data_3LUE
# 
_entry.id   3LUE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    4.007 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB  3LUE       
RCSB RCSB057742 
# 
loop_
_database_PDB_rev.num 
_database_PDB_rev.date 
_database_PDB_rev.date_original 
_database_PDB_rev.status 
_database_PDB_rev.replaces 
_database_PDB_rev.mod_type 
1 2010-04-28 2010-02-17 ? 3LUE 0 
2 2010-05-19 ?          ? 3LUE 1 
# 
_database_PDB_rev_record.rev_num   2 
_database_PDB_rev_record.type      JRNL 
_database_PDB_rev_record.details   ? 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-5170 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code      REL 
_pdbx_database_status.entry_id         3LUE 
_pdbx_database_status.deposit_site     RCSB 
_pdbx_database_status.process_site     RCSB 
_pdbx_database_status.status_code_sf   ? 
_pdbx_database_status.status_code_mr   ? 
_pdbx_database_status.SG_entry         ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Galkin, V.E.'        1 
'Orlova, A.'          2 
'Salmazo, A.'         3 
'Djinovic-Carugo, K.' 4 
'Egelman, E.H.'       5 
# 
_citation.id                        primary 
_citation.title                     'Opening of tandem calponin homology domains regulates their affinity for F-actin.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                614 
_citation.page_last                 616 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20383143 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1789 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Galkin, V.E.'        1 
primary 'Orlova, A.'          2 
primary 'Salmazo, A.'         3 
primary 'Djinovic-Carugo, K.' 4 
primary 'Egelman, E.H.'       5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.details 
1 polymer man 'Actin, cytoplasmic 1' 41651.809 10 ? 
2 polymer man Alpha-actinin-3        12471.813 10 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Beta-actin, Actin, cytoplasmic 1, N-terminally processed'               
2 'Alpha-actinin skeletal muscle isoform 3, F-actin cross-linking protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
1 'polypeptide(L)' no no 
;DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
;DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
A,B,C,D,E,F,G,H,I,J 
2 'polypeptide(L)' no no 
;AWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKL
VSIGAEEIVDGNLKMTLGMIWTIILRFAI
;
;AWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKL
VSIGAEEIVDGNLKMTLGMIWTIILRFAI
;
K,M,L,O,N,Q,P,S,R,T 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   ALA n 
1 6   ALA n 
1 7   LEU n 
1 8   VAL n 
1 9   VAL n 
1 10  ASP n 
1 11  ASN n 
1 12  GLY n 
1 13  SER n 
1 14  GLY n 
1 15  MET n 
1 16  CYS n 
1 17  LYS n 
1 18  ALA n 
1 19  GLY n 
1 20  PHE n 
1 21  ALA n 
1 22  GLY n 
1 23  ASP n 
1 24  ASP n 
1 25  ALA n 
1 26  PRO n 
1 27  ARG n 
1 28  ALA n 
1 29  VAL n 
1 30  PHE n 
1 31  PRO n 
1 32  SER n 
1 33  ILE n 
1 34  VAL n 
1 35  GLY n 
1 36  ARG n 
1 37  PRO n 
1 38  ARG n 
1 39  HIS n 
1 40  GLN n 
1 41  GLY n 
1 42  VAL n 
1 43  MET n 
1 44  VAL n 
1 45  GLY n 
1 46  MET n 
1 47  GLY n 
1 48  GLN n 
1 49  LYS n 
1 50  ASP n 
1 51  SER n 
1 52  TYR n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  GLU n 
1 57  ALA n 
1 58  GLN n 
1 59  SER n 
1 60  LYS n 
1 61  ARG n 
1 62  GLY n 
1 63  ILE n 
1 64  LEU n 
1 65  THR n 
1 66  LEU n 
1 67  LYS n 
1 68  TYR n 
1 69  PRO n 
1 70  ILE n 
1 71  GLU n 
1 72  HIS n 
1 73  GLY n 
1 74  ILE n 
1 75  VAL n 
1 76  THR n 
1 77  ASN n 
1 78  TRP n 
1 79  ASP n 
1 80  ASP n 
1 81  MET n 
1 82  GLU n 
1 83  LYS n 
1 84  ILE n 
1 85  TRP n 
1 86  HIS n 
1 87  HIS n 
1 88  THR n 
1 89  PHE n 
1 90  TYR n 
1 91  ASN n 
1 92  GLU n 
1 93  LEU n 
1 94  ARG n 
1 95  VAL n 
1 96  ALA n 
1 97  PRO n 
1 98  GLU n 
1 99  GLU n 
1 100 HIS n 
1 101 PRO n 
1 102 VAL n 
1 103 LEU n 
1 104 LEU n 
1 105 THR n 
1 106 GLU n 
1 107 ALA n 
1 108 PRO n 
1 109 LEU n 
1 110 ASN n 
1 111 PRO n 
1 112 LYS n 
1 113 ALA n 
1 114 ASN n 
1 115 ARG n 
1 116 GLU n 
1 117 LYS n 
1 118 MET n 
1 119 THR n 
1 120 GLN n 
1 121 ILE n 
1 122 MET n 
1 123 PHE n 
1 124 GLU n 
1 125 THR n 
1 126 PHE n 
1 127 ASN n 
1 128 THR n 
1 129 PRO n 
1 130 ALA n 
1 131 MET n 
1 132 TYR n 
1 133 VAL n 
1 134 ALA n 
1 135 ILE n 
1 136 GLN n 
1 137 ALA n 
1 138 VAL n 
1 139 LEU n 
1 140 SER n 
1 141 LEU n 
1 142 TYR n 
1 143 ALA n 
1 144 SER n 
1 145 GLY n 
1 146 ARG n 
1 147 THR n 
1 148 THR n 
1 149 GLY n 
1 150 ILE n 
1 151 VAL n 
1 152 MET n 
1 153 ASP n 
1 154 SER n 
1 155 GLY n 
1 156 ASP n 
1 157 GLY n 
1 158 VAL n 
1 159 THR n 
1 160 HIS n 
1 161 THR n 
1 162 VAL n 
1 163 PRO n 
1 164 ILE n 
1 165 TYR n 
1 166 GLU n 
1 167 GLY n 
1 168 TYR n 
1 169 ALA n 
1 170 LEU n 
1 171 PRO n 
1 172 HIS n 
1 173 ALA n 
1 174 ILE n 
1 175 LEU n 
1 176 ARG n 
1 177 LEU n 
1 178 ASP n 
1 179 LEU n 
1 180 ALA n 
1 181 GLY n 
1 182 ARG n 
1 183 ASP n 
1 184 LEU n 
1 185 THR n 
1 186 ASP n 
1 187 TYR n 
1 188 LEU n 
1 189 MET n 
1 190 LYS n 
1 191 ILE n 
1 192 LEU n 
1 193 THR n 
1 194 GLU n 
1 195 ARG n 
1 196 GLY n 
1 197 TYR n 
1 198 SER n 
1 199 PHE n 
1 200 THR n 
1 201 THR n 
1 202 THR n 
1 203 ALA n 
1 204 GLU n 
1 205 ARG n 
1 206 GLU n 
1 207 ILE n 
1 208 VAL n 
1 209 ARG n 
1 210 ASP n 
1 211 ILE n 
1 212 LYS n 
1 213 GLU n 
1 214 LYS n 
1 215 LEU n 
1 216 CYS n 
1 217 TYR n 
1 218 VAL n 
1 219 ALA n 
1 220 LEU n 
1 221 ASP n 
1 222 PHE n 
1 223 GLU n 
1 224 GLN n 
1 225 GLU n 
1 226 MET n 
1 227 ALA n 
1 228 THR n 
1 229 ALA n 
1 230 ALA n 
1 231 SER n 
1 232 SER n 
1 233 SER n 
1 234 SER n 
1 235 LEU n 
1 236 GLU n 
1 237 LYS n 
1 238 SER n 
1 239 TYR n 
1 240 GLU n 
1 241 LEU n 
1 242 PRO n 
1 243 ASP n 
1 244 GLY n 
1 245 GLN n 
1 246 VAL n 
1 247 ILE n 
1 248 THR n 
1 249 ILE n 
1 250 GLY n 
1 251 ASN n 
1 252 GLU n 
1 253 ARG n 
1 254 PHE n 
1 255 ARG n 
1 256 CYS n 
1 257 PRO n 
1 258 GLU n 
1 259 ALA n 
1 260 LEU n 
1 261 PHE n 
1 262 GLN n 
1 263 PRO n 
1 264 SER n 
1 265 PHE n 
1 266 LEU n 
1 267 GLY n 
1 268 MET n 
1 269 GLU n 
1 270 SER n 
1 271 CYS n 
1 272 GLY n 
1 273 ILE n 
1 274 HIS n 
1 275 GLU n 
1 276 THR n 
1 277 THR n 
1 278 PHE n 
1 279 ASN n 
1 280 SER n 
1 281 ILE n 
1 282 MET n 
1 283 LYS n 
1 284 CYS n 
1 285 ASP n 
1 286 VAL n 
1 287 ASP n 
1 288 ILE n 
1 289 ARG n 
1 290 LYS n 
1 291 ASP n 
1 292 LEU n 
1 293 TYR n 
1 294 ALA n 
1 295 ASN n 
1 296 THR n 
1 297 VAL n 
1 298 LEU n 
1 299 SER n 
1 300 GLY n 
1 301 GLY n 
1 302 THR n 
1 303 THR n 
1 304 MET n 
1 305 TYR n 
1 306 PRO n 
1 307 GLY n 
1 308 ILE n 
1 309 ALA n 
1 310 ASP n 
1 311 ARG n 
1 312 MET n 
1 313 GLN n 
1 314 LYS n 
1 315 GLU n 
1 316 ILE n 
1 317 THR n 
1 318 ALA n 
1 319 LEU n 
1 320 ALA n 
1 321 PRO n 
1 322 SER n 
1 323 THR n 
1 324 MET n 
1 325 LYS n 
1 326 ILE n 
1 327 LYS n 
1 328 ILE n 
1 329 ILE n 
1 330 ALA n 
1 331 PRO n 
1 332 PRO n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 TYR n 
1 337 SER n 
1 338 VAL n 
1 339 TRP n 
1 340 ILE n 
1 341 GLY n 
1 342 GLY n 
1 343 SER n 
1 344 ILE n 
1 345 LEU n 
1 346 ALA n 
1 347 SER n 
1 348 LEU n 
1 349 SER n 
1 350 THR n 
1 351 PHE n 
1 352 GLN n 
1 353 GLN n 
1 354 MET n 
1 355 TRP n 
1 356 ILE n 
1 357 SER n 
1 358 LYS n 
1 359 GLN n 
1 360 GLU n 
1 361 TYR n 
1 362 ASP n 
1 363 GLU n 
1 364 SER n 
1 365 GLY n 
1 366 PRO n 
1 367 SER n 
1 368 ILE n 
1 369 VAL n 
1 370 HIS n 
1 371 ARG n 
1 372 LYS n 
1 373 CYS n 
1 374 PHE n 
2 1   ALA n 
2 2   TRP n 
2 3   GLU n 
2 4   LYS n 
2 5   GLN n 
2 6   GLN n 
2 7   ARG n 
2 8   LYS n 
2 9   THR n 
2 10  PHE n 
2 11  THR n 
2 12  ALA n 
2 13  TRP n 
2 14  CYS n 
2 15  ASN n 
2 16  SER n 
2 17  HIS n 
2 18  LEU n 
2 19  ARG n 
2 20  LYS n 
2 21  ALA n 
2 22  GLY n 
2 23  THR n 
2 24  GLN n 
2 25  ILE n 
2 26  GLU n 
2 27  ASN n 
2 28  ILE n 
2 29  GLU n 
2 30  GLU n 
2 31  ASP n 
2 32  PHE n 
2 33  ARG n 
2 34  ASN n 
2 35  GLY n 
2 36  LEU n 
2 37  LYS n 
2 38  LEU n 
2 39  MET n 
2 40  LEU n 
2 41  LEU n 
2 42  LEU n 
2 43  GLU n 
2 44  VAL n 
2 45  ILE n 
2 46  SER n 
2 47  GLY n 
2 48  GLU n 
2 49  ARG n 
2 50  LEU n 
2 51  PRO n 
2 52  ARG n 
2 53  PRO n 
2 54  ASP n 
2 55  LYS n 
2 56  GLY n 
2 57  LYS n 
2 58  MET n 
2 59  ARG n 
2 60  PHE n 
2 61  HIS n 
2 62  LYS n 
2 63  ILE n 
2 64  ALA n 
2 65  ASN n 
2 66  VAL n 
2 67  ASN n 
2 68  LYS n 
2 69  ALA n 
2 70  LEU n 
2 71  ASP n 
2 72  PHE n 
2 73  ILE n 
2 74  ALA n 
2 75  SER n 
2 76  LYS n 
2 77  GLY n 
2 78  VAL n 
2 79  LYS n 
2 80  LEU n 
2 81  VAL n 
2 82  SER n 
2 83  ILE n 
2 84  GLY n 
2 85  ALA n 
2 86  GLU n 
2 87  GLU n 
2 88  ILE n 
2 89  VAL n 
2 90  ASP n 
2 91  GLY n 
2 92  ASN n 
2 93  LEU n 
2 94  LYS n 
2 95  MET n 
2 96  THR n 
2 97  LEU n 
2 98  GLY n 
2 99  MET n 
2 100 ILE n 
2 101 TRP n 
2 102 THR n 
2 103 ILE n 
2 104 ILE n 
2 105 LEU n 
2 106 ARG n 
2 107 PHE n 
2 108 ALA n 
2 109 ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 human ? ACTB  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 human ? ACTN3 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.biol_id 
1 UNP ACTB_HUMAN  P60709 1 
;DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 
RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 
IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 
GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE 
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSG 
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 
YDESGPSIVHRKCF
;
2  . 
2 UNP ACTN3_HUMAN Q08043 2 
;AWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRF 
HKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAI
;
42 . 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3LUE A 1 ? 374 ? P60709 2  375 2  375 
2  1 3LUE B 1 ? 374 ? P60709 2  375 2  375 
3  1 3LUE C 1 ? 374 ? P60709 2  375 2  375 
4  1 3LUE D 1 ? 374 ? P60709 2  375 2  375 
5  1 3LUE E 1 ? 374 ? P60709 2  375 2  375 
6  1 3LUE F 1 ? 374 ? P60709 2  375 2  375 
7  1 3LUE G 1 ? 374 ? P60709 2  375 2  375 
8  1 3LUE H 1 ? 374 ? P60709 2  375 2  375 
9  1 3LUE I 1 ? 374 ? P60709 2  375 2  375 
10 1 3LUE J 1 ? 374 ? P60709 2  375 2  375 
11 2 3LUE K 1 ? 109 ? Q08043 42 150 42 150 
12 2 3LUE M 1 ? 109 ? Q08043 42 150 42 150 
13 2 3LUE L 1 ? 109 ? Q08043 42 150 42 150 
14 2 3LUE O 1 ? 109 ? Q08043 42 150 42 150 
15 2 3LUE N 1 ? 109 ? Q08043 42 150 42 150 
16 2 3LUE Q 1 ? 109 ? Q08043 42 150 42 150 
17 2 3LUE P 1 ? 109 ? Q08043 42 150 42 150 
18 2 3LUE S 1 ? 109 ? Q08043 42 150 42 150 
19 2 3LUE R 1 ? 109 ? Q08043 42 150 42 150 
20 2 3LUE T 1 ? 109 ? Q08043 42 150 42 150 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.104 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.174 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.094  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.174 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.147 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.119 
GLY 'PEPTIDE LINKING'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.207 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.154 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.197 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.191 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.132 
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.210 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.164 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.146 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.191 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.120 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.228 
# 
_exptl.entry_id          3LUE 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id   1 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        37910 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               37910 
_refine_hist.d_res_high                       . 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  3LUE 
_struct.title                     'Model of alpha-actinin CH1 bound to F-actin' 
_struct.pdbx_descriptor           'Actin, cytoplasmic 1, Alpha-actinin-3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LUE 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;calponin homology domains, ATP-binding, Cytoskeleton, Methylation, Nucleotide-binding, Phosphoprotein, Actin-binding, STRUCTURAL PROTEIN, Deafness, Disease mutation, Dystonia
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;Authors state that the model is from a continuous helix where the rotation per subunit is -167.2 degrees and the rise per subunit is 26.6 Angstroms.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASP A 55  ? LEU A 64  ? ASP A 56  LEU A 65  5 ? 10 
HELX_P HELX_P2   2   ASN A 77  ? ASN A 91  ? ASN A 78  ASN A 92  1 ? 15 
HELX_P HELX_P3   3   ALA A 96  ? HIS A 100 ? ALA A 97  HIS A 101 5 ? 5  
HELX_P HELX_P4   4   PRO A 111 ? ASN A 127 ? PRO A 112 ASN A 128 1 ? 17 
HELX_P HELX_P5   5   GLN A 136 ? SER A 144 ? GLN A 137 SER A 145 1 ? 9  
HELX_P HELX_P6   6   PRO A 171 ? ILE A 174 ? PRO A 172 ILE A 175 5 ? 4  
HELX_P HELX_P7   7   ALA A 180 ? ARG A 195 ? ALA A 181 ARG A 196 1 ? 16 
HELX_P HELX_P8   8   THR A 201 ? ARG A 205 ? THR A 202 ARG A 206 5 ? 5  
HELX_P HELX_P9   9   GLU A 206 ? CYS A 216 ? GLU A 207 CYS A 217 1 ? 11 
HELX_P HELX_P10  10  ASP A 221 ? SER A 231 ? ASP A 222 SER A 232 1 ? 11 
HELX_P HELX_P11  11  ASN A 251 ? CYS A 256 ? ASN A 252 CYS A 257 1 ? 6  
HELX_P HELX_P12  12  PRO A 257 ? LEU A 260 ? PRO A 258 LEU A 261 5 ? 4  
HELX_P HELX_P13  13  GLY A 272 ? MET A 282 ? GLY A 273 MET A 283 1 ? 11 
HELX_P HELX_P14  14  ILE A 288 ? ASN A 295 ? ILE A 289 ASN A 296 1 ? 8  
HELX_P HELX_P15  15  GLY A 300 ? MET A 304 ? GLY A 301 MET A 305 5 ? 5  
HELX_P HELX_P16  16  GLY A 307 ? ALA A 320 ? GLY A 308 ALA A 321 1 ? 14 
HELX_P HELX_P17  17  TYR A 336 ? ALA A 346 ? TYR A 337 ALA A 347 1 ? 11 
HELX_P HELX_P18  18  SER A 347 ? GLN A 353 ? SER A 348 GLN A 354 5 ? 7  
HELX_P HELX_P19  19  LYS A 358 ? GLY A 365 ? LYS A 359 GLY A 366 1 ? 8  
HELX_P HELX_P20  20  ILE A 368 ? CYS A 373 ? ILE A 369 CYS A 374 1 ? 6  
HELX_P HELX_P21  21  ASP B 55  ? LEU B 64  ? ASP B 56  LEU B 65  5 ? 10 
HELX_P HELX_P22  22  ASN B 77  ? ASN B 91  ? ASN B 78  ASN B 92  1 ? 15 
HELX_P HELX_P23  23  ALA B 96  ? HIS B 100 ? ALA B 97  HIS B 101 5 ? 5  
HELX_P HELX_P24  24  PRO B 111 ? ASN B 127 ? PRO B 112 ASN B 128 1 ? 17 
HELX_P HELX_P25  25  GLN B 136 ? SER B 144 ? GLN B 137 SER B 145 1 ? 9  
HELX_P HELX_P26  26  PRO B 171 ? ILE B 174 ? PRO B 172 ILE B 175 5 ? 4  
HELX_P HELX_P27  27  ALA B 180 ? ARG B 195 ? ALA B 181 ARG B 196 1 ? 16 
HELX_P HELX_P28  28  THR B 201 ? ARG B 205 ? THR B 202 ARG B 206 5 ? 5  
HELX_P HELX_P29  29  GLU B 206 ? CYS B 216 ? GLU B 207 CYS B 217 1 ? 11 
HELX_P HELX_P30  30  ASP B 221 ? SER B 231 ? ASP B 222 SER B 232 1 ? 11 
HELX_P HELX_P31  31  ASN B 251 ? CYS B 256 ? ASN B 252 CYS B 257 1 ? 6  
HELX_P HELX_P32  32  PRO B 257 ? LEU B 260 ? PRO B 258 LEU B 261 5 ? 4  
HELX_P HELX_P33  33  GLY B 272 ? MET B 282 ? GLY B 273 MET B 283 1 ? 11 
HELX_P HELX_P34  34  ILE B 288 ? ASN B 295 ? ILE B 289 ASN B 296 1 ? 8  
HELX_P HELX_P35  35  GLY B 300 ? MET B 304 ? GLY B 301 MET B 305 5 ? 5  
HELX_P HELX_P36  36  GLY B 307 ? ALA B 320 ? GLY B 308 ALA B 321 1 ? 14 
HELX_P HELX_P37  37  TYR B 336 ? ALA B 346 ? TYR B 337 ALA B 347 1 ? 11 
HELX_P HELX_P38  38  SER B 347 ? GLN B 353 ? SER B 348 GLN B 354 5 ? 7  
HELX_P HELX_P39  39  LYS B 358 ? GLY B 365 ? LYS B 359 GLY B 366 1 ? 8  
HELX_P HELX_P40  40  ILE B 368 ? CYS B 373 ? ILE B 369 CYS B 374 1 ? 6  
HELX_P HELX_P41  41  ASP C 55  ? LEU C 64  ? ASP C 56  LEU C 65  5 ? 10 
HELX_P HELX_P42  42  ASN C 77  ? ASN C 91  ? ASN C 78  ASN C 92  1 ? 15 
HELX_P HELX_P43  43  ALA C 96  ? HIS C 100 ? ALA C 97  HIS C 101 5 ? 5  
HELX_P HELX_P44  44  PRO C 111 ? ASN C 127 ? PRO C 112 ASN C 128 1 ? 17 
HELX_P HELX_P45  45  GLN C 136 ? SER C 144 ? GLN C 137 SER C 145 1 ? 9  
HELX_P HELX_P46  46  PRO C 171 ? ILE C 174 ? PRO C 172 ILE C 175 5 ? 4  
HELX_P HELX_P47  47  ALA C 180 ? ARG C 195 ? ALA C 181 ARG C 196 1 ? 16 
HELX_P HELX_P48  48  THR C 201 ? ARG C 205 ? THR C 202 ARG C 206 5 ? 5  
HELX_P HELX_P49  49  GLU C 206 ? CYS C 216 ? GLU C 207 CYS C 217 1 ? 11 
HELX_P HELX_P50  50  ASP C 221 ? SER C 231 ? ASP C 222 SER C 232 1 ? 11 
HELX_P HELX_P51  51  ASN C 251 ? CYS C 256 ? ASN C 252 CYS C 257 1 ? 6  
HELX_P HELX_P52  52  PRO C 257 ? LEU C 260 ? PRO C 258 LEU C 261 5 ? 4  
HELX_P HELX_P53  53  GLY C 272 ? MET C 282 ? GLY C 273 MET C 283 1 ? 11 
HELX_P HELX_P54  54  ILE C 288 ? ASN C 295 ? ILE C 289 ASN C 296 1 ? 8  
HELX_P HELX_P55  55  GLY C 300 ? MET C 304 ? GLY C 301 MET C 305 5 ? 5  
HELX_P HELX_P56  56  GLY C 307 ? ALA C 320 ? GLY C 308 ALA C 321 1 ? 14 
HELX_P HELX_P57  57  TYR C 336 ? ALA C 346 ? TYR C 337 ALA C 347 1 ? 11 
HELX_P HELX_P58  58  SER C 347 ? GLN C 353 ? SER C 348 GLN C 354 5 ? 7  
HELX_P HELX_P59  59  LYS C 358 ? GLY C 365 ? LYS C 359 GLY C 366 1 ? 8  
HELX_P HELX_P60  60  ILE C 368 ? CYS C 373 ? ILE C 369 CYS C 374 1 ? 6  
HELX_P HELX_P61  61  ASP D 55  ? LEU D 64  ? ASP D 56  LEU D 65  5 ? 10 
HELX_P HELX_P62  62  ASN D 77  ? ASN D 91  ? ASN D 78  ASN D 92  1 ? 15 
HELX_P HELX_P63  63  ALA D 96  ? HIS D 100 ? ALA D 97  HIS D 101 5 ? 5  
HELX_P HELX_P64  64  PRO D 111 ? ASN D 127 ? PRO D 112 ASN D 128 1 ? 17 
HELX_P HELX_P65  65  GLN D 136 ? SER D 144 ? GLN D 137 SER D 145 1 ? 9  
HELX_P HELX_P66  66  PRO D 171 ? ILE D 174 ? PRO D 172 ILE D 175 5 ? 4  
HELX_P HELX_P67  67  ALA D 180 ? ARG D 195 ? ALA D 181 ARG D 196 1 ? 16 
HELX_P HELX_P68  68  THR D 201 ? ARG D 205 ? THR D 202 ARG D 206 5 ? 5  
HELX_P HELX_P69  69  GLU D 206 ? CYS D 216 ? GLU D 207 CYS D 217 1 ? 11 
HELX_P HELX_P70  70  ASP D 221 ? SER D 231 ? ASP D 222 SER D 232 1 ? 11 
HELX_P HELX_P71  71  ASN D 251 ? CYS D 256 ? ASN D 252 CYS D 257 1 ? 6  
HELX_P HELX_P72  72  PRO D 257 ? LEU D 260 ? PRO D 258 LEU D 261 5 ? 4  
HELX_P HELX_P73  73  GLY D 272 ? MET D 282 ? GLY D 273 MET D 283 1 ? 11 
HELX_P HELX_P74  74  ILE D 288 ? ASN D 295 ? ILE D 289 ASN D 296 1 ? 8  
HELX_P HELX_P75  75  GLY D 300 ? MET D 304 ? GLY D 301 MET D 305 5 ? 5  
HELX_P HELX_P76  76  GLY D 307 ? ALA D 320 ? GLY D 308 ALA D 321 1 ? 14 
HELX_P HELX_P77  77  TYR D 336 ? ALA D 346 ? TYR D 337 ALA D 347 1 ? 11 
HELX_P HELX_P78  78  SER D 347 ? GLN D 353 ? SER D 348 GLN D 354 5 ? 7  
HELX_P HELX_P79  79  LYS D 358 ? GLY D 365 ? LYS D 359 GLY D 366 1 ? 8  
HELX_P HELX_P80  80  ILE D 368 ? CYS D 373 ? ILE D 369 CYS D 374 1 ? 6  
HELX_P HELX_P81  81  ASP E 55  ? LEU E 64  ? ASP E 56  LEU E 65  5 ? 10 
HELX_P HELX_P82  82  ASN E 77  ? ASN E 91  ? ASN E 78  ASN E 92  1 ? 15 
HELX_P HELX_P83  83  ALA E 96  ? HIS E 100 ? ALA E 97  HIS E 101 5 ? 5  
HELX_P HELX_P84  84  PRO E 111 ? ASN E 127 ? PRO E 112 ASN E 128 1 ? 17 
HELX_P HELX_P85  85  GLN E 136 ? SER E 144 ? GLN E 137 SER E 145 1 ? 9  
HELX_P HELX_P86  86  PRO E 171 ? ILE E 174 ? PRO E 172 ILE E 175 5 ? 4  
HELX_P HELX_P87  87  ALA E 180 ? ARG E 195 ? ALA E 181 ARG E 196 1 ? 16 
HELX_P HELX_P88  88  THR E 201 ? ARG E 205 ? THR E 202 ARG E 206 5 ? 5  
HELX_P HELX_P89  89  GLU E 206 ? CYS E 216 ? GLU E 207 CYS E 217 1 ? 11 
HELX_P HELX_P90  90  ASP E 221 ? SER E 231 ? ASP E 222 SER E 232 1 ? 11 
HELX_P HELX_P91  91  ASN E 251 ? CYS E 256 ? ASN E 252 CYS E 257 1 ? 6  
HELX_P HELX_P92  92  PRO E 257 ? LEU E 260 ? PRO E 258 LEU E 261 5 ? 4  
HELX_P HELX_P93  93  GLY E 272 ? MET E 282 ? GLY E 273 MET E 283 1 ? 11 
HELX_P HELX_P94  94  ILE E 288 ? ASN E 295 ? ILE E 289 ASN E 296 1 ? 8  
HELX_P HELX_P95  95  GLY E 300 ? MET E 304 ? GLY E 301 MET E 305 5 ? 5  
HELX_P HELX_P96  96  GLY E 307 ? ALA E 320 ? GLY E 308 ALA E 321 1 ? 14 
HELX_P HELX_P97  97  TYR E 336 ? ALA E 346 ? TYR E 337 ALA E 347 1 ? 11 
HELX_P HELX_P98  98  SER E 347 ? GLN E 353 ? SER E 348 GLN E 354 5 ? 7  
HELX_P HELX_P99  99  LYS E 358 ? GLY E 365 ? LYS E 359 GLY E 366 1 ? 8  
HELX_P HELX_P100 100 ILE E 368 ? CYS E 373 ? ILE E 369 CYS E 374 1 ? 6  
HELX_P HELX_P101 101 ASP F 55  ? LEU F 64  ? ASP F 56  LEU F 65  5 ? 10 
HELX_P HELX_P102 102 ASN F 77  ? ASN F 91  ? ASN F 78  ASN F 92  1 ? 15 
HELX_P HELX_P103 103 ALA F 96  ? HIS F 100 ? ALA F 97  HIS F 101 5 ? 5  
HELX_P HELX_P104 104 PRO F 111 ? ASN F 127 ? PRO F 112 ASN F 128 1 ? 17 
HELX_P HELX_P105 105 GLN F 136 ? SER F 144 ? GLN F 137 SER F 145 1 ? 9  
HELX_P HELX_P106 106 PRO F 171 ? ILE F 174 ? PRO F 172 ILE F 175 5 ? 4  
HELX_P HELX_P107 107 ALA F 180 ? ARG F 195 ? ALA F 181 ARG F 196 1 ? 16 
HELX_P HELX_P108 108 THR F 201 ? ARG F 205 ? THR F 202 ARG F 206 5 ? 5  
HELX_P HELX_P109 109 GLU F 206 ? CYS F 216 ? GLU F 207 CYS F 217 1 ? 11 
HELX_P HELX_P110 110 ASP F 221 ? SER F 231 ? ASP F 222 SER F 232 1 ? 11 
HELX_P HELX_P111 111 ASN F 251 ? CYS F 256 ? ASN F 252 CYS F 257 1 ? 6  
HELX_P HELX_P112 112 PRO F 257 ? LEU F 260 ? PRO F 258 LEU F 261 5 ? 4  
HELX_P HELX_P113 113 GLY F 272 ? MET F 282 ? GLY F 273 MET F 283 1 ? 11 
HELX_P HELX_P114 114 ILE F 288 ? ASN F 295 ? ILE F 289 ASN F 296 1 ? 8  
HELX_P HELX_P115 115 GLY F 300 ? MET F 304 ? GLY F 301 MET F 305 5 ? 5  
HELX_P HELX_P116 116 GLY F 307 ? ALA F 320 ? GLY F 308 ALA F 321 1 ? 14 
HELX_P HELX_P117 117 TYR F 336 ? ALA F 346 ? TYR F 337 ALA F 347 1 ? 11 
HELX_P HELX_P118 118 SER F 347 ? GLN F 353 ? SER F 348 GLN F 354 5 ? 7  
HELX_P HELX_P119 119 LYS F 358 ? GLY F 365 ? LYS F 359 GLY F 366 1 ? 8  
HELX_P HELX_P120 120 ILE F 368 ? CYS F 373 ? ILE F 369 CYS F 374 1 ? 6  
HELX_P HELX_P121 121 ASP G 55  ? LEU G 64  ? ASP G 56  LEU G 65  5 ? 10 
HELX_P HELX_P122 122 ASN G 77  ? ASN G 91  ? ASN G 78  ASN G 92  1 ? 15 
HELX_P HELX_P123 123 ALA G 96  ? HIS G 100 ? ALA G 97  HIS G 101 5 ? 5  
HELX_P HELX_P124 124 PRO G 111 ? ASN G 127 ? PRO G 112 ASN G 128 1 ? 17 
HELX_P HELX_P125 125 GLN G 136 ? SER G 144 ? GLN G 137 SER G 145 1 ? 9  
HELX_P HELX_P126 126 PRO G 171 ? ILE G 174 ? PRO G 172 ILE G 175 5 ? 4  
HELX_P HELX_P127 127 ALA G 180 ? ARG G 195 ? ALA G 181 ARG G 196 1 ? 16 
HELX_P HELX_P128 128 THR G 201 ? ARG G 205 ? THR G 202 ARG G 206 5 ? 5  
HELX_P HELX_P129 129 GLU G 206 ? CYS G 216 ? GLU G 207 CYS G 217 1 ? 11 
HELX_P HELX_P130 130 ASP G 221 ? SER G 231 ? ASP G 222 SER G 232 1 ? 11 
HELX_P HELX_P131 131 ASN G 251 ? CYS G 256 ? ASN G 252 CYS G 257 1 ? 6  
HELX_P HELX_P132 132 PRO G 257 ? LEU G 260 ? PRO G 258 LEU G 261 5 ? 4  
HELX_P HELX_P133 133 GLY G 272 ? MET G 282 ? GLY G 273 MET G 283 1 ? 11 
HELX_P HELX_P134 134 ILE G 288 ? ASN G 295 ? ILE G 289 ASN G 296 1 ? 8  
HELX_P HELX_P135 135 GLY G 300 ? MET G 304 ? GLY G 301 MET G 305 5 ? 5  
HELX_P HELX_P136 136 GLY G 307 ? ALA G 320 ? GLY G 308 ALA G 321 1 ? 14 
HELX_P HELX_P137 137 TYR G 336 ? ALA G 346 ? TYR G 337 ALA G 347 1 ? 11 
HELX_P HELX_P138 138 SER G 347 ? GLN G 353 ? SER G 348 GLN G 354 5 ? 7  
HELX_P HELX_P139 139 LYS G 358 ? GLY G 365 ? LYS G 359 GLY G 366 1 ? 8  
HELX_P HELX_P140 140 ILE G 368 ? CYS G 373 ? ILE G 369 CYS G 374 1 ? 6  
HELX_P HELX_P141 141 ASP H 55  ? LEU H 64  ? ASP H 56  LEU H 65  5 ? 10 
HELX_P HELX_P142 142 ASN H 77  ? ASN H 91  ? ASN H 78  ASN H 92  1 ? 15 
HELX_P HELX_P143 143 ALA H 96  ? HIS H 100 ? ALA H 97  HIS H 101 5 ? 5  
HELX_P HELX_P144 144 PRO H 111 ? ASN H 127 ? PRO H 112 ASN H 128 1 ? 17 
HELX_P HELX_P145 145 GLN H 136 ? SER H 144 ? GLN H 137 SER H 145 1 ? 9  
HELX_P HELX_P146 146 PRO H 171 ? ILE H 174 ? PRO H 172 ILE H 175 5 ? 4  
HELX_P HELX_P147 147 ALA H 180 ? ARG H 195 ? ALA H 181 ARG H 196 1 ? 16 
HELX_P HELX_P148 148 THR H 201 ? ARG H 205 ? THR H 202 ARG H 206 5 ? 5  
HELX_P HELX_P149 149 GLU H 206 ? CYS H 216 ? GLU H 207 CYS H 217 1 ? 11 
HELX_P HELX_P150 150 ASP H 221 ? SER H 231 ? ASP H 222 SER H 232 1 ? 11 
HELX_P HELX_P151 151 ASN H 251 ? CYS H 256 ? ASN H 252 CYS H 257 1 ? 6  
HELX_P HELX_P152 152 PRO H 257 ? LEU H 260 ? PRO H 258 LEU H 261 5 ? 4  
HELX_P HELX_P153 153 GLY H 272 ? MET H 282 ? GLY H 273 MET H 283 1 ? 11 
HELX_P HELX_P154 154 ILE H 288 ? ASN H 295 ? ILE H 289 ASN H 296 1 ? 8  
HELX_P HELX_P155 155 GLY H 300 ? MET H 304 ? GLY H 301 MET H 305 5 ? 5  
HELX_P HELX_P156 156 GLY H 307 ? ALA H 320 ? GLY H 308 ALA H 321 1 ? 14 
HELX_P HELX_P157 157 TYR H 336 ? ALA H 346 ? TYR H 337 ALA H 347 1 ? 11 
HELX_P HELX_P158 158 SER H 347 ? GLN H 353 ? SER H 348 GLN H 354 5 ? 7  
HELX_P HELX_P159 159 LYS H 358 ? GLY H 365 ? LYS H 359 GLY H 366 1 ? 8  
HELX_P HELX_P160 160 ILE H 368 ? CYS H 373 ? ILE H 369 CYS H 374 1 ? 6  
HELX_P HELX_P161 161 ASP I 55  ? LEU I 64  ? ASP I 56  LEU I 65  5 ? 10 
HELX_P HELX_P162 162 ASN I 77  ? ASN I 91  ? ASN I 78  ASN I 92  1 ? 15 
HELX_P HELX_P163 163 ALA I 96  ? HIS I 100 ? ALA I 97  HIS I 101 5 ? 5  
HELX_P HELX_P164 164 PRO I 111 ? ASN I 127 ? PRO I 112 ASN I 128 1 ? 17 
HELX_P HELX_P165 165 GLN I 136 ? SER I 144 ? GLN I 137 SER I 145 1 ? 9  
HELX_P HELX_P166 166 PRO I 171 ? ILE I 174 ? PRO I 172 ILE I 175 5 ? 4  
HELX_P HELX_P167 167 ALA I 180 ? ARG I 195 ? ALA I 181 ARG I 196 1 ? 16 
HELX_P HELX_P168 168 THR I 201 ? ARG I 205 ? THR I 202 ARG I 206 5 ? 5  
HELX_P HELX_P169 169 GLU I 206 ? CYS I 216 ? GLU I 207 CYS I 217 1 ? 11 
HELX_P HELX_P170 170 ASP I 221 ? SER I 231 ? ASP I 222 SER I 232 1 ? 11 
HELX_P HELX_P171 171 ASN I 251 ? CYS I 256 ? ASN I 252 CYS I 257 1 ? 6  
HELX_P HELX_P172 172 PRO I 257 ? LEU I 260 ? PRO I 258 LEU I 261 5 ? 4  
HELX_P HELX_P173 173 GLY I 272 ? MET I 282 ? GLY I 273 MET I 283 1 ? 11 
HELX_P HELX_P174 174 ILE I 288 ? ASN I 295 ? ILE I 289 ASN I 296 1 ? 8  
HELX_P HELX_P175 175 GLY I 300 ? MET I 304 ? GLY I 301 MET I 305 5 ? 5  
HELX_P HELX_P176 176 GLY I 307 ? ALA I 320 ? GLY I 308 ALA I 321 1 ? 14 
HELX_P HELX_P177 177 TYR I 336 ? ALA I 346 ? TYR I 337 ALA I 347 1 ? 11 
HELX_P HELX_P178 178 SER I 347 ? GLN I 353 ? SER I 348 GLN I 354 5 ? 7  
HELX_P HELX_P179 179 LYS I 358 ? GLY I 365 ? LYS I 359 GLY I 366 1 ? 8  
HELX_P HELX_P180 180 ILE I 368 ? CYS I 373 ? ILE I 369 CYS I 374 1 ? 6  
HELX_P HELX_P181 181 ASP J 55  ? LEU J 64  ? ASP J 56  LEU J 65  5 ? 10 
HELX_P HELX_P182 182 ASN J 77  ? ASN J 91  ? ASN J 78  ASN J 92  1 ? 15 
HELX_P HELX_P183 183 ALA J 96  ? HIS J 100 ? ALA J 97  HIS J 101 5 ? 5  
HELX_P HELX_P184 184 PRO J 111 ? ASN J 127 ? PRO J 112 ASN J 128 1 ? 17 
HELX_P HELX_P185 185 GLN J 136 ? SER J 144 ? GLN J 137 SER J 145 1 ? 9  
HELX_P HELX_P186 186 PRO J 171 ? ILE J 174 ? PRO J 172 ILE J 175 5 ? 4  
HELX_P HELX_P187 187 ALA J 180 ? ARG J 195 ? ALA J 181 ARG J 196 1 ? 16 
HELX_P HELX_P188 188 THR J 201 ? ARG J 205 ? THR J 202 ARG J 206 5 ? 5  
HELX_P HELX_P189 189 GLU J 206 ? CYS J 216 ? GLU J 207 CYS J 217 1 ? 11 
HELX_P HELX_P190 190 ASP J 221 ? SER J 231 ? ASP J 222 SER J 232 1 ? 11 
HELX_P HELX_P191 191 ASN J 251 ? CYS J 256 ? ASN J 252 CYS J 257 1 ? 6  
HELX_P HELX_P192 192 PRO J 257 ? LEU J 260 ? PRO J 258 LEU J 261 5 ? 4  
HELX_P HELX_P193 193 GLY J 272 ? MET J 282 ? GLY J 273 MET J 283 1 ? 11 
HELX_P HELX_P194 194 ILE J 288 ? ASN J 295 ? ILE J 289 ASN J 296 1 ? 8  
HELX_P HELX_P195 195 GLY J 300 ? MET J 304 ? GLY J 301 MET J 305 5 ? 5  
HELX_P HELX_P196 196 GLY J 307 ? ALA J 320 ? GLY J 308 ALA J 321 1 ? 14 
HELX_P HELX_P197 197 TYR J 336 ? ALA J 346 ? TYR J 337 ALA J 347 1 ? 11 
HELX_P HELX_P198 198 SER J 347 ? GLN J 353 ? SER J 348 GLN J 354 5 ? 7  
HELX_P HELX_P199 199 LYS J 358 ? GLY J 365 ? LYS J 359 GLY J 366 1 ? 8  
HELX_P HELX_P200 200 ILE J 368 ? CYS J 373 ? ILE J 369 CYS J 374 1 ? 6  
HELX_P HELX_P201 201 ALA K 1   ? ARG K 19  ? ALA K 42  ARG K 60  1 ? 19 
HELX_P HELX_P202 202 LYS K 20  ? GLY K 22  ? LYS K 61  GLY K 63  5 ? 3  
HELX_P HELX_P203 203 GLY K 35  ? GLY K 47  ? GLY K 76  GLY K 88  1 ? 13 
HELX_P HELX_P204 204 MET K 58  ? SER K 75  ? MET K 99  SER K 116 1 ? 18 
HELX_P HELX_P205 205 GLY K 84  ? ASP K 90  ? GLY K 125 ASP K 131 1 ? 7  
HELX_P HELX_P206 206 ASN K 92  ? ILE K 109 ? ASN K 133 ILE K 150 1 ? 18 
HELX_P HELX_P207 207 ALA L 1   ? ARG L 19  ? ALA M 42  ARG M 60  1 ? 19 
HELX_P HELX_P208 208 LYS L 20  ? GLY L 22  ? LYS M 61  GLY M 63  5 ? 3  
HELX_P HELX_P209 209 GLY L 35  ? GLY L 47  ? GLY M 76  GLY M 88  1 ? 13 
HELX_P HELX_P210 210 MET L 58  ? SER L 75  ? MET M 99  SER M 116 1 ? 18 
HELX_P HELX_P211 211 GLY L 84  ? ASP L 90  ? GLY M 125 ASP M 131 1 ? 7  
HELX_P HELX_P212 212 ASN L 92  ? ILE L 109 ? ASN M 133 ILE M 150 1 ? 18 
HELX_P HELX_P213 213 ALA M 1   ? ARG M 19  ? ALA L 42  ARG L 60  1 ? 19 
HELX_P HELX_P214 214 LYS M 20  ? GLY M 22  ? LYS L 61  GLY L 63  5 ? 3  
HELX_P HELX_P215 215 GLY M 35  ? GLY M 47  ? GLY L 76  GLY L 88  1 ? 13 
HELX_P HELX_P216 216 MET M 58  ? SER M 75  ? MET L 99  SER L 116 1 ? 18 
HELX_P HELX_P217 217 GLY M 84  ? ASP M 90  ? GLY L 125 ASP L 131 1 ? 7  
HELX_P HELX_P218 218 ASN M 92  ? ILE M 109 ? ASN L 133 ILE L 150 1 ? 18 
HELX_P HELX_P219 219 ALA N 1   ? ARG N 19  ? ALA O 42  ARG O 60  1 ? 19 
HELX_P HELX_P220 220 LYS N 20  ? GLY N 22  ? LYS O 61  GLY O 63  5 ? 3  
HELX_P HELX_P221 221 GLY N 35  ? GLY N 47  ? GLY O 76  GLY O 88  1 ? 13 
HELX_P HELX_P222 222 MET N 58  ? SER N 75  ? MET O 99  SER O 116 1 ? 18 
HELX_P HELX_P223 223 GLY N 84  ? ASP N 90  ? GLY O 125 ASP O 131 1 ? 7  
HELX_P HELX_P224 224 ASN N 92  ? ILE N 109 ? ASN O 133 ILE O 150 1 ? 18 
HELX_P HELX_P225 225 ALA O 1   ? ARG O 19  ? ALA N 42  ARG N 60  1 ? 19 
HELX_P HELX_P226 226 LYS O 20  ? GLY O 22  ? LYS N 61  GLY N 63  5 ? 3  
HELX_P HELX_P227 227 GLY O 35  ? GLY O 47  ? GLY N 76  GLY N 88  1 ? 13 
HELX_P HELX_P228 228 MET O 58  ? SER O 75  ? MET N 99  SER N 116 1 ? 18 
HELX_P HELX_P229 229 GLY O 84  ? ASP O 90  ? GLY N 125 ASP N 131 1 ? 7  
HELX_P HELX_P230 230 ASN O 92  ? ILE O 109 ? ASN N 133 ILE N 150 1 ? 18 
HELX_P HELX_P231 231 ALA P 1   ? ARG P 19  ? ALA Q 42  ARG Q 60  1 ? 19 
HELX_P HELX_P232 232 LYS P 20  ? GLY P 22  ? LYS Q 61  GLY Q 63  5 ? 3  
HELX_P HELX_P233 233 GLY P 35  ? GLY P 47  ? GLY Q 76  GLY Q 88  1 ? 13 
HELX_P HELX_P234 234 MET P 58  ? SER P 75  ? MET Q 99  SER Q 116 1 ? 18 
HELX_P HELX_P235 235 GLY P 84  ? ASP P 90  ? GLY Q 125 ASP Q 131 1 ? 7  
HELX_P HELX_P236 236 ASN P 92  ? ILE P 109 ? ASN Q 133 ILE Q 150 1 ? 18 
HELX_P HELX_P237 237 ALA Q 1   ? ARG Q 19  ? ALA P 42  ARG P 60  1 ? 19 
HELX_P HELX_P238 238 LYS Q 20  ? GLY Q 22  ? LYS P 61  GLY P 63  5 ? 3  
HELX_P HELX_P239 239 GLY Q 35  ? GLY Q 47  ? GLY P 76  GLY P 88  1 ? 13 
HELX_P HELX_P240 240 MET Q 58  ? SER Q 75  ? MET P 99  SER P 116 1 ? 18 
HELX_P HELX_P241 241 GLY Q 84  ? ASP Q 90  ? GLY P 125 ASP P 131 1 ? 7  
HELX_P HELX_P242 242 ASN Q 92  ? ILE Q 109 ? ASN P 133 ILE P 150 1 ? 18 
HELX_P HELX_P243 243 ALA R 1   ? ARG R 19  ? ALA S 42  ARG S 60  1 ? 19 
HELX_P HELX_P244 244 LYS R 20  ? GLY R 22  ? LYS S 61  GLY S 63  5 ? 3  
HELX_P HELX_P245 245 GLY R 35  ? GLY R 47  ? GLY S 76  GLY S 88  1 ? 13 
HELX_P HELX_P246 246 MET R 58  ? SER R 75  ? MET S 99  SER S 116 1 ? 18 
HELX_P HELX_P247 247 GLY R 84  ? ASP R 90  ? GLY S 125 ASP S 131 1 ? 7  
HELX_P HELX_P248 248 ASN R 92  ? ILE R 109 ? ASN S 133 ILE S 150 1 ? 18 
HELX_P HELX_P249 249 ALA S 1   ? ARG S 19  ? ALA R 42  ARG R 60  1 ? 19 
HELX_P HELX_P250 250 LYS S 20  ? GLY S 22  ? LYS R 61  GLY R 63  5 ? 3  
HELX_P HELX_P251 251 GLY S 35  ? GLY S 47  ? GLY R 76  GLY R 88  1 ? 13 
HELX_P HELX_P252 252 MET S 58  ? SER S 75  ? MET R 99  SER R 116 1 ? 18 
HELX_P HELX_P253 253 GLY S 84  ? ASP S 90  ? GLY R 125 ASP R 131 1 ? 7  
HELX_P HELX_P254 254 ASN S 92  ? ILE S 109 ? ASN R 133 ILE R 150 1 ? 18 
HELX_P HELX_P255 255 ALA T 1   ? ARG T 19  ? ALA T 42  ARG T 60  1 ? 19 
HELX_P HELX_P256 256 LYS T 20  ? GLY T 22  ? LYS T 61  GLY T 63  5 ? 3  
HELX_P HELX_P257 257 GLY T 35  ? GLY T 47  ? GLY T 76  GLY T 88  1 ? 13 
HELX_P HELX_P258 258 MET T 58  ? SER T 75  ? MET T 99  SER T 116 1 ? 18 
HELX_P HELX_P259 259 GLY T 84  ? ASP T 90  ? GLY T 125 ASP T 131 1 ? 7  
HELX_P HELX_P260 260 ASN T 92  ? ILE T 109 ? ASN T 133 ILE T 150 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 6 ? 
B  ? 3 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 5 ? 
F  ? 2 ? 
G  ? 6 ? 
H  ? 3 ? 
I  ? 2 ? 
J  ? 3 ? 
K  ? 5 ? 
L  ? 2 ? 
M  ? 6 ? 
N  ? 3 ? 
O  ? 2 ? 
P  ? 3 ? 
Q  ? 5 ? 
R  ? 2 ? 
S  ? 6 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 5 ? 
X  ? 2 ? 
Y  ? 6 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 3 ? 
AC ? 5 ? 
AD ? 2 ? 
AE ? 6 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 3 ? 
AI ? 5 ? 
AJ ? 2 ? 
AK ? 6 ? 
AL ? 3 ? 
AM ? 2 ? 
AN ? 3 ? 
AO ? 5 ? 
AP ? 2 ? 
AQ ? 6 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 3 ? 
AU ? 5 ? 
AV ? 2 ? 
AW ? 6 ? 
AX ? 3 ? 
AY ? 2 ? 
AZ ? 3 ? 
BA ? 5 ? 
BB ? 2 ? 
BC ? 6 ? 
BD ? 3 ? 
BE ? 2 ? 
BF ? 3 ? 
BG ? 5 ? 
BH ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? parallel      
A  4 5 ? parallel      
A  5 6 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? parallel      
E  4 5 ? parallel      
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? parallel      
G  4 5 ? parallel      
G  5 6 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? parallel      
K  4 5 ? parallel      
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? parallel      
M  4 5 ? parallel      
M  5 6 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? parallel      
Q  4 5 ? parallel      
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? parallel      
S  4 5 ? parallel      
S  5 6 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? parallel      
W  4 5 ? parallel      
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Y  5 6 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AE 5 6 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? parallel      
AI 4 5 ? parallel      
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? parallel      
AK 4 5 ? parallel      
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? parallel      
AO 4 5 ? parallel      
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? parallel      
AQ 4 5 ? parallel      
AQ 5 6 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? parallel      
AU 4 5 ? parallel      
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? parallel      
AW 4 5 ? parallel      
AW 5 6 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? parallel      
BC 4 5 ? parallel      
BC 5 6 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? parallel      
BG 4 5 ? parallel      
BH 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.symmetry 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ALA A 28  ? PRO A 31  ? ? ALA A 29  PRO A 32  
A  2 MET A 15  ? PHE A 20  ? ? MET A 16  PHE A 21  
A  3 LEU A 7   ? ASN A 11  ? ? LEU A 8   ASN A 12  
A  4 VAL A 102 ? GLU A 106 ? ? VAL A 103 GLU A 107 
A  5 ALA A 130 ? ILE A 135 ? ? ALA A 131 ILE A 136 
A  6 ILE A 356 ? SER A 357 ? ? ILE A 357 SER A 358 
B  1 TYR A 52  ? VAL A 53  ? ? TYR A 53  VAL A 54  
B  2 VAL A 34  ? ARG A 36  ? ? VAL A 35  ARG A 37  
B  3 THR A 65  ? LYS A 67  ? ? THR A 66  LYS A 68  
C  1 ILE A 70  ? GLU A 71  ? ? ILE A 71  GLU A 72  
C  2 ILE A 74  ? VAL A 75  ? ? ILE A 75  VAL A 76  
D  1 TYR A 168 ? ALA A 169 ? ? TYR A 169 ALA A 170 
D  2 THR A 159 ? TYR A 165 ? ? THR A 160 TYR A 166 
D  3 LEU A 175 ? LEU A 177 ? ? LEU A 176 LEU A 178 
E  1 TYR A 168 ? ALA A 169 ? ? TYR A 169 ALA A 170 
E  2 THR A 159 ? TYR A 165 ? ? THR A 160 TYR A 166 
E  3 GLY A 149 ? SER A 154 ? ? GLY A 150 SER A 155 
E  4 THR A 296 ? SER A 299 ? ? THR A 297 SER A 300 
E  5 ILE A 328 ? ILE A 329 ? ? ILE A 329 ILE A 330 
F  1 LYS A 237 ? GLU A 240 ? ? LYS A 238 GLU A 241 
F  2 VAL A 246 ? ILE A 249 ? ? VAL A 247 ILE A 250 
G  1 ALA B 28  ? PRO B 31  ? ? ALA B 29  PRO B 32  
G  2 MET B 15  ? PHE B 20  ? ? MET B 16  PHE B 21  
G  3 LEU B 7   ? ASN B 11  ? ? LEU B 8   ASN B 12  
G  4 VAL B 102 ? GLU B 106 ? ? VAL B 103 GLU B 107 
G  5 ALA B 130 ? ILE B 135 ? ? ALA B 131 ILE B 136 
G  6 ILE B 356 ? SER B 357 ? ? ILE B 357 SER B 358 
H  1 TYR B 52  ? VAL B 53  ? ? TYR B 53  VAL B 54  
H  2 VAL B 34  ? ARG B 36  ? ? VAL B 35  ARG B 37  
H  3 THR B 65  ? LYS B 67  ? ? THR B 66  LYS B 68  
I  1 ILE B 70  ? GLU B 71  ? ? ILE B 71  GLU B 72  
I  2 ILE B 74  ? VAL B 75  ? ? ILE B 75  VAL B 76  
J  1 TYR B 168 ? ALA B 169 ? ? TYR B 169 ALA B 170 
J  2 THR B 159 ? TYR B 165 ? ? THR B 160 TYR B 166 
J  3 LEU B 175 ? LEU B 177 ? ? LEU B 176 LEU B 178 
K  1 TYR B 168 ? ALA B 169 ? ? TYR B 169 ALA B 170 
K  2 THR B 159 ? TYR B 165 ? ? THR B 160 TYR B 166 
K  3 GLY B 149 ? SER B 154 ? ? GLY B 150 SER B 155 
K  4 THR B 296 ? SER B 299 ? ? THR B 297 SER B 300 
K  5 ILE B 328 ? ILE B 329 ? ? ILE B 329 ILE B 330 
L  1 LYS B 237 ? GLU B 240 ? ? LYS B 238 GLU B 241 
L  2 VAL B 246 ? ILE B 249 ? ? VAL B 247 ILE B 250 
M  1 ALA C 28  ? PRO C 31  ? ? ALA C 29  PRO C 32  
M  2 MET C 15  ? PHE C 20  ? ? MET C 16  PHE C 21  
M  3 LEU C 7   ? ASN C 11  ? ? LEU C 8   ASN C 12  
M  4 VAL C 102 ? GLU C 106 ? ? VAL C 103 GLU C 107 
M  5 ALA C 130 ? ILE C 135 ? ? ALA C 131 ILE C 136 
M  6 ILE C 356 ? SER C 357 ? ? ILE C 357 SER C 358 
N  1 TYR C 52  ? VAL C 53  ? ? TYR C 53  VAL C 54  
N  2 VAL C 34  ? ARG C 36  ? ? VAL C 35  ARG C 37  
N  3 THR C 65  ? LYS C 67  ? ? THR C 66  LYS C 68  
O  1 ILE C 70  ? GLU C 71  ? ? ILE C 71  GLU C 72  
O  2 ILE C 74  ? VAL C 75  ? ? ILE C 75  VAL C 76  
P  1 TYR C 168 ? ALA C 169 ? ? TYR C 169 ALA C 170 
P  2 THR C 159 ? TYR C 165 ? ? THR C 160 TYR C 166 
P  3 LEU C 175 ? LEU C 177 ? ? LEU C 176 LEU C 178 
Q  1 TYR C 168 ? ALA C 169 ? ? TYR C 169 ALA C 170 
Q  2 THR C 159 ? TYR C 165 ? ? THR C 160 TYR C 166 
Q  3 GLY C 149 ? SER C 154 ? ? GLY C 150 SER C 155 
Q  4 THR C 296 ? SER C 299 ? ? THR C 297 SER C 300 
Q  5 ILE C 328 ? ILE C 329 ? ? ILE C 329 ILE C 330 
R  1 LYS C 237 ? GLU C 240 ? ? LYS C 238 GLU C 241 
R  2 VAL C 246 ? ILE C 249 ? ? VAL C 247 ILE C 250 
S  1 ALA D 28  ? PRO D 31  ? ? ALA D 29  PRO D 32  
S  2 MET D 15  ? PHE D 20  ? ? MET D 16  PHE D 21  
S  3 LEU D 7   ? ASN D 11  ? ? LEU D 8   ASN D 12  
S  4 VAL D 102 ? GLU D 106 ? ? VAL D 103 GLU D 107 
S  5 ALA D 130 ? ILE D 135 ? ? ALA D 131 ILE D 136 
S  6 ILE D 356 ? SER D 357 ? ? ILE D 357 SER D 358 
T  1 TYR D 52  ? VAL D 53  ? ? TYR D 53  VAL D 54  
T  2 VAL D 34  ? ARG D 36  ? ? VAL D 35  ARG D 37  
T  3 THR D 65  ? LYS D 67  ? ? THR D 66  LYS D 68  
U  1 ILE D 70  ? GLU D 71  ? ? ILE D 71  GLU D 72  
U  2 ILE D 74  ? VAL D 75  ? ? ILE D 75  VAL D 76  
V  1 TYR D 168 ? ALA D 169 ? ? TYR D 169 ALA D 170 
V  2 THR D 159 ? TYR D 165 ? ? THR D 160 TYR D 166 
V  3 LEU D 175 ? LEU D 177 ? ? LEU D 176 LEU D 178 
W  1 TYR D 168 ? ALA D 169 ? ? TYR D 169 ALA D 170 
W  2 THR D 159 ? TYR D 165 ? ? THR D 160 TYR D 166 
W  3 GLY D 149 ? SER D 154 ? ? GLY D 150 SER D 155 
W  4 THR D 296 ? SER D 299 ? ? THR D 297 SER D 300 
W  5 ILE D 328 ? ILE D 329 ? ? ILE D 329 ILE D 330 
X  1 LYS D 237 ? GLU D 240 ? ? LYS D 238 GLU D 241 
X  2 VAL D 246 ? ILE D 249 ? ? VAL D 247 ILE D 250 
Y  1 ALA E 28  ? PRO E 31  ? ? ALA E 29  PRO E 32  
Y  2 MET E 15  ? PHE E 20  ? ? MET E 16  PHE E 21  
Y  3 LEU E 7   ? ASN E 11  ? ? LEU E 8   ASN E 12  
Y  4 VAL E 102 ? GLU E 106 ? ? VAL E 103 GLU E 107 
Y  5 ALA E 130 ? ILE E 135 ? ? ALA E 131 ILE E 136 
Y  6 ILE E 356 ? SER E 357 ? ? ILE E 357 SER E 358 
Z  1 TYR E 52  ? VAL E 53  ? ? TYR E 53  VAL E 54  
Z  2 VAL E 34  ? ARG E 36  ? ? VAL E 35  ARG E 37  
Z  3 THR E 65  ? LYS E 67  ? ? THR E 66  LYS E 68  
AA 1 ILE E 70  ? GLU E 71  ? ? ILE E 71  GLU E 72  
AA 2 ILE E 74  ? VAL E 75  ? ? ILE E 75  VAL E 76  
AB 1 TYR E 168 ? ALA E 169 ? ? TYR E 169 ALA E 170 
AB 2 THR E 159 ? TYR E 165 ? ? THR E 160 TYR E 166 
AB 3 LEU E 175 ? LEU E 177 ? ? LEU E 176 LEU E 178 
AC 1 TYR E 168 ? ALA E 169 ? ? TYR E 169 ALA E 170 
AC 2 THR E 159 ? TYR E 165 ? ? THR E 160 TYR E 166 
AC 3 GLY E 149 ? SER E 154 ? ? GLY E 150 SER E 155 
AC 4 THR E 296 ? SER E 299 ? ? THR E 297 SER E 300 
AC 5 ILE E 328 ? ILE E 329 ? ? ILE E 329 ILE E 330 
AD 1 LYS E 237 ? GLU E 240 ? ? LYS E 238 GLU E 241 
AD 2 VAL E 246 ? ILE E 249 ? ? VAL E 247 ILE E 250 
AE 1 ALA F 28  ? PRO F 31  ? ? ALA F 29  PRO F 32  
AE 2 MET F 15  ? PHE F 20  ? ? MET F 16  PHE F 21  
AE 3 LEU F 7   ? ASN F 11  ? ? LEU F 8   ASN F 12  
AE 4 VAL F 102 ? GLU F 106 ? ? VAL F 103 GLU F 107 
AE 5 ALA F 130 ? ILE F 135 ? ? ALA F 131 ILE F 136 
AE 6 ILE F 356 ? SER F 357 ? ? ILE F 357 SER F 358 
AF 1 TYR F 52  ? VAL F 53  ? ? TYR F 53  VAL F 54  
AF 2 VAL F 34  ? ARG F 36  ? ? VAL F 35  ARG F 37  
AF 3 THR F 65  ? LYS F 67  ? ? THR F 66  LYS F 68  
AG 1 ILE F 70  ? GLU F 71  ? ? ILE F 71  GLU F 72  
AG 2 ILE F 74  ? VAL F 75  ? ? ILE F 75  VAL F 76  
AH 1 TYR F 168 ? ALA F 169 ? ? TYR F 169 ALA F 170 
AH 2 THR F 159 ? TYR F 165 ? ? THR F 160 TYR F 166 
AH 3 LEU F 175 ? LEU F 177 ? ? LEU F 176 LEU F 178 
AI 1 TYR F 168 ? ALA F 169 ? ? TYR F 169 ALA F 170 
AI 2 THR F 159 ? TYR F 165 ? ? THR F 160 TYR F 166 
AI 3 GLY F 149 ? SER F 154 ? ? GLY F 150 SER F 155 
AI 4 THR F 296 ? SER F 299 ? ? THR F 297 SER F 300 
AI 5 ILE F 328 ? ILE F 329 ? ? ILE F 329 ILE F 330 
AJ 1 LYS F 237 ? GLU F 240 ? ? LYS F 238 GLU F 241 
AJ 2 VAL F 246 ? ILE F 249 ? ? VAL F 247 ILE F 250 
AK 1 ALA G 28  ? PRO G 31  ? ? ALA G 29  PRO G 32  
AK 2 MET G 15  ? PHE G 20  ? ? MET G 16  PHE G 21  
AK 3 LEU G 7   ? ASN G 11  ? ? LEU G 8   ASN G 12  
AK 4 VAL G 102 ? GLU G 106 ? ? VAL G 103 GLU G 107 
AK 5 ALA G 130 ? ILE G 135 ? ? ALA G 131 ILE G 136 
AK 6 ILE G 356 ? SER G 357 ? ? ILE G 357 SER G 358 
AL 1 TYR G 52  ? VAL G 53  ? ? TYR G 53  VAL G 54  
AL 2 VAL G 34  ? ARG G 36  ? ? VAL G 35  ARG G 37  
AL 3 THR G 65  ? LYS G 67  ? ? THR G 66  LYS G 68  
AM 1 ILE G 70  ? GLU G 71  ? ? ILE G 71  GLU G 72  
AM 2 ILE G 74  ? VAL G 75  ? ? ILE G 75  VAL G 76  
AN 1 TYR G 168 ? ALA G 169 ? ? TYR G 169 ALA G 170 
AN 2 THR G 159 ? TYR G 165 ? ? THR G 160 TYR G 166 
AN 3 LEU G 175 ? LEU G 177 ? ? LEU G 176 LEU G 178 
AO 1 TYR G 168 ? ALA G 169 ? ? TYR G 169 ALA G 170 
AO 2 THR G 159 ? TYR G 165 ? ? THR G 160 TYR G 166 
AO 3 GLY G 149 ? SER G 154 ? ? GLY G 150 SER G 155 
AO 4 THR G 296 ? SER G 299 ? ? THR G 297 SER G 300 
AO 5 ILE G 328 ? ILE G 329 ? ? ILE G 329 ILE G 330 
AP 1 LYS G 237 ? GLU G 240 ? ? LYS G 238 GLU G 241 
AP 2 VAL G 246 ? ILE G 249 ? ? VAL G 247 ILE G 250 
AQ 1 ALA H 28  ? PRO H 31  ? ? ALA H 29  PRO H 32  
AQ 2 MET H 15  ? PHE H 20  ? ? MET H 16  PHE H 21  
AQ 3 LEU H 7   ? ASN H 11  ? ? LEU H 8   ASN H 12  
AQ 4 VAL H 102 ? GLU H 106 ? ? VAL H 103 GLU H 107 
AQ 5 ALA H 130 ? ILE H 135 ? ? ALA H 131 ILE H 136 
AQ 6 ILE H 356 ? SER H 357 ? ? ILE H 357 SER H 358 
AR 1 TYR H 52  ? VAL H 53  ? ? TYR H 53  VAL H 54  
AR 2 VAL H 34  ? ARG H 36  ? ? VAL H 35  ARG H 37  
AR 3 THR H 65  ? LYS H 67  ? ? THR H 66  LYS H 68  
AS 1 ILE H 70  ? GLU H 71  ? ? ILE H 71  GLU H 72  
AS 2 ILE H 74  ? VAL H 75  ? ? ILE H 75  VAL H 76  
AT 1 TYR H 168 ? ALA H 169 ? ? TYR H 169 ALA H 170 
AT 2 THR H 159 ? TYR H 165 ? ? THR H 160 TYR H 166 
AT 3 LEU H 175 ? LEU H 177 ? ? LEU H 176 LEU H 178 
AU 1 TYR H 168 ? ALA H 169 ? ? TYR H 169 ALA H 170 
AU 2 THR H 159 ? TYR H 165 ? ? THR H 160 TYR H 166 
AU 3 GLY H 149 ? SER H 154 ? ? GLY H 150 SER H 155 
AU 4 THR H 296 ? SER H 299 ? ? THR H 297 SER H 300 
AU 5 ILE H 328 ? ILE H 329 ? ? ILE H 329 ILE H 330 
AV 1 LYS H 237 ? GLU H 240 ? ? LYS H 238 GLU H 241 
AV 2 VAL H 246 ? ILE H 249 ? ? VAL H 247 ILE H 250 
AW 1 ALA I 28  ? PRO I 31  ? ? ALA I 29  PRO I 32  
AW 2 MET I 15  ? PHE I 20  ? ? MET I 16  PHE I 21  
AW 3 LEU I 7   ? ASN I 11  ? ? LEU I 8   ASN I 12  
AW 4 VAL I 102 ? GLU I 106 ? ? VAL I 103 GLU I 107 
AW 5 ALA I 130 ? ILE I 135 ? ? ALA I 131 ILE I 136 
AW 6 ILE I 356 ? SER I 357 ? ? ILE I 357 SER I 358 
AX 1 TYR I 52  ? VAL I 53  ? ? TYR I 53  VAL I 54  
AX 2 VAL I 34  ? ARG I 36  ? ? VAL I 35  ARG I 37  
AX 3 THR I 65  ? LYS I 67  ? ? THR I 66  LYS I 68  
AY 1 ILE I 70  ? GLU I 71  ? ? ILE I 71  GLU I 72  
AY 2 ILE I 74  ? VAL I 75  ? ? ILE I 75  VAL I 76  
AZ 1 TYR I 168 ? ALA I 169 ? ? TYR I 169 ALA I 170 
AZ 2 THR I 159 ? TYR I 165 ? ? THR I 160 TYR I 166 
AZ 3 LEU I 175 ? LEU I 177 ? ? LEU I 176 LEU I 178 
BA 1 TYR I 168 ? ALA I 169 ? ? TYR I 169 ALA I 170 
BA 2 THR I 159 ? TYR I 165 ? ? THR I 160 TYR I 166 
BA 3 GLY I 149 ? SER I 154 ? ? GLY I 150 SER I 155 
BA 4 THR I 296 ? SER I 299 ? ? THR I 297 SER I 300 
BA 5 ILE I 328 ? ILE I 329 ? ? ILE I 329 ILE I 330 
BB 1 LYS I 237 ? GLU I 240 ? ? LYS I 238 GLU I 241 
BB 2 VAL I 246 ? ILE I 249 ? ? VAL I 247 ILE I 250 
BC 1 ALA J 28  ? PRO J 31  ? ? ALA J 29  PRO J 32  
BC 2 MET J 15  ? PHE J 20  ? ? MET J 16  PHE J 21  
BC 3 LEU J 7   ? ASN J 11  ? ? LEU J 8   ASN J 12  
BC 4 VAL J 102 ? GLU J 106 ? ? VAL J 103 GLU J 107 
BC 5 ALA J 130 ? ILE J 135 ? ? ALA J 131 ILE J 136 
BC 6 ILE J 356 ? SER J 357 ? ? ILE J 357 SER J 358 
BD 1 TYR J 52  ? VAL J 53  ? ? TYR J 53  VAL J 54  
BD 2 VAL J 34  ? ARG J 36  ? ? VAL J 35  ARG J 37  
BD 3 THR J 65  ? LYS J 67  ? ? THR J 66  LYS J 68  
BE 1 ILE J 70  ? GLU J 71  ? ? ILE J 71  GLU J 72  
BE 2 ILE J 74  ? VAL J 75  ? ? ILE J 75  VAL J 76  
BF 1 TYR J 168 ? ALA J 169 ? ? TYR J 169 ALA J 170 
BF 2 THR J 159 ? TYR J 165 ? ? THR J 160 TYR J 166 
BF 3 LEU J 175 ? LEU J 177 ? ? LEU J 176 LEU J 178 
BG 1 TYR J 168 ? ALA J 169 ? ? TYR J 169 ALA J 170 
BG 2 THR J 159 ? TYR J 165 ? ? THR J 160 TYR J 166 
BG 3 GLY J 149 ? SER J 154 ? ? GLY J 150 SER J 155 
BG 4 THR J 296 ? SER J 299 ? ? THR J 297 SER J 300 
BG 5 ILE J 328 ? ILE J 329 ? ? ILE J 329 ILE J 330 
BH 1 LYS J 237 ? GLU J 240 ? ? LYS J 238 GLU J 241 
BH 2 VAL J 246 ? ILE J 249 ? ? VAL J 247 ILE J 250 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O PHE A 30  ? O PHE A 31  N CYS A 16  ? N CYS A 17  
A  2 3 O LYS A 17  ? O LYS A 18  N ASP A 10  ? N ASP A 11  
A  3 4 N VAL A 9   ? N VAL A 10  O LEU A 103 ? O LEU A 104 
A  4 5 N LEU A 104 ? N LEU A 105 O TYR A 132 ? O TYR A 133 
A  5 6 N MET A 131 ? N MET A 132 O ILE A 356 ? O ILE A 357 
B  1 2 O TYR A 52  ? O TYR A 53  N GLY A 35  ? N GLY A 36  
B  2 3 N VAL A 34  ? N VAL A 35  O LYS A 67  ? O LYS A 68  
C  1 2 N GLU A 71  ? N GLU A 72  O ILE A 74  ? O ILE A 75  
D  1 2 O TYR A 168 ? O TYR A 169 N TYR A 165 ? N TYR A 166 
D  2 3 N THR A 159 ? N THR A 160 O LEU A 177 ? O LEU A 178 
E  1 2 O TYR A 168 ? O TYR A 169 N TYR A 165 ? N TYR A 166 
E  2 3 O ILE A 164 ? O ILE A 165 N GLY A 149 ? N GLY A 150 
E  3 4 N MET A 152 ? N MET A 153 O SER A 299 ? O SER A 300 
E  4 5 N THR A 296 ? N THR A 297 O ILE A 329 ? O ILE A 330 
F  1 2 N LYS A 237 ? N LYS A 238 O ILE A 249 ? O ILE A 250 
G  1 2 O PHE B 30  ? O PHE B 31  N CYS B 16  ? N CYS B 17  
G  2 3 O LYS B 17  ? O LYS B 18  N ASP B 10  ? N ASP B 11  
G  3 4 N VAL B 9   ? N VAL B 10  O LEU B 103 ? O LEU B 104 
G  4 5 N LEU B 104 ? N LEU B 105 O TYR B 132 ? O TYR B 133 
G  5 6 N MET B 131 ? N MET B 132 O ILE B 356 ? O ILE B 357 
H  1 2 O TYR B 52  ? O TYR B 53  N GLY B 35  ? N GLY B 36  
H  2 3 N VAL B 34  ? N VAL B 35  O LYS B 67  ? O LYS B 68  
I  1 2 N GLU B 71  ? N GLU B 72  O ILE B 74  ? O ILE B 75  
J  1 2 O TYR B 168 ? O TYR B 169 N TYR B 165 ? N TYR B 166 
J  2 3 N THR B 159 ? N THR B 160 O LEU B 177 ? O LEU B 178 
K  1 2 O TYR B 168 ? O TYR B 169 N TYR B 165 ? N TYR B 166 
K  2 3 O ILE B 164 ? O ILE B 165 N GLY B 149 ? N GLY B 150 
K  3 4 N MET B 152 ? N MET B 153 O SER B 299 ? O SER B 300 
K  4 5 N THR B 296 ? N THR B 297 O ILE B 329 ? O ILE B 330 
L  1 2 N LYS B 237 ? N LYS B 238 O ILE B 249 ? O ILE B 250 
M  1 2 O PHE C 30  ? O PHE C 31  N CYS C 16  ? N CYS C 17  
M  2 3 O LYS C 17  ? O LYS C 18  N ASP C 10  ? N ASP C 11  
M  3 4 N VAL C 9   ? N VAL C 10  O LEU C 103 ? O LEU C 104 
M  4 5 N LEU C 104 ? N LEU C 105 O TYR C 132 ? O TYR C 133 
M  5 6 N MET C 131 ? N MET C 132 O ILE C 356 ? O ILE C 357 
N  1 2 O TYR C 52  ? O TYR C 53  N GLY C 35  ? N GLY C 36  
N  2 3 N VAL C 34  ? N VAL C 35  O LYS C 67  ? O LYS C 68  
O  1 2 N GLU C 71  ? N GLU C 72  O ILE C 74  ? O ILE C 75  
P  1 2 O TYR C 168 ? O TYR C 169 N TYR C 165 ? N TYR C 166 
P  2 3 N THR C 159 ? N THR C 160 O LEU C 177 ? O LEU C 178 
Q  1 2 O TYR C 168 ? O TYR C 169 N TYR C 165 ? N TYR C 166 
Q  2 3 O ILE C 164 ? O ILE C 165 N GLY C 149 ? N GLY C 150 
Q  3 4 N MET C 152 ? N MET C 153 O SER C 299 ? O SER C 300 
Q  4 5 N THR C 296 ? N THR C 297 O ILE C 329 ? O ILE C 330 
R  1 2 N LYS C 237 ? N LYS C 238 O ILE C 249 ? O ILE C 250 
S  1 2 O PHE D 30  ? O PHE D 31  N CYS D 16  ? N CYS D 17  
S  2 3 O LYS D 17  ? O LYS D 18  N ASP D 10  ? N ASP D 11  
S  3 4 N VAL D 9   ? N VAL D 10  O LEU D 103 ? O LEU D 104 
S  4 5 N LEU D 104 ? N LEU D 105 O TYR D 132 ? O TYR D 133 
S  5 6 N MET D 131 ? N MET D 132 O ILE D 356 ? O ILE D 357 
T  1 2 O TYR D 52  ? O TYR D 53  N GLY D 35  ? N GLY D 36  
T  2 3 N VAL D 34  ? N VAL D 35  O LYS D 67  ? O LYS D 68  
U  1 2 N GLU D 71  ? N GLU D 72  O ILE D 74  ? O ILE D 75  
V  1 2 O TYR D 168 ? O TYR D 169 N TYR D 165 ? N TYR D 166 
V  2 3 N THR D 159 ? N THR D 160 O LEU D 177 ? O LEU D 178 
W  1 2 O TYR D 168 ? O TYR D 169 N TYR D 165 ? N TYR D 166 
W  2 3 O ILE D 164 ? O ILE D 165 N GLY D 149 ? N GLY D 150 
W  3 4 N MET D 152 ? N MET D 153 O SER D 299 ? O SER D 300 
W  4 5 N THR D 296 ? N THR D 297 O ILE D 329 ? O ILE D 330 
X  1 2 N LYS D 237 ? N LYS D 238 O ILE D 249 ? O ILE D 250 
Y  1 2 O PHE E 30  ? O PHE E 31  N CYS E 16  ? N CYS E 17  
Y  2 3 O LYS E 17  ? O LYS E 18  N ASP E 10  ? N ASP E 11  
Y  3 4 N VAL E 9   ? N VAL E 10  O LEU E 103 ? O LEU E 104 
Y  4 5 N LEU E 104 ? N LEU E 105 O TYR E 132 ? O TYR E 133 
Y  5 6 N MET E 131 ? N MET E 132 O ILE E 356 ? O ILE E 357 
Z  1 2 O TYR E 52  ? O TYR E 53  N GLY E 35  ? N GLY E 36  
Z  2 3 N VAL E 34  ? N VAL E 35  O LYS E 67  ? O LYS E 68  
AA 1 2 N GLU E 71  ? N GLU E 72  O ILE E 74  ? O ILE E 75  
AB 1 2 O TYR E 168 ? O TYR E 169 N TYR E 165 ? N TYR E 166 
AB 2 3 N THR E 159 ? N THR E 160 O LEU E 177 ? O LEU E 178 
AC 1 2 O TYR E 168 ? O TYR E 169 N TYR E 165 ? N TYR E 166 
AC 2 3 O ILE E 164 ? O ILE E 165 N GLY E 149 ? N GLY E 150 
AC 3 4 N MET E 152 ? N MET E 153 O SER E 299 ? O SER E 300 
AC 4 5 N THR E 296 ? N THR E 297 O ILE E 329 ? O ILE E 330 
AD 1 2 N LYS E 237 ? N LYS E 238 O ILE E 249 ? O ILE E 250 
AE 1 2 O PHE F 30  ? O PHE F 31  N CYS F 16  ? N CYS F 17  
AE 2 3 O LYS F 17  ? O LYS F 18  N ASP F 10  ? N ASP F 11  
AE 3 4 N VAL F 9   ? N VAL F 10  O LEU F 103 ? O LEU F 104 
AE 4 5 N LEU F 104 ? N LEU F 105 O TYR F 132 ? O TYR F 133 
AE 5 6 N MET F 131 ? N MET F 132 O ILE F 356 ? O ILE F 357 
AF 1 2 O TYR F 52  ? O TYR F 53  N GLY F 35  ? N GLY F 36  
AF 2 3 N VAL F 34  ? N VAL F 35  O LYS F 67  ? O LYS F 68  
AG 1 2 N GLU F 71  ? N GLU F 72  O ILE F 74  ? O ILE F 75  
AH 1 2 O TYR F 168 ? O TYR F 169 N TYR F 165 ? N TYR F 166 
AH 2 3 N THR F 159 ? N THR F 160 O LEU F 177 ? O LEU F 178 
AI 1 2 O TYR F 168 ? O TYR F 169 N TYR F 165 ? N TYR F 166 
AI 2 3 O ILE F 164 ? O ILE F 165 N GLY F 149 ? N GLY F 150 
AI 3 4 N MET F 152 ? N MET F 153 O SER F 299 ? O SER F 300 
AI 4 5 N THR F 296 ? N THR F 297 O ILE F 329 ? O ILE F 330 
AJ 1 2 N LYS F 237 ? N LYS F 238 O ILE F 249 ? O ILE F 250 
AK 1 2 O PHE G 30  ? O PHE G 31  N CYS G 16  ? N CYS G 17  
AK 2 3 O LYS G 17  ? O LYS G 18  N ASP G 10  ? N ASP G 11  
AK 3 4 N VAL G 9   ? N VAL G 10  O LEU G 103 ? O LEU G 104 
AK 4 5 N LEU G 104 ? N LEU G 105 O TYR G 132 ? O TYR G 133 
AK 5 6 N MET G 131 ? N MET G 132 O ILE G 356 ? O ILE G 357 
AL 1 2 O TYR G 52  ? O TYR G 53  N GLY G 35  ? N GLY G 36  
AL 2 3 N VAL G 34  ? N VAL G 35  O LYS G 67  ? O LYS G 68  
AM 1 2 N GLU G 71  ? N GLU G 72  O ILE G 74  ? O ILE G 75  
AN 1 2 O TYR G 168 ? O TYR G 169 N TYR G 165 ? N TYR G 166 
AN 2 3 N THR G 159 ? N THR G 160 O LEU G 177 ? O LEU G 178 
AO 1 2 O TYR G 168 ? O TYR G 169 N TYR G 165 ? N TYR G 166 
AO 2 3 O ILE G 164 ? O ILE G 165 N GLY G 149 ? N GLY G 150 
AO 3 4 N MET G 152 ? N MET G 153 O SER G 299 ? O SER G 300 
AO 4 5 N THR G 296 ? N THR G 297 O ILE G 329 ? O ILE G 330 
AP 1 2 N LYS G 237 ? N LYS G 238 O ILE G 249 ? O ILE G 250 
AQ 1 2 O PHE H 30  ? O PHE H 31  N CYS H 16  ? N CYS H 17  
AQ 2 3 O LYS H 17  ? O LYS H 18  N ASP H 10  ? N ASP H 11  
AQ 3 4 N VAL H 9   ? N VAL H 10  O LEU H 103 ? O LEU H 104 
AQ 4 5 N LEU H 104 ? N LEU H 105 O TYR H 132 ? O TYR H 133 
AQ 5 6 N MET H 131 ? N MET H 132 O ILE H 356 ? O ILE H 357 
AR 1 2 O TYR H 52  ? O TYR H 53  N GLY H 35  ? N GLY H 36  
AR 2 3 N VAL H 34  ? N VAL H 35  O LYS H 67  ? O LYS H 68  
AS 1 2 N GLU H 71  ? N GLU H 72  O ILE H 74  ? O ILE H 75  
AT 1 2 O TYR H 168 ? O TYR H 169 N TYR H 165 ? N TYR H 166 
AT 2 3 N THR H 159 ? N THR H 160 O LEU H 177 ? O LEU H 178 
AU 1 2 O TYR H 168 ? O TYR H 169 N TYR H 165 ? N TYR H 166 
AU 2 3 O ILE H 164 ? O ILE H 165 N GLY H 149 ? N GLY H 150 
AU 3 4 N MET H 152 ? N MET H 153 O SER H 299 ? O SER H 300 
AU 4 5 N THR H 296 ? N THR H 297 O ILE H 329 ? O ILE H 330 
AV 1 2 N LYS H 237 ? N LYS H 238 O ILE H 249 ? O ILE H 250 
AW 1 2 O PHE I 30  ? O PHE I 31  N CYS I 16  ? N CYS I 17  
AW 2 3 O LYS I 17  ? O LYS I 18  N ASP I 10  ? N ASP I 11  
AW 3 4 N VAL I 9   ? N VAL I 10  O LEU I 103 ? O LEU I 104 
AW 4 5 N LEU I 104 ? N LEU I 105 O TYR I 132 ? O TYR I 133 
AW 5 6 N MET I 131 ? N MET I 132 O ILE I 356 ? O ILE I 357 
AX 1 2 O TYR I 52  ? O TYR I 53  N GLY I 35  ? N GLY I 36  
AX 2 3 N VAL I 34  ? N VAL I 35  O LYS I 67  ? O LYS I 68  
AY 1 2 N GLU I 71  ? N GLU I 72  O ILE I 74  ? O ILE I 75  
AZ 1 2 O TYR I 168 ? O TYR I 169 N TYR I 165 ? N TYR I 166 
AZ 2 3 N THR I 159 ? N THR I 160 O LEU I 177 ? O LEU I 178 
BA 1 2 O TYR I 168 ? O TYR I 169 N TYR I 165 ? N TYR I 166 
BA 2 3 O ILE I 164 ? O ILE I 165 N GLY I 149 ? N GLY I 150 
BA 3 4 N MET I 152 ? N MET I 153 O SER I 299 ? O SER I 300 
BA 4 5 N THR I 296 ? N THR I 297 O ILE I 329 ? O ILE I 330 
BB 1 2 N LYS I 237 ? N LYS I 238 O ILE I 249 ? O ILE I 250 
BC 1 2 O PHE J 30  ? O PHE J 31  N CYS J 16  ? N CYS J 17  
BC 2 3 O LYS J 17  ? O LYS J 18  N ASP J 10  ? N ASP J 11  
BC 3 4 N VAL J 9   ? N VAL J 10  O LEU J 103 ? O LEU J 104 
BC 4 5 N LEU J 104 ? N LEU J 105 O TYR J 132 ? O TYR J 133 
BC 5 6 N MET J 131 ? N MET J 132 O ILE J 356 ? O ILE J 357 
BD 1 2 O TYR J 52  ? O TYR J 53  N GLY J 35  ? N GLY J 36  
BD 2 3 N VAL J 34  ? N VAL J 35  O LYS J 67  ? O LYS J 68  
BE 1 2 N GLU J 71  ? N GLU J 72  O ILE J 74  ? O ILE J 75  
BF 1 2 O TYR J 168 ? O TYR J 169 N TYR J 165 ? N TYR J 166 
BF 2 3 N THR J 159 ? N THR J 160 O LEU J 177 ? O LEU J 178 
BG 1 2 O TYR J 168 ? O TYR J 169 N TYR J 165 ? N TYR J 166 
BG 2 3 O ILE J 164 ? O ILE J 165 N GLY J 149 ? N GLY J 150 
BG 3 4 N MET J 152 ? N MET J 153 O SER J 299 ? O SER J 300 
BG 4 5 N THR J 296 ? N THR J 297 O ILE J 329 ? O ILE J 330 
BH 1 2 N LYS J 237 ? N LYS J 238 O ILE J 249 ? O ILE J 250 
# 
_database_PDB_matrix.entry_id          3LUE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LUE 
_atom_sites.Cartn_transform_axes        ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
N 
C 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.Cartn_x_esd 
_atom_site.Cartn_y_esd 
_atom_site.Cartn_z_esd 
_atom_site.occupancy_esd 
_atom_site.B_iso_or_equiv_esd 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ASP A 1 1   ? -33.540 -28.935 117.643  1.00 10.00 ? ? ? ? ? ? 2   ASP A N   1 
ATOM 2     C CA  . ASP A 1 1   ? -33.328 -30.039 116.675  1.00 10.00 ? ? ? ? ? ? 2   ASP A CA  1 
ATOM 3     C C   . ASP A 1 1   ? -33.525 -29.728 115.150  1.00 10.00 ? ? ? ? ? ? 2   ASP A C   1 
ATOM 4     O O   . ASP A 1 1   ? -34.566 -29.920 114.501  1.00 10.00 ? ? ? ? ? ? 2   ASP A O   1 
ATOM 5     C CB  . ASP A 1 1   ? -34.216 -31.235 117.171  1.00 10.00 ? ? ? ? ? ? 2   ASP A CB  1 
ATOM 6     C CG  . ASP A 1 1   ? -34.189 -31.612 118.684  1.00 10.00 ? ? ? ? ? ? 2   ASP A CG  1 
ATOM 7     O OD1 . ASP A 1 1   ? -33.341 -31.055 119.413  1.00 10.00 ? ? ? ? ? ? 2   ASP A OD1 1 
ATOM 8     O OD2 . ASP A 1 1   ? -35.006 -32.458 119.128  1.00 10.00 ? ? ? ? ? ? 2   ASP A OD2 1 
ATOM 9     N N   . ASP A 1 2   ? -32.406 -29.200 114.602  1.00 10.00 ? ? ? ? ? ? 3   ASP A N   1 
ATOM 10    C CA  . ASP A 1 2   ? -32.151 -28.772 113.210  1.00 10.00 ? ? ? ? ? ? 3   ASP A CA  1 
ATOM 11    C C   . ASP A 1 2   ? -32.907 -27.535 112.783  1.00 10.00 ? ? ? ? ? ? 3   ASP A C   1 
ATOM 12    O O   . ASP A 1 2   ? -32.362 -26.540 112.298  1.00 10.00 ? ? ? ? ? ? 3   ASP A O   1 
ATOM 13    C CB  . ASP A 1 2   ? -32.469 -29.872 112.136  1.00 10.00 ? ? ? ? ? ? 3   ASP A CB  1 
ATOM 14    C CG  . ASP A 1 2   ? -32.291 -29.488 110.628  1.00 10.00 ? ? ? ? ? ? 3   ASP A CG  1 
ATOM 15    O OD1 . ASP A 1 2   ? -31.670 -28.449 110.294  1.00 10.00 ? ? ? ? ? ? 3   ASP A OD1 1 
ATOM 16    O OD2 . ASP A 1 2   ? -32.810 -30.249 109.772  1.00 10.00 ? ? ? ? ? ? 3   ASP A OD2 1 
ATOM 17    N N   . ASP A 1 3   ? -34.206 -27.649 112.817  1.00 10.00 ? ? ? ? ? ? 4   ASP A N   1 
ATOM 18    C CA  . ASP A 1 3   ? -35.021 -26.542 112.441  1.00 10.00 ? ? ? ? ? ? 4   ASP A CA  1 
ATOM 19    C C   . ASP A 1 3   ? -35.300 -26.192 113.877  1.00 10.00 ? ? ? ? ? ? 4   ASP A C   1 
ATOM 20    O O   . ASP A 1 3   ? -35.823 -26.949 114.712  1.00 10.00 ? ? ? ? ? ? 4   ASP A O   1 
ATOM 21    C CB  . ASP A 1 3   ? -36.193 -27.081 111.629  1.00 10.00 ? ? ? ? ? ? 4   ASP A CB  1 
ATOM 22    C CG  . ASP A 1 3   ? -36.031 -26.934 110.107  1.00 10.00 ? ? ? ? ? ? 4   ASP A CG  1 
ATOM 23    O OD1 . ASP A 1 3   ? -35.007 -26.400 109.623  1.00 10.00 ? ? ? ? ? ? 4   ASP A OD1 1 
ATOM 24    O OD2 . ASP A 1 3   ? -36.975 -27.347 109.413  1.00 10.00 ? ? ? ? ? ? 4   ASP A OD2 1 
ATOM 25    N N   . ILE A 1 4   ? -34.419 -25.197 114.003  1.00 10.00 ? ? ? ? ? ? 5   ILE A N   1 
ATOM 26    C CA  . ILE A 1 4   ? -34.110 -24.365 115.138  1.00 10.00 ? ? ? ? ? ? 5   ILE A CA  1 
ATOM 27    C C   . ILE A 1 4   ? -33.021 -24.909 116.032  1.00 10.00 ? ? ? ? ? ? 5   ILE A C   1 
ATOM 28    O O   . ILE A 1 4   ? -32.874 -26.019 116.554  1.00 10.00 ? ? ? ? ? ? 5   ILE A O   1 
ATOM 29    C CB  . ILE A 1 4   ? -35.386 -24.010 115.929  1.00 10.00 ? ? ? ? ? ? 5   ILE A CB  1 
ATOM 30    C CG1 . ILE A 1 4   ? -35.864 -22.799 115.092  1.00 10.00 ? ? ? ? ? ? 5   ILE A CG1 1 
ATOM 31    C CG2 . ILE A 1 4   ? -35.245 -23.690 117.429  1.00 10.00 ? ? ? ? ? ? 5   ILE A CG2 1 
ATOM 32    C CD1 . ILE A 1 4   ? -34.794 -21.670 114.902  1.00 10.00 ? ? ? ? ? ? 5   ILE A CD1 1 
ATOM 33    N N   . ALA A 1 5   ? -32.164 -23.984 115.602  1.00 10.00 ? ? ? ? ? ? 6   ALA A N   1 
ATOM 34    C CA  . ALA A 1 5   ? -30.741 -23.967 115.787  1.00 10.00 ? ? ? ? ? ? 6   ALA A CA  1 
ATOM 35    C C   . ALA A 1 5   ? -30.388 -22.693 115.005  1.00 10.00 ? ? ? ? ? ? 6   ALA A C   1 
ATOM 36    O O   . ALA A 1 5   ? -30.971 -22.358 113.946  1.00 10.00 ? ? ? ? ? ? 6   ALA A O   1 
ATOM 37    C CB  . ALA A 1 5   ? -30.022 -25.136 115.080  1.00 10.00 ? ? ? ? ? ? 6   ALA A CB  1 
ATOM 38    N N   . ALA A 1 6   ? -29.493 -21.945 115.637  1.00 10.00 ? ? ? ? ? ? 7   ALA A N   1 
ATOM 39    C CA  . ALA A 1 6   ? -28.870 -20.794 115.068  1.00 10.00 ? ? ? ? ? ? 7   ALA A CA  1 
ATOM 40    C C   . ALA A 1 6   ? -27.973 -21.312 113.945  1.00 10.00 ? ? ? ? ? ? 7   ALA A C   1 
ATOM 41    O O   . ALA A 1 6   ? -27.576 -22.486 113.918  1.00 10.00 ? ? ? ? ? ? 7   ALA A O   1 
ATOM 42    C CB  . ALA A 1 6   ? -28.058 -20.137 116.158  1.00 10.00 ? ? ? ? ? ? 7   ALA A CB  1 
ATOM 43    N N   . LEU A 1 7   ? -27.641 -20.461 112.995  1.00 10.00 ? ? ? ? ? ? 8   LEU A N   1 
ATOM 44    C CA  . LEU A 1 7   ? -26.741 -20.823 111.919  1.00 10.00 ? ? ? ? ? ? 8   LEU A CA  1 
ATOM 45    C C   . LEU A 1 7   ? -25.415 -20.178 112.289  1.00 10.00 ? ? ? ? ? ? 8   LEU A C   1 
ATOM 46    O O   . LEU A 1 7   ? -25.421 -18.943 112.479  1.00 10.00 ? ? ? ? ? ? 8   LEU A O   1 
ATOM 47    C CB  . LEU A 1 7   ? -27.176 -20.223 110.594  1.00 10.00 ? ? ? ? ? ? 8   LEU A CB  1 
ATOM 48    C CG  . LEU A 1 7   ? -28.635 -20.101 110.232  1.00 10.00 ? ? ? ? ? ? 8   LEU A CG  1 
ATOM 49    C CD1 . LEU A 1 7   ? -28.740 -19.411 108.899  1.00 10.00 ? ? ? ? ? ? 8   LEU A CD1 1 
ATOM 50    C CD2 . LEU A 1 7   ? -29.276 -21.442 110.204  1.00 10.00 ? ? ? ? ? ? 8   LEU A CD2 1 
ATOM 51    N N   . VAL A 1 8   ? -24.297 -20.880 112.460  1.00 10.00 ? ? ? ? ? ? 9   VAL A N   1 
ATOM 52    C CA  . VAL A 1 8   ? -23.066 -20.152 112.720  1.00 10.00 ? ? ? ? ? ? 9   VAL A CA  1 
ATOM 53    C C   . VAL A 1 8   ? -22.442 -19.756 111.361  1.00 10.00 ? ? ? ? ? ? 9   VAL A C   1 
ATOM 54    O O   . VAL A 1 8   ? -22.278 -20.621 110.490  1.00 10.00 ? ? ? ? ? ? 9   VAL A O   1 
ATOM 55    C CB  . VAL A 1 8   ? -22.083 -21.026 113.506  1.00 10.00 ? ? ? ? ? ? 9   VAL A CB  1 
ATOM 56    C CG1 . VAL A 1 8   ? -21.009 -20.083 114.099  1.00 10.00 ? ? ? ? ? ? 9   VAL A CG1 1 
ATOM 57    C CG2 . VAL A 1 8   ? -22.760 -21.814 114.574  1.00 10.00 ? ? ? ? ? ? 9   VAL A CG2 1 
ATOM 58    N N   . VAL A 1 9   ? -22.059 -18.522 111.069  1.00 10.00 ? ? ? ? ? ? 10  VAL A N   1 
ATOM 59    C CA  . VAL A 1 9   ? -21.462 -18.116 109.800  1.00 10.00 ? ? ? ? ? ? 10  VAL A CA  1 
ATOM 60    C C   . VAL A 1 9   ? -20.106 -17.555 110.224  1.00 10.00 ? ? ? ? ? ? 10  VAL A C   1 
ATOM 61    O O   . VAL A 1 9   ? -19.988 -16.572 110.996  1.00 10.00 ? ? ? ? ? ? 10  VAL A O   1 
ATOM 62    C CB  . VAL A 1 9   ? -22.327 -17.004 109.116  1.00 10.00 ? ? ? ? ? ? 10  VAL A CB  1 
ATOM 63    C CG1 . VAL A 1 9   ? -21.659 -16.387 107.926  1.00 10.00 ? ? ? ? ? ? 10  VAL A CG1 1 
ATOM 64    C CG2 . VAL A 1 9   ? -23.601 -17.619 108.591  1.00 10.00 ? ? ? ? ? ? 10  VAL A CG2 1 
ATOM 65    N N   . ASP A 1 10  ? -19.046 -18.204 109.751  1.00 10.00 ? ? ? ? ? ? 11  ASP A N   1 
ATOM 66    C CA  . ASP A 1 10  ? -17.720 -17.731 110.061  1.00 10.00 ? ? ? ? ? ? 11  ASP A CA  1 
ATOM 67    C C   . ASP A 1 10  ? -17.224 -17.139 108.791  1.00 10.00 ? ? ? ? ? ? 11  ASP A C   1 
ATOM 68    O O   . ASP A 1 10  ? -17.194 -17.836 107.790  1.00 10.00 ? ? ? ? ? ? 11  ASP A O   1 
ATOM 69    C CB  . ASP A 1 10  ? -16.819 -18.865 110.498  1.00 10.00 ? ? ? ? ? ? 11  ASP A CB  1 
ATOM 70    C CG  . ASP A 1 10  ? -15.388 -18.444 110.817  1.00 10.00 ? ? ? ? ? ? 11  ASP A CG  1 
ATOM 71    O OD1 . ASP A 1 10  ? -15.065 -17.272 111.001  1.00 10.00 ? ? ? ? ? ? 11  ASP A OD1 1 
ATOM 72    O OD2 . ASP A 1 10  ? -14.575 -19.337 110.871  1.00 10.00 ? ? ? ? ? ? 11  ASP A OD2 1 
ATOM 73    N N   . ASN A 1 11  ? -16.846 -15.871 108.853  1.00 10.00 ? ? ? ? ? ? 12  ASN A N   1 
ATOM 74    C CA  . ASN A 1 11  ? -16.461 -15.057 107.689  1.00 10.00 ? ? ? ? ? ? 12  ASN A CA  1 
ATOM 75    C C   . ASN A 1 11  ? -14.994 -14.816 107.625  1.00 10.00 ? ? ? ? ? ? 12  ASN A C   1 
ATOM 76    O O   . ASN A 1 11  ? -14.494 -13.908 108.319  1.00 10.00 ? ? ? ? ? ? 12  ASN A O   1 
ATOM 77    C CB  . ASN A 1 11  ? -17.044 -13.658 107.665  1.00 10.00 ? ? ? ? ? ? 12  ASN A CB  1 
ATOM 78    C CG  . ASN A 1 11  ? -18.529 -13.772 107.729  1.00 10.00 ? ? ? ? ? ? 12  ASN A CG  1 
ATOM 79    O OD1 . ASN A 1 11  ? -19.185 -14.065 106.726  1.00 10.00 ? ? ? ? ? ? 12  ASN A OD1 1 
ATOM 80    N ND2 . ASN A 1 11  ? -19.047 -13.609 108.953  1.00 10.00 ? ? ? ? ? ? 12  ASN A ND2 1 
ATOM 81    N N   . GLY A 1 12  ? -14.360 -15.713 106.869  1.00 10.00 ? ? ? ? ? ? 13  GLY A N   1 
ATOM 82    C CA  . GLY A 1 12  ? -12.943 -15.630 106.650  1.00 10.00 ? ? ? ? ? ? 13  GLY A CA  1 
ATOM 83    C C   . GLY A 1 12  ? -12.617 -14.967 105.318  1.00 10.00 ? ? ? ? ? ? 13  GLY A C   1 
ATOM 84    O O   . GLY A 1 12  ? -13.379 -14.991 104.333  1.00 10.00 ? ? ? ? ? ? 13  GLY A O   1 
ATOM 85    N N   . SER A 1 13  ? -11.422 -14.368 105.394  1.00 10.00 ? ? ? ? ? ? 14  SER A N   1 
ATOM 86    C CA  . SER A 1 13  ? -10.714 -13.761 104.287  1.00 10.00 ? ? ? ? ? ? 14  SER A CA  1 
ATOM 87    C C   . SER A 1 13  ? -10.499 -14.723 103.101  1.00 10.00 ? ? ? ? ? ? 14  SER A C   1 
ATOM 88    O O   . SER A 1 13  ? -10.601 -14.358 101.942  1.00 10.00 ? ? ? ? ? ? 14  SER A O   1 
ATOM 89    C CB  . SER A 1 13  ? -9.371  -13.272 104.796  1.00 10.00 ? ? ? ? ? ? 14  SER A CB  1 
ATOM 90    O OG  . SER A 1 13  ? -9.436  -12.370 105.899  1.00 10.00 ? ? ? ? ? ? 14  SER A OG  1 
ATOM 91    N N   . GLY A 1 14  ? -10.143 -15.963 103.335  1.00 10.00 ? ? ? ? ? ? 15  GLY A N   1 
ATOM 92    C CA  . GLY A 1 14  ? -10.010 -16.901 102.257  1.00 10.00 ? ? ? ? ? ? 15  GLY A CA  1 
ATOM 93    C C   . GLY A 1 14  ? -11.174 -17.856 102.127  1.00 10.00 ? ? ? ? ? ? 15  GLY A C   1 
ATOM 94    O O   . GLY A 1 14  ? -11.562 -18.179 101.004  1.00 10.00 ? ? ? ? ? ? 15  GLY A O   1 
ATOM 95    N N   . MET A 1 15  ? -11.773 -18.228 103.255  1.00 10.00 ? ? ? ? ? ? 16  MET A N   1 
ATOM 96    C CA  . MET A 1 15  ? -12.787 -19.256 103.381  1.00 10.00 ? ? ? ? ? ? 16  MET A CA  1 
ATOM 97    C C   . MET A 1 15  ? -13.967 -18.860 104.282  1.00 10.00 ? ? ? ? ? ? 16  MET A C   1 
ATOM 98    O O   . MET A 1 15  ? -13.809 -18.154 105.272  1.00 10.00 ? ? ? ? ? ? 16  MET A O   1 
ATOM 99    C CB  . MET A 1 15  ? -12.117 -20.493 103.950  1.00 10.00 ? ? ? ? ? ? 16  MET A CB  1 
ATOM 100   C CG  . MET A 1 15  ? -11.061 -21.212 103.150  1.00 10.00 ? ? ? ? ? ? 16  MET A CG  1 
ATOM 101   S SD  . MET A 1 15  ? -11.796 -21.753 101.573  1.00 10.00 ? ? ? ? ? ? 16  MET A SD  1 
ATOM 102   C CE  . MET A 1 15  ? -12.681 -23.251 101.912  1.00 10.00 ? ? ? ? ? ? 16  MET A CE  1 
ATOM 103   N N   . CYS A 1 16  ? -15.187 -19.301 104.009  1.00 10.00 ? ? ? ? ? ? 17  CYS A N   1 
ATOM 104   C CA  . CYS A 1 16  ? -16.345 -19.060 104.853  1.00 10.00 ? ? ? ? ? ? 17  CYS A CA  1 
ATOM 105   C C   . CYS A 1 16  ? -16.794 -20.445 105.244  1.00 10.00 ? ? ? ? ? ? 17  CYS A C   1 
ATOM 106   O O   . CYS A 1 16  ? -16.726 -21.341 104.404  1.00 10.00 ? ? ? ? ? ? 17  CYS A O   1 
ATOM 107   C CB  . CYS A 1 16  ? -17.551 -18.399 104.135  1.00 10.00 ? ? ? ? ? ? 17  CYS A CB  1 
ATOM 108   S SG  . CYS A 1 16  ? -17.501 -16.634 103.682  1.00 10.00 ? ? ? ? ? ? 17  CYS A SG  1 
ATOM 109   N N   . LYS A 1 17  ? -17.258 -20.684 106.460  1.00 10.00 ? ? ? ? ? ? 18  LYS A N   1 
ATOM 110   C CA  . LYS A 1 17  ? -17.730 -21.987 106.915  1.00 10.00 ? ? ? ? ? ? 18  LYS A CA  1 
ATOM 111   C C   . LYS A 1 17  ? -19.032 -21.620 107.621  1.00 10.00 ? ? ? ? ? ? 18  LYS A C   1 
ATOM 112   O O   . LYS A 1 17  ? -19.106 -20.629 108.364  1.00 10.00 ? ? ? ? ? ? 18  LYS A O   1 
ATOM 113   C CB  . LYS A 1 17  ? -16.769 -22.686 107.943  1.00 10.00 ? ? ? ? ? ? 18  LYS A CB  1 
ATOM 114   C CG  . LYS A 1 17  ? -15.398 -22.087 108.355  1.00 10.00 ? ? ? ? ? ? 18  LYS A CG  1 
ATOM 115   C CD  . LYS A 1 17  ? -14.308 -22.038 107.281  1.00 10.00 ? ? ? ? ? ? 18  LYS A CD  1 
ATOM 116   C CE  . LYS A 1 17  ? -13.047 -21.320 107.720  1.00 10.00 ? ? ? ? ? ? 18  LYS A CE  1 
ATOM 117   N NZ  . LYS A 1 17  ? -13.253 -19.902 107.581  1.00 10.00 ? ? ? ? ? ? 18  LYS A NZ  1 
ATOM 118   N N   . ALA A 1 18  ? -20.105 -22.340 107.294  1.00 10.00 ? ? ? ? ? ? 19  ALA A N   1 
ATOM 119   C CA  . ALA A 1 18  ? -21.446 -22.049 107.760  1.00 10.00 ? ? ? ? ? ? 19  ALA A CA  1 
ATOM 120   C C   . ALA A 1 18  ? -22.192 -23.319 108.080  1.00 10.00 ? ? ? ? ? ? 19  ALA A C   1 
ATOM 121   O O   . ALA A 1 18  ? -22.093 -24.324 107.381  1.00 10.00 ? ? ? ? ? ? 19  ALA A O   1 
ATOM 122   C CB  . ALA A 1 18  ? -22.243 -21.324 106.730  1.00 10.00 ? ? ? ? ? ? 19  ALA A CB  1 
ATOM 123   N N   . GLY A 1 19  ? -22.899 -23.349 109.180  1.00 10.00 ? ? ? ? ? ? 20  GLY A N   1 
ATOM 124   C CA  . GLY A 1 19  ? -23.581 -24.560 109.550  1.00 10.00 ? ? ? ? ? ? 20  GLY A CA  1 
ATOM 125   C C   . GLY A 1 19  ? -24.601 -24.278 110.623  1.00 10.00 ? ? ? ? ? ? 20  GLY A C   1 
ATOM 126   O O   . GLY A 1 19  ? -25.039 -23.134 110.841  1.00 10.00 ? ? ? ? ? ? 20  GLY A O   1 
ATOM 127   N N   . PHE A 1 20  ? -24.894 -25.358 111.324  1.00 10.00 ? ? ? ? ? ? 21  PHE A N   1 
ATOM 128   C CA  . PHE A 1 20  ? -25.943 -25.292 112.292  1.00 10.00 ? ? ? ? ? ? 21  PHE A CA  1 
ATOM 129   C C   . PHE A 1 20  ? -25.382 -25.582 113.663  1.00 10.00 ? ? ? ? ? ? 21  PHE A C   1 
ATOM 130   O O   . PHE A 1 20  ? -24.567 -26.495 113.854  1.00 10.00 ? ? ? ? ? ? 21  PHE A O   1 
ATOM 131   C CB  . PHE A 1 20  ? -27.034 -26.294 111.928  1.00 10.00 ? ? ? ? ? ? 21  PHE A CB  1 
ATOM 132   C CG  . PHE A 1 20  ? -27.858 -25.972 110.692  1.00 10.00 ? ? ? ? ? ? 21  PHE A CG  1 
ATOM 133   C CD1 . PHE A 1 20  ? -28.098 -24.692 110.262  1.00 10.00 ? ? ? ? ? ? 21  PHE A CD1 1 
ATOM 134   C CD2 . PHE A 1 20  ? -28.369 -26.988 109.933  1.00 10.00 ? ? ? ? ? ? 21  PHE A CD2 1 
ATOM 135   C CE1 . PHE A 1 20  ? -28.820 -24.453 109.099  1.00 10.00 ? ? ? ? ? ? 21  PHE A CE1 1 
ATOM 136   C CE2 . PHE A 1 20  ? -29.091 -26.747 108.777  1.00 10.00 ? ? ? ? ? ? 21  PHE A CE2 1 
ATOM 137   C CZ  . PHE A 1 20  ? -29.321 -25.473 108.351  1.00 10.00 ? ? ? ? ? ? 21  PHE A CZ  1 
ATOM 138   N N   . ALA A 1 21  ? -25.822 -24.740 114.606  1.00 10.00 ? ? ? ? ? ? 22  ALA A N   1 
ATOM 139   C CA  . ALA A 1 21  ? -25.405 -24.876 115.987  1.00 10.00 ? ? ? ? ? ? 22  ALA A CA  1 
ATOM 140   C C   . ALA A 1 21  ? -25.947 -26.198 116.494  1.00 10.00 ? ? ? ? ? ? 22  ALA A C   1 
ATOM 141   O O   . ALA A 1 21  ? -27.040 -26.642 116.120  1.00 10.00 ? ? ? ? ? ? 22  ALA A O   1 
ATOM 142   C CB  . ALA A 1 21  ? -25.945 -23.744 116.834  1.00 10.00 ? ? ? ? ? ? 22  ALA A CB  1 
ATOM 143   N N   . GLY A 1 22  ? -25.019 -26.813 117.248  1.00 10.00 ? ? ? ? ? ? 23  GLY A N   1 
ATOM 144   C CA  . GLY A 1 22  ? -25.143 -28.152 117.775  1.00 10.00 ? ? ? ? ? ? 23  GLY A CA  1 
ATOM 145   C C   . GLY A 1 22  ? -24.358 -29.136 116.920  1.00 10.00 ? ? ? ? ? ? 23  GLY A C   1 
ATOM 146   O O   . GLY A 1 22  ? -24.292 -30.325 117.259  1.00 10.00 ? ? ? ? ? ? 23  GLY A O   1 
ATOM 147   N N   . ASP A 1 23  ? -23.759 -28.713 115.797  1.00 10.00 ? ? ? ? ? ? 24  ASP A N   1 
ATOM 148   C CA  . ASP A 1 23  ? -23.010 -29.617 114.928  1.00 10.00 ? ? ? ? ? ? 24  ASP A CA  1 
ATOM 149   C C   . ASP A 1 23  ? -21.494 -29.535 115.104  1.00 10.00 ? ? ? ? ? ? 24  ASP A C   1 
ATOM 150   O O   . ASP A 1 23  ? -20.797 -28.553 115.399  1.00 10.00 ? ? ? ? ? ? 24  ASP A O   1 
ATOM 151   C CB  . ASP A 1 23  ? -23.275 -29.363 113.452  1.00 10.00 ? ? ? ? ? ? 24  ASP A CB  1 
ATOM 152   C CG  . ASP A 1 23  ? -24.651 -29.642 112.847  1.00 10.00 ? ? ? ? ? ? 24  ASP A CG  1 
ATOM 153   O OD1 . ASP A 1 23  ? -25.392 -30.483 113.333  1.00 10.00 ? ? ? ? ? ? 24  ASP A OD1 1 
ATOM 154   O OD2 . ASP A 1 23  ? -24.974 -29.040 111.822  1.00 10.00 ? ? ? ? ? ? 24  ASP A OD2 1 
ATOM 155   N N   . ASP A 1 24  ? -21.012 -30.731 114.871  1.00 10.00 ? ? ? ? ? ? 25  ASP A N   1 
ATOM 156   C CA  . ASP A 1 24  ? -19.607 -31.044 114.917  1.00 10.00 ? ? ? ? ? ? 25  ASP A CA  1 
ATOM 157   C C   . ASP A 1 24  ? -18.814 -30.330 113.808  1.00 10.00 ? ? ? ? ? ? 25  ASP A C   1 
ATOM 158   O O   . ASP A 1 24  ? -17.801 -29.701 114.090  1.00 10.00 ? ? ? ? ? ? 25  ASP A O   1 
ATOM 159   C CB  . ASP A 1 24  ? -19.570 -32.626 114.890  1.00 10.00 ? ? ? ? ? ? 25  ASP A CB  1 
ATOM 160   C CG  . ASP A 1 24  ? -20.053 -33.304 116.220  1.00 10.00 ? ? ? ? ? ? 25  ASP A CG  1 
ATOM 161   O OD1 . ASP A 1 24  ? -19.751 -32.793 117.297  1.00 10.00 ? ? ? ? ? ? 25  ASP A OD1 1 
ATOM 162   O OD2 . ASP A 1 24  ? -20.702 -34.359 116.224  1.00 10.00 ? ? ? ? ? ? 25  ASP A OD2 1 
ATOM 163   N N   . ALA A 1 25  ? -19.178 -30.294 112.533  1.00 10.00 ? ? ? ? ? ? 26  ALA A N   1 
ATOM 164   C CA  . ALA A 1 25  ? -18.330 -29.603 111.557  1.00 10.00 ? ? ? ? ? ? 26  ALA A CA  1 
ATOM 165   C C   . ALA A 1 25  ? -19.125 -28.651 110.684  1.00 10.00 ? ? ? ? ? ? 26  ALA A C   1 
ATOM 166   O O   . ALA A 1 25  ? -20.343 -28.800 110.585  1.00 10.00 ? ? ? ? ? ? 26  ALA A O   1 
ATOM 167   C CB  . ALA A 1 25  ? -17.653 -30.647 110.696  1.00 10.00 ? ? ? ? ? ? 26  ALA A CB  1 
ATOM 168   N N   . PRO A 1 26  ? -18.558 -27.637 110.064  1.00 10.00 ? ? ? ? ? ? 27  PRO A N   1 
ATOM 169   C CA  . PRO A 1 26  ? -19.219 -26.831 109.049  1.00 10.00 ? ? ? ? ? ? 27  PRO A CA  1 
ATOM 170   C C   . PRO A 1 26  ? -19.918 -27.599 107.944  1.00 10.00 ? ? ? ? ? ? 27  PRO A C   1 
ATOM 171   O O   . PRO A 1 26  ? -19.238 -28.449 107.366  1.00 10.00 ? ? ? ? ? ? 27  PRO A O   1 
ATOM 172   C CB  . PRO A 1 26  ? -18.135 -25.947 108.501  1.00 10.00 ? ? ? ? ? ? 27  PRO A CB  1 
ATOM 173   C CG  . PRO A 1 26  ? -16.876 -26.643 108.893  1.00 10.00 ? ? ? ? ? ? 27  PRO A CG  1 
ATOM 174   C CD  . PRO A 1 26  ? -17.220 -27.141 110.291  1.00 10.00 ? ? ? ? ? ? 27  PRO A CD  1 
ATOM 175   N N   . ARG A 1 27  ? -21.186 -27.331 107.596  1.00 10.00 ? ? ? ? ? ? 28  ARG A N   1 
ATOM 176   C CA  . ARG A 1 27  ? -21.828 -28.009 106.476  1.00 10.00 ? ? ? ? ? ? 28  ARG A CA  1 
ATOM 177   C C   . ARG A 1 27  ? -21.417 -27.398 105.152  1.00 10.00 ? ? ? ? ? ? 28  ARG A C   1 
ATOM 178   O O   . ARG A 1 27  ? -21.438 -28.099 104.145  1.00 10.00 ? ? ? ? ? ? 28  ARG A O   1 
ATOM 179   C CB  . ARG A 1 27  ? -23.354 -27.938 106.490  1.00 10.00 ? ? ? ? ? ? 28  ARG A CB  1 
ATOM 180   C CG  . ARG A 1 27  ? -24.161 -28.887 107.358  1.00 10.00 ? ? ? ? ? ? 28  ARG A CG  1 
ATOM 181   C CD  . ARG A 1 27  ? -25.309 -28.150 108.074  1.00 10.00 ? ? ? ? ? ? 28  ARG A CD  1 
ATOM 182   N NE  . ARG A 1 27  ? -25.971 -29.046 109.026  1.00 10.00 ? ? ? ? ? ? 28  ARG A NE  1 
ATOM 183   C CZ  . ARG A 1 27  ? -27.092 -29.739 108.713  1.00 10.00 ? ? ? ? ? ? 28  ARG A CZ  1 
ATOM 184   N NH1 . ARG A 1 27  ? -27.696 -29.593 107.499  1.00 10.00 ? ? ? ? ? ? 28  ARG A NH1 1 
ATOM 185   N NH2 . ARG A 1 27  ? -27.637 -30.543 109.655  1.00 10.00 ? ? ? ? ? ? 28  ARG A NH2 1 
ATOM 186   N N   . ALA A 1 28  ? -21.118 -26.105 105.060  1.00 10.00 ? ? ? ? ? ? 29  ALA A N   1 
ATOM 187   C CA  . ALA A 1 28  ? -20.746 -25.495 103.804  1.00 10.00 ? ? ? ? ? ? 29  ALA A CA  1 
ATOM 188   C C   . ALA A 1 28  ? -19.432 -24.816 104.044  1.00 10.00 ? ? ? ? ? ? 29  ALA A C   1 
ATOM 189   O O   . ALA A 1 28  ? -19.392 -23.876 104.861  1.00 10.00 ? ? ? ? ? ? 29  ALA A O   1 
ATOM 190   C CB  . ALA A 1 28  ? -21.651 -24.398 103.367  1.00 10.00 ? ? ? ? ? ? 29  ALA A CB  1 
ATOM 191   N N   . VAL A 1 29  ? -18.329 -25.253 103.419  1.00 10.00 ? ? ? ? ? ? 30  VAL A N   1 
ATOM 192   C CA  . VAL A 1 29  ? -17.123 -24.464 103.562  1.00 10.00 ? ? ? ? ? ? 30  VAL A CA  1 
ATOM 193   C C   . VAL A 1 29  ? -16.942 -23.859 102.176  1.00 10.00 ? ? ? ? ? ? 30  VAL A C   1 
ATOM 194   O O   . VAL A 1 29  ? -17.122 -24.637 101.235  1.00 10.00 ? ? ? ? ? ? 30  VAL A O   1 
ATOM 195   C CB  . VAL A 1 29  ? -16.057 -25.436 104.004  1.00 10.00 ? ? ? ? ? ? 30  VAL A CB  1 
ATOM 196   C CG1 . VAL A 1 29  ? -14.770 -24.711 104.299  1.00 10.00 ? ? ? ? ? ? 30  VAL A CG1 1 
ATOM 197   C CG2 . VAL A 1 29  ? -16.504 -26.107 105.277  1.00 10.00 ? ? ? ? ? ? 30  VAL A CG2 1 
ATOM 198   N N   . PHE A 1 30  ? -16.732 -22.574 101.876  1.00 10.00 ? ? ? ? ? ? 31  PHE A N   1 
ATOM 199   C CA  . PHE A 1 30  ? -16.559 -22.203 100.488  1.00 10.00 ? ? ? ? ? ? 31  PHE A CA  1 
ATOM 200   C C   . PHE A 1 30  ? -15.566 -21.129 100.332  1.00 10.00 ? ? ? ? ? ? 31  PHE A C   1 
ATOM 201   O O   . PHE A 1 30  ? -15.271 -20.512 101.337  1.00 10.00 ? ? ? ? ? ? 31  PHE A O   1 
ATOM 202   C CB  . PHE A 1 30  ? -17.811 -21.697 99.793   1.00 10.00 ? ? ? ? ? ? 31  PHE A CB  1 
ATOM 203   C CG  . PHE A 1 30  ? -18.804 -20.877 100.576  1.00 10.00 ? ? ? ? ? ? 31  PHE A CG  1 
ATOM 204   C CD1 . PHE A 1 30  ? -19.676 -21.522 101.439  1.00 10.00 ? ? ? ? ? ? 31  PHE A CD1 1 
ATOM 205   C CD2 . PHE A 1 30  ? -18.841 -19.507 100.422  1.00 10.00 ? ? ? ? ? ? 31  PHE A CD2 1 
ATOM 206   C CE1 . PHE A 1 30  ? -20.588 -20.830 102.158  1.00 10.00 ? ? ? ? ? ? 31  PHE A CE1 1 
ATOM 207   C CE2 . PHE A 1 30  ? -19.774 -18.807 101.161  1.00 10.00 ? ? ? ? ? ? 31  PHE A CE2 1 
ATOM 208   C CZ  . PHE A 1 30  ? -20.628 -19.477 102.012  1.00 10.00 ? ? ? ? ? ? 31  PHE A CZ  1 
ATOM 209   N N   . PRO A 1 31  ? -14.958 -20.954 99.150   1.00 10.00 ? ? ? ? ? ? 32  PRO A N   1 
ATOM 210   C CA  . PRO A 1 31  ? -14.151 -19.794 98.757   1.00 10.00 ? ? ? ? ? ? 32  PRO A CA  1 
ATOM 211   C C   . PRO A 1 31  ? -14.772 -18.401 98.966   1.00 10.00 ? ? ? ? ? ? 32  PRO A C   1 
ATOM 212   O O   . PRO A 1 31  ? -15.914 -18.163 98.506   1.00 10.00 ? ? ? ? ? ? 32  PRO A O   1 
ATOM 213   C CB  . PRO A 1 31  ? -13.828 -20.133 97.292   1.00 10.00 ? ? ? ? ? ? 32  PRO A CB  1 
ATOM 214   C CG  . PRO A 1 31  ? -13.600 -21.624 97.309   1.00 10.00 ? ? ? ? ? ? 32  PRO A CG  1 
ATOM 215   C CD  . PRO A 1 31  ? -14.741 -22.049 98.186   1.00 10.00 ? ? ? ? ? ? 32  PRO A CD  1 
ATOM 216   N N   . SER A 1 32  ? -14.081 -17.442 99.621   1.00 10.00 ? ? ? ? ? ? 33  SER A N   1 
ATOM 217   C CA  . SER A 1 32  ? -14.682 -16.112 99.786   1.00 10.00 ? ? ? ? ? ? 33  SER A CA  1 
ATOM 218   C C   . SER A 1 32  ? -14.390 -15.138 98.633   1.00 10.00 ? ? ? ? ? ? 33  SER A C   1 
ATOM 219   O O   . SER A 1 32  ? -13.662 -14.135 98.714   1.00 10.00 ? ? ? ? ? ? 33  SER A O   1 
ATOM 220   C CB  . SER A 1 32  ? -14.246 -15.432 101.123  1.00 10.00 ? ? ? ? ? ? 33  SER A CB  1 
ATOM 221   O OG  . SER A 1 32  ? -14.983 -15.867 102.267  1.00 10.00 ? ? ? ? ? ? 33  SER A OG  1 
ATOM 222   N N   . ILE A 1 33  ? -20.948 -13.562 94.667   1.00 10.00 ? ? ? ? ? ? 34  ILE A N   1 
ATOM 223   C CA  . ILE A 1 33  ? -21.489 -12.468 93.901   1.00 10.00 ? ? ? ? ? ? 34  ILE A CA  1 
ATOM 224   C C   . ILE A 1 33  ? -22.025 -12.903 92.529   1.00 10.00 ? ? ? ? ? ? 34  ILE A C   1 
ATOM 225   O O   . ILE A 1 33  ? -21.598 -13.941 91.982   1.00 10.00 ? ? ? ? ? ? 34  ILE A O   1 
ATOM 226   C CB  . ILE A 1 33  ? -20.409 -11.357 93.732   1.00 10.00 ? ? ? ? ? ? 34  ILE A CB  1 
ATOM 227   C CG1 . ILE A 1 33  ? -19.188 -11.387 94.654   1.00 10.00 ? ? ? ? ? ? 34  ILE A CG1 1 
ATOM 228   C CG2 . ILE A 1 33  ? -21.159 -10.107 94.153   1.00 10.00 ? ? ? ? ? ? 34  ILE A CG2 1 
ATOM 229   C CD1 . ILE A 1 33  ? -18.068 -12.145 93.972   1.00 10.00 ? ? ? ? ? ? 34  ILE A CD1 1 
ATOM 230   N N   . VAL A 1 34  ? -23.057 -12.172 92.059   1.00 10.00 ? ? ? ? ? ? 35  VAL A N   1 
ATOM 231   C CA  . VAL A 1 34  ? -23.646 -12.285 90.716   1.00 10.00 ? ? ? ? ? ? 35  VAL A CA  1 
ATOM 232   C C   . VAL A 1 34  ? -23.250 -10.988 90.045   1.00 10.00 ? ? ? ? ? ? 35  VAL A C   1 
ATOM 233   O O   . VAL A 1 34  ? -23.483 -9.895  90.590   1.00 10.00 ? ? ? ? ? ? 35  VAL A O   1 
ATOM 234   C CB  . VAL A 1 34  ? -25.195 -12.346 90.712   1.00 10.00 ? ? ? ? ? ? 35  VAL A CB  1 
ATOM 235   C CG1 . VAL A 1 34  ? -25.744 -12.097 89.328   1.00 10.00 ? ? ? ? ? ? 35  VAL A CG1 1 
