2969 O  O     . TRP B 1 138 ? 5.274   -10.851 16.751 1.00 26.86 ? 795  TRP B O     1 
ATOM   2970 C  CB    . TRP B 1 138 ? 2.933   -10.603 18.900 1.00 26.84 ? 795  TRP B CB    1 
ATOM   2971 C  CG    . TRP B 1 138 ? 2.675   -9.878  20.191 1.00 27.17 ? 795  TRP B CG    1 
ATOM   2972 C  CD1   . TRP B 1 138 ? 3.298   -8.748  20.637 1.00 27.26 ? 795  TRP B CD1   1 
ATOM   2973 C  CD2   . TRP B 1 138 ? 1.747   -10.252 21.214 1.00 27.58 ? 795  TRP B CD2   1 
ATOM   2974 N  NE1   . TRP B 1 138 ? 2.810   -8.388  21.867 1.00 27.48 ? 795  TRP B NE1   1 
ATOM   2975 C  CE2   . TRP B 1 138 ? 1.857   -9.295  22.248 1.00 27.71 ? 795  TRP B CE2   1 
ATOM   2976 C  CE3   . TRP B 1 138 ? 0.826   -11.298 21.356 1.00 27.90 ? 795  TRP B CE3   1 
ATOM   2977 C  CZ2   . TRP B 1 138 ? 1.082   -9.353  23.411 1.00 27.97 ? 795  TRP B CZ2   1 
ATOM   2978 C  CZ3   . TRP B 1 138 ? 0.055   -11.356 22.514 1.00 28.14 ? 795  TRP B CZ3   1 
ATOM   2979 C  CH2   . TRP B 1 138 ? 0.191   -10.389 23.526 1.00 28.12 ? 795  TRP B CH2   1 
ATOM   2980 N  N     . GLY B 1 139 ? 3.317   -10.827 15.636 1.00 26.80 ? 796  GLY B N     1 
ATOM   2981 C  CA    . GLY B 1 139 ? 3.859   -11.424 14.423 1.00 26.76 ? 796  GLY B CA    1 
ATOM   2982 C  C     . GLY B 1 139 ? 4.908   -10.513 13.812 1.00 26.69 ? 796  GLY B C     1 
ATOM   2983 O  O     . GLY B 1 139 ? 5.986   -10.970 13.424 1.00 26.71 ? 796  GLY B O     1 
ATOM   2984 N  N     . VAL B 1 140 ? 4.589   -9.221  13.738 1.00 26.63 ? 797  VAL B N     1 
ATOM   2985 C  CA    . VAL B 1 140 ? 5.520   -8.215  13.228 1.00 26.62 ? 797  VAL B CA    1 
ATOM   2986 C  C     . VAL B 1 140 ? 6.753   -8.142  14.128 1.00 26.63 ? 797  VAL B C     1 
ATOM   2987 O  O     . VAL B 1 140 ? 7.887   -8.222  13.644 1.00 26.67 ? 797  VAL B O     1 
ATOM   2988 C  CB    . VAL B 1 140 ? 4.881   -6.797  13.138 1.00 26.61 ? 797  VAL B CB    1 
ATOM   2989 C  CG1   . VAL B 1 140 ? 5.773   -5.858  12.340 1.00 26.55 ? 797  VAL B CG1   1 
ATOM   2990 C  CG2   . VAL B 1 140 ? 3.492   -6.850  12.518 1.00 26.66 ? 797  VAL B CG2   1 
ATOM   2991 N  N     . GLN B 1 141 ? 6.516   -8.009  15.433 1.00 26.55 ? 798  GLN B N     1 
ATOM   2992 C  CA    . GLN B 1 141 ? 7.582   -7.801  16.410 1.00 26.48 ? 798  GLN B CA    1 
ATOM   2993 C  C     . GLN B 1 141 ? 8.592   -8.945  16.462 1.00 26.52 ? 798  GLN B C     1 
ATOM   2994 O  O     . GLN B 1 141 ? 9.801   -8.701  16.437 1.00 26.55 ? 798  GLN B O     1 
ATOM   2995 C  CB    . GLN B 1 141 ? 6.999   -7.532  17.795 1.00 26.41 ? 798  GLN B CB    1 
ATOM   2996 C  CG    . GLN B 1 141 ? 6.235   -6.228  17.890 1.00 26.54 ? 798  GLN B CG    1 
ATOM   2997 C  CD    . GLN B 1 141 ? 5.483   -6.089  19.194 1.00 26.78 ? 798  GLN B CD    1 
ATOM   2998 O  OE1   . GLN B 1 141 ? 6.080   -5.883  20.249 1.00 27.05 ? 798  GLN B OE1   1 
ATOM   2999 N  NE2   . GLN B 1 141 ? 4.159   -6.189  19.127 1.00 26.83 ? 798  GLN B NE2   1 
ATOM   3000 N  N     . ILE B 1 142 ? 8.103   -10.183 16.527 1.00 26.58 ? 799  ILE B N     1 
ATOM   3001 C  CA    . ILE B 1 142 ? 8.982   -11.355 16.513 1.00 26.73 ? 799  ILE B CA    1 
ATOM   3002 C  C     . ILE B 1 142 ? 9.816   -11.392 15.233 1.00 27.04 ? 799  ILE B C     1 
ATOM   3003 O  O     . ILE B 1 142 ? 10.997  -11.748 15.264 1.00 27.12 ? 799  ILE B O     1 
ATOM   3004 C  CB    . ILE B 1 142 ? 8.194   -12.676 16.669 1.00 26.63 ? 799  ILE B CB    1 
ATOM   3005 C  CG1   . ILE B 1 142 ? 7.541   -12.743 18.052 1.00 26.48 ? 799  ILE B CG1   1 
ATOM   3006 C  CG2   . ILE B 1 142 ? 9.106   -13.887 16.457 1.00 26.47 ? 799  ILE B CG2   1 
ATOM   3007 C  CD1   . ILE B 1 142 ? 6.412   -13.753 18.164 1.00 26.24 ? 799  ILE B CD1   1 
ATOM   3008 N  N     . ALA B 1 143 ? 9.197   -11.010 14.116 1.00 27.38 ? 800  ALA B N     1 
ATOM   3009 C  CA    . ALA B 1 143 ? 9.882   -10.964 12.825 1.00 27.66 ? 800  ALA B CA    1 
ATOM   3010 C  C     . ALA B 1 143 ? 11.021  -9.942  12.812 1.00 27.85 ? 800  ALA B C     1 
ATOM   3011 O  O     . ALA B 1 143 ? 12.116  -10.241 12.328 1.00 27.87 ? 800  ALA B O     1 
ATOM   3012 C  CB    . ALA B 1 143 ? 8.892   -10.686 11.699 1.00 27.68 ? 800  ALA B CB    1 
ATOM   3013 N  N     . LYS B 1 144 ? 10.756  -8.748  13.351 1.00 28.08 ? 801  LYS B N     1 
ATOM   3014 C  CA    . LYS B 1 144 ? 11.748  -7.665  13.424 1.00 28.31 ? 801  LYS B CA    1 
ATOM   3015 C  C     . LYS B 1 144 ? 12.977  -8.043  14.254 1.00 28.43 ? 801  LYS B C     1 
ATOM   3016 O  O     . LYS B 1 144 ? 14.104  -7.672  13.914 1.00 28.42 ? 801  LYS B O     1 
ATOM   3017 C  CB    . LYS B 1 144 ? 11.117  -6.389  13.990 1.00 28.29 ? 801  LYS B CB    1 
ATOM   3018 C  CG    . LYS B 1 144 ? 10.078  -5.746  13.092 1.00 28.43 ? 801  LYS B CG    1 
ATOM   3019 C  CD    . LYS B 1 144 ? 9.645   -4.399  13.641 1.00 28.70 ? 801  LYS B CD    1 
ATOM   3020 C  CE    . LYS B 1 144 ? 8.714   -3.691  12.672 1.00 28.84 ? 801  LYS B CE    1 
ATOM   3021 N  NZ    . LYS B 1 144 ? 8.543   -2.240  13.037 1.00 28.99 ? 801  LYS B NZ    1 
ATOM   3022 N  N     . GLY B 1 145 ? 12.748  -8.771  15.344 1.00 28.55 ? 802  GLY B N     1 
ATOM   3023 C  CA    . GLY B 1 145 ? 13.832  -9.289  16.165 1.00 28.78 ? 802  GLY B CA    1 
ATOM   3024 C  C     . GLY B 1 145 ? 14.661  -10.269 15.363 1.00 28.96 ? 802  GLY B C     1 
ATOM   3025 O  O     . GLY B 1 145 ? 15.889  -10.179 15.328 1.00 28.97 ? 802  GLY B O     1 
ATOM   3026 N  N     . MET B 1 146 ? 13.974  -11.195 14.702 1.00 29.15 ? 803  MET B N     1 
ATOM   3027 C  CA    . MET B 1 146 ? 14.621  -12.239 13.917 1.00 29.30 ? 803  MET B CA    1 
ATOM   3028 C  C     . MET B 1 146 ? 15.376  -11.694 12.715 1.00 29.23 ? 803  MET B C     1 
ATOM   3029 O  O     . MET B 1 146 ? 16.427  -12.223 12.347 1.00 29.24 ? 803  MET B O     1 
ATOM   3030 C  CB    . MET B 1 146 ? 13.594  -13.271 13.472 1.00 29.40 ? 803  MET B CB    1 
ATOM   3031 C  CG    . MET B 1 146 ? 13.176  -14.207 14.575 1.00 29.78 ? 803  MET B CG    1 
ATOM   3032 S  SD    . MET B 1 146 ? 14.536  -15.295 15.013 1.00 30.67 ? 803  MET B SD    1 
ATOM   3033 C  CE    . MET B 1 146 ? 14.277  -15.421 16.767 1.00 30.22 ? 803  MET B CE    1 
ATOM   3034 N  N     . TYR B 1 147 ? 14.835  -10.642 12.105 1.00 29.15 ? 804  TYR B N     1 
ATOM   3035 C  CA    . TYR B 1 147 ? 15.529  -9.953  11.026 1.00 29.08 ? 804  TYR B CA    1 
ATOM   3036 C  C     . TYR B 1 147 ? 16.809  -9.320  11.562 1.00 28.97 ? 804  TYR B C     1 
ATOM   3037 O  O     . TYR B 1 147 ? 17.858  -9.405  10.921 1.00 28.95 ? 804  TYR B O     1 
ATOM   3038 C  CB    . TYR B 1 147 ? 14.628  -8.905  10.363 1.00 29.11 ? 804  TYR B CB    1 
ATOM   3039 C  CG    . TYR B 1 147 ? 15.340  -8.039  9.341  1.00 29.26 ? 804  TYR B CG    1 
ATOM   3040 C  CD1   . TYR B 1 147 ? 15.648  -6.709  9.624  1.00 29.53 ? 804  TYR B CD1   1 
ATOM   3041 C  CD2   . TYR B 1 147 ? 15.713  -8.552  8.097  1.00 29.33 ? 804  TYR B CD2   1 
ATOM   3042 C  CE1   . TYR B 1 147 ? 16.305  -5.908  8.695  1.00 29.59 ? 804  TYR B CE1   1 
ATOM   3043 C  CE2   . TYR B 1 147 ? 16.372  -7.759  7.161  1.00 29.43 ? 804  TYR B CE2   1 
ATOM   3044 C  CZ    . TYR B 1 147 ? 16.663  -6.439  7.468  1.00 29.57 ? 804  TYR B CZ    1 
ATOM   3045 O  OH    . TYR B 1 147 ? 17.311  -5.649  6.548  1.00 29.66 ? 804  TYR B OH    1 
ATOM   3046 N  N     . TYR B 1 148 ? 16.719  -8.698  12.736 1.00 28.86 ? 805  TYR B N     1 
ATOM   3047 C  CA    . TYR B 1 148 ? 17.893  -8.126  13.382 1.00 28.82 ? 805  TYR B CA    1 
ATOM   3048 C  C     . TYR B 1 148 ? 18.971  -9.192  13.576 1.00 28.96 ? 805  TYR B C     1 
ATOM   3049 O  O     . TYR B 1 148 ? 20.121  -8.998  13.176 1.00 28.98 ? 805  TYR B O     1 
ATOM   3050 C  CB    . TYR B 1 148 ? 17.527  -7.478  14.719 1.00 28.70 ? 805  TYR B CB    1 
ATOM   3051 C  CG    . TYR B 1 148 ? 18.721  -6.948  15.474 1.00 28.49 ? 805  TYR B CG    1 
ATOM   3052 C  CD1   . TYR B 1 148 ? 19.201  -5.662  15.243 1.00 28.34 ? 805  TYR B CD1   1 
ATOM   3053 C  CD2   . TYR B 1 148 ? 19.383  -7.740  16.411 1.00 28.36 ? 805  TYR B CD2   1 
ATOM   3054 C  CE1   . TYR B 1 148 ? 20.303  -5.175  15.935 1.00 28.32 ? 805  TYR B CE1   1 
ATOM   3055 C  CE2   . TYR B 1 148 ? 20.482  -7.263  17.107 1.00 28.22 ? 805  TYR B CE2   1 
ATOM   3056 C  CZ    . TYR B 1 148 ? 20.938  -5.983  16.863 1.00 28.23 ? 805  TYR B CZ    1 
ATOM   3057 O  OH    . TYR B 1 148 ? 22.029  -5.507  17.550 1.00 28.36 ? 805  TYR B OH    1 
ATOM   3058 N  N     . LEU B 1 149 ? 18.586  -10.313 14.186 1.00 29.17 ? 806  LEU B N     1 
ATOM   3059 C  CA    . LEU B 1 149 ? 19.489  -11.441 14.407 1.00 29.37 ? 806  LEU B CA    1 
ATOM   3060 C  C     . LEU B 1 149 ? 20.121  -11.918 13.114 1.00 29.59 ? 806  LEU B C     1 
ATOM   3061 O  O     . LEU B 1 149 ? 21.336  -12.129 13.052 1.00 29.70 ? 806  LEU B O     1 
ATOM   3062 C  CB    . LEU B 1 149 ? 18.754  -12.603 15.077 1.00 29.30 ? 806  LEU B CB    1 
ATOM   3063 C  CG    . LEU B 1 149 ? 18.336  -12.402 16.533 1.00 29.41 ? 806  LEU B CG    1 
ATOM   3064 C  CD1   . LEU B 1 149 ? 17.643  -13.640 17.075 1.00 29.38 ? 806  LEU B CD1   1 
ATOM   3065 C  CD2   . LEU B 1 149 ? 19.528  -12.020 17.411 1.00 29.42 ? 806  LEU B CD2   1 
ATOM   3066 N  N     . GLU B 1 150 ? 19.293  -12.080 12.085 1.00 29.88 ? 807  GLU B N     1 
ATOM   3067 C  CA    . GLU B 1 150 ? 19.763  -12.501 10.771 1.00 30.16 ? 807  GLU B CA    1 
ATOM   3068 C  C     . GLU B 1 150 ? 20.813  -11.534 10.228 1.00 30.10 ? 807  GLU B C     1 
ATOM   3069 O  O     . GLU B 1 150 ? 21.842  -11.955 9.695  1.00 30.12 ? 807  GLU B O     1 
ATOM   3070 C  CB    . GLU B 1 150 ? 18.595  -12.594 9.789  1.00 30.29 ? 807  GLU B CB    1 
ATOM   3071 C  CG    . GLU B 1 150 ? 18.767  -13.690 8.763  1.00 30.96 ? 807  GLU B CG    1 
ATOM   3072 C  CD    . GLU B 1 150 ? 18.237  -13.317 7.401  1.00 31.83 ? 807  GLU B CD    1 
ATOM   3073 O  OE1   . GLU B 1 150 ? 18.952  -12.607 6.661  1.00 32.09 ? 807  GLU B OE1   1 
ATOM   3074 O  OE2   . GLU B 1 150 ? 17.113  -13.747 7.061  1.00 32.37 ? 807  GLU B OE2   1 
ATOM   3075 N  N     . GLU B 1 151 ? 20.543  -10.240 10.382 1.00 30.05 ? 808  GLU B N     1 
ATOM   3076 C  CA    . GLU B 1 151 ? 21.403  -9.180  9.869  1.00 30.00 ? 808  GLU B CA    1 
ATOM   3077 C  C     . GLU B 1 151 ? 22.802  -9.178  10.464 1.00 29.81 ? 808  GLU B C     1 
ATOM   3078 O  O     . GLU B 1 151 ? 23.764  -8.806  9.792  1.00 29.82 ? 808  GLU B O     1 
ATOM   3079 C  CB    . GLU B 1 151 ? 20.762  -7.823  10.114 1.00 30.10 ? 808  GLU B CB    1 
ATOM   3080 C  CG    . GLU B 1 151 ? 19.984  -7.289  8.942  1.00 30.62 ? 808  GLU B CG    1 
ATOM   3081 C  CD    . GLU B 1 151 ? 19.977  -5.777  8.921  1.00 31.35 ? 808  GLU B CD    1 
ATOM   3082 O  OE1   . GLU B 1 151 ? 19.697  -5.164  9.976  1.00 31.52 ? 808  GLU B OE1   1 
ATOM   3083 O  OE2   . GLU B 1 151 ? 20.258  -5.199  7.850  1.00 31.57 ? 808  GLU B OE2   1 
ATOM   3084 N  N     . HIS B 1 152 ? 22.909  -9.577  11.727 1.00 29.55 ? 809  HIS B N     1 
ATOM   3085 C  CA    . HIS B 1 152 ? 24.202  -9.649  12.392 1.00 29.24 ? 809  HIS B CA    1 
ATOM   3086 C  C     . HIS B 1 152 ? 24.744  -11.081 12.406 1.00 28.78 ? 809  HIS B C     1 
ATOM   3087 O  O     . HIS B 1 152 ? 25.731  -11.378 13.083 1.00 28.77 ? 809  HIS B O     1 
ATOM   3088 C  CB    . HIS B 1 152 ? 24.112  -9.053  13.799 1.00 29.40 ? 809  HIS B CB    1 
ATOM   3089 C  CG    . HIS B 1 152 ? 23.836  -7.580  13.811 1.00 29.93 ? 809  HIS B CG    1 
ATOM   3090 N  ND1   . HIS B 1 152 ? 24.827  -6.637  13.980 1.00 30.34 ? 809  HIS B ND1   1 
ATOM   3091 C  CD2   . HIS B 1 152 ? 22.680  -6.888  13.666 1.00 30.33 ? 809  HIS B CD2   1 
ATOM   3092 C  CE1   . HIS B 1 152 ? 24.294  -5.429  13.943 1.00 30.53 ? 809  HIS B CE1   1 
ATOM   3093 N  NE2   . HIS B 1 152 ? 22.993  -5.553  13.753 1.00 30.60 ? 809  HIS B NE2   1 
ATOM   3094 N  N     . GLY B 1 153 ? 24.087  -11.959 11.649 1.00 28.23 ? 810  GLY B N     1 
ATOM   3095 C  CA    . GLY B 1 153 ? 24.569  -13.319 11.412 1.00 27.53 ? 810  GLY B CA    1 
ATOM   3096 C  C     . GLY B 1 153 ? 24.276  -14.348 12.490 1.00 27.09 ? 810  GLY B C     1 
ATOM   3097 O  O     . GLY B 1 153 ? 24.893  -15.415 12.507 1.00 27.07 ? 810  GLY B O     1 
ATOM   3098 N  N     . MET B 1 154 ? 23.328  -14.044 13.377 1.00 26.59 ? 811  MET B N     1 
ATOM   3099 C  CA    . MET B 1 154 ? 23.004  -14.921 14.509 1.00 26.10 ? 811  MET B CA    1 
ATOM   3100 C  C     . MET B 1 154 ? 21.850  -15.890 14.230 1.00 25.79 ? 811  MET B C     1 
ATOM   3101 O  O     . MET B 1 154 ? 20.681  -15.491 14.172 1.00 25.81 ? 811  MET B O     1 
ATOM   3102 C  CB    . MET B 1 154 ? 22.721  -14.092 15.772 1.00 26.10 ? 811  MET B CB    1 
ATOM   3103 C  CG    . MET B 1 154 ? 22.303  -14.900 17.008 1.00 25.96 ? 811  MET B CG    1 
ATOM   3104 S  SD    . MET B 1 154 ? 23.541  -16.070 17.616 1.00 26.03 ? 811  MET B SD    1 
ATOM   3105 C  CE    . MET B 1 154 ? 24.840  -14.958 18.166 1.00 25.63 ? 811  MET B CE    1 
ATOM   3106 N  N     . VAL B 1 155 ? 22.191  -17.162 14.058 1.00 25.32 ? 812  VAL B N     1 
ATOM   3107 C  CA    . VAL B 1 155 ? 21.189  -18.214 13.956 1.00 24.83 ? 812  VAL B CA    1 
ATOM   3108 C  C     . VAL B 1 155 ? 20.683  -18.523 15.365 1.00 24.61 ? 812  VAL B C     1 
ATOM   3109 O  O     . VAL B 1 155 ? 21.474  -18.678 16.299 1.00 24.82 ? 812  VAL B O     1 
ATOM   3110 C  CB    . VAL B 1 155 ? 21.761  -19.475 13.264 1.00 24.78 ? 812  VAL B CB    1 
ATOM   3111 C  CG1   . VAL B 1 155 ? 20.761  -20.622 13.294 1.00 24.68 ? 812  VAL B CG1   1 
ATOM   3112 C  CG2   . VAL B 1 155 ? 22.158  -19.156 11.824 1.00 24.76 ? 812  VAL B CG2   1 
ATOM   3113 N  N     . HIS B 1 156 ? 19.363  -18.594 15.509 1.00 24.21 ? 813  HIS B N     1 
ATOM   3114 C  CA    . HIS B 1 156 ? 18.721  -18.780 16.807 1.00 23.80 ? 813  HIS B CA    1 
ATOM   3115 C  C     . HIS B 1 156 ? 18.783  -20.228 17.300 1.00 23.68 ? 813  HIS B C     1 
ATOM   3116 O  O     . HIS B 1 156 ? 19.210  -20.486 18.429 1.00 23.72 ? 813  HIS B O     1 
ATOM   3117 C  CB    . HIS B 1 156 ? 17.268  -18.305 16.740 1.00 23.64 ? 813  HIS B CB    1 
ATOM   3118 C  CG    . HIS B 1 156 ? 16.623  -18.151 18.079 1.00 23.19 ? 813  HIS B CG    1 
ATOM   3119 N  ND1   . HIS B 1 156 ? 16.424  -19.211 18.936 1.00 22.86 ? 813  HIS B ND1   1 
ATOM   3120 C  CD2   . HIS B 1 156 ? 16.131  -17.061 18.710 1.00 22.77 ? 813  HIS B CD2   1 
ATOM   3121 C  CE1   . HIS B 1 156 ? 15.841  -18.779 20.039 1.00 22.79 ? 813  HIS B CE1   1 
ATOM   3122 N  NE2   . HIS B 1 156 ? 15.646  -17.479 19.925 1.00 22.65 ? 813  HIS B NE2   1 
ATOM   3123 N  N     . ARG B 1 157 ? 18.333  -21.153 16.449 1.00 23.43 ? 814  ARG B N     1 
ATOM   3124 C  CA    . ARG B 1 157 ? 18.309  -22.600 16.724 1.00 23.22 ? 814  ARG B CA    1 
ATOM   3125 C  C     . ARG B 1 157 ? 17.222  -23.085 17.696 1.00 23.14 ? 814  ARG B C     1 
ATOM   3126 O  O     . ARG B 1 157 ? 16.972  -24.289 17.789 1.00 23.07 ? 814  ARG B O     1 
ATOM   3127 C  CB    . ARG B 1 157 ? 19.690  -23.122 17.154 1.00 23.30 ? 814  ARG B CB    1 
ATOM   3128 C  CG    . ARG B 1 157 ? 20.694  -23.257 16.016 1.00 23.27 ? 814  ARG B CG    1 
ATOM   3129 C  CD    . ARG B 1 157 ? 21.898  -24.100 16.420 1.00 23.38 ? 814  ARG B CD    1 
ATOM   3130 N  NE    . ARG B 1 157 ? 21.538  -25.485 16.733 1.00 23.49 ? 814  ARG B NE    1 
ATOM   3131 C  CZ    . ARG B 1 157 ? 22.404  -26.434 17.088 1.00 23.75 ? 814  ARG B CZ    1 
ATOM   3132 N  NH1   . ARG B 1 157 ? 23.703  -26.167 17.179 1.00 23.58 ? 814  ARG B NH1   1 
ATOM   3133 N  NH2   . ARG B 1 157 ? 21.971  -27.658 17.357 1.00 23.83 ? 814  ARG B NH2   1 
ATOM   3134 N  N     . ASN B 1 158 ? 16.578  -22.161 18.407 1.00 23.07 ? 815  ASN B N     1 
ATOM   3135 C  CA    . ASN B 1 158 ? 15.547  -22.529 19.379 1.00 23.11 ? 815  ASN B CA    1 
ATOM   3136 C  C     . ASN B 1 158 ? 14.436  -21.486 19.507 1.00 23.19 ? 815  ASN B C     1 
ATOM   3137 O  O     . ASN B 1 158 ? 14.009  -21.149 20.614 1.00 23.12 ? 815  ASN B O     1 
ATOM   3138 C  CB    . ASN B 1 158 ? 16.189  -22.791 20.746 1.00 23.16 ? 815  ASN B CB    1 
ATOM   3139 C  CG    . ASN B 1 158 ? 15.376  -23.740 21.612 1.00 23.33 ? 815  ASN B CG    1 
ATOM   3140 O  OD1   . ASN B 1 158 ? 14.151  -23.671 21.663 1.00 23.80 ? 815  ASN B OD1   1 
ATOM   3141 N  ND2   . ASN B 1 158 ? 16.067  -24.625 22.314 1.00 23.91 ? 815  ASN B ND2   1 
ATOM   3142 N  N     . LEU B 1 159 ? 13.972  -20.962 18.379 1.00 23.31 ? 816  LEU B N     1 
ATOM   3143 C  CA    . LEU B 1 159 ? 12.899  -19.979 18.412 1.00 23.46 ? 816  LEU B CA    1 
ATOM   3144 C  C     . LEU B 1 159 ? 11.535  -20.667 18.530 1.00 23.52 ? 816  LEU B C     1 
ATOM   3145 O  O     . LEU B 1 159 ? 11.199  -21.552 17.741 1.00 23.54 ? 816  LEU B O     1 
ATOM   3146 C  CB    . LEU B 1 159 ? 12.971  -19.049 17.196 1.00 23.46 ? 816  LEU B CB    1 
ATOM   3147 C  CG    . LEU B 1 159 ? 11.710  -18.260 16.828 1.00 23.85 ? 816  LEU B CG    1 
ATOM   3148 C  CD1   . LEU B 1 159 ? 11.359  -17.176 17.854 1.00 23.97 ? 816  LEU B CD1   1 
ATOM   3149 C  CD2   . LEU B 1 159 ? 11.853  -17.669 15.436 1.00 24.40 ? 816  LEU B CD2   1 
ATOM   3150 N  N     . ALA B 1 160 ? 10.768  -20.245 19.534 1.00 23.57 ? 817  ALA B N     1 
ATOM   3151 C  CA    . ALA B 1 160 ? 9.462   -20.816 19.864 1.00 23.63 ? 817  ALA B CA    1 
ATOM   3152 C  C     . ALA B 1 160 ? 8.723   -19.840 20.776 1.00 23.73 ? 817  ALA B C     1 
ATOM   3153 O  O     . ALA B 1 160 ? 9.312   -18.866 21.252 1.00 23.90 ? 817  ALA B O     1 
ATOM   3154 C  CB    . ALA B 1 160 ? 9.627   -22.164 20.550 1.00 23.58 ? 817  ALA B CB    1 
ATOM   3155 N  N     . ALA B 1 161 ? 7.440   -20.094 21.020 1.00 23.69 ? 818  ALA B N     1 
ATOM   3156 C  CA    . ALA B 1 161 ? 6.613   -19.172 21.803 1.00 23.54 ? 818  ALA B CA    1 
ATOM   3157 C  C     . ALA B 1 161 ? 6.980   -19.156 23.285 1.00 23.41 ? 818  ALA B C     1 
ATOM   3158 O  O     . ALA B 1 161 ? 6.752   -18.157 23.969 1.00 23.43 ? 818  ALA B O     1 
ATOM   3159 C  CB    . ALA B 1 161 ? 5.134   -19.477 21.613 1.00 23.62 ? 818  ALA B CB    1 
ATOM   3160 N  N     . ARG B 1 162 ? 7.541   -20.262 23.773 1.00 23.28 ? 819  ARG B N     1 
ATOM   3161 C  CA    . ARG B 1 162 ? 8.106   -20.319 25.124 1.00 23.19 ? 819  ARG B CA    1 
ATOM   3162 C  C     . ARG B 1 162 ? 9.348   -19.429 25.203 1.00 23.38 ? 819  ARG B C     1 
ATOM   3163 O  O     . ARG B 1 162 ? 9.780   -19.042 26.290 1.00 23.40 ? 819  ARG B O     1 
ATOM   3164 C  CB    . ARG B 1 162 ? 8.464   -21.758 25.512 1.00 23.03 ? 819  ARG B CB    1 
ATOM   3165 C  CG    . ARG B 1 162 ? 9.654   -22.310 24.752 1.00 22.59 ? 819  ARG B CG    1 
ATOM   3166 C  CD    . ARG B 1 162 ? 9.922   -23.766 25.044 1.00 22.13 ? 819  ARG B CD    1 
ATOM   3167 N  NE    . ARG B 1 162 ? 10.857  -24.309 24.061 1.00 22.20 ? 819  ARG B NE    1 
ATOM   3168 C  CZ    . ARG B 1 162 ? 10.498  -24.833 22.891 1.00 22.54 ? 819  ARG B CZ    1 
ATOM   3169 N  NH1   . ARG B 1 162 ? 9.215   -24.902 22.553 1.00 22.67 ? 819  ARG B NH1   1 
ATOM   3170 N  NH2   . ARG B 1 162 ? 11.421  -25.295 22.058 1.00 22.52 ? 819  ARG B NH2   1 
ATOM   3171 N  N     . ASN B 1 163 ? 9.913   -19.115 24.039 1.00 23.65 ? 820  ASN B N     1 
ATOM   3172 C  CA    . ASN B 1 163 ? 11.100  -18.277 23.951 1.00 23.94 ? 820  ASN B CA    1 
ATOM   3173 C  C     . ASN B 1 163 ? 10.843  -16.850 23.472 1.00 24.24 ? 820  ASN B C     1 
ATOM   3174 O  O     . ASN B 1 163 ? 11.782  -16.111 23.162 1.00 24.28 ? 820  ASN B O     1 
ATOM   3175 C  CB    . ASN B 1 163 ? 12.170  -18.960 23.103 1.00 23.86 ? 820  ASN B CB    1 
ATOM   3176 C  CG    . ASN B 1 163 ? 12.888  -20.050 23.862 1.00 23.91 ? 820  ASN B CG    1 
ATOM   3177 O  OD1   . ASN B 1 163 ? 13.169  -19.907 25.052 1.00 23.87 ? 820  ASN B OD1   1 
ATOM   3178 N  ND2   . ASN B 1 163 ? 13.184  -21.152 23.184 1.00 24.01 ? 820  ASN B ND2   1 
ATOM   3179 N  N     . VAL B 1 164 ? 9.571   -16.468 23.406 1.00 24.69 ? 821  VAL B N     1 
ATOM   3180 C  CA    . VAL B 1 164 ? 9.209   -15.070 23.205 1.00 25.13 ? 821  VAL B CA    1 
ATOM   3181 C  C     . VAL B 1 164 ? 8.635   -14.571 24.529 1.00 25.56 ? 821  VAL B C     1 
ATOM   3182 O  O     . VAL B 1 164 ? 7.775   -15.226 25.122 1.00 25.63 ? 821  VAL B O     1 
ATOM   3183 C  CB    . VAL B 1 164 ? 8.206   -14.881 22.039 1.00 25.10 ? 821  VAL B CB    1 
ATOM   3184 C  CG1   . VAL B 1 164 ? 7.882   -13.406 21.839 1.00 25.09 ? 821  VAL B CG1   1 
ATOM   3185 C  CG2   . VAL B 1 164 ? 8.762   -15.469 20.749 1.00 24.79 ? 821  VAL B CG2   1 
ATOM   3186 N  N     . LEU B 1 165 ? 9.135   -13.426 24.994 1.00 26.06 ? 822  LEU B N     1 
