data_3LRA
# 
_entry.id   3LRA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LRA         
RCSB  RCSB057631   
WWPDB D_1000057631 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3LRA 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, X.' 1 
'Xie, X.'  2 
'Shen, Y.' 3 
'Long, J.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for tandem L27 domain-mediated polymerization' 
_citation.journal_abbrev            'Faseb J.' 
_citation.journal_volume            24 
_citation.page_first                4806 
_citation.page_last                 4815 
_citation.year                      2010 
_citation.journal_id_ASTM           FAJOEC 
_citation.country                   US 
_citation.journal_id_ISSN           0892-6638 
_citation.journal_id_CSD            2074 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20702775 
_citation.pdbx_database_id_DOI      10.1096/fj.10-163857 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, X.'  1  
primary 'Xie, X.'   2  
primary 'Chen, L.'  3  
primary 'Zhou, H.'  4  
primary 'Wang, Z.'  5  
primary 'Zhao, W.'  6  
primary 'Tian, R.'  7  
primary 'Zhang, R.' 8  
primary 'Tian, C.'  9  
primary 'Long, J.'  10 
primary 'Shen, Y.'  11 
# 
_cell.entry_id           3LRA 
_cell.length_a           153.190 
_cell.length_b           153.190 
_cell.length_c           58.903 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LRA 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Disks large homolog 1, MAGUK p55 subfamily member 7, Protein lin-7 homolog C' 29164.166 1  ? ? 
'L27 domain, L27 1/2 domain' 'Structural Basis for Assembling a Tripartite Complex Dlg1-MPP7-Mals3' 
2 water   nat water                                                                          18.015    41 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Dlg1, Synapse-associated protein 97, SAP-97, SAP97, hDlg, MPP7, MALS-3, Lin-7C, Mammalian lin-seven protein 3, Vertebrate lin-7 homolog 3, Veli-3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKLEVLFQGPGSDTGLYE
LLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPLNSEIRELL
KLLSKPNVKALLSVHDTVAQKNYDLEVLFQGPALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
REVYEHVYETVDIS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKLEVLFQGPGSDTGLYE
LLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPLNSEIRELL
KLLSKPNVKALLSVHDTVAQKNYDLEVLFQGPALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
REVYEHVYETVDIS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   VAL n 
1 3   ARG n 
1 4   LYS n 
1 5   GLN n 
1 6   ASP n 
1 7   THR n 
1 8   GLN n 
1 9   ARG n 
1 10  ALA n 
1 11  LEU n 
1 12  HIS n 
1 13  LEU n 
1 14  LEU n 
1 15  GLU n 
1 16  GLU n 
1 17  TYR n 
1 18  ARG n 
1 19  SER n 
1 20  LYS n 
1 21  LEU n 
1 22  SER n 
1 23  GLN n 
1 24  THR n 
1 25  GLU n 
1 26  ASP n 
1 27  ARG n 
1 28  GLN n 
1 29  LEU n 
1 30  ARG n 
1 31  SER n 
1 32  SER n 
1 33  ILE n 
1 34  GLU n 
1 35  ARG n 
1 36  VAL n 
1 37  ILE n 
1 38  ASN n 
1 39  ILE n 
1 40  PHE n 
1 41  GLN n 
1 42  SER n 
1 43  ASN n 
1 44  LEU n 
1 45  PHE n 
1 46  GLN n 
1 47  ALA n 
1 48  LEU n 
1 49  ILE n 
1 50  ASP n 
1 51  ILE n 
1 52  GLN n 
1 53  GLU n 
1 54  PHE n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  THR n 
1 59  LEU n 
1 60  LEU n 
1 61  ASP n 
1 62  ASN n 
1 63  PRO n 
1 64  LYS n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  LEU n 
1 69  PHE n 
1 70  GLN n 
1 71  GLY n 
1 72  PRO n 
1 73  GLY n 
1 74  SER n 
1 75  ASP n 
1 76  THR n 
1 77  GLY n 
1 78  LEU n 
1 79  TYR n 
1 80  GLU n 
1 81  LEU n 
1 82  LEU n 
1 83  ALA n 
1 84  ALA n 
1 85  LEU n 
1 86  PRO n 
1 87  ALA n 
1 88  GLN n 
1 89  LEU n 
1 90  GLN n 
1 91  PRO n 
1 92  HIS n 
1 93  VAL n 
1 94  ASP n 
1 95  SER n 
1 96  GLN n 
1 97  GLU n 
1 98  ASP n 
1 99  LEU n 
1 100 THR n 
1 101 PHE n 
1 102 LEU n 
1 103 TRP n 
1 104 ASP n 
1 105 MET n 
1 106 PHE n 
1 107 GLY n 
1 108 GLU n 
1 109 LYS n 
1 110 SER n 
1 111 LEU n 
1 112 HIS n 
1 113 SER n 
1 114 LEU n 
1 115 VAL n 
1 116 LYS n 
1 117 ILE n 
1 118 HIS n 
1 119 GLU n 
1 120 LYS n 
1 121 LEU n 
1 122 HIS n 
1 123 TYR n 
1 124 TYR n 
1 125 GLU n 
1 126 LYS n 
1 127 GLN n 
1 128 SER n 
1 129 PRO n 
1 130 VAL n 
1 131 PRO n 
1 132 ILE n 
1 133 LEU n 
1 134 HIS n 
1 135 GLY n 
1 136 ALA n 
1 137 ALA n 
1 138 ALA n 
1 139 LEU n 
1 140 ALA n 
1 141 ASP n 
1 142 ASP n 
1 143 LEU n 
1 144 ALA n 
1 145 GLU n 
1 146 GLU n 
1 147 LEU n 
1 148 GLN n 
1 149 ASN n 
1 150 LYS n 
1 151 PRO n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 GLU n 
1 156 ILE n 
1 157 ARG n 
1 158 GLU n 
1 159 LEU n 
1 160 LEU n 
1 161 LYS n 
1 162 LEU n 
1 163 LEU n 
1 164 SER n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 VAL n 
1 169 LYS n 
1 170 ALA n 
1 171 LEU n 
1 172 LEU n 
1 173 SER n 
1 174 VAL n 
1 175 HIS n 
1 176 ASP n 
1 177 THR n 
1 178 VAL n 
1 179 ALA n 
1 180 GLN n 
1 181 LYS n 
1 182 ASN n 
1 183 TYR n 
1 184 ASP n 
1 185 LEU n 
1 186 GLU n 
1 187 VAL n 
1 188 LEU n 
1 189 PHE n 
1 190 GLN n 
1 191 GLY n 
1 192 PRO n 
1 193 ALA n 
1 194 LEU n 
1 195 GLY n 
1 196 GLU n 
1 197 PRO n 
1 198 VAL n 
1 199 ARG n 
1 200 LEU n 
1 201 GLU n 
1 202 ARG n 
1 203 ASP n 
1 204 ILE n 
1 205 CYS n 
1 206 ARG n 
1 207 ALA n 
1 208 ILE n 
1 209 GLU n 
1 210 LEU n 
1 211 LEU n 
1 212 GLU n 
1 213 LYS n 
1 214 LEU n 
1 215 GLN n 
1 216 ARG n 
1 217 SER n 
1 218 GLY n 
1 219 GLU n 
1 220 VAL n 
1 221 PRO n 
1 222 PRO n 
1 223 GLN n 
1 224 LYS n 
1 225 LEU n 
1 226 GLN n 
1 227 ALA n 
1 228 LEU n 
1 229 GLN n 
1 230 ARG n 
1 231 VAL n 
1 232 LEU n 
1 233 GLN n 
1 234 SER n 
1 235 GLU n 
1 236 PHE n 
1 237 CYS n 
1 238 ASN n 
1 239 ALA n 
1 240 VAL n 
1 241 ARG n 
1 242 GLU n 
1 243 VAL n 
1 244 TYR n 
1 245 GLU n 
1 246 HIS n 
1 247 VAL n 
1 248 TYR n 
1 249 GLU n 
1 250 THR n 
1 251 VAL n 
1 252 ASP n 
1 253 ILE n 
1 254 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   64  human ? 'L27 domains of Dlg1, MPP7 and Mals3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? 'pET32a vector (Novagen)' 
;in-house-modified version of the pET32a vector (Novagen), in which the S-tag an
d the thrombin recognition site were replaced by a sequence encoding a TEV prote
ase cleavage site (Glu-Asn-Leu-Tyr-Phe-Gln-Ser)
;
? 
1 2 sample ? 73  184 human ? 'L27 domains of Dlg1, MPP7 and Mals3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? 'pET32a vector (Novagen)' 
;in-house-modified version of the pET32a vector (Novagen), in which the S-tag an
d the thrombin recognition site were replaced by a sequence encoding a TEV prote
ase cleavage site (Glu-Asn-Leu-Tyr-Phe-Gln-Ser)
;
? 
1 3 sample ? 193 254 human ? 'L27 domains of Dlg1, MPP7 and Mals3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? 'pET32a vector (Novagen)' 
;in-house-modified version of the pET32a vector (Novagen), in which the S-tag an
d the thrombin recognition site were replaced by a sequence encoding a TEV prote
ase cleavage site (Glu-Asn-Leu-Tyr-Phe-Gln-Ser)
;
? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DLG1_HUMAN  Q12959 1 PVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPK 2 ? 
2 PDB 3LRA        3LRA   1 LEVLFQGP 1 ? 
3 UNP MPP7_HUMAN  Q5T2T1 1 
;GSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPL
NSEIRELLKLLSKPNVKALLSVHDTVAQKNYD
;
9 ? 
4 UNP LIN7C_HUMAN Q9NUP9 1 ALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDIS 3 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LRA A 1   ? 64  ? Q12959 2 ? 65  ? 2   65  
2 2 3LRA A 65  ? 72  ? 3LRA   1 ? 8   ? 66  73  
3 3 3LRA A 73  ? 184 ? Q5T2T1 9 ? 120 ? 74  185 
4 2 3LRA A 185 ? 192 ? 3LRA   1 ? 8   ? 186 193 
5 4 3LRA A 193 ? 254 ? Q9NUP9 3 ? 64  ? 194 255 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3LRA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.42 
_exptl_crystal.density_percent_sol   64.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'10% PEG 8000, 0.2M MgCl2, 0.1M Guanidine HCl, 0.1M Tris-HCl, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'MAR CCD 165 mm'   2008-12-30 ? 
2 CCD 'ADSC QUANTUM 315' 2008-11-01 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si 111 CHANNEL'            'SINGLE WAVELENGTH' x-ray 
2 1 M 'SAGITALLY FOCUSED Si(111)' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0000 1.0 
2 0.9791 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'BSRF BEAMLINE 3W1A' BSRF 3W1A  ? 1.0000 
2 SYNCHROTRON 'APS BEAMLINE 19-ID' APS  19-ID ? 0.9791 
# 
_reflns.entry_id                     3LRA 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   5.0 
_reflns.d_resolution_low             38.3 
_reflns.d_resolution_high            2.95 
_reflns.number_obs                   8045 
_reflns.number_all                   8504 
_reflns.percent_possible_obs         95 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_Rsym_value              0.092 
_reflns.pdbx_netI_over_sigmaI        25.7 
_reflns.B_iso_Wilson_estimate        1.2 
_reflns.pdbx_redundancy              14.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.95 
_reflns_shell.d_res_low              3.06 
_reflns_shell.percent_possible_all   77.7 
_reflns_shell.Rmerge_I_obs           0.435 
_reflns_shell.pdbx_Rsym_value        0.435 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1047 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3LRA 
_refine.ls_number_reflns_obs                     8045 
_refine.ls_number_reflns_all                     8504 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          5.0 
_refine.pdbx_data_cutoff_high_absF               52963.05 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.30 
_refine.ls_d_res_high                            2.95 
_refine.ls_percent_reflns_obs                    94.6 
_refine.ls_R_factor_obs                          0.255 
_refine.ls_R_factor_all                          0.257 
_refine.ls_R_factor_R_work                       0.255 
_refine.ls_R_factor_R_free                       0.284 
_refine.ls_R_factor_R_free_error                 0.013 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.6 
_refine.ls_number_reflns_R_free                  472 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               67.2 
_refine.aniso_B[1][1]                            8.62 
_refine.aniso_B[2][2]                            8.62 
_refine.aniso_B[3][3]                            -17.24 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 52.039 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3LRA 
_refine_analyze.Luzzati_coordinate_error_obs    0.43 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.59 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2032 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             41 
_refine_hist.number_atoms_total               2073 
_refine_hist.d_res_high                       2.95 
_refine_hist.d_res_low                        38.30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 19.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.94  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.47  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.61  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.15  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.95 
_refine_ls_shell.d_res_low                        3.06 
_refine_ls_shell.number_reflns_R_work             1047 
_refine_ls_shell.R_factor_R_work                  0.338 
_refine_ls_shell.percent_reflns_obs               77.1 
_refine_ls_shell.R_factor_R_free                  0.373 
_refine_ls_shell.R_factor_R_free_error            0.047 
_refine_ls_shell.percent_reflns_R_free            5.7 
_refine_ls_shell.number_reflns_R_free             63 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                679 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param protein.top 
'X-RAY DIFFRACTION' 2 water_rep.param   water.top   
# 
_struct.entry_id                  3LRA 
_struct.title                     'Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3' 
_struct.pdbx_descriptor           'Disks large homolog 1, MAGUK p55 subfamily member 7, Protein lin-7 homolog C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LRA 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
;Tripartite Complex, L27 tetramer, Cell junction, Cell membrane, Endoplasmic reticulum, Host-virus interaction, Postsynaptic cell membrane, SH3 domain, Synapse, Tight junction, Exocytosis, Protein transport, Synaptosome, Transport, Membrane Protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 3   ? LYS A 20  ? ARG A 4   LYS A 21  1 ? 18 
HELX_P HELX_P2  2  GLN A 28  ? SER A 42  ? GLN A 29  SER A 43  1 ? 15 
HELX_P HELX_P3  3  SER A 42  ? TYR A 55  ? SER A 43  TYR A 56  1 ? 14 
HELX_P HELX_P4  4  ASN A 62  ? GLN A 70  ? ASN A 63  GLN A 71  5 ? 9  
HELX_P HELX_P5  5  GLY A 77  ? ALA A 84  ? GLY A 78  ALA A 85  1 ? 8  
HELX_P HELX_P6  6  ALA A 84  ? GLN A 90  ? ALA A 85  GLN A 91  1 ? 7  
HELX_P HELX_P7  7  GLU A 97  ? PHE A 106 ? GLU A 98  PHE A 107 1 ? 10 
HELX_P HELX_P8  8  SER A 110 ? LYS A 126 ? SER A 111 LYS A 127 1 ? 17 
HELX_P HELX_P9  9  GLY A 135 ? ASN A 149 ? GLY A 136 ASN A 150 1 ? 15 
HELX_P HELX_P10 10 ASN A 153 ? LEU A 163 ? ASN A 154 LEU A 164 1 ? 11 
HELX_P HELX_P11 11 LYS A 165 ? GLN A 180 ? LYS A 166 GLN A 181 1 ? 16 
HELX_P HELX_P12 12 ASP A 184 ? GLN A 190 ? ASP A 185 GLN A 191 1 ? 7  
HELX_P HELX_P13 13 GLN A 190 ? GLY A 195 ? GLN A 191 GLY A 196 1 ? 6  
HELX_P HELX_P14 14 GLU A 196 ? SER A 217 ? GLU A 197 SER A 218 1 ? 22 
HELX_P HELX_P15 15 PRO A 222 ? SER A 234 ? PRO A 223 SER A 235 1 ? 13 
HELX_P HELX_P16 16 SER A 234 ? VAL A 251 ? SER A 235 VAL A 252 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           220 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            221 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    221 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     222 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.38 
# 
_database_PDB_matrix.entry_id          3LRA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LRA 
_atom_sites.fract_transf_matrix[1][1]   0.006528 
_atom_sites.fract_transf_matrix[1][2]   0.003769 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007538 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016977 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1   ? 61.170 25.311  40.143 1.00 100.49 ? 2   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1   ? 61.537 24.177  41.029 1.00 99.74  ? 2   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1   ? 61.324 24.514  42.506 1.00 97.94  ? 2   PRO A C   1 
ATOM   4    O O   . PRO A 1 1   ? 62.041 25.343  43.073 1.00 97.30  ? 2   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1   ? 63.003 23.855  40.757 1.00 100.70 ? 2   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1   ? 63.523 25.228  40.316 1.00 101.94 ? 2   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1   ? 62.375 25.821  39.461 1.00 101.85 ? 2   PRO A CD  1 
ATOM   8    N N   . VAL A 1 2   ? 60.334 23.867  43.120 1.00 96.15  ? 3   VAL A N   1 
ATOM   9    C CA  . VAL A 1 2   ? 60.035 24.088  44.529 1.00 94.32  ? 3   VAL A CA  1 
ATOM   10   C C   . VAL A 1 2   ? 61.235 23.664  45.366 1.00 94.22  ? 3   VAL A C   1 
ATOM   11   O O   . VAL A 1 2   ? 61.679 22.523  45.286 1.00 93.98  ? 3   VAL A O   1 
ATOM   12   C CB  . VAL A 1 2   ? 58.836 23.253  44.993 1.00 92.86  ? 3   VAL A CB  1 
ATOM   13   C CG1 . VAL A 1 2   ? 58.523 23.577  46.441 1.00 91.44  ? 3   VAL A CG1 1 
ATOM   14   C CG2 . VAL A 1 2   ? 57.637 23.515  44.102 1.00 92.05  ? 3   VAL A CG2 1 
ATOM   15   N N   . ARG A 1 3   ? 61.758 24.581  46.171 1.00 93.67  ? 4   ARG A N   1 
ATOM   16   C CA  . ARG A 1 3   ? 62.907 24.264  47.009 1.00 92.39  ? 4   ARG A CA  1 
ATOM   17   C C   . ARG A 1 3   ? 62.459 23.661  48.340 1.00 91.84  ? 4   ARG A C   1 
ATOM   18   O O   . ARG A 1 3   ? 61.398 23.996  48.868 1.00 91.84  ? 4   ARG A O   1 
ATOM   19   C CB  . ARG A 1 3   ? 63.750 25.516  47.259 1.00 92.80  ? 4   ARG A CB  1 
ATOM   20   C CG  . ARG A 1 3   ? 64.210 26.223  45.989 1.00 93.07  ? 4   ARG A CG  1 
ATOM   21   C CD  . ARG A 1 3   ? 65.266 27.280  46.295 1.00 94.15  ? 4   ARG A CD  1 
ATOM   22   N NE  . ARG A 1 3   ? 64.914 28.107  47.453 1.00 94.64  ? 4   ARG A NE  1 
ATOM   23   C CZ  . ARG A 1 3   ? 63.859 28.912  47.521 1.00 94.41  ? 4   ARG A CZ  1 
ATOM   24   N NH1 . ARG A 1 3   ? 63.028 29.016  46.491 1.00 94.54  ? 4   ARG A NH1 1 
ATOM   25   N NH2 . ARG A 1 3   ? 63.627 29.608  48.628 1.00 93.05  ? 4   ARG A NH2 1 
ATOM   26   N N   . LYS A 1 4   ? 63.282 22.757  48.865 1.00 91.18  ? 5   LYS A N   1 
ATOM   27   C CA  . LYS A 1 4   ? 62.998 22.073  50.122 1.00 89.44  ? 5   LYS A CA  1 
ATOM   28   C C   . LYS A 1 4   ? 62.682 23.032  51.260 1.00 87.97  ? 5   LYS A C   1 
ATOM   29   O O   . LYS A 1 4   ? 61.707 22.843  51.982 1.00 86.97  ? 5   LYS A O   1 
ATOM   30   C CB  . LYS A 1 4   ? 64.191 21.188  50.511 1.00 89.60  ? 5   LYS A CB  1 
ATOM   31   C CG  . LYS A 1 4   ? 64.064 20.492  51.868 1.00 89.73  ? 5   LYS A CG  1 
ATOM   32   C CD  . LYS A 1 4   ? 62.992 19.396  51.885 1.00 89.12  ? 5   LYS A CD  1 
ATOM   33   C CE  . LYS A 1 4   ? 63.433 18.159  51.116 1.00 89.46  ? 5   LYS A CE  1 
ATOM   34   N NZ  . LYS A 1 4   ? 62.433 17.055  51.198 1.00 88.61  ? 5   LYS A NZ  1 
ATOM   35   N N   . GLN A 1 5   ? 63.502 24.064  51.416 1.00 86.62  ? 6   GLN A N   1 
ATOM   36   C CA  . GLN A 1 5   ? 63.301 25.031  52.488 1.00 86.26  ? 6   GLN A CA  1 
ATOM   37   C C   . GLN A 1 5   ? 61.921 25.669  52.453 1.00 85.02  ? 6   GLN A C   1 
ATOM   38   O O   . GLN A 1 5   ? 61.297 25.882  53.496 1.00 84.25  ? 6   GLN A O   1 
ATOM   39   C CB  . GLN A 1 5   ? 64.366 26.125  52.428 1.00 87.35  ? 6   GLN A CB  1 
ATOM   40   C CG  . GLN A 1 5   ? 64.123 27.198  51.392 1.00 88.18  ? 6   GLN A CG  1 
ATOM   41   C CD  . GLN A 1 5   ? 65.293 28.147  51.282 1.00 89.49  ? 6   GLN A CD  1 
ATOM   42   O OE1 . GLN A 1 5   ? 65.818 28.623  52.290 1.00 89.89  ? 6   GLN A OE1 1 
ATOM   43   N NE2 . GLN A 1 5   ? 65.711 28.431  50.052 1.00 89.92  ? 6   GLN A NE2 1 
ATOM   44   N N   . ASP A 1 6   ? 61.452 25.983  51.250 1.00 82.79  ? 7   ASP A N   1 
ATOM   45   C CA  . ASP A 1 6   ? 60.142 26.592  51.108 1.00 80.68  ? 7   ASP A CA  1 
ATOM   46   C C   . ASP A 1 6   ? 59.070 25.664  51.662 1.00 80.15  ? 7   ASP A C   1 
ATOM   47   O O   . ASP A 1 6   ? 58.341 26.036  52.581 1.00 80.50  ? 7   ASP A O   1 
ATOM   48   C CB  . ASP A 1 6   ? 59.867 26.922  49.642 1.00 79.41  ? 7   ASP A CB  1 
ATOM   49   C CG  . ASP A 1 6   ? 60.810 27.972  49.104 1.00 78.88  ? 7   ASP A CG  1 
ATOM   50   O OD1 . ASP A 1 6   ? 61.060 28.956  49.826 1.00 79.40  ? 7   ASP A OD1 1 
ATOM   51   O OD2 . ASP A 1 6   ? 61.300 27.826  47.967 1.00 78.20  ? 7   ASP A OD2 1 
ATOM   52   N N   . THR A 1 7   ? 58.983 24.455  51.119 1.00 79.47  ? 8   THR A N   1 
ATOM   53   C CA  . THR A 1 7   ? 57.994 23.483  51.582 1.00 78.96  ? 8   THR A CA  1 
ATOM   54   C C   . THR A 1 7   ? 58.114 23.330  53.095 1.00 78.83  ? 8   THR A C   1 
ATOM   55   O O   . THR A 1 7   ? 57.129 23.087  53.785 1.00 77.82  ? 8   THR A O   1 
ATOM   56   C CB  . THR A 1 7   ? 58.219 22.107  50.941 1.00 77.97  ? 8   THR A CB  1 
ATOM   57   O OG1 . THR A 1 7   ? 59.289 21.435  51.610 1.00 77.95  ? 8   THR A OG1 1 
ATOM   58   C CG2 . THR A 1 7   ? 58.596 22.265  49.489 1.00 79.10  ? 8   THR A CG2 1 
ATOM   59   N N   . GLN A 1 8   ? 59.341 23.477  53.594 1.00 79.42  ? 9   GLN A N   1 
ATOM   60   C CA  . GLN A 1 8   ? 59.646 23.373  55.016 1.00 79.33  ? 9   GLN A CA  1 
ATOM   61   C C   . GLN A 1 8   ? 59.113 24.575  55.783 1.00 80.42  ? 9   GLN A C   1 
ATOM   62   O O   . GLN A 1 8   ? 58.353 24.422  56.738 1.00 80.10  ? 9   GLN A O   1 
ATOM   63   C CB  . GLN A 1 8   ? 61.157 23.281  55.207 1.00 79.79  ? 9   GLN A CB  1 
ATOM   64   C CG  . GLN A 1 8   ? 61.767 21.992  54.683 1.00 80.87  ? 9   GLN A CG  1 
ATOM   65   C CD  . GLN A 1 8   ? 61.471 20.794  55.574 1.00 80.08  ? 9   GLN A CD  1 
ATOM   66   O OE1 . GLN A 1 8   ? 61.979 20.704  56.695 1.00 77.89  ? 9   GLN A OE1 1 
ATOM   67   N NE2 . GLN A 1 8   ? 60.644 19.866  55.078 1.00 78.56  ? 9   GLN A NE2 1 
ATOM   68   N N   . ARG A 1 9   ? 59.517 25.770  55.360 1.00 81.96  ? 10  ARG A N   1 
ATOM   69   C CA  . ARG A 1 9   ? 59.076 27.006  55.998 1.00 82.46  ? 10  ARG A CA  1 
ATOM   70   C C   . ARG A 1 9   ? 57.561 27.129  55.903 1.00 81.70  ? 10  ARG A C   1 
ATOM   71   O O   . ARG A 1 9   ? 56.914 27.653  56.802 1.00 81.44  ? 10  ARG A O   1 
ATOM   72   C CB  . ARG A 1 9   ? 59.727 28.212  55.322 1.00 84.12  ? 10  ARG A CB  1 
ATOM   73   C CG  . ARG A 1 9   ? 59.258 29.542  55.863 1.00 87.30  ? 10  ARG A CG  1 
ATOM   74   C CD  . ARG A 1 9   ? 59.770 30.692  55.007 1.00 90.39  ? 10  ARG A CD  1 
ATOM   75   N NE  . ARG A 1 9   ? 59.093 31.944  55.337 1.00 93.47  ? 10  ARG A NE  1 
ATOM   76   C CZ  . ARG A 1 9   ? 59.230 33.081  54.659 1.00 93.91  ? 10  ARG A CZ  1 
ATOM   77   N NH1 . ARG A 1 9   ? 60.029 33.134  53.604 1.00 93.77  ? 10  ARG A NH1 1 
ATOM   78   N NH2 . ARG A 1 9   ? 58.564 34.165  55.032 1.00 94.94  ? 10  ARG A NH2 1 
ATOM   79   N N   . ALA A 1 10  ? 57.000 26.641  54.803 1.00 81.19  ? 11  ALA A N   1 
ATOM   80   C CA  . ALA A 1 10  ? 55.565 26.700  54.604 1.00 80.69  ? 11  ALA A CA  1 
ATOM   81   C C   . ALA A 1 10  ? 54.873 25.695  55.512 1.00 81.75  ? 11  ALA A C   1 
ATOM   82   O O   . ALA A 1 10  ? 53.730 25.896  55.915 1.00 81.32  ? 11  ALA A O   1 
ATOM   83   C CB  . ALA A 1 10  ? 55.238 26.417  53.161 1.00 79.85  ? 11  ALA A CB  1 
ATOM   84   N N   . LEU A 1 11  ? 55.568 24.606  55.839 1.00 82.94  ? 12  LEU A N   1 
ATOM   85   C CA  . LEU A 1 11  ? 54.989 23.589  56.712 1.00 83.89  ? 12  LEU A CA  1 
ATOM   86   C C   . LEU A 1 11  ? 54.979 24.140  58.132 1.00 84.74  ? 12  LEU A C   1 
ATOM   87   O O   . LEU A 1 11  ? 54.027 23.936  58.887 1.00 84.28  ? 12  LEU A O   1 
ATOM   88   C CB  . LEU A 1 11  ? 55.793 22.281  56.635 1.00 83.16  ? 12  LEU A CB  1 
ATOM   89   C CG  . LEU A 1 11  ? 55.184 21.001  57.240 1.00 83.22  ? 12  LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 11  ? 55.331 21.032  58.737 1.00 84.00  ? 12  LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 11  ? 53.714 20.856  56.853 1.00 81.89  ? 12  LEU A CD2 1 
ATOM   92   N N   . HIS A 1 12  ? 56.041 24.855  58.483 1.00 86.26  ? 13  HIS A N   1 
ATOM   93   C CA  . HIS A 1 12  ? 56.146 25.468  59.801 1.00 87.42  ? 13  HIS A CA  1 
ATOM   94   C C   . HIS A 1 12  ? 55.011 26.482  59.962 1.00 86.81  ? 13  HIS A C   1 
ATOM   95   O O   . HIS A 1 12  ? 54.157 26.334  60.840 1.00 87.08  ? 13  HIS A O   1 
ATOM   96   C CB  . HIS A 1 12  ? 57.508 26.160  59.939 1.00 90.48  ? 13  HIS A CB  1 
ATOM   97   C CG  . HIS A 1 12  ? 57.646 27.009  61.168 1.00 94.75  ? 13  HIS A CG  1 
ATOM   98   N ND1 . HIS A 1 12  ? 56.945 28.185  61.346 1.00 96.23  ? 13  HIS A ND1 1 
ATOM   99   C CD2 . HIS A 1 12  ? 58.420 26.864  62.271 1.00 96.52  ? 13  HIS A CD2 1 
ATOM   100  C CE1 . HIS A 1 12  ? 57.283 28.727  62.503 1.00 96.39  ? 13  HIS A CE1 1 
ATOM   101  N NE2 . HIS A 1 12  ? 58.176 27.945  63.084 1.00 96.70  ? 13  HIS A NE2 1 
ATOM   102  N N   . LEU A 1 13  ? 54.993 27.491  59.090 1.00 84.72  ? 14  LEU A N   1 
ATOM   103  C CA  . LEU A 1 13  ? 53.980 28.544  59.126 1.00 83.02  ? 14  LEU A CA  1 
ATOM   104  C C   . LEU A 1 13  ? 52.553 27.998  59.074 1.00 82.05  ? 14  LEU A C   1 
ATOM   105  O O   . LEU A 1 13  ? 51.706 28.381  59.870 1.00 81.23  ? 14  LEU A O   1 
ATOM   106  C CB  . LEU A 1 13  ? 54.185 29.518  57.958 1.00 82.45  ? 14  LEU A CB  1 
ATOM   107  C CG  . LEU A 1 13  ? 55.551 30.184  57.760 1.00 82.17  ? 14  LEU A CG  1 
ATOM   108  C CD1 . LEU A 1 13  ? 55.503 31.094  56.551 1.00 81.88  ? 14  LEU A CD1 1 
ATOM   109  C CD2 . LEU A 1 13  ? 55.929 30.979  58.984 1.00 82.82  ? 14  LEU A CD2 1 
ATOM   110  N N   . LEU A 1 14  ? 52.295 27.094  58.140 1.00 82.53  ? 15  LEU A N   1 
ATOM   111  C CA  . LEU A 1 14  ? 50.964 26.531  57.979 1.00 82.84  ? 15  LEU A CA  1 
ATOM   112  C C   . LEU A 1 14  ? 50.451 25.879  59.247 1.00 83.94  ? 15  LEU A C   1 
ATOM   113  O O   . LEU A 1 14  ? 49.261 25.941  59.551 1.00 82.49  ? 15  LEU A O   1 
ATOM   114  C CB  . LEU A 1 14  ? 50.966 25.533  56.822 1.00 81.24  ? 15  LEU A CB  1 
ATOM   115  C CG  . LEU A 1 14  ? 49.603 25.247  56.193 1.00 81.29  ? 15  LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 14  ? 48.837 26.533  56.004 1.00 81.23  ? 15  LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 14  ? 49.793 24.557  54.860 1.00 81.69  ? 15  LEU A CD2 1 
ATOM   118  N N   . GLU A 1 15  ? 51.362 25.264  59.990 1.00 87.34  ? 16  GLU A N   1 
ATOM   119  C CA  . GLU A 1 15  ? 51.020 24.597  61.248 1.00 90.24  ? 16  GLU A CA  1 
ATOM   120  C C   . GLU A 1 15  ? 50.745 25.629  62.325 1.00 89.79  ? 16  GLU A C   1 
ATOM   121  O O   . GLU A 1 15  ? 49.795 25.508  63.098 1.00 89.18  ? 16  GLU A O   1 
ATOM   122  C CB  . GLU A 1 15  ? 52.173 23.693  61.695 1.00 93.23  ? 16  GLU A CB  1 
ATOM   123  C CG  . GLU A 1 15  ? 52.013 22.229  61.306 1.00 97.25  ? 16  GLU A CG  1 
ATOM   124  C CD  . GLU A 1 15  ? 53.333 21.468  61.314 1.00 99.89  ? 16  GLU A CD  1 
ATOM   125  O OE1 . GLU A 1 15  ? 53.297 20.216  61.298 1.00 101.65 ? 16  GLU A OE1 1 
ATOM   126  O OE2 . GLU A 1 15  ? 54.406 22.116  61.320 1.00 100.66 ? 16  GLU A OE2 1 
ATOM   127  N N   . GLU A 1 16  ? 51.599 26.647  62.356 1.00 89.15  ? 17  GLU A N   1 
ATOM   128  C CA  . GLU A 1 16  ? 51.489 27.741  63.304 1.00 88.52  ? 17  GLU A CA  1 
ATOM   129  C C   . GLU A 1 16  ? 50.065 28.288  63.270 1.00 87.74  ? 17  GLU A C   1 
ATOM   130  O O   . GLU A 1 16  ? 49.328 28.195  64.247 1.00 87.11  ? 17  GLU A O   1 
ATOM   131  C CB  . GLU A 1 16  ? 52.475 28.841  62.916 1.00 89.12  ? 17  GLU A CB  1 
ATOM   132  C CG  . GLU A 1 16  ? 52.887 29.754  64.042 1.00 91.07  ? 17  GLU A CG  1 
ATOM   133  C CD  . GLU A 1 16  ? 53.767 30.899  63.564 1.00 92.93  ? 17  GLU A CD  1 
ATOM   134  O OE1 . GLU A 1 16  ? 53.215 31.918  63.080 1.00 92.12  ? 17  GLU A OE1 1 
ATOM   135  O OE2 . GLU A 1 16  ? 55.011 30.773  63.664 1.00 93.65  ? 17  GLU A OE2 1 
ATOM   136  N N   . TYR A 1 17  ? 49.682 28.842  62.125 1.00 87.72  ? 18  TYR A N   1 