ATOM 236   C CG2 . VAL A 1 34  ? -25.663 -13.756 91.074   1.00 10.00 ? ? ? ? ? ? 35  VAL A CG2 1 
ATOM 237   N N   . GLY A 1 35  ? -22.708 -11.045 88.842   1.00 10.00 ? ? ? ? ? ? 36  GLY A N   1 
ATOM 238   C CA  . GLY A 1 35  ? -22.275 -9.828  88.191   1.00 10.00 ? ? ? ? ? ? 36  GLY A CA  1 
ATOM 239   C C   . GLY A 1 35  ? -22.911 -9.667  86.839   1.00 10.00 ? ? ? ? ? ? 36  GLY A C   1 
ATOM 240   O O   . GLY A 1 35  ? -22.673 -10.489 85.947   1.00 10.00 ? ? ? ? ? ? 36  GLY A O   1 
ATOM 241   N N   . ARG A 1 36  ? -23.735 -8.641  86.668   1.00 10.00 ? ? ? ? ? ? 37  ARG A N   1 
ATOM 242   C CA  . ARG A 1 36  ? -24.362 -8.391  85.360   1.00 10.00 ? ? ? ? ? ? 37  ARG A CA  1 
ATOM 243   C C   . ARG A 1 36  ? -23.622 -7.213  84.678   1.00 10.00 ? ? ? ? ? ? 37  ARG A C   1 
ATOM 244   O O   . ARG A 1 36  ? -23.265 -6.224  85.321   1.00 10.00 ? ? ? ? ? ? 37  ARG A O   1 
ATOM 245   C CB  . ARG A 1 36  ? -25.921 -8.144  85.577   1.00 10.00 ? ? ? ? ? ? 37  ARG A CB  1 
ATOM 246   C CG  . ARG A 1 36  ? -26.780 -7.182  84.694   1.00 10.00 ? ? ? ? ? ? 37  ARG A CG  1 
ATOM 247   C CD  . ARG A 1 36  ? -26.810 -7.286  83.136   1.00 10.00 ? ? ? ? ? ? 37  ARG A CD  1 
ATOM 248   N NE  . ARG A 1 36  ? -27.415 -6.069  82.562   1.00 10.00 ? ? ? ? ? ? 37  ARG A NE  1 
ATOM 249   C CZ  . ARG A 1 36  ? -27.124 -5.487  81.362   1.00 10.00 ? ? ? ? ? ? 37  ARG A CZ  1 
ATOM 250   N NH1 . ARG A 1 36  ? -26.207 -5.969  80.491   1.00 10.00 ? ? ? ? ? ? 37  ARG A NH1 1 
ATOM 251   N NH2 . ARG A 1 36  ? -27.766 -4.340  81.051   1.00 10.00 ? ? ? ? ? ? 37  ARG A NH2 1 
ATOM 252   N N   . PRO A 1 37  ? -23.270 -7.339  83.386   1.00 10.00 ? ? ? ? ? ? 38  PRO A N   1 
ATOM 253   C CA  . PRO A 1 37  ? -22.574 -6.333  82.608   1.00 10.00 ? ? ? ? ? ? 38  PRO A CA  1 
ATOM 254   C C   . PRO A 1 37  ? -22.975 -4.891  82.719   1.00 10.00 ? ? ? ? ? ? 38  PRO A C   1 
ATOM 255   O O   . PRO A 1 37  ? -22.082 -4.089  82.536   1.00 10.00 ? ? ? ? ? ? 38  PRO A O   1 
ATOM 256   C CB  . PRO A 1 37  ? -22.684 -6.862  81.215   1.00 10.00 ? ? ? ? ? ? 38  PRO A CB  1 
ATOM 257   C CG  . PRO A 1 37  ? -22.460 -8.351  81.364   1.00 10.00 ? ? ? ? ? ? 38  PRO A CG  1 
ATOM 258   C CD  . PRO A 1 37  ? -23.200 -8.631  82.673   1.00 10.00 ? ? ? ? ? ? 38  PRO A CD  1 
ATOM 259   N N   . ARG A 1 38  ? -24.205 -4.441  83.006   1.00 10.00 ? ? ? ? ? ? 39  ARG A N   1 
ATOM 260   C CA  . ARG A 1 38  ? -24.551 -3.003  83.026   1.00 10.00 ? ? ? ? ? ? 39  ARG A CA  1 
ATOM 261   C C   . ARG A 1 38  ? -23.984 -2.224  81.803   1.00 10.00 ? ? ? ? ? ? 39  ARG A C   1 
ATOM 262   O O   . ARG A 1 38  ? -23.524 -1.066  81.857   1.00 10.00 ? ? ? ? ? ? 39  ARG A O   1 
ATOM 263   C CB  . ARG A 1 38  ? -24.039 -2.401  84.372   1.00 10.00 ? ? ? ? ? ? 39  ARG A CB  1 
ATOM 264   C CG  . ARG A 1 38  ? -24.451 -0.982  84.848   1.00 10.00 ? ? ? ? ? ? 39  ARG A CG  1 
ATOM 265   C CD  . ARG A 1 38  ? -23.208 -0.270  85.452   1.00 10.00 ? ? ? ? ? ? 39  ARG A CD  1 
ATOM 266   N NE  . ARG A 1 38  ? -23.502 0.684   86.543   1.00 10.00 ? ? ? ? ? ? 39  ARG A NE  1 
ATOM 267   C CZ  . ARG A 1 38  ? -22.798 1.817   86.755   1.00 10.00 ? ? ? ? ? ? 39  ARG A CZ  1 
ATOM 268   N NH1 . ARG A 1 38  ? -21.767 2.181   85.980   1.00 10.00 ? ? ? ? ? ? 39  ARG A NH1 1 
ATOM 269   N NH2 . ARG A 1 38  ? -23.132 2.600   87.783   1.00 10.00 ? ? ? ? ? ? 39  ARG A NH2 1 
ATOM 270   N N   . HIS A 1 39  ? -23.959 -2.990  80.686   1.00 10.00 ? ? ? ? ? ? 40  HIS A N   1 
ATOM 271   C CA  . HIS A 1 39  ? -23.568 -2.681  79.308   1.00 10.00 ? ? ? ? ? ? 40  HIS A CA  1 
ATOM 272   C C   . HIS A 1 39  ? -23.631 -4.029  78.650   1.00 10.00 ? ? ? ? ? ? 40  HIS A C   1 
ATOM 273   O O   . HIS A 1 39  ? -22.805 -4.874  78.986   1.00 10.00 ? ? ? ? ? ? 40  HIS A O   1 
ATOM 274   C CB  . HIS A 1 39  ? -22.125 -2.274  79.007   1.00 10.00 ? ? ? ? ? ? 40  HIS A CB  1 
ATOM 275   C CG  . HIS A 1 39  ? -21.970 -0.765  78.948   1.00 10.00 ? ? ? ? ? ? 40  HIS A CG  1 
ATOM 276   N ND1 . HIS A 1 39  ? -20.953 -0.036  79.391   1.00 10.00 ? ? ? ? ? ? 40  HIS A ND1 1 
ATOM 277   C CD2 . HIS A 1 39  ? -22.942 0.098   78.530   1.00 10.00 ? ? ? ? ? ? 40  HIS A CD2 1 
ATOM 278   C CE1 . HIS A 1 39  ? -21.278 1.222   79.295   1.00 10.00 ? ? ? ? ? ? 40  HIS A CE1 1 
ATOM 279   N NE2 . HIS A 1 39  ? -22.475 1.288   78.771   1.00 10.00 ? ? ? ? ? ? 40  HIS A NE2 1 
ATOM 280   N N   . GLN A 1 40  ? -24.662 -4.249  77.819   1.00 10.00 ? ? ? ? ? ? 41  GLN A N   1 
ATOM 281   C CA  . GLN A 1 40  ? -24.833 -5.460  77.009   1.00 10.00 ? ? ? ? ? ? 41  GLN A CA  1 
ATOM 282   C C   . GLN A 1 40  ? -23.442 -5.987  76.626   1.00 10.00 ? ? ? ? ? ? 41  GLN A C   1 
ATOM 283   O O   . GLN A 1 40  ? -22.636 -5.311  75.939   1.00 10.00 ? ? ? ? ? ? 41  GLN A O   1 
ATOM 284   C CB  . GLN A 1 40  ? -25.600 -5.166  75.696   1.00 10.00 ? ? ? ? ? ? 41  GLN A CB  1 
ATOM 285   C CG  . GLN A 1 40  ? -26.670 -6.156  75.348   1.00 10.00 ? ? ? ? ? ? 41  GLN A CG  1 
ATOM 286   C CD  . GLN A 1 40  ? -27.853 -6.031  76.311   1.00 10.00 ? ? ? ? ? ? 41  GLN A CD  1 
ATOM 287   O OE1 . GLN A 1 40  ? -28.014 -6.734  77.329   1.00 10.00 ? ? ? ? ? ? 41  GLN A OE1 1 
ATOM 288   N NE2 . GLN A 1 40  ? -28.696 -5.062  75.968   1.00 10.00 ? ? ? ? ? ? 41  GLN A NE2 1 
ATOM 289   N N   . GLY A 1 41  ? -23.203 -7.129  77.272   1.00 10.00 ? ? ? ? ? ? 42  GLY A N   1 
ATOM 290   C CA  . GLY A 1 41  ? -21.952 -7.818  77.108   1.00 10.00 ? ? ? ? ? ? 42  GLY A CA  1 
ATOM 291   C C   . GLY A 1 41  ? -22.247 -9.174  76.506   1.00 10.00 ? ? ? ? ? ? 42  GLY A C   1 
ATOM 292   O O   . GLY A 1 41  ? -23.398 -9.467  76.130   1.00 10.00 ? ? ? ? ? ? 42  GLY A O   1 
ATOM 293   N N   . VAL A 1 42  ? -21.102 -9.904  76.452   1.00 10.00 ? ? ? ? ? ? 43  VAL A N   1 
ATOM 294   C CA  . VAL A 1 42  ? -20.834 -11.326 76.056   1.00 10.00 ? ? ? ? ? ? 43  VAL A CA  1 
ATOM 295   C C   . VAL A 1 42  ? -19.620 -11.529 75.120   1.00 10.00 ? ? ? ? ? ? 43  VAL A C   1 
ATOM 296   O O   . VAL A 1 42  ? -19.435 -10.942 74.030   1.00 10.00 ? ? ? ? ? ? 43  VAL A O   1 
ATOM 297   C CB  . VAL A 1 42  ? -22.103 -12.052 75.392   1.00 10.00 ? ? ? ? ? ? 43  VAL A CB  1 
ATOM 298   C CG1 . VAL A 1 42  ? -21.879 -13.350 74.601   1.00 10.00 ? ? ? ? ? ? 43  VAL A CG1 1 
ATOM 299   C CG2 . VAL A 1 42  ? -22.917 -12.412 76.608   1.00 10.00 ? ? ? ? ? ? 43  VAL A CG2 1 
ATOM 300   N N   . MET A 1 43  ? -18.731 -12.358 75.670   1.00 10.00 ? ? ? ? ? ? 44  MET A N   1 
ATOM 301   C CA  . MET A 1 43  ? -17.522 -12.752 74.967   1.00 10.00 ? ? ? ? ? ? 44  MET A CA  1 
ATOM 302   C C   . MET A 1 43  ? -18.020 -13.732 73.897   1.00 10.00 ? ? ? ? ? ? 44  MET A C   1 
ATOM 303   O O   . MET A 1 43  ? -18.981 -14.476 74.163   1.00 10.00 ? ? ? ? ? ? 44  MET A O   1 
ATOM 304   C CB  . MET A 1 43  ? -16.577 -13.431 75.969   1.00 10.00 ? ? ? ? ? ? 44  MET A CB  1 
ATOM 305   C CG  . MET A 1 43  ? -15.165 -13.645 75.494   1.00 10.00 ? ? ? ? ? ? 44  MET A CG  1 
ATOM 306   S SD  . MET A 1 43  ? -15.005 -14.866 74.160   1.00 10.00 ? ? ? ? ? ? 44  MET A SD  1 
ATOM 307   C CE  . MET A 1 43  ? -14.050 -15.971 75.210   1.00 10.00 ? ? ? ? ? ? 44  MET A CE  1 
ATOM 308   N N   . VAL A 1 44  ? -17.447 -13.789 72.679   1.00 10.00 ? ? ? ? ? ? 45  VAL A N   1 
ATOM 309   C CA  . VAL A 1 44  ? -17.854 -14.790 71.670   1.00 10.00 ? ? ? ? ? ? 45  VAL A CA  1 
ATOM 310   C C   . VAL A 1 44  ? -16.968 -16.048 71.839   1.00 10.00 ? ? ? ? ? ? 45  VAL A C   1 
ATOM 311   O O   . VAL A 1 44  ? -16.034 -16.466 71.148   1.00 10.00 ? ? ? ? ? ? 45  VAL A O   1 
ATOM 312   C CB  . VAL A 1 44  ? -17.755 -14.128 70.272   1.00 10.00 ? ? ? ? ? ? 45  VAL A CB  1 
ATOM 313   C CG1 . VAL A 1 44  ? -17.556 -15.115 69.123   1.00 10.00 ? ? ? ? ? ? 45  VAL A CG1 1 
ATOM 314   C CG2 . VAL A 1 44  ? -19.071 -13.354 70.109   1.00 10.00 ? ? ? ? ? ? 45  VAL A CG2 1 
ATOM 315   N N   . GLY A 1 45  ? -17.379 -16.625 72.956   1.00 10.00 ? ? ? ? ? ? 46  GLY A N   1 
ATOM 316   C CA  . GLY A 1 45  ? -16.908 -17.859 73.546   1.00 10.00 ? ? ? ? ? ? 46  GLY A CA  1 
ATOM 317   C C   . GLY A 1 45  ? -17.650 -17.951 74.874   1.00 10.00 ? ? ? ? ? ? 46  GLY A C   1 
ATOM 318   O O   . GLY A 1 45  ? -17.064 -18.047 75.966   1.00 10.00 ? ? ? ? ? ? 46  GLY A O   1 
ATOM 319   N N   . MET A 1 46  ? -18.953 -17.668 74.670   1.00 10.00 ? ? ? ? ? ? 47  MET A N   1 
ATOM 320   C CA  . MET A 1 46  ? -20.044 -17.761 75.620   1.00 10.00 ? ? ? ? ? ? 47  MET A CA  1 
ATOM 321   C C   . MET A 1 46  ? -21.360 -17.221 75.009   1.00 10.00 ? ? ? ? ? ? 47  MET A C   1 
ATOM 322   O O   . MET A 1 46  ? -21.382 -16.409 74.053   1.00 10.00 ? ? ? ? ? ? 47  MET A O   1 
ATOM 323   C CB  . MET A 1 46  ? -19.718 -17.005 76.945   1.00 10.00 ? ? ? ? ? ? 47  MET A CB  1 
ATOM 324   C CG  . MET A 1 46  ? -19.489 -15.509 77.054   1.00 10.00 ? ? ? ? ? ? 47  MET A CG  1 
ATOM 325   S SD  . MET A 1 46  ? -18.665 -15.143 78.640   1.00 10.00 ? ? ? ? ? ? 47  MET A SD  1 
ATOM 326   C CE  . MET A 1 46  ? -17.156 -16.047 78.335   1.00 10.00 ? ? ? ? ? ? 47  MET A CE  1 
ATOM 327   N N   . GLY A 1 47  ? -22.466 -17.803 75.555   1.00 10.00 ? ? ? ? ? ? 48  GLY A N   1 
ATOM 328   C CA  . GLY A 1 47  ? -23.835 -17.533 75.110   1.00 10.00 ? ? ? ? ? ? 48  GLY A CA  1 
ATOM 329   C C   . GLY A 1 47  ? -24.161 -16.083 75.440   1.00 10.00 ? ? ? ? ? ? 48  GLY A C   1 
ATOM 330   O O   . GLY A 1 47  ? -23.297 -15.460 76.081   1.00 10.00 ? ? ? ? ? ? 48  GLY A O   1 
ATOM 331   N N   . GLN A 1 48  ? -25.308 -15.448 75.089   1.00 10.00 ? ? ? ? ? ? 49  GLN A N   1 
ATOM 332   C CA  . GLN A 1 48  ? -25.550 -14.091 75.592   1.00 10.00 ? ? ? ? ? ? 49  GLN A CA  1 
ATOM 333   C C   . GLN A 1 48  ? -25.991 -14.426 77.029   1.00 10.00 ? ? ? ? ? ? 49  GLN A C   1 
ATOM 334   O O   . GLN A 1 48  ? -27.066 -15.012 77.250   1.00 10.00 ? ? ? ? ? ? 49  GLN A O   1 
ATOM 335   C CB  . GLN A 1 48  ? -26.643 -13.402 74.776   1.00 10.00 ? ? ? ? ? ? 49  GLN A CB  1 
ATOM 336   C CG  . GLN A 1 48  ? -26.527 -11.879 74.694   1.00 10.00 ? ? ? ? ? ? 49  GLN A CG  1 
ATOM 337   C CD  . GLN A 1 48  ? -27.225 -11.110 75.816   1.00 10.00 ? ? ? ? ? ? 49  GLN A CD  1 
ATOM 338   O OE1 . GLN A 1 48  ? -26.986 -11.429 76.972   1.00 10.00 ? ? ? ? ? ? 49  GLN A OE1 1 
ATOM 339   N NE2 . GLN A 1 48  ? -28.119 -10.129 75.614   1.00 10.00 ? ? ? ? ? ? 49  GLN A NE2 1 
ATOM 340   N N   . LYS A 1 49  ? -24.895 -14.384 77.840   1.00 10.00 ? ? ? ? ? ? 50  LYS A N   1 
ATOM 341   C CA  . LYS A 1 49  ? -24.712 -14.583 79.282   1.00 10.00 ? ? ? ? ? ? 50  LYS A CA  1 
ATOM 342   C C   . LYS A 1 49  ? -24.469 -13.215 79.908   1.00 10.00 ? ? ? ? ? ? 50  LYS A C   1 
ATOM 343   O O   . LYS A 1 49  ? -23.397 -12.603 79.784   1.00 10.00 ? ? ? ? ? ? 50  LYS A O   1 
ATOM 344   C CB  . LYS A 1 49  ? -23.483 -15.446 79.556   1.00 10.00 ? ? ? ? ? ? 50  LYS A CB  1 
ATOM 345   C CG  . LYS A 1 49  ? -23.732 -16.936 79.693   1.00 10.00 ? ? ? ? ? ? 50  LYS A CG  1 
ATOM 346   C CD  . LYS A 1 49  ? -24.102 -17.277 81.141   1.00 10.00 ? ? ? ? ? ? 50  LYS A CD  1 
ATOM 347   C CE  . LYS A 1 49  ? -22.886 -17.049 82.103   1.00 10.00 ? ? ? ? ? ? 50  LYS A CE  1 
ATOM 348   N NZ  . LYS A 1 49  ? -23.248 -17.074 83.508   1.00 10.00 ? ? ? ? ? ? 50  LYS A NZ  1 
ATOM 349   N N   . ASP A 1 50  ? -25.486 -12.673 80.562   1.00 10.00 ? ? ? ? ? ? 51  ASP A N   1 
ATOM 350   C CA  . ASP A 1 50  ? -25.279 -11.405 81.199   1.00 10.00 ? ? ? ? ? ? 51  ASP A CA  1 
ATOM 351   C C   . ASP A 1 50  ? -25.407 -11.509 82.714   1.00 10.00 ? ? ? ? ? ? 51  ASP A C   1 
ATOM 352   O O   . ASP A 1 50  ? -25.724 -10.507 83.347   1.00 10.00 ? ? ? ? ? ? 51  ASP A O   1 
ATOM 353   C CB  . ASP A 1 50  ? -26.263 -10.358 80.560   1.00 10.00 ? ? ? ? ? ? 51  ASP A CB  1 
ATOM 354   C CG  . ASP A 1 50  ? -25.844 -9.761  79.186   1.00 10.00 ? ? ? ? ? ? 51  ASP A CG  1 
ATOM 355   O OD1 . ASP A 1 50  ? -24.795 -10.117 78.619   1.00 10.00 ? ? ? ? ? ? 51  ASP A OD1 1 
ATOM 356   O OD2 . ASP A 1 50  ? -26.585 -8.930  78.659   1.00 10.00 ? ? ? ? ? ? 51  ASP A OD2 1 
ATOM 357   N N   . SER A 1 51  ? -25.203 -12.677 83.349   1.00 10.00 ? ? ? ? ? ? 52  SER A N   1 
ATOM 358   C CA  . SER A 1 51  ? -25.011 -12.742 84.795   1.00 10.00 ? ? ? ? ? ? 52  SER A CA  1 
ATOM 359   C C   . SER A 1 51  ? -23.804 -13.638 84.889   1.00 10.00 ? ? ? ? ? ? 52  SER A C   1 
ATOM 360   O O   . SER A 1 51  ? -23.885 -14.761 84.391   1.00 10.00 ? ? ? ? ? ? 52  SER A O   1 
ATOM 361   C CB  . SER A 1 51  ? -26.155 -13.421 85.619   1.00 10.00 ? ? ? ? ? ? 52  SER A CB  1 
ATOM 362   O OG  . SER A 1 51  ? -26.392 -14.839 85.509   1.00 10.00 ? ? ? ? ? ? 52  SER A OG  1 
ATOM 363   N N   . TYR A 1 52  ? -22.641 -13.211 85.351   1.00 10.00 ? ? ? ? ? ? 53  TYR A N   1 
ATOM 364   C CA  . TYR A 1 52  ? -21.551 -14.137 85.549   1.00 10.00 ? ? ? ? ? ? 53  TYR A CA  1 
ATOM 365   C C   . TYR A 1 52  ? -21.671 -14.402 87.046   1.00 10.00 ? ? ? ? ? ? 53  TYR A C   1 
ATOM 366   O O   . TYR A 1 52  ? -22.122 -13.529 87.783   1.00 10.00 ? ? ? ? ? ? 53  TYR A O   1 
ATOM 367   C CB  . TYR A 1 52  ? -20.268 -13.406 85.032   1.00 10.00 ? ? ? ? ? ? 53  TYR A CB  1 
ATOM 368   C CG  . TYR A 1 52  ? -20.281 -13.360 83.489   1.00 10.00 ? ? ? ? ? ? 53  TYR A CG  1 
ATOM 369   C CD1 . TYR A 1 52  ? -20.338 -14.570 82.795   1.00 10.00 ? ? ? ? ? ? 53  TYR A CD1 1 
ATOM 370   C CD2 . TYR A 1 52  ? -20.347 -12.187 82.761   1.00 10.00 ? ? ? ? ? ? 53  TYR A CD2 1 
ATOM 371   C CE1 . TYR A 1 52  ? -20.486 -14.653 81.413   1.00 10.00 ? ? ? ? ? ? 53  TYR A CE1 1 
ATOM 372   C CE2 . TYR A 1 52  ? -20.492 -12.258 81.365   1.00 10.00 ? ? ? ? ? ? 53  TYR A CE2 1 
ATOM 373   C CZ  . TYR A 1 52  ? -20.576 -13.486 80.680   1.00 10.00 ? ? ? ? ? ? 53  TYR A CZ  1 
ATOM 374   O OH  . TYR A 1 52  ? -20.851 -13.579 79.305   1.00 10.00 ? ? ? ? ? ? 53  TYR A OH  1 
ATOM 375   N N   . VAL A 1 53  ? -21.388 -15.590 87.564   1.00 10.00 ? ? ? ? ? ? 54  VAL A N   1 
ATOM 376   C CA  . VAL A 1 53  ? -21.593 -15.935 88.977   1.00 10.00 ? ? ? ? ? ? 54  VAL A CA  1 
ATOM 377   C C   . VAL A 1 53  ? -20.283 -16.425 89.626   1.00 10.00 ? ? ? ? ? ? 54  VAL A C   1 
ATOM 378   O O   . VAL A 1 53  ? -19.481 -17.129 88.977   1.00 10.00 ? ? ? ? ? ? 54  VAL A O   1 
ATOM 379   C CB  . VAL A 1 53  ? -22.750 -17.046 89.035   1.00 10.00 ? ? ? ? ? ? 54  VAL A CB  1 
ATOM 380   C CG1 . VAL A 1 53  ? -22.857 -17.734 90.382   1.00 10.00 ? ? ? ? ? ? 54  VAL A CG1 1 
ATOM 381   C CG2 . VAL A 1 53  ? -24.102 -16.375 88.886   1.00 10.00 ? ? ? ? ? ? 54  VAL A CG2 1 
ATOM 382   N N   . GLY A 1 54  ? -20.011 -16.145 90.900   1.00 10.00 ? ? ? ? ? ? 55  GLY A N   1 
ATOM 383   C CA  . GLY A 1 54  ? -18.848 -16.713 91.548   1.00 10.00 ? ? ? ? ? ? 55  GLY A CA  1 
ATOM 384   C C   . GLY A 1 54  ? -17.561 -16.076 91.067   1.00 10.00 ? ? ? ? ? ? 55  GLY A C   1 
ATOM 385   O O   . GLY A 1 54  ? -17.428 -14.858 91.010   1.00 10.00 ? ? ? ? ? ? 55  GLY A O   1 
ATOM 386   N N   . ASP A 1 55  ? -16.575 -16.902 90.692   1.00 10.00 ? ? ? ? ? ? 56  ASP A N   1 
ATOM 387   C CA  . ASP A 1 55  ? -15.198 -16.468 90.272   1.00 10.00 ? ? ? ? ? ? 56  ASP A CA  1 
ATOM 388   C C   . ASP A 1 55  ? -14.919 -16.001 88.826   1.00 10.00 ? ? ? ? ? ? 56  ASP A C   1 
ATOM 389   O O   . ASP A 1 55  ? -14.079 -15.130 88.560   1.00 10.00 ? ? ? ? ? ? 56  ASP A O   1 
ATOM 390   C CB  . ASP A 1 55  ? -14.170 -17.618 90.638   1.00 10.00 ? ? ? ? ? ? 56  ASP A CB  1 
ATOM 391   C CG  . ASP A 1 55  ? -14.579 -19.073 90.401   1.00 10.00 ? ? ? ? ? ? 56  ASP A CG  1 
ATOM 392   O OD1 . ASP A 1 55  ? -15.490 -19.389 89.600   1.00 10.00 ? ? ? ? ? ? 56  ASP A OD1 1 
ATOM 393   O OD2 . ASP A 1 55  ? -13.940 -19.898 91.058   1.00 10.00 ? ? ? ? ? ? 56  ASP A OD2 1 
ATOM 394   N N   . GLU A 1 56  ? -15.730 -16.520 87.896   1.00 10.00 ? ? ? ? ? ? 57  GLU A N   1 
ATOM 395   C CA  . GLU A 1 56  ? -15.778 -16.041 86.524   1.00 10.00 ? ? ? ? ? ? 57  GLU A CA  1 
ATOM 396   C C   . GLU A 1 56  ? -16.417 -14.665 86.478   1.00 10.00 ? ? ? ? ? ? 57  GLU A C   1 
ATOM 397   O O   . GLU A 1 56  ? -16.737 -14.180 85.399   1.00 10.00 ? ? ? ? ? ? 57  GLU A O   1 
ATOM 398   C CB  . GLU A 1 56  ? -16.610 -16.951 85.634   1.00 10.00 ? ? ? ? ? ? 57  GLU A CB  1 
ATOM 399   C CG  . GLU A 1 56  ? -18.068 -17.122 86.043   1.00 10.00 ? ? ? ? ? ? 57  GLU A CG  1 
ATOM 400   C CD  . GLU A 1 56  ? -18.888 -18.049 85.170   1.00 10.00 ? ? ? ? ? ? 57  GLU A CD  1 
ATOM 401   O OE1 . GLU A 1 56  ? -18.407 -19.107 84.783   1.00 10.00 ? ? ? ? ? ? 57  GLU A OE1 1 
ATOM 402   O OE2 . GLU A 1 56  ? -20.032 -17.712 84.898   1.00 10.00 ? ? ? ? ? ? 57  GLU A OE2 1 
ATOM 403   N N   . ALA A 1 57  ? -16.755 -14.085 87.627   1.00 10.00 ? ? ? ? ? ? 58  ALA A N   1 
ATOM 404   C CA  . ALA A 1 57  ? -17.280 -12.754 87.691   1.00 10.00 ? ? ? ? ? ? 58  ALA A CA  1 
ATOM 405   C C   . ALA A 1 57  ? -16.324 -11.992 88.573   1.00 10.00 ? ? ? ? ? ? 58  ALA A C   1 
ATOM 406   O O   . ALA A 1 57  ? -16.393 -10.785 88.741   1.00 10.00 ? ? ? ? ? ? 58  ALA A O   1 
ATOM 407   C CB  . ALA A 1 57  ? -18.630 -12.761 88.320   1.00 10.00 ? ? ? ? ? ? 58  ALA A CB  1 
ATOM 408   N N   . GLN A 1 58  ? -15.376 -12.634 89.196   1.00 10.00 ? ? ? ? ? ? 59  GLN A N   1 
ATOM 409   C CA  . GLN A 1 58  ? -14.401 -11.927 89.989   1.00 10.00 ? ? ? ? ? ? 59  GLN A CA  1 
ATOM 410   C C   . GLN A 1 58  ? -13.481 -11.345 88.892   1.00 10.00 ? ? ? ? ? ? 59  GLN A C   1 
ATOM 411   O O   . GLN A 1 58  ? -13.198 -10.143 88.796   1.00 10.00 ? ? ? ? ? ? 59  GLN A O   1 
ATOM 412   C CB  . GLN A 1 58  ? -13.736 -12.974 90.849   1.00 10.00 ? ? ? ? ? ? 59  GLN A CB  1 
ATOM 413   C CG  . GLN A 1 58  ? -12.608 -12.563 91.733   1.00 10.00 ? ? ? ? ? ? 59  GLN A CG  1 
ATOM 414   C CD  . GLN A 1 58  ? -13.072 -11.846 92.976   1.00 10.00 ? ? ? ? ? ? 59  GLN A CD  1 
ATOM 415   O OE1 . GLN A 1 58  ? -12.635 -12.174 94.070   1.00 10.00 ? ? ? ? ? ? 59  GLN A OE1 1 
ATOM 416   N NE2 . GLN A 1 58  ? -13.967 -10.875 92.974   1.00 10.00 ? ? ? ? ? ? 59  GLN A NE2 1 
ATOM 417   N N   . SER A 1 59  ? -13.106 -12.182 87.909   1.00 10.00 ? ? ? ? ? ? 60  SER A N   1 
ATOM 418   C CA  . SER A 1 59  ? -12.164 -11.845 86.846   1.00 10.00 ? ? ? ? ? ? 60  SER A CA  1 
ATOM 419   C C   . SER A 1 59  ? -12.706 -11.053 85.661   1.00 10.00 ? ? ? ? ? ? 60  SER A C   1 
ATOM 420   O O   . SER A 1 59  ? -12.301 -11.205 84.506   1.00 10.00 ? ? ? ? ? ? 60  SER A O   1 
ATOM 421   C CB  . SER A 1 59  ? -11.588 -13.185 86.460   1.00 10.00 ? ? ? ? ? ? 60  SER A CB  1 
ATOM 422   O OG  . SER A 1 59  ? -11.388 -13.951 87.659   1.00 10.00 ? ? ? ? ? ? 60  SER A OG  1 
ATOM 423   N N   . LYS A 1 60  ? -13.674 -10.202 85.966   1.00 10.00 ? ? ? ? ? ? 61  LYS A N   1 
ATOM 424   C CA  . LYS A 1 60  ? -14.313 -9.248  85.070   1.00 10.00 ? ? ? ? ? ? 61  LYS A CA  1 
ATOM 425   C C   . LYS A 1 60  ? -15.035 -8.290  86.018   1.00 10.00 ? ? ? ? ? ? 61  LYS A C   1 
ATOM 426   O O   . LYS A 1 60  ? -15.821 -7.484  85.542   1.00 10.00 ? ? ? ? ? ? 61  LYS A O   1 
ATOM 427   C CB  . LYS A 1 60  ? -15.380 -9.860  84.198   1.00 10.00 ? ? ? ? ? ? 61  LYS A CB  1 
ATOM 428   C CG  . LYS A 1 60  ? -14.954 -10.944 83.219   1.00 10.00 ? ? ? ? ? ? 61  LYS A CG  1 
ATOM 429   C CD  . LYS A 1 60  ? -16.088 -11.279 82.246   1.00 10.00 ? ? ? ? ? ? 61  LYS A CD  1 
ATOM 430   C CE  . LYS A 1 60  ? -15.573 -12.043 81.029   1.00 10.00 ? ? ? ? ? ? 61  LYS A CE  1 
ATOM 431   N NZ  . LYS A 1 60  ? -15.134 -13.399 81.355   1.00 10.00 ? ? ? ? ? ? 61  LYS A NZ  1 
ATOM 432   N N   . ARG A 1 61  ? -14.726 -8.303  87.338   1.00 10.00 ? ? ? ? ? ? 62  ARG A N   1 
ATOM 433   C CA  . ARG A 1 61  ? -15.382 -7.510  88.389   1.00 10.00 ? ? ? ? ? ? 62  ARG A CA  1 
ATOM 434   C C   . ARG A 1 61  ? -15.275 -6.024  88.119   1.00 10.00 ? ? ? ? ? ? 62  ARG A C   1 
ATOM 435   O O   . ARG A 1 61  ? -16.194 -5.228  88.298   1.00 10.00 ? ? ? ? ? ? 62  ARG A O   1 
ATOM 436   C CB  . ARG A 1 61  ? -14.739 -7.884  89.734   1.00 10.00 ? ? ? ? ? ? 62  ARG A CB  1 
ATOM 437   C CG  . ARG A 1 61  ? -14.265 -6.912  90.843   1.00 10.00 ? ? ? ? ? ? 62  ARG A CG  1 
ATOM 438   C CD  . ARG A 1 61  ? -13.480 -7.769  91.910   1.00 10.00 ? ? ? ? ? ? 62  ARG A CD  1 
ATOM 439   N NE  . ARG A 1 61  ? -13.395 -7.122  93.225   1.00 10.00 ? ? ? ? ? ? 62  ARG A NE  1 
ATOM 440   C CZ  . ARG A 1 61  ? -14.081 -7.518  94.332   1.00 10.00 ? ? ? ? ? ? 62  ARG A CZ  1 
ATOM 441   N NH1 . ARG A 1 61  ? -14.930 -8.593  94.388   1.00 10.00 ? ? ? ? ? ? 62  ARG A NH1 1 
ATOM 442   N NH2 . ARG A 1 61  ? -14.023 -6.683  95.387   1.00 10.00 ? ? ? ? ? ? 62  ARG A NH2 1 
ATOM 443   N N   . GLY A 1 62  ? -14.074 -5.719  87.612   1.00 10.00 ? ? ? ? ? ? 63  GLY A N   1 
ATOM 444   C CA  . GLY A 1 62  ? -13.705 -4.410  87.120   1.00 10.00 ? ? ? ? ? ? 63  GLY A CA  1 
ATOM 445   C C   . GLY A 1 62  ? -14.602 -4.039  85.960   1.00 10.00 ? ? ? ? ? ? 63  GLY A C   1 
ATOM 446   O O   . GLY A 1 62  ? -15.006 -2.896  85.926   1.00 10.00 ? ? ? ? ? ? 63  GLY A O   1 
ATOM 447   N N   . ILE A 1 63  ? -14.954 -4.901  85.007   1.00 10.00 ? ? ? ? ? ? 64  ILE A N   1 
ATOM 448   C CA  . ILE A 1 63  ? -15.841 -4.484  83.927   1.00 10.00 ? ? ? ? ? ? 64  ILE A CA  1 
ATOM 449   C C   . ILE A 1 63  ? -17.302 -4.746  84.192   1.00 10.00 ? ? ? ? ? ? 64  ILE A C   1 
ATOM 450   O O   . ILE A 1 63  ? -18.093 -4.419  83.305   1.00 10.00 ? ? ? ? ? ? 64  ILE A O   1 
ATOM 451   C CB  . ILE A 1 63  ? -15.493 -5.168  82.601   1.00 10.00 ? ? ? ? ? ? 64  ILE A CB  1 
ATOM 452   C CG1 . ILE A 1 63  ? -15.498 -6.661  82.695   1.00 10.00 ? ? ? ? ? ? 64  ILE A CG1 1 
ATOM 453   C CG2 . ILE A 1 63  ? -14.104 -4.655  82.185   1.00 10.00 ? ? ? ? ? ? 64  ILE A CG2 1 
ATOM 454   C CD1 . ILE A 1 63  ? -15.071 -7.326  81.374   1.00 10.00 ? ? ? ? ? ? 64  ILE A CD1 1 
ATOM 455   N N   . LEU A 1 64  ? -17.692 -5.242  85.391   1.00 10.00 ? ? ? ? ? ? 65  LEU A N   1 
ATOM 456   C CA  . LEU A 1 64  ? -19.070 -5.662  85.641   1.00 10.00 ? ? ? ? ? ? 65  LEU A CA  1 
ATOM 457   C C   . LEU A 1 64  ? -19.699 -5.042  86.864   1.00 10.00 ? ? ? ? ? ? 65  LEU A C   1 
ATOM 458   O O   . LEU A 1 64  ? -18.982 -4.600  87.767   1.00 10.00 ? ? ? ? ? ? 65  LEU A O   1 
ATOM 459   C CB  . LEU A 1 64  ? -19.167 -7.170  85.837   1.00 10.00 ? ? ? ? ? ? 65  LEU A CB  1 
ATOM 460   C CG  . LEU A 1 64  ? -18.732 -8.174  84.764   1.00 10.00 ? ? ? ? ? ? 65  LEU A CG  1 
ATOM 461   C CD1 . LEU A 1 64  ? -18.999 -9.577  85.232   1.00 10.00 ? ? ? ? ? ? 65  LEU A CD1 1 
ATOM 462   C CD2 . LEU A 1 64  ? -19.521 -7.950  83.503   1.00 10.00 ? ? ? ? ? ? 65  LEU A CD2 1 
ATOM 463   N N   . THR A 1 65  ? -21.034 -5.002  86.971   1.00 10.00 ? ? ? ? ? ? 66  THR A N   1 
ATOM 464   C CA  . THR A 1 65  ? -21.651 -4.604  88.262   1.00 10.00 ? ? ? ? ? ? 66  THR A CA  1 
ATOM 465   C C   . THR A 1 65  ? -22.142 -5.848  89.061   1.00 10.00 ? ? ? ? ? ? 66  THR A C   1 
ATOM 466   O O   . THR A 1 65  ? -22.927 -6.716  88.633   1.00 10.00 ? ? ? ? ? ? 66  THR A O   1 
ATOM 467   C CB  . THR A 1 65  ? -22.783 -3.566  87.925   1.00 10.00 ? ? ? ? ? ? 66  THR A CB  1 
ATOM 468   O OG1 . THR A 1 65  ? -22.128 -2.290  88.008   1.00 10.00 ? ? ? ? ? ? 66  THR A OG1 1 
ATOM 469   C CG2 . THR A 1 65  ? -24.013 -3.637  88.829   1.00 10.00 ? ? ? ? ? ? 66  THR A CG2 1 
ATOM 470   N N   . LEU A 1 66  ? -21.554 -5.955  90.249   1.00 10.00 ? ? ? ? ? ? 67  LEU A N   1 
ATOM 471   C CA  . LEU A 1 66  ? -21.764 -7.073  91.132   1.00 10.00 ? ? ? ? ? ? 67  LEU A CA  1 
ATOM 472   C C   . LEU A 1 66  ? -22.779 -6.943  92.267   1.00 10.00 ? ? ? ? ? ? 67  LEU A C   1 
ATOM 473   O O   . LEU A 1 66  ? -22.651 -6.069  93.128   1.00 10.00 ? ? ? ? ? ? 67  LEU A O   1 
ATOM 474   C CB  . LEU A 1 66  ? -20.433 -7.418  91.716   1.00 10.00 ? ? ? ? ? ? 67  LEU A CB  1 
ATOM 475   C CG  . LEU A 1 66  ? -19.248 -7.715  90.869   1.00 10.00 ? ? ? ? ? ? 67  LEU A CG  1 
ATOM 476   C CD1 . LEU A 1 66  ? -18.045 -7.495  91.790   1.00 10.00 ? ? ? ? ? ? 67  LEU A CD1 1 
ATOM 477   C CD2 . LEU A 1 66  ? -19.297 -9.104  90.255   1.00 10.00 ? ? ? ? ? ? 67  LEU A CD2 1 
ATOM 478   N N   . LYS A 1 67  ? -23.803 -7.789  92.330   1.00 10.00 ? ? ? ? ? ? 68  LYS A N   1 
ATOM 479   C CA  . LYS A 1 67  ? -24.759 -7.852  93.436   1.00 10.00 ? ? ? ? ? ? 68  LYS A CA  1 
ATOM 480   C C   . LYS A 1 67  ? -24.389 -9.010  94.405   1.00 10.00 ? ? ? ? ? ? 68  LYS A C   1 
ATOM 481   O O   . LYS A 1 67  ? -24.136 -10.164 94.009   1.00 10.00 ? ? ? ? ? ? 68  LYS A O   1 
ATOM 482   C CB  . LYS A 1 67  ? -26.196 -8.114  92.924   1.00 10.00 ? ? ? ? ? ? 68  LYS A CB  1 
ATOM 483   C CG  . LYS A 1 67  ? -27.150 -6.970  92.468   1.00 10.00 ? ? ? ? ? ? 68  LYS A CG  1 
ATOM 484   C CD  . LYS A 1 67  ? -28.489 -7.462  91.836   1.00 10.00 ? ? ? ? ? ? 68  LYS A CD  1 
ATOM 485   C CE  . LYS A 1 67  ? -28.412 -7.958  90.390   1.00 10.00 ? ? ? ? ? ? 68  LYS A CE  1 
ATOM 486   N NZ  . LYS A 1 67  ? -27.282 -8.844  90.104   1.00 10.00 ? ? ? ? ? ? 68  LYS A NZ  1 
ATOM 487   N N   . TYR A 1 68  ? -24.406 -8.717  95.715   1.00 10.00 ? ? ? ? ? ? 69  TYR A N   1 
ATOM 488   C CA  . TYR A 1 68  ? -24.149 -9.634  96.817   1.00 10.00 ? ? ? ? ? ? 69  TYR A CA  1 
ATOM 489   C C   . TYR A 1 68  ? -25.488 -10.105 97.384   1.00 10.00 ? ? ? ? ? ? 69  TYR A C   1 
ATOM 490   O O   . TYR A 1 68  ? -26.218 -9.301  97.985   1.00 10.00 ? ? ? ? ? ? 69  TYR A O   1 
ATOM 491   C CB  . TYR A 1 68  ? -23.410 -8.947  97.938   1.00 10.00 ? ? ? ? ? ? 69  TYR A CB  1 
ATOM 492   C CG  . TYR A 1 68  ? -21.969 -8.651  97.598   1.00 10.00 ? ? ? ? ? ? 69  TYR A CG  1 
ATOM 493   C CD1 . TYR A 1 68  ? -21.630 -7.599  96.746   1.00 10.00 ? ? ? ? ? ? 69  TYR A CD1 1 
ATOM 494   C CD2 . TYR A 1 68  ? -21.025 -9.474  98.160   1.00 10.00 ? ? ? ? ? ? 69  TYR A CD2 1 
ATOM 495   C CE1 . TYR A 1 68  ? -20.293 -7.381  96.437   1.00 10.00 ? ? ? ? ? ? 69  TYR A CE1 1 
ATOM 496   C CE2 . TYR A 1 68  ? -19.701 -9.259  97.867   1.00 10.00 ? ? ? ? ? ? 69  TYR A CE2 1 
ATOM 497   C CZ  . TYR A 1 68  ? -19.355 -8.219  97.013   1.00 10.00 ? ? ? ? ? ? 69  TYR A CZ  1 
ATOM 498   O OH  . TYR A 1 68  ? -18.022 -8.044  96.753   1.00 10.00 ? ? ? ? ? ? 69  TYR A OH  1 
ATOM 499   N N   . PRO A 1 69  ? -14.406 -9.754  99.137   1.00 10.00 ? ? ? ? ? ? 70  PRO A N   1 
ATOM 500   C CA  . PRO A 1 69  ? -15.040 -8.833  100.056  1.00 10.00 ? ? ? ? ? ? 70  PRO A CA  1 
ATOM 501   C C   . PRO A 1 69  ? -14.219 -8.618  101.316  1.00 10.00 ? ? ? ? ? ? 70  PRO A C   1 
ATOM 502   O O   . PRO A 1 69  ? -14.052 -7.500  101.784  1.00 10.00 ? ? ? ? ? ? 70  PRO A O   1 
ATOM 503   C CB  . PRO A 1 69  ? -16.356 -9.486  100.347  1.00 10.00 ? ? ? ? ? ? 70  PRO A CB  1 
ATOM 504   C CG  . PRO A 1 69  ? -16.490 -10.726 99.463   1.00 10.00 ? ? ? ? ? ? 70  PRO A CG  1 
ATOM 505   C CD  . PRO A 1 69  ? -15.051 -11.069 99.187   1.00 10.00 ? ? ? ? ? ? 70  PRO A CD  1 
ATOM 506   N N   . ILE A 1 70  ? -13.756 -9.710  101.923  1.00 10.00 ? ? ? ? ? ? 71  ILE A N   1 
ATOM 507   C CA  . ILE A 1 70  ? -13.183 -9.677  103.238  1.00 10.00 ? ? ? ? ? ? 71  ILE A CA  1 
ATOM 508   C C   . ILE A 1 70  ? -11.714 -9.577  102.954  1.00 10.00 ? ? ? ? ? ? 71  ILE A C   1 
ATOM 509   O O   . ILE A 1 70  ? -11.210 -10.298 102.095  1.00 10.00 ? ? ? ? ? ? 71  ILE A O   1 
ATOM 510   C CB  . ILE A 1 70  ? -13.585 -10.977 103.970  1.00 10.00 ? ? ? ? ? ? 71  ILE A CB  1 
ATOM 511   C CG1 . ILE A 1 70  ? -15.071 -11.237 103.987  1.00 10.00 ? ? ? ? ? ? 71  ILE A CG1 1 
ATOM 512   C CG2 . ILE A 1 70  ? -13.246 -10.830 105.394  1.00 10.00 ? ? ? ? ? ? 71  ILE A CG2 1 
ATOM 513   C CD1 . ILE A 1 70  ? -15.448 -12.750 104.091  1.00 10.00 ? ? ? ? ? ? 71  ILE A CD1 1 
ATOM 514   N N   . GLU A 1 71  ? -10.997 -8.767  103.711  1.00 10.00 ? ? ? ? ? ? 72  GLU A N   1 
ATOM 515   C CA  . GLU A 1 71  ? -9.616  -8.466  103.432  1.00 10.00 ? ? ? ? ? ? 72  GLU A CA  1 
ATOM 516   C C   . GLU A 1 71  ? -8.847  -8.184  104.709  1.00 10.00 ? ? ? ? ? ? 72  GLU A C   1 
ATOM 517   O O   . GLU A 1 71  ? -9.165  -7.240  105.423  1.00 10.00 ? ? ? ? ? ? 72  GLU A O   1 
ATOM 518   C CB  . GLU A 1 71  ? -9.676  -7.296  102.529  1.00 10.00 ? ? ? ? ? ? 72  GLU A CB  1 
ATOM 519   C CG  . GLU A 1 71  ? -8.366  -6.738  102.069  1.00 10.00 ? ? ? ? ? ? 72  GLU A CG  1 
ATOM 520   C CD  . GLU A 1 71  ? -8.586  -5.813  100.896  1.00 10.00 ? ? ? ? ? ? 72  GLU A CD  1 
ATOM 521   O OE1 . GLU A 1 71  ? -9.124  -6.310  99.875   1.00 10.00 ? ? ? ? ? ? 72  GLU A OE1 1 
ATOM 522   O OE2 . GLU A 1 71  ? -8.238  -4.625  101.028  1.00 10.00 ? ? ? ? ? ? 72  GLU A OE2 1 
ATOM 523   N N   . HIS A 1 72  ? -11.277 -5.156  106.423  1.00 10.00 ? ? ? ? ? ? 73  HIS A N   1 
ATOM 524   C CA  . HIS A 1 72  ? -11.056 -5.460  107.876  1.00 10.00 ? ? ? ? ? ? 73  HIS A CA  1 
ATOM 525   C C   . HIS A 1 72  ? -11.640 -6.648  108.523  1.00 10.00 ? ? ? ? ? ? 73  HIS A C   1 
ATOM 526   O O   . HIS A 1 72  ? -11.169 -7.028  109.643  1.00 10.00 ? ? ? ? ? ? 73  HIS A O   1 
ATOM 527   C CB  . HIS A 1 72  ? -10.494 -4.340  108.799  1.00 10.00 ? ? ? ? ? ? 73  HIS A CB  1 
ATOM 528   C CG  . HIS A 1 72  ? -9.089  -4.206  108.139  1.00 10.00 ? ? ? ? ? ? 73  HIS A CG  1 
ATOM 529   N ND1 . HIS A 1 72  ? -8.199  -5.170  108.518  1.00 10.00 ? ? ? ? ? ? 73  HIS A ND1 1 
ATOM 530   C CD2 . HIS A 1 72  ? -8.469  -3.413  107.292  1.00 10.00 ? ? ? ? ? ? 73  HIS A CD2 1 
ATOM 531   C CE1 . HIS A 1 72  ? -7.067  -4.991  107.935  1.00 10.00 ? ? ? ? ? ? 73  HIS A CE1 1 
ATOM 532   N NE2 . HIS A 1 72  ? -7.161  -3.889  107.136  1.00 10.00 ? ? ? ? ? ? 73  HIS A NE2 1 
ATOM 533   N N   . GLY A 1 73  ? -9.144  -9.766  107.199  1.00 10.00 ? ? ? ? ? ? 74  GLY A N   1 
ATOM 534   C CA  . GLY A 1 73  ? -10.219 -10.008 108.142  1.00 10.00 ? ? ? ? ? ? 74  GLY A CA  1 
ATOM 535   C C   . GLY A 1 73  ? -11.372 -9.016  108.125  1.00 10.00 ? ? ? ? ? ? 74  GLY A C   1 
ATOM 536   O O   . GLY A 1 73  ? -12.438 -9.375  108.635  1.00 10.00 ? ? ? ? ? ? 74  GLY A O   1 
ATOM 537   N N   . ILE A 1 74  ? -11.189 -7.808  107.554  1.00 10.00 ? ? ? ? ? ? 75  ILE A N   1 
ATOM 538   C CA  . ILE A 1 74  ? -12.143 -6.708  107.585  1.00 10.00 ? ? ? ? ? ? 75  ILE A CA  1 
ATOM 539   C C   . ILE A 1 74  ? -12.911 -6.613  106.268  1.00 10.00 ? ? ? ? ? ? 75  ILE A C   1 
ATOM 540   O O   . ILE A 1 74  ? -12.299 -6.852  105.231  1.00 10.00 ? ? ? ? ? ? 75  ILE A O   1 
ATOM 541   C CB  . ILE A 1 74  ? -11.369 -5.418  107.855  1.00 10.00 ? ? ? ? ? ? 75  ILE A CB  1 
ATOM 542   C CG1 . ILE A 1 74  ? -10.430 -5.573  109.055  1.00 10.00 ? ? ? ? ? ? 75  ILE A CG1 1 
ATOM 543   C CG2 . ILE A 1 74  ? -12.388 -4.281  108.012  1.00 10.00 ? ? ? ? ? ? 75  ILE A CG2 1 
ATOM 544   C CD1 . ILE A 1 74  ? -10.985 -5.995  110.416  1.00 10.00 ? ? ? ? ? ? 75  ILE A CD1 1 
ATOM 545   N N   . VAL A 1 75  ? -14.203 -6.247  106.200  1.00 10.00 ? ? ? ? ? ? 76  VAL A N   1 
ATOM 546   C CA  . VAL A 1 75  ? -14.964 -6.249  104.951  1.00 10.00 ? ? ? ? ? ? 76  VAL A CA  1 
ATOM 547   C C   . VAL A 1 75  ? -14.770 -4.876  104.350  1.00 10.00 ? ? ? ? ? ? 76  VAL A C   1 
ATOM 548   O O   . VAL A 1 75  ? -14.907 -3.836  105.015  1.00 10.00 ? ? ? ? ? ? 76  VAL A O   1 
ATOM 549   C CB  . VAL A 1 75  ? -16.466 -6.573  105.233  1.00 10.00 ? ? ? ? ? ? 76  VAL A CB  1 
ATOM 550   C CG1 . VAL A 1 75  ? -17.365 -6.351  104.028  1.00 10.00 ? ? ? ? ? ? 76  VAL A CG1 1 
ATOM 551   C CG2 . VAL A 1 75  ? -16.569 -8.061  105.574  1.00 10.00 ? ? ? ? ? ? 76  VAL A CG2 1 
ATOM 552   N N   . THR A 1 76  ? -14.261 -4.972  103.105  1.00 10.00 ? ? ? ? ? ? 77  THR A N   1 
ATOM 553   C CA  . THR A 1 76  ? -13.958 -3.808  102.279  1.00 10.00 ? ? ? ? ? ? 77  THR A CA  1 
ATOM 554   C C   . THR A 1 76  ? -15.091 -3.549  101.300  1.00 10.00 ? ? ? ? ? ? 77  THR A C   1 
ATOM 555   O O   . THR A 1 76  ? -15.310 -2.421  100.849  1.00 10.00 ? ? ? ? ? ? 77  THR A O   1 
ATOM 556   C CB  . THR A 1 76  ? -12.633 -4.011  101.491  1.00 10.00 ? ? ? ? ? ? 77  THR A CB  1 
ATOM 557   O OG1 . THR A 1 76  ? -12.670 -5.208  100.683  1.00 10.00 ? ? ? ? ? ? 77  THR A OG1 1 
ATOM 558   C CG2 . THR A 1 76  ? -11.484 -4.072  102.493  1.00 10.00 ? ? ? ? ? ? 77  THR A CG2 1 
ATOM 559   N N   . ASN A 1 77  ? -15.878 -4.565  100.967  1.00 10.00 ? ? ? ? ? ? 78  ASN A N   1 
ATOM 560   C CA  . ASN A 1 77  ? -16.896 -4.411  99.971   1.00 10.00 ? ? ? ? ? ? 78  ASN A CA  1 
ATOM 561   C C   . ASN A 1 77  ? -18.200 -4.902  100.526  1.00 10.00 ? ? ? ? ? ? 78  ASN A C   1 
ATOM 562   O O   . ASN A 1 77  ? -18.426 -6.098  100.706  1.00 10.00 ? ? ? ? ? ? 78  ASN A O   1 
ATOM 563   C CB  . ASN A 1 77  ? -16.495 -5.202  98.714   1.00 10.00 ? ? ? ? ? ? 78  ASN A CB  1 
ATOM 564   C CG  . ASN A 1 77  ? -17.346 -4.758  97.531   1.00 10.00 ? ? ? ? ? ? 78  ASN A CG  1 
ATOM 565   O OD1 . ASN A 1 77  ? -18.314 -5.447  97.227   1.00 10.00 ? ? ? ? ? ? 78  ASN A OD1 1 
ATOM 566   N ND2 . ASN A 1 77  ? -17.155 -3.597  96.899   1.00 10.00 ? ? ? ? ? ? 78  ASN A ND2 1 
ATOM 567   N N   . TRP A 1 78  ? -19.095 -3.995  100.819  1.00 10.00 ? ? ? ? ? ? 79  TRP A N   1 
ATOM 568   C CA  . TRP A 1 78  ? -20.339 -4.411  101.416  1.00 10.00 ? ? ? ? ? ? 79  TRP A CA  1 
ATOM 569   C C   . TRP A 1 78  ? -21.395 -5.018  100.518  1.00 10.00 ? ? ? ? ? ? 79  TRP A C   1 
ATOM 570   O O   . TRP A 1 78  ? -22.104 -5.882  101.015  1.00 10.00 ? ? ? ? ? ? 79  TRP A O   1 
ATOM 571   C CB  . TRP A 1 78  ? -20.878 -3.218  102.161  1.00 10.00 ? ? ? ? ? ? 79  TRP A CB  1 
ATOM 572   C CG  . TRP A 1 78  ? -20.167 -3.073  103.503  1.00 10.00 ? ? ? ? ? ? 79  TRP A CG  1 
ATOM 573   C CD1 . TRP A 1 78  ? -19.248 -2.095  103.756  1.00 10.00 ? ? ? ? ? ? 79  TRP A CD1 1 
ATOM 574   C CD2 . TRP A 1 78  ? -20.292 -3.976  104.505  1.00 10.00 ? ? ? ? ? ? 79  TRP A CD2 1 
ATOM 575   N NE1 . TRP A 1 78  ? -18.754 -2.392  104.912  1.00 10.00 ? ? ? ? ? ? 79  TRP A NE1 1 
ATOM 576   C CE2 . TRP A 1 78  ? -19.347 -3.511  105.396  1.00 10.00 ? ? ? ? ? ? 79  TRP A CE2 1 
ATOM 577   C CE3 . TRP A 1 78  ? -21.056 -5.102  104.731  1.00 10.00 ? ? ? ? ? ? 79  TRP A CE3 1 
ATOM 578   C CZ2 . TRP A 1 78  ? -19.144 -4.209  106.577  1.00 10.00 ? ? ? ? ? ? 79  TRP A CZ2 1 
ATOM 579   C CZ3 . TRP A 1 78  ? -20.853 -5.791  105.904  1.00 10.00 ? ? ? ? ? ? 79  TRP A CZ3 1 
ATOM 580   C CH2 . TRP A 1 78  ? -19.905 -5.342  106.807  1.00 10.00 ? ? ? ? ? ? 79  TRP A CH2 1 
ATOM 581   N N   . ASP A 1 79  ? -21.596 -4.735  99.230   1.00 10.00 ? ? ? ? ? ? 80  ASP A N   1 
ATOM 582   C CA  . ASP A 1 79  ? -22.665 -5.436  98.532   1.00 10.00 ? ? ? ? ? ? 80  ASP A CA  1 
ATOM 583   C C   . ASP A 1 79  ? -22.144 -6.793  98.122   1.00 10.00 ? ? ? ? ? ? 80  ASP A C   1 
ATOM 584   O O   . ASP A 1 79  ? -22.945 -7.729  98.025   1.00 10.00 ? ? ? ? ? ? 80  ASP A O   1 
ATOM 585   C CB  . ASP A 1 79  ? -23.144 -4.752  97.258   1.00 10.00 ? ? ? ? ? ? 80  ASP A CB  1 
ATOM 586   C CG  . ASP A 1 79  ? -23.148 -3.233  97.162   1.00 10.00 ? ? ? ? ? ? 80  ASP A CG  1 
ATOM 587   O OD1 . ASP A 1 79  ? -22.964 -2.503  98.145   1.00 10.00 ? ? ? ? ? ? 80  ASP A OD1 1 
ATOM 588   O OD2 . ASP A 1 79  ? -23.292 -2.767  96.036   1.00 10.00 ? ? ? ? ? ? 80  ASP A OD2 1 
ATOM 589   N N   . ASP A 1 80  ? -20.839 -6.962  97.861   1.00 10.00 ? ? ? ? ? ? 81  ASP A N   1 
ATOM 590   C CA  . ASP A 1 80  ? -20.395 -8.311  97.576   1.00 10.00 ? ? ? ? ? ? 81  ASP A CA  1 
ATOM 591   C C   . ASP A 1 80  ? -20.327 -9.177  98.841   1.00 10.00 ? ? ? ? ? ? 81  ASP A C   1 
ATOM 592   O O   . ASP A 1 80  ? -20.662 -10.372 98.788   1.00 10.00 ? ? ? ? ? ? 81  ASP A O   1 
ATOM 593   C CB  . ASP A 1 80  ? -19.073 -8.195  96.731   1.00 10.00 ? ? ? ? ? ? 81  ASP A CB  1 
ATOM 594   C CG  . ASP A 1 80  ? -19.571 -7.916  95.268   1.00 10.00 ? ? ? ? ? ? 81  ASP A CG  1 
ATOM 595   O OD1 . ASP A 1 80  ? -20.224 -8.794  94.692   1.00 10.00 ? ? ? ? ? ? 81  ASP A OD1 1 
ATOM 596   O OD2 . ASP A 1 80  ? -19.395 -6.837  94.679   1.00 10.00 ? ? ? ? ? ? 81  ASP A OD2 1 
ATOM 597   N N   . MET A 1 81  ? -20.055 -8.653  100.038  1.00 10.00 ? ? ? ? ? ? 82  MET A N   1 
ATOM 598   C CA  . MET A 1 81  ? -20.334 -9.458  101.243  1.00 10.00 ? ? ? ? ? ? 82  MET A CA  1 
ATOM 599   C C   . MET A 1 81  ? -21.859 -9.758  101.277  1.00 10.00 ? ? ? ? ? ? 82  MET A C   1 
ATOM 600   O O   . MET A 1 81  ? -22.248 -10.915 101.460  1.00 10.00 ? ? ? ? ? ? 82  MET A O   1 
ATOM 601   C CB  . MET A 1 81  ? -19.920 -8.698  102.515  1.00 10.00 ? ? ? ? ? ? 82  MET A CB  1 
ATOM 602   C CG  . MET A 1 81  ? -19.808 -9.569  103.780  1.00 10.00 ? ? ? ? ? ? 82  MET A CG  1 
ATOM 603   S SD  . MET A 1 81  ? -18.388 -10.694 104.078  1.00 10.00 ? ? ? ? ? ? 82  MET A SD  1 
ATOM 604   C CE  . MET A 1 81  ? -19.180 -12.280 104.030  1.00 10.00 ? ? ? ? ? ? 82  MET A CE  1 
ATOM 605   N N   . GLU A 1 82  ? -22.774 -8.832  100.960  1.00 10.00 ? ? ? ? ? ? 83  GLU A N   1 
ATOM 606   C CA  . GLU A 1 82  ? -24.191 -9.133  100.998  1.00 10.00 ? ? ? ? ? ? 83  GLU A CA  1 
ATOM 607   C C   . GLU A 1 82  ? -24.529 -10.274 100.103  1.00 10.00 ? ? ? ? ? ? 83  GLU A C   1 
ATOM 608   O O   . GLU A 1 82  ? -25.264 -11.171 100.512  1.00 10.00 ? ? ? ? ? ? 83  GLU A O   1 
ATOM 609   C CB  . GLU A 1 82  ? -25.050 -7.994  100.561  1.00 10.00 ? ? ? ? ? ? 83  GLU A CB  1 
ATOM 610   C CG  . GLU A 1 82  ? -25.220 -6.796  101.518  1.00 10.00 ? ? ? ? ? ? 83  GLU A CG  1 
ATOM 611   C CD  . GLU A 1 82  ? -26.395 -5.863  101.200  1.00 10.00 ? ? ? ? ? ? 83  GLU A CD  1 
ATOM 612   O OE1 . GLU A 1 82  ? -27.373 -6.328  100.597  1.00 10.00 ? ? ? ? ? ? 83  GLU A OE1 1 
ATOM 613   O OE2 . GLU A 1 82  ? -26.315 -4.682  101.578  1.00 10.00 ? ? ? ? ? ? 83  GLU A OE2 1 
ATOM 614   N N   . LYS A 1 83  ? -23.935 -10.301 98.930   1.00 10.00 ? ? ? ? ? ? 84  LYS A N   1 
ATOM 615   C CA  . LYS A 1 83  ? -24.077 -11.462 98.060   1.00 10.00 ? ? ? ? ? ? 84  LYS A CA  1 
ATOM 616   C C   . LYS A 1 83  ? -23.680 -12.771 98.747   1.00 10.00 ? ? ? ? ? ? 84  LYS A C   1 
ATOM 617   O O   . LYS A 1 83  ? -24.447 -13.753 98.712   1.00 10.00 ? ? ? ? ? ? 84  LYS A O   1 
ATOM 618   C CB  . LYS A 1 83  ? -23.204 -11.409 96.808   1.00 10.00 ? ? ? ? ? ? 84  LYS A CB  1 
ATOM 619   C CG  . LYS A 1 83  ? -23.121 -10.152 95.939   1.00 10.00 ? ? ? ? ? ? 84  LYS A CG  1 
ATOM 620   C CD  . LYS A 1 83  ? -24.459 -9.535  95.505   1.00 10.00 ? ? ? ? ? ? 84  LYS A CD  1 
ATOM 621   C CE  . LYS A 1 83  ? -24.284 -8.636  94.257   1.00 10.00 ? ? ? ? ? ? 84  LYS A CE  1 
ATOM 622   N NZ  . LYS A 1 83  ? -24.012 -9.427  93.063   1.00 10.00 ? ? ? ? ? ? 84  LYS A NZ  1 
ATOM 623   N N   . ILE A 1 84  ? -22.519 -12.804 99.412   1.00 10.00 ? ? ? ? ? ? 85  ILE A N   1 
ATOM 624   C CA  . ILE A 1 84  ? -22.021 -14.033 99.989   1.00 10.00 ? ? ? ? ? ? 85  ILE A CA  1 
ATOM 625   C C   . ILE A 1 84  ? -23.006 -14.593 100.972  1.00 10.00 ? ? ? ? ? ? 85  ILE A C   1 
ATOM 626   O O   . ILE A 1 84  ? -23.364 -15.779 100.900  1.00 10.00 ? ? ? ? ? ? 85  ILE A O   1 
ATOM 627   C CB  . ILE A 1 84  ? -20.643 -13.767 100.652  1.00 10.00 ? ? ? ? ? ? 85  ILE A CB  1 
ATOM 628   C CG1 . ILE A 1 84  ? -19.598 -13.722 99.547   1.00 10.00 ? ? ? ? ? ? 85  ILE A CG1 1 
ATOM 629   C CG2 . ILE A 1 84  ? -20.272 -14.843 101.657  1.00 10.00 ? ? ? ? ? ? 85  ILE A CG2 1 
ATOM 630   C CD1 . ILE A 1 84  ? -18.158 -13.850 100.026  1.00 10.00 ? ? ? ? ? ? 85  ILE A CD1 1 
ATOM 631   N N   . TRP A 1 85  ? -23.514 -13.699 101.824  1.00 10.00 ? ? ? ? ? ? 86  TRP A N   1 
ATOM 632   C CA  . TRP A 1 85  ? -24.454 -14.115 102.856  1.00 10.00 ? ? ? ? ? ? 86  TRP A CA  1 
ATOM 633   C C   . TRP A 1 85  ? -25.712 -14.628 102.191  1.00 10.00 ? ? ? ? ? ? 86  TRP A C   1 
ATOM 634   O O   . TRP A 1 85  ? -26.018 -15.784 102.433  1.00 10.00 ? ? ? ? ? ? 86  TRP A O   1 
ATOM 635   C CB  . TRP A 1 85  ? -24.754 -12.939 103.838  1.00 10.00 ? ? ? ? ? ? 86  TRP A CB  1 
ATOM 636   C CG  . TRP A 1 85  ? -23.631 -12.718 104.854  1.00 10.00 ? ? ? ? ? ? 86  TRP A CG  1 
ATOM 637   C CD1 . TRP A 1 85  ? -22.825 -13.767 105.197  1.00 10.00 ? ? ? ? ? ? 86  TRP A CD1 1 
ATOM 638   C CD2 . TRP A 1 85  ? -23.233 -11.540 105.446  1.00 10.00 ? ? ? ? ? ? 86  TRP A CD2 1 
ATOM 639   N NE1 . TRP A 1 85  ? -21.908 -13.278 105.971  1.00 10.00 ? ? ? ? ? ? 86  TRP A NE1 1 
ATOM 640   C CE2 . TRP A 1 85  ? -22.108 -11.966 106.148  1.00 10.00 ? ? ? ? ? ? 86  TRP A CE2 1 
ATOM 641   C CE3 . TRP A 1 85  ? -23.601 -10.207 105.516  1.00 10.00 ? ? ? ? ? ? 86  TRP A CE3 1 
ATOM 642   C CZ2 . TRP A 1 85  ? -21.317 -11.121 106.917  1.00 10.00 ? ? ? ? ? ? 86  TRP A CZ2 1 
ATOM 643   C CZ3 . TRP A 1 85  ? -22.823 -9.356  106.284  1.00 10.00 ? ? ? ? ? ? 86  TRP A CZ3 1 
ATOM 644   C CH2 . TRP A 1 85  ? -21.690 -9.808  106.975  1.00 10.00 ? ? ? ? ? ? 86  TRP A CH2 1 
ATOM 645   N N   . HIS A 1 86  ? -26.423 -13.907 101.334  1.00 10.00 ? ? ? ? ? ? 87  HIS A N   1 
ATOM 646   C CA  . HIS A 1 86  ? -27.551 -14.431 100.560  1.00 10.00 ? ? ? ? ? ? 87  HIS A CA  1 
ATOM 647   C C   . HIS A 1 86  ? -27.315 -15.842 100.028  1.00 10.00 ? ? ? ? ? ? 87  HIS A C   1 
ATOM 648   O O   . HIS A 1 86  ? -28.178 -16.680 100.187  1.00 10.00 ? ? ? ? ? ? 87  HIS A O   1 
ATOM 649   C CB  . HIS A 1 86  ? -27.807 -13.479 99.390   1.00 10.00 ? ? ? ? ? ? 87  HIS A CB  1 
ATOM 650   C CG  . HIS A 1 86  ? -29.151 -13.623 98.683   1.00 10.00 ? ? ? ? ? ? 87  HIS A CG  1 
ATOM 651   N ND1 . HIS A 1 86  ? -30.217 -12.790 98.681   1.00 10.00 ? ? ? ? ? ? 87  HIS A ND1 1 
ATOM 652   C CD2 . HIS A 1 86  ? -29.469 -14.695 97.873   1.00 10.00 ? ? ? ? ? ? 87  HIS A CD2 1 
ATOM 653   C CE1 . HIS A 1 86  ? -31.150 -13.311 97.908   1.00 10.00 ? ? ? ? ? ? 87  HIS A CE1 1 
ATOM 654   N NE2 . HIS A 1 86  ? -30.672 -14.449 97.440   1.00 10.00 ? ? ? ? ? ? 87  HIS A NE2 1 
ATOM 655   N N   . HIS A 1 87  ? -26.176 -16.131 99.402   1.00 10.00 ? ? ? ? ? ? 88  HIS A N   1 
ATOM 656   C CA  . HIS A 1 87  ? -25.728 -17.461 98.953   1.00 10.00 ? ? ? ? ? ? 88  HIS A CA  1 
ATOM 657   C C   . HIS A 1 87  ? -25.529 -18.458 100.121  1.00 10.00 ? ? ? ? ? ? 88  HIS A C   1 
ATOM 658   O O   . HIS A 1 87  ? -25.843 -19.657 99.977   1.00 10.00 ? ? ? ? ? ? 88  HIS A O   1 
ATOM 659   C CB  . HIS A 1 87  ? -24.387 -17.324 98.156   1.00 10.00 ? ? ? ? ? ? 88  HIS A CB  1 
ATOM 660   C CG  . HIS A 1 87  ? -23.809 -18.646 97.628   1.00 10.00 ? ? ? ? ? ? 88  HIS A CG  1 
ATOM 661   N ND1 . HIS A 1 87  ? -24.276 -19.443 96.668   1.00 10.00 ? ? ? ? ? ? 88  HIS A ND1 1 
ATOM 662   C CD2 . HIS A 1 87  ? -22.746 -19.308 98.186   1.00 10.00 ? ? ? ? ? ? 88  HIS A CD2 1 
ATOM 663   C CE1 . HIS A 1 87  ? -23.573 -20.543 96.643   1.00 10.00 ? ? ? ? ? ? 88  HIS A CE1 1 
ATOM 664   N NE2 . HIS A 1 87  ? -22.657 -20.443 97.564   1.00 10.00 ? ? ? ? ? ? 88  HIS A NE2 1 
ATOM 665   N N   . THR A 1 88  ? -24.934 -18.067 101.245  1.00 10.00 ? ? ? ? ? ? 89  THR A N   1 
ATOM 666   C CA  . THR A 1 88  ? -24.878 -18.899 102.454  1.00 10.00 ? ? ? ? ? ? 89  THR A CA  1 
ATOM 667   C C   . THR A 1 88  ? -26.298 -19.466 102.789  1.00 10.00 ? ? ? ? ? ? 89  THR A C   1 
ATOM 668   O O   . THR A 1 88  ? -26.541 -20.695 102.824  1.00 10.00 ? ? ? ? ? ? 89  THR A O   1 
ATOM 669   C CB  . THR A 1 88  ? -24.384 -18.036 103.671  1.00 10.00 ? ? ? ? ? ? 89  THR A CB  1 
ATOM 670   O OG1 . THR A 1 88  ? -23.172 -17.408 103.268  1.00 10.00 ? ? ? ? ? ? 89  THR A OG1 1 
ATOM 671   C CG2 . THR A 1 88  ? -24.230 -18.834 104.948  1.00 10.00 ? ? ? ? ? ? 89  THR A CG2 1 
ATOM 672   N N   . PHE A 1 89  ? -27.304 -18.583 102.959  1.00 10.00 ? ? ? ? ? ? 90  PHE A N   1 
ATOM 673   C CA  . PHE A 1 89  ? -28.644 -19.011 103.405  1.00 10.00 ? ? ? ? ? ? 90  PHE A CA  1 
ATOM 674   C C   . PHE A 1 89  ? -29.453 -19.690 102.307  1.00 10.00 ? ? ? ? ? ? 90  PHE A C   1 
ATOM 675   O O   . PHE A 1 89  ? -29.795 -20.875 102.369  1.00 10.00 ? ? ? ? ? ? 90  PHE A O   1 
ATOM 676   C CB  . PHE A 1 89  ? -29.445 -17.797 103.957  1.00 10.00 ? ? ? ? ? ? 90  PHE A CB  1 
ATOM 677   C CG  . PHE A 1 89  ? -28.742 -16.953 105.027  1.00 10.00 ? ? ? ? ? ? 90  PHE A CG  1 
ATOM 678   C CD1 . PHE A 1 89  ? -28.334 -17.502 106.228  1.00 10.00 ? ? ? ? ? ? 90  PHE A CD1 1 
ATOM 679   C CD2 . PHE A 1 89  ? -28.535 -15.616 104.804  1.00 10.00 ? ? ? ? ? ? 90  PHE A CD2 1 
ATOM 680   C CE1 . PHE A 1 89  ? -27.724 -16.703 107.186  1.00 10.00 ? ? ? ? ? ? 90  PHE A CE1 1 
ATOM 681   C CE2 . PHE A 1 89  ? -27.930 -14.844 105.753  1.00 10.00 ? ? ? ? ? ? 90  PHE A CE2 1 
ATOM 682   C CZ  . PHE A 1 89  ? -27.521 -15.368 106.949  1.00 10.00 ? ? ? ? ? ? 90  PHE A CZ  1 
ATOM 683   N N   . TYR A 1 90  ? -29.650 -18.947 101.224  1.00 10.00 ? ? ? ? ? ? 91  TYR A N   1 
ATOM 684   C CA  . TYR A 1 90  ? -30.477 -19.375 100.110  1.00 10.00 ? ? ? ? ? ? 91  TYR A CA  1 
ATOM 685   C C   . TYR A 1 90  ? -29.881 -20.376 99.170   1.00 10.00 ? ? ? ? ? ? 91  TYR A C   1 
ATOM 686   O O   . TYR A 1 90  ? -30.611 -20.903 98.349   1.00 10.00 ? ? ? ? ? ? 91  TYR A O   1 
ATOM 687   C CB  . TYR A 1 90  ? -30.894 -18.188 99.279   1.00 10.00 ? ? ? ? ? ? 91  TYR A CB  1 
ATOM 688   C CG  . TYR A 1 90  ? -31.672 -17.174 100.101  1.00 10.00 ? ? ? ? ? ? 91  TYR A CG  1 
ATOM 689   C CD1 . TYR A 1 90  ? -32.994 -17.366 100.448  1.00 10.00 ? ? ? ? ? ? 91  TYR A CD1 1 
ATOM 690   C CD2 . TYR A 1 90  ? -31.018 -16.026 100.459  1.00 10.00 ? ? ? ? ? ? 91  TYR A CD2 1 
ATOM 691   C CE1 . TYR A 1 90  ? -33.638 -16.372 101.149  1.00 10.00 ? ? ? ? ? ? 91  TYR A CE1 1 
ATOM 692   C CE2 . TYR A 1 90  ? -31.640 -15.041 101.162  1.00 10.00 ? ? ? ? ? ? 91  TYR A CE2 1 
ATOM 693   C CZ  . TYR A 1 90  ? -32.947 -15.229 101.495  1.00 10.00 ? ? ? ? ? ? 91  TYR A CZ  1 
ATOM 694   O OH  . TYR A 1 90  ? -33.537 -14.215 102.209  1.00 10.00 ? ? ? ? ? ? 91  TYR A OH  1 
ATOM 695   N N   . ASN A 1 91  ? -28.600 -20.666 99.155   1.00 10.00 ? ? ? ? ? ? 92  ASN A N   1 
ATOM 696   C CA  . ASN A 1 91  ? -28.100 -21.658 98.217   1.00 10.00 ? ? ? ? ? ? 92  ASN A CA  1 
ATOM 697   C C   . ASN A 1 91  ? -27.267 -22.696 98.941   1.00 10.00 ? ? ? ? ? ? 92  ASN A C   1 
ATOM 698   O O   . ASN A 1 91  ? -27.338 -23.859 98.560   1.00 10.00 ? ? ? ? ? ? 92  ASN A O   1 
ATOM 699   C CB  . ASN A 1 91  ? -27.249 -21.002 97.109   1.00 10.00 ? ? ? ? ? ? 92  ASN A CB  1 
ATOM 700   C CG  . ASN A 1 91  ? -27.938 -19.973 96.219   1.00 10.00 ? ? ? ? ? ? 92  ASN A CG  1 
ATOM 701   O OD1 . ASN A 1 91  ? -27.317 -19.071 95.661   1.00 10.00 ? ? ? ? ? ? 92  ASN A OD1 1 
ATOM 702   N ND2 . ASN A 1 91  ? -29.229 -20.000 96.054   1.00 10.00 ? ? ? ? ? ? 92  ASN A ND2 1 
ATOM 703   N N   . GLU A 1 92  ? -26.483 -22.340 99.976   1.00 10.00 ? ? ? ? ? ? 93  GLU A N   1 
ATOM 704   C CA  . GLU A 1 92  ? -25.705 -23.354 100.634  1.00 10.00 ? ? ? ? ? ? 93  GLU A CA  1 
ATOM 705   C C   . GLU A 1 92  ? -26.439 -24.069 101.766  1.00 10.00 ? ? ? ? ? ? 93  GLU A C   1 
ATOM 706   O O   . GLU A 1 92  ? -26.515 -25.301 101.780  1.00 10.00 ? ? ? ? ? ? 93  GLU A O   1 
ATOM 707   C CB  . GLU A 1 92  ? -24.437 -22.710 101.106  1.00 10.00 ? ? ? ? ? ? 93  GLU A CB  1 
ATOM 708   C CG  . GLU A 1 92  ? -23.226 -23.535 100.581  1.00 10.00 ? ? ? ? ? ? 93  GLU A CG  1 
ATOM 709   C CD  . GLU A 1 92  ? -22.862 -23.555 99.076   1.00 10.00 ? ? ? ? ? ? 93  GLU A CD  1 
ATOM 710   O OE1 . GLU A 1 92  ? -23.450 -24.303 98.280   1.00 10.00 ? ? ? ? ? ? 93  GLU A OE1 1 
ATOM 711   O OE2 . GLU A 1 92  ? -21.948 -22.838 98.683   1.00 10.00 ? ? ? ? ? ? 93  GLU A OE2 1 
ATOM 712   N N   . LEU A 1 93  ? -27.025 -23.395 102.742  1.00 10.00 ? ? ? ? ? ? 94  LEU A N   1 
ATOM 713   C CA  . LEU A 1 93  ? -27.643 -24.148 103.807  1.00 10.00 ? ? ? ? ? ? 94  LEU A CA  1 
ATOM 714   C C   . LEU A 1 93  ? -29.103 -24.426 103.501  1.00 10.00 ? ? ? ? ? ? 94  LEU A C   1 
ATOM 715   O O   . LEU A 1 93  ? -29.691 -25.341 104.089  1.00 10.00 ? ? ? ? ? ? 94  LEU A O   1 
ATOM 716   C CB  . LEU A 1 93  ? -27.420 -23.349 105.076  1.00 10.00 ? ? ? ? ? ? 94  LEU A CB  1 
ATOM 717   C CG  . LEU A 1 93  ? -25.965 -23.287 105.555  1.00 10.00 ? ? ? ? ? ? 94  LEU A CG  1 
ATOM 718   C CD1 . LEU A 1 93  ? -25.802 -22.086 106.472  1.00 10.00 ? ? ? ? ? ? 94  LEU A CD1 1 
ATOM 719   C CD2 . LEU A 1 93  ? -25.579 -24.597 106.228  1.00 10.00 ? ? ? ? ? ? 94  LEU A CD2 1 
ATOM 720   N N   . ARG A 1 94  ? -29.666 -23.641 102.544  1.00 10.00 ? ? ? ? ? ? 95  ARG A N   1 
ATOM 721   C CA  . ARG A 1 94  ? -31.052 -23.755 102.006  1.00 10.00 ? ? ? ? ? ? 95  ARG A CA  1 
ATOM 722   C C   . ARG A 1 94  ? -32.100 -23.448 103.121  1.00 10.00 ? ? ? ? ? ? 95  ARG A C   1 
ATOM 723   O O   . ARG A 1 94  ? -33.126 -24.113 103.361  1.00 10.00 ? ? ? ? ? ? 95  ARG A O   1 
ATOM 724   C CB  . ARG A 1 94  ? -31.252 -25.174 101.439  1.00 10.00 ? ? ? ? ? ? 95  ARG A CB  1 
ATOM 725   C CG  . ARG A 1 94  ? -30.209 -25.692 100.396  1.00 10.00 ? ? ? ? ? ? 95  ARG A CG  1 
ATOM 726   C CD  . ARG A 1 94  ? -30.551 -25.276 98.992   1.00 10.00 ? ? ? ? ? ? 95  ARG A CD  1 
ATOM 727   N NE  . ARG A 1 94  ? -31.868 -25.828 98.696   1.00 10.00 ? ? ? ? ? ? 95  ARG A NE  1 
ATOM 728   C CZ  . ARG A 1 94  ? -32.694 -25.215 97.842   1.00 10.00 ? ? ? ? ? ? 95  ARG A CZ  1 
ATOM 729   N NH1 . ARG A 1 94  ? -32.328 -24.077 97.203   1.00 10.00 ? ? ? ? ? ? 95  ARG A NH1 1 
ATOM 730   N NH2 . ARG A 1 94  ? -33.934 -25.701 97.713   1.00 10.00 ? ? ? ? ? ? 95  ARG A NH2 1 
ATOM 731   N N   . VAL A 1 95  ? -31.807 -22.291 103.728  1.00 10.00 ? ? ? ? ? ? 96  VAL A N   1 
ATOM 732   C CA  . VAL A 1 95  ? -32.407 -21.807 104.936  1.00 10.00 ? ? ? ? ? ? 96  VAL A CA  1 
ATOM 733   C C   . VAL A 1 95  ? -33.110 -20.460 104.681  1.00 10.00 ? ? ? ? ? ? 96  VAL A C   1 
ATOM 734   O O   . VAL A 1 95  ? -32.941 -19.756 103.667  1.00 10.00 ? ? ? ? ? ? 96  VAL A O   1 
ATOM 735   C CB  . VAL A 1 95  ? -31.207 -21.762 105.981  1.00 10.00 ? ? ? ? ? ? 96  VAL A CB  1 
ATOM 736   C CG1 . VAL A 1 95  ? -30.855 -20.362 106.498  1.00 10.00 ? ? ? ? ? ? 96  VAL A CG1 1 
ATOM 737   C CG2 . VAL A 1 95  ? -31.590 -22.742 107.082  1.00 10.00 ? ? ? ? ? ? 96  VAL A CG2 1 
ATOM 738   N N   . ALA A 1 96  ? -33.918 -20.112 105.674  1.00 10.00 ? ? ? ? ? ? 97  ALA A N   1 
ATOM 739   C CA  . ALA A 1 96  ? -34.662 -18.899 105.626  1.00 10.00 ? ? ? ? ? ? 97  ALA A CA  1 
ATOM 740   C C   . ALA A 1 96  ? -34.143 -18.076 106.766  1.00 10.00 ? ? ? ? ? ? 97  ALA A C   1 
ATOM 741   O O   . ALA A 1 96  ? -34.104 -18.546 107.896  1.00 10.00 ? ? ? ? ? ? 97  ALA A O   1 
ATOM 742   C CB  . ALA A 1 96  ? -36.109 -19.239 105.814  1.00 10.00 ? ? ? ? ? ? 97  ALA A CB  1 
ATOM 743   N N   . PRO A 1 97  ? -33.680 -16.876 106.502  1.00 10.00 ? ? ? ? ? ? 98  PRO A N   1 
ATOM 744   C CA  . PRO A 1 97  ? -33.069 -16.034 107.503  1.00 10.00 ? ? ? ? ? ? 98  PRO A CA  1 
ATOM 745   C C   . PRO A 1 97  ? -33.999 -15.611 108.607  1.00 10.00 ? ? ? ? ? ? 98  PRO A C   1 
ATOM 746   O O   . PRO A 1 97  ? -33.555 -15.620 109.759  1.00 10.00 ? ? ? ? ? ? 98  PRO A O   1 
ATOM 747   C CB  . PRO A 1 97  ? -32.489 -14.863 106.733  1.00 10.00 ? ? ? ? ? ? 98  PRO A CB  1 
ATOM 748   C CG  . PRO A 1 97  ? -32.098 -15.542 105.431  1.00 10.00 ? ? ? ? ? ? 98  PRO A CG  1 
ATOM 749   C CD  . PRO A 1 97  ? -33.313 -16.406 105.173  1.00 10.00 ? ? ? ? ? ? 98  PRO A CD  1 
ATOM 750   N N   . GLU A 1 98  ? -35.304 -15.422 108.329  1.00 10.00 ? ? ? ? ? ? 99  GLU A N   1 
ATOM 751   C CA  . GLU A 1 98  ? -36.272 -14.917 109.325  1.00 10.00 ? ? ? ? ? ? 99  GLU A CA  1 
ATOM 752   C C   . GLU A 1 98  ? -36.856 -15.817 110.419  1.00 10.00 ? ? ? ? ? ? 99  GLU A C   1 
ATOM 753   O O   . GLU A 1 98  ? -37.742 -15.433 111.199  1.00 10.00 ? ? ? ? ? ? 99  GLU A O   1 
ATOM 754   C CB  . GLU A 1 98  ? -37.445 -14.288 108.608  1.00 10.00 ? ? ? ? ? ? 99  GLU A CB  1 
ATOM 755   C CG  . GLU A 1 98  ? -38.115 -15.093 107.543  1.00 10.00 ? ? ? ? ? ? 99  GLU A CG  1 
ATOM 756   C CD  . GLU A 1 98  ? -37.557 -14.878 106.156  1.00 10.00 ? ? ? ? ? ? 99  GLU A CD  1 
ATOM 757   O OE1 . GLU A 1 98  ? -36.518 -14.235 105.977  1.00 10.00 ? ? ? ? ? ? 99  GLU A OE1 1 
ATOM 758   O OE2 . GLU A 1 98  ? -38.187 -15.362 105.218  1.00 10.00 ? ? ? ? ? ? 99  GLU A OE2 1 
ATOM 759   N N   . GLU A 1 99  ? -36.253 -17.001 110.496  1.00 10.00 ? ? ? ? ? ? 100 GLU A N   1 
ATOM 760   C CA  . GLU A 1 99  ? -36.633 -18.076 111.390  1.00 10.00 ? ? ? ? ? ? 100 GLU A CA  1 
ATOM 761   C C   . GLU A 1 99  ? -35.450 -18.583 112.242  1.00 10.00 ? ? ? ? ? ? 100 GLU A C   1 
ATOM 762   O O   . GLU A 1 99  ? -35.611 -19.501 113.059  1.00 10.00 ? ? ? ? ? ? 100 GLU A O   1 
ATOM 763   C CB  . GLU A 1 99  ? -37.157 -19.202 110.525  1.00 10.00 ? ? ? ? ? ? 100 GLU A CB  1 
ATOM 764   C CG  . GLU A 1 99  ? -38.333 -18.863 109.655  1.00 10.00 ? ? ? ? ? ? 100 GLU A CG  1 
ATOM 765   C CD  . GLU A 1 99  ? -38.647 -19.813 108.508  1.00 10.00 ? ? ? ? ? ? 100 GLU A CD  1 
ATOM 766   O OE1 . GLU A 1 99  ? -38.575 -21.045 108.657  1.00 10.00 ? ? ? ? ? ? 100 GLU A OE1 1 
ATOM 767   O OE2 . GLU A 1 99  ? -38.999 -19.293 107.439  1.00 10.00 ? ? ? ? ? ? 100 GLU A OE2 1 
ATOM 768   N N   . HIS A 1 100 ? -34.205 -18.103 112.029  1.00 10.00 ? ? ? ? ? ? 101 HIS A N   1 
ATOM 769   C CA  . HIS A 1 100 ? -32.999 -18.620 112.699  1.00 10.00 ? ? ? ? ? ? 101 HIS A CA  1 
ATOM 770   C C   . HIS A 1 100 ? -32.223 -17.430 113.192  1.00 10.00 ? ? ? ? ? ? 101 HIS A C   1 
ATOM 771   O O   . HIS A 1 100 ? -32.120 -16.401 112.516  1.00 10.00 ? ? ? ? ? ? 101 HIS A O   1 
ATOM 772   C CB  . HIS A 1 100 ? -32.066 -19.389 111.771  1.00 10.00 ? ? ? ? ? ? 101 HIS A CB  1 
ATOM 773   C CG  . HIS A 1 100 ? -32.694 -20.668 111.243  1.00 10.00 ? ? ? ? ? ? 101 HIS A CG  1 
ATOM 774   N ND1 . HIS A 1 100 ? -32.585 -21.892 111.754  1.00 10.00 ? ? ? ? ? ? 101 HIS A ND1 1 
ATOM 775   C CD2 . HIS A 1 100 ? -33.564 -20.741 110.173  1.00 10.00 ? ? ? ? ? ? 101 HIS A CD2 1 
ATOM 776   C CE1 . HIS A 1 100 ? -33.372 -22.700 111.055  1.00 10.00 ? ? ? ? ? ? 101 HIS A CE1 1 
ATOM 777   N NE2 . HIS A 1 100 ? -33.961 -22.001 110.108  1.00 10.00 ? ? ? ? ? ? 101 HIS A NE2 1 
ATOM 778   N N   . PRO A 1 101 ? -31.761 -17.459 114.427  1.00 10.00 ? ? ? ? ? ? 102 PRO A N   1 
ATOM 779   C CA  . PRO A 1 101 ? -30.807 -16.480 114.845  1.00 10.00 ? ? ? ? ? ? 102 PRO A CA  1 
ATOM 780   C C   . PRO A 1 101 ? -29.454 -16.771 114.198  1.00 10.00 ? ? ? ? ? ? 102 PRO A C   1 
ATOM 781   O O   . PRO A 1 101 ? -29.155 -17.931 113.878  1.00 10.00 ? ? ? ? ? ? 102 PRO A O   1 
ATOM 782   C CB  . PRO A 1 101 ? -30.933 -16.593 116.378  1.00 10.00 ? ? ? ? ? ? 102 PRO A CB  1 
ATOM 783   C CG  . PRO A 1 101 ? -31.374 -17.990 116.635  1.00 10.00 ? ? ? ? ? ? 102 PRO A CG  1 
ATOM 784   C CD  . PRO A 1 101 ? -32.404 -18.107 115.561  1.00 10.00 ? ? ? ? ? ? 102 PRO A CD  1 
ATOM 785   N N   . VAL A 1 102 ? -28.650 -15.752 113.916  1.00 10.00 ? ? ? ? ? ? 103 VAL A N   1 
ATOM 786   C CA  . VAL A 1 102 ? -27.319 -16.015 113.395  1.00 10.00 ? ? ? ? ? ? 103 VAL A CA  1 
ATOM 787   C C   . VAL A 1 102 ? -26.165 -15.582 114.307  1.00 10.00 ? ? ? ? ? ? 103 VAL A C   1 
ATOM 788   O O   . VAL A 1 102 ? -26.223 -14.549 115.010  1.00 10.00 ? ? ? ? ? ? 103 VAL A O   1 
ATOM 789   C CB  . VAL A 1 102 ? -27.136 -15.342 112.062  1.00 10.00 ? ? ? ? ? ? 103 VAL A CB  1 
ATOM 790   C CG1 . VAL A 1 102 ? -28.156 -15.937 111.100  1.00 10.00 ? ? ? ? ? ? 103 VAL A CG1 1 
ATOM 791   C CG2 . VAL A 1 102 ? -27.293 -13.840 112.188  1.00 10.00 ? ? ? ? ? ? 103 VAL A CG2 1 
ATOM 792   N N   . LEU A 1 103 ? -25.120 -16.408 114.433  1.00 10.00 ? ? ? ? ? ? 104 LEU A N   1 
ATOM 793   C CA  . LEU A 1 103 ? -23.982 -15.917 115.148  1.00 10.00 ? ? ? ? ? ? 104 LEU A CA  1 
ATOM 794   C C   . LEU A 1 103 ? -23.036 -15.605 114.006  1.00 10.00 ? ? ? ? ? ? 104 LEU A C   1 
ATOM 795   O O   . LEU A 1 103 ? -22.715 -16.495 113.213  1.00 10.00 ? ? ? ? ? ? 104 LEU A O   1 
ATOM 796   C CB  . LEU A 1 103 ? -23.422 -16.987 116.092  1.00 10.00 ? ? ? ? ? ? 104 LEU A CB  1 
ATOM 797   C CG  . LEU A 1 103 ? -22.178 -16.537 116.961  1.00 10.00 ? ? ? ? ? ? 104 LEU A CG  1 
ATOM 798   C CD1 . LEU A 1 103 ? -22.419 -16.832 118.440  1.00 10.00 ? ? ? ? ? ? 104 LEU A CD1 1 
ATOM 799   C CD2 . LEU A 1 103 ? -20.911 -17.236 116.455  1.00 10.00 ? ? ? ? ? ? 104 LEU A CD2 1 
ATOM 800   N N   . LEU A 1 104 ? -22.593 -14.383 113.780  1.00 10.00 ? ? ? ? ? ? 105 LEU A N   1 
ATOM 801   C CA  . LEU A 1 104 ? -21.680 -14.101 112.666  1.00 10.00 ? ? ? ? ? ? 105 LEU A CA  1 
ATOM 802   C C   . LEU A 1 104 ? -20.314 -13.974 113.283  1.00 10.00 ? ? ? ? ? ? 105 LEU A C   1 
ATOM 803   O O   . LEU A 1 104 ? -20.291 -13.381 114.358  1.00 10.00 ? ? ? ? ? ? 105 LEU A O   1 
ATOM 804   C CB  . LEU A 1 104 ? -21.941 -12.777 112.005  1.00 10.00 ? ? ? ? ? ? 105 LEU A CB  1 
ATOM 805   C CG  . LEU A 1 104 ? -23.230 -12.460 111.383  1.00 10.00 ? ? ? ? ? ? 105 LEU A CG  1 
ATOM 806   C CD1 . LEU A 1 104 ? -23.114 -11.041 110.966  1.00 10.00 ? ? ? ? ? ? 105 LEU A CD1 1 
ATOM 807   C CD2 . LEU A 1 104 ? -23.494 -13.248 110.133  1.00 10.00 ? ? ? ? ? ? 105 LEU A CD2 1 
ATOM 808   N N   . THR A 1 105 ? -19.174 -14.453 112.827  1.00 10.00 ? ? ? ? ? ? 106 THR A N   1 
ATOM 809   C CA  . THR A 1 105 ? -17.996 -14.056 113.581  1.00 10.00 ? ? ? ? ? ? 106 THR A CA  1 
ATOM 810   C C   . THR A 1 105 ? -17.360 -12.804 113.027  1.00 10.00 ? ? ? ? ? ? 106 THR A C   1 
ATOM 811   O O   . THR A 1 105 ? -17.686 -12.350 111.931  1.00 10.00 ? ? ? ? ? ? 106 THR A O   1 
ATOM 812   C CB  . THR A 1 105 ? -17.017 -15.198 113.618  1.00 10.00 ? ? ? ? ? ? 106 THR A CB  1 
ATOM 813   O OG1 . THR A 1 105 ? -16.745 -15.553 112.265  1.00 10.00 ? ? ? ? ? ? 106 THR A OG1 1 
ATOM 814   C CG2 . THR A 1 105 ? -17.548 -16.381 114.379  1.00 10.00 ? ? ? ? ? ? 106 THR A CG2 1 
ATOM 815   N N   . GLU A 1 106 ? -16.424 -12.222 113.739  1.00 10.00 ? ? ? ? ? ? 107 GLU A N   1 
ATOM 816   C CA  . GLU A 1 106 ? -15.766 -11.010 113.294  1.00 10.00 ? ? ? ? ? ? 107 GLU A CA  1 
ATOM 817   C C   . GLU A 1 106 ? -14.277 -10.935 113.683  1.00 10.00 ? ? ? ? ? ? 107 GLU A C   1 
ATOM 818   O O   . GLU A 1 106 ? -13.816 -11.692 114.535  1.00 10.00 ? ? ? ? ? ? 107 GLU A O   1 
ATOM 819   C CB  . GLU A 1 106 ? -16.495 -9.824  113.879  1.00 10.00 ? ? ? ? ? ? 107 GLU A CB  1 
ATOM 820   C CG  . GLU A 1 106 ? -16.529 -9.864  115.423  1.00 10.00 ? ? ? ? ? ? 107 GLU A CG  1 
ATOM 821   C CD  . GLU A 1 106 ? -16.564 -8.516  116.099  1.00 10.00 ? ? ? ? ? ? 107 GLU A CD  1 
ATOM 822   O OE1 . GLU A 1 106 ? -16.686 -7.497  115.445  1.00 10.00 ? ? ? ? ? ? 107 GLU A OE1 1 
ATOM 823   O OE2 . GLU A 1 106 ? -16.440 -8.484  117.303  1.00 10.00 ? ? ? ? ? ? 107 GLU A OE2 1 
ATOM 824   N N   . ALA A 1 107 ? -13.474 -10.143 112.994  1.00 10.00 ? ? ? ? ? ? 108 ALA A N   1 
ATOM 825   C CA  . ALA A 1 107 ? -12.082 -9.933  113.308  1.00 10.00 ? ? ? ? ? ? 108 ALA A CA  1 
ATOM 826   C C   . ALA A 1 107 ? -11.880 -9.326  114.677  1.00 10.00 ? ? ? ? ? ? 108 ALA A C   1 
ATOM 827   O O   . ALA A 1 107 ? -12.652 -8.445  115.059  1.00 10.00 ? ? ? ? ? ? 108 ALA A O   1 
ATOM 828   C CB  . ALA A 1 107 ? -11.445 -8.982  112.312  1.00 10.00 ? ? ? ? ? ? 108 ALA A CB  1 
ATOM 829   N N   . PRO A 1 108 ? -10.868 -9.733  115.456  1.00 10.00 ? ? ? ? ? ? 109 PRO A N   1 
ATOM 830   C CA  . PRO A 1 108 ? -10.328 -8.962  116.582  1.00 10.00 ? ? ? ? ? ? 109 PRO A CA  1 
ATOM 831   C C   . PRO A 1 108 ? -10.053 -7.551  116.104  1.00 10.00 ? ? ? ? ? ? 109 PRO A C   1 
ATOM 832   O O   . PRO A 1 108 ? -9.410  -7.364  115.048  1.00 10.00 ? ? ? ? ? ? 109 PRO A O   1 
ATOM 833   C CB  . PRO A 1 108 ? -9.054  -9.644  116.970  1.00 10.00 ? ? ? ? ? ? 109 PRO A CB  1 
ATOM 834   C CG  . PRO A 1 108 ? -9.186  -11.036 116.393  1.00 10.00 ? ? ? ? ? ? 109 PRO A CG  1 
ATOM 835   C CD  . PRO A 1 108 ? -10.033 -10.900 115.152  1.00 10.00 ? ? ? ? ? ? 109 PRO A CD  1 
ATOM 836   N N   . LEU A 1 109 ? -10.410 -6.579  116.922  1.00 10.00 ? ? ? ? ? ? 110 LEU A N   1 
ATOM 837   C CA  . LEU A 1 109 ? -10.263 -5.168  116.580  1.00 10.00 ? ? ? ? ? ? 110 LEU A CA  1 
ATOM 838   C C   . LEU A 1 109 ? -11.050 -4.709  115.306  1.00 10.00 ? ? ? ? ? ? 110 LEU A C   1 
ATOM 839   O O   . LEU A 1 109 ? -10.682 -3.738  114.623  1.00 10.00 ? ? ? ? ? ? 110 LEU A O   1 
ATOM 840   C CB  . LEU A 1 109 ? -8.761  -4.841  116.422  1.00 10.00 ? ? ? ? ? ? 110 LEU A CB  1 
ATOM 841   C CG  . LEU A 1 109 ? -7.732  -4.659  117.550  1.00 10.00 ? ? ? ? ? ? 110 LEU A CG  1 
ATOM 842   C CD1 . LEU A 1 109 ? -6.382  -4.991  116.950  1.00 10.00 ? ? ? ? ? ? 110 LEU A CD1 1 
ATOM 843   C CD2 . LEU A 1 109 ? -7.612  -3.237  118.061  1.00 10.00 ? ? ? ? ? ? 110 LEU A CD2 1 
ATOM 844   N N   . ASN A 1 110 ? -12.186 -5.349  114.947  1.00 10.00 ? ? ? ? ? ? 111 ASN A N   1 
ATOM 845   C CA  . ASN A 1 110 ? -12.989 -4.978  113.761  1.00 10.00 ? ? ? ? ? ? 111 ASN A CA  1 
ATOM 846   C C   . ASN A 1 110 ? -13.517 -3.550  113.898  1.00 10.00 ? ? ? ? ? ? 111 ASN A C   1 
ATOM 847   O O   . ASN A 1 110 ? -14.069 -3.221  114.969  1.00 10.00 ? ? ? ? ? ? 111 ASN A O   1 
ATOM 848   C CB  . ASN A 1 110 ? -14.130 -5.953  113.649  1.00 10.00 ? ? ? ? ? ? 111 ASN A CB  1 
ATOM 849   C CG  . ASN A 1 110 ? -15.117 -5.759  112.517  1.00 10.00 ? ? ? ? ? ? 111 ASN A CG  1 
ATOM 850   O OD1 . ASN A 1 110 ? -14.846 -5.266  111.436  1.00 10.00 ? ? ? ? ? ? 111 ASN A OD1 1 
ATOM 851   N ND2 . ASN A 1 110 ? -16.329 -6.246  112.645  1.00 10.00 ? ? ? ? ? ? 111 ASN A ND2 1 
ATOM 852   N N   . PRO A 1 111 ? -13.335 -2.638  112.941  1.00 10.00 ? ? ? ? ? ? 112 PRO A N   1 
ATOM 853   C CA  . PRO A 1 111 ? -13.821 -1.276  113.043  1.00 10.00 ? ? ? ? ? ? 112 PRO A CA  1 
ATOM 854   C C   . PRO A 1 111 ? -15.272 -1.108  113.493  1.00 10.00 ? ? ? ? ? ? 112 PRO A C   1 
ATOM 855   O O   . PRO A 1 111 ? -16.129 -1.905  113.148  1.00 10.00 ? ? ? ? ? ? 112 PRO A O   1 
ATOM 856   C CB  . PRO A 1 111 ? -13.518 -0.736  111.671  1.00 10.00 ? ? ? ? ? ? 112 PRO A CB  1 
ATOM 857   C CG  . PRO A 1 111 ? -12.224 -1.453  111.325  1.00 10.00 ? ? ? ? ? ? 112 PRO A CG  1 
ATOM 858   C CD  . PRO A 1 111 ? -12.565 -2.854  111.725  1.00 10.00 ? ? ? ? ? ? 112 PRO A CD  1 
ATOM 859   N N   . LYS A 1 112 ? -15.577 -0.109  114.317  1.00 10.00 ? ? ? ? ? ? 113 LYS A N   1 
ATOM 860   C CA  . LYS A 1 112 ? -16.900 0.262   114.822  1.00 10.00 ? ? ? ? ? ? 113 LYS A CA  1 
ATOM 861   C C   . LYS A 1 112 ? -18.027 0.185   113.832  1.00 10.00 ? ? ? ? ? ? 113 LYS A C   1 
ATOM 862   O O   . LYS A 1 112 ? -19.029 -0.477  114.081  1.00 10.00 ? ? ? ? ? ? 113 LYS A O   1 
ATOM 863   C CB  . LYS A 1 112 ? -17.009 1.694   115.292  1.00 10.00 ? ? ? ? ? ? 113 LYS A CB  1 
ATOM 864   C CG  . LYS A 1 112 ? -16.151 2.148   116.417  1.00 10.00 ? ? ? ? ? ? 113 LYS A CG  1 
ATOM 865   C CD  . LYS A 1 112 ? -16.750 1.687   117.720  1.00 10.00 ? ? ? ? ? ? 113 LYS A CD  1 
ATOM 866   C CE  . LYS A 1 112 ? -16.550 2.879   118.641  1.00 10.00 ? ? ? ? ? ? 113 LYS A CE  1 
ATOM 867   N NZ  . LYS A 1 112 ? -15.156 3.172   118.971  1.00 10.00 ? ? ? ? ? ? 113 LYS A NZ  1 
ATOM 868   N N   . ALA A 1 113 ? -17.880 0.911   112.734  1.00 10.00 ? ? ? ? ? ? 114 ALA A N   1 
ATOM 869   C CA  . ALA A 1 113 ? -18.898 1.026   111.721  1.00 10.00 ? ? ? ? ? ? 114 ALA A CA  1 
ATOM 870   C C   . ALA A 1 113 ? -19.123 -0.270  110.970  1.00 10.00 ? ? ? ? ? ? 114 ALA A C   1 
ATOM 871   O O   . ALA A 1 113 ? -20.174 -0.461  110.372  1.00 10.00 ? ? ? ? ? ? 114 ALA A O   1 
ATOM 872   C CB  . ALA A 1 113 ? -18.475 2.118   110.779  1.00 10.00 ? ? ? ? ? ? 114 ALA A CB  1 
ATOM 873   N N   . ASN A 1 114 ? -18.158 -1.173  111.004  1.00 10.00 ? ? ? ? ? ? 115 ASN A N   1 
ATOM 874   C CA  . ASN A 1 114 ? -18.310 -2.470  110.397  1.00 10.00 ? ? ? ? ? ? 115 ASN A CA  1 
ATOM 875   C C   . ASN A 1 114 ? -19.229 -3.265  111.218  1.00 10.00 ? ? ? ? ? ? 115 ASN A C   1 
ATOM 876   O O   . ASN A 1 114 ? -20.135 -3.827  110.638  1.00 10.00 ? ? ? ? ? ? 115 ASN A O   1 
ATOM 877   C CB  . ASN A 1 114 ? -17.025 -3.270  110.301  1.00 10.00 ? ? ? ? ? ? 115 ASN A CB  1 
ATOM 878   C CG  . ASN A 1 114 ? -16.093 -2.512  109.367  1.00 10.00 ? ? ? ? ? ? 115 ASN A CG  1 
ATOM 879   O OD1 . ASN A 1 114 ? -15.895 -1.318  109.573  1.00 10.00 ? ? ? ? ? ? 115 ASN A OD1 1 
ATOM 880   N ND2 . ASN A 1 114 ? -15.464 -2.998  108.317  1.00 10.00 ? ? ? ? ? ? 115 ASN A ND2 1 
ATOM 881   N N   . ARG A 1 115 ? -19.053 -3.293  112.537  1.00 10.00 ? ? ? ? ? ? 116 ARG A N   1 
ATOM 882   C CA  . ARG A 1 115 ? -19.910 -4.051  113.454  1.00 10.00 ? ? ? ? ? ? 116 ARG A CA  1 
ATOM 883   C C   . ARG A 1 115 ? -21.340 -3.602  113.282  1.00 10.00 ? ? ? ? ? ? 116 ARG A C   1 
ATOM 884   O O   . ARG A 1 115 ? -22.265 -4.395  113.134  1.00 10.00 ? ? ? ? ? ? 116 ARG A O   1 
ATOM 885   C CB  . ARG A 1 115 ? -19.464 -3.790  114.843  1.00 10.00 ? ? ? ? ? ? 116 ARG A CB  1 
ATOM 886   C CG  . ARG A 1 115 ? -18.179 -4.504  115.099  1.00 10.00 ? ? ? ? ? ? 116 ARG A CG  1 
ATOM 887   C CD  . ARG A 1 115 ? -17.460 -4.164  116.413  1.00 10.00 ? ? ? ? ? ? 116 ARG A CD  1 
ATOM 888   N NE  . ARG A 1 115 ? -18.104 -4.208  117.739  1.00 10.00 ? ? ? ? ? ? 116 ARG A NE  1 
ATOM 889   C CZ  . ARG A 1 115 ? -18.560 -5.268  118.415  1.00 10.00 ? ? ? ? ? ? 116 ARG A CZ  1 
ATOM 890   N NH1 . ARG A 1 115 ? -18.538 -6.513  117.970  1.00 10.00 ? ? ? ? ? ? 116 ARG A NH1 1 
ATOM 891   N NH2 . ARG A 1 115 ? -18.918 -5.088  119.685  1.00 10.00 ? ? ? ? ? ? 116 ARG A NH2 1 
ATOM 892   N N   . GLU A 1 116 ? -21.534 -2.296  113.186  1.00 10.00 ? ? ? ? ? ? 117 GLU A N   1 
ATOM 893   C CA  . GLU A 1 116 ? -22.849 -1.716  112.951  1.00 10.00 ? ? ? ? ? ? 117 GLU A CA  1 
ATOM 894   C C   . GLU A 1 116 ? -23.280 -2.078  111.565  1.00 10.00 ? ? ? ? ? ? 117 GLU A C   1 
ATOM 895   O O   . GLU A 1 116 ? -24.400 -2.572  111.507  1.00 10.00 ? ? ? ? ? ? 117 GLU A O   1 
ATOM 896   C CB  . GLU A 1 116 ? -22.901 -0.190  113.004  1.00 10.00 ? ? ? ? ? ? 117 GLU A CB  1 
ATOM 897   C CG  . GLU A 1 116 ? -22.272 0.426   114.236  1.00 10.00 ? ? ? ? ? ? 117 GLU A CG  1 
ATOM 898   C CD  . GLU A 1 116 ? -22.575 1.865   114.523  1.00 10.00 ? ? ? ? ? ? 117 GLU A CD  1 
ATOM 899   O OE1 . GLU A 1 116 ? -23.434 2.458   113.874  1.00 10.00 ? ? ? ? ? ? 117 GLU A OE1 1 
ATOM 900   O OE2 . GLU A 1 116 ? -21.955 2.375   115.448  1.00 10.00 ? ? ? ? ? ? 117 GLU A OE2 1 
ATOM 901   N N   . LYS A 1 117 ? -22.524 -1.968  110.464  1.00 10.00 ? ? ? ? ? ? 118 LYS A N   1 
ATOM 902   C CA  . LYS A 1 117 ? -23.122 -2.343  109.202  1.00 10.00 ? ? ? ? ? ? 118 LYS A CA  1 
ATOM 903   C C   . LYS A 1 117 ? -23.500 -3.798  109.173  1.00 10.00 ? ? ? ? ? ? 118 LYS A C   1 
ATOM 904   O O   . LYS A 1 117 ? -24.551 -4.080  108.602  1.00 10.00 ? ? ? ? ? ? 118 LYS A O   1 
ATOM 905   C CB  . LYS A 1 117 ? -22.221 -2.086  108.025  1.00 10.00 ? ? ? ? ? ? 118 LYS A CB  1 
ATOM 906   C CG  . LYS A 1 117 ? -23.092 -2.017  106.773  1.00 10.00 ? ? ? ? ? ? 118 LYS A CG  1 
ATOM 907   C CD  . LYS A 1 117 ? -22.597 -0.867  105.905  1.00 10.00 ? ? ? ? ? ? 118 LYS A CD  1 
ATOM 908   C CE  . LYS A 1 117 ? -23.361 -0.713  104.586  1.00 10.00 ? ? ? ? ? ? 118 LYS A CE  1 
ATOM 909   N NZ  . LYS A 1 117 ? -23.521 -1.959  103.842  1.00 10.00 ? ? ? ? ? ? 118 LYS A NZ  1 
ATOM 910   N N   . MET A 1 118 ? -22.806 -4.736  109.810  1.00 10.00 ? ? ? ? ? ? 119 MET A N   1 
ATOM 911   C CA  . MET A 1 118 ? -23.283 -6.090  109.740  1.00 10.00 ? ? ? ? ? ? 119 MET A CA  1 
ATOM 912   C C   . MET A 1 118 ? -24.466 -6.305  110.652  1.00 10.00 ? ? ? ? ? ? 119 MET A C   1 
ATOM 913   O O   . MET A 1 118 ? -25.218 -7.235  110.349  1.00 10.00 ? ? ? ? ? ? 119 MET A O   1 
ATOM 914   C CB  . MET A 1 118 ? -22.183 -7.043  110.068  1.00 10.00 ? ? ? ? ? ? 119 MET A CB  1 
ATOM 915   C CG  . MET A 1 118 ? -21.863 -7.425  111.477  1.00 10.00 ? ? ? ? ? ? 119 MET A CG  1 
ATOM 916   S SD  . MET A 1 118 ? -20.573 -8.710  111.386  1.00 10.00 ? ? ? ? ? ? 119 MET A SD  1 
ATOM 917   C CE  . MET A 1 118 ? -19.275 -7.511  111.310  1.00 10.00 ? ? ? ? ? ? 119 MET A CE  1 
ATOM 918   N N   . THR A 1 119 ? -24.700 -5.497  111.716  1.00 10.00 ? ? ? ? ? ? 120 THR A N   1 
ATOM 919   C CA  . THR A 1 119 ? -25.955 -5.534  112.490  1.00 10.00 ? ? ? ? ? ? 120 THR A CA  1 
ATOM 920   C C   . THR A 1 119 ? -27.174 -5.046  111.663  1.00 10.00 ? ? ? ? ? ? 120 THR A C   1 
ATOM 921   O O   . THR A 1 119 ? -28.256 -5.658  111.583  1.00 10.00 ? ? ? ? ? ? 120 THR A O   1 
ATOM 922   C CB  . THR A 1 119 ? -25.844 -4.649  113.723  1.00 10.00 ? ? ? ? ? ? 120 THR A CB  1 
ATOM 923   O OG1 . THR A 1 119 ? -24.706 -5.089  114.454  1.00 10.00 ? ? ? ? ? ? 120 THR A OG1 1 
ATOM 924   C CG2 . THR A 1 119 ? -27.094 -4.743  114.592  1.00 10.00 ? ? ? ? ? ? 120 THR A CG2 1 
ATOM 925   N N   . GLN A 1 120 ? -26.934 -3.903  111.040  1.00 10.00 ? ? ? ? ? ? 121 GLN A N   1 
ATOM 926   C CA  . GLN A 1 120 ? -27.761 -3.256  110.050  1.00 10.00 ? ? ? ? ? ? 121 GLN A CA  1 
ATOM 927   C C   . GLN A 1 120 ? -28.278 -4.228  109.013  1.00 10.00 ? ? ? ? ? ? 121 GLN A C   1 
ATOM 928   O O   . GLN A 1 120 ? -29.488 -4.483  109.073  1.00 10.00 ? ? ? ? ? ? 121 GLN A O   1 
ATOM 929   C CB  . GLN A 1 120 ? -26.908 -2.208  109.398  1.00 10.00 ? ? ? ? ? ? 121 GLN A CB  1 
ATOM 930   C CG  . GLN A 1 120 ? -27.485 -1.303  108.378  1.00 10.00 ? ? ? ? ? ? 121 GLN A CG  1 
ATOM 931   C CD  . GLN A 1 120 ? -27.713 -0.023  109.114  1.00 10.00 ? ? ? ? ? ? 121 GLN A CD  1 
ATOM 932   O OE1 . GLN A 1 120 ? -26.831 0.655   109.675  1.00 10.00 ? ? ? ? ? ? 121 GLN A OE1 1 
ATOM 933   N NE2 . GLN A 1 120 ? -29.013 0.220   109.109  1.00 10.00 ? ? ? ? ? ? 121 GLN A NE2 1 
ATOM 934   N N   . ILE A 1 121 ? -27.411 -4.764  108.100  1.00 10.00 ? ? ? ? ? ? 122 ILE A N   1 
ATOM 935   C CA  . ILE A 1 121 ? -27.762 -5.717  107.025  1.00 10.00 ? ? ? ? ? ? 122 ILE A CA  1 
ATOM 936   C C   . ILE A 1 121 ? -28.568 -6.925  107.527  1.00 10.00 ? ? ? ? ? ? 122 ILE A C   1 
ATOM 937   O O   . ILE A 1 121 ? -29.689 -7.256  107.068  1.00 10.00 ? ? ? ? ? ? 122 ILE A O   1 
ATOM 938   C CB  . ILE A 1 121 ? -26.437 -6.231  106.286  1.00 10.00 ? ? ? ? ? ? 122 ILE A CB  1 
ATOM 939   C CG1 . ILE A 1 121 ? -25.970 -5.099  105.397  1.00 10.00 ? ? ? ? ? ? 122 ILE A CG1 1 
ATOM 940   C CG2 . ILE A 1 121 ? -26.620 -7.510  105.417  1.00 10.00 ? ? ? ? ? ? 122 ILE A CG2 1 
ATOM 941   C CD1 . ILE A 1 121 ? -24.501 -5.237  105.052  1.00 10.00 ? ? ? ? ? ? 122 ILE A CD1 1 
ATOM 942   N N   . MET A 1 122 ? -27.968 -7.572  108.530  1.00 10.00 ? ? ? ? ? ? 123 MET A N   1 
ATOM 943   C CA  . MET A 1 122 ? -28.564 -8.758  109.080  1.00 10.00 ? ? ? ? ? ? 123 MET A CA  1 
ATOM 944   C C   . MET A 1 122 ? -29.952 -8.443  109.498  1.00 10.00 ? ? ? ? ? ? 123 MET A C   1 
ATOM 945   O O   . MET A 1 122 ? -30.822 -9.144  108.984  1.00 10.00 ? ? ? ? ? ? 123 MET A O   1 
ATOM 946   C CB  . MET A 1 122 ? -27.724 -9.248  110.234  1.00 10.00 ? ? ? ? ? ? 123 MET A CB  1 
ATOM 947   C CG  . MET A 1 122 ? -26.522 -10.031 109.683  1.00 10.00 ? ? ? ? ? ? 123 MET A CG  1 
ATOM 948   S SD  . MET A 1 122 ? -27.005 -11.656 109.052  1.00 10.00 ? ? ? ? ? ? 123 MET A SD  1 
ATOM 949   C CE  . MET A 1 122 ? -26.136 -11.635 107.514  1.00 10.00 ? ? ? ? ? ? 123 MET A CE  1 
ATOM 950   N N   . PHE A 1 123 ? -30.232 -7.333  110.201  1.00 10.00 ? ? ? ? ? ? 124 PHE A N   1 
ATOM 951   C CA  . PHE A 1 123 ? -31.613 -7.091  110.636  1.00 10.00 ? ? ? ? ? ? 124 PHE A CA  1 
ATOM 952   C C   . PHE A 1 123 ? -32.600 -6.572  109.628  1.00 10.00 ? ? ? ? ? ? 124 PHE A C   1 
ATOM 953   O O   . PHE A 1 123 ? -33.673 -7.154  109.469  1.00 10.00 ? ? ? ? ? ? 124 PHE A O   1 
ATOM 954   C CB  . PHE A 1 123 ? -31.703 -6.137  111.833  1.00 10.00 ? ? ? ? ? ? 124 PHE A CB  1 
ATOM 955   C CG  . PHE A 1 123 ? -31.426 -6.889  113.105  1.00 10.00 ? ? ? ? ? ? 124 PHE A CG  1 
ATOM 956   C CD1 . PHE A 1 123 ? -32.188 -7.961  113.435  1.00 10.00 ? ? ? ? ? ? 124 PHE A CD1 1 
ATOM 957   C CD2 . PHE A 1 123 ? -30.384 -6.513  113.883  1.00 10.00 ? ? ? ? ? ? 124 PHE A CD2 1 
ATOM 958   C CE1 . PHE A 1 123 ? -31.899 -8.657  114.548  1.00 10.00 ? ? ? ? ? ? 124 PHE A CE1 1 
ATOM 959   C CE2 . PHE A 1 123 ? -30.097 -7.218  115.006  1.00 10.00 ? ? ? ? ? ? 124 PHE A CE2 1 
ATOM 960   C CZ  . PHE A 1 123 ? -30.857 -8.282  115.328  1.00 10.00 ? ? ? ? ? ? 124 PHE A CZ  1 
ATOM 961   N N   . GLU A 1 124 ? -32.219 -5.520  108.929  1.00 10.00 ? ? ? ? ? ? 125 GLU A N   1 
ATOM 962   C CA  . GLU A 1 124 ? -33.076 -4.891  107.945  1.00 10.00 ? ? ? ? ? ? 125 GLU A CA  1 
ATOM 963   C C   . GLU A 1 124 ? -33.176 -5.618  106.607  1.00 10.00 ? ? ? ? ? ? 125 GLU A C   1 
ATOM 964   O O   . GLU A 1 124 ? -34.275 -5.722  106.048  1.00 10.00 ? ? ? ? ? ? 125 GLU A O   1 
ATOM 965   C CB  . GLU A 1 124 ? -32.568 -3.496  107.719  1.00 10.00 ? ? ? ? ? ? 125 GLU A CB  1 
ATOM 966   C CG  . GLU A 1 124 ? -32.664 -2.626  108.941  1.00 10.00 ? ? ? ? ? ? 125 GLU A CG  1 
ATOM 967   C CD  . GLU A 1 124 ? -32.099 -1.245  108.703  1.00 10.00 ? ? ? ? ? ? 125 GLU A CD  1 
ATOM 968   O OE1 . GLU A 1 124 ? -31.644 -0.949  107.598  1.00 10.00 ? ? ? ? ? ? 125 GLU A OE1 1 
ATOM 969   O OE2 . GLU A 1 124 ? -32.077 -0.437  109.627  1.00 10.00 ? ? ? ? ? ? 125 GLU A OE2 1 
ATOM 970   N N   . THR A 1 125 ? -32.020 -6.084  106.089  1.00 10.00 ? ? ? ? ? ? 126 THR A N   1 
ATOM 971   C CA  . THR A 1 125 ? -31.915 -6.761  104.812  1.00 10.00 ? ? ? ? ? ? 126 THR A CA  1 
ATOM 972   C C   . THR A 1 125 ? -32.226 -8.206  104.970  1.00 10.00 ? ? ? ? ? ? 126 THR A C   1 
ATOM 973   O O   . THR A 1 125 ? -32.849 -8.683  104.043  1.00 10.00 ? ? ? ? ? ? 126 THR A O   1 
ATOM 974   C CB  . THR A 1 125 ? -30.510 -6.605  104.248  1.00 10.00 ? ? ? ? ? ? 126 THR A CB  1 
ATOM 975   O OG1 . THR A 1 125 ? -30.265 -5.172  104.257  1.00 10.00 ? ? ? ? ? ? 126 THR A OG1 1 
ATOM 976   C CG2 . THR A 1 125 ? -30.323 -7.316  102.882  1.00 10.00 ? ? ? ? ? ? 126 THR A CG2 1 
ATOM 977   N N   . PHE A 1 126 ? -31.830 -8.965  106.009  1.00 10.00 ? ? ? ? ? ? 127 PHE A N   1 
ATOM 978   C CA  . PHE A 1 126 ? -32.247 -10.374 106.080  1.00 10.00 ? ? ? ? ? ? 127 PHE A CA  1 
ATOM 979   C C   . PHE A 1 126 ? -33.333 -10.705 107.077  1.00 10.00 ? ? ? ? ? ? 127 PHE A C   1 
ATOM 980   O O   . PHE A 1 126 ? -33.853 -11.829 107.093  1.00 10.00 ? ? ? ? ? ? 127 PHE A O   1 
ATOM 981   C CB  . PHE A 1 126 ? -31.052 -11.288 106.362  1.00 10.00 ? ? ? ? ? ? 127 PHE A CB  1 
ATOM 982   C CG  . PHE A 1 126 ? -30.129 -11.323 105.151  1.00 10.00 ? ? ? ? ? ? 127 PHE A CG  1 
ATOM 983   C CD1 . PHE A 1 126 ? -30.555 -11.871 103.954  1.00 10.00 ? ? ? ? ? ? 127 PHE A CD1 1 
ATOM 984   C CD2 . PHE A 1 126 ? -28.858 -10.778 105.223  1.00 10.00 ? ? ? ? ? ? 127 PHE A CD2 1 
ATOM 985   C CE1 . PHE A 1 126 ? -29.696 -11.853 102.864  1.00 10.00 ? ? ? ? ? ? 127 PHE A CE1 1 
ATOM 986   C CE2 . PHE A 1 126 ? -27.997 -10.765 104.126  1.00 10.00 ? ? ? ? ? ? 127 PHE A CE2 1 
ATOM 987   C CZ  . PHE A 1 126 ? -28.420 -11.303 102.939  1.00 10.00 ? ? ? ? ? ? 127 PHE A CZ  1 
ATOM 988   N N   . ASN A 1 127 ? -33.736 -9.704  107.872  1.00 10.00 ? ? ? ? ? ? 128 ASN A N   1 
ATOM 989   C CA  . ASN A 1 127 ? -34.840 -9.796  108.824  1.00 10.00 ? ? ? ? ? ? 128 ASN A CA  1 
ATOM 990   C C   . ASN A 1 127 ? -34.635 -10.993 109.706  1.00 10.00 ? ? ? ? ? ? 128 ASN A C   1 
ATOM 991   O O   . ASN A 1 127 ? -35.354 -11.986 109.667  1.00 10.00 ? ? ? ? ? ? 128 ASN A O   1 
ATOM 992   C CB  . ASN A 1 127 ? -36.212 -9.912  108.095  1.00 10.00 ? ? ? ? ? ? 128 ASN A CB  1 
ATOM 993   C CG  . ASN A 1 127 ? -37.472 -9.854  108.998  1.00 10.00 ? ? ? ? ? ? 128 ASN A CG  1 
ATOM 994   O OD1 . ASN A 1 127 ? -37.808 -8.811  109.574  1.00 10.00 ? ? ? ? ? ? 128 ASN A OD1 1 
ATOM 995   N ND2 . ASN A 1 127 ? -38.225 -10.943 109.204  1.00 10.00 ? ? ? ? ? ? 128 ASN A ND2 1 
ATOM 996   N N   . THR A 1 128 ? -33.596 -10.820 110.514  1.00 10.00 ? ? ? ? ? ? 129 THR A N   1 
ATOM 997   C CA  . THR A 1 128 ? -33.075 -11.883 111.379  1.00 10.00 ? ? ? ? ? ? 129 THR A CA  1 
ATOM 998   C C   . THR A 1 128 ? -33.768 -11.769 112.726  1.00 10.00 ? ? ? ? ? ? 129 THR A C   1 
ATOM 999   O O   . THR A 1 128 ? -33.791 -10.644 113.243  1.00 10.00 ? ? ? ? ? ? 129 THR A O   1 
ATOM 1000  C CB  . THR A 1 128 ? -31.476 -11.776 111.590  1.00 10.00 ? ? ? ? ? ? 129 THR A CB  1 
ATOM 1001  O OG1 . THR A 1 128 ? -30.663 -11.408 110.455  1.00 10.00 ? ? ? ? ? ? 129 THR A OG1 1 
ATOM 1002  C CG2 . THR A 1 128 ? -31.047 -13.190 111.859  1.00 10.00 ? ? ? ? ? ? 129 THR A CG2 1 
ATOM 1003  N N   . PRO A 1 129 ? -34.305 -12.839 113.334  1.00 10.00 ? ? ? ? ? ? 130 PRO A N   1 
ATOM 1004  C CA  . PRO A 1 129 ? -34.965 -12.815 114.606  1.00 10.00 ? ? ? ? ? ? 130 PRO A CA  1 
ATOM 1005  C C   . PRO A 1 129 ? -34.044 -12.228 115.659  1.00 10.00 ? ? ? ? ? ? 130 PRO A C   1 
ATOM 1006  O O   . PRO A 1 129 ? -34.529 -11.500 116.538  1.00 10.00 ? ? ? ? ? ? 130 PRO A O   1 
ATOM 1007  C CB  . PRO A 1 129 ? -35.325 -14.229 114.966  1.00 10.00 ? ? ? ? ? ? 130 PRO A CB  1 
ATOM 1008  C CG  . PRO A 1 129 ? -35.192 -15.002 113.717  1.00 10.00 ? ? ? ? ? ? 130 PRO A CG  1 
ATOM 1009  C CD  . PRO A 1 129 ? -34.142 -14.219 112.967  1.00 10.00 ? ? ? ? ? ? 130 PRO A CD  1 
ATOM 1010  N N   . ALA A 1 130 ? -32.727 -12.523 115.532  1.00 10.00 ? ? ? ? ? ? 131 ALA A N   1 
ATOM 1011  C CA  . ALA A 1 130 ? -31.670 -12.187 116.481  1.00 10.00 ? ? ? ? ? ? 131 ALA A CA  1 
ATOM 1012  C C   . ALA A 1 130 ? -30.301 -12.453 115.901  1.00 10.00 ? ? ? ? ? ? 131 ALA A C   1 
ATOM 1013  O O   . ALA A 1 130 ? -30.100 -13.258 114.990  1.00 10.00 ? ? ? ? ? ? 131 ALA A O   1 
ATOM 1014  C CB  . ALA A 1 130 ? -31.769 -13.031 117.725  1.00 10.00 ? ? ? ? ? ? 131 ALA A CB  1 
ATOM 1015  N N   . MET A 1 131 ? -29.334 -11.821 116.520  1.00 10.00 ? ? ? ? ? ? 132 MET A N   1 
ATOM 1016  C CA  . MET A 1 131 ? -28.000 -12.046 116.098  1.00 10.00 ? ? ? ? ? ? 132 MET A CA  1 
ATOM 1017  C C   . MET A 1 131 ? -26.999 -11.688 117.178  1.00 10.00 ? ? ? ? ? ? 132 MET A C   1 
ATOM 1018  O O   . MET A 1 131 ? -27.315 -11.011 118.158  1.00 10.00 ? ? ? ? ? ? 132 MET A O   1 
ATOM 1019  C CB  . MET A 1 131 ? -27.785 -11.246 114.747  1.00 10.00 ? ? ? ? ? ? 132 MET A CB  1 
ATOM 1020  C CG  . MET A 1 131 ? -27.625 -9.735  114.512  1.00 10.00 ? ? ? ? ? ? 132 MET A CG  1 
ATOM 1021  S SD  . MET A 1 131 ? -25.991 -8.989  114.740  1.00 10.00 ? ? ? ? ? ? 132 MET A SD  1 
ATOM 1022  C CE  . MET A 1 131 ? -25.439 -9.777  113.276  1.00 10.00 ? ? ? ? ? ? 132 MET A CE  1 
ATOM 1023  N N   . TYR A 1 132 ? -25.795 -12.273 117.036  1.00 10.00 ? ? ? ? ? ? 133 TYR A N   1 
ATOM 1024  C CA  . TYR A 1 132 ? -24.650 -11.964 117.856  1.00 10.00 ? ? ? ? ? ? 133 TYR A CA  1 
ATOM 1025  C C   . TYR A 1 132 ? -23.410 -12.014 116.924  1.00 10.00 ? ? ? ? ? ? 133 TYR A C   1 
ATOM 1026  O O   . TYR A 1 132 ? -23.361 -12.703 115.879  1.00 10.00 ? ? ? ? ? ? 133 TYR A O   1 