ATOM   3187 C  CA    . LEU B 1 165 ? 8.779   -12.877 26.305 1.00 26.51 ? 822  LEU B CA    1 
ATOM   3188 C  C     . LEU B 1 165 ? 8.204   -11.470 26.176 1.00 26.89 ? 822  LEU B C     1 
ATOM   3189 O  O     . LEU B 1 165 ? 8.568   -10.732 25.261 1.00 26.95 ? 822  LEU B O     1 
ATOM   3190 C  CB    . LEU B 1 165 ? 10.013  -12.820 27.217 1.00 26.47 ? 822  LEU B CB    1 
ATOM   3191 C  CG    . LEU B 1 165 ? 10.878  -14.048 27.532 1.00 26.48 ? 822  LEU B CG    1 
ATOM   3192 C  CD1   . LEU B 1 165 ? 12.138  -13.621 28.272 1.00 26.61 ? 822  LEU B CD1   1 
ATOM   3193 C  CD2   . LEU B 1 165 ? 10.128  -15.092 28.345 1.00 26.52 ? 822  LEU B CD2   1 
ATOM   3194 N  N     . LEU B 1 166 ? 7.327   -11.096 27.107 1.00 27.35 ? 823  LEU B N     1 
ATOM   3195 C  CA    . LEU B 1 166 ? 6.749   -9.749  27.134 1.00 27.73 ? 823  LEU B CA    1 
ATOM   3196 C  C     . LEU B 1 166 ? 7.624   -8.771  27.928 1.00 27.92 ? 823  LEU B C     1 
ATOM   3197 O  O     . LEU B 1 166 ? 7.871   -8.974  29.120 1.00 27.97 ? 823  LEU B O     1 
ATOM   3198 C  CB    . LEU B 1 166 ? 5.328   -9.765  27.721 1.00 27.76 ? 823  LEU B CB    1 
ATOM   3199 C  CG    . LEU B 1 166 ? 4.307   -10.859 27.370 1.00 27.92 ? 823  LEU B CG    1 
ATOM   3200 C  CD1   . LEU B 1 166 ? 3.060   -10.702 28.227 1.00 28.05 ? 823  LEU B CD1   1 
ATOM   3201 C  CD2   . LEU B 1 166 ? 3.932   -10.866 25.900 1.00 27.94 ? 823  LEU B CD2   1 
ATOM   3202 N  N     . LYS B 1 167 ? 8.099   -7.724  27.256 1.00 28.11 ? 824  LYS B N     1 
ATOM   3203 C  CA    . LYS B 1 167 ? 8.784   -6.612  27.921 1.00 28.27 ? 824  LYS B CA    1 
ATOM   3204 C  C     . LYS B 1 167 ? 7.730   -5.685  28.537 1.00 28.24 ? 824  LYS B C     1 
ATOM   3205 O  O     . LYS B 1 167 ? 7.962   -5.058  29.575 1.00 28.28 ? 824  LYS B O     1 
ATOM   3206 C  CB    . LYS B 1 167 ? 9.702   -5.873  26.927 1.00 28.33 ? 824  LYS B CB    1 
ATOM   3207 C  CG    . LYS B 1 167 ? 10.104  -4.436  27.301 1.00 28.70 ? 824  LYS B CG    1 
ATOM   3208 C  CD    . LYS B 1 167 ? 11.397  -4.351  28.112 1.00 29.25 ? 824  LYS B CD    1 
ATOM   3209 C  CE    . LYS B 1 167 ? 11.701  -2.899  28.485 1.00 29.54 ? 824  LYS B CE    1 
ATOM   3210 N  NZ    . LYS B 1 167 ? 13.121  -2.706  28.960 1.00 29.70 ? 824  LYS B NZ    1 
ATOM   3211 N  N     . SER B 1 168 ? 6.570   -5.620  27.887 1.00 28.18 ? 825  SER B N     1 
ATOM   3212 C  CA    . SER B 1 168 ? 5.397   -4.927  28.416 1.00 28.07 ? 825  SER B CA    1 
ATOM   3213 C  C     . SER B 1 168 ? 4.140   -5.616  27.875 1.00 27.90 ? 825  SER B C     1 
ATOM   3214 O  O     . SER B 1 168 ? 4.247   -6.467  26.988 1.00 27.88 ? 825  SER B O     1 
ATOM   3215 C  CB    . SER B 1 168 ? 5.429   -3.437  28.049 1.00 28.11 ? 825  SER B CB    1 
ATOM   3216 O  OG    . SER B 1 168 ? 5.229   -3.239  26.661 1.00 28.26 ? 825  SER B OG    1 
ATOM   3217 N  N     . PRO B 1 169 ? 2.948   -5.265  28.407 1.00 27.72 ? 826  PRO B N     1 
ATOM   3218 C  CA    . PRO B 1 169 ? 1.708   -5.896  27.946 1.00 27.56 ? 826  PRO B CA    1 
ATOM   3219 C  C     . PRO B 1 169 ? 1.504   -5.864  26.428 1.00 27.41 ? 826  PRO B C     1 
ATOM   3220 O  O     . PRO B 1 169 ? 0.700   -6.640  25.907 1.00 27.44 ? 826  PRO B O     1 
ATOM   3221 C  CB    . PRO B 1 169 ? 0.624   -5.073  28.644 1.00 27.55 ? 826  PRO B CB    1 
ATOM   3222 C  CG    . PRO B 1 169 ? 1.265   -4.627  29.899 1.00 27.60 ? 826  PRO B CG    1 
ATOM   3223 C  CD    . PRO B 1 169 ? 2.695   -4.345  29.534 1.00 27.74 ? 826  PRO B CD    1 
ATOM   3224 N  N     . SER B 1 170 ? 2.226   -4.986  25.733 1.00 27.21 ? 827  SER B N     1 
ATOM   3225 C  CA    . SER B 1 170 ? 2.136   -4.898  24.275 1.00 27.02 ? 827  SER B CA    1 
ATOM   3226 C  C     . SER B 1 170 ? 3.423   -5.307  23.545 1.00 26.95 ? 827  SER B C     1 
ATOM   3227 O  O     . SER B 1 170 ? 3.363   -5.850  22.442 1.00 26.95 ? 827  SER B O     1 
ATOM   3228 C  CB    . SER B 1 170 ? 1.695   -3.497  23.839 1.00 27.00 ? 827  SER B CB    1 
ATOM   3229 O  OG    . SER B 1 170 ? 2.757   -2.551  23.988 1.00 26.88 ? 827  SER B OG    1 
ATOM   3230 N  N     . GLN B 1 171 ? 4.576   -5.044  24.155 1.00 26.87 ? 828  GLN B N     1 
ATOM   3231 C  CA    . GLN B 1 171 ? 5.865   -5.299  23.504 1.00 26.79 ? 828  GLN B CA    1 
ATOM   3232 C  C     . GLN B 1 171 ? 6.413   -6.689  23.814 1.00 26.57 ? 828  GLN B C     1 
ATOM   3233 O  O     . GLN B 1 171 ? 6.339   -7.152  24.954 1.00 26.63 ? 828  GLN B O     1 
ATOM   3234 C  CB    . GLN B 1 171 ? 6.890   -4.222  23.884 1.00 26.88 ? 828  GLN B CB    1 
ATOM   3235 C  CG    . GLN B 1 171 ? 6.455   -2.793  23.560 1.00 27.30 ? 828  GLN B CG    1 
ATOM   3236 C  CD    . GLN B 1 171 ? 6.178   -2.580  22.081 1.00 27.88 ? 828  GLN B CD    1 
ATOM   3237 O  OE1   . GLN B 1 171 ? 5.027   -2.606  21.643 1.00 28.10 ? 828  GLN B OE1   1 
ATOM   3238 N  NE2   . GLN B 1 171 ? 7.236   -2.378  21.303 1.00 28.18 ? 828  GLN B NE2   1 
ATOM   3239 N  N     . VAL B 1 172 ? 6.958   -7.351  22.794 1.00 26.23 ? 829  VAL B N     1 
ATOM   3240 C  CA    . VAL B 1 172 ? 7.562   -8.677  22.968 1.00 25.92 ? 829  VAL B CA    1 
ATOM   3241 C  C     . VAL B 1 172 ? 9.013   -8.731  22.506 1.00 25.74 ? 829  VAL B C     1 
ATOM   3242 O  O     . VAL B 1 172 ? 9.443   -7.924  21.678 1.00 25.74 ? 829  VAL B O     1 
ATOM   3243 C  CB    . VAL B 1 172 ? 6.770   -9.802  22.255 1.00 25.91 ? 829  VAL B CB    1 
ATOM   3244 C  CG1   . VAL B 1 172 ? 5.459   -10.066 22.959 1.00 25.76 ? 829  VAL B CG1   1 
ATOM   3245 C  CG2   . VAL B 1 172 ? 6.562   -9.489  20.778 1.00 25.95 ? 829  VAL B CG2   1 
ATOM   3246 N  N     . GLN B 1 173 ? 9.755   -9.697  23.038 1.00 25.50 ? 830  GLN B N     1 
ATOM   3247 C  CA    . GLN B 1 173 ? 11.174  -9.819  22.746 1.00 25.27 ? 830  GLN B CA    1 
ATOM   3248 C  C     . GLN B 1 173 ? 11.605  -11.257 22.554 1.00 25.25 ? 830  GLN B C     1 
ATOM   3249 O  O     . GLN B 1 173 ? 11.205  -12.142 23.315 1.00 25.18 ? 830  GLN B O     1 
ATOM   3250 C  CB    . GLN B 1 173 ? 11.990  -9.200  23.870 1.00 25.27 ? 830  GLN B CB    1 
ATOM   3251 C  CG    . GLN B 1 173 ? 11.922  -7.696  23.916 1.00 25.11 ? 830  GLN B CG    1 
ATOM   3252 C  CD    . GLN B 1 173 ? 12.754  -7.128  25.029 1.00 24.81 ? 830  GLN B CD    1 
ATOM   3253 O  OE1   . GLN B 1 173 ? 12.795  -7.675  26.131 1.00 24.67 ? 830  GLN B OE1   1 
ATOM   3254 N  NE2   . GLN B 1 173 ? 13.426  -6.018  24.754 1.00 24.72 ? 830  GLN B NE2   1 
ATOM   3255 N  N     . VAL B 1 174 ? 12.433  -11.483 21.540 1.00 25.29 ? 831  VAL B N     1 
ATOM   3256 C  CA    . VAL B 1 174 ? 12.984  -12.808 21.285 1.00 25.50 ? 831  VAL B CA    1 
ATOM   3257 C  C     . VAL B 1 174 ? 14.074  -13.170 22.306 1.00 25.73 ? 831  VAL B C     1 
ATOM   3258 O  O     . VAL B 1 174 ? 15.053  -12.434 22.486 1.00 25.81 ? 831  VAL B O     1 
ATOM   3259 C  CB    . VAL B 1 174 ? 13.522  -12.926 19.846 1.00 25.45 ? 831  VAL B CB    1 
ATOM   3260 C  CG1   . VAL B 1 174 ? 14.363  -14.178 19.691 1.00 25.51 ? 831  VAL B CG1   1 
ATOM   3261 C  CG2   . VAL B 1 174 ? 12.373  -12.918 18.847 1.00 25.43 ? 831  VAL B CG2   1 
ATOM   3262 N  N     . ALA B 1 175 ? 13.886  -14.309 22.969 1.00 25.90 ? 832  ALA B N     1 
ATOM   3263 C  CA    . ALA B 1 175 ? 14.813  -14.782 23.995 1.00 26.09 ? 832  ALA B CA    1 
ATOM   3264 C  C     . ALA B 1 175 ? 15.533  -16.064 23.571 1.00 26.25 ? 832  ALA B C     1 
ATOM   3265 O  O     . ALA B 1 175 ? 15.137  -16.717 22.600 1.00 26.31 ? 832  ALA B O     1 
ATOM   3266 C  CB    . ALA B 1 175 ? 14.072  -14.999 25.312 1.00 25.99 ? 832  ALA B CB    1 
ATOM   3267 N  N     . ASP B 1 176 ? 16.600  -16.397 24.300 1.00 26.38 ? 833  ASP B N     1 
ATOM   3268 C  CA    . ASP B 1 176 ? 17.294  -17.691 24.196 1.00 26.49 ? 833  ASP B CA    1 
ATOM   3269 C  C     . ASP B 1 176 ? 18.014  -17.992 22.878 1.00 26.35 ? 833  ASP B C     1 
ATOM   3270 O  O     . ASP B 1 176 ? 18.253  -19.159 22.553 1.00 26.41 ? 833  ASP B O     1 
ATOM   3271 C  CB    . ASP B 1 176 ? 16.349  -18.849 24.550 1.00 26.64 ? 833  ASP B CB    1 
ATOM   3272 C  CG    . ASP B 1 176 ? 16.340  -19.165 26.032 1.00 27.17 ? 833  ASP B CG    1 
ATOM   3273 O  OD1   . ASP B 1 176 ? 17.291  -18.778 26.744 1.00 28.07 ? 833  ASP B OD1   1 
ATOM   3274 O  OD2   . ASP B 1 176 ? 15.379  -19.814 26.490 1.00 27.47 ? 833  ASP B OD2   1 
ATOM   3275 N  N     . PHE B 1 177 ? 18.368  -16.953 22.131 1.00 26.08 ? 834  PHE B N     1 
ATOM   3276 C  CA    . PHE B 1 177 ? 19.141  -17.126 20.905 1.00 25.93 ? 834  PHE B CA    1 
ATOM   3277 C  C     . PHE B 1 177 ? 20.595  -17.478 21.217 1.00 26.03 ? 834  PHE B C     1 
ATOM   3278 O  O     . PHE B 1 177 ? 21.150  -17.041 22.232 1.00 26.01 ? 834  PHE B O     1 
ATOM   3279 C  CB    . PHE B 1 177 ? 19.084  -15.854 20.061 1.00 25.83 ? 834  PHE B CB    1 
ATOM   3280 C  CG    . PHE B 1 177 ? 19.377  -14.607 20.837 1.00 25.55 ? 834  PHE B CG    1 
ATOM   3281 C  CD1   . PHE B 1 177 ? 20.666  -14.084 20.877 1.00 25.33 ? 834  PHE B CD1   1 
ATOM   3282 C  CD2   . PHE B 1 177 ? 18.368  -13.960 21.541 1.00 25.18 ? 834  PHE B CD2   1 
ATOM   3283 C  CE1   . PHE B 1 177 ? 20.942  -12.933 21.602 1.00 25.10 ? 834  PHE B CE1   1 
ATOM   3284 C  CE2   . PHE B 1 177 ? 18.635  -12.814 22.269 1.00 25.04 ? 834  PHE B CE2   1 
ATOM   3285 C  CZ    . PHE B 1 177 ? 19.925  -12.298 22.299 1.00 24.87 ? 834  PHE B CZ    1 
ATOM   3286 N  N     . GLY B 1 178 ? 21.198  -18.281 20.343 1.00 26.07 ? 835  GLY B N     1 
ATOM   3287 C  CA    . GLY B 1 178 ? 22.617  -18.614 20.429 1.00 26.09 ? 835  GLY B CA    1 
ATOM   3288 C  C     . GLY B 1 178 ? 23.005  -19.707 21.411 1.00 26.16 ? 835  GLY B C     1 
ATOM   3289 O  O     . GLY B 1 178 ? 24.092  -20.277 21.297 1.00 26.20 ? 835  GLY B O     1 
ATOM   3290 N  N     . VAL B 1 179 ? 22.125  -20.006 22.364 1.00 26.21 ? 836  VAL B N     1 
ATOM   3291 C  CA    . VAL B 1 179 ? 22.427  -20.957 23.442 1.00 26.31 ? 836  VAL B CA    1 
ATOM   3292 C  C     . VAL B 1 179 ? 22.890  -22.327 22.931 1.00 26.50 ? 836  VAL B C     1 
ATOM   3293 O  O     . VAL B 1 179 ? 23.896  -22.856 23.402 1.00 26.50 ? 836  VAL B O     1 
ATOM   3294 C  CB    . VAL B 1 179 ? 21.235  -21.125 24.419 1.00 26.28 ? 836  VAL B CB    1 
ATOM   3295 C  CG1   . VAL B 1 179 ? 21.633  -21.980 25.614 1.00 26.13 ? 836  VAL B CG1   1 
ATOM   3296 C  CG2   . VAL B 1 179 ? 20.729  -19.764 24.890 1.00 26.27 ? 836  VAL B CG2   1 
ATOM   3297 N  N     . ALA B 1 180 ? 22.160  -22.879 21.963 1.00 26.84 ? 837  ALA B N     1 
ATOM   3298 C  CA    . ALA B 1 180 ? 22.456  -24.199 21.393 1.00 27.24 ? 837  ALA B CA    1 
ATOM   3299 C  C     . ALA B 1 180 ? 23.886  -24.364 20.868 1.00 27.55 ? 837  ALA B C     1 
ATOM   3300 O  O     . ALA B 1 180 ? 24.460  -25.450 20.961 1.00 27.45 ? 837  ALA B O     1 
ATOM   3301 C  CB    . ALA B 1 180 ? 21.451  -24.533 20.294 1.00 27.25 ? 837  ALA B CB    1 
ATOM   3302 N  N     . ASP B 1 181 ? 24.453  -23.295 20.314 1.00 28.12 ? 838  ASP B N     1 
ATOM   3303 C  CA    . ASP B 1 181 ? 25.799  -23.364 19.742 1.00 28.83 ? 838  ASP B CA    1 
ATOM   3304 C  C     . ASP B 1 181 ? 26.925  -23.278 20.785 1.00 29.19 ? 838  ASP B C     1 
ATOM   3305 O  O     . ASP B 1 181 ? 28.096  -23.468 20.452 1.00 29.17 ? 838  ASP B O     1 
ATOM   3306 C  CB    . ASP B 1 181 ? 25.977  -22.329 18.624 1.00 28.89 ? 838  ASP B CB    1 
ATOM   3307 C  CG    . ASP B 1 181 ? 25.223  -22.703 17.354 1.00 29.29 ? 838  ASP B CG    1 
ATOM   3308 O  OD1   . ASP B 1 181 ? 25.373  -23.850 16.878 1.00 29.54 ? 838  ASP B OD1   1 
ATOM   3309 O  OD2   . ASP B 1 181 ? 24.485  -21.843 16.825 1.00 29.74 ? 838  ASP B OD2   1 
ATOM   3310 N  N     . LEU B 1 182 ? 26.563  -23.008 22.041 1.00 29.77 ? 839  LEU B N     1 
ATOM   3311 C  CA    . LEU B 1 182 ? 27.513  -23.050 23.157 1.00 30.36 ? 839  LEU B CA    1 
ATOM   3312 C  C     . LEU B 1 182 ? 27.933  -24.473 23.525 1.00 30.89 ? 839  LEU B C     1 
ATOM   3313 O  O     . LEU B 1 182 ? 28.877  -24.661 24.297 1.00 30.94 ? 839  LEU B O     1 
ATOM   3314 C  CB    . LEU B 1 182 ? 26.933  -22.377 24.411 1.00 30.29 ? 839  LEU B CB    1 
ATOM   3315 C  CG    . LEU B 1 182 ? 27.050  -20.875 24.709 1.00 30.38 ? 839  LEU B CG    1 
ATOM   3316 C  CD1   . LEU B 1 182 ? 28.402  -20.291 24.304 1.00 30.51 ? 839  LEU B CD1   1 
ATOM   3317 C  CD2   . LEU B 1 182 ? 25.913  -20.096 24.090 1.00 30.53 ? 839  LEU B CD2   1 
ATOM   3318 N  N     . LEU B 1 183 ? 27.239  -25.470 22.981 1.00 31.66 ? 840  LEU B N     1 
ATOM   3319 C  CA    . LEU B 1 183 ? 27.442  -26.857 23.404 1.00 32.53 ? 840  LEU B CA    1 
ATOM   3320 C  C     . LEU B 1 183 ? 27.653  -27.828 22.244 1.00 33.33 ? 840  LEU B C     1 
ATOM   3321 O  O     . LEU B 1 183 ? 27.099  -27.626 21.160 1.00 33.36 ? 840  LEU B O     1 
ATOM   3322 C  CB    . LEU B 1 183 ? 26.250  -27.331 24.248 1.00 32.43 ? 840  LEU B CB    1 
ATOM   3323 C  CG    . LEU B 1 183 ? 25.790  -26.444 25.413 1.00 32.36 ? 840  LEU B CG    1 
ATOM   3324 C  CD1   . LEU B 1 183 ? 24.347  -26.779 25.766 1.00 32.31 ? 840  LEU B CD1   1 
ATOM   3325 C  CD2   . LEU B 1 183 ? 26.700  -26.653 26.638 1.00 32.50 ? 840  LEU B CD2   1 
ATOM   3326 N  N     . PRO B 1 184 ? 28.452  -28.892 22.473 1.00 34.26 ? 841  PRO B N     1 
ATOM   3327 C  CA    . PRO B 1 184 ? 28.622  -29.969 21.490 1.00 35.08 ? 841  PRO B CA    1 
ATOM   3328 C  C     . PRO B 1 184 ? 27.288  -30.662 21.163 1.00 36.00 ? 841  PRO B C     1 
ATOM   3329 O  O     . PRO B 1 184 ? 26.380  -30.647 21.998 1.00 36.02 ? 841  PRO B O     1 
ATOM   3330 C  CB    . PRO B 1 184 ? 29.570  -30.947 22.199 1.00 35.03 ? 841  PRO B CB    1 
ATOM   3331 C  CG    . PRO B 1 184 ? 29.492  -30.594 23.649 1.00 34.66 ? 841  PRO B CG    1 
ATOM   3332 C  CD    . PRO B 1 184 ? 29.275  -29.121 23.676 1.00 34.28 ? 841  PRO B CD    1 
ATOM   3333 N  N     . PRO B 1 185 ? 27.162  -31.260 19.957 1.00 36.91 ? 842  PRO B N     1 
ATOM   3334 C  CA    . PRO B 1 185 ? 25.895  -31.891 19.537 1.00 37.65 ? 842  PRO B CA    1 
ATOM   3335 C  C     . PRO B 1 185 ? 25.476  -33.109 20.381 1.00 38.39 ? 842  PRO B C     1 
ATOM   3336 O  O     . PRO B 1 185 ? 26.333  -33.881 20.818 1.00 38.46 ? 842  PRO B O     1 
ATOM   3337 C  CB    . PRO B 1 185 ? 26.173  -32.309 18.086 1.00 37.62 ? 842  PRO B CB    1 
ATOM   3338 C  CG    . PRO B 1 185 ? 27.317  -31.451 17.648 1.00 37.32 ? 842  PRO B CG    1 
ATOM   3339 C  CD    . PRO B 1 185 ? 28.161  -31.280 18.872 1.00 36.98 ? 842  PRO B CD    1 
ATOM   3340 N  N     . ASP B 1 186 ? 24.163  -33.265 20.590 1.00 39.20 ? 843  ASP B N     1 
ATOM   3341 C  CA    . ASP B 1 186 ? 23.586  -34.297 21.477 1.00 39.97 ? 843  ASP B CA    1 
ATOM   3342 C  C     . ASP B 1 186 ? 22.083  -34.511 21.208 1.00 40.47 ? 843  ASP B C     1 
ATOM   3343 O  O     . ASP B 1 186 ? 21.446  -33.684 20.550 1.00 40.56 ? 843  ASP B O     1 
ATOM   3344 C  CB    . ASP B 1 186 ? 23.811  -33.909 22.947 1.00 39.96 ? 843  ASP B CB    1 
ATOM   3345 C  CG    . ASP B 1 186 ? 23.189  -34.894 23.925 1.00 40.02 ? 843  ASP B CG    1 
ATOM   3346 O  OD1   . ASP B 1 186 ? 22.314  -34.474 24.710 1.00 39.98 ? 843  ASP B OD1   1 
ATOM   3347 O  OD2   . ASP B 1 186 ? 23.565  -36.086 23.905 1.00 40.05 ? 843  ASP B OD2   1 
ATOM   3348 N  N     . ASP B 1 187 ? 21.521  -35.610 21.721 1.00 41.05 ? 844  ASP B N     1 
ATOM   3349 C  CA    . ASP B 1 187 ? 20.092  -35.915 21.539 1.00 41.57 ? 844  ASP B CA    1 
ATOM   3350 C  C     . ASP B 1 187 ? 19.235  -35.832 22.811 1.00 41.81 ? 844  ASP B C     1 
ATOM   3351 O  O     . ASP B 1 187 ? 19.346  -36.670 23.713 1.00 41.84 ? 844  ASP B O     1 
ATOM   3352 C  CB    . ASP B 1 187 ? 19.904  -37.268 20.840 1.00 41.61 ? 844  ASP B CB    1 
ATOM   3353 C  CG    . ASP B 1 187 ? 20.059  -37.174 19.328 1.00 41.77 ? 844  ASP B CG    1 
ATOM   3354 O  OD1   . ASP B 1 187 ? 20.212  -36.049 18.800 1.00 41.69 ? 844  ASP B OD1   1 
ATOM   3355 O  OD2   . ASP B 1 187 ? 20.023  -38.231 18.663 1.00 41.97 ? 844  ASP B OD2   1 
ATOM   3356 N  N     . LYS B 1 188 ? 18.379  -34.809 22.855 1.00 42.05 ? 845  LYS B N     1 
ATOM   3357 C  CA    . LYS B 1 188 ? 17.471  -34.570 23.980 1.00 42.20 ? 845  LYS B CA    1 
ATOM   3358 C  C     . LYS B 1 188 ? 16.013  -34.495 23.518 1.00 42.24 ? 845  LYS B C     1 
ATOM   3359 O  O     . LYS B 1 188 ? 15.621  -33.587 22.779 1.00 42.22 ? 845  LYS B O     1 
ATOM   3360 C  CB    . LYS B 1 188 ? 17.856  -33.288 24.733 1.00 42.21 ? 845  LYS B CB    1 
ATOM   3361 C  CG    . LYS B 1 188 ? 19.292  -33.259 25.243 1.00 42.34 ? 845  LYS B CG    1 
ATOM   3362 C  CD    . LYS B 1 188 ? 19.496  -32.163 26.283 1.00 42.42 ? 845  LYS B CD    1 
ATOM   3363 C  CE    . LYS B 1 188 ? 20.978  -31.924 26.555 1.00 42.42 ? 845  LYS B CE    1 
ATOM   3364 N  NZ    . LYS B 1 188 ? 21.660  -31.225 25.427 1.00 42.38 ? 845  LYS B NZ    1 
ATOM   3365 N  N     . PRO B 1 198 ? 12.256  -29.569 20.833 1.00 30.05 ? 855  PRO B N     1 
ATOM   3366 C  CA    . PRO B 1 198 ? 12.677  -28.713 19.730 1.00 29.97 ? 855  PRO B CA    1 
ATOM   3367 C  C     . PRO B 1 198 ? 12.386  -29.339 18.374 1.00 29.80 ? 855  PRO B C     1 
ATOM   3368 O  O     . PRO B 1 198 ? 12.284  -28.623 17.376 1.00 29.88 ? 855  PRO B O     1 
ATOM   3369 C  CB    . PRO B 1 198 ? 14.188  -28.606 19.937 1.00 29.99 ? 855  PRO B CB    1 
ATOM   3370 C  CG    . PRO B 1 198 ? 14.374  -28.730 21.412 1.00 30.07 ? 855  PRO B CG    1 
ATOM   3371 C  CD    . PRO B 1 198 ? 13.193  -29.503 21.968 1.00 30.13 ? 855  PRO B CD    1 
ATOM   3372 N  N     . ILE B 1 199 ? 12.261  -30.664 18.345 1.00 29.47 ? 856  ILE B N     1 
ATOM   3373 C  CA    . ILE B 1 199 ? 11.968  -31.388 17.111 1.00 29.13 ? 856  ILE B CA    1 
ATOM   3374 C  C     . ILE B 1 199 ? 10.690  -30.852 16.472 1.00 28.84 ? 856  ILE B C     1 
ATOM   3375 O  O     . ILE B 1 199 ? 10.610  -30.742 15.248 1.00 28.99 ? 856  ILE B O     1 
ATOM   3376 C  CB    . ILE B 1 199 ? 11.850  -32.924 17.342 1.00 29.19 ? 856  ILE B CB    1 
ATOM   3377 C  CG1   . ILE B 1 199 ? 13.057  -33.473 18.127 1.00 29.23 ? 856  ILE B CG1   1 
ATOM   3378 C  CG2   . ILE B 1 199 ? 11.654  -33.673 16.014 1.00 29.13 ? 856  ILE B CG2   1 
ATOM   3379 C  CD1   . ILE B 1 199 ? 14.425  -33.291 17.456 1.00 29.28 ? 856  ILE B CD1   1 
ATOM   3380 N  N     . LYS B 1 200 ? 9.706   -30.501 17.302 1.00 28.32 ? 857  LYS B N     1 
ATOM   3381 C  CA    . LYS B 1 200 ? 8.438   -29.946 16.813 1.00 27.66 ? 857  LYS B CA    1 
ATOM   3382 C  C     . LYS B 1 200 ? 8.590   -28.552 16.183 1.00 27.22 ? 857  LYS B C     1 
ATOM   3383 O  O     . LYS B 1 200 ? 7.666   -28.065 15.528 1.00 27.27 ? 857  LYS B O     1 
ATOM   3384 C  CB    . LYS B 1 200 ? 7.386   -29.898 17.927 1.00 27.66 ? 857  LYS B CB    1 
ATOM   3385 C  CG    . LYS B 1 200 ? 7.014   -31.234 18.550 1.00 27.44 ? 857  LYS B CG    1 
ATOM   3386 C  CD    . LYS B 1 200 ? 5.973   -31.015 19.638 1.00 27.10 ? 857  LYS B CD    1 
ATOM   3387 C  CE    . LYS B 1 200 ? 5.505   -32.320 20.258 1.00 26.94 ? 857  LYS B CE    1 
ATOM   3388 N  NZ    . LYS B 1 200 ? 4.287   -32.105 21.100 1.00 26.96 ? 857  LYS B NZ    1 
ATOM   3389 N  N     . TRP B 1 201 ? 9.748   -27.921 16.382 1.00 26.52 ? 858  TRP B N     1 
ATOM   3390 C  CA    . TRP B 1 201 ? 10.029  -26.590 15.829 1.00 25.85 ? 858  TRP B CA    1 
ATOM   3391 C  C     . TRP B 1 201 ? 11.167  -26.594 14.807 1.00 25.64 ? 858  TRP B C     1 
ATOM   3392 O  O     . TRP B 1 201 ? 11.530  -25.543 14.273 1.00 25.55 ? 858  TRP B O     1 
ATOM   3393 C  CB    . TRP B 1 201 ? 10.360  -25.594 16.946 1.00 25.73 ? 858  TRP B CB    1 
ATOM   3394 C  CG    . TRP B 1 201 ? 9.206   -25.277 17.826 1.00 24.80 ? 858  TRP B CG    1 
ATOM   3395 C  CD1   . TRP B 1 201 ? 8.409   -24.173 17.767 1.00 24.25 ? 858  TRP B CD1   1 
ATOM   3396 C  CD2   . TRP B 1 201 ? 8.710   -26.074 18.905 1.00 24.09 ? 858  TRP B CD2   1 
ATOM   3397 N  NE1   . TRP B 1 201 ? 7.444   -24.233 18.741 1.00 23.79 ? 858  TRP B NE1   1 
ATOM   3398 C  CE2   . TRP B 1 201 ? 7.606   -25.391 19.455 1.00 23.73 ? 858  TRP B CE2   1 
ATOM   3399 C  CE3   . TRP B 1 201 ? 9.094   -27.301 19.462 1.00 23.95 ? 858  TRP B CE3   1 
ATOM   3400 C  CZ2   . TRP B 1 201 ? 6.876   -25.894 20.534 1.00 23.60 ? 858  TRP B CZ2   1 
ATOM   3401 C  CZ3   . TRP B 1 201 ? 8.369   -27.802 20.536 1.00 23.64 ? 858  TRP B CZ3   1 
ATOM   3402 C  CH2   . TRP B 1 201 ? 7.272   -27.099 21.059 1.00 23.50 ? 858  TRP B CH2   1 
ATOM   3403 N  N     . MET B 1 202 ? 11.728  -27.768 14.538 1.00 25.37 ? 859  MET B N     1 
ATOM   3404 C  CA    . MET B 1 202 ? 12.856  -27.878 13.619 1.00 25.20 ? 859  MET B CA    1 