ATOM   137  C CA  . TYR A 1 17  ? 48.358 29.428  61.939 1.00 88.25  ? 18  TYR A CA  1 
ATOM   138  C C   . TYR A 1 17  ? 47.168 28.473  62.126 1.00 88.74  ? 18  TYR A C   1 
ATOM   139  O O   . TYR A 1 17  ? 46.022 28.910  62.201 1.00 87.68  ? 18  TYR A O   1 
ATOM   140  C CB  . TYR A 1 17  ? 48.295 30.097  60.560 1.00 87.59  ? 18  TYR A CB  1 
ATOM   141  C CG  . TYR A 1 17  ? 49.312 31.210  60.383 1.00 87.58  ? 18  TYR A CG  1 
ATOM   142  C CD1 . TYR A 1 17  ? 49.316 32.318  61.234 1.00 87.80  ? 18  TYR A CD1 1 
ATOM   143  C CD2 . TYR A 1 17  ? 50.281 31.154  59.383 1.00 87.59  ? 18  TYR A CD2 1 
ATOM   144  C CE1 . TYR A 1 17  ? 50.264 33.344  61.095 1.00 87.15  ? 18  TYR A CE1 1 
ATOM   145  C CE2 . TYR A 1 17  ? 51.231 32.171  59.233 1.00 87.77  ? 18  TYR A CE2 1 
ATOM   146  C CZ  . TYR A 1 17  ? 51.217 33.264  60.094 1.00 87.31  ? 18  TYR A CZ  1 
ATOM   147  O OH  . TYR A 1 17  ? 52.155 34.267  59.957 1.00 85.27  ? 18  TYR A OH  1 
ATOM   148  N N   . ARG A 1 18  ? 47.429 27.176  62.210 1.00 90.21  ? 19  ARG A N   1 
ATOM   149  C CA  . ARG A 1 18  ? 46.346 26.215  62.399 1.00 92.48  ? 19  ARG A CA  1 
ATOM   150  C C   . ARG A 1 18  ? 45.943 26.154  63.874 1.00 94.29  ? 19  ARG A C   1 
ATOM   151  O O   . ARG A 1 18  ? 44.775 25.920  64.204 1.00 93.73  ? 19  ARG A O   1 
ATOM   152  C CB  . ARG A 1 18  ? 46.782 24.817  61.937 1.00 92.72  ? 19  ARG A CB  1 
ATOM   153  C CG  . ARG A 1 18  ? 45.732 23.740  62.211 1.00 91.64  ? 19  ARG A CG  1 
ATOM   154  C CD  . ARG A 1 18  ? 46.332 22.341  62.372 1.00 89.26  ? 19  ARG A CD  1 
ATOM   155  N NE  . ARG A 1 18  ? 45.357 21.398  62.927 1.00 86.76  ? 19  ARG A NE  1 
ATOM   156  C CZ  . ARG A 1 18  ? 44.188 21.106  62.361 1.00 86.01  ? 19  ARG A CZ  1 
ATOM   157  N NH1 . ARG A 1 18  ? 43.838 21.679  61.214 1.00 85.88  ? 19  ARG A NH1 1 
ATOM   158  N NH2 . ARG A 1 18  ? 43.358 20.247  62.937 1.00 83.68  ? 19  ARG A NH2 1 
ATOM   159  N N   . SER A 1 19  ? 46.923 26.368  64.752 1.00 96.64  ? 20  SER A N   1 
ATOM   160  C CA  . SER A 1 19  ? 46.730 26.331  66.205 1.00 98.13  ? 20  SER A CA  1 
ATOM   161  C C   . SER A 1 19  ? 45.992 27.550  66.749 1.00 99.18  ? 20  SER A C   1 
ATOM   162  O O   . SER A 1 19  ? 45.200 27.429  67.687 1.00 98.82  ? 20  SER A O   1 
ATOM   163  C CB  . SER A 1 19  ? 48.083 26.222  66.909 1.00 97.87  ? 20  SER A CB  1 
ATOM   164  O OG  . SER A 1 19  ? 48.862 27.382  66.678 1.00 96.60  ? 20  SER A OG  1 
ATOM   165  N N   . LYS A 1 20  ? 46.265 28.717  66.166 1.00 100.24 ? 21  LYS A N   1 
ATOM   166  C CA  . LYS A 1 20  ? 45.628 29.967  66.572 1.00 101.13 ? 21  LYS A CA  1 
ATOM   167  C C   . LYS A 1 20  ? 44.156 30.030  66.154 1.00 101.88 ? 21  LYS A C   1 
ATOM   168  O O   . LYS A 1 20  ? 43.600 31.112  65.975 1.00 102.52 ? 21  LYS A O   1 
ATOM   169  C CB  . LYS A 1 20  ? 46.389 31.163  65.990 1.00 101.22 ? 21  LYS A CB  1 
ATOM   170  C CG  . LYS A 1 20  ? 47.798 31.351  66.581 1.00 102.22 ? 21  LYS A CG  1 
ATOM   171  C CD  . LYS A 1 20  ? 48.501 32.550  65.965 1.00 103.76 ? 21  LYS A CD  1 
ATOM   172  C CE  . LYS A 1 20  ? 49.893 32.754  66.561 1.00 105.02 ? 21  LYS A CE  1 
ATOM   173  N NZ  . LYS A 1 20  ? 50.627 33.917  65.948 1.00 107.25 ? 21  LYS A NZ  1 
ATOM   174  N N   . LEU A 1 21  ? 43.547 28.858  65.989 1.00 103.08 ? 22  LEU A N   1 
ATOM   175  C CA  . LEU A 1 21  ? 42.134 28.719  65.628 1.00 104.03 ? 22  LEU A CA  1 
ATOM   176  C C   . LEU A 1 21  ? 41.598 27.672  66.602 1.00 105.40 ? 22  LEU A C   1 
ATOM   177  O O   . LEU A 1 21  ? 42.372 26.833  67.075 1.00 106.38 ? 22  LEU A O   1 
ATOM   178  C CB  . LEU A 1 21  ? 42.001 28.236  64.184 1.00 103.37 ? 22  LEU A CB  1 
ATOM   179  C CG  . LEU A 1 21  ? 42.399 29.257  63.115 1.00 103.12 ? 22  LEU A CG  1 
ATOM   180  C CD1 . LEU A 1 21  ? 42.444 28.587  61.757 1.00 102.85 ? 22  LEU A CD1 1 
ATOM   181  C CD2 . LEU A 1 21  ? 41.406 30.414  63.122 1.00 102.74 ? 22  LEU A CD2 1 
ATOM   182  N N   . SER A 1 22  ? 40.302 27.706  66.915 1.00 106.69 ? 23  SER A N   1 
ATOM   183  C CA  . SER A 1 22  ? 39.751 26.746  67.883 1.00 108.07 ? 23  SER A CA  1 
ATOM   184  C C   . SER A 1 22  ? 38.620 25.853  67.353 1.00 107.34 ? 23  SER A C   1 
ATOM   185  O O   . SER A 1 22  ? 38.798 24.641  67.196 1.00 106.57 ? 23  SER A O   1 
ATOM   186  C CB  . SER A 1 22  ? 39.289 27.497  69.145 1.00 108.60 ? 23  SER A CB  1 
ATOM   187  O OG  . SER A 1 22  ? 39.111 26.618  70.249 1.00 109.42 ? 23  SER A OG  1 
ATOM   188  N N   . GLN A 1 23  ? 37.452 26.446  67.110 1.00 107.37 ? 24  GLN A N   1 
ATOM   189  C CA  . GLN A 1 23  ? 36.314 25.703  66.576 1.00 106.93 ? 24  GLN A CA  1 
ATOM   190  C C   . GLN A 1 23  ? 35.412 26.685  65.841 1.00 106.99 ? 24  GLN A C   1 
ATOM   191  O O   . GLN A 1 23  ? 34.518 26.296  65.086 1.00 107.06 ? 24  GLN A O   1 
ATOM   192  C CB  . GLN A 1 23  ? 35.527 25.007  67.694 1.00 106.98 ? 24  GLN A CB  1 
ATOM   193  C CG  . GLN A 1 23  ? 34.671 23.836  67.190 1.00 107.08 ? 24  GLN A CG  1 
ATOM   194  C CD  . GLN A 1 23  ? 33.735 23.259  68.245 1.00 106.76 ? 24  GLN A CD  1 
ATOM   195  O OE1 . GLN A 1 23  ? 32.793 23.926  68.695 1.00 105.90 ? 24  GLN A OE1 1 
ATOM   196  N NE2 . GLN A 1 23  ? 33.989 22.007  68.640 1.00 105.87 ? 24  GLN A NE2 1 
ATOM   197  N N   . THR A 1 24  ? 35.654 27.967  66.058 1.00 106.53 ? 25  THR A N   1 
ATOM   198  C CA  . THR A 1 24  ? 34.871 29.010  65.391 1.00 108.30 ? 25  THR A CA  1 
ATOM   199  C C   . THR A 1 24  ? 35.558 29.327  64.061 1.00 107.84 ? 25  THR A C   1 
ATOM   200  O O   . THR A 1 24  ? 36.758 29.644  64.023 1.00 109.16 ? 25  THR A O   1 
ATOM   201  C CB  . THR A 1 24  ? 34.779 30.339  66.220 1.00 106.94 ? 25  THR A CB  1 
ATOM   202  O OG1 . THR A 1 24  ? 33.745 31.177  65.663 1.00 105.15 ? 25  THR A OG1 1 
ATOM   203  C CG2 . THR A 1 24  ? 36.115 31.025  66.314 1.00 107.23 ? 25  THR A CG2 1 
ATOM   204  N N   . GLU A 1 25  ? 34.804 29.246  62.973 1.00 107.66 ? 26  GLU A N   1 
ATOM   205  C CA  . GLU A 1 25  ? 35.318 29.533  61.639 1.00 107.23 ? 26  GLU A CA  1 
ATOM   206  C C   . GLU A 1 25  ? 36.583 28.747  61.342 1.00 107.66 ? 26  GLU A C   1 
ATOM   207  O O   . GLU A 1 25  ? 37.412 29.174  60.548 1.00 107.69 ? 26  GLU A O   1 
ATOM   208  C CB  . GLU A 1 25  ? 35.588 31.039  61.462 1.00 107.25 ? 26  GLU A CB  1 
ATOM   209  C CG  . GLU A 1 25  ? 36.990 31.534  61.866 1.00 105.84 ? 26  GLU A CG  1 
ATOM   210  C CD  . GLU A 1 25  ? 37.962 31.665  60.688 1.00 105.02 ? 26  GLU A CD  1 
ATOM   211  O OE1 . GLU A 1 25  ? 39.149 31.959  60.939 1.00 104.46 ? 26  GLU A OE1 1 
ATOM   212  O OE2 . GLU A 1 25  ? 37.547 31.481  59.520 1.00 103.10 ? 26  GLU A OE2 1 
ATOM   213  N N   . ASP A 1 26  ? 36.744 27.593  61.974 1.00 107.38 ? 27  ASP A N   1 
ATOM   214  C CA  . ASP A 1 26  ? 37.931 26.799  61.710 1.00 107.56 ? 27  ASP A CA  1 
ATOM   215  C C   . ASP A 1 26  ? 37.654 25.304  61.573 1.00 106.11 ? 27  ASP A C   1 
ATOM   216  O O   . ASP A 1 26  ? 38.570 24.501  61.395 1.00 106.97 ? 27  ASP A O   1 
ATOM   217  C CB  . ASP A 1 26  ? 39.011 27.083  62.773 1.00 108.32 ? 27  ASP A CB  1 
ATOM   218  C CG  . ASP A 1 26  ? 38.571 26.721  64.184 1.00 109.01 ? 27  ASP A CG  1 
ATOM   219  O OD1 . ASP A 1 26  ? 38.344 25.519  64.445 1.00 109.79 ? 27  ASP A OD1 1 
ATOM   220  O OD2 . ASP A 1 26  ? 38.465 27.642  65.031 1.00 108.37 ? 27  ASP A OD2 1 
ATOM   221  N N   . ARG A 1 27  ? 36.379 24.931  61.622 1.00 104.99 ? 28  ARG A N   1 
ATOM   222  C CA  . ARG A 1 27  ? 36.013 23.533  61.472 1.00 103.91 ? 28  ARG A CA  1 
ATOM   223  C C   . ARG A 1 27  ? 36.291 23.170  60.018 1.00 102.26 ? 28  ARG A C   1 
ATOM   224  O O   . ARG A 1 27  ? 36.089 22.037  59.595 1.00 102.35 ? 28  ARG A O   1 
ATOM   225  C CB  . ARG A 1 27  ? 34.532 23.331  61.787 1.00 104.66 ? 28  ARG A CB  1 
ATOM   226  C CG  . ARG A 1 27  ? 34.132 21.878  61.975 1.00 106.48 ? 28  ARG A CG  1 
ATOM   227  C CD  . ARG A 1 27  ? 32.623 21.739  61.981 1.00 109.13 ? 28  ARG A CD  1 
ATOM   228  N NE  . ARG A 1 27  ? 32.138 20.944  63.107 1.00 112.56 ? 28  ARG A NE  1 
ATOM   229  C CZ  . ARG A 1 27  ? 32.244 21.304  64.385 1.00 114.04 ? 28  ARG A CZ  1 
ATOM   230  N NH1 . ARG A 1 27  ? 32.824 22.454  64.709 1.00 115.24 ? 28  ARG A NH1 1 
ATOM   231  N NH2 . ARG A 1 27  ? 31.764 20.519  65.343 1.00 113.79 ? 28  ARG A NH2 1 
ATOM   232  N N   . GLN A 1 28  ? 36.752 24.154  59.257 1.00 100.12 ? 29  GLN A N   1 
ATOM   233  C CA  . GLN A 1 28  ? 37.072 23.951  57.858 1.00 98.10  ? 29  GLN A CA  1 
ATOM   234  C C   . GLN A 1 28  ? 38.441 24.507  57.527 1.00 97.10  ? 29  GLN A C   1 
ATOM   235  O O   . GLN A 1 28  ? 39.277 23.789  56.995 1.00 97.69  ? 29  GLN A O   1 
ATOM   236  C CB  . GLN A 1 28  ? 36.029 24.601  56.963 1.00 97.99  ? 29  GLN A CB  1 
ATOM   237  C CG  . GLN A 1 28  ? 34.790 23.769  56.795 1.00 98.22  ? 29  GLN A CG  1 
ATOM   238  C CD  . GLN A 1 28  ? 34.367 23.685  55.358 1.00 99.42  ? 29  GLN A CD  1 
ATOM   239  O OE1 . GLN A 1 28  ? 33.369 23.041  55.031 1.00 99.95  ? 29  GLN A OE1 1 
ATOM   240  N NE2 . GLN A 1 28  ? 35.129 24.336  54.479 1.00 99.79  ? 29  GLN A NE2 1 
ATOM   241  N N   . LEU A 1 29  ? 38.681 25.775  57.827 1.00 95.37  ? 30  LEU A N   1 
ATOM   242  C CA  . LEU A 1 29  ? 39.992 26.342  57.535 1.00 94.48  ? 30  LEU A CA  1 
ATOM   243  C C   . LEU A 1 29  ? 41.070 25.472  58.175 1.00 94.69  ? 30  LEU A C   1 
ATOM   244  O O   . LEU A 1 29  ? 42.194 25.413  57.689 1.00 94.30  ? 30  LEU A O   1 
ATOM   245  C CB  . LEU A 1 29  ? 40.101 27.780  58.054 1.00 93.23  ? 30  LEU A CB  1 
ATOM   246  C CG  . LEU A 1 29  ? 41.462 28.450  57.824 1.00 92.40  ? 30  LEU A CG  1 
ATOM   247  C CD1 . LEU A 1 29  ? 41.835 28.360  56.357 1.00 92.60  ? 30  LEU A CD1 1 
ATOM   248  C CD2 . LEU A 1 29  ? 41.423 29.893  58.268 1.00 91.21  ? 30  LEU A CD2 1 
ATOM   249  N N   . ARG A 1 30  ? 40.722 24.789  59.264 1.00 95.65  ? 31  ARG A N   1 
ATOM   250  C CA  . ARG A 1 30  ? 41.672 23.914  59.948 1.00 95.30  ? 31  ARG A CA  1 
ATOM   251  C C   . ARG A 1 30  ? 41.621 22.533  59.333 1.00 94.80  ? 31  ARG A C   1 
ATOM   252  O O   . ARG A 1 30  ? 42.649 21.982  58.940 1.00 95.65  ? 31  ARG A O   1 
ATOM   253  C CB  . ARG A 1 30  ? 41.338 23.784  61.425 1.00 95.79  ? 31  ARG A CB  1 
ATOM   254  C CG  . ARG A 1 30  ? 41.393 25.070  62.200 1.00 96.48  ? 31  ARG A CG  1 
ATOM   255  C CD  . ARG A 1 30  ? 41.218 24.759  63.669 1.00 96.27  ? 31  ARG A CD  1 
ATOM   256  N NE  . ARG A 1 30  ? 42.478 24.355  64.281 1.00 96.97  ? 31  ARG A NE  1 
ATOM   257  C CZ  . ARG A 1 30  ? 42.565 23.530  65.318 1.00 97.82  ? 31  ARG A CZ  1 
ATOM   258  N NH1 . ARG A 1 30  ? 41.460 23.018  65.844 1.00 97.90  ? 31  ARG A NH1 1 
ATOM   259  N NH2 . ARG A 1 30  ? 43.749 23.237  65.844 1.00 97.92  ? 31  ARG A NH2 1 
ATOM   260  N N   . SER A 1 31  ? 40.419 21.971  59.264 1.00 93.32  ? 32  SER A N   1 
ATOM   261  C CA  . SER A 1 31  ? 40.233 20.654  58.677 1.00 91.70  ? 32  SER A CA  1 
ATOM   262  C C   . SER A 1 31  ? 40.839 20.670  57.279 1.00 90.81  ? 32  SER A C   1 
ATOM   263  O O   . SER A 1 31  ? 41.127 19.630  56.700 1.00 90.80  ? 32  SER A O   1 
ATOM   264  C CB  . SER A 1 31  ? 38.748 20.317  58.597 1.00 91.10  ? 32  SER A CB  1 
ATOM   265  O OG  . SER A 1 31  ? 38.565 19.012  58.080 1.00 90.92  ? 32  SER A OG  1 
ATOM   266  N N   . SER A 1 32  ? 41.036 21.870  56.752 1.00 90.64  ? 33  SER A N   1 
ATOM   267  C CA  . SER A 1 32  ? 41.617 22.065  55.432 1.00 89.95  ? 33  SER A CA  1 
ATOM   268  C C   . SER A 1 32  ? 43.138 22.211  55.565 1.00 89.12  ? 33  SER A C   1 
ATOM   269  O O   . SER A 1 32  ? 43.888 21.506  54.894 1.00 88.64  ? 33  SER A O   1 
ATOM   270  C CB  . SER A 1 32  ? 41.013 23.313  54.783 1.00 90.19  ? 33  SER A CB  1 
ATOM   271  O OG  . SER A 1 32  ? 41.318 23.384  53.404 1.00 91.56  ? 33  SER A OG  1 
ATOM   272  N N   . ILE A 1 33  ? 43.589 23.117  56.430 1.00 89.04  ? 34  ILE A N   1 
ATOM   273  C CA  . ILE A 1 33  ? 45.024 23.313  56.634 1.00 89.08  ? 34  ILE A CA  1 
ATOM   274  C C   . ILE A 1 33  ? 45.664 22.004  57.078 1.00 89.22  ? 34  ILE A C   1 
ATOM   275  O O   . ILE A 1 33  ? 46.871 21.835  56.973 1.00 90.06  ? 34  ILE A O   1 
ATOM   276  C CB  . ILE A 1 33  ? 45.323 24.395  57.699 1.00 89.33  ? 34  ILE A CB  1 
ATOM   277  C CG1 . ILE A 1 33  ? 44.928 25.770  57.163 1.00 90.51  ? 34  ILE A CG1 1 
ATOM   278  C CG2 . ILE A 1 33  ? 46.803 24.403  58.048 1.00 88.27  ? 34  ILE A CG2 1 
ATOM   279  C CD1 . ILE A 1 33  ? 44.966 26.860  58.204 1.00 91.91  ? 34  ILE A CD1 1 
ATOM   280  N N   . GLU A 1 34  ? 44.854 21.071  57.564 1.00 89.10  ? 35  GLU A N   1 
ATOM   281  C CA  . GLU A 1 34  ? 45.385 19.788  58.004 1.00 88.35  ? 35  GLU A CA  1 
ATOM   282  C C   . GLU A 1 34  ? 45.798 18.929  56.818 1.00 88.19  ? 35  GLU A C   1 
ATOM   283  O O   . GLU A 1 34  ? 46.893 18.373  56.813 1.00 89.49  ? 35  GLU A O   1 
ATOM   284  C CB  . GLU A 1 34  ? 44.367 19.028  58.855 1.00 88.71  ? 35  GLU A CB  1 
ATOM   285  C CG  . GLU A 1 34  ? 44.919 17.731  59.413 1.00 88.80  ? 35  GLU A CG  1 
ATOM   286  C CD  . GLU A 1 34  ? 46.280 17.915  60.075 1.00 88.81  ? 35  GLU A CD  1 
ATOM   287  O OE1 . GLU A 1 34  ? 47.249 18.268  59.367 1.00 88.82  ? 35  GLU A OE1 1 
ATOM   288  O OE2 . GLU A 1 34  ? 46.378 17.708  61.305 1.00 88.17  ? 35  GLU A OE2 1 
ATOM   289  N N   . ARG A 1 35  ? 44.919 18.816  55.824 1.00 86.94  ? 36  ARG A N   1 
ATOM   290  C CA  . ARG A 1 35  ? 45.209 18.035  54.628 1.00 84.40  ? 36  ARG A CA  1 
ATOM   291  C C   . ARG A 1 35  ? 46.625 18.364  54.173 1.00 81.57  ? 36  ARG A C   1 
ATOM   292  O O   . ARG A 1 35  ? 47.467 17.473  54.020 1.00 81.02  ? 36  ARG A O   1 
ATOM   293  C CB  . ARG A 1 35  ? 44.243 18.400  53.497 1.00 87.46  ? 36  ARG A CB  1 
ATOM   294  C CG  . ARG A 1 35  ? 42.784 18.340  53.855 1.00 91.47  ? 36  ARG A CG  1 
ATOM   295  C CD  . ARG A 1 35  ? 42.392 16.959  54.333 1.00 96.78  ? 36  ARG A CD  1 
ATOM   296  N NE  . ARG A 1 35  ? 40.956 16.872  54.591 1.00 102.31 ? 36  ARG A NE  1 
ATOM   297  C CZ  . ARG A 1 35  ? 40.331 15.793  55.060 1.00 104.90 ? 36  ARG A CZ  1 
ATOM   298  N NH1 . ARG A 1 35  ? 41.021 14.685  55.332 1.00 105.18 ? 36  ARG A NH1 1 
ATOM   299  N NH2 . ARG A 1 35  ? 39.013 15.819  55.256 1.00 106.16 ? 36  ARG A NH2 1 
ATOM   300  N N   . VAL A 1 36  ? 46.873 19.655  53.964 1.00 77.62  ? 37  VAL A N   1 
ATOM   301  C CA  . VAL A 1 36  ? 48.168 20.136  53.507 1.00 74.86  ? 37  VAL A CA  1 
ATOM   302  C C   . VAL A 1 36  ? 49.305 19.797  54.460 1.00 74.23  ? 37  VAL A C   1 
ATOM   303  O O   . VAL A 1 36  ? 50.379 19.395  54.015 1.00 74.07  ? 37  VAL A O   1 
ATOM   304  C CB  . VAL A 1 36  ? 48.153 21.658  53.288 1.00 73.80  ? 37  VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 36  ? 49.475 22.112  52.703 1.00 72.08  ? 37  VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 36  ? 47.011 22.034  52.373 1.00 72.75  ? 37  VAL A CG2 1 
ATOM   307  N N   . ILE A 1 37  ? 49.079 19.983  55.762 1.00 72.49  ? 38  ILE A N   1 
ATOM   308  C CA  . ILE A 1 37  ? 50.092 19.671  56.768 1.00 71.54  ? 38  ILE A CA  1 
ATOM   309  C C   . ILE A 1 37  ? 50.489 18.216  56.537 1.00 71.16  ? 38  ILE A C   1 
ATOM   310  O O   . ILE A 1 37  ? 51.649 17.900  56.254 1.00 70.32  ? 38  ILE A O   1 
ATOM   311  C CB  . ILE A 1 37  ? 49.531 19.769  58.204 1.00 72.41  ? 38  ILE A CB  1 
ATOM   312  C CG1 . ILE A 1 37  ? 49.012 21.171  58.491 1.00 72.33  ? 38  ILE A CG1 1 
ATOM   313  C CG2 . ILE A 1 37  ? 50.628 19.457  59.213 1.00 73.81  ? 38  ILE A CG2 1 
ATOM   314  C CD1 . ILE A 1 37  ? 50.086 22.193  58.661 1.00 73.83  ? 38  ILE A CD1 1 
ATOM   315  N N   . ASN A 1 38  ? 49.496 17.341  56.670 1.00 70.77  ? 39  ASN A N   1 
ATOM   316  C CA  . ASN A 1 38  ? 49.643 15.901  56.470 1.00 69.90  ? 39  ASN A CA  1 
ATOM   317  C C   . ASN A 1 38  ? 50.425 15.581  55.195 1.00 68.87  ? 39  ASN A C   1 
ATOM   318  O O   . ASN A 1 38  ? 51.500 14.978  55.251 1.00 68.72  ? 39  ASN A O   1 
ATOM   319  C CB  . ASN A 1 38  ? 48.264 15.258  56.387 1.00 69.96  ? 39  ASN A CB  1 
ATOM   320  C CG  . ASN A 1 38  ? 48.335 14.045  55.666 1.00 73.13  ? 39  ASN A CG  1 
ATOM   321  N N   . ILE A 1 39  ? 49.866 15.976  54.051 1.00 67.21  ? 40  ILE A N   1 
ATOM   322  C CA  . ILE A 1 39  ? 50.506 15.768  52.758 1.00 64.45  ? 40  ILE A CA  1 
ATOM   323  C C   . ILE A 1 39  ? 51.973 16.224  52.801 1.00 63.94  ? 40  ILE A C   1 
ATOM   324  O O   . ILE A 1 39  ? 52.873 15.502  52.380 1.00 64.16  ? 40  ILE A O   1 
ATOM   325  C CB  . ILE A 1 39  ? 49.773 16.559  51.643 1.00 62.71  ? 40  ILE A CB  1 
ATOM   326  C CG1 . ILE A 1 39  ? 48.403 15.935  51.382 1.00 60.53  ? 40  ILE A CG1 1 
ATOM   327  C CG2 . ILE A 1 39  ? 50.617 16.603  50.370 1.00 62.01  ? 40  ILE A CG2 1 
ATOM   328  C CD1 . ILE A 1 39  ? 47.682 16.551  50.212 1.00 58.30  ? 40  ILE A CD1 1 
ATOM   329  N N   . PHE A 1 40  ? 52.203 17.422  53.317 1.00 62.55  ? 41  PHE A N   1 
ATOM   330  C CA  . PHE A 1 40  ? 53.550 17.951  53.385 1.00 61.50  ? 41  PHE A CA  1 
ATOM   331  C C   . PHE A 1 40  ? 54.501 17.098  54.195 1.00 61.23  ? 41  PHE A C   1 
ATOM   332  O O   . PHE A 1 40  ? 55.619 16.843  53.763 1.00 61.30  ? 41  PHE A O   1 
ATOM   333  C CB  . PHE A 1 40  ? 53.525 19.384  53.921 1.00 61.39  ? 41  PHE A CB  1 
ATOM   334  C CG  . PHE A 1 40  ? 53.446 20.431  52.835 1.00 60.24  ? 41  PHE A CG  1 
ATOM   335  C CD1 . PHE A 1 40  ? 54.520 21.292  52.597 1.00 59.53  ? 41  PHE A CD1 1 
ATOM   336  C CD2 . PHE A 1 40  ? 52.327 20.526  52.019 1.00 59.76  ? 41  PHE A CD2 1 
ATOM   337  C CE1 . PHE A 1 40  ? 54.476 22.225  51.566 1.00 58.92  ? 41  PHE A CE1 1 
ATOM   338  C CE2 . PHE A 1 40  ? 52.275 21.458  50.982 1.00 59.27  ? 41  PHE A CE2 1 
ATOM   339  C CZ  . PHE A 1 40  ? 53.349 22.305  50.755 1.00 58.98  ? 41  PHE A CZ  1 
ATOM   340  N N   . GLN A 1 41  ? 54.071 16.638  55.363 1.00 62.50  ? 42  GLN A N   1 
ATOM   341  C CA  . GLN A 1 41  ? 54.962 15.813  56.179 1.00 62.03  ? 42  GLN A CA  1 
ATOM   342  C C   . GLN A 1 41  ? 55.053 14.356  55.721 1.00 60.47  ? 42  GLN A C   1 
ATOM   343  O O   . GLN A 1 41  ? 55.994 13.648  56.075 1.00 59.92  ? 42  GLN A O   1 
ATOM   344  C CB  . GLN A 1 41  ? 54.596 15.925  57.678 1.00 62.06  ? 42  GLN A CB  1 
ATOM   345  C CG  . GLN A 1 41  ? 53.125 15.778  58.059 1.00 61.83  ? 42  GLN A CG  1 
ATOM   346  C CD  . GLN A 1 41  ? 52.842 16.325  59.462 1.00 61.51  ? 42  GLN A CD  1 
ATOM   347  O OE1 . GLN A 1 41  ? 51.762 16.106  60.025 1.00 59.60  ? 42  GLN A OE1 1 
ATOM   348  N NE2 . GLN A 1 41  ? 53.815 17.052  60.025 1.00 58.56  ? 42  GLN A NE2 1 
ATOM   349  N N   . SER A 1 42  ? 54.091 13.927  54.909 1.00 59.31  ? 43  SER A N   1 
ATOM   350  C CA  . SER A 1 42  ? 54.066 12.578  54.355 1.00 58.53  ? 43  SER A CA  1 
ATOM   351  C C   . SER A 1 42  ? 55.440 12.198  53.812 1.00 57.87  ? 43  SER A C   1 
ATOM   352  O O   . SER A 1 42  ? 56.182 13.054  53.335 1.00 59.23  ? 43  SER A O   1 
ATOM   353  C CB  . SER A 1 42  ? 53.055 12.512  53.215 1.00 60.15  ? 43  SER A CB  1 
ATOM   354  O OG  . SER A 1 42  ? 53.138 11.281  52.526 1.00 64.87  ? 43  SER A OG  1 
ATOM   355  N N   . ASN A 1 43  ? 55.783 10.916  53.874 1.00 56.34  ? 44  ASN A N   1 
ATOM   356  C CA  . ASN A 1 43  ? 57.081 10.471  53.365 1.00 55.56  ? 44  ASN A CA  1 
ATOM   357  C C   . ASN A 1 43  ? 57.122 10.585  51.848 1.00 53.87  ? 44  ASN A C   1 
ATOM   358  O O   . ASN A 1 43  ? 58.089 11.064  51.282 1.00 52.98  ? 44  ASN A O   1 
ATOM   359  C CB  . ASN A 1 43  ? 57.375 9.029   53.806 1.00 55.37  ? 44  ASN A CB  1 
ATOM   360  C CG  . ASN A 1 43  ? 58.226 8.959   55.075 1.00 55.83  ? 44  ASN A CG  1 
ATOM   361  O OD1 . ASN A 1 43  ? 58.131 8.005   55.850 1.00 56.69  ? 44  ASN A OD1 1 
ATOM   362  N ND2 . ASN A 1 43  ? 59.077 9.965   55.275 1.00 53.98  ? 44  ASN A ND2 1 
ATOM   363  N N   . LEU A 1 44  ? 56.050 10.151  51.201 1.00 54.72  ? 45  LEU A N   1 
ATOM   364  C CA  . LEU A 1 44  ? 55.947 10.221  49.748 1.00 55.29  ? 45  LEU A CA  1 
ATOM   365  C C   . LEU A 1 44  ? 56.216 11.636  49.258 1.00 56.30  ? 45  LEU A C   1 
ATOM   366  O O   . LEU A 1 44  ? 57.085 11.857  48.413 1.00 56.09  ? 45  LEU A O   1 
ATOM   367  C CB  . LEU A 1 44  ? 54.554 9.769   49.292 1.00 55.65  ? 45  LEU A CB  1 
ATOM   368  C CG  . LEU A 1 44  ? 54.235 9.899   47.795 1.00 56.69  ? 45  LEU A CG  1 
ATOM   369  C CD1 . LEU A 1 44  ? 55.357 9.308   46.957 1.00 55.19  ? 45  LEU A CD1 1 
ATOM   370  C CD2 . LEU A 1 44  ? 52.934 9.182   47.487 1.00 58.12  ? 45  LEU A CD2 1 
ATOM   371  N N   . PHE A 1 45  ? 55.466 12.595  49.792 1.00 56.50  ? 46  PHE A N   1 
ATOM   372  C CA  . PHE A 1 45  ? 55.647 13.981  49.406 1.00 56.47  ? 46  PHE A CA  1 
ATOM   373  C C   . PHE A 1 45  ? 57.117 14.394  49.512 1.00 57.19  ? 46  PHE A C   1 
ATOM   374  O O   . PHE A 1 45  ? 57.691 14.921  48.555 1.00 59.23  ? 46  PHE A O   1 
ATOM   375  C CB  . PHE A 1 45  ? 54.806 14.900  50.288 1.00 56.58  ? 46  PHE A CB  1 
ATOM   376  C CG  . PHE A 1 45  ? 54.693 16.297  49.750 1.00 56.54  ? 46  PHE A CG  1 
ATOM   377  C CD1 . PHE A 1 45  ? 53.987 16.542  48.574 1.00 56.29  ? 46  PHE A CD1 1 
ATOM   378  C CD2 . PHE A 1 45  ? 55.343 17.356  50.369 1.00 55.84  ? 46  PHE A CD2 1 
ATOM   379  C CE1 . PHE A 1 45  ? 53.932 17.815  48.029 1.00 54.35  ? 46  PHE A CE1 1 
ATOM   380  C CE2 . PHE A 1 45  ? 55.290 18.629  49.827 1.00 55.14  ? 46  PHE A CE2 1 
ATOM   381  C CZ  . PHE A 1 45  ? 54.590 18.857  48.659 1.00 54.67  ? 46  PHE A CZ  1 
ATOM   382  N N   . GLN A 1 46  ? 57.727 14.155  50.670 1.00 56.54  ? 47  GLN A N   1 
ATOM   383  C CA  . GLN A 1 46  ? 59.120 14.523  50.869 1.00 55.36  ? 47  GLN A CA  1 
ATOM   384  C C   . GLN A 1 46  ? 60.042 13.944  49.781 1.00 52.36  ? 47  GLN A C   1 
ATOM   385  O O   . GLN A 1 46  ? 61.014 14.584  49.370 1.00 51.17  ? 47  GLN A O   1 
ATOM   386  C CB  . GLN A 1 46  ? 59.583 14.062  52.242 1.00 58.02  ? 47  GLN A CB  1 
ATOM   387  C CG  . GLN A 1 46  ? 60.851 14.767  52.717 1.00 64.43  ? 47  GLN A CG  1 
ATOM   388  C CD  . GLN A 1 46  ? 61.541 14.024  53.860 1.00 68.65  ? 47  GLN A CD  1 
ATOM   389  O OE1 . GLN A 1 46  ? 60.900 13.670  54.850 1.00 71.39  ? 47  GLN A OE1 1 
ATOM   390  N NE2 . GLN A 1 46  ? 62.849 13.788  53.727 1.00 69.06  ? 47  GLN A NE2 1 
ATOM   391  N N   . ALA A 1 47  ? 59.733 12.740  49.309 1.00 49.31  ? 48  ALA A N   1 
ATOM   392  C CA  . ALA A 1 47  ? 60.538 12.098  48.273 1.00 45.86  ? 48  ALA A CA  1 
ATOM   393  C C   . ALA A 1 47  ? 60.400 12.782  46.913 1.00 44.65  ? 48  ALA A C   1 
ATOM   394  O O   . ALA A 1 47  ? 61.373 12.851  46.165 1.00 43.68  ? 48  ALA A O   1 
ATOM   395  C CB  . ALA A 1 47  ? 60.167 10.642  48.162 1.00 42.21  ? 48  ALA A CB  1 
ATOM   396  N N   . LEU A 1 48  ? 59.194 13.273  46.604 1.00 43.45  ? 49  LEU A N   1 
ATOM   397  C CA  . LEU A 1 48  ? 58.910 13.977  45.349 1.00 43.20  ? 49  LEU A CA  1 
ATOM   398  C C   . LEU A 1 48  ? 59.701 15.289  45.249 1.00 44.65  ? 49  LEU A C   1 
ATOM   399  O O   . LEU A 1 48  ? 60.298 15.586  44.212 1.00 42.74  ? 49  LEU A O   1 
ATOM   400  C CB  . LEU A 1 48  ? 57.425 14.284  45.253 1.00 41.81  ? 49  LEU A CB  1 
ATOM   401  C CG  . LEU A 1 48  ? 56.527 13.053  45.247 1.00 43.16  ? 49  LEU A CG  1 
ATOM   402  C CD1 . LEU A 1 48  ? 55.070 13.482  45.282 1.00 43.16  ? 49  LEU A CD1 1 
ATOM   403  C CD2 . LEU A 1 48  ? 56.825 12.207  44.029 1.00 39.59  ? 49  LEU A CD2 1 
ATOM   404  N N   . ILE A 1 49  ? 59.703 16.065  46.327 1.00 45.60  ? 50  ILE A N   1 
ATOM   405  C CA  . ILE A 1 49  ? 60.447 17.320  46.372 1.00 47.15  ? 50  ILE A CA  1 
ATOM   406  C C   . ILE A 1 49  ? 61.922 17.069  46.089 1.00 46.79  ? 50  ILE A C   1 
ATOM   407  O O   . ILE A 1 49  ? 62.561 17.847  45.396 1.00 46.28  ? 50  ILE A O   1 
ATOM   408  C CB  . ILE A 1 49  ? 60.306 17.990  47.757 1.00 48.68  ? 50  ILE A CB  1 
ATOM   409  C CG1 . ILE A 1 49  ? 58.840 18.343  48.004 1.00 50.08  ? 50  ILE A CG1 1 
ATOM   410  C CG2 . ILE A 1 49  ? 61.163 19.248  47.836 1.00 45.61  ? 50  ILE A CG2 1 
ATOM   411  C CD1 . ILE A 1 49  ? 58.523 18.578  49.457 1.00 51.87  ? 50  ILE A CD1 1 
ATOM   412  N N   . ASP A 1 50  ? 62.455 15.980  46.638 1.00 49.39  ? 51  ASP A N   1 
ATOM   413  C CA  . ASP A 1 50  ? 63.860 15.618  46.450 1.00 51.38  ? 51  ASP A CA  1 
ATOM   414  C C   . ASP A 1 50  ? 64.172 15.203  45.011 1.00 51.34  ? 51  ASP A C   1 
ATOM   415  O O   . ASP A 1 50  ? 65.168 15.635  44.438 1.00 50.52  ? 51  ASP A O   1 
ATOM   416  C CB  . ASP A 1 50  ? 64.260 14.488  47.417 1.00 53.72  ? 51  ASP A CB  1 
ATOM   417  C CG  . ASP A 1 50  ? 64.295 14.937  48.874 1.00 57.07  ? 51  ASP A CG  1 
ATOM   418  O OD1 . ASP A 1 50  ? 64.821 14.168  49.707 1.00 56.87  ? 51  ASP A OD1 1 
ATOM   419  O OD2 . ASP A 1 50  ? 63.798 16.045  49.189 1.00 58.17  ? 51  ASP A OD2 1 
ATOM   420  N N   . ILE A 1 51  ? 63.325 14.364  44.423 1.00 51.89  ? 52  ILE A N   1 
ATOM   421  C CA  . ILE A 1 51  ? 63.551 13.927  43.050 1.00 53.80  ? 52  ILE A CA  1 
ATOM   422  C C   . ILE A 1 51  ? 63.511 15.168  42.187 1.00 54.70  ? 52  ILE A C   1 
ATOM   423  O O   . ILE A 1 51  ? 64.451 15.474  41.461 1.00 54.94  ? 52  ILE A O   1 
ATOM   424  C CB  . ILE A 1 51  ? 62.448 12.953  42.557 1.00 54.41  ? 52  ILE A CB  1 
ATOM   425  C CG1 . ILE A 1 51  ? 62.295 11.794  43.557 1.00 56.28  ? 52  ILE A CG1 1 
ATOM   426  C CG2 . ILE A 1 51  ? 62.815 12.410  41.164 1.00 51.28  ? 52  ILE A CG2 1 
ATOM   427  C CD1 . ILE A 1 51  ? 61.209 10.753  43.203 1.00 54.81  ? 52  ILE A CD1 1 
ATOM   428  N N   . GLN A 1 52  ? 62.404 15.890  42.302 1.00 55.34  ? 53  GLN A N   1 
ATOM   429  C CA  . GLN A 1 52  ? 62.165 17.115  41.557 1.00 54.47  ? 53  GLN A CA  1 
ATOM   430  C C   . GLN A 1 52  ? 63.305 18.116  41.680 1.00 54.38  ? 53  GLN A C   1 
ATOM   431  O O   . GLN A 1 52  ? 63.757 18.674  40.685 1.00 53.67  ? 53  GLN A O   1 
ATOM   432  C CB  . GLN A 1 52  ? 60.838 17.721  42.031 1.00 53.92  ? 53  GLN A CB  1 
ATOM   433  C CG  . GLN A 1 52  ? 60.444 19.045  41.440 1.00 56.45  ? 53  GLN A CG  1 
ATOM   434  C CD  . GLN A 1 52  ? 60.756 20.211  42.372 1.00 58.30  ? 53  GLN A CD  1 
ATOM   435  O OE1 . GLN A 1 52  ? 60.510 20.126  43.564 1.00 59.44  ? 53  GLN A OE1 1 
ATOM   436  N NE2 . GLN A 1 52  ? 61.284 21.306  41.825 1.00 60.23  ? 53  GLN A NE2 1 