ATOM 1027  C CB  . TYR A 1 132 ? -24.618 -12.985 118.967  1.00 10.00 ? ? ? ? ? ? 133 TYR A CB  1 
ATOM 1028  C CG  . TYR A 1 132 ? -23.677 -12.619 120.082  1.00 10.00 ? ? ? ? ? ? 133 TYR A CG  1 
ATOM 1029  C CD1 . TYR A 1 132 ? -24.070 -11.761 121.080  1.00 10.00 ? ? ? ? ? ? 133 TYR A CD1 1 
ATOM 1030  C CD2 . TYR A 1 132 ? -22.406 -13.145 120.073  1.00 10.00 ? ? ? ? ? ? 133 TYR A CD2 1 
ATOM 1031  C CE1 . TYR A 1 132 ? -23.173 -11.427 122.070  1.00 10.00 ? ? ? ? ? ? 133 TYR A CE1 1 
ATOM 1032  C CE2 . TYR A 1 132 ? -21.523 -12.821 121.053  1.00 10.00 ? ? ? ? ? ? 133 TYR A CE2 1 
ATOM 1033  C CZ  . TYR A 1 132 ? -21.905 -11.962 122.042  1.00 10.00 ? ? ? ? ? ? 133 TYR A CZ  1 
ATOM 1034  O OH  . TYR A 1 132 ? -20.964 -11.656 123.016  1.00 10.00 ? ? ? ? ? ? 133 TYR A OH  1 
ATOM 1035  N N   . VAL A 1 133 ? -22.422 -11.206 117.325  1.00 10.00 ? ? ? ? ? ? 134 VAL A N   1 
ATOM 1036  C CA  . VAL A 1 133 ? -21.174 -11.082 116.646  1.00 10.00 ? ? ? ? ? ? 134 VAL A CA  1 
ATOM 1037  C C   . VAL A 1 133 ? -20.104 -11.385 117.706  1.00 10.00 ? ? ? ? ? ? 134 VAL A C   1 
ATOM 1038  O O   . VAL A 1 133 ? -19.806 -10.648 118.636  1.00 10.00 ? ? ? ? ? ? 134 VAL A O   1 
ATOM 1039  C CB  . VAL A 1 133 ? -20.930 -9.668  116.114  1.00 10.00 ? ? ? ? ? ? 134 VAL A CB  1 
ATOM 1040  C CG1 . VAL A 1 133 ? -19.913 -9.861  115.074  1.00 10.00 ? ? ? ? ? ? 134 VAL A CG1 1 
ATOM 1041  C CG2 . VAL A 1 133 ? -22.069 -8.991  115.402  1.00 10.00 ? ? ? ? ? ? 134 VAL A CG2 1 
ATOM 1042  N N   . ALA A 1 134 ? -19.464 -12.524 117.557  1.00 10.00 ? ? ? ? ? ? 135 ALA A N   1 
ATOM 1043  C CA  . ALA A 1 134 ? -18.315 -12.906 118.346  1.00 10.00 ? ? ? ? ? ? 135 ALA A CA  1 
ATOM 1044  C C   . ALA A 1 134 ? -16.945 -12.760 117.583  1.00 10.00 ? ? ? ? ? ? 135 ALA A C   1 
ATOM 1045  O O   . ALA A 1 134 ? -16.789 -12.954 116.354  1.00 10.00 ? ? ? ? ? ? 135 ALA A O   1 
ATOM 1046  C CB  . ALA A 1 134 ? -18.633 -14.350 118.793  1.00 10.00 ? ? ? ? ? ? 135 ALA A CB  1 
ATOM 1047  N N   . ILE A 1 135 ? -15.898 -12.319 118.295  1.00 10.00 ? ? ? ? ? ? 136 ILE A N   1 
ATOM 1048  C CA  . ILE A 1 135 ? -14.536 -12.230 117.782  1.00 10.00 ? ? ? ? ? ? 136 ILE A CA  1 
ATOM 1049  C C   . ILE A 1 135 ? -14.100 -13.645 117.500  1.00 10.00 ? ? ? ? ? ? 136 ILE A C   1 
ATOM 1050  O O   . ILE A 1 135 ? -14.386 -14.522 118.313  1.00 10.00 ? ? ? ? ? ? 136 ILE A O   1 
ATOM 1051  C CB  . ILE A 1 135 ? -13.673 -11.605 118.836  1.00 10.00 ? ? ? ? ? ? 136 ILE A CB  1 
ATOM 1052  C CG1 . ILE A 1 135 ? -13.994 -10.110 118.886  1.00 10.00 ? ? ? ? ? ? 136 ILE A CG1 1 
ATOM 1053  C CG2 . ILE A 1 135 ? -12.206 -11.898 118.563  1.00 10.00 ? ? ? ? ? ? 136 ILE A CG2 1 
ATOM 1054  C CD1 . ILE A 1 135 ? -13.514 -9.349  120.196  1.00 10.00 ? ? ? ? ? ? 136 ILE A CD1 1 
ATOM 1055  N N   . GLN A 1 136 ? -13.332 -13.936 116.457  1.00 10.00 ? ? ? ? ? ? 137 GLN A N   1 
ATOM 1056  C CA  . GLN A 1 136 ? -13.006 -15.346 116.122  1.00 10.00 ? ? ? ? ? ? 137 GLN A CA  1 
ATOM 1057  C C   . GLN A 1 136 ? -12.138 -16.090 117.080  1.00 10.00 ? ? ? ? ? ? 137 GLN A C   1 
ATOM 1058  O O   . GLN A 1 136 ? -12.448 -17.234 117.321  1.00 10.00 ? ? ? ? ? ? 137 GLN A O   1 
ATOM 1059  C CB  . GLN A 1 136 ? -12.341 -15.427 114.790  1.00 10.00 ? ? ? ? ? ? 137 GLN A CB  1 
ATOM 1060  C CG  . GLN A 1 136 ? -13.260 -14.794 113.776  1.00 10.00 ? ? ? ? ? ? 137 GLN A CG  1 
ATOM 1061  C CD  . GLN A 1 136 ? -12.500 -14.183 112.642  1.00 10.00 ? ? ? ? ? ? 137 GLN A CD  1 
ATOM 1062  O OE1 . GLN A 1 136 ? -11.412 -14.687 112.309  1.00 10.00 ? ? ? ? ? ? 137 GLN A OE1 1 
ATOM 1063  N NE2 . GLN A 1 136 ? -13.071 -13.209 111.947  1.00 10.00 ? ? ? ? ? ? 137 GLN A NE2 1 
ATOM 1064  N N   . ALA A 1 137 ? -11.070 -15.468 117.650  1.00 10.00 ? ? ? ? ? ? 138 ALA A N   1 
ATOM 1065  C CA  . ALA A 1 137 ? -10.158 -16.090 118.584  1.00 10.00 ? ? ? ? ? ? 138 ALA A CA  1 
ATOM 1066  C C   . ALA A 1 137 ? -10.847 -16.550 119.856  1.00 10.00 ? ? ? ? ? ? 138 ALA A C   1 
ATOM 1067  O O   . ALA A 1 137 ? -10.528 -17.593 120.434  1.00 10.00 ? ? ? ? ? ? 138 ALA A O   1 
ATOM 1068  C CB  . ALA A 1 137 ? -9.104  -15.104 118.909  1.00 10.00 ? ? ? ? ? ? 138 ALA A CB  1 
ATOM 1069  N N   . VAL A 1 138 ? -11.848 -15.837 120.339  1.00 10.00 ? ? ? ? ? ? 139 VAL A N   1 
ATOM 1070  C CA  . VAL A 1 138 ? -12.573 -16.214 121.541  1.00 10.00 ? ? ? ? ? ? 139 VAL A CA  1 
ATOM 1071  C C   . VAL A 1 138 ? -13.370 -17.502 121.338  1.00 10.00 ? ? ? ? ? ? 139 VAL A C   1 
ATOM 1072  O O   . VAL A 1 138 ? -13.559 -18.234 122.310  1.00 10.00 ? ? ? ? ? ? 139 VAL A O   1 
ATOM 1073  C CB  . VAL A 1 138 ? -13.462 -14.971 121.956  1.00 10.00 ? ? ? ? ? ? 139 VAL A CB  1 
ATOM 1074  C CG1 . VAL A 1 138 ? -14.429 -15.322 123.045  1.00 10.00 ? ? ? ? ? ? 139 VAL A CG1 1 
ATOM 1075  C CG2 . VAL A 1 138 ? -12.597 -13.875 122.572  1.00 10.00 ? ? ? ? ? ? 139 VAL A CG2 1 
ATOM 1076  N N   . LEU A 1 139 ? -13.837 -17.861 120.138  1.00 10.00 ? ? ? ? ? ? 140 LEU A N   1 
ATOM 1077  C CA  . LEU A 1 139 ? -14.573 -19.124 119.881  1.00 10.00 ? ? ? ? ? ? 140 LEU A CA  1 
ATOM 1078  C C   . LEU A 1 139 ? -13.563 -20.253 119.681  1.00 10.00 ? ? ? ? ? ? 140 LEU A C   1 
ATOM 1079  O O   . LEU A 1 139 ? -13.875 -21.411 120.015  1.00 10.00 ? ? ? ? ? ? 140 LEU A O   1 
ATOM 1080  C CB  . LEU A 1 139 ? -15.431 -19.107 118.623  1.00 10.00 ? ? ? ? ? ? 140 LEU A CB  1 
ATOM 1081  C CG  . LEU A 1 139 ? -16.640 -18.195 118.475  1.00 10.00 ? ? ? ? ? ? 140 LEU A CG  1 
ATOM 1082  C CD1 . LEU A 1 139 ? -16.215 -16.797 118.705  1.00 10.00 ? ? ? ? ? ? 140 LEU A CD1 1 
ATOM 1083  C CD2 . LEU A 1 139 ? -17.171 -18.187 117.055  1.00 10.00 ? ? ? ? ? ? 140 LEU A CD2 1 
ATOM 1084  N N   . SER A 1 140 ? -12.364 -19.978 119.134  1.00 10.00 ? ? ? ? ? ? 141 SER A N   1 
ATOM 1085  C CA  . SER A 1 140 ? -11.265 -20.935 119.189  1.00 10.00 ? ? ? ? ? ? 141 SER A CA  1 
ATOM 1086  C C   . SER A 1 140 ? -10.994 -21.390 120.635  1.00 10.00 ? ? ? ? ? ? 141 SER A C   1 
ATOM 1087  O O   . SER A 1 140 ? -10.854 -22.595 120.889  1.00 10.00 ? ? ? ? ? ? 141 SER A O   1 
ATOM 1088  C CB  . SER A 1 140 ? -9.989  -20.312 118.673  1.00 10.00 ? ? ? ? ? ? 141 SER A CB  1 
ATOM 1089  O OG  . SER A 1 140 ? -10.120 -19.929 117.304  1.00 10.00 ? ? ? ? ? ? 141 SER A OG  1 
ATOM 1090  N N   . LEU A 1 141 ? -10.929 -20.457 121.606  1.00 10.00 ? ? ? ? ? ? 142 LEU A N   1 
ATOM 1091  C CA  . LEU A 1 141 ? -10.719 -20.801 123.001  1.00 10.00 ? ? ? ? ? ? 142 LEU A CA  1 
ATOM 1092  C C   . LEU A 1 141 ? -11.817 -21.642 123.708  1.00 10.00 ? ? ? ? ? ? 142 LEU A C   1 
ATOM 1093  O O   . LEU A 1 141 ? -11.586 -22.687 124.363  1.00 10.00 ? ? ? ? ? ? 142 LEU A O   1 
ATOM 1094  C CB  . LEU A 1 141 ? -10.515 -19.510 123.724  1.00 10.00 ? ? ? ? ? ? 142 LEU A CB  1 
ATOM 1095  C CG  . LEU A 1 141 ? -9.779  -19.683 125.020  1.00 10.00 ? ? ? ? ? ? 142 LEU A CG  1 
ATOM 1096  C CD1 . LEU A 1 141 ? -8.293  -19.981 124.740  1.00 10.00 ? ? ? ? ? ? 142 LEU A CD1 1 
ATOM 1097  C CD2 . LEU A 1 141 ? -9.958  -18.441 125.840  1.00 10.00 ? ? ? ? ? ? 142 LEU A CD2 1 
ATOM 1098  N N   . TYR A 1 142 ? -13.067 -21.200 123.551  1.00 10.00 ? ? ? ? ? ? 143 TYR A N   1 
ATOM 1099  C CA  . TYR A 1 142 ? -14.187 -21.916 124.110  1.00 10.00 ? ? ? ? ? ? 143 TYR A CA  1 
ATOM 1100  C C   . TYR A 1 142 ? -14.208 -23.330 123.551  1.00 10.00 ? ? ? ? ? ? 143 TYR A C   1 
ATOM 1101  O O   . TYR A 1 142 ? -14.396 -24.269 124.329  1.00 10.00 ? ? ? ? ? ? 143 TYR A O   1 
ATOM 1102  C CB  . TYR A 1 142 ? -15.529 -21.204 123.773  1.00 10.00 ? ? ? ? ? ? 143 TYR A CB  1 
ATOM 1103  C CG  . TYR A 1 142 ? -16.572 -21.501 124.864  1.00 10.00 ? ? ? ? ? ? 143 TYR A CG  1 
ATOM 1104  C CD1 . TYR A 1 142 ? -17.095 -22.794 125.030  1.00 10.00 ? ? ? ? ? ? 143 TYR A CD1 1 
ATOM 1105  C CD2 . TYR A 1 142 ? -16.954 -20.501 125.760  1.00 10.00 ? ? ? ? ? ? 143 TYR A CD2 1 
ATOM 1106  C CE1 . TYR A 1 142 ? -17.975 -23.087 126.071  1.00 10.00 ? ? ? ? ? ? 143 TYR A CE1 1 
ATOM 1107  C CE2 . TYR A 1 142 ? -17.843 -20.797 126.807  1.00 10.00 ? ? ? ? ? ? 143 TYR A CE2 1 
ATOM 1108  C CZ  . TYR A 1 142 ? -18.348 -22.092 126.972  1.00 10.00 ? ? ? ? ? ? 143 TYR A CZ  1 
ATOM 1109  O OH  . TYR A 1 142 ? -19.199 -22.397 128.039  1.00 10.00 ? ? ? ? ? ? 143 TYR A OH  1 
ATOM 1110  N N   . ALA A 1 143 ? -13.982 -23.528 122.242  1.00 10.00 ? ? ? ? ? ? 144 ALA A N   1 
ATOM 1111  C CA  . ALA A 1 143 ? -13.976 -24.864 121.654  1.00 10.00 ? ? ? ? ? ? 144 ALA A CA  1 
ATOM 1112  C C   . ALA A 1 143 ? -12.825 -25.771 122.153  1.00 10.00 ? ? ? ? ? ? 144 ALA A C   1 
ATOM 1113  O O   . ALA A 1 143 ? -12.852 -26.986 121.938  1.00 10.00 ? ? ? ? ? ? 144 ALA A O   1 
ATOM 1114  C CB  . ALA A 1 143 ? -13.929 -24.705 120.126  1.00 10.00 ? ? ? ? ? ? 144 ALA A CB  1 
ATOM 1115  N N   . SER A 1 144 ? -11.761 -25.253 122.787  1.00 10.00 ? ? ? ? ? ? 145 SER A N   1 
ATOM 1116  C CA  . SER A 1 144 ? -10.710 -26.086 123.377  1.00 10.00 ? ? ? ? ? ? 145 SER A CA  1 
ATOM 1117  C C   . SER A 1 144 ? -11.039 -26.396 124.824  1.00 10.00 ? ? ? ? ? ? 145 SER A C   1 
ATOM 1118  O O   . SER A 1 144 ? -10.323 -27.126 125.513  1.00 10.00 ? ? ? ? ? ? 145 SER A O   1 
ATOM 1119  C CB  . SER A 1 144 ? -9.347  -25.403 123.373  1.00 10.00 ? ? ? ? ? ? 145 SER A CB  1 
ATOM 1120  O OG  . SER A 1 144 ? -9.239  -24.240 124.181  1.00 10.00 ? ? ? ? ? ? 145 SER A OG  1 
ATOM 1121  N N   . GLY A 1 145 ? -9.444  -27.849 124.850  1.00 10.00 ? ? ? ? ? ? 146 GLY A N   1 
ATOM 1122  C CA  . GLY A 1 145 ? -9.833  -28.575 126.036  1.00 10.00 ? ? ? ? ? ? 146 GLY A CA  1 
ATOM 1123  C C   . GLY A 1 145 ? -9.360  -27.811 127.216  1.00 10.00 ? ? ? ? ? ? 146 GLY A C   1 
ATOM 1124  O O   . GLY A 1 145 ? -8.806  -28.372 128.153  1.00 10.00 ? ? ? ? ? ? 146 GLY A O   1 
ATOM 1125  N N   . ARG A 1 146 ? -9.591  -26.520 127.214  1.00 10.00 ? ? ? ? ? ? 147 ARG A N   1 
ATOM 1126  C CA  . ARG A 1 146 ? -9.013  -25.745 128.257  1.00 10.00 ? ? ? ? ? ? 147 ARG A CA  1 
ATOM 1127  C C   . ARG A 1 146 ? -9.977  -24.630 128.565  1.00 10.00 ? ? ? ? ? ? 147 ARG A C   1 
ATOM 1128  O O   . ARG A 1 146 ? -10.903 -24.297 127.826  1.00 10.00 ? ? ? ? ? ? 147 ARG A O   1 
ATOM 1129  C CB  . ARG A 1 146 ? -7.699  -25.360 127.685  1.00 10.00 ? ? ? ? ? ? 147 ARG A CB  1 
ATOM 1130  C CG  . ARG A 1 146 ? -6.715  -24.480 128.347  1.00 10.00 ? ? ? ? ? ? 147 ARG A CG  1 
ATOM 1131  C CD  . ARG A 1 146 ? -5.631  -24.638 127.317  1.00 10.00 ? ? ? ? ? ? 147 ARG A CD  1 
ATOM 1132  N NE  . ARG A 1 146 ? -4.777  -25.736 127.713  1.00 10.00 ? ? ? ? ? ? 147 ARG A NE  1 
ATOM 1133  C CZ  . ARG A 1 146 ? -4.275  -26.631 126.879  1.00 10.00 ? ? ? ? ? ? 147 ARG A CZ  1 
ATOM 1134  N NH1 . ARG A 1 146 ? -4.513  -26.621 125.576  1.00 10.00 ? ? ? ? ? ? 147 ARG A NH1 1 
ATOM 1135  N NH2 . ARG A 1 146 ? -3.518  -27.581 127.394  1.00 10.00 ? ? ? ? ? ? 147 ARG A NH2 1 
ATOM 1136  N N   . THR A 1 147 ? -9.773  -24.146 129.775  1.00 10.00 ? ? ? ? ? ? 148 THR A N   1 
ATOM 1137  C CA  . THR A 1 147 ? -10.628 -23.163 130.407  1.00 10.00 ? ? ? ? ? ? 148 THR A CA  1 
ATOM 1138  C C   . THR A 1 147 ? -9.913  -21.902 130.910  1.00 10.00 ? ? ? ? ? ? 148 THR A C   1 
ATOM 1139  O O   . THR A 1 147 ? -10.507 -20.818 131.049  1.00 10.00 ? ? ? ? ? ? 148 THR A O   1 
ATOM 1140  C CB  . THR A 1 147 ? -11.344 -23.992 131.479  1.00 10.00 ? ? ? ? ? ? 148 THR A CB  1 
ATOM 1141  O OG1 . THR A 1 147 ? -10.399 -24.988 131.933  1.00 10.00 ? ? ? ? ? ? 148 THR A OG1 1 
ATOM 1142  C CG2 . THR A 1 147 ? -12.658 -24.564 130.937  1.00 10.00 ? ? ? ? ? ? 148 THR A CG2 1 
ATOM 1143  N N   . THR A 1 148 ? -8.616  -21.973 131.105  1.00 10.00 ? ? ? ? ? ? 149 THR A N   1 
ATOM 1144  C CA  . THR A 1 148 ? -7.864  -20.815 131.520  1.00 10.00 ? ? ? ? ? ? 149 THR A CA  1 
ATOM 1145  C C   . THR A 1 148 ? -6.718  -20.711 130.484  1.00 10.00 ? ? ? ? ? ? 149 THR A C   1 
ATOM 1146  O O   . THR A 1 148 ? -6.259  -21.757 129.994  1.00 10.00 ? ? ? ? ? ? 149 THR A O   1 
ATOM 1147  C CB  . THR A 1 148 ? -7.362  -21.062 132.951  1.00 10.00 ? ? ? ? ? ? 149 THR A CB  1 
ATOM 1148  O OG1 . THR A 1 148 ? -8.288  -21.902 133.630  1.00 10.00 ? ? ? ? ? ? 149 THR A OG1 1 
ATOM 1149  C CG2 . THR A 1 148 ? -7.331  -19.798 133.742  1.00 10.00 ? ? ? ? ? ? 149 THR A CG2 1 
ATOM 1150  N N   . GLY A 1 149 ? -6.220  -19.564 130.064  1.00 10.00 ? ? ? ? ? ? 150 GLY A N   1 
ATOM 1151  C CA  . GLY A 1 149 ? -5.217  -19.560 129.044  1.00 10.00 ? ? ? ? ? ? 150 GLY A CA  1 
ATOM 1152  C C   . GLY A 1 149 ? -5.318  -18.231 128.380  1.00 10.00 ? ? ? ? ? ? 150 GLY A C   1 
ATOM 1153  O O   . GLY A 1 149 ? -6.035  -17.373 128.888  1.00 10.00 ? ? ? ? ? ? 150 GLY A O   1 
ATOM 1154  N N   . ILE A 1 150 ? -4.604  -17.996 127.308  1.00 10.00 ? ? ? ? ? ? 151 ILE A N   1 
ATOM 1155  C CA  . ILE A 1 150 ? -4.740  -16.784 126.505  1.00 10.00 ? ? ? ? ? ? 151 ILE A CA  1 
ATOM 1156  C C   . ILE A 1 150 ? -4.568  -17.326 125.099  1.00 10.00 ? ? ? ? ? ? 151 ILE A C   1 
ATOM 1157  O O   . ILE A 1 150 ? -3.815  -18.280 124.851  1.00 10.00 ? ? ? ? ? ? 151 ILE A O   1 
ATOM 1158  C CB  . ILE A 1 150 ? -3.650  -15.692 126.863  1.00 10.00 ? ? ? ? ? ? 151 ILE A CB  1 
ATOM 1159  C CG1 . ILE A 1 150 ? -3.497  -14.590 125.805  1.00 10.00 ? ? ? ? ? ? 151 ILE A CG1 1 
ATOM 1160  C CG2 . ILE A 1 150 ? -2.366  -16.442 127.125  1.00 10.00 ? ? ? ? ? ? 151 ILE A CG2 1 
ATOM 1161  C CD1 . ILE A 1 150 ? -2.849  -13.307 126.384  1.00 10.00 ? ? ? ? ? ? 151 ILE A CD1 1 
ATOM 1162  N N   . VAL A 1 151 ? -5.423  -16.806 124.225  1.00 10.00 ? ? ? ? ? ? 152 VAL A N   1 
ATOM 1163  C CA  . VAL A 1 151 ? -5.476  -17.226 122.842  1.00 10.00 ? ? ? ? ? ? 152 VAL A CA  1 
ATOM 1164  C C   . VAL A 1 151 ? -4.902  -16.064 122.078  1.00 10.00 ? ? ? ? ? ? 152 VAL A C   1 
ATOM 1165  O O   . VAL A 1 151 ? -4.981  -14.899 122.493  1.00 10.00 ? ? ? ? ? ? 152 VAL A O   1 
ATOM 1166  C CB  . VAL A 1 151 ? -6.935  -17.505 122.470  1.00 10.00 ? ? ? ? ? ? 152 VAL A CB  1 
ATOM 1167  C CG1 . VAL A 1 151 ? -7.088  -18.022 121.080  1.00 10.00 ? ? ? ? ? ? 152 VAL A CG1 1 
ATOM 1168  C CG2 . VAL A 1 151 ? -7.455  -18.620 123.344  1.00 10.00 ? ? ? ? ? ? 152 VAL A CG2 1 
ATOM 1169  N N   . MET A 1 152 ? -4.259  -16.360 120.972  1.00 10.00 ? ? ? ? ? ? 153 MET A N   1 
ATOM 1170  C CA  . MET A 1 152 ? -3.741  -15.305 120.141  1.00 10.00 ? ? ? ? ? ? 153 MET A CA  1 
ATOM 1171  C C   . MET A 1 152 ? -4.455  -15.583 118.836  1.00 10.00 ? ? ? ? ? ? 153 MET A C   1 
ATOM 1172  O O   . MET A 1 152 ? -4.181  -16.595 118.183  1.00 10.00 ? ? ? ? ? ? 153 MET A O   1 
ATOM 1173  C CB  . MET A 1 152 ? -2.252  -15.506 120.109  1.00 10.00 ? ? ? ? ? ? 153 MET A CB  1 
ATOM 1174  C CG  . MET A 1 152 ? -1.488  -14.274 119.698  1.00 10.00 ? ? ? ? ? ? 153 MET A CG  1 
ATOM 1175  S SD  . MET A 1 152 ? -1.750  -13.726 117.992  1.00 10.00 ? ? ? ? ? ? 153 MET A SD  1 
ATOM 1176  C CE  . MET A 1 152 ? -0.579  -14.797 117.233  1.00 10.00 ? ? ? ? ? ? 153 MET A CE  1 
ATOM 1177  N N   . ASP A 1 153 ? -5.397  -14.758 118.430  1.00 10.00 ? ? ? ? ? ? 154 ASP A N   1 
ATOM 1178  C CA  . ASP A 1 153 ? -6.258  -15.134 117.320  1.00 10.00 ? ? ? ? ? ? 154 ASP A CA  1 
ATOM 1179  C C   . ASP A 1 153 ? -5.943  -14.306 116.113  1.00 10.00 ? ? ? ? ? ? 154 ASP A C   1 
ATOM 1180  O O   . ASP A 1 153 ? -6.084  -13.085 116.226  1.00 10.00 ? ? ? ? ? ? 154 ASP A O   1 
ATOM 1181  C CB  . ASP A 1 153 ? -7.670  -14.939 117.811  1.00 10.00 ? ? ? ? ? ? 154 ASP A CB  1 
ATOM 1182  C CG  . ASP A 1 153 ? -8.770  -15.561 116.979  1.00 10.00 ? ? ? ? ? ? 154 ASP A CG  1 
ATOM 1183  O OD1 . ASP A 1 153 ? -9.085  -15.007 115.932  1.00 10.00 ? ? ? ? ? ? 154 ASP A OD1 1 
ATOM 1184  O OD2 . ASP A 1 153 ? -9.329  -16.586 117.378  1.00 10.00 ? ? ? ? ? ? 154 ASP A OD2 1 
ATOM 1185  N N   . SER A 1 154 ? -5.518  -14.874 114.990  1.00 10.00 ? ? ? ? ? ? 155 SER A N   1 
ATOM 1186  C CA  . SER A 1 154 ? -5.161  -14.050 113.852  1.00 10.00 ? ? ? ? ? ? 155 SER A CA  1 
ATOM 1187  C C   . SER A 1 154 ? -5.875  -14.520 112.619  1.00 10.00 ? ? ? ? ? ? 155 SER A C   1 
ATOM 1188  O O   . SER A 1 154 ? -5.538  -15.545 112.000  1.00 10.00 ? ? ? ? ? ? 155 SER A O   1 
ATOM 1189  C CB  . SER A 1 154 ? -3.629  -14.093 113.615  1.00 10.00 ? ? ? ? ? ? 155 SER A CB  1 
ATOM 1190  O OG  . SER A 1 154 ? -3.081  -12.979 112.881  1.00 10.00 ? ? ? ? ? ? 155 SER A OG  1 
ATOM 1191  N N   . GLY A 1 155 ? -6.852  -13.692 112.300  1.00 10.00 ? ? ? ? ? ? 156 GLY A N   1 
ATOM 1192  C CA  . GLY A 1 155 ? -7.680  -13.946 111.133  1.00 10.00 ? ? ? ? ? ? 156 GLY A CA  1 
ATOM 1193  C C   . GLY A 1 155 ? -7.269  -13.173 109.873  1.00 10.00 ? ? ? ? ? ? 156 GLY A C   1 
ATOM 1194  O O   . GLY A 1 155 ? -6.089  -13.146 109.467  1.00 10.00 ? ? ? ? ? ? 156 GLY A O   1 
ATOM 1195  N N   . ASP A 1 156 ? -8.215  -12.469 109.235  1.00 10.00 ? ? ? ? ? ? 157 ASP A N   1 
ATOM 1196  C CA  . ASP A 1 156 ? -7.923  -11.745 107.997  1.00 10.00 ? ? ? ? ? ? 157 ASP A CA  1 
ATOM 1197  C C   . ASP A 1 156 ? -7.889  -10.264 108.268  1.00 10.00 ? ? ? ? ? ? 157 ASP A C   1 
ATOM 1198  O O   . ASP A 1 156 ? -7.086  -9.535  107.666  1.00 10.00 ? ? ? ? ? ? 157 ASP A O   1 
ATOM 1199  C CB  . ASP A 1 156 ? -9.000  -12.058 106.986  1.00 10.00 ? ? ? ? ? ? 157 ASP A CB  1 
ATOM 1200  C CG  . ASP A 1 156 ? -8.775  -11.737 105.517  1.00 10.00 ? ? ? ? ? ? 157 ASP A CG  1 
ATOM 1201  O OD1 . ASP A 1 156 ? -8.188  -12.570 104.838  1.00 10.00 ? ? ? ? ? ? 157 ASP A OD1 1 
ATOM 1202  O OD2 . ASP A 1 156 ? -9.244  -10.695 105.053  1.00 10.00 ? ? ? ? ? ? 157 ASP A OD2 1 
ATOM 1203  N N   . GLY A 1 157 ? -8.730  -9.815  109.198  1.00 10.00 ? ? ? ? ? ? 158 GLY A N   1 
ATOM 1204  C CA  . GLY A 1 157 ? -8.796  -8.411  109.457  1.00 10.00 ? ? ? ? ? ? 158 GLY A CA  1 
ATOM 1205  C C   . GLY A 1 157 ? -8.291  -8.040  110.824  1.00 10.00 ? ? ? ? ? ? 158 GLY A C   1 
ATOM 1206  O O   . GLY A 1 157 ? -8.056  -6.841  111.022  1.00 10.00 ? ? ? ? ? ? 158 GLY A O   1 
ATOM 1207  N N   . VAL A 1 158 ? -8.146  -8.908  111.834  1.00 10.00 ? ? ? ? ? ? 159 VAL A N   1 
ATOM 1208  C CA  . VAL A 1 158 ? -7.619  -8.512  113.134  1.00 10.00 ? ? ? ? ? ? 159 VAL A CA  1 
ATOM 1209  C C   . VAL A 1 158 ? -6.901  -9.651  113.852  1.00 10.00 ? ? ? ? ? ? 159 VAL A C   1 
ATOM 1210  O O   . VAL A 1 158 ? -6.930  -10.838 113.481  1.00 10.00 ? ? ? ? ? ? 159 VAL A O   1 
ATOM 1211  C CB  . VAL A 1 158 ? -8.809  -7.960  113.927  1.00 10.00 ? ? ? ? ? ? 159 VAL A CB  1 
ATOM 1212  C CG1 . VAL A 1 158 ? -9.620  -9.104  114.420  1.00 10.00 ? ? ? ? ? ? 159 VAL A CG1 1 
ATOM 1213  C CG2 . VAL A 1 158 ? -8.360  -7.078  115.052  1.00 10.00 ? ? ? ? ? ? 159 VAL A CG2 1 
ATOM 1214  N N   . THR A 1 159 ? -6.181  -9.210  114.875  1.00 10.00 ? ? ? ? ? ? 160 THR A N   1 
ATOM 1215  C CA  . THR A 1 159 ? -5.496  -10.086 115.789  1.00 10.00 ? ? ? ? ? ? 160 THR A CA  1 
ATOM 1216  C C   . THR A 1 159 ? -5.839  -9.565  117.172  1.00 10.00 ? ? ? ? ? ? 160 THR A C   1 
ATOM 1217  O O   . THR A 1 159 ? -5.989  -8.366  117.460  1.00 10.00 ? ? ? ? ? ? 160 THR A O   1 
ATOM 1218  C CB  . THR A 1 159 ? -3.968  -10.039 115.535  1.00 10.00 ? ? ? ? ? ? 160 THR A CB  1 
ATOM 1219  O OG1 . THR A 1 159 ? -3.615  -10.471 114.219  1.00 10.00 ? ? ? ? ? ? 160 THR A OG1 1 
ATOM 1220  C CG2 . THR A 1 159 ? -3.302  -11.019 116.440  1.00 10.00 ? ? ? ? ? ? 160 THR A CG2 1 
ATOM 1221  N N   . HIS A 1 160 ? -6.130  -10.491 118.047  1.00 10.00 ? ? ? ? ? ? 161 HIS A N   1 
ATOM 1222  C CA  . HIS A 1 160 ? -6.278  -10.116 119.448  1.00 10.00 ? ? ? ? ? ? 161 HIS A CA  1 
ATOM 1223  C C   . HIS A 1 160 ? -5.617  -11.151 120.312  1.00 10.00 ? ? ? ? ? ? 161 HIS A C   1 
ATOM 1224  O O   . HIS A 1 160 ? -5.508  -12.339 119.940  1.00 10.00 ? ? ? ? ? ? 161 HIS A O   1 
ATOM 1225  C CB  . HIS A 1 160 ? -7.670  -10.113 120.008  1.00 10.00 ? ? ? ? ? ? 161 HIS A CB  1 
ATOM 1226  C CG  . HIS A 1 160 ? -8.611  -9.048  119.545  1.00 10.00 ? ? ? ? ? ? 161 HIS A CG  1 
ATOM 1227  N ND1 . HIS A 1 160 ? -9.236  -8.946  118.383  1.00 10.00 ? ? ? ? ? ? 161 HIS A ND1 1 
ATOM 1228  C CD2 . HIS A 1 160 ? -8.994  -8.017  120.353  1.00 10.00 ? ? ? ? ? ? 161 HIS A CD2 1 
ATOM 1229  C CE1 . HIS A 1 160 ? -9.998  -7.887  118.448  1.00 10.00 ? ? ? ? ? ? 161 HIS A CE1 1 
ATOM 1230  N NE2 . HIS A 1 160 ? -9.847  -7.336  119.632  1.00 10.00 ? ? ? ? ? ? 161 HIS A NE2 1 
ATOM 1231  N N   . THR A 1 161 ? -5.162  -10.634 121.439  1.00 10.00 ? ? ? ? ? ? 162 THR A N   1 
ATOM 1232  C CA  . THR A 1 161 ? -4.672  -11.476 122.500  1.00 10.00 ? ? ? ? ? ? 162 THR A CA  1 
ATOM 1233  C C   . THR A 1 161 ? -5.769  -11.315 123.590  1.00 10.00 ? ? ? ? ? ? 162 THR A C   1 
ATOM 1234  O O   . THR A 1 161 ? -6.208  -10.196 123.916  1.00 10.00 ? ? ? ? ? ? 162 THR A O   1 
ATOM 1235  C CB  . THR A 1 161 ? -3.285  -10.932 122.783  1.00 10.00 ? ? ? ? ? ? 162 THR A CB  1 
ATOM 1236  O OG1 . THR A 1 161 ? -3.255  -9.513  122.844  1.00 10.00 ? ? ? ? ? ? 162 THR A OG1 1 
ATOM 1237  C CG2 . THR A 1 161 ? -2.417  -11.434 121.665  1.00 10.00 ? ? ? ? ? ? 162 THR A CG2 1 
ATOM 1238  N N   . VAL A 1 162 ? -6.323  -12.440 124.083  1.00 10.00 ? ? ? ? ? ? 163 VAL A N   1 
ATOM 1239  C CA  . VAL A 1 162 ? -7.480  -12.445 124.948  1.00 10.00 ? ? ? ? ? ? 163 VAL A CA  1 
ATOM 1240  C C   . VAL A 1 162 ? -7.008  -13.256 126.129  1.00 10.00 ? ? ? ? ? ? 163 VAL A C   1 
ATOM 1241  O O   . VAL A 1 162 ? -6.757  -14.439 125.872  1.00 10.00 ? ? ? ? ? ? 163 VAL A O   1 
ATOM 1242  C CB  . VAL A 1 162 ? -8.668  -13.123 124.140  1.00 10.00 ? ? ? ? ? ? 163 VAL A CB  1 
ATOM 1243  C CG1 . VAL A 1 162 ? -9.957  -13.255 124.920  1.00 10.00 ? ? ? ? ? ? 163 VAL A CG1 1 
ATOM 1244  C CG2 . VAL A 1 162 ? -9.120  -12.194 123.029  1.00 10.00 ? ? ? ? ? ? 163 VAL A CG2 1 
ATOM 1245  N N   . PRO A 1 163 ? -6.820  -12.798 127.379  1.00 10.00 ? ? ? ? ? ? 164 PRO A N   1 
ATOM 1246  C CA  . PRO A 1 163 ? -6.684  -13.676 128.535  1.00 10.00 ? ? ? ? ? ? 164 PRO A CA  1 
ATOM 1247  C C   . PRO A 1 163 ? -8.036  -14.220 129.040  1.00 10.00 ? ? ? ? ? ? 164 PRO A C   1 
ATOM 1248  O O   . PRO A 1 163 ? -8.982  -13.460 129.188  1.00 10.00 ? ? ? ? ? ? 164 PRO A O   1 
ATOM 1249  C CB  . PRO A 1 163 ? -5.936  -12.817 129.535  1.00 10.00 ? ? ? ? ? ? 164 PRO A CB  1 
ATOM 1250  C CG  . PRO A 1 163 ? -5.560  -11.565 128.831  1.00 10.00 ? ? ? ? ? ? 164 PRO A CG  1 
ATOM 1251  C CD  . PRO A 1 163 ? -6.629  -11.417 127.790  1.00 10.00 ? ? ? ? ? ? 164 PRO A CD  1 
ATOM 1252  N N   . ILE A 1 164 ? -8.198  -15.508 129.265  1.00 10.00 ? ? ? ? ? ? 165 ILE A N   1 
ATOM 1253  C CA  . ILE A 1 164 ? -9.431  -16.130 129.681  1.00 10.00 ? ? ? ? ? ? 165 ILE A CA  1 
ATOM 1254  C C   . ILE A 1 164 ? -9.202  -16.832 131.027  1.00 10.00 ? ? ? ? ? ? 165 ILE A C   1 
ATOM 1255  O O   . ILE A 1 164 ? -8.323  -17.683 131.151  1.00 10.00 ? ? ? ? ? ? 165 ILE A O   1 
ATOM 1256  C CB  . ILE A 1 164 ? -9.853  -17.128 128.590  1.00 10.00 ? ? ? ? ? ? 165 ILE A CB  1 
ATOM 1257  C CG1 . ILE A 1 164 ? -10.257 -16.273 127.418  1.00 10.00 ? ? ? ? ? ? 165 ILE A CG1 1 
ATOM 1258  C CG2 . ILE A 1 164 ? -10.947 -18.126 129.025  1.00 10.00 ? ? ? ? ? ? 165 ILE A CG2 1 
ATOM 1259  C CD1 . ILE A 1 164 ? -9.953  -16.996 126.099  1.00 10.00 ? ? ? ? ? ? 165 ILE A CD1 1 
ATOM 1260  N N   . TYR A 1 165 ? -9.968  -16.484 132.063  1.00 10.00 ? ? ? ? ? ? 166 TYR A N   1 
ATOM 1261  C CA  . TYR A 1 165 ? -9.964  -17.123 133.369  1.00 10.00 ? ? ? ? ? ? 166 TYR A CA  1 
ATOM 1262  C C   . TYR A 1 165 ? -11.301 -17.854 133.485  1.00 10.00 ? ? ? ? ? ? 166 TYR A C   1 
ATOM 1263  O O   . TYR A 1 165 ? -12.381 -17.255 133.466  1.00 10.00 ? ? ? ? ? ? 166 TYR A O   1 
ATOM 1264  C CB  . TYR A 1 165 ? -9.874  -16.079 134.471  1.00 10.00 ? ? ? ? ? ? 166 TYR A CB  1 
ATOM 1265  C CG  . TYR A 1 165 ? -10.004 -16.596 135.900  1.00 10.00 ? ? ? ? ? ? 166 TYR A CG  1 
ATOM 1266  C CD1 . TYR A 1 165 ? -9.475  -17.816 136.222  1.00 10.00 ? ? ? ? ? ? 166 TYR A CD1 1 
ATOM 1267  C CD2 . TYR A 1 165 ? -10.665 -15.852 136.853  1.00 10.00 ? ? ? ? ? ? 166 TYR A CD2 1 
ATOM 1268  C CE1 . TYR A 1 165 ? -9.592  -18.326 137.481  1.00 10.00 ? ? ? ? ? ? 166 TYR A CE1 1 
ATOM 1269  C CE2 . TYR A 1 165 ? -10.784 -16.354 138.120  1.00 10.00 ? ? ? ? ? ? 166 TYR A CE2 1 
ATOM 1270  C CZ  . TYR A 1 165 ? -10.236 -17.581 138.410  1.00 10.00 ? ? ? ? ? ? 166 TYR A CZ  1 
ATOM 1271  O OH  . TYR A 1 165 ? -10.246 -18.084 139.674  1.00 10.00 ? ? ? ? ? ? 166 TYR A OH  1 
ATOM 1272  N N   . GLU A 1 166 ? -11.199 -19.171 133.530  1.00 10.00 ? ? ? ? ? ? 167 GLU A N   1 
ATOM 1273  C CA  . GLU A 1 166 ? -12.310 -20.048 133.684  1.00 10.00 ? ? ? ? ? ? 167 GLU A CA  1 
ATOM 1274  C C   . GLU A 1 166 ? -13.425 -19.901 132.647  1.00 10.00 ? ? ? ? ? ? 167 GLU A C   1 
ATOM 1275  O O   . GLU A 1 166 ? -14.595 -19.992 133.002  1.00 10.00 ? ? ? ? ? ? 167 GLU A O   1 
ATOM 1276  C CB  . GLU A 1 166 ? -12.817 -19.834 135.080  1.00 10.00 ? ? ? ? ? ? 167 GLU A CB  1 
ATOM 1277  C CG  . GLU A 1 166 ? -11.973 -20.345 136.210  1.00 10.00 ? ? ? ? ? ? 167 GLU A CG  1 
ATOM 1278  C CD  . GLU A 1 166 ? -11.743 -21.843 136.226  1.00 10.00 ? ? ? ? ? ? 167 GLU A CD  1 
ATOM 1279  O OE1 . GLU A 1 166 ? -12.485 -22.596 135.576  1.00 10.00 ? ? ? ? ? ? 167 GLU A OE1 1 
ATOM 1280  O OE2 . GLU A 1 166 ? -10.800 -22.261 136.909  1.00 10.00 ? ? ? ? ? ? 167 GLU A OE2 1 
ATOM 1281  N N   . GLY A 1 167 ? -13.141 -19.770 131.354  1.00 10.00 ? ? ? ? ? ? 168 GLY A N   1 
ATOM 1282  C CA  . GLY A 1 167 ? -14.149 -19.588 130.319  1.00 10.00 ? ? ? ? ? ? 168 GLY A CA  1 
ATOM 1283  C C   . GLY A 1 167 ? -14.636 -18.143 130.109  1.00 10.00 ? ? ? ? ? ? 168 GLY A C   1 
ATOM 1284  O O   . GLY A 1 167 ? -15.612 -17.868 129.391  1.00 10.00 ? ? ? ? ? ? 168 GLY A O   1 
ATOM 1285  N N   . TYR A 1 168 ? -13.947 -17.172 130.694  1.00 10.00 ? ? ? ? ? ? 169 TYR A N   1 
ATOM 1286  C CA  . TYR A 1 168 ? -14.403 -15.803 130.715  1.00 10.00 ? ? ? ? ? ? 169 TYR A CA  1 
ATOM 1287  C C   . TYR A 1 168 ? -13.216 -14.985 130.295  1.00 10.00 ? ? ? ? ? ? 169 TYR A C   1 
ATOM 1288  O O   . TYR A 1 168 ? -12.149 -15.058 130.903  1.00 10.00 ? ? ? ? ? ? 169 TYR A O   1 
ATOM 1289  C CB  . TYR A 1 168 ? -14.851 -15.367 132.147  1.00 10.00 ? ? ? ? ? ? 169 TYR A CB  1 
ATOM 1290  C CG  . TYR A 1 168 ? -16.085 -16.116 132.706  1.00 10.00 ? ? ? ? ? ? 169 TYR A CG  1 
ATOM 1291  C CD1 . TYR A 1 168 ? -17.344 -15.820 132.230  1.00 10.00 ? ? ? ? ? ? 169 TYR A CD1 1 
ATOM 1292  C CD2 . TYR A 1 168 ? -15.923 -17.155 133.617  1.00 10.00 ? ? ? ? ? ? 169 TYR A CD2 1 
ATOM 1293  C CE1 . TYR A 1 168 ? -18.425 -16.540 132.623  1.00 10.00 ? ? ? ? ? ? 169 TYR A CE1 1 
ATOM 1294  C CE2 . TYR A 1 168 ? -17.008 -17.893 134.021  1.00 10.00 ? ? ? ? ? ? 169 TYR A CE2 1 
ATOM 1295  C CZ  . TYR A 1 168 ? -18.242 -17.561 133.508  1.00 10.00 ? ? ? ? ? ? 169 TYR A CZ  1 
ATOM 1296  O OH  . TYR A 1 168 ? -19.363 -18.269 133.923  1.00 10.00 ? ? ? ? ? ? 169 TYR A OH  1 
ATOM 1297  N N   . ALA A 1 169 ? -13.421 -14.262 129.212  1.00 10.00 ? ? ? ? ? ? 170 ALA A N   1 
ATOM 1298  C CA  . ALA A 1 169 ? -12.422 -13.410 128.605  1.00 10.00 ? ? ? ? ? ? 170 ALA A CA  1 
ATOM 1299  C C   . ALA A 1 169 ? -12.233 -12.229 129.520  1.00 10.00 ? ? ? ? ? ? 170 ALA A C   1 
ATOM 1300  O O   . ALA A 1 169 ? -13.228 -11.722 130.039  1.00 10.00 ? ? ? ? ? ? 170 ALA A O   1 
ATOM 1301  C CB  . ALA A 1 169 ? -12.874 -12.881 127.249  1.00 10.00 ? ? ? ? ? ? 170 ALA A CB  1 
ATOM 1302  N N   . LEU A 1 170 ? -11.025 -11.707 129.692  1.00 10.00 ? ? ? ? ? ? 171 LEU A N   1 
ATOM 1303  C CA  . LEU A 1 170 ? -10.885 -10.614 130.604  1.00 10.00 ? ? ? ? ? ? 171 LEU A CA  1 
ATOM 1304  C C   . LEU A 1 170 ? -10.790 -9.315  129.804  1.00 10.00 ? ? ? ? ? ? 171 LEU A C   1 
ATOM 1305  O O   . LEU A 1 170 ? -9.684  -8.844  129.542  1.00 10.00 ? ? ? ? ? ? 171 LEU A O   1 
ATOM 1306  C CB  . LEU A 1 170 ? -9.646  -10.940 131.491  1.00 10.00 ? ? ? ? ? ? 171 LEU A CB  1 
ATOM 1307  C CG  . LEU A 1 170 ? -9.668  -12.300 132.294  1.00 10.00 ? ? ? ? ? ? 171 LEU A CG  1 
ATOM 1308  C CD1 . LEU A 1 170 ? -8.329  -12.474 133.008  1.00 10.00 ? ? ? ? ? ? 171 LEU A CD1 1 
ATOM 1309  C CD2 . LEU A 1 170 ? -10.831 -12.358 133.269  1.00 10.00 ? ? ? ? ? ? 171 LEU A CD2 1 
ATOM 1310  N N   . PRO A 1 171 ? -11.879 -8.604  129.486  1.00 10.00 ? ? ? ? ? ? 172 PRO A N   1 
ATOM 1311  C CA  . PRO A 1 171 ? -11.928 -7.491  128.540  1.00 10.00 ? ? ? ? ? ? 172 PRO A CA  1 
ATOM 1312  C C   . PRO A 1 171 ? -10.915 -6.370  128.772  1.00 10.00 ? ? ? ? ? ? 172 PRO A C   1 
ATOM 1313  O O   . PRO A 1 171 ? -10.429 -5.743  127.824  1.00 10.00 ? ? ? ? ? ? 172 PRO A O   1 
ATOM 1314  C CB  . PRO A 1 171 ? -13.311 -6.966  128.608  1.00 10.00 ? ? ? ? ? ? 172 PRO A CB  1 
ATOM 1315  C CG  . PRO A 1 171 ? -13.989 -8.172  129.093  1.00 10.00 ? ? ? ? ? ? 172 PRO A CG  1 
ATOM 1316  C CD  . PRO A 1 171 ? -13.127 -8.676  130.194  1.00 10.00 ? ? ? ? ? ? 172 PRO A CD  1 
ATOM 1317  N N   . HIS A 1 172 ? -10.568 -6.017  130.012  1.00 10.00 ? ? ? ? ? ? 173 HIS A N   1 
ATOM 1318  C CA  . HIS A 1 172 ? -9.492  -5.035  130.193  1.00 10.00 ? ? ? ? ? ? 173 HIS A CA  1 
ATOM 1319  C C   . HIS A 1 172 ? -8.104  -5.415  129.603  1.00 10.00 ? ? ? ? ? ? 173 HIS A C   1 
ATOM 1320  O O   . HIS A 1 172 ? -7.308  -4.552  129.189  1.00 10.00 ? ? ? ? ? ? 173 HIS A O   1 
ATOM 1321  C CB  . HIS A 1 172 ? -9.349  -4.769  131.686  1.00 10.00 ? ? ? ? ? ? 173 HIS A CB  1 
ATOM 1322  C CG  . HIS A 1 172 ? -9.045  -6.069  132.399  1.00 10.00 ? ? ? ? ? ? 173 HIS A CG  1 
ATOM 1323  N ND1 . HIS A 1 172 ? -9.819  -7.160  132.505  1.00 10.00 ? ? ? ? ? ? 173 HIS A ND1 1 
ATOM 1324  C CD2 . HIS A 1 172 ? -7.865  -6.275  133.082  1.00 10.00 ? ? ? ? ? ? 173 HIS A CD2 1 
ATOM 1325  C CE1 . HIS A 1 172 ? -9.114  -8.018  133.247  1.00 10.00 ? ? ? ? ? ? 173 HIS A CE1 1 
ATOM 1326  N NE2 . HIS A 1 172 ? -7.954  -7.484  133.589  1.00 10.00 ? ? ? ? ? ? 173 HIS A NE2 1 
ATOM 1327  N N   . ALA A 1 173 ? -7.771  -6.718  129.586  1.00 10.00 ? ? ? ? ? ? 174 ALA A N   1 
ATOM 1328  C CA  . ALA A 1 173 ? -6.446  -7.113  129.171  1.00 10.00 ? ? ? ? ? ? 174 ALA A CA  1 
ATOM 1329  C C   . ALA A 1 173 ? -6.461  -7.548  127.727  1.00 10.00 ? ? ? ? ? ? 174 ALA A C   1 
ATOM 1330  O O   . ALA A 1 173 ? -5.403  -7.958  127.251  1.00 10.00 ? ? ? ? ? ? 174 ALA A O   1 
ATOM 1331  C CB  . ALA A 1 173 ? -5.935  -8.254  130.041  1.00 10.00 ? ? ? ? ? ? 174 ALA A CB  1 
ATOM 1332  N N   . ILE A 1 174 ? -7.609  -7.477  127.007  1.00 10.00 ? ? ? ? ? ? 175 ILE A N   1 
ATOM 1333  C CA  . ILE A 1 174 ? -7.711  -7.835  125.593  1.00 10.00 ? ? ? ? ? ? 175 ILE A CA  1 
ATOM 1334  C C   . ILE A 1 174 ? -7.041  -6.686  124.838  1.00 10.00 ? ? ? ? ? ? 175 ILE A C   1 
ATOM 1335  O O   . ILE A 1 174 ? -7.154  -5.493  125.164  1.00 10.00 ? ? ? ? ? ? 175 ILE A O   1 
ATOM 1336  C CB  . ILE A 1 174 ? -9.188  -7.978  125.125  1.00 10.00 ? ? ? ? ? ? 175 ILE A CB  1 
ATOM 1337  C CG1 . ILE A 1 174 ? -9.798  -9.266  125.666  1.00 10.00 ? ? ? ? ? ? 175 ILE A CG1 1 
ATOM 1338  C CG2 . ILE A 1 174 ? -9.254  -8.119  123.606  1.00 10.00 ? ? ? ? ? ? 175 ILE A CG2 1 
ATOM 1339  C CD1 . ILE A 1 174 ? -11.290 -9.390  125.310  1.00 10.00 ? ? ? ? ? ? 175 ILE A CD1 1 
ATOM 1340  N N   . LEU A 1 175 ? -6.271  -7.071  123.832  1.00 10.00 ? ? ? ? ? ? 176 LEU A N   1 
ATOM 1341  C CA  . LEU A 1 175 ? -5.498  -6.146  123.023  1.00 10.00 ? ? ? ? ? ? 176 LEU A CA  1 
ATOM 1342  C C   . LEU A 1 175 ? -5.780  -6.575  121.583  1.00 10.00 ? ? ? ? ? ? 176 LEU A C   1 
ATOM 1343  O O   . LEU A 1 175 ? -5.967  -7.761  121.267  1.00 10.00 ? ? ? ? ? ? 176 LEU A O   1 
ATOM 1344  C CB  . LEU A 1 175 ? -4.011  -6.279  123.492  1.00 10.00 ? ? ? ? ? ? 176 LEU A CB  1 
ATOM 1345  C CG  . LEU A 1 175 ? -3.549  -5.671  124.823  1.00 10.00 ? ? ? ? ? ? 176 LEU A CG  1 
ATOM 1346  C CD1 . LEU A 1 175 ? -2.156  -6.032  125.205  1.00 10.00 ? ? ? ? ? ? 176 LEU A CD1 1 
ATOM 1347  C CD2 . LEU A 1 175 ? -3.367  -4.231  124.636  1.00 10.00 ? ? ? ? ? ? 176 LEU A CD2 1 
ATOM 1348  N N   . ARG A 1 176 ? -5.956  -5.567  120.740  1.00 10.00 ? ? ? ? ? ? 177 ARG A N   1 
ATOM 1349  C CA  . ARG A 1 176 ? -6.340  -5.674  119.323  1.00 10.00 ? ? ? ? ? ? 177 ARG A CA  1 
ATOM 1350  C C   . ARG A 1 176 ? -5.246  -5.105  118.469  1.00 10.00 ? ? ? ? ? ? 177 ARG A C   1 
ATOM 1351  O O   . ARG A 1 176 ? -4.767  -4.009  118.772  1.00 10.00 ? ? ? ? ? ? 177 ARG A O   1 
ATOM 1352  C CB  . ARG A 1 176 ? -7.659  -4.895  119.055  1.00 10.00 ? ? ? ? ? ? 177 ARG A CB  1 
ATOM 1353  C CG  . ARG A 1 176 ? -7.834  -4.126  117.759  1.00 10.00 ? ? ? ? ? ? 177 ARG A CG  1 
ATOM 1354  C CD  . ARG A 1 176 ? -9.240  -4.313  117.225  1.00 10.00 ? ? ? ? ? ? 177 ARG A CD  1 
ATOM 1355  N NE  . ARG A 1 176 ? -9.694  -3.234  116.338  1.00 10.00 ? ? ? ? ? ? 177 ARG A NE  1 
ATOM 1356  C CZ  . ARG A 1 176 ? -10.905 -3.303  115.743  1.00 10.00 ? ? ? ? ? ? 177 ARG A CZ  1 
ATOM 1357  N NH1 . ARG A 1 176 ? -11.660 -4.408  115.880  1.00 10.00 ? ? ? ? ? ? 177 ARG A NH1 1 
ATOM 1358  N NH2 . ARG A 1 176 ? -11.363 -2.316  114.948  1.00 10.00 ? ? ? ? ? ? 177 ARG A NH2 1 
ATOM 1359  N N   . LEU A 1 177 ? -4.939  -5.840  117.403  1.00 10.00 ? ? ? ? ? ? 178 LEU A N   1 
ATOM 1360  C CA  . LEU A 1 177 ? -3.889  -5.483  116.460  1.00 10.00 ? ? ? ? ? ? 178 LEU A CA  1 
ATOM 1361  C C   . LEU A 1 177 ? -4.509  -5.626  115.094  1.00 10.00 ? ? ? ? ? ? 178 LEU A C   1 
ATOM 1362  O O   . LEU A 1 177 ? -5.051  -6.664  114.675  1.00 10.00 ? ? ? ? ? ? 178 LEU A O   1 
ATOM 1363  C CB  . LEU A 1 177 ? -2.687  -6.426  116.536  1.00 10.00 ? ? ? ? ? ? 178 LEU A CB  1 
ATOM 1364  C CG  . LEU A 1 177 ? -1.295  -5.809  116.524  1.00 10.00 ? ? ? ? ? ? 178 LEU A CG  1 
ATOM 1365  C CD1 . LEU A 1 177 ? -0.374  -6.716  117.304  1.00 10.00 ? ? ? ? ? ? 178 LEU A CD1 1 
ATOM 1366  C CD2 . LEU A 1 177 ? -0.844  -5.545  115.100  1.00 10.00 ? ? ? ? ? ? 178 LEU A CD2 1 
ATOM 1367  N N   . ASP A 1 178 ? -4.392  -4.497  114.422  1.00 10.00 ? ? ? ? ? ? 179 ASP A N   1 
ATOM 1368  C CA  . ASP A 1 178 ? -4.963  -4.440  113.115  1.00 10.00 ? ? ? ? ? ? 179 ASP A CA  1 
ATOM 1369  C C   . ASP A 1 178 ? -3.905  -4.684  112.054  1.00 10.00 ? ? ? ? ? ? 179 ASP A C   1 
ATOM 1370  O O   . ASP A 1 178 ? -3.352  -3.817  111.359  1.00 10.00 ? ? ? ? ? ? 179 ASP A O   1 
ATOM 1371  C CB  . ASP A 1 178 ? -5.700  -3.070  113.052  1.00 10.00 ? ? ? ? ? ? 179 ASP A CB  1 
ATOM 1372  C CG  . ASP A 1 178 ? -7.118  -3.089  113.700  1.00 10.00 ? ? ? ? ? ? 179 ASP A CG  1 
ATOM 1373  O OD1 . ASP A 1 178 ? -7.533  -4.130  114.221  1.00 10.00 ? ? ? ? ? ? 179 ASP A OD1 1 
ATOM 1374  O OD2 . ASP A 1 178 ? -7.825  -2.071  113.692  1.00 10.00 ? ? ? ? ? ? 179 ASP A OD2 1 
ATOM 1375  N N   . LEU A 1 179 ? -3.591  -5.960  112.024  1.00 10.00 ? ? ? ? ? ? 180 LEU A N   1 
ATOM 1376  C CA  . LEU A 1 179 ? -2.646  -6.502  111.083  1.00 10.00 ? ? ? ? ? ? 180 LEU A CA  1 
ATOM 1377  C C   . LEU A 1 179 ? -2.901  -8.000  111.178  1.00 10.00 ? ? ? ? ? ? 180 LEU A C   1 
ATOM 1378  O O   . LEU A 1 179 ? -2.800  -8.610  112.246  1.00 10.00 ? ? ? ? ? ? 180 LEU A O   1 
ATOM 1379  C CB  . LEU A 1 179 ? -1.243  -6.089  111.517  1.00 10.00 ? ? ? ? ? ? 180 LEU A CB  1 
ATOM 1380  C CG  . LEU A 1 179 ? -0.086  -7.051  111.498  1.00 10.00 ? ? ? ? ? ? 180 LEU A CG  1 
ATOM 1381  C CD1 . LEU A 1 179 ? 0.297   -7.477  110.109  1.00 10.00 ? ? ? ? ? ? 180 LEU A CD1 1 
ATOM 1382  C CD2 . LEU A 1 179 ? 1.100   -6.330  112.056  1.00 10.00 ? ? ? ? ? ? 180 LEU A CD2 1 
ATOM 1383  N N   . ALA A 1 180 ? -3.331  -8.572  110.069  1.00 10.00 ? ? ? ? ? ? 181 ALA A N   1 
ATOM 1384  C CA  . ALA A 1 180 ? -3.651  -9.980  110.015  1.00 10.00 ? ? ? ? ? ? 181 ALA A CA  1 
ATOM 1385  C C   . ALA A 1 180 ? -3.505  -10.423 108.566  1.00 10.00 ? ? ? ? ? ? 181 ALA A C   1 
ATOM 1386  O O   . ALA A 1 180 ? -3.001  -9.572  107.820  1.00 10.00 ? ? ? ? ? ? 181 ALA A O   1 
ATOM 1387  C CB  . ALA A 1 180 ? -5.057  -10.182 110.424  1.00 10.00 ? ? ? ? ? ? 181 ALA A CB  1 
ATOM 1388  N N   . GLY A 1 181 ? -3.968  -11.617 108.137  1.00 10.00 ? ? ? ? ? ? 182 GLY A N   1 
ATOM 1389  C CA  . GLY A 1 181 ? -3.820  -12.145 106.792  1.00 10.00 ? ? ? ? ? ? 182 GLY A CA  1 
ATOM 1390  C C   . GLY A 1 181 ? -3.898  -11.196 105.574  1.00 10.00 ? ? ? ? ? ? 182 GLY A C   1 
ATOM 1391  O O   . GLY A 1 181 ? -3.132  -11.345 104.605  1.00 10.00 ? ? ? ? ? ? 182 GLY A O   1 
ATOM 1392  N N   . ARG A 1 182 ? -4.757  -10.187 105.525  1.00 10.00 ? ? ? ? ? ? 183 ARG A N   1 
ATOM 1393  C CA  . ARG A 1 182 ? -4.857  -9.335  104.350  1.00 10.00 ? ? ? ? ? ? 183 ARG A CA  1 
ATOM 1394  C C   . ARG A 1 182 ? -3.640  -8.417  104.254  1.00 10.00 ? ? ? ? ? ? 183 ARG A C   1 
ATOM 1395  O O   . ARG A 1 182 ? -3.102  -8.122  103.181  1.00 10.00 ? ? ? ? ? ? 183 ARG A O   1 
ATOM 1396  C CB  . ARG A 1 182 ? -6.141  -8.540  104.467  1.00 10.00 ? ? ? ? ? ? 183 ARG A CB  1 
ATOM 1397  C CG  . ARG A 1 182 ? -6.983  -8.313  103.234  1.00 10.00 ? ? ? ? ? ? 183 ARG A CG  1 
ATOM 1398  C CD  . ARG A 1 182 ? -8.373  -7.839  103.770  1.00 10.00 ? ? ? ? ? ? 183 ARG A CD  1 
ATOM 1399  N NE  . ARG A 1 182 ? -8.345  -6.534  104.468  1.00 10.00 ? ? ? ? ? ? 183 ARG A NE  1 
ATOM 1400  C CZ  . ARG A 1 182 ? -9.075  -5.437  104.096  1.00 10.00 ? ? ? ? ? ? 183 ARG A CZ  1 
ATOM 1401  N NH1 . ARG A 1 182 ? -9.932  -5.416  103.039  1.00 10.00 ? ? ? ? ? ? 183 ARG A NH1 1 
ATOM 1402  N NH2 . ARG A 1 182 ? -8.885  -4.290  104.773  1.00 10.00 ? ? ? ? ? ? 183 ARG A NH2 1 
ATOM 1403  N N   . ASP A 1 183 ? -3.159  -8.006  105.420  1.00 10.00 ? ? ? ? ? ? 184 ASP A N   1 
ATOM 1404  C CA  . ASP A 1 183 ? -2.003  -7.153  105.519  1.00 10.00 ? ? ? ? ? ? 184 ASP A CA  1 
ATOM 1405  C C   . ASP A 1 183 ? -0.811  -7.887  104.971  1.00 10.00 ? ? ? ? ? ? 184 ASP A C   1 
ATOM 1406  O O   . ASP A 1 183 ? 0.002   -7.293  104.268  1.00 10.00 ? ? ? ? ? ? 184 ASP A O   1 
ATOM 1407  C CB  . ASP A 1 183 ? -1.794  -6.789  106.965  1.00 10.00 ? ? ? ? ? ? 184 ASP A CB  1 
ATOM 1408  C CG  . ASP A 1 183 ? -2.951  -5.933  107.456  1.00 10.00 ? ? ? ? ? ? 184 ASP A CG  1 
ATOM 1409  O OD1 . ASP A 1 183 ? -4.015  -6.479  107.757  1.00 10.00 ? ? ? ? ? ? 184 ASP A OD1 1 
ATOM 1410  O OD2 . ASP A 1 183 ? -2.765  -4.721  107.511  1.00 10.00 ? ? ? ? ? ? 184 ASP A OD2 1 
ATOM 1411  N N   . LEU A 1 184 ? -0.757  -9.199  105.171  1.00 10.00 ? ? ? ? ? ? 185 LEU A N   1 
ATOM 1412  C CA  . LEU A 1 184 ? 0.320   -10.038 104.722  1.00 10.00 ? ? ? ? ? ? 185 LEU A CA  1 
ATOM 1413  C C   . LEU A 1 184 ? 0.171   -10.438 103.272  1.00 10.00 ? ? ? ? ? ? 185 LEU A C   1 
ATOM 1414  O O   . LEU A 1 184 ? 1.192   -10.587 102.602  1.00 10.00 ? ? ? ? ? ? 185 LEU A O   1 
ATOM 1415  C CB  . LEU A 1 184 ? 0.357   -11.210 105.635  1.00 10.00 ? ? ? ? ? ? 185 LEU A CB  1 
ATOM 1416  C CG  . LEU A 1 184 ? 1.445   -11.271 106.711  1.00 10.00 ? ? ? ? ? ? 185 LEU A CG  1 
ATOM 1417  C CD1 . LEU A 1 184 ? 1.643   -10.058 107.549  1.00 10.00 ? ? ? ? ? ? 185 LEU A CD1 1 
ATOM 1418  C CD2 . LEU A 1 184 ? 0.962   -12.331 107.648  1.00 10.00 ? ? ? ? ? ? 185 LEU A CD2 1 
ATOM 1419  N N   . THR A 1 185 ? -1.008  -10.618 102.686  1.00 10.00 ? ? ? ? ? ? 186 THR A N   1 
ATOM 1420  C CA  . THR A 1 185 ? -1.157  -10.829 101.238  1.00 10.00 ? ? ? ? ? ? 186 THR A CA  1 
ATOM 1421  C C   . THR A 1 185 ? -0.723  -9.610  100.440  1.00 10.00 ? ? ? ? ? ? 186 THR A C   1 
ATOM 1422  O O   . THR A 1 185 ? -0.032  -9.701  99.433   1.00 10.00 ? ? ? ? ? ? 186 THR A O   1 
ATOM 1423  C CB  . THR A 1 185 ? -2.618  -11.154 100.904  1.00 10.00 ? ? ? ? ? ? 186 THR A CB  1 
ATOM 1424  O OG1 . THR A 1 185 ? -2.927  -12.355 101.622  1.00 10.00 ? ? ? ? ? ? 186 THR A OG1 1 
ATOM 1425  C CG2 . THR A 1 185 ? -2.865  -11.362 99.437   1.00 10.00 ? ? ? ? ? ? 186 THR A CG2 1 
ATOM 1426  N N   . ASP A 1 186 ? -1.107  -8.456  100.941  1.00 10.00 ? ? ? ? ? ? 187 ASP A N   1 
ATOM 1427  C CA  . ASP A 1 186 ? -0.752  -7.185  100.393  1.00 10.00 ? ? ? ? ? ? 187 ASP A CA  1 
ATOM 1428  C C   . ASP A 1 186 ? 0.713   -6.814  100.367  1.00 10.00 ? ? ? ? ? ? 187 ASP A C   1 
ATOM 1429  O O   . ASP A 1 186 ? 1.178   -6.129  99.448   1.00 10.00 ? ? ? ? ? ? 187 ASP A O   1 
ATOM 1430  C CB  . ASP A 1 186 ? -1.447  -6.119  101.151  1.00 10.00 ? ? ? ? ? ? 187 ASP A CB  1 
ATOM 1431  C CG  . ASP A 1 186 ? -2.848  -5.923  100.717  1.00 10.00 ? ? ? ? ? ? 187 ASP A CG  1 
ATOM 1432  O OD1 . ASP A 1 186 ? -3.302  -6.573  99.788   1.00 10.00 ? ? ? ? ? ? 187 ASP A OD1 1 
ATOM 1433  O OD2 . ASP A 1 186 ? -3.510  -5.091  101.316  1.00 10.00 ? ? ? ? ? ? 187 ASP A OD2 1 
ATOM 1434  N N   . TYR A 1 187 ? 1.398   -7.147  101.464  1.00 10.00 ? ? ? ? ? ? 188 TYR A N   1 
ATOM 1435  C CA  . TYR A 1 187 ? 2.803   -6.848  101.590  1.00 10.00 ? ? ? ? ? ? 188 TYR A CA  1 
ATOM 1436  C C   . TYR A 1 187 ? 3.634   -7.812  100.775  1.00 10.00 ? ? ? ? ? ? 188 TYR A C   1 
ATOM 1437  O O   . TYR A 1 187 ? 4.722   -7.450  100.326  1.00 10.00 ? ? ? ? ? ? 188 TYR A O   1 
ATOM 1438  C CB  . TYR A 1 187 ? 3.125   -6.916  103.040  1.00 10.00 ? ? ? ? ? ? 188 TYR A CB  1 
ATOM 1439  C CG  . TYR A 1 187 ? 4.568   -6.714  103.344  1.00 10.00 ? ? ? ? ? ? 188 TYR A CG  1 
ATOM 1440  C CD1 . TYR A 1 187 ? 5.195   -5.524  103.087  1.00 10.00 ? ? ? ? ? ? 188 TYR A CD1 1 
ATOM 1441  C CD2 . TYR A 1 187 ? 5.220   -7.759  103.913  1.00 10.00 ? ? ? ? ? ? 188 TYR A CD2 1 
ATOM 1442  C CE1 . TYR A 1 187 ? 6.532   -5.382  103.424  1.00 10.00 ? ? ? ? ? ? 188 TYR A CE1 1 
ATOM 1443  C CE2 . TYR A 1 187 ? 6.549   -7.625  104.251  1.00 10.00 ? ? ? ? ? ? 188 TYR A CE2 1 
ATOM 1444  C CZ  . TYR A 1 187 ? 7.209   -6.442  104.011  1.00 10.00 ? ? ? ? ? ? 188 TYR A CZ  1 
ATOM 1445  O OH  . TYR A 1 187 ? 8.549   -6.350  104.388  1.00 10.00 ? ? ? ? ? ? 188 TYR A OH  1 
ATOM 1446  N N   . LEU A 1 188 ? 3.131   -9.015  100.563  1.00 10.00 ? ? ? ? ? ? 189 LEU A N   1 
ATOM 1447  C CA  . LEU A 1 188 ? 3.791   -10.003 99.740   1.00 10.00 ? ? ? ? ? ? 189 LEU A CA  1 
ATOM 1448  C C   . LEU A 1 188 ? 3.795   -9.511  98.298   1.00 10.00 ? ? ? ? ? ? 189 LEU A C   1 
ATOM 1449  O O   . LEU A 1 188 ? 4.836   -9.550  97.644   1.00 10.00 ? ? ? ? ? ? 189 LEU A O   1 
ATOM 1450  C CB  . LEU A 1 188 ? 3.040   -11.327 99.826   1.00 10.00 ? ? ? ? ? ? 189 LEU A CB  1 
ATOM 1451  C CG  . LEU A 1 188 ? 3.485   -12.408 98.849   1.00 10.00 ? ? ? ? ? ? 189 LEU A CG  1 
ATOM 1452  C CD1 . LEU A 1 188 ? 4.768   -13.032 99.362   1.00 10.00 ? ? ? ? ? ? 189 LEU A CD1 1 
ATOM 1453  C CD2 . LEU A 1 188 ? 2.390   -13.442 98.666   1.00 10.00 ? ? ? ? ? ? 189 LEU A CD2 1 
ATOM 1454  N N   . MET A 1 189 ? 2.642   -9.056  97.771   1.00 10.00 ? ? ? ? ? ? 190 MET A N   1 
ATOM 1455  C CA  . MET A 1 189 ? 2.458   -8.586  96.380   1.00 10.00 ? ? ? ? ? ? 190 MET A CA  1 
ATOM 1456  C C   . MET A 1 189 ? 3.349   -7.399  96.081   1.00 10.00 ? ? ? ? ? ? 190 MET A C   1 
ATOM 1457  O O   . MET A 1 189 ? 3.888   -7.365  94.978   1.00 10.00 ? ? ? ? ? ? 190 MET A O   1 
ATOM 1458  C CB  . MET A 1 189 ? 0.979   -8.174  96.119   1.00 10.00 ? ? ? ? ? ? 190 MET A CB  1 
ATOM 1459  C CG  . MET A 1 189 ? 0.438   -7.473  94.884   1.00 10.00 ? ? ? ? ? ? 190 MET A CG  1 
ATOM 1460  S SD  . MET A 1 189 ? -1.378  -7.712  94.775   1.00 10.00 ? ? ? ? ? ? 190 MET A SD  1 
ATOM 1461  C CE  . MET A 1 189 ? -2.006  -7.055  96.311   1.00 10.00 ? ? ? ? ? ? 190 MET A CE  1 
ATOM 1462  N N   . LYS A 1 190 ? 3.512   -6.459  97.034   1.00 10.00 ? ? ? ? ? ? 191 LYS A N   1 
ATOM 1463  C CA  . LYS A 1 190 ? 4.405   -5.317  96.901   1.00 10.00 ? ? ? ? ? ? 191 LYS A CA  1 
ATOM 1464  C C   . LYS A 1 190 ? 5.814   -5.821  96.933   1.00 10.00 ? ? ? ? ? ? 191 LYS A C   1 
ATOM 1465  O O   . LYS A 1 190 ? 6.523   -5.401  96.033   1.00 10.00 ? ? ? ? ? ? 191 LYS A O   1 
ATOM 1466  C CB  . LYS A 1 190 ? 4.296   -4.274  98.030   1.00 10.00 ? ? ? ? ? ? 191 LYS A CB  1 
ATOM 1467  C CG  . LYS A 1 190 ? 4.797   -2.923  97.523   1.00 10.00 ? ? ? ? ? ? 191 LYS A CG  1 
ATOM 1468  C CD  . LYS A 1 190 ? 4.585   -1.782  98.510   1.00 10.00 ? ? ? ? ? ? 191 LYS A CD  1 
ATOM 1469  C CE  . LYS A 1 190 ? 5.596   -1.670  99.663   1.00 10.00 ? ? ? ? ? ? 191 LYS A CE  1 
ATOM 1470  N NZ  . LYS A 1 190 ? 5.807   -2.929  100.369  1.00 10.00 ? ? ? ? ? ? 191 LYS A NZ  1 
ATOM 1471  N N   . ILE A 1 191 ? 6.276   -6.700  97.806   1.00 10.00 ? ? ? ? ? ? 192 ILE A N   1 
ATOM 1472  C CA  . ILE A 1 191 ? 7.672   -7.050  97.697   1.00 10.00 ? ? ? ? ? ? 192 ILE A CA  1 
ATOM 1473  C C   . ILE A 1 191 ? 7.836   -7.861  96.397   1.00 10.00 ? ? ? ? ? ? 192 ILE A C   1 
ATOM 1474  O O   . ILE A 1 191 ? 8.804   -7.614  95.681   1.00 10.00 ? ? ? ? ? ? 192 ILE A O   1 
ATOM 1475  C CB  . ILE A 1 191 ? 8.182   -7.806  99.057   1.00 10.00 ? ? ? ? ? ? 192 ILE A CB  1 
ATOM 1476  C CG1 . ILE A 1 191 ? 7.446   -9.074  99.581   1.00 10.00 ? ? ? ? ? ? 192 ILE A CG1 1 
ATOM 1477  C CG2 . ILE A 1 191 ? 8.026   -6.703  100.074  1.00 10.00 ? ? ? ? ? ? 192 ILE A CG2 1 
ATOM 1478  C CD1 . ILE A 1 191 ? 7.758   -9.776  100.967  1.00 10.00 ? ? ? ? ? ? 192 ILE A CD1 1 
ATOM 1479  N N   . LEU A 1 192 ? 6.892   -8.678  95.934   1.00 10.00 ? ? ? ? ? ? 193 LEU A N   1 
ATOM 1480  C CA  . LEU A 1 192 ? 6.992   -9.408  94.654   1.00 10.00 ? ? ? ? ? ? 193 LEU A CA  1 
ATOM 1481  C C   . LEU A 1 192 ? 6.999   -8.501  93.379   1.00 10.00 ? ? ? ? ? ? 193 LEU A C   1 
ATOM 1482  O O   . LEU A 1 192 ? 7.800   -8.679  92.455   1.00 10.00 ? ? ? ? ? ? 193 LEU A O   1 
ATOM 1483  C CB  . LEU A 1 192 ? 5.824   -10.403 94.653   1.00 10.00 ? ? ? ? ? ? 193 LEU A CB  1 
ATOM 1484  C CG  . LEU A 1 192 ? 6.089   -11.859 94.374   1.00 10.00 ? ? ? ? ? ? 193 LEU A CG  1 
ATOM 1485  C CD1 . LEU A 1 192 ? 7.286   -12.266 95.172   1.00 10.00 ? ? ? ? ? ? 193 LEU A CD1 1 
ATOM 1486  C CD2 . LEU A 1 192 ? 4.896   -12.721 94.717   1.00 10.00 ? ? ? ? ? ? 193 LEU A CD2 1 
ATOM 1487  N N   . THR A 1 193 ? 6.164   -7.467  93.318   1.00 10.00 ? ? ? ? ? ? 194 THR A N   1 
ATOM 1488  C CA  . THR A 1 193 ? 6.087   -6.421  92.284   1.00 10.00 ? ? ? ? ? ? 194 THR A CA  1 
ATOM 1489  C C   . THR A 1 193 ? 7.321   -5.501  92.340   1.00 10.00 ? ? ? ? ? ? 194 THR A C   1 
ATOM 1490  O O   . THR A 1 193 ? 7.722   -4.855  91.362   1.00 10.00 ? ? ? ? ? ? 194 THR A O   1 
ATOM 1491  C CB  . THR A 1 193 ? 4.725   -5.596  92.516   1.00 10.00 ? ? ? ? ? ? 194 THR A CB  1 
ATOM 1492  O OG1 . THR A 1 193 ? 3.690   -6.403  91.967   1.00 10.00 ? ? ? ? ? ? 194 THR A OG1 1 
ATOM 1493  C CG2 . THR A 1 193 ? 4.663   -4.212  91.910   1.00 10.00 ? ? ? ? ? ? 194 THR A CG2 1 
ATOM 1494  N N   . GLU A 1 194 ? 7.941   -5.374  93.525   1.00 10.00 ? ? ? ? ? ? 195 GLU A N   1 
ATOM 1495  C CA  . GLU A 1 194 ? 9.163   -4.590  93.665   1.00 10.00 ? ? ? ? ? ? 195 GLU A CA  1 
ATOM 1496  C C   . GLU A 1 194 ? 10.227  -5.350  92.905   1.00 10.00 ? ? ? ? ? ? 195 GLU A C   1 
ATOM 1497  O O   . GLU A 1 194 ? 11.014  -4.704  92.208   1.00 10.00 ? ? ? ? ? ? 195 GLU A O   1 
ATOM 1498  C CB  . GLU A 1 194 ? 9.575   -4.415  95.149   1.00 10.00 ? ? ? ? ? ? 195 GLU A CB  1 
ATOM 1499  C CG  . GLU A 1 194 ? 8.739   -3.264  95.726   1.00 10.00 ? ? ? ? ? ? 195 GLU A CG  1 
ATOM 1500  C CD  . GLU A 1 194 ? 9.049   -2.751  97.124   1.00 10.00 ? ? ? ? ? ? 195 GLU A CD  1 
ATOM 1501  O OE1 . GLU A 1 194 ? 9.468   -3.554  97.971   1.00 10.00 ? ? ? ? ? ? 195 GLU A OE1 1 
ATOM 1502  O OE2 . GLU A 1 194 ? 8.863   -1.535  97.351   1.00 10.00 ? ? ? ? ? ? 195 GLU A OE2 1 
ATOM 1503  N N   . ARG A 1 195 ? 10.178  -6.689  92.864   1.00 10.00 ? ? ? ? ? ? 196 ARG A N   1 
ATOM 1504  C CA  . ARG A 1 195 ? 11.135  -7.458  92.084   1.00 10.00 ? ? ? ? ? ? 196 ARG A CA  1 
ATOM 1505  C C   . ARG A 1 195 ? 10.782  -7.383  90.573   1.00 10.00 ? ? ? ? ? ? 196 ARG A C   1 
ATOM 1506  O O   . ARG A 1 195 ? 11.168  -8.223  89.765   1.00 10.00 ? ? ? ? ? ? 196 ARG A O   1 
ATOM 1507  C CB  . ARG A 1 195 ? 11.105  -8.893  92.698   1.00 10.00 ? ? ? ? ? ? 196 ARG A CB  1 
ATOM 1508  C CG  . ARG A 1 195 ? 12.377  -9.722  92.470   1.00 10.00 ? ? ? ? ? ? 196 ARG A CG  1 
ATOM 1509  C CD  . ARG A 1 195 ? 12.579  -10.957 93.323   1.00 10.00 ? ? ? ? ? ? 196 ARG A CD  1 
ATOM 1510  N NE  . ARG A 1 195 ? 12.700  -12.197 92.572   1.00 10.00 ? ? ? ? ? ? 196 ARG A NE  1 
ATOM 1511  C CZ  . ARG A 1 195 ? 13.227  -13.328 93.108   1.00 10.00 ? ? ? ? ? ? 196 ARG A CZ  1 
ATOM 1512  N NH1 . ARG A 1 195 ? 13.675  -13.439 94.363   1.00 10.00 ? ? ? ? ? ? 196 ARG A NH1 1 
ATOM 1513  N NH2 . ARG A 1 195 ? 13.416  -14.409 92.350   1.00 10.00 ? ? ? ? ? ? 196 ARG A NH2 1 
ATOM 1514  N N   . GLY A 1 196 ? 10.074  -6.343  90.120   1.00 10.00 ? ? ? ? ? ? 197 GLY A N   1 
ATOM 1515  C CA  . GLY A 1 196 ? 9.596   -6.224  88.760   1.00 10.00 ? ? ? ? ? ? 197 GLY A CA  1 
ATOM 1516  C C   . GLY A 1 196 ? 8.654   -7.372  88.327   1.00 10.00 ? ? ? ? ? ? 197 GLY A C   1 
ATOM 1517  O O   . GLY A 1 196 ? 8.836   -7.983  87.255   1.00 10.00 ? ? ? ? ? ? 197 GLY A O   1 
ATOM 1518  N N   . TYR A 1 197 ? 7.671   -7.742  89.155   1.00 10.00 ? ? ? ? ? ? 198 TYR A N   1 
ATOM 1519  C CA  . TYR A 1 197 ? 6.688   -8.748  88.787   1.00 10.00 ? ? ? ? ? ? 198 TYR A CA  1 
ATOM 1520  C C   . TYR A 1 197 ? 5.422   -7.974  88.529   1.00 10.00 ? ? ? ? ? ? 198 TYR A C   1 
ATOM 1521  O O   . TYR A 1 197 ? 5.262   -6.791  88.862   1.00 10.00 ? ? ? ? ? ? 198 TYR A O   1 
ATOM 1522  C CB  . TYR A 1 197 ? 6.378   -9.746  89.868   1.00 10.00 ? ? ? ? ? ? 198 TYR A CB  1 
ATOM 1523  C CG  . TYR A 1 197 ? 7.422   -10.825 89.988   1.00 10.00 ? ? ? ? ? ? 198 TYR A CG  1 
ATOM 1524  C CD1 . TYR A 1 197 ? 7.881   -11.538 88.913   1.00 10.00 ? ? ? ? ? ? 198 TYR A CD1 1 
ATOM 1525  C CD2 . TYR A 1 197 ? 7.886   -11.126 91.234   1.00 10.00 ? ? ? ? ? ? 198 TYR A CD2 1 
ATOM 1526  C CE1 . TYR A 1 197 ? 8.793   -12.550 89.120   1.00 10.00 ? ? ? ? ? ? 198 TYR A CE1 1 
ATOM 1527  C CE2 . TYR A 1 197 ? 8.794   -12.130 91.459   1.00 10.00 ? ? ? ? ? ? 198 TYR A CE2 1 
ATOM 1528  C CZ  . TYR A 1 197 ? 9.232   -12.835 90.395   1.00 10.00 ? ? ? ? ? ? 198 TYR A CZ  1 
ATOM 1529  O OH  . TYR A 1 197 ? 10.099  -13.873 90.659   1.00 10.00 ? ? ? ? ? ? 198 TYR A OH  1 
ATOM 1530  N N   . SER A 1 198 ? 4.483   -8.712  87.964   1.00 10.00 ? ? ? ? ? ? 199 SER A N   1 
ATOM 1531  C CA  . SER A 1 198 ? 3.326   -8.063  87.391   1.00 10.00 ? ? ? ? ? ? 199 SER A CA  1 
ATOM 1532  C C   . SER A 1 198 ? 2.078   -8.835  87.817   1.00 10.00 ? ? ? ? ? ? 199 SER A C   1 
ATOM 1533  O O   . SER A 1 198 ? 1.839   -9.950  87.324   1.00 10.00 ? ? ? ? ? ? 199 SER A O   1 
ATOM 1534  C CB  . SER A 1 198 ? 3.610   -8.078  85.865   1.00 10.00 ? ? ? ? ? ? 199 SER A CB  1 
ATOM 1535  O OG  . SER A 1 198 ? 4.964   -7.704  85.494   1.00 10.00 ? ? ? ? ? ? 199 SER A OG  1 
ATOM 1536  N N   . PHE A 1 199 ? 1.282   -8.305  88.764   1.00 10.00 ? ? ? ? ? ? 200 PHE A N   1 
ATOM 1537  C CA  . PHE A 1 199 ? 0.063   -9.012  89.176   1.00 10.00 ? ? ? ? ? ? 200 PHE A CA  1 
ATOM 1538  C C   . PHE A 1 199 ? -1.108  -8.227  88.678   1.00 10.00 ? ? ? ? ? ? 200 PHE A C   1 
ATOM 1539  O O   . PHE A 1 199 ? -2.106  -7.966  89.359   1.00 10.00 ? ? ? ? ? ? 200 PHE A O   1 
ATOM 1540  C CB  . PHE A 1 199 ? -0.005  -9.180  90.716   1.00 10.00 ? ? ? ? ? ? 200 PHE A CB  1 
ATOM 1541  C CG  . PHE A 1 199 ? 1.016   -10.245 91.074   1.00 10.00 ? ? ? ? ? ? 200 PHE A CG  1 
ATOM 1542  C CD1 . PHE A 1 199 ? 0.780   -11.553 90.692   1.00 10.00 ? ? ? ? ? ? 200 PHE A CD1 1 
ATOM 1543  C CD2 . PHE A 1 199 ? 2.176   -9.865  91.698   1.00 10.00 ? ? ? ? ? ? 200 PHE A CD2 1 
ATOM 1544  C CE1 . PHE A 1 199 ? 1.738   -12.494 90.940   1.00 10.00 ? ? ? ? ? ? 200 PHE A CE1 1 
ATOM 1545  C CE2 . PHE A 1 199 ? 3.127   -10.800 91.939   1.00 10.00 ? ? ? ? ? ? 200 PHE A CE2 1 
ATOM 1546  C CZ  . PHE A 1 199 ? 2.906   -12.104 91.561   1.00 10.00 ? ? ? ? ? ? 200 PHE A CZ  1 
ATOM 1547  N N   . THR A 1 200 ? -0.989  -7.985  87.374   1.00 10.00 ? ? ? ? ? ? 201 THR A N   1 
ATOM 1548  C CA  . THR A 1 200 ? -1.899  -7.006  86.837   1.00 10.00 ? ? ? ? ? ? 201 THR A CA  1 
ATOM 1549  C C   . THR A 1 200 ? -3.342  -7.432  86.628   1.00 10.00 ? ? ? ? ? ? 201 THR A C   1 
ATOM 1550  O O   . THR A 1 200 ? -4.163  -6.511  86.629   1.00 10.00 ? ? ? ? ? ? 201 THR A O   1 
ATOM 1551  C CB  . THR A 1 200 ? -1.211  -6.378  85.502   1.00 10.00 ? ? ? ? ? ? 201 THR A CB  1 
ATOM 1552  O OG1 . THR A 1 200 ? -0.598  -7.342  84.623   1.00 10.00 ? ? ? ? ? ? 201 THR A OG1 1 
ATOM 1553  C CG2 . THR A 1 200 ? -0.145  -5.380  86.000   1.00 10.00 ? ? ? ? ? ? 201 THR A CG2 1 
ATOM 1554  N N   . THR A 1 201 ? -3.749  -8.702  86.533   1.00 10.00 ? ? ? ? ? ? 202 THR A N   1 
ATOM 1555  C CA  . THR A 1 201 ? -5.164  -8.939  86.254   1.00 10.00 ? ? ? ? ? ? 202 THR A CA  1 
ATOM 1556  C C   . THR A 1 201 ? -6.092  -9.652  87.232   1.00 10.00 ? ? ? ? ? ? 202 THR A C   1 
ATOM 1557  O O   . THR A 1 201 ? -6.125  -10.887 87.272   1.00 10.00 ? ? ? ? ? ? 202 THR A O   1 
ATOM 1558  C CB  . THR A 1 201 ? -5.215  -9.610  84.855   1.00 10.00 ? ? ? ? ? ? 202 THR A CB  1 
ATOM 1559  O OG1 . THR A 1 201 ? -4.631  -8.586  84.052   1.00 10.00 ? ? ? ? ? ? 202 THR A OG1 1 
ATOM 1560  C CG2 . THR A 1 201 ? -6.596  -10.009 84.281   1.00 10.00 ? ? ? ? ? ? 202 THR A CG2 1 
ATOM 1561  N N   . THR A 1 202 ? -6.865  -8.849  87.985   1.00 10.00 ? ? ? ? ? ? 203 THR A N   1 
ATOM 1562  C CA  . THR A 1 202 ? -7.935  -9.227  88.947   1.00 10.00 ? ? ? ? ? ? 203 THR A CA  1 
ATOM 1563  C C   . THR A 1 202 ? -7.852  -10.569 89.687   1.00 10.00 ? ? ? ? ? ? 203 THR A C   1 
ATOM 1564  O O   . THR A 1 202 ? -7.597  -10.555 90.894   1.00 10.00 ? ? ? ? ? ? 203 THR A O   1 
ATOM 1565  C CB  . THR A 1 202 ? -9.412  -9.171  88.271   1.00 10.00 ? ? ? ? ? ? 203 THR A CB  1 
ATOM 1566  O OG1 . THR A 1 202 ? -9.418  -8.519  86.981   1.00 10.00 ? ? ? ? ? ? 203 THR A OG1 1 
ATOM 1567  C CG2 . THR A 1 202 ? -10.335 -8.430  89.251   1.00 10.00 ? ? ? ? ? ? 203 THR A CG2 1 
ATOM 1568  N N   . ALA A 1 203 ? -8.015  -11.703 88.966   1.00 10.00 ? ? ? ? ? ? 204 ALA A N   1 
ATOM 1569  C CA  . ALA A 1 203 ? -7.920  -13.065 89.472   1.00 10.00 ? ? ? ? ? ? 204 ALA A CA  1 
ATOM 1570  C C   . ALA A 1 203 ? -6.543  -13.055 90.057   1.00 10.00 ? ? ? ? ? ? 204 ALA A C   1 
ATOM 1571  O O   . ALA A 1 203 ? -6.464  -13.121 91.278   1.00 10.00 ? ? ? ? ? ? 204 ALA A O   1 
ATOM 1572  C CB  . ALA A 1 203 ? -7.861  -14.162 88.426   1.00 10.00 ? ? ? ? ? ? 204 ALA A CB  1 
ATOM 1573  N N   . GLU A 1 204 ? -5.494  -12.759 89.262   1.00 10.00 ? ? ? ? ? ? 205 GLU A N   1 
ATOM 1574  C CA  . GLU A 1 204 ? -4.148  -12.811 89.793   1.00 10.00 ? ? ? ? ? ? 205 GLU A CA  1 
ATOM 1575  C C   . GLU A 1 204 ? -3.821  -11.854 90.965   1.00 10.00 ? ? ? ? ? ? 205 GLU A C   1 
ATOM 1576  O O   . GLU A 1 204 ? -2.731  -12.006 91.536   1.00 10.00 ? ? ? ? ? ? 205 GLU A O   1 
ATOM 1577  C CB  . GLU A 1 204 ? -3.153  -12.670 88.598   1.00 10.00 ? ? ? ? ? ? 205 GLU A CB  1 
ATOM 1578  C CG  . GLU A 1 204 ? -2.824  -11.375 87.896   1.00 10.00 ? ? ? ? ? ? 205 GLU A CG  1 
ATOM 1579  C CD  . GLU A 1 204 ? -1.716  -11.515 86.839   1.00 10.00 ? ? ? ? ? ? 205 GLU A CD  1 
ATOM 1580  O OE1 . GLU A 1 204 ? -0.533  -11.411 87.167   1.00 10.00 ? ? ? ? ? ? 205 GLU A OE1 1 
ATOM 1581  O OE2 . GLU A 1 204 ? -2.010  -11.736 85.671   1.00 10.00 ? ? ? ? ? ? 205 GLU A OE2 1 
ATOM 1582  N N   . ARG A 1 205 ? -4.740  -11.006 91.470   1.00 10.00 ? ? ? ? ? ? 206 ARG A N   1 
ATOM 1583  C CA  . ARG A 1 205 ? -4.537  -10.282 92.746   1.00 10.00 ? ? ? ? ? ? 206 ARG A CA  1 
ATOM 1584  C C   . ARG A 1 205 ? -4.808  -11.249 93.924   1.00 10.00 ? ? ? ? ? ? 206 ARG A C   1 
ATOM 1585  O O   . ARG A 1 205 ? -4.376  -11.154 95.082   1.00 10.00 ? ? ? ? ? ? 206 ARG A O   1 
ATOM 1586  C CB  . ARG A 1 205 ? -5.500  -9.079  92.915   1.00 10.00 ? ? ? ? ? ? 206 ARG A CB  1 
ATOM 1587  C CG  . ARG A 1 205 ? -4.899  -7.995  93.847   1.00 10.00 ? ? ? ? ? ? 206 ARG A CG  1 
ATOM 1588  C CD  . ARG A 1 205 ? -5.472  -7.709  95.273   1.00 10.00 ? ? ? ? ? ? 206 ARG A CD  1 
ATOM 1589  N NE  . ARG A 1 205 ? -5.526  -8.769  96.299   1.00 10.00 ? ? ? ? ? ? 206 ARG A NE  1 
ATOM 1590  C CZ  . ARG A 1 205 ? -5.678  -8.437  97.592   1.00 10.00 ? ? ? ? ? ? 206 ARG A CZ  1 
ATOM 1591  N NH1 . ARG A 1 205 ? -5.756  -7.166  97.981   1.00 10.00 ? ? ? ? ? ? 206 ARG A NH1 1 
ATOM 1592  N NH2 . ARG A 1 205 ? -5.893  -9.372  98.506   1.00 10.00 ? ? ? ? ? ? 206 ARG A NH2 1 
ATOM 1593  N N   . GLU A 1 206 ? -5.660  -12.188 93.602   1.00 10.00 ? ? ? ? ? ? 207 GLU A N   1 
ATOM 1594  C CA  . GLU A 1 206 ? -5.932  -13.325 94.440   1.00 10.00 ? ? ? ? ? ? 207 GLU A CA  1 
ATOM 1595  C C   . GLU A 1 206 ? -4.868  -14.386 94.199   1.00 10.00 ? ? ? ? ? ? 207 GLU A C   1 
ATOM 1596  O O   . GLU A 1 206 ? -4.872  -15.395 94.884   1.00 10.00 ? ? ? ? ? ? 207 GLU A O   1 
ATOM 1597  C CB  . GLU A 1 206 ? -7.320  -13.885 94.105   1.00 10.00 ? ? ? ? ? ? 207 GLU A CB  1 
ATOM 1598  C CG  . GLU A 1 206 ? -8.262  -13.901 95.308   1.00 10.00 ? ? ? ? ? ? 207 GLU A CG  1 
ATOM 1599  C CD  . GLU A 1 206 ? -7.652  -14.602 96.540   1.00 10.00 ? ? ? ? ? ? 207 GLU A CD  1 
ATOM 1600  O OE1 . GLU A 1 206 ? -7.694  -15.840 96.596   1.00 10.00 ? ? ? ? ? ? 207 GLU A OE1 1 
ATOM 1601  O OE2 . GLU A 1 206 ? -7.124  -13.893 97.416   1.00 10.00 ? ? ? ? ? ? 207 GLU A OE2 1 
ATOM 1602  N N   . ILE A 1 207 ? -3.890  -14.262 93.311   1.00 10.00 ? ? ? ? ? ? 208 ILE A N   1 
ATOM 1603  C CA  . ILE A 1 207 ? -2.874  -15.310 93.156   1.00 10.00 ? ? ? ? ? ? 208 ILE A CA  1 
ATOM 1604  C C   . ILE A 1 207 ? -1.692  -15.115 94.129   1.00 10.00 ? ? ? ? ? ? 208 ILE A C   1 
ATOM 1605  O O   . ILE A 1 207 ? -0.884  -16.024 94.398   1.00 10.00 ? ? ? ? ? ? 208 ILE A O   1 
ATOM 1606  C CB  . ILE A 1 207 ? -2.481  -15.314 91.640   1.00 10.00 ? ? ? ? ? ? 208 ILE A CB  1 
ATOM 1607  C CG1 . ILE A 1 207 ? -2.793  -16.729 91.191   1.00 10.00 ? ? ? ? ? ? 208 ILE A CG1 1 
ATOM 1608  C CG2 . ILE A 1 207 ? -1.032  -14.908 91.297   1.00 10.00 ? ? ? ? ? ? 208 ILE A CG2 1 
ATOM 1609  C CD1 . ILE A 1 207 ? -4.244  -16.853 90.680   1.00 10.00 ? ? ? ? ? ? 208 ILE A CD1 1 
ATOM 1610  N N   . VAL A 1 208 ? -1.587  -13.918 94.726   1.00 10.00 ? ? ? ? ? ? 209 VAL A N   1 
ATOM 1611  C CA  . VAL A 1 208 ? -0.621  -13.723 95.790   1.00 10.00 ? ? ? ? ? ? 209 VAL A CA  1 
ATOM 1612  C C   . VAL A 1 208 ? -1.110  -14.456 97.047   1.00 10.00 ? ? ? ? ? ? 209 VAL A C   1 
ATOM 1613  O O   . VAL A 1 208 ? -0.270  -15.048 97.721   1.00 10.00 ? ? ? ? ? ? 209 VAL A O   1 
ATOM 1614  C CB  . VAL A 1 208 ? -0.385  -12.205 96.062   1.00 10.00 ? ? ? ? ? ? 209 VAL A CB  1 
ATOM 1615  C CG1 . VAL A 1 208 ? 0.406   -11.668 94.857   1.00 10.00 ? ? ? ? ? ? 209 VAL A CG1 1 
ATOM 1616  C CG2 . VAL A 1 208 ? -1.675  -11.407 96.211   1.00 10.00 ? ? ? ? ? ? 209 VAL A CG2 1 
ATOM 1617  N N   . ARG A 1 209 ? -2.432  -14.554 97.313   1.00 10.00 ? ? ? ? ? ? 210 ARG A N   1 
ATOM 1618  C CA  . ARG A 1 209 ? -3.033  -15.274 98.442   1.00 10.00 ? ? ? ? ? ? 210 ARG A CA  1 
ATOM 1619  C C   . ARG A 1 209 ? -2.517  -16.684 98.434   1.00 10.00 ? ? ? ? ? ? 210 ARG A C   1 
ATOM 1620  O O   . ARG A 1 209 ? -2.144  -17.178 99.466   1.00 10.00 ? ? ? ? ? ? 210 ARG A O   1 
ATOM 1621  C CB  . ARG A 1 209 ? -4.572  -15.334 98.327   1.00 10.00 ? ? ? ? ? ? 210 ARG A CB  1 
ATOM 1622  C CG  . ARG A 1 209 ? -5.417  -15.650 99.586   1.00 10.00 ? ? ? ? ? ? 210 ARG A CG  1 
ATOM 1623  C CD  . ARG A 1 209 ? -6.694  -16.581 99.464   1.00 10.00 ? ? ? ? ? ? 210 ARG A CD  1 
ATOM 1624  N NE  . ARG A 1 209 ? -6.401  -17.892 98.850   1.00 10.00 ? ? ? ? ? ? 210 ARG A NE  1 
ATOM 1625  C CZ  . ARG A 1 209 ? -6.845  -19.116 99.233   1.00 10.00 ? ? ? ? ? ? 210 ARG A CZ  1 
ATOM 1626  N NH1 . ARG A 1 209 ? -7.659  -19.358 100.274  1.00 10.00 ? ? ? ? ? ? 210 ARG A NH1 1 
ATOM 1627  N NH2 . ARG A 1 209 ? -6.396  -20.187 98.576   1.00 10.00 ? ? ? ? ? ? 210 ARG A NH2 1 
ATOM 1628  N N   . ASP A 1 210 ? -2.446  -17.390 97.317   1.00 10.00 ? ? ? ? ? ? 211 ASP A N   1 
ATOM 1629  C CA  . ASP A 1 210 ? -1.921  -18.765 97.294   1.00 10.00 ? ? ? ? ? ? 211 ASP A CA  1 
ATOM 1630  C C   . ASP A 1 210 ? -0.403  -18.831 97.427   1.00 10.00 ? ? ? ? ? ? 211 ASP A C   1 
ATOM 1631  O O   . ASP A 1 210 ? 0.077   -19.817 97.976   1.00 10.00 ? ? ? ? ? ? 211 ASP A O   1 
ATOM 1632  C CB  . ASP A 1 210 ? -2.182  -19.551 96.004   1.00 10.00 ? ? ? ? ? ? 211 ASP A CB  1 
ATOM 1633  C CG  . ASP A 1 210 ? -3.633  -19.666 95.646   1.00 10.00 ? ? ? ? ? ? 211 ASP A CG  1 
ATOM 1634  O OD1 . ASP A 1 210 ? -4.213  -18.692 95.099   1.00 10.00 ? ? ? ? ? ? 211 ASP A OD1 1 
ATOM 1635  O OD2 . ASP A 1 210 ? -4.159  -20.741 95.940   1.00 10.00 ? ? ? ? ? ? 211 ASP A OD2 1 
ATOM 1636  N N   . ILE A 1 211 ? 0.413   -17.895 96.921   1.00 10.00 ? ? ? ? ? ? 212 ILE A N   1 
ATOM 1637  C CA  . ILE A 1 211 ? 1.864   -17.971 97.149   1.00 10.00 ? ? ? ? ? ? 212 ILE A CA  1 
ATOM 1638  C C   . ILE A 1 211 ? 2.083   -17.831 98.684   1.00 10.00 ? ? ? ? ? ? 212 ILE A C   1 
ATOM 1639  O O   . ILE A 1 211 ? 2.723   -18.659 99.349   1.00 10.00 ? ? ? ? ? ? 212 ILE A O   1 
ATOM 1640  C CB  . ILE A 1 211 ? 2.555   -16.816 96.333   1.00 10.00 ? ? ? ? ? ? 212 ILE A CB  1 
ATOM 1641  C CG1 . ILE A 1 211 ? 2.306   -16.961 94.849   1.00 10.00 ? ? ? ? ? ? 212 ILE A CG1 1 
ATOM 1642  C CG2 . ILE A 1 211 ? 4.038   -16.864 96.538   1.00 10.00 ? ? ? ? ? ? 212 ILE A CG2 1 
ATOM 1643  C CD1 . ILE A 1 211 ? 2.318   -15.607 94.165   1.00 10.00 ? ? ? ? ? ? 212 ILE A CD1 1 
ATOM 1644  N N   . LYS A 1 212 ? 1.400   -16.849 99.283   1.00 10.00 ? ? ? ? ? ? 213 LYS A N   1 
ATOM 1645  C CA  . LYS A 1 212 ? 1.482   -16.478 100.668  1.00 10.00 ? ? ? ? ? ? 213 LYS A CA  1 
ATOM 1646  C C   . LYS A 1 212 ? 1.154   -17.684 101.451  1.00 10.00 ? ? ? ? ? ? 213 LYS A C   1 
ATOM 1647  O O   . LYS A 1 212 ? 1.954   -18.087 102.287  1.00 10.00 ? ? ? ? ? ? 213 LYS A O   1 
ATOM 1648  C CB  . LYS A 1 212 ? 0.477   -15.421 101.014  1.00 10.00 ? ? ? ? ? ? 213 LYS A CB  1 
ATOM 1649  C CG  . LYS A 1 212 ? 0.727   -14.793 102.345  1.00 10.00 ? ? ? ? ? ? 213 LYS A CG  1 
ATOM 1650  C CD  . LYS A 1 212 ? -0.433  -13.976 102.776  1.00 10.00 ? ? ? ? ? ? 213 LYS A CD  1 
ATOM 1651  C CE  . LYS A 1 212 ? -1.463  -14.952 103.253  1.00 10.00 ? ? ? ? ? ? 213 LYS A CE  1 
ATOM 1652  N NZ  . LYS A 1 212 ? -2.751  -14.307 103.330  1.00 10.00 ? ? ? ? ? ? 213 LYS A NZ  1 
ATOM 1653  N N   . GLU A 1 213 ? 0.037   -18.303 101.137  1.00 10.00 ? ? ? ? ? ? 214 GLU A N   1 
ATOM 1654  C CA  . GLU A 1 213 ? -0.313  -19.401 101.980  1.00 10.00 ? ? ? ? ? ? 214 GLU A CA  1 
ATOM 1655  C C   . GLU A 1 213 ? 0.534   -20.574 101.589  1.00 10.00 ? ? ? ? ? ? 214 GLU A C   1 
ATOM 1656  O O   . GLU A 1 213 ? 0.781   -21.382 102.482  1.00 10.00 ? ? ? ? ? ? 214 GLU A O   1 
ATOM 1657  C CB  . GLU A 1 213 ? -1.781  -19.789 101.850  1.00 10.00 ? ? ? ? ? ? 214 GLU A CB  1 
ATOM 1658  C CG  . GLU A 1 213 ? -2.777  -18.689 102.243  1.00 10.00 ? ? ? ? ? ? 214 GLU A CG  1 
ATOM 1659  C CD  . GLU A 1 213 ? -4.209  -18.994 101.801  1.00 10.00 ? ? ? ? ? ? 214 GLU A CD  1 
ATOM 1660  O OE1 . GLU A 1 213 ? -4.465  -20.067 101.261  1.00 10.00 ? ? ? ? ? ? 214 GLU A OE1 1 
ATOM 1661  O OE2 . GLU A 1 213 ? -5.077  -18.151 102.001  1.00 10.00 ? ? ? ? ? ? 214 GLU A OE2 1 
ATOM 1662  N N   . LYS A 1 214 ? 1.038   -20.716 100.350  1.00 10.00 ? ? ? ? ? ? 215 LYS A N   1 
ATOM 1663  C CA  . LYS A 1 214 ? 1.746   -21.938 100.029  1.00 10.00 ? ? ? ? ? ? 215 LYS A CA  1 
ATOM 1664  C C   . LYS A 1 214 ? 3.209   -21.983 100.299  1.00 10.00 ? ? ? ? ? ? 215 LYS A C   1 
ATOM 1665  O O   . LYS A 1 214 ? 3.738   -23.055 100.544  1.00 10.00 ? ? ? ? ? ? 215 LYS A O   1 
ATOM 1666  C CB  . LYS A 1 214 ? 1.598   -22.338 98.577   1.00 10.00 ? ? ? ? ? ? 215 LYS A CB  1 
ATOM 1667  C CG  . LYS A 1 214 ? 0.439   -23.318 98.352   1.00 10.00 ? ? ? ? ? ? 215 LYS A CG  1 
ATOM 1668  C CD  . LYS A 1 214 ? -0.912  -22.639 98.112   1.00 10.00 ? ? ? ? ? ? 215 LYS A CD  1 
ATOM 1669  C CE  . LYS A 1 214 ? -1.763  -23.519 97.191   1.00 10.00 ? ? ? ? ? ? 215 LYS A CE  1 
ATOM 1670  N NZ  . LYS A 1 214 ? -3.000  -22.853 96.830   1.00 10.00 ? ? ? ? ? ? 215 LYS A NZ  1 
ATOM 1671  N N   . LEU A 1 215 ? 3.905   -20.864 100.278  1.00 10.00 ? ? ? ? ? ? 216 LEU A N   1 
ATOM 1672  C CA  . LEU A 1 215 ? 5.356   -20.868 100.373  1.00 10.00 ? ? ? ? ? ? 216 LEU A CA  1 
ATOM 1673  C C   . LEU A 1 215 ? 5.819   -20.119 101.601  1.00 10.00 ? ? ? ? ? ? 216 LEU A C   1 
ATOM 1674  O O   . LEU A 1 215 ? 6.962   -20.369 102.002  1.00 10.00 ? ? ? ? ? ? 216 LEU A O   1 
ATOM 1675  C CB  . LEU A 1 215 ? 5.979   -20.222 99.088   1.00 10.00 ? ? ? ? ? ? 216 LEU A CB  1 
ATOM 1676  C CG  . LEU A 1 215 ? 5.474   -20.845 97.760   1.00 10.00 ? ? ? ? ? ? 216 LEU A CG  1 
ATOM 1677  C CD1 . LEU A 1 215 ? 5.685   -19.845 96.683   1.00 10.00 ? ? ? ? ? ? 216 LEU A CD1 1 
ATOM 1678  C CD2 . LEU A 1 215 ? 6.114   -22.210 97.480   1.00 10.00 ? ? ? ? ? ? 216 LEU A CD2 1 
ATOM 1679  N N   . CYS A 1 216 ? 5.039   -19.195 102.225  1.00 10.00 ? ? ? ? ? ? 217 CYS A N   1 
ATOM 1680  C CA  . CYS A 1 216 ? 5.556   -18.512 103.398  1.00 10.00 ? ? ? ? ? ? 217 CYS A CA  1 
ATOM 1681  C C   . CYS A 1 216 ? 5.799   -19.403 104.592  1.00 10.00 ? ? ? ? ? ? 217 CYS A C   1 
ATOM 1682  O O   . CYS A 1 216 ? 5.321   -20.524 104.667  1.00 10.00 ? ? ? ? ? ? 217 CYS A O   1 
ATOM 1683  C CB  . CYS A 1 216 ? 4.659   -17.399 103.766  1.00 10.00 ? ? ? ? ? ? 217 CYS A CB  1 
ATOM 1684  S SG  . CYS A 1 216 ? 5.044   -16.233 102.444  1.00 10.00 ? ? ? ? ? ? 217 CYS A SG  1 
ATOM 1685  N N   . TYR A 1 217 ? 6.717   -18.850 105.376  1.00 10.00 ? ? ? ? ? ? 218 TYR A N   1 
ATOM 1686  C CA  . TYR A 1 217 ? 7.434   -19.460 106.466  1.00 10.00 ? ? ? ? ? ? 218 TYR A CA  1 
ATOM 1687  C C   . TYR A 1 217 ? 7.742   -18.311 107.433  1.00 10.00 ? ? ? ? ? ? 218 TYR A C   1 
ATOM 1688  O O   . TYR A 1 217 ? 7.901   -17.142 107.038  1.00 10.00 ? ? ? ? ? ? 218 TYR A O   1 
ATOM 1689  C CB  . TYR A 1 217 ? 8.817   -20.027 106.020  1.00 10.00 ? ? ? ? ? ? 218 TYR A CB  1 
ATOM 1690  C CG  . TYR A 1 217 ? 8.957   -21.393 105.394  1.00 10.00 ? ? ? ? ? ? 218 TYR A CG  1 
ATOM 1691  C CD1 . TYR A 1 217 ? 8.066   -21.929 104.473  1.00 10.00 ? ? ? ? ? ? 218 TYR A CD1 1 
ATOM 1692  C CD2 . TYR A 1 217 ? 9.997   -22.180 105.841  1.00 10.00 ? ? ? ? ? ? 218 TYR A CD2 1 
ATOM 1693  C CE1 . TYR A 1 217 ? 8.203   -23.244 104.007  1.00 10.00 ? ? ? ? ? ? 218 TYR A CE1 1 
ATOM 1694  C CE2 . TYR A 1 217 ? 10.146  -23.490 105.382  1.00 10.00 ? ? ? ? ? ? 218 TYR A CE2 1 
ATOM 1695  C CZ  . TYR A 1 217 ? 9.251   -24.035 104.469  1.00 10.00 ? ? ? ? ? ? 218 TYR A CZ  1 
ATOM 1696  O OH  . TYR A 1 217 ? 9.435   -25.359 104.028  1.00 10.00 ? ? ? ? ? ? 218 TYR A OH  1 
ATOM 1697  N N   . VAL A 1 218 ? 7.899   -18.687 108.703  1.00 10.00 ? ? ? ? ? ? 219 VAL A N   1 
ATOM 1698  C CA  . VAL A 1 218 ? 8.343   -17.803 109.749  1.00 10.00 ? ? ? ? ? ? 219 VAL A CA  1 
ATOM 1699  C C   . VAL A 1 218 ? 9.726   -18.348 110.092  1.00 10.00 ? ? ? ? ? ? 219 VAL A C   1 
ATOM 1700  O O   . VAL A 1 218 ? 9.965   -19.546 110.253  1.00 10.00 ? ? ? ? ? ? 219 VAL A O   1 
ATOM 1701  C CB  . VAL A 1 218 ? 7.434   -17.877 110.990  1.00 10.00 ? ? ? ? ? ? 219 VAL A CB  1 
ATOM 1702  C CG1 . VAL A 1 218 ? 7.963   -16.904 112.037  1.00 10.00 ? ? ? ? ? ? 219 VAL A CG1 1 
ATOM 1703  C CG2 . VAL A 1 218 ? 6.011   -17.498 110.643  1.00 10.00 ? ? ? ? ? ? 219 VAL A CG2 1 
ATOM 1704  N N   . ALA A 1 219 ? 10.645  -17.389 110.130  1.00 10.00 ? ? ? ? ? ? 220 ALA A N   1 
ATOM 1705  C CA  . ALA A 1 219 ? 12.054  -17.577 110.420  1.00 10.00 ? ? ? ? ? ? 220 ALA A CA  1 
ATOM 1706  C C   . ALA A 1 219 ? 12.255  -17.555 111.913  1.00 10.00 ? ? ? ? ? ? 220 ALA A C   1 
ATOM 1707  O O   . ALA A 1 219 ? 11.538  -16.780 112.533  1.00 10.00 ? ? ? ? ? ? 220 ALA A O   1 
ATOM 1708  C CB  . ALA A 1 219 ? 12.916  -16.445 109.836  1.00 10.00 ? ? ? ? ? ? 220 ALA A CB  1 
ATOM 1709  N N   . LEU A 1 220 ? 13.213  -18.331 112.471  1.00 10.00 ? ? ? ? ? ? 221 LEU A N   1 
ATOM 1710  C CA  . LEU A 1 220 ? 13.555  -18.367 113.901  1.00 10.00 ? ? ? ? ? ? 221 LEU A CA  1 
ATOM 1711  C C   . LEU A 1 220 ? 14.422  -17.191 114.201  1.00 10.00 ? ? ? ? ? ? 221 LEU A C   1 
ATOM 1712  O O   . LEU A 1 220 ? 14.284  -16.482 115.191  1.00 10.00 ? ? ? ? ? ? 221 LEU A O   1 
ATOM 1713  C CB  . LEU A 1 220 ? 14.346  -19.597 114.315  1.00 10.00 ? ? ? ? ? ? 221 LEU A CB  1 
ATOM 1714  C CG  . LEU A 1 220 ? 13.714  -20.666 115.212  1.00 10.00 ? ? ? ? ? ? 221 LEU A CG  1 
ATOM 1715  C CD1 . LEU A 1 220 ? 14.851  -21.481 115.769  1.00 10.00 ? ? ? ? ? ? 221 LEU A CD1 1 
ATOM 1716  C CD2 . LEU A 1 220 ? 12.951  -20.077 116.415  1.00 10.00 ? ? ? ? ? ? 221 LEU A CD2 1 
ATOM 1717  N N   . ASP A 1 221 ? 15.370  -16.993 113.323  1.00 10.00 ? ? ? ? ? ? 222 ASP A N   1 
ATOM 1718  C CA  . ASP A 1 221 ? 16.173  -15.826 113.490  1.00 10.00 ? ? ? ? ? ? 222 ASP A CA  1 
ATOM 1719  C C   . ASP A 1 221 ? 16.130  -15.115 112.147  1.00 10.00 ? ? ? ? ? ? 222 ASP A C   1 
ATOM 1720  O O   . ASP A 1 221 ? 16.929  -15.484 111.271  1.00 10.00 ? ? ? ? ? ? 222 ASP A O   1 
ATOM 1721  C CB  . ASP A 1 221 ? 17.603  -16.234 113.890  1.00 10.00 ? ? ? ? ? ? 222 ASP A CB  1 
ATOM 1722  C CG  . ASP A 1 221 ? 18.251  -15.149 114.755  1.00 10.00 ? ? ? ? ? ? 222 ASP A CG  1 
ATOM 1723  O OD1 . ASP A 1 221 ? 18.313  -13.983 114.339  1.00 10.00 ? ? ? ? ? ? 222 ASP A OD1 1 
ATOM 1724  O OD2 . ASP A 1 221 ? 18.660  -15.471 115.886  1.00 10.00 ? ? ? ? ? ? 222 ASP A OD2 1 
ATOM 1725  N N   . PHE A 1 222 ? 15.215  -14.128 111.959  1.00 10.00 ? ? ? ? ? ? 223 PHE A N   1 
ATOM 1726  C CA  . PHE A 1 222 ? 15.159  -13.383 110.695  1.00 10.00 ? ? ? ? ? ? 223 PHE A CA  1 
ATOM 1727  C C   . PHE A 1 222 ? 16.554  -13.077 110.139  1.00 10.00 ? ? ? ? ? ? 223 PHE A C   1 
ATOM 1728  O O   . PHE A 1 222 ? 16.877  -13.500 109.035  1.00 10.00 ? ? ? ? ? ? 223 PHE A O   1 
ATOM 1729  C CB  . PHE A 1 222 ? 14.436  -12.068 110.874  1.00 10.00 ? ? ? ? ? ? 223 PHE A CB  1 
ATOM 1730  C CG  . PHE A 1 222 ? 14.098  -11.323 109.598  1.00 10.00 ? ? ? ? ? ? 223 PHE A CG  1 
ATOM 1731  C CD1 . PHE A 1 222 ? 13.419  -11.952 108.571  1.00 10.00 ? ? ? ? ? ? 223 PHE A CD1 1 
ATOM 1732  C CD2 . PHE A 1 222 ? 14.518  -10.022 109.448  1.00 10.00 ? ? ? ? ? ? 223 PHE A CD2 1 
ATOM 1733  C CE1 . PHE A 1 222 ? 13.164  -11.296 107.379  1.00 10.00 ? ? ? ? ? ? 223 PHE A CE1 1 
ATOM 1734  C CE2 . PHE A 1 222 ? 14.267  -9.367  108.251  1.00 10.00 ? ? ? ? ? ? 223 PHE A CE2 1 
ATOM 1735  C CZ  . PHE A 1 222 ? 13.591  -10.002 107.211  1.00 10.00 ? ? ? ? ? ? 223 PHE A CZ  1 
ATOM 1736  N N   . GLU A 1 223 ? 17.418  -12.499 110.990  1.00 10.00 ? ? ? ? ? ? 224 GLU A N   1 
ATOM 1737  C CA  . GLU A 1 223 ? 18.809  -12.111 110.701  1.00 10.00 ? ? ? ? ? ? 224 GLU A CA  1 
ATOM 1738  C C   . GLU A 1 223 ? 19.651  -13.264 110.164  1.00 10.00 ? ? ? ? ? ? 224 GLU A C   1 
ATOM 1739  O O   . GLU A 1 223 ? 19.994  -13.215 108.977  1.00 10.00 ? ? ? ? ? ? 224 GLU A O   1 
ATOM 1740  C CB  . GLU A 1 223 ? 19.302  -11.504 112.005  1.00 10.00 ? ? ? ? ? ? 224 GLU A CB  1 
ATOM 1741  C CG  . GLU A 1 223 ? 20.744  -11.461 112.492  1.00 10.00 ? ? ? ? ? ? 224 GLU A CG  1 
ATOM 1742  C CD  . GLU A 1 223 ? 20.830  -10.959 113.963  1.00 10.00 ? ? ? ? ? ? 224 GLU A CD  1 
ATOM 1743  O OE1 . GLU A 1 223 ? 20.135  -11.513 114.832  1.00 10.00 ? ? ? ? ? ? 224 GLU A OE1 1 
ATOM 1744  O OE2 . GLU A 1 223 ? 21.573  -10.007 114.258  1.00 10.00 ? ? ? ? ? ? 224 GLU A OE2 1 
ATOM 1745  N N   . GLN A 1 224 ? 19.892  -14.360 110.881  1.00 10.00 ? ? ? ? ? ? 225 GLN A N   1 
ATOM 1746  C CA  . GLN A 1 224 ? 20.621  -15.426 110.277  1.00 10.00 ? ? ? ? ? ? 225 GLN A CA  1 
ATOM 1747  C C   . GLN A 1 224 ? 19.768  -16.069 109.204  1.00 10.00 ? ? ? ? ? ? 225 GLN A C   1 
ATOM 1748  O O   . GLN A 1 224 ? 20.270  -16.868 108.407  1.00 10.00 ? ? ? ? ? ? 225 GLN A O   1 
ATOM 1749  C CB  . GLN A 1 224 ? 20.995  -16.429 111.313  1.00 10.00 ? ? ? ? ? ? 225 GLN A CB  1 
ATOM 1750  C CG  . GLN A 1 224 ? 22.385  -17.086 111.066  1.00 10.00 ? ? ? ? ? ? 225 GLN A CG  1 
ATOM 1751  C CD  . GLN A 1 224 ? 22.405  -18.508 110.491  1.00 10.00 ? ? ? ? ? ? 225 GLN A CD  1 
ATOM 1752  O OE1 . GLN A 1 224 ? 21.345  -19.073 110.192  1.00 10.00 ? ? ? ? ? ? 225 GLN A OE1 1 
ATOM 1753  N NE2 . GLN A 1 224 ? 23.564  -19.163 110.345  1.00 10.00 ? ? ? ? ? ? 225 GLN A NE2 1 
ATOM 1754  N N   . GLU A 1 225 ? 18.483  -15.776 109.031  1.00 10.00 ? ? ? ? ? ? 226 GLU A N   1 
ATOM 1755  C CA  . GLU A 1 225 ? 17.732  -16.365 107.943  1.00 10.00 ? ? ? ? ? ? 226 GLU A CA  1 
ATOM 1756  C C   . GLU A 1 225 ? 17.937  -15.579 106.678  1.00 10.00 ? ? ? ? ? ? 226 GLU A C   1 
ATOM 1757  O O   . GLU A 1 225 ? 17.899  -16.140 105.592  1.00 10.00 ? ? ? ? ? ? 226 GLU A O   1 
ATOM 1758  C CB  . GLU A 1 225 ? 16.302  -16.357 108.225  1.00 10.00 ? ? ? ? ? ? 226 GLU A CB  1 
ATOM 1759  C CG  . GLU A 1 225 ? 15.555  -17.233 107.288  1.00 10.00 ? ? ? ? ? ? 226 GLU A CG  1 
ATOM 1760  C CD  . GLU A 1 225 ? 15.720  -18.703 107.558  1.00 10.00 ? ? ? ? ? ? 226 GLU A CD  1 
ATOM 1761  O OE1 . GLU A 1 225 ? 15.857  -19.078 108.719  1.00 10.00 ? ? ? ? ? ? 226 GLU A OE1 1 
ATOM 1762  O OE2 . GLU A 1 225 ? 15.684  -19.494 106.613  1.00 10.00 ? ? ? ? ? ? 226 GLU A OE2 1 
ATOM 1763  N N   . MET A 1 226 ? 18.181  -14.287 106.753  1.00 10.00 ? ? ? ? ? ? 227 MET A N   1 
ATOM 1764  C CA  . MET A 1 226 ? 18.363  -13.525 105.536  1.00 10.00 ? ? ? ? ? ? 227 MET A CA  1 
ATOM 1765  C C   . MET A 1 226 ? 19.670  -13.909 104.832  1.00 10.00 ? ? ? ? ? ? 227 MET A C   1 
ATOM 1766  O O   . MET A 1 226 ? 19.759  -14.002 103.595  1.00 10.00 ? ? ? ? ? ? 227 MET A O   1 
ATOM 1767  C CB  . MET A 1 226 ? 18.325  -12.046 105.879  1.00 10.00 ? ? ? ? ? ? 227 MET A CB  1 
ATOM 1768  C CG  . MET A 1 226 ? 16.936  -11.436 106.032  1.00 10.00 ? ? ? ? ? ? 227 MET A CG  1 
ATOM 1769  S SD  . MET A 1 226 ? 15.888  -11.393 104.538  1.00 10.00 ? ? ? ? ? ? 227 MET A SD  1 
ATOM 1770  C CE  . MET A 1 226 ? 16.944  -10.520 103.414  1.00 10.00 ? ? ? ? ? ? 227 MET A CE  1 
ATOM 1771  N N   . ALA A 1 227 ? 20.740  -14.212 105.563  1.00 10.00 ? ? ? ? ? ? 228 ALA A N   1 
ATOM 1772  C CA  . ALA A 1 227 ? 21.987  -14.685 104.960  1.00 10.00 ? ? ? ? ? ? 228 ALA A CA  1 
ATOM 1773  C C   . ALA A 1 227 ? 21.952  -16.179 104.677  1.00 10.00 ? ? ? ? ? ? 228 ALA A C   1 
ATOM 1774  O O   . ALA A 1 227 ? 22.882  -16.739 104.097  1.00 10.00 ? ? ? ? ? ? 228 ALA A O   1 
ATOM 1775  C CB  . ALA A 1 227 ? 23.145  -14.430 105.869  1.00 10.00 ? ? ? ? ? ? 228 ALA A CB  1 
ATOM 1776  N N   . THR A 1 228 ? 20.863  -16.793 105.120  1.00 10.00 ? ? ? ? ? ? 229 THR A N   1 
ATOM 1777  C CA  . THR A 1 228 ? 20.489  -18.132 104.730  1.00 10.00 ? ? ? ? ? ? 229 THR A CA  1 
ATOM 1778  C C   . THR A 1 228 ? 19.242  -17.988 103.806  1.00 10.00 ? ? ? ? ? ? 229 THR A C   1 
ATOM 1779  O O   . THR A 1 228 ? 18.160  -18.580 103.964  1.00 10.00 ? ? ? ? ? ? 229 THR A O   1 
ATOM 1780  C CB  . THR A 1 228 ? 20.191  -18.944 105.991  1.00 10.00 ? ? ? ? ? ? 229 THR A CB  1 
ATOM 1781  O OG1 . THR A 1 228 ? 21.354  -18.844 106.796  1.00 10.00 ? ? ? ? ? ? 229 THR A OG1 1 
ATOM 1782  C CG2 . THR A 1 228 ? 19.884  -20.427 105.696  1.00 10.00 ? ? ? ? ? ? 229 THR A CG2 1 
ATOM 1783  N N   . ALA A 1 229 ? 19.429  -16.988 102.923  1.00 10.00 ? ? ? ? ? ? 230 ALA A N   1 
ATOM 1784  C CA  . ALA A 1 229 ? 18.666  -16.714 101.726  1.00 10.00 ? ? ? ? ? ? 230 ALA A CA  1 
ATOM 1785  C C   . ALA A 1 229 ? 19.927  -16.433 100.889  1.00 10.00 ? ? ? ? ? ? 230 ALA A C   1 
ATOM 1786  O O   . ALA A 1 229 ? 20.120  -17.156 99.918   1.00 10.00 ? ? ? ? ? ? 230 ALA A O   1 
ATOM 1787  C CB  . ALA A 1 229 ? 17.857  -15.427 101.736  1.00 10.00 ? ? ? ? ? ? 230 ALA A CB  1 
ATOM 1788  N N   . ALA A 1 230 ? 20.870  -15.498 101.189  1.00 10.00 ? ? ? ? ? ? 231 ALA A N   1 
ATOM 1789  C CA  . ALA A 1 230 ? 22.064  -15.316 100.346  1.00 10.00 ? ? ? ? ? ? 231 ALA A CA  1 
ATOM 1790  C C   . ALA A 1 230 ? 22.882  -16.598 100.165  1.00 10.00 ? ? ? ? ? ? 231 ALA A C   1 
ATOM 1791  O O   . ALA A 1 230 ? 23.558  -16.690 99.153   1.00 10.00 ? ? ? ? ? ? 231 ALA A O   1 
ATOM 1792  C CB  . ALA A 1 230 ? 23.003  -14.259 100.921  1.00 10.00 ? ? ? ? ? ? 231 ALA A CB  1 
ATOM 1793  N N   . SER A 1 231 ? 22.870  -17.621 101.051  1.00 10.00 ? ? ? ? ? ? 232 SER A N   1 
ATOM 1794  C CA  . SER A 1 231 ? 23.502  -18.916 100.803  1.00 10.00 ? ? ? ? ? ? 232 SER A CA  1 
ATOM 1795  C C   . SER A 1 231 ? 22.430  -19.812 100.160  1.00 10.00 ? ? ? ? ? ? 232 SER A C   1 
ATOM 1796  O O   . SER A 1 231 ? 22.135  -20.932 100.584  1.00 10.00 ? ? ? ? ? ? 232 SER A O   1 
ATOM 1797  C CB  . SER A 1 231 ? 23.916  -19.469 102.121  1.00 10.00 ? ? ? ? ? ? 232 SER A CB  1 
ATOM 1798  O OG  . SER A 1 231 ? 22.710  -19.592 102.889  1.00 10.00 ? ? ? ? ? ? 232 SER A OG  1 
ATOM 1799  N N   . SER A 1 232 ? 21.850  -19.269 99.110   1.00 10.00 ? ? ? ? ? ? 233 SER A N   1 
ATOM 1800  C CA  . SER A 1 232 ? 20.685  -19.780 98.466   1.00 10.00 ? ? ? ? ? ? 233 SER A CA  1 
ATOM 1801  C C   . SER A 1 232 ? 20.605  -21.273 98.253   1.00 10.00 ? ? ? ? ? ? 233 SER A C   1 
ATOM 1802  O O   . SER A 1 232 ? 20.354  -21.996 99.216   1.00 10.00 ? ? ? ? ? ? 233 SER A O   1 
ATOM 1803  C CB  . SER A 1 232 ? 20.569  -18.951 97.168   1.00 10.00 ? ? ? ? ? ? 233 SER A CB  1 
ATOM 1804  O OG  . SER A 1 232 ? 20.576  -17.550 97.464   1.00 10.00 ? ? ? ? ? ? 233 SER A OG  1 
ATOM 1805  N N   . SER A 1 233 ? 20.888  -21.770 97.052   1.00 10.00 ? ? ? ? ? ? 234 SER A N   1 
ATOM 1806  C CA  . SER A 1 233 ? 20.607  -23.134 96.620   1.00 10.00 ? ? ? ? ? ? 234 SER A CA  1 
ATOM 1807  C C   . SER A 1 233 ? 19.098  -23.443 96.868   1.00 10.00 ? ? ? ? ? ? 234 SER A C   1 
ATOM 1808  O O   . SER A 1 233 ? 18.242  -23.121 96.019   1.00 10.00 ? ? ? ? ? ? 234 SER A O   1 
ATOM 1809  C CB  . SER A 1 233 ? 21.554  -24.147 97.364   1.00 10.00 ? ? ? ? ? ? 234 SER A CB  1 
ATOM 1810  O OG  . SER A 1 233 ? 22.590  -23.509 98.098   1.00 10.00 ? ? ? ? ? ? 234 SER A OG  1 
ATOM 1811  N N   . SER A 1 234 ? 18.733  -23.857 98.092   1.00 10.00 ? ? ? ? ? ? 235 SER A N   1 
ATOM 1812  C CA  . SER A 1 234 ? 17.424  -24.376 98.442   1.00 10.00 ? ? ? ? ? ? 235 SER A CA  1 
ATOM 1813  C C   . SER A 1 234 ? 16.263  -23.438 98.817   1.00 10.00 ? ? ? ? ? ? 235 SER A C   1 
ATOM 1814  O O   . SER A 1 234 ? 15.143  -23.894 99.078   1.00 10.00 ? ? ? ? ? ? 235 SER A O   1 
ATOM 1815  C CB  . SER A 1 234 ? 17.773  -25.384 99.533   1.00 10.00 ? ? ? ? ? ? 235 SER A CB  1 
ATOM 1816  O OG  . SER A 1 234 ? 18.992  -26.128 99.251   1.00 10.00 ? ? ? ? ? ? 235 SER A OG  1 