ATOM   3405 C  C     . MET B 1 202 ? 12.432  -28.072 12.168 1.00 25.03 ? 859  MET B C     1 
ATOM   3406 O  O     . MET B 1 202 ? 11.459  -28.774 11.876 1.00 25.00 ? 859  MET B O     1 
ATOM   3407 C  CB    . MET B 1 202 ? 13.790  -29.011 14.044 1.00 25.25 ? 859  MET B CB    1 
ATOM   3408 C  CG    . MET B 1 202 ? 14.814  -28.614 15.097 1.00 25.41 ? 859  MET B CG    1 
ATOM   3409 S  SD    . MET B 1 202 ? 15.581  -30.031 15.912 1.00 25.54 ? 859  MET B SD    1 
ATOM   3410 C  CE    . MET B 1 202 ? 16.513  -30.762 14.573 1.00 25.30 ? 859  MET B CE    1 
ATOM   3411 N  N     . ALA B 1 203 ? 13.179  -27.439 11.269 1.00 24.80 ? 860  ALA B N     1 
ATOM   3412 C  CA    . ALA B 1 203 ? 13.049  -27.683 9.844  1.00 24.59 ? 860  ALA B CA    1 
ATOM   3413 C  C     . ALA B 1 203 ? 13.484  -29.108 9.544  1.00 24.53 ? 860  ALA B C     1 
ATOM   3414 O  O     . ALA B 1 203 ? 14.304  -29.683 10.264 1.00 24.51 ? 860  ALA B O     1 
ATOM   3415 C  CB    . ALA B 1 203 ? 13.885  -26.694 9.060  1.00 24.55 ? 860  ALA B CB    1 
ATOM   3416 N  N     . LEU B 1 204 ? 12.927  -29.672 8.480  1.00 24.54 ? 861  LEU B N     1 
ATOM   3417 C  CA    . LEU B 1 204 ? 13.216  -31.045 8.103  1.00 24.60 ? 861  LEU B CA    1 
ATOM   3418 C  C     . LEU B 1 204 ? 14.714  -31.293 7.897  1.00 24.73 ? 861  LEU B C     1 
ATOM   3419 O  O     . LEU B 1 204 ? 15.223  -32.345 8.291  1.00 24.79 ? 861  LEU B O     1 
ATOM   3420 C  CB    . LEU B 1 204 ? 12.412  -31.436 6.860  1.00 24.53 ? 861  LEU B CB    1 
ATOM   3421 C  CG    . LEU B 1 204 ? 12.128  -32.925 6.636  1.00 24.39 ? 861  LEU B CG    1 
ATOM   3422 C  CD1   . LEU B 1 204 ? 11.473  -33.577 7.855  1.00 24.22 ? 861  LEU B CD1   1 
ATOM   3423 C  CD2   . LEU B 1 204 ? 11.262  -33.112 5.400  1.00 24.38 ? 861  LEU B CD2   1 
ATOM   3424 N  N     . GLU B 1 205 ? 15.418  -30.328 7.301  1.00 24.89 ? 862  GLU B N     1 
ATOM   3425 C  CA    . GLU B 1 205 ? 16.857  -30.479 7.056  1.00 25.08 ? 862  GLU B CA    1 
ATOM   3426 C  C     . GLU B 1 205 ? 17.686  -30.440 8.344  1.00 25.21 ? 862  GLU B C     1 
ATOM   3427 O  O     . GLU B 1 205 ? 18.758  -31.040 8.408  1.00 25.21 ? 862  GLU B O     1 
ATOM   3428 C  CB    . GLU B 1 205 ? 17.377  -29.463 6.026  1.00 25.07 ? 862  GLU B CB    1 
ATOM   3429 C  CG    . GLU B 1 205 ? 17.596  -28.043 6.545  1.00 25.02 ? 862  GLU B CG    1 
ATOM   3430 C  CD    . GLU B 1 205 ? 16.368  -27.163 6.416  1.00 24.95 ? 862  GLU B CD    1 
ATOM   3431 O  OE1   . GLU B 1 205 ? 15.250  -27.697 6.255  1.00 25.03 ? 862  GLU B OE1   1 
ATOM   3432 O  OE2   . GLU B 1 205 ? 16.523  -25.925 6.477  1.00 24.89 ? 862  GLU B OE2   1 
ATOM   3433 N  N     . SER B 1 206 ? 17.183  -29.735 9.357  1.00 25.40 ? 863  SER B N     1 
ATOM   3434 C  CA    . SER B 1 206 ? 17.800  -29.729 10.682 1.00 25.60 ? 863  SER B CA    1 
ATOM   3435 C  C     . SER B 1 206 ? 17.622  -31.093 11.339 1.00 25.80 ? 863  SER B C     1 
ATOM   3436 O  O     . SER B 1 206 ? 18.518  -31.582 12.030 1.00 25.86 ? 863  SER B O     1 
ATOM   3437 C  CB    . SER B 1 206 ? 17.195  -28.634 11.563 1.00 25.57 ? 863  SER B CB    1 
ATOM   3438 O  OG    . SER B 1 206 ? 17.395  -27.351 10.997 1.00 25.50 ? 863  SER B OG    1 
ATOM   3439 N  N     . ILE B 1 207 ? 16.458  -31.698 11.112 1.00 26.00 ? 864  ILE B N     1 
ATOM   3440 C  CA    . ILE B 1 207 ? 16.160  -33.034 11.619 1.00 26.21 ? 864  ILE B CA    1 
ATOM   3441 C  C     . ILE B 1 207 ? 17.036  -34.086 10.930 1.00 26.39 ? 864  ILE B C     1 
ATOM   3442 O  O     . ILE B 1 207 ? 17.640  -34.922 11.603 1.00 26.43 ? 864  ILE B O     1 
ATOM   3443 C  CB    . ILE B 1 207 ? 14.645  -33.367 11.499 1.00 26.20 ? 864  ILE B CB    1 
ATOM   3444 C  CG1   . ILE B 1 207 ? 13.828  -32.396 12.362 1.00 26.23 ? 864  ILE B CG1   1 
ATOM   3445 C  CG2   . ILE B 1 207 ? 14.365  -34.818 11.906 1.00 26.17 ? 864  ILE B CG2   1 
ATOM   3446 C  CD1   . ILE B 1 207 ? 12.346  -32.336 12.032 1.00 26.30 ? 864  ILE B CD1   1 
ATOM   3447 N  N     . HIS B 1 208 ? 17.124  -34.021 9.601  1.00 26.65 ? 865  HIS B N     1 
ATOM   3448 C  CA    . HIS B 1 208 ? 17.884  -35.006 8.825  1.00 26.90 ? 865  HIS B CA    1 
ATOM   3449 C  C     . HIS B 1 208 ? 19.402  -34.780 8.840  1.00 27.04 ? 865  HIS B C     1 
ATOM   3450 O  O     . HIS B 1 208 ? 20.161  -35.674 9.220  1.00 27.00 ? 865  HIS B O     1 
ATOM   3451 C  CB    . HIS B 1 208 ? 17.383  -35.072 7.373  1.00 26.92 ? 865  HIS B CB    1 
ATOM   3452 C  CG    . HIS B 1 208 ? 15.997  -35.622 7.225  1.00 27.03 ? 865  HIS B CG    1 
ATOM   3453 N  ND1   . HIS B 1 208 ? 15.591  -36.798 7.819  1.00 27.18 ? 865  HIS B ND1   1 
ATOM   3454 C  CD2   . HIS B 1 208 ? 14.932  -35.170 6.523  1.00 27.11 ? 865  HIS B CD2   1 
ATOM   3455 C  CE1   . HIS B 1 208 ? 14.330  -37.037 7.504  1.00 27.11 ? 865  HIS B CE1   1 
ATOM   3456 N  NE2   . HIS B 1 208 ? 13.907  -36.064 6.717  1.00 27.19 ? 865  HIS B NE2   1 
ATOM   3457 N  N     . PHE B 1 209 ? 19.831  -33.586 8.429  1.00 27.27 ? 866  PHE B N     1 
ATOM   3458 C  CA    . PHE B 1 209 ? 21.250  -33.285 8.188  1.00 27.50 ? 866  PHE B CA    1 
ATOM   3459 C  C     . PHE B 1 209 ? 21.987  -32.599 9.351  1.00 27.54 ? 866  PHE B C     1 
ATOM   3460 O  O     . PHE B 1 209 ? 23.201  -32.387 9.272  1.00 27.60 ? 866  PHE B O     1 
ATOM   3461 C  CB    . PHE B 1 209 ? 21.395  -32.424 6.922  1.00 27.55 ? 866  PHE B CB    1 
ATOM   3462 C  CG    . PHE B 1 209 ? 21.598  -33.212 5.649  1.00 27.87 ? 866  PHE B CG    1 
ATOM   3463 C  CD1   . PHE B 1 209 ? 22.849  -33.247 5.033  1.00 28.15 ? 866  PHE B CD1   1 
ATOM   3464 C  CD2   . PHE B 1 209 ? 20.539  -33.893 5.049  1.00 28.05 ? 866  PHE B CD2   1 
ATOM   3465 C  CE1   . PHE B 1 209 ? 23.049  -33.960 3.848  1.00 28.28 ? 866  PHE B CE1   1 
ATOM   3466 C  CE2   . PHE B 1 209 ? 20.728  -34.611 3.864  1.00 28.18 ? 866  PHE B CE2   1 
ATOM   3467 C  CZ    . PHE B 1 209 ? 21.986  -34.644 3.263  1.00 28.28 ? 866  PHE B CZ    1 
ATOM   3468 N  N     . GLY B 1 210 ? 21.264  -32.253 10.418 1.00 27.55 ? 867  GLY B N     1 
ATOM   3469 C  CA    . GLY B 1 210 ? 21.843  -31.501 11.538 1.00 27.56 ? 867  GLY B CA    1 
ATOM   3470 C  C     . GLY B 1 210 ? 22.220  -30.073 11.164 1.00 27.58 ? 867  GLY B C     1 
ATOM   3471 O  O     . GLY B 1 210 ? 23.008  -29.426 11.857 1.00 27.62 ? 867  GLY B O     1 
ATOM   3472 N  N     . LYS B 1 211 ? 21.633  -29.588 10.071 1.00 27.56 ? 868  LYS B N     1 
ATOM   3473 C  CA    . LYS B 1 211 ? 21.970  -28.295 9.476  1.00 27.52 ? 868  LYS B CA    1 
ATOM   3474 C  C     . LYS B 1 211 ? 21.054  -27.173 9.978  1.00 27.33 ? 868  LYS B C     1 
ATOM   3475 O  O     . LYS B 1 211 ? 19.833  -27.245 9.828  1.00 27.40 ? 868  LYS B O     1 
ATOM   3476 C  CB    . LYS B 1 211 ? 21.902  -28.412 7.947  1.00 27.60 ? 868  LYS B CB    1 
ATOM   3477 C  CG    . LYS B 1 211 ? 22.148  -27.125 7.175  1.00 28.00 ? 868  LYS B CG    1 
ATOM   3478 C  CD    . LYS B 1 211 ? 21.985  -27.358 5.677  1.00 28.67 ? 868  LYS B CD    1 
ATOM   3479 C  CE    . LYS B 1 211 ? 21.922  -26.018 4.929  1.00 29.02 ? 868  LYS B CE    1 
ATOM   3480 N  NZ    . LYS B 1 211 ? 21.775  -26.246 3.454  1.00 29.18 ? 868  LYS B NZ    1 
ATOM   3481 N  N     . TYR B 1 212 ? 21.652  -26.140 10.567 1.00 27.06 ? 869  TYR B N     1 
ATOM   3482 C  CA    . TYR B 1 212 ? 20.898  -25.004 11.101 1.00 26.77 ? 869  TYR B CA    1 
ATOM   3483 C  C     . TYR B 1 212 ? 21.290  -23.703 10.407 1.00 26.68 ? 869  TYR B C     1 
ATOM   3484 O  O     . TYR B 1 212 ? 22.471  -23.352 10.356 1.00 26.69 ? 869  TYR B O     1 
ATOM   3485 C  CB    . TYR B 1 212 ? 21.119  -24.871 12.611 1.00 26.71 ? 869  TYR B CB    1 
ATOM   3486 C  CG    . TYR B 1 212 ? 20.644  -26.053 13.433 1.00 26.53 ? 869  TYR B CG    1 
ATOM   3487 C  CD1   . TYR B 1 212 ? 21.470  -27.159 13.643 1.00 26.40 ? 869  TYR B CD1   1 
ATOM   3488 C  CD2   . TYR B 1 212 ? 19.377  -26.057 14.017 1.00 26.12 ? 869  TYR B CD2   1 
ATOM   3489 C  CE1   . TYR B 1 212 ? 21.041  -28.246 14.398 1.00 26.31 ? 869  TYR B CE1   1 
ATOM   3490 C  CE2   . TYR B 1 212 ? 18.939  -27.136 14.780 1.00 26.05 ? 869  TYR B CE2   1 
ATOM   3491 C  CZ    . TYR B 1 212 ? 19.777  -28.226 14.968 1.00 26.26 ? 869  TYR B CZ    1 
ATOM   3492 O  OH    . TYR B 1 212 ? 19.353  -29.297 15.722 1.00 26.24 ? 869  TYR B OH    1 
ATOM   3493 N  N     . THR B 1 213 ? 20.298  -22.993 9.873  1.00 26.59 ? 870  THR B N     1 
ATOM   3494 C  CA    . THR B 1 213 ? 20.534  -21.728 9.170  1.00 26.47 ? 870  THR B CA    1 
ATOM   3495 C  C     . THR B 1 213 ? 19.512  -20.667 9.568  1.00 26.39 ? 870  THR B C     1 
ATOM   3496 O  O     . THR B 1 213 ? 18.629  -20.926 10.388 1.00 26.37 ? 870  THR B O     1 
ATOM   3497 C  CB    . THR B 1 213 ? 20.479  -21.909 7.637  1.00 26.46 ? 870  THR B CB    1 
ATOM   3498 O  OG1   . THR B 1 213 ? 19.219  -22.479 7.262  1.00 26.45 ? 870  THR B OG1   1 
ATOM   3499 C  CG2   . THR B 1 213 ? 21.615  -22.797 7.135  1.00 26.54 ? 870  THR B CG2   1 
ATOM   3500 N  N     . HIS B 1 214 ? 19.643  -19.472 8.990  1.00 26.35 ? 871  HIS B N     1 
ATOM   3501 C  CA    . HIS B 1 214 ? 18.628  -18.426 9.124  1.00 26.30 ? 871  HIS B CA    1 
ATOM   3502 C  C     . HIS B 1 214 ? 17.318  -18.919 8.530  1.00 26.22 ? 871  HIS B C     1 
ATOM   3503 O  O     . HIS B 1 214 ? 16.240  -18.585 9.017  1.00 26.19 ? 871  HIS B O     1 
ATOM   3504 C  CB    . HIS B 1 214 ? 19.043  -17.156 8.384  1.00 26.32 ? 871  HIS B CB    1 
ATOM   3505 C  CG    . HIS B 1 214 ? 20.389  -16.632 8.773  1.00 26.52 ? 871  HIS B CG    1 
ATOM   3506 N  ND1   . HIS B 1 214 ? 20.674  -16.176 10.043 1.00 26.57 ? 871  HIS B ND1   1 
ATOM   3507 C  CD2   . HIS B 1 214 ? 21.522  -16.466 8.051  1.00 26.52 ? 871  HIS B CD2   1 
ATOM   3508 C  CE1   . HIS B 1 214 ? 21.928  -15.764 10.088 1.00 26.47 ? 871  HIS B CE1   1 
ATOM   3509 N  NE2   . HIS B 1 214 ? 22.464  -15.928 8.892  1.00 26.48 ? 871  HIS B NE2   1 
ATOM   3510 N  N     . GLN B 1 215 ? 17.437  -19.723 7.475  1.00 26.14 ? 872  GLN B N     1 
ATOM   3511 C  CA    . GLN B 1 215 ? 16.295  -20.264 6.749  1.00 26.10 ? 872  GLN B CA    1 
ATOM   3512 C  C     . GLN B 1 215 ? 15.575  -21.376 7.517  1.00 25.89 ? 872  GLN B C     1 
ATOM   3513 O  O     . GLN B 1 215 ? 14.389  -21.622 7.282  1.00 25.91 ? 872  GLN B O     1 
ATOM   3514 C  CB    . GLN B 1 215 ? 16.726  -20.763 5.364  1.00 26.19 ? 872  GLN B CB    1 
ATOM   3515 C  CG    . GLN B 1 215 ? 17.413  -19.708 4.485  1.00 26.76 ? 872  GLN B CG    1 
ATOM   3516 C  CD    . GLN B 1 215 ? 18.917  -19.596 4.726  1.00 27.47 ? 872  GLN B CD    1 
ATOM   3517 O  OE1   . GLN B 1 215 ? 19.557  -20.533 5.200  1.00 27.65 ? 872  GLN B OE1   1 
ATOM   3518 N  NE2   . GLN B 1 215 ? 19.485  -18.444 4.383  1.00 27.80 ? 872  GLN B NE2   1 
ATOM   3519 N  N     . SER B 1 216 ? 16.285  -22.051 8.419  1.00 25.61 ? 873  SER B N     1 
ATOM   3520 C  CA    . SER B 1 216 ? 15.653  -23.046 9.285  1.00 25.33 ? 873  SER B CA    1 
ATOM   3521 C  C     . SER B 1 216 ? 14.991  -22.373 10.482 1.00 25.16 ? 873  SER B C     1 
ATOM   3522 O  O     . SER B 1 216 ? 14.041  -22.911 11.053 1.00 25.11 ? 873  SER B O     1 
ATOM   3523 C  CB    . SER B 1 216 ? 16.650  -24.114 9.740  1.00 25.33 ? 873  SER B CB    1 
ATOM   3524 O  OG    . SER B 1 216 ? 17.659  -23.558 10.564 1.00 25.45 ? 873  SER B OG    1 
ATOM   3525 N  N     . ASP B 1 217 ? 15.496  -21.199 10.859 1.00 24.98 ? 874  ASP B N     1 
ATOM   3526 C  CA    . ASP B 1 217 ? 14.851  -20.388 11.887 1.00 24.87 ? 874  ASP B CA    1 
ATOM   3527 C  C     . ASP B 1 217 ? 13.487  -19.936 11.399 1.00 24.73 ? 874  ASP B C     1 
ATOM   3528 O  O     . ASP B 1 217 ? 12.537  -19.852 12.182 1.00 24.72 ? 874  ASP B O     1 
ATOM   3529 C  CB    . ASP B 1 217 ? 15.694  -19.163 12.243 1.00 24.97 ? 874  ASP B CB    1 
ATOM   3530 C  CG    . ASP B 1 217 ? 16.713  -19.439 13.338 1.00 25.12 ? 874  ASP B CG    1 
ATOM   3531 O  OD1   . ASP B 1 217 ? 16.544  -20.406 14.119 1.00 24.98 ? 874  ASP B OD1   1 
ATOM   3532 O  OD2   . ASP B 1 217 ? 17.687  -18.663 13.420 1.00 25.46 ? 874  ASP B OD2   1 
ATOM   3533 N  N     . VAL B 1 218 ? 13.406  -19.645 10.099 1.00 24.53 ? 875  VAL B N     1 
ATOM   3534 C  CA    . VAL B 1 218 ? 12.157  -19.262 9.448  1.00 24.21 ? 875  VAL B CA    1 
ATOM   3535 C  C     . VAL B 1 218 ? 11.111  -20.353 9.654  1.00 24.07 ? 875  VAL B C     1 
ATOM   3536 O  O     . VAL B 1 218 ? 9.962   -20.051 9.980  1.00 24.08 ? 875  VAL B O     1 
ATOM   3537 C  CB    . VAL B 1 218 ? 12.354  -18.960 7.939  1.00 24.20 ? 875  VAL B CB    1 
ATOM   3538 C  CG1   . VAL B 1 218 ? 11.012  -18.763 7.236  1.00 24.24 ? 875  VAL B CG1   1 
ATOM   3539 C  CG2   . VAL B 1 218 ? 13.226  -17.727 7.750  1.00 24.12 ? 875  VAL B CG2   1 
ATOM   3540 N  N     . TRP B 1 219 ? 11.514  -21.614 9.487  1.00 23.86 ? 876  TRP B N     1 
ATOM   3541 C  CA    . TRP B 1 219 ? 10.628  -22.746 9.769  1.00 23.81 ? 876  TRP B CA    1 
ATOM   3542 C  C     . TRP B 1 219 ? 10.061  -22.655 11.188 1.00 23.88 ? 876  TRP B C     1 
ATOM   3543 O  O     . TRP B 1 219 ? 8.854   -22.790 11.390 1.00 23.89 ? 876  TRP B O     1 
ATOM   3544 C  CB    . TRP B 1 219 ? 11.354  -24.082 9.569  1.00 23.72 ? 876  TRP B CB    1 
ATOM   3545 C  CG    . TRP B 1 219 ? 10.463  -25.296 9.702  1.00 23.58 ? 876  TRP B CG    1 
ATOM   3546 C  CD1   . TRP B 1 219 ? 9.793   -25.707 10.822 1.00 23.50 ? 876  TRP B CD1   1 
ATOM   3547 C  CD2   . TRP B 1 219 ? 10.163  -26.262 8.683  1.00 23.41 ? 876  TRP B CD2   1 
ATOM   3548 N  NE1   . TRP B 1 219 ? 9.087   -26.856 10.560 1.00 23.49 ? 876  TRP B NE1   1 
ATOM   3549 C  CE2   . TRP B 1 219 ? 9.299   -27.221 9.258  1.00 23.31 ? 876  TRP B CE2   1 
ATOM   3550 C  CE3   . TRP B 1 219 ? 10.542  -26.410 7.342  1.00 23.19 ? 876  TRP B CE3   1 
ATOM   3551 C  CZ2   . TRP B 1 219 ? 8.803   -28.313 8.536  1.00 23.04 ? 876  TRP B CZ2   1 
ATOM   3552 C  CZ3   . TRP B 1 219 ? 10.048  -27.498 6.625  1.00 23.00 ? 876  TRP B CZ3   1 
ATOM   3553 C  CH2   . TRP B 1 219 ? 9.187   -28.434 7.226  1.00 22.93 ? 876  TRP B CH2   1 
ATOM   3554 N  N     . SER B 1 220 ? 10.943  -22.413 12.156 1.00 23.99 ? 877  SER B N     1 
ATOM   3555 C  CA    . SER B 1 220 ? 10.572  -22.308 13.563 1.00 24.10 ? 877  SER B CA    1 
ATOM   3556 C  C     . SER B 1 220 ? 9.628   -21.136 13.815 1.00 24.25 ? 877  SER B C     1 
ATOM   3557 O  O     . SER B 1 220 ? 8.680   -21.259 14.595 1.00 24.24 ? 877  SER B O     1 
ATOM   3558 C  CB    . SER B 1 220 ? 11.823  -22.168 14.431 1.00 24.08 ? 877  SER B CB    1 
ATOM   3559 O  OG    . SER B 1 220 ? 12.792  -23.144 14.089 1.00 24.00 ? 877  SER B OG    1 
ATOM   3560 N  N     . TYR B 1 221 ? 9.896   -20.008 13.155 1.00 24.42 ? 878  TYR B N     1 
ATOM   3561 C  CA    . TYR B 1 221 ? 9.017   -18.838 13.203 1.00 24.59 ? 878  TYR B CA    1 
ATOM   3562 C  C     . TYR B 1 221 ? 7.587   -19.225 12.825 1.00 24.51 ? 878  TYR B C     1 
ATOM   3563 O  O     . TYR B 1 221 ? 6.630   -18.810 13.484 1.00 24.50 ? 878  TYR B O     1 
ATOM   3564 C  CB    . TYR B 1 221 ? 9.541   -17.729 12.278 1.00 24.74 ? 878  TYR B CB    1 
ATOM   3565 C  CG    . TYR B 1 221 ? 8.628   -16.525 12.159 1.00 25.22 ? 878  TYR B CG    1 
ATOM   3566 C  CD1   . TYR B 1 221 ? 8.690   -15.485 13.085 1.00 25.74 ? 878  TYR B CD1   1 
ATOM   3567 C  CD2   . TYR B 1 221 ? 7.706   -16.424 11.116 1.00 25.89 ? 878  TYR B CD2   1 
ATOM   3568 C  CE1   . TYR B 1 221 ? 7.853   -14.376 12.982 1.00 26.24 ? 878  TYR B CE1   1 
ATOM   3569 C  CE2   . TYR B 1 221 ? 6.864   -15.317 11.002 1.00 26.42 ? 878  TYR B CE2   1 
ATOM   3570 C  CZ    . TYR B 1 221 ? 6.943   -14.299 11.939 1.00 26.58 ? 878  TYR B CZ    1 
ATOM   3571 O  OH    . TYR B 1 221 ? 6.116   -13.203 11.836 1.00 26.57 ? 878  TYR B OH    1 
ATOM   3572 N  N     . GLY B 1 222 ? 7.456   -20.025 11.767 1.00 24.36 ? 879  GLY B N     1 
ATOM   3573 C  CA    . GLY B 1 222 ? 6.163   -20.540 11.330 1.00 24.18 ? 879  GLY B CA    1 
ATOM   3574 C  C     . GLY B 1 222 ? 5.397   -21.267 12.420 1.00 24.06 ? 879  GLY B C     1 
ATOM   3575 O  O     . GLY B 1 222 ? 4.201   -21.026 12.607 1.00 24.18 ? 879  GLY B O     1 
ATOM   3576 N  N     . VAL B 1 223 ? 6.084   -22.155 13.139 1.00 23.84 ? 880  VAL B N     1 
ATOM   3577 C  CA    . VAL B 1 223 ? 5.463   -22.957 14.197 1.00 23.62 ? 880  VAL B CA    1 
ATOM   3578 C  C     . VAL B 1 223 ? 5.111   -22.070 15.388 1.00 23.67 ? 880  VAL B C     1 
ATOM   3579 O  O     . VAL B 1 223 ? 4.160   -22.343 16.122 1.00 23.67 ? 880  VAL B O     1 
ATOM   3580 C  CB    . VAL B 1 223 ? 6.379   -24.123 14.653 1.00 23.53 ? 880  VAL B CB    1 
ATOM   3581 C  CG1   . VAL B 1 223 ? 5.659   -25.026 15.649 1.00 23.32 ? 880  VAL B CG1   1 
ATOM   3582 C  CG2   . VAL B 1 223 ? 6.844   -24.941 13.454 1.00 23.50 ? 880  VAL B CG2   1 
ATOM   3583 N  N     . THR B 1 224 ? 5.886   -21.003 15.557 1.00 23.73 ? 881  THR B N     1 
ATOM   3584 C  CA    . THR B 1 224 ? 5.697   -20.059 16.648 1.00 23.74 ? 881  THR B CA    1 
ATOM   3585 C  C     . THR B 1 224 ? 4.427   -19.261 16.412 1.00 23.64 ? 881  THR B C     1 
ATOM   3586 O  O     . THR B 1 224 ? 3.553   -19.238 17.271 1.00 23.66 ? 881  THR B O     1 
ATOM   3587 C  CB    . THR B 1 224 ? 6.907   -19.119 16.790 1.00 23.78 ? 881  THR B CB    1 
ATOM   3588 O  OG1   . THR B 1 224 ? 8.115   -19.888 16.695 1.00 23.97 ? 881  THR B OG1   1 
ATOM   3589 C  CG2   . THR B 1 224 ? 6.879   -18.383 18.125 1.00 23.55 ? 881  THR B CG2   1 
ATOM   3590 N  N     . VAL B 1 225 ? 4.327   -18.631 15.240 1.00 23.58 ? 882  VAL B N     1 
ATOM   3591 C  CA    . VAL B 1 225 ? 3.116   -17.916 14.826 1.00 23.52 ? 882  VAL B CA    1 
ATOM   3592 C  C     . VAL B 1 225 ? 1.899   -18.828 14.959 1.00 23.50 ? 882  VAL B C     1 
ATOM   3593 O  O     . VAL B 1 225 ? 0.849   -18.408 15.454 1.00 23.44 ? 882  VAL B O     1 
ATOM   3594 C  CB    . VAL B 1 225 ? 3.232   -17.390 13.374 1.00 23.47 ? 882  VAL B CB    1 
ATOM   3595 C  CG1   . VAL B 1 225 ? 1.910   -16.813 12.890 1.00 23.69 ? 882  VAL B CG1   1 
ATOM   3596 C  CG2   . VAL B 1 225 ? 4.319   -16.336 13.279 1.00 23.50 ? 882  VAL B CG2   1 
ATOM   3597 N  N     . TRP B 1 226 ? 2.060   -20.081 14.538 1.00 23.58 ? 883  TRP B N     1 
ATOM   3598 C  CA    . TRP B 1 226 ? 1.011   -21.082 14.672 1.00 23.76 ? 883  TRP B CA    1 
ATOM   3599 C  C     . TRP B 1 226 ? 0.522   -21.187 16.113 1.00 24.09 ? 883  TRP B C     1 
ATOM   3600 O  O     . TRP B 1 226 ? -0.686  -21.211 16.356 1.00 24.10 ? 883  TRP B O     1 
ATOM   3601 C  CB    . TRP B 1 226 ? 1.496   -22.442 14.173 1.00 23.61 ? 883  TRP B CB    1 
ATOM   3602 C  CG    . TRP B 1 226 ? 0.420   -23.475 14.145 1.00 23.16 ? 883  TRP B CG    1 
ATOM   3603 C  CD1   . TRP B 1 226 ? -0.487  -23.685 13.149 1.00 22.72 ? 883  TRP B CD1   1 
ATOM   3604 C  CD2   . TRP B 1 226 ? 0.132   -24.442 15.159 1.00 22.64 ? 883  TRP B CD2   1 
ATOM   3605 N  NE1   . TRP B 1 226 ? -1.322  -24.724 13.476 1.00 22.48 ? 883  TRP B NE1   1 
ATOM   3606 C  CE2   . TRP B 1 226 ? -0.963  -25.209 14.705 1.00 22.42 ? 883  TRP B CE2   1 
ATOM   3607 C  CE3   . TRP B 1 226 ? 0.695   -24.739 16.406 1.00 22.45 ? 883  TRP B CE3   1 
ATOM   3608 C  CZ2   . TRP B 1 226 ? -1.510  -26.252 15.455 1.00 22.27 ? 883  TRP B CZ2   1 
ATOM   3609 C  CZ3   . TRP B 1 226 ? 0.151   -25.778 17.151 1.00 22.27 ? 883  TRP B CZ3   1 
ATOM   3610 C  CH2   . TRP B 1 226 ? -0.940  -26.521 16.672 1.00 22.17 ? 883  TRP B CH2   1 
ATOM   3611 N  N     . GLU B 1 227 ? 1.464   -21.235 17.056 1.00 24.52 ? 884  GLU B N     1 
ATOM   3612 C  CA    . GLU B 1 227 ? 1.149   -21.294 18.485 1.00 24.94 ? 884  GLU B CA    1 
ATOM   3613 C  C     . GLU B 1 227 ? 0.305   -20.100 18.923 1.00 25.08 ? 884  GLU B C     1 
ATOM   3614 O  O     . GLU B 1 227 ? -0.650  -20.256 19.683 1.00 25.06 ? 884  GLU B O     1 
ATOM   3615 C  CB    . GLU B 1 227 ? 2.422   -21.352 19.332 1.00 25.04 ? 884  GLU B CB    1 
ATOM   3616 C  CG    . GLU B 1 227 ? 3.306   -22.566 19.095 1.00 25.65 ? 884  GLU B CG    1 
ATOM   3617 C  CD    . GLU B 1 227 ? 4.506   -22.593 20.024 1.00 26.19 ? 884  GLU B CD    1 
ATOM   3618 O  OE1   . GLU B 1 227 ? 4.306   -22.751 21.248 1.00 26.35 ? 884  GLU B OE1   1 
ATOM   3619 O  OE2   . GLU B 1 227 ? 5.649   -22.460 19.535 1.00 26.28 ? 884  GLU B OE2   1 
ATOM   3620 N  N     . LEU B 1 228 ? 0.659   -18.917 18.428 1.00 25.27 ? 885  LEU B N     1 
ATOM   3621 C  CA    . LEU B 1 228 ? -0.019  -17.674 18.794 1.00 25.53 ? 885  LEU B CA    1 
ATOM   3622 C  C     . LEU B 1 228 ? -1.476  -17.642 18.346 1.00 25.53 ? 885  LEU B C     1 