ATOM   437  N N   . GLU A 1 53  ? 63.794 18.330  42.892 1.00 55.80  ? 54  GLU A N   1 
ATOM   438  C CA  . GLU A 1 53  ? 64.864 19.294  43.069 1.00 58.24  ? 54  GLU A CA  1 
ATOM   439  C C   . GLU A 1 53  ? 66.237 18.822  42.600 1.00 59.03  ? 54  GLU A C   1 
ATOM   440  O O   . GLU A 1 53  ? 66.989 19.605  42.012 1.00 60.36  ? 54  GLU A O   1 
ATOM   441  C CB  . GLU A 1 53  ? 64.939 19.742  44.531 1.00 59.01  ? 54  GLU A CB  1 
ATOM   442  C CG  . GLU A 1 53  ? 65.906 20.901  44.756 1.00 60.45  ? 54  GLU A CG  1 
ATOM   443  C CD  . GLU A 1 53  ? 65.593 21.676  46.019 1.00 62.34  ? 54  GLU A CD  1 
ATOM   444  O OE1 . GLU A 1 53  ? 66.342 22.629  46.337 1.00 61.68  ? 54  GLU A OE1 1 
ATOM   445  O OE2 . GLU A 1 53  ? 64.590 21.331  46.687 1.00 62.66  ? 54  GLU A OE2 1 
ATOM   446  N N   . PHE A 1 54  ? 66.572 17.555  42.845 1.00 58.32  ? 55  PHE A N   1 
ATOM   447  C CA  . PHE A 1 54  ? 67.880 17.027  42.440 1.00 57.57  ? 55  PHE A CA  1 
ATOM   448  C C   . PHE A 1 54  ? 67.986 16.664  40.974 1.00 59.06  ? 55  PHE A C   1 
ATOM   449  O O   . PHE A 1 54  ? 69.054 16.769  40.378 1.00 59.18  ? 55  PHE A O   1 
ATOM   450  C CB  . PHE A 1 54  ? 68.262 15.811  43.289 1.00 54.94  ? 55  PHE A CB  1 
ATOM   451  C CG  . PHE A 1 54  ? 68.981 16.158  44.549 1.00 51.64  ? 55  PHE A CG  1 
ATOM   452  C CD1 . PHE A 1 54  ? 70.324 16.518  44.511 1.00 49.08  ? 55  PHE A CD1 1 
ATOM   453  C CD2 . PHE A 1 54  ? 68.298 16.208  45.762 1.00 50.40  ? 55  PHE A CD2 1 
ATOM   454  C CE1 . PHE A 1 54  ? 70.984 16.925  45.661 1.00 48.45  ? 55  PHE A CE1 1 
ATOM   455  C CE2 . PHE A 1 54  ? 68.944 16.612  46.918 1.00 49.51  ? 55  PHE A CE2 1 
ATOM   456  C CZ  . PHE A 1 54  ? 70.294 16.976  46.869 1.00 49.65  ? 55  PHE A CZ  1 
ATOM   457  N N   . TYR A 1 55  ? 66.876 16.227  40.392 1.00 61.07  ? 56  TYR A N   1 
ATOM   458  C CA  . TYR A 1 55  ? 66.848 15.849  39.000 1.00 62.74  ? 56  TYR A CA  1 
ATOM   459  C C   . TYR A 1 55  ? 66.046 16.826  38.160 1.00 64.49  ? 56  TYR A C   1 
ATOM   460  O O   . TYR A 1 55  ? 65.624 16.495  37.058 1.00 65.53  ? 56  TYR A O   1 
ATOM   461  C CB  . TYR A 1 55  ? 66.269 14.455  38.883 1.00 62.38  ? 56  TYR A CB  1 
ATOM   462  C CG  . TYR A 1 55  ? 67.191 13.368  39.397 1.00 62.00  ? 56  TYR A CG  1 
ATOM   463  C CD1 . TYR A 1 55  ? 68.284 12.938  38.640 1.00 62.02  ? 56  TYR A CD1 1 
ATOM   464  C CD2 . TYR A 1 55  ? 66.972 12.776  40.636 1.00 61.93  ? 56  TYR A CD2 1 
ATOM   465  C CE1 . TYR A 1 55  ? 69.128 11.948  39.104 1.00 63.65  ? 56  TYR A CE1 1 
ATOM   466  C CE2 . TYR A 1 55  ? 67.812 11.788  41.119 1.00 63.04  ? 56  TYR A CE2 1 
ATOM   467  C CZ  . TYR A 1 55  ? 68.896 11.373  40.346 1.00 64.52  ? 56  TYR A CZ  1 
ATOM   468  O OH  . TYR A 1 55  ? 69.759 10.386  40.796 1.00 67.13  ? 56  TYR A OH  1 
ATOM   469  N N   . GLU A 1 56  ? 65.858 18.030  38.675 1.00 66.66  ? 57  GLU A N   1 
ATOM   470  C CA  . GLU A 1 56  ? 65.099 19.055  37.960 1.00 68.43  ? 57  GLU A CA  1 
ATOM   471  C C   . GLU A 1 56  ? 63.989 18.475  37.082 1.00 67.95  ? 57  GLU A C   1 
ATOM   472  O O   . GLU A 1 56  ? 64.099 18.416  35.851 1.00 66.48  ? 57  GLU A O   1 
ATOM   473  C CB  . GLU A 1 56  ? 66.040 19.906  37.123 1.00 70.47  ? 57  GLU A CB  1 
ATOM   474  C CG  . GLU A 1 56  ? 66.890 20.855  37.945 1.00 72.76  ? 57  GLU A CG  1 
ATOM   475  C CD  . GLU A 1 56  ? 68.365 20.736  37.627 1.00 75.44  ? 57  GLU A CD  1 
ATOM   476  O OE1 . GLU A 1 56  ? 68.822 19.582  37.438 1.00 77.21  ? 57  GLU A OE1 1 
ATOM   477  O OE2 . GLU A 1 56  ? 69.067 21.780  37.594 1.00 75.68  ? 57  GLU A OE2 1 
ATOM   478  N N   . VAL A 1 57  ? 62.929 18.009  37.733 1.00 67.62  ? 58  VAL A N   1 
ATOM   479  C CA  . VAL A 1 57  ? 61.793 17.437  37.030 1.00 67.26  ? 58  VAL A CA  1 
ATOM   480  C C   . VAL A 1 57  ? 60.756 18.523  36.807 1.00 68.04  ? 58  VAL A C   1 
ATOM   481  O O   . VAL A 1 57  ? 60.445 19.298  37.710 1.00 69.13  ? 58  VAL A O   1 
ATOM   482  C CB  . VAL A 1 57  ? 61.148 16.281  37.830 1.00 65.46  ? 58  VAL A CB  1 
ATOM   483  C CG1 . VAL A 1 57  ? 59.809 15.909  37.226 1.00 63.93  ? 58  VAL A CG1 1 
ATOM   484  C CG2 . VAL A 1 57  ? 62.078 15.089  37.832 1.00 62.93  ? 58  VAL A CG2 1 
ATOM   485  N N   . THR A 1 58  ? 60.233 18.572  35.590 1.00 67.69  ? 59  THR A N   1 
ATOM   486  C CA  . THR A 1 58  ? 59.242 19.562  35.197 1.00 67.15  ? 59  THR A CA  1 
ATOM   487  C C   . THR A 1 58  ? 58.274 18.849  34.274 1.00 67.05  ? 59  THR A C   1 
ATOM   488  O O   . THR A 1 58  ? 58.640 17.868  33.642 1.00 67.72  ? 59  THR A O   1 
ATOM   489  C CB  . THR A 1 58  ? 59.922 20.733  34.431 1.00 67.33  ? 59  THR A CB  1 
ATOM   490  O OG1 . THR A 1 58  ? 60.738 21.488  35.337 1.00 65.45  ? 59  THR A OG1 1 
ATOM   491  C CG2 . THR A 1 58  ? 58.890 21.638  33.785 1.00 68.52  ? 59  THR A CG2 1 
ATOM   492  N N   . LEU A 1 59  ? 57.033 19.315  34.207 1.00 67.31  ? 60  LEU A N   1 
ATOM   493  C CA  . LEU A 1 59  ? 56.061 18.702  33.305 1.00 66.50  ? 60  LEU A CA  1 
ATOM   494  C C   . LEU A 1 59  ? 56.530 18.990  31.876 1.00 65.77  ? 60  LEU A C   1 
ATOM   495  O O   . LEU A 1 59  ? 56.166 18.301  30.924 1.00 64.67  ? 60  LEU A O   1 
ATOM   496  C CB  . LEU A 1 59  ? 54.676 19.309  33.518 1.00 65.99  ? 60  LEU A CB  1 
ATOM   497  C CG  . LEU A 1 59  ? 54.104 19.193  34.921 1.00 65.28  ? 60  LEU A CG  1 
ATOM   498  C CD1 . LEU A 1 59  ? 52.752 19.889  34.972 1.00 65.13  ? 60  LEU A CD1 1 
ATOM   499  C CD2 . LEU A 1 59  ? 53.990 17.724  35.290 1.00 64.25  ? 60  LEU A CD2 1 
ATOM   500  N N   . LEU A 1 60  ? 57.343 20.033  31.754 1.00 65.23  ? 61  LEU A N   1 
ATOM   501  C CA  . LEU A 1 60  ? 57.893 20.462  30.483 1.00 66.22  ? 61  LEU A CA  1 
ATOM   502  C C   . LEU A 1 60  ? 59.106 19.613  30.209 1.00 67.13  ? 61  LEU A C   1 
ATOM   503  O O   . LEU A 1 60  ? 59.289 19.098  29.117 1.00 67.18  ? 61  LEU A O   1 
ATOM   504  C CB  . LEU A 1 60  ? 58.309 21.942  30.562 1.00 66.14  ? 61  LEU A CB  1 
ATOM   505  C CG  . LEU A 1 60  ? 59.074 22.572  29.390 1.00 64.03  ? 61  LEU A CG  1 
ATOM   506  C CD1 . LEU A 1 60  ? 58.277 22.386  28.117 1.00 64.97  ? 61  LEU A CD1 1 
ATOM   507  C CD2 . LEU A 1 60  ? 59.319 24.039  29.648 1.00 62.15  ? 61  LEU A CD2 1 
ATOM   508  N N   . ASP A 1 61  ? 59.930 19.472  31.235 1.00 68.13  ? 62  ASP A N   1 
ATOM   509  C CA  . ASP A 1 61  ? 61.161 18.717  31.146 1.00 68.83  ? 62  ASP A CA  1 
ATOM   510  C C   . ASP A 1 61  ? 60.904 17.215  31.089 1.00 68.09  ? 62  ASP A C   1 
ATOM   511  O O   . ASP A 1 61  ? 61.571 16.478  30.363 1.00 67.80  ? 62  ASP A O   1 
ATOM   512  C CB  . ASP A 1 61  ? 62.032 19.074  32.353 1.00 71.06  ? 62  ASP A CB  1 
ATOM   513  C CG  . ASP A 1 61  ? 62.334 20.559  32.431 1.00 71.38  ? 62  ASP A CG  1 
ATOM   514  O OD1 . ASP A 1 61  ? 62.772 21.039  33.501 1.00 72.42  ? 62  ASP A OD1 1 
ATOM   515  O OD2 . ASP A 1 61  ? 62.140 21.246  31.413 1.00 72.35  ? 62  ASP A OD2 1 
ATOM   516  N N   . ASN A 1 62  ? 59.927 16.775  31.863 1.00 68.26  ? 63  ASN A N   1 
ATOM   517  C CA  . ASN A 1 62  ? 59.578 15.371  31.929 1.00 68.73  ? 63  ASN A CA  1 
ATOM   518  C C   . ASN A 1 62  ? 58.090 15.278  31.647 1.00 68.78  ? 63  ASN A C   1 
ATOM   519  O O   . ASN A 1 62  ? 57.292 15.174  32.566 1.00 69.11  ? 63  ASN A O   1 
ATOM   520  C CB  . ASN A 1 62  ? 59.902 14.835  33.327 1.00 68.25  ? 63  ASN A CB  1 
ATOM   521  C CG  . ASN A 1 62  ? 61.242 15.347  33.851 1.00 68.26  ? 63  ASN A CG  1 
ATOM   522  O OD1 . ASN A 1 62  ? 61.395 16.527  34.154 1.00 67.65  ? 63  ASN A OD1 1 
ATOM   523  N ND2 . ASN A 1 62  ? 62.217 14.458  33.950 1.00 68.14  ? 63  ASN A ND2 1 
ATOM   524  N N   . PRO A 1 63  ? 57.701 15.323  30.363 1.00 69.02  ? 64  PRO A N   1 
ATOM   525  C CA  . PRO A 1 63  ? 56.288 15.253  29.981 1.00 68.37  ? 64  PRO A CA  1 
ATOM   526  C C   . PRO A 1 63  ? 55.553 13.930  30.171 1.00 68.05  ? 64  PRO A C   1 
ATOM   527  O O   . PRO A 1 63  ? 54.331 13.882  30.047 1.00 67.93  ? 64  PRO A O   1 
ATOM   528  C CB  . PRO A 1 63  ? 56.305 15.707  28.520 1.00 68.16  ? 64  PRO A CB  1 
ATOM   529  C CG  . PRO A 1 63  ? 57.628 15.240  28.041 1.00 68.64  ? 64  PRO A CG  1 
ATOM   530  C CD  . PRO A 1 63  ? 58.544 15.604  29.188 1.00 69.16  ? 64  PRO A CD  1 
ATOM   531  N N   . LYS A 1 64  ? 56.272 12.857  30.472 1.00 67.38  ? 65  LYS A N   1 
ATOM   532  C CA  . LYS A 1 64  ? 55.593 11.581  30.666 1.00 67.57  ? 65  LYS A CA  1 
ATOM   533  C C   . LYS A 1 64  ? 54.730 11.568  31.924 1.00 67.15  ? 65  LYS A C   1 
ATOM   534  O O   . LYS A 1 64  ? 53.909 10.675  32.109 1.00 66.28  ? 65  LYS A O   1 
ATOM   535  C CB  . LYS A 1 64  ? 56.599 10.431  30.723 1.00 68.80  ? 65  LYS A CB  1 
ATOM   536  C CG  . LYS A 1 64  ? 57.233 10.066  29.387 1.00 69.87  ? 65  LYS A CG  1 
ATOM   537  C CD  . LYS A 1 64  ? 57.998 8.745   29.494 1.00 72.03  ? 65  LYS A CD  1 
ATOM   538  C CE  . LYS A 1 64  ? 58.790 8.454   28.236 1.00 71.75  ? 65  LYS A CE  1 
ATOM   539  N NZ  . LYS A 1 64  ? 57.893 8.393   27.060 1.00 73.03  ? 65  LYS A NZ  1 
ATOM   540  N N   . LEU A 1 65  ? 54.917 12.567  32.782 1.00 67.14  ? 66  LEU A N   1 
ATOM   541  C CA  . LEU A 1 65  ? 54.157 12.672  34.026 1.00 68.04  ? 66  LEU A CA  1 
ATOM   542  C C   . LEU A 1 65  ? 52.688 12.981  33.779 1.00 68.98  ? 66  LEU A C   1 
ATOM   543  O O   . LEU A 1 65  ? 51.820 12.597  34.552 1.00 69.40  ? 66  LEU A O   1 
ATOM   544  C CB  . LEU A 1 65  ? 54.725 13.780  34.918 1.00 66.78  ? 66  LEU A CB  1 
ATOM   545  C CG  . LEU A 1 65  ? 56.210 13.819  35.266 1.00 66.37  ? 66  LEU A CG  1 
ATOM   546  C CD1 . LEU A 1 65  ? 56.465 14.960  36.246 1.00 64.56  ? 66  LEU A CD1 1 
ATOM   547  C CD2 . LEU A 1 65  ? 56.633 12.502  35.861 1.00 66.82  ? 66  LEU A CD2 1 
ATOM   548  N N   . GLU A 1 66  ? 52.420 13.688  32.688 1.00 71.00  ? 67  GLU A N   1 
ATOM   549  C CA  . GLU A 1 66  ? 51.064 14.094  32.335 1.00 71.10  ? 67  GLU A CA  1 
ATOM   550  C C   . GLU A 1 66  ? 49.996 13.009  32.481 1.00 71.25  ? 67  GLU A C   1 
ATOM   551  O O   . GLU A 1 66  ? 48.829 13.304  32.701 1.00 71.10  ? 67  GLU A O   1 
ATOM   552  C CB  . GLU A 1 66  ? 51.058 14.647  30.908 1.00 70.18  ? 67  GLU A CB  1 
ATOM   553  C CG  . GLU A 1 66  ? 50.278 15.951  30.753 1.00 69.11  ? 67  GLU A CG  1 
ATOM   554  C CD  . GLU A 1 66  ? 50.930 17.137  31.452 1.00 67.30  ? 67  GLU A CD  1 
ATOM   555  O OE1 . GLU A 1 66  ? 52.081 17.494  31.106 1.00 66.07  ? 67  GLU A OE1 1 
ATOM   556  O OE2 . GLU A 1 66  ? 50.278 17.720  32.342 1.00 65.95  ? 67  GLU A OE2 1 
ATOM   557  N N   . VAL A 1 67  ? 50.396 11.756  32.367 1.00 72.01  ? 68  VAL A N   1 
ATOM   558  C CA  . VAL A 1 67  ? 49.449 10.661  32.484 1.00 73.73  ? 68  VAL A CA  1 
ATOM   559  C C   . VAL A 1 67  ? 48.890 10.536  33.906 1.00 73.12  ? 68  VAL A C   1 
ATOM   560  O O   . VAL A 1 67  ? 47.866 9.895   34.123 1.00 71.86  ? 68  VAL A O   1 
ATOM   561  C CB  . VAL A 1 67  ? 50.120 9.319   32.083 1.00 76.31  ? 68  VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 67  ? 51.014 9.518   30.849 1.00 77.67  ? 68  VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 67  ? 50.936 8.766   33.249 1.00 77.86  ? 68  VAL A CG2 1 
ATOM   564  N N   . LEU A 1 68  ? 49.575 11.150  34.866 1.00 73.94  ? 69  LEU A N   1 
ATOM   565  C CA  . LEU A 1 68  ? 49.179 11.104  36.271 1.00 75.06  ? 69  LEU A CA  1 
ATOM   566  C C   . LEU A 1 68  ? 48.063 12.076  36.649 1.00 77.59  ? 69  LEU A C   1 
ATOM   567  O O   . LEU A 1 68  ? 47.528 12.016  37.764 1.00 77.91  ? 69  LEU A O   1 
ATOM   568  C CB  . LEU A 1 68  ? 50.386 11.386  37.156 1.00 72.96  ? 69  LEU A CB  1 
ATOM   569  C CG  . LEU A 1 68  ? 51.523 10.375  37.204 1.00 71.47  ? 69  LEU A CG  1 
ATOM   570  C CD1 . LEU A 1 68  ? 52.670 10.959  37.996 1.00 71.34  ? 69  LEU A CD1 1 
ATOM   571  C CD2 . LEU A 1 68  ? 51.038 9.100   37.844 1.00 71.71  ? 69  LEU A CD2 1 
ATOM   572  N N   . PHE A 1 69  ? 47.718 12.974  35.729 1.00 79.95  ? 70  PHE A N   1 
ATOM   573  C CA  . PHE A 1 69  ? 46.664 13.959  35.967 1.00 81.73  ? 70  PHE A CA  1 
ATOM   574  C C   . PHE A 1 69  ? 45.324 13.456  35.441 1.00 84.46  ? 70  PHE A C   1 
ATOM   575  O O   . PHE A 1 69  ? 44.432 14.233  35.115 1.00 84.87  ? 70  PHE A O   1 
ATOM   576  C CB  . PHE A 1 69  ? 47.032 15.276  35.293 1.00 79.30  ? 70  PHE A CB  1 
ATOM   577  C CG  . PHE A 1 69  ? 48.305 15.869  35.802 1.00 76.81  ? 70  PHE A CG  1 
ATOM   578  C CD1 . PHE A 1 69  ? 48.442 16.186  37.150 1.00 75.95  ? 70  PHE A CD1 1 
ATOM   579  C CD2 . PHE A 1 69  ? 49.381 16.076  34.951 1.00 75.56  ? 70  PHE A CD2 1 
ATOM   580  C CE1 . PHE A 1 69  ? 49.632 16.697  37.637 1.00 75.15  ? 70  PHE A CE1 1 
ATOM   581  C CE2 . PHE A 1 69  ? 50.577 16.587  35.434 1.00 75.07  ? 70  PHE A CE2 1 
ATOM   582  C CZ  . PHE A 1 69  ? 50.702 16.897  36.777 1.00 74.57  ? 70  PHE A CZ  1 
ATOM   583  N N   . GLN A 1 70  ? 45.198 12.141  35.373 1.00 88.46  ? 71  GLN A N   1 
ATOM   584  C CA  . GLN A 1 70  ? 43.992 11.500  34.883 1.00 92.33  ? 71  GLN A CA  1 
ATOM   585  C C   . GLN A 1 70  ? 43.850 10.167  35.617 1.00 93.98  ? 71  GLN A C   1 
ATOM   586  O O   . GLN A 1 70  ? 44.836 9.609   36.099 1.00 94.06  ? 71  GLN A O   1 
ATOM   587  C CB  . GLN A 1 70  ? 44.128 11.268  33.378 1.00 94.27  ? 71  GLN A CB  1 
ATOM   588  C CG  . GLN A 1 70  ? 44.586 12.512  32.618 1.00 97.20  ? 71  GLN A CG  1 
ATOM   589  C CD  . GLN A 1 70  ? 45.192 12.192  31.264 1.00 98.97  ? 71  GLN A CD  1 
ATOM   590  O OE1 . GLN A 1 70  ? 45.677 13.083  30.564 1.00 100.17 ? 71  GLN A OE1 1 
ATOM   591  N NE2 . GLN A 1 70  ? 45.171 10.918  30.890 1.00 99.10  ? 71  GLN A NE2 1 
ATOM   592  N N   . GLY A 1 71  ? 42.625 9.660   35.699 1.00 95.06  ? 72  GLY A N   1 
ATOM   593  C CA  . GLY A 1 71  ? 42.403 8.404   36.386 1.00 95.89  ? 72  GLY A CA  1 
ATOM   594  C C   . GLY A 1 71  ? 42.062 8.646   37.843 1.00 96.10  ? 72  GLY A C   1 
ATOM   595  O O   . GLY A 1 71  ? 41.917 9.800   38.258 1.00 96.44  ? 72  GLY A O   1 
ATOM   596  N N   . PRO A 1 72  ? 41.930 7.576   38.648 1.00 97.64  ? 73  PRO A N   1 
ATOM   597  C CA  . PRO A 1 72  ? 41.601 7.636   40.077 1.00 98.70  ? 73  PRO A CA  1 
ATOM   598  C C   . PRO A 1 72  ? 42.559 8.459   40.935 1.00 99.78  ? 73  PRO A C   1 
ATOM   599  O O   . PRO A 1 72  ? 43.683 8.032   41.216 1.00 98.42  ? 73  PRO A O   1 
ATOM   600  C CB  . PRO A 1 72  ? 41.575 6.162   40.483 1.00 98.22  ? 73  PRO A CB  1 
ATOM   601  C CG  . PRO A 1 72  ? 41.127 5.477   39.235 1.00 98.38  ? 73  PRO A CG  1 
ATOM   602  C CD  . PRO A 1 72  ? 41.959 6.179   38.182 1.00 98.23  ? 73  PRO A CD  1 
ATOM   603  N N   . GLY A 1 73  ? 42.095 9.624   41.373 1.00 100.99 ? 74  GLY A N   1 
ATOM   604  C CA  . GLY A 1 73  ? 42.921 10.489  42.193 1.00 104.09 ? 74  GLY A CA  1 
ATOM   605  C C   . GLY A 1 73  ? 43.529 11.631  41.398 1.00 106.52 ? 74  GLY A C   1 
ATOM   606  O O   . GLY A 1 73  ? 44.687 12.000  41.601 1.00 107.53 ? 74  GLY A O   1 
ATOM   607  N N   . SER A 1 74  ? 42.756 12.198  40.481 1.00 107.13 ? 75  SER A N   1 
ATOM   608  C CA  . SER A 1 74  ? 43.238 13.295  39.651 1.00 107.81 ? 75  SER A CA  1 
ATOM   609  C C   . SER A 1 74  ? 42.639 14.637  40.117 1.00 107.07 ? 75  SER A C   1 
ATOM   610  O O   . SER A 1 74  ? 43.212 15.323  40.987 1.00 107.50 ? 75  SER A O   1 
ATOM   611  C CB  . SER A 1 74  ? 42.880 13.037  38.180 1.00 108.93 ? 75  SER A CB  1 
ATOM   612  O OG  . SER A 1 74  ? 41.465 13.001  37.971 1.00 110.32 ? 75  SER A OG  1 
ATOM   613  N N   . ASP A 1 75  ? 41.485 14.990  39.550 1.00 107.68 ? 76  ASP A N   1 
ATOM   614  C CA  . ASP A 1 75  ? 40.836 16.242  39.876 1.00 106.05 ? 76  ASP A CA  1 
ATOM   615  C C   . ASP A 1 75  ? 40.118 16.127  41.184 1.00 103.51 ? 76  ASP A C   1 
ATOM   616  O O   . ASP A 1 75  ? 39.169 16.885  41.398 1.00 104.17 ? 76  ASP A O   1 
ATOM   617  C CB  . ASP A 1 75  ? 39.838 16.635  38.793 1.00 106.12 ? 76  ASP A CB  1 
ATOM   618  C CG  . ASP A 1 75  ? 39.728 18.141  38.611 1.00 105.62 ? 76  ASP A CG  1 
ATOM   619  O OD1 . ASP A 1 75  ? 40.568 18.878  39.182 1.00 105.55 ? 76  ASP A OD1 1 
ATOM   620  O OD2 . ASP A 1 75  ? 38.821 18.587  37.872 1.00 107.68 ? 76  ASP A OD2 1 
ATOM   621  N N   . THR A 1 76  ? 40.555 15.192  42.036 1.00 102.65 ? 77  THR A N   1 
ATOM   622  C CA  . THR A 1 76  ? 39.966 14.987  43.363 1.00 102.55 ? 77  THR A CA  1 
ATOM   623  C C   . THR A 1 76  ? 39.486 16.324  44.000 1.00 100.82 ? 77  THR A C   1 
ATOM   624  O O   . THR A 1 76  ? 38.903 16.338  45.080 1.00 99.38  ? 77  THR A O   1 
ATOM   625  C CB  . THR A 1 76  ? 40.971 14.311  44.318 1.00 102.50 ? 77  THR A CB  1 
ATOM   626  O OG1 . THR A 1 76  ? 40.341 14.080  45.582 1.00 105.46 ? 77  THR A OG1 1 
ATOM   627  C CG2 . THR A 1 76  ? 42.200 15.211  44.523 1.00 102.85 ? 77  THR A CG2 1 
ATOM   628  N N   . GLY A 1 77  ? 39.792 17.432  43.332 1.00 99.17  ? 78  GLY A N   1 
ATOM   629  C CA  . GLY A 1 77  ? 39.364 18.759  43.745 1.00 96.70  ? 78  GLY A CA  1 
ATOM   630  C C   . GLY A 1 77  ? 40.454 19.435  44.519 1.00 95.38  ? 78  GLY A C   1 
ATOM   631  O O   . GLY A 1 77  ? 40.438 20.645  44.690 1.00 94.49  ? 78  GLY A O   1 
ATOM   632  N N   . LEU A 1 78  ? 41.403 18.640  44.996 1.00 93.21  ? 79  LEU A N   1 
ATOM   633  C CA  . LEU A 1 78  ? 42.515 19.142  45.789 1.00 91.41  ? 79  LEU A CA  1 
ATOM   634  C C   . LEU A 1 78  ? 43.170 20.441  45.314 1.00 89.54  ? 79  LEU A C   1 
ATOM   635  O O   . LEU A 1 78  ? 43.698 21.196  46.128 1.00 89.51  ? 79  LEU A O   1 
ATOM   636  C CB  . LEU A 1 78  ? 43.577 18.052  45.907 1.00 92.53  ? 79  LEU A CB  1 
ATOM   637  C CG  . LEU A 1 78  ? 44.984 18.499  46.305 1.00 93.77  ? 79  LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 78  ? 45.655 17.403  47.115 1.00 93.87  ? 79  LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 78  ? 45.795 18.843  45.044 1.00 93.92  ? 79  LEU A CD2 1 
ATOM   640  N N   . TYR A 1 79  ? 43.158 20.701  44.011 1.00 87.97  ? 80  TYR A N   1 
ATOM   641  C CA  . TYR A 1 79  ? 43.777 21.919  43.506 1.00 86.38  ? 80  TYR A CA  1 
ATOM   642  C C   . TYR A 1 79  ? 43.214 23.172  44.170 1.00 85.42  ? 80  TYR A C   1 
ATOM   643  O O   . TYR A 1 79  ? 43.955 24.063  44.579 1.00 84.77  ? 80  TYR A O   1 
ATOM   644  C CB  . TYR A 1 79  ? 43.582 22.060  42.002 1.00 85.90  ? 80  TYR A CB  1 
ATOM   645  C CG  . TYR A 1 79  ? 43.895 23.467  41.544 1.00 86.77  ? 80  TYR A CG  1 
ATOM   646  C CD1 . TYR A 1 79  ? 45.193 23.972  41.628 1.00 87.16  ? 80  TYR A CD1 1 
ATOM   647  C CD2 . TYR A 1 79  ? 42.883 24.323  41.115 1.00 87.20  ? 80  TYR A CD2 1 
ATOM   648  C CE1 . TYR A 1 79  ? 45.474 25.292  41.302 1.00 87.44  ? 80  TYR A CE1 1 
ATOM   649  C CE2 . TYR A 1 79  ? 43.152 25.649  40.790 1.00 87.45  ? 80  TYR A CE2 1 
ATOM   650  C CZ  . TYR A 1 79  ? 44.451 26.126  40.885 1.00 87.98  ? 80  TYR A CZ  1 
ATOM   651  O OH  . TYR A 1 79  ? 44.727 27.438  40.573 1.00 88.65  ? 80  TYR A OH  1 
ATOM   652  N N   . GLU A 1 80  ? 41.892 23.245  44.253 1.00 84.78  ? 81  GLU A N   1 
ATOM   653  C CA  . GLU A 1 80  ? 41.242 24.397  44.852 1.00 83.82  ? 81  GLU A CA  1 
ATOM   654  C C   . GLU A 1 80  ? 41.790 24.686  46.247 1.00 82.68  ? 81  GLU A C   1 
ATOM   655  O O   . GLU A 1 80  ? 42.232 25.808  46.509 1.00 81.84  ? 81  GLU A O   1 
ATOM   656  C CB  . GLU A 1 80  ? 39.729 24.174  44.888 1.00 86.06  ? 81  GLU A CB  1 
ATOM   657  C CG  . GLU A 1 80  ? 39.045 24.256  43.503 1.00 88.23  ? 81  GLU A CG  1 
ATOM   658  C CD  . GLU A 1 80  ? 39.396 23.100  42.554 1.00 89.50  ? 81  GLU A CD  1 
ATOM   659  O OE1 . GLU A 1 80  ? 39.132 21.928  42.898 1.00 91.27  ? 81  GLU A OE1 1 
ATOM   660  O OE2 . GLU A 1 80  ? 39.925 23.361  41.451 1.00 88.92  ? 81  GLU A OE2 1 
ATOM   661  N N   . LEU A 1 81  ? 41.775 23.677  47.123 1.00 80.73  ? 82  LEU A N   1 
ATOM   662  C CA  . LEU A 1 81  ? 42.294 23.807  48.490 1.00 78.19  ? 82  LEU A CA  1 
ATOM   663  C C   . LEU A 1 81  ? 43.495 24.725  48.580 1.00 75.76  ? 82  LEU A C   1 
ATOM   664  O O   . LEU A 1 81  ? 43.407 25.839  49.080 1.00 74.78  ? 82  LEU A O   1 
ATOM   665  C CB  . LEU A 1 81  ? 42.725 22.453  49.043 1.00 80.75  ? 82  LEU A CB  1 
ATOM   666  C CG  . LEU A 1 81  ? 41.685 21.440  49.504 1.00 83.58  ? 82  LEU A CG  1 
ATOM   667  C CD1 . LEU A 1 81  ? 42.407 20.169  49.960 1.00 84.73  ? 82  LEU A CD1 1 
ATOM   668  C CD2 . LEU A 1 81  ? 40.853 22.032  50.640 1.00 83.67  ? 82  LEU A CD2 1 
ATOM   669  N N   . LEU A 1 82  ? 44.627 24.225  48.100 1.00 74.05  ? 83  LEU A N   1 
ATOM   670  C CA  . LEU A 1 82  ? 45.877 24.974  48.121 1.00 72.48  ? 83  LEU A CA  1 
ATOM   671  C C   . LEU A 1 82  ? 45.752 26.405  47.643 1.00 70.85  ? 83  LEU A C   1 
ATOM   672  O O   . LEU A 1 82  ? 46.276 27.327  48.268 1.00 70.45  ? 83  LEU A O   1 
ATOM   673  C CB  . LEU A 1 82  ? 46.924 24.275  47.260 1.00 72.92  ? 83  LEU A CB  1 
ATOM   674  C CG  . LEU A 1 82  ? 47.499 22.957  47.753 1.00 73.27  ? 83  LEU A CG  1 
ATOM   675  C CD1 . LEU A 1 82  ? 48.604 22.539  46.805 1.00 75.13  ? 83  LEU A CD1 1 
ATOM   676  C CD2 . LEU A 1 82  ? 48.049 23.119  49.158 1.00 73.02  ? 83  LEU A CD2 1 
ATOM   677  N N   . ALA A 1 83  ? 45.062 26.579  46.524 1.00 69.96  ? 84  ALA A N   1 
ATOM   678  C CA  . ALA A 1 83  ? 44.868 27.891  45.934 1.00 68.75  ? 84  ALA A CA  1 
ATOM   679  C C   . ALA A 1 83  ? 43.974 28.798  46.782 1.00 68.43  ? 84  ALA A C   1 
ATOM   680  O O   . ALA A 1 83  ? 44.272 29.976  46.967 1.00 67.56  ? 84  ALA A O   1 
ATOM   681  C CB  . ALA A 1 83  ? 44.294 27.733  44.546 1.00 68.59  ? 84  ALA A CB  1 
ATOM   682  N N   . ALA A 1 84  ? 42.876 28.249  47.290 1.00 67.64  ? 85  ALA A N   1 
ATOM   683  C CA  . ALA A 1 84  ? 41.957 29.019  48.116 1.00 66.84  ? 85  ALA A CA  1 
ATOM   684  C C   . ALA A 1 84  ? 42.460 29.213  49.543 1.00 67.66  ? 85  ALA A C   1 
ATOM   685  O O   . ALA A 1 84  ? 41.695 29.631  50.401 1.00 69.29  ? 85  ALA A O   1 
ATOM   686  C CB  . ALA A 1 84  ? 40.605 28.336  48.149 1.00 64.83  ? 85  ALA A CB  1 
ATOM   687  N N   . LEU A 1 85  ? 43.731 28.913  49.812 1.00 68.05  ? 86  LEU A N   1 
ATOM   688  C CA  . LEU A 1 85  ? 44.257 29.068  51.166 1.00 67.85  ? 86  LEU A CA  1 
ATOM   689  C C   . LEU A 1 85  ? 44.817 30.443  51.499 1.00 67.70  ? 86  LEU A C   1 
ATOM   690  O O   . LEU A 1 85  ? 44.382 31.068  52.461 1.00 68.32  ? 86  LEU A O   1 
ATOM   691  C CB  . LEU A 1 85  ? 45.334 28.014  51.478 1.00 68.28  ? 86  LEU A CB  1 
ATOM   692  C CG  . LEU A 1 85  ? 44.951 26.595  51.929 1.00 68.19  ? 86  LEU A CG  1 
ATOM   693  C CD1 . LEU A 1 85  ? 46.202 25.912  52.453 1.00 67.21  ? 86  LEU A CD1 1 
ATOM   694  C CD2 . LEU A 1 85  ? 43.891 26.618  53.015 1.00 67.87  ? 86  LEU A CD2 1 
ATOM   695  N N   . PRO A 1 86  ? 45.790 30.936  50.716 1.00 67.33  ? 87  PRO A N   1 
ATOM   696  C CA  . PRO A 1 86  ? 46.366 32.252  50.998 1.00 67.75  ? 87  PRO A CA  1 
ATOM   697  C C   . PRO A 1 86  ? 45.271 33.279  51.261 1.00 68.76  ? 87  PRO A C   1 
ATOM   698  O O   . PRO A 1 86  ? 45.489 34.298  51.926 1.00 68.00  ? 87  PRO A O   1 
ATOM   699  C CB  . PRO A 1 86  ? 47.160 32.553  49.729 1.00 67.16  ? 87  PRO A CB  1 
ATOM   700  C CG  . PRO A 1 86  ? 47.591 31.229  49.283 1.00 67.14  ? 87  PRO A CG  1 
ATOM   701  C CD  . PRO A 1 86  ? 46.337 30.403  49.460 1.00 67.50  ? 87  PRO A CD  1 
ATOM   702  N N   . ALA A 1 87  ? 44.088 32.991  50.734 1.00 69.35  ? 88  ALA A N   1 
ATOM   703  C CA  . ALA A 1 87  ? 42.939 33.863  50.892 1.00 69.20  ? 88  ALA A CA  1 
ATOM   704  C C   . ALA A 1 87  ? 42.350 33.725  52.295 1.00 68.30  ? 88  ALA A C   1 
ATOM   705  O O   . ALA A 1 87  ? 42.156 34.715  52.994 1.00 68.35  ? 88  ALA A O   1 
ATOM   706  C CB  . ALA A 1 87  ? 41.886 33.521  49.837 1.00 70.48  ? 88  ALA A CB  1 
ATOM   707  N N   . GLN A 1 88  ? 42.084 32.497  52.710 1.00 67.10  ? 89  GLN A N   1 
ATOM   708  C CA  . GLN A 1 88  ? 41.508 32.254  54.017 1.00 68.04  ? 89  GLN A CA  1 
ATOM   709  C C   . GLN A 1 88  ? 42.438 32.607  55.174 1.00 69.39  ? 89  GLN A C   1 
ATOM   710  O O   . GLN A 1 88  ? 41.989 33.068  56.216 1.00 68.49  ? 89  GLN A O   1 
ATOM   711  C CB  . GLN A 1 88  ? 41.099 30.797  54.107 1.00 67.29  ? 89  GLN A CB  1 
ATOM   712  C CG  . GLN A 1 88  ? 40.439 30.316  52.848 1.00 67.09  ? 89  GLN A CG  1 
ATOM   713  C CD  . GLN A 1 88  ? 39.814 28.960  53.005 1.00 67.57  ? 89  GLN A CD  1 
ATOM   714  O OE1 . GLN A 1 88  ? 40.446 28.018  53.494 1.00 69.13  ? 89  GLN A OE1 1 
ATOM   715  N NE2 . GLN A 1 88  ? 38.563 28.842  52.579 1.00 64.59  ? 89  GLN A NE2 1 
ATOM   716  N N   . LEU A 1 89  ? 43.734 32.387  54.992 1.00 72.03  ? 90  LEU A N   1 
ATOM   717  C CA  . LEU A 1 89  ? 44.706 32.680  56.040 1.00 75.14  ? 90  LEU A CA  1 
ATOM   718  C C   . LEU A 1 89  ? 45.105 34.151  56.087 1.00 77.21  ? 90  LEU A C   1 
ATOM   719  O O   . LEU A 1 89  ? 45.633 34.624  57.098 1.00 78.00  ? 90  LEU A O   1 
ATOM   720  C CB  . LEU A 1 89  ? 45.978 31.837  55.850 1.00 75.52  ? 90  LEU A CB  1 
ATOM   721  C CG  . LEU A 1 89  ? 45.947 30.324  56.052 1.00 75.20  ? 90  LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 89  ? 47.316 29.779  55.741 1.00 74.31  ? 90  LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 89  ? 45.544 29.982  57.476 1.00 74.89  ? 90  LEU A CD2 1 
ATOM   724  N N   . GLN A 1 90  ? 44.858 34.867  54.990 1.00 79.52  ? 91  GLN A N   1 
ATOM   725  C CA  . GLN A 1 90  ? 45.218 36.282  54.874 1.00 79.85  ? 91  GLN A CA  1 
ATOM   726  C C   . GLN A 1 90  ? 44.779 37.150  56.070 1.00 79.21  ? 91  GLN A C   1 
ATOM   727  O O   . GLN A 1 90  ? 45.547 37.991  56.550 1.00 78.84  ? 91  GLN A O   1 
ATOM   728  C CB  . GLN A 1 90  ? 44.666 36.850  53.554 1.00 81.42  ? 91  GLN A CB  1 
ATOM   729  C CG  . GLN A 1 90  ? 45.413 38.082  53.053 1.00 84.26  ? 91  GLN A CG  1 
ATOM   730  C CD  . GLN A 1 90  ? 45.055 38.493  51.628 1.00 85.34  ? 91  GLN A CD  1 
ATOM   731  O OE1 . GLN A 1 90  ? 45.644 39.427  51.078 1.00 85.28  ? 91  GLN A OE1 1 
ATOM   732  N NE2 . GLN A 1 90  ? 44.091 37.798  51.025 1.00 86.94  ? 91  GLN A NE2 1 
ATOM   733  N N   . PRO A 1 91  ? 43.542 36.965  56.562 1.00 78.29  ? 92  PRO A N   1 
ATOM   734  C CA  . PRO A 1 91  ? 43.066 37.754  57.704 1.00 78.46  ? 92  PRO A CA  1 
ATOM   735  C C   . PRO A 1 91  ? 43.950 37.552  58.946 1.00 79.75  ? 92  PRO A C   1 