ATOM 1817  N N   . LEU A 1 235 ? 16.443  -22.119 98.846   1.00 10.00 ? ? ? ? ? ? 236 LEU A N   1 
ATOM 1818  C CA  . LEU A 1 235 ? 15.365  -21.234 99.298   1.00 10.00 ? ? ? ? ? ? 236 LEU A CA  1 
ATOM 1819  C C   . LEU A 1 235 ? 14.413  -20.737 98.198   1.00 10.00 ? ? ? ? ? ? 236 LEU A C   1 
ATOM 1820  O O   . LEU A 1 235 ? 13.245  -20.414 98.490   1.00 10.00 ? ? ? ? ? ? 236 LEU A O   1 
ATOM 1821  C CB  . LEU A 1 235 ? 15.935  -19.991 100.011  1.00 10.00 ? ? ? ? ? ? 236 LEU A CB  1 
ATOM 1822  C CG  . LEU A 1 235 ? 16.803  -20.044 101.312  1.00 10.00 ? ? ? ? ? ? 236 LEU A CG  1 
ATOM 1823  C CD1 . LEU A 1 235 ? 15.876  -20.457 102.455  1.00 10.00 ? ? ? ? ? ? 236 LEU A CD1 1 
ATOM 1824  C CD2 . LEU A 1 235 ? 18.057  -20.961 101.150  1.00 10.00 ? ? ? ? ? ? 236 LEU A CD2 1 
ATOM 1825  N N   . GLU A 1 236 ? 14.846  -20.613 96.927   1.00 10.00 ? ? ? ? ? ? 237 GLU A N   1 
ATOM 1826  C CA  . GLU A 1 236 ? 13.917  -20.056 95.970   1.00 10.00 ? ? ? ? ? ? 237 GLU A CA  1 
ATOM 1827  C C   . GLU A 1 236 ? 13.012  -21.231 95.581   1.00 10.00 ? ? ? ? ? ? 237 GLU A C   1 
ATOM 1828  O O   . GLU A 1 236 ? 13.383  -22.410 95.432   1.00 10.00 ? ? ? ? ? ? 237 GLU A O   1 
ATOM 1829  C CB  . GLU A 1 236 ? 14.662  -19.431 94.719   1.00 10.00 ? ? ? ? ? ? 237 GLU A CB  1 
ATOM 1830  C CG  . GLU A 1 236 ? 15.803  -18.348 94.798   1.00 10.00 ? ? ? ? ? ? 237 GLU A CG  1 
ATOM 1831  C CD  . GLU A 1 236 ? 15.646  -16.804 95.008   1.00 10.00 ? ? ? ? ? ? 237 GLU A CD  1 
ATOM 1832  O OE1 . GLU A 1 236 ? 14.894  -16.086 94.312   1.00 10.00 ? ? ? ? ? ? 237 GLU A OE1 1 
ATOM 1833  O OE2 . GLU A 1 236 ? 16.377  -16.273 95.867   1.00 10.00 ? ? ? ? ? ? 237 GLU A OE2 1 
ATOM 1834  N N   . LYS A 1 237 ? 11.728  -20.920 95.556   1.00 10.00 ? ? ? ? ? ? 238 LYS A N   1 
ATOM 1835  C CA  . LYS A 1 237 ? 10.744  -21.853 95.012   1.00 10.00 ? ? ? ? ? ? 238 LYS A CA  1 
ATOM 1836  C C   . LYS A 1 237 ? 9.962   -21.126 93.914   1.00 10.00 ? ? ? ? ? ? 238 LYS A C   1 
ATOM 1837  O O   . LYS A 1 237 ? 9.907   -19.886 93.870   1.00 10.00 ? ? ? ? ? ? 238 LYS A O   1 
ATOM 1838  C CB  . LYS A 1 237 ? 9.747   -22.314 96.075   1.00 10.00 ? ? ? ? ? ? 238 LYS A CB  1 
ATOM 1839  C CG  . LYS A 1 237 ? 9.948   -23.685 96.697   1.00 10.00 ? ? ? ? ? ? 238 LYS A CG  1 
ATOM 1840  C CD  . LYS A 1 237 ? 11.139  -23.715 97.609   1.00 10.00 ? ? ? ? ? ? 238 LYS A CD  1 
ATOM 1841  C CE  . LYS A 1 237 ? 11.236  -25.098 98.248   1.00 10.00 ? ? ? ? ? ? 238 LYS A CE  1 
ATOM 1842  N NZ  . LYS A 1 237 ? 12.546  -25.283 98.855   1.00 10.00 ? ? ? ? ? ? 238 LYS A NZ  1 
ATOM 1843  N N   . SER A 1 238 ? 9.371   -21.879 92.998   1.00 10.00 ? ? ? ? ? ? 239 SER A N   1 
ATOM 1844  C CA  . SER A 1 238 ? 8.582   -21.289 91.926   1.00 10.00 ? ? ? ? ? ? 239 SER A CA  1 
ATOM 1845  C C   . SER A 1 238 ? 7.063   -21.589 91.950   1.00 10.00 ? ? ? ? ? ? 239 SER A C   1 
ATOM 1846  O O   . SER A 1 238 ? 6.524   -22.661 92.335   1.00 10.00 ? ? ? ? ? ? 239 SER A O   1 
ATOM 1847  C CB  . SER A 1 238 ? 9.186   -21.731 90.572   1.00 10.00 ? ? ? ? ? ? 239 SER A CB  1 
ATOM 1848  O OG  . SER A 1 238 ? 10.474  -21.162 90.324   1.00 10.00 ? ? ? ? ? ? 239 SER A OG  1 
ATOM 1849  N N   . TYR A 1 239 ? 6.429   -20.496 91.502   1.00 10.00 ? ? ? ? ? ? 240 TYR A N   1 
ATOM 1850  C CA  . TYR A 1 239 ? 5.010   -20.473 91.303   1.00 10.00 ? ? ? ? ? ? 240 TYR A CA  1 
ATOM 1851  C C   . TYR A 1 239 ? 4.675   -20.095 89.844   1.00 10.00 ? ? ? ? ? ? 240 TYR A C   1 
ATOM 1852  O O   . TYR A 1 239 ? 5.289   -19.262 89.155   1.00 10.00 ? ? ? ? ? ? 240 TYR A O   1 
ATOM 1853  C CB  . TYR A 1 239 ? 4.434   -19.504 92.263   1.00 10.00 ? ? ? ? ? ? 240 TYR A CB  1 
ATOM 1854  C CG  . TYR A 1 239 ? 3.019   -19.930 92.563   1.00 10.00 ? ? ? ? ? ? 240 TYR A CG  1 
ATOM 1855  C CD1 . TYR A 1 239 ? 1.997   -19.520 91.729   1.00 10.00 ? ? ? ? ? ? 240 TYR A CD1 1 
ATOM 1856  C CD2 . TYR A 1 239 ? 2.748   -20.703 93.660   1.00 10.00 ? ? ? ? ? ? 240 TYR A CD2 1 
ATOM 1857  C CE1 . TYR A 1 239 ? 0.691   -19.871 91.975   1.00 10.00 ? ? ? ? ? ? 240 TYR A CE1 1 
ATOM 1858  C CE2 . TYR A 1 239 ? 1.438   -21.052 93.911   1.00 10.00 ? ? ? ? ? ? 240 TYR A CE2 1 
ATOM 1859  C CZ  . TYR A 1 239 ? 0.424   -20.629 93.070   1.00 10.00 ? ? ? ? ? ? 240 TYR A CZ  1 
ATOM 1860  O OH  . TYR A 1 239 ? -0.893  -20.920 93.343   1.00 10.00 ? ? ? ? ? ? 240 TYR A OH  1 
ATOM 1861  N N   . GLU A 1 240 ? 3.648   -20.806 89.373   1.00 10.00 ? ? ? ? ? ? 241 GLU A N   1 
ATOM 1862  C CA  . GLU A 1 240 ? 3.204   -20.792 88.002   1.00 10.00 ? ? ? ? ? ? 241 GLU A CA  1 
ATOM 1863  C C   . GLU A 1 240 ? 1.956   -19.963 87.894   1.00 10.00 ? ? ? ? ? ? 241 GLU A C   1 
ATOM 1864  O O   . GLU A 1 240 ? 0.970   -20.225 88.577   1.00 10.00 ? ? ? ? ? ? 241 GLU A O   1 
ATOM 1865  C CB  . GLU A 1 240 ? 2.888   -22.205 87.561   1.00 10.00 ? ? ? ? ? ? 241 GLU A CB  1 
ATOM 1866  C CG  . GLU A 1 240 ? 2.755   -22.392 86.052   1.00 10.00 ? ? ? ? ? ? 241 GLU A CG  1 
ATOM 1867  C CD  . GLU A 1 240 ? 1.773   -23.474 85.614   1.00 10.00 ? ? ? ? ? ? 241 GLU A CD  1 
ATOM 1868  O OE1 . GLU A 1 240 ? 2.109   -24.664 85.771   1.00 10.00 ? ? ? ? ? ? 241 GLU A OE1 1 
ATOM 1869  O OE2 . GLU A 1 240 ? 0.693   -23.087 85.120   1.00 10.00 ? ? ? ? ? ? 241 GLU A OE2 1 
ATOM 1870  N N   . LEU A 1 241 ? 2.009   -18.969 87.048   1.00 10.00 ? ? ? ? ? ? 242 LEU A N   1 
ATOM 1871  C CA  . LEU A 1 241 ? 0.807   -18.235 86.703   1.00 10.00 ? ? ? ? ? ? 242 LEU A CA  1 
ATOM 1872  C C   . LEU A 1 241 ? -0.196  -19.103 85.889   1.00 10.00 ? ? ? ? ? ? 242 LEU A C   1 
ATOM 1873  O O   . LEU A 1 241 ? 0.167   -20.004 85.115   1.00 10.00 ? ? ? ? ? ? 242 LEU A O   1 
ATOM 1874  C CB  . LEU A 1 241 ? 1.183   -16.992 85.891   1.00 10.00 ? ? ? ? ? ? 242 LEU A CB  1 
ATOM 1875  C CG  . LEU A 1 241 ? 1.966   -15.829 86.513   1.00 10.00 ? ? ? ? ? ? 242 LEU A CG  1 
ATOM 1876  C CD1 . LEU A 1 241 ? 1.268   -15.352 87.768   1.00 10.00 ? ? ? ? ? ? 242 LEU A CD1 1 
ATOM 1877  C CD2 . LEU A 1 241 ? 3.377   -16.264 86.842   1.00 10.00 ? ? ? ? ? ? 242 LEU A CD2 1 
ATOM 1878  N N   . PRO A 1 242 ? -1.513  -18.880 86.008   1.00 10.00 ? ? ? ? ? ? 243 PRO A N   1 
ATOM 1879  C CA  . PRO A 1 242 ? -2.520  -19.252 84.998   1.00 10.00 ? ? ? ? ? ? 243 PRO A CA  1 
ATOM 1880  C C   . PRO A 1 242 ? -2.014  -18.932 83.583   1.00 10.00 ? ? ? ? ? ? 243 PRO A C   1 
ATOM 1881  O O   . PRO A 1 242 ? -1.980  -19.791 82.706   1.00 10.00 ? ? ? ? ? ? 243 PRO A O   1 
ATOM 1882  C CB  . PRO A 1 242 ? -3.763  -18.461 85.435   1.00 10.00 ? ? ? ? ? ? 243 PRO A CB  1 
ATOM 1883  C CG  . PRO A 1 242 ? -3.248  -17.538 86.549   1.00 10.00 ? ? ? ? ? ? 243 PRO A CG  1 
ATOM 1884  C CD  . PRO A 1 242 ? -2.166  -18.402 87.219   1.00 10.00 ? ? ? ? ? ? 243 PRO A CD  1 
ATOM 1885  N N   . ASP A 1 243 ? -1.535  -17.710 83.381   1.00 10.00 ? ? ? ? ? ? 244 ASP A N   1 
ATOM 1886  C CA  . ASP A 1 243 ? -0.830  -17.254 82.191   1.00 10.00 ? ? ? ? ? ? 244 ASP A CA  1 
ATOM 1887  C C   . ASP A 1 243 ? 0.260   -18.206 81.665   1.00 10.00 ? ? ? ? ? ? 244 ASP A C   1 
ATOM 1888  O O   . ASP A 1 243 ? 0.825   -17.884 80.626   1.00 10.00 ? ? ? ? ? ? 244 ASP A O   1 
ATOM 1889  C CB  . ASP A 1 243 ? -0.292  -15.871 82.622   1.00 10.00 ? ? ? ? ? ? 244 ASP A CB  1 
ATOM 1890  C CG  . ASP A 1 243 ? 0.758   -15.087 81.830   1.00 10.00 ? ? ? ? ? ? 244 ASP A CG  1 
ATOM 1891  O OD1 . ASP A 1 243 ? 1.863   -15.578 81.631   1.00 10.00 ? ? ? ? ? ? 244 ASP A OD1 1 
ATOM 1892  O OD2 . ASP A 1 243 ? 0.481   -13.946 81.440   1.00 10.00 ? ? ? ? ? ? 244 ASP A OD2 1 
ATOM 1893  N N   . GLY A 1 244 ? 0.673   -19.333 82.289   1.00 10.00 ? ? ? ? ? ? 245 GLY A N   1 
ATOM 1894  C CA  . GLY A 1 244 ? 1.785   -20.180 81.819   1.00 10.00 ? ? ? ? ? ? 245 GLY A CA  1 
ATOM 1895  C C   . GLY A 1 244 ? 3.139   -19.787 82.437   1.00 10.00 ? ? ? ? ? ? 245 GLY A C   1 
ATOM 1896  O O   . GLY A 1 244 ? 3.987   -20.648 82.664   1.00 10.00 ? ? ? ? ? ? 245 GLY A O   1 
ATOM 1897  N N   . GLN A 1 245 ? 3.327   -18.472 82.679   1.00 10.00 ? ? ? ? ? ? 246 GLN A N   1 
ATOM 1898  C CA  . GLN A 1 245 ? 4.516   -17.825 83.245   1.00 10.00 ? ? ? ? ? ? 246 GLN A CA  1 
ATOM 1899  C C   . GLN A 1 245 ? 5.064   -18.328 84.596   1.00 10.00 ? ? ? ? ? ? 246 GLN A C   1 
ATOM 1900  O O   . GLN A 1 245 ? 4.299   -18.931 85.374   1.00 10.00 ? ? ? ? ? ? 246 GLN A O   1 
ATOM 1901  C CB  . GLN A 1 245 ? 4.200   -16.345 83.388   1.00 10.00 ? ? ? ? ? ? 246 GLN A CB  1 
ATOM 1902  C CG  . GLN A 1 245 ? 5.065   -15.318 82.660   1.00 10.00 ? ? ? ? ? ? 246 GLN A CG  1 
ATOM 1903  C CD  . GLN A 1 245 ? 6.405   -15.040 83.335   1.00 10.00 ? ? ? ? ? ? 246 GLN A CD  1 
ATOM 1904  O OE1 . GLN A 1 245 ? 7.383   -15.802 83.259   1.00 10.00 ? ? ? ? ? ? 246 GLN A OE1 1 
ATOM 1905  N NE2 . GLN A 1 245 ? 6.482   -13.923 84.036   1.00 10.00 ? ? ? ? ? ? 246 GLN A NE2 1 
ATOM 1906  N N   . VAL A 1 246 ? 6.331   -17.970 84.968   1.00 10.00 ? ? ? ? ? ? 247 VAL A N   1 
ATOM 1907  C CA  . VAL A 1 246 ? 6.893   -18.374 86.245   1.00 10.00 ? ? ? ? ? ? 247 VAL A CA  1 
ATOM 1908  C C   . VAL A 1 246 ? 7.271   -17.265 87.247   1.00 10.00 ? ? ? ? ? ? 247 VAL A C   1 
ATOM 1909  O O   . VAL A 1 246 ? 7.635   -16.126 86.932   1.00 10.00 ? ? ? ? ? ? 247 VAL A O   1 
ATOM 1910  C CB  . VAL A 1 246 ? 8.068   -19.250 85.913   1.00 10.00 ? ? ? ? ? ? 247 VAL A CB  1 
ATOM 1911  C CG1 . VAL A 1 246 ? 9.356   -18.427 85.722   1.00 10.00 ? ? ? ? ? ? 247 VAL A CG1 1 
ATOM 1912  C CG2 . VAL A 1 246 ? 8.118   -20.316 87.003   1.00 10.00 ? ? ? ? ? ? 247 VAL A CG2 1 
ATOM 1913  N N   . ILE A 1 247 ? 7.192   -17.597 88.522   1.00 10.00 ? ? ? ? ? ? 248 ILE A N   1 
ATOM 1914  C CA  . ILE A 1 247 ? 7.454   -16.671 89.606   1.00 10.00 ? ? ? ? ? ? 248 ILE A CA  1 
ATOM 1915  C C   . ILE A 1 247 ? 8.602   -17.373 90.276   1.00 10.00 ? ? ? ? ? ? 248 ILE A C   1 
ATOM 1916  O O   . ILE A 1 247 ? 8.645   -18.616 90.284   1.00 10.00 ? ? ? ? ? ? 248 ILE A O   1 
ATOM 1917  C CB  . ILE A 1 247 ? 6.243   -16.622 90.582   1.00 10.00 ? ? ? ? ? ? 248 ILE A CB  1 
ATOM 1918  C CG1 . ILE A 1 247 ? 5.006   -16.203 89.859   1.00 10.00 ? ? ? ? ? ? 248 ILE A CG1 1 
ATOM 1919  C CG2 . ILE A 1 247 ? 6.404   -15.565 91.635   1.00 10.00 ? ? ? ? ? ? 248 ILE A CG2 1 
ATOM 1920  C CD1 . ILE A 1 247 ? 3.731   -16.482 90.688   1.00 10.00 ? ? ? ? ? ? 248 ILE A CD1 1 
ATOM 1921  N N   . THR A 1 248 ? 9.532   -16.618 90.814   1.00 10.00 ? ? ? ? ? ? 249 THR A N   1 
ATOM 1922  C CA  . THR A 1 248 ? 10.436  -17.251 91.743   1.00 10.00 ? ? ? ? ? ? 249 THR A CA  1 
ATOM 1923  C C   . THR A 1 248 ? 10.514  -16.377 92.983   1.00 10.00 ? ? ? ? ? ? 249 THR A C   1 
ATOM 1924  O O   . THR A 1 248 ? 10.559  -15.142 92.914   1.00 10.00 ? ? ? ? ? ? 249 THR A O   1 
ATOM 1925  C CB  . THR A 1 248 ? 11.801  -17.484 91.060   1.00 10.00 ? ? ? ? ? ? 249 THR A CB  1 
ATOM 1926  O OG1 . THR A 1 248 ? 11.473  -18.381 89.994   1.00 10.00 ? ? ? ? ? ? 249 THR A OG1 1 
ATOM 1927  C CG2 . THR A 1 248 ? 12.892  -18.150 91.922   1.00 10.00 ? ? ? ? ? ? 249 THR A CG2 1 
ATOM 1928  N N   . ILE A 1 249 ? 10.391  -17.062 94.133   1.00 10.00 ? ? ? ? ? ? 250 ILE A N   1 
ATOM 1929  C CA  . ILE A 1 249 ? 10.348  -16.436 95.441   1.00 10.00 ? ? ? ? ? ? 250 ILE A CA  1 
ATOM 1930  C C   . ILE A 1 249 ? 11.417  -17.041 96.325   1.00 10.00 ? ? ? ? ? ? 250 ILE A C   1 
ATOM 1931  O O   . ILE A 1 249 ? 11.720  -18.220 96.326   1.00 10.00 ? ? ? ? ? ? 250 ILE A O   1 
ATOM 1932  C CB  . ILE A 1 249 ? 8.976   -16.633 96.076   1.00 10.00 ? ? ? ? ? ? 250 ILE A CB  1 
ATOM 1933  C CG1 . ILE A 1 249 ? 7.952   -16.062 95.146   1.00 10.00 ? ? ? ? ? ? 250 ILE A CG1 1 
ATOM 1934  C CG2 . ILE A 1 249 ? 8.789   -15.844 97.335   1.00 10.00 ? ? ? ? ? ? 250 ILE A CG2 1 
ATOM 1935  C CD1 . ILE A 1 249 ? 7.215   -17.261 94.492   1.00 10.00 ? ? ? ? ? ? 250 ILE A CD1 1 
ATOM 1936  N N   . GLY A 1 250 ? 12.091  -16.133 96.973   1.00 10.00 ? ? ? ? ? ? 251 GLY A N   1 
ATOM 1937  C CA  . GLY A 1 250 ? 13.163  -16.498 97.858   1.00 10.00 ? ? ? ? ? ? 251 GLY A CA  1 
ATOM 1938  C C   . GLY A 1 250 ? 13.020  -15.772 99.183   1.00 10.00 ? ? ? ? ? ? 251 GLY A C   1 
ATOM 1939  O O   . GLY A 1 250 ? 12.081  -16.111 99.928   1.00 10.00 ? ? ? ? ? ? 251 GLY A O   1 
ATOM 1940  N N   . ASN A 1 251 ? 13.779  -14.682 99.448   1.00 10.00 ? ? ? ? ? ? 252 ASN A N   1 
ATOM 1941  C CA  . ASN A 1 251 ? 13.775  -14.105 100.794  1.00 10.00 ? ? ? ? ? ? 252 ASN A CA  1 
ATOM 1942  C C   . ASN A 1 251 ? 12.414  -13.602 101.287  1.00 10.00 ? ? ? ? ? ? 252 ASN A C   1 
ATOM 1943  O O   . ASN A 1 251 ? 12.099  -13.532 102.482  1.00 10.00 ? ? ? ? ? ? 252 ASN A O   1 
ATOM 1944  C CB  . ASN A 1 251 ? 14.801  -12.966 100.894  1.00 10.00 ? ? ? ? ? ? 252 ASN A CB  1 
ATOM 1945  C CG  . ASN A 1 251 ? 14.421  -11.595 100.381  1.00 10.00 ? ? ? ? ? ? 252 ASN A CG  1 
ATOM 1946  O OD1 . ASN A 1 251 ? 13.386  -11.362 99.762   1.00 10.00 ? ? ? ? ? ? 252 ASN A OD1 1 
ATOM 1947  N ND2 . ASN A 1 251 ? 15.296  -10.642 100.611  1.00 10.00 ? ? ? ? ? ? 252 ASN A ND2 1 
ATOM 1948  N N   . GLU A 1 252 ? 11.594  -13.341 100.289  1.00 10.00 ? ? ? ? ? ? 253 GLU A N   1 
ATOM 1949  C CA  . GLU A 1 252 ? 10.215  -12.981 100.449  1.00 10.00 ? ? ? ? ? ? 253 GLU A CA  1 
ATOM 1950  C C   . GLU A 1 252 ? 9.341   -13.925 101.274  1.00 10.00 ? ? ? ? ? ? 253 GLU A C   1 
ATOM 1951  O O   . GLU A 1 252 ? 8.509   -13.486 102.074  1.00 10.00 ? ? ? ? ? ? 253 GLU A O   1 
ATOM 1952  C CB  . GLU A 1 252 ? 9.638   -12.817 99.035   1.00 10.00 ? ? ? ? ? ? 253 GLU A CB  1 
ATOM 1953  C CG  . GLU A 1 252 ? 10.286  -11.683 98.285   1.00 10.00 ? ? ? ? ? ? 253 GLU A CG  1 
ATOM 1954  C CD  . GLU A 1 252 ? 10.990  -12.052 96.985   1.00 10.00 ? ? ? ? ? ? 253 GLU A CD  1 
ATOM 1955  O OE1 . GLU A 1 252 ? 11.570  -13.139 96.867   1.00 10.00 ? ? ? ? ? ? 253 GLU A OE1 1 
ATOM 1956  O OE2 . GLU A 1 252 ? 10.949  -11.198 96.101   1.00 10.00 ? ? ? ? ? ? 253 GLU A OE2 1 
ATOM 1957  N N   . ARG A 1 253 ? 9.523   -15.228 101.109  1.00 10.00 ? ? ? ? ? ? 254 ARG A N   1 
ATOM 1958  C CA  . ARG A 1 253 ? 8.726   -16.229 101.798  1.00 10.00 ? ? ? ? ? ? 254 ARG A CA  1 
ATOM 1959  C C   . ARG A 1 253 ? 8.674   -16.070 103.306  1.00 10.00 ? ? ? ? ? ? 254 ARG A C   1 
ATOM 1960  O O   . ARG A 1 253 ? 7.614   -16.268 103.900  1.00 10.00 ? ? ? ? ? ? 254 ARG A O   1 
ATOM 1961  C CB  . ARG A 1 253 ? 9.257   -17.591 101.546  1.00 10.00 ? ? ? ? ? ? 254 ARG A CB  1 
ATOM 1962  C CG  . ARG A 1 253 ? 9.003   -18.103 100.202  1.00 10.00 ? ? ? ? ? ? 254 ARG A CG  1 
ATOM 1963  C CD  . ARG A 1 253 ? 9.974   -19.217 100.223  1.00 10.00 ? ? ? ? ? ? 254 ARG A CD  1 
ATOM 1964  N NE  . ARG A 1 253 ? 9.294   -20.450 100.421  1.00 10.00 ? ? ? ? ? ? 254 ARG A NE  1 
ATOM 1965  C CZ  . ARG A 1 253 ? 9.987   -21.575 100.642  1.00 10.00 ? ? ? ? ? ? 254 ARG A CZ  1 
ATOM 1966  N NH1 . ARG A 1 253 ? 11.334  -21.606 100.696  1.00 10.00 ? ? ? ? ? ? 254 ARG A NH1 1 
ATOM 1967  N NH2 . ARG A 1 253 ? 9.330   -22.735 100.744  1.00 10.00 ? ? ? ? ? ? 254 ARG A NH2 1 
ATOM 1968  N N   . PHE A 1 254 ? 9.820   -15.777 103.955  1.00 10.00 ? ? ? ? ? ? 255 PHE A N   1 
ATOM 1969  C CA  . PHE A 1 254 ? 9.872   -15.594 105.410  1.00 10.00 ? ? ? ? ? ? 255 PHE A CA  1 
ATOM 1970  C C   . PHE A 1 254 ? 9.728   -14.109 105.792  1.00 10.00 ? ? ? ? ? ? 255 PHE A C   1 
ATOM 1971  O O   . PHE A 1 254 ? 9.212   -13.802 106.862  1.00 10.00 ? ? ? ? ? ? 255 PHE A O   1 
ATOM 1972  C CB  . PHE A 1 254 ? 11.209  -16.228 105.968  1.00 10.00 ? ? ? ? ? ? 255 PHE A CB  1 
ATOM 1973  C CG  . PHE A 1 254 ? 12.575  -15.622 105.605  1.00 10.00 ? ? ? ? ? ? 255 PHE A CG  1 
ATOM 1974  C CD1 . PHE A 1 254 ? 12.988  -14.420 106.176  1.00 10.00 ? ? ? ? ? ? 255 PHE A CD1 1 
ATOM 1975  C CD2 . PHE A 1 254 ? 13.351  -16.262 104.655  1.00 10.00 ? ? ? ? ? ? 255 PHE A CD2 1 
ATOM 1976  C CE1 . PHE A 1 254 ? 14.157  -13.844 105.785  1.00 10.00 ? ? ? ? ? ? 255 PHE A CE1 1 
ATOM 1977  C CE2 . PHE A 1 254 ? 14.520  -15.668 104.286  1.00 10.00 ? ? ? ? ? ? 255 PHE A CE2 1 
ATOM 1978  C CZ  . PHE A 1 254 ? 14.907  -14.473 104.839  1.00 10.00 ? ? ? ? ? ? 255 PHE A CZ  1 
ATOM 1979  N N   . ARG A 1 255 ? 10.154  -13.172 104.918  1.00 10.00 ? ? ? ? ? ? 256 ARG A N   1 
ATOM 1980  C CA  . ARG A 1 255 ? 10.022  -11.724 105.052  1.00 10.00 ? ? ? ? ? ? 256 ARG A CA  1 
ATOM 1981  C C   . ARG A 1 255 ? 8.540   -11.308 105.075  1.00 10.00 ? ? ? ? ? ? 256 ARG A C   1 
ATOM 1982  O O   . ARG A 1 255 ? 8.194   -10.218 105.514  1.00 10.00 ? ? ? ? ? ? 256 ARG A O   1 
ATOM 1983  C CB  . ARG A 1 255 ? 10.669  -10.945 103.868  1.00 10.00 ? ? ? ? ? ? 256 ARG A CB  1 
ATOM 1984  C CG  . ARG A 1 255 ? 12.175  -10.808 103.603  1.00 10.00 ? ? ? ? ? ? 256 ARG A CG  1 
ATOM 1985  C CD  . ARG A 1 255 ? 12.363  -9.453  102.905  1.00 10.00 ? ? ? ? ? ? 256 ARG A CD  1 
ATOM 1986  N NE  . ARG A 1 255 ? 12.205  -9.451  101.445  1.00 10.00 ? ? ? ? ? ? 256 ARG A NE  1 
ATOM 1987  C CZ  . ARG A 1 255 ? 12.026  -8.328  100.713  1.00 10.00 ? ? ? ? ? ? 256 ARG A CZ  1 
ATOM 1988  N NH1 . ARG A 1 255 ? 11.954  -7.106  101.223  1.00 10.00 ? ? ? ? ? ? 256 ARG A NH1 1 
ATOM 1989  N NH2 . ARG A 1 255 ? 11.916  -8.446  99.425   1.00 10.00 ? ? ? ? ? ? 256 ARG A NH2 1 
ATOM 1990  N N   . CYS A 1 256 ? 7.624   -12.092 104.529  1.00 10.00 ? ? ? ? ? ? 257 CYS A N   1 
ATOM 1991  C CA  . CYS A 1 256 ? 6.193   -11.769 104.560  1.00 10.00 ? ? ? ? ? ? 257 CYS A CA  1 
ATOM 1992  C C   . CYS A 1 256 ? 5.691   -11.942 106.017  1.00 10.00 ? ? ? ? ? ? 257 CYS A C   1 
ATOM 1993  O O   . CYS A 1 256 ? 5.544   -10.896 106.686  1.00 10.00 ? ? ? ? ? ? 257 CYS A O   1 
ATOM 1994  C CB  . CYS A 1 256 ? 5.511   -12.710 103.540  1.00 10.00 ? ? ? ? ? ? 257 CYS A CB  1 
ATOM 1995  S SG  . CYS A 1 256 ? 3.788   -12.350 103.218  1.00 10.00 ? ? ? ? ? ? 257 CYS A SG  1 
ATOM 1996  N N   . PRO A 1 257 ? 5.534   -13.153 106.634  1.00 10.00 ? ? ? ? ? ? 258 PRO A N   1 
ATOM 1997  C CA  . PRO A 1 257 ? 5.053   -13.303 107.999  1.00 10.00 ? ? ? ? ? ? 258 PRO A CA  1 
ATOM 1998  C C   . PRO A 1 257 ? 5.838   -12.479 108.981  1.00 10.00 ? ? ? ? ? ? 258 PRO A C   1 
ATOM 1999  O O   . PRO A 1 257 ? 5.252   -12.089 109.979  1.00 10.00 ? ? ? ? ? ? 258 PRO A O   1 
ATOM 2000  C CB  . PRO A 1 257 ? 5.146   -14.761 108.329  1.00 10.00 ? ? ? ? ? ? 258 PRO A CB  1 
ATOM 2001  C CG  . PRO A 1 257 ? 5.148   -15.395 106.967  1.00 10.00 ? ? ? ? ? ? 258 PRO A CG  1 
ATOM 2002  C CD  . PRO A 1 257 ? 6.036   -14.457 106.197  1.00 10.00 ? ? ? ? ? ? 258 PRO A CD  1 
ATOM 2003  N N   . GLU A 1 258 ? 7.097   -12.101 108.778  1.00 10.00 ? ? ? ? ? ? 259 GLU A N   1 
ATOM 2004  C CA  . GLU A 1 258 ? 7.851   -11.230 109.684  1.00 10.00 ? ? ? ? ? ? 259 GLU A CA  1 
ATOM 2005  C C   . GLU A 1 258 ? 7.260   -9.877  110.039  1.00 10.00 ? ? ? ? ? ? 259 GLU A C   1 
ATOM 2006  O O   . GLU A 1 258 ? 7.641   -9.202  111.009  1.00 10.00 ? ? ? ? ? ? 259 GLU A O   1 
ATOM 2007  C CB  . GLU A 1 258 ? 9.209   -11.007 109.083  1.00 10.00 ? ? ? ? ? ? 259 GLU A CB  1 
ATOM 2008  C CG  . GLU A 1 258 ? 10.134  -12.121 109.437  1.00 10.00 ? ? ? ? ? ? 259 GLU A CG  1 
ATOM 2009  C CD  . GLU A 1 258 ? 10.647  -11.950 110.838  1.00 10.00 ? ? ? ? ? ? 259 GLU A CD  1 
ATOM 2010  O OE1 . GLU A 1 258 ? 11.028  -10.846 111.218  1.00 10.00 ? ? ? ? ? ? 259 GLU A OE1 1 
ATOM 2011  O OE2 . GLU A 1 258 ? 10.661  -12.942 111.532  1.00 10.00 ? ? ? ? ? ? 259 GLU A OE2 1 
ATOM 2012  N N   . ALA A 1 259 ? 6.343   -9.419  109.209  1.00 10.00 ? ? ? ? ? ? 260 ALA A N   1 
ATOM 2013  C CA  . ALA A 1 259 ? 5.631   -8.201  109.513  1.00 10.00 ? ? ? ? ? ? 260 ALA A CA  1 
ATOM 2014  C C   . ALA A 1 259 ? 4.720   -8.408  110.731  1.00 10.00 ? ? ? ? ? ? 260 ALA A C   1 
ATOM 2015  O O   . ALA A 1 259 ? 4.304   -7.452  111.379  1.00 10.00 ? ? ? ? ? ? 260 ALA A O   1 
ATOM 2016  C CB  . ALA A 1 259 ? 4.824   -7.811  108.288  1.00 10.00 ? ? ? ? ? ? 260 ALA A CB  1 
ATOM 2017  N N   . LEU A 1 260 ? 4.384   -9.632  111.092  1.00 10.00 ? ? ? ? ? ? 261 LEU A N   1 
ATOM 2018  C CA  . LEU A 1 260 ? 3.662   -9.916  112.307  1.00 10.00 ? ? ? ? ? ? 261 LEU A CA  1 
ATOM 2019  C C   . LEU A 1 260 ? 4.479   -9.628  113.558  1.00 10.00 ? ? ? ? ? ? 261 LEU A C   1 
ATOM 2020  O O   . LEU A 1 260 ? 3.983   -9.231  114.616  1.00 10.00 ? ? ? ? ? ? 261 LEU A O   1 
ATOM 2021  C CB  . LEU A 1 260 ? 3.258   -11.366 112.288  1.00 10.00 ? ? ? ? ? ? 261 LEU A CB  1 
ATOM 2022  C CG  . LEU A 1 260 ? 2.054   -11.747 111.446  1.00 10.00 ? ? ? ? ? ? 261 LEU A CG  1 
ATOM 2023  C CD1 . LEU A 1 260 ? 1.904   -13.281 111.336  1.00 10.00 ? ? ? ? ? ? 261 LEU A CD1 1 
ATOM 2024  C CD2 . LEU A 1 260 ? 0.828   -11.114 112.118  1.00 10.00 ? ? ? ? ? ? 261 LEU A CD2 1 
ATOM 2025  N N   . PHE A 1 261 ? 5.775   -9.903  113.498  1.00 10.00 ? ? ? ? ? ? 262 PHE A N   1 
ATOM 2026  C CA  . PHE A 1 261 ? 6.675   -9.729  114.627  1.00 10.00 ? ? ? ? ? ? 262 PHE A CA  1 
ATOM 2027  C C   . PHE A 1 261 ? 7.285   -8.349  114.720  1.00 10.00 ? ? ? ? ? ? 262 PHE A C   1 
ATOM 2028  O O   . PHE A 1 261 ? 7.599   -7.900  115.830  1.00 10.00 ? ? ? ? ? ? 262 PHE A O   1 
ATOM 2029  C CB  . PHE A 1 261 ? 7.783   -10.774 114.563  1.00 10.00 ? ? ? ? ? ? 262 PHE A CB  1 
ATOM 2030  C CG  . PHE A 1 261 ? 7.169   -12.091 114.959  1.00 10.00 ? ? ? ? ? ? 262 PHE A CG  1 
ATOM 2031  C CD1 . PHE A 1 261 ? 6.915   -12.342 116.284  1.00 10.00 ? ? ? ? ? ? 262 PHE A CD1 1 
ATOM 2032  C CD2 . PHE A 1 261 ? 6.802   -13.001 114.006  1.00 10.00 ? ? ? ? ? ? 262 PHE A CD2 1 
ATOM 2033  C CE1 . PHE A 1 261 ? 6.286   -13.490 116.656  1.00 10.00 ? ? ? ? ? ? 262 PHE A CE1 1 
ATOM 2034  C CE2 . PHE A 1 261 ? 6.165   -14.160 114.393  1.00 10.00 ? ? ? ? ? ? 262 PHE A CE2 1 
ATOM 2035  C CZ  . PHE A 1 261 ? 5.908   -14.402 115.715  1.00 10.00 ? ? ? ? ? ? 262 PHE A CZ  1 
ATOM 2036  N N   . GLN A 1 262 ? 7.448   -7.729  113.555  1.00 10.00 ? ? ? ? ? ? 263 GLN A N   1 
ATOM 2037  C CA  . GLN A 1 262 ? 8.009   -6.413  113.379  1.00 10.00 ? ? ? ? ? ? 263 GLN A CA  1 
ATOM 2038  C C   . GLN A 1 262 ? 7.079   -5.612  112.464  1.00 10.00 ? ? ? ? ? ? 263 GLN A C   1 
ATOM 2039  O O   . GLN A 1 262 ? 7.259   -5.582  111.253  1.00 10.00 ? ? ? ? ? ? 263 GLN A O   1 
ATOM 2040  C CB  . GLN A 1 262 ? 9.365   -6.520  112.732  1.00 10.00 ? ? ? ? ? ? 263 GLN A CB  1 
ATOM 2041  C CG  . GLN A 1 262 ? 10.168  -7.703  113.236  1.00 10.00 ? ? ? ? ? ? 263 GLN A CG  1 
ATOM 2042  C CD  . GLN A 1 262 ? 11.582  -7.621  112.768  1.00 10.00 ? ? ? ? ? ? 263 GLN A CD  1 
ATOM 2043  O OE1 . GLN A 1 262 ? 12.101  -6.529  112.621  1.00 10.00 ? ? ? ? ? ? 263 GLN A OE1 1 
ATOM 2044  N NE2 . GLN A 1 262 ? 12.250  -8.731  112.556  1.00 10.00 ? ? ? ? ? ? 263 GLN A NE2 1 
ATOM 2045  N N   . PRO A 1 263 ? 6.059   -4.915  112.894  1.00 10.00 ? ? ? ? ? ? 264 PRO A N   1 
ATOM 2046  C CA  . PRO A 1 263 ? 5.152   -4.219  111.999  1.00 10.00 ? ? ? ? ? ? 264 PRO A CA  1 
ATOM 2047  C C   . PRO A 1 263 ? 5.751   -2.926  111.474  1.00 10.00 ? ? ? ? ? ? 264 PRO A C   1 
ATOM 2048  O O   . PRO A 1 263 ? 5.070   -2.104  110.865  1.00 10.00 ? ? ? ? ? ? 264 PRO A O   1 
ATOM 2049  C CB  . PRO A 1 263 ? 3.899   -4.031  112.836  1.00 10.00 ? ? ? ? ? ? 264 PRO A CB  1 
ATOM 2050  C CG  . PRO A 1 263 ? 4.044   -5.103  113.891  1.00 10.00 ? ? ? ? ? ? 264 PRO A CG  1 
ATOM 2051  C CD  . PRO A 1 263 ? 5.511   -5.011  114.225  1.00 10.00 ? ? ? ? ? ? 264 PRO A CD  1 
ATOM 2052  N N   . SER A 1 264 ? 7.042   -2.686  111.700  1.00 10.00 ? ? ? ? ? ? 265 SER A N   1 
ATOM 2053  C CA  . SER A 1 264 ? 7.781   -1.592  111.106  1.00 10.00 ? ? ? ? ? ? 265 SER A CA  1 
ATOM 2054  C C   . SER A 1 264 ? 7.933   -1.976  109.660  1.00 10.00 ? ? ? ? ? ? 265 SER A C   1 
ATOM 2055  O O   . SER A 1 264 ? 7.866   -1.092  108.818  1.00 10.00 ? ? ? ? ? ? 265 SER A O   1 
ATOM 2056  C CB  . SER A 1 264 ? 9.156   -1.440  111.762  1.00 10.00 ? ? ? ? ? ? 265 SER A CB  1 
ATOM 2057  O OG  . SER A 1 264 ? 9.634   -2.677  112.314  1.00 10.00 ? ? ? ? ? ? 265 SER A OG  1 
ATOM 2058  N N   . PHE A 1 265 ? 8.058   -3.276  109.345  1.00 10.00 ? ? ? ? ? ? 266 PHE A N   1 
ATOM 2059  C CA  . PHE A 1 265 ? 8.124   -3.744  107.973  1.00 10.00 ? ? ? ? ? ? 266 PHE A CA  1 
ATOM 2060  C C   . PHE A 1 265 ? 6.951   -3.238  107.218  1.00 10.00 ? ? ? ? ? ? 266 PHE A C   1 
ATOM 2061  O O   . PHE A 1 265 ? 7.115   -2.868  106.087  1.00 10.00 ? ? ? ? ? ? 266 PHE A O   1 
ATOM 2062  C CB  . PHE A 1 265 ? 8.034   -5.213  107.817  1.00 10.00 ? ? ? ? ? ? 266 PHE A CB  1 
ATOM 2063  C CG  . PHE A 1 265 ? 9.307   -5.961  108.144  1.00 10.00 ? ? ? ? ? ? 266 PHE A CG  1 
ATOM 2064  C CD1 . PHE A 1 265 ? 10.199  -5.456  109.049  1.00 10.00 ? ? ? ? ? ? 266 PHE A CD1 1 
ATOM 2065  C CD2 . PHE A 1 265 ? 9.535   -7.148  107.485  1.00 10.00 ? ? ? ? ? ? 266 PHE A CD2 1 
ATOM 2066  C CE1 . PHE A 1 265 ? 11.333  -6.155  109.292  1.00 10.00 ? ? ? ? ? ? 266 PHE A CE1 1 
ATOM 2067  C CE2 . PHE A 1 265 ? 10.679  -7.835  107.741  1.00 10.00 ? ? ? ? ? ? 266 PHE A CE2 1 
ATOM 2068  C CZ  . PHE A 1 265 ? 11.560  -7.324  108.637  1.00 10.00 ? ? ? ? ? ? 266 PHE A CZ  1 
ATOM 2069  N N   . LEU A 1 266 ? 5.785   -3.225  107.822  1.00 10.00 ? ? ? ? ? ? 267 LEU A N   1 
ATOM 2070  C CA  . LEU A 1 266 ? 4.608   -2.630  107.226  1.00 10.00 ? ? ? ? ? ? 267 LEU A CA  1 
ATOM 2071  C C   . LEU A 1 266 ? 4.510   -1.103  107.399  1.00 10.00 ? ? ? ? ? ? 267 LEU A C   1 
ATOM 2072  O O   . LEU A 1 266 ? 3.575   -0.491  106.871  1.00 10.00 ? ? ? ? ? ? 267 LEU A O   1 
ATOM 2073  C CB  . LEU A 1 266 ? 3.363   -3.287  107.831  1.00 10.00 ? ? ? ? ? ? 267 LEU A CB  1 
ATOM 2074  C CG  . LEU A 1 266 ? 3.253   -4.764  107.650  1.00 10.00 ? ? ? ? ? ? 267 LEU A CG  1 
ATOM 2075  C CD1 . LEU A 1 266 ? 1.833   -5.182  107.800  1.00 10.00 ? ? ? ? ? ? 267 LEU A CD1 1 
ATOM 2076  C CD2 . LEU A 1 266 ? 3.626   -5.130  106.236  1.00 10.00 ? ? ? ? ? ? 267 LEU A CD2 1 
ATOM 2077  N N   . GLY A 1 267 ? 5.373   -0.386  108.112  1.00 10.00 ? ? ? ? ? ? 268 GLY A N   1 
ATOM 2078  C CA  . GLY A 1 267 ? 5.222   1.056   108.184  1.00 10.00 ? ? ? ? ? ? 268 GLY A CA  1 
ATOM 2079  C C   . GLY A 1 267 ? 4.342   1.452   109.346  1.00 10.00 ? ? ? ? ? ? 268 GLY A C   1 
ATOM 2080  O O   . GLY A 1 267 ? 4.044   2.624   109.532  1.00 10.00 ? ? ? ? ? ? 268 GLY A O   1 
ATOM 2081  N N   . MET A 1 268 ? 4.050   0.457   110.195  1.00 10.00 ? ? ? ? ? ? 269 MET A N   1 
ATOM 2082  C CA  . MET A 1 268 ? 3.282   0.574   111.426  1.00 10.00 ? ? ? ? ? ? 269 MET A CA  1 
ATOM 2083  C C   . MET A 1 268 ? 4.144   0.647   112.674  1.00 10.00 ? ? ? ? ? ? 269 MET A C   1 
ATOM 2084  O O   . MET A 1 268 ? 5.137   -0.057  112.893  1.00 10.00 ? ? ? ? ? ? 269 MET A O   1 
ATOM 2085  C CB  . MET A 1 268 ? 2.385   -0.602  111.632  1.00 10.00 ? ? ? ? ? ? 269 MET A CB  1 
ATOM 2086  C CG  . MET A 1 268 ? 1.366   -0.769  110.553  1.00 10.00 ? ? ? ? ? ? 269 MET A CG  1 
ATOM 2087  S SD  . MET A 1 268 ? 0.622   -2.330  111.018  1.00 10.00 ? ? ? ? ? ? 269 MET A SD  1 
ATOM 2088  C CE  . MET A 1 268 ? -0.839  -2.254  109.998  1.00 10.00 ? ? ? ? ? ? 269 MET A CE  1 
ATOM 2089  N N   . GLU A 1 269 ? 3.653   1.529   113.529  1.00 10.00 ? ? ? ? ? ? 270 GLU A N   1 
ATOM 2090  C CA  . GLU A 1 269 ? 4.287   1.738   114.802  1.00 10.00 ? ? ? ? ? ? 270 GLU A CA  1 
ATOM 2091  C C   . GLU A 1 269 ? 4.014   0.566   115.737  1.00 10.00 ? ? ? ? ? ? 270 GLU A C   1 
ATOM 2092  O O   . GLU A 1 269 ? 4.651   0.482   116.781  1.00 10.00 ? ? ? ? ? ? 270 GLU A O   1 
ATOM 2093  C CB  . GLU A 1 269 ? 3.767   3.048   115.432  1.00 10.00 ? ? ? ? ? ? 270 GLU A CB  1 
ATOM 2094  C CG  . GLU A 1 269 ? 4.387   4.418   115.067  1.00 10.00 ? ? ? ? ? ? 270 GLU A CG  1 
ATOM 2095  C CD  . GLU A 1 269 ? 4.140   5.042   113.682  1.00 10.00 ? ? ? ? ? ? 270 GLU A CD  1 
ATOM 2096  O OE1 . GLU A 1 269 ? 3.582   4.398   112.778  1.00 10.00 ? ? ? ? ? ? 270 GLU A OE1 1 
ATOM 2097  O OE2 . GLU A 1 269 ? 4.515   6.211   113.506  1.00 10.00 ? ? ? ? ? ? 270 GLU A OE2 1 
ATOM 2098  N N   . SER A 1 270 ? 3.072   -0.347  115.460  1.00 10.00 ? ? ? ? ? ? 271 SER A N   1 
ATOM 2099  C CA  . SER A 1 270 ? 2.703   -1.382  116.415  1.00 10.00 ? ? ? ? ? ? 271 SER A CA  1 
ATOM 2100  C C   . SER A 1 270 ? 3.801   -2.364  116.785  1.00 10.00 ? ? ? ? ? ? 271 SER A C   1 
ATOM 2101  O O   . SER A 1 270 ? 4.687   -2.743  116.013  1.00 10.00 ? ? ? ? ? ? 271 SER A O   1 
ATOM 2102  C CB  . SER A 1 270 ? 1.529   -2.209  115.886  1.00 10.00 ? ? ? ? ? ? 271 SER A CB  1 
ATOM 2103  O OG  . SER A 1 270 ? 0.504   -1.396  115.324  1.00 10.00 ? ? ? ? ? ? 271 SER A OG  1 
ATOM 2104  N N   . CYS A 1 271 ? 3.677   -2.775  118.038  1.00 10.00 ? ? ? ? ? ? 272 CYS A N   1 
ATOM 2105  C CA  . CYS A 1 271 ? 4.414   -3.879  118.611  1.00 10.00 ? ? ? ? ? ? 272 CYS A CA  1 
ATOM 2106  C C   . CYS A 1 271 ? 4.075   -5.085  117.769  1.00 10.00 ? ? ? ? ? ? 272 CYS A C   1 
ATOM 2107  O O   . CYS A 1 271 ? 3.020   -5.090  117.142  1.00 10.00 ? ? ? ? ? ? 272 CYS A O   1 
ATOM 2108  C CB  . CYS A 1 271 ? 3.932   -4.152  120.046  1.00 10.00 ? ? ? ? ? ? 272 CYS A CB  1 
ATOM 2109  S SG  . CYS A 1 271 ? 4.538   -2.956  121.252  1.00 10.00 ? ? ? ? ? ? 272 CYS A SG  1 
ATOM 2110  N N   . GLY A 1 272 ? 4.890   -6.114  117.720  1.00 10.00 ? ? ? ? ? ? 273 GLY A N   1 
ATOM 2111  C CA  . GLY A 1 272 ? 4.458   -7.307  117.049  1.00 10.00 ? ? ? ? ? ? 273 GLY A CA  1 
ATOM 2112  C C   . GLY A 1 272 ? 3.694   -8.191  118.004  1.00 10.00 ? ? ? ? ? ? 273 GLY A C   1 
ATOM 2113  O O   . GLY A 1 272 ? 3.749   -8.123  119.233  1.00 10.00 ? ? ? ? ? ? 273 GLY A O   1 
ATOM 2114  N N   . ILE A 1 273 ? 3.168   -9.226  117.385  1.00 10.00 ? ? ? ? ? ? 274 ILE A N   1 
ATOM 2115  C CA  . ILE A 1 273 ? 2.410   -10.259 118.055  1.00 10.00 ? ? ? ? ? ? 274 ILE A CA  1 
ATOM 2116  C C   . ILE A 1 273 ? 2.955   -10.905 119.336  1.00 10.00 ? ? ? ? ? ? 274 ILE A C   1 
ATOM 2117  O O   . ILE A 1 273 ? 2.222   -11.393 120.204  1.00 10.00 ? ? ? ? ? ? 274 ILE A O   1 
ATOM 2118  C CB  . ILE A 1 273 ? 2.113   -11.254 116.863  1.00 10.00 ? ? ? ? ? ? 274 ILE A CB  1 
ATOM 2119  C CG1 . ILE A 1 273 ? 0.600   -11.352 116.953  1.00 10.00 ? ? ? ? ? ? 274 ILE A CG1 1 
ATOM 2120  C CG2 . ILE A 1 273 ? 2.833   -12.619 116.823  1.00 10.00 ? ? ? ? ? ? 274 ILE A CG2 1 
ATOM 2121  C CD1 . ILE A 1 273 ? -0.043  -9.976  116.685  1.00 10.00 ? ? ? ? ? ? 274 ILE A CD1 1 
ATOM 2122  N N   . HIS A 1 274 ? 4.275   -10.853 119.486  1.00 10.00 ? ? ? ? ? ? 275 HIS A N   1 
ATOM 2123  C CA  . HIS A 1 274 ? 4.930   -11.525 120.609  1.00 10.00 ? ? ? ? ? ? 275 HIS A CA  1 
ATOM 2124  C C   . HIS A 1 274 ? 4.921   -10.653 121.861  1.00 10.00 ? ? ? ? ? ? 275 HIS A C   1 
ATOM 2125  O O   . HIS A 1 274 ? 4.888   -11.105 123.000  1.00 10.00 ? ? ? ? ? ? 275 HIS A O   1 
ATOM 2126  C CB  . HIS A 1 274 ? 6.390   -11.909 120.212  1.00 10.00 ? ? ? ? ? ? 275 HIS A CB  1 
ATOM 2127  C CG  . HIS A 1 274 ? 7.281   -10.759 119.729  1.00 10.00 ? ? ? ? ? ? 275 HIS A CG  1 
ATOM 2128  N ND1 . HIS A 1 274 ? 7.199   -10.024 118.601  1.00 10.00 ? ? ? ? ? ? 275 HIS A ND1 1 
ATOM 2129  C CD2 . HIS A 1 274 ? 8.379   -10.323 120.426  1.00 10.00 ? ? ? ? ? ? 275 HIS A CD2 1 
ATOM 2130  C CE1 . HIS A 1 274 ? 8.203   -9.175  118.609  1.00 10.00 ? ? ? ? ? ? 275 HIS A CE1 1 
ATOM 2131  N NE2 . HIS A 1 274 ? 8.902   -9.362  119.704  1.00 10.00 ? ? ? ? ? ? 275 HIS A NE2 1 
ATOM 2132  N N   . GLU A 1 275 ? 4.872   -9.363  121.618  1.00 10.00 ? ? ? ? ? ? 276 GLU A N   1 
ATOM 2133  C CA  . GLU A 1 275 ? 4.844   -8.384  122.666  1.00 10.00 ? ? ? ? ? ? 276 GLU A CA  1 
ATOM 2134  C C   . GLU A 1 275 ? 3.446   -8.164  123.152  1.00 10.00 ? ? ? ? ? ? 276 GLU A C   1 
ATOM 2135  O O   . GLU A 1 275 ? 3.247   -7.872  124.304  1.00 10.00 ? ? ? ? ? ? 276 GLU A O   1 
ATOM 2136  C CB  . GLU A 1 275 ? 5.334   -7.118  122.164  1.00 10.00 ? ? ? ? ? ? 276 GLU A CB  1 
ATOM 2137  C CG  . GLU A 1 275 ? 6.734   -7.307  121.770  1.00 10.00 ? ? ? ? ? ? 276 GLU A CG  1 
ATOM 2138  C CD  . GLU A 1 275 ? 7.521   -6.231  122.459  1.00 10.00 ? ? ? ? ? ? 276 GLU A CD  1 
ATOM 2139  O OE1 . GLU A 1 275 ? 7.761   -6.346  123.663  1.00 10.00 ? ? ? ? ? ? 276 GLU A OE1 1 
ATOM 2140  O OE2 . GLU A 1 275 ? 7.889   -5.278  121.782  1.00 10.00 ? ? ? ? ? ? 276 GLU A OE2 1 
ATOM 2141  N N   . THR A 1 276 ? 2.470   -8.231  122.278  1.00 10.00 ? ? ? ? ? ? 277 THR A N   1 
ATOM 2142  C CA  . THR A 1 276 ? 1.090   -8.036  122.603  1.00 10.00 ? ? ? ? ? ? 277 THR A CA  1 
ATOM 2143  C C   . THR A 1 276 ? 0.659   -9.225  123.451  1.00 10.00 ? ? ? ? ? ? 277 THR A C   1 
ATOM 2144  O O   . THR A 1 276 ? 0.096   -8.878  124.496  1.00 10.00 ? ? ? ? ? ? 277 THR A O   1 
ATOM 2145  C CB  . THR A 1 276 ? 0.425   -7.858  121.234  1.00 10.00 ? ? ? ? ? ? 277 THR A CB  1 
ATOM 2146  O OG1 . THR A 1 276 ? 1.056   -6.662  120.820  1.00 10.00 ? ? ? ? ? ? 277 THR A OG1 1 
ATOM 2147  C CG2 . THR A 1 276 ? -1.073  -7.631  121.125  1.00 10.00 ? ? ? ? ? ? 277 THR A CG2 1 
ATOM 2148  N N   . THR A 1 277 ? 0.855   -10.553 123.169  1.00 10.00 ? ? ? ? ? ? 278 THR A N   1 
ATOM 2149  C CA  . THR A 1 277 ? 0.580   -11.627 124.130  1.00 10.00 ? ? ? ? ? ? 278 THR A CA  1 
ATOM 2150  C C   . THR A 1 277 ? 1.162   -11.251 125.511  1.00 10.00 ? ? ? ? ? ? 278 THR A C   1 
ATOM 2151  O O   . THR A 1 277 ? 0.483   -11.106 126.525  1.00 10.00 ? ? ? ? ? ? 278 THR A O   1 
ATOM 2152  C CB  . THR A 1 277 ? 1.211   -12.884 123.523  1.00 10.00 ? ? ? ? ? ? 278 THR A CB  1 
ATOM 2153  O OG1 . THR A 1 277 ? 0.544   -13.016 122.273  1.00 10.00 ? ? ? ? ? ? 278 THR A OG1 1 
ATOM 2154  C CG2 . THR A 1 277 ? 1.092   -14.165 124.357  1.00 10.00 ? ? ? ? ? ? 278 THR A CG2 1 
ATOM 2155  N N   . PHE A 1 278 ? 2.435   -10.886 125.597  1.00 10.00 ? ? ? ? ? ? 279 PHE A N   1 
ATOM 2156  C CA  . PHE A 1 278 ? 3.072   -10.449 126.846  1.00 10.00 ? ? ? ? ? ? 279 PHE A CA  1 
ATOM 2157  C C   . PHE A 1 278 ? 2.439   -9.210  127.472  1.00 10.00 ? ? ? ? ? ? 279 PHE A C   1 
ATOM 2158  O O   . PHE A 1 278 ? 2.502   -9.034  128.691  1.00 10.00 ? ? ? ? ? ? 279 PHE A O   1 
ATOM 2159  C CB  . PHE A 1 278 ? 4.585   -10.208 126.564  1.00 10.00 ? ? ? ? ? ? 279 PHE A CB  1 
ATOM 2160  C CG  . PHE A 1 278 ? 5.393   -9.668  127.745  1.00 10.00 ? ? ? ? ? ? 279 PHE A CG  1 
ATOM 2161  C CD1 . PHE A 1 278 ? 5.501   -8.284  127.942  1.00 10.00 ? ? ? ? ? ? 279 PHE A CD1 1 
ATOM 2162  C CD2 . PHE A 1 278 ? 6.010   -10.542 128.623  1.00 10.00 ? ? ? ? ? ? 279 PHE A CD2 1 
ATOM 2163  C CE1 . PHE A 1 278 ? 6.219   -7.783  129.017  1.00 10.00 ? ? ? ? ? ? 279 PHE A CE1 1 
ATOM 2164  C CE2 . PHE A 1 278 ? 6.722   -10.007 129.683  1.00 10.00 ? ? ? ? ? ? 279 PHE A CE2 1 
ATOM 2165  C CZ  . PHE A 1 278 ? 6.832   -8.636  129.887  1.00 10.00 ? ? ? ? ? ? 279 PHE A CZ  1 
ATOM 2166  N N   . ASN A 1 279 ? 1.844   -8.296  126.759  1.00 10.00 ? ? ? ? ? ? 280 ASN A N   1 
ATOM 2167  C CA  . ASN A 1 279 ? 1.350   -7.124  127.436  1.00 10.00 ? ? ? ? ? ? 280 ASN A CA  1 
ATOM 2168  C C   . ASN A 1 279 ? -0.061  -7.384  127.892  1.00 10.00 ? ? ? ? ? ? 280 ASN A C   1 
ATOM 2169  O O   . ASN A 1 279 ? -0.501  -6.586  128.708  1.00 10.00 ? ? ? ? ? ? 280 ASN A O   1 
ATOM 2170  C CB  . ASN A 1 279 ? 1.256   -5.865  126.593  1.00 10.00 ? ? ? ? ? ? 280 ASN A CB  1 
ATOM 2171  C CG  . ASN A 1 279 ? 2.541   -5.217  126.102  1.00 10.00 ? ? ? ? ? ? 280 ASN A CG  1 
ATOM 2172  O OD1 . ASN A 1 279 ? 2.486   -4.372  125.201  1.00 10.00 ? ? ? ? ? ? 280 ASN A OD1 1 
ATOM 2173  N ND2 . ASN A 1 279 ? 3.730   -5.548  126.605  1.00 10.00 ? ? ? ? ? ? 280 ASN A ND2 1 
ATOM 2174  N N   . SER A 1 280 ? -0.802  -8.404  127.420  1.00 10.00 ? ? ? ? ? ? 281 SER A N   1 
ATOM 2175  C CA  . SER A 1 280 ? -2.130  -8.736  127.944  1.00 10.00 ? ? ? ? ? ? 281 SER A CA  1 
ATOM 2176  C C   . SER A 1 280 ? -1.897  -9.481  129.247  1.00 10.00 ? ? ? ? ? ? 281 SER A C   1 
ATOM 2177  O O   . SER A 1 280 ? -2.400  -9.103  130.280  1.00 10.00 ? ? ? ? ? ? 281 SER A O   1 
ATOM 2178  C CB  . SER A 1 280 ? -2.914  -9.623  126.938  1.00 10.00 ? ? ? ? ? ? 281 SER A CB  1 
ATOM 2179  O OG  . SER A 1 280 ? -3.329  -8.865  125.813  1.00 10.00 ? ? ? ? ? ? 281 SER A OG  1 
ATOM 2180  N N   . ILE A 1 281 ? -1.079  -10.502 129.254  1.00 10.00 ? ? ? ? ? ? 282 ILE A N   1 
ATOM 2181  C CA  . ILE A 1 281 ? -0.604  -11.217 130.435  1.00 10.00 ? ? ? ? ? ? 282 ILE A CA  1 
ATOM 2182  C C   . ILE A 1 281 ? -0.200  -10.234 131.505  1.00 10.00 ? ? ? ? ? ? 282 ILE A C   1 
ATOM 2183  O O   . ILE A 1 281 ? -0.575  -10.461 132.634  1.00 10.00 ? ? ? ? ? ? 282 ILE A O   1 
ATOM 2184  C CB  . ILE A 1 281 ? 0.619   -12.090 130.083  1.00 10.00 ? ? ? ? ? ? 282 ILE A CB  1 
ATOM 2185  C CG1 . ILE A 1 281 ? 0.116   -13.343 129.464  1.00 10.00 ? ? ? ? ? ? 282 ILE A CG1 1 
ATOM 2186  C CG2 . ILE A 1 281 ? 1.476   -12.373 131.276  1.00 10.00 ? ? ? ? ? ? 282 ILE A CG2 1 
ATOM 2187  C CD1 . ILE A 1 281 ? 1.184   -14.244 128.896  1.00 10.00 ? ? ? ? ? ? 282 ILE A CD1 1 
ATOM 2188  N N   . MET A 1 282 ? 0.487   -9.149  131.271  1.00 10.00 ? ? ? ? ? ? 283 MET A N   1 
ATOM 2189  C CA  . MET A 1 282 ? 0.835   -8.292  132.362  1.00 10.00 ? ? ? ? ? ? 283 MET A CA  1 
ATOM 2190  C C   . MET A 1 282 ? -0.284  -7.477  132.989  1.00 10.00 ? ? ? ? ? ? 283 MET A C   1 
ATOM 2191  O O   . MET A 1 282 ? -0.140  -6.905  134.072  1.00 10.00 ? ? ? ? ? ? 283 MET A O   1 
ATOM 2192  C CB  . MET A 1 282 ? 1.914   -7.444  131.828  1.00 10.00 ? ? ? ? ? ? 283 MET A CB  1 
ATOM 2193  C CG  . MET A 1 282 ? 3.086   -8.397  131.605  1.00 10.00 ? ? ? ? ? ? 283 MET A CG  1 
ATOM 2194  S SD  . MET A 1 282 ? 3.901   -8.939  133.134  1.00 10.00 ? ? ? ? ? ? 283 MET A SD  1 
ATOM 2195  C CE  . MET A 1 282 ? 4.050   -7.268  133.781  1.00 10.00 ? ? ? ? ? ? 283 MET A CE  1 
ATOM 2196  N N   . LYS A 1 283 ? -1.417  -7.421  132.303  1.00 10.00 ? ? ? ? ? ? 284 LYS A N   1 
ATOM 2197  C CA  . LYS A 1 283 ? -2.601  -6.663  132.653  1.00 10.00 ? ? ? ? ? ? 284 LYS A CA  1 
ATOM 2198  C C   . LYS A 1 283 ? -3.591  -7.503  133.446  1.00 10.00 ? ? ? ? ? ? 284 LYS A C   1 
ATOM 2199  O O   . LYS A 1 283 ? -4.638  -7.040  133.925  1.00 10.00 ? ? ? ? ? ? 284 LYS A O   1 
ATOM 2200  C CB  . LYS A 1 283 ? -3.256  -6.165  131.362  1.00 10.00 ? ? ? ? ? ? 284 LYS A CB  1 
ATOM 2201  C CG  . LYS A 1 283 ? -2.736  -4.818  130.865  1.00 10.00 ? ? ? ? ? ? 284 LYS A CG  1 
ATOM 2202  C CD  . LYS A 1 283 ? -3.411  -4.474  129.567  1.00 10.00 ? ? ? ? ? ? 284 LYS A CD  1 
ATOM 2203  C CE  . LYS A 1 283 ? -3.424  -2.972  129.429  1.00 10.00 ? ? ? ? ? ? 284 LYS A CE  1 
ATOM 2204  N NZ  . LYS A 1 283 ? -4.451  -2.414  130.293  1.00 10.00 ? ? ? ? ? ? 284 LYS A NZ  1 
ATOM 2205  N N   . CYS A 1 284 ? -3.329  -8.797  133.532  1.00 10.00 ? ? ? ? ? ? 285 CYS A N   1 
ATOM 2206  C CA  . CYS A 1 284 ? -4.208  -9.696  134.268  1.00 10.00 ? ? ? ? ? ? 285 CYS A CA  1 
ATOM 2207  C C   . CYS A 1 284 ? -3.852  -9.835  135.777  1.00 10.00 ? ? ? ? ? ? 285 CYS A C   1 
ATOM 2208  O O   . CYS A 1 284 ? -2.827  -9.397  136.303  1.00 10.00 ? ? ? ? ? ? 285 CYS A O   1 
ATOM 2209  C CB  . CYS A 1 284 ? -4.130  -11.047 133.584  1.00 10.00 ? ? ? ? ? ? 285 CYS A CB  1 
ATOM 2210  S SG  . CYS A 1 284 ? -4.622  -11.110 131.856  1.00 10.00 ? ? ? ? ? ? 285 CYS A SG  1 
ATOM 2211  N N   . ASP A 1 285 ? -4.740  -10.482 136.501  1.00 10.00 ? ? ? ? ? ? 286 ASP A N   1 
ATOM 2212  C CA  . ASP A 1 285 ? -4.575  -10.861 137.879  1.00 10.00 ? ? ? ? ? ? 286 ASP A CA  1 
ATOM 2213  C C   . ASP A 1 285 ? -3.270  -11.582 138.064  1.00 10.00 ? ? ? ? ? ? 286 ASP A C   1 
ATOM 2214  O O   . ASP A 1 285 ? -3.054  -12.657 137.520  1.00 10.00 ? ? ? ? ? ? 286 ASP A O   1 
ATOM 2215  C CB  . ASP A 1 285 ? -5.685  -11.807 138.311  1.00 10.00 ? ? ? ? ? ? 286 ASP A CB  1 
ATOM 2216  C CG  . ASP A 1 285 ? -5.913  -11.779 139.805  1.00 10.00 ? ? ? ? ? ? 286 ASP A CG  1 
ATOM 2217  O OD1 . ASP A 1 285 ? -5.011  -12.005 140.618  1.00 10.00 ? ? ? ? ? ? 286 ASP A OD1 1 
ATOM 2218  O OD2 . ASP A 1 285 ? -7.053  -11.532 140.167  1.00 10.00 ? ? ? ? ? ? 286 ASP A OD2 1 
ATOM 2219  N N   . VAL A 1 286 ? -2.519  -11.061 139.012  1.00 10.00 ? ? ? ? ? ? 287 VAL A N   1 
ATOM 2220  C CA  . VAL A 1 286 ? -1.246  -11.594 139.426  1.00 10.00 ? ? ? ? ? ? 287 VAL A CA  1 
ATOM 2221  C C   . VAL A 1 286 ? -1.291  -13.087 139.625  1.00 10.00 ? ? ? ? ? ? 287 VAL A C   1 
ATOM 2222  O O   . VAL A 1 286 ? -0.344  -13.759 139.269  1.00 10.00 ? ? ? ? ? ? 287 VAL A O   1 
ATOM 2223  C CB  . VAL A 1 286 ? -0.873  -10.840 140.700  1.00 10.00 ? ? ? ? ? ? 287 VAL A CB  1 
ATOM 2224  C CG1 . VAL A 1 286 ? 0.368   -11.373 141.322  1.00 10.00 ? ? ? ? ? ? 287 VAL A CG1 1 
ATOM 2225  C CG2 . VAL A 1 286 ? -0.497  -9.442  140.365  1.00 10.00 ? ? ? ? ? ? 287 VAL A CG2 1 
ATOM 2226  N N   . ASP A 1 287 ? -2.396  -13.667 140.100  1.00 10.00 ? ? ? ? ? ? 288 ASP A N   1 
ATOM 2227  C CA  . ASP A 1 287 ? -2.451  -15.116 140.405  1.00 10.00 ? ? ? ? ? ? 288 ASP A CA  1 
ATOM 2228  C C   . ASP A 1 287 ? -2.930  -15.974 139.198  1.00 10.00 ? ? ? ? ? ? 288 ASP A C   1 
ATOM 2229  O O   . ASP A 1 287 ? -3.171  -17.196 139.356  1.00 10.00 ? ? ? ? ? ? 288 ASP A O   1 
ATOM 2230  C CB  . ASP A 1 287 ? -3.396  -15.427 141.654  1.00 10.00 ? ? ? ? ? ? 288 ASP A CB  1 
ATOM 2231  C CG  . ASP A 1 287 ? -3.214  -14.703 143.025  1.00 10.00 ? ? ? ? ? ? 288 ASP A CG  1 
ATOM 2232  O OD1 . ASP A 1 287 ? -2.282  -15.021 143.800  1.00 10.00 ? ? ? ? ? ? 288 ASP A OD1 1 
ATOM 2233  O OD2 . ASP A 1 287 ? -4.049  -13.829 143.325  1.00 10.00 ? ? ? ? ? ? 288 ASP A OD2 1 
ATOM 2234  N N   . ILE A 1 288 ? -3.156  -15.443 137.974  1.00 10.00 ? ? ? ? ? ? 289 ILE A N   1 
ATOM 2235  C CA  . ILE A 1 288 ? -3.473  -16.355 136.907  1.00 10.00 ? ? ? ? ? ? 289 ILE A CA  1 
ATOM 2236  C C   . ILE A 1 288 ? -2.403  -16.279 135.876  1.00 10.00 ? ? ? ? ? ? 289 ILE A C   1 
ATOM 2237  O O   . ILE A 1 288 ? -2.260  -17.186 135.088  1.00 10.00 ? ? ? ? ? ? 289 ILE A O   1 
ATOM 2238  C CB  . ILE A 1 288 ? -4.862  -16.073 136.310  1.00 10.00 ? ? ? ? ? ? 289 ILE A CB  1 
ATOM 2239  C CG1 . ILE A 1 288 ? -5.181  -14.661 135.934  1.00 10.00 ? ? ? ? ? ? 289 ILE A CG1 1 
ATOM 2240  C CG2 . ILE A 1 288 ? -5.797  -16.484 137.423  1.00 10.00 ? ? ? ? ? ? 289 ILE A CG2 1 
ATOM 2241  C CD1 . ILE A 1 288 ? -6.681  -14.398 135.712  1.00 10.00 ? ? ? ? ? ? 289 ILE A CD1 1 
ATOM 2242  N N   . ARG A 1 289 ? -1.488  -15.326 135.889  1.00 10.00 ? ? ? ? ? ? 290 ARG A N   1 
ATOM 2243  C CA  . ARG A 1 289 ? -0.425  -15.178 134.905  1.00 10.00 ? ? ? ? ? ? 290 ARG A CA  1 
ATOM 2244  C C   . ARG A 1 289 ? 0.332   -16.462 134.628  1.00 10.00 ? ? ? ? ? ? 290 ARG A C   1 
ATOM 2245  O O   . ARG A 1 289 ? 0.553   -16.847 133.474  1.00 10.00 ? ? ? ? ? ? 290 ARG A O   1 
ATOM 2246  C CB  . ARG A 1 289 ? 0.593   -14.120 135.352  1.00 10.00 ? ? ? ? ? ? 290 ARG A CB  1 
ATOM 2247  C CG  . ARG A 1 289 ? 0.027   -12.746 135.386  1.00 10.00 ? ? ? ? ? ? 290 ARG A CG  1 
ATOM 2248  C CD  . ARG A 1 289 ? 1.038   -11.688 135.713  1.00 10.00 ? ? ? ? ? ? 290 ARG A CD  1 
ATOM 2249  N NE  . ARG A 1 289 ? 0.225   -10.502 135.885  1.00 10.00 ? ? ? ? ? ? 290 ARG A NE  1 
ATOM 2250  C CZ  . ARG A 1 289 ? 0.672   -9.336  136.347  1.00 10.00 ? ? ? ? ? ? 290 ARG A CZ  1 
ATOM 2251  N NH1 . ARG A 1 289 ? 1.920   -9.089  136.709  1.00 10.00 ? ? ? ? ? ? 290 ARG A NH1 1 
ATOM 2252  N NH2 . ARG A 1 289 ? -0.187  -8.347  136.484  1.00 10.00 ? ? ? ? ? ? 290 ARG A NH2 1 
ATOM 2253  N N   . LYS A 1 290 ? 0.645   -17.204 135.686  1.00 10.00 ? ? ? ? ? ? 291 LYS A N   1 
ATOM 2254  C CA  . LYS A 1 290 ? 1.402   -18.426 135.502  1.00 10.00 ? ? ? ? ? ? 291 LYS A CA  1 
ATOM 2255  C C   . LYS A 1 290 ? 0.564   -19.394 134.701  1.00 10.00 ? ? ? ? ? ? 291 LYS A C   1 
ATOM 2256  O O   . LYS A 1 290 ? 1.088   -20.266 134.017  1.00 10.00 ? ? ? ? ? ? 291 LYS A O   1 
ATOM 2257  C CB  . LYS A 1 290 ? 1.780   -19.082 136.829  1.00 10.00 ? ? ? ? ? ? 291 LYS A CB  1 
ATOM 2258  C CG  . LYS A 1 290 ? 0.706   -19.506 137.864  1.00 10.00 ? ? ? ? ? ? 291 LYS A CG  1 
ATOM 2259  C CD  . LYS A 1 290 ? 0.026   -18.402 138.749  1.00 10.00 ? ? ? ? ? ? 291 LYS A CD  1 
ATOM 2260  C CE  . LYS A 1 290 ? 0.922   -17.406 139.539  1.00 10.00 ? ? ? ? ? ? 291 LYS A CE  1 
ATOM 2261  N NZ  . LYS A 1 290 ? 0.721   -16.045 139.035  1.00 10.00 ? ? ? ? ? ? 291 LYS A NZ  1 
ATOM 2262  N N   . ASP A 1 291 ? -0.749  -19.252 134.746  1.00 10.00 ? ? ? ? ? ? 292 ASP A N   1 
ATOM 2263  C CA  . ASP A 1 291 ? -1.609  -20.113 133.996  1.00 10.00 ? ? ? ? ? ? 292 ASP A CA  1 
ATOM 2264  C C   . ASP A 1 291 ? -1.646  -19.671 132.561  1.00 10.00 ? ? ? ? ? ? 292 ASP A C   1 
ATOM 2265  O O   . ASP A 1 291 ? -1.630  -20.514 131.663  1.00 10.00 ? ? ? ? ? ? 292 ASP A O   1 
ATOM 2266  C CB  . ASP A 1 291 ? -3.028  -20.112 134.611  1.00 10.00 ? ? ? ? ? ? 292 ASP A CB  1 
ATOM 2267  C CG  . ASP A 1 291 ? -3.142  -20.960 135.866  1.00 10.00 ? ? ? ? ? ? 292 ASP A CG  1 
ATOM 2268  O OD1 . ASP A 1 291 ? -2.773  -22.134 135.843  1.00 10.00 ? ? ? ? ? ? 292 ASP A OD1 1 
ATOM 2269  O OD2 . ASP A 1 291 ? -3.602  -20.441 136.877  1.00 10.00 ? ? ? ? ? ? 292 ASP A OD2 1 
ATOM 2270  N N   . LEU A 1 292 ? -1.692  -18.364 132.347  1.00 10.00 ? ? ? ? ? ? 293 LEU A N   1 
ATOM 2271  C CA  . LEU A 1 292 ? -1.706  -17.802 130.996  1.00 10.00 ? ? ? ? ? ? 293 LEU A CA  1 
ATOM 2272  C C   . LEU A 1 292 ? -0.366  -18.101 130.238  1.00 10.00 ? ? ? ? ? ? 293 LEU A C   1 
ATOM 2273  O O   . LEU A 1 292 ? -0.387  -18.481 129.048  1.00 10.00 ? ? ? ? ? ? 293 LEU A O   1 
ATOM 2274  C CB  . LEU A 1 292 ? -1.944  -16.334 131.127  1.00 10.00 ? ? ? ? ? ? 293 LEU A CB  1 
ATOM 2275  C CG  . LEU A 1 292 ? -3.158  -15.859 131.826  1.00 10.00 ? ? ? ? ? ? 293 LEU A CG  1 
ATOM 2276  C CD1 . LEU A 1 292 ? -3.236  -14.376 131.621  1.00 10.00 ? ? ? ? ? ? 293 LEU A CD1 1 
ATOM 2277  C CD2 . LEU A 1 292 ? -4.381  -16.522 131.278  1.00 10.00 ? ? ? ? ? ? 293 LEU A CD2 1 
ATOM 2278  N N   . TYR A 1 293 ? 0.843   -18.082 130.842  1.00 10.00 ? ? ? ? ? ? 294 TYR A N   1 
ATOM 2279  C CA  . TYR A 1 293 ? 2.031   -18.554 130.129  1.00 10.00 ? ? ? ? ? ? 294 TYR A CA  1 
ATOM 2280  C C   . TYR A 1 293 ? 2.070   -20.028 129.787  1.00 10.00 ? ? ? ? ? ? 294 TYR A C   1 
ATOM 2281  O O   . TYR A 1 293 ? 2.729   -20.462 128.853  1.00 10.00 ? ? ? ? ? ? 294 TYR A O   1 
ATOM 2282  C CB  . TYR A 1 293 ? 3.268   -18.280 130.915  1.00 10.00 ? ? ? ? ? ? 294 TYR A CB  1 
ATOM 2283  C CG  . TYR A 1 293 ? 3.654   -16.833 130.907  1.00 10.00 ? ? ? ? ? ? 294 TYR A CG  1 
ATOM 2284  C CD1 . TYR A 1 293 ? 4.381   -16.295 129.870  1.00 10.00 ? ? ? ? ? ? 294 TYR A CD1 1 
ATOM 2285  C CD2 . TYR A 1 293 ? 3.334   -16.077 131.998  1.00 10.00 ? ? ? ? ? ? 294 TYR A CD2 1 
ATOM 2286  C CE1 . TYR A 1 293 ? 4.797   -14.979 129.946  1.00 10.00 ? ? ? ? ? ? 294 TYR A CE1 1 
ATOM 2287  C CE2 . TYR A 1 293 ? 3.760   -14.764 132.075  1.00 10.00 ? ? ? ? ? ? 294 TYR A CE2 1 
ATOM 2288  C CZ  . TYR A 1 293 ? 4.492   -14.223 131.055  1.00 10.00 ? ? ? ? ? ? 294 TYR A CZ  1 
ATOM 2289  O OH  . TYR A 1 293 ? 4.955   -12.924 131.200  1.00 10.00 ? ? ? ? ? ? 294 TYR A OH  1 
ATOM 2290  N N   . ALA A 1 294 ? 1.458   -20.887 130.572  1.00 10.00 ? ? ? ? ? ? 295 ALA A N   1 
ATOM 2291  C CA  . ALA A 1 294 ? 1.454   -22.319 130.328  1.00 10.00 ? ? ? ? ? ? 295 ALA A CA  1 
ATOM 2292  C C   . ALA A 1 294 ? 0.457   -22.722 129.268  1.00 10.00 ? ? ? ? ? ? 295 ALA A C   1 
ATOM 2293  O O   . ALA A 1 294 ? 0.452   -23.870 128.819  1.00 10.00 ? ? ? ? ? ? 295 ALA A O   1 
ATOM 2294  C CB  . ALA A 1 294 ? 1.064   -23.052 131.577  1.00 10.00 ? ? ? ? ? ? 295 ALA A CB  1 
ATOM 2295  N N   . ASN A 1 295 ? -0.432  -21.778 128.902  1.00 10.00 ? ? ? ? ? ? 296 ASN A N   1 
ATOM 2296  C CA  . ASN A 1 295 ? -1.526  -22.047 127.983  1.00 10.00 ? ? ? ? ? ? 296 ASN A CA  1 
ATOM 2297  C C   . ASN A 1 295 ? -1.654  -20.896 126.997  1.00 10.00 ? ? ? ? ? ? 296 ASN A C   1 
ATOM 2298  O O   . ASN A 1 295 ? -2.538  -20.045 127.076  1.00 10.00 ? ? ? ? ? ? 296 ASN A O   1 
ATOM 2299  C CB  . ASN A 1 295 ? -2.779  -22.213 128.806  1.00 10.00 ? ? ? ? ? ? 296 ASN A CB  1 
ATOM 2300  C CG  . ASN A 1 295 ? -2.723  -23.373 129.787  1.00 10.00 ? ? ? ? ? ? 296 ASN A CG  1 
ATOM 2301  O OD1 . ASN A 1 295 ? -2.972  -24.531 129.445  1.00 10.00 ? ? ? ? ? ? 296 ASN A OD1 1 
ATOM 2302  N ND2 . ASN A 1 295 ? -2.363  -23.135 131.042  1.00 10.00 ? ? ? ? ? ? 296 ASN A ND2 1 
ATOM 2303  N N   . THR A 1 296 ? -0.655  -20.750 126.138  1.00 10.00 ? ? ? ? ? ? 297 THR A N   1 
ATOM 2304  C CA  . THR A 1 296 ? -0.723  -19.765 125.093  1.00 10.00 ? ? ? ? ? ? 297 THR A CA  1 
ATOM 2305  C C   . THR A 1 296 ? -1.156  -20.618 123.920  1.00 10.00 ? ? ? ? ? ? 297 THR A C   1 
ATOM 2306  O O   . THR A 1 296 ? -0.458  -21.581 123.580  1.00 10.00 ? ? ? ? ? ? 297 THR A O   1 
ATOM 2307  C CB  . THR A 1 296 ? 0.650   -19.155 124.954  1.00 10.00 ? ? ? ? ? ? 297 THR A CB  1 
ATOM 2308  O OG1 . THR A 1 296 ? 0.874   -18.484 126.160  1.00 10.00 ? ? ? ? ? ? 297 THR A OG1 1 
ATOM 2309  C CG2 . THR A 1 296 ? 0.765   -18.038 123.963  1.00 10.00 ? ? ? ? ? ? 297 THR A CG2 1 
ATOM 2310  N N   . VAL A 1 297 ? -2.355  -20.365 123.368  1.00 10.00 ? ? ? ? ? ? 298 VAL A N   1 
ATOM 2311  C CA  . VAL A 1 297 ? -2.946  -21.116 122.250  1.00 10.00 ? ? ? ? ? ? 298 VAL A CA  1 
ATOM 2312  C C   . VAL A 1 297 ? -3.040  -20.152 121.072  1.00 10.00 ? ? ? ? ? ? 298 VAL A C   1 
ATOM 2313  O O   . VAL A 1 297 ? -3.368  -18.951 121.227  1.00 10.00 ? ? ? ? ? ? 298 VAL A O   1 
ATOM 2314  C CB  . VAL A 1 297 ? -4.389  -21.637 122.593  1.00 10.00 ? ? ? ? ? ? 298 VAL A CB  1 
ATOM 2315  C CG1 . VAL A 1 297 ? -4.845  -22.509 121.428  1.00 10.00 ? ? ? ? ? ? 298 VAL A CG1 1 
ATOM 2316  C CG2 . VAL A 1 297 ? -4.443  -22.366 123.982  1.00 10.00 ? ? ? ? ? ? 298 VAL A CG2 1 
ATOM 2317  N N   . LEU A 1 298 ? -2.716  -20.646 119.883  1.00 10.00 ? ? ? ? ? ? 299 LEU A N   1 
ATOM 2318  C CA  . LEU A 1 298 ? -2.790  -19.782 118.718  1.00 10.00 ? ? ? ? ? ? 299 LEU A CA  1 
ATOM 2319  C C   . LEU A 1 298 ? -4.020  -20.216 117.941  1.00 10.00 ? ? ? ? ? ? 299 LEU A C   1 
ATOM 2320  O O   . LEU A 1 298 ? -4.309  -21.431 117.923  1.00 10.00 ? ? ? ? ? ? 299 LEU A O   1 
ATOM 2321  C CB  . LEU A 1 298 ? -1.500  -19.929 117.856  1.00 10.00 ? ? ? ? ? ? 299 LEU A CB  1 
ATOM 2322  C CG  . LEU A 1 298 ? -0.103  -19.884 118.500  1.00 10.00 ? ? ? ? ? ? 299 LEU A CG  1 
ATOM 2323  C CD1 . LEU A 1 298 ? 0.966   -19.854 117.412  1.00 10.00 ? ? ? ? ? ? 299 LEU A CD1 1 
ATOM 2324  C CD2 . LEU A 1 298 ? 0.038   -18.655 119.385  1.00 10.00 ? ? ? ? ? ? 299 LEU A CD2 1 
ATOM 2325  N N   . SER A 1 299 ? -4.806  -19.303 117.374  1.00 10.00 ? ? ? ? ? ? 300 SER A N   1 
ATOM 2326  C CA  . SER A 1 299 ? -5.869  -19.804 116.540  1.00 10.00 ? ? ? ? ? ? 300 SER A CA  1 
ATOM 2327  C C   . SER A 1 299 ? -6.074  -18.930 115.344  1.00 10.00 ? ? ? ? ? ? 300 SER A C   1 
ATOM 2328  O O   . SER A 1 299 ? -5.577  -17.801 115.418  1.00 10.00 ? ? ? ? ? ? 300 SER A O   1 
ATOM 2329  C CB  . SER A 1 299 ? -7.101  -19.873 117.331  1.00 10.00 ? ? ? ? ? ? 300 SER A CB  1 
ATOM 2330  O OG  . SER A 1 299 ? -7.708  -18.638 117.687  1.00 10.00 ? ? ? ? ? ? 300 SER A OG  1 
ATOM 2331  N N   . GLY A 1 300 ? -6.718  -19.302 114.244  1.00 10.00 ? ? ? ? ? ? 301 GLY A N   1 
ATOM 2332  C CA  . GLY A 1 300 ? -6.920  -18.393 113.084  1.00 10.00 ? ? ? ? ? ? 301 GLY A CA  1 
ATOM 2333  C C   . GLY A 1 300 ? -6.083  -18.772 111.878  1.00 10.00 ? ? ? ? ? ? 301 GLY A C   1 
ATOM 2334  O O   . GLY A 1 300 ? -5.033  -19.384 112.106  1.00 10.00 ? ? ? ? ? ? 301 GLY A O   1 
ATOM 2335  N N   . GLY A 1 301 ? -6.452  -18.465 110.627  1.00 10.00 ? ? ? ? ? ? 302 GLY A N   1 
ATOM 2336  C CA  . GLY A 1 301 ? -5.669  -18.765 109.425  1.00 10.00 ? ? ? ? ? ? 302 GLY A CA  1 
ATOM 2337  C C   . GLY A 1 301 ? -4.256  -18.160 109.428  1.00 10.00 ? ? ? ? ? ? 302 GLY A C   1 
ATOM 2338  O O   . GLY A 1 301 ? -3.271  -18.844 109.144  1.00 10.00 ? ? ? ? ? ? 302 GLY A O   1 
ATOM 2339  N N   . THR A 1 302 ? -4.014  -16.934 109.870  1.00 10.00 ? ? ? ? ? ? 303 THR A N   1 
ATOM 2340  C CA  . THR A 1 302 ? -2.682  -16.354 109.843  1.00 10.00 ? ? ? ? ? ? 303 THR A CA  1 
ATOM 2341  C C   . THR A 1 302 ? -1.774  -17.042 110.889  1.00 10.00 ? ? ? ? ? ? 303 THR A C   1 
ATOM 2342  O O   . THR A 1 302 ? -0.602  -16.673 111.048  1.00 10.00 ? ? ? ? ? ? 303 THR A O   1 
ATOM 2343  C CB  . THR A 1 302 ? -2.922  -14.784 110.026  1.00 10.00 ? ? ? ? ? ? 303 THR A CB  1 
ATOM 2344  O OG1 . THR A 1 302 ? -3.599  -14.339 108.854  1.00 10.00 ? ? ? ? ? ? 303 THR A OG1 1 
ATOM 2345  C CG2 . THR A 1 302 ? -1.692  -13.897 110.103  1.00 10.00 ? ? ? ? ? ? 303 THR A CG2 1 
ATOM 2346  N N   . THR A 1 303 ? -2.189  -18.079 111.663  1.00 10.00 ? ? ? ? ? ? 304 THR A N   1 
ATOM 2347  C CA  . THR A 1 303 ? -1.272  -18.721 112.632  1.00 10.00 ? ? ? ? ? ? 304 THR A CA  1 
ATOM 2348  C C   . THR A 1 303 ? -0.777  -20.026 112.023  1.00 10.00 ? ? ? ? ? ? 304 THR A C   1 
ATOM 2349  O O   . THR A 1 303 ? -0.107  -20.849 112.638  1.00 10.00 ? ? ? ? ? ? 304 THR A O   1 
ATOM 2350  C CB  . THR A 1 303 ? -1.918  -19.091 114.045  1.00 10.00 ? ? ? ? ? ? 304 THR A CB  1 
ATOM 2351  O OG1 . THR A 1 303 ? -2.901  -20.065 113.830  1.00 10.00 ? ? ? ? ? ? 304 THR A OG1 1 
ATOM 2352  C CG2 . THR A 1 303 ? -2.542  -17.934 114.752  1.00 10.00 ? ? ? ? ? ? 304 THR A CG2 1 
ATOM 2353  N N   . MET A 1 304 ? -1.108  -20.223 110.763  1.00 10.00 ? ? ? ? ? ? 305 MET A N   1 
ATOM 2354  C CA  . MET A 1 304 ? -0.774  -21.472 110.140  1.00 10.00 ? ? ? ? ? ? 305 MET A CA  1 
ATOM 2355  C C   . MET A 1 304 ? 0.646   -21.552 109.571  1.00 10.00 ? ? ? ? ? ? 305 MET A C   1 
ATOM 2356  O O   . MET A 1 304 ? 1.049   -22.587 109.048  1.00 10.00 ? ? ? ? ? ? 305 MET A O   1 
ATOM 2357  C CB  . MET A 1 304 ? -1.846  -21.683 109.089  1.00 10.00 ? ? ? ? ? ? 305 MET A CB  1 
ATOM 2358  C CG  . MET A 1 304 ? -3.203  -21.903 109.668  1.00 10.00 ? ? ? ? ? ? 305 MET A CG  1 
ATOM 2359  S SD  . MET A 1 304 ? -3.210  -23.555 110.374  1.00 10.00 ? ? ? ? ? ? 305 MET A SD  1 
ATOM 2360  C CE  . MET A 1 304 ? -3.895  -24.354 108.947  1.00 10.00 ? ? ? ? ? ? 305 MET A CE  1 
ATOM 2361  N N   . TYR A 1 305 ? 1.435   -20.493 109.640  1.00 10.00 ? ? ? ? ? ? 306 TYR A N   1 
ATOM 2362  C CA  . TYR A 1 305 ? 2.752   -20.439 109.053  1.00 10.00 ? ? ? ? ? ? 306 TYR A CA  1 
ATOM 2363  C C   . TYR A 1 305 ? 3.704   -21.410 109.670  1.00 10.00 ? ? ? ? ? ? 306 TYR A C   1 
ATOM 2364  O O   . TYR A 1 305 ? 3.808   -21.328 110.894  1.00 10.00 ? ? ? ? ? ? 306 TYR A O   1 
ATOM 2365  C CB  . TYR A 1 305 ? 3.338   -19.097 109.245  1.00 10.00 ? ? ? ? ? ? 306 TYR A CB  1 
ATOM 2366  C CG  . TYR A 1 305 ? 2.625   -18.039 108.470  1.00 10.00 ? ? ? ? ? ? 306 TYR A CG  1 
ATOM 2367  C CD1 . TYR A 1 305 ? 2.453   -18.189 107.104  1.00 10.00 ? ? ? ? ? ? 306 TYR A CD1 1 
ATOM 2368  C CD2 . TYR A 1 305 ? 2.223   -16.912 109.093  1.00 10.00 ? ? ? ? ? ? 306 TYR A CD2 1 
ATOM 2369  C CE1 . TYR A 1 305 ? 1.882   -17.190 106.334  1.00 10.00 ? ? ? ? ? ? 306 TYR A CE1 1 
ATOM 2370  C CE2 . TYR A 1 305 ? 1.649   -15.911 108.339  1.00 10.00 ? ? ? ? ? ? 306 TYR A CE2 1 
ATOM 2371  C CZ  . TYR A 1 305 ? 1.493   -16.067 106.981  1.00 10.00 ? ? ? ? ? ? 306 TYR A CZ  1 
ATOM 2372  O OH  . TYR A 1 305 ? 0.937   -15.073 106.256  1.00 10.00 ? ? ? ? ? ? 306 TYR A OH  1 
ATOM 2373  N N   . PRO A 1 306 ? 4.451   -22.275 108.965  1.00 10.00 ? ? ? ? ? ? 307 PRO A N   1 
ATOM 2374  C CA  . PRO A 1 306 ? 5.576   -23.013 109.496  1.00 10.00 ? ? ? ? ? ? 307 PRO A CA  1 
ATOM 2375  C C   . PRO A 1 306 ? 6.541   -22.048 110.172  1.00 10.00 ? ? ? ? ? ? 307 PRO A C   1 
ATOM 2376  O O   . PRO A 1 306 ? 6.752   -20.914 109.712  1.00 10.00 ? ? ? ? ? ? 307 PRO A O   1 
ATOM 2377  C CB  . PRO A 1 306 ? 6.126   -23.728 108.300  1.00 10.00 ? ? ? ? ? ? 307 PRO A CB  1 
ATOM 2378  C CG  . PRO A 1 306 ? 4.867   -24.082 107.583  1.00 10.00 ? ? ? ? ? ? 307 PRO A CG  1 
ATOM 2379  C CD  . PRO A 1 306 ? 4.188   -22.717 107.597  1.00 10.00 ? ? ? ? ? ? 307 PRO A CD  1 
ATOM 2380  N N   . GLY A 1 307 ? 7.003   -22.557 111.345  1.00 10.00 ? ? ? ? ? ? 308 GLY A N   1 
ATOM 2381  C CA  . GLY A 1 307 ? 7.823   -21.859 112.318  1.00 10.00 ? ? ? ? ? ? 308 GLY A CA  1 
ATOM 2382  C C   . GLY A 1 307 ? 7.081   -20.963 113.322  1.00 10.00 ? ? ? ? ? ? 308 GLY A C   1 
ATOM 2383  O O   . GLY A 1 307 ? 7.718   -20.507 114.298  1.00 10.00 ? ? ? ? ? ? 308 GLY A O   1 
ATOM 2384  N N   . ILE A 1 308 ? 5.754   -20.706 113.251  1.00 10.00 ? ? ? ? ? ? 309 ILE A N   1 
ATOM 2385  C CA  . ILE A 1 308 ? 5.198   -19.692 114.153  1.00 10.00 ? ? ? ? ? ? 309 ILE A CA  1 
ATOM 2386  C C   . ILE A 1 308 ? 5.120   -20.138 115.597  1.00 10.00 ? ? ? ? ? ? 309 ILE A C   1 
ATOM 2387  O O   . ILE A 1 308 ? 5.337   -19.293 116.476  1.00 10.00 ? ? ? ? ? ? 309 ILE A O   1 
ATOM 2388  C CB  . ILE A 1 308 ? 3.805   -19.208 113.651  1.00 10.00 ? ? ? ? ? ? 309 ILE A CB  1 
ATOM 2389  C CG1 . ILE A 1 308 ? 3.705   -17.797 114.176  1.00 10.00 ? ? ? ? ? ? 309 ILE A CG1 1 
ATOM 2390  C CG2 . ILE A 1 308 ? 2.637   -20.070 114.060  1.00 10.00 ? ? ? ? ? ? 309 ILE A CG2 1 
ATOM 2391  C CD1 . ILE A 1 308 ? 2.572   -16.993 113.559  1.00 10.00 ? ? ? ? ? ? 309 ILE A CD1 1 
ATOM 2392  N N   . ALA A 1 309 ? 4.874   -21.419 115.890  1.00 10.00 ? ? ? ? ? ? 310 ALA A N   1 
ATOM 2393  C CA  . ALA A 1 309 ? 4.894   -21.911 117.270  1.00 10.00 ? ? ? ? ? ? 310 ALA A CA  1 
ATOM 2394  C C   . ALA A 1 309 ? 6.253   -21.746 117.886  1.00 10.00 ? ? ? ? ? ? 310 ALA A C   1 
ATOM 2395  O O   . ALA A 1 309 ? 6.338   -21.146 118.948  1.00 10.00 ? ? ? ? ? ? 310 ALA A O   1 
ATOM 2396  C CB  . ALA A 1 309 ? 4.546   -23.392 117.344  1.00 10.00 ? ? ? ? ? ? 310 ALA A CB  1 
ATOM 2397  N N   . ASP A 1 310 ? 7.309   -22.264 117.248  1.00 10.00 ? ? ? ? ? ? 311 ASP A N   1 
ATOM 2398  C CA  . ASP A 1 310 ? 8.698   -22.078 117.703  1.00 10.00 ? ? ? ? ? ? 311 ASP A CA  1 
ATOM 2399  C C   . ASP A 1 310 ? 9.124   -20.645 117.861  1.00 10.00 ? ? ? ? ? ? 311 ASP A C   1 
ATOM 2400  O O   . ASP A 1 310 ? 9.823   -20.332 118.814  1.00 10.00 ? ? ? ? ? ? 311 ASP A O   1 
ATOM 2401  C CB  . ASP A 1 310 ? 9.773   -22.583 116.777  1.00 10.00 ? ? ? ? ? ? 311 ASP A CB  1 
ATOM 2402  C CG  . ASP A 1 310 ? 9.688   -24.042 116.464  1.00 10.00 ? ? ? ? ? ? 311 ASP A CG  1 
ATOM 2403  O OD1 . ASP A 1 310 ? 10.267  -24.805 117.218  1.00 10.00 ? ? ? ? ? ? 311 ASP A OD1 1 
ATOM 2404  O OD2 . ASP A 1 310 ? 9.055   -24.398 115.480  1.00 10.00 ? ? ? ? ? ? 311 ASP A OD2 1 
ATOM 2405  N N   . ARG A 1 311 ? 8.805   -19.784 116.925  1.00 10.00 ? ? ? ? ? ? 312 ARG A N   1 
ATOM 2406  C CA  . ARG A 1 311 ? 9.218   -18.415 117.020  1.00 10.00 ? ? ? ? ? ? 312 ARG A CA  1 
ATOM 2407  C C   . ARG A 1 311 ? 8.398   -17.694 118.055  1.00 10.00 ? ? ? ? ? ? 312 ARG A C   1 
ATOM 2408  O O   . ARG A 1 311 ? 8.921   -16.765 118.653  1.00 10.00 ? ? ? ? ? ? 312 ARG A O   1 
ATOM 2409  C CB  . ARG A 1 311 ? 9.058   -17.798 115.674  1.00 10.00 ? ? ? ? ? ? 312 ARG A CB  1 
ATOM 2410  C CG  . ARG A 1 311 ? 9.269   -16.341 115.667  1.00 10.00 ? ? ? ? ? ? 312 ARG A CG  1 
ATOM 2411  C CD  . ARG A 1 311 ? 10.686  -16.051 115.990  1.00 10.00 ? ? ? ? ? ? 312 ARG A CD  1 
ATOM 2412  N NE  . ARG A 1 311 ? 10.759  -14.623 116.047  1.00 10.00 ? ? ? ? ? ? 312 ARG A NE  1 
ATOM 2413  C CZ  . ARG A 1 311 ? 10.853  -13.920 114.936  1.00 10.00 ? ? ? ? ? ? 312 ARG A CZ  1 
ATOM 2414  N NH1 . ARG A 1 311 ? 10.895  -14.580 113.795  1.00 10.00 ? ? ? ? ? ? 312 ARG A NH1 1 
ATOM 2415  N NH2 . ARG A 1 311 ? 10.760  -12.579 114.944  1.00 10.00 ? ? ? ? ? ? 312 ARG A NH2 1 
ATOM 2416  N N   . MET A 1 312 ? 7.125   -18.010 118.264  1.00 10.00 ? ? ? ? ? ? 313 MET A N   1 
ATOM 2417  C CA  . MET A 1 312 ? 6.340   -17.421 119.321  1.00 10.00 ? ? ? ? ? ? 313 MET A CA  1 
ATOM 2418  C C   . MET A 1 312 ? 6.988   -17.875 120.624  1.00 10.00 ? ? ? ? ? ? 313 MET A C   1 
ATOM 2419  O O   . MET A 1 312 ? 7.376   -17.016 121.403  1.00 10.00 ? ? ? ? ? ? 313 MET A O   1 
ATOM 2420  C CB  . MET A 1 312 ? 4.894   -17.905 119.179  1.00 10.00 ? ? ? ? ? ? 313 MET A CB  1 
ATOM 2421  C CG  . MET A 1 312 ? 4.175   -16.822 118.436  1.00 10.00 ? ? ? ? ? ? 313 MET A CG  1 
ATOM 2422  S SD  . MET A 1 312 ? 4.016   -15.433 119.597  1.00 10.00 ? ? ? ? ? ? 313 MET A SD  1 
ATOM 2423  C CE  . MET A 1 312 ? 2.239   -15.399 119.685  1.00 10.00 ? ? ? ? ? ? 313 MET A CE  1 
ATOM 2424  N N   . GLN A 1 313 ? 7.232   -19.158 120.872  1.00 10.00 ? ? ? ? ? ? 314 GLN A N   1 
ATOM 2425  C CA  . GLN A 1 313 ? 7.926   -19.682 122.039  1.00 10.00 ? ? ? ? ? ? 314 GLN A CA  1 
ATOM 2426  C C   . GLN A 1 313 ? 9.227   -18.956 122.275  1.00 10.00 ? ? ? ? ? ? 314 GLN A C   1 
ATOM 2427  O O   . GLN A 1 313 ? 9.265   -18.246 123.275  1.00 10.00 ? ? ? ? ? ? 314 GLN A O   1 
ATOM 2428  C CB  . GLN A 1 313 ? 8.140   -21.162 121.816  1.00 10.00 ? ? ? ? ? ? 314 GLN A CB  1 
ATOM 2429  C CG  . GLN A 1 313 ? 9.163   -21.895 122.621  1.00 10.00 ? ? ? ? ? ? 314 GLN A CG  1 
ATOM 2430  C CD  . GLN A 1 313 ? 8.931   -22.085 124.100  1.00 10.00 ? ? ? ? ? ? 314 GLN A CD  1 
ATOM 2431  O OE1 . GLN A 1 313 ? 9.852   -21.893 124.912  1.00 10.00 ? ? ? ? ? ? 314 GLN A OE1 1 
ATOM 2432  N NE2 . GLN A 1 313 ? 7.725   -22.537 124.443  1.00 10.00 ? ? ? ? ? ? 314 GLN A NE2 1 
ATOM 2433  N N   . LYS A 1 314 ? 10.227  -18.995 121.391  1.00 10.00 ? ? ? ? ? ? 315 LYS A N   1 
ATOM 2434  C CA  . LYS A 1 314 ? 11.491  -18.280 121.485  1.00 10.00 ? ? ? ? ? ? 315 LYS A CA  1 
ATOM 2435  C C   . LYS A 1 314 ? 11.320  -16.847 121.951  1.00 10.00 ? ? ? ? ? ? 315 LYS A C   1 
ATOM 2436  O O   . LYS A 1 314 ? 12.051  -16.345 122.813  1.00 10.00 ? ? ? ? ? ? 315 LYS A O   1 
ATOM 2437  C CB  . LYS A 1 314 ? 12.078  -18.402 120.094  1.00 10.00 ? ? ? ? ? ? 315 LYS A CB  1 
ATOM 2438  C CG  . LYS A 1 314 ? 13.427  -17.875 119.622  1.00 10.00 ? ? ? ? ? ? 315 LYS A CG  1 
ATOM 2439  C CD  . LYS A 1 314 ? 13.482  -16.400 119.270  1.00 10.00 ? ? ? ? ? ? 315 LYS A CD  1 
ATOM 2440  C CE  . LYS A 1 314 ? 14.771  -16.047 118.545  1.00 10.00 ? ? ? ? ? ? 315 LYS A CE  1 
ATOM 2441  N NZ  . LYS A 1 314 ? 14.448  -14.972 117.617  1.00 10.00 ? ? ? ? ? ? 315 LYS A NZ  1 
ATOM 2442  N N   . GLU A 1 315 ? 10.291  -16.171 121.466  1.00 10.00 ? ? ? ? ? ? 316 GLU A N   1 
ATOM 2443  C CA  . GLU A 1 315 ? 10.125  -14.761 121.782  1.00 10.00 ? ? ? ? ? ? 316 GLU A CA  1 
ATOM 2444  C C   . GLU A 1 315 ? 9.436   -14.464 123.091  1.00 10.00 ? ? ? ? ? ? 316 GLU A C   1 
ATOM 2445  O O   . GLU A 1 315 ? 9.737   -13.453 123.738  1.00 10.00 ? ? ? ? ? ? 316 GLU A O   1 
ATOM 2446  C CB  . GLU A 1 315 ? 9.374   -14.090 120.642  1.00 10.00 ? ? ? ? ? ? 316 GLU A CB  1 
ATOM 2447  C CG  . GLU A 1 315 ? 10.103  -14.169 119.322  1.00 10.00 ? ? ? ? ? ? 316 GLU A CG  1 
ATOM 2448  C CD  . GLU A 1 315 ? 11.333  -13.283 119.146  1.00 10.00 ? ? ? ? ? ? 316 GLU A CD  1 
ATOM 2449  O OE1 . GLU A 1 315 ? 12.062  -12.955 120.082  1.00 10.00 ? ? ? ? ? ? 316 GLU A OE1 1 
ATOM 2450  O OE2 . GLU A 1 315 ? 11.564  -12.890 118.013  1.00 10.00 ? ? ? ? ? ? 316 GLU A OE2 1 
ATOM 2451  N N   . ILE A 1 316 ? 8.499   -15.312 123.496  1.00 10.00 ? ? ? ? ? ? 317 ILE A N   1 
ATOM 2452  C CA  . ILE A 1 316 ? 7.844   -15.089 124.763  1.00 10.00 ? ? ? ? ? ? 317 ILE A CA  1 
ATOM 2453  C C   . ILE A 1 316 ? 8.807   -15.547 125.824  1.00 10.00 ? ? ? ? ? ? 317 ILE A C   1 
ATOM 2454  O O   . ILE A 1 316 ? 8.915   -14.900 126.868  1.00 10.00 ? ? ? ? ? ? 317 ILE A O   1 
ATOM 2455  C CB  . ILE A 1 316 ? 6.540   -15.848 124.775  1.00 10.00 ? ? ? ? ? ? 317 ILE A CB  1 
ATOM 2456  C CG1 . ILE A 1 316 ? 5.529   -15.032 123.965  1.00 10.00 ? ? ? ? ? ? 317 ILE A CG1 1 
ATOM 2457  C CG2 . ILE A 1 316 ? 5.995   -15.968 126.170  1.00 10.00 ? ? ? ? ? ? 317 ILE A CG2 1 
ATOM 2458  C CD1 . ILE A 1 316 ? 4.250   -15.758 123.546  1.00 10.00 ? ? ? ? ? ? 317 ILE A CD1 1 
ATOM 2459  N N   . THR A 1 317 ? 9.565   -16.609 125.574  1.00 10.00 ? ? ? ? ? ? 318 THR A N   1 
ATOM 2460  C CA  . THR A 1 317 ? 10.636  -17.005 126.464  1.00 10.00 ? ? ? ? ? ? 318 THR A CA  1 
ATOM 2461  C C   . THR A 1 317 ? 11.672  -15.922 126.721  1.00 10.00 ? ? ? ? ? ? 318 THR A C   1 
ATOM 2462  O O   . THR A 1 317 ? 12.279  -15.898 127.789  1.00 10.00 ? ? ? ? ? ? 318 THR A O   1 
ATOM 2463  C CB  . THR A 1 317 ? 11.279  -18.245 125.875  1.00 10.00 ? ? ? ? ? ? 318 THR A CB  1 
ATOM 2464  O OG1 . THR A 1 317 ? 10.219  -19.195 125.663  1.00 10.00 ? ? ? ? ? ? 318 THR A OG1 1 
ATOM 2465  C CG2 . THR A 1 317 ? 12.334  -18.821 126.798  1.00 10.00 ? ? ? ? ? ? 318 THR A CG2 1 
ATOM 2466  N N   . ALA A 1 318 ? 11.943  -15.007 125.792  1.00 10.00 ? ? ? ? ? ? 319 ALA A N   1 
ATOM 2467  C CA  . ALA A 1 318 ? 12.870  -13.919 126.076  1.00 10.00 ? ? ? ? ? ? 319 ALA A CA  1 
ATOM 2468  C C   . ALA A 1 318 ? 12.243  -12.836 126.959  1.00 10.00 ? ? ? ? ? ? 319 ALA A C   1 
ATOM 2469  O O   . ALA A 1 318 ? 12.914  -12.351 127.877  1.00 10.00 ? ? ? ? ? ? 319 ALA A O   1 
ATOM 2470  C CB  . ALA A 1 318 ? 13.310  -13.294 124.792  1.00 10.00 ? ? ? ? ? ? 319 ALA A CB  1 
ATOM 2471  N N   . LEU A 1 319 ? 10.987  -12.396 126.743  1.00 10.00 ? ? ? ? ? ? 320 LEU A N   1 
ATOM 2472  C CA  . LEU A 1 319 ? 10.383  -11.385 127.622  1.00 10.00 ? ? ? ? ? ? 320 LEU A CA  1 
ATOM 2473  C C   . LEU A 1 319 ? 9.944   -11.883 129.031  1.00 10.00 ? ? ? ? ? ? 320 LEU A C   1 
ATOM 2474  O O   . LEU A 1 319 ? 9.874   -11.125 130.009  1.00 10.00 ? ? ? ? ? ? 320 LEU A O   1 
ATOM 2475  C CB  . LEU A 1 319 ? 9.200   -10.830 126.912  1.00 10.00 ? ? ? ? ? ? 320 LEU A CB  1 
ATOM 2476  C CG  . LEU A 1 319 ? 9.425   -10.182 125.572  1.00 10.00 ? ? ? ? ? ? 320 LEU A CG  1 
ATOM 2477  C CD1 . LEU A 1 319 ? 8.394   -10.638 124.557  1.00 10.00 ? ? ? ? ? ? 320 LEU A CD1 1 
ATOM 2478  C CD2 . LEU A 1 319 ? 9.337   -8.683  125.749  1.00 10.00 ? ? ? ? ? ? 320 LEU A CD2 1 
ATOM 2479  N N   . ALA A 1 320 ? 9.601   -13.177 129.142  1.00 10.00 ? ? ? ? ? ? 321 ALA A N   1 
ATOM 2480  C CA  . ALA A 1 320 ? 8.983   -13.747 130.325  1.00 10.00 ? ? ? ? ? ? 321 ALA A CA  1 
ATOM 2481  C C   . ALA A 1 320 ? 9.970   -13.869 131.454  1.00 10.00 ? ? ? ? ? ? 321 ALA A C   1 
ATOM 2482  O O   . ALA A 1 320 ? 11.133  -14.204 131.151  1.00 10.00 ? ? ? ? ? ? 321 ALA A O   1 
ATOM 2483  C CB  . ALA A 1 320 ? 8.496   -15.128 130.056  1.00 10.00 ? ? ? ? ? ? 321 ALA A CB  1 
ATOM 2484  N N   . PRO A 1 321 ? 9.592   -13.701 132.758  1.00 10.00 ? ? ? ? ? ? 322 PRO A N   1 
ATOM 2485  C CA  . PRO A 1 321 ? 10.486  -13.964 133.913  1.00 10.00 ? ? ? ? ? ? 322 PRO A CA  1 
ATOM 2486  C C   . PRO A 1 321 ? 11.261  -15.286 133.712  1.00 10.00 ? ? ? ? ? ? 322 PRO A C   1 
ATOM 2487  O O   . PRO A 1 321 ? 10.733  -16.289 133.183  1.00 10.00 ? ? ? ? ? ? 322 PRO A O   1 
ATOM 2488  C CB  . PRO A 1 321 ? 9.546   -13.966 135.093  1.00 10.00 ? ? ? ? ? ? 322 PRO A CB  1 
ATOM 2489  C CG  . PRO A 1 321 ? 8.481   -12.966 134.669  1.00 10.00 ? ? ? ? ? ? 322 PRO A CG  1 
ATOM 2490  C CD  . PRO A 1 321 ? 8.252   -13.312 133.202  1.00 10.00 ? ? ? ? ? ? 322 PRO A CD  1 
ATOM 2491  N N   . SER A 1 322 ? 12.506  -15.321 134.199  1.00 10.00 ? ? ? ? ? ? 323 SER A N   1 
ATOM 2492  C CA  . SER A 1 322 ? 13.451  -16.402 133.863  1.00 10.00 ? ? ? ? ? ? 323 SER A CA  1 
ATOM 2493  C C   . SER A 1 322 ? 13.131  -17.860 134.278  1.00 10.00 ? ? ? ? ? ? 323 SER A C   1 
ATOM 2494  O O   . SER A 1 322 ? 13.884  -18.820 134.077  1.00 10.00 ? ? ? ? ? ? 323 SER A O   1 
ATOM 2495  C CB  . SER A 1 322 ? 14.813  -15.840 134.405  1.00 10.00 ? ? ? ? ? ? 323 SER A CB  1 
ATOM 2496  O OG  . SER A 1 322 ? 15.025  -14.448 134.016  1.00 10.00 ? ? ? ? ? ? 323 SER A OG  1 
ATOM 2497  N N   . THR A 1 323 ? 11.924  -18.029 134.788  1.00 10.00 ? ? ? ? ? ? 324 THR A N   1 
ATOM 2498  C CA  . THR A 1 323 ? 11.452  -19.255 135.338  1.00 10.00 ? ? ? ? ? ? 324 THR A CA  1 
ATOM 2499  C C   . THR A 1 323 ? 10.178  -19.750 134.710  1.00 10.00 ? ? ? ? ? ? 324 THR A C   1 
ATOM 2500  O O   . THR A 1 323 ? 9.966   -20.963 134.824  1.00 10.00 ? ? ? ? ? ? 324 THR A O   1 
ATOM 2501  C CB  . THR A 1 323 ? 11.209  -19.074 136.840  1.00 10.00 ? ? ? ? ? ? 324 THR A CB  1 
ATOM 2502  O OG1 . THR A 1 323 ? 11.230  -17.662 137.124  1.00 10.00 ? ? ? ? ? ? 324 THR A OG1 1 
ATOM 2503  C CG2 . THR A 1 323 ? 12.236  -19.863 137.664  1.00 10.00 ? ? ? ? ? ? 324 THR A CG2 1 
ATOM 2504  N N   . MET A 1 324 ? 9.357   -18.915 134.029  1.00 10.00 ? ? ? ? ? ? 325 MET A N   1 
ATOM 2505  C CA  . MET A 1 324 ? 8.013   -19.338 133.640  1.00 10.00 ? ? ? ? ? ? 325 MET A CA  1 
ATOM 2506  C C   . MET A 1 324 ? 8.051   -20.572 132.776  1.00 10.00 ? ? ? ? ? ? 325 MET A C   1 
ATOM 2507  O O   . MET A 1 324 ? 8.933   -20.635 131.936  1.00 10.00 ? ? ? ? ? ? 325 MET A O   1 
ATOM 2508  C CB  . MET A 1 324 ? 7.314   -18.292 132.861  1.00 10.00 ? ? ? ? ? ? 325 MET A CB  1 
ATOM 2509  C CG  . MET A 1 324 ? 7.201   -17.018 133.613  1.00 10.00 ? ? ? ? ? ? 325 MET A CG  1 
ATOM 2510  S SD  . MET A 1 324 ? 5.983   -17.137 134.950  1.00 10.00 ? ? ? ? ? ? 325 MET A SD  1 
ATOM 2511  C CE  . MET A 1 324 ? 6.889   -16.358 136.265  1.00 10.00 ? ? ? ? ? ? 325 MET A CE  1 
ATOM 2512  N N   . LYS A 1 325 ? 7.221   -21.593 132.943  1.00 10.00 ? ? ? ? ? ? 326 LYS A N   1 
ATOM 2513  C CA  . LYS A 1 325 ? 7.190   -22.724 132.037  1.00 10.00 ? ? ? ? ? ? 326 LYS A CA  1 
ATOM 2514  C C   . LYS A 1 325 ? 6.382   -22.072 130.945  1.00 10.00 ? ? ? ? ? ? 326 LYS A C   1 
ATOM 2515  O O   . LYS A 1 325 ? 5.351   -21.537 131.317  1.00 10.00 ? ? ? ? ? ? 326 LYS A O   1 
ATOM 2516  C CB  . LYS A 1 325 ? 6.393   -23.888 132.599  1.00 10.00 ? ? ? ? ? ? 326 LYS A CB  1 
ATOM 2517  C CG  . LYS A 1 325 ? 6.403   -25.095 131.678  1.00 10.00 ? ? ? ? ? ? 326 LYS A CG  1 
ATOM 2518  C CD  . LYS A 1 325 ? 5.953   -26.342 132.437  1.00 10.00 ? ? ? ? ? ? 326 LYS A CD  1 
ATOM 2519  C CE  . LYS A 1 325 ? 4.432   -26.509 132.614  1.00 10.00 ? ? ? ? ? ? 326 LYS A CE  1 
ATOM 2520  N NZ  . LYS A 1 325 ? 3.797   -26.804 131.339  1.00 10.00 ? ? ? ? ? ? 326 LYS A NZ  1 
ATOM 2521  N N   . ILE A 1 326 ? 6.792   -21.998 129.677  1.00 10.00 ? ? ? ? ? ? 327 ILE A N   1 
ATOM 2522  C CA  . ILE A 1 326 ? 5.987   -21.370 128.664  1.00 10.00 ? ? ? ? ? ? 327 ILE A CA  1 
ATOM 2523  C C   . ILE A 1 326 ? 5.607   -22.449 127.678  1.00 10.00 ? ? ? ? ? ? 327 ILE A C   1 
ATOM 2524  O O   . ILE A 1 326 ? 6.447   -23.113 127.078  1.00 10.00 ? ? ? ? ? ? 327 ILE A O   1 
ATOM 2525  C CB  . ILE A 1 326 ? 6.788   -20.249 128.018  1.00 10.00 ? ? ? ? ? ? 327 ILE A CB  1 
ATOM 2526  C CG1 . ILE A 1 326 ? 7.030   -19.168 129.027  1.00 10.00 ? ? ? ? ? ? 327 ILE A CG1 1 
ATOM 2527  C CG2 . ILE A 1 326 ? 5.999   -19.569 126.926  1.00 10.00 ? ? ? ? ? ? 327 ILE A CG2 1 
ATOM 2528  C CD1 . ILE A 1 326 ? 7.814   -18.020 128.451  1.00 10.00 ? ? ? ? ? ? 327 ILE A CD1 1 
ATOM 2529  N N   . LYS A 1 327 ? 4.326   -22.669 127.473  1.00 10.00 ? ? ? ? ? ? 328 LYS A N   1 
ATOM 2530  C CA  . LYS A 1 327 ? 3.877   -23.770 126.656  1.00 10.00 ? ? ? ? ? ? 328 LYS A CA  1 
ATOM 2531  C C   . LYS A 1 327 ? 2.997   -23.071 125.644  1.00 10.00 ? ? ? ? ? ? 328 LYS A C   1 
ATOM 2532  O O   . LYS A 1 327 ? 2.005   -22.439 125.998  1.00 10.00 ? ? ? ? ? ? 328 LYS A O   1 
ATOM 2533  C CB  . LYS A 1 327 ? 3.190   -24.692 127.641  1.00 10.00 ? ? ? ? ? ? 328 LYS A CB  1 
ATOM 2534  C CG  . LYS A 1 327 ? 2.715   -26.061 127.202  1.00 10.00 ? ? ? ? ? ? 328 LYS A CG  1 
ATOM 2535  C CD  . LYS A 1 327 ? 2.563   -26.809 128.508  1.00 10.00 ? ? ? ? ? ? 328 LYS A CD  1 
ATOM 2536  C CE  . LYS A 1 327 ? 2.655   -28.314 128.429  1.00 10.00 ? ? ? ? ? ? 328 LYS A CE  1 
ATOM 2537  N NZ  . LYS A 1 327 ? 1.560   -28.899 127.666  1.00 10.00 ? ? ? ? ? ? 328 LYS A NZ  1 
ATOM 2538  N N   . ILE A 1 328 ? 3.466   -23.002 124.407  1.00 10.00 ? ? ? ? ? ? 329 ILE A N   1 
ATOM 2539  C CA  . ILE A 1 328 ? 2.733   -22.363 123.314  1.00 10.00 ? ? ? ? ? ? 329 ILE A CA  1 
ATOM 2540  C C   . ILE A 1 328 ? 1.910   -23.545 122.779  1.00 10.00 ? ? ? ? ? ? 329 ILE A C   1 
ATOM 2541  O O   . ILE A 1 328 ? 2.503   -24.631 122.794  1.00 10.00 ? ? ? ? ? ? 329 ILE A O   1 
ATOM 2542  C CB  . ILE A 1 328 ? 3.780   -21.779 122.324  1.00 10.00 ? ? ? ? ? ? 329 ILE A CB  1 
ATOM 2543  C CG1 . ILE A 1 328 ? 3.900   -20.324 122.556  1.00 10.00 ? ? ? ? ? ? 329 ILE A CG1 1 
ATOM 2544  C CG2 . ILE A 1 328 ? 3.309   -21.782 120.880  1.00 10.00 ? ? ? ? ? ? 329 ILE A CG2 1 
ATOM 2545  C CD1 . ILE A 1 328 ? 4.413   -19.857 123.891  1.00 10.00 ? ? ? ? ? ? 329 ILE A CD1 1 
ATOM 2546  N N   . ILE A 1 329 ? 0.626   -23.487 122.344  1.00 10.00 ? ? ? ? ? ? 330 ILE A N   1 
ATOM 2547  C CA  . ILE A 1 329 ? -0.154  -24.672 121.981  1.00 10.00 ? ? ? ? ? ? 330 ILE A CA  1 
ATOM 2548  C C   . ILE A 1 329 ? -0.571  -24.337 120.578  1.00 10.00 ? ? ? ? ? ? 330 ILE A C   1 
ATOM 2549  O O   . ILE A 1 329 ? -1.012  -23.207 120.336  1.00 10.00 ? ? ? ? ? ? 330 ILE A O   1 
ATOM 2550  C CB  . ILE A 1 329 ? -1.438  -24.871 122.886  1.00 10.00 ? ? ? ? ? ? 330 ILE A CB  1 
ATOM 2551  C CG1 . ILE A 1 329 ? -1.119  -25.500 124.238  1.00 10.00 ? ? ? ? ? ? 330 ILE A CG1 1 
ATOM 2552  C CG2 . ILE A 1 329 ? -2.421  -25.811 122.173  1.00 10.00 ? ? ? ? ? ? 330 ILE A CG2 1 
ATOM 2553  C CD1 . ILE A 1 329 ? -0.757  -24.514 125.329  1.00 10.00 ? ? ? ? ? ? 330 ILE A CD1 1 
ATOM 2554  N N   . ALA A 1 330 ? -0.458  -25.255 119.641  1.00 10.00 ? ? ? ? ? ? 331 ALA A N   1 
ATOM 2555  C CA  . ALA A 1 330 ? -0.794  -24.894 118.289  1.00 10.00 ? ? ? ? ? ? 331 ALA A CA  1 
ATOM 2556  C C   . ALA A 1 330 ? -1.321  -26.171 117.698  1.00 10.00 ? ? ? ? ? ? 331 ALA A C   1 
ATOM 2557  O O   . ALA A 1 330 ? -0.606  -26.949 117.025  1.00 10.00 ? ? ? ? ? ? 331 ALA A O   1 
ATOM 2558  C CB  . ALA A 1 330 ? 0.417   -24.428 117.500  1.00 10.00 ? ? ? ? ? ? 331 ALA A CB  1 
ATOM 2559  N N   . PRO A 1 331 ? -2.620  -26.427 118.042  1.00 10.00 ? ? ? ? ? ? 332 PRO A N   1 
ATOM 2560  C CA  . PRO A 1 331 ? -3.315  -27.626 117.619  1.00 10.00 ? ? ? ? ? ? 332 PRO A CA  1 
ATOM 2561  C C   . PRO A 1 331 ? -3.351  -27.591 116.100  1.00 10.00 ? ? ? ? ? ? 332 PRO A C   1 
ATOM 2562  O O   . PRO A 1 331 ? -3.644  -26.558 115.500  1.00 10.00 ? ? ? ? ? ? 332 PRO A O   1 
ATOM 2563  C CB  . PRO A 1 331 ? -4.662  -27.529 118.298  1.00 10.00 ? ? ? ? ? ? 332 PRO A CB  1 
ATOM 2564  C CG  . PRO A 1 331 ? -4.927  -26.058 118.359  1.00 10.00 ? ? ? ? ? ? 332 PRO A CG  1 
ATOM 2565  C CD  . PRO A 1 331 ? -3.567  -25.511 118.695  1.00 10.00 ? ? ? ? ? ? 332 PRO A CD  1 
ATOM 2566  N N   . PRO A 1 332 ? -3.095  -28.693 115.423  1.00 10.00 ? ? ? ? ? ? 333 PRO A N   1 
ATOM 2567  C CA  . PRO A 1 332 ? -3.031  -28.711 113.990  1.00 10.00 ? ? ? ? ? ? 333 PRO A CA  1 
ATOM 2568  C C   . PRO A 1 332 ? -4.366  -28.374 113.332  1.00 10.00 ? ? ? ? ? ? 333 PRO A C   1 
ATOM 2569  O O   . PRO A 1 332 ? -4.369  -28.186 112.119  1.00 10.00 ? ? ? ? ? ? 333 PRO A O   1 
ATOM 2570  C CB  . PRO A 1 332 ? -2.476  -30.107 113.705  1.00 10.00 ? ? ? ? ? ? 333 PRO A CB  1 
ATOM 2571  C CG  . PRO A 1 332 ? -2.926  -30.991 114.846  1.00 10.00 ? ? ? ? ? ? 333 PRO A CG  1 
ATOM 2572  C CD  . PRO A 1 332 ? -2.786  -30.002 116.001  1.00 10.00 ? ? ? ? ? ? 333 PRO A CD  1 
ATOM 2573  N N   . GLU A 1 333 ? -5.508  -28.224 114.031  1.00 10.00 ? ? ? ? ? ? 334 GLU A N   1 
ATOM 2574  C CA  . GLU A 1 333 ? -6.744  -27.909 113.344  1.00 10.00 ? ? ? ? ? ? 334 GLU A CA  1 
ATOM 2575  C C   . GLU A 1 333 ? -7.215  -26.520 113.580  1.00 10.00 ? ? ? ? ? ? 334 GLU A C   1 
ATOM 2576  O O   . GLU A 1 333 ? -8.388  -26.203 113.387  1.00 10.00 ? ? ? ? ? ? 334 GLU A O   1 
ATOM 2577  C CB  . GLU A 1 333 ? -7.863  -28.852 113.754  1.00 10.00 ? ? ? ? ? ? 334 GLU A CB  1 
ATOM 2578  C CG  . GLU A 1 333 ? -7.829  -30.276 113.144  1.00 10.00 ? ? ? ? ? ? 334 GLU A CG  1 
ATOM 2579  C CD  . GLU A 1 333 ? -6.749  -31.223 113.676  1.00 10.00 ? ? ? ? ? ? 334 GLU A CD  1 
ATOM 2580  O OE1 . GLU A 1 333 ? -6.134  -30.956 114.726  1.00 10.00 ? ? ? ? ? ? 334 GLU A OE1 1 
ATOM 2581  O OE2 . GLU A 1 333 ? -6.543  -32.253 113.019  1.00 10.00 ? ? ? ? ? ? 334 GLU A OE2 1 
ATOM 2582  N N   . ARG A 1 334 ? -6.241  -25.682 113.901  1.00 10.00 ? ? ? ? ? ? 335 ARG A N   1 
ATOM 2583  C CA  . ARG A 1 334 ? -6.423  -24.293 114.309  1.00 10.00 ? ? ? ? ? ? 335 ARG A CA  1 
ATOM 2584  C C   . ARG A 1 334 ? -6.924  -23.212 113.351  1.00 10.00 ? ? ? ? ? ? 335 ARG A C   1 
ATOM 2585  O O   . ARG A 1 334 ? -7.275  -22.113 113.808  1.00 10.00 ? ? ? ? ? ? 335 ARG A O   1 
ATOM 2586  C CB  . ARG A 1 334 ? -5.103  -23.860 114.939  1.00 10.00 ? ? ? ? ? ? 335 ARG A CB  1 
ATOM 2587  C CG  . ARG A 1 334 ? -4.199  -22.957 114.162  1.00 10.00 ? ? ? ? ? ? 335 ARG A CG  1 
ATOM 2588  C CD  . ARG A 1 334 ? -2.812  -23.052 114.721  1.00 10.00 ? ? ? ? ? ? 335 ARG A CD  1 
ATOM 2589  N NE  . ARG A 1 334 ? -2.241  -24.288 114.234  1.00 10.00 ? ? ? ? ? ? 335 ARG A NE  1 
ATOM 2590  C CZ  . ARG A 1 334 ? -1.016  -24.308 113.780  1.00 10.00 ? ? ? ? ? ? 335 ARG A CZ  1 
ATOM 2591  N NH1 . ARG A 1 334 ? -0.256  -23.222 113.739  1.00 10.00 ? ? ? ? ? ? 335 ARG A NH1 1 
ATOM 2592  N NH2 . ARG A 1 334 ? -0.542  -25.452 113.350  1.00 10.00 ? ? ? ? ? ? 335 ARG A NH2 1 
ATOM 2593  N N   . LYS A 1 335 ? -8.105  -26.201 112.094  1.00 10.00 ? ? ? ? ? ? 336 LYS A N   1 
ATOM 2594  C CA  . LYS A 1 335 ? -8.431  -25.481 110.855  1.00 10.00 ? ? ? ? ? ? 336 LYS A CA  1 
ATOM 2595  C C   . LYS A 1 335 ? -9.890  -25.022 111.085  1.00 10.00 ? ? ? ? ? ? 336 LYS A C   1 
ATOM 2596  O O   . LYS A 1 335 ? -10.305 -23.962 110.647  1.00 10.00 ? ? ? ? ? ? 336 LYS A O   1 
ATOM 2597  C CB  . LYS A 1 335 ? -8.287  -26.487 109.664  1.00 10.00 ? ? ? ? ? ? 336 LYS A CB  1 
ATOM 2598  C CG  . LYS A 1 335 ? -8.062  -26.061 108.194  1.00 10.00 ? ? ? ? ? ? 336 LYS A CG  1 
ATOM 2599  C CD  . LYS A 1 335 ? -9.304  -25.593 107.397  1.00 10.00 ? ? ? ? ? ? 336 LYS A CD  1 
ATOM 2600  C CE  . LYS A 1 335 ? -9.472  -24.063 107.124  1.00 10.00 ? ? ? ? ? ? 336 LYS A CE  1 
ATOM 2601  N NZ  . LYS A 1 335 ? -10.783 -23.748 106.580  1.00 10.00 ? ? ? ? ? ? 336 LYS A NZ  1 
ATOM 2602  N N   . TYR A 1 336 ? -10.723 -25.761 111.841  1.00 10.00 ? ? ? ? ? ? 337 TYR A N   1 
ATOM 2603  C CA  . TYR A 1 336 ? -12.105 -25.399 112.121  1.00 10.00 ? ? ? ? ? ? 337 TYR A CA  1 
ATOM 2604  C C   . TYR A 1 336 ? -12.498 -24.836 113.507  1.00 10.00 ? ? ? ? ? ? 337 TYR A C   1 
ATOM 2605  O O   . TYR A 1 336 ? -13.691 -24.652 113.795  1.00 10.00 ? ? ? ? ? ? 337 TYR A O   1 
ATOM 2606  C CB  . TYR A 1 336 ? -12.886 -26.663 111.739  1.00 10.00 ? ? ? ? ? ? 337 TYR A CB  1 