ATOM   3623 O  O     . LEU B 1 228 ? -2.356  -17.222 19.103 1.00 25.54 ? 885  LEU B O     1 
ATOM   3624 C  CB    . LEU B 1 228 ? 0.722   -16.472 18.202 1.00 25.61 ? 885  LEU B CB    1 
ATOM   3625 C  CG    . LEU B 1 228 ? 2.068   -16.042 18.829 1.00 26.23 ? 885  LEU B CG    1 
ATOM   3626 C  CD1   . LEU B 1 228 ? 3.139   -17.164 18.832 1.00 26.64 ? 885  LEU B CD1   1 
ATOM   3627 C  CD2   . LEU B 1 228 ? 2.581   -14.808 18.093 1.00 26.60 ? 885  LEU B CD2   1 
ATOM   3628 N  N     . MET B 1 229 ? -1.721  -18.089 17.117 1.00 25.46 ? 886  MET B N     1 
ATOM   3629 C  CA    . MET B 1 229 ? -3.053  -18.041 16.529 1.00 25.33 ? 886  MET B CA    1 
ATOM   3630 C  C     . MET B 1 229 ? -3.922  -19.163 17.076 1.00 25.21 ? 886  MET B C     1 
ATOM   3631 O  O     . MET B 1 229 ? -5.144  -19.028 17.158 1.00 25.25 ? 886  MET B O     1 
ATOM   3632 C  CB    . MET B 1 229 ? -2.967  -18.115 15.005 1.00 25.38 ? 886  MET B CB    1 
ATOM   3633 C  CG    . MET B 1 229 ? -1.994  -17.116 14.375 1.00 25.52 ? 886  MET B CG    1 
ATOM   3634 S  SD    . MET B 1 229 ? -2.376  -15.389 14.732 1.00 25.91 ? 886  MET B SD    1 
ATOM   3635 C  CE    . MET B 1 229 ? -0.951  -14.570 14.018 1.00 26.08 ? 886  MET B CE    1 
ATOM   3636 N  N     . THR B 1 230 ? -3.285  -20.266 17.459 1.00 24.98 ? 887  THR B N     1 
ATOM   3637 C  CA    . THR B 1 230 ? -3.986  -21.374 18.104 1.00 24.80 ? 887  THR B CA    1 
ATOM   3638 C  C     . THR B 1 230 ? -4.162  -21.127 19.602 1.00 24.67 ? 887  THR B C     1 
ATOM   3639 O  O     . THR B 1 230 ? -4.633  -22.007 20.328 1.00 24.65 ? 887  THR B O     1 
ATOM   3640 C  CB    . THR B 1 230 ? -3.246  -22.713 17.911 1.00 24.79 ? 887  THR B CB    1 
ATOM   3641 O  OG1   . THR B 1 230 ? -1.865  -22.559 18.260 1.00 24.86 ? 887  THR B OG1   1 
ATOM   3642 C  CG2   . THR B 1 230 ? -3.358  -23.197 16.477 1.00 24.81 ? 887  THR B CG2   1 
ATOM   3643 N  N     . PHE B 1 231 ? -3.797  -19.923 20.047 1.00 24.52 ? 888  PHE B N     1 
ATOM   3644 C  CA    . PHE B 1 231 ? -3.742  -19.569 21.468 1.00 24.40 ? 888  PHE B CA    1 
ATOM   3645 C  C     . PHE B 1 231 ? -2.970  -20.605 22.282 1.00 24.38 ? 888  PHE B C     1 
ATOM   3646 O  O     . PHE B 1 231 ? -3.452  -21.109 23.300 1.00 24.43 ? 888  PHE B O     1 
ATOM   3647 C  CB    . PHE B 1 231 ? -5.141  -19.319 22.051 1.00 24.36 ? 888  PHE B CB    1 
ATOM   3648 C  CG    . PHE B 1 231 ? -5.967  -18.357 21.249 1.00 24.34 ? 888  PHE B CG    1 
ATOM   3649 C  CD1   . PHE B 1 231 ? -5.529  -17.053 21.032 1.00 24.25 ? 888  PHE B CD1   1 
ATOM   3650 C  CD2   . PHE B 1 231 ? -7.185  -18.755 20.708 1.00 24.28 ? 888  PHE B CD2   1 
ATOM   3651 C  CE1   . PHE B 1 231 ? -6.291  -16.163 20.284 1.00 24.16 ? 888  PHE B CE1   1 
ATOM   3652 C  CE2   . PHE B 1 231 ? -7.955  -17.872 19.961 1.00 24.14 ? 888  PHE B CE2   1 
ATOM   3653 C  CZ    . PHE B 1 231 ? -7.507  -16.574 19.748 1.00 24.14 ? 888  PHE B CZ    1 
ATOM   3654 N  N     . GLY B 1 232 ? -1.773  -20.926 21.803 1.00 24.28 ? 889  GLY B N     1 
ATOM   3655 C  CA    . GLY B 1 232 ? -0.852  -21.801 22.513 1.00 24.22 ? 889  GLY B CA    1 
ATOM   3656 C  C     . GLY B 1 232 ? -1.214  -23.271 22.514 1.00 24.19 ? 889  GLY B C     1 
ATOM   3657 O  O     . GLY B 1 232 ? -1.158  -23.918 23.556 1.00 24.16 ? 889  GLY B O     1 
ATOM   3658 N  N     . ALA B 1 233 ? -1.593  -23.811 21.362 1.00 24.30 ? 890  ALA B N     1 
ATOM   3659 C  CA    . ALA B 1 233 ? -1.786  -25.255 21.257 1.00 24.50 ? 890  ALA B CA    1 
ATOM   3660 C  C     . ALA B 1 233 ? -0.432  -25.924 21.057 1.00 24.67 ? 890  ALA B C     1 
ATOM   3661 O  O     . ALA B 1 233 ? 0.445   -25.375 20.386 1.00 24.64 ? 890  ALA B O     1 
ATOM   3662 C  CB    . ALA B 1 233 ? -2.729  -25.599 20.117 1.00 24.38 ? 890  ALA B CB    1 
ATOM   3663 N  N     . GLU B 1 234 ? -0.257  -27.100 21.650 1.00 24.95 ? 891  GLU B N     1 
ATOM   3664 C  CA    . GLU B 1 234 ? 0.959   -27.867 21.436 1.00 25.30 ? 891  GLU B CA    1 
ATOM   3665 C  C     . GLU B 1 234 ? 0.965   -28.461 20.033 1.00 25.33 ? 891  GLU B C     1 
ATOM   3666 O  O     . GLU B 1 234 ? 0.006   -29.126 19.638 1.00 25.35 ? 891  GLU B O     1 
ATOM   3667 C  CB    . GLU B 1 234 ? 1.125   -28.949 22.501 1.00 25.42 ? 891  GLU B CB    1 
ATOM   3668 C  CG    . GLU B 1 234 ? 1.783   -28.432 23.774 1.00 26.31 ? 891  GLU B CG    1 
ATOM   3669 C  CD    . GLU B 1 234 ? 1.807   -29.449 24.904 1.00 27.34 ? 891  GLU B CD    1 
ATOM   3670 O  OE1   . GLU B 1 234 ? 2.312   -29.101 25.993 1.00 27.76 ? 891  GLU B OE1   1 
ATOM   3671 O  OE2   . GLU B 1 234 ? 1.325   -30.588 24.716 1.00 27.50 ? 891  GLU B OE2   1 
ATOM   3672 N  N     . PRO B 1 235 ? 2.042   -28.200 19.267 1.00 25.45 ? 892  PRO B N     1 
ATOM   3673 C  CA    . PRO B 1 235 ? 2.183   -28.694 17.901 1.00 25.60 ? 892  PRO B CA    1 
ATOM   3674 C  C     . PRO B 1 235 ? 2.274   -30.212 17.869 1.00 25.82 ? 892  PRO B C     1 
ATOM   3675 O  O     . PRO B 1 235 ? 2.823   -30.812 18.796 1.00 25.89 ? 892  PRO B O     1 
ATOM   3676 C  CB    . PRO B 1 235 ? 3.512   -28.082 17.441 1.00 25.57 ? 892  PRO B CB    1 
ATOM   3677 C  CG    . PRO B 1 235 ? 3.774   -26.958 18.379 1.00 25.47 ? 892  PRO B CG    1 
ATOM   3678 C  CD    . PRO B 1 235 ? 3.221   -27.419 19.679 1.00 25.47 ? 892  PRO B CD    1 
ATOM   3679 N  N     . TYR B 1 236 ? 1.726   -30.818 16.815 1.00 26.10 ? 893  TYR B N     1 
ATOM   3680 C  CA    . TYR B 1 236 ? 1.740   -32.277 16.625 1.00 26.39 ? 893  TYR B CA    1 
ATOM   3681 C  C     . TYR B 1 236 ? 1.172   -33.031 17.832 1.00 26.73 ? 893  TYR B C     1 
ATOM   3682 O  O     . TYR B 1 236 ? 1.641   -34.117 18.183 1.00 26.75 ? 893  TYR B O     1 
ATOM   3683 C  CB    . TYR B 1 236 ? 3.153   -32.761 16.261 1.00 26.31 ? 893  TYR B CB    1 
ATOM   3684 C  CG    . TYR B 1 236 ? 3.746   -32.002 15.097 1.00 26.10 ? 893  TYR B CG    1 
ATOM   3685 C  CD1   . TYR B 1 236 ? 4.616   -30.930 15.306 1.00 25.88 ? 893  TYR B CD1   1 
ATOM   3686 C  CD2   . TYR B 1 236 ? 3.413   -32.336 13.785 1.00 25.84 ? 893  TYR B CD2   1 
ATOM   3687 C  CE1   . TYR B 1 236 ? 5.149   -30.220 14.234 1.00 25.77 ? 893  TYR B CE1   1 
ATOM   3688 C  CE2   . TYR B 1 236 ? 3.939   -31.634 12.710 1.00 25.68 ? 893  TYR B CE2   1 
ATOM   3689 C  CZ    . TYR B 1 236 ? 4.805   -30.579 12.940 1.00 25.70 ? 893  TYR B CZ    1 
ATOM   3690 O  OH    . TYR B 1 236 ? 5.327   -29.888 11.873 1.00 25.74 ? 893  TYR B OH    1 
ATOM   3691 N  N     . ALA B 1 237 ? 0.144   -32.439 18.441 1.00 27.23 ? 894  ALA B N     1 
ATOM   3692 C  CA    . ALA B 1 237 ? -0.450  -32.924 19.688 1.00 27.77 ? 894  ALA B CA    1 
ATOM   3693 C  C     . ALA B 1 237 ? -0.975  -34.353 19.612 1.00 28.18 ? 894  ALA B C     1 
ATOM   3694 O  O     . ALA B 1 237 ? -1.632  -34.736 18.642 1.00 28.21 ? 894  ALA B O     1 
ATOM   3695 C  CB    . ALA B 1 237 ? -1.559  -31.981 20.144 1.00 27.73 ? 894  ALA B CB    1 
ATOM   3696 N  N     . GLY B 1 238 ? -0.666  -35.132 20.645 1.00 28.68 ? 895  GLY B N     1 
ATOM   3697 C  CA    . GLY B 1 238 ? -1.201  -36.482 20.795 1.00 29.33 ? 895  GLY B CA    1 
ATOM   3698 C  C     . GLY B 1 238 ? -0.322  -37.601 20.269 1.00 29.78 ? 895  GLY B C     1 
ATOM   3699 O  O     . GLY B 1 238 ? -0.259  -38.675 20.873 1.00 29.82 ? 895  GLY B O     1 
ATOM   3700 N  N     . LEU B 1 239 ? 0.358   -37.354 19.150 1.00 30.20 ? 896  LEU B N     1 
ATOM   3701 C  CA    . LEU B 1 239 ? 1.100   -38.408 18.443 1.00 30.61 ? 896  LEU B CA    1 
ATOM   3702 C  C     . LEU B 1 239 ? 2.605   -38.442 18.740 1.00 30.82 ? 896  LEU B C     1 
ATOM   3703 O  O     . LEU B 1 239 ? 3.189   -37.437 19.153 1.00 30.86 ? 896  LEU B O     1 
ATOM   3704 C  CB    . LEU B 1 239 ? 0.837   -38.340 16.928 1.00 30.62 ? 896  LEU B CB    1 
ATOM   3705 C  CG    . LEU B 1 239 ? 1.107   -37.058 16.129 1.00 30.68 ? 896  LEU B CG    1 
ATOM   3706 C  CD1   . LEU B 1 239 ? 2.570   -36.938 15.719 1.00 30.74 ? 896  LEU B CD1   1 
ATOM   3707 C  CD2   . LEU B 1 239 ? 0.217   -37.016 14.897 1.00 30.66 ? 896  LEU B CD2   1 
ATOM   3708 N  N     . ARG B 1 240 ? 3.214   -39.608 18.514 1.00 31.07 ? 897  ARG B N     1 
ATOM   3709 C  CA    . ARG B 1 240 ? 4.639   -39.836 18.789 1.00 31.28 ? 897  ARG B CA    1 
ATOM   3710 C  C     . ARG B 1 240 ? 5.554   -39.028 17.869 1.00 31.34 ? 897  ARG B C     1 
ATOM   3711 O  O     . ARG B 1 240 ? 5.254   -38.838 16.687 1.00 31.37 ? 897  ARG B O     1 
ATOM   3712 C  CB    . ARG B 1 240 ? 4.978   -41.331 18.692 1.00 31.32 ? 897  ARG B CB    1 
ATOM   3713 C  CG    . ARG B 1 240 ? 6.367   -41.704 19.225 1.00 31.47 ? 897  ARG B CG    1 
ATOM   3714 C  CD    . ARG B 1 240 ? 6.673   -43.189 19.069 1.00 31.72 ? 897  ARG B CD    1 
ATOM   3715 N  NE    . ARG B 1 240 ? 6.008   -43.999 20.088 1.00 31.94 ? 897  ARG B NE    1 
ATOM   3716 C  CZ    . ARG B 1 240 ? 4.861   -44.651 19.909 1.00 32.07 ? 897  ARG B CZ    1 
ATOM   3717 N  NH1   . ARG B 1 240 ? 4.231   -44.608 18.740 1.00 32.16 ? 897  ARG B NH1   1 
ATOM   3718 N  NH2   . ARG B 1 240 ? 4.342   -45.357 20.903 1.00 32.06 ? 897  ARG B NH2   1 
ATOM   3719 N  N     . LEU B 1 241 ? 6.670   -38.566 18.431 1.00 31.40 ? 898  LEU B N     1 
ATOM   3720 C  CA    . LEU B 1 241 ? 7.654   -37.755 17.713 1.00 31.47 ? 898  LEU B CA    1 
ATOM   3721 C  C     . LEU B 1 241 ? 8.188   -38.446 16.462 1.00 31.48 ? 898  LEU B C     1 
ATOM   3722 O  O     . LEU B 1 241 ? 8.260   -37.832 15.399 1.00 31.47 ? 898  LEU B O     1 
ATOM   3723 C  CB    . LEU B 1 241 ? 8.824   -37.380 18.633 1.00 31.49 ? 898  LEU B CB    1 
ATOM   3724 C  CG    . LEU B 1 241 ? 8.542   -36.729 19.992 1.00 31.59 ? 898  LEU B CG    1 
ATOM   3725 C  CD1   . LEU B 1 241 ? 9.789   -36.770 20.865 1.00 31.78 ? 898  LEU B CD1   1 
ATOM   3726 C  CD2   . LEU B 1 241 ? 8.031   -35.297 19.845 1.00 31.66 ? 898  LEU B CD2   1 
ATOM   3727 N  N     . ALA B 1 242 ? 8.557   -39.719 16.595 1.00 31.49 ? 899  ALA B N     1 
ATOM   3728 C  CA    . ALA B 1 242 ? 9.108   -40.500 15.482 1.00 31.55 ? 899  ALA B CA    1 
ATOM   3729 C  C     . ALA B 1 242 ? 8.361   -40.286 14.160 1.00 31.58 ? 899  ALA B C     1 
ATOM   3730 O  O     . ALA B 1 242 ? 8.979   -40.257 13.093 1.00 31.61 ? 899  ALA B O     1 
ATOM   3731 C  CB    . ALA B 1 242 ? 9.145   -41.982 15.841 1.00 31.55 ? 899  ALA B CB    1 
ATOM   3732 N  N     . GLU B 1 243 ? 7.038   -40.132 14.241 1.00 31.57 ? 900  GLU B N     1 
ATOM   3733 C  CA    . GLU B 1 243 ? 6.200   -39.950 13.051 1.00 31.52 ? 900  GLU B CA    1 
ATOM   3734 C  C     . GLU B 1 243 ? 6.283   -38.540 12.457 1.00 31.38 ? 900  GLU B C     1 
ATOM   3735 O  O     . GLU B 1 243 ? 6.024   -38.358 11.267 1.00 31.36 ? 900  GLU B O     1 
ATOM   3736 C  CB    . GLU B 1 243 ? 4.738   -40.336 13.329 1.00 31.57 ? 900  GLU B CB    1 
ATOM   3737 C  CG    . GLU B 1 243 ? 3.923   -40.608 12.055 1.00 31.88 ? 900  GLU B CG    1 
ATOM   3738 C  CD    . GLU B 1 243 ? 2.513   -41.118 12.320 1.00 32.27 ? 900  GLU B CD    1 
ATOM   3739 O  OE1   . GLU B 1 243 ? 2.327   -41.946 13.238 1.00 32.36 ? 900  GLU B OE1   1 
ATOM   3740 O  OE2   . GLU B 1 243 ? 1.589   -40.700 11.589 1.00 32.37 ? 900  GLU B OE2   1 
ATOM   3741 N  N     . VAL B 1 244 ? 6.648   -37.556 13.278 1.00 31.23 ? 901  VAL B N     1 
ATOM   3742 C  CA    . VAL B 1 244 ? 6.750   -36.162 12.823 1.00 31.12 ? 901  VAL B CA    1 
ATOM   3743 C  C     . VAL B 1 244 ? 7.592   -36.015 11.537 1.00 31.09 ? 901  VAL B C     1 
ATOM   3744 O  O     . VAL B 1 244 ? 7.049   -35.597 10.511 1.00 31.09 ? 901  VAL B O     1 
ATOM   3745 C  CB    . VAL B 1 244 ? 7.224   -35.193 13.952 1.00 31.10 ? 901  VAL B CB    1 
ATOM   3746 C  CG1   . VAL B 1 244 ? 7.377   -33.777 13.428 1.00 31.00 ? 901  VAL B CG1   1 
ATOM   3747 C  CG2   . VAL B 1 244 ? 6.247   -35.213 15.122 1.00 31.09 ? 901  VAL B CG2   1 
ATOM   3748 N  N     . PRO B 1 245 ? 8.900   -36.378 11.572 1.00 31.05 ? 902  PRO B N     1 
ATOM   3749 C  CA    . PRO B 1 245 ? 9.684   -36.228 10.338 1.00 31.02 ? 902  PRO B CA    1 
ATOM   3750 C  C     . PRO B 1 245 ? 9.099   -36.966 9.126  1.00 31.01 ? 902  PRO B C     1 
ATOM   3751 O  O     . PRO B 1 245 ? 9.272   -36.511 7.995  1.00 31.01 ? 902  PRO B O     1 
ATOM   3752 C  CB    . PRO B 1 245 ? 11.057  -36.806 10.713 1.00 31.00 ? 902  PRO B CB    1 
ATOM   3753 C  CG    . PRO B 1 245 ? 10.818  -37.631 11.928 1.00 30.98 ? 902  PRO B CG    1 
ATOM   3754 C  CD    . PRO B 1 245 ? 9.723   -36.935 12.662 1.00 31.02 ? 902  PRO B CD    1 
ATOM   3755 N  N     . ASP B 1 246 ? 8.410   -38.082 9.364  1.00 31.02 ? 903  ASP B N     1 
ATOM   3756 C  CA    . ASP B 1 246 ? 7.763   -38.846 8.291  1.00 31.08 ? 903  ASP B CA    1 
ATOM   3757 C  C     . ASP B 1 246 ? 6.491   -38.159 7.788  1.00 31.05 ? 903  ASP B C     1 
ATOM   3758 O  O     . ASP B 1 246 ? 6.167   -38.226 6.599  1.00 31.04 ? 903  ASP B O     1 
ATOM   3759 C  CB    . ASP B 1 246 ? 7.451   -40.274 8.753  1.00 31.10 ? 903  ASP B CB    1 
ATOM   3760 C  CG    . ASP B 1 246 ? 8.698   -41.052 9.144  1.00 31.21 ? 903  ASP B CG    1 
ATOM   3761 O  OD1   . ASP B 1 246 ? 9.466   -40.569 10.004 1.00 31.28 ? 903  ASP B OD1   1 
ATOM   3762 O  OD2   . ASP B 1 246 ? 8.903   -42.157 8.598  1.00 31.28 ? 903  ASP B OD2   1 
ATOM   3763 N  N     . LEU B 1 247 ? 5.783   -37.507 8.708  1.00 31.01 ? 904  LEU B N     1 
ATOM   3764 C  CA    . LEU B 1 247 ? 4.580   -36.737 8.403  1.00 30.94 ? 904  LEU B CA    1 
ATOM   3765 C  C     . LEU B 1 247 ? 4.912   -35.509 7.555  1.00 30.83 ? 904  LEU B C     1 
ATOM   3766 O  O     . LEU B 1 247 ? 4.181   -35.181 6.616  1.00 30.83 ? 904  LEU B O     1 
ATOM   3767 C  CB    . LEU B 1 247 ? 3.889   -36.314 9.704  1.00 30.96 ? 904  LEU B CB    1 
ATOM   3768 C  CG    . LEU B 1 247 ? 2.520   -35.632 9.648  1.00 31.10 ? 904  LEU B CG    1 
ATOM   3769 C  CD1   . LEU B 1 247 ? 1.401   -36.653 9.459  1.00 31.16 ? 904  LEU B CD1   1 
ATOM   3770 C  CD2   . LEU B 1 247 ? 2.293   -34.817 10.912 1.00 31.14 ? 904  LEU B CD2   1 
ATOM   3771 N  N     . LEU B 1 248 ? 6.010   -34.835 7.899  1.00 30.69 ? 905  LEU B N     1 
ATOM   3772 C  CA    . LEU B 1 248 ? 6.515   -33.719 7.103  1.00 30.53 ? 905  LEU B CA    1 
ATOM   3773 C  C     . LEU B 1 248 ? 6.928   -34.187 5.713  1.00 30.42 ? 905  LEU B C     1 
ATOM   3774 O  O     . LEU B 1 248 ? 6.584   -33.552 4.717  1.00 30.39 ? 905  LEU B O     1 
ATOM   3775 C  CB    . LEU B 1 248 ? 7.700   -33.028 7.791  1.00 30.53 ? 905  LEU B CB    1 
ATOM   3776 C  CG    . LEU B 1 248 ? 7.509   -31.959 8.878  1.00 30.60 ? 905  LEU B CG    1 
ATOM   3777 C  CD1   . LEU B 1 248 ? 6.248   -31.118 8.685  1.00 30.70 ? 905  LEU B CD1   1 
ATOM   3778 C  CD2   . LEU B 1 248 ? 7.528   -32.556 10.261 1.00 30.65 ? 905  LEU B CD2   1 
ATOM   3779 N  N     . GLU B 1 249 ? 7.659   -35.301 5.655  1.00 30.31 ? 906  GLU B N     1 
ATOM   3780 C  CA    . GLU B 1 249 ? 8.101   -35.880 4.383  1.00 30.24 ? 906  GLU B CA    1 
ATOM   3781 C  C     . GLU B 1 249 ? 6.930   -36.214 3.458  1.00 30.15 ? 906  GLU B C     1 
ATOM   3782 O  O     . GLU B 1 249 ? 7.028   -36.034 2.243  1.00 30.14 ? 906  GLU B O     1 
ATOM   3783 C  CB    . GLU B 1 249 ? 8.978   -37.116 4.608  1.00 30.27 ? 906  GLU B CB    1 
ATOM   3784 C  CG    . GLU B 1 249 ? 10.431  -36.795 4.949  1.00 30.40 ? 906  GLU B CG    1 
ATOM   3785 C  CD    . GLU B 1 249 ? 11.381  -37.946 4.655  1.00 30.59 ? 906  GLU B CD    1 
ATOM   3786 O  OE1   . GLU B 1 249 ? 11.449  -38.387 3.486  1.00 30.54 ? 906  GLU B OE1   1 
ATOM   3787 O  OE2   . GLU B 1 249 ? 12.073  -38.401 5.591  1.00 30.71 ? 906  GLU B OE2   1 
ATOM   3788 N  N     . LYS B 1 250 ? 5.830   -36.693 4.038  1.00 30.07 ? 907  LYS B N     1 
ATOM   3789 C  CA    . LYS B 1 250 ? 4.608   -36.981 3.280  1.00 29.97 ? 907  LYS B CA    1 
ATOM   3790 C  C     . LYS B 1 250 ? 3.915   -35.711 2.776  1.00 29.92 ? 907  LYS B C     1 
ATOM   3791 O  O     . LYS B 1 250 ? 2.936   -35.784 2.028  1.00 29.94 ? 907  LYS B O     1 
ATOM   3792 C  CB    . LYS B 1 250 ? 3.636   -37.824 4.113  1.00 29.97 ? 907  LYS B CB    1 
ATOM   3793 C  CG    . LYS B 1 250 ? 4.003   -39.297 4.209  1.00 29.95 ? 907  LYS B CG    1 
ATOM   3794 C  CD    . LYS B 1 250 ? 3.017   -40.047 5.089  1.00 29.97 ? 907  LYS B CD    1 
ATOM   3795 C  CE    . LYS B 1 250 ? 3.379   -41.518 5.201  1.00 29.97 ? 907  LYS B CE    1 
ATOM   3796 N  NZ    . LYS B 1 250 ? 2.448   -42.246 6.108  1.00 29.98 ? 907  LYS B NZ    1 
ATOM   3797 N  N     . GLY B 1 251 ? 4.423   -34.553 3.191  1.00 29.86 ? 908  GLY B N     1 
ATOM   3798 C  CA    . GLY B 1 251 ? 3.949   -33.273 2.678  1.00 29.78 ? 908  GLY B CA    1 
ATOM   3799 C  C     . GLY B 1 251 ? 2.895   -32.573 3.513  1.00 29.73 ? 908  GLY B C     1 
ATOM   3800 O  O     . GLY B 1 251 ? 2.522   -31.439 3.206  1.00 29.74 ? 908  GLY B O     1 
ATOM   3801 N  N     . GLU B 1 252 ? 2.405   -33.232 4.561  1.00 29.64 ? 909  GLU B N     1 
ATOM   3802 C  CA    . GLU B 1 252 ? 1.410   -32.607 5.433  1.00 29.56 ? 909  GLU B CA    1 
ATOM   3803 C  C     . GLU B 1 252 ? 2.055   -31.772 6.540  1.00 29.36 ? 909  GLU B C     1 
ATOM   3804 O  O     . GLU B 1 252 ? 3.121   -32.110 7.065  1.00 29.35 ? 909  GLU B O     1 
ATOM   3805 C  CB    . GLU B 1 252 ? 0.419   -33.638 6.001  1.00 29.63 ? 909  GLU B CB    1 
ATOM   3806 C  CG    . GLU B 1 252 ? -0.766  -33.047 6.807  1.00 30.03 ? 909  GLU B CG    1 
ATOM   3807 C  CD    . GLU B 1 252 ? -1.651  -32.071 6.018  1.00 30.41 ? 909  GLU B CD    1 
ATOM   3808 O  OE1   . GLU B 1 252 ? -1.689  -32.143 4.769  1.00 30.63 ? 909  GLU B OE1   1 
ATOM   3809 O  OE2   . GLU B 1 252 ? -2.325  -31.234 6.660  1.00 30.37 ? 909  GLU B OE2   1 
ATOM   3810 N  N     . ARG B 1 253 ? 1.389   -30.668 6.864  1.00 29.10 ? 910  ARG B N     1 
ATOM   3811 C  CA    . ARG B 1 253 ? 1.842   -29.719 7.870  1.00 28.84 ? 910  ARG B CA    1 
ATOM   3812 C  C     . ARG B 1 253 ? 0.748   -29.574 8.925  1.00 28.78 ? 910  ARG B C     1 
ATOM   3813 O  O     . ARG B 1 253 ? -0.272  -30.269 8.863  1.00 28.77 ? 910  ARG B O     1 
ATOM   3814 C  CB    . ARG B 1 253 ? 2.153   -28.367 7.210  1.00 28.77 ? 910  ARG B CB    1 
ATOM   3815 C  CG    . ARG B 1 253 ? 3.067   -28.458 5.984  1.00 28.59 ? 910  ARG B CG    1 
ATOM   3816 C  CD    . ARG B 1 253 ? 4.523   -28.663 6.384  1.00 28.36 ? 910  ARG B CD    1 
ATOM   3817 N  NE    . ARG B 1 253 ? 5.098   -29.864 5.780  1.00 28.02 ? 910  ARG B NE    1 
ATOM   3818 C  CZ    . ARG B 1 253 ? 5.878   -29.881 4.703  1.00 27.87 ? 910  ARG B CZ    1 
ATOM   3819 N  NH1   . ARG B 1 253 ? 6.192   -28.758 4.075  1.00 27.88 ? 910  ARG B NH1   1 
ATOM   3820 N  NH2   . ARG B 1 253 ? 6.340   -31.035 4.248  1.00 27.81 ? 910  ARG B NH2   1 
ATOM   3821 N  N     . LEU B 1 254 ? 0.956   -28.682 9.891  1.00 28.68 ? 911  LEU B N     1 
ATOM   3822 C  CA    . LEU B 1 254 ? -0.036  -28.434 10.937 1.00 28.66 ? 911  LEU B CA    1 
ATOM   3823 C  C     . LEU B 1 254 ? -1.311  -27.812 10.362 1.00 28.68 ? 911  LEU B C     1 
ATOM   3824 O  O     . LEU B 1 254 ? -1.262  -27.100 9.356  1.00 28.70 ? 911  LEU B O     1 
ATOM   3825 C  CB    . LEU B 1 254 ? 0.541   -27.545 12.042 1.00 28.64 ? 911  LEU B CB    1 
ATOM   3826 C  CG    . LEU B 1 254 ? 1.741   -28.097 12.820 1.00 28.68 ? 911  LEU B CG    1 
ATOM   3827 C  CD1   . LEU B 1 254 ? 3.039   -27.490 12.303 1.00 28.75 ? 911  LEU B CD1   1 
ATOM   3828 C  CD2   . LEU B 1 254 ? 1.586   -27.796 14.293 1.00 28.59 ? 911  LEU B CD2   1 
ATOM   3829 N  N     . ALA B 1 255 ? -2.445  -28.094 11.001 1.00 28.69 ? 912  ALA B N     1 
ATOM   3830 C  CA    . ALA B 1 255 ? -3.743  -27.581 10.554 1.00 28.67 ? 912  ALA B CA    1 
ATOM   3831 C  C     . ALA B 1 255 ? -3.832  -26.067 10.728 1.00 28.64 ? 912  ALA B C     1 
ATOM   3832 O  O     . ALA B 1 255 ? -3.112  -25.491 11.547 1.00 28.61 ? 912  ALA B O     1 
ATOM   3833 C  CB    . ALA B 1 255 ? -4.874  -28.274 11.304 1.00 28.68 ? 912  ALA B CB    1 
ATOM   3834 N  N     . GLN B 1 256 ? -4.708  -25.426 9.955  1.00 28.60 ? 913  GLN B N     1 
ATOM   3835 C  CA    . GLN B 1 256 ? -4.894  -23.982 10.073 1.00 28.52 ? 913  GLN B CA    1 
ATOM   3836 C  C     . GLN B 1 256 ? -5.745  -23.640 11.297 1.00 28.33 ? 913  GLN B C     1 
ATOM   3837 O  O     . GLN B 1 256 ? -6.818  -24.217 11.487 1.00 28.33 ? 913  GLN B O     1 
ATOM   3838 C  CB    . GLN B 1 256 ? -5.470  -23.367 8.788  1.00 28.55 ? 913  GLN B CB    1 
ATOM   3839 C  CG    . GLN B 1 256 ? -6.969  -23.487 8.597  1.00 28.92 ? 913  GLN B CG    1 
ATOM   3840 C  CD    . GLN B 1 256 ? -7.550  -22.293 7.863  1.00 29.27 ? 913  GLN B CD    1 