ATOM   736  O O   . PRO A 1 91  ? 44.405 38.520  59.565 1.00 79.07  ? 92  PRO A O   1 
ATOM   737  C CB  . PRO A 1 91  ? 41.650 37.220  57.916 1.00 77.80  ? 92  PRO A CB  1 
ATOM   738  C CG  . PRO A 1 91  ? 41.230 36.833  56.542 1.00 76.67  ? 92  PRO A CG  1 
ATOM   739  C CD  . PRO A 1 91  ? 42.451 36.147  56.007 1.00 77.29  ? 92  PRO A CD  1 
ATOM   740  N N   . HIS A 1 92  ? 44.189 36.283  59.280 1.00 80.53  ? 93  HIS A N   1 
ATOM   741  C CA  . HIS A 1 92  ? 44.987 35.865  60.434 1.00 80.75  ? 93  HIS A CA  1 
ATOM   742  C C   . HIS A 1 92  ? 46.488 36.106  60.348 1.00 82.28  ? 93  HIS A C   1 
ATOM   743  O O   . HIS A 1 92  ? 47.172 36.134  61.369 1.00 81.62  ? 93  HIS A O   1 
ATOM   744  C CB  . HIS A 1 92  ? 44.743 34.392  60.681 1.00 78.59  ? 93  HIS A CB  1 
ATOM   745  C CG  . HIS A 1 92  ? 43.294 34.029  60.715 1.00 78.40  ? 93  HIS A CG  1 
ATOM   746  N ND1 . HIS A 1 92  ? 42.496 34.240  61.819 1.00 78.18  ? 93  HIS A ND1 1 
ATOM   747  C CD2 . HIS A 1 92  ? 42.491 33.495  59.767 1.00 78.38  ? 93  HIS A CD2 1 
ATOM   748  C CE1 . HIS A 1 92  ? 41.265 33.848  61.549 1.00 78.60  ? 93  HIS A CE1 1 
ATOM   749  N NE2 . HIS A 1 92  ? 41.234 33.392  60.310 1.00 77.97  ? 93  HIS A NE2 1 
ATOM   750  N N   . VAL A 1 93  ? 47.002 36.263  59.134 1.00 85.41  ? 94  VAL A N   1 
ATOM   751  C CA  . VAL A 1 93  ? 48.425 36.508  58.938 1.00 87.91  ? 94  VAL A CA  1 
ATOM   752  C C   . VAL A 1 93  ? 48.722 37.972  59.258 1.00 89.88  ? 94  VAL A C   1 
ATOM   753  O O   . VAL A 1 93  ? 48.138 38.877  58.664 1.00 90.89  ? 94  VAL A O   1 
ATOM   754  C CB  . VAL A 1 93  ? 48.854 36.211  57.478 1.00 87.14  ? 94  VAL A CB  1 
ATOM   755  C CG1 . VAL A 1 93  ? 50.379 36.318  57.340 1.00 86.49  ? 94  VAL A CG1 1 
ATOM   756  C CG2 . VAL A 1 93  ? 48.376 34.831  57.069 1.00 85.64  ? 94  VAL A CG2 1 
ATOM   757  N N   . ASP A 1 94  ? 49.625 38.196  60.205 1.00 91.97  ? 95  ASP A N   1 
ATOM   758  C CA  . ASP A 1 94  ? 49.993 39.551  60.602 1.00 94.28  ? 95  ASP A CA  1 
ATOM   759  C C   . ASP A 1 94  ? 51.414 39.893  60.162 1.00 95.91  ? 95  ASP A C   1 
ATOM   760  O O   . ASP A 1 94  ? 52.109 40.665  60.832 1.00 95.33  ? 95  ASP A O   1 
ATOM   761  C CB  . ASP A 1 94  ? 49.872 39.712  62.125 1.00 94.44  ? 95  ASP A CB  1 
ATOM   762  C CG  . ASP A 1 94  ? 48.426 39.700  62.610 1.00 94.62  ? 95  ASP A CG  1 
ATOM   763  O OD1 . ASP A 1 94  ? 48.211 39.601  63.836 1.00 94.15  ? 95  ASP A OD1 1 
ATOM   764  O OD2 . ASP A 1 94  ? 47.503 39.797  61.775 1.00 95.00  ? 95  ASP A OD2 1 
ATOM   765  N N   . SER A 1 95  ? 51.843 39.318  59.041 1.00 97.99  ? 96  SER A N   1 
ATOM   766  C CA  . SER A 1 95  ? 53.183 39.580  58.534 1.00 100.36 ? 96  SER A CA  1 
ATOM   767  C C   . SER A 1 95  ? 53.251 39.792  57.033 1.00 101.90 ? 96  SER A C   1 
ATOM   768  O O   . SER A 1 95  ? 52.903 38.906  56.252 1.00 101.69 ? 96  SER A O   1 
ATOM   769  C CB  . SER A 1 95  ? 54.133 38.449  58.912 1.00 100.94 ? 96  SER A CB  1 
ATOM   770  O OG  . SER A 1 95  ? 55.462 38.778  58.533 1.00 102.07 ? 96  SER A OG  1 
ATOM   771  N N   . GLN A 1 96  ? 53.722 40.976  56.652 1.00 104.45 ? 97  GLN A N   1 
ATOM   772  C CA  . GLN A 1 96  ? 53.874 41.369  55.255 1.00 107.24 ? 97  GLN A CA  1 
ATOM   773  C C   . GLN A 1 96  ? 54.894 40.473  54.564 1.00 107.96 ? 97  GLN A C   1 
ATOM   774  O O   . GLN A 1 96  ? 55.127 40.576  53.353 1.00 108.02 ? 97  GLN A O   1 
ATOM   775  C CB  . GLN A 1 96  ? 54.329 42.831  55.182 1.00 108.23 ? 97  GLN A CB  1 
ATOM   776  C CG  . GLN A 1 96  ? 55.394 43.189  56.221 1.00 110.25 ? 97  GLN A CG  1 
ATOM   777  C CD  . GLN A 1 96  ? 55.802 44.661  56.185 1.00 111.44 ? 97  GLN A CD  1 
ATOM   778  O OE1 . GLN A 1 96  ? 56.487 45.151  57.091 1.00 111.05 ? 97  GLN A OE1 1 
ATOM   779  N NE2 . GLN A 1 96  ? 55.388 45.368  55.132 1.00 111.66 ? 97  GLN A NE2 1 
ATOM   780  N N   . GLU A 1 97  ? 55.498 39.591  55.350 1.00 108.31 ? 98  GLU A N   1 
ATOM   781  C CA  . GLU A 1 97  ? 56.499 38.674  54.839 1.00 108.24 ? 98  GLU A CA  1 
ATOM   782  C C   . GLU A 1 97  ? 55.899 37.313  54.537 1.00 107.03 ? 98  GLU A C   1 
ATOM   783  O O   . GLU A 1 97  ? 56.089 36.766  53.455 1.00 107.48 ? 98  GLU A O   1 
ATOM   784  C CB  . GLU A 1 97  ? 57.626 38.523  55.856 1.00 110.39 ? 98  GLU A CB  1 
ATOM   785  C CG  . GLU A 1 97  ? 58.681 37.518  55.448 1.00 112.87 ? 98  GLU A CG  1 
ATOM   786  C CD  . GLU A 1 97  ? 59.263 37.823  54.087 1.00 114.05 ? 98  GLU A CD  1 
ATOM   787  O OE1 . GLU A 1 97  ? 59.855 38.912  53.924 1.00 114.85 ? 98  GLU A OE1 1 
ATOM   788  O OE2 . GLU A 1 97  ? 59.124 36.975  53.179 1.00 114.62 ? 98  GLU A OE2 1 
ATOM   789  N N   . ASP A 1 98  ? 55.168 36.768  55.501 1.00 105.26 ? 99  ASP A N   1 
ATOM   790  C CA  . ASP A 1 98  ? 54.552 35.465  55.327 1.00 103.38 ? 99  ASP A CA  1 
ATOM   791  C C   . ASP A 1 98  ? 53.411 35.516  54.321 1.00 102.71 ? 99  ASP A C   1 
ATOM   792  O O   . ASP A 1 98  ? 53.279 34.628  53.478 1.00 103.13 ? 99  ASP A O   1 
ATOM   793  C CB  . ASP A 1 98  ? 54.035 34.941  56.667 1.00 102.10 ? 99  ASP A CB  1 
ATOM   794  C CG  . ASP A 1 98  ? 55.103 34.948  57.744 1.00 100.88 ? 99  ASP A CG  1 
ATOM   795  O OD1 . ASP A 1 98  ? 56.306 34.983  57.399 1.00 98.90  ? 99  ASP A OD1 1 
ATOM   796  O OD2 . ASP A 1 98  ? 54.735 34.911  58.936 1.00 99.79  ? 99  ASP A OD2 1 
ATOM   797  N N   . LEU A 1 99  ? 52.596 36.560  54.406 1.00 101.49 ? 100 LEU A N   1 
ATOM   798  C CA  . LEU A 1 99  ? 51.461 36.704  53.502 1.00 99.79  ? 100 LEU A CA  1 
ATOM   799  C C   . LEU A 1 99  ? 51.902 36.588  52.052 1.00 98.49  ? 100 LEU A C   1 
ATOM   800  O O   . LEU A 1 99  ? 51.331 35.816  51.283 1.00 97.66  ? 100 LEU A O   1 
ATOM   801  C CB  . LEU A 1 99  ? 50.763 38.045  53.733 1.00 99.43  ? 100 LEU A CB  1 
ATOM   802  C CG  . LEU A 1 99  ? 49.294 38.099  53.309 1.00 98.87  ? 100 LEU A CG  1 
ATOM   803  C CD1 . LEU A 1 99  ? 48.512 36.968  53.972 1.00 97.38  ? 100 LEU A CD1 1 
ATOM   804  C CD2 . LEU A 1 99  ? 48.715 39.450  53.687 1.00 98.36  ? 100 LEU A CD2 1 
ATOM   805  N N   . THR A 1 100 ? 52.926 37.350  51.682 1.00 97.70  ? 101 THR A N   1 
ATOM   806  C CA  . THR A 1 100 ? 53.440 37.306  50.316 1.00 97.06  ? 101 THR A CA  1 
ATOM   807  C C   . THR A 1 100 ? 53.978 35.908  50.013 1.00 95.89  ? 101 THR A C   1 
ATOM   808  O O   . THR A 1 100 ? 53.770 35.372  48.924 1.00 95.79  ? 101 THR A O   1 
ATOM   809  C CB  . THR A 1 100 ? 54.578 38.327  50.102 1.00 96.84  ? 101 THR A CB  1 
ATOM   810  O OG1 . THR A 1 100 ? 55.739 37.912  50.828 1.00 96.46  ? 101 THR A OG1 1 
ATOM   811  C CG2 . THR A 1 100 ? 54.153 39.702  50.592 1.00 97.64  ? 101 THR A CG2 1 
ATOM   812  N N   . PHE A 1 101 ? 54.667 35.321  50.992 1.00 94.25  ? 102 PHE A N   1 
ATOM   813  C CA  . PHE A 1 101 ? 55.237 33.985  50.852 1.00 91.90  ? 102 PHE A CA  1 
ATOM   814  C C   . PHE A 1 101 ? 54.144 32.965  50.582 1.00 90.26  ? 102 PHE A C   1 
ATOM   815  O O   . PHE A 1 101 ? 54.264 32.144  49.682 1.00 90.49  ? 102 PHE A O   1 
ATOM   816  C CB  . PHE A 1 101 ? 55.990 33.585  52.126 1.00 92.47  ? 102 PHE A CB  1 
ATOM   817  C CG  . PHE A 1 101 ? 56.528 32.175  52.101 1.00 93.03  ? 102 PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 101 ? 57.582 31.830  51.262 1.00 92.83  ? 102 PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 101 ? 55.951 31.181  52.887 1.00 93.16  ? 102 PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 101 ? 58.065 30.521  51.219 1.00 91.63  ? 102 PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 101 ? 56.428 29.871  52.848 1.00 91.91  ? 102 PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 101 ? 57.479 29.542  52.008 1.00 91.81  ? 102 PHE A CZ  1 
ATOM   823  N N   . LEU A 1 102 ? 53.076 33.016  51.372 1.00 87.76  ? 103 LEU A N   1 
ATOM   824  C CA  . LEU A 1 102 ? 51.976 32.081  51.206 1.00 85.65  ? 103 LEU A CA  1 
ATOM   825  C C   . LEU A 1 102 ? 51.320 32.202  49.842 1.00 84.28  ? 103 LEU A C   1 
ATOM   826  O O   . LEU A 1 102 ? 51.063 31.197  49.197 1.00 84.40  ? 103 LEU A O   1 
ATOM   827  C CB  . LEU A 1 102 ? 50.933 32.281  52.306 1.00 86.22  ? 103 LEU A CB  1 
ATOM   828  C CG  . LEU A 1 102 ? 51.406 32.053  53.743 1.00 85.89  ? 103 LEU A CG  1 
ATOM   829  C CD1 . LEU A 1 102 ? 50.200 32.015  54.672 1.00 85.94  ? 103 LEU A CD1 1 
ATOM   830  C CD2 . LEU A 1 102 ? 52.165 30.747  53.834 1.00 85.49  ? 103 LEU A CD2 1 
ATOM   831  N N   . TRP A 1 103 ? 51.042 33.421  49.396 1.00 82.98  ? 104 TRP A N   1 
ATOM   832  C CA  . TRP A 1 103 ? 50.430 33.575  48.086 1.00 81.63  ? 104 TRP A CA  1 
ATOM   833  C C   . TRP A 1 103 ? 51.403 33.074  47.030 1.00 80.38  ? 104 TRP A C   1 
ATOM   834  O O   . TRP A 1 103 ? 50.999 32.652  45.957 1.00 79.90  ? 104 TRP A O   1 
ATOM   835  C CB  . TRP A 1 103 ? 50.056 35.039  47.810 1.00 82.30  ? 104 TRP A CB  1 
ATOM   836  C CG  . TRP A 1 103 ? 48.665 35.415  48.278 1.00 83.24  ? 104 TRP A CG  1 
ATOM   837  C CD1 . TRP A 1 103 ? 48.335 36.054  49.439 1.00 83.61  ? 104 TRP A CD1 1 
ATOM   838  C CD2 . TRP A 1 103 ? 47.420 35.121  47.617 1.00 83.10  ? 104 TRP A CD2 1 
ATOM   839  N NE1 . TRP A 1 103 ? 46.966 36.168  49.548 1.00 82.96  ? 104 TRP A NE1 1 
ATOM   840  C CE2 . TRP A 1 103 ? 46.382 35.596  48.449 1.00 83.42  ? 104 TRP A CE2 1 
ATOM   841  C CE3 . TRP A 1 103 ? 47.083 34.484  46.417 1.00 82.84  ? 104 TRP A CE3 1 
ATOM   842  C CZ2 . TRP A 1 103 ? 45.033 35.471  48.107 1.00 83.54  ? 104 TRP A CZ2 1 
ATOM   843  C CZ3 . TRP A 1 103 ? 45.742 34.359  46.080 1.00 82.71  ? 104 TRP A CZ3 1 
ATOM   844  C CH2 . TRP A 1 103 ? 44.735 34.843  46.927 1.00 83.40  ? 104 TRP A CH2 1 
ATOM   845  N N   . ASP A 1 104 ? 52.691 33.114  47.343 1.00 80.56  ? 105 ASP A N   1 
ATOM   846  C CA  . ASP A 1 104 ? 53.715 32.649  46.414 1.00 80.60  ? 105 ASP A CA  1 
ATOM   847  C C   . ASP A 1 104 ? 53.666 31.133  46.249 1.00 80.54  ? 105 ASP A C   1 
ATOM   848  O O   . ASP A 1 104 ? 53.533 30.640  45.137 1.00 81.65  ? 105 ASP A O   1 
ATOM   849  C CB  . ASP A 1 104 ? 55.110 33.063  46.895 1.00 81.83  ? 105 ASP A CB  1 
ATOM   850  C CG  . ASP A 1 104 ? 55.549 34.410  46.345 1.00 82.93  ? 105 ASP A CG  1 
ATOM   851  O OD1 . ASP A 1 104 ? 56.549 34.960  46.855 1.00 83.17  ? 105 ASP A OD1 1 
ATOM   852  O OD2 . ASP A 1 104 ? 54.908 34.914  45.400 1.00 83.54  ? 105 ASP A OD2 1 
ATOM   853  N N   . MET A 1 105 ? 53.767 30.397  47.353 1.00 79.62  ? 106 MET A N   1 
ATOM   854  C CA  . MET A 1 105 ? 53.732 28.935  47.311 1.00 77.41  ? 106 MET A CA  1 
ATOM   855  C C   . MET A 1 105 ? 52.407 28.424  46.783 1.00 76.06  ? 106 MET A C   1 
ATOM   856  O O   . MET A 1 105 ? 52.366 27.705  45.793 1.00 76.63  ? 106 MET A O   1 
ATOM   857  C CB  . MET A 1 105 ? 53.957 28.333  48.705 1.00 78.25  ? 106 MET A CB  1 
ATOM   858  C CG  . MET A 1 105 ? 55.331 28.563  49.328 1.00 79.36  ? 106 MET A CG  1 
ATOM   859  S SD  . MET A 1 105 ? 56.705 27.782  48.478 1.00 80.61  ? 106 MET A SD  1 
ATOM   860  C CE  . MET A 1 105 ? 57.419 29.233  47.580 1.00 79.40  ? 106 MET A CE  1 
ATOM   861  N N   . PHE A 1 106 ? 51.328 28.790  47.469 1.00 75.05  ? 107 PHE A N   1 
ATOM   862  C CA  . PHE A 1 106 ? 49.979 28.366  47.106 1.00 75.24  ? 107 PHE A CA  1 
ATOM   863  C C   . PHE A 1 106 ? 49.230 29.436  46.315 1.00 75.56  ? 107 PHE A C   1 
ATOM   864  O O   . PHE A 1 106 ? 49.826 30.403  45.841 1.00 76.54  ? 107 PHE A O   1 
ATOM   865  C CB  . PHE A 1 106 ? 49.202 28.017  48.380 1.00 74.93  ? 107 PHE A CB  1 
ATOM   866  C CG  . PHE A 1 106 ? 49.993 27.186  49.362 1.00 76.21  ? 107 PHE A CG  1 
ATOM   867  C CD1 . PHE A 1 106 ? 50.168 25.820  49.166 1.00 76.50  ? 107 PHE A CD1 1 
ATOM   868  C CD2 . PHE A 1 106 ? 50.608 27.780  50.463 1.00 76.92  ? 107 PHE A CD2 1 
ATOM   869  C CE1 . PHE A 1 106 ? 50.931 25.063  50.051 1.00 75.25  ? 107 PHE A CE1 1 
ATOM   870  C CE2 . PHE A 1 106 ? 51.380 27.028  51.356 1.00 74.66  ? 107 PHE A CE2 1 
ATOM   871  C CZ  . PHE A 1 106 ? 51.542 25.673  51.145 1.00 75.02  ? 107 PHE A CZ  1 
ATOM   872  N N   . SER A 1 110 ? 54.243 24.930  39.784 1.00 58.67  ? 111 SER A N   1 
ATOM   873  C CA  . SER A 1 110 ? 55.153 23.842  40.149 1.00 60.09  ? 111 SER A CA  1 
ATOM   874  C C   . SER A 1 110 ? 54.601 23.003  41.309 1.00 61.15  ? 111 SER A C   1 
ATOM   875  O O   . SER A 1 110 ? 54.332 21.805  41.136 1.00 60.39  ? 111 SER A O   1 
ATOM   876  C CB  . SER A 1 110 ? 56.559 24.382  40.504 1.00 59.85  ? 111 SER A CB  1 
ATOM   877  O OG  . SER A 1 110 ? 56.487 25.613  41.196 1.00 60.40  ? 111 SER A OG  1 
ATOM   878  N N   . LEU A 1 111 ? 54.439 23.626  42.482 1.00 60.37  ? 112 LEU A N   1 
ATOM   879  C CA  . LEU A 1 111 ? 53.920 22.962  43.682 1.00 58.46  ? 112 LEU A CA  1 
ATOM   880  C C   . LEU A 1 111 ? 52.550 22.285  43.498 1.00 58.39  ? 112 LEU A C   1 
ATOM   881  O O   . LEU A 1 111 ? 52.337 21.172  43.968 1.00 58.64  ? 112 LEU A O   1 
ATOM   882  C CB  . LEU A 1 111 ? 53.823 23.965  44.834 1.00 58.21  ? 112 LEU A CB  1 
ATOM   883  C CG  . LEU A 1 111 ? 53.332 23.407  46.176 1.00 58.34  ? 112 LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 111 ? 54.441 22.592  46.802 1.00 59.49  ? 112 LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 111 ? 52.931 24.521  47.109 1.00 54.95  ? 112 LEU A CD2 1 
ATOM   886  N N   . HIS A 1 112 ? 51.616 22.958  42.838 1.00 59.51  ? 113 HIS A N   1 
ATOM   887  C CA  . HIS A 1 112 ? 50.288 22.389  42.611 1.00 60.46  ? 113 HIS A CA  1 
ATOM   888  C C   . HIS A 1 112 ? 50.377 21.052  41.877 1.00 60.66  ? 113 HIS A C   1 
ATOM   889  O O   . HIS A 1 112 ? 49.687 20.090  42.215 1.00 60.42  ? 113 HIS A O   1 
ATOM   890  C CB  . HIS A 1 112 ? 49.437 23.363  41.805 1.00 60.47  ? 113 HIS A CB  1 
ATOM   891  C CG  . HIS A 1 112 ? 49.052 24.586  42.569 1.00 62.95  ? 113 HIS A CG  1 
ATOM   892  N ND1 . HIS A 1 112 ? 48.093 24.569  43.555 1.00 64.43  ? 113 HIS A ND1 1 
ATOM   893  C CD2 . HIS A 1 112 ? 49.541 25.848  42.539 1.00 63.71  ? 113 HIS A CD2 1 
ATOM   894  C CE1 . HIS A 1 112 ? 48.009 25.768  44.107 1.00 65.24  ? 113 HIS A CE1 1 
ATOM   895  N NE2 . HIS A 1 112 ? 48.878 26.562  43.509 1.00 64.95  ? 113 HIS A NE2 1 
ATOM   896  N N   . SER A 1 113 ? 51.242 21.000  40.869 1.00 60.78  ? 114 SER A N   1 
ATOM   897  C CA  . SER A 1 113 ? 51.460 19.788  40.090 1.00 58.89  ? 114 SER A CA  1 
ATOM   898  C C   . SER A 1 113 ? 52.050 18.741  41.026 1.00 57.82  ? 114 SER A C   1 
ATOM   899  O O   . SER A 1 113 ? 51.669 17.578  41.002 1.00 57.57  ? 114 SER A O   1 
ATOM   900  C CB  . SER A 1 113 ? 52.451 20.062  38.967 1.00 59.24  ? 114 SER A CB  1 
ATOM   901  O OG  . SER A 1 113 ? 52.052 21.173  38.200 1.00 61.14  ? 114 SER A OG  1 
ATOM   902  N N   . LEU A 1 114 ? 52.994 19.171  41.851 1.00 56.63  ? 115 LEU A N   1 
ATOM   903  C CA  . LEU A 1 114 ? 53.630 18.278  42.795 1.00 55.89  ? 115 LEU A CA  1 
ATOM   904  C C   . LEU A 1 114 ? 52.566 17.595  43.650 1.00 55.43  ? 115 LEU A C   1 
ATOM   905  O O   . LEU A 1 114 ? 52.475 16.374  43.672 1.00 56.16  ? 115 LEU A O   1 
ATOM   906  C CB  . LEU A 1 114 ? 54.583 19.073  43.680 1.00 57.68  ? 115 LEU A CB  1 
ATOM   907  C CG  . LEU A 1 114 ? 55.788 18.318  44.247 1.00 60.61  ? 115 LEU A CG  1 
ATOM   908  C CD1 . LEU A 1 114 ? 55.315 17.088  45.051 1.00 62.26  ? 115 LEU A CD1 1 
ATOM   909  C CD2 . LEU A 1 114 ? 56.710 17.902  43.105 1.00 59.39  ? 115 LEU A CD2 1 
ATOM   910  N N   . VAL A 1 115 ? 51.754 18.390  44.340 1.00 54.70  ? 116 VAL A N   1 
ATOM   911  C CA  . VAL A 1 115 ? 50.695 17.880  45.212 1.00 53.21  ? 116 VAL A CA  1 
ATOM   912  C C   . VAL A 1 115 ? 49.667 16.990  44.520 1.00 54.29  ? 116 VAL A C   1 
ATOM   913  O O   . VAL A 1 115 ? 49.167 16.049  45.132 1.00 54.63  ? 116 VAL A O   1 
ATOM   914  C CB  . VAL A 1 115 ? 49.957 19.046  45.928 1.00 51.62  ? 116 VAL A CB  1 
ATOM   915  C CG1 . VAL A 1 115 ? 48.785 18.519  46.729 1.00 48.30  ? 116 VAL A CG1 1 
ATOM   916  C CG2 . VAL A 1 115 ? 50.933 19.802  46.848 1.00 49.23  ? 116 VAL A CG2 1 
ATOM   917  N N   . LYS A 1 116 ? 49.345 17.278  43.259 1.00 55.74  ? 117 LYS A N   1 
ATOM   918  C CA  . LYS A 1 116 ? 48.380 16.455  42.530 1.00 55.90  ? 117 LYS A CA  1 
ATOM   919  C C   . LYS A 1 116 ? 49.016 15.097  42.268 1.00 54.18  ? 117 LYS A C   1 
ATOM   920  O O   . LYS A 1 116 ? 48.356 14.062  42.378 1.00 52.37  ? 117 LYS A O   1 
ATOM   921  C CB  . LYS A 1 116 ? 47.991 17.104  41.198 1.00 59.63  ? 117 LYS A CB  1 
ATOM   922  C CG  . LYS A 1 116 ? 47.276 18.423  41.340 1.00 63.99  ? 117 LYS A CG  1 
ATOM   923  C CD  . LYS A 1 116 ? 46.838 18.978  39.997 1.00 68.96  ? 117 LYS A CD  1 
ATOM   924  C CE  . LYS A 1 116 ? 45.356 19.302  40.017 1.00 72.58  ? 117 LYS A CE  1 
ATOM   925  N NZ  . LYS A 1 116 ? 45.030 20.497  39.198 1.00 76.05  ? 117 LYS A NZ  1 
ATOM   926  N N   . ILE A 1 117 ? 50.301 15.112  41.918 1.00 53.19  ? 118 ILE A N   1 
ATOM   927  C CA  . ILE A 1 117 ? 51.034 13.880  41.677 1.00 53.36  ? 118 ILE A CA  1 
ATOM   928  C C   . ILE A 1 117 ? 51.053 13.071  42.966 1.00 54.47  ? 118 ILE A C   1 
ATOM   929  O O   . ILE A 1 117 ? 50.884 11.858  42.931 1.00 54.56  ? 118 ILE A O   1 
ATOM   930  C CB  . ILE A 1 117 ? 52.466 14.158  41.234 1.00 52.53  ? 118 ILE A CB  1 
ATOM   931  C CG1 . ILE A 1 117 ? 52.448 14.725  39.821 1.00 53.02  ? 118 ILE A CG1 1 
ATOM   932  C CG2 . ILE A 1 117 ? 53.285 12.890  41.284 1.00 51.65  ? 118 ILE A CG2 1 
ATOM   933  C CD1 . ILE A 1 117 ? 53.819 14.999  39.255 1.00 51.98  ? 118 ILE A CD1 1 
ATOM   934  N N   . HIS A 1 118 ? 51.245 13.739  44.103 1.00 55.25  ? 119 HIS A N   1 
ATOM   935  C CA  . HIS A 1 118 ? 51.245 13.051  45.390 1.00 57.00  ? 119 HIS A CA  1 
ATOM   936  C C   . HIS A 1 118 ? 49.907 12.355  45.647 1.00 58.21  ? 119 HIS A C   1 
ATOM   937  O O   . HIS A 1 118 ? 49.870 11.220  46.096 1.00 58.69  ? 119 HIS A O   1 
ATOM   938  C CB  . HIS A 1 118 ? 51.510 14.026  46.537 1.00 56.53  ? 119 HIS A CB  1 
ATOM   939  C CG  . HIS A 1 118 ? 51.370 13.402  47.891 1.00 57.64  ? 119 HIS A CG  1 
ATOM   940  N ND1 . HIS A 1 118 ? 52.375 12.670  48.486 1.00 57.86  ? 119 HIS A ND1 1 
ATOM   941  C CD2 . HIS A 1 118 ? 50.312 13.341  48.733 1.00 57.22  ? 119 HIS A CD2 1 
ATOM   942  C CE1 . HIS A 1 118 ? 51.940 12.183  49.635 1.00 57.61  ? 119 HIS A CE1 1 
ATOM   943  N NE2 . HIS A 1 118 ? 50.691 12.574  49.807 1.00 57.19  ? 119 HIS A NE2 1 
ATOM   944  N N   . GLU A 1 119 ? 48.808 13.046  45.373 1.00 60.00  ? 120 GLU A N   1 
ATOM   945  C CA  . GLU A 1 119 ? 47.479 12.484  45.582 1.00 62.25  ? 120 GLU A CA  1 
ATOM   946  C C   . GLU A 1 119 ? 47.217 11.306  44.667 1.00 62.29  ? 120 GLU A C   1 
ATOM   947  O O   . GLU A 1 119 ? 46.432 10.422  44.990 1.00 63.25  ? 120 GLU A O   1 
ATOM   948  C CB  . GLU A 1 119 ? 46.405 13.557  45.355 1.00 64.92  ? 120 GLU A CB  1 
ATOM   949  C CG  . GLU A 1 119 ? 45.639 13.978  46.622 1.00 69.12  ? 120 GLU A CG  1 
ATOM   950  C CD  . GLU A 1 119 ? 46.537 14.107  47.858 1.00 71.42  ? 120 GLU A CD  1 
ATOM   951  O OE1 . GLU A 1 119 ? 47.608 14.754  47.768 1.00 71.77  ? 120 GLU A OE1 1 
ATOM   952  O OE2 . GLU A 1 119 ? 46.163 13.558  48.922 1.00 72.03  ? 120 GLU A OE2 1 
ATOM   953  N N   . LYS A 1 120 ? 47.883 11.290  43.521 1.00 62.77  ? 121 LYS A N   1 
ATOM   954  C CA  . LYS A 1 120 ? 47.696 10.219  42.558 1.00 62.08  ? 121 LYS A CA  1 
ATOM   955  C C   . LYS A 1 120 ? 48.503 9.001   42.956 1.00 61.43  ? 121 LYS A C   1 
ATOM   956  O O   . LYS A 1 120 ? 48.026 7.879   42.876 1.00 61.21  ? 121 LYS A O   1 
ATOM   957  C CB  . LYS A 1 120 ? 48.116 10.684  41.157 1.00 63.96  ? 121 LYS A CB  1 
ATOM   958  C CG  . LYS A 1 120 ? 47.251 10.110  40.032 1.00 66.99  ? 121 LYS A CG  1 
ATOM   959  C CD  . LYS A 1 120 ? 47.252 8.582   40.052 1.00 68.81  ? 121 LYS A CD  1 
ATOM   960  C CE  . LYS A 1 120 ? 46.015 8.007   39.370 1.00 69.10  ? 121 LYS A CE  1 
ATOM   961  N NZ  . LYS A 1 120 ? 45.874 8.455   37.965 1.00 69.97  ? 121 LYS A NZ  1 
ATOM   962  N N   . LEU A 1 121 ? 49.740 9.220   43.374 1.00 62.01  ? 122 LEU A N   1 
ATOM   963  C CA  . LEU A 1 121 ? 50.599 8.117   43.773 1.00 63.11  ? 122 LEU A CA  1 
ATOM   964  C C   . LEU A 1 121 ? 50.074 7.539   45.068 1.00 65.68  ? 122 LEU A C   1 
ATOM   965  O O   . LEU A 1 121 ? 50.008 6.335   45.229 1.00 67.76  ? 122 LEU A O   1 
ATOM   966  C CB  . LEU A 1 121 ? 52.038 8.597   43.960 1.00 60.90  ? 122 LEU A CB  1 
ATOM   967  C CG  . LEU A 1 121 ? 52.651 9.266   42.729 1.00 60.68  ? 122 LEU A CG  1 
ATOM   968  C CD1 . LEU A 1 121 ? 53.946 9.931   43.127 1.00 60.82  ? 122 LEU A CD1 1 
ATOM   969  C CD2 . LEU A 1 121 ? 52.862 8.245   41.608 1.00 59.06  ? 122 LEU A CD2 1 
ATOM   970  N N   . HIS A 1 122 ? 49.687 8.408   45.992 1.00 68.59  ? 123 HIS A N   1 
ATOM   971  C CA  . HIS A 1 122 ? 49.161 7.986   47.282 1.00 70.96  ? 123 HIS A CA  1 
ATOM   972  C C   . HIS A 1 122 ? 47.972 7.062   47.102 1.00 72.06  ? 123 HIS A C   1 
ATOM   973  O O   . HIS A 1 122 ? 47.749 6.160   47.899 1.00 71.39  ? 123 HIS A O   1 
ATOM   974  C CB  . HIS A 1 122 ? 48.728 9.202   48.092 1.00 72.90  ? 123 HIS A CB  1 
ATOM   975  C CG  . HIS A 1 122 ? 48.235 8.864   49.461 1.00 74.42  ? 123 HIS A CG  1 
ATOM   976  N ND1 . HIS A 1 122 ? 49.076 8.449   50.472 1.00 75.27  ? 123 HIS A ND1 1 
ATOM   977  C CD2 . HIS A 1 122 ? 46.988 8.858   49.983 1.00 74.70  ? 123 HIS A CD2 1 
ATOM   978  C CE1 . HIS A 1 122 ? 48.367 8.204   51.556 1.00 75.92  ? 123 HIS A CE1 1 
ATOM   979  N NE2 . HIS A 1 122 ? 47.095 8.444   51.285 1.00 75.89  ? 123 HIS A NE2 1 
ATOM   980  N N   . TYR A 1 123 ? 47.198 7.312   46.055 1.00 75.02  ? 124 TYR A N   1 
ATOM   981  C CA  . TYR A 1 123 ? 46.032 6.502   45.746 1.00 79.17  ? 124 TYR A CA  1 
ATOM   982  C C   . TYR A 1 123 ? 46.458 5.076   45.389 1.00 79.78  ? 124 TYR A C   1 
ATOM   983  O O   . TYR A 1 123 ? 45.840 4.110   45.836 1.00 80.83  ? 124 TYR A O   1 
ATOM   984  C CB  . TYR A 1 123 ? 45.263 7.121   44.583 1.00 83.55  ? 124 TYR A CB  1 
ATOM   985  C CG  . TYR A 1 123 ? 44.381 6.143   43.851 1.00 89.39  ? 124 TYR A CG  1 
ATOM   986  C CD1 . TYR A 1 123 ? 43.125 5.785   44.350 1.00 91.55  ? 124 TYR A CD1 1 
ATOM   987  C CD2 . TYR A 1 123 ? 44.818 5.546   42.667 1.00 92.22  ? 124 TYR A CD2 1 
ATOM   988  C CE1 . TYR A 1 123 ? 42.325 4.854   43.683 1.00 94.30  ? 124 TYR A CE1 1 
ATOM   989  C CE2 . TYR A 1 123 ? 44.036 4.616   41.994 1.00 94.82  ? 124 TYR A CE2 1 
ATOM   990  C CZ  . TYR A 1 123 ? 42.791 4.274   42.503 1.00 95.70  ? 124 TYR A CZ  1 
ATOM   991  O OH  . TYR A 1 123 ? 42.016 3.362   41.820 1.00 97.36  ? 124 TYR A OH  1 
ATOM   992  N N   . TYR A 1 124 ? 47.503 4.948   44.573 1.00 79.95  ? 125 TYR A N   1 
ATOM   993  C CA  . TYR A 1 124 ? 48.024 3.638   44.178 1.00 78.74  ? 125 TYR A CA  1 
ATOM   994  C C   . TYR A 1 124 ? 48.619 2.921   45.377 1.00 78.48  ? 125 TYR A C   1 
ATOM   995  O O   . TYR A 1 124 ? 48.299 1.769   45.651 1.00 77.87  ? 125 TYR A O   1 
ATOM   996  C CB  . TYR A 1 124 ? 49.113 3.791   43.128 1.00 79.01  ? 125 TYR A CB  1 
ATOM   997  C CG  . TYR A 1 124 ? 48.623 4.164   41.757 1.00 79.74  ? 125 TYR A CG  1 
ATOM   998  C CD1 . TYR A 1 124 ? 47.696 3.367   41.092 1.00 80.00  ? 125 TYR A CD1 1 
ATOM   999  C CD2 . TYR A 1 124 ? 49.144 5.272   41.094 1.00 79.43  ? 125 TYR A CD2 1 
ATOM   1000 C CE1 . TYR A 1 124 ? 47.306 3.654   39.792 1.00 80.85  ? 125 TYR A CE1 1 
ATOM   1001 C CE2 . TYR A 1 124 ? 48.765 5.573   39.799 1.00 80.15  ? 125 TYR A CE2 1 
ATOM   1002 C CZ  . TYR A 1 124 ? 47.847 4.758   39.147 1.00 81.41  ? 125 TYR A CZ  1 
ATOM   1003 O OH  . TYR A 1 124 ? 47.484 5.036   37.843 1.00 81.31  ? 125 TYR A OH  1 
ATOM   1004 N N   . GLU A 1 125 ? 49.506 3.622   46.077 1.00 79.05  ? 126 GLU A N   1 
ATOM   1005 C CA  . GLU A 1 125 ? 50.173 3.097   47.260 1.00 79.79  ? 126 GLU A CA  1 
ATOM   1006 C C   . GLU A 1 125 ? 49.232 2.437   48.252 1.00 78.31  ? 126 GLU A C   1 
ATOM   1007 O O   . GLU A 1 125 ? 49.614 1.520   48.961 1.00 78.14  ? 126 GLU A O   1 
ATOM   1008 C CB  . GLU A 1 125 ? 50.935 4.213   47.967 1.00 82.68  ? 126 GLU A CB  1 
ATOM   1009 C CG  . GLU A 1 125 ? 51.291 3.893   49.407 1.00 87.65  ? 126 GLU A CG  1 
ATOM   1010 C CD  . GLU A 1 125 ? 52.128 4.983   50.050 1.00 91.15  ? 126 GLU A CD  1 
ATOM   1011 O OE1 . GLU A 1 125 ? 51.781 6.175   49.857 1.00 92.64  ? 126 GLU A OE1 1 
ATOM   1012 O OE2 . GLU A 1 125 ? 53.122 4.651   50.747 1.00 91.61  ? 126 GLU A OE2 1 
ATOM   1013 N N   . LYS A 1 126 ? 48.002 2.918   48.324 1.00 77.92  ? 127 LYS A N   1 
ATOM   1014 C CA  . LYS A 1 126 ? 47.038 2.331   49.239 1.00 77.56  ? 127 LYS A CA  1 
ATOM   1015 C C   . LYS A 1 126 ? 46.633 0.932   48.752 1.00 76.03  ? 127 LYS A C   1 
ATOM   1016 O O   . LYS A 1 126 ? 46.108 0.124   49.524 1.00 75.65  ? 127 LYS A O   1 
ATOM   1017 C CB  . LYS A 1 126 ? 45.816 3.254   49.376 1.00 79.04  ? 127 LYS A CB  1 
ATOM   1018 C CG  . LYS A 1 126 ? 46.120 4.548   50.152 1.00 81.58  ? 127 LYS A CG  1 
ATOM   1019 C CD  . LYS A 1 126 ? 44.876 5.405   50.463 1.00 83.23  ? 127 LYS A CD  1 
ATOM   1020 C CE  . LYS A 1 126 ? 44.428 6.255   49.273 1.00 84.01  ? 127 LYS A CE  1 
ATOM   1021 N NZ  . LYS A 1 126 ? 43.962 5.448   48.106 1.00 83.00  ? 127 LYS A NZ  1 
ATOM   1022 N N   . GLN A 1 127 ? 46.889 0.657   47.473 1.00 73.76  ? 128 GLN A N   1 
ATOM   1023 C CA  . GLN A 1 127 ? 46.592 -0.642  46.865 1.00 71.81  ? 128 GLN A CA  1 
ATOM   1024 C C   . GLN A 1 127 ? 47.867 -1.482  46.858 1.00 69.17  ? 128 GLN A C   1 
ATOM   1025 O O   . GLN A 1 127 ? 47.937 -2.533  46.224 1.00 68.46  ? 128 GLN A O   1 
ATOM   1026 C CB  . GLN A 1 127 ? 46.128 -0.476  45.422 1.00 74.38  ? 128 GLN A CB  1 
ATOM   1027 C CG  . GLN A 1 127 ? 44.780 0.189   45.225 1.00 76.40  ? 128 GLN A CG  1 
ATOM   1028 C CD  . GLN A 1 127 ? 44.636 0.728   43.814 1.00 78.49  ? 128 GLN A CD  1 
ATOM   1029 O OE1 . GLN A 1 127 ? 44.956 0.039   42.833 1.00 77.11  ? 128 GLN A OE1 1 
ATOM   1030 N NE2 . GLN A 1 127 ? 44.163 1.968   43.701 1.00 78.81  ? 128 GLN A NE2 1 
ATOM   1031 N N   . SER A 1 128 ? 48.882 -0.991  47.551 1.00 66.59  ? 129 SER A N   1 
ATOM   1032 C CA  . SER A 1 128 ? 50.160 -1.675  47.643 1.00 63.60  ? 129 SER A CA  1 
ATOM   1033 C C   . SER A 1 128 ? 50.012 -3.069  48.218 1.00 60.93  ? 129 SER A C   1 
ATOM   1034 O O   . SER A 1 128 ? 49.154 -3.318  49.064 1.00 61.08  ? 129 SER A O   1 