ATOM 2607  C CG  . TYR A 1 336 ? -12.984 -26.757 110.243  1.00 10.00 ? ? ? ? ? ? 337 TYR A CG  1 
ATOM 2608  C CD1 . TYR A 1 336 ? -13.031 -25.586 109.531  1.00 10.00 ? ? ? ? ? ? 337 TYR A CD1 1 
ATOM 2609  C CD2 . TYR A 1 336 ? -12.923 -27.946 109.588  1.00 10.00 ? ? ? ? ? ? 337 TYR A CD2 1 
ATOM 2610  C CE1 . TYR A 1 336 ? -12.990 -25.568 108.162  1.00 10.00 ? ? ? ? ? ? 337 TYR A CE1 1 
ATOM 2611  C CE2 . TYR A 1 336 ? -12.885 -27.947 108.208  1.00 10.00 ? ? ? ? ? ? 337 TYR A CE2 1 
ATOM 2612  C CZ  . TYR A 1 336 ? -12.908 -26.757 107.519  1.00 10.00 ? ? ? ? ? ? 337 TYR A CZ  1 
ATOM 2613  O OH  . TYR A 1 336 ? -12.778 -26.690 106.157  1.00 10.00 ? ? ? ? ? ? 337 TYR A OH  1 
ATOM 2614  N N   . SER A 1 337 ? -11.544 -24.513 114.396  1.00 10.00 ? ? ? ? ? ? 338 SER A N   1 
ATOM 2615  C CA  . SER A 1 337 ? -11.776 -23.956 115.733  1.00 10.00 ? ? ? ? ? ? 338 SER A CA  1 
ATOM 2616  C C   . SER A 1 337 ? -12.782 -22.814 115.760  1.00 10.00 ? ? ? ? ? ? 338 SER A C   1 
ATOM 2617  O O   . SER A 1 337 ? -13.794 -22.959 116.434  1.00 10.00 ? ? ? ? ? ? 338 SER A O   1 
ATOM 2618  C CB  . SER A 1 337 ? -10.482 -23.428 116.364  1.00 10.00 ? ? ? ? ? ? 338 SER A CB  1 
ATOM 2619  O OG  . SER A 1 337 ? -9.631  -24.529 116.630  1.00 10.00 ? ? ? ? ? ? 338 SER A OG  1 
ATOM 2620  N N   . VAL A 1 338 ? -12.639 -21.741 115.018  1.00 10.00 ? ? ? ? ? ? 339 VAL A N   1 
ATOM 2621  C CA  . VAL A 1 338 ? -13.589 -20.678 115.122  1.00 10.00 ? ? ? ? ? ? 339 VAL A CA  1 
ATOM 2622  C C   . VAL A 1 338 ? -15.019 -21.177 114.848  1.00 10.00 ? ? ? ? ? ? 339 VAL A C   1 
ATOM 2623  O O   . VAL A 1 338 ? -15.915 -20.939 115.660  1.00 10.00 ? ? ? ? ? ? 339 VAL A O   1 
ATOM 2624  C CB  . VAL A 1 338 ? -13.108 -19.609 114.158  1.00 10.00 ? ? ? ? ? ? 339 VAL A CB  1 
ATOM 2625  C CG1 . VAL A 1 338 ? -14.115 -18.455 114.101  1.00 10.00 ? ? ? ? ? ? 339 VAL A CG1 1 
ATOM 2626  C CG2 . VAL A 1 338 ? -11.730 -19.120 114.622  1.00 10.00 ? ? ? ? ? ? 339 VAL A CG2 1 
ATOM 2627  N N   . TRP A 1 339 ? -15.281 -22.035 113.868  1.00 10.00 ? ? ? ? ? ? 340 TRP A N   1 
ATOM 2628  C CA  . TRP A 1 339 ? -16.630 -22.461 113.627  1.00 10.00 ? ? ? ? ? ? 340 TRP A CA  1 
ATOM 2629  C C   . TRP A 1 339 ? -17.096 -23.392 114.747  1.00 10.00 ? ? ? ? ? ? 340 TRP A C   1 
ATOM 2630  O O   . TRP A 1 339 ? -18.230 -23.200 115.198  1.00 10.00 ? ? ? ? ? ? 340 TRP A O   1 
ATOM 2631  C CB  . TRP A 1 339 ? -16.719 -23.147 112.259  1.00 10.00 ? ? ? ? ? ? 340 TRP A CB  1 
ATOM 2632  C CG  . TRP A 1 339 ? -18.159 -23.361 111.857  1.00 10.00 ? ? ? ? ? ? 340 TRP A CG  1 
ATOM 2633  C CD1 . TRP A 1 339 ? -18.891 -22.429 111.172  1.00 10.00 ? ? ? ? ? ? 340 TRP A CD1 1 
ATOM 2634  C CD2 . TRP A 1 339 ? -18.918 -24.419 112.264  1.00 10.00 ? ? ? ? ? ? 340 TRP A CD2 1 
ATOM 2635  N NE1 . TRP A 1 339 ? -20.127 -22.890 111.180  1.00 10.00 ? ? ? ? ? ? 340 TRP A NE1 1 
ATOM 2636  C CE2 . TRP A 1 339 ? -20.171 -24.072 111.827  1.00 10.00 ? ? ? ? ? ? 340 TRP A CE2 1 
ATOM 2637  C CE3 . TRP A 1 339 ? -18.658 -25.591 112.961  1.00 10.00 ? ? ? ? ? ? 340 TRP A CE3 1 
ATOM 2638  C CZ2 . TRP A 1 339 ? -21.185 -24.944 112.126  1.00 10.00 ? ? ? ? ? ? 340 TRP A CZ2 1 
ATOM 2639  C CZ3 . TRP A 1 339 ? -19.675 -26.457 113.245  1.00 10.00 ? ? ? ? ? ? 340 TRP A CZ3 1 
ATOM 2640  C CH2 . TRP A 1 339 ? -20.929 -26.118 112.829  1.00 10.00 ? ? ? ? ? ? 340 TRP A CH2 1 
ATOM 2641  N N   . ILE A 1 340 ? -16.376 -24.353 115.323  1.00 10.00 ? ? ? ? ? ? 341 ILE A N   1 
ATOM 2642  C CA  . ILE A 1 340 ? -16.992 -25.255 116.303  1.00 10.00 ? ? ? ? ? ? 341 ILE A CA  1 
ATOM 2643  C C   . ILE A 1 340 ? -17.087 -24.617 117.668  1.00 10.00 ? ? ? ? ? ? 341 ILE A C   1 
ATOM 2644  O O   . ILE A 1 340 ? -17.872 -25.066 118.510  1.00 10.00 ? ? ? ? ? ? 341 ILE A O   1 
ATOM 2645  C CB  . ILE A 1 340 ? -16.210 -26.565 116.411  1.00 10.00 ? ? ? ? ? ? 341 ILE A CB  1 
ATOM 2646  C CG1 . ILE A 1 340 ? -16.043 -27.216 115.015  1.00 10.00 ? ? ? ? ? ? 341 ILE A CG1 1 
ATOM 2647  C CG2 . ILE A 1 340 ? -16.976 -27.512 117.337  1.00 10.00 ? ? ? ? ? ? 341 ILE A CG2 1 
ATOM 2648  C CD1 . ILE A 1 340 ? -14.610 -27.636 114.684  1.00 10.00 ? ? ? ? ? ? 341 ILE A CD1 1 
ATOM 2649  N N   . GLY A 1 341 ? -16.354 -23.541 117.912  1.00 10.00 ? ? ? ? ? ? 342 GLY A N   1 
ATOM 2650  C CA  . GLY A 1 341 ? -16.543 -22.786 119.139  1.00 10.00 ? ? ? ? ? ? 342 GLY A CA  1 
ATOM 2651  C C   . GLY A 1 341 ? -17.854 -22.007 119.165  1.00 10.00 ? ? ? ? ? ? 342 GLY A C   1 
ATOM 2652  O O   . GLY A 1 341 ? -18.451 -21.804 120.222  1.00 10.00 ? ? ? ? ? ? 342 GLY A O   1 
ATOM 2653  N N   . GLY A 1 342 ? -18.260 -21.504 118.012  1.00 10.00 ? ? ? ? ? ? 343 GLY A N   1 
ATOM 2654  C CA  . GLY A 1 342 ? -19.521 -20.830 117.789  1.00 10.00 ? ? ? ? ? ? 343 GLY A CA  1 
ATOM 2655  C C   . GLY A 1 342 ? -20.666 -21.826 117.760  1.00 10.00 ? ? ? ? ? ? 343 GLY A C   1 
ATOM 2656  O O   . GLY A 1 342 ? -21.656 -21.601 118.435  1.00 10.00 ? ? ? ? ? ? 343 GLY A O   1 
ATOM 2657  N N   . SER A 1 343 ? -20.624 -22.920 116.993  1.00 10.00 ? ? ? ? ? ? 344 SER A N   1 
ATOM 2658  C CA  . SER A 1 343 ? -21.573 -24.001 117.135  1.00 10.00 ? ? ? ? ? ? 344 SER A CA  1 
ATOM 2659  C C   . SER A 1 343 ? -21.865 -24.483 118.552  1.00 10.00 ? ? ? ? ? ? 344 SER A C   1 
ATOM 2660  O O   . SER A 1 343 ? -22.990 -24.932 118.743  1.00 10.00 ? ? ? ? ? ? 344 SER A O   1 
ATOM 2661  C CB  . SER A 1 343 ? -21.094 -25.180 116.343  1.00 10.00 ? ? ? ? ? ? 344 SER A CB  1 
ATOM 2662  O OG  . SER A 1 343 ? -21.886 -26.342 116.604  1.00 10.00 ? ? ? ? ? ? 344 SER A OG  1 
ATOM 2663  N N   . ILE A 1 344 ? -20.931 -24.513 119.507  1.00 10.00 ? ? ? ? ? ? 345 ILE A N   1 
ATOM 2664  C CA  . ILE A 1 344 ? -21.077 -24.923 120.917  1.00 10.00 ? ? ? ? ? ? 345 ILE A CA  1 
ATOM 2665  C C   . ILE A 1 344 ? -21.878 -23.880 121.670  1.00 10.00 ? ? ? ? ? ? 345 ILE A C   1 
ATOM 2666  O O   . ILE A 1 344 ? -22.882 -24.116 122.360  1.00 10.00 ? ? ? ? ? ? 345 ILE A O   1 
ATOM 2667  C CB  . ILE A 1 344 ? -19.676 -25.073 121.653  1.00 10.00 ? ? ? ? ? ? 345 ILE A CB  1 
ATOM 2668  C CG1 . ILE A 1 344 ? -19.037 -26.335 121.172  1.00 10.00 ? ? ? ? ? ? 345 ILE A CG1 1 
ATOM 2669  C CG2 . ILE A 1 344 ? -19.769 -25.172 123.173  1.00 10.00 ? ? ? ? ? ? 345 ILE A CG2 1 
ATOM 2670  C CD1 . ILE A 1 344 ? -17.609 -26.482 121.751  1.00 10.00 ? ? ? ? ? ? 345 ILE A CD1 1 
ATOM 2671  N N   . LEU A 1 345 ? -21.302 -22.679 121.520  1.00 10.00 ? ? ? ? ? ? 346 LEU A N   1 
ATOM 2672  C CA  . LEU A 1 345 ? -21.799 -21.468 122.147  1.00 10.00 ? ? ? ? ? ? 346 LEU A CA  1 
ATOM 2673  C C   . LEU A 1 345 ? -23.224 -21.249 121.708  1.00 10.00 ? ? ? ? ? ? 346 LEU A C   1 
ATOM 2674  O O   . LEU A 1 345 ? -24.076 -21.414 122.562  1.00 10.00 ? ? ? ? ? ? 346 LEU A O   1 
ATOM 2675  C CB  . LEU A 1 345 ? -20.829 -20.338 121.747  1.00 10.00 ? ? ? ? ? ? 346 LEU A CB  1 
ATOM 2676  C CG  . LEU A 1 345 ? -20.712 -18.991 122.485  1.00 10.00 ? ? ? ? ? ? 346 LEU A CG  1 
ATOM 2677  C CD1 . LEU A 1 345 ? -21.359 -17.940 121.577  1.00 10.00 ? ? ? ? ? ? 346 LEU A CD1 1 
ATOM 2678  C CD2 . LEU A 1 345 ? -21.215 -19.123 123.958  1.00 10.00 ? ? ? ? ? ? 346 LEU A CD2 1 
ATOM 2679  N N   . ALA A 1 346 ? -23.567 -21.058 120.439  1.00 10.00 ? ? ? ? ? ? 347 ALA A N   1 
ATOM 2680  C CA  . ALA A 1 346 ? -24.934 -20.823 120.039  1.00 10.00 ? ? ? ? ? ? 347 ALA A CA  1 
ATOM 2681  C C   . ALA A 1 346 ? -25.907 -21.981 120.227  1.00 10.00 ? ? ? ? ? ? 347 ALA A C   1 
ATOM 2682  O O   . ALA A 1 346 ? -27.044 -21.877 119.732  1.00 10.00 ? ? ? ? ? ? 347 ALA A O   1 
ATOM 2683  C CB  . ALA A 1 346 ? -24.973 -20.425 118.583  1.00 10.00 ? ? ? ? ? ? 347 ALA A CB  1 
ATOM 2684  N N   . SER A 1 347 ? -25.473 -23.110 120.827  1.00 10.00 ? ? ? ? ? ? 348 SER A N   1 
ATOM 2685  C CA  . SER A 1 347 ? -26.372 -24.204 121.125  1.00 10.00 ? ? ? ? ? ? 348 SER A CA  1 
ATOM 2686  C C   . SER A 1 347 ? -26.700 -24.221 122.592  1.00 10.00 ? ? ? ? ? ? 348 SER A C   1 
ATOM 2687  O O   . SER A 1 347 ? -27.698 -24.850 122.951  1.00 10.00 ? ? ? ? ? ? 348 SER A O   1 
ATOM 2688  C CB  . SER A 1 347 ? -25.777 -25.574 120.748  1.00 10.00 ? ? ? ? ? ? 348 SER A CB  1 
ATOM 2689  O OG  . SER A 1 347 ? -24.390 -25.723 120.983  1.00 10.00 ? ? ? ? ? ? 348 SER A OG  1 
ATOM 2690  N N   . LEU A 1 348 ? -25.913 -23.594 123.470  1.00 10.00 ? ? ? ? ? ? 349 LEU A N   1 
ATOM 2691  C CA  . LEU A 1 348 ? -26.209 -23.600 124.906  1.00 10.00 ? ? ? ? ? ? 349 LEU A CA  1 
ATOM 2692  C C   . LEU A 1 348 ? -27.487 -22.773 125.190  1.00 10.00 ? ? ? ? ? ? 349 LEU A C   1 
ATOM 2693  O O   . LEU A 1 348 ? -27.717 -21.743 124.529  1.00 10.00 ? ? ? ? ? ? 349 LEU A O   1 
ATOM 2694  C CB  . LEU A 1 348 ? -25.005 -23.025 125.659  1.00 10.00 ? ? ? ? ? ? 349 LEU A CB  1 
ATOM 2695  C CG  . LEU A 1 348 ? -23.670 -23.738 125.462  1.00 10.00 ? ? ? ? ? ? 349 LEU A CG  1 
ATOM 2696  C CD1 . LEU A 1 348 ? -22.526 -22.845 125.891  1.00 10.00 ? ? ? ? ? ? 349 LEU A CD1 1 
ATOM 2697  C CD2 . LEU A 1 348 ? -23.640 -25.004 126.286  1.00 10.00 ? ? ? ? ? ? 349 LEU A CD2 1 
ATOM 2698  N N   . SER A 1 349 ? -28.362 -23.173 126.136  1.00 10.00 ? ? ? ? ? ? 350 SER A N   1 
ATOM 2699  C CA  . SER A 1 349 ? -29.555 -22.401 126.405  1.00 10.00 ? ? ? ? ? ? 350 SER A CA  1 
ATOM 2700  C C   . SER A 1 349 ? -29.155 -21.115 127.031  1.00 10.00 ? ? ? ? ? ? 350 SER A C   1 
ATOM 2701  O O   . SER A 1 349 ? -29.932 -20.160 126.986  1.00 10.00 ? ? ? ? ? ? 350 SER A O   1 
ATOM 2702  C CB  . SER A 1 349 ? -30.484 -23.072 127.337  1.00 10.00 ? ? ? ? ? ? 350 SER A CB  1 
ATOM 2703  O OG  . SER A 1 349 ? -31.648 -23.574 126.653  1.00 10.00 ? ? ? ? ? ? 350 SER A OG  1 
ATOM 2704  N N   . THR A 1 350 ? -27.940 -21.109 127.602  1.00 10.00 ? ? ? ? ? ? 351 THR A N   1 
ATOM 2705  C CA  . THR A 1 350 ? -27.202 -19.929 128.081  1.00 10.00 ? ? ? ? ? ? 351 THR A CA  1 
ATOM 2706  C C   . THR A 1 350 ? -27.255 -18.737 127.078  1.00 10.00 ? ? ? ? ? ? 351 THR A C   1 
ATOM 2707  O O   . THR A 1 350 ? -27.622 -17.602 127.359  1.00 10.00 ? ? ? ? ? ? 351 THR A O   1 
ATOM 2708  C CB  . THR A 1 350 ? -25.729 -20.471 128.319  1.00 10.00 ? ? ? ? ? ? 351 THR A CB  1 
ATOM 2709  O OG1 . THR A 1 350 ? -25.879 -21.588 129.191  1.00 10.00 ? ? ? ? ? ? 351 THR A OG1 1 
ATOM 2710  C CG2 . THR A 1 350 ? -24.731 -19.444 128.820  1.00 10.00 ? ? ? ? ? ? 351 THR A CG2 1 
ATOM 2711  N N   . PHE A 1 351 ? -26.983 -19.059 125.823  1.00 10.00 ? ? ? ? ? ? 352 PHE A N   1 
ATOM 2712  C CA  . PHE A 1 351 ? -26.745 -18.089 124.809  1.00 10.00 ? ? ? ? ? ? 352 PHE A CA  1 
ATOM 2713  C C   . PHE A 1 351 ? -27.968 -17.311 124.401  1.00 10.00 ? ? ? ? ? ? 352 PHE A C   1 
ATOM 2714  O O   . PHE A 1 351 ? -27.856 -16.147 124.036  1.00 10.00 ? ? ? ? ? ? 352 PHE A O   1 
ATOM 2715  C CB  . PHE A 1 351 ? -26.143 -18.827 123.631  1.00 10.00 ? ? ? ? ? ? 352 PHE A CB  1 
ATOM 2716  C CG  . PHE A 1 351 ? -25.513 -17.802 122.699  1.00 10.00 ? ? ? ? ? ? 352 PHE A CG  1 
ATOM 2717  C CD1 . PHE A 1 351 ? -24.432 -17.056 123.137  1.00 10.00 ? ? ? ? ? ? 352 PHE A CD1 1 
ATOM 2718  C CD2 . PHE A 1 351 ? -26.049 -17.558 121.472  1.00 10.00 ? ? ? ? ? ? 352 PHE A CD2 1 
ATOM 2719  C CE1 . PHE A 1 351 ? -23.898 -16.070 122.364  1.00 10.00 ? ? ? ? ? ? 352 PHE A CE1 1 
ATOM 2720  C CE2 . PHE A 1 351 ? -25.490 -16.568 120.729  1.00 10.00 ? ? ? ? ? ? 352 PHE A CE2 1 
ATOM 2721  C CZ  . PHE A 1 351 ? -24.436 -15.825 121.153  1.00 10.00 ? ? ? ? ? ? 352 PHE A CZ  1 
ATOM 2722  N N   . GLN A 1 352 ? -29.170 -17.882 124.458  1.00 10.00 ? ? ? ? ? ? 353 GLN A N   1 
ATOM 2723  C CA  . GLN A 1 352 ? -30.343 -17.155 124.006  1.00 10.00 ? ? ? ? ? ? 353 GLN A CA  1 
ATOM 2724  C C   . GLN A 1 352 ? -30.507 -15.895 124.826  1.00 10.00 ? ? ? ? ? ? 353 GLN A C   1 
ATOM 2725  O O   . GLN A 1 352 ? -31.101 -14.942 124.369  1.00 10.00 ? ? ? ? ? ? 353 GLN A O   1 
ATOM 2726  C CB  . GLN A 1 352 ? -31.611 -18.040 124.086  1.00 10.00 ? ? ? ? ? ? 353 GLN A CB  1 
ATOM 2727  C CG  . GLN A 1 352 ? -32.831 -17.558 123.171  1.00 10.00 ? ? ? ? ? ? 353 GLN A CG  1 
ATOM 2728  C CD  . GLN A 1 352 ? -32.755 -17.260 121.635  1.00 10.00 ? ? ? ? ? ? 353 GLN A CD  1 
ATOM 2729  O OE1 . GLN A 1 352 ? -33.238 -16.255 121.117  1.00 10.00 ? ? ? ? ? ? 353 GLN A OE1 1 
ATOM 2730  N NE2 . GLN A 1 352 ? -32.173 -18.084 120.787  1.00 10.00 ? ? ? ? ? ? 353 GLN A NE2 1 
ATOM 2731  N N   . GLN A 1 353 ? -29.910 -15.791 125.998  1.00 10.00 ? ? ? ? ? ? 354 GLN A N   1 
ATOM 2732  C CA  . GLN A 1 353 ? -29.928 -14.558 126.725  1.00 10.00 ? ? ? ? ? ? 354 GLN A CA  1 
ATOM 2733  C C   . GLN A 1 353 ? -28.490 -14.180 126.444  1.00 10.00 ? ? ? ? ? ? 354 GLN A C   1 
ATOM 2734  O O   . GLN A 1 353 ? -27.582 -14.600 127.164  1.00 10.00 ? ? ? ? ? ? 354 GLN A O   1 
ATOM 2735  C CB  . GLN A 1 353 ? -30.081 -14.728 128.245  1.00 10.00 ? ? ? ? ? ? 354 GLN A CB  1 
ATOM 2736  C CG  . GLN A 1 353 ? -30.530 -16.083 128.802  1.00 10.00 ? ? ? ? ? ? 354 GLN A CG  1 
ATOM 2737  C CD  . GLN A 1 353 ? -31.855 -16.565 128.208  1.00 10.00 ? ? ? ? ? ? 354 GLN A CD  1 
ATOM 2738  O OE1 . GLN A 1 353 ? -32.861 -15.830 128.196  1.00 10.00 ? ? ? ? ? ? 354 GLN A OE1 1 
ATOM 2739  N NE2 . GLN A 1 353 ? -31.837 -17.810 127.688  1.00 10.00 ? ? ? ? ? ? 354 GLN A NE2 1 
ATOM 2740  N N   . MET A 1 354 ? -28.246 -13.528 125.328  1.00 10.00 ? ? ? ? ? ? 355 MET A N   1 
ATOM 2741  C CA  . MET A 1 354 ? -26.929 -13.032 124.979  1.00 10.00 ? ? ? ? ? ? 355 MET A CA  1 
ATOM 2742  C C   . MET A 1 354 ? -27.040 -12.377 123.624  1.00 10.00 ? ? ? ? ? ? 355 MET A C   1 
ATOM 2743  O O   . MET A 1 354 ? -26.189 -11.558 123.314  1.00 10.00 ? ? ? ? ? ? 355 MET A O   1 
ATOM 2744  C CB  . MET A 1 354 ? -25.931 -14.136 124.892  1.00 10.00 ? ? ? ? ? ? 355 MET A CB  1 
ATOM 2745  C CG  . MET A 1 354 ? -24.539 -13.734 125.187  1.00 10.00 ? ? ? ? ? ? 355 MET A CG  1 
ATOM 2746  S SD  . MET A 1 354 ? -23.623 -15.274 125.484  1.00 10.00 ? ? ? ? ? ? 355 MET A SD  1 
ATOM 2747  C CE  . MET A 1 354 ? -24.228 -15.496 127.147  1.00 10.00 ? ? ? ? ? ? 355 MET A CE  1 
ATOM 2748  N N   . TRP A 1 355 ? -28.022 -12.779 122.795  1.00 10.00 ? ? ? ? ? ? 356 TRP A N   1 
ATOM 2749  C CA  . TRP A 1 355 ? -28.301 -12.186 121.495  1.00 10.00 ? ? ? ? ? ? 356 TRP A CA  1 
ATOM 2750  C C   . TRP A 1 355 ? -28.809 -10.757 121.581  1.00 10.00 ? ? ? ? ? ? 356 TRP A C   1 
ATOM 2751  O O   . TRP A 1 355 ? -29.283 -10.303 122.622  1.00 10.00 ? ? ? ? ? ? 356 TRP A O   1 
ATOM 2752  C CB  . TRP A 1 355 ? -29.418 -12.803 120.727  1.00 10.00 ? ? ? ? ? ? 356 TRP A CB  1 
ATOM 2753  C CG  . TRP A 1 355 ? -29.387 -14.251 120.421  1.00 10.00 ? ? ? ? ? ? 356 TRP A CG  1 
ATOM 2754  C CD1 . TRP A 1 355 ? -30.251 -14.978 121.135  1.00 10.00 ? ? ? ? ? ? 356 TRP A CD1 1 
ATOM 2755  C CD2 . TRP A 1 355 ? -28.552 -14.939 119.547  1.00 10.00 ? ? ? ? ? ? 356 TRP A CD2 1 
ATOM 2756  N NE1 . TRP A 1 355 ? -29.961 -16.185 120.735  1.00 10.00 ? ? ? ? ? ? 356 TRP A NE1 1 
ATOM 2757  C CE2 . TRP A 1 355 ? -28.966 -16.238 119.802  1.00 10.00 ? ? ? ? ? ? 356 TRP A CE2 1 
ATOM 2758  C CE3 . TRP A 1 355 ? -27.532 -14.735 118.608  1.00 10.00 ? ? ? ? ? ? 356 TRP A CE3 1 
ATOM 2759  C CZ2 . TRP A 1 355 ? -28.354 -17.327 119.147  1.00 10.00 ? ? ? ? ? ? 356 TRP A CZ2 1 
ATOM 2760  C CZ3 . TRP A 1 355 ? -26.917 -15.807 117.954  1.00 10.00 ? ? ? ? ? ? 356 TRP A CZ3 1 
ATOM 2761  C CH2 . TRP A 1 355 ? -27.327 -17.108 118.225  1.00 10.00 ? ? ? ? ? ? 356 TRP A CH2 1 
ATOM 2762  N N   . ILE A 1 356 ? -28.824 -10.099 120.429  1.00 10.00 ? ? ? ? ? ? 357 ILE A N   1 
ATOM 2763  C CA  . ILE A 1 356 ? -29.416 -8.802  120.209  1.00 10.00 ? ? ? ? ? ? 357 ILE A CA  1 
ATOM 2764  C C   . ILE A 1 356 ? -30.636 -9.247  119.410  1.00 10.00 ? ? ? ? ? ? 357 ILE A C   1 
ATOM 2765  O O   . ILE A 1 356 ? -30.501 -9.993  118.420  1.00 10.00 ? ? ? ? ? ? 357 ILE A O   1 
ATOM 2766  C CB  . ILE A 1 356 ? -28.498 -7.959  119.375  1.00 10.00 ? ? ? ? ? ? 357 ILE A CB  1 
ATOM 2767  C CG1 . ILE A 1 356 ? -27.132 -7.861  120.015  1.00 10.00 ? ? ? ? ? ? 357 ILE A CG1 1 
ATOM 2768  C CG2 . ILE A 1 356 ? -29.141 -6.606  119.207  1.00 10.00 ? ? ? ? ? ? 357 ILE A CG2 1 
ATOM 2769  C CD1 . ILE A 1 356 ? -26.000 -7.416  119.075  1.00 10.00 ? ? ? ? ? ? 357 ILE A CD1 1 
ATOM 2770  N N   . SER A 1 357 ? -31.823 -8.885  119.891  1.00 10.00 ? ? ? ? ? ? 358 SER A N   1 
ATOM 2771  C CA  . SER A 1 357 ? -33.050 -9.312  119.270  1.00 10.00 ? ? ? ? ? ? 358 SER A CA  1 
ATOM 2772  C C   . SER A 1 357 ? -33.532 -8.248  118.321  1.00 10.00 ? ? ? ? ? ? 358 SER A C   1 
ATOM 2773  O O   . SER A 1 357 ? -33.102 -7.084  118.433  1.00 10.00 ? ? ? ? ? ? 358 SER A O   1 
ATOM 2774  C CB  . SER A 1 357 ? -34.119 -9.535  120.322  1.00 10.00 ? ? ? ? ? ? 358 SER A CB  1 
ATOM 2775  O OG  . SER A 1 357 ? -34.348 -8.454  121.248  1.00 10.00 ? ? ? ? ? ? 358 SER A OG  1 
ATOM 2776  N N   . LYS A 1 358 ? -34.494 -8.628  117.459  1.00 10.00 ? ? ? ? ? ? 359 LYS A N   1 
ATOM 2777  C CA  . LYS A 1 358 ? -35.140 -7.726  116.497  1.00 10.00 ? ? ? ? ? ? 359 LYS A CA  1 
ATOM 2778  C C   . LYS A 1 358 ? -35.665 -6.573  117.289  1.00 10.00 ? ? ? ? ? ? 359 LYS A C   1 
ATOM 2779  O O   . LYS A 1 358 ? -35.263 -5.450  117.012  1.00 10.00 ? ? ? ? ? ? 359 LYS A O   1 
ATOM 2780  C CB  . LYS A 1 358 ? -36.296 -8.391  115.789  1.00 10.00 ? ? ? ? ? ? 359 LYS A CB  1 
ATOM 2781  C CG  . LYS A 1 358 ? -36.311 -8.088  114.281  1.00 10.00 ? ? ? ? ? ? 359 LYS A CG  1 
ATOM 2782  C CD  . LYS A 1 358 ? -36.277 -6.629  113.756  1.00 10.00 ? ? ? ? ? ? 359 LYS A CD  1 
ATOM 2783  C CE  . LYS A 1 358 ? -36.152 -6.672  112.217  1.00 10.00 ? ? ? ? ? ? 359 LYS A CE  1 
ATOM 2784  N NZ  . LYS A 1 358 ? -36.005 -5.346  111.647  1.00 10.00 ? ? ? ? ? ? 359 LYS A NZ  1 
ATOM 2785  N N   . GLN A 1 359 ? -36.442 -6.861  118.351  1.00 10.00 ? ? ? ? ? ? 360 GLN A N   1 
ATOM 2786  C CA  . GLN A 1 359 ? -36.926 -5.839  119.288  1.00 10.00 ? ? ? ? ? ? 360 GLN A CA  1 
ATOM 2787  C C   . GLN A 1 359 ? -35.860 -4.829  119.730  1.00 10.00 ? ? ? ? ? ? 360 GLN A C   1 
ATOM 2788  O O   . GLN A 1 359 ? -36.039 -3.594  119.620  1.00 10.00 ? ? ? ? ? ? 360 GLN A O   1 
ATOM 2789  C CB  . GLN A 1 359 ? -37.470 -6.445  120.585  1.00 10.00 ? ? ? ? ? ? 360 GLN A CB  1 
ATOM 2790  C CG  . GLN A 1 359 ? -37.742 -7.965  120.688  1.00 10.00 ? ? ? ? ? ? 360 GLN A CG  1 
ATOM 2791  C CD  . GLN A 1 359 ? -37.968 -8.475  122.129  1.00 10.00 ? ? ? ? ? ? 360 GLN A CD  1 
ATOM 2792  O OE1 . GLN A 1 359 ? -39.068 -8.918  122.465  1.00 10.00 ? ? ? ? ? ? 360 GLN A OE1 1 
ATOM 2793  N NE2 . GLN A 1 359 ? -36.990 -8.495  123.052  1.00 10.00 ? ? ? ? ? ? 360 GLN A NE2 1 
ATOM 2794  N N   . GLU A 1 360 ? -34.696 -5.338  120.176  1.00 10.00 ? ? ? ? ? ? 361 GLU A N   1 
ATOM 2795  C CA  . GLU A 1 360 ? -33.647 -4.456  120.686  1.00 10.00 ? ? ? ? ? ? 361 GLU A CA  1 
ATOM 2796  C C   . GLU A 1 360 ? -33.056 -3.597  119.617  1.00 10.00 ? ? ? ? ? ? 361 GLU A C   1 
ATOM 2797  O O   . GLU A 1 360 ? -32.772 -2.428  119.843  1.00 10.00 ? ? ? ? ? ? 361 GLU A O   1 
ATOM 2798  C CB  . GLU A 1 360 ? -32.541 -5.262  121.329  1.00 10.00 ? ? ? ? ? ? 361 GLU A CB  1 
ATOM 2799  C CG  . GLU A 1 360 ? -33.153 -5.970  122.547  1.00 10.00 ? ? ? ? ? ? 361 GLU A CG  1 
ATOM 2800  C CD  . GLU A 1 360 ? -32.246 -6.863  123.403  1.00 10.00 ? ? ? ? ? ? 361 GLU A CD  1 
ATOM 2801  O OE1 . GLU A 1 360 ? -31.132 -6.401  123.743  1.00 10.00 ? ? ? ? ? ? 361 GLU A OE1 1 
ATOM 2802  O OE2 . GLU A 1 360 ? -32.702 -7.989  123.745  1.00 10.00 ? ? ? ? ? ? 361 GLU A OE2 1 
ATOM 2803  N N   . TYR A 1 361 ? -32.920 -4.157  118.432  1.00 10.00 ? ? ? ? ? ? 362 TYR A N   1 
ATOM 2804  C CA  . TYR A 1 361 ? -32.366 -3.416  117.325  1.00 10.00 ? ? ? ? ? ? 362 TYR A CA  1 
ATOM 2805  C C   . TYR A 1 361 ? -33.257 -2.208  117.014  1.00 10.00 ? ? ? ? ? ? 362 TYR A C   1 
ATOM 2806  O O   . TYR A 1 361 ? -32.762 -1.135  116.674  1.00 10.00 ? ? ? ? ? ? 362 TYR A O   1 
ATOM 2807  C CB  . TYR A 1 361 ? -32.253 -4.355  116.088  1.00 10.00 ? ? ? ? ? ? 362 TYR A CB  1 
ATOM 2808  C CG  . TYR A 1 361 ? -31.697 -3.615  114.866  1.00 10.00 ? ? ? ? ? ? 362 TYR A CG  1 
ATOM 2809  C CD1 . TYR A 1 361 ? -30.401 -3.123  114.855  1.00 10.00 ? ? ? ? ? ? 362 TYR A CD1 1 
ATOM 2810  C CD2 . TYR A 1 361 ? -32.526 -3.368  113.790  1.00 10.00 ? ? ? ? ? ? 362 TYR A CD2 1 
ATOM 2811  C CE1 . TYR A 1 361 ? -29.937 -2.387  113.791  1.00 10.00 ? ? ? ? ? ? 362 TYR A CE1 1 
ATOM 2812  C CE2 . TYR A 1 361 ? -32.062 -2.620  112.732  1.00 10.00 ? ? ? ? ? ? 362 TYR A CE2 1 
ATOM 2813  C CZ  . TYR A 1 361 ? -30.782 -2.140  112.751  1.00 10.00 ? ? ? ? ? ? 362 TYR A CZ  1 
ATOM 2814  O OH  . TYR A 1 361 ? -30.390 -1.328  111.729  1.00 10.00 ? ? ? ? ? ? 362 TYR A OH  1 
ATOM 2815  N N   . ASP A 1 362 ? -34.578 -2.377  117.085  1.00 10.00 ? ? ? ? ? ? 363 ASP A N   1 
ATOM 2816  C CA  . ASP A 1 362 ? -35.538 -1.296  116.853  1.00 10.00 ? ? ? ? ? ? 363 ASP A CA  1 
ATOM 2817  C C   . ASP A 1 362 ? -35.410 -0.216  117.886  1.00 10.00 ? ? ? ? ? ? 363 ASP A C   1 
ATOM 2818  O O   . ASP A 1 362 ? -35.424 0.971   117.591  1.00 10.00 ? ? ? ? ? ? 363 ASP A O   1 
ATOM 2819  C CB  . ASP A 1 362 ? -36.968 -1.724  116.974  1.00 10.00 ? ? ? ? ? ? 363 ASP A CB  1 
ATOM 2820  C CG  . ASP A 1 362 ? -37.416 -2.394  115.739  1.00 10.00 ? ? ? ? ? ? 363 ASP A CG  1 
ATOM 2821  O OD1 . ASP A 1 362 ? -37.246 -1.744  114.714  1.00 10.00 ? ? ? ? ? ? 363 ASP A OD1 1 
ATOM 2822  O OD2 . ASP A 1 362 ? -37.930 -3.516  115.807  1.00 10.00 ? ? ? ? ? ? 363 ASP A OD2 1 
ATOM 2823  N N   . GLU A 1 363 ? -35.393 -0.769  119.118  1.00 10.00 ? ? ? ? ? ? 364 GLU A N   1 
ATOM 2824  C CA  . GLU A 1 363 ? -35.270 0.006   120.325  1.00 10.00 ? ? ? ? ? ? 364 GLU A CA  1 
ATOM 2825  C C   . GLU A 1 363 ? -34.037 0.876   120.113  1.00 10.00 ? ? ? ? ? ? 364 GLU A C   1 
ATOM 2826  O O   . GLU A 1 363 ? -34.229 2.099   120.042  1.00 10.00 ? ? ? ? ? ? 364 GLU A O   1 
ATOM 2827  C CB  . GLU A 1 363 ? -35.135 -0.983  121.539  1.00 10.00 ? ? ? ? ? ? 364 GLU A CB  1 
ATOM 2828  C CG  . GLU A 1 363 ? -34.639 -0.557  122.952  1.00 10.00 ? ? ? ? ? ? 364 GLU A CG  1 
ATOM 2829  C CD  . GLU A 1 363 ? -34.036 -1.715  123.803  1.00 10.00 ? ? ? ? ? ? 364 GLU A CD  1 
ATOM 2830  O OE1 . GLU A 1 363 ? -34.735 -2.718  124.096  1.00 10.00 ? ? ? ? ? ? 364 GLU A OE1 1 
ATOM 2831  O OE2 . GLU A 1 363 ? -32.854 -1.612  124.158  1.00 10.00 ? ? ? ? ? ? 364 GLU A OE2 1 
ATOM 2832  N N   . SER A 1 364 ? -32.853 0.292   119.847  1.00 10.00 ? ? ? ? ? ? 365 SER A N   1 
ATOM 2833  C CA  . SER A 1 364 ? -31.641 1.089   119.899  1.00 10.00 ? ? ? ? ? ? 365 SER A CA  1 
ATOM 2834  C C   . SER A 1 364 ? -31.158 1.596   118.570  1.00 10.00 ? ? ? ? ? ? 365 SER A C   1 
ATOM 2835  O O   . SER A 1 364 ? -30.799 2.769   118.396  1.00 10.00 ? ? ? ? ? ? 365 SER A O   1 
ATOM 2836  C CB  . SER A 1 364 ? -30.569 0.268   120.544  1.00 10.00 ? ? ? ? ? ? 365 SER A CB  1 
ATOM 2837  O OG  . SER A 1 364 ? -31.051 -0.628  121.524  1.00 10.00 ? ? ? ? ? ? 365 SER A OG  1 
ATOM 2838  N N   . GLY A 1 365 ? -31.133 0.718   117.596  1.00 10.00 ? ? ? ? ? ? 366 GLY A N   1 
ATOM 2839  C CA  . GLY A 1 365 ? -30.591 1.065   116.311  1.00 10.00 ? ? ? ? ? ? 366 GLY A CA  1 
ATOM 2840  C C   . GLY A 1 365 ? -29.441 0.115   116.091  1.00 10.00 ? ? ? ? ? ? 366 GLY A C   1 
ATOM 2841  O O   . GLY A 1 365 ? -29.458 -0.923  116.761  1.00 10.00 ? ? ? ? ? ? 366 GLY A O   1 
ATOM 2842  N N   . PRO A 1 366 ? -28.456 0.357   115.203  1.00 10.00 ? ? ? ? ? ? 367 PRO A N   1 
ATOM 2843  C CA  . PRO A 1 366 ? -27.247 -0.471  115.046  1.00 10.00 ? ? ? ? ? ? 367 PRO A CA  1 
ATOM 2844  C C   . PRO A 1 366 ? -26.129 -0.392  116.102  1.00 10.00 ? ? ? ? ? ? 367 PRO A C   1 
ATOM 2845  O O   . PRO A 1 366 ? -25.334 -1.308  116.298  1.00 10.00 ? ? ? ? ? ? 367 PRO A O   1 
ATOM 2846  C CB  . PRO A 1 366 ? -26.772 -0.115  113.639  1.00 10.00 ? ? ? ? ? ? 367 PRO A CB  1 
ATOM 2847  C CG  . PRO A 1 366 ? -27.270 1.286   113.455  1.00 10.00 ? ? ? ? ? ? 367 PRO A CG  1 
ATOM 2848  C CD  . PRO A 1 366 ? -28.654 1.164   114.012  1.00 10.00 ? ? ? ? ? ? 367 PRO A CD  1 
ATOM 2849  N N   . SER A 1 367 ? -26.087 0.732   116.817  1.00 10.00 ? ? ? ? ? ? 368 SER A N   1 
ATOM 2850  C CA  . SER A 1 367 ? -25.132 1.005   117.865  1.00 10.00 ? ? ? ? ? ? 368 SER A CA  1 
ATOM 2851  C C   . SER A 1 367 ? -25.132 -0.119  118.899  1.00 10.00 ? ? ? ? ? ? 368 SER A C   1 
ATOM 2852  O O   . SER A 1 367 ? -24.056 -0.591  119.244  1.00 10.00 ? ? ? ? ? ? 368 SER A O   1 
ATOM 2853  C CB  . SER A 1 367 ? -25.514 2.340   118.514  1.00 10.00 ? ? ? ? ? ? 368 SER A CB  1 
ATOM 2854  O OG  . SER A 1 367 ? -24.445 3.141   119.046  1.00 10.00 ? ? ? ? ? ? 368 SER A OG  1 
ATOM 2855  N N   . ILE A 1 368 ? -26.273 -0.621  119.365  1.00 10.00 ? ? ? ? ? ? 369 ILE A N   1 
ATOM 2856  C CA  . ILE A 1 368 ? -26.365 -1.661  120.370  1.00 10.00 ? ? ? ? ? ? 369 ILE A CA  1 
ATOM 2857  C C   . ILE A 1 368 ? -25.341 -2.787  120.247  1.00 10.00 ? ? ? ? ? ? 369 ILE A C   1 
ATOM 2858  O O   . ILE A 1 368 ? -25.029 -3.342  121.316  1.00 10.00 ? ? ? ? ? ? 369 ILE A O   1 
ATOM 2859  C CB  . ILE A 1 368 ? -27.809 -2.260  120.353  1.00 10.00 ? ? ? ? ? ? 369 ILE A CB  1 
ATOM 2860  C CG1 . ILE A 1 368 ? -27.962 -3.119  121.586  1.00 10.00 ? ? ? ? ? ? 369 ILE A CG1 1 
ATOM 2861  C CG2 . ILE A 1 368 ? -28.089 -3.069  119.117  1.00 10.00 ? ? ? ? ? ? 369 ILE A CG2 1 
ATOM 2862  C CD1 . ILE A 1 368 ? -29.220 -3.986  121.724  1.00 10.00 ? ? ? ? ? ? 369 ILE A CD1 1 
ATOM 2863  N N   . VAL A 1 369 ? -24.754 -3.107  119.059  1.00 10.00 ? ? ? ? ? ? 370 VAL A N   1 
ATOM 2864  C CA  . VAL A 1 369 ? -23.741 -4.161  118.922  1.00 10.00 ? ? ? ? ? ? 370 VAL A CA  1 
ATOM 2865  C C   . VAL A 1 369 ? -22.591 -3.843  119.845  1.00 10.00 ? ? ? ? ? ? 370 VAL A C   1 
ATOM 2866  O O   . VAL A 1 369 ? -21.999 -4.753  120.365  1.00 10.00 ? ? ? ? ? ? 370 VAL A O   1 
ATOM 2867  C CB  . VAL A 1 369 ? -22.943 -4.302  117.629  1.00 10.00 ? ? ? ? ? ? 370 VAL A CB  1 
ATOM 2868  C CG1 . VAL A 1 369 ? -22.936 -5.733  117.250  1.00 10.00 ? ? ? ? ? ? 370 VAL A CG1 1 
ATOM 2869  C CG2 . VAL A 1 369 ? -23.442 -3.390  116.588  1.00 10.00 ? ? ? ? ? ? 370 VAL A CG2 1 
ATOM 2870  N N   . HIS A 1 370 ? -22.261 -2.587  120.105  1.00 10.00 ? ? ? ? ? ? 371 HIS A N   1 
ATOM 2871  C CA  . HIS A 1 370 ? -21.119 -2.242  120.931  1.00 10.00 ? ? ? ? ? ? 371 HIS A CA  1 
ATOM 2872  C C   . HIS A 1 370 ? -21.371 -2.517  122.390  1.00 10.00 ? ? ? ? ? ? 371 HIS A C   1 
ATOM 2873  O O   . HIS A 1 370 ? -20.476 -2.726  123.201  1.00 10.00 ? ? ? ? ? ? 371 HIS A O   1 
ATOM 2874  C CB  . HIS A 1 370 ? -20.726 -0.749  120.811  1.00 10.00 ? ? ? ? ? ? 371 HIS A CB  1 
ATOM 2875  C CG  . HIS A 1 370 ? -20.612 -0.245  119.372  1.00 10.00 ? ? ? ? ? ? 371 HIS A CG  1 
ATOM 2876  N ND1 . HIS A 1 370 ? -20.204 -0.888  118.276  1.00 10.00 ? ? ? ? ? ? 371 HIS A ND1 1 
ATOM 2877  C CD2 . HIS A 1 370 ? -21.024 1.016   118.967  1.00 10.00 ? ? ? ? ? ? 371 HIS A CD2 1 
ATOM 2878  C CE1 . HIS A 1 370 ? -20.361 -0.081  117.244  1.00 10.00 ? ? ? ? ? ? 371 HIS A CE1 1 
ATOM 2879  N NE2 . HIS A 1 370 ? -20.856 1.064   117.673  1.00 10.00 ? ? ? ? ? ? 371 HIS A NE2 1 
ATOM 2880  N N   . ARG A 1 371 ? -22.622 -2.562  122.740  1.00 10.00 ? ? ? ? ? ? 372 ARG A N   1 
ATOM 2881  C CA  . ARG A 1 371 ? -22.964 -2.680  124.119  1.00 10.00 ? ? ? ? ? ? 372 ARG A CA  1 
ATOM 2882  C C   . ARG A 1 371 ? -22.997 -4.139  124.369  1.00 10.00 ? ? ? ? ? ? 372 ARG A C   1 
ATOM 2883  O O   . ARG A 1 371 ? -22.378 -4.572  125.309  1.00 10.00 ? ? ? ? ? ? 372 ARG A O   1 
ATOM 2884  C CB  . ARG A 1 371 ? -24.341 -2.005  124.371  1.00 10.00 ? ? ? ? ? ? 372 ARG A CB  1 
ATOM 2885  C CG  . ARG A 1 371 ? -24.519 -0.521  123.891  1.00 10.00 ? ? ? ? ? ? 372 ARG A CG  1 
ATOM 2886  C CD  . ARG A 1 371 ? -24.212 0.667   124.808  1.00 10.00 ? ? ? ? ? ? 372 ARG A CD  1 
ATOM 2887  N NE  . ARG A 1 371 ? -22.836 0.746   125.261  1.00 10.00 ? ? ? ? ? ? 372 ARG A NE  1 
ATOM 2888  C CZ  . ARG A 1 371 ? -21.811 1.290   124.592  1.00 10.00 ? ? ? ? ? ? 372 ARG A CZ  1 
ATOM 2889  N NH1 . ARG A 1 371 ? -21.973 1.856   123.401  1.00 10.00 ? ? ? ? ? ? 372 ARG A NH1 1 
ATOM 2890  N NH2 . ARG A 1 371 ? -20.579 1.195   125.110  1.00 10.00 ? ? ? ? ? ? 372 ARG A NH2 1 
ATOM 2891  N N   . LYS A 1 372 ? -23.669 -4.905  123.517  1.00 10.00 ? ? ? ? ? ? 373 LYS A N   1 
ATOM 2892  C CA  . LYS A 1 372 ? -23.943 -6.261  123.895  1.00 10.00 ? ? ? ? ? ? 373 LYS A CA  1 
ATOM 2893  C C   . LYS A 1 372 ? -22.968 -7.296  123.538  1.00 10.00 ? ? ? ? ? ? 373 LYS A C   1 
ATOM 2894  O O   . LYS A 1 372 ? -22.982 -8.394  124.111  1.00 10.00 ? ? ? ? ? ? 373 LYS A O   1 
ATOM 2895  C CB  . LYS A 1 372 ? -25.248 -6.719  123.353  1.00 10.00 ? ? ? ? ? ? 373 LYS A CB  1 
ATOM 2896  C CG  . LYS A 1 372 ? -26.425 -5.947  123.941  1.00 10.00 ? ? ? ? ? ? 373 LYS A CG  1 
ATOM 2897  C CD  . LYS A 1 372 ? -27.708 -6.716  123.958  1.00 10.00 ? ? ? ? ? ? 373 LYS A CD  1 
ATOM 2898  C CE  . LYS A 1 372 ? -27.588 -7.710  125.063  1.00 10.00 ? ? ? ? ? ? 373 LYS A CE  1 
ATOM 2899  N NZ  . LYS A 1 372 ? -28.880 -8.339  125.148  1.00 10.00 ? ? ? ? ? ? 373 LYS A NZ  1 
ATOM 2900  N N   . CYS A 1 373 ? -22.075 -6.930  122.642  1.00 10.00 ? ? ? ? ? ? 374 CYS A N   1 
ATOM 2901  C CA  . CYS A 1 373 ? -21.069 -7.871  122.189  1.00 10.00 ? ? ? ? ? ? 374 CYS A CA  1 
ATOM 2902  C C   . CYS A 1 373 ? -19.694 -7.430  122.734  1.00 10.00 ? ? ? ? ? ? 374 CYS A C   1 
ATOM 2903  O O   . CYS A 1 373 ? -18.819 -6.989  121.961  1.00 10.00 ? ? ? ? ? ? 374 CYS A O   1 
ATOM 2904  C CB  . CYS A 1 373 ? -21.187 -7.911  120.641  1.00 10.00 ? ? ? ? ? ? 374 CYS A CB  1 
ATOM 2905  S SG  . CYS A 1 373 ? -22.857 -8.346  119.987  1.00 10.00 ? ? ? ? ? ? 374 CYS A SG  1 
ATOM 2906  N N   . PHE A 1 374 ? -19.711 -7.355  124.131  1.00 10.00 ? ? ? ? ? ? 375 PHE A N   1 
ATOM 2907  C CA  . PHE A 1 374 ? -18.686 -7.159  125.223  1.00 10.00 ? ? ? ? ? ? 375 PHE A CA  1 
ATOM 2908  C C   . PHE A 1 374 ? -18.744 -6.380  126.568  1.00 10.00 ? ? ? ? ? ? 375 PHE A C   1 
ATOM 2909  O O   . PHE A 1 374 ? -17.781 -6.348  127.368  1.00 10.00 ? ? ? ? ? ? 375 PHE A O   1 
ATOM 2910  C CB  . PHE A 1 374 ? -17.402 -6.765  124.551  1.00 10.00 ? ? ? ? ? ? 375 PHE A CB  1 
ATOM 2911  C CG  . PHE A 1 374 ? -16.698 -8.105  124.408  1.00 10.00 ? ? ? ? ? ? 375 PHE A CG  1 
ATOM 2912  C CD1 . PHE A 1 374 ? -17.405 -9.300  124.353  1.00 10.00 ? ? ? ? ? ? 375 PHE A CD1 1 
ATOM 2913  C CD2 . PHE A 1 374 ? -15.322 -8.092  124.329  1.00 10.00 ? ? ? ? ? ? 375 PHE A CD2 1 
ATOM 2914  C CE1 . PHE A 1 374 ? -16.746 -10.466 124.219  1.00 10.00 ? ? ? ? ? ? 375 PHE A CE1 1 
ATOM 2915  C CE2 . PHE A 1 374 ? -14.656 -9.278  124.189  1.00 10.00 ? ? ? ? ? ? 375 PHE A CE2 1 
ATOM 2916  C CZ  . PHE A 1 374 ? -15.371 -10.464 124.136  1.00 10.00 ? ? ? ? ? ? 375 PHE A CZ  1 
ATOM 2917  O OXT . PHE A 1 374 ? -19.852 -6.004  126.909  1.00 10.00 ? ? ? ? ? ? 375 PHE A OXT 1 
ATOM 2918  N N   . ASP B 1 1   ? 39.128  20.765  91.073   1.00 10.00 ? ? ? ? ? ? 2   ASP B N   1 
ATOM 2919  C CA  . ASP B 1 1   ? 39.166  21.889  90.105   1.00 10.00 ? ? ? ? ? ? 2   ASP B CA  1 
ATOM 2920  C C   . ASP B 1 1   ? 39.290  21.541  88.580   1.00 10.00 ? ? ? ? ? ? 2   ASP B C   1 
ATOM 2921  O O   . ASP B 1 1   ? 40.347  21.498  87.931   1.00 10.00 ? ? ? ? ? ? 2   ASP B O   1 
ATOM 2922  C CB  . ASP B 1 1   ? 40.297  22.857  90.601   1.00 10.00 ? ? ? ? ? ? 2   ASP B CB  1 
ATOM 2923  C CG  . ASP B 1 1   ? 40.355  23.231  92.114   1.00 10.00 ? ? ? ? ? ? 2   ASP B CG  1 
ATOM 2924  O OD1 . ASP B 1 1   ? 39.405  22.875  92.843   1.00 10.00 ? ? ? ? ? ? 2   ASP B OD1 1 
ATOM 2925  O OD2 . ASP B 1 1   ? 41.339  23.875  92.558   1.00 10.00 ? ? ? ? ? ? 2   ASP B OD2 1 
ATOM 2926  N N   . ASP B 1 2   ? 38.081  21.275  88.032   1.00 10.00 ? ? ? ? ? ? 3   ASP B N   1 
ATOM 2927  C CA  . ASP B 1 2   ? 37.737  20.914  86.640   1.00 10.00 ? ? ? ? ? ? 3   ASP B CA  1 
ATOM 2928  C C   . ASP B 1 2   ? 38.199  19.541  86.213   1.00 10.00 ? ? ? ? ? ? 3   ASP B C   1 
ATOM 2929  O O   . ASP B 1 2   ? 37.447  18.691  85.728   1.00 10.00 ? ? ? ? ? ? 3   ASP B O   1 
ATOM 2930  C CB  . ASP B 1 2   ? 38.292  21.916  85.566   1.00 10.00 ? ? ? ? ? ? 3   ASP B CB  1 
ATOM 2931  C CG  . ASP B 1 2   ? 38.033  21.582  84.058   1.00 10.00 ? ? ? ? ? ? 3   ASP B CG  1 
ATOM 2932  O OD1 . ASP B 1 2   ? 37.197  20.706  83.724   1.00 10.00 ? ? ? ? ? ? 3   ASP B OD1 1 
ATOM 2933  O OD2 . ASP B 1 2   ? 38.708  22.208  83.202   1.00 10.00 ? ? ? ? ? ? 3   ASP B OD2 1 
ATOM 2934  N N   . ASP B 1 3   ? 39.492  19.363  86.247   1.00 10.00 ? ? ? ? ? ? 4   ASP B N   1 
ATOM 2935  C CA  . ASP B 1 3   ? 40.040  18.103  85.871   1.00 10.00 ? ? ? ? ? ? 4   ASP B CA  1 
ATOM 2936  C C   . ASP B 1 3   ? 40.235  17.699  87.307   1.00 10.00 ? ? ? ? ? ? 4   ASP B C   1 
ATOM 2937  O O   . ASP B 1 3   ? 40.913  18.322  88.142   1.00 10.00 ? ? ? ? ? ? 4   ASP B O   1 
ATOM 2938  C CB  . ASP B 1 3   ? 41.303  18.367  85.059   1.00 10.00 ? ? ? ? ? ? 4   ASP B CB  1 
ATOM 2939  C CG  . ASP B 1 3   ? 41.112  18.260  83.537   1.00 10.00 ? ? ? ? ? ? 4   ASP B CG  1 
ATOM 2940  O OD1 . ASP B 1 3   ? 39.995  17.967  83.053   1.00 10.00 ? ? ? ? ? ? 4   ASP B OD1 1 
ATOM 2941  O OD2 . ASP B 1 3   ? 42.125  18.454  82.843   1.00 10.00 ? ? ? ? ? ? 4   ASP B OD2 1 
ATOM 2942  N N   . ILE B 1 4   ? 39.155  16.925  87.433   1.00 10.00 ? ? ? ? ? ? 5   ILE B N   1 
ATOM 2943  C CA  . ILE B 1 4   ? 38.669  16.182  88.568   1.00 10.00 ? ? ? ? ? ? 5   ILE B CA  1 
ATOM 2944  C C   . ILE B 1 4   ? 37.728  16.954  89.462   1.00 10.00 ? ? ? ? ? ? 5   ILE B C   1 
ATOM 2945  O O   . ILE B 1 4   ? 37.831  18.070  89.984   1.00 10.00 ? ? ? ? ? ? 5   ILE B O   1 
ATOM 2946  C CB  . ILE B 1 4   ? 39.834  15.552  89.359   1.00 10.00 ? ? ? ? ? ? 5   ILE B CB  1 
ATOM 2947  C CG1 . ILE B 1 4   ? 40.032  14.266  88.522   1.00 10.00 ? ? ? ? ? ? 5   ILE B CG1 1 
ATOM 2948  C CG2 . ILE B 1 4   ? 39.626  15.272  90.859   1.00 10.00 ? ? ? ? ? ? 5   ILE B CG2 1 
ATOM 2949  C CD1 . ILE B 1 4   ? 38.737  13.403  88.332   1.00 10.00 ? ? ? ? ? ? 5   ILE B CD1 1 
ATOM 2950  N N   . ALA B 1 5   ? 36.687  16.242  89.032   1.00 10.00 ? ? ? ? ? ? 6   ALA B N   1 
ATOM 2951  C CA  . ALA B 1 5   ? 35.296  16.542  89.217   1.00 10.00 ? ? ? ? ? ? 6   ALA B CA  1 
ATOM 2952  C C   . ALA B 1 5   ? 34.669  15.379  88.435   1.00 10.00 ? ? ? ? ? ? 6   ALA B C   1 
ATOM 2953  O O   . ALA B 1 5   ? 35.163  14.922  87.376   1.00 10.00 ? ? ? ? ? ? 6   ALA B O   1 
ATOM 2954  C CB  . ALA B 1 5   ? 34.854  17.841  88.510   1.00 10.00 ? ? ? ? ? ? 6   ALA B CB  1 
ATOM 2955  N N   . ALA B 1 6   ? 33.630  14.848  89.067   1.00 10.00 ? ? ? ? ? ? 7   ALA B N   1 
ATOM 2956  C CA  . ALA B 1 6   ? 32.766  13.864  88.498   1.00 10.00 ? ? ? ? ? ? 7   ALA B CA  1 
ATOM 2957  C C   . ALA B 1 6   ? 32.007  14.568  87.375   1.00 10.00 ? ? ? ? ? ? 7   ALA B C   1 
ATOM 2958  O O   . ALA B 1 6   ? 31.881  15.801  87.348   1.00 10.00 ? ? ? ? ? ? 7   ALA B O   1 
ATOM 2959  C CB  . ALA B 1 6   ? 31.829  13.403  89.588   1.00 10.00 ? ? ? ? ? ? 7   ALA B CB  1 
ATOM 2960  N N   . LEU B 1 7   ? 31.495  13.812  86.425   1.00 10.00 ? ? ? ? ? ? 8   LEU B N   1 
ATOM 2961  C CA  . LEU B 1 7   ? 30.698  14.365  85.349   1.00 10.00 ? ? ? ? ? ? 8   LEU B CA  1 
ATOM 2962  C C   . LEU B 1 7   ? 29.262  14.031  85.719   1.00 10.00 ? ? ? ? ? ? 8   LEU B C   1 
ATOM 2963  O O   . LEU B 1 7   ? 28.993  12.824  85.909   1.00 10.00 ? ? ? ? ? ? 8   LEU B O   1 
ATOM 2964  C CB  . LEU B 1 7   ? 30.988  13.684  84.024   1.00 10.00 ? ? ? ? ? ? 8   LEU B CB  1 
ATOM 2965  C CG  . LEU B 1 7   ? 32.384  13.240  83.662   1.00 10.00 ? ? ? ? ? ? 8   LEU B CG  1 
ATOM 2966  C CD1 . LEU B 1 7   ? 32.333  12.544  82.329   1.00 10.00 ? ? ? ? ? ? 8   LEU B CD1 1 
ATOM 2967  C CD2 . LEU B 1 7   ? 33.306  14.405  83.634   1.00 10.00 ? ? ? ? ? ? 8   LEU B CD2 1 
ATOM 2968  N N   . VAL B 1 8   ? 28.327  14.964  85.890   1.00 10.00 ? ? ? ? ? ? 9   VAL B N   1 
ATOM 2969  C CA  . VAL B 1 8   ? 26.965  14.527  86.150   1.00 10.00 ? ? ? ? ? ? 9   VAL B CA  1 
ATOM 2970  C C   . VAL B 1 8   ? 26.269  14.279  84.791   1.00 10.00 ? ? ? ? ? ? 9   VAL B C   1 
ATOM 2971  O O   . VAL B 1 8   ? 26.301  15.159  83.920   1.00 10.00 ? ? ? ? ? ? 9   VAL B O   1 
ATOM 2972  C CB  . VAL B 1 8   ? 26.201  15.597  86.936   1.00 10.00 ? ? ? ? ? ? 9   VAL B CB  1 
ATOM 2973  C CG1 . VAL B 1 8   ? 24.945  14.916  87.529   1.00 10.00 ? ? ? ? ? ? 9   VAL B CG1 1 
ATOM 2974  C CG2 . VAL B 1 8   ? 27.036  16.215  88.004   1.00 10.00 ? ? ? ? ? ? 9   VAL B CG2 1 
ATOM 2975  N N   . VAL B 1 9   ? 25.621  13.161  84.499   1.00 10.00 ? ? ? ? ? ? 10  VAL B N   1 
ATOM 2976  C CA  . VAL B 1 9   ? 24.949  12.897  83.230   1.00 10.00 ? ? ? ? ? ? 10  VAL B CA  1 
ATOM 2977  C C   . VAL B 1 9   ? 23.502  12.652  83.654   1.00 10.00 ? ? ? ? ? ? 10  VAL B C   1 
ATOM 2978  O O   . VAL B 1 9   ? 23.169  11.720  84.426   1.00 10.00 ? ? ? ? ? ? 10  VAL B O   1 
ATOM 2979  C CB  . VAL B 1 9   ? 25.546  11.621  82.546   1.00 10.00 ? ? ? ? ? ? 10  VAL B CB  1 
ATOM 2980  C CG1 . VAL B 1 9   ? 24.757  11.168  81.356   1.00 10.00 ? ? ? ? ? ? 10  VAL B CG1 1 
ATOM 2981  C CG2 . VAL B 1 9   ? 26.924  11.938  82.021   1.00 10.00 ? ? ? ? ? ? 10  VAL B CG2 1 
ATOM 2982  N N   . ASP B 1 10  ? 22.612  13.520  83.181   1.00 10.00 ? ? ? ? ? ? 11  ASP B N   1 
ATOM 2983  C CA  . ASP B 1 10  ? 21.215  13.353  83.491   1.00 10.00 ? ? ? ? ? ? 11  ASP B CA  1 
ATOM 2984  C C   . ASP B 1 10  ? 20.600  12.886  82.221   1.00 10.00 ? ? ? ? ? ? 11  ASP B C   1 
ATOM 2985  O O   . ASP B 1 10  ? 20.725  13.572  81.220   1.00 10.00 ? ? ? ? ? ? 11  ASP B O   1 
ATOM 2986  C CB  . ASP B 1 10  ? 20.588  14.659  83.928   1.00 10.00 ? ? ? ? ? ? 11  ASP B CB  1 
ATOM 2987  C CG  . ASP B 1 10  ? 19.099  14.566  84.247   1.00 10.00 ? ? ? ? ? ? 11  ASP B CG  1 
ATOM 2988  O OD1 . ASP B 1 10  ? 18.524  13.495  84.431   1.00 10.00 ? ? ? ? ? ? 11  ASP B OD1 1 
ATOM 2989  O OD2 . ASP B 1 10  ? 18.505  15.618  84.301   1.00 10.00 ? ? ? ? ? ? 11  ASP B OD2 1 
ATOM 2990  N N   . ASN B 1 11  ? 19.950  11.734  82.283   1.00 10.00 ? ? ? ? ? ? 12  ASN B N   1 
ATOM 2991  C CA  . ASN B 1 11  ? 19.394  11.026  81.119   1.00 10.00 ? ? ? ? ? ? 12  ASN B CA  1 
ATOM 2992  C C   . ASN B 1 11  ? 17.910  11.116  81.055   1.00 10.00 ? ? ? ? ? ? 12  ASN B C   1 
ATOM 2993  O O   . ASN B 1 11  ? 17.221  10.342  81.749   1.00 10.00 ? ? ? ? ? ? 12  ASN B O   1 
ATOM 2994  C CB  . ASN B 1 11  ? 19.652  9.532   81.095   1.00 10.00 ? ? ? ? ? ? 12  ASN B CB  1 
ATOM 2995  C CG  . ASN B 1 11  ? 21.125  9.313   81.159   1.00 10.00 ? ? ? ? ? ? 12  ASN B CG  1 
ATOM 2996  O OD1 . ASN B 1 11  ? 21.830  9.454   80.156   1.00 10.00 ? ? ? ? ? ? 12  ASN B OD1 1 
ATOM 2997  N ND2 . ASN B 1 11  ? 21.593  9.039   82.383   1.00 10.00 ? ? ? ? ? ? 12  ASN B ND2 1 
ATOM 2998  N N   . GLY B 1 12  ? 17.491  12.132  80.299   1.00 10.00 ? ? ? ? ? ? 13  GLY B N   1 
ATOM 2999  C CA  . GLY B 1 12  ? 16.091  12.366  80.080   1.00 10.00 ? ? ? ? ? ? 13  GLY B CA  1 
ATOM 3000  C C   . GLY B 1 12  ? 15.626  11.791  78.748   1.00 10.00 ? ? ? ? ? ? 13  GLY B C   1 
ATOM 3001  O O   . GLY B 1 12  ? 16.374  11.645  77.763   1.00 10.00 ? ? ? ? ? ? 13  GLY B O   1 
ATOM 3002  N N   . SER B 1 13  ? 14.327  11.473  78.824   1.00 10.00 ? ? ? ? ? ? 14  SER B N   1 
ATOM 3003  C CA  . SER B 1 13  ? 13.503  11.038  77.717   1.00 10.00 ? ? ? ? ? ? 14  SER B CA  1 
ATOM 3004  C C   . SER B 1 13  ? 13.506  12.024  76.531   1.00 10.00 ? ? ? ? ? ? 14  SER B C   1 
ATOM 3005  O O   . SER B 1 13  ? 13.524  11.646  75.372   1.00 10.00 ? ? ? ? ? ? 14  SER B O   1 
ATOM 3006  C CB  . SER B 1 13  ? 12.085  10.860  78.226   1.00 10.00 ? ? ? ? ? ? 14  SER B CB  1 
ATOM 3007  O OG  . SER B 1 13  ? 11.947  9.966   79.329   1.00 10.00 ? ? ? ? ? ? 14  SER B OG  1 
ATOM 3008  N N   . GLY B 1 14  ? 13.435  13.312  76.765   1.00 10.00 ? ? ? ? ? ? 15  GLY B N   1 
ATOM 3009  C CA  . GLY B 1 14  ? 13.513  14.256  75.687   1.00 10.00 ? ? ? ? ? ? 15  GLY B CA  1 
ATOM 3010  C C   . GLY B 1 14  ? 14.861  14.929  75.557   1.00 10.00 ? ? ? ? ? ? 15  GLY B C   1 
ATOM 3011  O O   . GLY B 1 14  ? 15.310  15.157  74.434   1.00 10.00 ? ? ? ? ? ? 15  GLY B O   1 
ATOM 3012  N N   . MET B 1 15  ? 15.527  15.159  76.685   1.00 10.00 ? ? ? ? ? ? 16  MET B N   1 
ATOM 3013  C CA  . MET B 1 15  ? 16.744  15.936  76.811   1.00 10.00 ? ? ? ? ? ? 16  MET B CA  1 
ATOM 3014  C C   . MET B 1 15  ? 17.807  15.287  77.712   1.00 10.00 ? ? ? ? ? ? 16  MET B C   1 
ATOM 3015  O O   . MET B 1 15  ? 17.495  14.635  78.702   1.00 10.00 ? ? ? ? ? ? 16  MET B O   1 
ATOM 3016  C CB  . MET B 1 15  ? 16.366  17.291  77.380   1.00 10.00 ? ? ? ? ? ? 16  MET B CB  1 
ATOM 3017  C CG  . MET B 1 15  ? 15.495  18.226  76.580   1.00 10.00 ? ? ? ? ? ? 16  MET B CG  1 
ATOM 3018  S SD  . MET B 1 15  ? 16.332  18.591  75.003   1.00 10.00 ? ? ? ? ? ? 16  MET B SD  1 
ATOM 3019  C CE  . MET B 1 15  ? 17.528  19.854  75.342   1.00 10.00 ? ? ? ? ? ? 16  MET B CE  1 
ATOM 3020  N N   . CYS B 1 16  ? 19.094  15.447  77.439   1.00 10.00 ? ? ? ? ? ? 17  CYS B N   1 
ATOM 3021  C CA  . CYS B 1 16  ? 20.169  14.954  78.283   1.00 10.00 ? ? ? ? ? ? 17  CYS B CA  1 
ATOM 3022  C C   . CYS B 1 16  ? 20.915  16.205  78.674   1.00 10.00 ? ? ? ? ? ? 17  CYS B C   1 
ATOM 3023  O O   . CYS B 1 16  ? 21.047  17.094  77.834   1.00 10.00 ? ? ? ? ? ? 17  CYS B O   1 
ATOM 3024  C CB  . CYS B 1 16  ? 21.199  14.042  77.565   1.00 10.00 ? ? ? ? ? ? 17  CYS B CB  1 
ATOM 3025  S SG  . CYS B 1 16  ? 20.758  12.332  77.112   1.00 10.00 ? ? ? ? ? ? 17  CYS B SG  1 
ATOM 3026  N N   . LYS B 1 17  ? 21.421  16.335  79.890   1.00 10.00 ? ? ? ? ? ? 18  LYS B N   1 
ATOM 3027  C CA  . LYS B 1 17  ? 22.170  17.501  80.345   1.00 10.00 ? ? ? ? ? ? 18  LYS B CA  1 
ATOM 3028  C C   . LYS B 1 17  ? 23.358  16.854  81.051   1.00 10.00 ? ? ? ? ? ? 18  LYS B C   1 
ATOM 3029  O O   . LYS B 1 17  ? 23.210  15.871  81.794   1.00 10.00 ? ? ? ? ? ? 18  LYS B O   1 
ATOM 3030  C CB  . LYS B 1 17  ? 21.388  18.396  81.373   1.00 10.00 ? ? ? ? ? ? 18  LYS B CB  1 
ATOM 3031  C CG  . LYS B 1 17  ? 19.919  18.117  81.785   1.00 10.00 ? ? ? ? ? ? 18  LYS B CG  1 
ATOM 3032  C CD  . LYS B 1 17  ? 18.845  18.310  80.711   1.00 10.00 ? ? ? ? ? ? 18  LYS B CD  1 
ATOM 3033  C CE  . LYS B 1 17  ? 17.455  17.890  81.150   1.00 10.00 ? ? ? ? ? ? 18  LYS B CE  1 
ATOM 3034  N NZ  . LYS B 1 17  ? 17.341  16.462  81.011   1.00 10.00 ? ? ? ? ? ? 18  LYS B NZ  1 
ATOM 3035  N N   . ALA B 1 18  ? 24.564  17.318  80.724   1.00 10.00 ? ? ? ? ? ? 19  ALA B N   1 
ATOM 3036  C CA  . ALA B 1 18  ? 25.806  16.736  81.190   1.00 10.00 ? ? ? ? ? ? 19  ALA B CA  1 
ATOM 3037  C C   . ALA B 1 18  ? 26.816  17.808  81.510   1.00 10.00 ? ? ? ? ? ? 19  ALA B C   1 
ATOM 3038  O O   . ALA B 1 18  ? 26.943  18.810  80.811   1.00 10.00 ? ? ? ? ? ? 19  ALA B O   1 
ATOM 3039  C CB  . ALA B 1 18  ? 26.423  15.853  80.160   1.00 10.00 ? ? ? ? ? ? 19  ALA B CB  1 
ATOM 3040  N N   . GLY B 1 19  ? 27.513  17.681  82.610   1.00 10.00 ? ? ? ? ? ? 20  GLY B N   1 
ATOM 3041  C CA  . GLY B 1 19  ? 28.446  18.710  82.980   1.00 10.00 ? ? ? ? ? ? 20  GLY B CA  1 
ATOM 3042  C C   . GLY B 1 19  ? 29.378  18.209  84.053   1.00 10.00 ? ? ? ? ? ? 20  GLY B C   1 
ATOM 3043  O O   . GLY B 1 19  ? 29.551  16.996  84.271   1.00 10.00 ? ? ? ? ? ? 20  GLY B O   1 
ATOM 3044  N N   . PHE B 1 20  ? 29.904  19.197  84.754   1.00 10.00 ? ? ? ? ? ? 21  PHE B N   1 
ATOM 3045  C CA  . PHE B 1 20  ? 30.912  18.900  85.722   1.00 10.00 ? ? ? ? ? ? 21  PHE B CA  1 
ATOM 3046  C C   . PHE B 1 20  ? 30.430  19.307  87.093   1.00 10.00 ? ? ? ? ? ? 21  PHE B C   1 
ATOM 3047  O O   . PHE B 1 20  ? 29.837  20.378  87.284   1.00 10.00 ? ? ? ? ? ? 21  PHE B O   1 
ATOM 3048  C CB  . PHE B 1 20  ? 32.198  19.635  85.358   1.00 10.00 ? ? ? ? ? ? 21  PHE B CB  1 
ATOM 3049  C CG  . PHE B 1 20  ? 32.930  19.137  84.122   1.00 10.00 ? ? ? ? ? ? 21  PHE B CG  1 
ATOM 3050  C CD1 . PHE B 1 20  ? 32.879  17.836  83.692   1.00 10.00 ? ? ? ? ? ? 21  PHE B CD1 1 
ATOM 3051  C CD2 . PHE B 1 20  ? 33.654  20.015  83.363   1.00 10.00 ? ? ? ? ? ? 21  PHE B CD2 1 
ATOM 3052  C CE1 . PHE B 1 20  ? 33.531  17.443  82.529   1.00 10.00 ? ? ? ? ? ? 21  PHE B CE1 1 
ATOM 3053  C CE2 . PHE B 1 20  ? 34.304  19.619  82.207   1.00 10.00 ? ? ? ? ? ? 21  PHE B CE2 1 
ATOM 3054  C CZ  . PHE B 1 20  ? 34.245  18.326  81.781   1.00 10.00 ? ? ? ? ? ? 21  PHE B CZ  1 
ATOM 3055  N N   . ALA B 1 21  ? 30.671  18.388  88.036   1.00 10.00 ? ? ? ? ? ? 22  ALA B N   1 
ATOM 3056  C CA  . ALA B 1 21  ? 30.295  18.614  89.417   1.00 10.00 ? ? ? ? ? ? 22  ALA B CA  1 
ATOM 3057  C C   . ALA B 1 21  ? 31.117  19.782  89.924   1.00 10.00 ? ? ? ? ? ? 22  ALA B C   1 
ATOM 3058  O O   . ALA B 1 21  ? 32.281  19.972  89.550   1.00 10.00 ? ? ? ? ? ? 22  ALA B O   1 
ATOM 3059  C CB  . ALA B 1 21  ? 30.569  17.389  90.264   1.00 10.00 ? ? ? ? ? ? 22  ALA B CB  1 
ATOM 3060  N N   . GLY B 1 22  ? 30.349  20.588  90.678   1.00 10.00 ? ? ? ? ? ? 23  GLY B N   1 
ATOM 3061  C CA  . GLY B 1 22  ? 30.767  21.866  91.205   1.00 10.00 ? ? ? ? ? ? 23  GLY B CA  1 
ATOM 3062  C C   . GLY B 1 22  ? 30.220  23.000  90.350   1.00 10.00 ? ? ? ? ? ? 23  GLY B C   1 
ATOM 3063  O O   . GLY B 1 22  ? 30.419  24.174  90.689   1.00 10.00 ? ? ? ? ? ? 23  GLY B O   1 
ATOM 3064  N N   . ASP B 1 23  ? 29.542  22.721  89.227   1.00 10.00 ? ? ? ? ? ? 24  ASP B N   1 
ATOM 3065  C CA  . ASP B 1 23  ? 29.013  23.767  88.358   1.00 10.00 ? ? ? ? ? ? 24  ASP B CA  1 
ATOM 3066  C C   . ASP B 1 23  ? 27.515  24.024  88.534   1.00 10.00 ? ? ? ? ? ? 24  ASP B C   1 
ATOM 3067  O O   . ASP B 1 23  ? 26.618  23.221  88.829   1.00 10.00 ? ? ? ? ? ? 24  ASP B O   1 
ATOM 3068  C CB  . ASP B 1 23  ? 29.215  23.462  86.882   1.00 10.00 ? ? ? ? ? ? 24  ASP B CB  1 
ATOM 3069  C CG  . ASP B 1 23  ? 30.618  23.428  86.277   1.00 10.00 ? ? ? ? ? ? 24  ASP B CG  1 
ATOM 3070  O OD1 . ASP B 1 23  ? 31.528  24.083  86.763   1.00 10.00 ? ? ? ? ? ? 24  ASP B OD1 1 
ATOM 3071  O OD2 . ASP B 1 23  ? 30.799  22.769  85.252   1.00 10.00 ? ? ? ? ? ? 24  ASP B OD2 1 
ATOM 3072  N N   . ASP B 1 24  ? 27.311  25.298  88.301   1.00 10.00 ? ? ? ? ? ? 25  ASP B N   1 
ATOM 3073  C CA  . ASP B 1 24  ? 26.011  25.915  88.347   1.00 10.00 ? ? ? ? ? ? 25  ASP B CA  1 
ATOM 3074  C C   . ASP B 1 24  ? 25.079  25.395  87.238   1.00 10.00 ? ? ? ? ? ? 25  ASP B C   1 
ATOM 3075  O O   . ASP B 1 24  ? 23.952  25.007  87.520   1.00 10.00 ? ? ? ? ? ? 25  ASP B O   1 
ATOM 3076  C CB  . ASP B 1 24  ? 26.326  27.466  88.320   1.00 10.00 ? ? ? ? ? ? 25  ASP B CB  1 
ATOM 3077  C CG  . ASP B 1 24  ? 26.948  28.019  89.650   1.00 10.00 ? ? ? ? ? ? 25  ASP B CG  1 
ATOM 3078  O OD1 . ASP B 1 24  ? 26.540  27.589  90.727   1.00 10.00 ? ? ? ? ? ? 25  ASP B OD1 1 
ATOM 3079  O OD2 . ASP B 1 24  ? 27.815  28.904  89.654   1.00 10.00 ? ? ? ? ? ? 25  ASP B OD2 1 
ATOM 3080  N N   . ALA B 1 25  ? 25.427  25.279  85.963   1.00 10.00 ? ? ? ? ? ? 26  ALA B N   1 
ATOM 3081  C CA  . ALA B 1 25  ? 24.446  24.793  84.987   1.00 10.00 ? ? ? ? ? ? 26  ALA B CA  1 
ATOM 3082  C C   . ALA B 1 25  ? 25.010  23.689  84.114   1.00 10.00 ? ? ? ? ? ? 26  ALA B C   1 
ATOM 3083  O O   . ALA B 1 25  ? 26.231  23.564  84.015   1.00 10.00 ? ? ? ? ? ? 26  ALA B O   1 
ATOM 3084  C CB  . ALA B 1 25  ? 24.018  25.961  84.126   1.00 10.00 ? ? ? ? ? ? 26  ALA B CB  1 
ATOM 3085  N N   . PRO B 1 26  ? 24.232  22.826  83.494   1.00 10.00 ? ? ? ? ? ? 27  PRO B N   1 
ATOM 3086  C CA  . PRO B 1 26  ? 24.697  21.893  82.479   1.00 10.00 ? ? ? ? ? ? 27  PRO B CA  1 
ATOM 3087  C C   . PRO B 1 26  ? 25.549  22.487  81.374   1.00 10.00 ? ? ? ? ? ? 27  PRO B C   1 
ATOM 3088  O O   . PRO B 1 26  ? 25.075  23.467  80.796   1.00 10.00 ? ? ? ? ? ? 27  PRO B O   1 
ATOM 3089  C CB  . PRO B 1 26  ? 23.444  21.272  81.931   1.00 10.00 ? ? ? ? ? ? 27  PRO B CB  1 
ATOM 3090  C CG  . PRO B 1 26  ? 22.371  22.231  82.323   1.00 10.00 ? ? ? ? ? ? 27  PRO B CG  1 
ATOM 3091  C CD  . PRO B 1 26  ? 22.817  22.640  83.721   1.00 10.00 ? ? ? ? ? ? 27  PRO B CD  1 
ATOM 3092  N N   . ARG B 1 27  ? 26.727  21.944  81.026   1.00 10.00 ? ? ? ? ? ? 28  ARG B N   1 
ATOM 3093  C CA  . ARG B 1 27  ? 27.503  22.462  79.906   1.00 10.00 ? ? ? ? ? ? 28  ARG B CA  1 
ATOM 3094  C C   . ARG B 1 27  ? 26.966  21.958  78.582   1.00 10.00 ? ? ? ? ? ? 28  ARG B C   1 
ATOM 3095  O O   . ARG B 1 27  ? 27.143  22.637  77.575   1.00 10.00 ? ? ? ? ? ? 28  ARG B O   1 
ATOM 3096  C CB  . ARG B 1 27  ? 28.975  22.054  79.920   1.00 10.00 ? ? ? ? ? ? 28  ARG B CB  1 
ATOM 3097  C CG  . ARG B 1 27  ? 29.972  22.800  80.788   1.00 10.00 ? ? ? ? ? ? 28  ARG B CG  1 
ATOM 3098  C CD  . ARG B 1 27  ? 30.929  21.827  81.504   1.00 10.00 ? ? ? ? ? ? 28  ARG B CD  1 
ATOM 3099  N NE  . ARG B 1 27  ? 31.773  22.554  82.456   1.00 10.00 ? ? ? ? ? ? 28  ARG B NE  1 
ATOM 3100  C CZ  . ARG B 1 27  ? 33.019  22.980  82.143   1.00 10.00 ? ? ? ? ? ? 28  ARG B CZ  1 
ATOM 3101  N NH1 . ARG B 1 27  ? 33.576  22.704  80.929   1.00 10.00 ? ? ? ? ? ? 28  ARG B NH1 1 
ATOM 3102  N NH2 . ARG B 1 27  ? 33.730  23.643  83.085   1.00 10.00 ? ? ? ? ? ? 28  ARG B NH2 1 
ATOM 3103  N N   . ALA B 1 28  ? 26.388  20.764  78.490   1.00 10.00 ? ? ? ? ? ? 29  ALA B N   1 
ATOM 3104  C CA  . ALA B 1 28  ? 25.889  20.251  77.234   1.00 10.00 ? ? ? ? ? ? 29  ALA B CA  1 
ATOM 3105  C C   . ALA B 1 28  ? 24.457  19.882  77.474   1.00 10.00 ? ? ? ? ? ? 29  ALA B C   1 
ATOM 3106  O O   . ALA B 1 28  ? 24.210  18.973  78.291   1.00 10.00 ? ? ? ? ? ? 29  ALA B O   1 
ATOM 3107  C CB  . ALA B 1 28  ? 26.528  18.981  76.797   1.00 10.00 ? ? ? ? ? ? 29  ALA B CB  1 
ATOM 3108  N N   . VAL B 1 29  ? 23.479  20.553  76.849   1.00 10.00 ? ? ? ? ? ? 30  VAL B N   1 
ATOM 3109  C CA  . VAL B 1 29  ? 22.128  20.051  76.992   1.00 10.00 ? ? ? ? ? ? 30  VAL B CA  1 
ATOM 3110  C C   . VAL B 1 29  ? 21.817  19.501  75.606   1.00 10.00 ? ? ? ? ? ? 30  VAL B C   1 
ATOM 3111  O O   . VAL B 1 29  ? 22.165  20.219  74.665   1.00 10.00 ? ? ? ? ? ? 30  VAL B O   1 
ATOM 3112  C CB  . VAL B 1 29  ? 21.304  21.236  77.434   1.00 10.00 ? ? ? ? ? ? 30  VAL B CB  1 
ATOM 3113  C CG1 . VAL B 1 29  ? 19.888  20.814  77.729   1.00 10.00 ? ? ? ? ? ? 30  VAL B CG1 1 
ATOM 3114  C CG2 . VAL B 1 29  ? 21.889  21.790  78.707   1.00 10.00 ? ? ? ? ? ? 30  VAL B CG2 1 
ATOM 3115  N N   . PHE B 1 30  ? 21.327  18.295  75.306   1.00 10.00 ? ? ? ? ? ? 31  PHE B N   1 
ATOM 3116  C CA  . PHE B 1 30  ? 21.076  17.972  73.918   1.00 10.00 ? ? ? ? ? ? 31  PHE B CA  1 
ATOM 3117  C C   . PHE B 1 30  ? 19.870  17.145  73.762   1.00 10.00 ? ? ? ? ? ? 31  PHE B C   1 
ATOM 3118  O O   . PHE B 1 30  ? 19.445  16.609  74.767   1.00 10.00 ? ? ? ? ? ? 31  PHE B O   1 
ATOM 3119  C CB  . PHE B 1 30  ? 22.184  17.200  73.223   1.00 10.00 ? ? ? ? ? ? 31  PHE B CB  1 
ATOM 3120  C CG  . PHE B 1 30  ? 22.971  16.180  74.006   1.00 10.00 ? ? ? ? ? ? 31  PHE B CG  1 
ATOM 3121  C CD1 . PHE B 1 30  ? 23.964  16.615  74.869   1.00 10.00 ? ? ? ? ? ? 31  PHE B CD1 1 
ATOM 3122  C CD2 . PHE B 1 30  ? 22.702  14.836  73.852   1.00 10.00 ? ? ? ? ? ? 31  PHE B CD2 1 
ATOM 3123  C CE1 . PHE B 1 30  ? 24.700  15.738  75.588   1.00 10.00 ? ? ? ? ? ? 31  PHE B CE1 1 
ATOM 3124  C CE2 . PHE B 1 30  ? 23.457  13.947  74.591   1.00 10.00 ? ? ? ? ? ? 31  PHE B CE2 1 
ATOM 3125  C CZ  . PHE B 1 30  ? 24.438  14.410  75.442   1.00 10.00 ? ? ? ? ? ? 31  PHE B CZ  1 
ATOM 3126  N N   . PRO B 1 31  ? 19.237  17.110  72.580   1.00 10.00 ? ? ? ? ? ? 32  PRO B N   1 
ATOM 3127  C CA  . PRO B 1 31  ? 18.193  16.157  72.187   1.00 10.00 ? ? ? ? ? ? 32  PRO B CA  1 
ATOM 3128  C C   . PRO B 1 31  ? 18.490  14.661  72.396   1.00 10.00 ? ? ? ? ? ? 32  PRO B C   1 
ATOM 3129  O O   . PRO B 1 31  ? 19.550  14.176  71.936   1.00 10.00 ? ? ? ? ? ? 32  PRO B O   1 
ATOM 3130  C CB  . PRO B 1 31  ? 17.953  16.560  70.722   1.00 10.00 ? ? ? ? ? ? 32  PRO B CB  1 
ATOM 3131  C CG  . PRO B 1 31  ? 18.062  18.064  70.739   1.00 10.00 ? ? ? ? ? ? 32  PRO B CG  1 
ATOM 3132  C CD  . PRO B 1 31  ? 19.269  18.225  71.616   1.00 10.00 ? ? ? ? ? ? 32  PRO B CD  1 
ATOM 3133  N N   . SER B 1 32  ? 17.603  13.879  73.051   1.00 10.00 ? ? ? ? ? ? 33  SER B N   1 
ATOM 3134  C CA  . SER B 1 32  ? 17.893  12.450  73.216   1.00 10.00 ? ? ? ? ? ? 33  SER B CA  1 
ATOM 3135  C C   . SER B 1 32  ? 17.393  11.565  72.063   1.00 10.00 ? ? ? ? ? ? 33  SER B C   1 
ATOM 3136  O O   . SER B 1 32  ? 16.460  10.749  72.144   1.00 10.00 ? ? ? ? ? ? 33  SER B O   1 
ATOM 3137  C CB  . SER B 1 32  ? 17.317  11.883  74.553   1.00 10.00 ? ? ? ? ? ? 33  SER B CB  1 
ATOM 3138  O OG  . SER B 1 32  ? 18.132  12.144  75.697   1.00 10.00 ? ? ? ? ? ? 33  SER B OG  1 
ATOM 3139  N N   . ILE B 1 33  ? 23.437  8.571   68.097   1.00 10.00 ? ? ? ? ? ? 34  ILE B N   1 
ATOM 3140  C CA  . ILE B 1 33  ? 23.721  7.385   67.331   1.00 10.00 ? ? ? ? ? ? 34  ILE B CA  1 
ATOM 3141  C C   . ILE B 1 33  ? 24.341  7.690   65.959   1.00 10.00 ? ? ? ? ? ? 34  ILE B C   1 
ATOM 3142  O O   . ILE B 1 33  ? 24.154  8.797   65.412   1.00 10.00 ? ? ? ? ? ? 34  ILE B O   1 
ATOM 3143  C CB  . ILE B 1 33  ? 22.422  6.541   67.162   1.00 10.00 ? ? ? ? ? ? 34  ILE B CB  1 
ATOM 3144  C CG1 . ILE B 1 33  ? 21.238  6.842   68.084   1.00 10.00 ? ? ? ? ? ? 34  ILE B CG1 1 
ATOM 3145  C CG2 . ILE B 1 33  ? 22.875  5.157   67.583   1.00 10.00 ? ? ? ? ? ? 34  ILE B CG2 1 
ATOM 3146  C CD1 . ILE B 1 33  ? 20.314  7.829   67.402   1.00 10.00 ? ? ? ? ? ? 34  ILE B CD1 1 
ATOM 3147  N N   . VAL B 1 34  ? 25.185  6.748   65.489   1.00 10.00 ? ? ? ? ? ? 35  VAL B N   1 
ATOM 3148  C CA  . VAL B 1 34  ? 25.784  6.727   64.146   1.00 10.00 ? ? ? ? ? ? 35  VAL B CA  1 
ATOM 3149  C C   . VAL B 1 34  ? 25.109  5.551   63.475   1.00 10.00 ? ? ? ? ? ? 35  VAL B C   1 
ATOM 3150  O O   . VAL B 1 34  ? 25.093  4.433   64.020   1.00 10.00 ? ? ? ? ? ? 35  VAL B O   1 
ATOM 3151  C CB  . VAL B 1 34  ? 27.308  6.443   64.142   1.00 10.00 ? ? ? ? ? ? 35  VAL B CB  1 
ATOM 3152  C CG1 . VAL B 1 34  ? 27.787  6.078   62.758   1.00 10.00 ? ? ? ? ? ? 35  VAL B CG1 1 
ATOM 3153  C CG2 . VAL B 1 34  ? 28.077  7.714   64.504   1.00 10.00 ? ? ? ? ? ? 35  VAL B CG2 1 
ATOM 3154  N N   . GLY B 1 35  ? 24.593  5.727   62.272   1.00 10.00 ? ? ? ? ? ? 36  GLY B N   1 
ATOM 3155  C CA  . GLY B 1 35  ? 23.901  4.636   61.621   1.00 10.00 ? ? ? ? ? ? 36  GLY B CA  1 
ATOM 3156  C C   . GLY B 1 35  ? 24.486  4.338   60.269   1.00 10.00 ? ? ? ? ? ? 36  GLY B C   1 
ATOM 3157  O O   . GLY B 1 35  ? 24.436  5.193   59.377   1.00 10.00 ? ? ? ? ? ? 36  GLY B O   1 
ATOM 3158  N N   . ARG B 1 36  ? 25.061  3.155   60.098   1.00 10.00 ? ? ? ? ? ? 37  ARG B N   1 
ATOM 3159  C CA  . ARG B 1 36  ? 25.617  2.772   58.790   1.00 10.00 ? ? ? ? ? ? 37  ARG B CA  1 
ATOM 3160  C C   . ARG B 1 36  ? 24.634  1.787   58.108   1.00 10.00 ? ? ? ? ? ? 37  ARG B C   1 
ATOM 3161  O O   . ARG B 1 36  ? 24.066  0.902   58.751   1.00 10.00 ? ? ? ? ? ? 37  ARG B O   1 
ATOM 3162  C CB  . ARG B 1 36  ? 27.082  2.184   59.007   1.00 10.00 ? ? ? ? ? ? 37  ARG B CB  1 
ATOM 3163  C CG  . ARG B 1 36  ? 27.706  1.055   58.124   1.00 10.00 ? ? ? ? ? ? 37  ARG B CG  1 
ATOM 3164  C CD  . ARG B 1 36  ? 27.759  1.150   56.566   1.00 10.00 ? ? ? ? ? ? 37  ARG B CD  1 
ATOM 3165  N NE  . ARG B 1 36  ? 28.078  -0.171  55.992   1.00 10.00 ? ? ? ? ? ? 37  ARG B NE  1 
ATOM 3166  C CZ  . ARG B 1 36  ? 27.665  -0.673  54.792   1.00 10.00 ? ? ? ? ? ? 37  ARG B CZ  1 
ATOM 3167  N NH1 . ARG B 1 36  ? 26.878  0.000   53.921   1.00 10.00 ? ? ? ? ? ? 37  ARG B NH1 1 
ATOM 3168  N NH2 . ARG B 1 36  ? 28.036  -1.934  54.481   1.00 10.00 ? ? ? ? ? ? 37  ARG B NH2 1 
ATOM 3169  N N   . PRO B 1 37  ? 24.318  1.989   56.816   1.00 10.00 ? ? ? ? ? ? 38  PRO B N   1 
ATOM 3170  C CA  . PRO B 1 37  ? 23.417  1.162   56.038   1.00 10.00 ? ? ? ? ? ? 38  PRO B CA  1 
ATOM 3171  C C   . PRO B 1 37  ? 23.488  -0.333  56.149   1.00 10.00 ? ? ? ? ? ? 38  PRO B C   1 
ATOM 3172  O O   . PRO B 1 37  ? 22.438  -0.917  55.966   1.00 10.00 ? ? ? ? ? ? 38  PRO B O   1 
ATOM 3173  C CB  . PRO B 1 37  ? 23.642  1.654   54.645   1.00 10.00 ? ? ? ? ? ? 38  PRO B CB  1 
ATOM 3174  C CG  . PRO B 1 37  ? 23.753  3.155   54.794   1.00 10.00 ? ? ? ? ? ? 38  PRO B CG  1 
ATOM 3175  C CD  . PRO B 1 37  ? 24.537  3.264   56.103   1.00 10.00 ? ? ? ? ? ? 38  PRO B CD  1 
ATOM 3176  N N   . ARG B 1 38  ? 24.587  -1.045  56.436   1.00 10.00 ? ? ? ? ? ? 39  ARG B N   1 
ATOM 3177  C CA  . ARG B 1 38  ? 24.605  -2.524  56.456   1.00 10.00 ? ? ? ? ? ? 39  ARG B CA  1 
ATOM 3178  C C   . ARG B 1 38  ? 23.879  -3.157  55.233   1.00 10.00 ? ? ? ? ? ? 39  ARG B C   1 
ATOM 3179  O O   . ARG B 1 38  ? 23.174  -4.184  55.287   1.00 10.00 ? ? ? ? ? ? 39  ARG B O   1 
ATOM 3180  C CB  . ARG B 1 38  ? 23.972  -2.997  57.802   1.00 10.00 ? ? ? ? ? ? 39  ARG B CB  1 
ATOM 3181  C CG  . ARG B 1 38  ? 24.058  -4.472  58.278   1.00 10.00 ? ? ? ? ? ? 39  ARG B CG  1 
ATOM 3182  C CD  . ARG B 1 38  ? 22.689  -4.891  58.882   1.00 10.00 ? ? ? ? ? ? 39  ARG B CD  1 
ATOM 3183  N NE  . ARG B 1 38  ? 22.763  -5.885  59.973   1.00 10.00 ? ? ? ? ? ? 39  ARG B NE  1 
ATOM 3184  C CZ  . ARG B 1 38  ? 21.825  -6.835  60.185   1.00 10.00 ? ? ? ? ? ? 39  ARG B CZ  1 
ATOM 3185  N NH1 . ARG B 1 38  ? 20.740  -6.960  59.410   1.00 10.00 ? ? ? ? ? ? 39  ARG B NH1 1 
ATOM 3186  N NH2 . ARG B 1 38  ? 21.977  -7.672  61.213   1.00 10.00 ? ? ? ? ? ? 39  ARG B NH2 1 
ATOM 3187  N N   . HIS B 1 39  ? 24.025  -2.405  54.116   1.00 10.00 ? ? ? ? ? ? 40  HIS B N   1 
ATOM 3188  C CA  . HIS B 1 39  ? 23.575  -2.620  52.738   1.00 10.00 ? ? ? ? ? ? 40  HIS B CA  1 
ATOM 3189  C C   . HIS B 1 39  ? 23.936  -1.319  52.080   1.00 10.00 ? ? ? ? ? ? 40  HIS B C   1 
ATOM 3190  O O   . HIS B 1 39  ? 23.318  -0.312  52.416   1.00 10.00 ? ? ? ? ? ? 40  HIS B O   1 
ATOM 3191  C CB  . HIS B 1 39  ? 22.078  -2.696  52.437   1.00 10.00 ? ? ? ? ? ? 40  HIS B CB  1 
ATOM 3192  C CG  . HIS B 1 39  ? 21.592  -4.133  52.378   1.00 10.00 ? ? ? ? ? ? 40  HIS B CG  1 
ATOM 3193  N ND1 . HIS B 1 39  ? 20.438  -4.617  52.821   1.00 10.00 ? ? ? ? ? ? 40  HIS B ND1 1 
ATOM 3194  C CD2 . HIS B 1 39  ? 22.347  -5.190  51.960   1.00 10.00 ? ? ? ? ? ? 40  HIS B CD2 1 
ATOM 3195  C CE1 . HIS B 1 39  ? 20.476  -5.917  52.725   1.00 10.00 ? ? ? ? ? ? 40  HIS B CE1 1 
ATOM 3196  N NE2 . HIS B 1 39  ? 21.627  -6.247  52.201   1.00 10.00 ? ? ? ? ? ? 40  HIS B NE2 1 
ATOM 3197  N N   . GLN B 1 40  ? 24.990  -1.333  51.249   1.00 10.00 ? ? ? ? ? ? 41  GLN B N   1 
ATOM 3198  C CA  . GLN B 1 40  ? 25.426  -0.191  50.439   1.00 10.00 ? ? ? ? ? ? 41  GLN B CA  1 
ATOM 3199  C C   . GLN B 1 40  ? 24.186  0.632   50.056   1.00 10.00 ? ? ? ? ? ? 41  GLN B C   1 
ATOM 3200  O O   . GLN B 1 40  ? 23.251  0.152   49.369   1.00 10.00 ? ? ? ? ? ? 41  GLN B O   1 
ATOM 3201  C CB  . GLN B 1 40  ? 26.108  -0.648  49.126   1.00 10.00 ? ? ? ? ? ? 41  GLN B CB  1 
ATOM 3202  C CG  . GLN B 1 40  ? 27.372  0.080   48.778   1.00 10.00 ? ? ? ? ? ? 41  GLN B CG  1 
ATOM 3203  C CD  . GLN B 1 40  ? 28.496  -0.304  49.741   1.00 10.00 ? ? ? ? ? ? 41  GLN B CD  1 
ATOM 3204  O OE1 . GLN B 1 40  ? 28.810  0.345   50.759   1.00 10.00 ? ? ? ? ? ? 41  GLN B OE1 1 
ATOM 3205  N NE2 . GLN B 1 40  ? 29.103  -1.437  49.398   1.00 10.00 ? ? ? ? ? ? 41  GLN B NE2 1 
ATOM 3206  N N   . GLY B 1 41  ? 24.206  1.798   50.702   1.00 10.00 ? ? ? ? ? ? 42  GLY B N   1 
ATOM 3207  C CA  . GLY B 1 41  ? 23.141  2.749   50.538   1.00 10.00 ? ? ? ? ? ? 42  GLY B CA  1 
ATOM 3208  C C   . GLY B 1 41  ? 23.729  4.004   49.936   1.00 10.00 ? ? ? ? ? ? 42  GLY B C   1 
ATOM 3209  O O   . GLY B 1 41  ? 24.916  4.035   49.560   1.00 10.00 ? ? ? ? ? ? 42  GLY B O   1 
ATOM 3210  N N   . VAL B 1 42  ? 22.775  4.971   49.882   1.00 10.00 ? ? ? ? ? ? 43  VAL B N   1 
ATOM 3211  C CA  . VAL B 1 42  ? 22.829  6.417   49.486   1.00 10.00 ? ? ? ? ? ? 43  VAL B CA  1 
ATOM 3212  C C   . VAL B 1 42  ? 21.690  6.885   48.550   1.00 10.00 ? ? ? ? ? ? 43  VAL B C   1 
ATOM 3213  O O   . VAL B 1 42  ? 21.380  6.353   47.460   1.00 10.00 ? ? ? ? ? ? 43  VAL B O   1 
ATOM 3214  C CB  . VAL B 1 42  ? 24.228  6.843   48.822   1.00 10.00 ? ? ? ? ? ? 43  VAL B CB  1 
ATOM 3215  C CG1 . VAL B 1 42  ? 24.297  8.158   48.031   1.00 10.00 ? ? ? ? ? ? 43  VAL B CG1 1 
ATOM 3216  C CG2 . VAL B 1 42  ? 25.101  7.013   50.038   1.00 10.00 ? ? ? ? ? ? 43  VAL B CG2 1 
ATOM 3217  N N   . MET B 1 43  ? 21.008  7.890   49.100   1.00 10.00 ? ? ? ? ? ? 44  MET B N   1 
ATOM 3218  C CA  . MET B 1 43  ? 19.917  8.543   48.397   1.00 10.00 ? ? ? ? ? ? 44  MET B CA  1 
ATOM 3219  C C   . MET B 1 43  ? 20.619  9.388   47.327   1.00 10.00 ? ? ? ? ? ? 44  MET B C   1 
ATOM 3220  O O   . MET B 1 43  ? 21.722  9.899   47.593   1.00 10.00 ? ? ? ? ? ? 44  MET B O   1 
ATOM 3221  C CB  . MET B 1 43  ? 19.146  9.415   49.399   1.00 10.00 ? ? ? ? ? ? 44  MET B CB  1 
ATOM 3222  C CG  . MET B 1 43  ? 17.817  9.937   48.924   1.00 10.00 ? ? ? ? ? ? 44  MET B CG  1 
ATOM 3223  S SD  . MET B 1 43  ? 17.932  11.163  47.590   1.00 10.00 ? ? ? ? ? ? 44  MET B SD  1 
ATOM 3224  C CE  . MET B 1 43  ? 17.246  12.452  48.640   1.00 10.00 ? ? ? ? ? ? 44  MET B CE  1 
ATOM 3225  N N   . VAL B 1 44  ? 20.073  9.571   46.109   1.00 10.00 ? ? ? ? ? ? 45  VAL B N   1 
ATOM 3226  C CA  . VAL B 1 44  ? 20.693  10.456  45.100   1.00 10.00 ? ? ? ? ? ? 45  VAL B CA  1 
ATOM 3227  C C   . VAL B 1 44  ? 20.108  11.879  45.269   1.00 10.00 ? ? ? ? ? ? 45  VAL B C   1 
ATOM 3228  O O   . VAL B 1 44  ? 19.290  12.495  44.578   1.00 10.00 ? ? ? ? ? ? 45  VAL B O   1 
ATOM 3229  C CB  . VAL B 1 44  ? 20.449  9.832   43.702   1.00 10.00 ? ? ? ? ? ? 45  VAL B CB  1 
ATOM 3230  C CG1 . VAL B 1 44  ? 20.474  10.839  42.553   1.00 10.00 ? ? ? ? ? ? 45  VAL B CG1 1 
ATOM 3231  C CG2 . VAL B 1 44  ? 21.561  8.786   43.539   1.00 10.00 ? ? ? ? ? ? 45  VAL B CG2 1 
ATOM 3232  N N   . GLY B 1 45  ? 20.636  12.350  46.386   1.00 10.00 ? ? ? ? ? ? 46  GLY B N   1 
ATOM 3233  C CA  . GLY B 1 45  ? 20.452  13.659  46.976   1.00 10.00 ? ? ? ? ? ? 46  GLY B CA  1 
ATOM 3234  C C   . GLY B 1 45  ? 21.196  13.583  48.304   1.00 10.00 ? ? ? ? ? ? 46  GLY B C   1 
ATOM 3235  O O   . GLY B 1 45  ? 20.645  13.808  49.396   1.00 10.00 ? ? ? ? ? ? 46  GLY B O   1 
ATOM 3236  N N   . MET B 1 46  ? 22.404  13.018  48.100   1.00 10.00 ? ? ? ? ? ? 47  MET B N   1 
ATOM 3237  C CA  . MET B 1 46  ? 23.487  12.867  49.050   1.00 10.00 ? ? ? ? ? ? 47  MET B CA  1 
ATOM 3238  C C   . MET B 1 46  ? 24.651  12.048  48.439   1.00 10.00 ? ? ? ? ? ? 47  MET B C   1 
ATOM 3239  O O   . MET B 1 46  ? 24.492  11.251  47.483   1.00 10.00 ? ? ? ? ? ? 47  MET B O   1 
ATOM 3240  C CB  . MET B 1 46  ? 23.002  12.201  50.375   1.00 10.00 ? ? ? ? ? ? 47  MET B CB  1 
ATOM 3241  C CG  . MET B 1 46  ? 22.447  10.794  50.484   1.00 10.00 ? ? ? ? ? ? 47  MET B CG  1 
ATOM 3242  S SD  . MET B 1 46  ? 21.561  10.620  52.070   1.00 10.00 ? ? ? ? ? ? 47  MET B SD  1 
ATOM 3243  C CE  . MET B 1 46  ? 20.291  11.837  51.765   1.00 10.00 ? ? ? ? ? ? 47  MET B CE  1 
ATOM 3244  N N   . GLY B 1 47  ? 25.859  12.370  48.985   1.00 10.00 ? ? ? ? ? ? 48  GLY B N   1 
ATOM 3245  C CA  . GLY B 1 47  ? 27.133  11.803  48.540   1.00 10.00 ? ? ? ? ? ? 48  GLY B CA  1 
ATOM 3246  C C   . GLY B 1 47  ? 27.129  10.316  48.870   1.00 10.00 ? ? ? ? ? ? 48  GLY B C   1 
ATOM 3247  O O   . GLY B 1 47  ? 26.149  9.901   49.511   1.00 10.00 ? ? ? ? ? ? 48  GLY B O   1 
ATOM 3248  N N   . GLN B 1 48  ? 28.107  9.442   48.519   1.00 10.00 ? ? ? ? ? ? 49  GLN B N   1 
ATOM 3249  C CA  . GLN B 1 48  ? 28.041  8.066   49.022   1.00 10.00 ? ? ? ? ? ? 49  GLN B CA  1 
ATOM 3250  C C   . GLN B 1 48  ? 28.545  8.294   50.459   1.00 10.00 ? ? ? ? ? ? 49  GLN B C   1 
ATOM 3251  O O   . GLN B 1 48  ? 29.723  8.627   50.680   1.00 10.00 ? ? ? ? ? ? 49  GLN B O   1 
ATOM 3252  C CB  . GLN B 1 48  ? 28.954  7.151   48.206   1.00 10.00 ? ? ? ? ? ? 49  GLN B CB  1 
ATOM 3253  C CG  . GLN B 1 48  ? 28.502  5.692   48.124   1.00 10.00 ? ? ? ? ? ? 49  GLN B CG  1 
ATOM 3254  C CD  . GLN B 1 48  ? 29.013  4.787   49.246   1.00 10.00 ? ? ? ? ? ? 49  GLN B CD  1 
ATOM 3255  O OE1 . GLN B 1 48  ? 28.850  5.151   50.402   1.00 10.00 ? ? ? ? ? ? 49  GLN B OE1 1 
ATOM 3256  N NE2 . GLN B 1 48  ? 29.667  3.632   49.044   1.00 10.00 ? ? ? ? ? ? 49  GLN B NE2 1 
ATOM 3257  N N   . LYS B 1 49  ? 27.468  8.497   51.270   1.00 10.00 ? ? ? ? ? ? 50  LYS B N   1 
ATOM 3258  C CA  . LYS B 1 49  ? 27.333  8.731   52.712   1.00 10.00 ? ? ? ? ? ? 50  LYS B CA  1 
ATOM 3259  C C   . LYS B 1 49  ? 26.793  7.452   53.338   1.00 10.00 ? ? ? ? ? ? 50  LYS B C   1 
ATOM 3260  O O   . LYS B 1 49  ? 25.611  7.093   53.214   1.00 10.00 ? ? ? ? ? ? 50  LYS B O   1 
ATOM 3261  C CB  . LYS B 1 49  ? 26.327  9.846   52.986   1.00 10.00 ? ? ? ? ? ? 50  LYS B CB  1 
ATOM 3262  C CG  . LYS B 1 49  ? 26.900  11.243  53.123   1.00 10.00 ? ? ? ? ? ? 50  LYS B CG  1 
ATOM 3263  C CD  . LYS B 1 49  ? 27.337  11.493  54.571   1.00 10.00 ? ? ? ? ? ? 50  LYS B CD  1 
ATOM 3264  C CE  . LYS B 1 49  ? 26.100  11.541  55.533   1.00 10.00 ? ? ? ? ? ? 50  LYS B CE  1 
ATOM 3265  N NZ  . LYS B 1 49  ? 26.459  11.485  56.938   1.00 10.00 ? ? ? ? ? ? 50  LYS B NZ  1 
ATOM 3266  N N   . ASP B 1 50  ? 27.663  6.698   53.992   1.00 10.00 ? ? ? ? ? ? 51  ASP B N   1 
ATOM 3267  C CA  . ASP B 1 50  ? 27.180  5.507   54.629   1.00 10.00 ? ? ? ? ? ? 51  ASP B CA  1 
ATOM 3268  C C   . ASP B 1 50  ? 27.328  5.580   56.144   1.00 10.00 ? ? ? ? ? ? 51  ASP B C   1 
ATOM 3269  O O   . ASP B 1 50  ? 27.415  4.532   56.777   1.00 10.00 ? ? ? ? ? ? 51  ASP B O   1 
ATOM 3270  C CB  . ASP B 1 50  ? 27.908  4.268   53.990   1.00 10.00 ? ? ? ? ? ? 51  ASP B CB  1 
ATOM 3271  C CG  . ASP B 1 50  ? 27.366  3.778   52.616   1.00 10.00 ? ? ? ? ? ? 51  ASP B CG  1 
ATOM 3272  O OD1 . ASP B 1 50  ? 26.423  4.358   52.049   1.00 10.00 ? ? ? ? ? ? 51  ASP B OD1 1 
ATOM 3273  O OD2 . ASP B 1 50  ? 27.904  2.803   52.089   1.00 10.00 ? ? ? ? ? ? 51  ASP B OD2 1 
ATOM 3274  N N   . SER B 1 51  ? 27.388  6.764   56.779   1.00 10.00 ? ? ? ? ? ? 52  SER B N   1 
ATOM 3275  C CA  . SER B 1 51  ? 27.216  6.870   58.225   1.00 10.00 ? ? ? ? ? ? 52  SER B CA  1 
ATOM 3276  C C   . SER B 1 51  ? 26.238  8.011   58.319   1.00 10.00 ? ? ? ? ? ? 52  SER B C   1 
ATOM 3277  O O   . SER B 1 51  ? 26.566  9.088   57.821   1.00 10.00 ? ? ? ? ? ? 52  SER B O   1 
ATOM 3278  C CB  . SER B 1 51  ? 28.483  7.277   59.049   1.00 10.00 ? ? ? ? ? ? 52  SER B CB  1 
ATOM 3279  O OG  . SER B 1 51  ? 29.028  8.608   58.939   1.00 10.00 ? ? ? ? ? ? 52  SER B OG  1 
ATOM 3280  N N   . TYR B 1 52  ? 25.009  7.854   58.781   1.00 10.00 ? ? ? ? ? ? 53  TYR B N   1 
ATOM 3281  C CA  . TYR B 1 52  ? 24.153  8.998   58.979   1.00 10.00 ? ? ? ? ? ? 53  TYR B CA  1 
ATOM 3282  C C   . TYR B 1 52  ? 24.329  9.230   60.476   1.00 10.00 ? ? ? ? ? ? 53  TYR B C   1 
ATOM 3283  O O   . TYR B 1 52  ? 24.574  8.278   61.213   1.00 10.00 ? ? ? ? ? ? 53  TYR B O   1 
ATOM 3284  C CB  . TYR B 1 52  ? 22.739  8.570   58.462   1.00 10.00 ? ? ? ? ? ? 53  TYR B CB  1 
ATOM 3285  C CG  . TYR B 1 52  ? 22.742  8.523   56.919   1.00 10.00 ? ? ? ? ? ? 53  TYR B CG  1 
ATOM 3286  C CD1 . TYR B 1 52  ? 23.066  9.690   56.225   1.00 10.00 ? ? ? ? ? ? 53  TYR B CD1 1 
ATOM 3287  C CD2 . TYR B 1 52  ? 22.546  7.364   56.191   1.00 10.00 ? ? ? ? ? ? 53  TYR B CD2 1 
ATOM 3288  C CE1 . TYR B 1 52  ? 23.229  9.738   54.843   1.00 10.00 ? ? ? ? ? ? 53  TYR B CE1 1 
ATOM 3289  C CE2 . TYR B 1 52  ? 22.703  7.401   54.795   1.00 10.00 ? ? ? ? ? ? 53  TYR B CE2 1 
ATOM 3290  C CZ  . TYR B 1 52  ? 23.057  8.580   54.110   1.00 10.00 ? ? ? ? ? ? 53  TYR B CZ  1 
ATOM 3291  O OH  . TYR B 1 52  ? 23.345  8.609   52.735   1.00 10.00 ? ? ? ? ? ? 53  TYR B OH  1 
ATOM 3292  N N   . VAL B 1 53  ? 24.316  10.452  60.994   1.00 10.00 ? ? ? ? ? ? 54  VAL B N   1 
ATOM 3293  C CA  . VAL B 1 53  ? 24.592  10.742  62.407   1.00 10.00 ? ? ? ? ? ? 54  VAL B CA  1 
ATOM 3294  C C   . VAL B 1 53  ? 23.424  11.511  63.056   1.00 10.00 ? ? ? ? ? ? 54  VAL B C   1 
ATOM 3295  O O   . VAL B 1 53  ? 22.799  12.375  62.407   1.00 10.00 ? ? ? ? ? ? 54  VAL B O   1 
ATOM 3296  C CB  . VAL B 1 53  ? 25.967  11.568  62.465   1.00 10.00 ? ? ? ? ? ? 54  VAL B CB  1 
ATOM 3297  C CG1 . VAL B 1 53  ? 26.224  12.216  63.812   1.00 10.00 ? ? ? ? ? ? 54  VAL B CG1 1 
ATOM 3298  C CG2 . VAL B 1 53  ? 27.137  10.614  62.316   1.00 10.00 ? ? ? ? ? ? 54  VAL B CG2 1 
ATOM 3299  N N   . GLY B 1 54  ? 23.097  11.298  64.330   1.00 10.00 ? ? ? ? ? ? 55  GLY B N   1 
ATOM 3300  C CA  . GLY B 1 54  ? 22.089  12.110  64.978   1.00 10.00 ? ? ? ? ? ? 55  GLY B CA  1 
ATOM 3301  C C   . GLY B 1 54  ? 20.692  11.775  64.497   1.00 10.00 ? ? ? ? ? ? 55  GLY B C   1 
ATOM 3302  O O   . GLY B 1 54  ? 20.292  10.617  64.440   1.00 10.00 ? ? ? ? ? ? 55  GLY B O   1 
ATOM 3303  N N   . ASP B 1 55  ? 19.914  12.799  64.122   1.00 10.00 ? ? ? ? ? ? 56  ASP B N   1 
ATOM 3304  C CA  . ASP B 1 55  ? 18.476  12.682  63.702   1.00 10.00 ? ? ? ? ? ? 56  ASP B CA  1 
ATOM 3305  C C   . ASP B 1 55  ? 18.099  12.289  62.256   1.00 10.00 ? ? ? ? ? ? 56  ASP B C   1 
ATOM 3306  O O   . ASP B 1 55  ? 17.087  11.626  61.990   1.00 10.00 ? ? ? ? ? ? 56  ASP B O   1 
ATOM 3307  C CB  . ASP B 1 55  ? 17.728  14.032  64.068   1.00 10.00 ? ? ? ? ? ? 56  ASP B CB  1 
ATOM 3308  C CG  . ASP B 1 55  ? 18.450  15.360  63.831   1.00 10.00 ? ? ? ? ? ? 56  ASP B CG  1 
ATOM 3309  O OD1 . ASP B 1 55  ? 19.409  15.465  63.030   1.00 10.00 ? ? ? ? ? ? 56  ASP B OD1 1 
ATOM 3310  O OD2 . ASP B 1 55  ? 18.010  16.305  64.488   1.00 10.00 ? ? ? ? ? ? 56  ASP B OD2 1 
ATOM 3311  N N   . GLU B 1 56  ? 19.005  12.615  61.326   1.00 10.00 ? ? ? ? ? ? 57  GLU B N   1 
ATOM 3312  C CA  . GLU B 1 56  ? 18.946  12.137  59.954   1.00 10.00 ? ? ? ? ? ? 57  GLU B CA  1 
ATOM 3313  C C   . GLU B 1 56  ? 19.264  10.654  59.908   1.00 10.00 ? ? ? ? ? ? 57  GLU B C   1 
ATOM 3314  O O   . GLU B 1 56  ? 19.468  10.109  58.829   1.00 10.00 ? ? ? ? ? ? 57  GLU B O   1 
ATOM 3315  C CB  . GLU B 1 56  ? 19.959  12.839  59.064   1.00 10.00 ? ? ? ? ? ? 57  GLU B CB  1 
ATOM 3316  C CG  . GLU B 1 56  ? 21.419  12.682  59.473   1.00 10.00 ? ? ? ? ? ? 57  GLU B CG  1 
ATOM 3317  C CD  . GLU B 1 56  ? 22.424  13.404  58.600   1.00 10.00 ? ? ? ? ? ? 57  GLU B CD  1 
ATOM 3318  O OE1 . GLU B 1 56  ? 22.190  14.543  58.213   1.00 10.00 ? ? ? ? ? ? 57  GLU B OE1 1 
ATOM 3319  O OE2 . GLU B 1 56  ? 23.465  12.821  58.328   1.00 10.00 ? ? ? ? ? ? 57  GLU B OE2 1 
ATOM 3320  N N   . ALA B 1 57  ? 19.464  10.013  61.057   1.00 10.00 ? ? ? ? ? ? 58  ALA B N   1 
ATOM 3321  C CA  . ALA B 1 57  ? 19.681  8.598   61.121   1.00 10.00 ? ? ? ? ? ? 58  ALA B CA  1 
ATOM 3322  C C   . ALA B 1 57  ? 18.580  8.068   62.003   1.00 10.00 ? ? ? ? ? ? 58  ALA B C   1 
ATOM 3323  O O   . ALA B 1 57  ? 18.378  6.875   62.171   1.00 10.00 ? ? ? ? ? ? 58  ALA B O   1 
ATOM 3324  C CB  . ALA B 1 57  ? 20.998  8.306   61.750   1.00 10.00 ? ? ? ? ? ? 58  ALA B CB  1 
ATOM 3325  N N   . GLN B 1 58  ? 17.798  8.904   62.626   1.00 10.00 ? ? ? ? ? ? 59  GLN B N   1 
ATOM 3326  C CA  . GLN B 1 58  ? 16.690  8.432   63.419   1.00 10.00 ? ? ? ? ? ? 59  GLN B CA  1 
ATOM 3327  C C   . GLN B 1 58  ? 15.664  8.068   62.322   1.00 10.00 ? ? ? ? ? ? 59  GLN B C   1 
ATOM 3328  O O   . GLN B 1 58  ? 15.121  6.959   62.226   1.00 10.00 ? ? ? ? ? ? 59  GLN B O   1 
ATOM 3329  C CB  . GLN B 1 58  ? 16.274  9.600   64.279   1.00 10.00 ? ? ? ? ? ? 59  GLN B CB  1 
ATOM 3330  C CG  . GLN B 1 58  ? 15.083  9.450   65.163   1.00 10.00 ? ? ? ? ? ? 59  GLN B CG  1 
ATOM 3331  C CD  . GLN B 1 58  ? 15.376  8.647   66.406   1.00 10.00 ? ? ? ? ? ? 59  GLN B CD  1 
ATOM 3332  O OE1 . GLN B 1 58  ? 15.023  9.064   67.500   1.00 10.00 ? ? ? ? ? ? 59  GLN B OE1 1 
ATOM 3333  N NE2 . GLN B 1 58  ? 16.034  7.502   66.404   1.00 10.00 ? ? ? ? ? ? 59  GLN B NE2 1 
ATOM 3334  N N   . SER B 1 59  ? 15.484  8.968   61.339   1.00 10.00 ? ? ? ? ? ? 60  SER B N   1 
ATOM 3335  C CA  . SER B 1 59  ? 14.491  8.848   60.276   1.00 10.00 ? ? ? ? ? ? 60  SER B CA  1 
ATOM 3336  C C   . SER B 1 59  ? 14.843  7.956   59.091   1.00 10.00 ? ? ? ? ? ? 60  SER B C   1 
ATOM 3337  O O   . SER B 1 59  ? 14.482  8.194   57.936   1.00 10.00 ? ? ? ? ? ? 60  SER B O   1 
ATOM 3338  C CB  . SER B 1 59  ? 14.227  10.283  59.890   1.00 10.00 ? ? ? ? ? ? 60  SER B CB  1 
ATOM 3339  O OG  . SER B 1 59  ? 14.202  11.074  61.089   1.00 10.00 ? ? ? ? ? ? 60  SER B OG  1 
ATOM 3340  N N   . LYS B 1 60  ? 15.598  6.911   59.396   1.00 10.00 ? ? ? ? ? ? 61  LYS B N   1 
ATOM 3341  C CA  . LYS B 1 60  ? 16.010  5.839   58.500   1.00 10.00 ? ? ? ? ? ? 61  LYS B CA  1 
ATOM 3342  C C   . LYS B 1 60  ? 16.500  4.745   59.448   1.00 10.00 ? ? ? ? ? ? 61  LYS B C   1 
ATOM 3343  O O   . LYS B 1 60  ? 17.088  3.784   58.972   1.00 10.00 ? ? ? ? ? ? 61  LYS B O   1 
ATOM 3344  C CB  . LYS B 1 60  ? 17.185  6.199   57.628   1.00 10.00 ? ? ? ? ? ? 61  LYS B CB  1 
ATOM 3345  C CG  . LYS B 1 60  ? 17.011  7.350   56.649   1.00 10.00 ? ? ? ? ? ? 61  LYS B CG  1 
ATOM 3346  C CD  . LYS B 1 60  ? 18.191  7.425   55.676   1.00 10.00 ? ? ? ? ? ? 61  LYS B CD  1 
ATOM 3347  C CE  . LYS B 1 60  ? 17.859  8.284   54.459   1.00 10.00 ? ? ? ? ? ? 61  LYS B CE  1 
ATOM 3348  N NZ  . LYS B 1 60  ? 17.732  9.703   54.785   1.00 10.00 ? ? ? ? ? ? 61  LYS B NZ  1 
ATOM 3349  N N   . ARG B 1 61  ? 16.202  4.826   60.768   1.00 10.00 ? ? ? ? ? ? 62  ARG B N   1 
ATOM 3350  C CA  . ARG B 1 61  ? 16.666  3.906   61.819   1.00 10.00 ? ? ? ? ? ? 62  ARG B CA  1 
ATOM 3351  C C   . ARG B 1 61  ? 16.232  2.481   61.549   1.00 10.00 ? ? ? ? ? ? 62  ARG B C   1 
ATOM 3352  O O   . ARG B 1 61  ? 16.951  1.501   61.728   1.00 10.00 ? ? ? ? ? ? 62  ARG B O   1 
ATOM 3353  C CB  . ARG B 1 61  ? 16.122  4.414   63.164   1.00 10.00 ? ? ? ? ? ? 62  ARG B CB  1 
ATOM 3354  C CG  . ARG B 1 61  ? 15.444  3.572   64.273   1.00 10.00 ? ? ? ? ? ? 62  ARG B CG  1 
ATOM 3355  C CD  . ARG B 1 61  ? 14.868  4.581   65.340   1.00 10.00 ? ? ? ? ? ? 62  ARG B CD  1 
ATOM 3356  N NE  . ARG B 1 61  ? 14.642  3.969   66.655   1.00 10.00 ? ? ? ? ? ? 62  ARG B NE  1 
ATOM 3357  C CZ  . ARG B 1 61  ? 15.399  4.203   67.762   1.00 10.00 ? ? ? ? ? ? 62  ARG B CZ  1 
ATOM 3358  N NH1 . ARG B 1 61  ? 16.466  5.063   67.818   1.00 10.00 ? ? ? ? ? ? 62  ARG B NH1 1 
ATOM 3359  N NH2 . ARG B 1 61  ? 15.157  3.403   68.817   1.00 10.00 ? ? ? ? ? ? 62  ARG B NH2 1 
ATOM 3360  N N   . GLY B 1 62  ? 14.992  2.451   61.042   1.00 10.00 ? ? ? ? ? ? 63  GLY B N   1 
ATOM 3361  C CA  . GLY B 1 62  ? 14.342  1.256   60.550   1.00 10.00 ? ? ? ? ? ? 63  GLY B CA  1 
ATOM 3362  C C   . GLY B 1 62  ? 15.135  0.696   59.390   1.00 10.00 ? ? ? ? ? ? 63  GLY B C   1 
ATOM 3363  O O   . GLY B 1 62  ? 15.274  -0.508  59.356   1.00 10.00 ? ? ? ? ? ? 63  GLY B O   1 
ATOM 3364  N N   . ILE B 1 63  ? 15.669  1.458   58.437   1.00 10.00 ? ? ? ? ? ? 64  ILE B N   1 
ATOM 3365  C CA  . ILE B 1 63  ? 16.442  0.855   57.357   1.00 10.00 ? ? ? ? ? ? 64  ILE B CA  1 
ATOM 3366  C C   . ILE B 1 63  ? 17.924  0.785   57.622   1.00 10.00 ? ? ? ? ? ? 64  ILE B C   1 
ATOM 3367  O O   . ILE B 1 63  ? 18.623  0.291   56.735   1.00 10.00 ? ? ? ? ? ? 64  ILE B O   1 
ATOM 3368  C CB  . ILE B 1 63  ? 16.254  1.598   56.031   1.00 10.00 ? ? ? ? ? ? 64  ILE B CB  1 
ATOM 3369  C CG1 . ILE B 1 63  ? 16.591  3.053   56.125   1.00 10.00 ? ? ? ? ? ? 64  ILE B CG1 1 
ATOM 3370  C CG2 . ILE B 1 63  ? 14.785  1.407   55.615   1.00 10.00 ? ? ? ? ? ? 64  ILE B CG2 1 
ATOM 3371  C CD1 . ILE B 1 63  ? 16.322  3.796   54.804   1.00 10.00 ? ? ? ? ? ? 64  ILE B CD1 1 
ATOM 3372  N N   . LEU B 1 64  ? 18.414  1.183   58.821   1.00 10.00 ? ? ? ? ? ? 65  LEU B N   1 
ATOM 3373  C CA  . LEU B 1 64  ? 19.851  1.286   59.071   1.00 10.00 ? ? ? ? ? ? 65  LEU B CA  1 
ATOM 3374  C C   . LEU B 1 64  ? 20.327  0.542   60.294   1.00 10.00 ? ? ? ? ? ? 65  LEU B C   1 
ATOM 3375  O O   . LEU B 1 64  ? 19.530  0.270   61.197   1.00 10.00 ? ? ? ? ? ? 65  LEU B O   1 
ATOM 3376  C CB  . LEU B 1 64  ? 20.281  2.735   59.267   1.00 10.00 ? ? ? ? ? ? 65  LEU B CB  1 
ATOM 3377  C CG  . LEU B 1 64  ? 20.080  3.810   58.194   1.00 10.00 ? ? ? ? ? ? 65  LEU B CG  1 
ATOM 3378  C CD1 . LEU B 1 64  ? 20.651  5.119   58.662   1.00 10.00 ? ? ? ? ? ? 65  LEU B CD1 1 
ATOM 3379  C CD2 . LEU B 1 64  ? 20.799  3.416   56.933   1.00 10.00 ? ? ? ? ? ? 65  LEU B CD2 1 
ATOM 3380  N N   . THR B 1 65  ? 21.619  0.206   60.401   1.00 10.00 ? ? ? ? ? ? 66  THR B N   1 
ATOM 3381  C CA  . THR B 1 65  ? 22.133  -0.319  61.692   1.00 10.00 ? ? ? ? ? ? 66  THR B CA  1 
ATOM 3382  C C   . THR B 1 65  ? 22.887  0.785   62.491   1.00 10.00 ? ? ? ? ? ? 66  THR B C   1 
ATOM 3383  O O   . THR B 1 65  ? 23.846  1.457   62.063   1.00 10.00 ? ? ? ? ? ? 66  THR B O   1 
ATOM 3384  C CB  . THR B 1 65  ? 23.006  -1.582  61.355   1.00 10.00 ? ? ? ? ? ? 66  THR B CB  1 
ATOM 3385  O OG1 . THR B 1 65  ? 22.084  -2.681  61.438   1.00 10.00 ? ? ? ? ? ? 66  THR B OG1 1 
ATOM 3386  C CG2 . THR B 1 65  ? 24.222  -1.786  62.259   1.00 10.00 ? ? ? ? ? ? 66  THR B CG2 1 
ATOM 3387  N N   . LEU B 1 66  ? 22.338  1.020   63.679   1.00 10.00 ? ? ? ? ? ? 67  LEU B N   1 
ATOM 3388  C CA  . LEU B 1 66  ? 22.791  2.063   64.562   1.00 10.00 ? ? ? ? ? ? 67  LEU B CA  1 
ATOM 3389  C C   . LEU B 1 66  ? 23.752  1.711   65.697   1.00 10.00 ? ? ? ? ? ? 67  LEU B C   1 
ATOM 3390  O O   . LEU B 1 66  ? 23.433  0.887   66.558   1.00 10.00 ? ? ? ? ? ? 67  LEU B O   1 
ATOM 3391  C CB  . LEU B 1 66  ? 21.570  2.696   65.146   1.00 10.00 ? ? ? ? ? ? 67  LEU B CB  1 
ATOM 3392  C CG  . LEU B 1 66  ? 20.480  3.248   64.299   1.00 10.00 ? ? ? ? ? ? 67  LEU B CG  1 
ATOM 3393  C CD1 . LEU B 1 66  ? 19.259  3.301   65.220   1.00 10.00 ? ? ? ? ? ? 67  LEU B CD1 1 
ATOM 3394  C CD2 . LEU B 1 66  ? 20.836  4.592   63.685   1.00 10.00 ? ? ? ? ? ? 67  LEU B CD2 1 
ATOM 3395  N N   . LYS B 1 67  ? 24.939  2.309   65.760   1.00 10.00 ? ? ? ? ? ? 68  LYS B N   1 
ATOM 3396  C CA  . LYS B 1 67  ? 25.884  2.158   66.866   1.00 10.00 ? ? ? ? ? ? 68  LYS B CA  1 
ATOM 3397  C C   . LYS B 1 67  ? 25.781  3.370   67.835   1.00 10.00 ? ? ? ? ? ? 68  LYS B C   1 