ATOM   3841 O  OE1   . GLN B 1 256 ? -7.252  -22.061 6.690  1.00 29.26 ? 913  GLN B OE1   1 
ATOM   3842 N  NE2   . GLN B 1 256 ? -8.389  -21.529 8.553  1.00 29.45 ? 913  GLN B NE2   1 
ATOM   3843 N  N     . PRO B 1 257 ? -5.250  -22.717 12.143 1.00 28.19 ? 914  PRO B N     1 
ATOM   3844 C  CA    . PRO B 1 257 ? -5.944  -22.286 13.360 1.00 28.07 ? 914  PRO B CA    1 
ATOM   3845 C  C     . PRO B 1 257 ? -7.341  -21.737 13.072 1.00 27.97 ? 914  PRO B C     1 
ATOM   3846 O  O     . PRO B 1 257 ? -7.572  -21.172 12.000 1.00 27.93 ? 914  PRO B O     1 
ATOM   3847 C  CB    . PRO B 1 257 ? -5.045  -21.168 13.896 1.00 28.07 ? 914  PRO B CB    1 
ATOM   3848 C  CG    . PRO B 1 257 ? -3.706  -21.451 13.330 1.00 28.01 ? 914  PRO B CG    1 
ATOM   3849 C  CD    . PRO B 1 257 ? -3.950  -22.038 11.984 1.00 28.12 ? 914  PRO B CD    1 
ATOM   3850 N  N     . GLN B 1 258 ? -8.251  -21.896 14.032 1.00 27.88 ? 915  GLN B N     1 
ATOM   3851 C  CA    . GLN B 1 258 ? -9.651  -21.479 13.881 1.00 27.81 ? 915  GLN B CA    1 
ATOM   3852 C  C     . GLN B 1 258 ? -9.833  -19.994 13.567 1.00 27.64 ? 915  GLN B C     1 
ATOM   3853 O  O     . GLN B 1 258 ? -10.830 -19.606 12.958 1.00 27.70 ? 915  GLN B O     1 
ATOM   3854 C  CB    . GLN B 1 258 ? -10.461 -21.828 15.134 1.00 27.85 ? 915  GLN B CB    1 
ATOM   3855 C  CG    . GLN B 1 258 ? -10.848 -23.292 15.258 1.00 28.33 ? 915  GLN B CG    1 
ATOM   3856 C  CD    . GLN B 1 258 ? -11.702 -23.565 16.485 1.00 29.04 ? 915  GLN B CD    1 
ATOM   3857 O  OE1   . GLN B 1 258 ? -12.881 -23.208 16.531 1.00 29.37 ? 915  GLN B OE1   1 
ATOM   3858 N  NE2   . GLN B 1 258 ? -11.110 -24.211 17.484 1.00 29.24 ? 915  GLN B NE2   1 
ATOM   3859 N  N     . ILE B 1 259 ? -8.874  -19.172 13.980 1.00 27.46 ? 916  ILE B N     1 
ATOM   3860 C  CA    . ILE B 1 259 ? -8.999  -17.720 13.844 1.00 27.30 ? 916  ILE B CA    1 
ATOM   3861 C  C     . ILE B 1 259 ? -8.300  -17.141 12.609 1.00 27.24 ? 916  ILE B C     1 
ATOM   3862 O  O     . ILE B 1 259 ? -8.340  -15.926 12.388 1.00 27.26 ? 916  ILE B O     1 
ATOM   3863 C  CB    . ILE B 1 259 ? -8.503  -16.977 15.116 1.00 27.31 ? 916  ILE B CB    1 
ATOM   3864 C  CG1   . ILE B 1 259 ? -6.979  -17.084 15.254 1.00 27.29 ? 916  ILE B CG1   1 
ATOM   3865 C  CG2   . ILE B 1 259 ? -9.239  -17.479 16.360 1.00 27.20 ? 916  ILE B CG2   1 
ATOM   3866 C  CD1   . ILE B 1 259 ? -6.375  -16.077 16.244 1.00 27.49 ? 916  ILE B CD1   1 
ATOM   3867 N  N     . CYS B 1 260 ? -7.686  -18.000 11.796 1.00 27.13 ? 917  CYS B N     1 
ATOM   3868 C  CA    . CYS B 1 260 ? -6.885  -17.535 10.660 1.00 27.09 ? 917  CYS B CA    1 
ATOM   3869 C  C     . CYS B 1 260 ? -7.580  -17.639 9.304  1.00 26.94 ? 917  CYS B C     1 
ATOM   3870 O  O     . CYS B 1 260 ? -8.051  -18.713 8.913  1.00 26.88 ? 917  CYS B O     1 
ATOM   3871 C  CB    . CYS B 1 260 ? -5.540  -18.264 10.610 1.00 27.09 ? 917  CYS B CB    1 
ATOM   3872 S  SG    . CYS B 1 260 ? -4.409  -17.818 11.936 1.00 27.63 ? 917  CYS B SG    1 
ATOM   3873 N  N     . THR B 1 261 ? -7.632  -16.516 8.591  1.00 26.76 ? 918  THR B N     1 
ATOM   3874 C  CA    . THR B 1 261 ? -8.095  -16.495 7.207  1.00 26.58 ? 918  THR B CA    1 
ATOM   3875 C  C     . THR B 1 261 ? -7.036  -17.158 6.340  1.00 26.51 ? 918  THR B C     1 
ATOM   3876 O  O     . THR B 1 261 ? -5.853  -17.146 6.689  1.00 26.47 ? 918  THR B O     1 
ATOM   3877 C  CB    . THR B 1 261 ? -8.328  -15.058 6.703  1.00 26.57 ? 918  THR B CB    1 
ATOM   3878 O  OG1   . THR B 1 261 ? -7.096  -14.304 6.808  1.00 26.59 ? 918  THR B OG1   1 
ATOM   3879 C  CG2   . THR B 1 261 ? -9.439  -14.373 7.523  1.00 26.53 ? 918  THR B CG2   1 
ATOM   3880 N  N     . ILE B 1 262 ? -7.458  -17.733 5.215  1.00 26.45 ? 919  ILE B N     1 
ATOM   3881 C  CA    . ILE B 1 262 ? -6.548  -18.469 4.328  1.00 26.37 ? 919  ILE B CA    1 
ATOM   3882 C  C     . ILE B 1 262 ? -5.175  -17.799 4.135  1.00 26.39 ? 919  ILE B C     1 
ATOM   3883 O  O     . ILE B 1 262 ? -4.153  -18.483 4.058  1.00 26.32 ? 919  ILE B O     1 
ATOM   3884 C  CB    . ILE B 1 262 ? -7.214  -18.793 2.954  1.00 26.31 ? 919  ILE B CB    1 
ATOM   3885 C  CG1   . ILE B 1 262 ? -6.347  -19.755 2.125  1.00 26.19 ? 919  ILE B CG1   1 
ATOM   3886 C  CG2   . ILE B 1 262 ? -7.542  -17.519 2.169  1.00 26.38 ? 919  ILE B CG2   1 
ATOM   3887 C  CD1   . ILE B 1 262 ? -6.111  -21.118 2.767  1.00 25.96 ? 919  ILE B CD1   1 
ATOM   3888 N  N     . ASP B 1 263 ? -5.167  -16.468 4.087  1.00 26.45 ? 920  ASP B N     1 
ATOM   3889 C  CA    . ASP B 1 263 ? -3.955  -15.687 3.843  1.00 26.53 ? 920  ASP B CA    1 
ATOM   3890 C  C     . ASP B 1 263 ? -2.927  -15.782 4.972  1.00 26.60 ? 920  ASP B C     1 
ATOM   3891 O  O     . ASP B 1 263 ? -1.724  -15.805 4.706  1.00 26.59 ? 920  ASP B O     1 
ATOM   3892 C  CB    . ASP B 1 263 ? -4.314  -14.226 3.559  1.00 26.53 ? 920  ASP B CB    1 
ATOM   3893 C  CG    . ASP B 1 263 ? -5.193  -14.069 2.327  1.00 26.63 ? 920  ASP B CG    1 
ATOM   3894 O  OD1   . ASP B 1 263 ? -4.692  -14.286 1.204  1.00 26.66 ? 920  ASP B OD1   1 
ATOM   3895 O  OD2   . ASP B 1 263 ? -6.384  -13.720 2.482  1.00 26.55 ? 920  ASP B OD2   1 
ATOM   3896 N  N     . VAL B 1 264 ? -3.395  -15.838 6.220  1.00 26.67 ? 921  VAL B N     1 
ATOM   3897 C  CA    . VAL B 1 264 ? -2.496  -16.005 7.370  1.00 26.74 ? 921  VAL B CA    1 
ATOM   3898 C  C     . VAL B 1 264 ? -1.871  -17.396 7.353  1.00 26.81 ? 921  VAL B C     1 
ATOM   3899 O  O     . VAL B 1 264 ? -0.649  -17.532 7.455  1.00 26.84 ? 921  VAL B O     1 
ATOM   3900 C  CB    . VAL B 1 264 ? -3.201  -15.787 8.735  1.00 26.73 ? 921  VAL B CB    1 
ATOM   3901 C  CG1   . VAL B 1 264 ? -2.174  -15.710 9.866  1.00 26.59 ? 921  VAL B CG1   1 
ATOM   3902 C  CG2   . VAL B 1 264 ? -4.056  -14.536 8.716  1.00 26.73 ? 921  VAL B CG2   1 
ATOM   3903 N  N     . TYR B 1 265 ? -2.711  -18.422 7.222  1.00 26.88 ? 922  TYR B N     1 
ATOM   3904 C  CA    . TYR B 1 265 ? -2.231  -19.798 7.163  1.00 26.99 ? 922  TYR B CA    1 
ATOM   3905 C  C     . TYR B 1 265 ? -1.158  -19.956 6.093  1.00 27.16 ? 922  TYR B C     1 
ATOM   3906 O  O     . TYR B 1 265 ? -0.168  -20.657 6.304  1.00 27.18 ? 922  TYR B O     1 
ATOM   3907 C  CB    . TYR B 1 265 ? -3.384  -20.776 6.917  1.00 26.91 ? 922  TYR B CB    1 
ATOM   3908 C  CG    . TYR B 1 265 ? -2.962  -22.232 6.877  1.00 26.68 ? 922  TYR B CG    1 
ATOM   3909 C  CD1   . TYR B 1 265 ? -2.217  -22.794 7.917  1.00 26.52 ? 922  TYR B CD1   1 
ATOM   3910 C  CD2   . TYR B 1 265 ? -3.321  -23.053 5.809  1.00 26.52 ? 922  TYR B CD2   1 
ATOM   3911 C  CE1   . TYR B 1 265 ? -1.835  -24.131 7.890  1.00 26.30 ? 922  TYR B CE1   1 
ATOM   3912 C  CE2   . TYR B 1 265 ? -2.944  -24.394 5.773  1.00 26.37 ? 922  TYR B CE2   1 
ATOM   3913 C  CZ    . TYR B 1 265 ? -2.201  -24.924 6.816  1.00 26.27 ? 922  TYR B CZ    1 
ATOM   3914 O  OH    . TYR B 1 265 ? -1.824  -26.246 6.786  1.00 26.17 ? 922  TYR B OH    1 
ATOM   3915 N  N     . MET B 1 266 ? -1.354  -19.285 4.959  1.00 27.37 ? 923  MET B N     1 
ATOM   3916 C  CA    . MET B 1 266 ? -0.406  -19.335 3.851  1.00 27.58 ? 923  MET B CA    1 
ATOM   3917 C  C     . MET B 1 266 ? 0.980   -18.805 4.208  1.00 27.60 ? 923  MET B C     1 
ATOM   3918 O  O     . MET B 1 266 ? 1.980   -19.328 3.720  1.00 27.61 ? 923  MET B O     1 
ATOM   3919 C  CB    . MET B 1 266 ? -0.960  -18.622 2.613  1.00 27.66 ? 923  MET B CB    1 
ATOM   3920 C  CG    . MET B 1 266 ? -2.009  -19.434 1.839  1.00 27.84 ? 923  MET B CG    1 
ATOM   3921 S  SD    . MET B 1 266 ? -1.621  -21.199 1.809  1.00 28.13 ? 923  MET B SD    1 
ATOM   3922 C  CE    . MET B 1 266 ? -1.996  -21.592 0.078  1.00 28.31 ? 923  MET B CE    1 
ATOM   3923 N  N     . VAL B 1 267 ? 1.035   -17.784 5.065  1.00 27.61 ? 924  VAL B N     1 
ATOM   3924 C  CA    . VAL B 1 267 ? 2.311   -17.253 5.563  1.00 27.58 ? 924  VAL B CA    1 
ATOM   3925 C  C     . VAL B 1 267 ? 3.108   -18.361 6.254  1.00 27.47 ? 924  VAL B C     1 
ATOM   3926 O  O     . VAL B 1 267 ? 4.303   -18.528 6.004  1.00 27.49 ? 924  VAL B O     1 
ATOM   3927 C  CB    . VAL B 1 267 ? 2.125   -16.074 6.560  1.00 27.59 ? 924  VAL B CB    1 
ATOM   3928 C  CG1   . VAL B 1 267 ? 3.440   -15.337 6.760  1.00 27.68 ? 924  VAL B CG1   1 
ATOM   3929 C  CG2   . VAL B 1 267 ? 1.057   -15.105 6.083  1.00 27.64 ? 924  VAL B CG2   1 
ATOM   3930 N  N     . MET B 1 268 ? 2.425   -19.112 7.115  1.00 27.27 ? 925  MET B N     1 
ATOM   3931 C  CA    . MET B 1 268 ? 3.013   -20.234 7.842  1.00 27.05 ? 925  MET B CA    1 
ATOM   3932 C  C     . MET B 1 268 ? 3.459   -21.373 6.922  1.00 26.77 ? 925  MET B C     1 
ATOM   3933 O  O     . MET B 1 268 ? 4.561   -21.896 7.079  1.00 26.84 ? 925  MET B O     1 
ATOM   3934 C  CB    . MET B 1 268 ? 2.019   -20.763 8.877  1.00 27.13 ? 925  MET B CB    1 
ATOM   3935 C  CG    . MET B 1 268 ? 1.851   -19.882 10.108 1.00 27.46 ? 925  MET B CG    1 
ATOM   3936 S  SD    . MET B 1 268 ? 0.189   -19.928 10.816 1.00 28.04 ? 925  MET B SD    1 
ATOM   3937 C  CE    . MET B 1 268 ? -0.168  -21.682 10.794 1.00 27.83 ? 925  MET B CE    1 
ATOM   3938 N  N     . VAL B 1 269 ? 2.602   -21.757 5.975  1.00 26.35 ? 926  VAL B N     1 
ATOM   3939 C  CA    . VAL B 1 269 ? 2.901   -22.858 5.049  1.00 25.96 ? 926  VAL B CA    1 
ATOM   3940 C  C     . VAL B 1 269 ? 4.157   -22.553 4.231  1.00 25.74 ? 926  VAL B C     1 
ATOM   3941 O  O     . VAL B 1 269 ? 4.962   -23.446 3.955  1.00 25.67 ? 926  VAL B O     1 
ATOM   3942 C  CB    . VAL B 1 269 ? 1.707   -23.158 4.098  1.00 25.96 ? 926  VAL B CB    1 
ATOM   3943 C  CG1   . VAL B 1 269 ? 1.986   -24.400 3.246  1.00 25.82 ? 926  VAL B CG1   1 
ATOM   3944 C  CG2   . VAL B 1 269 ? 0.435   -23.370 4.900  1.00 25.96 ? 926  VAL B CG2   1 
ATOM   3945 N  N     . LYS B 1 270 ? 4.310   -21.283 3.860  1.00 25.46 ? 927  LYS B N     1 
ATOM   3946 C  CA    . LYS B 1 270 ? 5.493   -20.791 3.156  1.00 25.22 ? 927  LYS B CA    1 
ATOM   3947 C  C     . LYS B 1 270 ? 6.766   -20.951 3.994  1.00 24.98 ? 927  LYS B C     1 
ATOM   3948 O  O     . LYS B 1 270 ? 7.847   -21.171 3.444  1.00 24.98 ? 927  LYS B O     1 
ATOM   3949 C  CB    . LYS B 1 270 ? 5.304   -19.321 2.760  1.00 25.28 ? 927  LYS B CB    1 
ATOM   3950 C  CG    . LYS B 1 270 ? 4.345   -19.092 1.590  1.00 25.48 ? 927  LYS B CG    1 
ATOM   3951 C  CD    . LYS B 1 270 ? 3.584   -17.766 1.713  1.00 25.94 ? 927  LYS B CD    1 
ATOM   3952 C  CE    . LYS B 1 270 ? 4.266   -16.613 0.988  1.00 26.28 ? 927  LYS B CE    1 
ATOM   3953 N  NZ    . LYS B 1 270 ? 5.467   -16.090 1.709  1.00 26.54 ? 927  LYS B NZ    1 
ATOM   3954 N  N     . CYS B 1 271 ? 6.633   -20.841 5.317  1.00 24.62 ? 928  CYS B N     1 
ATOM   3955 C  CA    . CYS B 1 271 ? 7.758   -21.058 6.228  1.00 24.32 ? 928  CYS B CA    1 
ATOM   3956 C  C     . CYS B 1 271 ? 8.223   -22.512 6.211  1.00 24.30 ? 928  CYS B C     1 
ATOM   3957 O  O     . CYS B 1 271 ? 9.385   -22.801 6.510  1.00 24.29 ? 928  CYS B O     1 
ATOM   3958 C  CB    . CYS B 1 271 ? 7.390   -20.661 7.661  1.00 24.25 ? 928  CYS B CB    1 
ATOM   3959 S  SG    . CYS B 1 271 ? 7.063   -18.903 7.922  1.00 23.81 ? 928  CYS B SG    1 
ATOM   3960 N  N     . TRP B 1 272 ? 7.314   -23.417 5.852  1.00 24.21 ? 929  TRP B N     1 
ATOM   3961 C  CA    . TRP B 1 272 ? 7.570   -24.852 5.956  1.00 24.23 ? 929  TRP B CA    1 
ATOM   3962 C  C     . TRP B 1 272 ? 7.812   -25.548 4.611  1.00 24.19 ? 929  TRP B C     1 
ATOM   3963 O  O     . TRP B 1 272 ? 7.679   -26.768 4.504  1.00 24.13 ? 929  TRP B O     1 
ATOM   3964 C  CB    . TRP B 1 272 ? 6.449   -25.537 6.752  1.00 24.29 ? 929  TRP B CB    1 
ATOM   3965 C  CG    . TRP B 1 272 ? 6.121   -24.846 8.056  1.00 24.68 ? 929  TRP B CG    1 
ATOM   3966 C  CD1   . TRP B 1 272 ? 7.007   -24.273 8.927  1.00 25.07 ? 929  TRP B CD1   1 
ATOM   3967 C  CD2   . TRP B 1 272 ? 4.823   -24.673 8.639  1.00 24.99 ? 929  TRP B CD2   1 
ATOM   3968 N  NE1   . TRP B 1 272 ? 6.341   -23.745 10.005 1.00 25.13 ? 929  TRP B NE1   1 
ATOM   3969 C  CE2   . TRP B 1 272 ? 5.000   -23.976 9.855  1.00 25.08 ? 929  TRP B CE2   1 
ATOM   3970 C  CE3   . TRP B 1 272 ? 3.526   -25.035 8.250  1.00 25.26 ? 929  TRP B CE3   1 
ATOM   3971 C  CZ2   . TRP B 1 272 ? 3.933   -23.638 10.687 1.00 25.24 ? 929  TRP B CZ2   1 
ATOM   3972 C  CZ3   . TRP B 1 272 ? 2.463   -24.694 9.079  1.00 25.38 ? 929  TRP B CZ3   1 
ATOM   3973 C  CH2   . TRP B 1 272 ? 2.676   -24.003 10.284 1.00 25.52 ? 929  TRP B CH2   1 
ATOM   3974 N  N     . MET B 1 273 ? 8.187   -24.769 3.597  1.00 24.28 ? 930  MET B N     1 
ATOM   3975 C  CA    . MET B 1 273 ? 8.535   -25.309 2.282  1.00 24.49 ? 930  MET B CA    1 
ATOM   3976 C  C     . MET B 1 273 ? 9.813   -26.143 2.362  1.00 24.52 ? 930  MET B C     1 
ATOM   3977 O  O     . MET B 1 273 ? 10.802  -25.703 2.947  1.00 24.55 ? 930  MET B O     1 
ATOM   3978 C  CB    . MET B 1 273 ? 8.721   -24.173 1.269  1.00 24.58 ? 930  MET B CB    1 
ATOM   3979 C  CG    . MET B 1 273 ? 7.469   -23.350 0.967  1.00 24.99 ? 930  MET B CG    1 
ATOM   3980 S  SD    . MET B 1 273 ? 6.292   -24.164 -0.135 1.00 25.76 ? 930  MET B SD    1 
ATOM   3981 C  CE    . MET B 1 273 ? 5.242   -25.026 1.036  1.00 25.84 ? 930  MET B CE    1 
ATOM   3982 N  N     . ILE B 1 274 ? 9.789   -27.339 1.774  1.00 24.60 ? 931  ILE B N     1 
ATOM   3983 C  CA    . ILE B 1 274 ? 10.955  -28.234 1.779  1.00 24.69 ? 931  ILE B CA    1 
ATOM   3984 C  C     . ILE B 1 274 ? 12.221  -27.522 1.293  1.00 24.76 ? 931  ILE B C     1 
ATOM   3985 O  O     . ILE B 1 274 ? 13.302  -27.723 1.853  1.00 24.81 ? 931  ILE B O     1 
ATOM   3986 C  CB    . ILE B 1 274 ? 10.718  -29.525 0.939  1.00 24.71 ? 931  ILE B CB    1 
ATOM   3987 C  CG1   . ILE B 1 274 ? 9.381   -30.194 1.301  1.00 24.90 ? 931  ILE B CG1   1 
ATOM   3988 C  CG2   . ILE B 1 274 ? 11.890  -30.509 1.087  1.00 24.71 ? 931  ILE B CG2   1 
ATOM   3989 C  CD1   . ILE B 1 274 ? 9.306   -30.775 2.712  1.00 25.15 ? 931  ILE B CD1   1 
ATOM   3990 N  N     . ASP B 1 275 ? 12.085  -26.692 0.260  1.00 24.85 ? 932  ASP B N     1 
ATOM   3991 C  CA    . ASP B 1 275 ? 13.212  -25.904 -0.233 1.00 24.93 ? 932  ASP B CA    1 
ATOM   3992 C  C     . ASP B 1 275 ? 13.386  -24.638 0.594  1.00 25.00 ? 932  ASP B C     1 
ATOM   3993 O  O     . ASP B 1 275 ? 12.556  -23.724 0.548  1.00 24.96 ? 932  ASP B O     1 
ATOM   3994 C  CB    . ASP B 1 275 ? 13.061  -25.566 -1.719 1.00 24.93 ? 932  ASP B CB    1 
ATOM   3995 C  CG    . ASP B 1 275 ? 14.257  -24.792 -2.278 1.00 25.03 ? 932  ASP B CG    1 
ATOM   3996 O  OD1   . ASP B 1 275 ? 15.103  -24.305 -1.493 1.00 25.15 ? 932  ASP B OD1   1 
ATOM   3997 O  OD2   . ASP B 1 275 ? 14.350  -24.670 -3.519 1.00 25.01 ? 932  ASP B OD2   1 
ATOM   3998 N  N     . GLU B 1 276 ? 14.486  -24.600 1.340  1.00 25.13 ? 933  GLU B N     1 
ATOM   3999 C  CA    . GLU B 1 276 ? 14.803  -23.487 2.231  1.00 25.28 ? 933  GLU B CA    1 
ATOM   4000 C  C     . GLU B 1 276 ? 15.018  -22.159 1.506  1.00 25.27 ? 933  GLU B C     1 
ATOM   4001 O  O     . GLU B 1 276 ? 14.688  -21.099 2.048  1.00 25.22 ? 933  GLU B O     1 
ATOM   4002 C  CB    . GLU B 1 276 ? 16.004  -23.824 3.122  1.00 25.37 ? 933  GLU B CB    1 
ATOM   4003 C  CG    . GLU B 1 276 ? 17.204  -24.421 2.393  1.00 25.84 ? 933  GLU B CG    1 
ATOM   4004 C  CD    . GLU B 1 276 ? 18.364  -24.730 3.327  1.00 26.53 ? 933  GLU B CD    1 
ATOM   4005 O  OE1   . GLU B 1 276 ? 18.532  -24.019 4.342  1.00 26.80 ? 933  GLU B OE1   1 
ATOM   4006 O  OE2   . GLU B 1 276 ? 19.118  -25.684 3.039  1.00 26.82 ? 933  GLU B OE2   1 
ATOM   4007 N  N     . ASN B 1 277 ? 15.568  -22.207 0.294  1.00 25.30 ? 934  ASN B N     1 
ATOM   4008 C  CA    . ASN B 1 277 ? 15.704  -20.997 -0.519 1.00 25.39 ? 934  ASN B CA    1 
ATOM   4009 C  C     . ASN B 1 277 ? 14.345  -20.361 -0.818 1.00 25.38 ? 934  ASN B C     1 
ATOM   4010 O  O     . ASN B 1 277 ? 14.230  -19.133 -0.930 1.00 25.46 ? 934  ASN B O     1 
ATOM   4011 C  CB    . ASN B 1 277 ? 16.440  -21.295 -1.827 1.00 25.39 ? 934  ASN B CB    1 
ATOM   4012 C  CG    . ASN B 1 277 ? 17.891  -21.689 -1.612 1.00 25.56 ? 934  ASN B CG    1 
ATOM   4013 O  OD1   . ASN B 1 277 ? 18.433  -21.559 -0.512 1.00 25.61 ? 934  ASN B OD1   1 
ATOM   4014 N  ND2   . ASN B 1 277 ? 18.530  -22.173 -2.669 1.00 25.73 ? 934  ASN B ND2   1 
ATOM   4015 N  N     . ILE B 1 278 ? 13.324  -21.216 -0.936 1.00 25.32 ? 935  ILE B N     1 
ATOM   4016 C  CA    . ILE B 1 278 ? 11.955  -20.782 -1.241 1.00 25.22 ? 935  ILE B CA    1 
ATOM   4017 C  C     . ILE B 1 278 ? 11.268  -20.039 -0.087 1.00 25.17 ? 935  ILE B C     1 
ATOM   4018 O  O     . ILE B 1 278 ? 10.553  -19.059 -0.321 1.00 25.20 ? 935  ILE B O     1 
ATOM   4019 C  CB    . ILE B 1 278 ? 11.078  -21.975 -1.709 1.00 25.22 ? 935  ILE B CB    1 
ATOM   4020 C  CG1   . ILE B 1 278 ? 11.543  -22.463 -3.085 1.00 25.31 ? 935  ILE B CG1   1 
ATOM   4021 C  CG2   . ILE B 1 278 ? 9.604   -21.592 -1.747 1.00 25.14 ? 935  ILE B CG2   1 
ATOM   4022 C  CD1   . ILE B 1 278 ? 10.733  -23.622 -3.663 1.00 25.62 ? 935  ILE B CD1   1 
ATOM   4023 N  N     . ARG B 1 279 ? 11.486  -20.504 1.142  1.00 25.09 ? 936  ARG B N     1 
ATOM   4024 C  CA    . ARG B 1 279 ? 10.867  -19.908 2.330  1.00 25.09 ? 936  ARG B CA    1 
ATOM   4025 C  C     . ARG B 1 279 ? 11.182  -18.412 2.414  1.00 25.28 ? 936  ARG B C     1 
ATOM   4026 O  O     . ARG B 1 279 ? 12.275  -17.990 2.025  1.00 25.33 ? 936  ARG B O     1 
ATOM   4027 C  CB    . ARG B 1 279 ? 11.357  -20.616 3.597  1.00 25.01 ? 936  ARG B CB    1 
ATOM   4028 C  CG    . ARG B 1 279 ? 11.245  -22.135 3.547  1.00 24.67 ? 936  ARG B CG    1 
ATOM   4029 C  CD    . ARG B 1 279 ? 12.045  -22.756 4.673  1.00 23.98 ? 936  ARG B CD    1 
ATOM   4030 N  NE    . ARG B 1 279 ? 12.158  -24.205 4.533  1.00 23.71 ? 936  ARG B NE    1 
ATOM   4031 C  CZ    . ARG B 1 279 ? 12.963  -24.974 5.261  1.00 23.42 ? 936  ARG B CZ    1 
ATOM   4032 N  NH1   . ARG B 1 279 ? 13.744  -24.439 6.195  1.00 23.09 ? 936  ARG B NH1   1 
ATOM   4033 N  NH2   . ARG B 1 279 ? 12.992  -26.284 5.052  1.00 23.11 ? 936  ARG B NH2   1 
ATOM   4034 N  N     . PRO B 1 280 ? 10.225  -17.605 2.918  1.00 25.52 ? 937  PRO B N     1 
ATOM   4035 C  CA    . PRO B 1 280 ? 10.413  -16.155 2.955  1.00 25.84 ? 937  PRO B CA    1 
ATOM   4036 C  C     . PRO B 1 280 ? 11.453  -15.696 3.978  1.00 26.30 ? 937  PRO B C     1 
ATOM   4037 O  O     . PRO B 1 280 ? 11.573  -16.286 5.057  1.00 26.37 ? 937  PRO B O     1 
ATOM   4038 C  CB    . PRO B 1 280 ? 9.030   -15.637 3.358  1.00 25.75 ? 937  PRO B CB    1 
ATOM   4039 C  CG    . PRO B 1 280 ? 8.435   -16.739 4.142  1.00 25.50 ? 937  PRO B CG    1 
ATOM   4040 C  CD    . PRO B 1 280 ? 8.935   -18.005 3.514  1.00 25.50 ? 937  PRO B CD    1 
ATOM   4041 N  N     . THR B 1 281 ? 12.199  -14.652 3.626  1.00 26.82 ? 938  THR B N     1 
ATOM   4042 C  CA    . THR B 1 281 ? 13.104  -13.991 4.559  1.00 27.37 ? 938  THR B CA    1 
ATOM   4043 C  C     . THR B 1 281 ? 12.286  -13.452 5.728  1.00 27.78 ? 938  THR B C     1 
ATOM   4044 O  O     . THR B 1 281 ? 11.070  -13.289 5.612  1.00 27.87 ? 938  THR B O     1 
ATOM   4045 C  CB    . THR B 1 281 ? 13.835  -12.804 3.892  1.00 27.35 ? 938  THR B CB    1 
ATOM   4046 O  OG1   . THR B 1 281 ? 12.895  -11.761 3.596  1.00 27.36 ? 938  THR B OG1   1 
ATOM   4047 C  CG2   . THR B 1 281 ? 14.535  -13.239 2.604  1.00 27.35 ? 938  THR B CG2   1 
ATOM   4048 N  N     . PHE B 1 282 ? 12.943  -13.169 6.848  1.00 28.33 ? 939  PHE B N     1 
ATOM   4049 C  CA    . PHE B 1 282 ? 12.262  -12.517 7.963  1.00 28.81 ? 939  PHE B CA    1 
ATOM   4050 C  C     . PHE B 1 282 ? 11.802  -11.112 7.582  1.00 29.10 ? 939  PHE B C     1 
ATOM   4051 O  O     . PHE B 1 282 ? 10.787  -10.631 8.089  1.00 29.20 ? 939  PHE B O     1 
ATOM   4052 C  CB    . PHE B 1 282 ? 13.153  -12.467 9.205  1.00 28.84 ? 939  PHE B CB    1 
ATOM   4053 C  CG    . PHE B 1 282 ? 13.299  -13.790 9.897  1.00 28.82 ? 939  PHE B CG    1 
ATOM   4054 C  CD1   . PHE B 1 282 ? 14.501  -14.484 9.846  1.00 28.87 ? 939  PHE B CD1   1 
ATOM   4055 C  CD2   . PHE B 1 282 ? 12.231  -14.347 10.596 1.00 28.80 ? 939  PHE B CD2   1 
ATOM   4056 C  CE1   . PHE B 1 282 ? 14.642  -15.710 10.485 1.00 28.86 ? 939  PHE B CE1   1 
ATOM   4057 C  CE2   . PHE B 1 282 ? 12.361  -15.573 11.237 1.00 28.90 ? 939  PHE B CE2   1 
ATOM   4058 C  CZ    . PHE B 1 282 ? 13.570  -16.255 11.183 1.00 29.04 ? 939  PHE B CZ    1 