ATOM   1035 C CB  . SER A 1 128 ? 51.119 -0.869  48.529 1.00 65.42  ? 129 SER A CB  1 
ATOM   1036 O OG  . SER A 1 128 ? 52.221 -1.641  48.992 1.00 67.03  ? 129 SER A OG  1 
ATOM   1037 N N   . PRO A 1 129 ? 50.834 -4.008  47.738 1.00 58.20  ? 130 PRO A N   1 
ATOM   1038 C CA  . PRO A 1 129 ? 50.786 -5.384  48.235 1.00 56.68  ? 130 PRO A CA  1 
ATOM   1039 C C   . PRO A 1 129 ? 51.605 -5.404  49.520 1.00 55.31  ? 130 PRO A C   1 
ATOM   1040 O O   . PRO A 1 129 ? 52.393 -4.497  49.767 1.00 56.19  ? 130 PRO A O   1 
ATOM   1041 C CB  . PRO A 1 129 ? 51.463 -6.178  47.131 1.00 56.26  ? 130 PRO A CB  1 
ATOM   1042 C CG  . PRO A 1 129 ? 51.304 -5.298  45.914 1.00 57.89  ? 130 PRO A CG  1 
ATOM   1043 C CD  . PRO A 1 129 ? 51.569 -3.943  46.467 1.00 57.18  ? 130 PRO A CD  1 
ATOM   1044 N N   . VAL A 1 130 ? 51.430 -6.430  50.339 1.00 53.95  ? 131 VAL A N   1 
ATOM   1045 C CA  . VAL A 1 130 ? 52.178 -6.523  51.588 1.00 51.80  ? 131 VAL A CA  1 
ATOM   1046 C C   . VAL A 1 130 ? 53.548 -7.187  51.423 1.00 49.35  ? 131 VAL A C   1 
ATOM   1047 O O   . VAL A 1 130 ? 53.671 -8.249  50.816 1.00 49.52  ? 131 VAL A O   1 
ATOM   1048 C CB  . VAL A 1 130 ? 51.385 -7.317  52.642 1.00 51.79  ? 131 VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 130 ? 52.127 -7.310  53.959 1.00 52.01  ? 131 VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 130 ? 50.002 -6.733  52.797 1.00 48.83  ? 131 VAL A CG2 1 
ATOM   1051 N N   . PRO A 1 131 ? 54.600 -6.563  51.957 1.00 46.57  ? 132 PRO A N   1 
ATOM   1052 C CA  . PRO A 1 131 ? 55.936 -7.145  51.841 1.00 47.36  ? 132 PRO A CA  1 
ATOM   1053 C C   . PRO A 1 131 ? 56.113 -8.447  52.636 1.00 46.75  ? 132 PRO A C   1 
ATOM   1054 O O   . PRO A 1 131 ? 55.568 -8.594  53.729 1.00 45.14  ? 132 PRO A O   1 
ATOM   1055 C CB  . PRO A 1 131 ? 56.837 -6.017  52.341 1.00 47.57  ? 132 PRO A CB  1 
ATOM   1056 C CG  . PRO A 1 131 ? 55.958 -5.255  53.278 1.00 47.27  ? 132 PRO A CG  1 
ATOM   1057 C CD  . PRO A 1 131 ? 54.666 -5.213  52.530 1.00 45.82  ? 132 PRO A CD  1 
ATOM   1058 N N   . ILE A 1 132 ? 56.859 -9.393  52.067 1.00 47.07  ? 133 ILE A N   1 
ATOM   1059 C CA  . ILE A 1 132 ? 57.121 -10.677 52.729 1.00 46.77  ? 133 ILE A CA  1 
ATOM   1060 C C   . ILE A 1 132 ? 57.765 -10.422 54.101 1.00 46.04  ? 133 ILE A C   1 
ATOM   1061 O O   . ILE A 1 132 ? 57.373 -10.996 55.115 1.00 46.31  ? 133 ILE A O   1 
ATOM   1062 C CB  . ILE A 1 132 ? 58.062 -11.589 51.844 1.00 46.01  ? 133 ILE A CB  1 
ATOM   1063 C CG1 . ILE A 1 132 ? 57.269 -12.164 50.683 1.00 45.31  ? 133 ILE A CG1 1 
ATOM   1064 C CG2 . ILE A 1 132 ? 58.664 -12.721 52.648 1.00 44.95  ? 133 ILE A CG2 1 
ATOM   1065 C CD1 . ILE A 1 132 ? 55.909 -12.673 51.081 1.00 44.55  ? 133 ILE A CD1 1 
ATOM   1066 N N   . LEU A 1 133 ? 58.769 -9.557  54.108 1.00 44.20  ? 134 LEU A N   1 
ATOM   1067 C CA  . LEU A 1 133 ? 59.470 -9.193  55.321 1.00 43.66  ? 134 LEU A CA  1 
ATOM   1068 C C   . LEU A 1 133 ? 60.022 -7.780  55.172 1.00 42.98  ? 134 LEU A C   1 
ATOM   1069 O O   . LEU A 1 133 ? 59.873 -7.159  54.124 1.00 41.84  ? 134 LEU A O   1 
ATOM   1070 C CB  . LEU A 1 133 ? 60.583 -10.194 55.613 1.00 43.28  ? 134 LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 133 ? 61.534 -10.599 54.501 1.00 43.29  ? 134 LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 133 ? 62.787 -9.742  54.545 1.00 43.73  ? 134 LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 133 ? 61.883 -12.058 54.687 1.00 43.27  ? 134 LEU A CD2 1 
ATOM   1074 N N   . HIS A 1 134 ? 60.638 -7.278  56.233 1.00 43.36  ? 135 HIS A N   1 
ATOM   1075 C CA  . HIS A 1 134 ? 61.181 -5.929  56.254 1.00 43.17  ? 135 HIS A CA  1 
ATOM   1076 C C   . HIS A 1 134 ? 62.685 -5.846  56.220 1.00 44.75  ? 135 HIS A C   1 
ATOM   1077 O O   . HIS A 1 134 ? 63.232 -4.741  56.296 1.00 45.73  ? 135 HIS A O   1 
ATOM   1078 C CB  . HIS A 1 134 ? 60.698 -5.197  57.493 1.00 43.02  ? 135 HIS A CB  1 
ATOM   1079 C CG  . HIS A 1 134 ? 59.325 -4.641  57.364 1.00 45.90  ? 135 HIS A CG  1 
ATOM   1080 N ND1 . HIS A 1 134 ? 58.357 -5.221  56.567 1.00 47.92  ? 135 HIS A ND1 1 
ATOM   1081 C CD2 . HIS A 1 134 ? 58.740 -3.567  57.939 1.00 46.43  ? 135 HIS A CD2 1 
ATOM   1082 C CE1 . HIS A 1 134 ? 57.239 -4.531  56.660 1.00 47.48  ? 135 HIS A CE1 1 
ATOM   1083 N NE2 . HIS A 1 134 ? 57.444 -3.520  57.488 1.00 48.42  ? 135 HIS A NE2 1 
ATOM   1084 N N   . GLY A 1 135 ? 63.362 -6.985  56.119 1.00 44.20  ? 136 GLY A N   1 
ATOM   1085 C CA  . GLY A 1 135 ? 64.808 -6.937  56.073 1.00 45.16  ? 136 GLY A CA  1 
ATOM   1086 C C   . GLY A 1 135 ? 65.395 -7.838  55.016 1.00 46.03  ? 136 GLY A C   1 
ATOM   1087 O O   . GLY A 1 135 ? 66.045 -8.823  55.341 1.00 50.46  ? 136 GLY A O   1 
ATOM   1088 N N   . ALA A 1 136 ? 65.177 -7.527  53.746 1.00 45.55  ? 137 ALA A N   1 
ATOM   1089 C CA  . ALA A 1 136 ? 65.720 -8.370  52.684 1.00 43.09  ? 137 ALA A CA  1 
ATOM   1090 C C   . ALA A 1 136 ? 67.229 -8.160  52.532 1.00 41.93  ? 137 ALA A C   1 
ATOM   1091 O O   . ALA A 1 136 ? 67.975 -9.114  52.336 1.00 40.73  ? 137 ALA A O   1 
ATOM   1092 C CB  . ALA A 1 136 ? 65.020 -8.080  51.384 1.00 42.26  ? 137 ALA A CB  1 
ATOM   1093 N N   . ALA A 1 137 ? 67.665 -6.910  52.640 1.00 41.30  ? 138 ALA A N   1 
ATOM   1094 C CA  . ALA A 1 137 ? 69.073 -6.575  52.527 1.00 39.20  ? 138 ALA A CA  1 
ATOM   1095 C C   . ALA A 1 137 ? 69.857 -7.338  53.598 1.00 40.47  ? 138 ALA A C   1 
ATOM   1096 O O   . ALA A 1 137 ? 70.914 -7.905  53.301 1.00 41.29  ? 138 ALA A O   1 
ATOM   1097 C CB  . ALA A 1 137 ? 69.255 -5.084  52.690 1.00 40.45  ? 138 ALA A CB  1 
ATOM   1098 N N   . ALA A 1 138 ? 69.350 -7.355  54.837 1.00 39.77  ? 139 ALA A N   1 
ATOM   1099 C CA  . ALA A 1 138 ? 70.002 -8.087  55.929 1.00 36.67  ? 139 ALA A CA  1 
ATOM   1100 C C   . ALA A 1 138 ? 70.015 -9.545  55.528 1.00 37.64  ? 139 ALA A C   1 
ATOM   1101 O O   . ALA A 1 138 ? 71.075 -10.156 55.419 1.00 39.12  ? 139 ALA A O   1 
ATOM   1102 C CB  . ALA A 1 138 ? 69.239 -7.932  57.196 1.00 34.52  ? 139 ALA A CB  1 
ATOM   1103 N N   . LEU A 1 139 ? 68.820 -10.086 55.287 1.00 37.69  ? 140 LEU A N   1 
ATOM   1104 C CA  . LEU A 1 139 ? 68.648 -11.473 54.868 1.00 38.28  ? 140 LEU A CA  1 
ATOM   1105 C C   . LEU A 1 139 ? 69.696 -11.865 53.829 1.00 40.42  ? 140 LEU A C   1 
ATOM   1106 O O   . LEU A 1 139 ? 70.461 -12.812 54.047 1.00 40.88  ? 140 LEU A O   1 
ATOM   1107 C CB  . LEU A 1 139 ? 67.245 -11.676 54.282 1.00 36.09  ? 140 LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 139 ? 66.909 -13.001 53.569 1.00 35.03  ? 140 LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 139 ? 67.092 -14.179 54.524 1.00 32.11  ? 140 LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 139 ? 65.475 -12.945 53.037 1.00 31.44  ? 140 LEU A CD2 1 
ATOM   1111 N N   . ALA A 1 140 ? 69.725 -11.137 52.710 1.00 41.53  ? 141 ALA A N   1 
ATOM   1112 C CA  . ALA A 1 140 ? 70.678 -11.397 51.636 1.00 41.89  ? 141 ALA A CA  1 
ATOM   1113 C C   . ALA A 1 140 ? 72.100 -11.507 52.181 1.00 43.89  ? 141 ALA A C   1 
ATOM   1114 O O   . ALA A 1 140 ? 72.910 -12.267 51.648 1.00 44.74  ? 141 ALA A O   1 
ATOM   1115 C CB  . ALA A 1 140 ? 70.606 -10.308 50.619 1.00 40.37  ? 141 ALA A CB  1 
ATOM   1116 N N   . ASP A 1 141 ? 72.389 -10.755 53.245 1.00 43.81  ? 142 ASP A N   1 
ATOM   1117 C CA  . ASP A 1 141 ? 73.701 -10.766 53.864 1.00 44.70  ? 142 ASP A CA  1 
ATOM   1118 C C   . ASP A 1 141 ? 73.952 -11.971 54.769 1.00 45.13  ? 142 ASP A C   1 
ATOM   1119 O O   . ASP A 1 141 ? 75.067 -12.492 54.831 1.00 43.21  ? 142 ASP A O   1 
ATOM   1120 C CB  . ASP A 1 141 ? 73.887 -9.469  54.638 1.00 47.54  ? 142 ASP A CB  1 
ATOM   1121 C CG  . ASP A 1 141 ? 74.550 -8.394  53.801 1.00 51.56  ? 142 ASP A CG  1 
ATOM   1122 O OD1 . ASP A 1 141 ? 75.769 -8.517  53.518 1.00 55.45  ? 142 ASP A OD1 1 
ATOM   1123 O OD2 . ASP A 1 141 ? 73.857 -7.435  53.412 1.00 51.45  ? 142 ASP A OD2 1 
ATOM   1124 N N   . ASP A 1 142 ? 72.916 -12.405 55.482 1.00 47.13  ? 143 ASP A N   1 
ATOM   1125 C CA  . ASP A 1 142 ? 73.037 -13.561 56.366 1.00 48.72  ? 143 ASP A CA  1 
ATOM   1126 C C   . ASP A 1 142 ? 73.228 -14.798 55.509 1.00 49.93  ? 143 ASP A C   1 
ATOM   1127 O O   . ASP A 1 142 ? 73.992 -15.701 55.860 1.00 52.54  ? 143 ASP A O   1 
ATOM   1128 C CB  . ASP A 1 142 ? 71.782 -13.744 57.220 1.00 47.41  ? 143 ASP A CB  1 
ATOM   1129 C CG  . ASP A 1 142 ? 71.622 -12.660 58.245 1.00 48.07  ? 143 ASP A CG  1 
ATOM   1130 O OD1 . ASP A 1 142 ? 72.658 -12.088 58.653 1.00 46.15  ? 143 ASP A OD1 1 
ATOM   1131 O OD2 . ASP A 1 142 ? 70.467 -12.391 58.647 1.00 49.96  ? 143 ASP A OD2 1 
ATOM   1132 N N   . LEU A 1 143 ? 72.520 -14.828 54.383 1.00 49.39  ? 144 LEU A N   1 
ATOM   1133 C CA  . LEU A 1 143 ? 72.595 -15.938 53.445 1.00 48.06  ? 144 LEU A CA  1 
ATOM   1134 C C   . LEU A 1 143 ? 73.950 -15.979 52.755 1.00 47.60  ? 144 LEU A C   1 
ATOM   1135 O O   . LEU A 1 143 ? 74.544 -17.036 52.637 1.00 47.68  ? 144 LEU A O   1 
ATOM   1136 C CB  . LEU A 1 143 ? 71.490 -15.805 52.408 1.00 47.99  ? 144 LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 143 ? 71.557 -16.709 51.187 1.00 47.47  ? 144 LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 143 ? 71.502 -18.146 51.606 1.00 47.34  ? 144 LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 143 ? 70.393 -16.383 50.275 1.00 48.79  ? 144 LEU A CD2 1 
ATOM   1140 N N   . ALA A 1 144 ? 74.445 -14.832 52.310 1.00 47.51  ? 145 ALA A N   1 
ATOM   1141 C CA  . ALA A 1 144 ? 75.734 -14.783 51.634 1.00 47.53  ? 145 ALA A CA  1 
ATOM   1142 C C   . ALA A 1 144 ? 76.909 -15.043 52.565 1.00 48.60  ? 145 ALA A C   1 
ATOM   1143 O O   . ALA A 1 144 ? 78.007 -15.322 52.105 1.00 47.04  ? 145 ALA A O   1 
ATOM   1144 C CB  . ALA A 1 144 ? 75.903 -13.450 50.933 1.00 47.55  ? 145 ALA A CB  1 
ATOM   1145 N N   . GLU A 1 145 ? 76.685 -14.931 53.872 1.00 52.06  ? 146 GLU A N   1 
ATOM   1146 C CA  . GLU A 1 145 ? 77.734 -15.192 54.847 1.00 55.67  ? 146 GLU A CA  1 
ATOM   1147 C C   . GLU A 1 145 ? 77.822 -16.689 54.927 1.00 56.84  ? 146 GLU A C   1 
ATOM   1148 O O   . GLU A 1 145 ? 78.902 -17.267 54.857 1.00 57.32  ? 146 GLU A O   1 
ATOM   1149 C CB  . GLU A 1 145 ? 77.370 -14.646 56.227 1.00 59.43  ? 146 GLU A CB  1 
ATOM   1150 C CG  . GLU A 1 145 ? 78.200 -15.254 57.379 1.00 64.51  ? 146 GLU A CG  1 
ATOM   1151 C CD  . GLU A 1 145 ? 79.704 -15.018 57.221 1.00 69.28  ? 146 GLU A CD  1 
ATOM   1152 O OE1 . GLU A 1 145 ? 80.132 -13.847 57.241 1.00 71.44  ? 146 GLU A OE1 1 
ATOM   1153 O OE2 . GLU A 1 145 ? 80.467 -15.997 57.073 1.00 71.76  ? 146 GLU A OE2 1 
ATOM   1154 N N   . GLU A 1 146 ? 76.657 -17.309 55.076 1.00 57.63  ? 147 GLU A N   1 
ATOM   1155 C CA  . GLU A 1 146 ? 76.562 -18.758 55.144 1.00 59.83  ? 147 GLU A CA  1 
ATOM   1156 C C   . GLU A 1 146 ? 77.199 -19.447 53.951 1.00 59.16  ? 147 GLU A C   1 
ATOM   1157 O O   . GLU A 1 146 ? 78.099 -20.260 54.109 1.00 58.99  ? 147 GLU A O   1 
ATOM   1158 C CB  . GLU A 1 146 ? 75.103 -19.193 55.220 1.00 62.87  ? 147 GLU A CB  1 
ATOM   1159 C CG  . GLU A 1 146 ? 74.420 -18.891 56.532 1.00 67.92  ? 147 GLU A CG  1 
ATOM   1160 C CD  . GLU A 1 146 ? 73.068 -19.544 56.605 1.00 71.23  ? 147 GLU A CD  1 
ATOM   1161 O OE1 . GLU A 1 146 ? 72.484 -19.555 57.702 1.00 74.18  ? 147 GLU A OE1 1 
ATOM   1162 O OE2 . GLU A 1 146 ? 72.589 -20.047 55.564 1.00 72.06  ? 147 GLU A OE2 1 
ATOM   1163 N N   . LEU A 1 147 ? 76.723 -19.121 52.757 1.00 60.30  ? 148 LEU A N   1 
ATOM   1164 C CA  . LEU A 1 147 ? 77.219 -19.729 51.532 1.00 61.70  ? 148 LEU A CA  1 
ATOM   1165 C C   . LEU A 1 147 ? 78.728 -19.739 51.346 1.00 63.73  ? 148 LEU A C   1 
ATOM   1166 O O   . LEU A 1 147 ? 79.276 -20.745 50.889 1.00 62.81  ? 148 LEU A O   1 
ATOM   1167 C CB  . LEU A 1 147 ? 76.564 -19.076 50.314 1.00 59.83  ? 148 LEU A CB  1 
ATOM   1168 C CG  . LEU A 1 147 ? 75.047 -19.195 50.181 1.00 59.33  ? 148 LEU A CG  1 
ATOM   1169 C CD1 . LEU A 1 147 ? 74.630 -18.609 48.851 1.00 60.85  ? 148 LEU A CD1 1 
ATOM   1170 C CD2 . LEU A 1 147 ? 74.621 -20.642 50.266 1.00 58.95  ? 148 LEU A CD2 1 
ATOM   1171 N N   . GLN A 1 148 ? 79.399 -18.637 51.683 1.00 66.51  ? 149 GLN A N   1 
ATOM   1172 C CA  . GLN A 1 148 ? 80.847 -18.567 51.513 1.00 69.99  ? 149 GLN A CA  1 
ATOM   1173 C C   . GLN A 1 148 ? 81.584 -19.462 52.497 1.00 71.44  ? 149 GLN A C   1 
ATOM   1174 O O   . GLN A 1 148 ? 82.759 -19.797 52.300 1.00 71.12  ? 149 GLN A O   1 
ATOM   1175 C CB  . GLN A 1 148 ? 81.344 -17.126 51.638 1.00 71.76  ? 149 GLN A CB  1 
ATOM   1176 C CG  . GLN A 1 148 ? 80.905 -16.385 52.882 1.00 73.58  ? 149 GLN A CG  1 
ATOM   1177 C CD  . GLN A 1 148 ? 81.633 -15.051 53.038 1.00 75.73  ? 149 GLN A CD  1 
ATOM   1178 O OE1 . GLN A 1 148 ? 82.784 -15.002 53.487 1.00 75.44  ? 149 GLN A OE1 1 
ATOM   1179 N NE2 . GLN A 1 148 ? 80.969 -13.962 52.645 1.00 76.70  ? 149 GLN A NE2 1 
ATOM   1180 N N   . ASN A 1 149 ? 80.878 -19.851 53.554 1.00 73.02  ? 150 ASN A N   1 
ATOM   1181 C CA  . ASN A 1 149 ? 81.430 -20.733 54.575 1.00 74.63  ? 150 ASN A CA  1 
ATOM   1182 C C   . ASN A 1 149 ? 81.103 -22.168 54.204 1.00 75.11  ? 150 ASN A C   1 
ATOM   1183 O O   . ASN A 1 149 ? 80.844 -23.005 55.071 1.00 75.31  ? 150 ASN A O   1 
ATOM   1184 C CB  . ASN A 1 149 ? 80.818 -20.414 55.938 1.00 75.88  ? 150 ASN A CB  1 
ATOM   1185 C CG  . ASN A 1 149 ? 81.453 -19.206 56.596 1.00 77.39  ? 150 ASN A CG  1 
ATOM   1186 O OD1 . ASN A 1 149 ? 81.485 -18.117 56.030 1.00 77.95  ? 150 ASN A OD1 1 
ATOM   1187 N ND2 . ASN A 1 149 ? 81.963 -19.397 57.803 1.00 79.49  ? 150 ASN A ND2 1 
ATOM   1188 N N   . LYS A 1 150 ? 81.087 -22.442 52.906 1.00 75.93  ? 151 LYS A N   1 
ATOM   1189 C CA  . LYS A 1 150 ? 80.794 -23.777 52.404 1.00 77.48  ? 151 LYS A CA  1 
ATOM   1190 C C   . LYS A 1 150 ? 81.628 -24.016 51.156 1.00 78.08  ? 151 LYS A C   1 
ATOM   1191 O O   . LYS A 1 150 ? 82.168 -23.074 50.565 1.00 78.89  ? 151 LYS A O   1 
ATOM   1192 C CB  . LYS A 1 150 ? 79.310 -23.925 52.040 1.00 78.31  ? 151 LYS A CB  1 
ATOM   1193 C CG  . LYS A 1 150 ? 78.356 -23.195 52.960 1.00 80.76  ? 151 LYS A CG  1 
ATOM   1194 C CD  . LYS A 1 150 ? 76.957 -23.765 52.877 1.00 80.88  ? 151 LYS A CD  1 
ATOM   1195 C CE  . LYS A 1 150 ? 76.930 -25.139 53.507 1.00 83.95  ? 151 LYS A CE  1 
ATOM   1196 N NZ  . LYS A 1 150 ? 77.474 -25.117 54.907 1.00 85.48  ? 151 LYS A NZ  1 
ATOM   1197 N N   . PRO A 1 151 ? 81.749 -25.286 50.741 1.00 77.57  ? 152 PRO A N   1 
ATOM   1198 C CA  . PRO A 1 151 ? 82.521 -25.646 49.551 1.00 76.27  ? 152 PRO A CA  1 
ATOM   1199 C C   . PRO A 1 151 ? 81.937 -24.908 48.357 1.00 74.60  ? 152 PRO A C   1 
ATOM   1200 O O   . PRO A 1 151 ? 80.727 -24.929 48.144 1.00 74.14  ? 152 PRO A O   1 
ATOM   1201 C CB  . PRO A 1 151 ? 82.317 -27.154 49.456 1.00 77.05  ? 152 PRO A CB  1 
ATOM   1202 C CG  . PRO A 1 151 ? 82.142 -27.558 50.892 1.00 77.74  ? 152 PRO A CG  1 
ATOM   1203 C CD  . PRO A 1 151 ? 81.218 -26.489 51.404 1.00 78.14  ? 152 PRO A CD  1 
ATOM   1204 N N   . LEU A 1 152 ? 82.791 -24.259 47.580 1.00 73.57  ? 153 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 152 ? 82.319 -23.511 46.427 1.00 73.78  ? 153 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 152 ? 81.690 -24.291 45.272 1.00 73.16  ? 153 LEU A C   1 
ATOM   1207 O O   . LEU A 1 152 ? 82.357 -24.979 44.499 1.00 73.31  ? 153 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 152 ? 83.428 -22.623 45.874 1.00 74.68  ? 153 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 152 ? 83.285 -21.148 46.247 1.00 74.80  ? 153 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 152 ? 84.100 -20.309 45.266 1.00 73.55  ? 153 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 152 ? 81.808 -20.744 46.210 1.00 74.10  ? 153 LEU A CD2 1 
ATOM   1212 N N   . ASN A 1 153 ? 80.381 -24.136 45.168 1.00 73.43  ? 154 ASN A N   1 
ATOM   1213 C CA  . ASN A 1 153 ? 79.571 -24.750 44.141 1.00 72.17  ? 154 ASN A CA  1 
ATOM   1214 C C   . ASN A 1 153 ? 79.545 -23.683 43.039 1.00 71.37  ? 154 ASN A C   1 
ATOM   1215 O O   . ASN A 1 153 ? 79.846 -22.522 43.303 1.00 71.23  ? 154 ASN A O   1 
ATOM   1216 C CB  . ASN A 1 153 ? 78.179 -24.961 44.728 1.00 73.94  ? 154 ASN A CB  1 
ATOM   1217 C CG  . ASN A 1 153 ? 77.310 -25.835 43.881 1.00 76.68  ? 154 ASN A CG  1 
ATOM   1218 O OD1 . ASN A 1 153 ? 77.199 -25.635 42.673 1.00 80.06  ? 154 ASN A OD1 1 
ATOM   1219 N ND2 . ASN A 1 153 ? 76.667 -26.816 44.508 1.00 77.46  ? 154 ASN A ND2 1 
ATOM   1220 N N   . SER A 1 154 ? 79.197 -24.050 41.817 1.00 70.71  ? 155 SER A N   1 
ATOM   1221 C CA  . SER A 1 154 ? 79.151 -23.070 40.741 1.00 70.12  ? 155 SER A CA  1 
ATOM   1222 C C   . SER A 1 154 ? 77.911 -22.201 40.856 1.00 70.10  ? 155 SER A C   1 
ATOM   1223 O O   . SER A 1 154 ? 77.810 -21.163 40.205 1.00 70.05  ? 155 SER A O   1 
ATOM   1224 C CB  . SER A 1 154 ? 79.161 -23.771 39.398 1.00 71.47  ? 155 SER A CB  1 
ATOM   1225 O OG  . SER A 1 154 ? 80.255 -24.669 39.338 1.00 75.50  ? 155 SER A OG  1 
ATOM   1226 N N   . GLU A 1 155 ? 76.960 -22.643 41.673 1.00 70.30  ? 156 GLU A N   1 
ATOM   1227 C CA  . GLU A 1 155 ? 75.741 -21.882 41.900 1.00 69.24  ? 156 GLU A CA  1 
ATOM   1228 C C   . GLU A 1 155 ? 76.036 -20.938 43.053 1.00 67.63  ? 156 GLU A C   1 
ATOM   1229 O O   . GLU A 1 155 ? 75.546 -19.813 43.096 1.00 68.41  ? 156 GLU A O   1 
ATOM   1230 C CB  . GLU A 1 155 ? 74.574 -22.797 42.278 1.00 71.98  ? 156 GLU A CB  1 
ATOM   1231 C CG  . GLU A 1 155 ? 73.824 -23.387 41.095 1.00 75.60  ? 156 GLU A CG  1 
ATOM   1232 C CD  . GLU A 1 155 ? 74.589 -24.482 40.395 1.00 77.86  ? 156 GLU A CD  1 
ATOM   1233 O OE1 . GLU A 1 155 ? 74.669 -25.600 40.958 1.00 78.60  ? 156 GLU A OE1 1 
ATOM   1234 O OE2 . GLU A 1 155 ? 75.108 -24.216 39.285 1.00 80.70  ? 156 GLU A OE2 1 
ATOM   1235 N N   . ILE A 1 156 ? 76.850 -21.398 43.992 1.00 65.27  ? 157 ILE A N   1 
ATOM   1236 C CA  . ILE A 1 156 ? 77.211 -20.564 45.122 1.00 64.14  ? 157 ILE A CA  1 
ATOM   1237 C C   . ILE A 1 156 ? 78.056 -19.379 44.639 1.00 63.87  ? 157 ILE A C   1 
ATOM   1238 O O   . ILE A 1 156 ? 77.973 -18.284 45.197 1.00 64.78  ? 157 ILE A O   1 
ATOM   1239 C CB  . ILE A 1 156 ? 77.993 -21.374 46.189 1.00 63.10  ? 157 ILE A CB  1 
ATOM   1240 C CG1 . ILE A 1 156 ? 77.060 -22.379 46.864 1.00 60.99  ? 157 ILE A CG1 1 
ATOM   1241 C CG2 . ILE A 1 156 ? 78.589 -20.441 47.224 1.00 64.55  ? 157 ILE A CG2 1 
ATOM   1242 C CD1 . ILE A 1 156 ? 77.663 -23.072 48.054 1.00 57.63  ? 157 ILE A CD1 1 
ATOM   1243 N N   . ARG A 1 157 ? 78.862 -19.596 43.600 1.00 61.68  ? 158 ARG A N   1 
ATOM   1244 C CA  . ARG A 1 157 ? 79.710 -18.538 43.048 1.00 58.37  ? 158 ARG A CA  1 
ATOM   1245 C C   . ARG A 1 157 ? 78.909 -17.525 42.259 1.00 56.13  ? 158 ARG A C   1 
ATOM   1246 O O   . ARG A 1 157 ? 79.127 -16.325 42.340 1.00 55.70  ? 158 ARG A O   1 
ATOM   1247 C CB  . ARG A 1 157 ? 80.770 -19.116 42.111 1.00 59.45  ? 158 ARG A CB  1 
ATOM   1248 C CG  . ARG A 1 157 ? 82.034 -19.581 42.773 1.00 63.03  ? 158 ARG A CG  1 
ATOM   1249 C CD  . ARG A 1 157 ? 83.186 -19.518 41.788 1.00 65.17  ? 158 ARG A CD  1 
ATOM   1250 N NE  . ARG A 1 157 ? 83.013 -20.447 40.683 1.00 67.62  ? 158 ARG A NE  1 
ATOM   1251 C CZ  . ARG A 1 157 ? 83.138 -21.767 40.791 1.00 69.11  ? 158 ARG A CZ  1 
ATOM   1252 N NH1 . ARG A 1 157 ? 83.443 -22.318 41.962 1.00 68.38  ? 158 ARG A NH1 1 
ATOM   1253 N NH2 . ARG A 1 157 ? 82.956 -22.535 39.725 1.00 70.16  ? 158 ARG A NH2 1 
ATOM   1254 N N   . GLU A 1 158 ? 77.971 -18.023 41.478 1.00 53.79  ? 159 GLU A N   1 
ATOM   1255 C CA  . GLU A 1 158 ? 77.173 -17.152 40.655 1.00 53.03  ? 159 GLU A CA  1 
ATOM   1256 C C   . GLU A 1 158 ? 76.114 -16.433 41.453 1.00 51.45  ? 159 GLU A C   1 
ATOM   1257 O O   . GLU A 1 158 ? 75.644 -15.367 41.064 1.00 51.86  ? 159 GLU A O   1 
ATOM   1258 C CB  . GLU A 1 158 ? 76.517 -17.944 39.543 1.00 54.10  ? 159 GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 158 ? 76.188 -17.092 38.364 1.00 57.34  ? 159 GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 158 ? 75.088 -17.682 37.562 1.00 61.31  ? 159 GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 158 ? 75.176 -18.880 37.213 1.00 62.59  ? 159 GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 158 ? 74.129 -16.940 37.283 1.00 65.25  ? 159 GLU A OE2 1 
ATOM   1263 N N   . LEU A 1 159 ? 75.722 -17.029 42.568 1.00 48.26  ? 160 LEU A N   1 
ATOM   1264 C CA  . LEU A 1 159 ? 74.724 -16.406 43.413 1.00 46.72  ? 160 LEU A CA  1 
ATOM   1265 C C   . LEU A 1 159 ? 75.376 -15.315 44.256 1.00 46.34  ? 160 LEU A C   1 
ATOM   1266 O O   . LEU A 1 159 ? 74.882 -14.197 44.297 1.00 45.93  ? 160 LEU A O   1 
ATOM   1267 C CB  . LEU A 1 159 ? 74.068 -17.430 44.325 1.00 46.18  ? 160 LEU A CB  1 
ATOM   1268 C CG  . LEU A 1 159 ? 72.924 -16.854 45.150 1.00 44.56  ? 160 LEU A CG  1 
ATOM   1269 C CD1 . LEU A 1 159 ? 71.842 -16.333 44.224 1.00 44.75  ? 160 LEU A CD1 1 
ATOM   1270 C CD2 . LEU A 1 159 ? 72.371 -17.926 46.055 1.00 44.99  ? 160 LEU A CD2 1 
ATOM   1271 N N   . LEU A 1 160 ? 76.480 -15.637 44.924 1.00 45.44  ? 161 LEU A N   1 
ATOM   1272 C CA  . LEU A 1 160 ? 77.169 -14.646 45.740 1.00 45.53  ? 161 LEU A CA  1 
ATOM   1273 C C   . LEU A 1 160 ? 77.616 -13.461 44.899 1.00 47.57  ? 161 LEU A C   1 
ATOM   1274 O O   . LEU A 1 160 ? 77.765 -12.349 45.404 1.00 50.03  ? 161 LEU A O   1 
ATOM   1275 C CB  . LEU A 1 160 ? 78.378 -15.255 46.456 1.00 43.53  ? 161 LEU A CB  1 
ATOM   1276 C CG  . LEU A 1 160 ? 78.092 -16.196 47.630 1.00 40.70  ? 161 LEU A CG  1 
ATOM   1277 C CD1 . LEU A 1 160 ? 79.374 -16.508 48.357 1.00 37.63  ? 161 LEU A CD1 1 
ATOM   1278 C CD2 . LEU A 1 160 ? 77.110 -15.561 48.569 1.00 39.42  ? 161 LEU A CD2 1 
ATOM   1279 N N   . LYS A 1 161 ? 77.834 -13.689 43.615 1.00 47.85  ? 162 LYS A N   1 
ATOM   1280 C CA  . LYS A 1 161 ? 78.232 -12.602 42.751 1.00 48.03  ? 162 LYS A CA  1 
ATOM   1281 C C   . LYS A 1 161 ? 77.033 -11.702 42.467 1.00 48.29  ? 162 LYS A C   1 
ATOM   1282 O O   . LYS A 1 161 ? 77.151 -10.485 42.433 1.00 49.74  ? 162 LYS A O   1 
ATOM   1283 C CB  . LYS A 1 161 ? 78.812 -13.151 41.453 1.00 48.61  ? 162 LYS A CB  1 
ATOM   1284 C CG  . LYS A 1 161 ? 80.333 -13.206 41.457 1.00 50.15  ? 162 LYS A CG  1 
ATOM   1285 C CD  . LYS A 1 161 ? 80.921 -13.644 40.110 1.00 50.63  ? 162 LYS A CD  1 
ATOM   1286 C CE  . LYS A 1 161 ? 80.656 -15.122 39.815 1.00 49.90  ? 162 LYS A CE  1 
ATOM   1287 N NZ  . LYS A 1 161 ? 81.495 -15.622 38.709 1.00 48.89  ? 162 LYS A NZ  1 
ATOM   1288 N N   . LEU A 1 162 ? 75.869 -12.298 42.278 1.00 47.97  ? 163 LEU A N   1 
ATOM   1289 C CA  . LEU A 1 162 ? 74.676 -11.512 41.999 1.00 49.40  ? 163 LEU A CA  1 
ATOM   1290 C C   . LEU A 1 162 ? 74.237 -10.672 43.195 1.00 49.98  ? 163 LEU A C   1 
ATOM   1291 O O   . LEU A 1 162 ? 73.921 -9.494  43.065 1.00 49.90  ? 163 LEU A O   1 
ATOM   1292 C CB  . LEU A 1 162 ? 73.533 -12.436 41.590 1.00 49.94  ? 163 LEU A CB  1 
ATOM   1293 C CG  . LEU A 1 162 ? 72.997 -12.264 40.179 1.00 51.65  ? 163 LEU A CG  1 
ATOM   1294 C CD1 . LEU A 1 162 ? 74.139 -12.283 39.197 1.00 53.60  ? 163 LEU A CD1 1 
ATOM   1295 C CD2 . LEU A 1 162 ? 72.008 -13.377 39.877 1.00 54.09  ? 163 LEU A CD2 1 
ATOM   1296 N N   . LEU A 1 163 ? 74.220 -11.285 44.369 1.00 49.07  ? 164 LEU A N   1 
ATOM   1297 C CA  . LEU A 1 163 ? 73.790 -10.583 45.561 1.00 48.45  ? 164 LEU A CA  1 
ATOM   1298 C C   . LEU A 1 163 ? 74.664 -9.368  45.842 1.00 48.73  ? 164 LEU A C   1 
ATOM   1299 O O   . LEU A 1 163 ? 74.271 -8.469  46.596 1.00 48.73  ? 164 LEU A O   1 
ATOM   1300 C CB  . LEU A 1 163 ? 73.809 -11.531 46.770 1.00 47.34  ? 164 LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 163 ? 73.009 -12.837 46.689 1.00 45.02  ? 164 LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 163 ? 73.144 -13.567 48.018 1.00 44.22  ? 164 LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 163 ? 71.547 -12.566 46.353 1.00 39.96  ? 164 LEU A CD2 1 
ATOM   1304 N N   . SER A 1 164 ? 75.846 -9.336  45.235 1.00 47.98  ? 165 SER A N   1 
ATOM   1305 C CA  . SER A 1 164 ? 76.747 -8.224  45.468 1.00 48.53  ? 165 SER A CA  1 
ATOM   1306 C C   . SER A 1 164 ? 76.801 -7.208  44.346 1.00 47.91  ? 165 SER A C   1 
ATOM   1307 O O   . SER A 1 164 ? 77.632 -6.300  44.377 1.00 48.43  ? 165 SER A O   1 
ATOM   1308 C CB  . SER A 1 164 ? 78.147 -8.743  45.789 1.00 50.37  ? 165 SER A CB  1 
ATOM   1309 O OG  . SER A 1 164 ? 78.120 -9.532  46.977 1.00 54.39  ? 165 SER A OG  1 
ATOM   1310 N N   . LYS A 1 165 ? 75.925 -7.357  43.351 1.00 46.81  ? 166 LYS A N   1 
ATOM   1311 C CA  . LYS A 1 165 ? 75.860 -6.388  42.252 1.00 45.07  ? 166 LYS A CA  1 
ATOM   1312 C C   . LYS A 1 165 ? 75.169 -5.155  42.804 1.00 44.32  ? 166 LYS A C   1 
ATOM   1313 O O   . LYS A 1 165 ? 74.289 -5.252  43.655 1.00 45.08  ? 166 LYS A O   1 
ATOM   1314 C CB  . LYS A 1 165 ? 75.041 -6.900  41.061 1.00 44.74  ? 166 LYS A CB  1 
ATOM   1315 C CG  . LYS A 1 165 ? 75.845 -7.622  40.013 1.00 44.97  ? 166 LYS A CG  1 
ATOM   1316 C CD  . LYS A 1 165 ? 75.006 -7.947  38.776 1.00 44.46  ? 166 LYS A CD  1 
ATOM   1317 C CE  . LYS A 1 165 ? 74.769 -6.724  37.894 1.00 44.78  ? 166 LYS A CE  1 
ATOM   1318 N NZ  . LYS A 1 165 ? 74.250 -7.070  36.535 1.00 41.66  ? 166 LYS A NZ  1 
ATOM   1319 N N   . PRO A 1 166 ? 75.556 -3.971  42.327 1.00 43.36  ? 167 PRO A N   1 
ATOM   1320 C CA  . PRO A 1 166 ? 74.943 -2.736  42.813 1.00 41.77  ? 167 PRO A CA  1 
ATOM   1321 C C   . PRO A 1 166 ? 73.443 -2.646  42.605 1.00 39.87  ? 167 PRO A C   1 
ATOM   1322 O O   . PRO A 1 166 ? 72.727 -2.162  43.478 1.00 41.28  ? 167 PRO A O   1 
ATOM   1323 C CB  . PRO A 1 166 ? 75.723 -1.657  42.065 1.00 42.39  ? 167 PRO A CB  1 
ATOM   1324 C CG  . PRO A 1 166 ? 76.201 -2.360  40.831 1.00 43.23  ? 167 PRO A CG  1 
ATOM   1325 C CD  . PRO A 1 166 ? 76.625 -3.681  41.361 1.00 43.22  ? 167 PRO A CD  1 
ATOM   1326 N N   . ASN A 1 167 ? 72.971 -3.137  41.470 1.00 37.79  ? 168 ASN A N   1 
ATOM   1327 C CA  . ASN A 1 167 ? 71.560 -3.078  41.156 1.00 36.13  ? 168 ASN A CA  1 
ATOM   1328 C C   . ASN A 1 167 ? 70.735 -3.955  42.047 1.00 35.73  ? 168 ASN A C   1 
ATOM   1329 O O   . ASN A 1 167 ? 69.661 -3.544  42.472 1.00 35.29  ? 168 ASN A O   1 
ATOM   1330 C CB  . ASN A 1 167 ? 71.324 -3.446  39.691 1.00 37.81  ? 168 ASN A CB  1 