ATOM 3398  O O   . LYS B 1 67  ? 25.791  4.551   67.439   1.00 10.00 ? ? ? ? ? ? 68  LYS B O   1 
ATOM 3399  C CB  . LYS B 1 67  ? 27.344  2.095   66.354   1.00 10.00 ? ? ? ? ? ? 68  LYS B CB  1 
ATOM 3400  C CG  . LYS B 1 67  ? 28.020  0.767   65.898   1.00 10.00 ? ? ? ? ? ? 68  LYS B CG  1 
ATOM 3401  C CD  . LYS B 1 67  ? 29.435  0.949   65.266   1.00 10.00 ? ? ? ? ? ? 68  LYS B CD  1 
ATOM 3402  C CE  . LYS B 1 67  ? 29.470  1.450   63.820   1.00 10.00 ? ? ? ? ? ? 68  LYS B CE  1 
ATOM 3403  N NZ  . LYS B 1 67  ? 28.565  2.564   63.534   1.00 10.00 ? ? ? ? ? ? 68  LYS B NZ  1 
ATOM 3404  N N   . TYR B 1 68  ? 25.733  3.080   69.145   1.00 10.00 ? ? ? ? ? ? 69  TYR B N   1 
ATOM 3405  C CA  . TYR B 1 68  ? 25.685  4.031   70.247   1.00 10.00 ? ? ? ? ? ? 69  TYR B CA  1 
ATOM 3406  C C   . TYR B 1 68  ? 27.095  4.193   70.814   1.00 10.00 ? ? ? ? ? ? 69  TYR B C   1 
ATOM 3407  O O   . TYR B 1 68  ? 27.629  3.246   71.415   1.00 10.00 ? ? ? ? ? ? 69  TYR B O   1 
ATOM 3408  C CB  . TYR B 1 68  ? 24.812  3.526   71.368   1.00 10.00 ? ? ? ? ? ? 69  TYR B CB  1 
ATOM 3409  C CG  . TYR B 1 68  ? 23.342  3.556   71.028   1.00 10.00 ? ? ? ? ? ? 69  TYR B CG  1 
ATOM 3410  C CD1 . TYR B 1 68  ? 22.777  2.606   70.176   1.00 10.00 ? ? ? ? ? ? 69  TYR B CD1 1 
ATOM 3411  C CD2 . TYR B 1 68  ? 22.604  4.569   71.590   1.00 10.00 ? ? ? ? ? ? 69  TYR B CD2 1 
ATOM 3412  C CE1 . TYR B 1 68  ? 21.425  2.690   69.867   1.00 10.00 ? ? ? ? ? ? 69  TYR B CE1 1 
ATOM 3413  C CE2 . TYR B 1 68  ? 21.265  4.653   71.297   1.00 10.00 ? ? ? ? ? ? 69  TYR B CE2 1 
ATOM 3414  C CZ  . TYR B 1 68  ? 20.697  3.716   70.443   1.00 10.00 ? ? ? ? ? ? 69  TYR B CZ  1 
ATOM 3415  O OH  . TYR B 1 68  ? 19.359  3.841   70.183   1.00 10.00 ? ? ? ? ? ? 69  TYR B OH  1 
ATOM 3416  N N   . PRO B 1 69  ? 16.212  6.312   72.567   1.00 10.00 ? ? ? ? ? ? 70  PRO B N   1 
ATOM 3417  C CA  . PRO B 1 69  ? 16.626  5.272   73.486   1.00 10.00 ? ? ? ? ? ? 70  PRO B CA  1 
ATOM 3418  C C   . PRO B 1 69  ? 15.778  5.245   74.746   1.00 10.00 ? ? ? ? ? ? 70  PRO B C   1 
ATOM 3419  O O   . PRO B 1 69  ? 15.367  4.192   75.214   1.00 10.00 ? ? ? ? ? ? 70  PRO B O   1 
ATOM 3420  C CB  . PRO B 1 69  ? 18.054  5.617   73.777   1.00 10.00 ? ? ? ? ? ? 70  PRO B CB  1 
ATOM 3421  C CG  . PRO B 1 69  ? 18.460  6.796   72.893   1.00 10.00 ? ? ? ? ? ? 70  PRO B CG  1 
ATOM 3422  C CD  . PRO B 1 69  ? 17.133  7.450   72.617   1.00 10.00 ? ? ? ? ? ? 70  PRO B CD  1 
ATOM 3423  N N   . ILE B 1 70  ? 15.568  6.413   75.353   1.00 10.00 ? ? ? ? ? ? 71  ILE B N   1 
ATOM 3424  C CA  . ILE B 1 70  ? 15.003  6.507   76.668   1.00 10.00 ? ? ? ? ? ? 71  ILE B CA  1 
ATOM 3425  C C   . ILE B 1 70  ? 13.548  6.737   76.384   1.00 10.00 ? ? ? ? ? ? 71  ILE B C   1 
ATOM 3426  O O   . ILE B 1 70  ? 13.217  7.552   75.525   1.00 10.00 ? ? ? ? ? ? 71  ILE B O   1 
ATOM 3427  C CB  . ILE B 1 70  ? 15.684  7.687   77.400   1.00 10.00 ? ? ? ? ? ? 71  ILE B CB  1 
ATOM 3428  C CG1 . ILE B 1 70  ? 17.190  7.609   77.417   1.00 10.00 ? ? ? ? ? ? 71  ILE B CG1 1 
ATOM 3429  C CG2 . ILE B 1 70  ? 15.320  7.618   78.824   1.00 10.00 ? ? ? ? ? ? 71  ILE B CG2 1 
ATOM 3430  C CD1 . ILE B 1 70  ? 17.894  9.002   77.521   1.00 10.00 ? ? ? ? ? ? 71  ILE B CD1 1 
ATOM 3431  N N   . GLU B 1 71  ? 12.670  6.106   77.141   1.00 10.00 ? ? ? ? ? ? 72  GLU B N   1 
ATOM 3432  C CA  . GLU B 1 71  ? 11.256  6.119   76.862   1.00 10.00 ? ? ? ? ? ? 72  GLU B CA  1 
ATOM 3433  C C   . GLU B 1 71  ? 10.444  6.015   78.139   1.00 10.00 ? ? ? ? ? ? 72  GLU B C   1 
ATOM 3434  O O   . GLU B 1 71  ? 10.544  5.024   78.853   1.00 10.00 ? ? ? ? ? ? 72  GLU B O   1 
ATOM 3435  C CB  . GLU B 1 71  ? 11.055  4.965   75.959   1.00 10.00 ? ? ? ? ? ? 72  GLU B CB  1 
ATOM 3436  C CG  . GLU B 1 71  ? 9.654   4.712   75.499   1.00 10.00 ? ? ? ? ? ? 72  GLU B CG  1 
ATOM 3437  C CD  . GLU B 1 71  ? 9.663   3.761   74.326   1.00 10.00 ? ? ? ? ? ? 72  GLU B CD  1 
ATOM 3438  O OE1 . GLU B 1 71  ? 10.297  4.126   73.305   1.00 10.00 ? ? ? ? ? ? 72  GLU B OE1 1 
ATOM 3439  O OE2 . GLU B 1 71  ? 9.060   2.680   74.458   1.00 10.00 ? ? ? ? ? ? 72  GLU B OE2 1 
ATOM 3440  N N   . HIS B 1 72  ? 12.140  2.523   79.853   1.00 10.00 ? ? ? ? ? ? 73  HIS B N   1 
ATOM 3441  C CA  . HIS B 1 72  ? 11.992  2.869   81.306   1.00 10.00 ? ? ? ? ? ? 73  HIS B CA  1 
ATOM 3442  C C   . HIS B 1 72  ? 12.825  3.897   81.953   1.00 10.00 ? ? ? ? ? ? 73  HIS B C   1 
ATOM 3443  O O   . HIS B 1 72  ? 12.451  4.372   83.073   1.00 10.00 ? ? ? ? ? ? 73  HIS B O   1 
ATOM 3444  C CB  . HIS B 1 72  ? 11.196  1.902   82.229   1.00 10.00 ? ? ? ? ? ? 73  HIS B CB  1 
ATOM 3445  C CG  . HIS B 1 72  ? 9.796   2.083   81.569   1.00 10.00 ? ? ? ? ? ? 73  HIS B CG  1 
ATOM 3446  N ND1 . HIS B 1 72  ? 9.143   3.220   81.948   1.00 10.00 ? ? ? ? ? ? 73  HIS B ND1 1 
ATOM 3447  C CD2 . HIS B 1 72  ? 9.015   1.447   80.722   1.00 10.00 ? ? ? ? ? ? 73  HIS B CD2 1 
ATOM 3448  C CE1 . HIS B 1 72  ? 7.999   3.297   81.365   1.00 10.00 ? ? ? ? ? ? 73  HIS B CE1 1 
ATOM 3449  N NE2 . HIS B 1 72  ? 7.846   2.201   80.566   1.00 10.00 ? ? ? ? ? ? 73  HIS B NE2 1 
ATOM 3450  N N   . GLY B 1 73  ? 11.085  7.492   80.629   1.00 10.00 ? ? ? ? ? ? 74  GLY B N   1 
ATOM 3451  C CA  . GLY B 1 73  ? 12.186  7.489   81.572   1.00 10.00 ? ? ? ? ? ? 74  GLY B CA  1 
ATOM 3452  C C   . GLY B 1 73  ? 13.091  6.266   81.555   1.00 10.00 ? ? ? ? ? ? 74  GLY B C   1 
ATOM 3453  O O   . GLY B 1 73  ? 14.209  6.379   82.065   1.00 10.00 ? ? ? ? ? ? 74  GLY B O   1 
ATOM 3454  N N   . ILE B 1 74  ? 12.643  5.128   80.984   1.00 10.00 ? ? ? ? ? ? 75  ILE B N   1 
ATOM 3455  C CA  . ILE B 1 74  ? 13.330  3.844   81.015   1.00 10.00 ? ? ? ? ? ? 75  ILE B CA  1 
ATOM 3456  C C   . ILE B 1 74  ? 14.057  3.581   79.698   1.00 10.00 ? ? ? ? ? ? 75  ILE B C   1 
ATOM 3457  O O   . ILE B 1 74  ? 13.514  3.950   78.661   1.00 10.00 ? ? ? ? ? ? 75  ILE B O   1 
ATOM 3458  C CB  . ILE B 1 74  ? 12.288  2.758   81.285   1.00 10.00 ? ? ? ? ? ? 75  ILE B CB  1 
ATOM 3459  C CG1 . ILE B 1 74  ? 11.407  3.118   82.485   1.00 10.00 ? ? ? ? ? ? 75  ILE B CG1 1 
ATOM 3460  C CG2 . ILE B 1 74  ? 13.029  1.423   81.442   1.00 10.00 ? ? ? ? ? ? 75  ILE B CG2 1 
ATOM 3461  C CD1 . ILE B 1 74  ? 12.042  3.406   83.846   1.00 10.00 ? ? ? ? ? ? 75  ILE B CD1 1 
ATOM 3462  N N   . VAL B 1 75  ? 15.236  2.937   79.630   1.00 10.00 ? ? ? ? ? ? 76  VAL B N   1 
ATOM 3463  C CA  . VAL B 1 75  ? 15.978  2.770   78.381   1.00 10.00 ? ? ? ? ? ? 76  VAL B CA  1 
ATOM 3464  C C   . VAL B 1 75  ? 15.484  1.474   77.780   1.00 10.00 ? ? ? ? ? ? 76  VAL B C   1 
ATOM 3465  O O   . VAL B 1 75  ? 15.387  0.430   78.445   1.00 10.00 ? ? ? ? ? ? 76  VAL B O   1 
ATOM 3466  C CB  . VAL B 1 75  ? 17.514  2.753   78.663   1.00 10.00 ? ? ? ? ? ? 76  VAL B CB  1 
ATOM 3467  C CG1 . VAL B 1 75  ? 18.342  2.337   77.458   1.00 10.00 ? ? ? ? ? ? 76  VAL B CG1 1 
ATOM 3468  C CG2 . VAL B 1 75  ? 17.946  4.180   79.004   1.00 10.00 ? ? ? ? ? ? 76  VAL B CG2 1 
ATOM 3469  N N   . THR B 1 76  ? 15.009  1.682   76.535   1.00 10.00 ? ? ? ? ? ? 77  THR B N   1 
ATOM 3470  C CA  . THR B 1 76  ? 14.455  0.614   75.709   1.00 10.00 ? ? ? ? ? ? 77  THR B CA  1 
ATOM 3471  C C   . THR B 1 76  ? 15.503  0.109   74.730   1.00 10.00 ? ? ? ? ? ? 77  THR B C   1 
ATOM 3472  O O   . THR B 1 76  ? 15.465  -1.039  74.279   1.00 10.00 ? ? ? ? ? ? 77  THR B O   1 
ATOM 3473  C CB  . THR B 1 76  ? 13.208  1.106   74.921   1.00 10.00 ? ? ? ? ? ? 77  THR B CB  1 
ATOM 3474  O OG1 . THR B 1 76  ? 13.510  2.265   74.113   1.00 10.00 ? ? ? ? ? ? 77  THR B OG1 1 
ATOM 3475  C CG2 . THR B 1 76  ? 12.101  1.420   75.923   1.00 10.00 ? ? ? ? ? ? 77  THR B CG2 1 
ATOM 3476  N N   . ASN B 1 77  ? 16.495  0.925   74.397   1.00 10.00 ? ? ? ? ? ? 78  ASN B N   1 
ATOM 3477  C CA  . ASN B 1 77  ? 17.454  0.549   73.401   1.00 10.00 ? ? ? ? ? ? 78  ASN B CA  1 
ATOM 3478  C C   . ASN B 1 77  ? 18.834  0.738   73.956   1.00 10.00 ? ? ? ? ? ? 78  ASN B C   1 
ATOM 3479  O O   . ASN B 1 77  ? 19.320  1.854   74.136   1.00 10.00 ? ? ? ? ? ? 78  ASN B O   1 
ATOM 3480  C CB  . ASN B 1 77  ? 17.239  1.409   72.144   1.00 10.00 ? ? ? ? ? ? 78  ASN B CB  1 
ATOM 3481  C CG  . ASN B 1 77  ? 17.969  0.788   70.961   1.00 10.00 ? ? ? ? ? ? 78  ASN B CG  1 
ATOM 3482  O OD1 . ASN B 1 77  ? 19.067  1.244   70.657   1.00 10.00 ? ? ? ? ? ? 78  ASN B OD1 1 
ATOM 3483  N ND2 . ASN B 1 77  ? 17.525  -0.302  70.329   1.00 10.00 ? ? ? ? ? ? 78  ASN B ND2 1 
ATOM 3484  N N   . TRP B 1 78  ? 19.506  -0.345  74.249   1.00 10.00 ? ? ? ? ? ? 79  TRP B N   1 
ATOM 3485  C CA  . TRP B 1 78  ? 20.810  -0.216  74.846   1.00 10.00 ? ? ? ? ? ? 79  TRP B CA  1 
ATOM 3486  C C   . TRP B 1 78  ? 21.975  0.141   73.948   1.00 10.00 ? ? ? ? ? ? 79  TRP B C   1 
ATOM 3487  O O   . TRP B 1 78  ? 22.858  0.827   74.445   1.00 10.00 ? ? ? ? ? ? 79  TRP B O   1 
ATOM 3488  C CB  . TRP B 1 78  ? 21.071  -1.498  75.591   1.00 10.00 ? ? ? ? ? ? 79  TRP B CB  1 
ATOM 3489  C CG  . TRP B 1 78  ? 20.346  -1.482  76.933   1.00 10.00 ? ? ? ? ? ? 79  TRP B CG  1 
ATOM 3490  C CD1 . TRP B 1 78  ? 19.233  -2.232  77.186   1.00 10.00 ? ? ? ? ? ? 79  TRP B CD1 1 
ATOM 3491  C CD2 . TRP B 1 78  ? 20.668  -0.629  77.935   1.00 10.00 ? ? ? ? ? ? 79  TRP B CD2 1 
ATOM 3492  N NE1 . TRP B 1 78  ? 18.817  -1.832  78.342   1.00 10.00 ? ? ? ? ? ? 79  TRP B NE1 1 
ATOM 3493  C CE2 . TRP B 1 78  ? 19.644  -0.873  78.826   1.00 10.00 ? ? ? ? ? ? 79  TRP B CE2 1 
ATOM 3494  C CE3 . TRP B 1 78  ? 21.663  0.299   78.161   1.00 10.00 ? ? ? ? ? ? 79  TRP B CE3 1 
ATOM 3495  C CZ2 . TRP B 1 78  ? 19.601  -0.148  80.007   1.00 10.00 ? ? ? ? ? ? 79  TRP B CZ2 1 
ATOM 3496  C CZ3 . TRP B 1 78  ? 21.618  1.016   79.334   1.00 10.00 ? ? ? ? ? ? 79  TRP B CZ3 1 
ATOM 3497  C CH2 . TRP B 1 78  ? 20.594  0.789   80.237   1.00 10.00 ? ? ? ? ? ? 79  TRP B CH2 1 
ATOM 3498  N N   . ASP B 1 79  ? 22.108  -0.179  72.660   1.00 10.00 ? ? ? ? ? ? 80  ASP B N   1 
ATOM 3499  C CA  . ASP B 1 79  ? 23.306  0.267   71.962   1.00 10.00 ? ? ? ? ? ? 80  ASP B CA  1 
ATOM 3500  C C   . ASP B 1 79  ? 23.100  1.706   71.552   1.00 10.00 ? ? ? ? ? ? 80  ASP B C   1 
ATOM 3501  O O   . ASP B 1 79  ? 24.088  2.440   71.455   1.00 10.00 ? ? ? ? ? ? 80  ASP B O   1 
ATOM 3502  C CB  . ASP B 1 79  ? 23.622  -0.506  70.688   1.00 10.00 ? ? ? ? ? ? 80  ASP B CB  1 
ATOM 3503  C CG  . ASP B 1 79  ? 23.288  -1.988  70.592   1.00 10.00 ? ? ? ? ? ? 80  ASP B CG  1 
ATOM 3504  O OD1 . ASP B 1 79  ? 22.947  -2.659  71.575   1.00 10.00 ? ? ? ? ? ? 80  ASP B OD1 1 
ATOM 3505  O OD2 . ASP B 1 79  ? 23.325  -2.474  69.466   1.00 10.00 ? ? ? ? ? ? 80  ASP B OD2 1 
ATOM 3506  N N   . ASP B 1 80  ? 21.865  2.161   71.291   1.00 10.00 ? ? ? ? ? ? 81  ASP B N   1 
ATOM 3507  C CA  . ASP B 1 80  ? 21.731  3.575   71.006   1.00 10.00 ? ? ? ? ? ? 81  ASP B CA  1 
ATOM 3508  C C   . ASP B 1 80  ? 21.857  4.434   72.271   1.00 10.00 ? ? ? ? ? ? 81  ASP B C   1 
ATOM 3509  O O   . ASP B 1 80  ? 22.450  5.525   72.218   1.00 10.00 ? ? ? ? ? ? 81  ASP B O   1 
ATOM 3510  C CB  . ASP B 1 80  ? 20.416  3.755   70.161   1.00 10.00 ? ? ? ? ? ? 81  ASP B CB  1 
ATOM 3511  C CG  . ASP B 1 80  ? 20.840  3.373   68.698   1.00 10.00 ? ? ? ? ? ? 81  ASP B CG  1 
ATOM 3512  O OD1 . ASP B 1 80  ? 21.672  4.083   68.122   1.00 10.00 ? ? ? ? ? ? 81  ASP B OD1 1 
ATOM 3513  O OD2 . ASP B 1 80  ? 20.429  2.360   68.109   1.00 10.00 ? ? ? ? ? ? 81  ASP B OD2 1 
ATOM 3514  N N   . MET B 1 81  ? 21.476  3.984   73.468   1.00 10.00 ? ? ? ? ? ? 82  MET B N   1 
ATOM 3515  C CA  . MET B 1 81  ? 21.926  4.706   74.673   1.00 10.00 ? ? ? ? ? ? 82  MET B CA  1 
ATOM 3516  C C   . MET B 1 81  ? 23.480  4.660   74.707   1.00 10.00 ? ? ? ? ? ? 82  MET B C   1 
ATOM 3517  O O   . MET B 1 81  ? 24.117  5.702   74.890   1.00 10.00 ? ? ? ? ? ? 82  MET B O   1 
ATOM 3518  C CB  . MET B 1 81  ? 21.354  4.057   75.945   1.00 10.00 ? ? ? ? ? ? 82  MET B CB  1 
ATOM 3519  C CG  . MET B 1 81  ? 21.439  4.932   77.210   1.00 10.00 ? ? ? ? ? ? 82  MET B CG  1 
ATOM 3520  S SD  . MET B 1 81  ? 20.303  6.344   77.508   1.00 10.00 ? ? ? ? ? ? 82  MET B SD  1 
ATOM 3521  C CE  . MET B 1 81  ? 21.428  7.714   77.460   1.00 10.00 ? ? ? ? ? ? 82  MET B CE  1 
ATOM 3522  N N   . GLU B 1 82  ? 24.167  3.554   74.390   1.00 10.00 ? ? ? ? ? ? 83  GLU B N   1 
ATOM 3523  C CA  . GLU B 1 82  ? 25.615  3.533   74.428   1.00 10.00 ? ? ? ? ? ? 83  GLU B CA  1 
ATOM 3524  C C   . GLU B 1 82  ? 26.198  4.570   73.533   1.00 10.00 ? ? ? ? ? ? 83  GLU B C   1 
ATOM 3525  O O   . GLU B 1 82  ? 27.114  5.282   73.942   1.00 10.00 ? ? ? ? ? ? 83  GLU B O   1 
ATOM 3526  C CB  . GLU B 1 82  ? 26.200  2.232   73.991   1.00 10.00 ? ? ? ? ? ? 83  GLU B CB  1 
ATOM 3527  C CG  . GLU B 1 82  ? 26.100  1.026   74.948   1.00 10.00 ? ? ? ? ? ? 83  GLU B CG  1 
ATOM 3528  C CD  . GLU B 1 82  ? 27.038  -0.144  74.630   1.00 10.00 ? ? ? ? ? ? 83  GLU B CD  1 
ATOM 3529  O OE1 . GLU B 1 82  ? 28.095  0.092   74.027   1.00 10.00 ? ? ? ? ? ? 83  GLU B OE1 1 
ATOM 3530  O OE2 . GLU B 1 82  ? 26.698  -1.279  75.008   1.00 10.00 ? ? ? ? ? ? 83  GLU B OE2 1 
ATOM 3531  N N   . LYS B 1 83  ? 25.625  4.729   72.360   1.00 10.00 ? ? ? ? ? ? 84  LYS B N   1 
ATOM 3532  C CA  . LYS B 1 83  ? 26.021  5.829   71.490   1.00 10.00 ? ? ? ? ? ? 84  LYS B CA  1 
ATOM 3533  C C   . LYS B 1 83  ? 25.925  7.194   72.177   1.00 10.00 ? ? ? ? ? ? 84  LYS B C   1 
ATOM 3534  O O   . LYS B 1 83  ? 26.891  7.981   72.142   1.00 10.00 ? ? ? ? ? ? 84  LYS B O   1 
ATOM 3535  C CB  . LYS B 1 83  ? 25.158  5.971   70.238   1.00 10.00 ? ? ? ? ? ? 84  LYS B CB  1 
ATOM 3536  C CG  . LYS B 1 83  ? 24.798  4.764   69.369   1.00 10.00 ? ? ? ? ? ? 84  LYS B CG  1 
ATOM 3537  C CD  . LYS B 1 83  ? 25.966  3.866   68.935   1.00 10.00 ? ? ? ? ? ? 84  LYS B CD  1 
ATOM 3538  C CE  . LYS B 1 83  ? 25.595  3.028   67.687   1.00 10.00 ? ? ? ? ? ? 84  LYS B CE  1 
ATOM 3539  N NZ  . LYS B 1 83  ? 25.506  3.860   66.493   1.00 10.00 ? ? ? ? ? ? 84  LYS B NZ  1 
ATOM 3540  N N   . ILE B 1 84  ? 24.800  7.483   72.842   1.00 10.00 ? ? ? ? ? ? 85  ILE B N   1 
ATOM 3541  C CA  . ILE B 1 84  ? 24.587  8.792   73.419   1.00 10.00 ? ? ? ? ? ? 85  ILE B CA  1 
ATOM 3542  C C   . ILE B 1 84  ? 25.672  9.120   74.402   1.00 10.00 ? ? ? ? ? ? 85  ILE B C   1 
ATOM 3543  O O   . ILE B 1 84  ? 26.284  10.196  74.330   1.00 10.00 ? ? ? ? ? ? 85  ILE B O   1 
ATOM 3544  C CB  . ILE B 1 84  ? 23.184  8.839   74.082   1.00 10.00 ? ? ? ? ? ? 85  ILE B CB  1 
ATOM 3545  C CG1 . ILE B 1 84  ? 22.156  9.027   72.977   1.00 10.00 ? ? ? ? ? ? 85  ILE B CG1 1 
ATOM 3546  C CG2 . ILE B 1 84  ? 23.061  9.971   75.087   1.00 10.00 ? ? ? ? ? ? 85  ILE B CG2 1 
ATOM 3547  C CD1 . ILE B 1 84  ? 20.780  9.472   73.456   1.00 10.00 ? ? ? ? ? ? 85  ILE B CD1 1 
ATOM 3548  N N   . TRP B 1 85  ? 25.969  8.136   75.254   1.00 10.00 ? ? ? ? ? ? 86  TRP B N   1 
ATOM 3549  C CA  . TRP B 1 85  ? 26.978  8.332   76.286   1.00 10.00 ? ? ? ? ? ? 86  TRP B CA  1 
ATOM 3550  C C   . TRP B 1 85  ? 28.318  8.553   75.621   1.00 10.00 ? ? ? ? ? ? 86  TRP B C   1 
ATOM 3551  O O   . TRP B 1 85  ? 28.874  9.612   75.863   1.00 10.00 ? ? ? ? ? ? 86  TRP B O   1 
ATOM 3552  C CB  . TRP B 1 85  ? 27.009  7.119   77.268   1.00 10.00 ? ? ? ? ? ? 86  TRP B CB  1 
ATOM 3553  C CG  . TRP B 1 85  ? 25.865  7.153   78.284   1.00 10.00 ? ? ? ? ? ? 86  TRP B CG  1 
ATOM 3554  C CD1 . TRP B 1 85  ? 25.312  8.355   78.627   1.00 10.00 ? ? ? ? ? ? 86  TRP B CD1 1 
ATOM 3555  C CD2 . TRP B 1 85  ? 25.216  6.093   78.876   1.00 10.00 ? ? ? ? ? ? 86  TRP B CD2 1 
ATOM 3556  N NE1 . TRP B 1 85  ? 24.309  8.082   79.401   1.00 10.00 ? ? ? ? ? ? 86  TRP B NE1 1 
ATOM 3557  C CE2 . TRP B 1 85  ? 24.213  6.758   79.578   1.00 10.00 ? ? ? ? ? ? 86  TRP B CE2 1 
ATOM 3558  C CE3 . TRP B 1 85  ? 25.278  4.712   78.946   1.00 10.00 ? ? ? ? ? ? 86  TRP B CE3 1 
ATOM 3559  C CZ2 . TRP B 1 85  ? 23.254  6.110   80.347   1.00 10.00 ? ? ? ? ? ? 86  TRP B CZ2 1 
ATOM 3560  C CZ3 . TRP B 1 85  ? 24.331  4.054   79.714   1.00 10.00 ? ? ? ? ? ? 86  TRP B CZ3 1 
ATOM 3561  C CH2 . TRP B 1 85  ? 23.327  4.746   80.405   1.00 10.00 ? ? ? ? ? ? 86  TRP B CH2 1 
ATOM 3562  N N   . HIS B 1 86  ? 28.852  7.692   74.764   1.00 10.00 ? ? ? ? ? ? 87  HIS B N   1 
ATOM 3563  C CA  . HIS B 1 86  ? 30.068  7.953   73.990   1.00 10.00 ? ? ? ? ? ? 87  HIS B CA  1 
ATOM 3564  C C   . HIS B 1 86  ? 30.151  9.381   73.458   1.00 10.00 ? ? ? ? ? ? 87  HIS B C   1 
ATOM 3565  O O   . HIS B 1 86  ? 31.178  10.006  73.617   1.00 10.00 ? ? ? ? ? ? 87  HIS B O   1 
ATOM 3566  C CB  . HIS B 1 86  ? 30.106  6.968   72.820   1.00 10.00 ? ? ? ? ? ? 87  HIS B CB  1 
ATOM 3567  C CG  . HIS B 1 86  ? 31.448  6.809   72.113   1.00 10.00 ? ? ? ? ? ? 87  HIS B CG  1 
ATOM 3568  N ND1 . HIS B 1 86  ? 32.303  5.760   72.111   1.00 10.00 ? ? ? ? ? ? 87  HIS B ND1 1 
ATOM 3569  C CD2 . HIS B 1 86  ? 31.996  7.785   71.303   1.00 10.00 ? ? ? ? ? ? 87  HIS B CD2 1 
ATOM 3570  C CE1 . HIS B 1 86  ? 33.328  6.062   71.338   1.00 10.00 ? ? ? ? ? ? 87  HIS B CE1 1 
ATOM 3571  N NE2 . HIS B 1 86  ? 33.114  7.277   70.870   1.00 10.00 ? ? ? ? ? ? 87  HIS B NE2 1 
ATOM 3572  N N   . HIS B 1 87  ? 29.105  9.916   72.832   1.00 10.00 ? ? ? ? ? ? 88  HIS B N   1 
ATOM 3573  C CA  . HIS B 1 87  ? 28.963  11.312  72.383   1.00 10.00 ? ? ? ? ? ? 88  HIS B CA  1 
ATOM 3574  C C   . HIS B 1 87  ? 28.991  12.328  73.551   1.00 10.00 ? ? ? ? ? ? 88  HIS B C   1 
ATOM 3575  O O   . HIS B 1 87  ? 29.563  13.427  73.407   1.00 10.00 ? ? ? ? ? ? 88  HIS B O   1 
ATOM 3576  C CB  . HIS B 1 87  ? 27.625  11.476  71.586   1.00 10.00 ? ? ? ? ? ? 88  HIS B CB  1 
ATOM 3577  C CG  . HIS B 1 87  ? 27.355  12.894  71.058   1.00 10.00 ? ? ? ? ? ? 88  HIS B CG  1 
ATOM 3578  N ND1 . HIS B 1 87  ? 27.988  13.567  70.098   1.00 10.00 ? ? ? ? ? ? 88  HIS B ND1 1 
ATOM 3579  C CD2 . HIS B 1 87  ? 26.465  13.775  71.616   1.00 10.00 ? ? ? ? ? ? 88  HIS B CD2 1 
ATOM 3580  C CE1 . HIS B 1 87  ? 27.546  14.795  70.073   1.00 10.00 ? ? ? ? ? ? 88  HIS B CE1 1 
ATOM 3581  N NE2 . HIS B 1 87  ? 26.631  14.902  70.994   1.00 10.00 ? ? ? ? ? ? 88  HIS B NE2 1 
ATOM 3582  N N   . THR B 1 88  ? 28.324  12.079  74.675   1.00 10.00 ? ? ? ? ? ? 89  THR B N   1 
ATOM 3583  C CA  . THR B 1 88  ? 28.454  12.903  75.884   1.00 10.00 ? ? ? ? ? ? 89  THR B CA  1 
ATOM 3584  C C   . THR B 1 88  ? 29.964  13.141  76.219   1.00 10.00 ? ? ? ? ? ? 89  THR B C   1 
ATOM 3585  O O   . THR B 1 88  ? 30.474  14.285  76.254   1.00 10.00 ? ? ? ? ? ? 89  THR B O   1 
ATOM 3586  C CB  . THR B 1 88  ? 27.781  12.171  77.101   1.00 10.00 ? ? ? ? ? ? 89  THR B CB  1 
ATOM 3587  O OG1 . THR B 1 88  ? 26.459  11.828  76.698   1.00 10.00 ? ? ? ? ? ? 89  THR B OG1 1 
ATOM 3588  C CG2 . THR B 1 88  ? 27.808  12.983  78.378   1.00 10.00 ? ? ? ? ? ? 89  THR B CG2 1 
ATOM 3589  N N   . PHE B 1 89  ? 30.749  12.056  76.389   1.00 10.00 ? ? ? ? ? ? 90  PHE B N   1 
ATOM 3590  C CA  . PHE B 1 89  ? 32.150  12.175  76.835   1.00 10.00 ? ? ? ? ? ? 90  PHE B CA  1 
ATOM 3591  C C   . PHE B 1 89  ? 33.090  12.658  75.737   1.00 10.00 ? ? ? ? ? ? 90  PHE B C   1 
ATOM 3592  O O   . PHE B 1 89  ? 33.687  13.737  75.799   1.00 10.00 ? ? ? ? ? ? 90  PHE B O   1 
ATOM 3593  C CB  . PHE B 1 89  ? 32.662  10.814  77.387   1.00 10.00 ? ? ? ? ? ? 90  PHE B CB  1 
ATOM 3594  C CG  . PHE B 1 89  ? 31.789  10.147  78.457   1.00 10.00 ? ? ? ? ? ? 90  PHE B CG  1 
ATOM 3595  C CD1 . PHE B 1 89  ? 31.513  10.773  79.658   1.00 10.00 ? ? ? ? ? ? 90  PHE B CD1 1 
ATOM 3596  C CD2 . PHE B 1 89  ? 31.291  8.889   78.234   1.00 10.00 ? ? ? ? ? ? 90  PHE B CD2 1 
ATOM 3597  C CE1 . PHE B 1 89  ? 30.741  10.130  80.616   1.00 10.00 ? ? ? ? ? ? 90  PHE B CE1 1 
ATOM 3598  C CE2 . PHE B 1 89  ? 30.529  8.271   79.183   1.00 10.00 ? ? ? ? ? ? 90  PHE B CE2 1 
ATOM 3599  C CZ  . PHE B 1 89  ? 30.247  8.873   80.379   1.00 10.00 ? ? ? ? ? ? 90  PHE B CZ  1 
ATOM 3600  N N   . TYR B 1 90  ? 33.117  11.890  74.654   1.00 10.00 ? ? ? ? ? ? 91  TYR B N   1 
ATOM 3601  C CA  . TYR B 1 90  ? 34.018  12.124  73.540   1.00 10.00 ? ? ? ? ? ? 91  TYR B CA  1 
ATOM 3602  C C   . TYR B 1 90  ? 33.659  13.232  72.600   1.00 10.00 ? ? ? ? ? ? 91  TYR B C   1 
ATOM 3603  O O   . TYR B 1 90  ? 34.489  13.584  71.779   1.00 10.00 ? ? ? ? ? ? 91  TYR B O   1 
ATOM 3604  C CB  . TYR B 1 90  ? 34.162  10.873  72.709   1.00 10.00 ? ? ? ? ? ? 91  TYR B CB  1 
ATOM 3605  C CG  . TYR B 1 90  ? 34.695  9.712   73.531   1.00 10.00 ? ? ? ? ? ? 91  TYR B CG  1 
ATOM 3606  C CD1 . TYR B 1 90  ? 36.027  9.606   73.878   1.00 10.00 ? ? ? ? ? ? 91  TYR B CD1 1 
ATOM 3607  C CD2 . TYR B 1 90  ? 33.803  8.738   73.889   1.00 10.00 ? ? ? ? ? ? 91  TYR B CD2 1 
ATOM 3608  C CE1 . TYR B 1 90  ? 36.434  8.493   74.579   1.00 10.00 ? ? ? ? ? ? 91  TYR B CE1 1 
ATOM 3609  C CE2 . TYR B 1 90  ? 34.190  7.640   74.592   1.00 10.00 ? ? ? ? ? ? 91  TYR B CE2 1 
ATOM 3610  C CZ  . TYR B 1 90  ? 35.506  7.532   74.925   1.00 10.00 ? ? ? ? ? ? 91  TYR B CZ  1 
ATOM 3611  O OH  . TYR B 1 90  ? 35.856  6.413   75.639   1.00 10.00 ? ? ? ? ? ? 91  TYR B OH  1 
ATOM 3612  N N   . ASN B 1 91  ? 32.475  13.799  72.585   1.00 10.00 ? ? ? ? ? ? 92  ASN B N   1 
ATOM 3613  C CA  . ASN B 1 91  ? 32.208  14.877  71.647   1.00 10.00 ? ? ? ? ? ? 92  ASN B CA  1 
ATOM 3614  C C   . ASN B 1 91  ? 31.626  16.074  72.371   1.00 10.00 ? ? ? ? ? ? 92  ASN B C   1 
ATOM 3615  O O   . ASN B 1 91  ? 31.954  17.192  71.990   1.00 10.00 ? ? ? ? ? ? 92  ASN B O   1 
ATOM 3616  C CB  . ASN B 1 91  ? 31.233  14.426  70.539   1.00 10.00 ? ? ? ? ? ? 92  ASN B CB  1 
ATOM 3617  C CG  . ASN B 1 91  ? 31.676  13.270  69.649   1.00 10.00 ? ? ? ? ? ? 92  ASN B CG  1 
ATOM 3618  O OD1 . ASN B 1 91  ? 30.870  12.529  69.091   1.00 10.00 ? ? ? ? ? ? 92  ASN B OD1 1 
ATOM 3619  N ND2 . ASN B 1 91  ? 32.940  13.010  69.484   1.00 10.00 ? ? ? ? ? ? 92  ASN B ND2 1 
ATOM 3620  N N   . GLU B 1 92  ? 30.783  15.902  73.406   1.00 10.00 ? ? ? ? ? ? 93  GLU B N   1 
ATOM 3621  C CA  . GLU B 1 92  ? 30.250  17.062  74.064   1.00 10.00 ? ? ? ? ? ? 93  GLU B CA  1 
ATOM 3622  C C   . GLU B 1 92  ? 31.123  17.597  75.196   1.00 10.00 ? ? ? ? ? ? 93  GLU B C   1 
ATOM 3623  O O   . GLU B 1 92  ? 31.471  18.781  75.210   1.00 10.00 ? ? ? ? ? ? 93  GLU B O   1 
ATOM 3624  C CB  . GLU B 1 92  ? 28.870  16.717  74.536   1.00 10.00 ? ? ? ? ? ? 93  GLU B CB  1 
ATOM 3625  C CG  . GLU B 1 92  ? 27.872  17.790  74.011   1.00 10.00 ? ? ? ? ? ? 93  GLU B CG  1 
ATOM 3626  C CD  . GLU B 1 92  ? 27.521  17.890  72.506   1.00 10.00 ? ? ? ? ? ? 93  GLU B CD  1 
ATOM 3627  O OE1 . GLU B 1 92  ? 28.262  18.489  71.710   1.00 10.00 ? ? ? ? ? ? 93  GLU B OE1 1 
ATOM 3628  O OE2 . GLU B 1 92  ? 26.471  17.394  72.113   1.00 10.00 ? ? ? ? ? ? 93  GLU B OE2 1 
ATOM 3629  N N   . LEU B 1 93  ? 31.545  16.810  76.172   1.00 10.00 ? ? ? ? ? ? 94  LEU B N   1 
ATOM 3630  C CA  . LEU B 1 93  ? 32.315  17.407  77.237   1.00 10.00 ? ? ? ? ? ? 94  LEU B CA  1 
ATOM 3631  C C   . LEU B 1 93  ? 33.801  17.354  76.931   1.00 10.00 ? ? ? ? ? ? 94  LEU B C   1 
ATOM 3632  O O   . LEU B 1 93  ? 34.577  18.115  77.519   1.00 10.00 ? ? ? ? ? ? 94  LEU B O   1 
ATOM 3633  C CB  . LEU B 1 93  ? 31.920  16.677  78.506   1.00 10.00 ? ? ? ? ? ? 94  LEU B CB  1 
ATOM 3634  C CG  . LEU B 1 93  ? 30.488  16.940  78.985   1.00 10.00 ? ? ? ? ? ? 94  LEU B CG  1 
ATOM 3635  C CD1 . LEU B 1 93  ? 30.062  15.805  79.902   1.00 10.00 ? ? ? ? ? ? 94  LEU B CD1 1 
ATOM 3636  C CD2 . LEU B 1 93  ? 30.403  18.303  79.658   1.00 10.00 ? ? ? ? ? ? 94  LEU B CD2 1 
ATOM 3637  N N   . ARG B 1 94  ? 34.175  16.463  75.974   1.00 10.00 ? ? ? ? ? ? 95  ARG B N   1 
ATOM 3638  C CA  . ARG B 1 94  ? 35.552  16.266  75.436   1.00 10.00 ? ? ? ? ? ? 95  ARG B CA  1 
ATOM 3639  C C   . ARG B 1 94  ? 36.505  15.734  76.551   1.00 10.00 ? ? ? ? ? ? 95  ARG B C   1 
ATOM 3640  O O   . ARG B 1 94  ? 37.653  16.155  76.791   1.00 10.00 ? ? ? ? ? ? 95  ARG B O   1 
ATOM 3641  C CB  . ARG B 1 94  ? 36.062  17.606  74.869   1.00 10.00 ? ? ? ? ? ? 95  ARG B CB  1 
ATOM 3642  C CG  . ARG B 1 94  ? 35.160  18.342  73.826   1.00 10.00 ? ? ? ? ? ? 95  ARG B CG  1 
ATOM 3643  C CD  . ARG B 1 94  ? 35.401  17.861  72.422   1.00 10.00 ? ? ? ? ? ? 95  ARG B CD  1 
ATOM 3644  N NE  . ARG B 1 94  ? 36.807  18.107  72.126   1.00 10.00 ? ? ? ? ? ? 95  ARG B NE  1 
ATOM 3645  C CZ  . ARG B 1 94  ? 37.477  17.326  71.272   1.00 10.00 ? ? ? ? ? ? 95  ARG B CZ  1 
ATOM 3646  N NH1 . ARG B 1 94  ? 36.868  16.297  70.633   1.00 10.00 ? ? ? ? ? ? 95  ARG B NH1 1 
ATOM 3647  N NH2 . ARG B 1 94  ? 38.794  17.524  71.143   1.00 10.00 ? ? ? ? ? ? 95  ARG B NH2 1 
ATOM 3648  N N   . VAL B 1 95  ? 35.963  14.672  77.158   1.00 10.00 ? ? ? ? ? ? 96  VAL B N   1 
ATOM 3649  C CA  . VAL B 1 95  ? 36.440  14.066  78.366   1.00 10.00 ? ? ? ? ? ? 96  VAL B CA  1 
ATOM 3650  C C   . VAL B 1 95  ? 36.827  12.597  78.111   1.00 10.00 ? ? ? ? ? ? 96  VAL B C   1 
ATOM 3651  O O   . VAL B 1 95  ? 36.506  11.948  77.097   1.00 10.00 ? ? ? ? ? ? 96  VAL B O   1 
ATOM 3652  C CB  . VAL B 1 95  ? 35.260  14.289  79.411   1.00 10.00 ? ? ? ? ? ? 96  VAL B CB  1 
ATOM 3653  C CG1 . VAL B 1 95  ? 34.607  13.002  79.928   1.00 10.00 ? ? ? ? ? ? 96  VAL B CG1 1 
ATOM 3654  C CG2 . VAL B 1 95  ? 35.851  15.159  80.512   1.00 10.00 ? ? ? ? ? ? 96  VAL B CG2 1 
ATOM 3655  N N   . ALA B 1 96  ? 37.537  12.078  79.104   1.00 10.00 ? ? ? ? ? ? 97  ALA B N   1 
ATOM 3656  C CA  . ALA B 1 96  ? 37.993  10.730  79.056   1.00 10.00 ? ? ? ? ? ? 97  ALA B CA  1 
ATOM 3657  C C   . ALA B 1 96  ? 37.304  10.043  80.196   1.00 10.00 ? ? ? ? ? ? 97  ALA B C   1 
ATOM 3658  O O   . ALA B 1 96  ? 37.371  10.510  81.326   1.00 10.00 ? ? ? ? ? ? 97  ALA B O   1 
ATOM 3659  C CB  . ALA B 1 96  ? 39.480  10.740  79.244   1.00 10.00 ? ? ? ? ? ? 97  ALA B CB  1 
ATOM 3660  N N   . PRO B 1 97  ? 36.586  8.976   79.932   1.00 10.00 ? ? ? ? ? ? 98  PRO B N   1 
ATOM 3661  C CA  . PRO B 1 97  ? 35.804  8.290   80.933   1.00 10.00 ? ? ? ? ? ? 98  PRO B CA  1 
ATOM 3662  C C   . PRO B 1 97  ? 36.617  7.672   82.037   1.00 10.00 ? ? ? ? ? ? 98  PRO B C   1 
ATOM 3663  O O   . PRO B 1 97  ? 36.186  7.778   83.189   1.00 10.00 ? ? ? ? ? ? 98  PRO B O   1 
ATOM 3664  C CB  . PRO B 1 97  ? 34.978  7.277   80.163   1.00 10.00 ? ? ? ? ? ? 98  PRO B CB  1 
ATOM 3665  C CG  . PRO B 1 97  ? 34.748  8.026   78.861   1.00 10.00 ? ? ? ? ? ? 98  PRO B CG  1 
ATOM 3666  C CD  . PRO B 1 97  ? 36.125  8.599   78.603   1.00 10.00 ? ? ? ? ? ? 98  PRO B CD  1 
ATOM 3667  N N   . GLU B 1 98  ? 37.847  7.197   81.759   1.00 10.00 ? ? ? ? ? ? 99  GLU B N   1 
ATOM 3668  C CA  . GLU B 1 98  ? 38.679  6.490   82.755   1.00 10.00 ? ? ? ? ? ? 99  GLU B CA  1 
ATOM 3669  C C   . GLU B 1 98  ? 39.448  7.237   83.849   1.00 10.00 ? ? ? ? ? ? 99  GLU B C   1 
ATOM 3670  O O   . GLU B 1 98  ? 40.226  6.667   84.629   1.00 10.00 ? ? ? ? ? ? 99  GLU B O   1 
ATOM 3671  C CB  . GLU B 1 98  ? 39.683  5.616   82.038   1.00 10.00 ? ? ? ? ? ? 99  GLU B CB  1 
ATOM 3672  C CG  . GLU B 1 98  ? 40.515  6.252   80.973   1.00 10.00 ? ? ? ? ? ? 99  GLU B CG  1 
ATOM 3673  C CD  . GLU B 1 98  ? 39.923  6.166   79.586   1.00 10.00 ? ? ? ? ? ? 99  GLU B CD  1 
ATOM 3674  O OE1 . GLU B 1 98  ? 38.768  5.770   79.407   1.00 10.00 ? ? ? ? ? ? 99  GLU B OE1 1 
ATOM 3675  O OE2 . GLU B 1 98  ? 40.645  6.499   78.648   1.00 10.00 ? ? ? ? ? ? 99  GLU B OE2 1 
ATOM 3676  N N   . GLU B 1 99  ? 39.123  8.526   83.926   1.00 10.00 ? ? ? ? ? ? 100 GLU B N   1 
ATOM 3677  C CA  . GLU B 1 99  ? 39.733  9.490   84.820   1.00 10.00 ? ? ? ? ? ? 100 GLU B CA  1 
ATOM 3678  C C   . GLU B 1 99  ? 38.692  10.247  85.672   1.00 10.00 ? ? ? ? ? ? 100 GLU B C   1 
ATOM 3679  O O   . GLU B 1 99  ? 39.053  11.106  86.489   1.00 10.00 ? ? ? ? ? ? 100 GLU B O   1 
ATOM 3680  C CB  . GLU B 1 99  ? 40.493  10.472  83.955   1.00 10.00 ? ? ? ? ? ? 100 GLU B CB  1 
ATOM 3681  C CG  . GLU B 1 99  ? 41.564  9.880   83.085   1.00 10.00 ? ? ? ? ? ? 100 GLU B CG  1 
ATOM 3682  C CD  . GLU B 1 99  ? 42.082  10.736  81.938   1.00 10.00 ? ? ? ? ? ? 100 GLU B CD  1 
ATOM 3683  O OE1 . GLU B 1 99  ? 42.285  11.954  82.087   1.00 10.00 ? ? ? ? ? ? 100 GLU B OE1 1 
ATOM 3684  O OE2 . GLU B 1 99  ? 42.309  10.151  80.869   1.00 10.00 ? ? ? ? ? ? 100 GLU B OE2 1 
ATOM 3685  N N   . HIS B 1 100 ? 37.371  10.056  85.459   1.00 10.00 ? ? ? ? ? ? 101 HIS B N   1 
ATOM 3686  C CA  . HIS B 1 100 ? 36.310  10.827  86.129   1.00 10.00 ? ? ? ? ? ? 101 HIS B CA  1 
ATOM 3687  C C   . HIS B 1 100 ? 35.289  9.839   86.622   1.00 10.00 ? ? ? ? ? ? 101 HIS B C   1 
ATOM 3688  O O   . HIS B 1 100 ? 34.960  8.858   85.946   1.00 10.00 ? ? ? ? ? ? 101 HIS B O   1 
ATOM 3689  C CB  . HIS B 1 100 ? 35.571  11.784  85.201   1.00 10.00 ? ? ? ? ? ? 101 HIS B CB  1 
ATOM 3690  C CG  . HIS B 1 100 ? 36.467  12.892  84.673   1.00 10.00 ? ? ? ? ? ? 101 HIS B CG  1 
ATOM 3691  N ND1 . HIS B 1 100 ? 36.633  14.110  85.184   1.00 10.00 ? ? ? ? ? ? 101 HIS B ND1 1 
ATOM 3692  C CD2 . HIS B 1 100 ? 37.332  12.770  83.603   1.00 10.00 ? ? ? ? ? ? 101 HIS B CD2 1 
ATOM 3693  C CE1 . HIS B 1 100 ? 37.579  14.723  84.485   1.00 10.00 ? ? ? ? ? ? 101 HIS B CE1 1 
ATOM 3694  N NE2 . HIS B 1 100 ? 37.998  13.910  83.538   1.00 10.00 ? ? ? ? ? ? 101 HIS B NE2 1 
ATOM 3695  N N   . PRO B 1 101 ? 34.845  9.970   87.857   1.00 10.00 ? ? ? ? ? ? 102 PRO B N   1 
ATOM 3696  C CA  . PRO B 1 101 ? 33.697  9.227   88.275   1.00 10.00 ? ? ? ? ? ? 102 PRO B CA  1 
ATOM 3697  C C   . PRO B 1 101 ? 32.443  9.812   87.628   1.00 10.00 ? ? ? ? ? ? 102 PRO B C   1 
ATOM 3698  O O   . PRO B 1 101 ? 32.409  11.009  87.308   1.00 10.00 ? ? ? ? ? ? 102 PRO B O   1 
ATOM 3699  C CB  . PRO B 1 101 ? 33.845  9.309   89.808   1.00 10.00 ? ? ? ? ? ? 102 PRO B CB  1 
ATOM 3700  C CG  . PRO B 1 101 ? 34.586  10.574  90.065   1.00 10.00 ? ? ? ? ? ? 102 PRO B CG  1 
ATOM 3701  C CD  . PRO B 1 101 ? 35.615  10.459  88.991   1.00 10.00 ? ? ? ? ? ? 102 PRO B CD  1 
ATOM 3702  N N   . VAL B 1 102 ? 31.433  8.996   87.346   1.00 10.00 ? ? ? ? ? ? 103 VAL B N   1 
ATOM 3703  C CA  . VAL B 1 102 ? 30.194  9.549   86.825   1.00 10.00 ? ? ? ? ? ? 103 VAL B CA  1 
ATOM 3704  C C   . VAL B 1 102 ? 28.972  9.382   87.737   1.00 10.00 ? ? ? ? ? ? 103 VAL B C   1 
ATOM 3705  O O   . VAL B 1 102 ? 28.799  8.363   88.440   1.00 10.00 ? ? ? ? ? ? 103 VAL B O   1 
ATOM 3706  C CB  . VAL B 1 102 ? 29.866  8.933   85.492   1.00 10.00 ? ? ? ? ? ? 103 VAL B CB  1 
ATOM 3707  C CG1 . VAL B 1 102 ? 30.992  9.287   84.530   1.00 10.00 ? ? ? ? ? ? 103 VAL B CG1 1 
ATOM 3708  C CG2 . VAL B 1 102 ? 29.685  7.434   85.618   1.00 10.00 ? ? ? ? ? ? 103 VAL B CG2 1 
ATOM 3709  N N   . LEU B 1 103 ? 28.137  10.420  87.863   1.00 10.00 ? ? ? ? ? ? 104 LEU B N   1 
ATOM 3710  C CA  . LEU B 1 103 ? 26.917  10.194  88.578   1.00 10.00 ? ? ? ? ? ? 104 LEU B CA  1 
ATOM 3711  C C   . LEU B 1 103 ? 25.927  10.100  87.436   1.00 10.00 ? ? ? ? ? ? 104 LEU B C   1 
ATOM 3712  O O   . LEU B 1 103 ? 25.811  11.039  86.643   1.00 10.00 ? ? ? ? ? ? 104 LEU B O   1 
ATOM 3713  C CB  . LEU B 1 103 ? 26.609  11.362  89.522   1.00 10.00 ? ? ? ? ? ? 104 LEU B CB  1 
ATOM 3714  C CG  . LEU B 1 103 ? 25.297  11.199  90.391   1.00 10.00 ? ? ? ? ? ? 104 LEU B CG  1 
ATOM 3715  C CD1 . LEU B 1 103 ? 25.597  11.433  91.870   1.00 10.00 ? ? ? ? ? ? 104 LEU B CD1 1 
ATOM 3716  C CD2 . LEU B 1 103 ? 24.216  12.162  89.885   1.00 10.00 ? ? ? ? ? ? 104 LEU B CD2 1 
ATOM 3717  N N   . LEU B 1 104 ? 25.223  9.007   87.210   1.00 10.00 ? ? ? ? ? ? 105 LEU B N   1 
ATOM 3718  C CA  . LEU B 1 104 ? 24.270  8.935   86.096   1.00 10.00 ? ? ? ? ? ? 105 LEU B CA  1 
ATOM 3719  C C   . LEU B 1 104 ? 22.910  9.115   86.713   1.00 10.00 ? ? ? ? ? ? 105 LEU B C   1 
ATOM 3720  O O   . LEU B 1 104 ? 22.756  8.541   87.788   1.00 10.00 ? ? ? ? ? ? 105 LEU B O   1 
ATOM 3721  C CB  . LEU B 1 104 ? 24.231  7.586   85.435   1.00 10.00 ? ? ? ? ? ? 105 LEU B CB  1 
ATOM 3722  C CG  . LEU B 1 104 ? 25.417  6.990   84.813   1.00 10.00 ? ? ? ? ? ? 105 LEU B CG  1 
ATOM 3723  C CD1 . LEU B 1 104 ? 24.989  5.633   84.396   1.00 10.00 ? ? ? ? ? ? 105 LEU B CD1 1 
ATOM 3724  C CD2 . LEU B 1 104 ? 25.849  7.700   83.563   1.00 10.00 ? ? ? ? ? ? 105 LEU B CD2 1 
ATOM 3725  N N   . THR B 1 105 ? 21.905  9.834   86.257   1.00 10.00 ? ? ? ? ? ? 106 THR B N   1 
ATOM 3726  C CA  . THR B 1 105 ? 20.668  9.709   87.011   1.00 10.00 ? ? ? ? ? ? 106 THR B CA  1 
ATOM 3727  C C   . THR B 1 105 ? 19.770  8.630   86.457   1.00 10.00 ? ? ? ? ? ? 106 THR B C   1 
ATOM 3728  O O   . THR B 1 105 ? 19.987  8.114   85.361   1.00 10.00 ? ? ? ? ? ? 106 THR B O   1 
ATOM 3729  C CB  . THR B 1 105 ? 19.967  11.040  87.048   1.00 10.00 ? ? ? ? ? ? 106 THR B CB  1 
ATOM 3730  O OG1 . THR B 1 105 ? 19.780  11.446  85.695   1.00 10.00 ? ? ? ? ? ? 106 THR B OG1 1 
ATOM 3731  C CG2 . THR B 1 105 ? 20.747  12.076  87.809   1.00 10.00 ? ? ? ? ? ? 106 THR B CG2 1 
ATOM 3732  N N   . GLU B 1 106 ? 18.727  8.270   87.169   1.00 10.00 ? ? ? ? ? ? 107 GLU B N   1 
ATOM 3733  C CA  . GLU B 1 106 ? 17.817  7.234   86.724   1.00 10.00 ? ? ? ? ? ? 107 GLU B CA  1 
ATOM 3734  C C   . GLU B 1 106 ? 16.348  7.492   87.113   1.00 10.00 ? ? ? ? ? ? 107 GLU B C   1 
ATOM 3735  O O   . GLU B 1 106 ? 16.068  8.332   87.965   1.00 10.00 ? ? ? ? ? ? 107 GLU B O   1 
ATOM 3736  C CB  . GLU B 1 106 ? 18.265  5.916   87.309   1.00 10.00 ? ? ? ? ? ? 107 GLU B CB  1 
ATOM 3737  C CG  . GLU B 1 106 ? 18.307  5.947   88.853   1.00 10.00 ? ? ? ? ? ? 107 GLU B CG  1 
ATOM 3738  C CD  . GLU B 1 106 ? 18.042  4.625   89.529   1.00 10.00 ? ? ? ? ? ? 107 GLU B CD  1 
ATOM 3739  O OE1 . GLU B 1 106 ? 17.935  3.604   88.875   1.00 10.00 ? ? ? ? ? ? 107 GLU B OE1 1 
ATOM 3740  O OE2 . GLU B 1 106 ? 17.913  4.621   90.733   1.00 10.00 ? ? ? ? ? ? 107 GLU B OE2 1 
ATOM 3741  N N   . ALA B 1 107 ? 15.390  6.897   86.424   1.00 10.00 ? ? ? ? ? ? 108 ALA B N   1 
ATOM 3742  C CA  . ALA B 1 107 ? 13.986  7.002   86.738   1.00 10.00 ? ? ? ? ? ? 108 ALA B CA  1 
ATOM 3743  C C   . ALA B 1 107 ? 13.655  6.455   88.107   1.00 10.00 ? ? ? ? ? ? 108 ALA B C   1 
ATOM 3744  O O   . ALA B 1 107 ? 14.211  5.424   88.489   1.00 10.00 ? ? ? ? ? ? 108 ALA B O   1 
ATOM 3745  C CB  . ALA B 1 107 ? 13.154  6.217   85.742   1.00 10.00 ? ? ? ? ? ? 108 ALA B CB  1 
ATOM 3746  N N   . PRO B 1 108 ? 12.758  7.077   88.886   1.00 10.00 ? ? ? ? ? ? 109 PRO B N   1 
ATOM 3747  C CA  . PRO B 1 108 ? 12.061  6.445   90.012   1.00 10.00 ? ? ? ? ? ? 109 PRO B CA  1 
ATOM 3748  C C   . PRO B 1 108 ? 11.479  5.130   89.534   1.00 10.00 ? ? ? ? ? ? 109 PRO B C   1 
ATOM 3749  O O   . PRO B 1 108 ? 10.811  5.091   88.478   1.00 10.00 ? ? ? ? ? ? 109 PRO B O   1 
ATOM 3750  C CB  . PRO B 1 108 ? 10.970  7.393   90.400   1.00 10.00 ? ? ? ? ? ? 109 PRO B CB  1 
ATOM 3751  C CG  . PRO B 1 108 ? 11.407  8.720   89.823   1.00 10.00 ? ? ? ? ? ? 109 PRO B CG  1 
ATOM 3752  C CD  . PRO B 1 108 ? 12.203  8.400   88.582   1.00 10.00 ? ? ? ? ? ? 109 PRO B CD  1 
ATOM 3753  N N   . LEU B 1 109 ? 11.611  4.103   90.352   1.00 10.00 ? ? ? ? ? ? 110 LEU B N   1 
ATOM 3754  C CA  . LEU B 1 109 ? 11.154  2.760   90.010   1.00 10.00 ? ? ? ? ? ? 110 LEU B CA  1 
ATOM 3755  C C   . LEU B 1 109 ? 11.820  2.138   88.736   1.00 10.00 ? ? ? ? ? ? 110 LEU B C   1 
ATOM 3756  O O   . LEU B 1 109 ? 11.246  1.273   88.053   1.00 10.00 ? ? ? ? ? ? 110 LEU B O   1 
ATOM 3757  C CB  . LEU B 1 109 ? 9.617   2.774   89.852   1.00 10.00 ? ? ? ? ? ? 110 LEU B CB  1 
ATOM 3758  C CG  . LEU B 1 109 ? 8.573   2.826   90.980   1.00 10.00 ? ? ? ? ? ? 110 LEU B CG  1 
ATOM 3759  C CD1 . LEU B 1 109 ? 7.331   3.449   90.380   1.00 10.00 ? ? ? ? ? ? 110 LEU B CD1 1 
ATOM 3760  C CD2 . LEU B 1 109 ? 8.140   1.466   91.491   1.00 10.00 ? ? ? ? ? ? 110 LEU B CD2 1 
ATOM 3761  N N   . ASN B 1 110 ? 13.069  2.509   88.377   1.00 10.00 ? ? ? ? ? ? 111 ASN B N   1 
ATOM 3762  C CA  . ASN B 1 110 ? 13.770  1.969   87.191   1.00 10.00 ? ? ? ? ? ? 111 ASN B CA  1 
ATOM 3763  C C   . ASN B 1 110 ? 13.968  0.460   87.328   1.00 10.00 ? ? ? ? ? ? 111 ASN B C   1 
ATOM 3764  O O   . ASN B 1 110 ? 14.433  0.016   88.399   1.00 10.00 ? ? ? ? ? ? 111 ASN B O   1 
ATOM 3765  C CB  . ASN B 1 110 ? 15.099  2.667   87.079   1.00 10.00 ? ? ? ? ? ? 111 ASN B CB  1 
ATOM 3766  C CG  . ASN B 1 110 ? 16.018  2.258   85.947   1.00 10.00 ? ? ? ? ? ? 111 ASN B CG  1 
ATOM 3767  O OD1 . ASN B 1 110 ? 15.645  1.837   84.866   1.00 10.00 ? ? ? ? ? ? 111 ASN B OD1 1 
ATOM 3768  N ND2 . ASN B 1 110 ? 17.308  2.464   86.075   1.00 10.00 ? ? ? ? ? ? 111 ASN B ND2 1 
ATOM 3769  N N   . PRO B 1 111 ? 13.587  -0.389  86.371   1.00 10.00 ? ? ? ? ? ? 112 PRO B N   1 
ATOM 3770  C CA  . PRO B 1 111 ? 13.760  -1.825  86.473   1.00 10.00 ? ? ? ? ? ? 112 PRO B CA  1 
ATOM 3771  C C   . PRO B 1 111 ? 15.137  -2.311  86.923   1.00 10.00 ? ? ? ? ? ? 112 PRO B C   1 
ATOM 3772  O O   . PRO B 1 111 ? 16.149  -1.725  86.578   1.00 10.00 ? ? ? ? ? ? 112 PRO B O   1 
ATOM 3773  C CB  . PRO B 1 111 ? 13.344  -2.284  85.101   1.00 10.00 ? ? ? ? ? ? 112 PRO B CB  1 
ATOM 3774  C CG  . PRO B 1 111 ? 12.242  -1.298  84.755   1.00 10.00 ? ? ? ? ? ? 112 PRO B CG  1 
ATOM 3775  C CD  . PRO B 1 111 ? 12.885  -0.007  85.155   1.00 10.00 ? ? ? ? ? ? 112 PRO B CD  1 
ATOM 3776  N N   . LYS B 1 112 ? 15.212  -3.353  87.747   1.00 10.00 ? ? ? ? ? ? 113 LYS B N   1 
ATOM 3777  C CA  . LYS B 1 112 ? 16.420  -4.009  88.252   1.00 10.00 ? ? ? ? ? ? 113 LYS B CA  1 
ATOM 3778  C C   . LYS B 1 112 ? 17.536  -4.183  87.262   1.00 10.00 ? ? ? ? ? ? 113 LYS B C   1 
ATOM 3779  O O   . LYS B 1 112 ? 18.660  -3.760  87.511   1.00 10.00 ? ? ? ? ? ? 113 LYS B O   1 
ATOM 3780  C CB  . LYS B 1 112 ? 16.209  -5.429  88.722   1.00 10.00 ? ? ? ? ? ? 113 LYS B CB  1 
ATOM 3781  C CG  . LYS B 1 112 ? 15.271  -5.681  89.847   1.00 10.00 ? ? ? ? ? ? 113 LYS B CG  1 
ATOM 3782  C CD  . LYS B 1 112 ? 15.957  -5.364  91.150   1.00 10.00 ? ? ? ? ? ? 113 LYS B CD  1 
ATOM 3783  C CE  . LYS B 1 112 ? 15.497  -6.483  92.071   1.00 10.00 ? ? ? ? ? ? 113 LYS B CE  1 
ATOM 3784  N NZ  . LYS B 1 112 ? 14.073  -6.458  92.401   1.00 10.00 ? ? ? ? ? ? 113 LYS B NZ  1 
ATOM 3785  N N   . ALA B 1 113 ? 17.232  -4.859  86.164   1.00 10.00 ? ? ? ? ? ? 114 ALA B N   1 
ATOM 3786  C CA  . ALA B 1 113 ? 18.198  -5.197  85.151   1.00 10.00 ? ? ? ? ? ? 114 ALA B CA  1 
ATOM 3787  C C   . ALA B 1 113 ? 18.706  -3.983  84.400   1.00 10.00 ? ? ? ? ? ? 114 ALA B C   1 
ATOM 3788  O O   . ALA B 1 113 ? 19.773  -4.030  83.802   1.00 10.00 ? ? ? ? ? ? 114 ALA B O   1 
ATOM 3789  C CB  . ALA B 1 113 ? 17.543  -6.167  84.209   1.00 10.00 ? ? ? ? ? ? 114 ALA B CB  1 
ATOM 3790  N N   . ASN B 1 114 ? 17.965  -2.888  84.434   1.00 10.00 ? ? ? ? ? ? 115 ASN B N   1 
ATOM 3791  C CA  . ASN B 1 114 ? 18.401  -1.658  83.827   1.00 10.00 ? ? ? ? ? ? 115 ASN B CA  1 
ATOM 3792  C C   . ASN B 1 114 ? 19.474  -1.087  84.648   1.00 10.00 ? ? ? ? ? ? 115 ASN B C   1 
ATOM 3793  O O   . ASN B 1 114 ? 20.482  -0.740  84.068   1.00 10.00 ? ? ? ? ? ? 115 ASN B O   1 
ATOM 3794  C CB  . ASN B 1 114 ? 17.326  -0.592  83.731   1.00 10.00 ? ? ? ? ? ? 115 ASN B CB  1 
ATOM 3795  C CG  . ASN B 1 114 ? 16.249  -1.124  82.797   1.00 10.00 ? ? ? ? ? ? 115 ASN B CG  1 
ATOM 3796  O OD1 . ASN B 1 114 ? 15.791  -2.245  83.003   1.00 10.00 ? ? ? ? ? ? 115 ASN B OD1 1 
ATOM 3797  N ND2 . ASN B 1 114 ? 15.744  -0.510  81.747   1.00 10.00 ? ? ? ? ? ? 115 ASN B ND2 1 
ATOM 3798  N N   . ARG B 1 115 ? 19.309  -1.020  85.967   1.00 10.00 ? ? ? ? ? ? 116 ARG B N   1 
ATOM 3799  C CA  . ARG B 1 115 ? 20.312  -0.472  86.884   1.00 10.00 ? ? ? ? ? ? 116 ARG B CA  1 
ATOM 3800  C C   . ARG B 1 115 ? 21.607  -1.227  86.712   1.00 10.00 ? ? ? ? ? ? 116 ARG B C   1 
ATOM 3801  O O   . ARG B 1 115 ? 22.686  -0.659  86.564   1.00 10.00 ? ? ? ? ? ? 116 ARG B O   1 
ATOM 3802  C CB  . ARG B 1 115 ? 19.820  -0.627  88.273   1.00 10.00 ? ? ? ? ? ? 116 ARG B CB  1 
ATOM 3803  C CG  . ARG B 1 115 ? 18.725  0.354   88.529   1.00 10.00 ? ? ? ? ? ? 116 ARG B CG  1 
ATOM 3804  C CD  . ARG B 1 115 ? 17.949  0.183   89.843   1.00 10.00 ? ? ? ? ? ? 116 ARG B CD  1 
ATOM 3805  N NE  . ARG B 1 115 ? 18.586  0.083   91.169   1.00 10.00 ? ? ? ? ? ? 116 ARG B NE  1 
ATOM 3806  C CZ  . ARG B 1 115 ? 19.267  1.015   91.845   1.00 10.00 ? ? ? ? ? ? 116 ARG B CZ  1 
ATOM 3807  N NH1 . ARG B 1 115 ? 19.521  2.234   91.400   1.00 10.00 ? ? ? ? ? ? 116 ARG B NH1 1 
ATOM 3808  N NH2 . ARG B 1 115 ? 19.576  0.760   93.115   1.00 10.00 ? ? ? ? ? ? 116 ARG B NH2 1 
ATOM 3809  N N   . GLU B 1 116 ? 21.506  -2.544  86.616   1.00 10.00 ? ? ? ? ? ? 117 GLU B N   1 
ATOM 3810  C CA  . GLU B 1 116 ? 22.659  -3.401  86.381   1.00 10.00 ? ? ? ? ? ? 117 GLU B CA  1 
ATOM 3811  C C   . GLU B 1 116 ? 23.160  -3.144  84.995   1.00 10.00 ? ? ? ? ? ? 117 GLU B C   1 
ATOM 3812  O O   . GLU B 1 116 ? 24.362  -2.911  84.937   1.00 10.00 ? ? ? ? ? ? 117 GLU B O   1 
ATOM 3813  C CB  . GLU B 1 116 ? 22.372  -4.900  86.434   1.00 10.00 ? ? ? ? ? ? 117 GLU B CB  1 
ATOM 3814  C CG  . GLU B 1 116 ? 21.622  -5.361  87.666   1.00 10.00 ? ? ? ? ? ? 117 GLU B CG  1 
ATOM 3815  C CD  . GLU B 1 116 ? 21.598  -6.831  87.953   1.00 10.00 ? ? ? ? ? ? 117 GLU B CD  1 
ATOM 3816  O OE1 . GLU B 1 116 ? 22.303  -7.601  87.304   1.00 10.00 ? ? ? ? ? ? 117 GLU B OE1 1 
ATOM 3817  O OE2 . GLU B 1 116 ? 20.880  -7.191  88.878   1.00 10.00 ? ? ? ? ? ? 117 GLU B OE2 1 
ATOM 3818  N N   . LYS B 1 117 ? 22.398  -3.082  83.894   1.00 10.00 ? ? ? ? ? ? 118 LYS B N   1 
ATOM 3819  C CA  . LYS B 1 117 ? 23.065  -2.850  82.632   1.00 10.00 ? ? ? ? ? ? 118 LYS B CA  1 
ATOM 3820  C C   . LYS B 1 117 ? 23.757  -1.515  82.603   1.00 10.00 ? ? ? ? ? ? 118 LYS B C   1 
ATOM 3821  O O   . LYS B 1 117 ? 24.844  -1.473  82.032   1.00 10.00 ? ? ? ? ? ? 118 LYS B O   1 
ATOM 3822  C CB  . LYS B 1 117 ? 22.129  -2.900  81.455   1.00 10.00 ? ? ? ? ? ? 118 LYS B CB  1 
ATOM 3823  C CG  . LYS B 1 117 ? 22.963  -3.161  80.203   1.00 10.00 ? ? ? ? ? ? 118 LYS B CG  1 
ATOM 3824  C CD  . LYS B 1 117 ? 22.225  -4.173  79.335   1.00 10.00 ? ? ? ? ? ? 118 LYS B CD  1 
ATOM 3825  C CE  . LYS B 1 117 ? 22.936  -4.492  78.016   1.00 10.00 ? ? ? ? ? ? 118 LYS B CE  1 
ATOM 3826  N NZ  . LYS B 1 117 ? 23.369  -3.313  77.272   1.00 10.00 ? ? ? ? ? ? 118 LYS B NZ  1 
ATOM 3827  N N   . MET B 1 118 ? 23.288  -0.447  83.240   1.00 10.00 ? ? ? ? ? ? 119 MET B N   1 
ATOM 3828  C CA  . MET B 1 118 ? 24.054  0.768   83.170   1.00 10.00 ? ? ? ? ? ? 119 MET B CA  1 
ATOM 3829  C C   . MET B 1 118 ? 25.255  0.714   84.082   1.00 10.00 ? ? ? ? ? ? 119 MET B C   1 
ATOM 3830  O O   . MET B 1 118 ? 26.195  1.454   83.779   1.00 10.00 ? ? ? ? ? ? 119 MET B O   1 
ATOM 3831  C CB  . MET B 1 118 ? 23.194  1.941   83.498   1.00 10.00 ? ? ? ? ? ? 119 MET B CB  1 
ATOM 3832  C CG  . MET B 1 118 ? 22.966  2.385   84.907   1.00 10.00 ? ? ? ? ? ? 119 MET B CG  1 
ATOM 3833  S SD  . MET B 1 118 ? 21.994  3.924   84.816   1.00 10.00 ? ? ? ? ? ? 119 MET B SD  1 
ATOM 3834  C CE  . MET B 1 118 ? 20.462  3.043   84.740   1.00 10.00 ? ? ? ? ? ? 119 MET B CE  1 
ATOM 3835  N N   . THR B 1 119 ? 25.304  -0.125  85.146   1.00 10.00 ? ? ? ? ? ? 120 THR B N   1 
ATOM 3836  C CA  . THR B 1 119 ? 26.536  -0.368  85.920   1.00 10.00 ? ? ? ? ? ? 120 THR B CA  1 
ATOM 3837  C C   . THR B 1 119 ? 27.616  -1.114  85.093   1.00 10.00 ? ? ? ? ? ? 120 THR B C   1 
ATOM 3838  O O   . THR B 1 119 ? 28.807  -0.758  85.013   1.00 10.00 ? ? ? ? ? ? 120 THR B O   1 
ATOM 3839  C CB  . THR B 1 119 ? 26.231  -1.206  87.153   1.00 10.00 ? ? ? ? ? ? 120 THR B CB  1 
ATOM 3840  O OG1 . THR B 1 119 ? 25.220  -0.525  87.884   1.00 10.00 ? ? ? ? ? ? 120 THR B OG1 1 
ATOM 3841  C CG2 . THR B 1 119 ? 27.471  -1.392  88.022   1.00 10.00 ? ? ? ? ? ? 120 THR B CG2 1 
ATOM 3842  N N   . GLN B 1 120 ? 27.129  -2.175  84.470   1.00 10.00 ? ? ? ? ? ? 121 GLN B N   1 
ATOM 3843  C CA  . GLN B 1 120 ? 27.791  -2.990  83.480   1.00 10.00 ? ? ? ? ? ? 121 GLN B CA  1 
ATOM 3844  C C   . GLN B 1 120 ? 28.511  -2.157  82.443   1.00 10.00 ? ? ? ? ? ? 121 GLN B C   1 
ATOM 3845  O O   . GLN B 1 120 ? 29.747  -2.177  82.503   1.00 10.00 ? ? ? ? ? ? 121 GLN B O   1 
ATOM 3846  C CB  . GLN B 1 120 ? 26.726  -3.823  82.828   1.00 10.00 ? ? ? ? ? ? 121 GLN B CB  1 
ATOM 3847  C CG  . GLN B 1 120 ? 27.088  -4.833  81.808   1.00 10.00 ? ? ? ? ? ? 121 GLN B CG  1 
ATOM 3848  C CD  . GLN B 1 120 ? 27.026  -6.132  82.544   1.00 10.00 ? ? ? ? ? ? 121 GLN B CD  1 
ATOM 3849  O OE1 . GLN B 1 120 ? 26.016  -6.597  83.105   1.00 10.00 ? ? ? ? ? ? 121 GLN B OE1 1 
ATOM 3850  N NE2 . GLN B 1 120 ? 28.240  -6.658  82.539   1.00 10.00 ? ? ? ? ? ? 121 GLN B NE2 1 
ATOM 3851  N N   . ILE B 1 121 ? 27.784  -1.442  81.530   1.00 10.00 ? ? ? ? ? ? 122 ILE B N   1 
ATOM 3852  C CA  . ILE B 1 121 ? 28.338  -0.591  80.455   1.00 10.00 ? ? ? ? ? ? 122 ILE B CA  1 
ATOM 3853  C C   . ILE B 1 121 ? 29.393  0.408   80.957   1.00 10.00 ? ? ? ? ? ? 122 ILE B C   1 
ATOM 3854  O O   . ILE B 1 121 ? 30.559  0.482   80.498   1.00 10.00 ? ? ? ? ? ? 122 ILE B O   1 
ATOM 3855  C CB  . ILE B 1 121 ? 27.161  0.205   79.716   1.00 10.00 ? ? ? ? ? ? 122 ILE B CB  1 
ATOM 3856  C CG1 . ILE B 1 121 ? 26.454  -0.795  78.827   1.00 10.00 ? ? ? ? ? ? 122 ILE B CG1 1 
ATOM 3857  C CG2 . ILE B 1 121 ? 27.623  1.411   78.847   1.00 10.00 ? ? ? ? ? ? 122 ILE B CG2 1 
ATOM 3858  C CD1 . ILE B 1 121 ? 25.052  -0.335  78.482   1.00 10.00 ? ? ? ? ? ? 122 ILE B CD1 1 
ATOM 3859  N N   . MET B 1 122 ? 28.951  1.172   81.960   1.00 10.00 ? ? ? ? ? ? 123 MET B N   1 
ATOM 3860  C CA  . MET B 1 122 ? 29.795  2.196   82.510   1.00 10.00 ? ? ? ? ? ? 123 MET B CA  1 
ATOM 3861  C C   . MET B 1 122 ? 31.079  1.581   82.928   1.00 10.00 ? ? ? ? ? ? 123 MET B C   1 
ATOM 3862  O O   . MET B 1 122 ? 32.083  2.071   82.414   1.00 10.00 ? ? ? ? ? ? 123 MET B O   1 
ATOM 3863  C CB  . MET B 1 122 ? 29.085  2.861   83.664   1.00 10.00 ? ? ? ? ? ? 123 MET B CB  1 
ATOM 3864  C CG  . MET B 1 122 ? 28.087  3.891   83.113   1.00 10.00 ? ? ? ? ? ? 123 MET B CG  1 
ATOM 3865  S SD  . MET B 1 122 ? 28.920  5.369   82.482   1.00 10.00 ? ? ? ? ? ? 123 MET B SD  1 
ATOM 3866  C CE  . MET B 1 122 ? 28.067  5.541   80.944   1.00 10.00 ? ? ? ? ? ? 123 MET B CE  1 
ATOM 3867  N N   . PHE B 1 123 ? 31.106  0.437   83.631   1.00 10.00 ? ? ? ? ? ? 124 PHE B N   1 
ATOM 3868  C CA  . PHE B 1 123 ? 32.399  -0.106  84.066   1.00 10.00 ? ? ? ? ? ? 124 PHE B CA  1 
ATOM 3869  C C   . PHE B 1 123 ? 33.245  -0.831  83.058   1.00 10.00 ? ? ? ? ? ? 124 PHE B C   1 
ATOM 3870  O O   . PHE B 1 123 ? 34.421  -0.502  82.899   1.00 10.00 ? ? ? ? ? ? 124 PHE B O   1 
ATOM 3871  C CB  . PHE B 1 123 ? 32.274  -1.057  85.263   1.00 10.00 ? ? ? ? ? ? 124 PHE B CB  1 
ATOM 3872  C CG  . PHE B 1 123 ? 32.171  -0.261  86.535   1.00 10.00 ? ? ? ? ? ? 124 PHE B CG  1 
ATOM 3873  C CD1 . PHE B 1 123 ? 33.152  0.615   86.865   1.00 10.00 ? ? ? ? ? ? 124 PHE B CD1 1 
ATOM 3874  C CD2 . PHE B 1 123 ? 31.071  -0.397  87.313   1.00 10.00 ? ? ? ? ? ? 124 PHE B CD2 1 
ATOM 3875  C CE1 . PHE B 1 123 ? 33.025  1.357   87.978   1.00 10.00 ? ? ? ? ? ? 124 PHE B CE1 1 
ATOM 3876  C CE2 . PHE B 1 123 ? 30.948  0.355   88.436   1.00 10.00 ? ? ? ? ? ? 124 PHE B CE2 1 
ATOM 3877  C CZ  . PHE B 1 123 ? 31.926  1.223   88.758   1.00 10.00 ? ? ? ? ? ? 124 PHE B CZ  1 
ATOM 3878  N N   . GLU B 1 124 ? 32.640  -1.772  82.359   1.00 10.00 ? ? ? ? ? ? 125 GLU B N   1 
ATOM 3879  C CA  . GLU B 1 124 ? 33.336  -2.576  81.375   1.00 10.00 ? ? ? ? ? ? 125 GLU B CA  1 
ATOM 3880  C C   . GLU B 1 124 ? 33.595  -1.890  80.037   1.00 10.00 ? ? ? ? ? ? 125 GLU B C   1 
ATOM 3881  O O   . GLU B 1 124 ? 34.690  -2.032  79.478   1.00 10.00 ? ? ? ? ? ? 125 GLU B O   1 
ATOM 3882  C CB  . GLU B 1 124 ? 32.532  -3.824  81.149   1.00 10.00 ? ? ? ? ? ? 125 GLU B CB  1 
ATOM 3883  C CG  . GLU B 1 124 ? 32.432  -4.693  82.371   1.00 10.00 ? ? ? ? ? ? 125 GLU B CG  1 
ATOM 3884  C CD  . GLU B 1 124 ? 31.573  -5.914  82.133   1.00 10.00 ? ? ? ? ? ? 125 GLU B CD  1 
ATOM 3885  O OE1 . GLU B 1 124 ? 31.065  -6.102  81.028   1.00 10.00 ? ? ? ? ? ? 125 GLU B OE1 1 
ATOM 3886  O OE2 . GLU B 1 124 ? 31.373  -6.697  83.057   1.00 10.00 ? ? ? ? ? ? 125 GLU B OE2 1 
ATOM 3887  N N   . THR B 1 125 ? 32.572  -1.178  79.519   1.00 10.00 ? ? ? ? ? ? 126 THR B N   1 
ATOM 3888  C CA  . THR B 1 125 ? 32.620  -0.495  78.242   1.00 10.00 ? ? ? ? ? ? 126 THR B CA  1 
ATOM 3889  C C   . THR B 1 125 ? 33.244  0.845   78.400   1.00 10.00 ? ? ? ? ? ? 126 THR B C   1 
ATOM 3890  O O   . THR B 1 125 ? 33.957  1.172   77.473   1.00 10.00 ? ? ? ? ? ? 126 THR B O   1 
ATOM 3891  C CB  . THR B 1 125 ? 31.215  -0.335  77.678   1.00 10.00 ? ? ? ? ? ? 126 THR B CB  1 
ATOM 3892  O OG1 . THR B 1 125 ? 30.658  -1.678  77.687   1.00 10.00 ? ? ? ? ? ? 126 THR B OG1 1 
ATOM 3893  C CG2 . THR B 1 125 ? 31.190  0.400   76.312   1.00 10.00 ? ? ? ? ? ? 126 THR B CG2 1 
ATOM 3894  N N   . PHE B 1 126 ? 33.026  1.672   79.439   1.00 10.00 ? ? ? ? ? ? 127 PHE B N   1 
ATOM 3895  C CA  . PHE B 1 126 ? 33.746  2.955   79.510   1.00 10.00 ? ? ? ? ? ? 127 PHE B CA  1 
ATOM 3896  C C   . PHE B 1 126 ? 34.878  3.036   80.507   1.00 10.00 ? ? ? ? ? ? 127 PHE B C   1 
ATOM 3897  O O   . PHE B 1 126 ? 35.634  4.016   80.523   1.00 10.00 ? ? ? ? ? ? 127 PHE B O   1 
ATOM 3898  C CB  . PHE B 1 126 ? 32.783  4.111   79.792   1.00 10.00 ? ? ? ? ? ? 127 PHE B CB  1 
ATOM 3899  C CG  . PHE B 1 126 ? 31.891  4.350   78.581   1.00 10.00 ? ? ? ? ? ? 127 PHE B CG  1 
ATOM 3900  C CD1 . PHE B 1 126 ? 32.428  4.790   77.384   1.00 10.00 ? ? ? ? ? ? 127 PHE B CD1 1 
ATOM 3901  C CD2 . PHE B 1 126 ? 30.531  4.101   78.653   1.00 10.00 ? ? ? ? ? ? 127 PHE B CD2 1 
ATOM 3902  C CE1 . PHE B 1 126 ? 31.586  4.963   76.294   1.00 10.00 ? ? ? ? ? ? 127 PHE B CE1 1 
ATOM 3903  C CE2 . PHE B 1 126 ? 29.688  4.279   77.556   1.00 10.00 ? ? ? ? ? ? 127 PHE B CE2 1 
ATOM 3904  C CZ  . PHE B 1 126 ? 30.220  4.710   76.369   1.00 10.00 ? ? ? ? ? ? 127 PHE B CZ  1 
ATOM 3905  N N   . ASN B 1 127 ? 35.049  1.970   81.302   1.00 10.00 ? ? ? ? ? ? 128 ASN B N   1 
ATOM 3906  C CA  . ASN B 1 127 ? 36.146  1.815   82.254   1.00 10.00 ? ? ? ? ? ? 128 ASN B CA  1 
ATOM 3907  C C   . ASN B 1 127 ? 36.211  3.027   83.136   1.00 10.00 ? ? ? ? ? ? 128 ASN B C   1 
ATOM 3908  O O   . ASN B 1 127 ? 37.133  3.836   83.097   1.00 10.00 ? ? ? ? ? ? 128 ASN B O   1 
ATOM 3909  C CB  . ASN B 1 127 ? 37.509  1.624   81.525   1.00 10.00 ? ? ? ? ? ? 128 ASN B CB  1 
ATOM 3910  C CG  . ASN B 1 127 ? 38.724  1.287   82.428   1.00 10.00 ? ? ? ? ? ? 128 ASN B CG  1 
ATOM 3911  O OD1 . ASN B 1 127 ? 38.821  0.195   83.004   1.00 10.00 ? ? ? ? ? ? 128 ASN B OD1 1 
ATOM 3912  N ND2 . ASN B 1 127 ? 39.700  2.182   82.634   1.00 10.00 ? ? ? ? ? ? 128 ASN B ND2 1 
ATOM 3913  N N   . THR B 1 128 ? 35.160  3.089   83.944   1.00 10.00 ? ? ? ? ? ? 129 THR B N   1 
ATOM 3914  C CA  . THR B 1 128 ? 34.888  4.241   84.809   1.00 10.00 ? ? ? ? ? ? 129 THR B CA  1 
ATOM 3915  C C   . THR B 1 128 ? 35.538  3.976   86.156   1.00 10.00 ? ? ? ? ? ? 129 THR B C   1 
ATOM 3916  O O   . THR B 1 128 ? 35.311  2.875   86.673   1.00 10.00 ? ? ? ? ? ? 129 THR B O   1 
ATOM 3917  C CB  . THR B 1 128 ? 33.305  4.492   85.020   1.00 10.00 ? ? ? ? ? ? 129 THR B CB  1 
ATOM 3918  O OG1 . THR B 1 128 ? 32.430  4.315   83.885   1.00 10.00 ? ? ? ? ? ? 129 THR B OG1 1 
ATOM 3919  C CG2 . THR B 1 128 ? 33.201  5.966   85.289   1.00 10.00 ? ? ? ? ? ? 129 THR B CG2 1 
ATOM 3920  N N   . PRO B 1 129 ? 36.300  4.900   86.764   1.00 10.00 ? ? ? ? ? ? 130 PRO B N   1 
ATOM 3921  C CA  . PRO B 1 129 ? 36.938  4.730   88.036   1.00 10.00 ? ? ? ? ? ? 130 PRO B CA  1 
ATOM 3922  C C   . PRO B 1 129 ? 35.910  4.362   89.089   1.00 10.00 ? ? ? ? ? ? 130 PRO B C   1 
ATOM 3923  O O   . PRO B 1 129 ? 36.221  3.546   89.968   1.00 10.00 ? ? ? ? ? ? 130 PRO B O   1 
ATOM 3924  C CB  . PRO B 1 129 ? 37.603  6.030   88.396   1.00 10.00 ? ? ? ? ? ? 130 PRO B CB  1 
ATOM 3925  C CG  . PRO B 1 129 ? 37.645  6.813   87.147   1.00 10.00 ? ? ? ? ? ? 130 PRO B CG  1 
ATOM 3926  C CD  . PRO B 1 129 ? 36.448  6.282   86.397   1.00 10.00 ? ? ? ? ? ? 130 PRO B CD  1 
ATOM 3927  N N   . ALA B 1 130 ? 34.690  4.943   88.962   1.00 10.00 ? ? ? ? ? ? 131 ALA B N   1 
ATOM 3928  C CA  . ALA B 1 130 ? 33.586  4.850   89.911   1.00 10.00 ? ? ? ? ? ? 131 ALA B CA  1 
ATOM 3929  C C   . ALA B 1 130 ? 32.309  5.413   89.331   1.00 10.00 ? ? ? ? ? ? 131 ALA B C   1 
ATOM 3930  O O   . ALA B 1 130 ? 32.292  6.243   88.420   1.00 10.00 ? ? ? ? ? ? 131 ALA B O   1 
ATOM 3931  C CB  . ALA B 1 130 ? 33.870  5.651   91.155   1.00 10.00 ? ? ? ? ? ? 131 ALA B CB  1 
ATOM 3932  N N   . MET B 1 131 ? 31.227  5.012   89.950   1.00 10.00 ? ? ? ? ? ? 132 MET B N   1 
ATOM 3933  C CA  . MET B 1 131 ? 29.976  5.528   89.528   1.00 10.00 ? ? ? ? ? ? 132 MET B CA  1 
ATOM 3934  C C   . MET B 1 131 ? 28.920  5.401   90.608   1.00 10.00 ? ? ? ? ? ? 132 MET B C   1 
ATOM 3935  O O   . MET B 1 131 ? 29.078  4.671   91.588   1.00 10.00 ? ? ? ? ? ? 132 MET B O   1 
ATOM 3936  C CB  . MET B 1 131 ? 29.589  4.795   88.177   1.00 10.00 ? ? ? ? ? ? 132 MET B CB  1 
ATOM 3937  C CG  . MET B 1 131 ? 29.097  3.357   87.942   1.00 10.00 ? ? ? ? ? ? 132 MET B CG  1 
ATOM 3938  S SD  . MET B 1 131 ? 27.338  2.993   88.170   1.00 10.00 ? ? ? ? ? ? 132 MET B SD  1 
ATOM 3939  C CE  . MET B 1 131 ? 26.975  3.884   86.706   1.00 10.00 ? ? ? ? ? ? 132 MET B CE  1 
ATOM 3940  N N   . TYR B 1 132 ? 27.877  6.238   90.466   1.00 10.00 ? ? ? ? ? ? 133 TYR B N   1 
ATOM 3941  C CA  . TYR B 1 132 ? 26.691  6.191   91.286   1.00 10.00 ? ? ? ? ? ? 133 TYR B CA  1 
ATOM 3942  C C   . TYR B 1 132 ? 25.493  6.515   90.354   1.00 10.00 ? ? ? ? ? ? 133 TYR B C   1 
ATOM 3943  O O   . TYR B 1 132 ? 25.599  7.199   89.309   1.00 10.00 ? ? ? ? ? ? 133 TYR B O   1 
ATOM 3944  C CB  . TYR B 1 132 ? 26.887  7.194   92.397   1.00 10.00 ? ? ? ? ? ? 133 TYR B CB  1 
ATOM 3945  C CG  . TYR B 1 132 ? 25.888  7.046   93.512   1.00 10.00 ? ? ? ? ? ? 133 TYR B CG  1 
ATOM 3946  C CD1 . TYR B 1 132 ? 26.080  6.122   94.510   1.00 10.00 ? ? ? ? ? ? 133 TYR B CD1 1 
ATOM 3947  C CD2 . TYR B 1 132 ? 24.766  7.842   93.503   1.00 10.00 ? ? ? ? ? ? 133 TYR B CD2 1 
ATOM 3948  C CE1 . TYR B 1 132 ? 25.132  5.996   95.500   1.00 10.00 ? ? ? ? ? ? 133 TYR B CE1 1 
ATOM 3949  C CE2 . TYR B 1 132 ? 23.833  7.722   94.483   1.00 10.00 ? ? ? ? ? ? 133 TYR B CE2 1 
ATOM 3950  C CZ  . TYR B 1 132 ? 24.014  6.799   95.472   1.00 10.00 ? ? ? ? ? ? 133 TYR B CZ  1 
ATOM 3951  O OH  . TYR B 1 132 ? 23.029  6.710   96.446   1.00 10.00 ? ? ? ? ? ? 133 TYR B OH  1 
ATOM 3952  N N   . VAL B 1 133 ? 24.351  5.947   90.755   1.00 10.00 ? ? ? ? ? ? 134 VAL B N   1 
ATOM 3953  C CA  . VAL B 1 133 ? 23.106  6.103   90.076   1.00 10.00 ? ? ? ? ? ? 134 VAL B CA  1 
ATOM 3954  C C   . VAL B 1 133 ? 22.130  6.636   91.136   1.00 10.00 ? ? ? ? ? ? 134 VAL B C   1 
ATOM 3955  O O   . VAL B 1 133 ? 21.676  5.984   92.066   1.00 10.00 ? ? ? ? ? ? 134 VAL B O   1 
ATOM 3956  C CB  . VAL B 1 133 ? 22.554  4.779   89.544   1.00 10.00 ? ? ? ? ? ? 134 VAL B CB  1 
ATOM 3957  C CG1 . VAL B 1 133 ? 21.605  5.193   88.504   1.00 10.00 ? ? ? ? ? ? 134 VAL B CG1 1 
ATOM 3958  C CG2 . VAL B 1 133 ? 23.514  3.866   88.832   1.00 10.00 ? ? ? ? ? ? 134 VAL B CG2 1 
ATOM 3959  N N   . ALA B 1 134 ? 21.759  7.889   90.987   1.00 10.00 ? ? ? ? ? ? 135 ALA B N   1 
ATOM 3960  C CA  . ALA B 1 134 ? 20.724  8.517   91.776   1.00 10.00 ? ? ? ? ? ? 135 ALA B CA  1 
ATOM 3961  C C   . ALA B 1 134 ? 19.356  8.678   91.013   1.00 10.00 ? ? ? ? ? ? 135 ALA B C   1 
ATOM 3962  O O   . ALA B 1 134 ? 19.247  8.902   89.784   1.00 10.00 ? ? ? ? ? ? 135 ALA B O   1 
ATOM 3963  C CB  . ALA B 1 134 ? 21.354  9.854   92.223   1.00 10.00 ? ? ? ? ? ? 135 ALA B CB  1 
ATOM 3964  N N   . ILE B 1 135 ? 18.237  8.481   91.725   1.00 10.00 ? ? ? ? ? ? 136 ILE B N   1 
ATOM 3965  C CA  . ILE B 1 135 ? 16.889  8.697   91.212   1.00 10.00 ? ? ? ? ? ? 136 ILE B CA  1 
ATOM 3966  C C   . ILE B 1 135 ? 16.778  10.173  90.930   1.00 10.00 ? ? ? ? ? ? 136 ILE B C   1 
ATOM 3967  O O   . ILE B 1 135 ? 17.251  10.964  91.743   1.00 10.00 ? ? ? ? ? ? 136 ILE B O   1 
ATOM 3968  C CB  . ILE B 1 135 ? 15.909  8.279   92.266   1.00 10.00 ? ? ? ? ? ? 136 ILE B CB  1 
ATOM 3969  C CG1 . ILE B 1 135 ? 15.889  6.750   92.316   1.00 10.00 ? ? ? ? ? ? 136 ILE B CG1 1 
ATOM 3970  C CG2 . ILE B 1 135 ? 14.543  8.890   91.993   1.00 10.00 ? ? ? ? ? ? 136 ILE B CG2 1 
ATOM 3971  C CD1 . ILE B 1 135 ? 15.253  6.115   93.626   1.00 10.00 ? ? ? ? ? ? 136 ILE B CD1 1 
ATOM 3972  N N   . GLN B 1 136 ? 16.093  10.628  89.887   1.00 10.00 ? ? ? ? ? ? 137 GLN B N   1 
ATOM 3973  C CA  . GLN B 1 136 ? 16.089  12.074  89.552   1.00 10.00 ? ? ? ? ? ? 137 GLN B CA  1 
ATOM 3974  C C   . GLN B 1 136 ? 15.408  12.993  90.510   1.00 10.00 ? ? ? ? ? ? 137 GLN B C   1 
ATOM 3975  O O   . GLN B 1 136 ? 15.964  14.039  90.751   1.00 10.00 ? ? ? ? ? ? 137 GLN B O   1 
ATOM 3976  C CB  . GLN B 1 136 ? 15.459  12.301  88.220   1.00 10.00 ? ? ? ? ? ? 137 GLN B CB  1 
ATOM 3977  C CG  . GLN B 1 136 ? 16.214  11.480  87.206   1.00 10.00 ? ? ? ? ? ? 137 GLN B CG  1 
ATOM 3978  C CD  . GLN B 1 136 ? 15.337  11.053  86.072   1.00 10.00 ? ? ? ? ? ? 137 GLN B CD  1 
ATOM 3979  O OE1 . GLN B 1 136 ? 14.388  11.786  85.739   1.00 10.00 ? ? ? ? ? ? 137 GLN B OE1 1 
ATOM 3980  N NE2 . GLN B 1 136 ? 15.678  9.977   85.377   1.00 10.00 ? ? ? ? ? ? 137 GLN B NE2 1 
ATOM 3981  N N   . ALA B 1 137 ? 14.228  12.623  91.080   1.00 10.00 ? ? ? ? ? ? 138 ALA B N   1 
ATOM 3982  C CA  . ALA B 1 137 ? 13.477  13.433  92.014   1.00 10.00 ? ? ? ? ? ? 138 ALA B CA  1 
ATOM 3983  C C   . ALA B 1 137 ? 14.252  13.728  93.286   1.00 10.00 ? ? ? ? ? ? 138 ALA B C   1 
ATOM 3984  O O   . ALA B 1 137 ? 14.172  14.816  93.864   1.00 10.00 ? ? ? ? ? ? 138 ALA B O   1 
ATOM 3985  C CB  . ALA B 1 137 ? 12.231  12.705  92.339   1.00 10.00 ? ? ? ? ? ? 138 ALA B CB  1 
ATOM 3986  N N   . VAL B 1 138 ? 15.069  12.810  93.769   1.00 10.00 ? ? ? ? ? ? 139 VAL B N   1 
ATOM 3987  C CA  . VAL B 1 138 ? 15.859  13.017  94.971   1.00 10.00 ? ? ? ? ? ? 139 VAL B CA  1 
ATOM 3988  C C   . VAL B 1 138 ? 16.923  14.096  94.768   1.00 10.00 ? ? ? ? ? ? 139 VAL B C   1 
ATOM 3989  O O   . VAL B 1 138 ? 17.269  14.768  95.740   1.00 10.00 ? ? ? ? ? ? 139 VAL B O   1 
ATOM 3990  C CB  . VAL B 1 138 ? 16.450  11.607  95.386   1.00 10.00 ? ? ? ? ? ? 139 VAL B CB  1 
ATOM 3991  C CG1 . VAL B 1 138 ? 17.471  11.736  96.475   1.00 10.00 ? ? ? ? ? ? 139 VAL B CG1 1 
ATOM 3992  C CG2 . VAL B 1 138 ? 15.364  10.731  96.002   1.00 10.00 ? ? ? ? ? ? 139 VAL B CG2 1 
ATOM 3993  N N   . LEU B 1 139 ? 17.458  14.343  93.568   1.00 10.00 ? ? ? ? ? ? 140 LEU B N   1 
ATOM 3994  C CA  . LEU B 1 139 ? 18.456  15.410  93.311   1.00 10.00 ? ? ? ? ? ? 140 LEU B CA  1 
ATOM 3995  C C   . LEU B 1 139 ? 17.722  16.735  93.111   1.00 10.00 ? ? ? ? ? ? 140 LEU B C   1 
ATOM 3996  O O   . LEU B 1 139 ? 18.283  17.795  93.445   1.00 10.00 ? ? ? ? ? ? 140 LEU B O   1 
ATOM 3997  C CB  . LEU B 1 139 ? 19.289  15.204  92.053   1.00 10.00 ? ? ? ? ? ? 140 LEU B CB  1 
ATOM 3998  C CG  . LEU B 1 139 ? 20.265  14.046  91.905   1.00 10.00 ? ? ? ? ? ? 140 LEU B CG  1 
ATOM 3999  C CD1 . LEU B 1 139 ? 19.540  12.776  92.135   1.00 10.00 ? ? ? ? ? ? 140 LEU B CD1 1 
ATOM 4000  C CD2 . LEU B 1 139 ? 20.781  13.919  90.485   1.00 10.00 ? ? ? ? ? ? 140 LEU B CD2 1 
ATOM 4001  N N   . SER B 1 140 ? 16.492  16.733  92.564   1.00 10.00 ? ? ? ? ? ? 141 SER B N   1 
ATOM 4002  C CA  . SER B 1 140 ? 15.633  17.910  92.619   1.00 10.00 ? ? ? ? ? ? 141 SER B CA  1 
ATOM 4003  C C   . SER B 1 140 ? 15.470  18.414  94.065   1.00 10.00 ? ? ? ? ? ? 141 SER B C   1 
ATOM 4004  O O   . SER B 1 140 ? 15.600  19.621  94.319   1.00 10.00 ? ? ? ? ? ? 141 SER B O   1 
ATOM 4005  C CB  . SER B 1 140 ? 14.250  17.586  92.103   1.00 10.00 ? ? ? ? ? ? 141 SER B CB  1 
ATOM 4006  O OG  . SER B 1 140 ? 14.292  17.184  90.734   1.00 10.00 ? ? ? ? ? ? 141 SER B OG  1 
ATOM 4007  N N   . LEU B 1 141 ? 15.199  17.519  95.036   1.00 10.00 ? ? ? ? ? ? 142 LEU B N   1 
ATOM 4008  C CA  . LEU B 1 141 ? 15.070  17.901  96.431   1.00 10.00 ? ? ? ? ? ? 142 LEU B CA  1 
ATOM 4009  C C   . LEU B 1 141 ? 16.328  18.477  97.138   1.00 10.00 ? ? ? ? ? ? 142 LEU B C   1 
ATOM 4010  O O   . LEU B 1 141 ? 16.335  19.548  97.793   1.00 10.00 ? ? ? ? ? ? 142 LEU B O   1 
ATOM 4011  C CB  . LEU B 1 141 ? 14.584  16.688  97.154   1.00 10.00 ? ? ? ? ? ? 142 LEU B CB  1 
ATOM 4012  C CG  . LEU B 1 141 ? 13.906  17.020  98.450   1.00 10.00 ? ? ? ? ? ? 142 LEU B CG  1 
ATOM 4013  C CD1 . LEU B 1 141 ? 12.523  17.640  98.170   1.00 10.00 ? ? ? ? ? ? 142 LEU B CD1 1 
ATOM 4014  C CD2 . LEU B 1 141 ? 13.805  15.770  99.270   1.00 10.00 ? ? ? ? ? ? 142 LEU B CD2 1 
ATOM 4015  N N   . TYR B 1 142 ? 17.448  17.769  96.981   1.00 10.00 ? ? ? ? ? ? 143 TYR B N   1 
ATOM 4016  C CA  . TYR B 1 142 ? 18.700  18.218  97.540   1.00 10.00 ? ? ? ? ? ? 143 TYR B CA  1 
ATOM 4017  C C   . TYR B 1 142 ? 19.034  19.593  96.981   1.00 10.00 ? ? ? ? ? ? 143 TYR B C   1 
ATOM 4018  O O   . TYR B 1 142 ? 19.425  20.466  97.759   1.00 10.00 ? ? ? ? ? ? 143 TYR B O   1 
ATOM 4019  C CB  . TYR B 1 142 ? 19.850  17.226  97.203   1.00 10.00 ? ? ? ? ? ? 143 TYR B CB  1 
ATOM 4020  C CG  . TYR B 1 142 ? 20.933  17.284  98.294   1.00 10.00 ? ? ? ? ? ? 143 TYR B CG  1 
ATOM 4021  C CD1 . TYR B 1 142 ? 21.730  18.429  98.460   1.00 10.00 ? ? ? ? ? ? 143 TYR B CD1 1 
ATOM 4022  C CD2 . TYR B 1 142 ? 21.083  16.224  99.190   1.00 10.00 ? ? ? ? ? ? 143 TYR B CD2 1 
ATOM 4023  C CE1 . TYR B 1 142 ? 22.653  18.519  99.501   1.00 10.00 ? ? ? ? ? ? 143 TYR B CE1 1 
ATOM 4024  C CE2 . TYR B 1 142 ? 22.015  16.315  100.237  1.00 10.00 ? ? ? ? ? ? 143 TYR B CE2 1 
ATOM 4025  C CZ  . TYR B 1 142 ? 22.796  17.466  100.402  1.00 10.00 ? ? ? ? ? ? 143 TYR B CZ  1 
ATOM 4026  O OH  . TYR B 1 142 ? 23.693  17.575  101.469  1.00 10.00 ? ? ? ? ? ? 143 TYR B OH  1 
ATOM 4027  N N   . ALA B 1 143 ? 18.858  19.836  95.672   1.00 10.00 ? ? ? ? ? ? 144 ALA B N   1 
ATOM 4028  C CA  . ALA B 1 143 ? 19.148  21.140  95.084   1.00 10.00 ? ? ? ? ? ? 144 ALA B CA  1 
ATOM 4029  C C   . ALA B 1 143 ? 18.227  22.279  95.583   1.00 10.00 ? ? ? ? ? ? 144 ALA B C   1 
ATOM 4030  O O   . ALA B 1 143 ? 18.524  23.458  95.368   1.00 10.00 ? ? ? ? ? ? 144 ALA B O   1 
ATOM 4031  C CB  . ALA B 1 143 ? 19.067  20.995  93.556   1.00 10.00 ? ? ? ? ? ? 144 ALA B CB  1 
ATOM 4032  N N   . SER B 1 144 ? 17.075  22.011  96.217   1.00 10.00 ? ? ? ? ? ? 145 SER B N   1 
ATOM 4033  C CA  . SER B 1 144 ? 16.235  23.056  96.807   1.00 10.00 ? ? ? ? ? ? 145 SER B CA  1 
ATOM 4034  C C   . SER B 1 144 ? 16.625  23.286  98.254   1.00 10.00 ? ? ? ? ? ? 145 SER B C   1 
ATOM 4035  O O   . SER B 1 144 ? 16.089  24.157  98.943   1.00 10.00 ? ? ? ? ? ? 145 SER B O   1 
ATOM 4036  C CB  . SER B 1 144 ? 14.755  22.693  96.803   1.00 10.00 ? ? ? ? ? ? 145 SER B CB  1 
ATOM 4037  O OG  . SER B 1 144 ? 14.391  21.583  97.611   1.00 10.00 ? ? ? ? ? ? 145 SER B OG  1 
ATOM 4038  N N   . GLY B 1 145 ? 15.393  25.057  98.280   1.00 10.00 ? ? ? ? ? ? 146 GLY B N   1 
ATOM 4039  C CA  . GLY B 1 145 ? 15.933  25.678  99.466   1.00 10.00 ? ? ? ? ? ? 146 GLY B CA  1 
ATOM 4040  C C   . GLY B 1 145 ? 15.302  25.038  100.646  1.00 10.00 ? ? ? ? ? ? 146 GLY B C   1 
ATOM 4041  O O   . GLY B 1 145 ? 14.886  25.708  101.583  1.00 10.00 ? ? ? ? ? ? 146 GLY B O   1 
ATOM 4042  N N   . ARG B 1 146 ? 15.240  23.728  100.644  1.00 10.00 ? ? ? ? ? ? 147 ARG B N   1 
ATOM 4043  C CA  . ARG B 1 146 ? 14.505  23.101  101.687  1.00 10.00 ? ? ? ? ? ? 147 ARG B CA  1 
ATOM 4044  C C   . ARG B 1 146 ? 15.198  21.799  101.995  1.00 10.00 ? ? ? ? ? ? 147 ARG B C   1 
ATOM 4045  O O   . ARG B 1 146 ? 16.027  21.269  101.256  1.00 10.00 ? ? ? ? ? ? 147 ARG B O   1 
ATOM 4046  C CB  . ARG B 1 146 ? 13.138  23.017  101.115  1.00 10.00 ? ? ? ? ? ? 147 ARG B CB  1 
ATOM 4047  C CG  . ARG B 1 146 ? 11.983  22.378  101.777  1.00 10.00 ? ? ? ? ? ? 147 ARG B CG  1 
ATOM 4048  C CD  . ARG B 1 146 ? 10.962  22.772  100.747  1.00 10.00 ? ? ? ? ? ? 147 ARG B CD  1 
ATOM 4049  N NE  . ARG B 1 146 ? 10.372  24.033  101.143  1.00 10.00 ? ? ? ? ? ? 147 ARG B NE  1 
ATOM 4050  C CZ  . ARG B 1 146 ? 10.083  25.017  100.309  1.00 10.00 ? ? ? ? ? ? 147 ARG B CZ  1 
ATOM 4051  N NH1 . ARG B 1 146 ? 10.312  24.954  99.006   1.00 10.00 ? ? ? ? ? ? 147 ARG B NH1 1 
ATOM 4052  N NH2 . ARG B 1 146 ? 9.555   26.111  100.824  1.00 10.00 ? ? ? ? ? ? 147 ARG B NH2 1 
ATOM 4053  N N   . THR B 1 147 ? 14.891  21.373  103.205  1.00 10.00 ? ? ? ? ? ? 148 THR B N   1 
ATOM 4054  C CA  . THR B 1 147 ? 15.506  20.224  103.837  1.00 10.00 ? ? ? ? ? ? 148 THR B CA  1 
ATOM 4055  C C   . THR B 1 147 ? 14.529  19.154  104.340  1.00 10.00 ? ? ? ? ? ? 148 THR B C   1 
ATOM 4056  O O   . THR B 1 147 ? 14.868  17.965  104.479  1.00 10.00 ? ? ? ? ? ? 148 THR B O   1 
ATOM 4057  C CB  . THR B 1 147 ? 16.389  20.874  104.909  1.00 10.00 ? ? ? ? ? ? 148 THR B CB  1 
ATOM 4058  O OG1 . THR B 1 147 ? 15.689  22.054  105.363  1.00 10.00 ? ? ? ? ? ? 148 THR B OG1 1 
ATOM 4059  C CG2 . THR B 1 147 ? 17.797  21.140  104.367  1.00 10.00 ? ? ? ? ? ? 148 THR B CG2 1 
ATOM 4060  N N   . THR B 1 148 ? 13.280  19.511  104.535  1.00 10.00 ? ? ? ? ? ? 149 THR B N   1 
ATOM 4061  C CA  . THR B 1 148 ? 12.290  18.549  104.950  1.00 10.00 ? ? ? ? ? ? 149 THR B CA  1 
ATOM 4062  C C   . THR B 1 148 ? 11.150  18.702  103.914  1.00 10.00 ? ? ? ? ? ? 149 THR B C   1 
ATOM 4063  O O   . THR B 1 148 ? 10.934  19.824  103.424  1.00 10.00 ? ? ? ? ? ? 149 THR B O   1 
ATOM 4064  C CB  . THR B 1 148 ? 11.855  18.901  106.381  1.00 10.00 ? ? ? ? ? ? 149 THR B CB  1 
ATOM 4065  O OG1 . THR B 1 148 ? 12.944  19.514  107.060  1.00 10.00 ? ? ? ? ? ? 149 THR B OG1 1 
ATOM 4066  C CG2 . THR B 1 148 ? 11.544  17.676  107.172  1.00 10.00 ? ? ? ? ? ? 149 THR B CG2 1 
ATOM 4067  N N   . GLY B 1 149 ? 10.409  17.694  103.494  1.00 10.00 ? ? ? ? ? ? 150 GLY B N   1 
ATOM 4068  C CA  . GLY B 1 149 ? 9.431   17.913  102.474  1.00 10.00 ? ? ? ? ? ? 150 GLY B CA  1 
ATOM 4069  C C   . GLY B 1 149 ? 9.234   16.595  101.810  1.00 10.00 ? ? ? ? ? ? 150 GLY B C   1 
ATOM 4070  O O   . GLY B 1 149 ? 9.742   15.599  102.318  1.00 10.00 ? ? ? ? ? ? 150 GLY B O   1 
ATOM 4071  N N   . ILE B 1 150 ? 8.485   16.525  100.738  1.00 10.00 ? ? ? ? ? ? 151 ILE B N   1 
ATOM 4072  C CA  . ILE B 1 150 ? 8.349   15.312  99.935   1.00 10.00 ? ? ? ? ? ? 151 ILE B CA  1 
ATOM 4073  C C   . ILE B 1 150 ? 8.302   15.879  98.529   1.00 10.00 ? ? ? ? ? ? 151 ILE B C   1 
ATOM 4074  O O   . ILE B 1 150 ? 7.779   16.977  98.281   1.00 10.00 ? ? ? ? ? ? 151 ILE B O   1 
ATOM 4075  C CB  . ILE B 1 150 ? 7.043   14.490  100.293  1.00 10.00 ? ? ? ? ? ? 151 ILE B CB  1 
ATOM 4076  C CG1 . ILE B 1 150 ? 6.650   13.449  99.235   1.00 10.00 ? ? ? ? ? ? 151 ILE B CG1 1 
ATOM 4077  C CG2 . ILE B 1 150 ? 5.958   15.506  100.555  1.00 10.00 ? ? ? ? ? ? 151 ILE B CG2 1 
ATOM 4078  C CD1 . ILE B 1 150 ? 5.733   12.342  99.814   1.00 10.00 ? ? ? ? ? ? 151 ILE B CD1 1 
ATOM 4079  N N   . VAL B 1 151 ? 9.019   15.183  97.655   1.00 10.00 ? ? ? ? ? ? 152 VAL B N   1 
ATOM 4080  C CA  . VAL B 1 151 ? 9.164   15.580  96.272   1.00 10.00 ? ? ? ? ? ? 152 VAL B CA  1 
ATOM 4081  C C   . VAL B 1 151 ? 8.347   14.575  95.508   1.00 10.00 ? ? ? ? ? ? 152 VAL B C   1 
ATOM 4082  O O   . VAL B 1 151 ? 8.165   13.421  95.923   1.00 10.00 ? ? ? ? ? ? 152 VAL B O   1 
ATOM 4083  C CB  . VAL B 1 151 ? 10.650  15.528  95.900   1.00 10.00 ? ? ? ? ? ? 152 VAL B CB  1 
ATOM 4084  C CG1 . VAL B 1 151 ? 10.913  15.998  94.510   1.00 10.00 ? ? ? ? ? ? 152 VAL B CG1 1 
ATOM 4085  C CG2 . VAL B 1 151 ? 11.404  16.500  96.774   1.00 10.00 ? ? ? ? ? ? 152 VAL B CG2 1 
ATOM 4086  N N   . MET B 1 152 ? 7.785   15.006  94.402   1.00 10.00 ? ? ? ? ? ? 153 MET B N   1 
ATOM 4087  C CA  . MET B 1 152 ? 7.046   14.092  93.571   1.00 10.00 ? ? ? ? ? ? 153 MET B CA  1 
ATOM 4088  C C   . MET B 1 152 ? 7.804   14.205  92.266   1.00 10.00 ? ? ? ? ? ? 153 MET B C   1 
ATOM 4089  O O   . MET B 1 152 ? 7.761   15.253  91.613   1.00 10.00 ? ? ? ? ? ? 153 MET B O   1 
ATOM 4090  C CB  . MET B 1 152 ? 5.639   14.619  93.539   1.00 10.00 ? ? ? ? ? ? 153 MET B CB  1 
ATOM 4091  C CG  . MET B 1 152 ? 4.621   13.587  93.128   1.00 10.00 ? ? ? ? ? ? 153 MET B CG  1 
ATOM 4092  S SD  . MET B 1 152 ? 4.754   12.995  91.422   1.00 10.00 ? ? ? ? ? ? 153 MET B SD  1 
ATOM 4093  C CE  . MET B 1 152 ? 3.850   14.299  90.663   1.00 10.00 ? ? ? ? ? ? 153 MET B CE  1 
ATOM 4094  N N   . ASP B 1 153 ? 8.540   13.191  91.860   1.00 10.00 ? ? ? ? ? ? 154 ASP B N   1 
ATOM 4095  C CA  . ASP B 1 153 ? 9.462   13.366  90.750   1.00 10.00 ? ? ? ? ? ? 154 ASP B CA  1 
ATOM 4096  C C   . ASP B 1 153 ? 8.971   12.629  89.543   1.00 10.00 ? ? ? ? ? ? 154 ASP B C   1 
ATOM 4097  O O   . ASP B 1 153 ? 8.838   11.407  89.656   1.00 10.00 ? ? ? ? ? ? 154 ASP B O   1 
ATOM 4098  C CB  . ASP B 1 153 ? 10.796  12.863  91.241   1.00 10.00 ? ? ? ? ? ? 154 ASP B CB  1 
ATOM 4099  C CG  . ASP B 1 153 ? 12.007  13.225  90.409   1.00 10.00 ? ? ? ? ? ? 154 ASP B CG  1 
ATOM 4100  O OD1 . ASP B 1 153 ? 12.190  12.615  89.362   1.00 10.00 ? ? ? ? ? ? 154 ASP B OD1 1 
ATOM 4101  O OD2 . ASP B 1 153 ? 12.779  14.100  90.808   1.00 10.00 ? ? ? ? ? ? 154 ASP B OD2 1 
ATOM 4102  N N   . SER B 1 154 ? 8.683   13.277  88.420   1.00 10.00 ? ? ? ? ? ? 155 SER B N   1 
ATOM 4103  C CA  . SER B 1 154 ? 8.152   12.554  87.282   1.00 10.00 ? ? ? ? ? ? 155 SER B CA  1 
ATOM 4104  C C   . SER B 1 154 ? 8.953   12.853  86.049   1.00 10.00 ? ? ? ? ? ? 155 SER B C   1 
ATOM 4105  O O   . SER B 1 154 ? 8.851   13.927  85.430   1.00 10.00 ? ? ? ? ? ? 155 SER B O   1 
ATOM 4106  C CB  . SER B 1 154 ? 6.668   12.936  87.045   1.00 10.00 ? ? ? ? ? ? 155 SER B CB  1 
ATOM 4107  O OG  . SER B 1 154 ? 5.887   11.971  86.311   1.00 10.00 ? ? ? ? ? ? 155 SER B OG  1 
ATOM 4108  N N   . GLY B 1 155 ? 9.721   11.829  85.730   1.00 10.00 ? ? ? ? ? ? 156 GLY B N   1 
ATOM 4109  C CA  . GLY B 1 155 ? 10.586  11.892  84.563   1.00 10.00 ? ? ? ? ? ? 156 GLY B CA  1 
ATOM 4110  C C   . GLY B 1 155 ? 10.012  11.230  83.303   1.00 10.00 ? ? ? ? ? ? 156 GLY B C   1 
ATOM 4111  O O   . GLY B 1 155 ? 8.857   11.465  82.897   1.00 10.00 ? ? ? ? ? ? 156 GLY B O   1 
ATOM 4112  N N   . ASP B 1 156 ? 10.778  10.334  82.665   1.00 10.00 ? ? ? ? ? ? 157 ASP B N   1 
ATOM 4113  C CA  . ASP B 1 156 ? 10.334  9.693   81.427   1.00 10.00 ? ? ? ? ? ? 157 ASP B CA  1 
ATOM 4114  C C   . ASP B 1 156 ? 9.971   8.256   81.698   1.00 10.00 ? ? ? ? ? ? 157 ASP B C   1 
ATOM 4115  O O   . ASP B 1 156 ? 9.027   7.723   81.096   1.00 10.00 ? ? ? ? ? ? 157 ASP B O   1 
ATOM 4116  C CB  . ASP B 1 156 ? 11.453  9.759   80.416   1.00 10.00 ? ? ? ? ? ? 157 ASP B CB  1 
ATOM 4117  C CG  . ASP B 1 156 ? 11.163  9.496   78.947   1.00 10.00 ? ? ? ? ? ? 157 ASP B CG  1 
ATOM 4118  O OD1 . ASP B 1 156 ? 10.775  10.438  78.268   1.00 10.00 ? ? ? ? ? ? 157 ASP B OD1 1 
ATOM 4119  O OD2 . ASP B 1 156 ? 11.388  8.375   78.483   1.00 10.00 ? ? ? ? ? ? 157 ASP B OD2 1 
ATOM 4120  N N   . GLY B 1 157 ? 10.691  7.631   82.628   1.00 10.00 ? ? ? ? ? ? 158 GLY B N   1 
ATOM 4121  C CA  . GLY B 1 157 ? 10.444  6.248   82.887   1.00 10.00 ? ? ? ? ? ? 158 GLY B CA  1 
ATOM 4122  C C   . GLY B 1 157 ? 9.870   5.998   84.254   1.00 10.00 ? ? ? ? ? ? 158 GLY B C   1 
ATOM 4123  O O   . GLY B 1 157 ? 9.374   4.881   84.452   1.00 10.00 ? ? ? ? ? ? 158 GLY B O   1 
ATOM 4124  N N   . VAL B 1 158 ? 9.921   6.877   85.264   1.00 10.00 ? ? ? ? ? ? 159 VAL B N   1 
ATOM 4125  C CA  . VAL B 1 158 ? 9.318   6.607   86.564   1.00 10.00 ? ? ? ? ? ? 159 VAL B CA  1 
ATOM 4126  C C   . VAL B 1 158 ? 8.872   7.877   87.282   1.00 10.00 ? ? ? ? ? ? 159 VAL B C   1 
ATOM 4127  O O   . VAL B 1 158 ? 9.164   9.028   86.911   1.00 10.00 ? ? ? ? ? ? 159 VAL B O   1 
ATOM 4128  C CB  . VAL B 1 158 ? 10.356  5.805   87.357   1.00 10.00 ? ? ? ? ? ? 159 VAL B CB  1 
ATOM 4129  C CG1 . VAL B 1 158 ? 11.401  6.741   87.850   1.00 10.00 ? ? ? ? ? ? 159 VAL B CG1 1 
ATOM 4130  C CG2 . VAL B 1 158 ? 9.723   5.045   88.482   1.00 10.00 ? ? ? ? ? ? 159 VAL B CG2 1 
ATOM 4131  N N   . THR B 1 159 ? 8.072   7.608   88.305   1.00 10.00 ? ? ? ? ? ? 160 THR B N   1 
ATOM 4132  C CA  . THR B 1 159 ? 7.599   8.614   89.219   1.00 10.00 ? ? ? ? ? ? 160 THR B CA  1 
ATOM 4133  C C   . THR B 1 159 ? 7.817   8.029   90.602   1.00 10.00 ? ? ? ? ? ? 160 THR B C   1 
ATOM 4134  O O   . THR B 1 159 ? 7.697   6.827   90.890   1.00 10.00 ? ? ? ? ? ? 160 THR B O   1 
ATOM 4135  C CB  . THR B 1 159 ? 6.099   8.907   88.965   1.00 10.00 ? ? ? ? ? ? 160 THR B CB  1 
ATOM 4136  O OG1 . THR B 1 159 ? 5.850   9.407   87.649   1.00 10.00 ? ? ? ? ? ? 160 THR B OG1 1 
ATOM 4137  C CG2 . THR B 1 159 ? 5.667   10.011  89.870   1.00 10.00 ? ? ? ? ? ? 160 THR B CG2 1 
ATOM 4138  N N   . HIS B 1 160 ? 8.307   8.868   91.477   1.00 10.00 ? ? ? ? ? ? 161 HIS B N   1 
ATOM 4139  C CA  . HIS B 1 160 ? 8.368   8.469   92.878   1.00 10.00 ? ? ? ? ? ? 161 HIS B CA  1 
ATOM 4140  C C   . HIS B 1 160 ? 7.953   9.625   93.742   1.00 10.00 ? ? ? ? ? ? 161 HIS B C   1 
ATOM 4141  O O   . HIS B 1 160 ? 8.110   10.808  93.370   1.00 10.00 ? ? ? ? ? ? 161 HIS B O   1 
ATOM 4142  C CB  . HIS B 1 160 ? 9.724   8.157   93.438   1.00 10.00 ? ? ? ? ? ? 161 HIS B CB  1 
ATOM 4143  C CG  . HIS B 1 160 ? 10.405  6.910   92.975   1.00 10.00 ? ? ? ? ? ? 161 HIS B CG  1 
ATOM 4144  N ND1 . HIS B 1 160 ? 10.992  6.672   91.813   1.00 10.00 ? ? ? ? ? ? 161 HIS B ND1 1 
ATOM 4145  C CD2 . HIS B 1 160 ? 10.550  5.820   93.783   1.00 10.00 ? ? ? ? ? ? 161 HIS B CD2 1 
ATOM 4146  C CE1 . HIS B 1 160 ? 11.500  5.470   91.878   1.00 10.00 ? ? ? ? ? ? 161 HIS B CE1 1 
ATOM 4147  N NE2 . HIS B 1 160 ? 11.230  4.967   93.062   1.00 10.00 ? ? ? ? ? ? 161 HIS B NE2 1 
ATOM 4148  N N   . THR B 1 161 ? 7.394   9.222   94.869   1.00 10.00 ? ? ? ? ? ? 162 THR B N   1 
ATOM 4149  C CA  . THR B 1 161 ? 7.104   10.152  95.930   1.00 10.00 ? ? ? ? ? ? 162 THR B CA  1 
ATOM 4150  C C   . THR B 1 161 ? 8.138   9.752   97.020   1.00 10.00 ? ? ? ? ? ? 162 THR B C   1 
ATOM 4151  O O   . THR B 1 161 ? 8.317   8.563   97.346   1.00 10.00 ? ? ? ? ? ? 162 THR B O   1 
ATOM 4152  C CB  . THR B 1 161 ? 5.631   9.929   96.213   1.00 10.00 ? ? ? ? ? ? 162 THR B CB  1 
ATOM 4153  O OG1 . THR B 1 161 ? 5.287   8.553   96.274   1.00 10.00 ? ? ? ? ? ? 162 THR B OG1 1 
ATOM 4154  C CG2 . THR B 1 161 ? 4.895   10.611  95.095   1.00 10.00 ? ? ? ? ? ? 162 THR B CG2 1 
ATOM 4155  N N   . VAL B 1 162 ? 8.928   10.725  97.513   1.00 10.00 ? ? ? ? ? ? 163 VAL B N   1 
ATOM 4156  C CA  . VAL B 1 162 ? 10.056  10.474  98.378   1.00 10.00 ? ? ? ? ? ? 163 VAL B CA  1 
ATOM 4157  C C   . VAL B 1 162 ? 9.777   11.368  99.559   1.00 10.00 ? ? ? ? ? ? 163 VAL B C   1 
ATOM 4158  O O   . VAL B 1 162 ? 9.795   12.578  99.302   1.00 10.00 ? ? ? ? ? ? 163 VAL B O   1 
ATOM 4159  C CB  . VAL B 1 162 ? 11.366  10.871  97.570   1.00 10.00 ? ? ? ? ? ? 163 VAL B CB  1 
ATOM 4160  C CG1 . VAL B 1 162 ? 12.652  10.713  98.350   1.00 10.00 ? ? ? ? ? ? 163 VAL B CG1 1 
ATOM 4161  C CG2 . VAL B 1 162 ? 11.600  9.864   96.459   1.00 10.00 ? ? ? ? ? ? 163 VAL B CG2 1 
ATOM 4162  N N   . PRO B 1 163 ? 9.492   10.964  100.809  1.00 10.00 ? ? ? ? ? ? 164 PRO B N   1 
ATOM 4163  C CA  . PRO B 1 163 ? 9.554   11.851  101.965  1.00 10.00 ? ? ? ? ? ? 164 PRO B CA  1 
ATOM 4164  C C   . PRO B 1 163 ? 10.993  12.080  102.470  1.00 10.00 ? ? ? ? ? ? 164 PRO B C   1 
ATOM 4165  O O   . PRO B 1 163 ? 11.747  11.129  102.618  1.00 10.00 ? ? ? ? ? ? 164 PRO B O   1 
ATOM 4166  C CB  . PRO B 1 163 ? 8.635   11.179  102.965  1.00 10.00 ? ? ? ? ? ? 164 PRO B CB  1 
ATOM 4167  C CG  . PRO B 1 163 ? 7.989   10.041  102.261  1.00 10.00 ? ? ? ? ? ? 164 PRO B CG  1 
ATOM 4168  C CD  . PRO B 1 163 ? 8.999   9.660   101.220  1.00 10.00 ? ? ? ? ? ? 164 PRO B CD  1 
ATOM 4169  N N   . ILE B 1 164 ? 11.437  13.300  102.695  1.00 10.00 ? ? ? ? ? ? 165 ILE B N   1 
ATOM 4170  C CA  . ILE B 1 164 ? 12.778  13.633  103.111  1.00 10.00 ? ? ? ? ? ? 165 ILE B CA  1 
ATOM 4171  C C   . ILE B 1 164 ? 12.710  14.369  104.457  1.00 10.00 ? ? ? ? ? ? 165 ILE B C   1 
ATOM 4172  O O   . ILE B 1 164 ? 12.042  15.393  104.581  1.00 10.00 ? ? ? ? ? ? 165 ILE B O   1 
ATOM 4173  C CB  . ILE B 1 164 ? 13.410  14.513  102.020  1.00 10.00 ? ? ? ? ? ? 165 ILE B CB  1 
ATOM 4174  C CG1 . ILE B 1 164 ? 13.615  13.589  100.848  1.00 10.00 ? ? ? ? ? ? 165 ILE B CG1 1 
ATOM 4175  C CG2 . ILE B 1 164 ? 14.699  15.243  102.455  1.00 10.00 ? ? ? ? ? ? 165 ILE B CG2 1 
ATOM 4176  C CD1 . ILE B 1 164 ? 13.478  14.361  99.529   1.00 10.00 ? ? ? ? ? ? 165 ILE B CD1 1 
ATOM 4177  N N   . TYR B 1 165 ? 13.379  13.859  105.493  1.00 10.00 ? ? ? ? ? ? 166 TYR B N   1 
ATOM 4178  C CA  . TYR B 1 165 ? 13.517  14.483  106.799  1.00 10.00 ? ? ? ? ? ? 166 TYR B CA  1 
ATOM 4179  C C   . TYR B 1 165 ? 14.984  14.899  106.915  1.00 10.00 ? ? ? ? ? ? 166 TYR B C   1 
ATOM 4180  O O   . TYR B 1 165 ? 15.903  14.075  106.896  1.00 10.00 ? ? ? ? ? ? 166 TYR B O   1 
ATOM 4181  C CB  . TYR B 1 165 ? 13.198  13.485  107.901  1.00 10.00 ? ? ? ? ? ? 166 TYR B CB  1 
ATOM 4182  C CG  . TYR B 1 165 ? 13.440  13.960  109.330  1.00 10.00 ? ? ? ? ? ? 166 TYR B CG  1 
ATOM 4183  C CD1 . TYR B 1 165 ? 13.195  15.268  109.652  1.00 10.00 ? ? ? ? ? ? 166 TYR B CD1 1 
ATOM 4184  C CD2 . TYR B 1 165 ? 13.919  13.088  110.283  1.00 10.00 ? ? ? ? ? ? 166 TYR B CD2 1 
ATOM 4185  C CE1 . TYR B 1 165 ? 13.422  15.738  110.911  1.00 10.00 ? ? ? ? ? ? 166 TYR B CE1 1 
ATOM 4186  C CE2 . TYR B 1 165 ? 14.146  13.551  111.550  1.00 10.00 ? ? ? ? ? ? 166 TYR B CE2 1 
ATOM 4187  C CZ  . TYR B 1 165 ? 13.884  14.869  111.840  1.00 10.00 ? ? ? ? ? ? 166 TYR B CZ  1 