ATOM   4059 N  N     . LYS B 1 283 ? 12.554  -10.468 6.688  1.00 29.42 ? 940  LYS B N     1 
ATOM   4060 C  CA    . LYS B 1 283 ? 12.232  -9.124  6.203  1.00 29.74 ? 940  LYS B CA    1 
ATOM   4061 C  C     . LYS B 1 283 ? 10.882  -9.081  5.494  1.00 29.96 ? 940  LYS B C     1 
ATOM   4062 O  O     . LYS B 1 283 ? 10.122  -8.125  5.658  1.00 30.01 ? 940  LYS B O     1 
ATOM   4063 C  CB    . LYS B 1 283 ? 13.327  -8.610  5.265  1.00 29.71 ? 940  LYS B CB    1 
ATOM   4064 N  N     . GLU B 1 284 ? 10.597  -10.118 4.708  1.00 30.17 ? 941  GLU B N     1 
ATOM   4065 C  CA    . GLU B 1 284 ? 9.317   -10.246 4.017  1.00 30.34 ? 941  GLU B CA    1 
ATOM   4066 C  C     . GLU B 1 284 ? 8.210   -10.559 5.005  1.00 30.35 ? 941  GLU B C     1 
ATOM   4067 O  O     . GLU B 1 284 ? 7.108   -10.016 4.902  1.00 30.42 ? 941  GLU B O     1 
ATOM   4068 C  CB    . GLU B 1 284 ? 9.380   -11.346 2.962  1.00 30.36 ? 941  GLU B CB    1 
ATOM   4069 C  CG    . GLU B 1 284 ? 10.173  -10.972 1.724  1.00 30.63 ? 941  GLU B CG    1 
ATOM   4070 C  CD    . GLU B 1 284 ? 10.887  -12.163 1.116  1.00 30.90 ? 941  GLU B CD    1 
ATOM   4071 O  OE1   . GLU B 1 284 ? 10.662  -13.303 1.573  1.00 30.99 ? 941  GLU B OE1   1 
ATOM   4072 O  OE2   . GLU B 1 284 ? 11.686  -11.958 0.179  1.00 30.95 ? 941  GLU B OE2   1 
ATOM   4073 N  N     . LEU B 1 285 ? 8.510   -11.440 5.957  1.00 30.34 ? 942  LEU B N     1 
ATOM   4074 C  CA    . LEU B 1 285 ? 7.558   -11.815 6.995  1.00 30.38 ? 942  LEU B CA    1 
ATOM   4075 C  C     . LEU B 1 285 ? 7.138   -10.585 7.793  1.00 30.48 ? 942  LEU B C     1 
ATOM   4076 O  O     . LEU B 1 285 ? 5.955   -10.413 8.106  1.00 30.47 ? 942  LEU B O     1 
ATOM   4077 C  CB    . LEU B 1 285 ? 8.148   -12.889 7.914  1.00 30.35 ? 942  LEU B CB    1 
ATOM   4078 C  CG    . LEU B 1 285 ? 8.396   -14.274 7.306  1.00 30.29 ? 942  LEU B CG    1 
ATOM   4079 C  CD1   . LEU B 1 285 ? 9.415   -15.041 8.130  1.00 30.43 ? 942  LEU B CD1   1 
ATOM   4080 C  CD2   . LEU B 1 285 ? 7.105   -15.069 7.184  1.00 30.37 ? 942  LEU B CD2   1 
ATOM   4081 N  N     . ALA B 1 286 ? 8.116   -9.731  8.105  1.00 30.60 ? 943  ALA B N     1 
ATOM   4082 C  CA    . ALA B 1 286 ? 7.860   -8.434  8.728  1.00 30.69 ? 943  ALA B CA    1 
ATOM   4083 C  C     . ALA B 1 286 ? 6.886   -7.608  7.890  1.00 30.74 ? 943  ALA B C     1 
ATOM   4084 O  O     . ALA B 1 286 ? 5.923   -7.054  8.417  1.00 30.74 ? 943  ALA B O     1 
ATOM   4085 C  CB    . ALA B 1 286 ? 9.168   -7.672  8.932  1.00 30.67 ? 943  ALA B CB    1 
ATOM   4086 N  N     . ASN B 1 287 ? 7.135   -7.559  6.583  1.00 30.81 ? 944  ASN B N     1 
ATOM   4087 C  CA    . ASN B 1 287 ? 6.347   -6.744  5.663  1.00 30.88 ? 944  ASN B CA    1 
ATOM   4088 C  C     . ASN B 1 287 ? 4.937   -7.260  5.367  1.00 30.86 ? 944  ASN B C     1 
ATOM   4089 O  O     . ASN B 1 287 ? 4.062   -6.467  5.010  1.00 30.88 ? 944  ASN B O     1 
ATOM   4090 C  CB    . ASN B 1 287 ? 7.117   -6.504  4.358  1.00 30.92 ? 944  ASN B CB    1 
ATOM   4091 C  CG    . ASN B 1 287 ? 8.366   -5.653  4.559  1.00 31.05 ? 944  ASN B CG    1 
ATOM   4092 O  OD1   . ASN B 1 287 ? 8.646   -5.180  5.662  1.00 31.33 ? 944  ASN B OD1   1 
ATOM   4093 N  ND2   . ASN B 1 287 ? 9.123   -5.459  3.485  1.00 31.04 ? 944  ASN B ND2   1 
ATOM   4094 N  N     . GLU B 1 288 ? 4.705   -8.567  5.505  1.00 30.75 ? 945  GLU B N     1 
ATOM   4095 C  CA    . GLU B 1 288 ? 3.344   -9.078  5.314  1.00 30.64 ? 945  GLU B CA    1 
ATOM   4096 C  C     . GLU B 1 288 ? 2.454   -8.859  6.538  1.00 30.36 ? 945  GLU B C     1 
ATOM   4097 O  O     . GLU B 1 288 ? 1.297   -8.459  6.393  1.00 30.48 ? 945  GLU B O     1 
ATOM   4098 C  CB    . GLU B 1 288 ? 3.291   -10.536 4.830  1.00 30.71 ? 945  GLU B CB    1 
ATOM   4099 C  CG    . GLU B 1 288 ? 1.904   -10.891 4.243  1.00 31.21 ? 945  GLU B CG    1 
ATOM   4100 C  CD    . GLU B 1 288 ? 1.852   -12.215 3.490  1.00 31.69 ? 945  GLU B CD    1 
ATOM   4101 O  OE1   . GLU B 1 288 ? 2.484   -13.198 3.936  1.00 31.92 ? 945  GLU B OE1   1 
ATOM   4102 O  OE2   . GLU B 1 288 ? 1.158   -12.274 2.452  1.00 31.65 ? 945  GLU B OE2   1 
ATOM   4103 N  N     . PHE B 1 289 ? 2.988   -9.106  7.732  1.00 29.90 ? 946  PHE B N     1 
ATOM   4104 C  CA    . PHE B 1 289 ? 2.225   -8.871  8.954  1.00 29.46 ? 946  PHE B CA    1 
ATOM   4105 C  C     . PHE B 1 289 ? 1.941   -7.390  9.166  1.00 29.26 ? 946  PHE B C     1 
ATOM   4106 O  O     . PHE B 1 289 ? 0.856   -7.030  9.620  1.00 29.21 ? 946  PHE B O     1 
ATOM   4107 C  CB    . PHE B 1 289 ? 2.920   -9.482  10.171 1.00 29.42 ? 946  PHE B CB    1 
ATOM   4108 C  CG    . PHE B 1 289 ? 2.687   -10.956 10.318 1.00 29.14 ? 946  PHE B CG    1 
ATOM   4109 C  CD1   . PHE B 1 289 ? 1.680   -11.434 11.149 1.00 28.97 ? 946  PHE B CD1   1 
ATOM   4110 C  CD2   . PHE B 1 289 ? 3.465   -11.870 9.617  1.00 28.87 ? 946  PHE B CD2   1 
ATOM   4111 C  CE1   . PHE B 1 289 ? 1.458   -12.802 11.283 1.00 28.86 ? 946  PHE B CE1   1 
ATOM   4112 C  CE2   . PHE B 1 289 ? 3.251   -13.235 9.745  1.00 28.72 ? 946  PHE B CE2   1 
ATOM   4113 C  CZ    . PHE B 1 289 ? 2.246   -13.702 10.579 1.00 28.71 ? 946  PHE B CZ    1 
ATOM   4114 N  N     . THR B 1 290 ? 2.909   -6.542  8.817  1.00 28.97 ? 947  THR B N     1 
ATOM   4115 C  CA    . THR B 1 290 ? 2.748   -5.089  8.912  1.00 28.68 ? 947  THR B CA    1 
ATOM   4116 C  C     . THR B 1 290 ? 1.517   -4.616  8.140  1.00 28.49 ? 947  THR B C     1 
ATOM   4117 O  O     . THR B 1 290 ? 0.712   -3.846  8.668  1.00 28.51 ? 947  THR B O     1 
ATOM   4118 C  CB    . THR B 1 290 ? 3.996   -4.328  8.402  1.00 28.69 ? 947  THR B CB    1 
ATOM   4119 O  OG1   . THR B 1 290 ? 5.170   -4.841  9.043  1.00 28.68 ? 947  THR B OG1   1 
ATOM   4120 C  CG2   . THR B 1 290 ? 3.885   -2.835  8.700  1.00 28.64 ? 947  THR B CG2   1 
ATOM   4121 N  N     . ARG B 1 291 ? 1.370   -5.083  6.901  1.00 28.21 ? 948  ARG B N     1 
ATOM   4122 C  CA    . ARG B 1 291 ? 0.248   -4.659  6.066  1.00 27.93 ? 948  ARG B CA    1 
ATOM   4123 C  C     . ARG B 1 291 ? -1.054  -5.380  6.430  1.00 27.78 ? 948  ARG B C     1 
ATOM   4124 O  O     . ARG B 1 291 ? -2.142  -4.853  6.199  1.00 27.76 ? 948  ARG B O     1 
ATOM   4125 C  CB    . ARG B 1 291 ? 0.574   -4.783  4.570  1.00 27.91 ? 948  ARG B CB    1 
ATOM   4126 C  CG    . ARG B 1 291 ? 0.296   -6.141  3.955  1.00 27.77 ? 948  ARG B CG    1 
ATOM   4127 C  CD    . ARG B 1 291 ? 0.102   -6.026  2.450  1.00 27.51 ? 948  ARG B CD    1 
ATOM   4128 N  NE    . ARG B 1 291 ? -0.822  -7.043  1.949  1.00 27.26 ? 948  ARG B NE    1 
ATOM   4129 C  CZ    . ARG B 1 291 ? -0.492  -8.307  1.691  1.00 27.20 ? 948  ARG B CZ    1 
ATOM   4130 N  NH1   . ARG B 1 291 ? 0.751   -8.737  1.881  1.00 27.29 ? 948  ARG B NH1   1 
ATOM   4131 N  NH2   . ARG B 1 291 ? -1.412  -9.148  1.241  1.00 27.12 ? 948  ARG B NH2   1 
ATOM   4132 N  N     . MET B 1 292 ? -0.933  -6.577  7.001  1.00 27.61 ? 949  MET B N     1 
ATOM   4133 C  CA    . MET B 1 292 ? -2.086  -7.301  7.527  1.00 27.48 ? 949  MET B CA    1 
ATOM   4134 C  C     . MET B 1 292 ? -2.562  -6.684  8.834  1.00 27.41 ? 949  MET B C     1 
ATOM   4135 O  O     . MET B 1 292 ? -3.750  -6.722  9.153  1.00 27.35 ? 949  MET B O     1 
ATOM   4136 C  CB    . MET B 1 292 ? -1.746  -8.771  7.744  1.00 27.49 ? 949  MET B CB    1 
ATOM   4137 C  CG    . MET B 1 292 ? -1.815  -9.609  6.485  1.00 27.51 ? 949  MET B CG    1 
ATOM   4138 S  SD    . MET B 1 292 ? -1.168  -11.273 6.715  1.00 27.83 ? 949  MET B SD    1 
ATOM   4139 C  CE    . MET B 1 292 ? -2.187  -11.863 8.059  1.00 27.74 ? 949  MET B CE    1 
ATOM   4140 N  N     . ALA B 1 293 ? -1.616  -6.122  9.585  1.00 27.42 ? 950  ALA B N     1 
ATOM   4141 C  CA    . ALA B 1 293 ? -1.904  -5.440  10.845 1.00 27.40 ? 950  ALA B CA    1 
ATOM   4142 C  C     . ALA B 1 293 ? -2.711  -4.167  10.618 1.00 27.39 ? 950  ALA B C     1 
ATOM   4143 O  O     . ALA B 1 293 ? -3.416  -3.708  11.519 1.00 27.40 ? 950  ALA B O     1 
ATOM   4144 C  CB    . ALA B 1 293 ? -0.614  -5.123  11.590 1.00 27.35 ? 950  ALA B CB    1 
ATOM   4145 N  N     . ARG B 1 294 ? -2.601  -3.604  9.416  1.00 27.41 ? 951  ARG B N     1 
ATOM   4146 C  CA    . ARG B 1 294 ? -3.371  -2.423  9.030  1.00 27.45 ? 951  ARG B CA    1 
ATOM   4147 C  C     . ARG B 1 294 ? -4.876  -2.707  8.985  1.00 27.52 ? 951  ARG B C     1 
ATOM   4148 O  O     . ARG B 1 294 ? -5.685  -1.777  9.008  1.00 27.52 ? 951  ARG B O     1 
ATOM   4149 C  CB    . ARG B 1 294 ? -2.885  -1.881  7.682  1.00 27.39 ? 951  ARG B CB    1 
ATOM   4150 N  N     . ASP B 1 295 ? -5.243  -3.987  8.924  1.00 27.64 ? 952  ASP B N     1 
ATOM   4151 C  CA    . ASP B 1 295 ? -6.647  -4.401  8.977  1.00 27.76 ? 952  ASP B CA    1 
ATOM   4152 C  C     . ASP B 1 295 ? -6.816  -5.747  9.699  1.00 27.79 ? 952  ASP B C     1 
ATOM   4153 O  O     . ASP B 1 295 ? -7.002  -6.779  9.052  1.00 27.75 ? 952  ASP B O     1 
ATOM   4154 C  CB    . ASP B 1 295 ? -7.241  -4.462  7.563  1.00 27.83 ? 952  ASP B CB    1 
ATOM   4155 C  CG    . ASP B 1 295 ? -8.765  -4.446  7.558  1.00 27.97 ? 952  ASP B CG    1 
ATOM   4156 O  OD1   . ASP B 1 295 ? -9.386  -4.482  8.645  1.00 28.15 ? 952  ASP B OD1   1 
ATOM   4157 O  OD2   . ASP B 1 295 ? -9.347  -4.395  6.453  1.00 28.07 ? 952  ASP B OD2   1 
ATOM   4158 N  N     . PRO B 1 296 ? -6.764  -5.736  11.047 1.00 27.87 ? 953  PRO B N     1 
ATOM   4159 C  CA    . PRO B 1 296 ? -6.783  -6.984  11.829 1.00 27.90 ? 953  PRO B CA    1 
ATOM   4160 C  C     . PRO B 1 296 ? -7.981  -7.939  11.630 1.00 27.93 ? 953  PRO B C     1 
ATOM   4161 O  O     . PRO B 1 296 ? -7.752  -9.143  11.482 1.00 27.87 ? 953  PRO B O     1 
ATOM   4162 C  CB    . PRO B 1 296 ? -6.694  -6.505  13.288 1.00 27.93 ? 953  PRO B CB    1 
ATOM   4163 C  CG    . PRO B 1 296 ? -6.960  -5.038  13.259 1.00 27.90 ? 953  PRO B CG    1 
ATOM   4164 C  CD    . PRO B 1 296 ? -6.564  -4.552  11.905 1.00 27.88 ? 953  PRO B CD    1 
ATOM   4165 N  N     . PRO B 1 297 ? -9.239  -7.429  11.623 1.00 27.98 ? 954  PRO B N     1 
ATOM   4166 C  CA    . PRO B 1 297 ? -10.361 -8.373  11.552 1.00 28.03 ? 954  PRO B CA    1 
ATOM   4167 C  C     . PRO B 1 297 ? -10.537 -9.005  10.172 1.00 28.10 ? 954  PRO B C     1 
ATOM   4168 O  O     . PRO B 1 297 ? -11.222 -10.023 10.043 1.00 28.05 ? 954  PRO B O     1 
ATOM   4169 C  CB    . PRO B 1 297 ? -11.583 -7.502  11.887 1.00 28.01 ? 954  PRO B CB    1 
ATOM   4170 C  CG    . PRO B 1 297 ? -11.038 -6.178  12.331 1.00 27.98 ? 954  PRO B CG    1 
ATOM   4171 C  CD    . PRO B 1 297 ? -9.736  -6.043  11.634 1.00 27.98 ? 954  PRO B CD    1 
ATOM   4172 N  N     . ARG B 1 298 ? -9.929  -8.394  9.159  1.00 28.20 ? 955  ARG B N     1 
ATOM   4173 C  CA    . ARG B 1 298 ? -9.907  -8.950  7.813  1.00 28.36 ? 955  ARG B CA    1 
ATOM   4174 C  C     . ARG B 1 298 ? -9.099  -10.247 7.770  1.00 28.31 ? 955  ARG B C     1 
ATOM   4175 O  O     . ARG B 1 298 ? -9.468  -11.189 7.069  1.00 28.32 ? 955  ARG B O     1 
ATOM   4176 C  CB    . ARG B 1 298 ? -9.330  -7.932  6.826  1.00 28.45 ? 955  ARG B CB    1 
ATOM   4177 C  CG    . ARG B 1 298 ? -9.254  -8.418  5.383  1.00 29.07 ? 955  ARG B CG    1 
ATOM   4178 C  CD    . ARG B 1 298 ? -8.531  -7.407  4.509  1.00 30.28 ? 955  ARG B CD    1 
ATOM   4179 N  NE    . ARG B 1 298 ? -8.270  -7.930  3.170  1.00 31.21 ? 955  ARG B NE    1 
ATOM   4180 C  CZ    . ARG B 1 298 ? -7.644  -7.258  2.207  1.00 31.77 ? 955  ARG B CZ    1 
ATOM   4181 N  NH1   . ARG B 1 298 ? -7.206  -6.023  2.420  1.00 31.89 ? 955  ARG B NH1   1 
ATOM   4182 N  NH2   . ARG B 1 298 ? -7.456  -7.823  1.022  1.00 31.97 ? 955  ARG B NH2   1 
ATOM   4183 N  N     . TYR B 1 299 ? -8.005  -10.290 8.532  1.00 28.26 ? 956  TYR B N     1 
ATOM   4184 C  CA    . TYR B 1 299 ? -7.095  -11.433 8.506  1.00 28.16 ? 956  TYR B CA    1 
ATOM   4185 C  C     . TYR B 1 299 ? -7.296  -12.431 9.647  1.00 27.98 ? 956  TYR B C     1 
ATOM   4186 O  O     . TYR B 1 299 ? -7.003  -13.617 9.489  1.00 27.95 ? 956  TYR B O     1 
ATOM   4187 C  CB    . TYR B 1 299 ? -5.646  -10.955 8.438  1.00 28.28 ? 956  TYR B CB    1 
ATOM   4188 C  CG    . TYR B 1 299 ? -5.385  -10.081 7.234  1.00 28.61 ? 956  TYR B CG    1 
ATOM   4189 C  CD1   . TYR B 1 299 ? -5.432  -8.695  7.337  1.00 28.90 ? 956  TYR B CD1   1 
ATOM   4190 C  CD2   . TYR B 1 299 ? -5.123  -10.641 5.985  1.00 28.80 ? 956  TYR B CD2   1 
ATOM   4191 C  CE1   . TYR B 1 299 ? -5.209  -7.884  6.232  1.00 29.05 ? 956  TYR B CE1   1 
ATOM   4192 C  CE2   . TYR B 1 299 ? -4.896  -9.839  4.873  1.00 28.96 ? 956  TYR B CE2   1 
ATOM   4193 C  CZ    . TYR B 1 299 ? -4.937  -8.461  5.007  1.00 29.05 ? 956  TYR B CZ    1 
ATOM   4194 O  OH    . TYR B 1 299 ? -4.712  -7.661  3.912  1.00 29.08 ? 956  TYR B OH    1 
ATOM   4195 N  N     . LEU B 1 300 ? -7.796  -11.962 10.786 1.00 27.75 ? 957  LEU B N     1 
ATOM   4196 C  CA    . LEU B 1 300 ? -8.097  -12.860 11.900 1.00 27.55 ? 957  LEU B CA    1 
ATOM   4197 C  C     . LEU B 1 300 ? -9.549  -12.735 12.354 1.00 27.58 ? 957  LEU B C     1 
ATOM   4198 O  O     . LEU B 1 300 ? -10.116 -11.639 12.349 1.00 27.58 ? 957  LEU B O     1 
ATOM   4199 C  CB    . LEU B 1 300 ? -7.137  -12.631 13.076 1.00 27.50 ? 957  LEU B CB    1 
ATOM   4200 C  CG    . LEU B 1 300 ? -5.631  -12.868 12.884 1.00 27.08 ? 957  LEU B CG    1 
ATOM   4201 C  CD1   . LEU B 1 300 ? -4.902  -12.580 14.183 1.00 26.79 ? 957  LEU B CD1   1 
ATOM   4202 C  CD2   . LEU B 1 300 ? -5.316  -14.280 12.408 1.00 26.64 ? 957  LEU B CD2   1 
ATOM   4203 N  N     . VAL B 1 301 ? -10.149 -13.859 12.742 1.00 27.58 ? 958  VAL B N     1 
ATOM   4204 C  CA    . VAL B 1 301 ? -11.562 -13.870 13.133 1.00 27.62 ? 958  VAL B CA    1 
ATOM   4205 C  C     . VAL B 1 301 ? -11.781 -14.479 14.525 1.00 27.66 ? 958  VAL B C     1 
ATOM   4206 O  O     . VAL B 1 301 ? -11.634 -15.690 14.720 1.00 27.65 ? 958  VAL B O     1 
ATOM   4207 C  CB    . VAL B 1 301 ? -12.459 -14.567 12.060 1.00 27.59 ? 958  VAL B CB    1 
ATOM   4208 C  CG1   . VAL B 1 301 ? -13.904 -14.659 12.529 1.00 27.59 ? 958  VAL B CG1   1 
ATOM   4209 C  CG2   . VAL B 1 301 ? -12.388 -13.828 10.726 1.00 27.47 ? 958  VAL B CG2   1 
ATOM   4210 N  N     . ILE B 1 302 ? -12.127 -13.618 15.484 1.00 27.72 ? 959  ILE B N     1 
ATOM   4211 C  CA    . ILE B 1 302 ? -12.470 -14.043 16.846 1.00 27.80 ? 959  ILE B CA    1 
ATOM   4212 C  C     . ILE B 1 302 ? -13.986 -14.210 16.993 1.00 27.79 ? 959  ILE B C     1 
ATOM   4213 O  O     . ILE B 1 302 ? -14.500 -14.487 18.106 1.00 27.77 ? 959  ILE B O     1 
ATOM   4214 C  CB    . ILE B 1 302 ? -11.920 -13.067 17.940 1.00 27.87 ? 959  ILE B CB    1 
ATOM   4215 C  CG1   . ILE B 1 302 ? -12.590 -11.686 17.848 1.00 28.02 ? 959  ILE B CG1   1 
ATOM   4216 C  CG2   . ILE B 1 302 ? -10.389 -12.978 17.873 1.00 27.75 ? 959  ILE B CG2   1 
ATOM   4217 C  CD1   . ILE B 1 302 ? -12.621 -10.913 19.175 1.00 28.17 ? 959  ILE B CD1   1 
HETATM 4218 MG MG    . MG  C 2 .   ? 13.771  -29.218 51.182 1.00 49.82 ? 202  MG  A MG    1 
HETATM 4219 P  PG    . ANP D 3 .   ? 13.928  -26.039 52.073 1.00 48.01 ? 301  ANP A PG    1 
HETATM 4220 O  O1G   . ANP D 3 .   ? 14.131  -27.514 52.318 1.00 47.29 ? 301  ANP A O1G   1 
HETATM 4221 O  O2G   . ANP D 3 .   ? 13.677  -25.238 53.327 1.00 47.90 ? 301  ANP A O2G   1 
HETATM 4222 O  O3G   . ANP D 3 .   ? 14.962  -25.434 51.156 1.00 48.13 ? 301  ANP A O3G   1 
HETATM 4223 P  PB    . ANP D 3 .   ? 12.200  -26.998 49.836 1.00 47.75 ? 301  ANP A PB    1 
HETATM 4224 O  O1B   . ANP D 3 .   ? 10.916  -26.613 49.139 1.00 48.00 ? 301  ANP A O1B   1 
HETATM 4225 O  O2B   . ANP D 3 .   ? 12.346  -28.423 50.320 1.00 47.85 ? 301  ANP A O2B   1 
HETATM 4226 N  N3B   . ANP D 3 .   ? 12.424  -25.927 51.193 1.00 47.88 ? 301  ANP A N3B   1 
HETATM 4227 P  PA    . ANP D 3 .   ? 14.520  -27.748 48.415 1.00 46.36 ? 301  ANP A PA    1 
HETATM 4228 O  O1A   . ANP D 3 .   ? 15.599  -27.012 47.656 1.00 46.37 ? 301  ANP A O1A   1 
HETATM 4229 O  O2A   . ANP D 3 .   ? 14.882  -28.553 49.640 1.00 46.24 ? 301  ANP A O2A   1 
HETATM 4230 O  O3A   . ANP D 3 .   ? 13.405  -26.664 48.824 1.00 47.14 ? 301  ANP A O3A   1 
HETATM 4231 O  "O5'" . ANP D 3 .   ? 13.734  -28.719 47.394 1.00 45.99 ? 301  ANP A "O5'" 1 
HETATM 4232 C  "C5'" . ANP D 3 .   ? 12.968  -28.191 46.307 1.00 45.56 ? 301  ANP A "C5'" 1 
HETATM 4233 C  "C4'" . ANP D 3 .   ? 11.925  -29.201 45.829 1.00 45.32 ? 301  ANP A "C4'" 1 
HETATM 4234 O  "O4'" . ANP D 3 .   ? 12.519  -30.474 45.540 1.00 44.93 ? 301  ANP A "O4'" 1 
HETATM 4235 C  "C3'" . ANP D 3 .   ? 10.838  -29.439 46.870 1.00 45.41 ? 301  ANP A "C3'" 1 
HETATM 4236 O  "O3'" . ANP D 3 .   ? 9.558   -29.334 46.228 1.00 45.57 ? 301  ANP A "O3'" 1 
HETATM 4237 C  "C2'" . ANP D 3 .   ? 11.081  -30.862 47.341 1.00 45.37 ? 301  ANP A "C2'" 1 
HETATM 4238 O  "O2'" . ANP D 3 .   ? 9.878   -31.542 47.722 1.00 45.48 ? 301  ANP A "O2'" 1 
HETATM 4239 C  "C1'" . ANP D 3 .   ? 11.738  -31.512 46.136 1.00 44.97 ? 301  ANP A "C1'" 1 
HETATM 4240 N  N9    . ANP D 3 .   ? 12.586  -32.666 46.515 1.00 44.77 ? 301  ANP A N9    1 
HETATM 4241 C  C8    . ANP D 3 .   ? 13.648  -32.644 47.345 1.00 44.79 ? 301  ANP A C8    1 
HETATM 4242 N  N7    . ANP D 3 .   ? 14.200  -33.878 47.469 1.00 44.65 ? 301  ANP A N7    1 
HETATM 4243 C  C5    . ANP D 3 .   ? 13.482  -34.713 46.699 1.00 44.56 ? 301  ANP A C5    1 
HETATM 4244 C  C6    . ANP D 3 .   ? 13.516  -36.156 46.365 1.00 44.53 ? 301  ANP A C6    1 
HETATM 4245 N  N6    . ANP D 3 .   ? 14.460  -36.967 46.896 1.00 44.72 ? 301  ANP A N6    1 
HETATM 4246 N  N1    . ANP D 3 .   ? 12.578  -36.635 45.514 1.00 44.65 ? 301  ANP A N1    1 
HETATM 4247 C  C2    . ANP D 3 .   ? 11.631  -35.839 44.977 1.00 44.59 ? 301  ANP A C2    1 
HETATM 4248 N  N3    . ANP D 3 .   ? 11.541  -34.521 45.235 1.00 44.58 ? 301  ANP A N3    1 
HETATM 4249 C  C4    . ANP D 3 .   ? 12.419  -33.911 46.071 1.00 44.65 ? 301  ANP A C4    1 
HETATM 4250 MG MG    . MG  E 2 .   ? 13.617  -20.333 27.366 1.00 57.55 ? 202  MG  B MG    1 
HETATM 4251 P  PG    . ANP F 3 .   ? 13.934  -23.869 26.172 1.00 39.29 ? 301  ANP B PG    1 
HETATM 4252 O  O1G   . ANP F 3 .   ? 13.978  -22.371 26.001 1.00 38.17 ? 301  ANP B O1G   1 
HETATM 4253 O  O2G   . ANP F 3 .   ? 13.601  -24.616 24.902 1.00 39.31 ? 301  ANP B O2G   1 
HETATM 4254 O  O3G   . ANP F 3 .   ? 15.125  -24.435 26.911 1.00 39.70 ? 301  ANP B O3G   1 
HETATM 4255 P  PB    . ANP F 3 .   ? 12.206  -22.988 28.412 1.00 38.97 ? 301  ANP B PB    1 
HETATM 4256 O  O1B   . ANP F 3 .   ? 10.887  -23.371 29.036 1.00 39.14 ? 301  ANP B O1B   1 
HETATM 4257 O  O2B   . ANP F 3 .   ? 12.338  -21.618 27.792 1.00 38.44 ? 301  ANP B O2B   1 
HETATM 4258 N  N3B   . ANP F 3 .   ? 12.577  -24.193 27.214 1.00 38.82 ? 301  ANP B N3B   1 
HETATM 4259 P  PA    . ANP F 3 .   ? 14.501  -22.168 29.932 1.00 38.69 ? 301  ANP B PA    1 
HETATM 4260 O  O1A   . ANP F 3 .   ? 15.514  -22.988 30.693 1.00 39.02 ? 301  ANP B O1A   1 
HETATM 4261 O  O2A   . ANP F 3 .   ? 14.934  -21.419 28.699 1.00 38.98 ? 301  ANP B O2A   1 
HETATM 4262 O  O3A   . ANP F 3 .   ? 13.313  -23.191 29.566 1.00 39.30 ? 301  ANP B O3A   1 
HETATM 4263 O  "O5'" . ANP F 3 .   ? 13.783  -21.132 30.933 1.00 38.71 ? 301  ANP B "O5'" 1 
HETATM 4264 C  "C5'" . ANP F 3 .   ? 13.063  -21.625 32.061 1.00 39.41 ? 301  ANP B "C5'" 1 
HETATM 4265 C  "C4'" . ANP F 3 .   ? 12.054  -20.601 32.578 1.00 39.88 ? 301  ANP B "C4'" 1 
HETATM 4266 O  "O4'" . ANP F 3 .   ? 12.667  -19.325 32.783 1.00 39.67 ? 301  ANP B "O4'" 1 
HETATM 4267 C  "C3'" . ANP F 3 .   ? 10.887  -20.394 31.623 1.00 40.03 ? 301  ANP B "C3'" 1 
HETATM 4268 O  "O3'" . ANP F 3 .   ? 9.677   -20.568 32.367 1.00 40.14 ? 301  ANP B "O3'" 1 
HETATM 4269 C  "C2'" . ANP F 3 .   ? 11.017  -18.955 31.161 1.00 40.07 ? 301  ANP B "C2'" 1 
HETATM 4270 O  "O2'" . ANP F 3 .   ? 9.746   -18.324 30.975 1.00 40.51 ? 301  ANP B "O2'" 1 
HETATM 4271 C  "C1'" . ANP F 3 .   ? 11.804  -18.304 32.286 1.00 39.52 ? 301  ANP B "C1'" 1 
HETATM 4272 N  N9    . ANP F 3 .   ? 12.603  -17.157 31.805 1.00 38.89 ? 301  ANP B N9    1 
HETATM 4273 C  C8    . ANP F 3 .   ? 13.613  -17.207 30.918 1.00 38.91 ? 301  ANP B C8    1 
HETATM 4274 N  N7    . ANP F 3 .   ? 14.128  -15.971 30.699 1.00 39.00 ? 301  ANP B N7    1 
HETATM 4275 C  C5    . ANP F 3 .   ? 13.437  -15.110 31.465 1.00 38.73 ? 301  ANP B C5    1 
HETATM 4276 C  C6    . ANP F 3 .   ? 13.467  -13.652 31.717 1.00 38.83 ? 301  ANP B C6    1 