ATOM   1331 C CG  . ASN A 1 167 ? 71.622 -4.890  39.391 1.00 37.92  ? 168 ASN A CG  1 
ATOM   1332 O OD1 . ASN A 1 167 ? 72.565 -5.470  39.933 1.00 38.39  ? 168 ASN A OD1 1 
ATOM   1333 N ND2 . ASN A 1 167 ? 70.828 -5.479  38.497 1.00 37.04  ? 168 ASN A ND2 1 
ATOM   1334 N N   . VAL A 1 168 ? 71.223 -5.165  42.325 1.00 36.76  ? 169 VAL A N   1 
ATOM   1335 C CA  . VAL A 1 168 ? 70.495 -6.092  43.203 1.00 38.30  ? 169 VAL A CA  1 
ATOM   1336 C C   . VAL A 1 168 ? 70.535 -5.538  44.625 1.00 38.78  ? 169 VAL A C   1 
ATOM   1337 O O   . VAL A 1 168 ? 69.505 -5.435  45.306 1.00 38.69  ? 169 VAL A O   1 
ATOM   1338 C CB  . VAL A 1 168 ? 71.125 -7.494  43.228 1.00 37.85  ? 169 VAL A CB  1 
ATOM   1339 C CG1 . VAL A 1 168 ? 70.253 -8.446  44.054 1.00 33.41  ? 169 VAL A CG1 1 
ATOM   1340 C CG2 . VAL A 1 168 ? 71.307 -8.009  41.815 1.00 38.91  ? 169 VAL A CG2 1 
ATOM   1341 N N   . LYS A 1 169 ? 71.738 -5.183  45.069 1.00 37.93  ? 170 LYS A N   1 
ATOM   1342 C CA  . LYS A 1 169 ? 71.916 -4.596  46.384 1.00 39.71  ? 170 LYS A CA  1 
ATOM   1343 C C   . LYS A 1 169 ? 70.961 -3.402  46.580 1.00 40.59  ? 170 LYS A C   1 
ATOM   1344 O O   . LYS A 1 169 ? 70.445 -3.184  47.680 1.00 40.50  ? 170 LYS A O   1 
ATOM   1345 C CB  . LYS A 1 169 ? 73.373 -4.169  46.575 1.00 40.83  ? 170 LYS A CB  1 
ATOM   1346 C CG  . LYS A 1 169 ? 74.319 -5.321  46.939 1.00 44.39  ? 170 LYS A CG  1 
ATOM   1347 C CD  . LYS A 1 169 ? 75.587 -4.861  47.685 1.00 49.71  ? 170 LYS A CD  1 
ATOM   1348 C CE  . LYS A 1 169 ? 76.694 -4.275  46.737 1.00 53.42  ? 170 LYS A CE  1 
ATOM   1349 N NZ  . LYS A 1 169 ? 78.082 -4.169  47.356 1.00 53.57  ? 170 LYS A NZ  1 
ATOM   1350 N N   . ALA A 1 170 ? 70.714 -2.639  45.518 1.00 39.47  ? 171 ALA A N   1 
ATOM   1351 C CA  . ALA A 1 170 ? 69.792 -1.503  45.597 1.00 39.28  ? 171 ALA A CA  1 
ATOM   1352 C C   . ALA A 1 170 ? 68.321 -1.967  45.713 1.00 38.57  ? 171 ALA A C   1 
ATOM   1353 O O   . ALA A 1 170 ? 67.540 -1.427  46.494 1.00 35.48  ? 171 ALA A O   1 
ATOM   1354 C CB  . ALA A 1 170 ? 69.961 -0.596  44.372 1.00 37.39  ? 171 ALA A CB  1 
ATOM   1355 N N   . LEU A 1 171 ? 67.943 -2.973  44.928 1.00 39.12  ? 172 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 171 ? 66.568 -3.480  44.961 1.00 37.07  ? 172 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 171 ? 66.218 -3.874  46.368 1.00 36.44  ? 172 LEU A C   1 
ATOM   1358 O O   . LEU A 1 171 ? 65.146 -3.533  46.871 1.00 35.88  ? 172 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 171 ? 66.399 -4.705  44.053 1.00 35.20  ? 172 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 171 ? 64.953 -5.186  43.899 1.00 32.67  ? 172 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 171 ? 64.097 -4.066  43.352 1.00 32.33  ? 172 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 171 ? 64.901 -6.367  42.972 1.00 31.48  ? 172 LEU A CD2 1 
ATOM   1363 N N   . LEU A 1 172 ? 67.136 -4.606  46.996 1.00 35.50  ? 173 LEU A N   1 
ATOM   1364 C CA  . LEU A 1 172 ? 66.944 -5.059  48.365 1.00 33.54  ? 173 LEU A CA  1 
ATOM   1365 C C   . LEU A 1 172 ? 66.909 -3.857  49.302 1.00 34.62  ? 173 LEU A C   1 
ATOM   1366 O O   . LEU A 1 172 ? 66.026 -3.735  50.152 1.00 34.30  ? 173 LEU A O   1 
ATOM   1367 C CB  . LEU A 1 172 ? 68.068 -6.001  48.773 1.00 31.74  ? 173 LEU A CB  1 
ATOM   1368 C CG  . LEU A 1 172 ? 68.154 -7.340  48.060 1.00 29.39  ? 173 LEU A CG  1 
ATOM   1369 C CD1 . LEU A 1 172 ? 69.215 -8.146  48.739 1.00 27.52  ? 173 LEU A CD1 1 
ATOM   1370 C CD2 . LEU A 1 172 ? 66.832 -8.070  48.118 1.00 25.57  ? 173 LEU A CD2 1 
ATOM   1371 N N   . SER A 1 173 ? 67.876 -2.959  49.146 1.00 33.43  ? 174 SER A N   1 
ATOM   1372 C CA  . SER A 1 173 ? 67.901 -1.755  49.970 1.00 32.40  ? 174 SER A CA  1 
ATOM   1373 C C   . SER A 1 173 ? 66.615 -0.932  49.787 1.00 31.29  ? 174 SER A C   1 
ATOM   1374 O O   . SER A 1 173 ? 65.980 -0.558  50.753 1.00 33.50  ? 174 SER A O   1 
ATOM   1375 C CB  . SER A 1 173 ? 69.107 -0.896  49.625 1.00 32.97  ? 174 SER A CB  1 
ATOM   1376 O OG  . SER A 1 173 ? 69.006 0.323   50.317 1.00 36.37  ? 174 SER A OG  1 
ATOM   1377 N N   . VAL A 1 174 ? 66.231 -0.629  48.556 1.00 28.92  ? 175 VAL A N   1 
ATOM   1378 C CA  . VAL A 1 174 ? 64.993 0.106   48.358 1.00 28.64  ? 175 VAL A CA  1 
ATOM   1379 C C   . VAL A 1 174 ? 63.803 -0.717  48.904 1.00 31.38  ? 175 VAL A C   1 
ATOM   1380 O O   . VAL A 1 174 ? 62.882 -0.172  49.496 1.00 31.87  ? 175 VAL A O   1 
ATOM   1381 C CB  . VAL A 1 174 ? 64.769 0.433   46.854 1.00 28.15  ? 175 VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 174 ? 63.379 1.040   46.640 1.00 22.38  ? 175 VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 174 ? 65.848 1.394   46.362 1.00 24.68  ? 175 VAL A CG2 1 
ATOM   1384 N N   . HIS A 1 175 ? 63.833 -2.031  48.704 1.00 33.54  ? 176 HIS A N   1 
ATOM   1385 C CA  . HIS A 1 175 ? 62.771 -2.906  49.179 1.00 36.06  ? 176 HIS A CA  1 
ATOM   1386 C C   . HIS A 1 175 ? 62.450 -2.637  50.628 1.00 39.36  ? 176 HIS A C   1 
ATOM   1387 O O   . HIS A 1 175 ? 61.291 -2.434  50.983 1.00 41.45  ? 176 HIS A O   1 
ATOM   1388 C CB  . HIS A 1 175 ? 63.179 -4.373  49.069 1.00 34.85  ? 176 HIS A CB  1 
ATOM   1389 C CG  . HIS A 1 175 ? 62.229 -5.316  49.757 1.00 34.44  ? 176 HIS A CG  1 
ATOM   1390 N ND1 . HIS A 1 175 ? 61.131 -5.864  49.129 1.00 34.38  ? 176 HIS A ND1 1 
ATOM   1391 C CD2 . HIS A 1 175 ? 62.209 -5.787  51.026 1.00 31.07  ? 176 HIS A CD2 1 
ATOM   1392 C CE1 . HIS A 1 175 ? 60.479 -6.636  49.979 1.00 34.04  ? 176 HIS A CE1 1 
ATOM   1393 N NE2 . HIS A 1 175 ? 61.112 -6.605  51.136 1.00 33.04  ? 176 HIS A NE2 1 
ATOM   1394 N N   . ASP A 1 176 ? 63.489 -2.676  51.464 1.00 41.27  ? 177 ASP A N   1 
ATOM   1395 C CA  . ASP A 1 176 ? 63.355 -2.453  52.900 1.00 41.90  ? 177 ASP A CA  1 
ATOM   1396 C C   . ASP A 1 176 ? 62.914 -1.028  53.229 1.00 41.83  ? 177 ASP A C   1 
ATOM   1397 O O   . ASP A 1 176 ? 62.028 -0.822  54.063 1.00 41.60  ? 177 ASP A O   1 
ATOM   1398 C CB  . ASP A 1 176 ? 64.680 -2.769  53.597 1.00 43.09  ? 177 ASP A CB  1 
ATOM   1399 C CG  . ASP A 1 176 ? 65.134 -4.191  53.362 1.00 45.99  ? 177 ASP A CG  1 
ATOM   1400 O OD1 . ASP A 1 176 ? 64.271 -5.057  53.097 1.00 44.12  ? 177 ASP A OD1 1 
ATOM   1401 O OD2 . ASP A 1 176 ? 66.353 -4.440  53.451 1.00 48.41  ? 177 ASP A OD2 1 
ATOM   1402 N N   . THR A 1 177 ? 63.537 -0.048  52.581 1.00 41.33  ? 178 THR A N   1 
ATOM   1403 C CA  . THR A 1 177 ? 63.183 1.346   52.804 1.00 42.56  ? 178 THR A CA  1 
ATOM   1404 C C   . THR A 1 177 ? 61.678 1.564   52.644 1.00 43.18  ? 178 THR A C   1 
ATOM   1405 O O   . THR A 1 177 ? 61.031 2.166   53.501 1.00 42.66  ? 178 THR A O   1 
ATOM   1406 C CB  . THR A 1 177 ? 63.942 2.268   51.828 1.00 43.67  ? 178 THR A CB  1 
ATOM   1407 O OG1 . THR A 1 177 ? 65.194 2.650   52.411 1.00 45.98  ? 178 THR A OG1 1 
ATOM   1408 C CG2 . THR A 1 177 ? 63.125 3.522   51.520 1.00 44.23  ? 178 THR A CG2 1 
ATOM   1409 N N   . VAL A 1 178 ? 61.132 1.079   51.535 1.00 42.84  ? 179 VAL A N   1 
ATOM   1410 C CA  . VAL A 1 178 ? 59.711 1.211   51.247 1.00 42.67  ? 179 VAL A CA  1 
ATOM   1411 C C   . VAL A 1 178 ? 58.878 0.276   52.124 1.00 44.65  ? 179 VAL A C   1 
ATOM   1412 O O   . VAL A 1 178 ? 57.759 0.617   52.521 1.00 45.30  ? 179 VAL A O   1 
ATOM   1413 C CB  . VAL A 1 178 ? 59.423 0.902   49.762 1.00 40.97  ? 179 VAL A CB  1 
ATOM   1414 C CG1 . VAL A 1 178 ? 57.977 1.235   49.419 1.00 36.57  ? 179 VAL A CG1 1 
ATOM   1415 C CG2 . VAL A 1 178 ? 60.364 1.695   48.893 1.00 37.87  ? 179 VAL A CG2 1 
ATOM   1416 N N   . ALA A 1 179 ? 59.423 -0.901  52.413 1.00 44.90  ? 180 ALA A N   1 
ATOM   1417 C CA  . ALA A 1 179 ? 58.739 -1.879  53.257 1.00 45.46  ? 180 ALA A CA  1 
ATOM   1418 C C   . ALA A 1 179 ? 58.565 -1.286  54.649 1.00 44.73  ? 180 ALA A C   1 
ATOM   1419 O O   . ALA A 1 179 ? 57.477 -1.314  55.212 1.00 44.78  ? 180 ALA A O   1 
ATOM   1420 C CB  . ALA A 1 179 ? 59.553 -3.166  53.342 1.00 45.81  ? 180 ALA A CB  1 
ATOM   1421 N N   . GLN A 1 180 ? 59.656 -0.724  55.165 1.00 44.53  ? 181 GLN A N   1 
ATOM   1422 C CA  . GLN A 1 180 ? 59.725 -0.114  56.489 1.00 43.78  ? 181 GLN A CA  1 
ATOM   1423 C C   . GLN A 1 180 ? 59.134 1.281   56.636 1.00 44.17  ? 181 GLN A C   1 
ATOM   1424 O O   . GLN A 1 180 ? 59.120 1.811   57.741 1.00 42.74  ? 181 GLN A O   1 
ATOM   1425 C CB  . GLN A 1 180 ? 61.183 -0.060  56.943 1.00 43.36  ? 181 GLN A CB  1 
ATOM   1426 C CG  . GLN A 1 180 ? 61.862 -1.413  57.058 1.00 44.29  ? 181 GLN A CG  1 
ATOM   1427 C CD  . GLN A 1 180 ? 63.353 -1.287  57.234 1.00 44.90  ? 181 GLN A CD  1 
ATOM   1428 O OE1 . GLN A 1 180 ? 63.834 -0.352  57.886 1.00 45.73  ? 181 GLN A OE1 1 
ATOM   1429 N NE2 . GLN A 1 180 ? 64.105 -2.234  56.661 1.00 43.20  ? 181 GLN A NE2 1 
ATOM   1430 N N   . LYS A 1 181 ? 58.683 1.880   55.535 1.00 45.31  ? 182 LYS A N   1 
ATOM   1431 C CA  . LYS A 1 181 ? 58.096 3.218   55.559 1.00 47.36  ? 182 LYS A CA  1 
ATOM   1432 C C   . LYS A 1 181 ? 59.076 4.253   56.102 1.00 50.93  ? 182 LYS A C   1 
ATOM   1433 O O   . LYS A 1 181 ? 58.706 5.140   56.879 1.00 50.00  ? 182 LYS A O   1 
ATOM   1434 C CB  . LYS A 1 181 ? 56.860 3.218   56.442 1.00 47.06  ? 182 LYS A CB  1 
ATOM   1435 C CG  . LYS A 1 181 ? 55.811 2.228   56.061 1.00 47.93  ? 182 LYS A CG  1 
ATOM   1436 C CD  . LYS A 1 181 ? 54.968 2.744   54.945 1.00 48.66  ? 182 LYS A CD  1 
ATOM   1437 C CE  . LYS A 1 181 ? 53.751 1.866   54.795 1.00 50.94  ? 182 LYS A CE  1 
ATOM   1438 N NZ  . LYS A 1 181 ? 53.043 1.739   56.109 1.00 50.62  ? 182 LYS A NZ  1 
ATOM   1439 N N   . ASN A 1 182 ? 60.326 4.156   55.680 1.00 55.11  ? 183 ASN A N   1 
ATOM   1440 C CA  . ASN A 1 182 ? 61.330 5.068   56.180 1.00 60.86  ? 183 ASN A CA  1 
ATOM   1441 C C   . ASN A 1 182 ? 62.166 5.764   55.105 1.00 62.67  ? 183 ASN A C   1 
ATOM   1442 O O   . ASN A 1 182 ? 63.320 5.385   54.867 1.00 64.91  ? 183 ASN A O   1 
ATOM   1443 C CB  . ASN A 1 182 ? 62.230 4.302   57.145 1.00 65.43  ? 183 ASN A CB  1 
ATOM   1444 C CG  . ASN A 1 182 ? 63.423 5.112   57.593 1.00 72.13  ? 183 ASN A CG  1 
ATOM   1445 O OD1 . ASN A 1 182 ? 63.296 6.301   57.951 1.00 73.80  ? 183 ASN A OD1 1 
ATOM   1446 N ND2 . ASN A 1 182 ? 64.601 4.479   57.584 1.00 74.34  ? 183 ASN A ND2 1 
ATOM   1447 N N   . TYR A 1 183 ? 61.599 6.795   54.476 1.00 62.43  ? 184 TYR A N   1 
ATOM   1448 C CA  . TYR A 1 183 ? 62.293 7.540   53.424 1.00 62.96  ? 184 TYR A CA  1 
ATOM   1449 C C   . TYR A 1 183 ? 63.601 8.175   53.896 1.00 62.48  ? 184 TYR A C   1 
ATOM   1450 O O   . TYR A 1 183 ? 63.734 8.579   55.038 1.00 62.14  ? 184 TYR A O   1 
ATOM   1451 C CB  . TYR A 1 183 ? 61.386 8.629   52.841 1.00 64.80  ? 184 TYR A CB  1 
ATOM   1452 C CG  . TYR A 1 183 ? 62.088 9.515   51.833 1.00 65.24  ? 184 TYR A CG  1 
ATOM   1453 C CD1 . TYR A 1 183 ? 62.679 8.970   50.697 1.00 66.17  ? 184 TYR A CD1 1 
ATOM   1454 C CD2 . TYR A 1 183 ? 62.213 10.882  52.045 1.00 64.09  ? 184 TYR A CD2 1 
ATOM   1455 C CE1 . TYR A 1 183 ? 63.382 9.764   49.800 1.00 66.18  ? 184 TYR A CE1 1 
ATOM   1456 C CE2 . TYR A 1 183 ? 62.918 11.685  51.152 1.00 65.10  ? 184 TYR A CE2 1 
ATOM   1457 C CZ  . TYR A 1 183 ? 63.501 11.116  50.032 1.00 66.02  ? 184 TYR A CZ  1 
ATOM   1458 O OH  . TYR A 1 183 ? 64.218 11.881  49.140 1.00 67.19  ? 184 TYR A OH  1 
ATOM   1459 N N   . ASP A 1 184 ? 64.559 8.279   52.986 1.00 62.04  ? 185 ASP A N   1 
ATOM   1460 C CA  . ASP A 1 184 ? 65.866 8.829   53.298 1.00 62.49  ? 185 ASP A CA  1 
ATOM   1461 C C   . ASP A 1 184 ? 66.530 9.237   51.985 1.00 62.69  ? 185 ASP A C   1 
ATOM   1462 O O   . ASP A 1 184 ? 66.823 8.380   51.150 1.00 62.06  ? 185 ASP A O   1 
ATOM   1463 C CB  . ASP A 1 184 ? 66.703 7.742   53.983 1.00 65.05  ? 185 ASP A CB  1 
ATOM   1464 C CG  . ASP A 1 184 ? 68.099 8.210   54.375 1.00 66.03  ? 185 ASP A CG  1 
ATOM   1465 O OD1 . ASP A 1 184 ? 68.961 7.336   54.619 1.00 68.33  ? 185 ASP A OD1 1 
ATOM   1466 O OD2 . ASP A 1 184 ? 68.340 9.430   54.457 1.00 65.11  ? 185 ASP A OD2 1 
ATOM   1467 N N   . LEU A 1 185 ? 66.767 10.536  51.804 1.00 63.78  ? 186 LEU A N   1 
ATOM   1468 C CA  . LEU A 1 185 ? 67.405 11.044  50.589 1.00 64.34  ? 186 LEU A CA  1 
ATOM   1469 C C   . LEU A 1 185 ? 68.534 10.130  50.121 1.00 67.03  ? 186 LEU A C   1 
ATOM   1470 O O   . LEU A 1 185 ? 68.751 9.972   48.923 1.00 66.86  ? 186 LEU A O   1 
ATOM   1471 C CB  . LEU A 1 185 ? 67.974 12.446  50.811 1.00 62.01  ? 186 LEU A CB  1 
ATOM   1472 C CG  . LEU A 1 185 ? 68.660 13.022  49.567 1.00 60.30  ? 186 LEU A CG  1 
ATOM   1473 C CD1 . LEU A 1 185 ? 67.586 13.421  48.574 1.00 60.91  ? 186 LEU A CD1 1 
ATOM   1474 C CD2 . LEU A 1 185 ? 69.536 14.203  49.910 1.00 56.20  ? 186 LEU A CD2 1 
ATOM   1475 N N   . GLU A 1 186 ? 69.258 9.530   51.062 1.00 70.10  ? 187 GLU A N   1 
ATOM   1476 C CA  . GLU A 1 186 ? 70.357 8.642   50.697 1.00 72.97  ? 187 GLU A CA  1 
ATOM   1477 C C   . GLU A 1 186 ? 69.805 7.549   49.813 1.00 72.94  ? 187 GLU A C   1 
ATOM   1478 O O   . GLU A 1 186 ? 70.415 7.172   48.815 1.00 72.11  ? 187 GLU A O   1 
ATOM   1479 C CB  . GLU A 1 186 ? 71.014 8.009   51.936 1.00 76.24  ? 187 GLU A CB  1 
ATOM   1480 C CG  . GLU A 1 186 ? 72.269 7.177   51.599 1.00 79.54  ? 187 GLU A CG  1 
ATOM   1481 C CD  . GLU A 1 186 ? 72.954 6.583   52.820 1.00 81.68  ? 187 GLU A CD  1 
ATOM   1482 O OE1 . GLU A 1 186 ? 73.214 7.326   53.789 1.00 84.10  ? 187 GLU A OE1 1 
ATOM   1483 O OE2 . GLU A 1 186 ? 73.247 5.370   52.807 1.00 81.84  ? 187 GLU A OE2 1 
ATOM   1484 N N   . VAL A 1 187 ? 68.635 7.052   50.187 1.00 73.22  ? 188 VAL A N   1 
ATOM   1485 C CA  . VAL A 1 187 ? 67.997 5.992   49.427 1.00 74.61  ? 188 VAL A CA  1 
ATOM   1486 C C   . VAL A 1 187 ? 67.472 6.485   48.090 1.00 72.50  ? 188 VAL A C   1 
ATOM   1487 O O   . VAL A 1 187 ? 67.164 5.692   47.220 1.00 72.93  ? 188 VAL A O   1 
ATOM   1488 C CB  . VAL A 1 187 ? 66.860 5.318   50.250 1.00 76.69  ? 188 VAL A CB  1 
ATOM   1489 C CG1 . VAL A 1 187 ? 66.090 4.312   49.385 1.00 75.72  ? 188 VAL A CG1 1 
ATOM   1490 C CG2 . VAL A 1 187 ? 67.470 4.590   51.467 1.00 77.68  ? 188 VAL A CG2 1 
ATOM   1491 N N   . LEU A 1 188 ? 67.391 7.796   47.916 1.00 71.24  ? 189 LEU A N   1 
ATOM   1492 C CA  . LEU A 1 188 ? 66.932 8.345   46.649 1.00 70.23  ? 189 LEU A CA  1 
ATOM   1493 C C   . LEU A 1 188 ? 68.016 8.092   45.594 1.00 71.14  ? 189 LEU A C   1 
ATOM   1494 O O   . LEU A 1 188 ? 67.724 7.632   44.494 1.00 71.69  ? 189 LEU A O   1 
ATOM   1495 C CB  . LEU A 1 188 ? 66.671 9.857   46.776 1.00 68.95  ? 189 LEU A CB  1 
ATOM   1496 C CG  . LEU A 1 188 ? 66.218 10.637  45.528 1.00 67.03  ? 189 LEU A CG  1 
ATOM   1497 C CD1 . LEU A 1 188 ? 64.736 10.492  45.307 1.00 63.88  ? 189 LEU A CD1 1 
ATOM   1498 C CD2 . LEU A 1 188 ? 66.568 12.097  45.697 1.00 65.95  ? 189 LEU A CD2 1 
ATOM   1499 N N   . PHE A 1 189 ? 69.266 8.385   45.950 1.00 72.18  ? 190 PHE A N   1 
ATOM   1500 C CA  . PHE A 1 189 ? 70.407 8.216   45.049 1.00 72.01  ? 190 PHE A CA  1 
ATOM   1501 C C   . PHE A 1 189 ? 70.680 6.768   44.698 1.00 71.56  ? 190 PHE A C   1 
ATOM   1502 O O   . PHE A 1 189 ? 71.368 6.483   43.723 1.00 71.78  ? 190 PHE A O   1 
ATOM   1503 C CB  . PHE A 1 189 ? 71.659 8.835   45.668 1.00 72.63  ? 190 PHE A CB  1 
ATOM   1504 C CG  . PHE A 1 189 ? 71.560 10.317  45.870 1.00 73.95  ? 190 PHE A CG  1 
ATOM   1505 C CD1 . PHE A 1 189 ? 71.546 11.178  44.784 1.00 74.54  ? 190 PHE A CD1 1 
ATOM   1506 C CD2 . PHE A 1 189 ? 71.456 10.857  47.144 1.00 75.12  ? 190 PHE A CD2 1 
ATOM   1507 C CE1 . PHE A 1 189 ? 71.428 12.555  44.967 1.00 74.68  ? 190 PHE A CE1 1 
ATOM   1508 C CE2 . PHE A 1 189 ? 71.337 12.237  47.333 1.00 74.99  ? 190 PHE A CE2 1 
ATOM   1509 C CZ  . PHE A 1 189 ? 71.323 13.082  46.244 1.00 73.95  ? 190 PHE A CZ  1 
ATOM   1510 N N   . GLN A 1 190 ? 70.156 5.853   45.501 1.00 71.38  ? 191 GLN A N   1 
ATOM   1511 C CA  . GLN A 1 190 ? 70.340 4.438   45.225 1.00 71.10  ? 191 GLN A CA  1 
ATOM   1512 C C   . GLN A 1 190 ? 69.515 4.094   44.000 1.00 69.60  ? 191 GLN A C   1 
ATOM   1513 O O   . GLN A 1 190 ? 69.684 3.041   43.398 1.00 69.53  ? 191 GLN A O   1 
ATOM   1514 C CB  . GLN A 1 190 ? 69.893 3.590   46.419 1.00 73.48  ? 191 GLN A CB  1 
ATOM   1515 C CG  . GLN A 1 190 ? 70.941 3.515   47.530 1.00 75.99  ? 191 GLN A CG  1 
ATOM   1516 C CD  . GLN A 1 190 ? 70.544 2.585   48.664 1.00 77.25  ? 191 GLN A CD  1 
ATOM   1517 O OE1 . GLN A 1 190 ? 69.763 2.954   49.558 1.00 77.66  ? 191 GLN A OE1 1 
ATOM   1518 N NE2 . GLN A 1 190 ? 71.075 1.363   48.629 1.00 76.64  ? 191 GLN A NE2 1 
ATOM   1519 N N   . GLY A 1 191 ? 68.616 5.001   43.640 1.00 68.38  ? 192 GLY A N   1 
ATOM   1520 C CA  . GLY A 1 191 ? 67.775 4.791   42.482 1.00 65.85  ? 192 GLY A CA  1 
ATOM   1521 C C   . GLY A 1 191 ? 68.585 4.449   41.251 1.00 63.42  ? 192 GLY A C   1 
ATOM   1522 O O   . GLY A 1 191 ? 68.452 3.361   40.697 1.00 65.59  ? 192 GLY A O   1 
ATOM   1523 N N   . PRO A 1 192 ? 69.441 5.361   40.794 1.00 60.90  ? 193 PRO A N   1 
ATOM   1524 C CA  . PRO A 1 192 ? 70.257 5.098   39.609 1.00 59.36  ? 193 PRO A CA  1 
ATOM   1525 C C   . PRO A 1 192 ? 71.188 3.879   39.658 1.00 57.71  ? 193 PRO A C   1 
ATOM   1526 O O   . PRO A 1 192 ? 71.782 3.520   38.640 1.00 58.02  ? 193 PRO A O   1 
ATOM   1527 C CB  . PRO A 1 192 ? 71.020 6.416   39.412 1.00 60.59  ? 193 PRO A CB  1 
ATOM   1528 C CG  . PRO A 1 192 ? 70.998 7.057   40.763 1.00 61.23  ? 193 PRO A CG  1 
ATOM   1529 C CD  . PRO A 1 192 ? 69.617 6.742   41.263 1.00 60.10  ? 193 PRO A CD  1 
ATOM   1530 N N   . ALA A 1 193 ? 71.323 3.244   40.823 1.00 54.35  ? 194 ALA A N   1 
ATOM   1531 C CA  . ALA A 1 193 ? 72.202 2.074   40.940 1.00 50.51  ? 194 ALA A CA  1 
ATOM   1532 C C   . ALA A 1 193 ? 71.505 0.830   40.449 1.00 47.78  ? 194 ALA A C   1 
ATOM   1533 O O   . ALA A 1 193 ? 72.161 -0.145  40.060 1.00 46.57  ? 194 ALA A O   1 
ATOM   1534 C CB  . ALA A 1 193 ? 72.660 1.868   42.373 1.00 51.48  ? 194 ALA A CB  1 
ATOM   1535 N N   . LEU A 1 194 ? 70.176 0.866   40.470 1.00 44.68  ? 195 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 194 ? 69.379 -0.253  39.998 1.00 43.85  ? 195 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 194 ? 69.546 -0.403  38.470 1.00 43.41  ? 195 LEU A C   1 
ATOM   1538 O O   . LEU A 1 194 ? 69.400 -1.502  37.913 1.00 43.78  ? 195 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 194 ? 67.909 -0.037  40.366 1.00 44.23  ? 195 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 194 ? 67.497 -0.114  41.842 1.00 43.98  ? 195 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 194 ? 67.190 1.264   42.368 1.00 42.58  ? 195 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 194 ? 66.267 -1.002  41.977 1.00 43.32  ? 195 LEU A CD2 1 
ATOM   1543 N N   . GLY A 1 195 ? 69.852 0.710   37.808 1.00 41.60  ? 196 GLY A N   1 
ATOM   1544 C CA  . GLY A 1 195 ? 70.077 0.705   36.374 1.00 39.70  ? 196 GLY A CA  1 
ATOM   1545 C C   . GLY A 1 195 ? 68.913 0.350   35.479 1.00 39.36  ? 196 GLY A C   1 
ATOM   1546 O O   . GLY A 1 195 ? 67.760 0.569   35.824 1.00 39.16  ? 196 GLY A O   1 
ATOM   1547 N N   . GLU A 1 196 ? 69.239 -0.196  34.315 1.00 41.85  ? 197 GLU A N   1 
ATOM   1548 C CA  . GLU A 1 196 ? 68.257 -0.591  33.306 1.00 44.99  ? 197 GLU A CA  1 
ATOM   1549 C C   . GLU A 1 196 ? 67.266 -1.570  33.920 1.00 45.26  ? 197 GLU A C   1 
ATOM   1550 O O   . GLU A 1 196 ? 67.648 -2.609  34.446 1.00 46.08  ? 197 GLU A O   1 
ATOM   1551 C CB  . GLU A 1 196 ? 69.004 -1.225  32.128 1.00 48.69  ? 197 GLU A CB  1 
ATOM   1552 C CG  . GLU A 1 196 ? 68.395 -1.042  30.754 1.00 53.69  ? 197 GLU A CG  1 
ATOM   1553 C CD  . GLU A 1 196 ? 67.254 -1.990  30.518 1.00 58.62  ? 197 GLU A CD  1 
ATOM   1554 O OE1 . GLU A 1 196 ? 66.103 -1.658  30.896 1.00 60.86  ? 197 GLU A OE1 1 
ATOM   1555 O OE2 . GLU A 1 196 ? 67.516 -3.079  29.965 1.00 60.44  ? 197 GLU A OE2 1 
ATOM   1556 N N   . PRO A 1 197 ? 65.974 -1.243  33.869 1.00 44.28  ? 198 PRO A N   1 
ATOM   1557 C CA  . PRO A 1 197 ? 64.946 -2.117  34.443 1.00 43.86  ? 198 PRO A CA  1 
ATOM   1558 C C   . PRO A 1 197 ? 64.875 -3.550  33.938 1.00 44.02  ? 198 PRO A C   1 
ATOM   1559 O O   . PRO A 1 197 ? 64.511 -4.444  34.683 1.00 44.19  ? 198 PRO A O   1 
ATOM   1560 C CB  . PRO A 1 197 ? 63.656 -1.352  34.172 1.00 45.09  ? 198 PRO A CB  1 
ATOM   1561 C CG  . PRO A 1 197 ? 64.100 0.073   34.205 1.00 44.78  ? 198 PRO A CG  1 
ATOM   1562 C CD  . PRO A 1 197 ? 65.381 0.019   33.404 1.00 44.35  ? 198 PRO A CD  1 
ATOM   1563 N N   . VAL A 1 198 ? 65.203 -3.780  32.674 1.00 45.30  ? 199 VAL A N   1 
ATOM   1564 C CA  . VAL A 1 198 ? 65.145 -5.142  32.138 1.00 45.20  ? 199 VAL A CA  1 
ATOM   1565 C C   . VAL A 1 198 ? 66.308 -6.011  32.623 1.00 45.24  ? 199 VAL A C   1 
ATOM   1566 O O   . VAL A 1 198 ? 66.140 -7.190  32.931 1.00 43.85  ? 199 VAL A O   1 
ATOM   1567 C CB  . VAL A 1 198 ? 65.101 -5.144  30.586 1.00 44.90  ? 199 VAL A CB  1 
ATOM   1568 C CG1 . VAL A 1 198 ? 65.212 -6.563  30.061 1.00 44.24  ? 199 VAL A CG1 1 
ATOM   1569 C CG2 . VAL A 1 198 ? 63.792 -4.532  30.110 1.00 45.42  ? 199 VAL A CG2 1 
ATOM   1570 N N   . ARG A 1 199 ? 67.493 -5.432  32.695 1.00 45.36  ? 200 ARG A N   1 
ATOM   1571 C CA  . ARG A 1 199 ? 68.624 -6.186  33.177 1.00 45.68  ? 200 ARG A CA  1 
ATOM   1572 C C   . ARG A 1 199 ? 68.341 -6.574  34.623 1.00 47.52  ? 200 ARG A C   1 
ATOM   1573 O O   . ARG A 1 199 ? 68.614 -7.698  35.038 1.00 49.22  ? 200 ARG A O   1 
ATOM   1574 C CB  . ARG A 1 199 ? 69.881 -5.337  33.114 1.00 46.62  ? 200 ARG A CB  1 
ATOM   1575 C CG  . ARG A 1 199 ? 71.116 -6.059  33.577 1.00 49.54  ? 200 ARG A CG  1 
ATOM   1576 C CD  . ARG A 1 199 ? 71.458 -7.186  32.632 1.00 54.50  ? 200 ARG A CD  1 
ATOM   1577 N NE  . ARG A 1 199 ? 72.115 -8.288  33.326 1.00 58.54  ? 200 ARG A NE  1 
ATOM   1578 C CZ  . ARG A 1 199 ? 73.301 -8.784  33.001 1.00 59.43  ? 200 ARG A CZ  1 
ATOM   1579 N NH1 . ARG A 1 199 ? 73.977 -8.276  31.980 1.00 59.56  ? 200 ARG A NH1 1 
ATOM   1580 N NH2 . ARG A 1 199 ? 73.809 -9.783  33.705 1.00 59.75  ? 200 ARG A NH2 1 
ATOM   1581 N N   . LEU A 1 200 ? 67.795 -5.638  35.391 1.00 47.64  ? 201 LEU A N   1 
ATOM   1582 C CA  . LEU A 1 200 ? 67.497 -5.907  36.784 1.00 48.36  ? 201 LEU A CA  1 
ATOM   1583 C C   . LEU A 1 200 ? 66.544 -7.079  36.904 1.00 49.12  ? 201 LEU A C   1 
ATOM   1584 O O   . LEU A 1 200 ? 66.806 -8.028  37.635 1.00 51.00  ? 201 LEU A O   1 
ATOM   1585 C CB  . LEU A 1 200 ? 66.883 -4.677  37.466 1.00 47.76  ? 201 LEU A CB  1 
ATOM   1586 C CG  . LEU A 1 200 ? 66.490 -4.855  38.945 1.00 44.98  ? 201 LEU A CG  1 
ATOM   1587 C CD1 . LEU A 1 200 ? 67.721 -5.154  39.784 1.00 44.67  ? 201 LEU A CD1 1 
ATOM   1588 C CD2 . LEU A 1 200 ? 65.812 -3.622  39.450 1.00 42.59  ? 201 LEU A CD2 1 
ATOM   1589 N N   . GLU A 1 201 ? 65.433 -7.010  36.188 1.00 49.37  ? 202 GLU A N   1 
ATOM   1590 C CA  . GLU A 1 201 ? 64.434 -8.071  36.225 1.00 50.06  ? 202 GLU A CA  1 
ATOM   1591 C C   . GLU A 1 201 ? 65.025 -9.381  35.760 1.00 49.79  ? 202 GLU A C   1 
ATOM   1592 O O   . GLU A 1 201 ? 64.594 -10.458 36.149 1.00 49.23  ? 202 GLU A O   1 
ATOM   1593 C CB  . GLU A 1 201 ? 63.264 -7.708  35.331 1.00 52.10  ? 202 GLU A CB  1 
ATOM   1594 C CG  . GLU A 1 201 ? 62.221 -8.780  35.228 1.00 54.86  ? 202 GLU A CG  1 
ATOM   1595 C CD  . GLU A 1 201 ? 61.232 -8.456  34.143 1.00 60.39  ? 202 GLU A CD  1 
ATOM   1596 O OE1 . GLU A 1 201 ? 61.628 -8.518  32.947 1.00 62.32  ? 202 GLU A OE1 1 
ATOM   1597 O OE2 . GLU A 1 201 ? 60.070 -8.119  34.485 1.00 61.53  ? 202 GLU A OE2 1 
ATOM   1598 N N   . ARG A 1 202 ? 66.027 -9.288  34.904 1.00 50.86  ? 203 ARG A N   1 
ATOM   1599 C CA  . ARG A 1 202 ? 66.673 -10.488 34.412 1.00 51.62  ? 203 ARG A CA  1 
ATOM   1600 C C   . ARG A 1 202 ? 67.703 -11.022 35.395 1.00 52.11  ? 203 ARG A C   1 
ATOM   1601 O O   . ARG A 1 202 ? 67.858 -12.242 35.520 1.00 53.27  ? 203 ARG A O   1 
ATOM   1602 C CB  . ARG A 1 202 ? 67.291 -10.237 33.036 1.00 51.90  ? 203 ARG A CB  1 
ATOM   1603 C CG  . ARG A 1 202 ? 66.247 -10.386 31.932 1.00 52.07  ? 203 ARG A CG  1 
ATOM   1604 C CD  . ARG A 1 202 ? 66.716 -9.945  30.559 1.00 52.55  ? 203 ARG A CD  1 
ATOM   1605 N NE  . ARG A 1 202 ? 65.607 -10.047 29.621 1.00 51.32  ? 203 ARG A NE  1 
ATOM   1606 C CZ  . ARG A 1 202 ? 65.526 -9.388  28.477 1.00 50.15  ? 203 ARG A CZ  1 
ATOM   1607 N NH1 . ARG A 1 202 ? 66.496 -8.561  28.105 1.00 47.41  ? 203 ARG A NH1 1 
ATOM   1608 N NH2 . ARG A 1 202 ? 64.452 -9.558  27.722 1.00 49.24  ? 203 ARG A NH2 1 
ATOM   1609 N N   . ASP A 1 203 ? 68.411 -10.130 36.089 1.00 50.22  ? 204 ASP A N   1 
ATOM   1610 C CA  . ASP A 1 203 ? 69.386 -10.575 37.082 1.00 48.13  ? 204 ASP A CA  1 
ATOM   1611 C C   . ASP A 1 203 ? 68.641 -11.218 38.259 1.00 47.10  ? 204 ASP A C   1 
ATOM   1612 O O   . ASP A 1 203 ? 69.079 -12.221 38.812 1.00 45.13  ? 204 ASP A O   1 
ATOM   1613 C CB  . ASP A 1 203 ? 70.220 -9.405  37.585 1.00 47.21  ? 204 ASP A CB  1 
ATOM   1614 C CG  . ASP A 1 203 ? 71.350 -9.071  36.665 1.00 48.43  ? 204 ASP A CG  1 
ATOM   1615 O OD1 . ASP A 1 203 ? 71.487 -9.757  35.631 1.00 49.15  ? 204 ASP A OD1 1 
ATOM   1616 O OD2 . ASP A 1 203 ? 72.109 -8.133  36.979 1.00 46.60  ? 204 ASP A OD2 1 
ATOM   1617 N N   . ILE A 1 204 ? 67.501 -10.645 38.617 1.00 47.19  ? 205 ILE A N   1 
ATOM   1618 C CA  . ILE A 1 204 ? 66.705 -11.144 39.721 1.00 47.12  ? 205 ILE A CA  1 
ATOM   1619 C C   . ILE A 1 204 ? 66.125 -12.513 39.414 1.00 48.78  ? 205 ILE A C   1 
ATOM   1620 O O   . ILE A 1 204 ? 66.109 -13.383 40.276 1.00 50.24  ? 205 ILE A O   1 
ATOM   1621 C CB  . ILE A 1 204 ? 65.575 -10.132 40.084 1.00 47.31  ? 205 ILE A CB  1 
ATOM   1622 C CG1 . ILE A 1 204 ? 65.969 -9.356  41.335 1.00 46.33  ? 205 ILE A CG1 1 
ATOM   1623 C CG2 . ILE A 1 204 ? 64.255 -10.843 40.321 1.00 48.73  ? 205 ILE A CG2 1 
ATOM   1624 C CD1 . ILE A 1 204 ? 67.336 -8.717  41.244 1.00 46.70  ? 205 ILE A CD1 1 
ATOM   1625 N N   . CYS A 1 205 ? 65.642 -12.719 38.195 1.00 49.04  ? 206 CYS A N   1 
ATOM   1626 C CA  . CYS A 1 205 ? 65.080 -14.019 37.852 1.00 48.73  ? 206 CYS A CA  1 
ATOM   1627 C C   . CYS A 1 205 ? 66.153 -15.090 37.917 1.00 48.92  ? 206 CYS A C   1 
ATOM   1628 O O   . CYS A 1 205 ? 65.900 -16.190 38.387 1.00 50.48  ? 206 CYS A O   1 