ATOM 4188  O OH  . TYR B 1 165 ? 14.006  15.357  113.104  1.00 10.00 ? ? ? ? ? ? 166 TYR B OH  1 
ATOM 4189  N N   . GLU B 1 166 ? 15.176  16.206  106.960  1.00 10.00 ? ? ? ? ? ? 167 GLU B N   1 
ATOM 4190  C CA  . GLU B 1 166 ? 16.455  16.814  107.114  1.00 10.00 ? ? ? ? ? ? 167 GLU B CA  1 
ATOM 4191  C C   . GLU B 1 166 ? 17.509  16.423  106.077  1.00 10.00 ? ? ? ? ? ? 167 GLU B C   1 
ATOM 4192  O O   . GLU B 1 166 ? 18.670  16.252  106.432  1.00 10.00 ? ? ? ? ? ? 167 GLU B O   1 
ATOM 4193  C CB  . GLU B 1 166 ? 16.902  16.493  108.510  1.00 10.00 ? ? ? ? ? ? 167 GLU B CB  1 
ATOM 4194  C CG  . GLU B 1 166 ? 16.192  17.178  109.640  1.00 10.00 ? ? ? ? ? ? 167 GLU B CG  1 
ATOM 4195  C CD  . GLU B 1 166 ? 16.300  18.690  109.656  1.00 10.00 ? ? ? ? ? ? 167 GLU B CD  1 
ATOM 4196  O OE1 . GLU B 1 166 ? 17.191  19.259  109.006  1.00 10.00 ? ? ? ? ? ? 167 GLU B OE1 1 
ATOM 4197  O OE2 . GLU B 1 166 ? 15.474  19.307  110.339  1.00 10.00 ? ? ? ? ? ? 167 GLU B OE2 1 
ATOM 4198  N N   . GLY B 1 167 ? 17.203  16.358  104.784  1.00 10.00 ? ? ? ? ? ? 168 GLY B N   1 
ATOM 4199  C CA  . GLY B 1 167 ? 18.146  15.957  103.749  1.00 10.00 ? ? ? ? ? ? 168 GLY B CA  1 
ATOM 4200  C C   . GLY B 1 167 ? 18.300  14.440  103.539  1.00 10.00 ? ? ? ? ? ? 168 GLY B C   1 
ATOM 4201  O O   . GLY B 1 167 ? 19.190  13.955  102.821  1.00 10.00 ? ? ? ? ? ? 168 GLY B O   1 
ATOM 4202  N N   . TYR B 1 168 ? 17.412  13.646  104.124  1.00 10.00 ? ? ? ? ? ? 169 TYR B N   1 
ATOM 4203  C CA  . TYR B 1 168 ? 17.553  12.210  104.145  1.00 10.00 ? ? ? ? ? ? 169 TYR B CA  1 
ATOM 4204  C C   . TYR B 1 168 ? 16.214  11.676  103.725  1.00 10.00 ? ? ? ? ? ? 169 TYR B C   1 
ATOM 4205  O O   . TYR B 1 168 ? 15.189  11.985  104.333  1.00 10.00 ? ? ? ? ? ? 169 TYR B O   1 
ATOM 4206  C CB  . TYR B 1 168 ? 17.893  11.685  105.577  1.00 10.00 ? ? ? ? ? ? 169 TYR B CB  1 
ATOM 4207  C CG  . TYR B 1 168 ? 19.262  12.141  106.136  1.00 10.00 ? ? ? ? ? ? 169 TYR B CG  1 
ATOM 4208  C CD1 . TYR B 1 168 ? 20.424  11.573  105.660  1.00 10.00 ? ? ? ? ? ? 169 TYR B CD1 1 
ATOM 4209  C CD2 . TYR B 1 168 ? 19.335  13.191  107.047  1.00 10.00 ? ? ? ? ? ? 169 TYR B CD2 1 
ATOM 4210  C CE1 . TYR B 1 168 ? 21.638  12.035  106.053  1.00 10.00 ? ? ? ? ? ? 169 TYR B CE1 1 
ATOM 4211  C CE2 . TYR B 1 168 ? 20.557  13.670  107.451  1.00 10.00 ? ? ? ? ? ? 169 TYR B CE2 1 
ATOM 4212  C CZ  . TYR B 1 168 ? 21.687  13.072  106.938  1.00 10.00 ? ? ? ? ? ? 169 TYR B CZ  1 
ATOM 4213  O OH  . TYR B 1 168 ? 22.936  13.513  107.353  1.00 10.00 ? ? ? ? ? ? 169 TYR B OH  1 
ATOM 4214  N N   . ALA B 1 169 ? 16.253  10.925  102.642  1.00 10.00 ? ? ? ? ? ? 170 ALA B N   1 
ATOM 4215  C CA  . ALA B 1 169 ? 15.089  10.317  102.035  1.00 10.00 ? ? ? ? ? ? 170 ALA B CA  1 
ATOM 4216  C C   . ALA B 1 169 ? 14.643  9.207   102.950  1.00 10.00 ? ? ? ? ? ? 170 ALA B C   1 
ATOM 4217  O O   . ALA B 1 169 ? 15.501  8.492   103.469  1.00 10.00 ? ? ? ? ? ? 170 ALA B O   1 
ATOM 4218  C CB  . ALA B 1 169 ? 15.413  9.701   100.679  1.00 10.00 ? ? ? ? ? ? 170 ALA B CB  1 
ATOM 4219  N N   . LEU B 1 170 ? 13.349  8.966   103.122  1.00 10.00 ? ? ? ? ? ? 171 LEU B N   1 
ATOM 4220  C CA  . LEU B 1 170 ? 12.970  7.932   104.034  1.00 10.00 ? ? ? ? ? ? 171 LEU B CA  1 
ATOM 4221  C C   . LEU B 1 170 ? 12.589  6.686   103.234  1.00 10.00 ? ? ? ? ? ? 171 LEU B C   1 
ATOM 4222  O O   . LEU B 1 170 ? 11.406  6.472   102.972  1.00 10.00 ? ? ? ? ? ? 171 LEU B O   1 
ATOM 4223  C CB  . LEU B 1 170 ? 11.835  8.525   104.921  1.00 10.00 ? ? ? ? ? ? 171 LEU B CB  1 
ATOM 4224  C CG  . LEU B 1 170 ? 12.158  9.846   105.724  1.00 10.00 ? ? ? ? ? ? 171 LEU B CG  1 
ATOM 4225  C CD1 . LEU B 1 170 ? 10.891  10.313  106.438  1.00 10.00 ? ? ? ? ? ? 171 LEU B CD1 1 
ATOM 4226  C CD2 . LEU B 1 170 ? 13.305  9.644   106.699  1.00 10.00 ? ? ? ? ? ? 171 LEU B CD2 1 
ATOM 4227  N N   . PRO B 1 171 ? 13.493  5.752   102.916  1.00 10.00 ? ? ? ? ? ? 172 PRO B N   1 
ATOM 4228  C CA  . PRO B 1 171 ? 13.293  4.655   101.970  1.00 10.00 ? ? ? ? ? ? 172 PRO B CA  1 
ATOM 4229  C C   . PRO B 1 171 ? 12.057  3.787   102.202  1.00 10.00 ? ? ? ? ? ? 172 PRO B C   1 
ATOM 4230  O O   . PRO B 1 171 ? 11.444  3.284   101.254  1.00 10.00 ? ? ? ? ? ? 172 PRO B O   1 
ATOM 4231  C CB  . PRO B 1 171 ? 14.526  3.836   102.038  1.00 10.00 ? ? ? ? ? ? 172 PRO B CB  1 
ATOM 4232  C CG  . PRO B 1 171 ? 15.454  4.862   102.523  1.00 10.00 ? ? ? ? ? ? 172 PRO B CG  1 
ATOM 4233  C CD  . PRO B 1 171 ? 14.726  5.545   103.624  1.00 10.00 ? ? ? ? ? ? 172 PRO B CD  1 
ATOM 4234  N N   . HIS B 1 172 ? 11.641  3.520   103.442  1.00 10.00 ? ? ? ? ? ? 173 HIS B N   1 
ATOM 4235  C CA  . HIS B 1 172 ? 10.373  2.802   103.623  1.00 10.00 ? ? ? ? ? ? 173 HIS B CA  1 
ATOM 4236  C C   . HIS B 1 172 ? 9.104   3.480   103.033  1.00 10.00 ? ? ? ? ? ? 173 HIS B C   1 
ATOM 4237  O O   . HIS B 1 172 ? 8.136   2.816   102.619  1.00 10.00 ? ? ? ? ? ? 173 HIS B O   1 
ATOM 4238  C CB  . HIS B 1 172 ? 10.175  2.574   105.116  1.00 10.00 ? ? ? ? ? ? 173 HIS B CB  1 
ATOM 4239  C CG  . HIS B 1 172 ? 10.166  3.909   105.829  1.00 10.00 ? ? ? ? ? ? 173 HIS B CG  1 
ATOM 4240  N ND1 . HIS B 1 172 ? 11.164  4.800   105.935  1.00 10.00 ? ? ? ? ? ? 173 HIS B ND1 1 
ATOM 4241  C CD2 . HIS B 1 172 ? 9.062   4.372   106.512  1.00 10.00 ? ? ? ? ? ? 173 HIS B CD2 1 
ATOM 4242  C CE1 . HIS B 1 172 ? 10.667  5.794   106.677  1.00 10.00 ? ? ? ? ? ? 173 HIS B CE1 1 
ATOM 4243  N NE2 . HIS B 1 172 ? 9.417   5.531   107.019  1.00 10.00 ? ? ? ? ? ? 173 HIS B NE2 1 
ATOM 4244  N N   . ALA B 1 173 ? 9.069   4.825   103.016  1.00 10.00 ? ? ? ? ? ? 174 ALA B N   1 
ATOM 4245  C CA  . ALA B 1 173 ? 7.865   5.504   102.601  1.00 10.00 ? ? ? ? ? ? 174 ALA B CA  1 
ATOM 4246  C C   . ALA B 1 173 ? 7.976   5.924   101.157  1.00 10.00 ? ? ? ? ? ? 174 ALA B C   1 
ATOM 4247  O O   . ALA B 1 173 ? 7.036   6.559   100.681  1.00 10.00 ? ? ? ? ? ? 174 ALA B O   1 
ATOM 4248  C CB  . ALA B 1 173 ? 7.620   6.730   103.471  1.00 10.00 ? ? ? ? ? ? 174 ALA B CB  1 
ATOM 4249  N N   . ILE B 1 174 ? 9.079   5.601   100.437  1.00 10.00 ? ? ? ? ? ? 175 ILE B N   1 
ATOM 4250  C CA  . ILE B 1 174 ? 9.259   5.927   99.023   1.00 10.00 ? ? ? ? ? ? 175 ILE B CA  1 
ATOM 4251  C C   . ILE B 1 174 ? 8.350   4.956   98.268   1.00 10.00 ? ? ? ? ? ? 175 ILE B C   1 
ATOM 4252  O O   . ILE B 1 174 ? 8.195   3.767   98.594   1.00 10.00 ? ? ? ? ? ? 175 ILE B O   1 
ATOM 4253  C CB  . ILE B 1 174 ? 10.730  5.738   98.555   1.00 10.00 ? ? ? ? ? ? 175 ILE B CB  1 
ATOM 4254  C CG1 . ILE B 1 174 ? 11.611  6.859   99.096   1.00 10.00 ? ? ? ? ? ? 175 ILE B CG1 1 
ATOM 4255  C CG2 . ILE B 1 174 ? 10.825  5.861   97.036   1.00 10.00 ? ? ? ? ? ? 175 ILE B CG2 1 
ATOM 4256  C CD1 . ILE B 1 174 ? 13.093  6.649   98.740   1.00 10.00 ? ? ? ? ? ? 175 ILE B CD1 1 
ATOM 4257  N N   . LEU B 1 175 ? 7.684   5.502   97.262   1.00 10.00 ? ? ? ? ? ? 176 LEU B N   1 
ATOM 4258  C CA  . LEU B 1 175 ? 6.726   4.772   96.453   1.00 10.00 ? ? ? ? ? ? 176 LEU B CA  1 
ATOM 4259  C C   . LEU B 1 175 ? 7.096   5.127   95.013   1.00 10.00 ? ? ? ? ? ? 176 LEU B C   1 
ATOM 4260  O O   . LEU B 1 175 ? 7.542   6.242   94.697   1.00 10.00 ? ? ? ? ? ? 176 LEU B O   1 
ATOM 4261  C CB  . LEU B 1 175 ? 5.305   5.231   96.922   1.00 10.00 ? ? ? ? ? ? 176 LEU B CB  1 
ATOM 4262  C CG  . LEU B 1 175 ? 4.720   4.741   98.253   1.00 10.00 ? ? ? ? ? ? 176 LEU B CG  1 
ATOM 4263  C CD1 . LEU B 1 175 ? 3.441   5.403   98.635   1.00 10.00 ? ? ? ? ? ? 176 LEU B CD1 1 
ATOM 4264  C CD2 . LEU B 1 175 ? 4.222   3.378   98.066   1.00 10.00 ? ? ? ? ? ? 176 LEU B CD2 1 
ATOM 4265  N N   . ARG B 1 176 ? 7.043   4.106   94.170   1.00 10.00 ? ? ? ? ? ? 177 ARG B N   1 
ATOM 4266  C CA  . ARG B 1 176 ? 7.442   4.125   92.753   1.00 10.00 ? ? ? ? ? ? 177 ARG B CA  1 
ATOM 4267  C C   . ARG B 1 176 ? 6.249   3.813   91.899   1.00 10.00 ? ? ? ? ? ? 177 ARG B C   1 
ATOM 4268  O O   . ARG B 1 176 ? 5.538   2.850   92.202   1.00 10.00 ? ? ? ? ? ? 177 ARG B O   1 
ATOM 4269  C CB  . ARG B 1 176 ? 8.555   3.072   92.485   1.00 10.00 ? ? ? ? ? ? 177 ARG B CB  1 
ATOM 4270  C CG  . ARG B 1 176 ? 8.555   2.283   91.189   1.00 10.00 ? ? ? ? ? ? 177 ARG B CG  1 
ATOM 4271  C CD  . ARG B 1 176 ? 9.967   2.154   90.655   1.00 10.00 ? ? ? ? ? ? 177 ARG B CD  1 
ATOM 4272  N NE  . ARG B 1 176 ? 10.170  1.001   89.768   1.00 10.00 ? ? ? ? ? ? 177 ARG B NE  1 
ATOM 4273  C CZ  . ARG B 1 176 ? 11.367  0.799   89.173   1.00 10.00 ? ? ? ? ? ? 177 ARG B CZ  1 
ATOM 4274  N NH1 . ARG B 1 176 ? 12.348  1.708   89.310   1.00 10.00 ? ? ? ? ? ? 177 ARG B NH1 1 
ATOM 4275  N NH2 . ARG B 1 176 ? 11.593  -0.265  88.378   1.00 10.00 ? ? ? ? ? ? 177 ARG B NH2 1 
ATOM 4276  N N   . LEU B 1 177 ? 6.113   4.598   90.833   1.00 10.00 ? ? ? ? ? ? 178 LEU B N   1 
ATOM 4277  C CA  . LEU B 1 177 ? 5.009   4.483   89.890   1.00 10.00 ? ? ? ? ? ? 178 LEU B CA  1 
ATOM 4278  C C   . LEU B 1 177 ? 5.646   4.484   88.524   1.00 10.00 ? ? ? ? ? ? 178 LEU B C   1 
ATOM 4279  O O   . LEU B 1 177 ? 6.405   5.376   88.105   1.00 10.00 ? ? ? ? ? ? 178 LEU B O   1 
ATOM 4280  C CB  . LEU B 1 177 ? 4.047   5.669   89.966   1.00 10.00 ? ? ? ? ? ? 178 LEU B CB  1 
ATOM 4281  C CG  . LEU B 1 177 ? 2.553   5.376   89.954   1.00 10.00 ? ? ? ? ? ? 178 LEU B CG  1 
ATOM 4282  C CD1 . LEU B 1 177 ? 1.857   6.465   90.734   1.00 10.00 ? ? ? ? ? ? 178 LEU B CD1 1 
ATOM 4283  C CD2 . LEU B 1 177 ? 2.054   5.219   88.530   1.00 10.00 ? ? ? ? ? ? 178 LEU B CD2 1 
ATOM 4284  N N   . ASP B 1 178 ? 5.280   3.409   87.852   1.00 10.00 ? ? ? ? ? ? 179 ASP B N   1 
ATOM 4285  C CA  . ASP B 1 178 ? 5.825   3.227   86.545   1.00 10.00 ? ? ? ? ? ? 179 ASP B CA  1 
ATOM 4286  C C   . ASP B 1 178 ? 4.848   3.700   85.484   1.00 10.00 ? ? ? ? ? ? 179 ASP B C   1 
ATOM 4287  O O   . ASP B 1 178 ? 4.116   2.978   84.789   1.00 10.00 ? ? ? ? ? ? 179 ASP B O   1 
ATOM 4288  C CB  . ASP B 1 178 ? 6.239   1.728   86.482   1.00 10.00 ? ? ? ? ? ? 179 ASP B CB  1 
ATOM 4289  C CG  . ASP B 1 178 ? 7.626   1.431   87.130   1.00 10.00 ? ? ? ? ? ? 179 ASP B CG  1 
ATOM 4290  O OD1 . ASP B 1 178 ? 8.262   2.354   87.651   1.00 10.00 ? ? ? ? ? ? 179 ASP B OD1 1 
ATOM 4291  O OD2 . ASP B 1 178 ? 8.089   0.282   87.122   1.00 10.00 ? ? ? ? ? ? 179 ASP B OD2 1 
ATOM 4292  N N   . LEU B 1 179 ? 4.825   5.014   85.454   1.00 10.00 ? ? ? ? ? ? 180 LEU B N   1 
ATOM 4293  C CA  . LEU B 1 179 ? 4.023   5.752   84.513   1.00 10.00 ? ? ? ? ? ? 180 LEU B CA  1 
ATOM 4294  C C   . LEU B 1 179 ? 4.605   7.156   84.608   1.00 10.00 ? ? ? ? ? ? 180 LEU B C   1 
ATOM 4295  O O   . LEU B 1 179 ? 4.643   7.774   85.676   1.00 10.00 ? ? ? ? ? ? 180 LEU B O   1 
ATOM 4296  C CB  . LEU B 1 179 ? 2.564   5.661   84.947   1.00 10.00 ? ? ? ? ? ? 180 LEU B CB  1 
ATOM 4297  C CG  . LEU B 1 179 ? 1.650   6.855   84.928   1.00 10.00 ? ? ? ? ? ? 180 LEU B CG  1 
ATOM 4298  C CD1 . LEU B 1 179 ? 1.370   7.356   83.539   1.00 10.00 ? ? ? ? ? ? 180 LEU B CD1 1 
ATOM 4299  C CD2 . LEU B 1 179 ? 0.333   6.416   85.486   1.00 10.00 ? ? ? ? ? ? 180 LEU B CD2 1 
ATOM 4300  N N   . ALA B 1 180 ? 5.152   7.619   83.499   1.00 10.00 ? ? ? ? ? ? 181 ALA B N   1 
ATOM 4301  C CA  . ALA B 1 180 ? 5.776   8.920   83.445   1.00 10.00 ? ? ? ? ? ? 181 ALA B CA  1 
ATOM 4302  C C   . ALA B 1 180 ? 5.732   9.384   81.996   1.00 10.00 ? ? ? ? ? ? 181 ALA B C   1 
ATOM 4303  O O   . ALA B 1 180 ? 5.052   8.666   81.250   1.00 10.00 ? ? ? ? ? ? 181 ALA B O   1 
ATOM 4304  C CB  . ALA B 1 180 ? 7.192   8.804   83.854   1.00 10.00 ? ? ? ? ? ? 181 ALA B CB  1 
ATOM 4305  N N   . GLY B 1 181 ? 6.449   10.446  81.567   1.00 10.00 ? ? ? ? ? ? 182 GLY B N   1 
ATOM 4306  C CA  . GLY B 1 181 ? 6.422   10.994  80.222   1.00 10.00 ? ? ? ? ? ? 182 GLY B CA  1 
ATOM 4307  C C   . GLY B 1 181 ? 6.287   10.051  79.004   1.00 10.00 ? ? ? ? ? ? 182 GLY B C   1 
ATOM 4308  O O   . GLY B 1 181 ? 5.573   10.366  78.035   1.00 10.00 ? ? ? ? ? ? 182 GLY B O   1 
ATOM 4309  N N   . ARG B 1 182 ? 6.901   8.877   78.955   1.00 10.00 ? ? ? ? ? ? 183 ARG B N   1 
ATOM 4310  C CA  . ARG B 1 182 ? 6.808   8.024   77.780   1.00 10.00 ? ? ? ? ? ? 183 ARG B CA  1 
ATOM 4311  C C   . ARG B 1 182 ? 5.418   7.399   77.684   1.00 10.00 ? ? ? ? ? ? 183 ARG B C   1 
ATOM 4312  O O   . ARG B 1 182 ? 4.828   7.230   76.611   1.00 10.00 ? ? ? ? ? ? 183 ARG B O   1 
ATOM 4313  C CB  . ARG B 1 182 ? 7.884   6.963   77.897   1.00 10.00 ? ? ? ? ? ? 183 ARG B CB  1 
ATOM 4314  C CG  . ARG B 1 182 ? 8.655   6.555   76.664   1.00 10.00 ? ? ? ? ? ? 183 ARG B CG  1 
ATOM 4315  C CD  . ARG B 1 182 ? 9.904   5.784   77.200   1.00 10.00 ? ? ? ? ? ? 183 ARG B CD  1 
ATOM 4316  N NE  . ARG B 1 182 ? 9.587   4.518   77.898   1.00 10.00 ? ? ? ? ? ? 183 ARG B NE  1 
ATOM 4317  C CZ  . ARG B 1 182 ? 10.055  3.286   77.526   1.00 10.00 ? ? ? ? ? ? 183 ARG B CZ  1 
ATOM 4318  N NH1 . ARG B 1 182 ? 10.887  3.075   76.469   1.00 10.00 ? ? ? ? ? ? 183 ARG B NH1 1 
ATOM 4319  N NH2 . ARG B 1 182 ? 9.616   2.210   78.203   1.00 10.00 ? ? ? ? ? ? 183 ARG B NH2 1 
ATOM 4320  N N   . ASP B 1 183 ? 4.858   7.104   78.850   1.00 10.00 ? ? ? ? ? ? 184 ASP B N   1 
ATOM 4321  C CA  . ASP B 1 183 ? 3.541   6.530   78.949   1.00 10.00 ? ? ? ? ? ? 184 ASP B CA  1 
ATOM 4322  C C   . ASP B 1 183 ? 2.542   7.510   78.401   1.00 10.00 ? ? ? ? ? ? 184 ASP B C   1 
ATOM 4323  O O   . ASP B 1 183 ? 1.617   7.112   77.698   1.00 10.00 ? ? ? ? ? ? 184 ASP B O   1 
ATOM 4324  C CB  . ASP B 1 183 ? 3.257   6.221   80.395   1.00 10.00 ? ? ? ? ? ? 184 ASP B CB  1 
ATOM 4325  C CG  . ASP B 1 183 ? 4.195   5.129   80.886   1.00 10.00 ? ? ? ? ? ? 184 ASP B CG  1 
ATOM 4326  O OD1 . ASP B 1 183 ? 5.353   5.426   81.187   1.00 10.00 ? ? ? ? ? ? 184 ASP B OD1 1 
ATOM 4327  O OD2 . ASP B 1 183 ? 3.744   3.989   80.941   1.00 10.00 ? ? ? ? ? ? 184 ASP B OD2 1 
ATOM 4328  N N   . LEU B 1 184 ? 2.781   8.802   78.601   1.00 10.00 ? ? ? ? ? ? 185 LEU B N   1 
ATOM 4329  C CA  . LEU B 1 184 ? 1.917   9.858   78.152   1.00 10.00 ? ? ? ? ? ? 185 LEU B CA  1 
ATOM 4330  C C   . LEU B 1 184 ? 2.151   10.216  76.702   1.00 10.00 ? ? ? ? ? ? 185 LEU B C   1 
ATOM 4331  O O   . LEU B 1 184 ? 1.189   10.587  76.032   1.00 10.00 ? ? ? ? ? ? 185 LEU B O   1 
ATOM 4332  C CB  . LEU B 1 184 ? 2.142   11.009  79.065   1.00 10.00 ? ? ? ? ? ? 185 LEU B CB  1 
ATOM 4333  C CG  . LEU B 1 184 ? 1.094   11.311  80.141   1.00 10.00 ? ? ? ? ? ? 185 LEU B CG  1 
ATOM 4334  C CD1 . LEU B 1 184 ? 0.632   10.171  80.979   1.00 10.00 ? ? ? ? ? ? 185 LEU B CD1 1 
ATOM 4335  C CD2 . LEU B 1 184 ? 1.800   12.237  81.078   1.00 10.00 ? ? ? ? ? ? 185 LEU B CD2 1 
ATOM 4336  N N   . THR B 1 185 ? 3.341   10.129  76.116   1.00 10.00 ? ? ? ? ? ? 186 THR B N   1 
ATOM 4337  C CA  . THR B 1 185 ? 3.533   10.302  74.668   1.00 10.00 ? ? ? ? ? ? 186 THR B CA  1 
ATOM 4338  C C   . THR B 1 185 ? 2.839   9.209   73.870   1.00 10.00 ? ? ? ? ? ? 186 THR B C   1 
ATOM 4339  O O   . THR B 1 185 ? 2.185   9.452   72.863   1.00 10.00 ? ? ? ? ? ? 186 THR B O   1 
ATOM 4340  C CB  . THR B 1 185 ? 5.029   10.294  74.334   1.00 10.00 ? ? ? ? ? ? 186 THR B CB  1 
ATOM 4341  O OG1 . THR B 1 185 ? 5.598   11.396  75.052   1.00 10.00 ? ? ? ? ? ? 186 THR B OG1 1 
ATOM 4342  C CG2 . THR B 1 185 ? 5.316   10.442  72.867   1.00 10.00 ? ? ? ? ? ? 186 THR B CG2 1 
ATOM 4343  N N   . ASP B 1 186 ? 2.957   7.999   74.371   1.00 10.00 ? ? ? ? ? ? 187 ASP B N   1 
ATOM 4344  C CA  . ASP B 1 186 ? 2.329   6.838   73.823   1.00 10.00 ? ? ? ? ? ? 187 ASP B CA  1 
ATOM 4345  C C   . ASP B 1 186 ? 0.818   6.802   73.797   1.00 10.00 ? ? ? ? ? ? 187 ASP B C   1 
ATOM 4346  O O   . ASP B 1 186 ? 0.213   6.238   72.878   1.00 10.00 ? ? ? ? ? ? 187 ASP B O   1 
ATOM 4347  C CB  . ASP B 1 186 ? 2.769   5.645   74.581   1.00 10.00 ? ? ? ? ? ? 187 ASP B CB  1 
ATOM 4348  C CG  . ASP B 1 186 ? 4.093   5.143   74.147   1.00 10.00 ? ? ? ? ? ? 187 ASP B CG  1 
ATOM 4349  O OD1 . ASP B 1 186 ? 4.679   5.676   73.218   1.00 10.00 ? ? ? ? ? ? 187 ASP B OD1 1 
ATOM 4350  O OD2 . ASP B 1 186 ? 4.553   4.185   74.746   1.00 10.00 ? ? ? ? ? ? 187 ASP B OD2 1 
ATOM 4351  N N   . TYR B 1 187 ? 0.224   7.279   74.894   1.00 10.00 ? ? ? ? ? ? 188 TYR B N   1 
ATOM 4352  C CA  . TYR B 1 187 ? -1.213  7.299   75.020   1.00 10.00 ? ? ? ? ? ? 188 TYR B CA  1 
ATOM 4353  C C   . TYR B 1 187 ? -1.809  8.424   74.205   1.00 10.00 ? ? ? ? ? ? 188 TYR B C   1 
ATOM 4354  O O   . TYR B 1 187 ? -2.949  8.313   73.756   1.00 10.00 ? ? ? ? ? ? 188 TYR B O   1 
ATOM 4355  C CB  . TYR B 1 187 ? -1.511  7.437   76.470   1.00 10.00 ? ? ? ? ? ? 188 TYR B CB  1 
ATOM 4356  C CG  . TYR B 1 187 ? -2.963  7.561   76.774   1.00 10.00 ? ? ? ? ? ? 188 TYR B CG  1 
ATOM 4357  C CD1 . TYR B 1 187 ? -3.838  6.540   76.517   1.00 10.00 ? ? ? ? ? ? 188 TYR B CD1 1 
ATOM 4358  C CD2 . TYR B 1 187 ? -3.366  8.724   77.343   1.00 10.00 ? ? ? ? ? ? 188 TYR B CD2 1 
ATOM 4359  C CE1 . TYR B 1 187 ? -5.174  6.698   76.854   1.00 10.00 ? ? ? ? ? ? 188 TYR B CE1 1 
ATOM 4360  C CE2 . TYR B 1 187 ? -4.692  8.889   77.681   1.00 10.00 ? ? ? ? ? ? 188 TYR B CE2 1 
ATOM 4361  C CZ  . TYR B 1 187 ? -5.598  7.882   77.441   1.00 10.00 ? ? ? ? ? ? 188 TYR B CZ  1 
ATOM 4362  O OH  . TYR B 1 187 ? -6.926  8.089   77.818   1.00 10.00 ? ? ? ? ? ? 188 TYR B OH  1 
ATOM 4363  N N   . LEU B 1 188 ? -1.051  9.485   73.993   1.00 10.00 ? ? ? ? ? ? 189 LEU B N   1 
ATOM 4364  C CA  . LEU B 1 188 ? -1.475  10.595  73.170   1.00 10.00 ? ? ? ? ? ? 189 LEU B CA  1 
ATOM 4365  C C   . LEU B 1 188 ? -1.588  10.116  71.728   1.00 10.00 ? ? ? ? ? ? 189 LEU B C   1 
ATOM 4366  O O   . LEU B 1 188 ? -2.595  10.386  71.074   1.00 10.00 ? ? ? ? ? ? 189 LEU B O   1 
ATOM 4367  C CB  . LEU B 1 188 ? -0.448  11.719  73.256   1.00 10.00 ? ? ? ? ? ? 189 LEU B CB  1 
ATOM 4368  C CG  . LEU B 1 188 ? -0.643  12.872  72.279   1.00 10.00 ? ? ? ? ? ? 189 LEU B CG  1 
ATOM 4369  C CD1 . LEU B 1 188 ? -1.755  13.766  72.792   1.00 10.00 ? ? ? ? ? ? 189 LEU B CD1 1 
ATOM 4370  C CD2 . LEU B 1 188 ? 0.654   13.638  72.096   1.00 10.00 ? ? ? ? ? ? 189 LEU B CD2 1 
ATOM 4371  N N   . MET B 1 189 ? -0.565  9.417   71.201   1.00 10.00 ? ? ? ? ? ? 190 MET B N   1 
ATOM 4372  C CA  . MET B 1 189 ? -0.490  8.918   69.810   1.00 10.00 ? ? ? ? ? ? 190 MET B CA  1 
ATOM 4373  C C   . MET B 1 189 ? -1.623  7.958   69.511   1.00 10.00 ? ? ? ? ? ? 190 MET B C   1 
ATOM 4374  O O   . MET B 1 189 ? -2.155  8.045   68.408   1.00 10.00 ? ? ? ? ? ? 190 MET B O   1 
ATOM 4375  C CB  . MET B 1 189 ? 0.860   8.187   69.549   1.00 10.00 ? ? ? ? ? ? 190 MET B CB  1 
ATOM 4376  C CG  . MET B 1 189 ? 1.232   7.383   68.314   1.00 10.00 ? ? ? ? ? ? 190 MET B CG  1 
ATOM 4377  S SD  . MET B 1 189 ? 3.056   7.214   68.205   1.00 10.00 ? ? ? ? ? ? 190 MET B SD  1 
ATOM 4378  C CE  . MET B 1 189 ? 3.522   6.433   69.741   1.00 10.00 ? ? ? ? ? ? 190 MET B CE  1 
ATOM 4379  N N   . LYS B 1 190 ? -1.990  7.077   70.464   1.00 10.00 ? ? ? ? ? ? 191 LYS B N   1 
ATOM 4380  C CA  . LYS B 1 190 ? -3.114  6.163   70.331   1.00 10.00 ? ? ? ? ? ? 191 LYS B CA  1 
ATOM 4381  C C   . LYS B 1 190 ? -4.376  6.967   70.363   1.00 10.00 ? ? ? ? ? ? 191 LYS B C   1 
ATOM 4382  O O   . LYS B 1 190 ? -5.161  6.715   69.463   1.00 10.00 ? ? ? ? ? ? 191 LYS B O   1 
ATOM 4383  C CB  . LYS B 1 190 ? -3.240  5.122   71.460   1.00 10.00 ? ? ? ? ? ? 191 LYS B CB  1 
ATOM 4384  C CG  . LYS B 1 190 ? -4.028  3.916   70.953   1.00 10.00 ? ? ? ? ? ? 191 LYS B CG  1 
ATOM 4385  C CD  . LYS B 1 190 ? -4.075  2.756   71.940   1.00 10.00 ? ? ? ? ? ? 191 LYS B CD  1 
ATOM 4386  C CE  . LYS B 1 190 ? -5.086  2.871   73.093   1.00 10.00 ? ? ? ? ? ? 191 LYS B CE  1 
ATOM 4387  N NZ  . LYS B 1 190 ? -5.012  4.145   73.799   1.00 10.00 ? ? ? ? ? ? 191 LYS B NZ  1 
ATOM 4388  N N   . ILE B 1 191 ? -4.631  7.926   71.236   1.00 10.00 ? ? ? ? ? ? 192 ILE B N   1 
ATOM 4389  C CA  . ILE B 1 191 ? -5.915  8.578   71.127   1.00 10.00 ? ? ? ? ? ? 192 ILE B CA  1 
ATOM 4390  C C   . ILE B 1 191 ? -5.894  9.405   69.827   1.00 10.00 ? ? ? ? ? ? 192 ILE B C   1 
ATOM 4391  O O   . ILE B 1 191 ? -6.893  9.379   69.111   1.00 10.00 ? ? ? ? ? ? 192 ILE B O   1 
ATOM 4392  C CB  . ILE B 1 191 ? -6.245  9.428   72.487   1.00 10.00 ? ? ? ? ? ? 192 ILE B CB  1 
ATOM 4393  C CG1 . ILE B 1 191 ? -5.245  10.501  73.011   1.00 10.00 ? ? ? ? ? ? 192 ILE B CG1 1 
ATOM 4394  C CG2 . ILE B 1 191 ? -6.337  8.318   73.504   1.00 10.00 ? ? ? ? ? ? 192 ILE B CG2 1 
ATOM 4395  C CD1 . ILE B 1 191 ? -5.394  11.255  74.397   1.00 10.00 ? ? ? ? ? ? 192 ILE B CD1 1 
ATOM 4396  N N   . LEU B 1 192 ? -4.793  9.992   69.364   1.00 10.00 ? ? ? ? ? ? 193 LEU B N   1 
ATOM 4397  C CA  . LEU B 1 192 ? -4.728  10.726  68.084   1.00 10.00 ? ? ? ? ? ? 193 LEU B CA  1 
ATOM 4398  C C   . LEU B 1 192 ? -4.937  9.843   66.809   1.00 10.00 ? ? ? ? ? ? 193 LEU B C   1 
ATOM 4399  O O   . LEU B 1 192 ? -5.678  10.195  65.885   1.00 10.00 ? ? ? ? ? ? 193 LEU B O   1 
ATOM 4400  C CB  . LEU B 1 192 ? -3.368  11.437  68.083   1.00 10.00 ? ? ? ? ? ? 193 LEU B CB  1 
ATOM 4401  C CG  . LEU B 1 192 ? -3.304  12.915  67.804   1.00 10.00 ? ? ? ? ? ? 193 LEU B CG  1 
ATOM 4402  C CD1 . LEU B 1 192 ? -4.381  13.578  68.602   1.00 10.00 ? ? ? ? ? ? 193 LEU B CD1 1 
ATOM 4403  C CD2 . LEU B 1 192 ? -1.949  13.490  68.147   1.00 10.00 ? ? ? ? ? ? 193 LEU B CD2 1 
ATOM 4404  N N   . THR B 1 193 ? -4.352  8.650   66.748   1.00 10.00 ? ? ? ? ? ? 194 THR B N   1 
ATOM 4405  C CA  . THR B 1 193 ? -4.510  7.612   65.714   1.00 10.00 ? ? ? ? ? ? 194 THR B CA  1 
ATOM 4406  C C   . THR B 1 193 ? -5.917  6.989   65.770   1.00 10.00 ? ? ? ? ? ? 194 THR B C   1 
ATOM 4407  O O   . THR B 1 193 ? -6.451  6.448   64.792   1.00 10.00 ? ? ? ? ? ? 194 THR B O   1 
ATOM 4408  C CB  . THR B 1 193 ? -3.364  6.506   65.946   1.00 10.00 ? ? ? ? ? ? 194 THR B CB  1 
ATOM 4409  O OG1 . THR B 1 193 ? -2.176  7.062   65.397   1.00 10.00 ? ? ? ? ? ? 194 THR B OG1 1 
ATOM 4410  C CG2 . THR B 1 193 ? -3.611  5.142   65.340   1.00 10.00 ? ? ? ? ? ? 194 THR B CG2 1 
ATOM 4411  N N   . GLU B 1 194 ? -6.550  7.003   66.955   1.00 10.00 ? ? ? ? ? ? 195 GLU B N   1 
ATOM 4412  C CA  . GLU B 1 194 ? -7.915  6.511   67.095   1.00 10.00 ? ? ? ? ? ? 195 GLU B CA  1 
ATOM 4413  C C   . GLU B 1 194 ? -8.783  7.487   66.335   1.00 10.00 ? ? ? ? ? ? 195 GLU B C   1 
ATOM 4414  O O   . GLU B 1 194 ? -9.694  7.032   65.638   1.00 10.00 ? ? ? ? ? ? 195 GLU B O   1 
ATOM 4415  C CB  . GLU B 1 194 ? -8.356  6.431   68.579   1.00 10.00 ? ? ? ? ? ? 195 GLU B CB  1 
ATOM 4416  C CG  . GLU B 1 194 ? -7.796  5.123   69.156   1.00 10.00 ? ? ? ? ? ? 195 GLU B CG  1 
ATOM 4417  C CD  . GLU B 1 194 ? -8.212  4.691   70.554   1.00 10.00 ? ? ? ? ? ? 195 GLU B CD  1 
ATOM 4418  O OE1 . GLU B 1 194 ? -8.442  5.567   71.401   1.00 10.00 ? ? ? ? ? ? 195 GLU B OE1 1 
ATOM 4419  O OE2 . GLU B 1 194 ? -8.301  3.464   70.781   1.00 10.00 ? ? ? ? ? ? 195 GLU B OE2 1 
ATOM 4420  N N   . ARG B 1 195 ? -8.439  8.782   66.294   1.00 10.00 ? ? ? ? ? ? 196 ARG B N   1 
ATOM 4421  C CA  . ARG B 1 195 ? -9.201  9.744   65.514   1.00 10.00 ? ? ? ? ? ? 196 ARG B CA  1 
ATOM 4422  C C   . ARG B 1 195 ? -8.873  9.593   64.003   1.00 10.00 ? ? ? ? ? ? 196 ARG B C   1 
ATOM 4423  O O   . ARG B 1 195 ? -9.063  10.498  63.195   1.00 10.00 ? ? ? ? ? ? 196 ARG B O   1 
ATOM 4424  C CB  . ARG B 1 195 ? -8.853  11.137  66.128   1.00 10.00 ? ? ? ? ? ? 196 ARG B CB  1 
ATOM 4425  C CG  . ARG B 1 195 ? -9.909  12.227  65.900   1.00 10.00 ? ? ? ? ? ? 196 ARG B CG  1 
ATOM 4426  C CD  . ARG B 1 195 ? -9.832  13.477  66.753   1.00 10.00 ? ? ? ? ? ? 196 ARG B CD  1 
ATOM 4427  N NE  . ARG B 1 195 ? -9.675  14.712  66.002   1.00 10.00 ? ? ? ? ? ? 196 ARG B NE  1 
ATOM 4428  C CZ  . ARG B 1 195 ? -9.937  15.932  66.538   1.00 10.00 ? ? ? ? ? ? 196 ARG B CZ  1 
ATOM 4429  N NH1 . ARG B 1 195 ? -10.349 16.140  67.793   1.00 10.00 ? ? ? ? ? ? 196 ARG B NH1 1 
ATOM 4430  N NH2 . ARG B 1 195 ? -9.882  17.029  65.780   1.00 10.00 ? ? ? ? ? ? 196 ARG B NH2 1 
ATOM 4431  N N   . GLY B 1 196 ? -8.414  8.422   63.550   1.00 10.00 ? ? ? ? ? ? 197 GLY B N   1 
ATOM 4432  C CA  . GLY B 1 196 ? -7.974  8.200   62.190   1.00 10.00 ? ? ? ? ? ? 197 GLY B CA  1 
ATOM 4433  C C   . GLY B 1 196 ? -6.801  9.109   61.757   1.00 10.00 ? ? ? ? ? ? 197 GLY B C   1 
ATOM 4434  O O   . GLY B 1 196 ? -6.843  9.746   60.685   1.00 10.00 ? ? ? ? ? ? 197 GLY B O   1 
ATOM 4435  N N   . TYR B 1 197 ? -5.760  9.252   62.585   1.00 10.00 ? ? ? ? ? ? 198 TYR B N   1 
ATOM 4436  C CA  . TYR B 1 197 ? -4.579  10.014  62.217   1.00 10.00 ? ? ? ? ? ? 198 TYR B CA  1 
ATOM 4437  C C   . TYR B 1 197 ? -3.516  8.979   61.959   1.00 10.00 ? ? ? ? ? ? 198 TYR B C   1 
ATOM 4438  O O   . TYR B 1 197 ? -3.623  7.790   62.292   1.00 10.00 ? ? ? ? ? ? 198 TYR B O   1 
ATOM 4439  C CB  . TYR B 1 197 ? -4.055  10.919  63.298   1.00 10.00 ? ? ? ? ? ? 198 TYR B CB  1 
ATOM 4440  C CG  . TYR B 1 197 ? -4.833  12.203  63.418   1.00 10.00 ? ? ? ? ? ? 198 TYR B CG  1 
ATOM 4441  C CD1 . TYR B 1 197 ? -5.122  13.000  62.343   1.00 10.00 ? ? ? ? ? ? 198 TYR B CD1 1 
ATOM 4442  C CD2 . TYR B 1 197 ? -5.218  12.599  64.664   1.00 10.00 ? ? ? ? ? ? 198 TYR B CD2 1 
ATOM 4443  C CE1 . TYR B 1 197 ? -5.787  14.190  62.550   1.00 10.00 ? ? ? ? ? ? 198 TYR B CE1 1 
ATOM 4444  C CE2 . TYR B 1 197 ? -5.881  13.780  64.889   1.00 10.00 ? ? ? ? ? ? 198 TYR B CE2 1 
ATOM 4445  C CZ  . TYR B 1 197 ? -6.152  14.565  63.825   1.00 10.00 ? ? ? ? ? ? 198 TYR B CZ  1 
ATOM 4446  O OH  . TYR B 1 197 ? -6.767  15.769  64.089   1.00 10.00 ? ? ? ? ? ? 198 TYR B OH  1 
ATOM 4447  N N   . SER B 1 198 ? -2.437  9.489   61.394   1.00 10.00 ? ? ? ? ? ? 199 SER B N   1 
ATOM 4448  C CA  . SER B 1 198 ? -1.453  8.601   60.821   1.00 10.00 ? ? ? ? ? ? 199 SER B CA  1 
ATOM 4449  C C   . SER B 1 198 ? -0.065  9.076   61.247   1.00 10.00 ? ? ? ? ? ? 199 SER B C   1 
ATOM 4450  O O   . SER B 1 198 ? 0.416   10.110  60.754   1.00 10.00 ? ? ? ? ? ? 199 SER B O   1 
ATOM 4451  C CB  . SER B 1 198 ? -1.726  8.678   59.295   1.00 10.00 ? ? ? ? ? ? 199 SER B CB  1 
ATOM 4452  O OG  . SER B 1 198 ? -3.129  8.614   58.924   1.00 10.00 ? ? ? ? ? ? 199 SER B OG  1 
ATOM 4453  N N   . PHE B 1 199 ? 0.594   8.382   62.194   1.00 10.00 ? ? ? ? ? ? 200 PHE B N   1 
ATOM 4454  C CA  . PHE B 1 199 ? 1.939   8.802   62.606   1.00 10.00 ? ? ? ? ? ? 200 PHE B CA  1 
ATOM 4455  C C   . PHE B 1 199 ? 2.907   7.776   62.108   1.00 10.00 ? ? ? ? ? ? 200 PHE B C   1 
ATOM 4456  O O   . PHE B 1 199 ? 3.822   7.300   62.789   1.00 10.00 ? ? ? ? ? ? 200 PHE B O   1 
ATOM 4457  C CB  . PHE B 1 199 ? 2.044   8.950   64.146   1.00 10.00 ? ? ? ? ? ? 200 PHE B CB  1 
ATOM 4458  C CG  . PHE B 1 199 ? 1.284   10.215  64.504   1.00 10.00 ? ? ? ? ? ? 200 PHE B CG  1 
ATOM 4459  C CD1 . PHE B 1 199 ? 1.805   11.438  64.122   1.00 10.00 ? ? ? ? ? ? 200 PHE B CD1 1 
ATOM 4460  C CD2 . PHE B 1 199 ? 0.069   10.102  65.128   1.00 10.00 ? ? ? ? ? ? 200 PHE B CD2 1 
ATOM 4461  C CE1 . PHE B 1 199 ? 1.080   12.568  64.370   1.00 10.00 ? ? ? ? ? ? 200 PHE B CE1 1 
ATOM 4462  C CE2 . PHE B 1 199 ? -0.651  11.225  65.369   1.00 10.00 ? ? ? ? ? ? 200 PHE B CE2 1 
ATOM 4463  C CZ  . PHE B 1 199 ? -0.145  12.447  64.991   1.00 10.00 ? ? ? ? ? ? 200 PHE B CZ  1 
ATOM 4464  N N   . THR B 1 200 ? 2.738   7.566   60.804   1.00 10.00 ? ? ? ? ? ? 201 THR B N   1 
ATOM 4465  C CA  . THR B 1 200 ? 3.407   6.409   60.267   1.00 10.00 ? ? ? ? ? ? 201 THR B CA  1 
ATOM 4466  C C   . THR B 1 200 ? 4.908   6.504   60.058   1.00 10.00 ? ? ? ? ? ? 201 THR B C   1 
ATOM 4467  O O   . THR B 1 200 ? 5.505   5.424   60.059   1.00 10.00 ? ? ? ? ? ? 201 THR B O   1 
ATOM 4468  C CB  . THR B 1 200 ? 2.597   5.950   58.932   1.00 10.00 ? ? ? ? ? ? 201 THR B CB  1 
ATOM 4469  O OG1 . THR B 1 200 ? 2.213   7.026   58.053   1.00 10.00 ? ? ? ? ? ? 201 THR B OG1 1 
ATOM 4470  C CG2 . THR B 1 200 ? 1.336   5.213   59.430   1.00 10.00 ? ? ? ? ? ? 201 THR B CG2 1 
ATOM 4471  N N   . THR B 1 201 ? 5.587   7.652   59.963   1.00 10.00 ? ? ? ? ? ? 202 THR B N   1 
ATOM 4472  C CA  . THR B 1 201 ? 7.021   7.569   59.684   1.00 10.00 ? ? ? ? ? ? 202 THR B CA  1 
ATOM 4473  C C   . THR B 1 201 ? 8.083   8.058   60.662   1.00 10.00 ? ? ? ? ? ? 202 THR B C   1 
ATOM 4474  O O   . THR B 1 201 ? 8.390   9.255   60.702   1.00 10.00 ? ? ? ? ? ? 202 THR B O   1 
ATOM 4475  C CB  . THR B 1 201 ? 7.218   8.212   58.285   1.00 10.00 ? ? ? ? ? ? 202 THR B CB  1 
ATOM 4476  O OG1 . THR B 1 201 ? 6.422   7.344   57.482   1.00 10.00 ? ? ? ? ? ? 202 THR B OG1 1 
ATOM 4477  C CG2 . THR B 1 201 ? 8.654   8.294   57.711   1.00 10.00 ? ? ? ? ? ? 202 THR B CG2 1 
ATOM 4478  N N   . THR B 1 202 ? 8.658   7.103   61.415   1.00 10.00 ? ? ? ? ? ? 203 THR B N   1 
ATOM 4479  C CA  . THR B 1 202 ? 9.786   7.234   62.377   1.00 10.00 ? ? ? ? ? ? 203 THR B CA  1 
ATOM 4480  C C   . THR B 1 202 ? 10.003  8.562   63.117   1.00 10.00 ? ? ? ? ? ? 203 THR B C   1 
ATOM 4481  O O   . THR B 1 202 ? 9.751   8.605   64.324   1.00 10.00 ? ? ? ? ? ? 203 THR B O   1 
ATOM 4482  C CB  . THR B 1 202 ? 11.213  6.852   61.701   1.00 10.00 ? ? ? ? ? ? 203 THR B CB  1 
ATOM 4483  O OG1 . THR B 1 202 ? 11.074  6.215   60.411   1.00 10.00 ? ? ? ? ? ? 203 THR B OG1 1 
ATOM 4484  C CG2 . THR B 1 202 ? 11.949  5.925   62.681   1.00 10.00 ? ? ? ? ? ? 203 THR B CG2 1 
ATOM 4485  N N   . ALA B 1 203 ? 10.414  9.631   62.396   1.00 10.00 ? ? ? ? ? ? 204 ALA B N   1 
ATOM 4486  C CA  . ALA B 1 203 ? 10.624  10.980  62.902   1.00 10.00 ? ? ? ? ? ? 204 ALA B CA  1 
ATOM 4487  C C   . ALA B 1 203 ? 9.279   11.276  63.487   1.00 10.00 ? ? ? ? ? ? 204 ALA B C   1 
ATOM 4488  O O   . ALA B 1 203 ? 9.216   11.358  64.708   1.00 10.00 ? ? ? ? ? ? 204 ALA B O   1 
ATOM 4489  C CB  . ALA B 1 203 ? 10.809  12.063  61.856   1.00 10.00 ? ? ? ? ? ? 204 ALA B CB  1 
ATOM 4490  N N   . GLU B 1 204 ? 8.190   11.221  62.692   1.00 10.00 ? ? ? ? ? ? 205 GLU B N   1 
ATOM 4491  C CA  . GLU B 1 204 ? 6.889   11.570  63.223   1.00 10.00 ? ? ? ? ? ? 205 GLU B CA  1 
ATOM 4492  C C   . GLU B 1 204 ? 6.358   10.709  64.395   1.00 10.00 ? ? ? ? ? ? 205 GLU B C   1 
ATOM 4493  O O   . GLU B 1 204 ? 5.329   11.099  64.966   1.00 10.00 ? ? ? ? ? ? 205 GLU B O   1 
ATOM 4494  C CB  . GLU B 1 204 ? 5.887   11.653  62.028   1.00 10.00 ? ? ? ? ? ? 205 GLU B CB  1 
ATOM 4495  C CG  . GLU B 1 204 ? 5.280   10.464  61.326   1.00 10.00 ? ? ? ? ? ? 205 GLU B CG  1 
ATOM 4496  C CD  . GLU B 1 204 ? 4.230   10.847  60.269   1.00 10.00 ? ? ? ? ? ? 205 GLU B CD  1 
ATOM 4497  O OE1 . GLU B 1 204 ? 3.054   11.007  60.597   1.00 10.00 ? ? ? ? ? ? 205 GLU B OE1 1 
ATOM 4498  O OE2 . GLU B 1 204 ? 4.566   10.997  59.101   1.00 10.00 ? ? ? ? ? ? 205 GLU B OE2 1 
ATOM 4499  N N   . ARG B 1 205 ? 7.066   9.678   64.900   1.00 10.00 ? ? ? ? ? ? 206 ARG B N   1 
ATOM 4500  C CA  . ARG B 1 205 ? 6.707   9.018   66.176   1.00 10.00 ? ? ? ? ? ? 206 ARG B CA  1 
ATOM 4501  C C   . ARG B 1 205 ? 7.185   9.900   67.354   1.00 10.00 ? ? ? ? ? ? 206 ARG B C   1 
ATOM 4502  O O   . ARG B 1 205 ? 6.743   9.904   68.512   1.00 10.00 ? ? ? ? ? ? 206 ARG B O   1 
ATOM 4503  C CB  . ARG B 1 205 ? 7.379   7.631   66.345   1.00 10.00 ? ? ? ? ? ? 206 ARG B CB  1 
ATOM 4504  C CG  . ARG B 1 205 ? 6.552   6.707   67.277   1.00 10.00 ? ? ? ? ? ? 206 ARG B CG  1 
ATOM 4505  C CD  . ARG B 1 205 ? 7.047   6.301   68.703   1.00 10.00 ? ? ? ? ? ? 206 ARG B CD  1 
ATOM 4506  N NE  . ARG B 1 205 ? 7.335   7.323   69.729   1.00 10.00 ? ? ? ? ? ? 206 ARG B NE  1 
ATOM 4507  C CZ  . ARG B 1 205 ? 7.410   6.965   71.022   1.00 10.00 ? ? ? ? ? ? 206 ARG B CZ  1 
ATOM 4508  N NH1 . ARG B 1 205 ? 7.203   5.709   71.411   1.00 10.00 ? ? ? ? ? ? 206 ARG B NH1 1 
ATOM 4509  N NH2 . ARG B 1 205 ? 7.827   7.829   71.936   1.00 10.00 ? ? ? ? ? ? 206 ARG B NH2 1 
ATOM 4510  N N   . GLU B 1 206 ? 8.225   10.627  67.032   1.00 10.00 ? ? ? ? ? ? 207 GLU B N   1 
ATOM 4511  C CA  . GLU B 1 206 ? 8.742   11.675  67.870   1.00 10.00 ? ? ? ? ? ? 207 GLU B CA  1 
ATOM 4512  C C   . GLU B 1 206 ? 7.941   12.946  67.629   1.00 10.00 ? ? ? ? ? ? 207 GLU B C   1 
ATOM 4513  O O   . GLU B 1 206 ? 8.169   13.929  68.314   1.00 10.00 ? ? ? ? ? ? 207 GLU B O   1 
ATOM 4514  C CB  . GLU B 1 206 ? 10.221  11.913  67.535   1.00 10.00 ? ? ? ? ? ? 207 GLU B CB  1 
ATOM 4515  C CG  . GLU B 1 206 ? 11.142  11.719  68.738   1.00 10.00 ? ? ? ? ? ? 207 GLU B CG  1 
ATOM 4516  C CD  . GLU B 1 206 ? 10.703  12.538  69.970   1.00 10.00 ? ? ? ? ? ? 207 GLU B CD  1 
ATOM 4517  O OE1 . GLU B 1 206 ? 11.019  13.736  70.026   1.00 10.00 ? ? ? ? ? ? 207 GLU B OE1 1 
ATOM 4518  O OE2 . GLU B 1 206 ? 10.031  11.964  70.846   1.00 10.00 ? ? ? ? ? ? 207 GLU B OE2 1 
ATOM 4519  N N   . ILE B 1 207 ? 6.960   13.043  66.741   1.00 10.00 ? ? ? ? ? ? 208 ILE B N   1 
ATOM 4520  C CA  . ILE B 1 207 ? 6.202   14.289  66.586   1.00 10.00 ? ? ? ? ? ? 208 ILE B CA  1 
ATOM 4521  C C   . ILE B 1 207 ? 5.006   14.362  67.559   1.00 10.00 ? ? ? ? ? ? 208 ILE B C   1 
ATOM 4522  O O   . ILE B 1 207 ? 4.421   15.428  67.828   1.00 10.00 ? ? ? ? ? ? 208 ILE B O   1 
ATOM 4523  C CB  . ILE B 1 207 ? 5.819   14.381  65.070   1.00 10.00 ? ? ? ? ? ? 208 ILE B CB  1 
ATOM 4524  C CG1 . ILE B 1 207 ? 6.438   15.691  64.621   1.00 10.00 ? ? ? ? ? ? 208 ILE B CG1 1 
ATOM 4525  C CG2 . ILE B 1 207 ? 4.317   14.306  64.727   1.00 10.00 ? ? ? ? ? ? 208 ILE B CG2 1 
ATOM 4526  C CD1 . ILE B 1 207 ? 7.881   15.490  64.110   1.00 10.00 ? ? ? ? ? ? 208 ILE B CD1 1 
ATOM 4527  N N   . VAL B 1 208 ? 4.638   13.218  68.156   1.00 10.00 ? ? ? ? ? ? 209 VAL B N   1 
ATOM 4528  C CA  . VAL B 1 208 ? 3.653   13.243  69.220   1.00 10.00 ? ? ? ? ? ? 209 VAL B CA  1 
ATOM 4529  C C   . VAL B 1 208 ? 4.292   13.849  70.477   1.00 10.00 ? ? ? ? ? ? 209 VAL B C   1 
ATOM 4530  O O   . VAL B 1 208 ? 3.605   14.613  71.151   1.00 10.00 ? ? ? ? ? ? 209 VAL B O   1 
ATOM 4531  C CB  . VAL B 1 208 ? 3.086   11.815  69.492   1.00 10.00 ? ? ? ? ? ? 209 VAL B CB  1 
ATOM 4532  C CG1 . VAL B 1 208 ? 2.195   11.467  68.287   1.00 10.00 ? ? ? ? ? ? 209 VAL B CG1 1 
ATOM 4533  C CG2 . VAL B 1 208 ? 4.167   10.750  69.641   1.00 10.00 ? ? ? ? ? ? 209 VAL B CG2 1 
ATOM 4534  N N   . ARG B 1 209 ? 5.604   13.651  70.743   1.00 10.00 ? ? ? ? ? ? 210 ARG B N   1 
ATOM 4535  C CA  . ARG B 1 209 ? 6.349   14.219  71.872   1.00 10.00 ? ? ? ? ? ? 210 ARG B CA  1 
ATOM 4536  C C   . ARG B 1 209 ? 6.159   15.708  71.864   1.00 10.00 ? ? ? ? ? ? 210 ARG B C   1 
ATOM 4537  O O   . ARG B 1 209 ? 5.905   16.273  72.896   1.00 10.00 ? ? ? ? ? ? 210 ARG B O   1 
ATOM 4538  C CB  . ARG B 1 209 ? 7.863   13.936  71.757   1.00 10.00 ? ? ? ? ? ? 210 ARG B CB  1 
ATOM 4539  C CG  . ARG B 1 209 ? 8.757   14.057  73.016   1.00 10.00 ? ? ? ? ? ? 210 ARG B CG  1 
ATOM 4540  C CD  . ARG B 1 209 ? 10.208  14.680  72.894   1.00 10.00 ? ? ? ? ? ? 210 ARG B CD  1 
ATOM 4541  N NE  . ARG B 1 209 ? 10.214  16.024  72.280   1.00 10.00 ? ? ? ? ? ? 210 ARG B NE  1 
ATOM 4542  C CZ  . ARG B 1 209 ? 10.919  17.119  72.663   1.00 10.00 ? ? ? ? ? ? 210 ARG B CZ  1 
ATOM 4543  N NH1 . ARG B 1 209 ? 11.766  17.174  73.704   1.00 10.00 ? ? ? ? ? ? 210 ARG B NH1 1 
ATOM 4544  N NH2 . ARG B 1 209 ? 10.720  18.263  72.006   1.00 10.00 ? ? ? ? ? ? 210 ARG B NH2 1 
ATOM 4545  N N   . ASP B 1 210 ? 6.246   16.413  70.747   1.00 10.00 ? ? ? ? ? ? 211 ASP B N   1 
ATOM 4546  C CA  . ASP B 1 210 ? 6.040   17.870  70.724   1.00 10.00 ? ? ? ? ? ? 211 ASP B CA  1 
ATOM 4547  C C   . ASP B 1 210 ? 4.575   18.272  70.857   1.00 10.00 ? ? ? ? ? ? 211 ASP B C   1 
ATOM 4548  O O   . ASP B 1 210 ? 4.325   19.339  71.406   1.00 10.00 ? ? ? ? ? ? 211 ASP B O   1 
ATOM 4549  C CB  . ASP B 1 210 ? 6.469   18.578  69.434   1.00 10.00 ? ? ? ? ? ? 211 ASP B CB  1 
ATOM 4550  C CG  . ASP B 1 210 ? 7.910   18.368  69.076   1.00 10.00 ? ? ? ? ? ? 211 ASP B CG  1 
ATOM 4551  O OD1 . ASP B 1 210 ? 8.259   17.290  68.529   1.00 10.00 ? ? ? ? ? ? 211 ASP B OD1 1 
ATOM 4552  O OD2 . ASP B 1 210 ? 8.661   19.300  69.370   1.00 10.00 ? ? ? ? ? ? 211 ASP B OD2 1 
ATOM 4553  N N   . ILE B 1 211 ? 3.571   17.540  70.351   1.00 10.00 ? ? ? ? ? ? 212 ILE B N   1 
ATOM 4554  C CA  . ILE B 1 211 ? 2.173   17.936  70.579   1.00 10.00 ? ? ? ? ? ? 212 ILE B CA  1 
ATOM 4555  C C   . ILE B 1 211 ? 1.928   17.848  72.114   1.00 10.00 ? ? ? ? ? ? 212 ILE B C   1 
ATOM 4556  O O   . ILE B 1 211 ? 1.489   18.798  72.779   1.00 10.00 ? ? ? ? ? ? 212 ILE B O   1 
ATOM 4557  C CB  . ILE B 1 211 ? 1.243   16.964  69.763   1.00 10.00 ? ? ? ? ? ? 212 ILE B CB  1 
ATOM 4558  C CG1 . ILE B 1 211 ? 1.518   17.050  68.279   1.00 10.00 ? ? ? ? ? ? 212 ILE B CG1 1 
ATOM 4559  C CG2 . ILE B 1 211 ? -0.193  17.340  69.968   1.00 10.00 ? ? ? ? ? ? 212 ILE B CG2 1 
ATOM 4560  C CD1 . ILE B 1 211 ? 1.206   15.732  67.595   1.00 10.00 ? ? ? ? ? ? 212 ILE B CD1 1 
ATOM 4561  N N   . LYS B 1 212 ? 2.376   16.739  72.713   1.00 10.00 ? ? ? ? ? ? 213 LYS B N   1 
ATOM 4562  C CA  . LYS B 1 212 ? 2.215   16.396  74.098   1.00 10.00 ? ? ? ? ? ? 213 LYS B CA  1 
ATOM 4563  C C   . LYS B 1 212 ? 2.802   17.499  74.881   1.00 10.00 ? ? ? ? ? ? 213 LYS B C   1 
ATOM 4564  O O   . LYS B 1 212 ? 2.111   18.069  75.717   1.00 10.00 ? ? ? ? ? ? 213 LYS B O   1 
ATOM 4565  C CB  . LYS B 1 212 ? 2.959   15.142  74.444   1.00 10.00 ? ? ? ? ? ? 213 LYS B CB  1 
ATOM 4566  C CG  . LYS B 1 212 ? 2.576   14.585  75.775   1.00 10.00 ? ? ? ? ? ? 213 LYS B CG  1 
ATOM 4567  C CD  . LYS B 1 212 ? 3.526   13.531  76.206   1.00 10.00 ? ? ? ? ? ? 213 LYS B CD  1 
ATOM 4568  C CE  . LYS B 1 212 ? 4.747   14.254  76.683   1.00 10.00 ? ? ? ? ? ? 213 LYS B CE  1 
ATOM 4569  N NZ  . LYS B 1 212 ? 5.859   13.339  76.760   1.00 10.00 ? ? ? ? ? ? 213 LYS B NZ  1 
ATOM 4570  N N   . GLU B 1 213 ? 4.028   17.854  74.567   1.00 10.00 ? ? ? ? ? ? 214 GLU B N   1 
ATOM 4571  C CA  . GLU B 1 213 ? 4.613   18.847  75.410   1.00 10.00 ? ? ? ? ? ? 214 GLU B CA  1 
ATOM 4572  C C   . GLU B 1 213 ? 4.048   20.179  75.019   1.00 10.00 ? ? ? ? ? ? 214 GLU B C   1 
ATOM 4573  O O   . GLU B 1 213 ? 3.987   21.022  75.912   1.00 10.00 ? ? ? ? ? ? 214 GLU B O   1 
ATOM 4574  C CB  . GLU B 1 213 ? 6.131   18.900  75.280   1.00 10.00 ? ? ? ? ? ? 214 GLU B CB  1 
ATOM 4575  C CG  . GLU B 1 213 ? 6.858   17.606  75.673   1.00 10.00 ? ? ? ? ? ? 214 GLU B CG  1 
ATOM 4576  C CD  . GLU B 1 213 ? 8.321   17.585  75.231   1.00 10.00 ? ? ? ? ? ? 214 GLU B CD  1 
ATOM 4577  O OE1 . GLU B 1 213 ? 8.810   18.574  74.691   1.00 10.00 ? ? ? ? ? ? 214 GLU B OE1 1 
ATOM 4578  O OE2 . GLU B 1 213 ? 8.981   16.570  75.431   1.00 10.00 ? ? ? ? ? ? 214 GLU B OE2 1 
ATOM 4579  N N   . LYS B 1 214 ? 3.589   20.430  73.780   1.00 10.00 ? ? ? ? ? ? 215 LYS B N   1 
ATOM 4580  C CA  . LYS B 1 214 ? 3.169   21.779  73.459   1.00 10.00 ? ? ? ? ? ? 215 LYS B CA  1 
ATOM 4581  C C   . LYS B 1 214 ? 1.753   22.147  73.729   1.00 10.00 ? ? ? ? ? ? 215 LYS B C   1 
ATOM 4582  O O   . LYS B 1 214 ? 1.475   23.310  73.974   1.00 10.00 ? ? ? ? ? ? 215 LYS B O   1 
ATOM 4583  C CB  . LYS B 1 214 ? 3.403   22.135  72.007   1.00 10.00 ? ? ? ? ? ? 215 LYS B CB  1 
ATOM 4584  C CG  . LYS B 1 214 ? 4.750   22.834  71.782   1.00 10.00 ? ? ? ? ? ? 215 LYS B CG  1 
ATOM 4585  C CD  . LYS B 1 214 ? 5.916   21.871  71.542   1.00 10.00 ? ? ? ? ? ? 215 LYS B CD  1 
ATOM 4586  C CE  . LYS B 1 214 ? 6.942   22.540  70.621   1.00 10.00 ? ? ? ? ? ? 215 LYS B CE  1 
ATOM 4587  N NZ  . LYS B 1 214 ? 8.000   21.616  70.260   1.00 10.00 ? ? ? ? ? ? 215 LYS B NZ  1 
ATOM 4588  N N   . LEU B 1 215 ? 0.826   21.210  73.708   1.00 10.00 ? ? ? ? ? ? 216 LEU B N   1 
ATOM 4589  C CA  . LEU B 1 215 ? -0.589  21.536  73.803   1.00 10.00 ? ? ? ? ? ? 216 LEU B CA  1 
ATOM 4590  C C   . LEU B 1 215 ? -1.206  20.908  75.031   1.00 10.00 ? ? ? ? ? ? 216 LEU B C   1 
ATOM 4591  O O   . LEU B 1 215 ? -2.265  21.407  75.432   1.00 10.00 ? ? ? ? ? ? 216 LEU B O   1 
ATOM 4592  C CB  . LEU B 1 215 ? -1.339  21.045  72.518   1.00 10.00 ? ? ? ? ? ? 216 LEU B CB  1 
ATOM 4593  C CG  . LEU B 1 215 ? -0.708  21.541  71.190   1.00 10.00 ? ? ? ? ? ? 216 LEU B CG  1 
ATOM 4594  C CD1 . LEU B 1 215 ? -1.136  20.612  70.113   1.00 10.00 ? ? ? ? ? ? 216 LEU B CD1 1 
ATOM 4595  C CD2 . LEU B 1 215 ? -1.029  23.013  70.910   1.00 10.00 ? ? ? ? ? ? 216 LEU B CD2 1 
ATOM 4596  N N   . CYS B 1 216 ? -0.650  19.835  75.655   1.00 10.00 ? ? ? ? ? ? 217 CYS B N   1 
ATOM 4597  C CA  . CYS B 1 216 ? -1.307  19.284  76.828   1.00 10.00 ? ? ? ? ? ? 217 CYS B CA  1 
ATOM 4598  C C   . CYS B 1 216 ? -1.345  20.206  78.022   1.00 10.00 ? ? ? ? ? ? 217 CYS B C   1 
ATOM 4599  O O   . CYS B 1 216 ? -0.631  21.194  78.097   1.00 10.00 ? ? ? ? ? ? 217 CYS B O   1 
ATOM 4600  C CB  . CYS B 1 216 ? -0.679  17.999  77.196   1.00 10.00 ? ? ? ? ? ? 217 CYS B CB  1 
ATOM 4601  S SG  . CYS B 1 216 ? -1.313  16.947  75.874   1.00 10.00 ? ? ? ? ? ? 217 CYS B SG  1 
ATOM 4602  N N   . TYR B 1 217 ? -2.364  19.871  78.806   1.00 10.00 ? ? ? ? ? ? 218 TYR B N   1 
ATOM 4603  C CA  . TYR B 1 217 ? -2.927  20.625  79.896   1.00 10.00 ? ? ? ? ? ? 218 TYR B CA  1 
ATOM 4604  C C   . TYR B 1 217 ? -3.482  19.573  80.863   1.00 10.00 ? ? ? ? ? ? 218 TYR B C   1 
ATOM 4605  O O   . TYR B 1 217 ? -3.897  18.468  80.468   1.00 10.00 ? ? ? ? ? ? 218 TYR B O   1 
ATOM 4606  C CB  . TYR B 1 217 ? -4.149  21.485  79.450   1.00 10.00 ? ? ? ? ? ? 218 TYR B CB  1 
ATOM 4607  C CG  . TYR B 1 217 ? -3.983  22.848  78.824   1.00 10.00 ? ? ? ? ? ? 218 TYR B CG  1 
ATOM 4608  C CD1 . TYR B 1 217 ? -2.995  23.173  77.903   1.00 10.00 ? ? ? ? ? ? 218 TYR B CD1 1 
ATOM 4609  C CD2 . TYR B 1 217 ? -4.822  23.846  79.271   1.00 10.00 ? ? ? ? ? ? 218 TYR B CD2 1 
ATOM 4610  C CE1 . TYR B 1 217 ? -2.836  24.485  77.437   1.00 10.00 ? ? ? ? ? ? 218 TYR B CE1 1 
ATOM 4611  C CE2 . TYR B 1 217 ? -4.676  25.157  78.812   1.00 10.00 ? ? ? ? ? ? 218 TYR B CE2 1 
ATOM 4612  C CZ  . TYR B 1 217 ? -3.683  25.489  77.899   1.00 10.00 ? ? ? ? ? ? 218 TYR B CZ  1 
ATOM 4613  O OH  . TYR B 1 217 ? -3.568  26.821  77.458   1.00 10.00 ? ? ? ? ? ? 218 TYR B OH  1 
ATOM 4614  N N   . VAL B 1 218 ? -3.552  19.974  82.133   1.00 10.00 ? ? ? ? ? ? 219 VAL B N   1 
ATOM 4615  C CA  . VAL B 1 218 ? -4.181  19.211  83.179   1.00 10.00 ? ? ? ? ? ? 219 VAL B CA  1 
ATOM 4616  C C   . VAL B 1 218 ? -5.409  20.049  83.522   1.00 10.00 ? ? ? ? ? ? 219 VAL B C   1 
ATOM 4617  O O   . VAL B 1 218 ? -5.376  21.271  83.683   1.00 10.00 ? ? ? ? ? ? 219 VAL B O   1 
ATOM 4618  C CB  . VAL B 1 218 ? -3.279  19.082  84.420   1.00 10.00 ? ? ? ? ? ? 219 VAL B CB  1 
ATOM 4619  C CG1 . VAL B 1 218 ? -4.010  18.251  85.467   1.00 10.00 ? ? ? ? ? ? 219 VAL B CG1 1 
ATOM 4620  C CG2 . VAL B 1 218 ? -1.975  18.396  84.073   1.00 10.00 ? ? ? ? ? ? 219 VAL B CG2 1 
ATOM 4621  N N   . ALA B 1 219 ? -6.518  19.319  83.560   1.00 10.00 ? ? ? ? ? ? 220 ALA B N   1 
ATOM 4622  C CA  . ALA B 1 219 ? -7.850  19.815  83.850   1.00 10.00 ? ? ? ? ? ? 220 ALA B CA  1 
ATOM 4623  C C   . ALA B 1 219 ? -8.050  19.838  85.343   1.00 10.00 ? ? ? ? ? ? 220 ALA B C   1 
ATOM 4624  O O   . ALA B 1 219 ? -7.524  18.923  85.963   1.00 10.00 ? ? ? ? ? ? 220 ALA B O   1 
ATOM 4625  C CB  . ALA B 1 219 ? -8.942  18.903  83.266   1.00 10.00 ? ? ? ? ? ? 220 ALA B CB  1 
ATOM 4626  N N   . LEU B 1 220 ? -8.812  20.808  85.901   1.00 10.00 ? ? ? ? ? ? 221 LEU B N   1 
ATOM 4627  C CA  . LEU B 1 220 ? -9.138  20.918  87.331   1.00 10.00 ? ? ? ? ? ? 221 LEU B CA  1 
ATOM 4628  C C   . LEU B 1 220 ? -10.244 19.964  87.631   1.00 10.00 ? ? ? ? ? ? 221 LEU B C   1 
ATOM 4629  O O   . LEU B 1 220 ? -10.267 19.243  88.621   1.00 10.00 ? ? ? ? ? ? 221 LEU B O   1 
ATOM 4630  C CB  . LEU B 1 220 ? -9.636  22.294  87.745   1.00 10.00 ? ? ? ? ? ? 221 LEU B CB  1 
ATOM 4631  C CG  . LEU B 1 220 ? -8.782  23.195  88.642   1.00 10.00 ? ? ? ? ? ? 221 LEU B CG  1 
ATOM 4632  C CD1 . LEU B 1 220 ? -9.710  24.242  89.199   1.00 10.00 ? ? ? ? ? ? 221 LEU B CD1 1 
ATOM 4633  C CD2 . LEU B 1 220 ? -8.170  22.452  89.845   1.00 10.00 ? ? ? ? ? ? 221 LEU B CD2 1 
ATOM 4634  N N   . ASP B 1 221 ? -11.213 19.982  86.753   1.00 10.00 ? ? ? ? ? ? 222 ASP B N   1 
ATOM 4635  C CA  . ASP B 1 221 ? -12.255 19.022  86.920   1.00 10.00 ? ? ? ? ? ? 222 ASP B CA  1 
ATOM 4636  C C   . ASP B 1 221 ? -12.371 18.319  85.577   1.00 10.00 ? ? ? ? ? ? 222 ASP B C   1 
ATOM 4637  O O   . ASP B 1 221 ? -13.068 18.857  84.701   1.00 10.00 ? ? ? ? ? ? 222 ASP B O   1 
ATOM 4638  C CB  . ASP B 1 221 ? -13.558 19.737  87.320   1.00 10.00 ? ? ? ? ? ? 222 ASP B CB  1 
ATOM 4639  C CG  . ASP B 1 221 ? -14.431 18.823  88.185   1.00 10.00 ? ? ? ? ? ? 222 ASP B CG  1 
ATOM 4640  O OD1 . ASP B 1 221 ? -14.751 17.701  87.769   1.00 10.00 ? ? ? ? ? ? 222 ASP B OD1 1 
ATOM 4641  O OD2 . ASP B 1 221 ? -14.758 19.229  89.316   1.00 10.00 ? ? ? ? ? ? 222 ASP B OD2 1 
ATOM 4642  N N   . PHE B 1 222 ? -11.698 17.154  85.389   1.00 10.00 ? ? ? ? ? ? 223 PHE B N   1 
ATOM 4643  C CA  . PHE B 1 222 ? -11.809 16.415  84.125   1.00 10.00 ? ? ? ? ? ? 223 PHE B CA  1 
ATOM 4644  C C   . PHE B 1 222 ? -13.237 16.427  83.569   1.00 10.00 ? ? ? ? ? ? 223 PHE B C   1 
ATOM 4645  O O   . PHE B 1 222 ? -13.457 16.911  82.465   1.00 10.00 ? ? ? ? ? ? 223 PHE B O   1 
ATOM 4646  C CB  . PHE B 1 222 ? -11.396 14.973  84.304   1.00 10.00 ? ? ? ? ? ? 223 PHE B CB  1 
ATOM 4647  C CG  . PHE B 1 222 ? -11.231 14.171  83.028   1.00 10.00 ? ? ? ? ? ? 223 PHE B CG  1 
ATOM 4648  C CD1 . PHE B 1 222 ? -10.430 14.633  82.001   1.00 10.00 ? ? ? ? ? ? 223 PHE B CD1 1 
ATOM 4649  C CD2 . PHE B 1 222 ? -11.930 12.996  82.878   1.00 10.00 ? ? ? ? ? ? 223 PHE B CD2 1 
ATOM 4650  C CE1 . PHE B 1 222 ? -10.327 13.937  80.809   1.00 10.00 ? ? ? ? ? ? 223 PHE B CE1 1 
ATOM 4651  C CE2 . PHE B 1 222 ? -11.831 12.302  81.681   1.00 10.00 ? ? ? ? ? ? 223 PHE B CE2 1 
ATOM 4652  C CZ  . PHE B 1 222 ? -11.031 12.770  80.641   1.00 10.00 ? ? ? ? ? ? 223 PHE B CZ  1 
ATOM 4653  N N   . GLU B 1 223 ? -14.208 16.055  84.420   1.00 10.00 ? ? ? ? ? ? 224 GLU B N   1 
ATOM 4654  C CA  . GLU B 1 223 ? -15.650 15.985  84.131   1.00 10.00 ? ? ? ? ? ? 224 GLU B CA  1 
ATOM 4655  C C   . GLU B 1 223 ? -16.214 17.297  83.594   1.00 10.00 ? ? ? ? ? ? 224 GLU B C   1 
ATOM 4656  O O   . GLU B 1 223 ? -16.560 17.325  82.407   1.00 10.00 ? ? ? ? ? ? 224 GLU B O   1 
ATOM 4657  C CB  . GLU B 1 223 ? -16.265 15.503  85.435   1.00 10.00 ? ? ? ? ? ? 224 GLU B CB  1 
ATOM 4658  C CG  . GLU B 1 223 ? -17.681 15.782  85.922   1.00 10.00 ? ? ? ? ? ? 224 GLU B CG  1 
ATOM 4659  C CD  . GLU B 1 223 ? -17.877 15.311  87.393   1.00 10.00 ? ? ? ? ? ? 224 GLU B CD  1 
ATOM 4660  O OE1 . GLU B 1 223 ? -17.075 15.696  88.262   1.00 10.00 ? ? ? ? ? ? 224 GLU B OE1 1 
ATOM 4661  O OE2 . GLU B 1 223 ? -18.812 14.548  87.688   1.00 10.00 ? ? ? ? ? ? 224 GLU B OE2 1 
ATOM 4662  N N   . GLN B 1 224 ? -16.207 18.418  84.311   1.00 10.00 ? ? ? ? ? ? 225 GLN B N   1 
ATOM 4663  C CA  . GLN B 1 224 ? -16.680 19.620  83.707   1.00 10.00 ? ? ? ? ? ? 225 GLN B CA  1 
ATOM 4664  C C   . GLN B 1 224 ? -15.706 20.057  82.634   1.00 10.00 ? ? ? ? ? ? 225 GLN B C   1 
ATOM 4665  O O   . GLN B 1 224 ? -16.018 20.948  81.837   1.00 10.00 ? ? ? ? ? ? 225 GLN B O   1 
ATOM 4666  C CB  . GLN B 1 224 ? -16.823 20.681  84.743   1.00 10.00 ? ? ? ? ? ? 225 GLN B CB  1 
ATOM 4667  C CG  . GLN B 1 224 ? -18.032 21.630  84.496   1.00 10.00 ? ? ? ? ? ? 225 GLN B CG  1 
ATOM 4668  C CD  . GLN B 1 224 ? -17.736 23.021  83.921   1.00 10.00 ? ? ? ? ? ? 225 GLN B CD  1 
ATOM 4669  O OE1 . GLN B 1 224 ? -16.577 23.336  83.622   1.00 10.00 ? ? ? ? ? ? 225 GLN B OE1 1 
ATOM 4670  N NE2 . GLN B 1 224 ? -18.721 23.918  83.775   1.00 10.00 ? ? ? ? ? ? 225 GLN B NE2 1 
ATOM 4671  N N   . GLU B 1 225 ? -14.518 19.486  82.461   1.00 10.00 ? ? ? ? ? ? 226 GLU B N   1 
ATOM 4672  C CA  . GLU B 1 225 ? -13.655 19.894  81.373   1.00 10.00 ? ? ? ? ? ? 226 GLU B CA  1 
ATOM 4673  C C   . GLU B 1 225 ? -14.030 19.173  80.108   1.00 10.00 ? ? ? ? ? ? 226 GLU B C   1 
ATOM 4674  O O   . GLU B 1 225 ? -13.868 19.712  79.022   1.00 10.00 ? ? ? ? ? ? 226 GLU B O   1 
ATOM 4675  C CB  . GLU B 1 225 ? -12.263 19.569  81.655   1.00 10.00 ? ? ? ? ? ? 226 GLU B CB  1 
ATOM 4676  C CG  . GLU B 1 225 ? -11.340 20.257  80.718   1.00 10.00 ? ? ? ? ? ? 226 GLU B CG  1 
ATOM 4677  C CD  . GLU B 1 225 ? -11.174 21.726  80.988   1.00 10.00 ? ? ? ? ? ? 226 GLU B CD  1 
ATOM 4678  O OE1 . GLU B 1 225 ? -11.225 22.123  82.149   1.00 10.00 ? ? ? ? ? ? 226 GLU B OE1 1 
ATOM 4679  O OE2 . GLU B 1 225 ? -10.964 22.490  80.043   1.00 10.00 ? ? ? ? ? ? 226 GLU B OE2 1 
ATOM 4680  N N   . MET B 1 226 ? -14.554 17.968  80.183   1.00 10.00 ? ? ? ? ? ? 227 MET B N   1 
ATOM 4681  C CA  . MET B 1 226 ? -14.901 17.265  78.966   1.00 10.00 ? ? ? ? ? ? 227 MET B CA  1 
ATOM 4682  C C   . MET B 1 226 ? -16.090 17.930  78.262   1.00 10.00 ? ? ? ? ? ? 227 MET B C   1 
ATOM 4683  O O   . MET B 1 226 ? -16.156 18.040  77.025   1.00 10.00 ? ? ? ? ? ? 227 MET B O   1 
ATOM 4684  C CB  . MET B 1 226 ? -15.193 15.814  79.309   1.00 10.00 ? ? ? ? ? ? 227 MET B CB  1 
ATOM 4685  C CG  . MET B 1 226 ? -13.974 14.911  79.462   1.00 10.00 ? ? ? ? ? ? 227 MET B CG  1 
ATOM 4686  S SD  . MET B 1 226 ? -12.961 14.637  77.968   1.00 10.00 ? ? ? ? ? ? 227 MET B SD  1 
ATOM 4687  C CE  . MET B 1 226 ? -14.185 14.020  76.844   1.00 10.00 ? ? ? ? ? ? 227 MET B CE  1 
ATOM 4688  N N   . ALA B 1 227 ? -17.066 18.463  78.993   1.00 10.00 ? ? ? ? ? ? 228 ALA B N   1 
ATOM 4689  C CA  . ALA B 1 227 ? -18.177 19.201  78.390   1.00 10.00 ? ? ? ? ? ? 228 ALA B CA  1 
ATOM 4690  C C   . ALA B 1 227 ? -17.811 20.650  78.107   1.00 10.00 ? ? ? ? ? ? 228 ALA B C   1 
ATOM 4691  O O   . ALA B 1 227 ? -18.593 21.402  77.527   1.00 10.00 ? ? ? ? ? ? 228 ALA B O   1 
ATOM 4692  C CB  . ALA B 1 227 ? -19.363 19.209  79.299   1.00 10.00 ? ? ? ? ? ? 228 ALA B CB  1 
ATOM 4693  N N   . THR B 1 228 ? -16.613 21.007  78.550   1.00 10.00 ? ? ? ? ? ? 229 THR B N   1 
ATOM 4694  C CA  . THR B 1 228 ? -15.951 22.229  78.160   1.00 10.00 ? ? ? ? ? ? 229 THR B CA  1 
ATOM 4695  C C   . THR B 1 228 ? -14.767 21.812  77.236   1.00 10.00 ? ? ? ? ? ? 229 THR B C   1 
ATOM 4696  O O   . THR B 1 228 ? -13.581 22.148  77.394   1.00 10.00 ? ? ? ? ? ? 229 THR B O   1 
ATOM 4697  C CB  . THR B 1 228 ? -15.480 22.954  79.421   1.00 10.00 ? ? ? ? ? ? 229 THR B CB  1 
ATOM 4698  O OG1 . THR B 1 228 ? -16.637 23.115  80.226   1.00 10.00 ? ? ? ? ? ? 229 THR B OG1 1 
ATOM 4699  C CG2 . THR B 1 228 ? -14.851 24.333  79.126   1.00 10.00 ? ? ? ? ? ? 229 THR B CG2 1 
ATOM 4700  N N   . ALA B 1 229 ? -15.172 20.878  76.353   1.00 10.00 ? ? ? ? ? ? 230 ALA B N   1 
ATOM 4701  C CA  . ALA B 1 229 ? -14.488 20.441  75.156   1.00 10.00 ? ? ? ? ? ? 230 ALA B CA  1 
ATOM 4702  C C   . ALA B 1 229 ? -15.780 20.448  74.319   1.00 10.00 ? ? ? ? ? ? 230 ALA B C   1 
ATOM 4703  O O   . ALA B 1 229 ? -15.808 21.196  73.348   1.00 10.00 ? ? ? ? ? ? 230 ALA B O   1 
ATOM 4704  C CB  . ALA B 1 229 ? -13.985 19.007  75.166   1.00 10.00 ? ? ? ? ? ? 230 ALA B CB  1 
ATOM 4705  N N   . ALA B 1 230 ? -16.908 19.745  74.619   1.00 10.00 ? ? ? ? ? ? 231 ALA B N   1 
ATOM 4706  C CA  . ALA B 1 230 ? -18.112 19.833  73.776   1.00 10.00 ? ? ? ? ? ? 231 ALA B CA  1 
ATOM 4707  C C   . ALA B 1 230 ? -18.625 21.265  73.595   1.00 10.00 ? ? ? ? ? ? 231 ALA B C   1 
ATOM 4708  O O   . ALA B 1 230 ? -19.264 21.504  72.583   1.00 10.00 ? ? ? ? ? ? 231 ALA B O   1 
ATOM 4709  C CB  . ALA B 1 230 ? -19.263 19.011  74.351   1.00 10.00 ? ? ? ? ? ? 231 ALA B CB  1 
ATOM 4710  N N   . SER B 1 231 ? -18.386 22.260  74.481   1.00 10.00 ? ? ? ? ? ? 232 SER B N   1 
ATOM 4711  C CA  . SER B 1 231 ? -18.715 23.663  74.233   1.00 10.00 ? ? ? ? ? ? 232 SER B CA  1 
ATOM 4712  C C   . SER B 1 231 ? -17.471 24.298  73.590   1.00 10.00 ? ? ? ? ? ? 232 SER B C   1 
ATOM 4713  O O   . SER B 1 231 ? -16.934 25.324  74.014   1.00 10.00 ? ? ? ? ? ? 232 SER B O   1 
ATOM 4714  C CB  . SER B 1 231 ? -18.995 24.293  75.551   1.00 10.00 ? ? ? ? ? ? 232 SER B CB  1 
ATOM 4715  O OG  . SER B 1 231 ? -17.793 24.145  76.319   1.00 10.00 ? ? ? ? ? ? 232 SER B OG  1 
ATOM 4716  N N   . SER B 1 232 ? -17.026 23.640  72.540   1.00 10.00 ? ? ? ? ? ? 233 SER B N   1 
ATOM 4717  C CA  . SER B 1 232 ? -15.776 23.880  71.896   1.00 10.00 ? ? ? ? ? ? 233 SER B CA  1 
ATOM 4718  C C   . SER B 1 232 ? -15.366 25.318  71.683   1.00 10.00 ? ? ? ? ? ? 233 SER B C   1 
ATOM 4719  O O   . SER B 1 232 ? -14.961 25.967  72.646   1.00 10.00 ? ? ? ? ? ? 233 SER B O   1 
ATOM 4720  C CB  . SER B 1 232 ? -15.847 23.045  70.598   1.00 10.00 ? ? ? ? ? ? 233 SER B CB  1 
ATOM 4721  O OG  . SER B 1 232 ? -16.165 21.681  70.894   1.00 10.00 ? ? ? ? ? ? 233 SER B OG  1 
ATOM 4722  N N   . SER B 1 233 ? -15.532 25.865  70.482   1.00 10.00 ? ? ? ? ? ? 234 SER B N   1 
ATOM 4723  C CA  . SER B 1 233 ? -14.955 27.133  70.050   1.00 10.00 ? ? ? ? ? ? 234 SER B CA  1 
ATOM 4724  C C   . SER B 1 233 ? -13.416 27.098  70.298   1.00 10.00 ? ? ? ? ? ? 234 SER B C   1 
ATOM 4725  O O   . SER B 1 233 ? -12.652 26.594  69.449   1.00 10.00 ? ? ? ? ? ? 234 SER B O   1 
ATOM 4726  C CB  . SER B 1 233 ? -15.654 28.330  70.794   1.00 10.00 ? ? ? ? ? ? 234 SER B CB  1 
ATOM 4727  O OG  . SER B 1 233 ? -16.805 27.939  71.528   1.00 10.00 ? ? ? ? ? ? 234 SER B OG  1 
ATOM 4728  N N   . SER B 1 234 ? -12.967 27.422  71.522   1.00 10.00 ? ? ? ? ? ? 235 SER B N   1 
ATOM 4729  C CA  . SER B 1 234 ? -11.576 27.636  71.872   1.00 10.00 ? ? ? ? ? ? 235 SER B CA  1 
ATOM 4730  C C   . SER B 1 234 ? -10.653 26.464  72.247   1.00 10.00 ? ? ? ? ? ? 235 SER B C   1 
ATOM 4731  O O   . SER B 1 234 ? -9.459  26.660  72.508   1.00 10.00 ? ? ? ? ? ? 235 SER B O   1 
ATOM 4732  C CB  . SER B 1 234 ? -11.692 28.697  72.963   1.00 10.00 ? ? ? ? ? ? 235 SER B CB  1 
ATOM 4733  O OG  . SER B 1 234 ? -12.715 29.693  72.681   1.00 10.00 ? ? ? ? ? ? 235 SER B OG  1 
ATOM 4734  N N   . LEU B 1 235 ? -11.121 25.218  72.276   1.00 10.00 ? ? ? ? ? ? 236 LEU B N   1 
ATOM 4735  C CA  . LEU B 1 235 ? -10.266 24.116  72.728   1.00 10.00 ? ? ? ? ? ? 236 LEU B CA  1 
ATOM 4736  C C   . LEU B 1 235 ? -9.448  23.420  71.628   1.00 10.00 ? ? ? ? ? ? 236 LEU B C   1 
ATOM 4737  O O   . LEU B 1 235 ? -8.381  22.846  71.920   1.00 10.00 ? ? ? ? ? ? 236 LEU B O   1 
ATOM 4738  C CB  . LEU B 1 235 ? -11.098 23.030  73.441   1.00 10.00 ? ? ? ? ? ? 236 LEU B CB  1 
ATOM 4739  C CG  . LEU B 1 235 ? -11.933 23.275  74.742   1.00 10.00 ? ? ? ? ? ? 236 LEU B CG  1 
ATOM 4740  C CD1 . LEU B 1 235 ? -10.937 23.471  75.885   1.00 10.00 ? ? ? ? ? ? 236 LEU B CD1 1 
ATOM 4741  C CD2 . LEU B 1 235 ? -12.952 24.447  74.580   1.00 10.00 ? ? ? ? ? ? 236 LEU B CD2 1 
ATOM 4742  N N   . GLU B 1 236 ? -9.898  23.395  70.357   1.00 10.00 ? ? ? ? ? ? 237 GLU B N   1 
ATOM 4743  C CA  . GLU B 1 236 ? -9.116  22.646  69.400   1.00 10.00 ? ? ? ? ? ? 237 GLU B CA  1 
ATOM 4744  C C   . GLU B 1 236 ? -7.973  23.591  69.011   1.00 10.00 ? ? ? ? ? ? 237 GLU B C   1 
ATOM 4745  O O   . GLU B 1 236 ? -8.072  24.823  68.862   1.00 10.00 ? ? ? ? ? ? 237 GLU B O   1 
ATOM 4746  C CB  . GLU B 1 236 ? -9.981  22.202  68.149   1.00 10.00 ? ? ? ? ? ? 237 GLU B CB  1 
ATOM 4747  C CG  . GLU B 1 236 ? -11.334 21.399  68.228   1.00 10.00 ? ? ? ? ? ? 237 GLU B CG  1 
ATOM 4748  C CD  . GLU B 1 236 ? -11.524 19.859  68.438   1.00 10.00 ? ? ? ? ? ? 237 GLU B CD  1 
ATOM 4749  O OE1 . GLU B 1 236 ? -10.950 18.991  67.742   1.00 10.00 ? ? ? ? ? ? 237 GLU B OE1 1 
ATOM 4750  O OE2 . GLU B 1 236 ? -12.354 19.504  69.297   1.00 10.00 ? ? ? ? ? ? 237 GLU B OE2 1 
ATOM 4751  N N   . LYS B 1 237 ? -6.790  23.002  68.986   1.00 10.00 ? ? ? ? ? ? 238 LYS B N   1 
ATOM 4752  C CA  . LYS B 1 237 ? -5.623  23.693  68.442   1.00 10.00 ? ? ? ? ? ? 238 LYS B CA  1 
ATOM 4753  C C   . LYS B 1 237 ? -5.022  22.811  67.344   1.00 10.00 ? ? ? ? ? ? 238 LYS B C   1 
ATOM 4754  O O   . LYS B 1 237 ? -5.243  21.590  67.300   1.00 10.00 ? ? ? ? ? ? 238 LYS B O   1 
ATOM 4755  C CB  . LYS B 1 237 ? -4.549  23.922  69.505   1.00 10.00 ? ? ? ? ? ? 238 LYS B CB  1 
ATOM 4756  C CG  . LYS B 1 237 ? -4.440  25.303  70.127   1.00 10.00 ? ? ? ? ? ? 238 LYS B CG  1 
ATOM 4757  C CD  . LYS B 1 237 ? -5.595  25.597  71.039   1.00 10.00 ? ? ? ? ? ? 238 LYS B CD  1 
ATOM 4758  C CE  . LYS B 1 237 ? -5.382  26.967  71.678   1.00 10.00 ? ? ? ? ? ? 238 LYS B CE  1 
ATOM 4759  N NZ  . LYS B 1 237 ? -6.618  27.438  72.285   1.00 10.00 ? ? ? ? ? ? 238 LYS B NZ  1 
ATOM 4760  N N   . SER B 1 238 ? -4.278  23.414  66.428   1.00 10.00 ? ? ? ? ? ? 239 SER B N   1 
ATOM 4761  C CA  . SER B 1 238 ? -3.640  22.663  65.356   1.00 10.00 ? ? ? ? ? ? 239 SER B CA  1 
ATOM 4762  C C   . SER B 1 238 ? -2.093  22.618  65.380   1.00 10.00 ? ? ? ? ? ? 239 SER B C   1 
ATOM 4763  O O   . SER B 1 238 ? -1.329  23.544  65.765   1.00 10.00 ? ? ? ? ? ? 239 SER B O   1 
ATOM 4764  C CB  . SER B 1 238 ? -4.131  23.228  64.002   1.00 10.00 ? ? ? ? ? ? 239 SER B CB  1 
ATOM 4765  O OG  . SER B 1 238 ? -5.513  22.959  63.754   1.00 10.00 ? ? ? ? ? ? 239 SER B OG  1 
ATOM 4766  N N   . TYR B 1 239 ? -1.717  21.412  64.932   1.00 10.00 ? ? ? ? ? ? 240 TYR B N   1 
ATOM 4767  C CA  . TYR B 1 239 ? -0.339  21.074  64.733   1.00 10.00 ? ? ? ? ? ? 240 TYR B CA  1 
ATOM 4768  C C   . TYR B 1 239 ? -0.095  20.632  63.274   1.00 10.00 ? ? ? ? ? ? 240 TYR B C   1 
ATOM 4769  O O   . TYR B 1 239 ? -0.880  19.955  62.585   1.00 10.00 ? ? ? ? ? ? 240 TYR B O   1 
ATOM 4770  C CB  . TYR B 1 239 ? 0.008   20.002  65.693   1.00 10.00 ? ? ? ? ? ? 240 TYR B CB  1 
ATOM 4771  C CG  . TYR B 1 239 ? 1.482   20.103  65.993   1.00 10.00 ? ? ? ? ? ? 240 TYR B CG  1 
ATOM 4772  C CD1 . TYR B 1 239 ? 2.387   19.476  65.159   1.00 10.00 ? ? ? ? ? ? 240 TYR B CD1 1 
ATOM 4773  C CD2 . TYR B 1 239 ? 1.918   20.797  67.090   1.00 10.00 ? ? ? ? ? ? 240 TYR B CD2 1 
ATOM 4774  C CE1 . TYR B 1 239 ? 3.739   19.529  65.405   1.00 10.00 ? ? ? ? ? ? 240 TYR B CE1 1 
ATOM 4775  C CE2 . TYR B 1 239 ? 3.273   20.846  67.341   1.00 10.00 ? ? ? ? ? ? 240 TYR B CE2 1 
ATOM 4776  C CZ  . TYR B 1 239 ? 4.168   20.208  66.500   1.00 10.00 ? ? ? ? ? ? 240 TYR B CZ  1 
ATOM 4777  O OH  . TYR B 1 239 ? 5.516   20.199  66.773   1.00 10.00 ? ? ? ? ? ? 240 TYR B OH  1 
ATOM 4778  N N   . GLU B 1 240 ? 1.063   21.096  62.803   1.00 10.00 ? ? ? ? ? ? 241 GLU B N   1 
ATOM 4779  C CA  . GLU B 1 240 ? 1.493   20.984  61.432   1.00 10.00 ? ? ? ? ? ? 241 GLU B CA  1 
ATOM 4780  C C   . GLU B 1 240 ? 2.526   19.899  61.324   1.00 10.00 ? ? ? ? ? ? 241 GLU B C   1 
ATOM 4781  O O   . GLU B 1 240 ? 3.545   19.935  62.007   1.00 10.00 ? ? ? ? ? ? 241 GLU B O   1 
ATOM 4782  C CB  . GLU B 1 240 ? 2.115   22.292  60.991   1.00 10.00 ? ? ? ? ? ? 241 GLU B CB  1 
ATOM 4783  C CG  . GLU B 1 240 ? 2.286   22.445  59.482   1.00 10.00 ? ? ? ? ? ? 241 GLU B CG  1 
ATOM 4784  C CD  . GLU B 1 240 ? 3.484   23.282  59.044   1.00 10.00 ? ? ? ? ? ? 241 GLU B CD  1 
ATOM 4785  O OE1 . GLU B 1 240 ? 3.420   24.517  59.201   1.00 10.00 ? ? ? ? ? ? 241 GLU B OE1 1 
ATOM 4786  O OE2 . GLU B 1 240 ? 4.451   22.664  58.550   1.00 10.00 ? ? ? ? ? ? 241 GLU B OE2 1 
ATOM 4787  N N   . LEU B 1 241 ? 2.254   18.942  60.478   1.00 10.00 ? ? ? ? ? ? 242 LEU B N   1 
ATOM 4788  C CA  . LEU B 1 241 ? 3.263   17.959  60.133   1.00 10.00 ? ? ? ? ? ? 242 LEU B CA  1 
ATOM 4789  C C   . LEU B 1 241 ? 4.433   18.583  59.319   1.00 10.00 ? ? ? ? ? ? 242 LEU B C   1 
ATOM 4790  O O   . LEU B 1 241 ? 4.279   19.542  58.545   1.00 10.00 ? ? ? ? ? ? 242 LEU B O   1 
ATOM 4791  C CB  . LEU B 1 241 ? 2.620   16.831  59.321   1.00 10.00 ? ? ? ? ? ? 242 LEU B CB  1 
ATOM 4792  C CG  . LEU B 1 241 ? 1.598   15.870  59.943   1.00 10.00 ? ? ? ? ? ? 242 LEU B CG  1 
ATOM 4793  C CD1 . LEU B 1 241 ? 2.173   15.250  61.198   1.00 10.00 ? ? ? ? ? ? 242 LEU B CD1 1 
ATOM 4794  C CD2 . LEU B 1 241 ? 0.319   16.608  60.272   1.00 10.00 ? ? ? ? ? ? 242 LEU B CD2 1 
ATOM 4795  N N   . PRO B 1 242 ? 5.668   18.072  59.438   1.00 10.00 ? ? ? ? ? ? 243 PRO B N   1 
ATOM 4796  C CA  . PRO B 1 242 ? 6.732   18.211  58.428   1.00 10.00 ? ? ? ? ? ? 243 PRO B CA  1 
ATOM 4797  C C   . PRO B 1 242 ? 6.167   18.012  57.013   1.00 10.00 ? ? ? ? ? ? 243 PRO B C   1 
ATOM 4798  O O   . PRO B 1 242 ? 6.325   18.857  56.136   1.00 10.00 ? ? ? ? ? ? 243 PRO B O   1 
ATOM 4799  C CB  . PRO B 1 242 ? 7.768   17.164  58.865   1.00 10.00 ? ? ? ? ? ? 243 PRO B CB  1 
ATOM 4800  C CG  . PRO B 1 242 ? 7.061   16.379  59.979   1.00 10.00 ? ? ? ? ? ? 243 PRO B CG  1 
ATOM 4801  C CD  . PRO B 1 242 ? 6.198   17.462  60.649   1.00 10.00 ? ? ? ? ? ? 243 PRO B CD  1 
ATOM 4802  N N   . ASP B 1 243 ? 5.429   16.927  56.811   1.00 10.00 ? ? ? ? ? ? 244 ASP B N   1 
ATOM 4803  C CA  . ASP B 1 243 ? 4.641   16.639  55.621   1.00 10.00 ? ? ? ? ? ? 244 ASP B CA  1 
ATOM 4804  C C   . ASP B 1 243 ? 3.789   17.809  55.095   1.00 10.00 ? ? ? ? ? ? 244 ASP B C   1 
ATOM 4805  O O   . ASP B 1 243 ? 3.167   17.621  54.056   1.00 10.00 ? ? ? ? ? ? 244 ASP B O   1 
ATOM 4806  C CB  . ASP B 1 243 ? 3.809   15.410  56.052   1.00 10.00 ? ? ? ? ? ? 244 ASP B CB  1 
ATOM 4807  C CG  . ASP B 1 243 ? 2.611   14.879  55.260   1.00 10.00 ? ? ? ? ? ? 244 ASP B CG  1 
ATOM 4808  O OD1 . ASP B 1 243 ? 1.643   15.603  55.061   1.00 10.00 ? ? ? ? ? ? 244 ASP B OD1 1 
ATOM 4809  O OD2 . ASP B 1 243 ? 2.628   13.704  54.870   1.00 10.00 ? ? ? ? ? ? 244 ASP B OD2 1 
ATOM 4810  N N   . GLY B 1 244 ? 3.637   19.000  55.719   1.00 10.00 ? ? ? ? ? ? 245 GLY B N   1 
ATOM 4811  C CA  . GLY B 1 244 ? 2.741   20.072  55.249   1.00 10.00 ? ? ? ? ? ? 245 GLY B CA  1 
ATOM 4812  C C   . GLY B 1 244 ? 1.334   19.990  55.867   1.00 10.00 ? ? ? ? ? ? 245 GLY B C   1 
ATOM 4813  O O   . GLY B 1 244 ? 0.697   21.018  56.094   1.00 10.00 ? ? ? ? ? ? 245 GLY B O   1 
ATOM 4814  N N   . GLN B 1 245 ? 0.858   18.749  56.109   1.00 10.00 ? ? ? ? ? ? 246 GLN B N   1 
ATOM 4815  C CA  . GLN B 1 245 ? -0.445  18.383  56.675   1.00 10.00 ? ? ? ? ? ? 246 GLN B CA  1 
ATOM 4816  C C   . GLN B 1 245 ? -0.868  18.995  58.026   1.00 10.00 ? ? ? ? ? ? 246 GLN B C   1 
ATOM 4817  O O   . GLN B 1 245 ? 0.012   19.413  58.804   1.00 10.00 ? ? ? ? ? ? 246 GLN B O   1 
ATOM 4818  C CB  . GLN B 1 245 ? -0.466  16.870  56.818   1.00 10.00 ? ? ? ? ? ? 246 GLN B CB  1 
ATOM 4819  C CG  . GLN B 1 245 ? -1.537  16.060  56.090   1.00 10.00 ? ? ? ? ? ? 246 GLN B CG  1 
ATOM 4820  C CD  . GLN B 1 245 ? -2.905  16.086  56.765   1.00 10.00 ? ? ? ? ? ? 246 GLN B CD  1 
ATOM 4821  O OE1 . GLN B 1 245 ? -3.689  17.047  56.689   1.00 10.00 ? ? ? ? ? ? 246 GLN B OE1 1 
ATOM 4822  N NE2 . GLN B 1 245 ? -3.228  15.014  57.466   1.00 10.00 ? ? ? ? ? ? 246 GLN B NE2 1 
ATOM 4823  N N   . VAL B 1 246 ? -2.182  18.927  58.398   1.00 10.00 ? ? ? ? ? ? 247 VAL B N   1 
ATOM 4824  C CA  . VAL B 1 246 ? -2.641  19.446  59.675   1.00 10.00 ? ? ? ? ? ? 247 VAL B CA  1 
ATOM 4825  C C   . VAL B 1 246 ? -3.255  18.449  60.677   1.00 10.00 ? ? ? ? ? ? 247 VAL B C   1 
ATOM 4826  O O   . VAL B 1 246 ? -3.863  17.418  60.362   1.00 10.00 ? ? ? ? ? ? 247 VAL B O   1 
ATOM 4827  C CB  . VAL B 1 246 ? -3.592  20.561  59.343   1.00 10.00 ? ? ? ? ? ? 247 VAL B CB  1 
ATOM 4828  C CG1 . VAL B 1 246 ? -5.030  20.045  59.152   1.00 10.00 ? ? ? ? ? ? 247 VAL B CG1 1 
ATOM 4829  C CG2 . VAL B 1 246 ? -3.403  21.612  60.433   1.00 10.00 ? ? ? ? ? ? 247 VAL B CG2 1 
ATOM 4830  N N   . ILE B 1 247 ? -3.105  18.754  61.952   1.00 10.00 ? ? ? ? ? ? 248 ILE B N   1 
ATOM 4831  C CA  . ILE B 1 247 ? -3.566  17.910  63.036   1.00 10.00 ? ? ? ? ? ? 248 ILE B CA  1 
ATOM 4832  C C   . ILE B 1 247 ? -4.530  18.849  63.706   1.00 10.00 ? ? ? ? ? ? 248 ILE B C   1 
ATOM 4833  O O   . ILE B 1 247 ? -4.295  20.071  63.714   1.00 10.00 ? ? ? ? ? ? 248 ILE B O   1 
ATOM 4834  C CB  . ILE B 1 247 ? -2.396  17.593  64.012   1.00 10.00 ? ? ? ? ? ? 248 ILE B CB  1 
ATOM 4835  C CG1 . ILE B 1 247 ? -1.283  16.910  63.289   1.00 10.00 ? ? ? ? ? ? 248 ILE B CG1 1 
ATOM 4836  C CG2 . ILE B 1 247 ? -2.788  16.599  65.065   1.00 10.00 ? ? ? ? ? ? 248 ILE B CG2 1 
ATOM 4837  C CD1 . ILE B 1 247 ? 0.022   16.899  64.118   1.00 10.00 ? ? ? ? ? ? 248 ILE B CD1 1 
ATOM 4838  N N   . THR B 1 248 ? -5.604  18.320  64.244   1.00 10.00 ? ? ? ? ? ? 249 THR B N   1 
ATOM 4839  C CA  . THR B 1 248 ? -6.345  19.138  65.173   1.00 10.00 ? ? ? ? ? ? 249 THR B CA  1 
ATOM 4840  C C   . THR B 1 248 ? -6.615  18.303  66.413   1.00 10.00 ? ? ? ? ? ? 249 THR B C   1 
ATOM 4841  O O   . THR B 1 248 ? -6.933  17.109  66.344   1.00 10.00 ? ? ? ? ? ? 249 THR B O   1 
ATOM 4842  C CB  . THR B 1 248 ? -7.623  19.668  64.490   1.00 10.00 ? ? ? ? ? ? 249 THR B CB  1 
ATOM 4843  O OG1 . THR B 1 248 ? -7.105  20.470  63.424   1.00 10.00 ? ? ? ? ? ? 249 THR B OG1 1 
ATOM 4844  C CG2 . THR B 1 248 ? -8.539  20.560  65.352   1.00 10.00 ? ? ? ? ? ? 249 THR B CG2 1 
ATOM 4845  N N   . ILE B 1 249 ? -6.342  18.944  67.563   1.00 10.00 ? ? ? ? ? ? 250 ILE B N   1 
ATOM 4846  C CA  . ILE B 1 249 ? -6.440  18.324  68.871   1.00 10.00 ? ? ? ? ? ? 250 ILE B CA  1 
ATOM 4847  C C   . ILE B 1 249 ? -7.348  19.151  69.755   1.00 10.00 ? ? ? ? ? ? 250 ILE B C   1 
ATOM 4848  O O   . ILE B 1 249 ? -7.381  20.368  69.756   1.00 10.00 ? ? ? ? ? ? 250 ILE B O   1 
ATOM 4849  C CB  . ILE B 1 249 ? -5.058  18.211  69.506   1.00 10.00 ? ? ? ? ? ? 250 ILE B CB  1 
ATOM 4850  C CG1 . ILE B 1 249 ? -4.187  17.427  68.576   1.00 10.00 ? ? ? ? ? ? 250 ILE B CG1 1 
ATOM 4851  C CG2 . ILE B 1 249 ? -5.051  17.400  70.765   1.00 10.00 ? ? ? ? ? ? 250 ILE B CG2 1 
ATOM 4852  C CD1 . ILE B 1 249 ? -3.202  18.432  67.922   1.00 10.00 ? ? ? ? ? ? 250 ILE B CD1 1 
ATOM 4853  N N   . GLY B 1 250 ? -8.207  18.416  70.403   1.00 10.00 ? ? ? ? ? ? 251 GLY B N   1 
ATOM 4854  C CA  . GLY B 1 250 ? -9.170  19.009  71.288   1.00 10.00 ? ? ? ? ? ? 251 GLY B CA  1 
ATOM 4855  C C   . GLY B 1 250 ? -9.192  18.270  72.613   1.00 10.00 ? ? ? ? ? ? 251 GLY B C   1 
ATOM 4856  O O   . GLY B 1 250 ? -8.202  18.392  73.358   1.00 10.00 ? ? ? ? ? ? 251 GLY B O   1 
ATOM 4857  N N   . ASN B 1 251 ? -10.175 17.375  72.878   1.00 10.00 ? ? ? ? ? ? 252 ASN B N   1 
ATOM 4858  C CA  . ASN B 1 251 ? -10.299 16.812  74.224   1.00 10.00 ? ? ? ? ? ? 252 ASN B CA  1 
ATOM 4859  C C   . ASN B 1 251 ? -9.084  16.019  74.717   1.00 10.00 ? ? ? ? ? ? 252 ASN B C   1 
ATOM 4860  O O   . ASN B 1 251 ? -8.791  15.881  75.912   1.00 10.00 ? ? ? ? ? ? 252 ASN B O   1 
ATOM 4861  C CB  . ASN B 1 251 ? -11.552 15.929  74.324   1.00 10.00 ? ? ? ? ? ? 252 ASN B CB  1 
ATOM 4862  C CG  . ASN B 1 251 ? -11.486 14.508  73.811   1.00 10.00 ? ? ? ? ? ? 252 ASN B CG  1 
ATOM 4863  O OD1 . ASN B 1 251 ? -10.528 14.050  73.192   1.00 10.00 ? ? ? ? ? ? 252 ASN B OD1 1 
ATOM 4864  N ND2 . ASN B 1 251 ? -12.551 13.773  74.041   1.00 10.00 ? ? ? ? ? ? 252 ASN B ND2 1 
ATOM 4865  N N   . GLU B 1 252 ? -8.342  15.582  73.719   1.00 10.00 ? ? ? ? ? ? 253 GLU B N   1 
ATOM 4866  C CA  . GLU B 1 252 ? -7.077  14.925  73.879   1.00 10.00 ? ? ? ? ? ? 253 GLU B CA  1 
ATOM 4867  C C   . GLU B 1 252 ? -6.016  15.652  74.704   1.00 10.00 ? ? ? ? ? ? 253 GLU B C   1 
ATOM 4868  O O   . GLU B 1 252 ? -5.302  15.039  75.504   1.00 10.00 ? ? ? ? ? ? 253 GLU B O   1 
ATOM 4869  C CB  . GLU B 1 252 ? -6.551  14.637  72.465   1.00 10.00 ? ? ? ? ? ? 253 GLU B CB  1 
ATOM 4870  C CG  . GLU B 1 252 ? -7.435  13.675  71.715   1.00 10.00 ? ? ? ? ? ? 253 GLU B CG  1 
ATOM 4871  C CD  . GLU B 1 252 ? -8.039  14.191  70.415   1.00 10.00 ? ? ? ? ? ? 253 GLU B CD  1 
ATOM 4872  O OE1 . GLU B 1 252 ? -8.364  15.380  70.297   1.00 10.00 ? ? ? ? ? ? 253 GLU B OE1 1 
ATOM 4873  O OE2 . GLU B 1 252 ? -8.189  13.350  69.531   1.00 10.00 ? ? ? ? ? ? 253 GLU B OE2 1 
ATOM 4874  N N   . ARG B 1 253 ? -5.904  16.962  74.539   1.00 10.00 ? ? ? ? ? ? 254 ARG B N   1 
ATOM 4875  C CA  . ARG B 1 253 ? -4.904  17.762  75.228   1.00 10.00 ? ? ? ? ? ? 254 ARG B CA  1 
ATOM 4876  C C   . ARG B 1 253 ? -4.889  17.595  76.736   1.00 10.00 ? ? ? ? ? ? 254 ARG B C   1 
ATOM 4877  O O   . ARG B 1 253 ? -3.812  17.553  77.330   1.00 10.00 ? ? ? ? ? ? 254 ARG B O   1 
ATOM 4878  C CB  . ARG B 1 253 ? -5.120  19.207  74.976   1.00 10.00 ? ? ? ? ? ? 254 ARG B CB  1 
ATOM 4879  C CG  . ARG B 1 253 ? -4.759  19.650  73.632   1.00 10.00 ? ? ? ? ? ? 254 ARG B CG  1 
ATOM 4880  C CD  . ARG B 1 253 ? -5.457  20.952  73.653   1.00 10.00 ? ? ? ? ? ? 254 ARG B CD  1 
ATOM 4881  N NE  . ARG B 1 253 ? -4.521  22.003  73.851   1.00 10.00 ? ? ? ? ? ? 254 ARG B NE  1 
ATOM 4882  C CZ  . ARG B 1 253 ? -4.947  23.254  74.072   1.00 10.00 ? ? ? ? ? ? 254 ARG B CZ  1 
ATOM 4883  N NH1 . ARG B 1 253 ? -6.254  23.583  74.126   1.00 10.00 ? ? ? ? ? ? 254 ARG B NH1 1 
ATOM 4884  N NH2 . ARG B 1 253 ? -4.049  24.239  74.174   1.00 10.00 ? ? ? ? ? ? 254 ARG B NH2 1 
ATOM 4885  N N   . PHE B 1 254 ? -6.072  17.564  77.385   1.00 10.00 ? ? ? ? ? ? 255 PHE B N   1 
ATOM 4886  C CA  . PHE B 1 254 ? -6.162  17.397  78.840   1.00 10.00 ? ? ? ? ? ? 255 PHE B CA  1 
ATOM 4887  C C   . PHE B 1 254 ? -6.352  15.917  79.222   1.00 10.00 ? ? ? ? ? ? 255 PHE B C   1 
ATOM 4888  O O   . PHE B 1 254 ? -5.917  15.503  80.292   1.00 10.00 ? ? ? ? ? ? 255 PHE B O   1 
ATOM 4889  C CB  . PHE B 1 254 ? -7.326  18.312  79.398   1.00 10.00 ? ? ? ? ? ? 255 PHE B CB  1 
ATOM 4890  C CG  . PHE B 1 254 ? -8.792  18.025  79.035   1.00 10.00 ? ? ? ? ? ? 255 PHE B CG  1 
ATOM 4891  C CD1 . PHE B 1 254 ? -9.462  16.944  79.606   1.00 10.00 ? ? ? ? ? ? 255 PHE B CD1 1 
ATOM 4892  C CD2 . PHE B 1 254 ? -9.407  18.821  78.085   1.00 10.00 ? ? ? ? ? ? 255 PHE B CD2 1 
ATOM 4893  C CE1 . PHE B 1 254 ? -10.729 16.642  79.215   1.00 10.00 ? ? ? ? ? ? 255 PHE B CE1 1 
ATOM 4894  C CE2 . PHE B 1 254 ? -10.678 18.501  77.716   1.00 10.00 ? ? ? ? ? ? 255 PHE B CE2 1 
ATOM 4895  C CZ  . PHE B 1 254 ? -11.321 17.422  78.269   1.00 10.00 ? ? ? ? ? ? 255 PHE B CZ  1 
ATOM 4896  N N   . ARG B 1 255 ? -6.976  15.098  78.348   1.00 10.00 ? ? ? ? ? ? 256 ARG B N   1 
ATOM 4897  C CA  . ARG B 1 255 ? -7.168  13.657  78.482   1.00 10.00 ? ? ? ? ? ? 256 ARG B CA  1 
ATOM 4898  C C   . ARG B 1 255 ? -5.816  12.922  78.505   1.00 10.00 ? ? ? ? ? ? 256 ARG B C   1 
ATOM 4899  O O   . ARG B 1 255 ? -5.721  11.783  78.944   1.00 10.00 ? ? ? ? ? ? 256 ARG B O   1 
ATOM 4900  C CB  . ARG B 1 255 ? -7.973  13.041  77.298   1.00 10.00 ? ? ? ? ? ? 256 ARG B CB  1 
ATOM 4901  C CG  . ARG B 1 255 ? -9.471  13.241  77.033   1.00 10.00 ? ? ? ? ? ? 256 ARG B CG  1 
ATOM 4902  C CD  . ARG B 1 255 ? -9.955  11.962  76.335   1.00 10.00 ? ? ? ? ? ? 256 ARG B CD  1 
ATOM 4903  N NE  . ARG B 1 255 ? -9.802  11.925  74.875   1.00 10.00 ? ? ? ? ? ? 256 ARG B NE  1 
ATOM 4904  C CZ  . ARG B 1 255 ? -9.876  10.791  74.143   1.00 10.00 ? ? ? ? ? ? 256 ARG B CZ  1 
ATOM 4905  N NH1 . ARG B 1 255 ? -10.077 9.583   74.653   1.00 10.00 ? ? ? ? ? ? 256 ARG B NH1 1 
ATOM 4906  N NH2 . ARG B 1 255 ? -9.743  10.881  72.855   1.00 10.00 ? ? ? ? ? ? 256 ARG B NH2 1 
ATOM 4907  N N   . CYS B 1 256 ? -4.749  13.483  77.959   1.00 10.00 ? ? ? ? ? ? 257 CYS B N   1 
ATOM 4908  C CA  . CYS B 1 256 ? -3.425  12.850  77.990   1.00 10.00 ? ? ? ? ? ? 257 CYS B CA  1 
ATOM 4909  C C   . CYS B 1 256 ? -2.897  12.908  79.447   1.00 10.00 ? ? ? ? ? ? 257 CYS B C   1 
ATOM 4910  O O   . CYS B 1 256 ? -2.986  11.855  80.116   1.00 10.00 ? ? ? ? ? ? 257 CYS B O   1 
ATOM 4911  C CB  . CYS B 1 256 ? -2.551  13.616  76.970   1.00 10.00 ? ? ? ? ? ? 257 CYS B CB  1 
ATOM 4912  S SG  . CYS B 1 256 ? -0.950  12.883  76.648   1.00 10.00 ? ? ? ? ? ? 257 CYS B SG  1 
ATOM 4913  N N   . PRO B 1 257 ? -2.475  14.053  80.064   1.00 10.00 ? ? ? ? ? ? 258 PRO B N   1 
ATOM 4914  C CA  . PRO B 1 257 ? -1.973  14.093  81.429   1.00 10.00 ? ? ? ? ? ? 258 PRO B CA  1 
ATOM 4915  C C   . PRO B 1 257 ? -2.921  13.463  82.411   1.00 10.00 ? ? ? ? ? ? 258 PRO B C   1 
ATOM 4916  O O   . PRO B 1 257 ? -2.436  12.953  83.409   1.00 10.00 ? ? ? ? ? ? 258 PRO B O   1 
ATOM 4917  C CB  . PRO B 1 257 ? -1.740  15.535  81.759   1.00 10.00 ? ? ? ? ? ? 258 PRO B CB  1 
ATOM 4918  C CG  . PRO B 1 257 ? -1.601  16.154  80.397   1.00 10.00 ? ? ? ? ? ? 258 PRO B CG  1 
ATOM 4919  C CD  . PRO B 1 257 ? -2.675  15.437  79.627   1.00 10.00 ? ? ? ? ? ? 258 PRO B CD  1 
ATOM 4920  N N   . GLU B 1 258 ? -4.233  13.375  82.208   1.00 10.00 ? ? ? ? ? ? 259 GLU B N   1 
ATOM 4921  C CA  . GLU B 1 258 ? -5.161  12.693  83.114   1.00 10.00 ? ? ? ? ? ? 259 GLU B CA  1 
ATOM 4922  C C   . GLU B 1 258 ? -4.885  11.242  83.469   1.00 10.00 ? ? ? ? ? ? 259 GLU B C   1 
ATOM 4923  O O   . GLU B 1 258 ? -5.407  10.669  84.439   1.00 10.00 ? ? ? ? ? ? 259 GLU B O   1 
ATOM 4924  C CB  . GLU B 1 258 ? -6.535  12.777  82.513   1.00 10.00 ? ? ? ? ? ? 259 GLU B CB  1 
ATOM 4925  C CG  . GLU B 1 258 ? -7.190  14.069  82.867   1.00 10.00 ? ? ? ? ? ? 259 GLU B CG  1 
ATOM 4926  C CD  . GLU B 1 258 ? -7.727  14.016  84.268   1.00 10.00 ? ? ? ? ? ? 259 GLU B CD  1 
ATOM 4927  O OE1 . GLU B 1 258 ? -8.344  13.025  84.648   1.00 10.00 ? ? ? ? ? ? 259 GLU B OE1 1 
ATOM 4928  O OE2 . GLU B 1 258 ? -7.521  14.987  84.962   1.00 10.00 ? ? ? ? ? ? 259 GLU B OE2 1 
ATOM 4929  N N   . ALA B 1 259 ? -4.093  10.592  82.639   1.00 10.00 ? ? ? ? ? ? 260 ALA B N   1 
ATOM 4930  C CA  . ALA B 1 259 ? -3.669  9.247   82.943   1.00 10.00 ? ? ? ? ? ? 260 ALA B CA  1 
ATOM 4931  C C   . ALA B 1 259 ? -2.735  9.247   84.161   1.00 10.00 ? ? ? ? ? ? 260 ALA B C   1 
ATOM 4932  O O   . ALA B 1 259 ? -2.541  8.222   84.809   1.00 10.00 ? ? ? ? ? ? 260 ALA B O   1 
ATOM 4933  C CB  . ALA B 1 259 ? -2.969  8.688   81.718   1.00 10.00 ? ? ? ? ? ? 260 ALA B CB  1 
ATOM 4934  N N   . LEU B 1 260 ? -2.136  10.365  84.522   1.00 10.00 ? ? ? ? ? ? 261 LEU B N   1 
ATOM 4935  C CA  . LEU B 1 260 ? -1.369  10.481  85.737   1.00 10.00 ? ? ? ? ? ? 261 LEU B CA  1 
ATOM 4936  C C   . LEU B 1 260 ? -2.229  10.383  86.988   1.00 10.00 ? ? ? ? ? ? 261 LEU B C   1 
ATOM 4937  O O   . LEU B 1 260 ? -1.833  9.885   88.046   1.00 10.00 ? ? ? ? ? ? 261 LEU B O   1 
ATOM 4938  C CB  . LEU B 1 260 ? -0.653  11.806  85.718   1.00 10.00 ? ? ? ? ? ? 261 LEU B CB  1 
ATOM 4939  C CG  . LEU B 1 260 ? 0.606   11.910  84.876   1.00 10.00 ? ? ? ? ? ? 261 LEU B CG  1 
ATOM 4940  C CD1 . LEU B 1 260 ? 1.092   13.373  84.766   1.00 10.00 ? ? ? ? ? ? 261 LEU B CD1 1 
ATOM 4941  C CD2 . LEU B 1 260 ? 1.661   11.020  85.548   1.00 10.00 ? ? ? ? ? ? 261 LEU B CD2 1 
ATOM 4942  N N   . PHE B 1 261 ? -3.431  10.938  86.928   1.00 10.00 ? ? ? ? ? ? 262 PHE B N   1 
ATOM 4943  C CA  . PHE B 1 261 ? -4.348  10.968  88.057   1.00 10.00 ? ? ? ? ? ? 262 PHE B CA  1 
ATOM 4944  C C   . PHE B 1 261 ? -5.249  9.758   88.150   1.00 10.00 ? ? ? ? ? ? 262 PHE B C   1 
ATOM 4945  O O   . PHE B 1 261 ? -5.655  9.390   89.260   1.00 10.00 ? ? ? ? ? ? 262 PHE B O   1 
ATOM 4946  C CB  . PHE B 1 261 ? -5.196  12.233  87.993   1.00 10.00 ? ? ? ? ? ? 262 PHE B CB  1 
ATOM 4947  C CG  . PHE B 1 261 ? -4.305  13.381  88.389   1.00 10.00 ? ? ? ? ? ? 262 PHE B CG  1 
ATOM 4948  C CD1 . PHE B 1 261 ? -4.002  13.569  89.714   1.00 10.00 ? ? ? ? ? ? 262 PHE B CD1 1 
ATOM 4949  C CD2 . PHE B 1 261 ? -3.745  14.187  87.436   1.00 10.00 ? ? ? ? ? ? 262 PHE B CD2 1 
ATOM 4950  C CE1 . PHE B 1 261 ? -3.133  14.549  90.086   1.00 10.00 ? ? ? ? ? ? 262 PHE B CE1 1 
ATOM 4951  C CE2 . PHE B 1 261 ? -2.867  15.175  87.823   1.00 10.00 ? ? ? ? ? ? 262 PHE B CE2 1 
ATOM 4952  C CZ  . PHE B 1 261 ? -2.562  15.355  89.145   1.00 10.00 ? ? ? ? ? ? 262 PHE B CZ  1 
ATOM 4953  N N   . GLN B 1 262 ? -5.546  9.190   86.985   1.00 10.00 ? ? ? ? ? ? 263 GLN B N   1 
ATOM 4954  C CA  . GLN B 1 262 ? -6.385  8.031   86.809   1.00 10.00 ? ? ? ? ? ? 263 GLN B CA  1 
ATOM 4955  C C   . GLN B 1 262 ? -5.656  7.044   85.894   1.00 10.00 ? ? ? ? ? ? 263 GLN B C   1 
ATOM 4956  O O   . GLN B 1 262 ? -5.838  7.054   84.683   1.00 10.00 ? ? ? ? ? ? 263 GLN B O   1 
ATOM 4957  C CB  . GLN B 1 262 ? -7.683  8.436   86.162   1.00 10.00 ? ? ? ? ? ? 263 GLN B CB  1 
ATOM 4958  C CG  . GLN B 1 262 ? -8.204  9.769   86.666   1.00 10.00 ? ? ? ? ? ? 263 GLN B CG  1 
ATOM 4959  C CD  . GLN B 1 262 ? -9.600  10.002  86.198   1.00 10.00 ? ? ? ? ? ? 263 GLN B CD  1 
ATOM 4960  O OE1 . GLN B 1 262 ? -10.349 9.053   86.051   1.00 10.00 ? ? ? ? ? ? 263 GLN B OE1 1 
ATOM 4961  N NE2 . GLN B 1 262 ? -10.006 11.234  85.986   1.00 10.00 ? ? ? ? ? ? 263 GLN B NE2 1 
ATOM 4962  N N   . PRO B 1 263 ? -4.817  6.138   86.324   1.00 10.00 ? ? ? ? ? ? 264 PRO B N   1 
ATOM 4963  C CA  . PRO B 1 263 ? -4.087  5.258   85.429   1.00 10.00 ? ? ? ? ? ? 264 PRO B CA  1 
ATOM 4964  C C   . PRO B 1 263 ? -4.958  4.130   84.904   1.00 10.00 ? ? ? ? ? ? 264 PRO B C   1 
ATOM 4965  O O   . PRO B 1 263 ? -4.476  3.177   84.295   1.00 10.00 ? ? ? ? ? ? 264 PRO B O   1 
ATOM 4966  C CB  . PRO B 1 263 ? -2.907  4.796   86.266   1.00 10.00 ? ? ? ? ? ? 264 PRO B CB  1 
ATOM 4967  C CG  . PRO B 1 263 ? -2.810  5.873   87.321   1.00 10.00 ? ? ? ? ? ? 264 PRO B CG  1 
ATOM 4968  C CD  . PRO B 1 263 ? -4.260  6.110   87.655   1.00 10.00 ? ? ? ? ? ? 264 PRO B CD  1 
ATOM 4969  N N   . SER B 1 264 ? -6.270  4.183   85.130   1.00 10.00 ? ? ? ? ? ? 265 SER B N   1 
ATOM 4970  C CA  . SER B 1 264 ? -7.233  3.280   84.536   1.00 10.00 ? ? ? ? ? ? 265 SER B CA  1 
ATOM 4971  C C   . SER B 1 264 ? -7.296  3.689   83.090   1.00 10.00 ? ? ? ? ? ? 265 SER B C   1 
ATOM 4972  O O   . SER B 1 264 ? -7.427  2.812   82.248   1.00 10.00 ? ? ? ? ? ? 265 SER B O   1 
ATOM 4973  C CB  . SER B 1 264 ? -8.607  3.437   85.192   1.00 10.00 ? ? ? ? ? ? 265 SER B CB  1 
ATOM 4974  O OG  . SER B 1 264 ? -8.799  4.750   85.744   1.00 10.00 ? ? ? ? ? ? 265 SER B OG  1 
ATOM 4975  N N   . PHE B 1 265 ? -7.129  4.984   82.775   1.00 10.00 ? ? ? ? ? ? 266 PHE B N   1 
ATOM 4976  C CA  . PHE B 1 265 ? -7.089  5.455   81.403   1.00 10.00 ? ? ? ? ? ? 266 PHE B CA  1 
ATOM 4977  C C   . PHE B 1 265 ? -6.058  4.701   80.648   1.00 10.00 ? ? ? ? ? ? 266 PHE B C   1 