HETATM 4277 N  N6    . ANP F 3 .   ? 14.369  -12.869 31.080 1.00 39.12 ? 301  ANP B N6    1 
HETATM 4278 N  N1    . ANP F 3 .   ? 12.570  -13.138 32.594 1.00 38.76 ? 301  ANP B N1    1 
HETATM 4279 C  C2    . ANP F 3 .   ? 11.672  -13.923 33.229 1.00 38.82 ? 301  ANP B C2    1 
HETATM 4280 N  N3    . ANP F 3 .   ? 11.591  -15.257 33.048 1.00 38.61 ? 301  ANP B N3    1 
HETATM 4281 C  C4    . ANP F 3 .   ? 12.432  -15.895 32.195 1.00 38.57 ? 301  ANP B C4    1 
HETATM 4282 O  O     . HOH G 4 .   ? 8.169   -42.173 46.482 1.00 23.00 ? 1011 HOH A O     1 
HETATM 4283 O  O     . HOH G 4 .   ? 18.800  -21.261 46.915 1.00 13.01 ? 1012 HOH A O     1 
HETATM 4284 O  O     . HOH H 4 .   ? 29.766  -19.514 36.622 1.00 23.32 ? 1013 HOH B O     1 
HETATM 4285 O  O     . HOH H 4 .   ? 18.823  -28.333 31.276 1.00 2.00  ? 1014 HOH B O     1 
HETATM 4286 O  O     . HOH H 4 .   ? 6.842   -27.884 0.638  1.00 11.75 ? 1015 HOH B O     1 
HETATM 4287 O  O     . HOH H 4 .   ? 18.525  -29.551 33.902 1.00 10.80 ? 1016 HOH B O     1 
HETATM 4288 O  O     . HOH H 4 .   ? 10.792  -25.683 34.393 1.00 40.26 ? 1017 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   658  ?   ?   ?   A . n 
A 1 2   HIS 2   659  ?   ?   ?   A . n 
A 1 3   HIS 3   660  ?   ?   ?   A . n 
A 1 4   HIS 4   661  ?   ?   ?   A . n 
A 1 5   HIS 5   662  ?   ?   ?   A . n 
A 1 6   HIS 6   663  ?   ?   ?   A . n 
A 1 7   HIS 7   664  ?   ?   ?   A . n 
A 1 8   GLY 8   665  ?   ?   ?   A . n 
A 1 9   GLU 9   666  ?   ?   ?   A . n 
A 1 10  SER 10  667  ?   ?   ?   A . n 
A 1 11  ILE 11  668  ?   ?   ?   A . n 
A 1 12  GLU 12  669  ?   ?   ?   A . n 
A 1 13  PRO 13  670  ?   ?   ?   A . n 
A 1 14  LEU 14  671  ?   ?   ?   A . n 
A 1 15  ASP 15  672  ?   ?   ?   A . n 
A 1 16  PRO 16  673  ?   ?   ?   A . n 
A 1 17  SER 17  674  ?   ?   ?   A . n 
A 1 18  GLU 18  675  ?   ?   ?   A . n 
A 1 19  LYS 19  676  ?   ?   ?   A . n 
A 1 20  ALA 20  677  ?   ?   ?   A . n 
A 1 21  ASN 21  678  ?   ?   ?   A . n 
A 1 22  LYS 22  679  ?   ?   ?   A . n 
A 1 23  VAL 23  680  680 VAL VAL A . n 
A 1 24  LEU 24  681  681 LEU LEU A . n 
A 1 25  ALA 25  682  682 ALA ALA A . n 
A 1 26  ARG 26  683  683 ARG ARG A . n 
A 1 27  ILE 27  684  684 ILE ILE A . n 
A 1 28  PHE 28  685  685 PHE PHE A . n 
A 1 29  LYS 29  686  686 LYS LYS A . n 
A 1 30  GLU 30  687  687 GLU GLU A . n 
A 1 31  THR 31  688  688 THR THR A . n 
A 1 32  GLU 32  689  689 GLU GLU A . n 
A 1 33  LEU 33  690  690 LEU LEU A . n 
A 1 34  ARG 34  691  691 ARG ARG A . n 
A 1 35  LYS 35  692  692 LYS LYS A . n 
A 1 36  LEU 36  693  693 LEU LEU A . n 
A 1 37  LYS 37  694  694 LYS LYS A . n 
A 1 38  VAL 38  695  695 VAL VAL A . n 
A 1 39  LEU 39  696  696 LEU LEU A . n 
A 1 40  GLY 40  697  697 GLY GLY A . n 
A 1 41  SER 41  698  698 SER SER A . n 
A 1 42  GLY 42  699  699 GLY GLY A . n 
A 1 43  VAL 43  700  700 VAL VAL A . n 
A 1 44  PHE 44  701  701 PHE PHE A . n 
A 1 45  GLY 45  702  702 GLY GLY A . n 
A 1 46  THR 46  703  703 THR THR A . n 
A 1 47  VAL 47  704  704 VAL VAL A . n 
A 1 48  HIS 48  705  705 HIS HIS A . n 
A 1 49  LYS 49  706  706 LYS LYS A . n 
A 1 50  GLY 50  707  707 GLY GLY A . n 
A 1 51  VAL 51  708  708 VAL VAL A . n 
A 1 52  TRP 52  709  709 TRP TRP A . n 
A 1 53  ILE 53  710  710 ILE ILE A . n 
A 1 54  PRO 54  711  711 PRO PRO A . n 
A 1 55  GLU 55  712  712 GLU GLU A . n 
A 1 56  GLY 56  713  713 GLY GLY A . n 
A 1 57  GLU 57  714  714 GLU GLU A . n 
A 1 58  SER 58  715  715 SER SER A . n 
A 1 59  ILE 59  716  716 ILE ILE A . n 
A 1 60  LYS 60  717  717 LYS LYS A . n 
A 1 61  ILE 61  718  718 ILE ILE A . n 
A 1 62  PRO 62  719  719 PRO PRO A . n 
A 1 63  VAL 63  720  720 VAL VAL A . n 
A 1 64  CYS 64  721  721 CYS CYS A . n 
A 1 65  ILE 65  722  722 ILE ILE A . n 
A 1 66  LYS 66  723  723 LYS LYS A . n 
A 1 67  VAL 67  724  724 VAL VAL A . n 
A 1 68  ILE 68  725  725 ILE ILE A . n 
A 1 69  GLU 69  726  726 GLU GLU A . n 
A 1 70  ASP 70  727  727 ASP ASP A . n 
A 1 71  LYS 71  728  728 LYS LYS A . n 
A 1 72  SER 72  729  ?   ?   ?   A . n 
A 1 73  GLY 73  730  ?   ?   ?   A . n 
A 1 74  ARG 74  731  ?   ?   ?   A . n 
A 1 75  GLN 75  732  732 GLN GLN A . n 
A 1 76  SER 76  733  733 SER SER A . n 
A 1 77  PHE 77  734  734 PHE PHE A . n 
A 1 78  GLN 78  735  735 GLN GLN A . n 
A 1 79  ALA 79  736  736 ALA ALA A . n 
A 1 80  VAL 80  737  737 VAL VAL A . n 
A 1 81  THR 81  738  738 THR THR A . n 
A 1 82  ASP 82  739  739 ASP ASP A . n 
A 1 83  HIS 83  740  740 HIS HIS A . n 
A 1 84  MET 84  741  741 MET MET A . n 
A 1 85  LEU 85  742  742 LEU LEU A . n 
A 1 86  ALA 86  743  743 ALA ALA A . n 
A 1 87  ILE 87  744  744 ILE ILE A . n 
A 1 88  GLY 88  745  745 GLY GLY A . n 
A 1 89  SER 89  746  746 SER SER A . n 
A 1 90  LEU 90  747  747 LEU LEU A . n 
A 1 91  ASP 91  748  748 ASP ASP A . n 
A 1 92  HIS 92  749  749 HIS HIS A . n 
A 1 93  ALA 93  750  750 ALA ALA A . n 
A 1 94  HIS 94  751  751 HIS HIS A . n 
A 1 95  ILE 95  752  752 ILE ILE A . n 
A 1 96  VAL 96  753  753 VAL VAL A . n 
A 1 97  ARG 97  754  754 ARG ARG A . n 
A 1 98  LEU 98  755  755 LEU LEU A . n 
A 1 99  LEU 99  756  756 LEU LEU A . n 
A 1 100 GLY 100 757  757 GLY GLY A . n 
A 1 101 LEU 101 758  758 LEU LEU A . n 
A 1 102 CYS 102 759  759 CYS CYS A . n 
A 1 103 PRO 103 760  760 PRO PRO A . n 
A 1 104 GLY 104 761  761 GLY GLY A . n 
A 1 105 SER 105 762  762 SER SER A . n 
A 1 106 SER 106 763  763 SER SER A . n 
A 1 107 LEU 107 764  764 LEU LEU A . n 
A 1 108 GLN 108 765  765 GLN GLN A . n 
A 1 109 LEU 109 766  766 LEU LEU A . n 
A 1 110 VAL 110 767  767 VAL VAL A . n 
A 1 111 THR 111 768  768 THR THR A . n 
A 1 112 GLN 112 769  769 GLN GLN A . n 
A 1 113 TYR 113 770  770 TYR TYR A . n 
A 1 114 LEU 114 771  771 LEU LEU A . n 
A 1 115 PRO 115 772  772 PRO PRO A . n 
A 1 116 LEU 116 773  773 LEU LEU A . n 
A 1 117 GLY 117 774  774 GLY GLY A . n 
A 1 118 SER 118 775  775 SER SER A . n 
A 1 119 LEU 119 776  776 LEU LEU A . n 
A 1 120 LEU 120 777  777 LEU LEU A . n 
A 1 121 ASP 121 778  778 ASP ASP A . n 
A 1 122 HIS 122 779  779 HIS HIS A . n 
A 1 123 VAL 123 780  780 VAL VAL A . n 
A 1 124 ARG 124 781  781 ARG ARG A . n 
A 1 125 GLN 125 782  782 GLN GLN A . n 
A 1 126 HIS 126 783  783 HIS HIS A . n 
A 1 127 ARG 127 784  784 ARG ARG A . n 
A 1 128 GLY 128 785  785 GLY GLY A . n 
A 1 129 ALA 129 786  786 ALA ALA A . n 
A 1 130 LEU 130 787  787 LEU LEU A . n 
A 1 131 GLY 131 788  788 GLY GLY A . n 
A 1 132 PRO 132 789  789 PRO PRO A . n 
A 1 133 GLN 133 790  790 GLN GLN A . n 
A 1 134 LEU 134 791  791 LEU LEU A . n 
A 1 135 LEU 135 792  792 LEU LEU A . n 
A 1 136 LEU 136 793  793 LEU LEU A . n 
A 1 137 ASN 137 794  794 ASN ASN A . n 
A 1 138 TRP 138 795  795 TRP TRP A . n 
A 1 139 GLY 139 796  796 GLY GLY A . n 
A 1 140 VAL 140 797  797 VAL VAL A . n 
A 1 141 GLN 141 798  798 GLN GLN A . n 
A 1 142 ILE 142 799  799 ILE ILE A . n 
A 1 143 ALA 143 800  800 ALA ALA A . n 
A 1 144 LYS 144 801  801 LYS LYS A . n 
A 1 145 GLY 145 802  802 GLY GLY A . n 
A 1 146 MET 146 803  803 MET MET A . n 
A 1 147 TYR 147 804  804 TYR TYR A . n 
A 1 148 TYR 148 805  805 TYR TYR A . n 
A 1 149 LEU 149 806  806 LEU LEU A . n 
A 1 150 GLU 150 807  807 GLU GLU A . n 
A 1 151 GLU 151 808  808 GLU GLU A . n 
A 1 152 HIS 152 809  809 HIS HIS A . n 
A 1 153 GLY 153 810  810 GLY GLY A . n 
A 1 154 MET 154 811  811 MET MET A . n 
A 1 155 VAL 155 812  812 VAL VAL A . n 
A 1 156 HIS 156 813  813 HIS HIS A . n 
A 1 157 ARG 157 814  814 ARG ARG A . n 
A 1 158 ASN 158 815  815 ASN ASN A . n 
A 1 159 LEU 159 816  816 LEU LEU A . n 
A 1 160 ALA 160 817  817 ALA ALA A . n 
A 1 161 ALA 161 818  818 ALA ALA A . n 
A 1 162 ARG 162 819  819 ARG ARG A . n 
A 1 163 ASN 163 820  820 ASN ASN A . n 
A 1 164 VAL 164 821  821 VAL VAL A . n 
A 1 165 LEU 165 822  822 LEU LEU A . n 
A 1 166 LEU 166 823  823 LEU LEU A . n 
A 1 167 LYS 167 824  824 LYS LYS A . n 
A 1 168 SER 168 825  825 SER SER A . n 
A 1 169 PRO 169 826  826 PRO PRO A . n 
A 1 170 SER 170 827  827 SER SER A . n 
A 1 171 GLN 171 828  828 GLN GLN A . n 
A 1 172 VAL 172 829  829 VAL VAL A . n 
A 1 173 GLN 173 830  830 GLN GLN A . n 
A 1 174 VAL 174 831  831 VAL VAL A . n 
A 1 175 ALA 175 832  832 ALA ALA A . n 
A 1 176 ASP 176 833  833 ASP ASP A . n 
A 1 177 PHE 177 834  834 PHE PHE A . n 
A 1 178 GLY 178 835  835 GLY GLY A . n 
A 1 179 VAL 179 836  836 VAL VAL A . n 
A 1 180 ALA 180 837  837 ALA ALA A . n 
A 1 181 ASP 181 838  838 ASP ASP A . n 
A 1 182 LEU 182 839  839 LEU LEU A . n 
A 1 183 LEU 183 840  840 LEU LEU A . n 
A 1 184 PRO 184 841  841 PRO PRO A . n 
A 1 185 PRO 185 842  842 PRO PRO A . n 
A 1 186 ASP 186 843  843 ASP ASP A . n 
A 1 187 ASP 187 844  844 ASP ASP A . n 
A 1 188 LYS 188 845  ?   ?   ?   A . n 
A 1 189 GLN 189 846  ?   ?   ?   A . n 
A 1 190 LEU 190 847  ?   ?   ?   A . n 
A 1 191 LEU 191 848  ?   ?   ?   A . n 
A 1 192 TYR 192 849  ?   ?   ?   A . n 
A 1 193 SER 193 850  ?   ?   ?   A . n 
A 1 194 GLU 194 851  ?   ?   ?   A . n 
A 1 195 ALA 195 852  ?   ?   ?   A . n 
A 1 196 LYS 196 853  ?   ?   ?   A . n 
A 1 197 THR 197 854  854 THR THR A . n 
A 1 198 PRO 198 855  855 PRO PRO A . n 
A 1 199 ILE 199 856  856 ILE ILE A . n 
A 1 200 LYS 200 857  857 LYS LYS A . n 
A 1 201 TRP 201 858  858 TRP TRP A . n 
A 1 202 MET 202 859  859 MET MET A . n 
A 1 203 ALA 203 860  860 ALA ALA A . n 
A 1 204 LEU 204 861  861 LEU LEU A . n 
A 1 205 GLU 205 862  862 GLU GLU A . n 
A 1 206 SER 206 863  863 SER SER A . n 
A 1 207 ILE 207 864  864 ILE ILE A . n 
A 1 208 HIS 208 865  865 HIS HIS A . n 
A 1 209 PHE 209 866  866 PHE PHE A . n 
A 1 210 GLY 210 867  867 GLY GLY A . n 
A 1 211 LYS 211 868  868 LYS LYS A . n 
A 1 212 TYR 212 869  869 TYR TYR A . n 
A 1 213 THR 213 870  870 THR THR A . n 
A 1 214 HIS 214 871  871 HIS HIS A . n 
A 1 215 GLN 215 872  872 GLN GLN A . n 
A 1 216 SER 216 873  873 SER SER A . n 
A 1 217 ASP 217 874  874 ASP ASP A . n 
A 1 218 VAL 218 875  875 VAL VAL A . n 
A 1 219 TRP 219 876  876 TRP TRP A . n 
A 1 220 SER 220 877  877 SER SER A . n 
A 1 221 TYR 221 878  878 TYR TYR A . n 
A 1 222 GLY 222 879  879 GLY GLY A . n 
A 1 223 VAL 223 880  880 VAL VAL A . n 
A 1 224 THR 224 881  881 THR THR A . n 
A 1 225 VAL 225 882  882 VAL VAL A . n 
A 1 226 TRP 226 883  883 TRP TRP A . n 
A 1 227 GLU 227 884  884 GLU GLU A . n 
A 1 228 LEU 228 885  885 LEU LEU A . n 
A 1 229 MET 229 886  886 MET MET A . n 
A 1 230 THR 230 887  887 THR THR A . n 
A 1 231 PHE 231 888  888 PHE PHE A . n 
A 1 232 GLY 232 889  889 GLY GLY A . n 
A 1 233 ALA 233 890  890 ALA ALA A . n 
A 1 234 GLU 234 891  891 GLU GLU A . n 
A 1 235 PRO 235 892  892 PRO PRO A . n 
A 1 236 TYR 236 893  893 TYR TYR A . n 
A 1 237 ALA 237 894  894 ALA ALA A . n 
A 1 238 GLY 238 895  895 GLY GLY A . n 
A 1 239 LEU 239 896  896 LEU LEU A . n 
A 1 240 ARG 240 897  897 ARG ARG A . n 
A 1 241 LEU 241 898  898 LEU LEU A . n 
A 1 242 ALA 242 899  899 ALA ALA A . n 
A 1 243 GLU 243 900  900 GLU GLU A . n 
A 1 244 VAL 244 901  901 VAL VAL A . n 
A 1 245 PRO 245 902  902 PRO PRO A . n 
A 1 246 ASP 246 903  903 ASP ASP A . n 
A 1 247 LEU 247 904  904 LEU LEU A . n 
A 1 248 LEU 248 905  905 LEU LEU A . n 
A 1 249 GLU 249 906  906 GLU GLU A . n 
A 1 250 LYS 250 907  907 LYS LYS A . n 
A 1 251 GLY 251 908  908 GLY GLY A . n 
A 1 252 GLU 252 909  909 GLU GLU A . n 
A 1 253 ARG 253 910  910 ARG ARG A . n 
A 1 254 LEU 254 911  911 LEU LEU A . n 
A 1 255 ALA 255 912  912 ALA ALA A . n 
A 1 256 GLN 256 913  913 GLN GLN A . n 
A 1 257 PRO 257 914  914 PRO PRO A . n 
A 1 258 GLN 258 915  915 GLN GLN A . n 
A 1 259 ILE 259 916  916 ILE ILE A . n 
A 1 260 CYS 260 917  917 CYS CYS A . n 
A 1 261 THR 261 918  918 THR THR A . n 
A 1 262 ILE 262 919  919 ILE ILE A . n 
A 1 263 ASP 263 920  920 ASP ASP A . n 
A 1 264 VAL 264 921  921 VAL VAL A . n 
A 1 265 TYR 265 922  922 TYR TYR A . n 
A 1 266 MET 266 923  923 MET MET A . n 
A 1 267 VAL 267 924  924 VAL VAL A . n 
A 1 268 MET 268 925  925 MET MET A . n 
A 1 269 VAL 269 926  926 VAL VAL A . n 
A 1 270 LYS 270 927  927 LYS LYS A . n 
A 1 271 CYS 271 928  928 CYS CYS A . n 
A 1 272 TRP 272 929  929 TRP TRP A . n 
A 1 273 MET 273 930  930 MET MET A . n 
A 1 274 ILE 274 931  931 ILE ILE A . n 
A 1 275 ASP 275 932  932 ASP ASP A . n 
A 1 276 GLU 276 933  933 GLU GLU A . n 
A 1 277 ASN 277 934  934 ASN ASN A . n 
A 1 278 ILE 278 935  935 ILE ILE A . n 
A 1 279 ARG 279 936  936 ARG ARG A . n 
A 1 280 PRO 280 937  937 PRO PRO A . n 
A 1 281 THR 281 938  938 THR THR A . n 
A 1 282 PHE 282 939  939 PHE PHE A . n 
A 1 283 LYS 283 940  940 LYS LYS A . n 
A 1 284 GLU 284 941  941 GLU GLU A . n 
A 1 285 LEU 285 942  942 LEU LEU A . n 
A 1 286 ALA 286 943  943 ALA ALA A . n 
A 1 287 ASN 287 944  944 ASN ASN A . n 
A 1 288 GLU 288 945  945 GLU GLU A . n 
A 1 289 PHE 289 946  946 PHE PHE A . n 
A 1 290 THR 290 947  947 THR THR A . n 
A 1 291 ARG 291 948  948 ARG ARG A . n 
A 1 292 MET 292 949  949 MET MET A . n 
A 1 293 ALA 293 950  950 ALA ALA A . n 
A 1 294 ARG 294 951  951 ARG ARG A . n 
A 1 295 ASP 295 952  952 ASP ASP A . n 
A 1 296 PRO 296 953  953 PRO PRO A . n 
A 1 297 PRO 297 954  954 PRO PRO A . n 
A 1 298 ARG 298 955  955 ARG ARG A . n 
A 1 299 TYR 299 956  956 TYR TYR A . n 
A 1 300 LEU 300 957  957 LEU LEU A . n 
A 1 301 VAL 301 958  958 VAL VAL A . n 
A 1 302 ILE 302 959  959 ILE ILE A . n 
A 1 303 LYS 303 960  ?   ?   ?   A . n 
A 1 304 ARG 304 961  ?   ?   ?   A . n 
A 1 305 GLU 305 962  ?   ?   ?   A . n 
A 1 306 SER 306 963  ?   ?   ?   A . n 
A 1 307 GLY 307 964  ?   ?   ?   A . n 
A 1 308 PRO 308 965  ?   ?   ?   A . n 
A 1 309 GLY 309 966  ?   ?   ?   A . n 
A 1 310 ILE 310 967  ?   ?   ?   A . n 
A 1 311 ALA 311 968  ?   ?   ?   A . n 
A 1 312 PRO 312 969  ?   ?   ?   A . n 
A 1 313 GLY 313 970  ?   ?   ?   A . n 
A 1 314 PRO 314 971  ?   ?   ?   A . n 
A 1 315 GLU 315 972  ?   ?   ?   A . n 
A 1 316 PRO 316 973  ?   ?   ?   A . n 
A 1 317 HIS 317 974  ?   ?   ?   A . n 
A 1 318 GLY 318 975  ?   ?   ?   A . n 
A 1 319 LEU 319 976  ?   ?   ?   A . n 
A 1 320 THR 320 977  ?   ?   ?   A . n 
A 1 321 ASN 321 978  ?   ?   ?   A . n 
A 1 322 LYS 322 979  ?   ?   ?   A . n 
A 1 323 LYS 323 980  ?   ?   ?   A . n 
A 1 324 LEU 324 981  ?   ?   ?   A . n 
A 1 325 GLU 325 982  ?   ?   ?   A . n 
A 1 326 GLU 326 983  ?   ?   ?   A . n 
A 1 327 VAL 327 984  ?   ?   ?   A . n 
A 1 328 GLU 328 985  ?   ?   ?   A . n 
A 1 329 LEU 329 986  ?   ?   ?   A . n 
A 1 330 GLU 330 987  ?   ?   ?   A . n 
A 1 331 PRO 331 988  ?   ?   ?   A . n 
A 1 332 GLU 332 989  ?   ?   ?   A . n 
A 1 333 LEU 333 990  ?   ?   ?   A . n 
A 1 334 ASP 334 991  ?   ?   ?   A . n 
A 1 335 LEU 335 992  ?   ?   ?   A . n 
A 1 336 ASP 336 993  ?   ?   ?   A . n 
A 1 337 LEU 337 994  ?   ?   ?   A . n 
A 1 338 ASP 338 995  ?   ?   ?   A . n 
A 1 339 LEU 339 996  ?   ?   ?   A . n 
A 1 340 GLU 340 997  ?   ?   ?   A . n 
A 1 341 ALA 341 998  ?   ?   ?   A . n 
A 1 342 GLU 342 999  ?   ?   ?   A . n 
A 1 343 GLU 343 1000 ?   ?   ?   A . n 
A 1 344 ASP 344 1001 ?   ?   ?   A . n 
B 1 1   MET 1   658  ?   ?   ?   B . n 
B 1 2   HIS 2   659  ?   ?   ?   B . n 
B 1 3   HIS 3   660  ?   ?   ?   B . n 
B 1 4   HIS 4   661  ?   ?   ?   B . n 
B 1 5   HIS 5   662  ?   ?   ?   B . n 
B 1 6   HIS 6   663  ?   ?   ?   B . n 
B 1 7   HIS 7   664  ?   ?   ?   B . n 
B 1 8   GLY 8   665  ?   ?   ?   B . n 
B 1 9   GLU 9   666  ?   ?   ?   B . n 
B 1 10  SER 10  667  ?   ?   ?   B . n 
B 1 11  ILE 11  668  ?   ?   ?   B . n 
B 1 12  GLU 12  669  ?   ?   ?   B . n 
B 1 13  PRO 13  670  ?   ?   ?   B . n 
B 1 14  LEU 14  671  ?   ?   ?   B . n 
B 1 15  ASP 15  672  ?   ?   ?   B . n 
B 1 16  PRO 16  673  ?   ?   ?   B . n 
B 1 17  SER 17  674  ?   ?   ?   B . n 
B 1 18  GLU 18  675  ?   ?   ?   B . n 
B 1 19  LYS 19  676  ?   ?   ?   B . n 
B 1 20  ALA 20  677  ?   ?   ?   B . n 
B 1 21  ASN 21  678  ?   ?   ?   B . n 
B 1 22  LYS 22  679  ?   ?   ?   B . n 
B 1 23  VAL 23  680  680 VAL VAL B . n 
B 1 24  LEU 24  681  681 LEU LEU B . n 
B 1 25  ALA 25  682  682 ALA ALA B . n 
B 1 26  ARG 26  683  683 ARG ARG B . n 
B 1 27  ILE 27  684  684 ILE ILE B . n 
B 1 28  PHE 28  685  685 PHE PHE B . n 
B 1 29  LYS 29  686  686 LYS LYS B . n 
B 1 30  GLU 30  687  687 GLU GLU B . n 
B 1 31  THR 31  688  688 THR THR B . n 
B 1 32  GLU 32  689  689 GLU GLU B . n 
B 1 33  LEU 33  690  690 LEU LEU B . n 
B 1 34  ARG 34  691  691 ARG ARG B . n 
B 1 35  LYS 35  692  692 LYS LYS B . n 
B 1 36  LEU 36  693  693 LEU LEU B . n 
B 1 37  LYS 37  694  694 LYS LYS B . n 
B 1 38  VAL 38  695  695 VAL VAL B . n 
B 1 39  LEU 39  696  696 LEU LEU B . n 
B 1 40  GLY 40  697  697 GLY GLY B . n 
B 1 41  SER 41  698  698 SER SER B . n 
B 1 42  GLY 42  699  699 GLY GLY B . n 
B 1 43  VAL 43  700  700 VAL VAL B . n 
B 1 44  PHE 44  701  701 PHE PHE B . n 
B 1 45  GLY 45  702  702 GLY GLY B . n 
B 1 46  THR 46  703  703 THR THR B . n 
B 1 47  VAL 47  704  704 VAL VAL B . n 
B 1 48  HIS 48  705  705 HIS HIS B . n 
B 1 49  LYS 49  706  706 LYS LYS B . n 
B 1 50  GLY 50  707  707 GLY GLY B . n 
B 1 51  VAL 51  708  708 VAL VAL B . n 
B 1 52  TRP 52  709  709 TRP TRP B . n 
B 1 53  ILE 53  710  710 ILE ILE B . n 
B 1 54  PRO 54  711  711 PRO PRO B . n 
B 1 55  GLU 55  712  ?   ?   ?   B . n 
B 1 56  GLY 56  713  713 GLY GLY B . n 
B 1 57  GLU 57  714  714 GLU GLU B . n 
B 1 58  SER 58  715  715 SER SER B . n 
B 1 59  ILE 59  716  716 ILE ILE B . n 
B 1 60  LYS 60  717  717 LYS LYS B . n 
B 1 61  ILE 61  718  718 ILE ILE B . n 
B 1 62  PRO 62  719  719 PRO PRO B . n 
B 1 63  VAL 63  720  720 VAL VAL B . n 
B 1 64  CYS 64  721  721 CYS CYS B . n 
B 1 65  ILE 65  722  722 ILE ILE B . n 
B 1 66  LYS 66  723  723 LYS LYS B . n 
B 1 67  VAL 67  724  724 VAL VAL B . n 
B 1 68  ILE 68  725  725 ILE ILE B . n 
B 1 69  GLU 69  726  726 GLU GLU B . n 
B 1 70  ASP 70  727  727 ASP ASP B . n 
B 1 71  LYS 71  728  728 LYS LYS B . n 
B 1 72  SER 72  729  729 SER SER B . n 
B 1 73  GLY 73  730  ?   ?   ?   B . n 
B 1 74  ARG 74  731  ?   ?   ?   B . n 
B 1 75  GLN 75  732  732 GLN GLN B . n 
B 1 76  SER 76  733  733 SER SER B . n 
B 1 77  PHE 77  734  734 PHE PHE B . n 
B 1 78  GLN 78  735  735 GLN GLN B . n 
B 1 79  ALA 79  736  736 ALA ALA B . n 
B 1 80  VAL 80  737  737 VAL VAL B . n 
B 1 81  THR 81  738  738 THR THR B . n 
B 1 82  ASP 82  739  739 ASP ASP B . n 
B 1 83  HIS 83  740  740 HIS HIS B . n 
B 1 84  MET 84  741  741 MET MET B . n 
B 1 85  LEU 85  742  742 LEU LEU B . n 
B 1 86  ALA 86  743  743 ALA ALA B . n 
B 1 87  ILE 87  744  744 ILE ILE B . n 
B 1 88  GLY 88  745  745 GLY GLY B . n 
B 1 89  SER 89  746  746 SER SER B . n 
B 1 90  LEU 90  747  747 LEU LEU B . n 
B 1 91  ASP 91  748  748 ASP ASP B . n 
B 1 92  HIS 92  749  749 HIS HIS B . n 
B 1 93  ALA 93  750  750 ALA ALA B . n 
B 1 94  HIS 94  751  751 HIS HIS B . n 
B 1 95  ILE 95  752  752 ILE ILE B . n 
B 1 96  VAL 96  753  753 VAL VAL B . n 
B 1 97  ARG 97  754  754 ARG ARG B . n 
B 1 98  LEU 98  755  755 LEU LEU B . n 
B 1 99  LEU 99  756  756 LEU LEU B . n 
B 1 100 GLY 100 757  757 GLY GLY B . n 
B 1 101 LEU 101 758  758 LEU LEU B . n 
B 1 102 CYS 102 759  759 CYS CYS B . n 
B 1 103 PRO 103 760  760 PRO PRO B . n 
B 1 104 GLY 104 761  761 GLY GLY B . n 
B 1 105 SER 105 762  762 SER SER B . n 
B 1 106 SER 106 763  763 SER SER B . n 
B 1 107 LEU 107 764  764 LEU LEU B . n 
B 1 108 GLN 108 765  765 GLN GLN B . n 
B 1 109 LEU 109 766  766 LEU LEU B . n 
B 1 110 VAL 110 767  767 VAL VAL B . n 
B 1 111 THR 111 768  768 THR THR B . n 
B 1 112 GLN 112 769  769 GLN GLN B . n 
B 1 113 TYR 113 770  770 TYR TYR B . n 
B 1 114 LEU 114 771  771 LEU LEU B . n 
B 1 115 PRO 115 772  772 PRO PRO B . n 
B 1 116 LEU 116 773  773 LEU LEU B . n 
B 1 117 GLY 117 774  774 GLY GLY B . n 
B 1 118 SER 118 775  775 SER SER B . n 
B 1 119 LEU 119 776  776 LEU LEU B . n 
B 1 120 LEU 120 777  777 LEU LEU B . n 
B 1 121 ASP 121 778  778 ASP ASP B . n 
B 1 122 HIS 122 779  779 HIS HIS B . n 
B 1 123 VAL 123 780  780 VAL VAL B . n 
B 1 124 ARG 124 781  781 ARG ARG B . n 
B 1 125 GLN 125 782  782 GLN GLN B . n 
B 1 126 HIS 126 783  783 HIS HIS B . n 
B 1 127 ARG 127 784  784 ARG ARG B . n 
B 1 128 GLY 128 785  785 GLY GLY B . n 
B 1 129 ALA 129 786  786 ALA ALA B . n 
B 1 130 LEU 130 787  787 LEU LEU B . n 
B 1 131 GLY 131 788  788 GLY GLY B . n 
B 1 132 PRO 132 789  789 PRO PRO B . n 
B 1 133 GLN 133 790  790 GLN GLN B . n 