ATOM   1629 C CB  . CYS A 1 205 ? 64.450 -13.980 36.467 1.00 46.44  ? 206 CYS A CB  1 
ATOM   1630 S SG  . CYS A 1 205 ? 62.901 -13.058 36.496 1.00 48.99  ? 206 CYS A SG  1 
ATOM   1631 N N   . ARG A 1 206 ? 67.354 -14.757 37.464 1.00 49.91  ? 207 ARG A N   1 
ATOM   1632 C CA  . ARG A 1 206 ? 68.455 -15.699 37.490 1.00 49.70  ? 207 ARG A CA  1 
ATOM   1633 C C   . ARG A 1 206 ? 68.822 -16.003 38.928 1.00 50.64  ? 207 ARG A C   1 
ATOM   1634 O O   . ARG A 1 206 ? 69.240 -17.123 39.249 1.00 52.16  ? 207 ARG A O   1 
ATOM   1635 C CB  . ARG A 1 206 ? 69.654 -15.120 36.764 1.00 51.04  ? 207 ARG A CB  1 
ATOM   1636 C CG  . ARG A 1 206 ? 70.879 -15.992 36.831 1.00 53.24  ? 207 ARG A CG  1 
ATOM   1637 C CD  . ARG A 1 206 ? 70.584 -17.432 36.411 1.00 54.70  ? 207 ARG A CD  1 
ATOM   1638 N NE  . ARG A 1 206 ? 71.799 -18.080 35.919 1.00 56.84  ? 207 ARG A NE  1 
ATOM   1639 C CZ  . ARG A 1 206 ? 72.025 -19.390 35.932 1.00 56.95  ? 207 ARG A CZ  1 
ATOM   1640 N NH1 . ARG A 1 206 ? 71.121 -20.226 36.417 1.00 55.50  ? 207 ARG A NH1 1 
ATOM   1641 N NH2 . ARG A 1 206 ? 73.170 -19.861 35.459 1.00 56.61  ? 207 ARG A NH2 1 
ATOM   1642 N N   . ALA A 1 207 ? 68.671 -15.002 39.795 1.00 49.08  ? 208 ALA A N   1 
ATOM   1643 C CA  . ALA A 1 207 ? 68.962 -15.181 41.215 1.00 47.27  ? 208 ALA A CA  1 
ATOM   1644 C C   . ALA A 1 207 ? 67.966 -16.196 41.800 1.00 46.79  ? 208 ALA A C   1 
ATOM   1645 O O   . ALA A 1 207 ? 68.335 -17.064 42.595 1.00 46.11  ? 208 ALA A O   1 
ATOM   1646 C CB  . ALA A 1 207 ? 68.853 -13.856 41.941 1.00 45.35  ? 208 ALA A CB  1 
ATOM   1647 N N   . ILE A 1 208 ? 66.704 -16.081 41.393 1.00 46.70  ? 209 ILE A N   1 
ATOM   1648 C CA  . ILE A 1 208 ? 65.644 -16.976 41.841 1.00 47.59  ? 209 ILE A CA  1 
ATOM   1649 C C   . ILE A 1 208 ? 65.916 -18.402 41.357 1.00 49.50  ? 209 ILE A C   1 
ATOM   1650 O O   . ILE A 1 208 ? 65.692 -19.364 42.089 1.00 50.19  ? 209 ILE A O   1 
ATOM   1651 C CB  . ILE A 1 208 ? 64.271 -16.487 41.328 1.00 46.35  ? 209 ILE A CB  1 
ATOM   1652 C CG1 . ILE A 1 208 ? 63.961 -15.110 41.926 1.00 45.57  ? 209 ILE A CG1 1 
ATOM   1653 C CG2 . ILE A 1 208 ? 63.196 -17.478 41.691 1.00 48.36  ? 209 ILE A CG2 1 
ATOM   1654 C CD1 . ILE A 1 208 ? 62.633 -14.522 41.520 1.00 43.57  ? 209 ILE A CD1 1 
ATOM   1655 N N   . GLU A 1 209 ? 66.405 -18.532 40.126 1.00 50.94  ? 210 GLU A N   1 
ATOM   1656 C CA  . GLU A 1 209 ? 66.748 -19.833 39.566 1.00 53.21  ? 210 GLU A CA  1 
ATOM   1657 C C   . GLU A 1 209 ? 67.823 -20.508 40.433 1.00 53.60  ? 210 GLU A C   1 
ATOM   1658 O O   . GLU A 1 209 ? 67.623 -21.620 40.923 1.00 53.82  ? 210 GLU A O   1 
ATOM   1659 C CB  . GLU A 1 209 ? 67.283 -19.674 38.136 1.00 55.66  ? 210 GLU A CB  1 
ATOM   1660 C CG  . GLU A 1 209 ? 66.222 -19.422 37.056 1.00 57.93  ? 210 GLU A CG  1 
ATOM   1661 C CD  . GLU A 1 209 ? 66.830 -19.001 35.706 1.00 59.02  ? 210 GLU A CD  1 
ATOM   1662 O OE1 . GLU A 1 209 ? 67.995 -19.375 35.440 1.00 59.20  ? 210 GLU A OE1 1 
ATOM   1663 O OE2 . GLU A 1 209 ? 66.144 -18.306 34.913 1.00 57.69  ? 210 GLU A OE2 1 
ATOM   1664 N N   . LEU A 1 210 ? 68.958 -19.834 40.614 1.00 53.14  ? 211 LEU A N   1 
ATOM   1665 C CA  . LEU A 1 210 ? 70.056 -20.370 41.422 1.00 53.77  ? 211 LEU A CA  1 
ATOM   1666 C C   . LEU A 1 210 ? 69.601 -20.637 42.862 1.00 54.53  ? 211 LEU A C   1 
ATOM   1667 O O   . LEU A 1 210 ? 70.149 -21.488 43.554 1.00 55.83  ? 211 LEU A O   1 
ATOM   1668 C CB  . LEU A 1 210 ? 71.217 -19.377 41.454 1.00 53.38  ? 211 LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 210 ? 71.816 -18.874 40.141 1.00 54.50  ? 211 LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 210 ? 72.659 -17.647 40.436 1.00 53.24  ? 211 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 210 ? 72.656 -19.965 39.477 1.00 53.96  ? 211 LEU A CD2 1 
ATOM   1672 N N   . LEU A 1 211 ? 68.602 -19.891 43.309 1.00 55.53  ? 212 LEU A N   1 
ATOM   1673 C CA  . LEU A 1 211 ? 68.073 -20.016 44.660 1.00 55.17  ? 212 LEU A CA  1 
ATOM   1674 C C   . LEU A 1 211 ? 67.279 -21.306 44.827 1.00 56.20  ? 212 LEU A C   1 
ATOM   1675 O O   . LEU A 1 211 ? 67.438 -22.026 45.816 1.00 55.22  ? 212 LEU A O   1 
ATOM   1676 C CB  . LEU A 1 211 ? 67.183 -18.807 44.950 1.00 55.73  ? 212 LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 211 ? 67.315 -18.027 46.264 1.00 55.88  ? 212 LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 211 ? 68.776 -17.861 46.670 1.00 53.81  ? 212 LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 211 ? 66.641 -16.665 46.078 1.00 53.63  ? 212 LEU A CD2 1 
ATOM   1680 N N   . GLU A 1 212 ? 66.416 -21.585 43.848 1.00 57.50  ? 213 GLU A N   1 
ATOM   1681 C CA  . GLU A 1 212 ? 65.576 -22.780 43.856 1.00 56.57  ? 213 GLU A CA  1 
ATOM   1682 C C   . GLU A 1 212 ? 66.453 -23.992 43.674 1.00 55.07  ? 213 GLU A C   1 
ATOM   1683 O O   . GLU A 1 212 ? 66.263 -25.010 44.310 1.00 55.32  ? 213 GLU A O   1 
ATOM   1684 C CB  . GLU A 1 212 ? 64.567 -22.719 42.711 1.00 57.62  ? 213 GLU A CB  1 
ATOM   1685 C CG  . GLU A 1 212 ? 63.685 -21.497 42.749 1.00 61.95  ? 213 GLU A CG  1 
ATOM   1686 C CD  . GLU A 1 212 ? 62.818 -21.374 41.516 1.00 65.31  ? 213 GLU A CD  1 
ATOM   1687 O OE1 . GLU A 1 212 ? 63.382 -21.431 40.403 1.00 68.95  ? 213 GLU A OE1 1 
ATOM   1688 O OE2 . GLU A 1 212 ? 61.582 -21.216 41.652 1.00 66.25  ? 213 GLU A OE2 1 
ATOM   1689 N N   . LYS A 1 213 ? 67.430 -23.860 42.791 1.00 55.76  ? 214 LYS A N   1 
ATOM   1690 C CA  . LYS A 1 213 ? 68.353 -24.933 42.492 1.00 56.14  ? 214 LYS A CA  1 
ATOM   1691 C C   . LYS A 1 213 ? 69.118 -25.393 43.738 1.00 56.98  ? 214 LYS A C   1 
ATOM   1692 O O   . LYS A 1 213 ? 69.156 -26.589 44.024 1.00 60.22  ? 214 LYS A O   1 
ATOM   1693 C CB  . LYS A 1 213 ? 69.317 -24.465 41.408 1.00 56.71  ? 214 LYS A CB  1 
ATOM   1694 C CG  . LYS A 1 213 ? 70.070 -25.568 40.705 1.00 59.54  ? 214 LYS A CG  1 
ATOM   1695 C CD  . LYS A 1 213 ? 71.050 -24.993 39.668 1.00 62.57  ? 214 LYS A CD  1 
ATOM   1696 C CE  . LYS A 1 213 ? 70.358 -24.170 38.552 1.00 60.99  ? 214 LYS A CE  1 
ATOM   1697 N NZ  . LYS A 1 213 ? 71.325 -23.675 37.513 1.00 58.30  ? 214 LYS A NZ  1 
ATOM   1698 N N   . LEU A 1 214 ? 69.718 -24.465 44.484 1.00 54.94  ? 215 LEU A N   1 
ATOM   1699 C CA  . LEU A 1 214 ? 70.473 -24.826 45.682 1.00 52.93  ? 215 LEU A CA  1 
ATOM   1700 C C   . LEU A 1 214 ? 69.605 -25.523 46.717 1.00 53.42  ? 215 LEU A C   1 
ATOM   1701 O O   . LEU A 1 214 ? 70.093 -26.321 47.519 1.00 53.39  ? 215 LEU A O   1 
ATOM   1702 C CB  . LEU A 1 214 ? 71.113 -23.590 46.302 1.00 53.13  ? 215 LEU A CB  1 
ATOM   1703 C CG  . LEU A 1 214 ? 72.298 -22.961 45.567 1.00 52.62  ? 215 LEU A CG  1 
ATOM   1704 C CD1 . LEU A 1 214 ? 72.757 -21.737 46.346 1.00 53.64  ? 215 LEU A CD1 1 
ATOM   1705 C CD2 . LEU A 1 214 ? 73.435 -23.949 45.447 1.00 51.50  ? 215 LEU A CD2 1 
ATOM   1706 N N   . GLN A 1 215 ? 68.319 -25.212 46.708 1.00 55.27  ? 216 GLN A N   1 
ATOM   1707 C CA  . GLN A 1 215 ? 67.378 -25.830 47.628 1.00 56.56  ? 216 GLN A CA  1 
ATOM   1708 C C   . GLN A 1 215 ? 67.065 -27.243 47.172 1.00 59.85  ? 216 GLN A C   1 
ATOM   1709 O O   . GLN A 1 215 ? 67.070 -28.164 47.978 1.00 60.82  ? 216 GLN A O   1 
ATOM   1710 C CB  . GLN A 1 215 ? 66.089 -25.029 47.679 1.00 55.04  ? 216 GLN A CB  1 
ATOM   1711 C CG  . GLN A 1 215 ? 66.160 -23.745 48.471 1.00 51.47  ? 216 GLN A CG  1 
ATOM   1712 C CD  . GLN A 1 215 ? 64.934 -22.879 48.249 1.00 50.89  ? 216 GLN A CD  1 
ATOM   1713 O OE1 . GLN A 1 215 ? 64.824 -22.178 47.243 1.00 49.66  ? 216 GLN A OE1 1 
ATOM   1714 N NE2 . GLN A 1 215 ? 64.000 -22.937 49.180 1.00 48.51  ? 216 GLN A NE2 1 
ATOM   1715 N N   . ARG A 1 216 ? 66.795 -27.405 45.877 1.00 64.26  ? 217 ARG A N   1 
ATOM   1716 C CA  . ARG A 1 216 ? 66.478 -28.711 45.308 1.00 68.97  ? 217 ARG A CA  1 
ATOM   1717 C C   . ARG A 1 216 ? 67.569 -29.747 45.539 1.00 70.40  ? 217 ARG A C   1 
ATOM   1718 O O   . ARG A 1 216 ? 67.275 -30.936 45.687 1.00 70.95  ? 217 ARG A O   1 
ATOM   1719 C CB  . ARG A 1 216 ? 66.185 -28.603 43.805 1.00 71.41  ? 217 ARG A CB  1 
ATOM   1720 C CG  . ARG A 1 216 ? 64.747 -28.217 43.474 1.00 77.12  ? 217 ARG A CG  1 
ATOM   1721 C CD  . ARG A 1 216 ? 64.373 -28.565 42.027 1.00 82.68  ? 217 ARG A CD  1 
ATOM   1722 N NE  . ARG A 1 216 ? 65.045 -27.734 41.017 1.00 86.44  ? 217 ARG A NE  1 
ATOM   1723 C CZ  . ARG A 1 216 ? 64.675 -26.497 40.673 1.00 87.31  ? 217 ARG A CZ  1 
ATOM   1724 N NH1 . ARG A 1 216 ? 63.624 -25.914 41.253 1.00 86.60  ? 217 ARG A NH1 1 
ATOM   1725 N NH2 . ARG A 1 216 ? 65.356 -25.836 39.738 1.00 86.73  ? 217 ARG A NH2 1 
ATOM   1726 N N   . SER A 1 217 ? 68.822 -29.308 45.571 1.00 71.50  ? 218 SER A N   1 
ATOM   1727 C CA  . SER A 1 217 ? 69.920 -30.235 45.803 1.00 74.88  ? 218 SER A CA  1 
ATOM   1728 C C   . SER A 1 217 ? 70.398 -30.158 47.256 1.00 76.79  ? 218 SER A C   1 
ATOM   1729 O O   . SER A 1 217 ? 71.595 -30.077 47.527 1.00 76.86  ? 218 SER A O   1 
ATOM   1730 C CB  . SER A 1 217 ? 71.066 -29.940 44.838 1.00 75.00  ? 218 SER A CB  1 
ATOM   1731 O OG  . SER A 1 217 ? 71.477 -28.594 44.940 1.00 76.28  ? 218 SER A OG  1 
ATOM   1732 N N   . GLY A 1 218 ? 69.433 -30.200 48.173 1.00 79.59  ? 219 GLY A N   1 
ATOM   1733 C CA  . GLY A 1 218 ? 69.685 -30.135 49.608 1.00 82.13  ? 219 GLY A CA  1 
ATOM   1734 C C   . GLY A 1 218 ? 71.121 -30.282 50.090 1.00 84.53  ? 219 GLY A C   1 
ATOM   1735 O O   . GLY A 1 218 ? 71.574 -31.379 50.421 1.00 85.20  ? 219 GLY A O   1 
ATOM   1736 N N   . GLU A 1 219 ? 71.843 -29.171 50.144 1.00 86.81  ? 220 GLU A N   1 
ATOM   1737 C CA  . GLU A 1 219 ? 73.226 -29.197 50.597 1.00 88.20  ? 220 GLU A CA  1 
ATOM   1738 C C   . GLU A 1 219 ? 73.628 -27.927 51.331 1.00 89.10  ? 220 GLU A C   1 
ATOM   1739 O O   . GLU A 1 219 ? 74.780 -27.773 51.724 1.00 88.83  ? 220 GLU A O   1 
ATOM   1740 C CB  . GLU A 1 219 ? 74.164 -29.395 49.411 1.00 88.76  ? 220 GLU A CB  1 
ATOM   1741 C CG  . GLU A 1 219 ? 74.096 -30.757 48.769 1.00 89.53  ? 220 GLU A CG  1 
ATOM   1742 C CD  . GLU A 1 219 ? 75.220 -30.972 47.776 1.00 90.05  ? 220 GLU A CD  1 
ATOM   1743 O OE1 . GLU A 1 219 ? 75.300 -32.074 47.195 1.00 90.82  ? 220 GLU A OE1 1 
ATOM   1744 O OE2 . GLU A 1 219 ? 76.027 -30.038 47.576 1.00 89.44  ? 220 GLU A OE2 1 
ATOM   1745 N N   . VAL A 1 220 ? 72.683 -27.015 51.523 1.00 89.95  ? 221 VAL A N   1 
ATOM   1746 C CA  . VAL A 1 220 ? 72.994 -25.774 52.198 1.00 91.09  ? 221 VAL A CA  1 
ATOM   1747 C C   . VAL A 1 220 ? 72.497 -25.774 53.647 1.00 92.02  ? 221 VAL A C   1 
ATOM   1748 O O   . VAL A 1 220 ? 73.299 -25.730 54.579 1.00 91.93  ? 221 VAL A O   1 
ATOM   1749 C CB  . VAL A 1 220 ? 72.409 -24.572 51.420 1.00 92.72  ? 221 VAL A CB  1 
ATOM   1750 C CG1 . VAL A 1 220 ? 73.075 -23.274 51.875 1.00 93.85  ? 221 VAL A CG1 1 
ATOM   1751 C CG2 . VAL A 1 220 ? 72.618 -24.781 49.926 1.00 93.06  ? 221 VAL A CG2 1 
ATOM   1752 N N   . PRO A 1 221 ? 71.174 -25.841 53.868 1.00 92.78  ? 222 PRO A N   1 
ATOM   1753 C CA  . PRO A 1 221 ? 70.017 -25.875 52.974 1.00 91.55  ? 222 PRO A CA  1 
ATOM   1754 C C   . PRO A 1 221 ? 68.941 -24.954 53.581 1.00 90.84  ? 222 PRO A C   1 
ATOM   1755 O O   . PRO A 1 221 ? 67.738 -25.229 53.514 1.00 88.28  ? 222 PRO A O   1 
ATOM   1756 C CB  . PRO A 1 221 ? 69.619 -27.344 53.057 1.00 94.01  ? 222 PRO A CB  1 
ATOM   1757 C CG  . PRO A 1 221 ? 69.939 -27.701 54.561 1.00 94.93  ? 222 PRO A CG  1 
ATOM   1758 C CD  . PRO A 1 221 ? 70.815 -26.538 55.105 1.00 94.05  ? 222 PRO A CD  1 
ATOM   1759 N N   . PRO A 1 222 ? 69.382 -23.833 54.175 1.00 90.88  ? 223 PRO A N   1 
ATOM   1760 C CA  . PRO A 1 222 ? 68.552 -22.817 54.826 1.00 88.70  ? 223 PRO A CA  1 
ATOM   1761 C C   . PRO A 1 222 ? 67.146 -22.545 54.333 1.00 85.71  ? 223 PRO A C   1 
ATOM   1762 O O   . PRO A 1 222 ? 66.716 -22.962 53.256 1.00 84.25  ? 223 PRO A O   1 
ATOM   1763 C CB  . PRO A 1 222 ? 69.420 -21.562 54.745 1.00 89.69  ? 223 PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 222 ? 70.769 -22.106 54.914 1.00 91.24  ? 223 PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 222 ? 70.746 -23.303 53.996 1.00 91.13  ? 223 PRO A CD  1 
ATOM   1766 N N   . GLN A 1 223 ? 66.440 -21.833 55.197 1.00 81.70  ? 224 GLN A N   1 
ATOM   1767 C CA  . GLN A 1 223 ? 65.098 -21.391 54.953 1.00 76.90  ? 224 GLN A CA  1 
ATOM   1768 C C   . GLN A 1 223 ? 65.395 -20.016 54.412 1.00 73.52  ? 224 GLN A C   1 
ATOM   1769 O O   . GLN A 1 223 ? 64.516 -19.322 53.918 1.00 73.54  ? 224 GLN A O   1 
ATOM   1770 C CB  . GLN A 1 223 ? 64.331 -21.287 56.270 1.00 78.41  ? 224 GLN A CB  1 
ATOM   1771 C CG  . GLN A 1 223 ? 63.959 -22.626 56.906 1.00 80.71  ? 224 GLN A CG  1 
ATOM   1772 C CD  . GLN A 1 223 ? 65.108 -23.314 57.629 1.00 81.61  ? 224 GLN A CD  1 
ATOM   1773 O OE1 . GLN A 1 223 ? 66.205 -23.494 57.077 1.00 79.97  ? 224 GLN A OE1 1 
ATOM   1774 N NE2 . GLN A 1 223 ? 64.849 -23.723 58.874 1.00 81.64  ? 224 GLN A NE2 1 
ATOM   1775 N N   . LYS A 1 224 ? 66.666 -19.636 54.517 1.00 69.02  ? 225 LYS A N   1 
ATOM   1776 C CA  . LYS A 1 224 ? 67.118 -18.341 54.045 1.00 64.42  ? 225 LYS A CA  1 
ATOM   1777 C C   . LYS A 1 224 ? 66.983 -18.253 52.535 1.00 61.68  ? 225 LYS A C   1 
ATOM   1778 O O   . LYS A 1 224 ? 66.516 -17.252 52.007 1.00 60.97  ? 225 LYS A O   1 
ATOM   1779 C CB  . LYS A 1 224 ? 68.570 -18.096 54.462 1.00 64.47  ? 225 LYS A CB  1 
ATOM   1780 C CG  . LYS A 1 224 ? 68.782 -17.991 55.965 1.00 64.15  ? 225 LYS A CG  1 
ATOM   1781 C CD  . LYS A 1 224 ? 70.098 -17.308 56.283 1.00 64.84  ? 225 LYS A CD  1 
ATOM   1782 C CE  . LYS A 1 224 ? 70.396 -17.309 57.770 1.00 65.00  ? 225 LYS A CE  1 
ATOM   1783 N NZ  . LYS A 1 224 ? 69.289 -16.735 58.567 1.00 65.55  ? 225 LYS A NZ  1 
ATOM   1784 N N   . LEU A 1 225 ? 67.396 -19.308 51.841 1.00 59.78  ? 226 LEU A N   1 
ATOM   1785 C CA  . LEU A 1 225 ? 67.297 -19.343 50.388 1.00 56.86  ? 226 LEU A CA  1 
ATOM   1786 C C   . LEU A 1 225 ? 65.823 -19.250 50.043 1.00 56.03  ? 226 LEU A C   1 
ATOM   1787 O O   . LEU A 1 225 ? 65.414 -18.457 49.202 1.00 56.62  ? 226 LEU A O   1 
ATOM   1788 C CB  . LEU A 1 225 ? 67.888 -20.643 49.838 1.00 54.76  ? 226 LEU A CB  1 
ATOM   1789 C CG  . LEU A 1 225 ? 69.414 -20.764 49.869 1.00 54.70  ? 226 LEU A CG  1 
ATOM   1790 C CD1 . LEU A 1 225 ? 69.893 -20.829 51.295 1.00 56.38  ? 226 LEU A CD1 1 
ATOM   1791 C CD2 . LEU A 1 225 ? 69.854 -22.007 49.135 1.00 55.11  ? 226 LEU A CD2 1 
ATOM   1792 N N   . GLN A 1 226 ? 65.027 -20.066 50.718 1.00 55.29  ? 227 GLN A N   1 
ATOM   1793 C CA  . GLN A 1 226 ? 63.585 -20.077 50.518 1.00 54.74  ? 227 GLN A CA  1 
ATOM   1794 C C   . GLN A 1 226 ? 63.016 -18.674 50.741 1.00 54.84  ? 227 GLN A C   1 
ATOM   1795 O O   . GLN A 1 226 ? 62.322 -18.120 49.894 1.00 54.84  ? 227 GLN A O   1 
ATOM   1796 C CB  . GLN A 1 226 ? 62.956 -21.063 51.500 1.00 55.61  ? 227 GLN A CB  1 
ATOM   1797 C CG  . GLN A 1 226 ? 61.458 -20.988 51.588 1.00 59.56  ? 227 GLN A CG  1 
ATOM   1798 C CD  . GLN A 1 226 ? 60.774 -21.397 50.300 1.00 63.19  ? 227 GLN A CD  1 
ATOM   1799 O OE1 . GLN A 1 226 ? 59.541 -21.380 50.212 1.00 64.42  ? 227 GLN A OE1 1 
ATOM   1800 N NE2 . GLN A 1 226 ? 61.566 -21.770 49.287 1.00 64.42  ? 227 GLN A NE2 1 
ATOM   1801 N N   . ALA A 1 227 ? 63.337 -18.101 51.893 1.00 54.55  ? 228 ALA A N   1 
ATOM   1802 C CA  . ALA A 1 227 ? 62.882 -16.770 52.259 1.00 52.75  ? 228 ALA A CA  1 
ATOM   1803 C C   . ALA A 1 227 ? 63.266 -15.719 51.234 1.00 52.52  ? 228 ALA A C   1 
ATOM   1804 O O   . ALA A 1 227 ? 62.438 -14.883 50.868 1.00 51.96  ? 228 ALA A O   1 
ATOM   1805 C CB  . ALA A 1 227 ? 63.451 -16.392 53.610 1.00 52.77  ? 228 ALA A CB  1 
ATOM   1806 N N   . LEU A 1 228 ? 64.521 -15.739 50.787 1.00 51.47  ? 229 LEU A N   1 
ATOM   1807 C CA  . LEU A 1 228 ? 64.958 -14.755 49.811 1.00 51.03  ? 229 LEU A CA  1 
ATOM   1808 C C   . LEU A 1 228 ? 64.251 -15.010 48.504 1.00 53.37  ? 229 LEU A C   1 
ATOM   1809 O O   . LEU A 1 228 ? 63.883 -14.064 47.794 1.00 53.07  ? 229 LEU A O   1 
ATOM   1810 C CB  . LEU A 1 228 ? 66.469 -14.808 49.593 1.00 48.57  ? 229 LEU A CB  1 
ATOM   1811 C CG  . LEU A 1 228 ? 67.030 -13.743 48.637 1.00 44.69  ? 229 LEU A CG  1 
ATOM   1812 C CD1 . LEU A 1 228 ? 66.548 -12.394 49.096 1.00 45.33  ? 229 LEU A CD1 1 
ATOM   1813 C CD2 . LEU A 1 228 ? 68.549 -13.763 48.603 1.00 39.59  ? 229 LEU A CD2 1 
ATOM   1814 N N   . GLN A 1 229 ? 64.048 -16.286 48.180 1.00 54.52  ? 230 GLN A N   1 
ATOM   1815 C CA  . GLN A 1 229 ? 63.359 -16.624 46.944 1.00 55.83  ? 230 GLN A CA  1 
ATOM   1816 C C   . GLN A 1 229 ? 61.920 -16.115 47.020 1.00 55.20  ? 230 GLN A C   1 
ATOM   1817 O O   . GLN A 1 229 ? 61.349 -15.681 46.034 1.00 53.61  ? 230 GLN A O   1 
ATOM   1818 C CB  . GLN A 1 229 ? 63.365 -18.129 46.713 1.00 58.43  ? 230 GLN A CB  1 
ATOM   1819 C CG  . GLN A 1 229 ? 62.775 -18.508 45.364 1.00 61.32  ? 230 GLN A CG  1 
ATOM   1820 C CD  . GLN A 1 229 ? 61.968 -19.770 45.422 1.00 61.21  ? 230 GLN A CD  1 
ATOM   1821 O OE1 . GLN A 1 229 ? 62.513 -20.855 45.608 1.00 62.68  ? 230 GLN A OE1 1 
ATOM   1822 N NE2 . GLN A 1 229 ? 60.651 -19.636 45.277 1.00 60.77  ? 230 GLN A NE2 1 
ATOM   1823 N N   . ARG A 1 230 ? 61.344 -16.166 48.211 1.00 56.93  ? 231 ARG A N   1 
ATOM   1824 C CA  . ARG A 1 230 ? 59.987 -15.679 48.413 1.00 58.47  ? 231 ARG A CA  1 
ATOM   1825 C C   . ARG A 1 230 ? 59.901 -14.148 48.391 1.00 57.92  ? 231 ARG A C   1 
ATOM   1826 O O   . ARG A 1 230 ? 58.895 -13.588 47.956 1.00 58.62  ? 231 ARG A O   1 
ATOM   1827 C CB  . ARG A 1 230 ? 59.427 -16.206 49.733 1.00 61.19  ? 231 ARG A CB  1 
ATOM   1828 C CG  . ARG A 1 230 ? 59.160 -17.698 49.724 1.00 68.55  ? 231 ARG A CG  1 
ATOM   1829 C CD  . ARG A 1 230 ? 58.279 -18.071 50.886 1.00 72.63  ? 231 ARG A CD  1 
ATOM   1830 N NE  . ARG A 1 230 ? 57.064 -17.265 50.876 1.00 76.47  ? 231 ARG A NE  1 
ATOM   1831 C CZ  . ARG A 1 230 ? 56.438 -16.868 51.977 1.00 79.63  ? 231 ARG A CZ  1 
ATOM   1832 N NH1 . ARG A 1 230 ? 56.928 -17.210 53.166 1.00 81.72  ? 231 ARG A NH1 1 
ATOM   1833 N NH2 . ARG A 1 230 ? 55.330 -16.134 51.888 1.00 80.27  ? 231 ARG A NH2 1 
ATOM   1834 N N   . VAL A 1 231 ? 60.940 -13.468 48.869 1.00 55.43  ? 232 VAL A N   1 
ATOM   1835 C CA  . VAL A 1 231 ? 60.928 -12.015 48.861 1.00 52.51  ? 232 VAL A CA  1 
ATOM   1836 C C   . VAL A 1 231 ? 61.082 -11.534 47.433 1.00 49.71  ? 232 VAL A C   1 
ATOM   1837 O O   . VAL A 1 231 ? 60.438 -10.569 47.042 1.00 47.84  ? 232 VAL A O   1 
ATOM   1838 C CB  . VAL A 1 231 ? 62.063 -11.416 49.710 1.00 53.52  ? 232 VAL A CB  1 
ATOM   1839 C CG1 . VAL A 1 231 ? 63.384 -11.780 49.121 1.00 56.96  ? 232 VAL A CG1 1 
ATOM   1840 C CG2 . VAL A 1 231 ? 61.946 -9.914  49.761 1.00 52.64  ? 232 VAL A CG2 1 
ATOM   1841 N N   . LEU A 1 232 ? 61.923 -12.219 46.654 1.00 48.56  ? 233 LEU A N   1 
ATOM   1842 C CA  . LEU A 1 232 ? 62.155 -11.846 45.253 1.00 46.96  ? 233 LEU A CA  1 
ATOM   1843 C C   . LEU A 1 232 ? 60.972 -12.132 44.331 1.00 46.76  ? 233 LEU A C   1 
ATOM   1844 O O   . LEU A 1 232 ? 60.794 -11.457 43.314 1.00 47.81  ? 233 LEU A O   1 
ATOM   1845 C CB  . LEU A 1 232 ? 63.395 -12.543 44.704 1.00 43.81  ? 233 LEU A CB  1 
ATOM   1846 C CG  . LEU A 1 232 ? 64.726 -12.031 45.238 1.00 42.61  ? 233 LEU A CG  1 
ATOM   1847 C CD1 . LEU A 1 232 ? 65.869 -12.736 44.536 1.00 39.98  ? 233 LEU A CD1 1 
ATOM   1848 C CD2 . LEU A 1 232 ? 64.799 -10.529 45.022 1.00 41.27  ? 233 LEU A CD2 1 
ATOM   1849 N N   . GLN A 1 233 ? 60.165 -13.123 44.686 1.00 46.60  ? 234 GLN A N   1 
ATOM   1850 C CA  . GLN A 1 233 ? 59.001 -13.452 43.891 1.00 47.07  ? 234 GLN A CA  1 
ATOM   1851 C C   . GLN A 1 233 ? 57.834 -12.660 44.433 1.00 47.58  ? 234 GLN A C   1 
ATOM   1852 O O   . GLN A 1 233 ? 56.797 -12.561 43.802 1.00 48.98  ? 234 GLN A O   1 
ATOM   1853 C CB  . GLN A 1 233 ? 58.706 -14.944 43.968 1.00 48.03  ? 234 GLN A CB  1 
ATOM   1854 C CG  . GLN A 1 233 ? 59.839 -15.813 43.432 1.00 50.32  ? 234 GLN A CG  1 
ATOM   1855 C CD  . GLN A 1 233 ? 59.496 -17.298 43.415 1.00 52.05  ? 234 GLN A CD  1 
ATOM   1856 O OE1 . GLN A 1 233 ? 59.079 -17.862 44.424 1.00 51.38  ? 234 GLN A OE1 1 
ATOM   1857 N NE2 . GLN A 1 233 ? 59.685 -17.938 42.267 1.00 52.11  ? 234 GLN A NE2 1 
ATOM   1858 N N   . SER A 1 234 ? 58.032 -12.097 45.619 1.00 47.80  ? 235 SER A N   1 
ATOM   1859 C CA  . SER A 1 234 ? 57.044 -11.285 46.323 1.00 48.25  ? 235 SER A CA  1 
ATOM   1860 C C   . SER A 1 234 ? 56.303 -10.347 45.374 1.00 48.58  ? 235 SER A C   1 
ATOM   1861 O O   . SER A 1 234 ? 56.942 -9.637  44.596 1.00 48.83  ? 235 SER A O   1 
ATOM   1862 C CB  . SER A 1 234 ? 57.772 -10.465 47.396 1.00 48.64  ? 235 SER A CB  1 
ATOM   1863 O OG  . SER A 1 234 ? 56.894 -9.634  48.138 1.00 53.82  ? 235 SER A OG  1 
ATOM   1864 N N   . GLU A 1 235 ? 54.972 -10.311 45.434 1.00 48.56  ? 236 GLU A N   1 
ATOM   1865 C CA  . GLU A 1 235 ? 54.258 -9.414  44.522 1.00 50.43  ? 236 GLU A CA  1 
ATOM   1866 C C   . GLU A 1 235 ? 54.420 -7.945  44.919 1.00 47.46  ? 236 GLU A C   1 
ATOM   1867 O O   . GLU A 1 235 ? 54.043 -7.043  44.175 1.00 46.63  ? 236 GLU A O   1 
ATOM   1868 C CB  . GLU A 1 235 ? 52.774 -9.792  44.396 1.00 55.37  ? 236 GLU A CB  1 
ATOM   1869 C CG  . GLU A 1 235 ? 51.857 -9.251  45.470 1.00 64.58  ? 236 GLU A CG  1 
ATOM   1870 C CD  . GLU A 1 235 ? 50.385 -9.542  45.157 1.00 70.54  ? 236 GLU A CD  1 
ATOM   1871 O OE1 . GLU A 1 235 ? 50.049 -10.743 45.006 1.00 72.72  ? 236 GLU A OE1 1 
ATOM   1872 O OE2 . GLU A 1 235 ? 49.571 -8.581  45.052 1.00 72.46  ? 236 GLU A OE2 1 
ATOM   1873 N N   . PHE A 1 236 ? 54.989 -7.726  46.103 1.00 44.98  ? 237 PHE A N   1 
ATOM   1874 C CA  . PHE A 1 236 ? 55.279 -6.389  46.619 1.00 39.90  ? 237 PHE A CA  1 
ATOM   1875 C C   . PHE A 1 236 ? 56.623 -5.990  46.026 1.00 38.13  ? 237 PHE A C   1 
ATOM   1876 O O   . PHE A 1 236 ? 56.818 -4.863  45.579 1.00 37.18  ? 237 PHE A O   1 
ATOM   1877 C CB  . PHE A 1 236 ? 55.395 -6.403  48.142 1.00 38.75  ? 237 PHE A CB  1 
ATOM   1878 C CG  . PHE A 1 236 ? 56.092 -5.191  48.699 1.00 37.80  ? 237 PHE A CG  1 
ATOM   1879 C CD1 . PHE A 1 236 ? 55.401 -4.003  48.880 1.00 36.72  ? 237 PHE A CD1 1 
ATOM   1880 C CD2 . PHE A 1 236 ? 57.462 -5.227  48.990 1.00 36.22  ? 237 PHE A CD2 1 
ATOM   1881 C CE1 . PHE A 1 236 ? 56.064 -2.864  49.336 1.00 36.75  ? 237 PHE A CE1 1 
ATOM   1882 C CE2 . PHE A 1 236 ? 58.128 -4.099  49.444 1.00 34.54  ? 237 PHE A CE2 1 
ATOM   1883 C CZ  . PHE A 1 236 ? 57.429 -2.913  49.617 1.00 35.23  ? 237 PHE A CZ  1 
ATOM   1884 N N   . CYS A 1 237 ? 57.557 -6.931  46.042 1.00 36.50  ? 238 CYS A N   1 
ATOM   1885 C CA  . CYS A 1 237 ? 58.875 -6.700  45.479 1.00 37.63  ? 238 CYS A CA  1 
ATOM   1886 C C   . CYS A 1 237 ? 58.744 -6.454  43.978 1.00 39.42  ? 238 CYS A C   1 
ATOM   1887 O O   . CYS A 1 237 ? 59.472 -5.646  43.398 1.00 40.38  ? 238 CYS A O   1 
ATOM   1888 C CB  . CYS A 1 237 ? 59.761 -7.915  45.726 1.00 35.04  ? 238 CYS A CB  1 
ATOM   1889 S SG  . CYS A 1 237 ? 61.444 -7.747  45.103 1.00 37.40  ? 238 CYS A SG  1 
ATOM   1890 N N   . ASN A 1 238 ? 57.807 -7.166  43.354 1.00 41.33  ? 239 ASN A N   1 
ATOM   1891 C CA  . ASN A 1 238 ? 57.534 -7.031  41.922 1.00 40.92  ? 239 ASN A CA  1 
ATOM   1892 C C   . ASN A 1 238 ? 56.981 -5.642  41.671 1.00 39.00  ? 239 ASN A C   1 
ATOM   1893 O O   . ASN A 1 238 ? 57.293 -5.004  40.678 1.00 38.08  ? 239 ASN A O   1 
ATOM   1894 C CB  . ASN A 1 238 ? 56.501 -8.071  41.479 1.00 43.51  ? 239 ASN A CB  1 
ATOM   1895 C CG  . ASN A 1 238 ? 57.133 -9.385  41.018 1.00 47.06  ? 239 ASN A CG  1 
ATOM   1896 O OD1 . ASN A 1 238 ? 56.434 -10.384 40.836 1.00 48.58  ? 239 ASN A OD1 1 
ATOM   1897 N ND2 . ASN A 1 238 ? 58.454 -9.386  40.820 1.00 47.72  ? 239 ASN A ND2 1 
ATOM   1898 N N   . ALA A 1 239 ? 56.142 -5.194  42.597 1.00 39.12  ? 240 ALA A N   1 
ATOM   1899 C CA  . ALA A 1 239 ? 55.529 -3.882  42.531 1.00 38.24  ? 240 ALA A CA  1 
ATOM   1900 C C   . ALA A 1 239 ? 56.598 -2.792  42.592 1.00 39.33  ? 240 ALA A C   1 
ATOM   1901 O O   . ALA A 1 239 ? 56.527 -1.802  41.868 1.00 39.44  ? 240 ALA A O   1 
ATOM   1902 C CB  . ALA A 1 239 ? 54.543 -3.731  43.672 1.00 33.98  ? 240 ALA A CB  1 
ATOM   1903 N N   . VAL A 1 240 ? 57.597 -2.984  43.449 1.00 41.16  ? 241 VAL A N   1 
ATOM   1904 C CA  . VAL A 1 240 ? 58.684 -2.014  43.584 1.00 44.11  ? 241 VAL A CA  1 
ATOM   1905 C C   . VAL A 1 240 ? 59.404 -1.790  42.272 1.00 46.63  ? 241 VAL A C   1 
ATOM   1906 O O   . VAL A 1 240 ? 59.787 -0.662  41.972 1.00 47.18  ? 241 VAL A O   1 
ATOM   1907 C CB  . VAL A 1 240 ? 59.756 -2.450  44.634 1.00 43.46  ? 241 VAL A CB  1 
ATOM   1908 C CG1 . VAL A 1 240 ? 60.956 -1.514  44.570 1.00 39.10  ? 241 VAL A CG1 1 
ATOM   1909 C CG2 . VAL A 1 240 ? 59.158 -2.439  46.050 1.00 40.27  ? 241 VAL A CG2 1 
ATOM   1910 N N   . ARG A 1 241 ? 59.597 -2.866  41.508 1.00 49.16  ? 242 ARG A N   1 
ATOM   1911 C CA  . ARG A 1 241 ? 60.276 -2.790  40.221 1.00 49.23  ? 242 ARG A CA  1 
ATOM   1912 C C   . ARG A 1 241 ? 59.409 -2.184  39.124 1.00 50.23  ? 242 ARG A C   1 
ATOM   1913 O O   . ARG A 1 241 ? 59.938 -1.573  38.198 1.00 51.17  ? 242 ARG A O   1 
ATOM   1914 C CB  . ARG A 1 241 ? 60.754 -4.168  39.792 1.00 49.18  ? 242 ARG A CB  1 
ATOM   1915 C CG  . ARG A 1 241 ? 61.806 -4.748  40.697 1.00 51.41  ? 242 ARG A CG  1 
ATOM   1916 C CD  . ARG A 1 241 ? 62.358 -6.074  40.168 1.00 54.23  ? 242 ARG A CD  1 
ATOM   1917 N NE  . ARG A 1 241 ? 61.315 -7.087  39.994 1.00 57.19  ? 242 ARG A NE  1 
ATOM   1918 C CZ  . ARG A 1 241 ? 60.543 -7.213  38.918 1.00 56.34  ? 242 ARG A CZ  1 
ATOM   1919 N NH1 . ARG A 1 241 ? 60.685 -6.398  37.893 1.00 57.06  ? 242 ARG A NH1 1 
ATOM   1920 N NH2 . ARG A 1 241 ? 59.611 -8.150  38.876 1.00 56.56  ? 242 ARG A NH2 1 
ATOM   1921 N N   . GLU A 1 242 ? 58.089 -2.354  39.210 1.00 50.90  ? 243 GLU A N   1 
ATOM   1922 C CA  . GLU A 1 242 ? 57.209 -1.768  38.200 1.00 53.05  ? 243 GLU A CA  1 
ATOM   1923 C C   . GLU A 1 242 ? 57.294 -0.271  38.357 1.00 51.12  ? 243 GLU A C   1 
ATOM   1924 O O   . GLU A 1 242 ? 57.524 0.458   37.401 1.00 50.99  ? 243 GLU A O   1 
ATOM   1925 C CB  . GLU A 1 242 ? 55.755 -2.196  38.384 1.00 56.23  ? 243 GLU A CB  1 
ATOM   1926 C CG  . GLU A 1 242 ? 55.503 -3.668  38.180 1.00 66.10  ? 243 GLU A CG  1 
ATOM   1927 C CD  . GLU A 1 242 ? 54.042 -3.957  37.897 1.00 71.90  ? 243 GLU A CD  1 
ATOM   1928 O OE1 . GLU A 1 242 ? 53.180 -3.349  38.575 1.00 74.19  ? 243 GLU A OE1 1 
ATOM   1929 O OE2 . GLU A 1 242 ? 53.754 -4.790  37.002 1.00 75.64  ? 243 GLU A OE2 1 
ATOM   1930 N N   . VAL A 1 243 ? 57.103 0.175   39.591 1.00 48.51  ? 244 VAL A N   1 
ATOM   1931 C CA  . VAL A 1 243 ? 57.171 1.582   39.915 1.00 45.12  ? 244 VAL A CA  1 
ATOM   1932 C C   . VAL A 1 243 ? 58.527 2.171   39.525 1.00 44.96  ? 244 VAL A C   1 
ATOM   1933 O O   . VAL A 1 243 ? 58.629 3.364   39.257 1.00 45.24  ? 244 VAL A O   1 
ATOM   1934 C CB  . VAL A 1 243 ? 56.932 1.789   41.406 1.00 42.72  ? 244 VAL A CB  1 
ATOM   1935 C CG1 . VAL A 1 243 ? 56.982 3.268   41.751 1.00 41.40  ? 244 VAL A CG1 1 
ATOM   1936 C CG2 . VAL A 1 243 ? 55.594 1.217   41.773 1.00 39.81  ? 244 VAL A CG2 1 
ATOM   1937 N N   . TYR A 1 244 ? 59.566 1.335   39.491 1.00 45.26  ? 245 TYR A N   1 
ATOM   1938 C CA  . TYR A 1 244 ? 60.906 1.786   39.122 1.00 44.32  ? 245 TYR A CA  1 
ATOM   1939 C C   . TYR A 1 244 ? 60.985 1.979   37.619 1.00 47.05  ? 245 TYR A C   1 
ATOM   1940 O O   . TYR A 1 244 ? 61.599 2.931   37.135 1.00 46.86  ? 245 TYR A O   1 
ATOM   1941 C CB  . TYR A 1 244 ? 61.957 0.769   39.547 1.00 39.51  ? 245 TYR A CB  1 
ATOM   1942 C CG  . TYR A 1 244 ? 63.353 1.135   39.069 1.00 38.56  ? 245 TYR A CG  1 
ATOM   1943 C CD1 . TYR A 1 244 ? 63.961 2.322   39.483 1.00 37.99  ? 245 TYR A CD1 1 
ATOM   1944 C CD2 . TYR A 1 244 ? 64.065 0.309   38.190 1.00 34.42  ? 245 TYR A CD2 1 
ATOM   1945 C CE1 . TYR A 1 244 ? 65.225 2.664   39.041 1.00 33.87  ? 245 TYR A CE1 1 
ATOM   1946 C CE2 . TYR A 1 244 ? 65.323 0.653   37.746 1.00 29.71  ? 245 TYR A CE2 1 
ATOM   1947 C CZ  . TYR A 1 244 ? 65.889 1.825   38.175 1.00 32.26  ? 245 TYR A CZ  1 
ATOM   1948 O OH  . TYR A 1 244 ? 67.127 2.181   37.748 1.00 31.33  ? 245 TYR A OH  1 
ATOM   1949 N N   . GLU A 1 245 ? 60.369 1.052   36.887 1.00 51.10  ? 246 GLU A N   1 
ATOM   1950 C CA  . GLU A 1 245 ? 60.321 1.095   35.424 1.00 53.55  ? 246 GLU A CA  1 
ATOM   1951 C C   . GLU A 1 245 ? 59.788 2.442   34.954 1.00 52.65  ? 246 GLU A C   1 
ATOM   1952 O O   . GLU A 1 245 ? 60.370 3.080   34.083 1.00 53.14  ? 246 GLU A O   1 
ATOM   1953 C CB  . GLU A 1 245 ? 59.406 -0.007  34.895 1.00 58.12  ? 246 GLU A CB  1 
ATOM   1954 C CG  . GLU A 1 245 ? 58.744 0.334   33.567 1.00 65.03  ? 246 GLU A CG  1 
ATOM   1955 C CD  . GLU A 1 245 ? 57.638 -0.642  33.193 1.00 69.62  ? 246 GLU A CD  1 
ATOM   1956 O OE1 . GLU A 1 245 ? 56.967 -0.409  32.156 1.00 71.94  ? 246 GLU A OE1 1 
ATOM   1957 O OE2 . GLU A 1 245 ? 57.445 -1.638  33.935 1.00 70.35  ? 246 GLU A OE2 1 
ATOM   1958 N N   . HIS A 1 246 ? 58.671 2.859   35.542 1.00 50.94  ? 247 HIS A N   1 
ATOM   1959 C CA  . HIS A 1 246 ? 58.042 4.124   35.209 1.00 49.39  ? 247 HIS A CA  1 
ATOM   1960 C C   . HIS A 1 246 ? 58.937 5.300   35.538 1.00 49.23  ? 247 HIS A C   1 
ATOM   1961 O O   . HIS A 1 246 ? 59.101 6.208   34.726 1.00 49.66  ? 247 HIS A O   1 
ATOM   1962 C CB  . HIS A 1 246 ? 56.720 4.274   35.947 1.00 48.99  ? 247 HIS A CB  1 
ATOM   1963 C CG  . HIS A 1 246 ? 55.732 3.196   35.634 1.00 52.17  ? 247 HIS A CG  1 
ATOM   1964 N ND1 . HIS A 1 246 ? 55.782 1.950   36.218 1.00 54.28  ? 247 HIS A ND1 1 
ATOM   1965 C CD2 . HIS A 1 246 ? 54.692 3.163   34.768 1.00 52.38  ? 247 HIS A CD2 1 
ATOM   1966 C CE1 . HIS A 1 246 ? 54.817 1.194   35.723 1.00 55.63  ? 247 HIS A CE1 1 
ATOM   1967 N NE2 . HIS A 1 246 ? 54.141 1.907   34.840 1.00 54.84  ? 247 HIS A NE2 1 
ATOM   1968 N N   . VAL A 1 247 ? 59.527 5.296   36.724 1.00 48.19  ? 248 VAL A N   1 
ATOM   1969 C CA  . VAL A 1 247 ? 60.405 6.399   37.086 1.00 48.12  ? 248 VAL A CA  1 
ATOM   1970 C C   . VAL A 1 247 ? 61.614 6.499   36.153 1.00 51.05  ? 248 VAL A C   1 
ATOM   1971 O O   . VAL A 1 247 ? 62.082 7.603   35.855 1.00 51.54  ? 248 VAL A O   1 
ATOM   1972 C CB  . VAL A 1 247 ? 60.917 6.272   38.537 1.00 45.42  ? 248 VAL A CB  1 
ATOM   1973 C CG1 . VAL A 1 247 ? 61.876 7.410   38.855 1.00 42.83  ? 248 VAL A CG1 1 
ATOM   1974 C CG2 . VAL A 1 247 ? 59.757 6.289   39.488 1.00 44.12  ? 248 VAL A CG2 1 
ATOM   1975 N N   . TYR A 1 248 ? 62.106 5.349   35.690 1.00 51.02  ? 249 TYR A N   1 
ATOM   1976 C CA  . TYR A 1 248 ? 63.268 5.291   34.813 1.00 51.64  ? 249 TYR A CA  1 
ATOM   1977 C C   . TYR A 1 248 ? 62.986 5.873   33.434 1.00 53.07  ? 249 TYR A C   1 
ATOM   1978 O O   . TYR A 1 248 ? 63.910 6.267   32.721 1.00 51.24  ? 249 TYR A O   1 
ATOM   1979 C CB  . TYR A 1 248 ? 63.732 3.845   34.667 1.00 50.42  ? 249 TYR A CB  1 
ATOM   1980 C CG  . TYR A 1 248 ? 65.051 3.699   33.960 1.00 49.50  ? 249 TYR A CG  1 
ATOM   1981 C CD1 . TYR A 1 248 ? 66.234 4.087   34.578 1.00 49.71  ? 249 TYR A CD1 1 
ATOM   1982 C CD2 . TYR A 1 248 ? 65.121 3.150   32.682 1.00 49.37  ? 249 TYR A CD2 1 
ATOM   1983 C CE1 . TYR A 1 248 ? 67.461 3.930   33.945 1.00 51.16  ? 249 TYR A CE1 1 
ATOM   1984 C CE2 . TYR A 1 248 ? 66.337 2.982   32.036 1.00 49.67  ? 249 TYR A CE2 1 
ATOM   1985 C CZ  . TYR A 1 248 ? 67.509 3.373   32.673 1.00 51.89  ? 249 TYR A CZ  1 
ATOM   1986 O OH  . TYR A 1 248 ? 68.733 3.191   32.059 1.00 53.57  ? 249 TYR A OH  1 
ATOM   1987 N N   . GLU A 1 249 ? 61.711 5.904   33.066 1.00 55.51  ? 250 GLU A N   1 
ATOM   1988 C CA  . GLU A 1 249 ? 61.294 6.441   31.777 1.00 58.83  ? 250 GLU A CA  1 
ATOM   1989 C C   . GLU A 1 249 ? 61.058 7.938   31.844 1.00 59.43  ? 250 GLU A C   1 
ATOM   1990 O O   . GLU A 1 249 ? 61.607 8.703   31.048 1.00 60.85  ? 250 GLU A O   1 
ATOM   1991 C CB  . GLU A 1 249 ? 59.993 5.794   31.315 1.00 61.08  ? 250 GLU A CB  1 
ATOM   1992 C CG  . GLU A 1 249 ? 60.107 4.350   30.933 1.00 66.40  ? 250 GLU A CG  1 
ATOM   1993 C CD  . GLU A 1 249 ? 58.766 3.665   30.987 1.00 69.51  ? 250 GLU A CD  1 
ATOM   1994 O OE1 . GLU A 1 249 ? 58.672 2.501   30.543 1.00 72.47  ? 250 GLU A OE1 1 
ATOM   1995 O OE2 . GLU A 1 249 ? 57.805 4.294   31.486 1.00 70.25  ? 250 GLU A OE2 1 
ATOM   1996 N N   . THR A 1 250 ? 60.227 8.348   32.797 1.00 58.81  ? 251 THR A N   1 
ATOM   1997 C CA  . THR A 1 250 ? 59.886 9.750   32.930 1.00 57.76  ? 251 THR A CA  1 
ATOM   1998 C C   . THR A 1 250 ? 61.030 10.654  33.357 1.00 57.76  ? 251 THR A C   1 
ATOM   1999 O O   . THR A 1 250 ? 60.996 11.845  33.051 1.00 57.68  ? 251 THR A O   1 
ATOM   2000 C CB  . THR A 1 250 ? 58.725 9.944   33.892 1.00 57.88  ? 251 THR A CB  1 
ATOM   2001 O OG1 . THR A 1 250 ? 59.228 9.923   35.223 1.00 59.99  ? 251 THR A OG1 1 
ATOM   2002 C CG2 . THR A 1 250 ? 57.692 8.829   33.721 1.00 55.31  ? 251 THR A CG2 1 
ATOM   2003 N N   . VAL A 1 251 ? 62.040 10.108  34.042 1.00 56.81  ? 252 VAL A N   1 
ATOM   2004 C CA  . VAL A 1 251 ? 63.194 10.913  34.477 1.00 56.31  ? 252 VAL A CA  1 
ATOM   2005 C C   . VAL A 1 251 ? 64.557 10.261  34.219 1.00 58.05  ? 252 VAL A C   1 
ATOM   2006 O O   . VAL A 1 251 ? 64.772 9.110   34.559 1.00 58.21  ? 252 VAL A O   1 
ATOM   2007 C CB  . VAL A 1 251 ? 63.131 11.248  35.988 1.00 53.83  ? 252 VAL A CB  1 
ATOM   2008 C CG1 . VAL A 1 251 ? 64.032 12.427  36.298 1.00 52.22  ? 252 VAL A CG1 1 
ATOM   2009 C CG2 . VAL A 1 251 ? 61.726 11.529  36.406 1.00 52.29  ? 252 VAL A CG2 1 
ATOM   2010 N N   . ASP A 1 252 ? 65.484 11.006  33.627 1.00 61.54  ? 253 ASP A N   1 
ATOM   2011 C CA  . ASP A 1 252 ? 66.811 10.475  33.349 1.00 64.85  ? 253 ASP A CA  1 
ATOM   2012 C C   . ASP A 1 252 ? 67.563 10.363  34.659 1.00 67.34  ? 253 ASP A C   1 
ATOM   2013 O O   . ASP A 1 252 ? 67.924 11.369  35.257 1.00 66.65  ? 253 ASP A O   1 
ATOM   2014 C CB  . ASP A 1 252 ? 67.577 11.397  32.392 1.00 65.93  ? 253 ASP A CB  1 
ATOM   2015 C CG  . ASP A 1 252 ? 68.891 10.777  31.884 1.00 68.56  ? 253 ASP A CG  1 
ATOM   2016 O OD1 . ASP A 1 252 ? 69.746 10.403  32.715 1.00 68.37  ? 253 ASP A OD1 1 
ATOM   2017 O OD2 . ASP A 1 252 ? 69.078 10.663  30.649 1.00 69.80  ? 253 ASP A OD2 1 
ATOM   2018 N N   . ILE A 1 253 ? 67.784 9.126   35.098 1.00 71.88  ? 254 ILE A N   1 
ATOM   2019 C CA  . ILE A 1 253 ? 68.503 8.854   36.340 1.00 75.40  ? 254 ILE A CA  1 
ATOM   2020 C C   . ILE A 1 253 ? 69.958 8.527   36.019 1.00 78.19  ? 254 ILE A C   1 
ATOM   2021 O O   . ILE A 1 253 ? 70.875 9.245   36.425 1.00 78.44  ? 254 ILE A O   1 
ATOM   2022 C CB  . ILE A 1 253 ? 67.922 7.637   37.092 1.00 74.72  ? 254 ILE A CB  1 
ATOM   2023 C CG1 . ILE A 1 253 ? 66.400 7.628   37.028 1.00 75.25  ? 254 ILE A CG1 1 
ATOM   2024 C CG2 . ILE A 1 253 ? 68.333 7.696   38.520 1.00 75.46  ? 254 ILE A CG2 1 
ATOM   2025 C CD1 . ILE A 1 253 ? 65.763 6.465   37.778 1.00 74.91  ? 254 ILE A CD1 1 
ATOM   2026 N N   . SER A 1 254 ? 70.156 7.431   35.284 1.00 81.99  ? 255 SER A N   1 
ATOM   2027 C CA  . SER A 1 254 ? 71.493 6.979   34.893 1.00 85.13  ? 255 SER A CA  1 
ATOM   2028 C C   . SER A 1 254 ? 72.113 7.927   33.853 1.00 86.23  ? 255 SER A C   1 
ATOM   2029 O O   . SER A 1 254 ? 72.575 7.412   32.805 1.00 87.39  ? 255 SER A O   1 
ATOM   2030 C CB  . SER A 1 254 ? 71.426 5.551   34.311 1.00 85.81  ? 255 SER A CB  1 
ATOM   2031 O OG  . SER A 1 254 ? 70.851 4.626   35.223 1.00 84.44  ? 255 SER A OG  1 
ATOM   2032 O OXT . SER A 1 254 ? 72.137 9.162   34.094 1.00 85.78  ? 255 SER A OXT 1 
HETATM 2033 O O   . HOH B 2 .   ? 54.654 -0.493  52.686 1.00 26.04  ? 256 HOH A O   1 
HETATM 2034 O O   . HOH B 2 .   ? 78.023 -27.172 48.979 1.00 47.07  ? 257 HOH A O   1 
HETATM 2035 O O   . HOH B 2 .   ? 75.728 -19.095 33.919 1.00 53.84  ? 258 HOH A O   1 
HETATM 2036 O O   . HOH B 2 .   ? 62.012 -4.552  36.516 1.00 48.55  ? 259 HOH A O   1 
HETATM 2037 O O   . HOH B 2 .   ? 67.116 7.102   33.289 1.00 37.91  ? 260 HOH A O   1 
HETATM 2038 O O   . HOH B 2 .   ? 72.476 10.308  38.334 1.00 60.25  ? 261 HOH A O   1 
HETATM 2039 O O   . HOH B 2 .   ? 60.546 -12.423 38.721 1.00 46.75  ? 262 HOH A O   1 
HETATM 2040 O O   . HOH B 2 .   ? 56.514 -6.383  37.889 1.00 39.76  ? 263 HOH A O   1 
HETATM 2041 O O   . HOH B 2 .   ? 67.814 -20.265 32.075 1.00 46.21  ? 264 HOH A O   1 
HETATM 2042 O O   . HOH B 2 .   ? 51.021 34.584  43.144 1.00 24.36  ? 265 HOH A O   1 
HETATM 2043 O O   . HOH B 2 .   ? 56.650 31.200  43.166 1.00 55.37  ? 266 HOH A O   1 
HETATM 2044 O O   . HOH B 2 .   ? 49.254 20.833  33.816 1.00 64.29  ? 267 HOH A O   1 
HETATM 2045 O O   . HOH B 2 .   ? 56.369 27.514  39.226 1.00 60.97  ? 268 HOH A O   1 
HETATM 2046 O O   . HOH B 2 .   ? 54.863 5.651   44.776 1.00 34.88  ? 269 HOH A O   1 
HETATM 2047 O O   . HOH B 2 .   ? 58.014 7.558   44.100 1.00 44.07  ? 270 HOH A O   1 
HETATM 2048 O O   . HOH B 2 .   ? 48.212 -4.203  43.439 1.00 54.90  ? 271 HOH A O   1 
HETATM 2049 O O   . HOH B 2 .   ? 59.623 -15.522 55.387 1.00 58.85  ? 272 HOH A O   1 
HETATM 2050 O O   . HOH B 2 .   ? 75.012 -9.287  49.887 1.00 40.80  ? 273 HOH A O   1 
HETATM 2051 O O   . HOH B 2 .   ? 83.861 -12.612 55.229 1.00 68.30  ? 274 HOH A O   1 
HETATM 2052 O O   . HOH B 2 .   ? 85.624 -22.545 52.352 1.00 54.32  ? 275 HOH A O   1 
HETATM 2053 O O   . HOH B 2 .   ? 75.614 -29.071 42.386 1.00 48.35  ? 276 HOH A O   1 
HETATM 2054 O O   . HOH B 2 .   ? 70.143 -31.939 41.862 1.00 55.99  ? 277 HOH A O   1 
HETATM 2055 O O   . HOH B 2 .   ? 79.455 -27.780 37.634 1.00 54.57  ? 278 HOH A O   1 
HETATM 2056 O O   . HOH B 2 .   ? 79.343 -8.894  41.632 1.00 51.01  ? 279 HOH A O   1 
HETATM 2057 O O   . HOH B 2 .   ? 73.209 -0.661  48.900 1.00 32.77  ? 280 HOH A O   1 
HETATM 2058 O O   . HOH B 2 .   ? 73.433 6.408   48.512 1.00 46.52  ? 281 HOH A O   1 
HETATM 2059 O O   . HOH B 2 .   ? 60.950 -4.764  32.712 1.00 53.11  ? 282 HOH A O   1 
HETATM 2060 O O   . HOH B 2 .   ? 70.808 -12.565 33.609 1.00 51.74  ? 283 HOH A O   1 
HETATM 2061 O O   . HOH B 2 .   ? 71.487 11.640  28.697 1.00 50.82  ? 284 HOH A O   1 
HETATM 2062 O O   . HOH B 2 .   ? 64.898 -18.268 31.741 1.00 62.83  ? 285 HOH A O   1 
HETATM 2063 O O   . HOH B 2 .   ? 63.605 -13.016 28.583 1.00 53.57  ? 286 HOH A O   1 
HETATM 2064 O O   . HOH B 2 .   ? 64.643 15.072  52.449 1.00 40.18  ? 287 HOH A O   1 
HETATM 2065 O O   . HOH B 2 .   ? 60.686 8.386   58.324 1.00 36.05  ? 288 HOH A O   1 
HETATM 2066 O O   . HOH B 2 .   ? 56.937 34.793  61.954 1.00 45.71  ? 289 HOH A O   1 
HETATM 2067 O O   . HOH B 2 .   ? 59.264 31.649  63.086 1.00 48.27  ? 290 HOH A O   1 
HETATM 2068 O O   . HOH B 2 .   ? 40.741 17.552  60.685 1.00 54.67  ? 291 HOH A O   1 
HETATM 2069 O O   . HOH B 2 .   ? 51.333 9.629   55.633 1.00 40.90  ? 292 HOH A O   1 
HETATM 2070 O O   . HOH B 2 .   ? 51.358 5.678   53.423 1.00 51.07  ? 293 HOH A O   1 
HETATM 2071 O O   . HOH B 2 .   ? 66.770 18.657  48.866 1.00 32.81  ? 294 HOH A O   1 
HETATM 2072 O O   . HOH B 2 .   ? 36.337 29.705  54.996 1.00 37.83  ? 295 HOH A O   1 
HETATM 2073 O O   . HOH B 2 .   ? 61.346 -23.586 45.607 1.00 40.59  ? 296 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   2   2   PRO PRO A . n 
A 1 2   VAL 2   3   3   VAL VAL A . n 
A 1 3   ARG 3   4   4   ARG ARG A . n 
A 1 4   LYS 4   5   5   LYS LYS A . n 
A 1 5   GLN 5   6   6   GLN GLN A . n 
A 1 6   ASP 6   7   7   ASP ASP A . n 
A 1 7   THR 7   8   8   THR THR A . n 
A 1 8   GLN 8   9   9   GLN GLN A . n 
A 1 9   ARG 9   10  10  ARG ARG A . n 
A 1 10  ALA 10  11  11  ALA ALA A . n 
A 1 11  LEU 11  12  12  LEU LEU A . n 
A 1 12  HIS 12  13  13  HIS HIS A . n 
A 1 13  LEU 13  14  14  LEU LEU A . n 
A 1 14  LEU 14  15  15  LEU LEU A . n 
A 1 15  GLU 15  16  16  GLU GLU A . n 
A 1 16  GLU 16  17  17  GLU GLU A . n 
A 1 17  TYR 17  18  18  TYR TYR A . n 
A 1 18  ARG 18  19  19  ARG ARG A . n 
A 1 19  SER 19  20  20  SER SER A . n 
A 1 20  LYS 20  21  21  LYS LYS A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  SER 22  23  23  SER SER A . n 
A 1 23  GLN 23  24  24  GLN GLN A . n 
A 1 24  THR 24  25  25  THR THR A . n 
A 1 25  GLU 25  26  26  GLU GLU A . n 
A 1 26  ASP 26  27  27  ASP ASP A . n 
A 1 27  ARG 27  28  28  ARG ARG A . n 
A 1 28  GLN 28  29  29  GLN GLN A . n 
A 1 29  LEU 29  30  30  LEU LEU A . n 
A 1 30  ARG 30  31  31  ARG ARG A . n 
A 1 31  SER 31  32  32  SER SER A . n 
A 1 32  SER 32  33  33  SER SER A . n 
A 1 33  ILE 33  34  34  ILE ILE A . n 
A 1 34  GLU 34  35  35  GLU GLU A . n 
A 1 35  ARG 35  36  36  ARG ARG A . n 
A 1 36  VAL 36  37  37  VAL VAL A . n 
A 1 37  ILE 37  38  38  ILE ILE A . n 
A 1 38  ASN 38  39  39  ASN SER A . n 
A 1 39  ILE 39  40  40  ILE ILE A . n 
A 1 40  PHE 40  41  41  PHE PHE A . n 
A 1 41  GLN 41  42  42  GLN GLN A . n 
A 1 42  SER 42  43  43  SER SER A . n 
A 1 43  ASN 43  44  44  ASN ASN A . n 
A 1 44  LEU 44  45  45  LEU LEU A . n 
A 1 45  PHE 45  46  46  PHE PHE A . n 
A 1 46  GLN 46  47  47  GLN GLN A . n 
A 1 47  ALA 47  48  48  ALA ALA A . n 
A 1 48  LEU 48  49  49  LEU LEU A . n 
A 1 49  ILE 49  50  50  ILE ILE A . n 
A 1 50  ASP 50  51  51  ASP ASP A . n 
A 1 51  ILE 51  52  52  ILE ILE A . n 
A 1 52  GLN 52  53  53  GLN GLN A . n 
A 1 53  GLU 53  54  54  GLU GLU A . n 
A 1 54  PHE 54  55  55  PHE PHE A . n 
A 1 55  TYR 55  56  56  TYR TYR A . n 
A 1 56  GLU 56  57  57  GLU GLU A . n 
A 1 57  VAL 57  58  58  VAL VAL A . n 
A 1 58  THR 58  59  59  THR THR A . n 
A 1 59  LEU 59  60  60  LEU LEU A . n 
A 1 60  LEU 60  61  61  LEU LEU A . n 
A 1 61  ASP 61  62  62  ASP ASP A . n 
A 1 62  ASN 62  63  63  ASN ASN A . n 
A 1 63  PRO 63  64  64  PRO PRO A . n 
A 1 64  LYS 64  65  65  LYS LYS A . n 
A 1 65  LEU 65  66  66  LEU LEU A . n 
A 1 66  GLU 66  67  67  GLU GLU A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  LEU 68  69  69  LEU LEU A . n 
A 1 69  PHE 69  70  70  PHE PHE A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  GLY 71  72  72  GLY GLY A . n 
A 1 72  PRO 72  73  73  PRO PRO A . n 
A 1 73  GLY 73  74  74  GLY GLY A . n 
A 1 74  SER 74  75  75  SER SER A . n 
A 1 75  ASP 75  76  76  ASP ASP A . n 
A 1 76  THR 76  77  77  THR THR A . n 
A 1 77  GLY 77  78  78  GLY GLY A . n 
A 1 78  LEU 78  79  79  LEU LEU A . n 
A 1 79  TYR 79  80  80  TYR TYR A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  LEU 81  82  82  LEU LEU A . n 
A 1 82  LEU 82  83  83  LEU LEU A . n 
A 1 83  ALA 83  84  84  ALA ALA A . n 
A 1 84  ALA 84  85  85  ALA ALA A . n 
A 1 85  LEU 85  86  86  LEU LEU A . n 
A 1 86  PRO 86  87  87  PRO PRO A . n 
A 1 87  ALA 87  88  88  ALA ALA A . n 
A 1 88  GLN 88  89  89  GLN GLN A . n 
A 1 89  LEU 89  90  90  LEU LEU A . n 
A 1 90  GLN 90  91  91  GLN GLN A . n 
A 1 91  PRO 91  92  92  PRO PRO A . n 
A 1 92  HIS 92  93  93  HIS HIS A . n 
A 1 93  VAL 93  94  94  VAL VAL A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  SER 95  96  96  SER SER A . n 
A 1 96  GLN 96  97  97  GLN GLN A . n 
A 1 97  GLU 97  98  98  GLU GLU A . n 
A 1 98  ASP 98  99  99  ASP ASP A . n 
A 1 99  LEU 99  100 100 LEU LEU A . n 
A 1 100 THR 100 101 101 THR THR A . n 
A 1 101 PHE 101 102 102 PHE PHE A . n 
A 1 102 LEU 102 103 103 LEU LEU A . n 
A 1 103 TRP 103 104 104 TRP TRP A . n 
A 1 104 ASP 104 105 105 ASP ASP A . n 
A 1 105 MET 105 106 106 MET MET A . n 
A 1 106 PHE 106 107 107 PHE PHE A . n 
A 1 107 GLY 107 108 ?   ?   ?   A . n 
A 1 108 GLU 108 109 ?   ?   ?   A . n 
A 1 109 LYS 109 110 ?   ?   ?   A . n 
A 1 110 SER 110 111 111 SER SER A . n 
A 1 111 LEU 111 112 112 LEU LEU A . n 
A 1 112 HIS 112 113 113 HIS HIS A . n 
A 1 113 SER 113 114 114 SER SER A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 LYS 116 117 117 LYS LYS A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 HIS 118 119 119 HIS HIS A . n 
A 1 119 GLU 119 120 120 GLU GLU A . n 
A 1 120 LYS 120 121 121 LYS LYS A . n 
A 1 121 LEU 121 122 122 LEU LEU A . n 
A 1 122 HIS 122 123 123 HIS HIS A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 TYR 124 125 125 TYR TYR A . n 
A 1 125 GLU 125 126 126 GLU GLU A . n 
A 1 126 LYS 126 127 127 LYS LYS A . n 
A 1 127 GLN 127 128 128 GLN GLN A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 PRO 129 130 130 PRO PRO A . n 
A 1 130 VAL 130 131 131 VAL VAL A . n 
A 1 131 PRO 131 132 132 PRO PRO A . n 
A 1 132 ILE 132 133 133 ILE ILE A . n 
A 1 133 LEU 133 134 134 LEU LEU A . n 
A 1 134 HIS 134 135 135 HIS HIS A . n 
A 1 135 GLY 135 136 136 GLY GLY A . n 
A 1 136 ALA 136 137 137 ALA ALA A . n 
A 1 137 ALA 137 138 138 ALA ALA A . n 
A 1 138 ALA 138 139 139 ALA ALA A . n 
A 1 139 LEU 139 140 140 LEU LEU A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 ASP 141 142 142 ASP ASP A . n 
A 1 142 ASP 142 143 143 ASP ASP A . n 
A 1 143 LEU 143 144 144 LEU LEU A . n 
A 1 144 ALA 144 145 145 ALA ALA A . n 
A 1 145 GLU 145 146 146 GLU GLU A . n 
A 1 146 GLU 146 147 147 GLU GLU A . n 
A 1 147 LEU 147 148 148 LEU LEU A . n 
A 1 148 GLN 148 149 149 GLN GLN A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 LYS 150 151 151 LYS LYS A . n 
A 1 151 PRO 151 152 152 PRO PRO A . n 
A 1 152 LEU 152 153 153 LEU LEU A . n 
A 1 153 ASN 153 154 154 ASN ASN A . n 
A 1 154 SER 154 155 155 SER SER A . n 
A 1 155 GLU 155 156 156 GLU GLU A . n 
A 1 156 ILE 156 157 157 ILE ILE A . n 
A 1 157 ARG 157 158 158 ARG ARG A . n 
A 1 158 GLU 158 159 159 GLU GLU A . n 
A 1 159 LEU 159 160 160 LEU LEU A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 LYS 161 162 162 LYS LYS A . n 
A 1 162 LEU 162 163 163 LEU LEU A . n 
A 1 163 LEU 163 164 164 LEU LEU A . n 
A 1 164 SER 164 165 165 SER SER A . n 
A 1 165 LYS 165 166 166 LYS LYS A . n 
A 1 166 PRO 166 167 167 PRO PRO A . n 
A 1 167 ASN 167 168 168 ASN ASN A . n 
A 1 168 VAL 168 169 169 VAL VAL A . n 
A 1 169 LYS 169 170 170 LYS LYS A . n 
A 1 170 ALA 170 171 171 ALA ALA A . n 
A 1 171 LEU 171 172 172 LEU LEU A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 SER 173 174 174 SER SER A . n 
A 1 174 VAL 174 175 175 VAL VAL A . n 
A 1 175 HIS 175 176 176 HIS HIS A . n 
A 1 176 ASP 176 177 177 ASP ASP A . n 
A 1 177 THR 177 178 178 THR THR A . n 
A 1 178 VAL 178 179 179 VAL VAL A . n 
A 1 179 ALA 179 180 180 ALA ALA A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 LYS 181 182 182 LYS LYS A . n 
A 1 182 ASN 182 183 183 ASN ASN A . n 
A 1 183 TYR 183 184 184 TYR TYR A . n 
A 1 184 ASP 184 185 185 ASP ASP A . n 
A 1 185 LEU 185 186 186 LEU LEU A . n 
A 1 186 GLU 186 187 187 GLU GLU A . n 
A 1 187 VAL 187 188 188 VAL VAL A . n 
A 1 188 LEU 188 189 189 LEU LEU A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLN 190 191 191 GLN GLN A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 PRO 192 193 193 PRO PRO A . n 
A 1 193 ALA 193 194 194 ALA ALA A . n 
A 1 194 LEU 194 195 195 LEU LEU A . n 
A 1 195 GLY 195 196 196 GLY GLY A . n 
A 1 196 GLU 196 197 197 GLU GLU A . n 
A 1 197 PRO 197 198 198 PRO PRO A . n 
A 1 198 VAL 198 199 199 VAL VAL A . n 
A 1 199 ARG 199 200 200 ARG ARG A . n 
A 1 200 LEU 200 201 201 LEU LEU A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 ARG 202 203 203 ARG ARG A . n 
A 1 203 ASP 203 204 204 ASP ASP A . n 
A 1 204 ILE 204 205 205 ILE ILE A . n 
A 1 205 CYS 205 206 206 CYS CYS A . n 
A 1 206 ARG 206 207 207 ARG ARG A . n 
A 1 207 ALA 207 208 208 ALA ALA A . n 
A 1 208 ILE 208 209 209 ILE ILE A . n 
A 1 209 GLU 209 210 210 GLU GLU A . n 
A 1 210 LEU 210 211 211 LEU LEU A . n 
A 1 211 LEU 211 212 212 LEU LEU A . n 
A 1 212 GLU 212 213 213 GLU GLU A . n 
A 1 213 LYS 213 214 214 LYS LYS A . n 
A 1 214 LEU 214 215 215 LEU LEU A . n 
A 1 215 GLN 215 216 216 GLN GLN A . n 
A 1 216 ARG 216 217 217 ARG ARG A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 GLY 218 219 219 GLY GLY A . n 
A 1 219 GLU 219 220 220 GLU GLU A . n 
A 1 220 VAL 220 221 221 VAL VAL A . n 
A 1 221 PRO 221 222 222 PRO PRO A . n 
A 1 222 PRO 222 223 223 PRO PRO A . n 
A 1 223 GLN 223 224 224 GLN GLN A . n 
A 1 224 LYS 224 225 225 LYS LYS A . n 
A 1 225 LEU 225 226 226 LEU LEU A . n 
A 1 226 GLN 226 227 227 GLN GLN A . n 
A 1 227 ALA 227 228 228 ALA ALA A . n 
A 1 228 LEU 228 229 229 LEU LEU A . n 
A 1 229 GLN 229 230 230 GLN GLN A . n 
A 1 230 ARG 230 231 231 ARG ARG A . n 
A 1 231 VAL 231 232 232 VAL VAL A . n 
A 1 232 LEU 232 233 233 LEU LEU A . n 
A 1 233 GLN 233 234 234 GLN GLN A . n 
A 1 234 SER 234 235 235 SER SER A . n 
A 1 235 GLU 235 236 236 GLU GLU A . n 
A 1 236 PHE 236 237 237 PHE PHE A . n 
A 1 237 CYS 237 238 238 CYS CYS A . n 
A 1 238 ASN 238 239 239 ASN ASN A . n 
A 1 239 ALA 239 240 240 ALA ALA A . n 
A 1 240 VAL 240 241 241 VAL VAL A . n 
A 1 241 ARG 241 242 242 ARG ARG A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 VAL 243 244 244 VAL VAL A . n 
A 1 244 TYR 244 245 245 TYR TYR A . n 
A 1 245 GLU 245 246 246 GLU GLU A . n 
A 1 246 HIS 246 247 247 HIS HIS A . n 
A 1 247 VAL 247 248 248 VAL VAL A . n 
A 1 248 TYR 248 249 249 TYR TYR A . n 
A 1 249 GLU 249 250 250 GLU GLU A . n 
A 1 250 THR 250 251 251 THR THR A . n 
A 1 251 VAL 251 252 252 VAL VAL A . n 
A 1 252 ASP 252 253 253 ASP ASP A . n 
A 1 253 ILE 253 254 254 ILE ILE A . n 
A 1 254 SER 254 255 255 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  256 3  HOH HOH A . 
B 2 HOH 2  257 4  HOH HOH A . 
B 2 HOH 3  258 5  HOH HOH A . 
B 2 HOH 4  259 6  HOH HOH A . 
B 2 HOH 5  260 7  HOH HOH A . 
B 2 HOH 6  261 8  HOH HOH A . 
B 2 HOH 7  262 9  HOH HOH A . 
B 2 HOH 8  263 10 HOH HOH A . 
B 2 HOH 9  264 11 HOH HOH A . 
B 2 HOH 10 265 12 HOH HOH A . 
B 2 HOH 11 266 13 HOH HOH A . 
B 2 HOH 12 267 22 HOH HOH A . 
B 2 HOH 13 268 25 HOH HOH A . 
B 2 HOH 14 269 26 HOH HOH A . 
B 2 HOH 15 270 27 HOH HOH A . 
B 2 HOH 16 271 28 HOH HOH A . 
B 2 HOH 17 272 29 HOH HOH A . 
B 2 HOH 18 273 30 HOH HOH A . 
B 2 HOH 19 274 31 HOH HOH A . 
B 2 HOH 20 275 32 HOH HOH A . 
B 2 HOH 21 276 33 HOH HOH A . 
B 2 HOH 22 277 34 HOH HOH A . 
B 2 HOH 23 278 35 HOH HOH A . 
B 2 HOH 24 279 36 HOH HOH A . 
B 2 HOH 25 280 37 HOH HOH A . 
B 2 HOH 26 281 38 HOH HOH A . 
B 2 HOH 27 282 39 HOH HOH A . 
B 2 HOH 28 283 40 HOH HOH A . 
B 2 HOH 29 284 41 HOH HOH A . 
B 2 HOH 30 285 42 HOH HOH A . 
B 2 HOH 31 286 43 HOH HOH A . 
B 2 HOH 32 287 44 HOH HOH A . 
B 2 HOH 33 288 45 HOH HOH A . 
B 2 HOH 34 289 46 HOH HOH A . 
B 2 HOH 35 290 47 HOH HOH A . 
B 2 HOH 36 291 48 HOH HOH A . 
B 2 HOH 37 292 49 HOH HOH A . 
B 2 HOH 38 293 50 HOH HOH A . 
B 2 HOH 39 294 51 HOH HOH A . 
B 2 HOH 40 295 52 HOH HOH A . 
B 2 HOH 41 296 54 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-17 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-06-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
SHELXS   phasing           .   ? 2 
CNS      refinement        1.2 ? 3 
HKL-2000 'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
_pdbx_entry_details.entry_id             3LRA 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'THE INTERNAL SEQUENCE LEVLFQGP ARE LINKER.' 
_pdbx_entry_details.compound_details     
;THE L27 DOMAINS OF HUMAN DLG1 (TERMED AS L27HDLG1), HUMAN MPP7 (TERMED AS L27N AND L27C) AND HUMAN MALS3 (TERMED AS L27HMALS3) WERE COVALENTLY LINKED TOGETHER BY PRECISSION PROTEASE CLEAVAGE SITE AS ONE SINGLE POLYPEPTIDE.
;
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    76 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLY 
_pdbx_validate_close_contact.auth_seq_id_2    78 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.10 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLN 
_pdbx_validate_symm_contact.auth_seq_id_1     181 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLN 
_pdbx_validate_symm_contact.auth_seq_id_2     181 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_557 
_pdbx_validate_symm_contact.dist              2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 21  ? ? -71.67  25.05  
2  1 SER A 23  ? ? -121.20 -70.08 
3  1 GLN A 24  ? ? -154.68 -13.43 
4  1 GLN A 29  ? ? -131.22 -54.48 
5  1 GLU A 57  ? ? 31.48   73.20  
6  1 PRO A 73  ? ? -57.41  107.72 
7  1 SER A 75  ? ? -104.84 -89.99 
8  1 ASP A 76  ? ? -78.70  24.01  
9  1 THR A 77  ? ? -34.34  -6.38  
10 1 LEU A 82  ? ? -34.66  -73.64 
11 1 ASN A 150 ? ? -91.90  34.28  
12 1 ASP A 185 ? ? -161.09 115.15 
13 1 LEU A 186 ? ? -39.84  -35.32 
14 1 PRO A 193 ? ? -58.53  -8.41  
15 1 SER A 218 ? ? -101.06 47.87  
16 1 VAL A 221 ? ? -103.01 -64.28 
17 1 PRO A 223 ? ? -31.01  165.80 
18 1 ILE A 254 ? ? -98.02  -63.04 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASN 39 ? OD1 ? A ASN 38 OD1 
2 1 Y 1 A ASN 39 ? ND2 ? A ASN 38 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 108 ? A GLY 107 
2 1 Y 1 A GLU 109 ? A GLU 108 
3 1 Y 1 A LYS 110 ? A LYS 109 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#