B 1 134 LEU 134 791  791 LEU LEU B . n 
B 1 135 LEU 135 792  792 LEU LEU B . n 
B 1 136 LEU 136 793  793 LEU LEU B . n 
B 1 137 ASN 137 794  794 ASN ASN B . n 
B 1 138 TRP 138 795  795 TRP TRP B . n 
B 1 139 GLY 139 796  796 GLY GLY B . n 
B 1 140 VAL 140 797  797 VAL VAL B . n 
B 1 141 GLN 141 798  798 GLN GLN B . n 
B 1 142 ILE 142 799  799 ILE ILE B . n 
B 1 143 ALA 143 800  800 ALA ALA B . n 
B 1 144 LYS 144 801  801 LYS LYS B . n 
B 1 145 GLY 145 802  802 GLY GLY B . n 
B 1 146 MET 146 803  803 MET MET B . n 
B 1 147 TYR 147 804  804 TYR TYR B . n 
B 1 148 TYR 148 805  805 TYR TYR B . n 
B 1 149 LEU 149 806  806 LEU LEU B . n 
B 1 150 GLU 150 807  807 GLU GLU B . n 
B 1 151 GLU 151 808  808 GLU GLU B . n 
B 1 152 HIS 152 809  809 HIS HIS B . n 
B 1 153 GLY 153 810  810 GLY GLY B . n 
B 1 154 MET 154 811  811 MET MET B . n 
B 1 155 VAL 155 812  812 VAL VAL B . n 
B 1 156 HIS 156 813  813 HIS HIS B . n 
B 1 157 ARG 157 814  814 ARG ARG B . n 
B 1 158 ASN 158 815  815 ASN ASN B . n 
B 1 159 LEU 159 816  816 LEU LEU B . n 
B 1 160 ALA 160 817  817 ALA ALA B . n 
B 1 161 ALA 161 818  818 ALA ALA B . n 
B 1 162 ARG 162 819  819 ARG ARG B . n 
B 1 163 ASN 163 820  820 ASN ASN B . n 
B 1 164 VAL 164 821  821 VAL VAL B . n 
B 1 165 LEU 165 822  822 LEU LEU B . n 
B 1 166 LEU 166 823  823 LEU LEU B . n 
B 1 167 LYS 167 824  824 LYS LYS B . n 
B 1 168 SER 168 825  825 SER SER B . n 
B 1 169 PRO 169 826  826 PRO PRO B . n 
B 1 170 SER 170 827  827 SER SER B . n 
B 1 171 GLN 171 828  828 GLN GLN B . n 
B 1 172 VAL 172 829  829 VAL VAL B . n 
B 1 173 GLN 173 830  830 GLN GLN B . n 
B 1 174 VAL 174 831  831 VAL VAL B . n 
B 1 175 ALA 175 832  832 ALA ALA B . n 
B 1 176 ASP 176 833  833 ASP ASP B . n 
B 1 177 PHE 177 834  834 PHE PHE B . n 
B 1 178 GLY 178 835  835 GLY GLY B . n 
B 1 179 VAL 179 836  836 VAL VAL B . n 
B 1 180 ALA 180 837  837 ALA ALA B . n 
B 1 181 ASP 181 838  838 ASP ASP B . n 
B 1 182 LEU 182 839  839 LEU LEU B . n 
B 1 183 LEU 183 840  840 LEU LEU B . n 
B 1 184 PRO 184 841  841 PRO PRO B . n 
B 1 185 PRO 185 842  842 PRO PRO B . n 
B 1 186 ASP 186 843  843 ASP ASP B . n 
B 1 187 ASP 187 844  844 ASP ASP B . n 
B 1 188 LYS 188 845  845 LYS LYS B . n 
B 1 189 GLN 189 846  ?   ?   ?   B . n 
B 1 190 LEU 190 847  ?   ?   ?   B . n 
B 1 191 LEU 191 848  ?   ?   ?   B . n 
B 1 192 TYR 192 849  ?   ?   ?   B . n 
B 1 193 SER 193 850  ?   ?   ?   B . n 
B 1 194 GLU 194 851  ?   ?   ?   B . n 
B 1 195 ALA 195 852  ?   ?   ?   B . n 
B 1 196 LYS 196 853  ?   ?   ?   B . n 
B 1 197 THR 197 854  ?   ?   ?   B . n 
B 1 198 PRO 198 855  855 PRO PRO B . n 
B 1 199 ILE 199 856  856 ILE ILE B . n 
B 1 200 LYS 200 857  857 LYS LYS B . n 
B 1 201 TRP 201 858  858 TRP TRP B . n 
B 1 202 MET 202 859  859 MET MET B . n 
B 1 203 ALA 203 860  860 ALA ALA B . n 
B 1 204 LEU 204 861  861 LEU LEU B . n 
B 1 205 GLU 205 862  862 GLU GLU B . n 
B 1 206 SER 206 863  863 SER SER B . n 
B 1 207 ILE 207 864  864 ILE ILE B . n 
B 1 208 HIS 208 865  865 HIS HIS B . n 
B 1 209 PHE 209 866  866 PHE PHE B . n 
B 1 210 GLY 210 867  867 GLY GLY B . n 
B 1 211 LYS 211 868  868 LYS LYS B . n 
B 1 212 TYR 212 869  869 TYR TYR B . n 
B 1 213 THR 213 870  870 THR THR B . n 
B 1 214 HIS 214 871  871 HIS HIS B . n 
B 1 215 GLN 215 872  872 GLN GLN B . n 
B 1 216 SER 216 873  873 SER SER B . n 
B 1 217 ASP 217 874  874 ASP ASP B . n 
B 1 218 VAL 218 875  875 VAL VAL B . n 
B 1 219 TRP 219 876  876 TRP TRP B . n 
B 1 220 SER 220 877  877 SER SER B . n 
B 1 221 TYR 221 878  878 TYR TYR B . n 
B 1 222 GLY 222 879  879 GLY GLY B . n 
B 1 223 VAL 223 880  880 VAL VAL B . n 
B 1 224 THR 224 881  881 THR THR B . n 
B 1 225 VAL 225 882  882 VAL VAL B . n 
B 1 226 TRP 226 883  883 TRP TRP B . n 
B 1 227 GLU 227 884  884 GLU GLU B . n 
B 1 228 LEU 228 885  885 LEU LEU B . n 
B 1 229 MET 229 886  886 MET MET B . n 
B 1 230 THR 230 887  887 THR THR B . n 
B 1 231 PHE 231 888  888 PHE PHE B . n 
B 1 232 GLY 232 889  889 GLY GLY B . n 
B 1 233 ALA 233 890  890 ALA ALA B . n 
B 1 234 GLU 234 891  891 GLU GLU B . n 
B 1 235 PRO 235 892  892 PRO PRO B . n 
B 1 236 TYR 236 893  893 TYR TYR B . n 
B 1 237 ALA 237 894  894 ALA ALA B . n 
B 1 238 GLY 238 895  895 GLY GLY B . n 
B 1 239 LEU 239 896  896 LEU LEU B . n 
B 1 240 ARG 240 897  897 ARG ARG B . n 
B 1 241 LEU 241 898  898 LEU LEU B . n 
B 1 242 ALA 242 899  899 ALA ALA B . n 
B 1 243 GLU 243 900  900 GLU GLU B . n 
B 1 244 VAL 244 901  901 VAL VAL B . n 
B 1 245 PRO 245 902  902 PRO PRO B . n 
B 1 246 ASP 246 903  903 ASP ASP B . n 
B 1 247 LEU 247 904  904 LEU LEU B . n 
B 1 248 LEU 248 905  905 LEU LEU B . n 
B 1 249 GLU 249 906  906 GLU GLU B . n 
B 1 250 LYS 250 907  907 LYS LYS B . n 
B 1 251 GLY 251 908  908 GLY GLY B . n 
B 1 252 GLU 252 909  909 GLU GLU B . n 
B 1 253 ARG 253 910  910 ARG ARG B . n 
B 1 254 LEU 254 911  911 LEU LEU B . n 
B 1 255 ALA 255 912  912 ALA ALA B . n 
B 1 256 GLN 256 913  913 GLN GLN B . n 
B 1 257 PRO 257 914  914 PRO PRO B . n 
B 1 258 GLN 258 915  915 GLN GLN B . n 
B 1 259 ILE 259 916  916 ILE ILE B . n 
B 1 260 CYS 260 917  917 CYS CYS B . n 
B 1 261 THR 261 918  918 THR THR B . n 
B 1 262 ILE 262 919  919 ILE ILE B . n 
B 1 263 ASP 263 920  920 ASP ASP B . n 
B 1 264 VAL 264 921  921 VAL VAL B . n 
B 1 265 TYR 265 922  922 TYR TYR B . n 
B 1 266 MET 266 923  923 MET MET B . n 
B 1 267 VAL 267 924  924 VAL VAL B . n 
B 1 268 MET 268 925  925 MET MET B . n 
B 1 269 VAL 269 926  926 VAL VAL B . n 
B 1 270 LYS 270 927  927 LYS LYS B . n 
B 1 271 CYS 271 928  928 CYS CYS B . n 
B 1 272 TRP 272 929  929 TRP TRP B . n 
B 1 273 MET 273 930  930 MET MET B . n 
B 1 274 ILE 274 931  931 ILE ILE B . n 
B 1 275 ASP 275 932  932 ASP ASP B . n 
B 1 276 GLU 276 933  933 GLU GLU B . n 
B 1 277 ASN 277 934  934 ASN ASN B . n 
B 1 278 ILE 278 935  935 ILE ILE B . n 
B 1 279 ARG 279 936  936 ARG ARG B . n 
B 1 280 PRO 280 937  937 PRO PRO B . n 
B 1 281 THR 281 938  938 THR THR B . n 
B 1 282 PHE 282 939  939 PHE PHE B . n 
B 1 283 LYS 283 940  940 LYS LYS B . n 
B 1 284 GLU 284 941  941 GLU GLU B . n 
B 1 285 LEU 285 942  942 LEU LEU B . n 
B 1 286 ALA 286 943  943 ALA ALA B . n 
B 1 287 ASN 287 944  944 ASN ASN B . n 
B 1 288 GLU 288 945  945 GLU GLU B . n 
B 1 289 PHE 289 946  946 PHE PHE B . n 
B 1 290 THR 290 947  947 THR THR B . n 
B 1 291 ARG 291 948  948 ARG ARG B . n 
B 1 292 MET 292 949  949 MET MET B . n 
B 1 293 ALA 293 950  950 ALA ALA B . n 
B 1 294 ARG 294 951  951 ARG ARG B . n 
B 1 295 ASP 295 952  952 ASP ASP B . n 
B 1 296 PRO 296 953  953 PRO PRO B . n 
B 1 297 PRO 297 954  954 PRO PRO B . n 
B 1 298 ARG 298 955  955 ARG ARG B . n 
B 1 299 TYR 299 956  956 TYR TYR B . n 
B 1 300 LEU 300 957  957 LEU LEU B . n 
B 1 301 VAL 301 958  958 VAL VAL B . n 
B 1 302 ILE 302 959  959 ILE ILE B . n 
B 1 303 LYS 303 960  ?   ?   ?   B . n 
B 1 304 ARG 304 961  ?   ?   ?   B . n 
B 1 305 GLU 305 962  ?   ?   ?   B . n 
B 1 306 SER 306 963  ?   ?   ?   B . n 
B 1 307 GLY 307 964  ?   ?   ?   B . n 
B 1 308 PRO 308 965  ?   ?   ?   B . n 
B 1 309 GLY 309 966  ?   ?   ?   B . n 
B 1 310 ILE 310 967  ?   ?   ?   B . n 
B 1 311 ALA 311 968  ?   ?   ?   B . n 
B 1 312 PRO 312 969  ?   ?   ?   B . n 
B 1 313 GLY 313 970  ?   ?   ?   B . n 
B 1 314 PRO 314 971  ?   ?   ?   B . n 
B 1 315 GLU 315 972  ?   ?   ?   B . n 
B 1 316 PRO 316 973  ?   ?   ?   B . n 
B 1 317 HIS 317 974  ?   ?   ?   B . n 
B 1 318 GLY 318 975  ?   ?   ?   B . n 
B 1 319 LEU 319 976  ?   ?   ?   B . n 
B 1 320 THR 320 977  ?   ?   ?   B . n 
B 1 321 ASN 321 978  ?   ?   ?   B . n 
B 1 322 LYS 322 979  ?   ?   ?   B . n 
B 1 323 LYS 323 980  ?   ?   ?   B . n 
B 1 324 LEU 324 981  ?   ?   ?   B . n 
B 1 325 GLU 325 982  ?   ?   ?   B . n 
B 1 326 GLU 326 983  ?   ?   ?   B . n 
B 1 327 VAL 327 984  ?   ?   ?   B . n 
B 1 328 GLU 328 985  ?   ?   ?   B . n 
B 1 329 LEU 329 986  ?   ?   ?   B . n 
B 1 330 GLU 330 987  ?   ?   ?   B . n 
B 1 331 PRO 331 988  ?   ?   ?   B . n 
B 1 332 GLU 332 989  ?   ?   ?   B . n 
B 1 333 LEU 333 990  ?   ?   ?   B . n 
B 1 334 ASP 334 991  ?   ?   ?   B . n 
B 1 335 LEU 335 992  ?   ?   ?   B . n 
B 1 336 ASP 336 993  ?   ?   ?   B . n 
B 1 337 LEU 337 994  ?   ?   ?   B . n 
B 1 338 ASP 338 995  ?   ?   ?   B . n 
B 1 339 LEU 339 996  ?   ?   ?   B . n 
B 1 340 GLU 340 997  ?   ?   ?   B . n 
B 1 341 ALA 341 998  ?   ?   ?   B . n 
B 1 342 GLU 342 999  ?   ?   ?   B . n 
B 1 343 GLU 343 1000 ?   ?   ?   B . n 
B 1 344 ASP 344 1001 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1 202  202  MG  MG  A . 
D 3 ANP 1 301  301  ANP ANP A . 
E 2 MG  1 202  202  MG  MG  B . 
F 3 ANP 1 301  301  ANP ANP B . 
G 4 HOH 1 1011 1011 HOH HOH A . 
G 4 HOH 2 1012 1012 HOH HOH A . 
H 4 HOH 1 1013 1013 HOH HOH B . 
H 4 HOH 2 1014 1014 HOH HOH B . 
H 4 HOH 3 1015 1015 HOH HOH B . 
H 4 HOH 4 1016 1016 HOH HOH B . 
H 4 HOH 5 1017 1017 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O2A ? D ANP .   ? A ANP 301 ? 1_555 85.8  ? 
2  O2B ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O1G ? D ANP .   ? A ANP 301 ? 1_555 92.1  ? 
3  O2A ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O1G ? D ANP .   ? A ANP 301 ? 1_555 93.0  ? 
4  O2B ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 176 ? A ASP 833 ? 1_555 169.2 ? 
5  O2A ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 176 ? A ASP 833 ? 1_555 83.7  ? 
6  O1G ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 176 ? A ASP 833 ? 1_555 90.6  ? 
7  O2B ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD1 ? A ASN 163 ? A ASN 820 ? 1_555 104.0 ? 
8  O2A ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD1 ? A ASN 163 ? A ASN 820 ? 1_555 159.3 ? 
9  O1G ? D ANP .   ? A ANP 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD1 ? A ASN 163 ? A ASN 820 ? 1_555 68.8  ? 
10 OD2 ? A ASP 176 ? A ASP 833 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD1 ? A ASN 163 ? A ASN 820 ? 1_555 86.7  ? 
11 O2B ? F ANP .   ? B ANP 301 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 OD2 ? B ASP 176 ? B ASP 833 ? 1_555 150.3 ? 
12 O2B ? F ANP .   ? B ANP 301 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O2A ? F ANP .   ? B ANP 301 ? 1_555 86.0  ? 
13 OD2 ? B ASP 176 ? B ASP 833 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O2A ? F ANP .   ? B ANP 301 ? 1_555 82.3  ? 
14 O2B ? F ANP .   ? B ANP 301 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 OD1 ? B ASN 163 ? B ASN 820 ? 1_555 102.4 ? 
15 OD2 ? B ASP 176 ? B ASP 833 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 OD1 ? B ASN 163 ? B ASN 820 ? 1_555 72.6  ? 
16 O2A ? F ANP .   ? B ANP 301 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 OD1 ? B ASN 163 ? B ASN 820 ? 1_555 142.9 ? 
17 O2B ? F ANP .   ? B ANP 301 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O1G ? F ANP .   ? B ANP 301 ? 1_555 70.0  ? 
18 OD2 ? B ASP 176 ? B ASP 833 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O1G ? F ANP .   ? B ANP 301 ? 1_555 81.2  ? 
19 O2A ? F ANP .   ? B ANP 301 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O1G ? F ANP .   ? B ANP 301 ? 1_555 80.7  ? 
20 OD1 ? B ASN 163 ? B ASN 820 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O1G ? F ANP .   ? B ANP 301 ? 1_555 69.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-04-21 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 23.4330 -35.5810 45.4250 0.0829 0.3513 0.2317 0.0636  -0.0778 0.0090  3.4193 3.7402 7.4621 0.4637  
-0.0178 -2.8374 0.0288  0.0900  -0.1189 0.0471  -0.1558 -0.2182 -0.2125 0.6191  0.1476  
'X-RAY DIFFRACTION' 2 ? refined 7.0330  -30.6840 64.0460 0.2793 0.6803 0.2926 0.1597  0.1124  0.0882  6.0648 2.4923 3.8879 -1.0828 
-0.1934 0.2777  -0.1148 0.1111  0.0038  -0.7709 0.0261  0.5227  0.5745  -0.1631 -0.6445 
'X-RAY DIFFRACTION' 3 ? refined 23.3460 -14.6490 32.4840 0.1003 0.3819 0.2519 -0.0620 -0.1264 -0.0104 4.0734 2.8083 7.0335 -0.2972 
0.2445  -1.8684 -0.0860 0.0665  0.0195  -0.3418 0.0949  -0.1892 0.2422  -0.4729 0.4187  
'X-RAY DIFFRACTION' 4 ? refined 7.2140  -19.8260 14.2760 0.1122 0.4108 0.2240 -0.0377 -0.1399 -0.0352 5.0163 3.9379 5.9185 0.0552  
0.6856  0.8108  0.1451  -0.2465 0.1015  0.3359  -0.3230 0.3940  -0.3230 0.2448  -0.4727 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 680 A 774 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 775 A 959 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 B 680 B 774 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 B 775 B 959 ? . . . . ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 PHASER      .        ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 DM          .        ?               program 'Kevin Cowtan'       kowtan@ysbl.york.ac.uk      phasing           
http://www.ccp4.ac.uk/dist/html/dm.html      Fortran_77 ? 
5 REFMAC      5.5.0072 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
6 PDB_EXTRACT 3.005    'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
7 HKL-2000    .        ?               ?       ?                    ?                           'data collection' ? ?          ? 
8 HKL-2000    .        ?               ?       ?                    ?                           'data reduction'  ? ?          ? 
9 HKL-2000    .        ?               ?       ?                    ?                           'data scaling'    ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 736 ? ? 92.16   129.39  
2  1 ARG A 784 ? ? 58.40   -128.81 
3  1 ASN A 815 ? ? -153.15 37.57   
4  1 PRO A 842 ? ? -51.29  107.47  
5  1 PRO A 855 ? ? -45.34  -17.97  
6  1 ARG A 910 ? ? 59.15   -176.37 
7  1 ALA B 736 ? ? 87.34   135.23  
8  1 ASP B 748 ? ? -165.36 117.23  
9  1 ARG B 784 ? ? 64.34   -134.86 
10 1 ARG B 814 ? ? 74.69   -13.10  
11 1 ASN B 815 ? ? -147.74 43.30   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 712 ? CG  ? A GLU 55  CG  
2  1 Y 1 A GLU 712 ? CD  ? A GLU 55  CD  
3  1 Y 1 A GLU 712 ? OE1 ? A GLU 55  OE1 
4  1 Y 1 A GLU 712 ? OE2 ? A GLU 55  OE2 
5  1 Y 1 A GLU 714 ? CG  ? A GLU 57  CG  
6  1 Y 1 A GLU 714 ? CD  ? A GLU 57  CD  
7  1 Y 1 A GLU 714 ? OE1 ? A GLU 57  OE1 
8  1 Y 1 A GLU 714 ? OE2 ? A GLU 57  OE2 
9  1 Y 1 A GLN 782 ? CG  ? A GLN 125 CG  
10 1 Y 1 A GLN 782 ? CD  ? A GLN 125 CD  
11 1 Y 1 A GLN 782 ? OE1 ? A GLN 125 OE1 
12 1 Y 1 A GLN 782 ? NE2 ? A GLN 125 NE2 
13 1 Y 1 A LEU 904 ? CG  ? A LEU 247 CG  
14 1 Y 1 A LEU 904 ? CD1 ? A LEU 247 CD1 
15 1 Y 1 A LEU 904 ? CD2 ? A LEU 247 CD2 
16 1 Y 1 B LYS 694 ? CD  ? B LYS 37  CD  
17 1 Y 1 B LYS 694 ? CE  ? B LYS 37  CE  
18 1 Y 1 B LYS 694 ? NZ  ? B LYS 37  NZ  
19 1 Y 1 B LYS 940 ? CG  ? B LYS 283 CG  
20 1 Y 1 B LYS 940 ? CD  ? B LYS 283 CD  
21 1 Y 1 B LYS 940 ? CE  ? B LYS 283 CE  
22 1 Y 1 B LYS 940 ? NZ  ? B LYS 283 NZ  
23 1 Y 1 B ARG 951 ? CG  ? B ARG 294 CG  
24 1 Y 1 B ARG 951 ? CD  ? B ARG 294 CD  
25 1 Y 1 B ARG 951 ? NE  ? B ARG 294 NE  
26 1 Y 1 B ARG 951 ? CZ  ? B ARG 294 CZ  
27 1 Y 1 B ARG 951 ? NH1 ? B ARG 294 NH1 
28 1 Y 1 B ARG 951 ? NH2 ? B ARG 294 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 658  ? A MET 1   
2   1 Y 1 A HIS 659  ? A HIS 2   
3   1 Y 1 A HIS 660  ? A HIS 3   
4   1 Y 1 A HIS 661  ? A HIS 4   
5   1 Y 1 A HIS 662  ? A HIS 5   
6   1 Y 1 A HIS 663  ? A HIS 6   
7   1 Y 1 A HIS 664  ? A HIS 7   
8   1 Y 1 A GLY 665  ? A GLY 8   
9   1 Y 1 A GLU 666  ? A GLU 9   
10  1 Y 1 A SER 667  ? A SER 10  
11  1 Y 1 A ILE 668  ? A ILE 11  
12  1 Y 1 A GLU 669  ? A GLU 12  
13  1 Y 1 A PRO 670  ? A PRO 13  
14  1 Y 1 A LEU 671  ? A LEU 14  
15  1 Y 1 A ASP 672  ? A ASP 15  
16  1 Y 1 A PRO 673  ? A PRO 16  
17  1 Y 1 A SER 674  ? A SER 17  
18  1 Y 1 A GLU 675  ? A GLU 18  
19  1 Y 1 A LYS 676  ? A LYS 19  
20  1 Y 1 A ALA 677  ? A ALA 20  
21  1 Y 1 A ASN 678  ? A ASN 21  
22  1 Y 1 A LYS 679  ? A LYS 22  
23  1 Y 1 A SER 729  ? A SER 72  
24  1 Y 1 A GLY 730  ? A GLY 73  
25  1 Y 1 A ARG 731  ? A ARG 74  
26  1 Y 1 A LYS 845  ? A LYS 188 
27  1 Y 1 A GLN 846  ? A GLN 189 
28  1 Y 1 A LEU 847  ? A LEU 190 
29  1 Y 1 A LEU 848  ? A LEU 191 
30  1 Y 1 A TYR 849  ? A TYR 192 
31  1 Y 1 A SER 850  ? A SER 193 
32  1 Y 1 A GLU 851  ? A GLU 194 
33  1 Y 1 A ALA 852  ? A ALA 195 
34  1 Y 1 A LYS 853  ? A LYS 196 
35  1 Y 1 A LYS 960  ? A LYS 303 
36  1 Y 1 A ARG 961  ? A ARG 304 
37  1 Y 1 A GLU 962  ? A GLU 305 
38  1 Y 1 A SER 963  ? A SER 306 
39  1 Y 1 A GLY 964  ? A GLY 307 
40  1 Y 1 A PRO 965  ? A PRO 308 
41  1 Y 1 A GLY 966  ? A GLY 309 
42  1 Y 1 A ILE 967  ? A ILE 310 
43  1 Y 1 A ALA 968  ? A ALA 311 
44  1 Y 1 A PRO 969  ? A PRO 312 
45  1 Y 1 A GLY 970  ? A GLY 313 
46  1 Y 1 A PRO 971  ? A PRO 314 
47  1 Y 1 A GLU 972  ? A GLU 315 
48  1 Y 1 A PRO 973  ? A PRO 316 
49  1 Y 1 A HIS 974  ? A HIS 317 
50  1 Y 1 A GLY 975  ? A GLY 318 
51  1 Y 1 A LEU 976  ? A LEU 319 
52  1 Y 1 A THR 977  ? A THR 320 
53  1 Y 1 A ASN 978  ? A ASN 321 
54  1 Y 1 A LYS 979  ? A LYS 322 
55  1 Y 1 A LYS 980  ? A LYS 323 
56  1 Y 1 A LEU 981  ? A LEU 324 
57  1 Y 1 A GLU 982  ? A GLU 325 
58  1 Y 1 A GLU 983  ? A GLU 326 
59  1 Y 1 A VAL 984  ? A VAL 327 
60  1 Y 1 A GLU 985  ? A GLU 328 
61  1 Y 1 A LEU 986  ? A LEU 329 
62  1 Y 1 A GLU 987  ? A GLU 330 
63  1 Y 1 A PRO 988  ? A PRO 331 
64  1 Y 1 A GLU 989  ? A GLU 332 
65  1 Y 1 A LEU 990  ? A LEU 333 
66  1 Y 1 A ASP 991  ? A ASP 334 
67  1 Y 1 A LEU 992  ? A LEU 335 
68  1 Y 1 A ASP 993  ? A ASP 336 
69  1 Y 1 A LEU 994  ? A LEU 337 
70  1 Y 1 A ASP 995  ? A ASP 338 
71  1 Y 1 A LEU 996  ? A LEU 339 
72  1 Y 1 A GLU 997  ? A GLU 340 
73  1 Y 1 A ALA 998  ? A ALA 341 
74  1 Y 1 A GLU 999  ? A GLU 342 
75  1 Y 1 A GLU 1000 ? A GLU 343 
76  1 Y 1 A ASP 1001 ? A ASP 344 
77  1 Y 1 B MET 658  ? B MET 1   
78  1 Y 1 B HIS 659  ? B HIS 2   
79  1 Y 1 B HIS 660  ? B HIS 3   
80  1 Y 1 B HIS 661  ? B HIS 4   
81  1 Y 1 B HIS 662  ? B HIS 5   
82  1 Y 1 B HIS 663  ? B HIS 6   
83  1 Y 1 B HIS 664  ? B HIS 7   
84  1 Y 1 B GLY 665  ? B GLY 8   
85  1 Y 1 B GLU 666  ? B GLU 9   
86  1 Y 1 B SER 667  ? B SER 10  
87  1 Y 1 B ILE 668  ? B ILE 11  
88  1 Y 1 B GLU 669  ? B GLU 12  
89  1 Y 1 B PRO 670  ? B PRO 13  
90  1 Y 1 B LEU 671  ? B LEU 14  
91  1 Y 1 B ASP 672  ? B ASP 15  
92  1 Y 1 B PRO 673  ? B PRO 16  
93  1 Y 1 B SER 674  ? B SER 17  
94  1 Y 1 B GLU 675  ? B GLU 18  
95  1 Y 1 B LYS 676  ? B LYS 19  
96  1 Y 1 B ALA 677  ? B ALA 20  
97  1 Y 1 B ASN 678  ? B ASN 21  
98  1 Y 1 B LYS 679  ? B LYS 22  
99  1 Y 1 B GLU 712  ? B GLU 55  
100 1 Y 1 B GLY 730  ? B GLY 73  
101 1 Y 1 B ARG 731  ? B ARG 74  
102 1 Y 1 B GLN 846  ? B GLN 189 
103 1 Y 1 B LEU 847  ? B LEU 190 
104 1 Y 1 B LEU 848  ? B LEU 191 
105 1 Y 1 B TYR 849  ? B TYR 192 
106 1 Y 1 B SER 850  ? B SER 193 
107 1 Y 1 B GLU 851  ? B GLU 194 
108 1 Y 1 B ALA 852  ? B ALA 195 
109 1 Y 1 B LYS 853  ? B LYS 196 
110 1 Y 1 B THR 854  ? B THR 197 
111 1 Y 1 B LYS 960  ? B LYS 303 
112 1 Y 1 B ARG 961  ? B ARG 304 
113 1 Y 1 B GLU 962  ? B GLU 305 
114 1 Y 1 B SER 963  ? B SER 306 
115 1 Y 1 B GLY 964  ? B GLY 307 
116 1 Y 1 B PRO 965  ? B PRO 308 
117 1 Y 1 B GLY 966  ? B GLY 309 
118 1 Y 1 B ILE 967  ? B ILE 310 
119 1 Y 1 B ALA 968  ? B ALA 311 
120 1 Y 1 B PRO 969  ? B PRO 312 
121 1 Y 1 B GLY 970  ? B GLY 313 
122 1 Y 1 B PRO 971  ? B PRO 314 
123 1 Y 1 B GLU 972  ? B GLU 315 
124 1 Y 1 B PRO 973  ? B PRO 316 
125 1 Y 1 B HIS 974  ? B HIS 317 
126 1 Y 1 B GLY 975  ? B GLY 318 
127 1 Y 1 B LEU 976  ? B LEU 319 
128 1 Y 1 B THR 977  ? B THR 320 
129 1 Y 1 B ASN 978  ? B ASN 321 
130 1 Y 1 B LYS 979  ? B LYS 322 
131 1 Y 1 B LYS 980  ? B LYS 323 
132 1 Y 1 B LEU 981  ? B LEU 324 
133 1 Y 1 B GLU 982  ? B GLU 325 
134 1 Y 1 B GLU 983  ? B GLU 326 
135 1 Y 1 B VAL 984  ? B VAL 327 
136 1 Y 1 B GLU 985  ? B GLU 328 
137 1 Y 1 B LEU 986  ? B LEU 329 
138 1 Y 1 B GLU 987  ? B GLU 330 
139 1 Y 1 B PRO 988  ? B PRO 331 
140 1 Y 1 B GLU 989  ? B GLU 332 
141 1 Y 1 B LEU 990  ? B LEU 333 
142 1 Y 1 B ASP 991  ? B ASP 334 
143 1 Y 1 B LEU 992  ? B LEU 335 
144 1 Y 1 B ASP 993  ? B ASP 336 
145 1 Y 1 B LEU 994  ? B LEU 337 
146 1 Y 1 B ASP 995  ? B ASP 338 
147 1 Y 1 B LEU 996  ? B LEU 339 
148 1 Y 1 B GLU 997  ? B GLU 340 
149 1 Y 1 B ALA 998  ? B ALA 341 
150 1 Y 1 B GLU 999  ? B GLU 342 
151 1 Y 1 B GLU 1000 ? B GLU 343 
152 1 Y 1 B ASP 1001 ? B ASP 344 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                               MG  
3 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
4 water                                         HOH 
#