ATOM 4978  O O   . PHE B 1 265 ? -6.301  4.376   79.517   1.00 10.00 ? ? ? ? ? ? 266 PHE B O   1 
ATOM 4979  C CB  . PHE B 1 265 ? -6.676  6.867   81.247   1.00 10.00 ? ? ? ? ? ? 266 PHE B CB  1 
ATOM 4980  C CG  . PHE B 1 265 ? -7.751  7.879   81.574   1.00 10.00 ? ? ? ? ? ? 266 PHE B CG  1 
ATOM 4981  C CD1 . PHE B 1 265 ? -8.733  7.585   82.479   1.00 10.00 ? ? ? ? ? ? 266 PHE B CD1 1 
ATOM 4982  C CD2 . PHE B 1 265 ? -7.710  9.087   80.915   1.00 10.00 ? ? ? ? ? ? 266 PHE B CD2 1 
ATOM 4983  C CE1 . PHE B 1 265 ? -9.684  8.518   82.722   1.00 10.00 ? ? ? ? ? ? 266 PHE B CE1 1 
ATOM 4984  C CE2 . PHE B 1 265 ? -8.673  10.010  81.171   1.00 10.00 ? ? ? ? ? ? 266 PHE B CE2 1 
ATOM 4985  C CZ  . PHE B 1 265 ? -9.645  9.709   82.067   1.00 10.00 ? ? ? ? ? ? 266 PHE B CZ  1 
ATOM 4986  N N   . LEU B 1 266 ? -4.925  4.429   81.252   1.00 10.00 ? ? ? ? ? ? 267 LEU B N   1 
ATOM 4987  C CA  . LEU B 1 266 ? -3.909  3.587   80.656   1.00 10.00 ? ? ? ? ? ? 267 LEU B CA  1 
ATOM 4988  C C   . LEU B 1 266 ? -4.153  2.077   80.829   1.00 10.00 ? ? ? ? ? ? 267 LEU B C   1 
ATOM 4989  O O   . LEU B 1 266 ? -3.377  1.273   80.301   1.00 10.00 ? ? ? ? ? ? 267 LEU B O   1 
ATOM 4990  C CB  . LEU B 1 266 ? -2.550  3.952   81.261   1.00 10.00 ? ? ? ? ? ? 267 LEU B CB  1 
ATOM 4991  C CG  . LEU B 1 266 ? -2.114  5.368   81.080   1.00 10.00 ? ? ? ? ? ? 267 LEU B CG  1 
ATOM 4992  C CD1 . LEU B 1 266 ? -0.637  5.460   81.230   1.00 10.00 ? ? ? ? ? ? 267 LEU B CD1 1 
ATOM 4993  C CD2 . LEU B 1 266 ? -2.396  5.808   79.666   1.00 10.00 ? ? ? ? ? ? 267 LEU B CD2 1 
ATOM 4994  N N   . GLY B 1 267 ? -5.154  1.569   81.542   1.00 10.00 ? ? ? ? ? ? 268 GLY B N   1 
ATOM 4995  C CA  . GLY B 1 267 ? -5.326  0.130   81.614   1.00 10.00 ? ? ? ? ? ? 268 GLY B CA  1 
ATOM 4996  C C   . GLY B 1 267 ? -4.556  -0.452  82.776   1.00 10.00 ? ? ? ? ? ? 268 GLY B C   1 
ATOM 4997  O O   . GLY B 1 267 ? -4.526  -1.661  82.962   1.00 10.00 ? ? ? ? ? ? 268 GLY B O   1 
ATOM 4998  N N   . MET B 1 268 ? -4.050  0.454   83.625   1.00 10.00 ? ? ? ? ? ? 269 MET B N   1 
ATOM 4999  C CA  . MET B 1 268 ? -3.327  0.169   84.856   1.00 10.00 ? ? ? ? ? ? 269 MET B CA  1 
ATOM 5000  C C   . MET B 1 268 ? -4.184  0.289   86.104   1.00 10.00 ? ? ? ? ? ? 269 MET B C   1 
ATOM 5001  O O   . MET B 1 268 ? -4.996  1.196   86.323   1.00 10.00 ? ? ? ? ? ? 269 MET B O   1 
ATOM 5002  C CB  . MET B 1 268 ? -2.192  1.116   85.062   1.00 10.00 ? ? ? ? ? ? 269 MET B CB  1 
ATOM 5003  C CG  . MET B 1 268 ? -1.161  1.053   83.983   1.00 10.00 ? ? ? ? ? ? 269 MET B CG  1 
ATOM 5004  S SD  . MET B 1 268 ? -0.089  2.410   84.448   1.00 10.00 ? ? ? ? ? ? 269 MET B SD  1 
ATOM 5005  C CE  . MET B 1 268 ? 1.318   2.012   83.428   1.00 10.00 ? ? ? ? ? ? 269 MET B CE  1 
ATOM 5006  N N   . GLU B 1 269 ? -3.902  -0.680  86.959   1.00 10.00 ? ? ? ? ? ? 270 GLU B N   1 
ATOM 5007  C CA  . GLU B 1 269 ? -4.566  -0.743  88.232   1.00 10.00 ? ? ? ? ? ? 270 GLU B CA  1 
ATOM 5008  C C   . GLU B 1 269 ? -4.039  0.340   89.167   1.00 10.00 ? ? ? ? ? ? 270 GLU B C   1 
ATOM 5009  O O   . GLU B 1 269 ? -4.642  0.563   90.211   1.00 10.00 ? ? ? ? ? ? 270 GLU B O   1 
ATOM 5010  C CB  . GLU B 1 269 ? -4.350  -2.135  88.862   1.00 10.00 ? ? ? ? ? ? 270 GLU B CB  1 
ATOM 5011  C CG  . GLU B 1 269 ? -5.259  -3.333  88.497   1.00 10.00 ? ? ? ? ? ? 270 GLU B CG  1 
ATOM 5012  C CD  . GLU B 1 269 ? -5.157  -3.997  87.112   1.00 10.00 ? ? ? ? ? ? 270 GLU B CD  1 
ATOM 5013  O OE1 . GLU B 1 269 ? -4.469  -3.493  86.208   1.00 10.00 ? ? ? ? ? ? 270 GLU B OE1 1 
ATOM 5014  O OE2 . GLU B 1 269 ? -5.781  -5.053  86.936   1.00 10.00 ? ? ? ? ? ? 270 GLU B OE2 1 
ATOM 5015  N N   . SER B 1 270 ? -2.918  1.020   88.890   1.00 10.00 ? ? ? ? ? ? 271 SER B N   1 
ATOM 5016  C CA  . SER B 1 270 ? -2.328  1.948   89.845   1.00 10.00 ? ? ? ? ? ? 271 SER B CA  1 
ATOM 5017  C C   . SER B 1 270 ? -3.181  3.149   90.215   1.00 10.00 ? ? ? ? ? ? 271 SER B C   1 
ATOM 5018  O O   . SER B 1 270 ? -3.961  3.715   89.443   1.00 10.00 ? ? ? ? ? ? 271 SER B O   1 
ATOM 5019  C CB  . SER B 1 270 ? -1.000  2.493   89.316   1.00 10.00 ? ? ? ? ? ? 271 SER B CB  1 
ATOM 5020  O OG  . SER B 1 270 ? -0.181  1.473   88.754   1.00 10.00 ? ? ? ? ? ? 271 SER B OG  1 
ATOM 5021  N N   . CYS B 1 271 ? -2.969  3.522   91.468   1.00 10.00 ? ? ? ? ? ? 272 CYS B N   1 
ATOM 5022  C CA  . CYS B 1 271 ? -3.442  4.763   92.041   1.00 10.00 ? ? ? ? ? ? 272 CYS B CA  1 
ATOM 5023  C C   . CYS B 1 271 ? -2.844  5.863   91.199   1.00 10.00 ? ? ? ? ? ? 272 CYS B C   1 
ATOM 5024  O O   . CYS B 1 271 ? -1.815  5.634   90.572   1.00 10.00 ? ? ? ? ? ? 272 CYS B O   1 
ATOM 5025  C CB  . CYS B 1 271 ? -2.912  4.922   93.476   1.00 10.00 ? ? ? ? ? ? 272 CYS B CB  1 
ATOM 5026  S SG  . CYS B 1 271 ? -3.769  3.890   94.682   1.00 10.00 ? ? ? ? ? ? 272 CYS B SG  1 
ATOM 5027  N N   . GLY B 1 272 ? -3.410  7.047   91.150   1.00 10.00 ? ? ? ? ? ? 273 GLY B N   1 
ATOM 5028  C CA  . GLY B 1 272 ? -2.724  8.115   90.479   1.00 10.00 ? ? ? ? ? ? 273 GLY B CA  1 
ATOM 5029  C C   . GLY B 1 272 ? -1.783  8.807   91.434   1.00 10.00 ? ? ? ? ? ? 273 GLY B C   1 
ATOM 5030  O O   . GLY B 1 272 ? -1.852  8.752   92.663   1.00 10.00 ? ? ? ? ? ? 273 GLY B O   1 
ATOM 5031  N N   . ILE B 1 273 ? -1.040  9.699   90.815   1.00 10.00 ? ? ? ? ? ? 274 ILE B N   1 
ATOM 5032  C CA  . ILE B 1 273 ? -0.071  10.538  91.485   1.00 10.00 ? ? ? ? ? ? 274 ILE B CA  1 
ATOM 5033  C C   . ILE B 1 273 ? -0.460  11.289  92.766   1.00 10.00 ? ? ? ? ? ? 274 ILE B C   1 
ATOM 5034  O O   . ILE B 1 273 ? 0.363   11.602  93.634   1.00 10.00 ? ? ? ? ? ? 274 ILE B O   1 
ATOM 5035  C CB  . ILE B 1 273 ? 0.439   11.442  90.293   1.00 10.00 ? ? ? ? ? ? 274 ILE B CB  1 
ATOM 5036  C CG1 . ILE B 1 273 ? 1.936   11.202  90.383   1.00 10.00 ? ? ? ? ? ? 274 ILE B CG1 1 
ATOM 5037  C CG2 . ILE B 1 273 ? 0.039   12.933  90.253   1.00 10.00 ? ? ? ? ? ? 274 ILE B CG2 1 
ATOM 5038  C CD1 . ILE B 1 273 ? 2.257   9.718   90.115   1.00 10.00 ? ? ? ? ? ? 274 ILE B CD1 1 
ATOM 5039  N N   . HIS B 1 274 ? -1.758  11.531  92.916   1.00 10.00 ? ? ? ? ? ? 275 HIS B N   1 
ATOM 5040  C CA  . HIS B 1 274 ? -2.247  12.332  94.039   1.00 10.00 ? ? ? ? ? ? 275 HIS B CA  1 
ATOM 5041  C C   . HIS B 1 274 ? -2.432  11.480  95.291   1.00 10.00 ? ? ? ? ? ? 275 HIS B C   1 
ATOM 5042  O O   . HIS B 1 274 ? -2.300  11.913  96.430   1.00 10.00 ? ? ? ? ? ? 275 HIS B O   1 
ATOM 5043  C CB  . HIS B 1 274 ? -3.586  13.030  93.642   1.00 10.00 ? ? ? ? ? ? 275 HIS B CB  1 
ATOM 5044  C CG  . HIS B 1 274 ? -4.710  12.107  93.159   1.00 10.00 ? ? ? ? ? ? 275 HIS B CG  1 
ATOM 5045  N ND1 . HIS B 1 274 ? -4.793  11.372  92.031   1.00 10.00 ? ? ? ? ? ? 275 HIS B ND1 1 
ATOM 5046  C CD2 . HIS B 1 274 ? -5.877  11.925  93.856   1.00 10.00 ? ? ? ? ? ? 275 HIS B CD2 1 
ATOM 5047  C CE1 . HIS B 1 274 ? -5.961  10.768  92.039   1.00 10.00 ? ? ? ? ? ? 275 HIS B CE1 1 
ATOM 5048  N NE2 . HIS B 1 274 ? -6.601  11.105  93.134   1.00 10.00 ? ? ? ? ? ? 275 HIS B NE2 1 
ATOM 5049  N N   . GLU B 1 275 ? -2.672  10.211  95.048   1.00 10.00 ? ? ? ? ? ? 276 GLU B N   1 
ATOM 5050  C CA  . GLU B 1 275 ? -2.861  9.250   96.096   1.00 10.00 ? ? ? ? ? ? 276 GLU B CA  1 
ATOM 5051  C C   . GLU B 1 275 ? -1.547  8.725   96.582   1.00 10.00 ? ? ? ? ? ? 276 GLU B C   1 
ATOM 5052  O O   . GLU B 1 275 ? -1.418  8.397   97.734   1.00 10.00 ? ? ? ? ? ? 276 GLU B O   1 
ATOM 5053  C CB  . GLU B 1 275 ? -3.621  8.125   95.594   1.00 10.00 ? ? ? ? ? ? 276 GLU B CB  1 
ATOM 5054  C CG  . GLU B 1 275 ? -4.943  8.620   95.200   1.00 10.00 ? ? ? ? ? ? 276 GLU B CG  1 
ATOM 5055  C CD  . GLU B 1 275 ? -5.950  7.746   95.889   1.00 10.00 ? ? ? ? ? ? 276 GLU B CD  1 
ATOM 5056  O OE1 . GLU B 1 275 ? -6.158  7.911   97.093   1.00 10.00 ? ? ? ? ? ? 276 GLU B OE1 1 
ATOM 5057  O OE2 . GLU B 1 275 ? -6.520  6.898   95.212   1.00 10.00 ? ? ? ? ? ? 276 GLU B OE2 1 
ATOM 5058  N N   . THR B 1 276 ? -0.580  8.574   95.708   1.00 10.00 ? ? ? ? ? ? 277 THR B N   1 
ATOM 5059  C CA  . THR B 1 276 ? 0.722   8.077   96.033   1.00 10.00 ? ? ? ? ? ? 277 THR B CA  1 
ATOM 5060  C C   . THR B 1 276 ? 1.406   9.141   96.881   1.00 10.00 ? ? ? ? ? ? 277 THR B C   1 
ATOM 5061  O O   . THR B 1 276 ? 1.878   8.678   97.926   1.00 10.00 ? ? ? ? ? ? 277 THR B O   1 
ATOM 5062  C CB  . THR B 1 276 ? 1.331   7.757   94.664   1.00 10.00 ? ? ? ? ? ? 277 THR B CB  1 
ATOM 5063  O OG1 . THR B 1 276 ? 0.450   6.730   94.250   1.00 10.00 ? ? ? ? ? ? 277 THR B OG1 1 
ATOM 5064  C CG2 . THR B 1 276 ? 2.741   7.202   94.555   1.00 10.00 ? ? ? ? ? ? 277 THR B CG2 1 
ATOM 5065  N N   . THR B 1 277 ? 1.510   10.480  96.599   1.00 10.00 ? ? ? ? ? ? 278 THR B N   1 
ATOM 5066  C CA  . THR B 1 277 ? 2.016   11.465  97.560   1.00 10.00 ? ? ? ? ? ? 278 THR B CA  1 
ATOM 5067  C C   . THR B 1 277 ? 1.366   11.228  98.941   1.00 10.00 ? ? ? ? ? ? 278 THR B C   1 
ATOM 5068  O O   . THR B 1 277 ? 1.995   10.936  99.955   1.00 10.00 ? ? ? ? ? ? 278 THR B O   1 
ATOM 5069  C CB  . THR B 1 277 ? 1.680   12.831  96.953   1.00 10.00 ? ? ? ? ? ? 278 THR B CB  1 
ATOM 5070  O OG1 . THR B 1 277 ? 2.360   12.812  95.703   1.00 10.00 ? ? ? ? ? ? 278 THR B OG1 1 
ATOM 5071  C CG2 . THR B 1 277 ? 2.080   14.053  97.787   1.00 10.00 ? ? ? ? ? ? 278 THR B CG2 1 
ATOM 5072  N N   . PHE B 1 278 ? 0.043   11.154  99.027   1.00 10.00 ? ? ? ? ? ? 279 PHE B N   1 
ATOM 5073  C CA  . PHE B 1 278 ? -0.675  10.870  100.276  1.00 10.00 ? ? ? ? ? ? 279 PHE B CA  1 
ATOM 5074  C C   . PHE B 1 278 ? -0.333  9.521   100.902  1.00 10.00 ? ? ? ? ? ? 279 PHE B C   1 
ATOM 5075  O O   . PHE B 1 278 ? -0.433  9.364   102.121  1.00 10.00 ? ? ? ? ? ? 279 PHE B O   1 
ATOM 5076  C CB  . PHE B 1 278 ? -2.204  10.971  99.994   1.00 10.00 ? ? ? ? ? ? 279 PHE B CB  1 
ATOM 5077  C CG  . PHE B 1 278 ? -3.111  10.624  101.175  1.00 10.00 ? ? ? ? ? ? 279 PHE B CG  1 
ATOM 5078  C CD1 . PHE B 1 278 ? -3.524  9.298   101.372  1.00 10.00 ? ? ? ? ? ? 279 PHE B CD1 1 
ATOM 5079  C CD2 . PHE B 1 278 ? -3.519  11.614  102.053  1.00 10.00 ? ? ? ? ? ? 279 PHE B CD2 1 
ATOM 5080  C CE1 . PHE B 1 278 ? -4.336  8.970   102.447  1.00 10.00 ? ? ? ? ? ? 279 PHE B CE1 1 
ATOM 5081  C CE2 . PHE B 1 278 ? -4.332  11.250  103.113  1.00 10.00 ? ? ? ? ? ? 279 PHE B CE2 1 
ATOM 5082  C CZ  . PHE B 1 278 ? -4.743  9.937   103.317  1.00 10.00 ? ? ? ? ? ? 279 PHE B CZ  1 
ATOM 5083  N N   . ASN B 1 279 ? 0.044   8.498   100.189  1.00 10.00 ? ? ? ? ? ? 280 ASN B N   1 
ATOM 5084  C CA  . ASN B 1 279 ? 0.266   7.246   100.866  1.00 10.00 ? ? ? ? ? ? 280 ASN B CA  1 
ATOM 5085  C C   . ASN B 1 279 ? 1.700   7.186   101.322  1.00 10.00 ? ? ? ? ? ? 280 ASN B C   1 
ATOM 5086  O O   . ASN B 1 279 ? 1.951   6.311   102.138  1.00 10.00 ? ? ? ? ? ? 280 ASN B O   1 
ATOM 5087  C CB  . ASN B 1 279 ? 0.077   5.997   100.023  1.00 10.00 ? ? ? ? ? ? 280 ASN B CB  1 
ATOM 5088  C CG  . ASN B 1 279 ? -1.319  5.651   99.532   1.00 10.00 ? ? ? ? ? ? 280 ASN B CG  1 
ATOM 5089  O OD1 . ASN B 1 279 ? -1.453  4.815   98.631   1.00 10.00 ? ? ? ? ? ? 280 ASN B OD1 1 
ATOM 5090  N ND2 . ASN B 1 279 ? -2.405  6.238   100.035  1.00 10.00 ? ? ? ? ? ? 280 ASN B ND2 1 
ATOM 5091  N N   . SER B 1 280 ? 2.648   8.016   100.850  1.00 10.00 ? ? ? ? ? ? 281 SER B N   1 
ATOM 5092  C CA  . SER B 1 280 ? 4.017   8.045   101.374  1.00 10.00 ? ? ? ? ? ? 281 SER B CA  1 
ATOM 5093  C C   . SER B 1 280 ? 3.955   8.823   102.677  1.00 10.00 ? ? ? ? ? ? 281 SER B C   1 
ATOM 5094  O O   . SER B 1 280 ? 4.362   8.342   103.710  1.00 10.00 ? ? ? ? ? ? 281 SER B O   1 
ATOM 5095  C CB  . SER B 1 280 ? 4.978   8.735   100.368  1.00 10.00 ? ? ? ? ? ? 281 SER B CB  1 
ATOM 5096  O OG  . SER B 1 280 ? 5.215   7.904   99.243   1.00 10.00 ? ? ? ? ? ? 281 SER B OG  1 
ATOM 5097  N N   . ILE B 1 281 ? 3.384   10.000  102.684  1.00 10.00 ? ? ? ? ? ? 282 ILE B N   1 
ATOM 5098  C CA  . ILE B 1 281 ? 3.080   10.802  103.865  1.00 10.00 ? ? ? ? ? ? 282 ILE B CA  1 
ATOM 5099  C C   . ILE B 1 281 ? 2.467   9.934   104.935  1.00 10.00 ? ? ? ? ? ? 282 ILE B C   1 
ATOM 5100  O O   . ILE B 1 281 ? 2.884   10.072  106.064  1.00 10.00 ? ? ? ? ? ? 282 ILE B O   1 
ATOM 5101  C CB  . ILE B 1 281 ? 2.081   11.925  103.513  1.00 10.00 ? ? ? ? ? ? 282 ILE B CB  1 
ATOM 5102  C CG1 . ILE B 1 281 ? 2.850   13.035  102.894  1.00 10.00 ? ? ? ? ? ? 282 ILE B CG1 1 
ATOM 5103  C CG2 . ILE B 1 281 ? 1.309   12.392  104.706  1.00 10.00 ? ? ? ? ? ? 282 ILE B CG2 1 
ATOM 5104  C CD1 . ILE B 1 281 ? 2.009   14.151  102.326  1.00 10.00 ? ? ? ? ? ? 282 ILE B CD1 1 
ATOM 5105  N N   . MET B 1 282 ? 1.557   9.029   104.701  1.00 10.00 ? ? ? ? ? ? 283 MET B N   1 
ATOM 5106  C CA  . MET B 1 282 ? 1.027   8.270   105.792  1.00 10.00 ? ? ? ? ? ? 283 MET B CA  1 
ATOM 5107  C C   . MET B 1 282 ? 1.938   7.227   106.419  1.00 10.00 ? ? ? ? ? ? 283 MET B C   1 
ATOM 5108  O O   . MET B 1 282 ? 1.670   6.702   107.502  1.00 10.00 ? ? ? ? ? ? 283 MET B O   1 
ATOM 5109  C CB  . MET B 1 282 ? -0.213  7.683   105.258  1.00 10.00 ? ? ? ? ? ? 283 MET B CB  1 
ATOM 5110  C CG  . MET B 1 282 ? -1.144  8.873   105.035  1.00 10.00 ? ? ? ? ? ? 283 MET B CG  1 
ATOM 5111  S SD  . MET B 1 282 ? -1.819  9.582   106.564  1.00 10.00 ? ? ? ? ? ? 283 MET B SD  1 
ATOM 5112  C CE  . MET B 1 282 ? -2.335  7.986   107.211  1.00 10.00 ? ? ? ? ? ? 283 MET B CE  1 
ATOM 5113  N N   . LYS B 1 283 ? 3.029   6.921   105.733  1.00 10.00 ? ? ? ? ? ? 284 LYS B N   1 
ATOM 5114  C CA  . LYS B 1 283 ? 4.015   5.919   106.083  1.00 10.00 ? ? ? ? ? ? 284 LYS B CA  1 
ATOM 5115  C C   . LYS B 1 283 ? 5.167   6.518   106.876  1.00 10.00 ? ? ? ? ? ? 284 LYS B C   1 
ATOM 5116  O O   . LYS B 1 283 ? 6.086   5.835   107.355  1.00 10.00 ? ? ? ? ? ? 284 LYS B O   1 
ATOM 5117  C CB  . LYS B 1 283 ? 4.544   5.288   104.792  1.00 10.00 ? ? ? ? ? ? 284 LYS B CB  1 
ATOM 5118  C CG  . LYS B 1 283 ? 3.738   4.090   104.295  1.00 10.00 ? ? ? ? ? ? 284 LYS B CG  1 
ATOM 5119  C CD  . LYS B 1 283 ? 4.319   3.604   102.997  1.00 10.00 ? ? ? ? ? ? 284 LYS B CD  1 
ATOM 5120  C CE  . LYS B 1 283 ? 3.999   2.137   102.859  1.00 10.00 ? ? ? ? ? ? 284 LYS B CE  1 
ATOM 5121  N NZ  . LYS B 1 283 ? 4.876   1.365   103.723  1.00 10.00 ? ? ? ? ? ? 284 LYS B NZ  1 
ATOM 5122  N N   . CYS B 1 284 ? 5.199   7.838   106.962  1.00 10.00 ? ? ? ? ? ? 285 CYS B N   1 
ATOM 5123  C CA  . CYS B 1 284 ? 6.256   8.520   107.698  1.00 10.00 ? ? ? ? ? ? 285 CYS B CA  1 
ATOM 5124  C C   . CYS B 1 284 ? 5.940   8.734   109.207  1.00 10.00 ? ? ? ? ? ? 285 CYS B C   1 
ATOM 5125  O O   . CYS B 1 284 ? 4.843   8.534   109.733  1.00 10.00 ? ? ? ? ? ? 285 CYS B O   1 
ATOM 5126  C CB  . CYS B 1 284 ? 6.480   9.854   107.014  1.00 10.00 ? ? ? ? ? ? 285 CYS B CB  1 
ATOM 5127  S SG  . CYS B 1 284 ? 6.974   9.806   105.286  1.00 10.00 ? ? ? ? ? ? 285 CYS B SG  1 
ATOM 5128  N N   . ASP B 1 285 ? 6.950   9.167   109.931  1.00 10.00 ? ? ? ? ? ? 286 ASP B N   1 
ATOM 5129  C CA  . ASP B 1 285 ? 6.873   9.574   111.309  1.00 10.00 ? ? ? ? ? ? 286 ASP B CA  1 
ATOM 5130  C C   . ASP B 1 285 ? 5.760   10.566  111.494  1.00 10.00 ? ? ? ? ? ? 286 ASP B C   1 
ATOM 5131  O O   . ASP B 1 285 ? 5.788   11.663  110.950  1.00 10.00 ? ? ? ? ? ? 286 ASP B O   1 
ATOM 5132  C CB  . ASP B 1 285 ? 8.165   10.250  111.741  1.00 10.00 ? ? ? ? ? ? 286 ASP B CB  1 
ATOM 5133  C CG  . ASP B 1 285 ? 8.382   10.172  113.235  1.00 10.00 ? ? ? ? ? ? 286 ASP B CG  1 
ATOM 5134  O OD1 . ASP B 1 285 ? 7.551   10.592  114.048  1.00 10.00 ? ? ? ? ? ? 286 ASP B OD1 1 
ATOM 5135  O OD2 . ASP B 1 285 ? 9.437   9.678   113.597  1.00 10.00 ? ? ? ? ? ? 286 ASP B OD2 1 
ATOM 5136  N N   . VAL B 1 286 ? 4.912   10.225  112.442  1.00 10.00 ? ? ? ? ? ? 287 VAL B N   1 
ATOM 5137  C CA  . VAL B 1 286 ? 3.790   11.028  112.856  1.00 10.00 ? ? ? ? ? ? 287 VAL B CA  1 
ATOM 5138  C C   . VAL B 1 286 ? 4.165   12.473  113.055  1.00 10.00 ? ? ? ? ? ? 287 VAL B C   1 
ATOM 5139  O O   . VAL B 1 286 ? 3.391   13.339  112.699  1.00 10.00 ? ? ? ? ? ? 287 VAL B O   1 
ATOM 5140  C CB  . VAL B 1 286 ? 3.258   10.375  114.130  1.00 10.00 ? ? ? ? ? ? 287 VAL B CB  1 
ATOM 5141  C CG1 . VAL B 1 286 ? 2.166   11.171  114.752  1.00 10.00 ? ? ? ? ? ? 287 VAL B CG1 1 
ATOM 5142  C CG2 . VAL B 1 286 ? 2.582   9.096   113.795  1.00 10.00 ? ? ? ? ? ? 287 VAL B CG2 1 
ATOM 5143  N N   . ASP B 1 287 ? 5.371   12.793  113.530  1.00 10.00 ? ? ? ? ? ? 288 ASP B N   1 
ATOM 5144  C CA  . ASP B 1 287 ? 5.747   14.194  113.835  1.00 10.00 ? ? ? ? ? ? 288 ASP B CA  1 
ATOM 5145  C C   . ASP B 1 287 ? 6.404   14.924  112.628  1.00 10.00 ? ? ? ? ? ? 288 ASP B C   1 
ATOM 5146  O O   . ASP B 1 287 ? 6.911   16.062  112.786  1.00 10.00 ? ? ? ? ? ? 288 ASP B O   1 
ATOM 5147  C CB  . ASP B 1 287 ? 6.737   14.288  115.084  1.00 10.00 ? ? ? ? ? ? 288 ASP B CB  1 
ATOM 5148  C CG  . ASP B 1 287 ? 6.399   13.623  116.455  1.00 10.00 ? ? ? ? ? ? 288 ASP B CG  1 
ATOM 5149  O OD1 . ASP B 1 287 ? 5.560   14.139  117.230  1.00 10.00 ? ? ? ? ? ? 288 ASP B OD1 1 
ATOM 5150  O OD2 . ASP B 1 287 ? 7.019   12.585  116.755  1.00 10.00 ? ? ? ? ? ? 288 ASP B OD2 1 
ATOM 5151  N N   . ILE B 1 288 ? 6.506   14.357  111.404  1.00 10.00 ? ? ? ? ? ? 289 ILE B N   1 
ATOM 5152  C CA  . ILE B 1 288 ? 7.018   15.175  110.337  1.00 10.00 ? ? ? ? ? ? 289 ILE B CA  1 
ATOM 5153  C C   . ILE B 1 288 ? 5.958   15.339  109.306  1.00 10.00 ? ? ? ? ? ? 289 ILE B C   1 
ATOM 5154  O O   . ILE B 1 288 ? 6.020   16.255  108.518  1.00 10.00 ? ? ? ? ? ? 289 ILE B O   1 
ATOM 5155  C CB  . ILE B 1 288 ? 8.309   14.592  109.740  1.00 10.00 ? ? ? ? ? ? 289 ILE B CB  1 
ATOM 5156  C CG1 . ILE B 1 288 ? 8.307   13.144  109.364  1.00 10.00 ? ? ? ? ? ? 289 ILE B CG1 1 
ATOM 5157  C CG2 . ILE B 1 288 ? 9.313   14.785  110.853  1.00 10.00 ? ? ? ? ? ? 289 ILE B CG2 1 
ATOM 5158  C CD1 . ILE B 1 288 ? 9.711   12.555  109.142  1.00 10.00 ? ? ? ? ? ? 289 ILE B CD1 1 
ATOM 5159  N N   . ARG B 1 289 ? 4.854   14.613  109.319  1.00 10.00 ? ? ? ? ? ? 290 ARG B N   1 
ATOM 5160  C CA  . ARG B 1 289 ? 3.784   14.705  108.335  1.00 10.00 ? ? ? ? ? ? 290 ARG B CA  1 
ATOM 5161  C C   . ARG B 1 289 ? 3.332   16.125  108.058  1.00 10.00 ? ? ? ? ? ? 290 ARG B C   1 
ATOM 5162  O O   . ARG B 1 289 ? 3.202   16.549  106.904  1.00 10.00 ? ? ? ? ? ? 290 ARG B O   1 
ATOM 5163  C CB  . ARG B 1 289 ? 2.557   13.899  108.782  1.00 10.00 ? ? ? ? ? ? 290 ARG B CB  1 
ATOM 5164  C CG  . ARG B 1 289 ? 2.804   12.434  108.816  1.00 10.00 ? ? ? ? ? ? 290 ARG B CG  1 
ATOM 5165  C CD  . ARG B 1 289 ? 1.584   11.627  109.143  1.00 10.00 ? ? ? ? ? ? 290 ARG B CD  1 
ATOM 5166  N NE  . ARG B 1 289 ? 2.113   10.290  109.315  1.00 10.00 ? ? ? ? ? ? 290 ARG B NE  1 
ATOM 5167  C CZ  . ARG B 1 289 ? 1.418   9.252   109.777  1.00 10.00 ? ? ? ? ? ? 290 ARG B CZ  1 
ATOM 5168  N NH1 . ARG B 1 289 ? 0.146   9.288   110.139  1.00 10.00 ? ? ? ? ? ? 290 ARG B NH1 1 
ATOM 5169  N NH2 . ARG B 1 289 ? 2.036   8.097   109.914  1.00 10.00 ? ? ? ? ? ? 290 ARG B NH2 1 
ATOM 5170  N N   . LYS B 1 290 ? 3.191   16.917  109.116  1.00 10.00 ? ? ? ? ? ? 291 LYS B N   1 
ATOM 5171  C CA  . LYS B 1 290 ? 2.725   18.277  108.932  1.00 10.00 ? ? ? ? ? ? 291 LYS B CA  1 
ATOM 5172  C C   . LYS B 1 290 ? 3.756   19.035  108.131  1.00 10.00 ? ? ? ? ? ? 291 LYS B C   1 
ATOM 5173  O O   . LYS B 1 290 ? 3.440   20.002  107.447  1.00 10.00 ? ? ? ? ? ? 291 LYS B O   1 
ATOM 5174  C CB  . LYS B 1 290 ? 2.502   19.001  110.259  1.00 10.00 ? ? ? ? ? ? 291 LYS B CB  1 
ATOM 5175  C CG  . LYS B 1 290 ? 3.643   19.176  111.294  1.00 10.00 ? ? ? ? ? ? 291 LYS B CG  1 
ATOM 5176  C CD  . LYS B 1 290 ? 4.061   17.948  112.179  1.00 10.00 ? ? ? ? ? ? 291 LYS B CD  1 
ATOM 5177  C CE  . LYS B 1 290 ? 2.966   17.176  112.969  1.00 10.00 ? ? ? ? ? ? 291 LYS B CE  1 
ATOM 5178  N NZ  . LYS B 1 290 ? 2.860   15.804  112.465  1.00 10.00 ? ? ? ? ? ? 291 LYS B NZ  1 
ATOM 5179  N N   . ASP B 1 291 ? 5.005   18.605  108.176  1.00 10.00 ? ? ? ? ? ? 292 ASP B N   1 
ATOM 5180  C CA  . ASP B 1 291 ? 6.035   19.254  107.426  1.00 10.00 ? ? ? ? ? ? 292 ASP B CA  1 
ATOM 5181  C C   . ASP B 1 291 ? 5.973   18.815  105.991  1.00 10.00 ? ? ? ? ? ? 292 ASP B C   1 
ATOM 5182  O O   . ASP B 1 291 ? 6.145   19.640  105.093  1.00 10.00 ? ? ? ? ? ? 292 ASP B O   1 
ATOM 5183  C CB  . ASP B 1 291 ? 7.419   18.937  108.041  1.00 10.00 ? ? ? ? ? ? 292 ASP B CB  1 
ATOM 5184  C CG  . ASP B 1 291 ? 7.718   19.739  109.296  1.00 10.00 ? ? ? ? ? ? 292 ASP B CG  1 
ATOM 5185  O OD1 . ASP B 1 291 ? 7.619   20.965  109.273  1.00 10.00 ? ? ? ? ? ? 292 ASP B OD1 1 
ATOM 5186  O OD2 . ASP B 1 291 ? 8.051   19.131  110.307  1.00 10.00 ? ? ? ? ? ? 292 ASP B OD2 1 
ATOM 5187  N N   . LEU B 1 292 ? 5.727   17.530  105.777  1.00 10.00 ? ? ? ? ? ? 293 LEU B N   1 
ATOM 5188  C CA  . LEU B 1 292 ? 5.616   16.979  104.426  1.00 10.00 ? ? ? ? ? ? 293 LEU B CA  1 
ATOM 5189  C C   . LEU B 1 292 ? 4.376   17.568  103.668  1.00 10.00 ? ? ? ? ? ? 293 LEU B C   1 
ATOM 5190  O O   . LEU B 1 292 ? 4.481   17.934  102.478  1.00 10.00 ? ? ? ? ? ? 293 LEU B O   1 
ATOM 5191  C CB  . LEU B 1 292 ? 5.522   15.495  104.557  1.00 10.00 ? ? ? ? ? ? 293 LEU B CB  1 
ATOM 5192  C CG  . LEU B 1 292 ? 6.601   14.762  105.256  1.00 10.00 ? ? ? ? ? ? 293 LEU B CG  1 
ATOM 5193  C CD1 . LEU B 1 292 ? 6.348   13.298  105.051  1.00 10.00 ? ? ? ? ? ? 293 LEU B CD1 1 
ATOM 5194  C CD2 . LEU B 1 292 ? 7.941   15.136  104.708  1.00 10.00 ? ? ? ? ? ? 293 LEU B CD2 1 
ATOM 5195  N N   . TYR B 1 293 ? 3.193   17.818  104.272  1.00 10.00 ? ? ? ? ? ? 294 TYR B N   1 
ATOM 5196  C CA  . TYR B 1 293 ? 2.140   18.542  103.559  1.00 10.00 ? ? ? ? ? ? 294 TYR B CA  1 
ATOM 5197  C C   . TYR B 1 293 ? 2.429   19.988  103.217  1.00 10.00 ? ? ? ? ? ? 294 TYR B C   1 
ATOM 5198  O O   . TYR B 1 293 ? 1.883   20.557  102.283  1.00 10.00 ? ? ? ? ? ? 294 TYR B O   1 
ATOM 5199  C CB  . TYR B 1 293 ? 0.873   18.550  104.345  1.00 10.00 ? ? ? ? ? ? 294 TYR B CB  1 
ATOM 5200  C CG  . TYR B 1 293 ? 0.175   17.224  104.337  1.00 10.00 ? ? ? ? ? ? 294 TYR B CG  1 
ATOM 5201  C CD1 . TYR B 1 293 ? -0.653  16.861  103.300  1.00 10.00 ? ? ? ? ? ? 294 TYR B CD1 1 
ATOM 5202  C CD2 . TYR B 1 293 ? 0.319   16.416  105.428  1.00 10.00 ? ? ? ? ? ? 294 TYR B CD2 1 
ATOM 5203  C CE1 . TYR B 1 293 ? -1.351  15.670  103.376  1.00 10.00 ? ? ? ? ? ? 294 TYR B CE1 1 
ATOM 5204  C CE2 . TYR B 1 293 ? -0.387  15.230  105.505  1.00 10.00 ? ? ? ? ? ? 294 TYR B CE2 1 
ATOM 5205  C CZ  . TYR B 1 293 ? -1.222  14.866  104.485  1.00 10.00 ? ? ? ? ? ? 294 TYR B CZ  1 
ATOM 5206  O OH  . TYR B 1 293 ? -1.961  13.702  104.630  1.00 10.00 ? ? ? ? ? ? 294 TYR B OH  1 
ATOM 5207  N N   . ALA B 1 294 ? 3.216   20.689  104.002  1.00 10.00 ? ? ? ? ? ? 295 ALA B N   1 
ATOM 5208  C CA  . ALA B 1 294 ? 3.538   22.085  103.758  1.00 10.00 ? ? ? ? ? ? 295 ALA B CA  1 
ATOM 5209  C C   . ALA B 1 294 ? 4.600   22.256  102.698  1.00 10.00 ? ? ? ? ? ? 295 ALA B C   1 
ATOM 5210  O O   . ALA B 1 294 ? 4.860   23.375  102.249  1.00 10.00 ? ? ? ? ? ? 295 ALA B O   1 
ATOM 5211  C CB  . ALA B 1 294 ? 4.082   22.713  105.007  1.00 10.00 ? ? ? ? ? ? 295 ALA B CB  1 
ATOM 5212  N N   . ASN B 1 295 ? 5.257   21.138  102.332  1.00 10.00 ? ? ? ? ? ? 296 ASN B N   1 
ATOM 5213  C CA  . ASN B 1 295 ? 6.384   21.158  101.413  1.00 10.00 ? ? ? ? ? ? 296 ASN B CA  1 
ATOM 5214  C C   . ASN B 1 295 ? 6.253   20.007  100.427  1.00 10.00 ? ? ? ? ? ? 296 ASN B C   1 
ATOM 5215  O O   . ASN B 1 295 ? 6.926   18.981  100.506  1.00 10.00 ? ? ? ? ? ? 296 ASN B O   1 
ATOM 5216  C CB  . ASN B 1 295 ? 7.642   21.041  102.236  1.00 10.00 ? ? ? ? ? ? 296 ASN B CB  1 
ATOM 5217  C CG  . ASN B 1 295 ? 7.845   22.185  103.217  1.00 10.00 ? ? ? ? ? ? 296 ASN B CG  1 
ATOM 5218  O OD1 . ASN B 1 295 ? 8.345   23.259  102.875  1.00 10.00 ? ? ? ? ? ? 296 ASN B OD1 1 
ATOM 5219  N ND2 . ASN B 1 295 ? 7.441   22.033  104.472  1.00 10.00 ? ? ? ? ? ? 296 ASN B ND2 1 
ATOM 5220  N N   . THR B 1 296 ? 5.246   20.087  99.568   1.00 10.00 ? ? ? ? ? ? 297 THR B N   1 
ATOM 5221  C CA  . THR B 1 296 ? 5.094   19.111  98.523   1.00 10.00 ? ? ? ? ? ? 297 THR B CA  1 
ATOM 5222  C C   . THR B 1 296 ? 5.706   19.846  97.350   1.00 10.00 ? ? ? ? ? ? 297 THR B C   1 
ATOM 5223  O O   . THR B 1 296 ? 5.239   20.941  97.010   1.00 10.00 ? ? ? ? ? ? 297 THR B O   1 
ATOM 5224  C CB  . THR B 1 296 ? 3.619   18.821  98.384   1.00 10.00 ? ? ? ? ? ? 297 THR B CB  1 
ATOM 5225  O OG1 . THR B 1 296 ? 3.252   18.216  99.590   1.00 10.00 ? ? ? ? ? ? 297 THR B OG1 1 
ATOM 5226  C CG2 . THR B 1 296 ? 3.260   17.757  97.393   1.00 10.00 ? ? ? ? ? ? 297 THR B CG2 1 
ATOM 5227  N N   . VAL B 1 297 ? 6.819   19.334  96.798   1.00 10.00 ? ? ? ? ? ? 298 VAL B N   1 
ATOM 5228  C CA  . VAL B 1 297 ? 7.562   19.935  95.680   1.00 10.00 ? ? ? ? ? ? 298 VAL B CA  1 
ATOM 5229  C C   . VAL B 1 297 ? 7.439   18.974  94.502   1.00 10.00 ? ? ? ? ? ? 298 VAL B C   1 
ATOM 5230  O O   . VAL B 1 297 ? 7.492   17.730  94.657   1.00 10.00 ? ? ? ? ? ? 298 VAL B O   1 
ATOM 5231  C CB  . VAL B 1 297 ? 9.084   20.122  96.023   1.00 10.00 ? ? ? ? ? ? 298 VAL B CB  1 
ATOM 5232  C CG1 . VAL B 1 297 ? 9.723   20.871  94.858   1.00 10.00 ? ? ? ? ? ? 298 VAL B CG1 1 
ATOM 5233  C CG2 . VAL B 1 297 ? 9.299   20.821  97.412   1.00 10.00 ? ? ? ? ? ? 298 VAL B CG2 1 
ATOM 5234  N N   . LEU B 1 298 ? 7.233   19.528  93.313   1.00 10.00 ? ? ? ? ? ? 299 LEU B N   1 
ATOM 5235  C CA  . LEU B 1 298 ? 7.113   18.669  92.148   1.00 10.00 ? ? ? ? ? ? 299 LEU B CA  1 
ATOM 5236  C C   . LEU B 1 298 ? 8.409   18.819  91.371   1.00 10.00 ? ? ? ? ? ? 299 LEU B C   1 
ATOM 5237  O O   . LEU B 1 298 ? 8.960   19.939  91.353   1.00 10.00 ? ? ? ? ? ? 299 LEU B O   1 
ATOM 5238  C CB  . LEU B 1 298 ? 5.888   19.098  91.286   1.00 10.00 ? ? ? ? ? ? 299 LEU B CB  1 
ATOM 5239  C CG  . LEU B 1 298 ? 4.516   19.365  91.930   1.00 10.00 ? ? ? ? ? ? 299 LEU B CG  1 
ATOM 5240  C CD1 . LEU B 1 298 ? 3.467   19.572  90.842   1.00 10.00 ? ? ? ? ? ? 299 LEU B CD1 1 
ATOM 5241  C CD2 . LEU B 1 298 ? 4.105   18.197  92.815   1.00 10.00 ? ? ? ? ? ? 299 LEU B CD2 1 
ATOM 5242  N N   . SER B 1 299 ? 8.972   17.754  90.804   1.00 10.00 ? ? ? ? ? ? 300 SER B N   1 
ATOM 5243  C CA  . SER B 1 299 ? 10.120  18.006  89.970   1.00 10.00 ? ? ? ? ? ? 300 SER B CA  1 
ATOM 5244  C C   . SER B 1 299 ? 10.126  17.109  88.774   1.00 10.00 ? ? ? ? ? ? 300 SER B C   1 
ATOM 5245  O O   . SER B 1 299 ? 9.391   16.118  88.848   1.00 10.00 ? ? ? ? ? ? 300 SER B O   1 
ATOM 5246  C CB  . SER B 1 299 ? 11.337  17.800  90.761   1.00 10.00 ? ? ? ? ? ? 300 SER B CB  1 
ATOM 5247  O OG  . SER B 1 299 ? 11.654  16.461  91.117   1.00 10.00 ? ? ? ? ? ? 300 SER B OG  1 
ATOM 5248  N N   . GLY B 1 300 ? 10.836  17.329  87.674   1.00 10.00 ? ? ? ? ? ? 301 GLY B N   1 
ATOM 5249  C CA  . GLY B 1 300 ? 10.831  16.397  86.514   1.00 10.00 ? ? ? ? ? ? 301 GLY B CA  1 
ATOM 5250  C C   . GLY B 1 300 ? 10.100  16.952  85.308   1.00 10.00 ? ? ? ? ? ? 301 GLY B C   1 
ATOM 5251  O O   . GLY B 1 300 ? 9.212   17.782  85.536   1.00 10.00 ? ? ? ? ? ? 301 GLY B O   1 
ATOM 5252  N N   . GLY B 1 301 ? 10.391  16.571  84.057   1.00 10.00 ? ? ? ? ? ? 302 GLY B N   1 
ATOM 5253  C CA  . GLY B 1 301 ? 9.694   17.038  82.855   1.00 10.00 ? ? ? ? ? ? 302 GLY B CA  1 
ATOM 5254  C C   . GLY B 1 301 ? 8.183   16.762  82.858   1.00 10.00 ? ? ? ? ? ? 302 GLY B C   1 
ATOM 5255  O O   . GLY B 1 301 ? 7.374   17.647  82.574   1.00 10.00 ? ? ? ? ? ? 302 GLY B O   1 
ATOM 5256  N N   . THR B 1 302 ? 7.674   15.620  83.300   1.00 10.00 ? ? ? ? ? ? 303 THR B N   1 
ATOM 5257  C CA  . THR B 1 302 ? 6.247   15.350  83.273   1.00 10.00 ? ? ? ? ? ? 303 THR B CA  1 
ATOM 5258  C C   . THR B 1 302 ? 5.514   16.223  84.319   1.00 10.00 ? ? ? ? ? ? 303 THR B C   1 
ATOM 5259  O O   . THR B 1 302 ? 4.289   16.123  84.478   1.00 10.00 ? ? ? ? ? ? 303 THR B O   1 
ATOM 5260  C CB  . THR B 1 302 ? 6.132   13.766  83.456   1.00 10.00 ? ? ? ? ? ? 303 THR B CB  1 
ATOM 5261  O OG1 . THR B 1 302 ? 6.693   13.182  82.284   1.00 10.00 ? ? ? ? ? ? 303 THR B OG1 1 
ATOM 5262  C CG2 . THR B 1 302 ? 4.736   13.174  83.533   1.00 10.00 ? ? ? ? ? ? 303 THR B CG2 1 
ATOM 5263  N N   . THR B 1 303 ? 6.149   17.142  85.093   1.00 10.00 ? ? ? ? ? ? 304 THR B N   1 
ATOM 5264  C CA  . THR B 1 303 ? 5.397   17.971  86.062   1.00 10.00 ? ? ? ? ? ? 304 THR B CA  1 
ATOM 5265  C C   . THR B 1 303 ? 5.205   19.354  85.453   1.00 10.00 ? ? ? ? ? ? 304 THR B C   1 
ATOM 5266  O O   . THR B 1 303 ? 4.734   20.305  86.068   1.00 10.00 ? ? ? ? ? ? 304 THR B O   1 
ATOM 5267  C CB  . THR B 1 303 ? 6.109   18.188  87.475   1.00 10.00 ? ? ? ? ? ? 304 THR B CB  1 
ATOM 5268  O OG1 . THR B 1 303 ? 7.284   18.920  87.260   1.00 10.00 ? ? ? ? ? ? 304 THR B OG1 1 
ATOM 5269  C CG2 . THR B 1 303 ? 6.461   16.922  88.182   1.00 10.00 ? ? ? ? ? ? 304 THR B CG2 1 
ATOM 5270  N N   . MET B 1 304 ? 5.571   19.473  84.193   1.00 10.00 ? ? ? ? ? ? 305 MET B N   1 
ATOM 5271  C CA  . MET B 1 304 ? 5.523   20.764  83.570   1.00 10.00 ? ? ? ? ? ? 305 MET B CA  1 
ATOM 5272  C C   . MET B 1 304 ? 4.156   21.157  83.001   1.00 10.00 ? ? ? ? ? ? 305 MET B C   1 
ATOM 5273  O O   . MET B 1 304 ? 3.993   22.256  82.478   1.00 10.00 ? ? ? ? ? ? 305 MET B O   1 
ATOM 5274  C CB  . MET B 1 304 ? 6.614   20.731  82.519   1.00 10.00 ? ? ? ? ? ? 305 MET B CB  1 
ATOM 5275  C CG  . MET B 1 304 ? 7.987   20.645  83.098   1.00 10.00 ? ? ? ? ? ? 305 MET B CG  1 
ATOM 5276  S SD  . MET B 1 304 ? 8.360   22.254  83.804   1.00 10.00 ? ? ? ? ? ? 305 MET B SD  1 
ATOM 5277  C CE  . MET B 1 304 ? 9.205   22.881  82.377   1.00 10.00 ? ? ? ? ? ? 305 MET B CE  1 
ATOM 5278  N N   . TYR B 1 305 ? 3.151   20.300  83.070   1.00 10.00 ? ? ? ? ? ? 306 TYR B N   1 
ATOM 5279  C CA  . TYR B 1 305 ? 1.855   20.540  82.483   1.00 10.00 ? ? ? ? ? ? 306 TYR B CA  1 
ATOM 5280  C C   . TYR B 1 305 ? 1.143   21.698  83.100   1.00 10.00 ? ? ? ? ? ? 306 TYR B C   1 
ATOM 5281  O O   . TYR B 1 305 ? 1.023   21.641  84.324   1.00 10.00 ? ? ? ? ? ? 306 TYR B O   1 
ATOM 5282  C CB  . TYR B 1 305 ? 0.986   19.362  82.675   1.00 10.00 ? ? ? ? ? ? 306 TYR B CB  1 
ATOM 5283  C CG  . TYR B 1 305 ? 1.446   18.171  81.900   1.00 10.00 ? ? ? ? ? ? 306 TYR B CG  1 
ATOM 5284  C CD1 . TYR B 1 305 ? 1.647   18.279  80.534   1.00 10.00 ? ? ? ? ? ? 306 TYR B CD1 1 
ATOM 5285  C CD2 . TYR B 1 305 ? 1.588   16.983  82.523   1.00 10.00 ? ? ? ? ? ? 306 TYR B CD2 1 
ATOM 5286  C CE1 . TYR B 1 305 ? 1.982   17.178  79.764   1.00 10.00 ? ? ? ? ? ? 306 TYR B CE1 1 
ATOM 5287  C CE2 . TYR B 1 305 ? 1.926   15.880  81.769   1.00 10.00 ? ? ? ? ? ? 306 TYR B CE2 1 
ATOM 5288  C CZ  . TYR B 1 305 ? 2.112   15.998  80.411   1.00 10.00 ? ? ? ? ? ? 306 TYR B CZ  1 
ATOM 5289  O OH  . TYR B 1 305 ? 2.433   14.905  79.686   1.00 10.00 ? ? ? ? ? ? 306 TYR B OH  1 
ATOM 5290  N N   . PRO B 1 306 ? 0.606   22.707  82.395   1.00 10.00 ? ? ? ? ? ? 307 PRO B N   1 
ATOM 5291  C CA  . PRO B 1 306 ? -0.327  23.676  82.926   1.00 10.00 ? ? ? ? ? ? 307 PRO B CA  1 
ATOM 5292  C C   . PRO B 1 306 ? -1.482  22.950  83.602   1.00 10.00 ? ? ? ? ? ? 307 PRO B C   1 
ATOM 5293  O O   . PRO B 1 306 ? -1.939  21.891  83.142   1.00 10.00 ? ? ? ? ? ? 307 PRO B O   1 
ATOM 5294  C CB  . PRO B 1 306 ? -0.704  24.496  81.730   1.00 10.00 ? ? ? ? ? ? 307 PRO B CB  1 
ATOM 5295  C CG  . PRO B 1 306 ? 0.602   24.562  81.013   1.00 10.00 ? ? ? ? ? ? 307 PRO B CG  1 
ATOM 5296  C CD  . PRO B 1 306 ? 0.961   23.080  81.027   1.00 10.00 ? ? ? ? ? ? 307 PRO B CD  1 
ATOM 5297  N N   . GLY B 1 307 ? -1.819  23.549  84.775   1.00 10.00 ? ? ? ? ? ? 308 GLY B N   1 
ATOM 5298  C CA  . GLY B 1 307 ? -2.774  23.050  85.748   1.00 10.00 ? ? ? ? ? ? 308 GLY B CA  1 
ATOM 5299  C C   . GLY B 1 307 ? -2.250  22.012  86.752   1.00 10.00 ? ? ? ? ? ? 308 GLY B C   1 
ATOM 5300  O O   . GLY B 1 307 ? -2.972  21.708  87.728   1.00 10.00 ? ? ? ? ? ? 308 GLY B O   1 
ATOM 5301  N N   . ILE B 1 308 ? -1.012  21.466  86.681   1.00 10.00 ? ? ? ? ? ? 309 ILE B N   1 
ATOM 5302  C CA  . ILE B 1 308 ? -0.695  20.354  87.583   1.00 10.00 ? ? ? ? ? ? 309 ILE B CA  1 
ATOM 5303  C C   . ILE B 1 308 ? -0.520  20.772  89.027   1.00 10.00 ? ? ? ? ? ? 309 ILE B C   1 
ATOM 5304  O O   . ILE B 1 308 ? -0.919  19.997  89.906   1.00 10.00 ? ? ? ? ? ? 309 ILE B O   1 
ATOM 5305  C CB  . ILE B 1 308 ? 0.555   19.574  87.081   1.00 10.00 ? ? ? ? ? ? 309 ILE B CB  1 
ATOM 5306  C CG1 . ILE B 1 308 ? 0.340   18.176  87.606   1.00 10.00 ? ? ? ? ? ? 309 ILE B CG1 1 
ATOM 5307  C CG2 . ILE B 1 308 ? 1.886   20.155  87.490   1.00 10.00 ? ? ? ? ? ? 309 ILE B CG2 1 
ATOM 5308  C CD1 . ILE B 1 308 ? 1.265   17.140  86.989   1.00 10.00 ? ? ? ? ? ? 309 ILE B CD1 1 
ATOM 5309  N N   . ALA B 1 309 ? 0.004   21.967  89.320   1.00 10.00 ? ? ? ? ? ? 310 ALA B N   1 
ATOM 5310  C CA  . ALA B 1 309 ? 0.094   22.450  90.700   1.00 10.00 ? ? ? ? ? ? 310 ALA B CA  1 
ATOM 5311  C C   . ALA B 1 309 ? -1.268  22.592  91.316   1.00 10.00 ? ? ? ? ? ? 310 ALA B C   1 
ATOM 5312  O O   . ALA B 1 309 ? -1.484  22.025  92.378   1.00 10.00 ? ? ? ? ? ? 310 ALA B O   1 
ATOM 5313  C CB  . ALA B 1 309 ? 0.762   23.817  90.774   1.00 10.00 ? ? ? ? ? ? 310 ALA B CB  1 
ATOM 5314  N N   . ASP B 1 310 ? -2.183  23.331  90.678   1.00 10.00 ? ? ? ? ? ? 311 ASP B N   1 
ATOM 5315  C CA  . ASP B 1 310 ? -3.578  23.459  91.133   1.00 10.00 ? ? ? ? ? ? 311 ASP B CA  1 
ATOM 5316  C C   . ASP B 1 310 ? -4.312  22.155  91.291   1.00 10.00 ? ? ? ? ? ? 311 ASP B C   1 
ATOM 5317  O O   . ASP B 1 310 ? -5.063  22.005  92.244   1.00 10.00 ? ? ? ? ? ? 311 ASP B O   1 
ATOM 5318  C CB  . ASP B 1 310 ? -4.514  24.190  90.207   1.00 10.00 ? ? ? ? ? ? 311 ASP B CB  1 
ATOM 5319  C CG  . ASP B 1 310 ? -4.107  25.593  89.894   1.00 10.00 ? ? ? ? ? ? 311 ASP B CG  1 
ATOM 5320  O OD1 . ASP B 1 310 ? -4.502  26.466  90.648   1.00 10.00 ? ? ? ? ? ? 311 ASP B OD1 1 
ATOM 5321  O OD2 . ASP B 1 310 ? -3.412  25.800  88.910   1.00 10.00 ? ? ? ? ? ? 311 ASP B OD2 1 
ATOM 5322  N N   . ARG B 1 311 ? -4.192  21.246  90.355   1.00 10.00 ? ? ? ? ? ? 312 ARG B N   1 
ATOM 5323  C CA  . ARG B 1 311 ? -4.899  20.002  90.450   1.00 10.00 ? ? ? ? ? ? 312 ARG B CA  1 
ATOM 5324  C C   . ARG B 1 311 ? -4.259  19.117  91.485   1.00 10.00 ? ? ? ? ? ? 312 ARG B C   1 
ATOM 5325  O O   . ARG B 1 311 ? -4.976  18.327  92.083   1.00 10.00 ? ? ? ? ? ? 312 ARG B O   1 
ATOM 5326  C CB  . ARG B 1 311 ? -4.880  19.365  89.104   1.00 10.00 ? ? ? ? ? ? 312 ARG B CB  1 
ATOM 5327  C CG  . ARG B 1 311 ? -5.409  17.991  89.097   1.00 10.00 ? ? ? ? ? ? 312 ARG B CG  1 
ATOM 5328  C CD  . ARG B 1 311 ? -6.855  18.024  89.420   1.00 10.00 ? ? ? ? ? ? 312 ARG B CD  1 
ATOM 5329  N NE  . ARG B 1 311 ? -7.244  16.647  89.477   1.00 10.00 ? ? ? ? ? ? 312 ARG B NE  1 
ATOM 5330  C CZ  . ARG B 1 311 ? -7.491  15.983  88.366   1.00 10.00 ? ? ? ? ? ? 312 ARG B CZ  1 
ATOM 5331  N NH1 . ARG B 1 311 ? -7.385  16.635  87.225   1.00 10.00 ? ? ? ? ? ? 312 ARG B NH1 1 
ATOM 5332  N NH2 . ARG B 1 311 ? -7.698  14.654  88.374   1.00 10.00 ? ? ? ? ? ? 312 ARG B NH2 1 
ATOM 5333  N N   . MET B 1 312 ? -2.948  19.143  91.694   1.00 10.00 ? ? ? ? ? ? 313 MET B N   1 
ATOM 5334  C CA  . MET B 1 312 ? -2.313  18.394  92.751   1.00 10.00 ? ? ? ? ? ? 313 MET B CA  1 
ATOM 5335  C C   . MET B 1 312 ? -2.845  18.981  94.054   1.00 10.00 ? ? ? ? ? ? 313 MET B C   1 
ATOM 5336  O O   . MET B 1 312 ? -3.413  18.229  94.833   1.00 10.00 ? ? ? ? ? ? 313 MET B O   1 
ATOM 5337  C CB  . MET B 1 312 ? -0.796  18.544  92.609   1.00 10.00 ? ? ? ? ? ? 313 MET B CB  1 
ATOM 5338  C CG  . MET B 1 312 ? -0.335  17.329  91.866   1.00 10.00 ? ? ? ? ? ? 313 MET B CG  1 
ATOM 5339  S SD  . MET B 1 312 ? -0.489  15.939  93.027   1.00 10.00 ? ? ? ? ? ? 313 MET B SD  1 
ATOM 5340  C CE  . MET B 1 312 ? 1.236   15.512  93.115   1.00 10.00 ? ? ? ? ? ? 313 MET B CE  1 
ATOM 5341  N N   . GLN B 1 313 ? -2.797  20.286  94.302   1.00 10.00 ? ? ? ? ? ? 314 GLN B N   1 
ATOM 5342  C CA  . GLN B 1 313 ? -3.358  20.950  95.469   1.00 10.00 ? ? ? ? ? ? 314 GLN B CA  1 
ATOM 5343  C C   . GLN B 1 313 ? -4.787  20.532  95.705   1.00 10.00 ? ? ? ? ? ? 314 GLN B C   1 
ATOM 5344  O O   . GLN B 1 313 ? -4.982  19.848  96.705   1.00 10.00 ? ? ? ? ? ? 314 GLN B O   1 
ATOM 5345  C CB  . GLN B 1 313 ? -3.238  22.441  95.246   1.00 10.00 ? ? ? ? ? ? 314 GLN B CB  1 
ATOM 5346  C CG  . GLN B 1 313 ? -4.072  23.383  96.051   1.00 10.00 ? ? ? ? ? ? 314 GLN B CG  1 
ATOM 5347  C CD  . GLN B 1 313 ? -3.804  23.516  97.530   1.00 10.00 ? ? ? ? ? ? 314 GLN B CD  1 
ATOM 5348  O OE1 . GLN B 1 313 ? -4.744  23.534  98.342   1.00 10.00 ? ? ? ? ? ? 314 GLN B OE1 1 
ATOM 5349  N NE2 . GLN B 1 313 ? -2.527  23.690  97.873   1.00 10.00 ? ? ? ? ? ? 314 GLN B NE2 1 
ATOM 5350  N N   . LYS B 1 314 ? -5.754  20.792  94.821   1.00 10.00 ? ? ? ? ? ? 315 LYS B N   1 
ATOM 5351  C CA  . LYS B 1 314 ? -7.145  20.375  94.915   1.00 10.00 ? ? ? ? ? ? 315 LYS B CA  1 
ATOM 5352  C C   . LYS B 1 314 ? -7.297  18.940  95.381   1.00 10.00 ? ? ? ? ? ? 315 LYS B C   1 
ATOM 5353  O O   . LYS B 1 314 ? -8.121  18.613  96.243   1.00 10.00 ? ? ? ? ? ? 315 LYS B O   1 
ATOM 5354  C CB  . LYS B 1 314 ? -7.690  20.624  93.524   1.00 10.00 ? ? ? ? ? ? 315 LYS B CB  1 
ATOM 5355  C CG  . LYS B 1 314 ? -9.122  20.410  93.052   1.00 10.00 ? ? ? ? ? ? 315 LYS B CG  1 
ATOM 5356  C CD  . LYS B 1 314 ? -9.503  18.984  92.700   1.00 10.00 ? ? ? ? ? ? 315 LYS B CD  1 
ATOM 5357  C CE  . LYS B 1 314 ? -10.839 18.927  91.975   1.00 10.00 ? ? ? ? ? ? 315 LYS B CE  1 
ATOM 5358  N NZ  . LYS B 1 314 ? -10.762 17.807  91.047   1.00 10.00 ? ? ? ? ? ? 315 LYS B NZ  1 
ATOM 5359  N N   . GLU B 1 315 ? -6.443  18.052  94.896   1.00 10.00 ? ? ? ? ? ? 316 GLU B N   1 
ATOM 5360  C CA  . GLU B 1 315 ? -6.594  16.641  95.212   1.00 10.00 ? ? ? ? ? ? 316 GLU B CA  1 
ATOM 5361  C C   . GLU B 1 315 ? -5.989  16.198  96.521   1.00 10.00 ? ? ? ? ? ? 316 GLU B C   1 
ATOM 5362  O O   . GLU B 1 315 ? -6.506  15.280  97.168   1.00 10.00 ? ? ? ? ? ? 316 GLU B O   1 
ATOM 5363  C CB  . GLU B 1 315 ? -6.011  15.819  94.072   1.00 10.00 ? ? ? ? ? ? 316 GLU B CB  1 
ATOM 5364  C CG  . GLU B 1 315 ? -6.704  16.059  92.752   1.00 10.00 ? ? ? ? ? ? 316 GLU B CG  1 
ATOM 5365  C CD  . GLU B 1 315 ? -8.100  15.469  92.576   1.00 10.00 ? ? ? ? ? ? 316 GLU B CD  1 
ATOM 5366  O OE1 . GLU B 1 315 ? -8.884  15.309  93.512   1.00 10.00 ? ? ? ? ? ? 316 GLU B OE1 1 
ATOM 5367  O OE2 . GLU B 1 315 ? -8.412  15.136  91.443   1.00 10.00 ? ? ? ? ? ? 316 GLU B OE2 1 
ATOM 5368  N N   . ILE B 1 316 ? -4.886  16.817  96.926   1.00 10.00 ? ? ? ? ? ? 317 ILE B N   1 
ATOM 5369  C CA  . ILE B 1 316 ? -4.298  16.454  98.193   1.00 10.00 ? ? ? ? ? ? 317 ILE B CA  1 
ATOM 5370  C C   . ILE B 1 316 ? -5.135  17.115  99.254   1.00 10.00 ? ? ? ? ? ? 317 ILE B C   1 
ATOM 5371  O O   . ILE B 1 316 ? -5.384  16.507  100.298  1.00 10.00 ? ? ? ? ? ? 317 ILE B O   1 
ATOM 5372  C CB  . ILE B 1 316 ? -2.858  16.904  98.205   1.00 10.00 ? ? ? ? ? ? 317 ILE B CB  1 
ATOM 5373  C CG1 . ILE B 1 316 ? -2.053  15.884  97.395   1.00 10.00 ? ? ? ? ? ? 317 ILE B CG1 1 
ATOM 5374  C CG2 . ILE B 1 316 ? -2.299  16.900  99.600   1.00 10.00 ? ? ? ? ? ? 317 ILE B CG2 1 
ATOM 5375  C CD1 . ILE B 1 316 ? -0.645  16.308  96.976   1.00 10.00 ? ? ? ? ? ? 317 ILE B CD1 1 
ATOM 5376  N N   . THR B 1 317 ? -5.638  18.318  99.004   1.00 10.00 ? ? ? ? ? ? 318 THR B N   1 
ATOM 5377  C CA  . THR B 1 317 ? -6.594  18.942  99.894   1.00 10.00 ? ? ? ? ? ? 318 THR B CA  1 
ATOM 5378  C C   . THR B 1 317 ? -7.845  18.116  100.151  1.00 10.00 ? ? ? ? ? ? 318 THR B C   1 
ATOM 5379  O O   . THR B 1 317 ? -8.442  18.228  101.219  1.00 10.00 ? ? ? ? ? ? 318 THR B O   1 
ATOM 5380  C CB  . THR B 1 317 ? -6.946  20.294  99.305   1.00 10.00 ? ? ? ? ? ? 318 THR B CB  1 
ATOM 5381  O OG1 . THR B 1 317 ? -5.702  20.985  99.093   1.00 10.00 ? ? ? ? ? ? 318 THR B OG1 1 
ATOM 5382  C CG2 . THR B 1 317 ? -7.846  21.090  100.228  1.00 10.00 ? ? ? ? ? ? 318 THR B CG2 1 
ATOM 5383  N N   . ALA B 1 318 ? -8.313  17.284  99.222   1.00 10.00 ? ? ? ? ? ? 319 ALA B N   1 
ATOM 5384  C CA  . ALA B 1 318 ? -9.458  16.430  99.506   1.00 10.00 ? ? ? ? ? ? 319 ALA B CA  1 
ATOM 5385  C C   . ALA B 1 318 ? -9.087  15.234  100.389  1.00 10.00 ? ? ? ? ? ? 319 ALA B C   1 
ATOM 5386  O O   . ALA B 1 318 ? -9.849  14.910  101.307  1.00 10.00 ? ? ? ? ? ? 319 ALA B O   1 
ATOM 5387  C CB  . ALA B 1 318 ? -10.026 15.918  98.222   1.00 10.00 ? ? ? ? ? ? 319 ALA B CB  1 
ATOM 5388  N N   . LEU B 1 319 ? -7.960  14.527  100.173  1.00 10.00 ? ? ? ? ? ? 320 LEU B N   1 
ATOM 5389  C CA  . LEU B 1 319 ? -7.596  13.407  101.052  1.00 10.00 ? ? ? ? ? ? 320 LEU B CA  1 
ATOM 5390  C C   . LEU B 1 319 ? -7.057  13.794  102.461  1.00 10.00 ? ? ? ? ? ? 320 LEU B C   1 
ATOM 5391  O O   . LEU B 1 319 ? -7.157  13.040  103.439  1.00 10.00 ? ? ? ? ? ? 320 LEU B O   1 
ATOM 5392  C CB  . LEU B 1 319 ? -6.565  12.602  100.342  1.00 10.00 ? ? ? ? ? ? 320 LEU B CB  1 
ATOM 5393  C CG  . LEU B 1 319 ? -6.928  12.021  99.002   1.00 10.00 ? ? ? ? ? ? 320 LEU B CG  1 
ATOM 5394  C CD1 . LEU B 1 319 ? -5.822  12.236  97.987   1.00 10.00 ? ? ? ? ? ? 320 LEU B CD1 1 
ATOM 5395  C CD2 . LEU B 1 319 ? -7.176  10.539  99.179   1.00 10.00 ? ? ? ? ? ? 320 LEU B CD2 1 
ATOM 5396  N N   . ALA B 1 320 ? -6.435  14.980  102.572  1.00 10.00 ? ? ? ? ? ? 321 ALA B N   1 
ATOM 5397  C CA  . ALA B 1 320 ? -5.707  15.398  103.755  1.00 10.00 ? ? ? ? ? ? 321 ALA B CA  1 
ATOM 5398  C C   . ALA B 1 320 ? -6.641  15.737  104.884  1.00 10.00 ? ? ? ? ? ? 321 ALA B C   1 
ATOM 5399  O O   . ALA B 1 320 ? -7.701  16.322  104.581  1.00 10.00 ? ? ? ? ? ? 321 ALA B O   1 
ATOM 5400  C CB  . ALA B 1 320 ? -4.925  16.637  103.486  1.00 10.00 ? ? ? ? ? ? 321 ALA B CB  1 
ATOM 5401  N N   . PRO B 1 321 ? -6.310  15.488  106.188  1.00 10.00 ? ? ? ? ? ? 322 PRO B N   1 
ATOM 5402  C CA  . PRO B 1 321 ? -7.124  15.944  107.343  1.00 10.00 ? ? ? ? ? ? 322 PRO B CA  1 
ATOM 5403  C C   . PRO B 1 321 ? -7.585  17.405  107.142  1.00 10.00 ? ? ? ? ? ? 322 PRO B C   1 
ATOM 5404  O O   . PRO B 1 321 ? -6.848  18.266  106.613  1.00 10.00 ? ? ? ? ? ? 322 PRO B O   1 
ATOM 5405  C CB  . PRO B 1 321 ? -6.206  15.737  108.523  1.00 10.00 ? ? ? ? ? ? 322 PRO B CB  1 
ATOM 5406  C CG  . PRO B 1 321 ? -5.390  14.526  108.099  1.00 10.00 ? ? ? ? ? ? 322 PRO B CG  1 
ATOM 5407  C CD  . PRO B 1 321 ? -5.090  14.813  106.632  1.00 10.00 ? ? ? ? ? ? 322 PRO B CD  1 
ATOM 5408  N N   . SER B 1 322 ? -8.792  17.715  107.629  1.00 10.00 ? ? ? ? ? ? 323 SER B N   1 
ATOM 5409  C CA  . SER B 1 322 ? -9.473  18.979  107.293  1.00 10.00 ? ? ? ? ? ? 323 SER B CA  1 
ATOM 5410  C C   . SER B 1 322 ? -8.837  20.330  107.708  1.00 10.00 ? ? ? ? ? ? 323 SER B C   1 
ATOM 5411  O O   . SER B 1 322 ? -9.358  21.433  107.507  1.00 10.00 ? ? ? ? ? ? 323 SER B O   1 
ATOM 5412  C CB  . SER B 1 322 ? -10.926 18.734  107.835  1.00 10.00 ? ? ? ? ? ? 323 SER B CB  1 
ATOM 5413  O OG  . SER B 1 322 ? -11.442 17.424  107.446  1.00 10.00 ? ? ? ? ? ? 323 SER B OG  1 
ATOM 5414  N N   . THR B 1 323 ? -7.623  20.227  108.218  1.00 10.00 ? ? ? ? ? ? 324 THR B N   1 
ATOM 5415  C CA  . THR B 1 323 ? -6.891  21.317  108.768  1.00 10.00 ? ? ? ? ? ? 324 THR B CA  1 
ATOM 5416  C C   . THR B 1 323 ? -5.538  21.517  108.140  1.00 10.00 ? ? ? ? ? ? 324 THR B C   1 
ATOM 5417  O O   . THR B 1 323 ? -5.062  22.653  108.254  1.00 10.00 ? ? ? ? ? ? 324 THR B O   1 
ATOM 5418  C CB  . THR B 1 323 ? -6.694  21.087  110.270  1.00 10.00 ? ? ? ? ? ? 324 THR B CB  1 
ATOM 5419  O OG1 . THR B 1 323 ? -7.028  19.715  110.554  1.00 10.00 ? ? ? ? ? ? 324 THR B OG1 1 
ATOM 5420  C CG2 . THR B 1 323 ? -7.520  22.084  111.094  1.00 10.00 ? ? ? ? ? ? 324 THR B CG2 1 
ATOM 5421  N N   . MET B 1 324 ? -4.923  20.521  107.459  1.00 10.00 ? ? ? ? ? ? 325 MET B N   1 
ATOM 5422  C CA  . MET B 1 324 ? -3.519  20.634  107.070  1.00 10.00 ? ? ? ? ? ? 325 MET B CA  1 
ATOM 5423  C C   . MET B 1 324 ? -3.282  21.846  106.206  1.00 10.00 ? ? ? ? ? ? 325 MET B C   1 
ATOM 5424  O O   . MET B 1 324 ? -4.128  22.104  105.366  1.00 10.00 ? ? ? ? ? ? 325 MET B O   1 
ATOM 5425  C CB  . MET B 1 324 ? -3.070  19.460  106.291  1.00 10.00 ? ? ? ? ? ? 325 MET B CB  1 
ATOM 5426  C CG  . MET B 1 324 ? -3.242  18.192  107.043  1.00 10.00 ? ? ? ? ? ? 325 MET B CG  1 
ATOM 5427  S SD  . MET B 1 324 ? -2.028  18.038  108.380  1.00 10.00 ? ? ? ? ? ? 325 MET B SD  1 
ATOM 5428  C CE  . MET B 1 324 ? -3.084  17.480  109.695  1.00 10.00 ? ? ? ? ? ? 325 MET B CE  1 
ATOM 5429  N N   . LYS B 1 325 ? -2.246  22.658  106.373  1.00 10.00 ? ? ? ? ? ? 326 LYS B N   1 
ATOM 5430  C CA  . LYS B 1 325 ? -1.964  23.753  105.467  1.00 10.00 ? ? ? ? ? ? 326 LYS B CA  1 
ATOM 5431  C C   . LYS B 1 325 ? -1.321  22.938  104.375  1.00 10.00 ? ? ? ? ? ? 326 LYS B C   1 
ATOM 5432  O O   . LYS B 1 325 ? -0.435  22.188  104.747  1.00 10.00 ? ? ? ? ? ? 326 LYS B O   1 
ATOM 5433  C CB  . LYS B 1 325 ? -0.929  24.711  106.029  1.00 10.00 ? ? ? ? ? ? 326 LYS B CB  1 
ATOM 5434  C CG  . LYS B 1 325 ? -0.670  25.890  105.108  1.00 10.00 ? ? ? ? ? ? 326 LYS B CG  1 
ATOM 5435  C CD  . LYS B 1 325 ? 0.045   27.006  105.867  1.00 10.00 ? ? ? ? ? ? 326 LYS B CD  1 
ATOM 5436  C CE  . LYS B 1 325 ? 1.565   26.831  106.044  1.00 10.00 ? ? ? ? ? ? 326 LYS B CE  1 
ATOM 5437  N NZ  . LYS B 1 325 ? 2.250   26.978  104.769  1.00 10.00 ? ? ? ? ? ? 326 LYS B NZ  1 
ATOM 5438  N N   . ILE B 1 326 ? -1.738  22.957  103.107  1.00 10.00 ? ? ? ? ? ? 327 ILE B N   1 
ATOM 5439  C CA  . ILE B 1 326 ? -1.092  22.166  102.094  1.00 10.00 ? ? ? ? ? ? 327 ILE B CA  1 
ATOM 5440  C C   . ILE B 1 326 ? -0.482  23.134  101.108  1.00 10.00 ? ? ? ? ? ? 327 ILE B C   1 
ATOM 5441  O O   . ILE B 1 326 ? -1.154  23.968  100.508  1.00 10.00 ? ? ? ? ? ? 327 ILE B O   1 
ATOM 5442  C CB  . ILE B 1 326 ? -2.122  21.251  101.448  1.00 10.00 ? ? ? ? ? ? 327 ILE B CB  1 
ATOM 5443  C CG1 . ILE B 1 326 ? -2.598  20.250  102.457  1.00 10.00 ? ? ? ? ? ? 327 ILE B CG1 1 
ATOM 5444  C CG2 . ILE B 1 326 ? -1.503  20.413  100.356  1.00 10.00 ? ? ? ? ? ? 327 ILE B CG2 1 
ATOM 5445  C CD1 . ILE B 1 326 ? -3.617  19.305  101.881  1.00 10.00 ? ? ? ? ? ? 327 ILE B CD1 1 
ATOM 5446  N N   . LYS B 1 327 ? 0.816   23.063  100.903  1.00 10.00 ? ? ? ? ? ? 328 LYS B N   1 
ATOM 5447  C CA  . LYS B 1 327 ? 1.498   24.037  100.086  1.00 10.00 ? ? ? ? ? ? 328 LYS B CA  1 
ATOM 5448  C C   . LYS B 1 327 ? 2.202   23.161  99.074   1.00 10.00 ? ? ? ? ? ? 328 LYS B C   1 
ATOM 5449  O O   . LYS B 1 327 ? 3.028   22.324  99.428   1.00 10.00 ? ? ? ? ? ? 328 LYS B O   1 
ATOM 5450  C CB  . LYS B 1 327 ? 2.372   24.784  101.071  1.00 10.00 ? ? ? ? ? ? 328 LYS B CB  1 
ATOM 5451  C CG  . LYS B 1 327 ? 3.140   26.014  100.632  1.00 10.00 ? ? ? ? ? ? 328 LYS B CG  1 
ATOM 5452  C CD  . LYS B 1 327 ? 3.455   26.709  101.938  1.00 10.00 ? ? ? ? ? ? 328 LYS B CD  1 
ATOM 5453  C CE  . LYS B 1 327 ? 3.698   28.197  101.859  1.00 10.00 ? ? ? ? ? ? 328 LYS B CE  1 
ATOM 5454  N NZ  . LYS B 1 327 ? 4.896   28.524  101.096  1.00 10.00 ? ? ? ? ? ? 328 LYS B NZ  1 
ATOM 5455  N N   . ILE B 1 328 ? 1.728   23.197  97.837   1.00 10.00 ? ? ? ? ? ? 329 ILE B N   1 
ATOM 5456  C CA  . ILE B 1 328 ? 2.301   22.412  96.744   1.00 10.00 ? ? ? ? ? ? 329 ILE B CA  1 
ATOM 5457  C C   . ILE B 1 328 ? 3.366   23.382  96.209   1.00 10.00 ? ? ? ? ? ? 329 ILE B C   1 
ATOM 5458  O O   . ILE B 1 328 ? 3.029   24.571  96.224   1.00 10.00 ? ? ? ? ? ? 329 ILE B O   1 
ATOM 5459  C CB  . ILE B 1 328 ? 1.150   22.074  95.754   1.00 10.00 ? ? ? ? ? ? 329 ILE B CB  1 
ATOM 5460  C CG1 . ILE B 1 328 ? 0.711   20.683  95.986   1.00 10.00 ? ? ? ? ? ? 329 ILE B CG1 1 
ATOM 5461  C CG2 . ILE B 1 328 ? 1.610   21.973  94.310   1.00 10.00 ? ? ? ? ? ? 329 ILE B CG2 1 
ATOM 5462  C CD1 . ILE B 1 328 ? 0.106   20.341  97.321   1.00 10.00 ? ? ? ? ? ? 329 ILE B CD1 1 
ATOM 5463  N N   . ILE B 1 329 ? 4.605   23.039  95.774   1.00 10.00 ? ? ? ? ? ? 330 ILE B N   1 
ATOM 5464  C CA  . ILE B 1 329 ? 5.628   24.022  95.411   1.00 10.00 ? ? ? ? ? ? 330 ILE B CA  1 
ATOM 5465  C C   . ILE B 1 329 ? 5.961   23.602  94.008   1.00 10.00 ? ? ? ? ? ? 330 ILE B C   1 
ATOM 5466  O O   . ILE B 1 329 ? 6.140   22.403  93.766   1.00 10.00 ? ? ? ? ? ? 330 ILE B O   1 
ATOM 5467  C CB  . ILE B 1 329 ? 6.925   23.931  96.316   1.00 10.00 ? ? ? ? ? ? 330 ILE B CB  1 
ATOM 5468  C CG1 . ILE B 1 329 ? 6.754   24.615  97.668   1.00 10.00 ? ? ? ? ? ? 330 ILE B CG1 1 
ATOM 5469  C CG2 . ILE B 1 329 ? 8.093   24.629  95.603   1.00 10.00 ? ? ? ? ? ? 330 ILE B CG2 1 
ATOM 5470  C CD1 . ILE B 1 329 ? 6.182   23.734  98.759   1.00 10.00 ? ? ? ? ? ? 330 ILE B CD1 1 
ATOM 5471  N N   . ALA B 1 330 ? 6.054   24.522  93.071   1.00 10.00 ? ? ? ? ? ? 331 ALA B N   1 
ATOM 5472  C CA  . ALA B 1 330 ? 6.302   24.096  91.719   1.00 10.00 ? ? ? ? ? ? 331 ALA B CA  1 
ATOM 5473  C C   . ALA B 1 330 ? 7.100   25.224  91.128   1.00 10.00 ? ? ? ? ? ? 331 ALA B C   1 
ATOM 5474  O O   . ALA B 1 330 ? 6.575   26.141  90.455   1.00 10.00 ? ? ? ? ? ? 331 ALA B O   1 
ATOM 5475  C CB  . ALA B 1 330 ? 5.018   23.910  90.930   1.00 10.00 ? ? ? ? ? ? 331 ALA B CB  1 
ATOM 5476  N N   . PRO B 1 331 ? 8.423   25.186  91.472   1.00 10.00 ? ? ? ? ? ? 332 PRO B N   1 
ATOM 5477  C CA  . PRO B 1 331 ? 9.367   26.200  91.049   1.00 10.00 ? ? ? ? ? ? 332 PRO B CA  1 
ATOM 5478  C C   . PRO B 1 331 ? 9.394   26.158  89.530   1.00 10.00 ? ? ? ? ? ? 332 PRO B C   1 
ATOM 5479  O O   . PRO B 1 331 ? 9.451   25.086  88.930   1.00 10.00 ? ? ? ? ? ? 332 PRO B O   1 
ATOM 5480  C CB  . PRO B 1 331 ? 10.659  25.806  91.728   1.00 10.00 ? ? ? ? ? ? 332 PRO B CB  1 
ATOM 5481  C CG  . PRO B 1 331 ? 10.591  24.314  91.789   1.00 10.00 ? ? ? ? ? ? 332 PRO B CG  1 
ATOM 5482  C CD  . PRO B 1 331 ? 9.142   24.082  92.125   1.00 10.00 ? ? ? ? ? ? 332 PRO B CD  1 
ATOM 5483  N N   . PRO B 1 332 ? 9.390   27.290  88.853   1.00 10.00 ? ? ? ? ? ? 333 PRO B N   1 
ATOM 5484  C CA  . PRO B 1 332 ? 9.331   27.321  87.420   1.00 10.00 ? ? ? ? ? ? 333 PRO B CA  1 
ATOM 5485  C C   . PRO B 1 332 ? 10.557  26.697  86.762   1.00 10.00 ? ? ? ? ? ? 333 PRO B C   1 
ATOM 5486  O O   . PRO B 1 332 ? 10.519  26.512  85.549   1.00 10.00 ? ? ? ? ? ? 333 PRO B O   1 
ATOM 5487  C CB  . PRO B 1 332 ? 9.099   28.805  87.135   1.00 10.00 ? ? ? ? ? ? 333 PRO B CB  1 
ATOM 5488  C CG  . PRO B 1 332 ? 9.735   29.568  88.276   1.00 10.00 ? ? ? ? ? ? 333 PRO B CG  1 
ATOM 5489  C CD  . PRO B 1 332 ? 9.379   28.634  89.431   1.00 10.00 ? ? ? ? ? ? 333 PRO B CD  1 
ATOM 5490  N N   . GLU B 1 333 ? 11.638  26.296  87.461   1.00 10.00 ? ? ? ? ? ? 334 GLU B N   1 
ATOM 5491  C CA  . GLU B 1 333 ? 12.773  25.714  86.774   1.00 10.00 ? ? ? ? ? ? 334 GLU B CA  1 
ATOM 5492  C C   . GLU B 1 333 ? 12.924  24.255  87.010   1.00 10.00 ? ? ? ? ? ? 334 GLU B C   1 
ATOM 5493  O O   . GLU B 1 333 ? 13.997  23.687  86.817   1.00 10.00 ? ? ? ? ? ? 334 GLU B O   1 
ATOM 5494  C CB  . GLU B 1 333 ? 14.074  26.386  87.184   1.00 10.00 ? ? ? ? ? ? 334 GLU B CB  1 
ATOM 5495  C CG  . GLU B 1 333 ? 14.356  27.782  86.574   1.00 10.00 ? ? ? ? ? ? 334 GLU B CG  1 
ATOM 5496  C CD  . GLU B 1 333 ? 13.513  28.945  87.106   1.00 10.00 ? ? ? ? ? ? 334 GLU B CD  1 
ATOM 5497  O OE1 . GLU B 1 333 ? 12.855  28.821  88.156   1.00 10.00 ? ? ? ? ? ? 334 GLU B OE1 1 
ATOM 5498  O OE2 . GLU B 1 333 ? 13.542  29.995  86.449   1.00 10.00 ? ? ? ? ? ? 334 GLU B OE2 1 
ATOM 5499  N N   . ARG B 1 334 ? 11.788  23.655  87.331   1.00 10.00 ? ? ? ? ? ? 335 ARG B N   1 
ATOM 5500  C CA  . ARG B 1 334 ? 11.657  22.260  87.739   1.00 10.00 ? ? ? ? ? ? 335 ARG B CA  1 
ATOM 5501  C C   . ARG B 1 334 ? 11.906  21.095  86.781   1.00 10.00 ? ? ? ? ? ? 335 ARG B C   1 
ATOM 5502  O O   . ARG B 1 334 ? 12.003  19.946  87.238   1.00 10.00 ? ? ? ? ? ? 335 ARG B O   1 
ATOM 5503  C CB  . ARG B 1 334 ? 10.273  22.131  88.369   1.00 10.00 ? ? ? ? ? ? 335 ARG B CB  1 
ATOM 5504  C CG  . ARG B 1 334 ? 9.192   21.451  87.592   1.00 10.00 ? ? ? ? ? ? 335 ARG B CG  1 
ATOM 5505  C CD  . ARG B 1 334 ? 7.860   21.852  88.151   1.00 10.00 ? ? ? ? ? ? 335 ARG B CD  1 
ATOM 5506  N NE  . ARG B 1 334 ? 7.579   23.183  87.664   1.00 10.00 ? ? ? ? ? ? 335 ARG B NE  1 
ATOM 5507  C CZ  . ARG B 1 334 ? 6.389   23.475  87.210   1.00 10.00 ? ? ? ? ? ? 335 ARG B CZ  1 
ATOM 5508  N NH1 . ARG B 1 334 ? 5.407   22.586  87.169   1.00 10.00 ? ? ? ? ? ? 335 ARG B NH1 1 
ATOM 5509  N NH2 . ARG B 1 334 ? 6.180   24.697  86.780   1.00 10.00 ? ? ? ? ? ? 335 ARG B NH2 1 
ATOM 5510  N N   . LYS B 1 335 ? 13.721  23.747  85.524   1.00 10.00 ? ? ? ? ? ? 336 LYS B N   1 
ATOM 5511  C CA  . LYS B 1 335 ? 13.879  22.973  84.285   1.00 10.00 ? ? ? ? ? ? 336 LYS B CA  1 
ATOM 5512  C C   . LYS B 1 335 ? 15.199  22.201  84.515   1.00 10.00 ? ? ? ? ? ? 336 LYS B C   1 
ATOM 5513  O O   . LYS B 1 335 ? 15.368  21.075  84.077   1.00 10.00 ? ? ? ? ? ? 336 LYS B O   1 
ATOM 5514  C CB  . LYS B 1 335 ? 13.962  23.985  83.094   1.00 10.00 ? ? ? ? ? ? 336 LYS B CB  1 
ATOM 5515  C CG  . LYS B 1 335 ? 13.648  23.620  81.624   1.00 10.00 ? ? ? ? ? ? 336 LYS B CG  1 
ATOM 5516  C CD  . LYS B 1 335 ? 14.755  22.888  80.827   1.00 10.00 ? ? ? ? ? ? 336 LYS B CD  1 
ATOM 5517  C CE  . LYS B 1 335 ? 14.579  21.358  80.554   1.00 10.00 ? ? ? ? ? ? 336 LYS B CE  1 
ATOM 5518  N NZ  . LYS B 1 335 ? 15.787  20.761  80.010   1.00 10.00 ? ? ? ? ? ? 336 LYS B NZ  1 
ATOM 5519  N N   . TYR B 1 336 ? 16.176  22.737  85.271   1.00 10.00 ? ? ? ? ? ? 337 TYR B N   1 
ATOM 5520  C CA  . TYR B 1 336 ? 17.443  22.077  85.551   1.00 10.00 ? ? ? ? ? ? 337 TYR B CA  1 
ATOM 5521  C C   . TYR B 1 336 ? 17.701  21.441  86.937   1.00 10.00 ? ? ? ? ? ? 337 TYR B C   1 
ATOM 5522  O O   . TYR B 1 336 ? 18.823  20.997  87.225   1.00 10.00 ? ? ? ? ? ? 337 TYR B O   1 
ATOM 5523  C CB  . TYR B 1 336 ? 18.485  23.136  85.169   1.00 10.00 ? ? ? ? ? ? 337 TYR B CB  1 
ATOM 5524  C CG  . TYR B 1 336 ? 18.601  23.205  83.673   1.00 10.00 ? ? ? ? ? ? 337 TYR B CG  1 
ATOM 5525  C CD1 . TYR B 1 336 ? 18.387  22.054  82.961   1.00 10.00 ? ? ? ? ? ? 337 TYR B CD1 1 
ATOM 5526  C CD2 . TYR B 1 336 ? 18.806  24.379  83.018   1.00 10.00 ? ? ? ? ? ? 337 TYR B CD2 1 
ATOM 5527  C CE1 . TYR B 1 336 ? 18.344  22.045  81.592   1.00 10.00 ? ? ? ? ? ? 337 TYR B CE1 1 
ATOM 5528  C CE2 . TYR B 1 336 ? 18.770  24.388  81.638   1.00 10.00 ? ? ? ? ? ? 337 TYR B CE2 1 
ATOM 5529  C CZ  . TYR B 1 336 ? 18.527  23.223  80.949   1.00 10.00 ? ? ? ? ? ? 337 TYR B CZ  1 
ATOM 5530  O OH  . TYR B 1 336 ? 18.386  23.186  79.587   1.00 10.00 ? ? ? ? ? ? 337 TYR B OH  1 
ATOM 5531  N N   . SER B 1 337 ? 16.699  21.338  87.826   1.00 10.00 ? ? ? ? ? ? 338 SER B N   1 
ATOM 5532  C CA  . SER B 1 337 ? 16.802  20.743  89.163   1.00 10.00 ? ? ? ? ? ? 338 SER B CA  1 
ATOM 5533  C C   . SER B 1 337 ? 17.529  19.406  89.190   1.00 10.00 ? ? ? ? ? ? 338 SER B C   1 
ATOM 5534  O O   . SER B 1 337 ? 18.548  19.323  89.864   1.00 10.00 ? ? ? ? ? ? 338 SER B O   1 
ATOM 5535  C CB  . SER B 1 337 ? 15.423  20.516  89.794   1.00 10.00 ? ? ? ? ? ? 338 SER B CB  1 
ATOM 5536  O OG  . SER B 1 337 ? 14.838  21.778  90.060   1.00 10.00 ? ? ? ? ? ? 338 SER B OG  1 
ATOM 5537  N N   . VAL B 1 338 ? 17.152  18.391  88.448   1.00 10.00 ? ? ? ? ? ? 339 VAL B N   1 
ATOM 5538  C CA  . VAL B 1 338 ? 17.841  17.144  88.552   1.00 10.00 ? ? ? ? ? ? 339 VAL B CA  1 
ATOM 5539  C C   . VAL B 1 338 ? 19.347  17.313  88.278   1.00 10.00 ? ? ? ? ? ? 339 VAL B C   1 
ATOM 5540  O O   . VAL B 1 338 ? 20.168  16.882  89.090   1.00 10.00 ? ? ? ? ? ? 339 VAL B O   1 
ATOM 5541  C CB  . VAL B 1 338 ? 17.135  16.209  87.588   1.00 10.00 ? ? ? ? ? ? 339 VAL B CB  1 
ATOM 5542  C CG1 . VAL B 1 338 ? 17.860  14.860  87.531   1.00 10.00 ? ? ? ? ? ? 339 VAL B CG1 1 
ATOM 5543  C CG2 . VAL B 1 338 ? 15.683  16.038  88.052   1.00 10.00 ? ? ? ? ? ? 339 VAL B CG2 1 
ATOM 5544  N N   . TRP B 1 339 ? 19.793  18.092  87.298   1.00 10.00 ? ? ? ? ? ? 340 TRP B N   1 
ATOM 5545  C CA  . TRP B 1 339 ? 21.202  18.207  87.057   1.00 10.00 ? ? ? ? ? ? 340 TRP B CA  1 
ATOM 5546  C C   . TRP B 1 339 ? 21.863  19.011  88.177   1.00 10.00 ? ? ? ? ? ? 340 TRP B C   1 
ATOM 5547  O O   . TRP B 1 339 ? 22.926  18.573  88.628   1.00 10.00 ? ? ? ? ? ? 340 TRP B O   1 
ATOM 5548  C CB  . TRP B 1 339 ? 21.442  18.857  85.689   1.00 10.00 ? ? ? ? ? ? 340 TRP B CB  1 
ATOM 5549  C CG  . TRP B 1 339 ? 22.893  18.746  85.287   1.00 10.00 ? ? ? ? ? ? 340 TRP B CG  1 
ATOM 5550  C CD1 . TRP B 1 339 ? 23.400  17.674  84.602   1.00 10.00 ? ? ? ? ? ? 340 TRP B CD1 1 
ATOM 5551  C CD2 . TRP B 1 339 ? 23.868  19.609  85.694   1.00 10.00 ? ? ? ? ? ? 340 TRP B CD2 1 
ATOM 5552  N NE1 . TRP B 1 339 ? 24.708  17.849  84.610   1.00 10.00 ? ? ? ? ? ? 340 TRP B NE1 1 
ATOM 5553  C CE2 . TRP B 1 339 ? 25.013  18.991  85.257   1.00 10.00 ? ? ? ? ? ? 340 TRP B CE2 1 
ATOM 5554  C CE3 . TRP B 1 339 ? 23.875  20.809  86.391   1.00 10.00 ? ? ? ? ? ? 340 TRP B CE3 1 
ATOM 5555  C CZ2 . TRP B 1 339 ? 26.195  19.617  85.556   1.00 10.00 ? ? ? ? ? ? 340 TRP B CZ2 1 
ATOM 5556  C CZ3 . TRP B 1 339 ? 25.059  21.427  86.675   1.00 10.00 ? ? ? ? ? ? 340 TRP B CZ3 1 
ATOM 5557  C CH2 . TRP B 1 339 ? 26.206  20.819  86.259   1.00 10.00 ? ? ? ? ? ? 340 TRP B CH2 1 
ATOM 5558  N N   . ILE B 1 340 ? 21.375  20.109  88.753   1.00 10.00 ? ? ? ? ? ? 341 ILE B N   1 
ATOM 5559  C CA  . ILE B 1 340 ? 22.176  20.852  89.733   1.00 10.00 ? ? ? ? ? ? 341 ILE B CA  1 
ATOM 5560  C C   . ILE B 1 340 ? 22.127  20.208  91.098   1.00 10.00 ? ? ? ? ? ? 341 ILE B C   1 
ATOM 5561  O O   . ILE B 1 340 ? 22.992  20.471  91.940   1.00 10.00 ? ? ? ? ? ? 341 ILE B O   1 
ATOM 5562  C CB  . ILE B 1 340 ? 21.704  22.303  89.841   1.00 10.00 ? ? ? ? ? ? 341 ILE B CB  1 
ATOM 5563  C CG1 . ILE B 1 340 ? 21.686  22.974  88.445   1.00 10.00 ? ? ? ? ? ? 341 ILE B CG1 1 
ATOM 5564  C CG2 . ILE B 1 340 ? 22.661  23.056  90.767   1.00 10.00 ? ? ? ? ? ? 341 ILE B CG2 1 
ATOM 5565  C CD1 . ILE B 1 340 ? 20.382  23.702  88.114   1.00 10.00 ? ? ? ? ? ? 341 ILE B CD1 1 
ATOM 5566  N N   . GLY B 1 341 ? 21.173  19.322  91.342   1.00 10.00 ? ? ? ? ? ? 342 GLY B N   1 
ATOM 5567  C CA  . GLY B 1 341 ? 21.190  18.544  92.569   1.00 10.00 ? ? ? ? ? ? 342 GLY B CA  1 
ATOM 5568  C C   . GLY B 1 341 ? 22.295  17.493  92.595   1.00 10.00 ? ? ? ? ? ? 342 GLY B C   1 
ATOM 5569  O O   . GLY B 1 341 ? 22.832  17.163  93.652   1.00 10.00 ? ? ? ? ? ? 342 GLY B O   1 
ATOM 5570  N N   . GLY B 1 342 ? 22.580  16.912  91.442   1.00 10.00 ? ? ? ? ? ? 343 GLY B N   1 
ATOM 5571  C CA  . GLY B 1 342 ? 23.659  15.975  91.219   1.00 10.00 ? ? ? ? ? ? 343 GLY B CA  1 
ATOM 5572  C C   . GLY B 1 342 ? 24.997  16.692  91.190   1.00 10.00 ? ? ? ? ? ? 343 GLY B C   1 
ATOM 5573  O O   . GLY B 1 342 ? 25.912  16.253  91.865   1.00 10.00 ? ? ? ? ? ? 343 GLY B O   1 
ATOM 5574  N N   . SER B 1 343 ? 25.199  17.768  90.423   1.00 10.00 ? ? ? ? ? ? 344 SER B N   1 
ATOM 5575  C CA  . SER B 1 343 ? 26.364  18.612  90.565   1.00 10.00 ? ? ? ? ? ? 344 SER B CA  1 
ATOM 5576  C C   . SER B 1 343 ? 26.756  19.017  91.982   1.00 10.00 ? ? ? ? ? ? 344 SER B C   1 
ATOM 5577  O O   . SER B 1 343 ? 27.953  19.204  92.173   1.00 10.00 ? ? ? ? ? ? 344 SER B O   1 
ATOM 5578  C CB  . SER B 1 343 ? 26.159  19.867  89.773   1.00 10.00 ? ? ? ? ? ? 344 SER B CB  1 
ATOM 5579  O OG  . SER B 1 343 ? 27.189  20.825  90.034   1.00 10.00 ? ? ? ? ? ? 344 SER B OG  1 
ATOM 5580  N N   . ILE B 1 344 ? 25.851  19.253  92.937   1.00 10.00 ? ? ? ? ? ? 345 ILE B N   1 
ATOM 5581  C CA  . ILE B 1 344 ? 26.086  19.621  94.347   1.00 10.00 ? ? ? ? ? ? 345 ILE B CA  1 
ATOM 5582  C C   . ILE B 1 344 ? 26.635  18.426  95.100   1.00 10.00 ? ? ? ? ? ? 345 ILE B C   1 
ATOM 5583  O O   . ILE B 1 344 ? 27.666  18.433  95.790   1.00 10.00 ? ? ? ? ? ? 345 ILE B O   1 
ATOM 5584  C CB  . ILE B 1 344 ? 24.753  20.077  95.083   1.00 10.00 ? ? ? ? ? ? 345 ILE B CB  1 
ATOM 5585  C CG1 . ILE B 1 344 ? 24.410  21.450  94.602   1.00 10.00 ? ? ? ? ? ? 345 ILE B CG1 1 
ATOM 5586  C CG2 . ILE B 1 344 ? 24.865  20.153  96.603   1.00 10.00 ? ? ? ? ? ? 345 ILE B CG2 1 
ATOM 5587  C CD1 . ILE B 1 344 ? 23.050  21.911  95.181   1.00 10.00 ? ? ? ? ? ? 345 ILE B CD1 1 
ATOM 5588  N N   . LEU B 1 345 ? 25.806  17.382  94.950   1.00 10.00 ? ? ? ? ? ? 346 LEU B N   1 
ATOM 5589  C CA  . LEU B 1 345 ? 26.022  16.091  95.577   1.00 10.00 ? ? ? ? ? ? 346 LEU B CA  1 
ATOM 5590  C C   . LEU B 1 345 ? 27.362  15.561  95.138   1.00 10.00 ? ? ? ? ? ? 346 LEU B C   1 
ATOM 5591  O O   . LEU B 1 345 ? 28.230  15.533  95.992   1.00 10.00 ? ? ? ? ? ? 346 LEU B O   1 
ATOM 5592  C CB  . LEU B 1 345 ? 24.825  15.205  95.177   1.00 10.00 ? ? ? ? ? ? 346 LEU B CB  1 
ATOM 5593  C CG  . LEU B 1 345 ? 24.412  13.918  95.915   1.00 10.00 ? ? ? ? ? ? 346 LEU B CG  1 
ATOM 5594  C CD1 . LEU B 1 345 ? 24.809  12.749  95.007   1.00 10.00 ? ? ? ? ? ? 346 LEU B CD1 1 
ATOM 5595  C CD2 . LEU B 1 345 ? 24.932  13.934  97.388   1.00 10.00 ? ? ? ? ? ? 346 LEU B CD2 1 
ATOM 5596  N N   . ALA B 1 346 ? 27.654  15.299  93.869   1.00 10.00 ? ? ? ? ? ? 347 ALA B N   1 
ATOM 5597  C CA  . ALA B 1 346 ? 28.935  14.766  93.469   1.00 10.00 ? ? ? ? ? ? 347 ALA B CA  1 
ATOM 5598  C C   . ALA B 1 346 ? 30.142  15.680  93.657   1.00 10.00 ? ? ? ? ? ? 347 ALA B C   1 
ATOM 5599  O O   . ALA B 1 346 ? 31.227  15.325  93.162   1.00 10.00 ? ? ? ? ? ? 347 ALA B O   1 
ATOM 5600  C CB  . ALA B 1 346 ? 28.885  14.370  92.013   1.00 10.00 ? ? ? ? ? ? 347 ALA B CB  1 
ATOM 5601  N N   . SER B 1 347 ? 29.969  16.876  94.257   1.00 10.00 ? ? ? ? ? ? 348 SER B N   1 
ATOM 5602  C CA  . SER B 1 347 ? 31.088  17.743  94.555   1.00 10.00 ? ? ? ? ? ? 348 SER B CA  1 
ATOM 5603  C C   . SER B 1 347 ? 31.412  17.688  96.022   1.00 10.00 ? ? ? ? ? ? 348 SER B C   1 
ATOM 5604  O O   . SER B 1 347 ? 32.524  18.079  96.381   1.00 10.00 ? ? ? ? ? ? 348 SER B O   1 
ATOM 5605  C CB  . SER B 1 347 ? 30.812  19.211  94.178   1.00 10.00 ? ? ? ? ? ? 348 SER B CB  1 
ATOM 5606  O OG  . SER B 1 347 ? 29.493  19.665  94.413   1.00 10.00 ? ? ? ? ? ? 348 SER B OG  1 
ATOM 5607  N N   . LEU B 1 348 ? 30.505  17.250  96.900   1.00 10.00 ? ? ? ? ? ? 349 LEU B N   1 
ATOM 5608  C CA  . LEU B 1 348 ? 30.795  17.191  98.336   1.00 10.00 ? ? ? ? ? ? 349 LEU B CA  1 
ATOM 5609  C C   . LEU B 1 348 ? 31.858  16.100  98.620   1.00 10.00 ? ? ? ? ? ? 349 LEU B C   1 
ATOM 5610  O O   . LEU B 1 348 ? 31.853  15.045  97.959   1.00 10.00 ? ? ? ? ? ? 349 LEU B O   1 
ATOM 5611  C CB  . LEU B 1 348 ? 29.494  16.898  99.089   1.00 10.00 ? ? ? ? ? ? 349 LEU B CB  1 
ATOM 5612  C CG  . LEU B 1 348 ? 28.350  17.889  98.892   1.00 10.00 ? ? ? ? ? ? 349 LEU B CG  1 
ATOM 5613  C CD1 . LEU B 1 348 ? 27.037  17.272  99.321   1.00 10.00 ? ? ? ? ? ? 349 LEU B CD1 1 
ATOM 5614  C CD2 . LEU B 1 348 ? 28.602  19.131  99.716   1.00 10.00 ? ? ? ? ? ? 349 LEU B CD2 1 
ATOM 5615  N N   . SER B 1 349 ? 32.800  16.296  99.566   1.00 10.00 ? ? ? ? ? ? 350 SER B N   1 
ATOM 5616  C CA  . SER B 1 349 ? 33.791  15.279  99.835   1.00 10.00 ? ? ? ? ? ? 350 SER B CA  1 
ATOM 5617  C C   . SER B 1 349 ? 33.116  14.113  100.461  1.00 10.00 ? ? ? ? ? ? 350 SER B C   1 
ATOM 5618  O O   . SER B 1 349 ? 33.661  13.010  100.416  1.00 10.00 ? ? ? ? ? ? 350 SER B O   1 
ATOM 5619  C CB  . SER B 1 349 ? 34.846  15.727  100.767  1.00 10.00 ? ? ? ? ? ? 350 SER B CB  1 
ATOM 5620  O OG  . SER B 1 349 ? 36.093  15.958  100.083  1.00 10.00 ? ? ? ? ? ? 350 SER B OG  1 
ATOM 5621  N N   . THR B 1 350 ? 31.930  14.378  101.032  1.00 10.00 ? ? ? ? ? ? 351 THR B N   1 
ATOM 5622  C CA  . THR B 1 350 ? 30.949  13.391  101.511  1.00 10.00 ? ? ? ? ? ? 351 THR B CA  1 
ATOM 5623  C C   . THR B 1 350 ? 30.736  12.217  100.508  1.00 10.00 ? ? ? ? ? ? 351 THR B C   1 
ATOM 5624  O O   . THR B 1 350 ? 30.841  11.029  100.789  1.00 10.00 ? ? ? ? ? ? 351 THR B O   1 
ATOM 5625  C CB  . THR B 1 350 ? 29.632  14.246  101.749  1.00 10.00 ? ? ? ? ? ? 351 THR B CB  1 
ATOM 5626  O OG1 . THR B 1 350 ? 30.027  15.302  102.621  1.00 10.00 ? ? ? ? ? ? 351 THR B OG1 1 
ATOM 5627  C CG2 . THR B 1 350 ? 28.431  13.467  102.250  1.00 10.00 ? ? ? ? ? ? 351 THR B CG2 1 
ATOM 5628  N N   . PHE B 1 351 ? 30.542  12.592  99.253   1.00 10.00 ? ? ? ? ? ? 352 PHE B N   1 
ATOM 5629  C CA  . PHE B 1 351 ? 30.094  11.698  98.239   1.00 10.00 ? ? ? ? ? ? 352 PHE B CA  1 
ATOM 5630  C C   . PHE B 1 351 ? 31.114  10.668  97.831   1.00 10.00 ? ? ? ? ? ? 352 PHE B C   1 
ATOM 5631  O O   . PHE B 1 351 ? 30.746  9.558   97.466   1.00 10.00 ? ? ? ? ? ? 352 PHE B O   1 
ATOM 5632  C CB  . PHE B 1 351 ? 29.671  12.552  97.061   1.00 10.00 ? ? ? ? ? ? 352 PHE B CB  1 
ATOM 5633  C CG  . PHE B 1 351 ? 28.829  11.692  96.129   1.00 10.00 ? ? ? ? ? ? 352 PHE B CG  1 
ATOM 5634  C CD1 . PHE B 1 351 ? 27.610  11.204  96.567   1.00 10.00 ? ? ? ? ? ? 352 PHE B CD1 1 
ATOM 5635  C CD2 . PHE B 1 351 ? 29.297  11.335  94.902   1.00 10.00 ? ? ? ? ? ? 352 PHE B CD2 1 
ATOM 5636  C CE1 . PHE B 1 351 ? 26.870  10.362  95.794   1.00 10.00 ? ? ? ? ? ? 352 PHE B CE1 1 
ATOM 5637  C CE2 . PHE B 1 351 ? 28.533  10.493  94.159   1.00 10.00 ? ? ? ? ? ? 352 PHE B CE2 1 
ATOM 5638  C CZ  . PHE B 1 351 ? 27.340  10.004  94.583   1.00 10.00 ? ? ? ? ? ? 352 PHE B CZ  1 
ATOM 5639  N N   . GLN B 1 352 ? 32.413  10.958  97.888   1.00 10.00 ? ? ? ? ? ? 353 GLN B N   1 
ATOM 5640  C CA  . GLN B 1 352 ? 33.394  9.989   97.436   1.00 10.00 ? ? ? ? ? ? 353 GLN B CA  1 
ATOM 5641  C C   . GLN B 1 352 ? 33.275  8.723   98.256   1.00 10.00 ? ? ? ? ? ? 353 GLN B C   1 
ATOM 5642  O O   . GLN B 1 352 ? 33.642  7.662   97.799   1.00 10.00 ? ? ? ? ? ? 353 GLN B O   1 
ATOM 5643  C CB  . GLN B 1 352 ? 34.828  10.570  97.516   1.00 10.00 ? ? ? ? ? ? 353 GLN B CB  1 
ATOM 5644  C CG  . GLN B 1 352 ? 35.910  9.830   96.601   1.00 10.00 ? ? ? ? ? ? 353 GLN B CG  1 
ATOM 5645  C CD  . GLN B 1 352 ? 35.770  9.556   95.065   1.00 10.00 ? ? ? ? ? ? 353 GLN B CD  1 
ATOM 5646  O OE1 . GLN B 1 352 ? 36.018  8.468   94.547   1.00 10.00 ? ? ? ? ? ? 353 GLN B OE1 1 
ATOM 5647  N NE2 . GLN B 1 352 ? 35.385  10.488  94.217   1.00 10.00 ? ? ? ? ? ? 353 GLN B NE2 1 
ATOM 5648  N N   . GLN B 1 353 ? 32.669  8.755   99.428   1.00 10.00 ? ? ? ? ? ? 354 GLN B N   1 
ATOM 5649  C CA  . GLN B 1 353 ? 32.414  7.549   100.155  1.00 10.00 ? ? ? ? ? ? 354 GLN B CA  1 
ATOM 5650  C C   . GLN B 1 353 ? 30.928  7.499   99.874   1.00 10.00 ? ? ? ? ? ? 354 GLN B C   1 
ATOM 5651  O O   . GLN B 1 353 ? 30.136  8.110   100.594  1.00 10.00 ? ? ? ? ? ? 354 GLN B O   1 
ATOM 5652  C CB  . GLN B 1 353 ? 32.600  7.681   101.675  1.00 10.00 ? ? ? ? ? ? 354 GLN B CB  1 
ATOM 5653  C CG  . GLN B 1 353 ? 33.339  8.902   102.232  1.00 10.00 ? ? ? ? ? ? 354 GLN B CG  1 
ATOM 5654  C CD  . GLN B 1 353 ? 34.738  9.078   101.638  1.00 10.00 ? ? ? ? ? ? 354 GLN B CD  1 
ATOM 5655  O OE1 . GLN B 1 353 ? 35.556  8.138   101.626  1.00 10.00 ? ? ? ? ? ? 354 GLN B OE1 1 
ATOM 5656  N NE2 . GLN B 1 353 ? 34.997  10.295  101.118  1.00 10.00 ? ? ? ? ? ? 354 GLN B NE2 1 
ATOM 5657  N N   . MET B 1 354 ? 30.545  6.918   98.758   1.00 10.00 ? ? ? ? ? ? 355 MET B N   1 
ATOM 5658  C CA  . MET B 1 354 ? 29.151  6.726   98.409   1.00 10.00 ? ? ? ? ? ? 355 MET B CA  1 
ATOM 5659  C C   . MET B 1 354 ? 29.113  6.063   97.054   1.00 10.00 ? ? ? ? ? ? 355 MET B C   1 
ATOM 5660  O O   . MET B 1 354 ? 28.102  5.454   96.744   1.00 10.00 ? ? ? ? ? ? 355 MET B O   1 
ATOM 5661  C CB  . MET B 1 354 ? 28.423  8.024   98.322   1.00 10.00 ? ? ? ? ? ? 355 MET B CB  1 
ATOM 5662  C CG  . MET B 1 354 ? 26.976  7.942   98.617   1.00 10.00 ? ? ? ? ? ? 355 MET B CG  1 
ATOM 5663  S SD  . MET B 1 354 ? 26.425  9.647   98.914   1.00 10.00 ? ? ? ? ? ? 355 MET B SD  1 
ATOM 5664  C CE  . MET B 1 354 ? 27.064  9.729   100.577  1.00 10.00 ? ? ? ? ? ? 355 MET B CE  1 
ATOM 5665  N N   . TRP B 1 355 ? 30.160  6.238   96.225   1.00 10.00 ? ? ? ? ? ? 356 TRP B N   1 
ATOM 5666  C CA  . TRP B 1 355 ? 30.300  5.598   94.925   1.00 10.00 ? ? ? ? ? ? 356 TRP B CA  1 
ATOM 5667  C C   . TRP B 1 355 ? 30.478  4.091   95.011   1.00 10.00 ? ? ? ? ? ? 356 TRP B C   1 
ATOM 5668  O O   . TRP B 1 355 ? 30.840  3.543   96.052   1.00 10.00 ? ? ? ? ? ? 356 TRP B O   1 
ATOM 5669  C CB  . TRP B 1 355 ? 31.527  5.951   94.157   1.00 10.00 ? ? ? ? ? ? 356 TRP B CB  1 
ATOM 5670  C CG  . TRP B 1 355 ? 31.818  7.369   93.851   1.00 10.00 ? ? ? ? ? ? 356 TRP B CG  1 
ATOM 5671  C CD1 . TRP B 1 355 ? 32.822  7.887   94.565   1.00 10.00 ? ? ? ? ? ? 356 TRP B CD1 1 
ATOM 5672  C CD2 . TRP B 1 355 ? 31.156  8.226   92.977   1.00 10.00 ? ? ? ? ? ? 356 TRP B CD2 1 
ATOM 5673  N NE1 . TRP B 1 355 ? 32.807  9.128   94.165   1.00 10.00 ? ? ? ? ? ? 356 TRP B NE1 1 
ATOM 5674  C CE2 . TRP B 1 355 ? 31.848  9.401   93.232   1.00 10.00 ? ? ? ? ? ? 356 TRP B CE2 1 
ATOM 5675  C CE3 . TRP B 1 355 ? 30.116  8.253   92.038   1.00 10.00 ? ? ? ? ? ? 356 TRP B CE3 1 
ATOM 5676  C CZ2 . TRP B 1 355 ? 31.494  10.598  92.577   1.00 10.00 ? ? ? ? ? ? 356 TRP B CZ2 1 
ATOM 5677  C CZ3 . TRP B 1 355 ? 29.755  9.435   91.384   1.00 10.00 ? ? ? ? ? ? 356 TRP B CZ3 1 
ATOM 5678  C CH2 . TRP B 1 355 ? 30.444  10.613  91.655   1.00 10.00 ? ? ? ? ? ? 356 TRP B CH2 1 
ATOM 5679  N N   . ILE B 1 356 ? 30.347  3.446   93.859   1.00 10.00 ? ? ? ? ? ? 357 ILE B N   1 
ATOM 5680  C CA  . ILE B 1 356 ? 30.636  2.050   93.639   1.00 10.00 ? ? ? ? ? ? 357 ILE B CA  1 
ATOM 5681  C C   . ILE B 1 356 ? 31.924  2.213   92.840   1.00 10.00 ? ? ? ? ? ? 357 ILE B C   1 
ATOM 5682  O O   . ILE B 1 356 ? 31.959  2.970   91.850   1.00 10.00 ? ? ? ? ? ? 357 ILE B O   1 
ATOM 5683  C CB  . ILE B 1 356 ? 29.554  1.432   92.805   1.00 10.00 ? ? ? ? ? ? 357 ILE B CB  1 
ATOM 5684  C CG1 . ILE B 1 356 ? 28.200  1.640   93.445   1.00 10.00 ? ? ? ? ? ? 357 ILE B CG1 1 
ATOM 5685  C CG2 . ILE B 1 356 ? 29.881  -0.030  92.637   1.00 10.00 ? ? ? ? ? ? 357 ILE B CG2 1 
ATOM 5686  C CD1 . ILE B 1 356 ? 26.997  1.457   92.505   1.00 10.00 ? ? ? ? ? ? 357 ILE B CD1 1 
ATOM 5687  N N   . SER B 1 357 ? 33.001  1.596   93.321   1.00 10.00 ? ? ? ? ? ? 358 SER B N   1 
ATOM 5688  C CA  . SER B 1 357 ? 34.293  1.741   92.700   1.00 10.00 ? ? ? ? ? ? 358 SER B CA  1 
ATOM 5689  C C   . SER B 1 357 ? 34.526  0.596   91.751   1.00 10.00 ? ? ? ? ? ? 358 SER B C   1 
ATOM 5690  O O   . SER B 1 357 ? 33.849  -0.443  91.863   1.00 10.00 ? ? ? ? ? ? 358 SER B O   1 
ATOM 5691  C CB  . SER B 1 357 ? 35.385  1.721   93.752   1.00 10.00 ? ? ? ? ? ? 358 SER B CB  1 
ATOM 5692  O OG  . SER B 1 357 ? 35.368  0.616   94.678   1.00 10.00 ? ? ? ? ? ? 358 SER B OG  1 
ATOM 5693  N N   . LYS B 1 358 ? 35.549  0.753   90.889   1.00 10.00 ? ? ? ? ? ? 359 LYS B N   1 
ATOM 5694  C CA  . LYS B 1 358 ? 35.979  -0.270  89.927   1.00 10.00 ? ? ? ? ? ? 359 LYS B CA  1 
ATOM 5695  C C   . LYS B 1 358 ? 36.234  -1.511  90.719   1.00 10.00 ? ? ? ? ? ? 359 LYS B C   1 
ATOM 5696  O O   . LYS B 1 358 ? 35.593  -2.516  90.442   1.00 10.00 ? ? ? ? ? ? 359 LYS B O   1 
ATOM 5697  C CB  . LYS B 1 358 ? 37.253  0.121   89.219   1.00 10.00 ? ? ? ? ? ? 359 LYS B CB  1 
ATOM 5698  C CG  . LYS B 1 358 ? 37.201  -0.177  87.711   1.00 10.00 ? ? ? ? ? ? 359 LYS B CG  1 
ATOM 5699  C CD  . LYS B 1 358 ? 36.844  -1.592  87.186   1.00 10.00 ? ? ? ? ? ? 359 LYS B CD  1 
ATOM 5700  C CE  . LYS B 1 358 ? 36.731  -1.522  85.647   1.00 10.00 ? ? ? ? ? ? 359 LYS B CE  1 
ATOM 5701  N NZ  . LYS B 1 358 ? 36.293  -2.783  85.077   1.00 10.00 ? ? ? ? ? ? 359 LYS B NZ  1 
ATOM 5702  N N   . GLN B 1 359 ? 37.056  -1.403  91.781   1.00 10.00 ? ? ? ? ? ? 360 GLN B N   1 
ATOM 5703  C CA  . GLN B 1 359 ? 37.301  -2.506  92.718   1.00 10.00 ? ? ? ? ? ? 360 GLN B CA  1 
ATOM 5704  C C   . GLN B 1 359 ? 36.037  -3.254  93.160   1.00 10.00 ? ? ? ? ? ? 360 GLN B C   1 
ATOM 5705  O O   . GLN B 1 359 ? 35.938  -4.499  93.050   1.00 10.00 ? ? ? ? ? ? 360 GLN B O   1 
ATOM 5706  C CB  . GLN B 1 359 ? 37.966  -2.036  94.015   1.00 10.00 ? ? ? ? ? ? 360 GLN B CB  1 
ATOM 5707  C CG  . GLN B 1 359 ? 38.568  -0.615  94.118   1.00 10.00 ? ? ? ? ? ? 360 GLN B CG  1 
ATOM 5708  C CD  . GLN B 1 359 ? 38.902  -0.167  95.559   1.00 10.00 ? ? ? ? ? ? 360 GLN B CD  1 
ATOM 5709  O OE1 . GLN B 1 359 ? 40.073  0.020   95.895   1.00 10.00 ? ? ? ? ? ? 360 GLN B OE1 1 
ATOM 5710  N NE2 . GLN B 1 359 ? 37.953  0.068   96.482   1.00 10.00 ? ? ? ? ? ? 360 GLN B NE2 1 
ATOM 5711  N N   . GLU B 1 360 ? 35.015  -2.499  93.606   1.00 10.00 ? ? ? ? ? ? 361 GLU B N   1 
ATOM 5712  C CA  . GLU B 1 360 ? 33.797  -3.127  94.116   1.00 10.00 ? ? ? ? ? ? 361 GLU B CA  1 
ATOM 5713  C C   . GLU B 1 360 ? 33.029  -3.833  93.047   1.00 10.00 ? ? ? ? ? ? 361 GLU B C   1 
ATOM 5714  O O   . GLU B 1 360 ? 32.493  -4.910  93.273   1.00 10.00 ? ? ? ? ? ? 361 GLU B O   1 
ATOM 5715  C CB  . GLU B 1 360 ? 32.897  -2.096  94.759   1.00 10.00 ? ? ? ? ? ? 361 GLU B CB  1 
ATOM 5716  C CG  . GLU B 1 360 ? 33.651  -1.541  95.977   1.00 10.00 ? ? ? ? ? ? 361 GLU B CG  1 
ATOM 5717  C CD  . GLU B 1 360 ? 32.965  -0.469  96.833   1.00 10.00 ? ? ? ? ? ? 361 GLU B CD  1 
ATOM 5718  O OE1 . GLU B 1 360 ? 31.776  -0.672  97.173   1.00 10.00 ? ? ? ? ? ? 361 GLU B OE1 1 
ATOM 5719  O OE2 . GLU B 1 360 ? 33.659  0.528   97.175   1.00 10.00 ? ? ? ? ? ? 361 GLU B OE2 1 
ATOM 5720  N N   . TYR B 1 361 ? 33.021  -3.257  91.862   1.00 10.00 ? ? ? ? ? ? 362 TYR B N   1 
ATOM 5721  C CA  . TYR B 1 361 ? 32.316  -3.857  90.755   1.00 10.00 ? ? ? ? ? ? 362 TYR B CA  1 
ATOM 5722  C C   . TYR B 1 361 ? 32.917  -5.232  90.444   1.00 10.00 ? ? ? ? ? ? 362 TYR B C   1 
ATOM 5723  O O   . TYR B 1 361 ? 32.196  -6.169  90.104   1.00 10.00 ? ? ? ? ? ? 362 TYR B O   1 
ATOM 5724  C CB  . TYR B 1 361 ? 32.415  -2.916  89.518   1.00 10.00 ? ? ? ? ? ? 362 TYR B CB  1 
ATOM 5725  C CG  . TYR B 1 361 ? 31.708  -3.514  88.296   1.00 10.00 ? ? ? ? ? ? 362 TYR B CG  1 
ATOM 5726  C CD1 . TYR B 1 361 ? 30.335  -3.706  88.285   1.00 10.00 ? ? ? ? ? ? 362 TYR B CD1 1 
ATOM 5727  C CD2 . TYR B 1 361 ? 32.462  -3.939  87.220   1.00 10.00 ? ? ? ? ? ? 362 TYR B CD2 1 
ATOM 5728  C CE1 . TYR B 1 361 ? 29.720  -4.321  87.221   1.00 10.00 ? ? ? ? ? ? 362 TYR B CE1 1 
ATOM 5729  C CE2 . TYR B 1 361 ? 31.843  -4.565  86.162   1.00 10.00 ? ? ? ? ? ? 362 TYR B CE2 1 
ATOM 5730  C CZ  . TYR B 1 361 ? 30.489  -4.749  86.181   1.00 10.00 ? ? ? ? ? ? 362 TYR B CZ  1 
ATOM 5731  O OH  . TYR B 1 361 ? 29.926  -5.454  85.159   1.00 10.00 ? ? ? ? ? ? 362 TYR B OH  1 
ATOM 5732  N N   . ASP B 1 362 ? 34.243  -5.361  90.515   1.00 10.00 ? ? ? ? ? ? 363 ASP B N   1 
ATOM 5733  C CA  . ASP B 1 362 ? 34.939  -6.628  90.283   1.00 10.00 ? ? ? ? ? ? 363 ASP B CA  1 
ATOM 5734  C C   . ASP B 1 362 ? 34.573  -7.653  91.316   1.00 10.00 ? ? ? ? ? ? 363 ASP B C   1 
ATOM 5735  O O   . ASP B 1 362 ? 34.324  -8.813  91.021   1.00 10.00 ? ? ? ? ? ? 363 ASP B O   1 
ATOM 5736  C CB  . ASP B 1 362 ? 36.428  -6.529  90.404   1.00 10.00 ? ? ? ? ? ? 363 ASP B CB  1 
ATOM 5737  C CG  . ASP B 1 362 ? 37.014  -5.974  89.169   1.00 10.00 ? ? ? ? ? ? 363 ASP B CG  1 
ATOM 5738  O OD1 . ASP B 1 362 ? 36.703  -6.570  88.144   1.00 10.00 ? ? ? ? ? ? 363 ASP B OD1 1 
ATOM 5739  O OD2 . ASP B 1 362 ? 37.764  -4.994  89.237   1.00 10.00 ? ? ? ? ? ? 363 ASP B OD2 1 
ATOM 5740  N N   . GLU B 1 363 ? 34.680  -7.109  92.548   1.00 10.00 ? ? ? ? ? ? 364 GLU B N   1 
ATOM 5741  C CA  . GLU B 1 363 ? 34.388  -7.837  93.755   1.00 10.00 ? ? ? ? ? ? 364 GLU B CA  1 
ATOM 5742  C C   . GLU B 1 363 ? 32.993  -8.413  93.543   1.00 10.00 ? ? ? ? ? ? 364 GLU B C   1 
ATOM 5743  O O   . GLU B 1 363 ? 32.908  -9.648  93.472   1.00 10.00 ? ? ? ? ? ? 364 GLU B O   1 
ATOM 5744  C CB  . GLU B 1 363 ? 34.476  -6.844  94.969   1.00 10.00 ? ? ? ? ? ? 364 GLU B CB  1 
ATOM 5745  C CG  . GLU B 1 363 ? 33.898  -7.149  96.382   1.00 10.00 ? ? ? ? ? ? 364 GLU B CG  1 
ATOM 5746  C CD  . GLU B 1 363 ? 33.567  -5.886  97.233   1.00 10.00 ? ? ? ? ? ? 364 GLU B CD  1 
ATOM 5747  O OE1 . GLU B 1 363 ? 34.471  -5.063  97.526   1.00 10.00 ? ? ? ? ? ? 364 GLU B OE1 1 
ATOM 5748  O OE2 . GLU B 1 363 ? 32.392  -5.724  97.588   1.00 10.00 ? ? ? ? ? ? 364 GLU B OE2 1 
ATOM 5749  N N   . SER B 1 364 ? 31.968  -7.580  93.277   1.00 10.00 ? ? ? ? ? ? 365 SER B N   1 
ATOM 5750  C CA  . SER B 1 364 ? 30.609  -8.088  93.329   1.00 10.00 ? ? ? ? ? ? 365 SER B CA  1 
ATOM 5751  C C   . SER B 1 364 ? 30.026  -8.475  92.000   1.00 10.00 ? ? ? ? ? ? 365 SER B C   1 
ATOM 5752  O O   . SER B 1 364 ? 29.416  -9.539  91.826   1.00 10.00 ? ? ? ? ? ? 365 SER B O   1 
ATOM 5753  C CB  . SER B 1 364 ? 29.746  -7.049  93.974   1.00 10.00 ? ? ? ? ? ? 365 SER B CB  1 
ATOM 5754  O OG  . SER B 1 364 ? 30.415  -6.283  94.954   1.00 10.00 ? ? ? ? ? ? 365 SER B OG  1 
ATOM 5755  N N   . GLY B 1 365 ? 30.197  -7.613  91.026   1.00 10.00 ? ? ? ? ? ? 366 GLY B N   1 
ATOM 5756  C CA  . GLY B 1 365 ? 29.591  -7.832  89.741   1.00 10.00 ? ? ? ? ? ? 366 GLY B CA  1 
ATOM 5757  C C   . GLY B 1 365 ? 28.681  -6.650  89.521   1.00 10.00 ? ? ? ? ? ? 366 GLY B C   1 
ATOM 5758  O O   . GLY B 1 365 ? 28.928  -5.642  90.191   1.00 10.00 ? ? ? ? ? ? 366 GLY B O   1 
ATOM 5759  N N   . PRO B 1 366 ? 27.666  -6.667  88.633   1.00 10.00 ? ? ? ? ? ? 367 PRO B N   1 
ATOM 5760  C CA  . PRO B 1 366 ? 26.671  -5.591  88.476   1.00 10.00 ? ? ? ? ? ? 367 PRO B CA  1 
ATOM 5761  C C   . PRO B 1 366 ? 25.564  -5.420  89.532   1.00 10.00 ? ? ? ? ? ? 367 PRO B C   1 
ATOM 5762  O O   . PRO B 1 366 ? 24.992  -4.350  89.728   1.00 10.00 ? ? ? ? ? ? 367 PRO B O   1 
ATOM 5763  C CB  . PRO B 1 366 ? 26.129  -5.833  87.069   1.00 10.00 ? ? ? ? ? ? 367 PRO B CB  1 
ATOM 5764  C CG  . PRO B 1 366 ? 26.304  -7.309  86.885   1.00 10.00 ? ? ? ? ? ? 367 PRO B CG  1 
ATOM 5765  C CD  . PRO B 1 366 ? 27.680  -7.498  87.442   1.00 10.00 ? ? ? ? ? ? 367 PRO B CD  1 
ATOM 5766  N N   . SER B 1 367 ? 25.273  -6.506  90.247   1.00 10.00 ? ? ? ? ? ? 368 SER B N   1 
ATOM 5767  C CA  . SER B 1 367 ? 24.282  -6.561  91.295   1.00 10.00 ? ? ? ? ? ? 368 SER B CA  1 
ATOM 5768  C C   . SER B 1 367 ? 24.531  -5.465  92.329   1.00 10.00 ? ? ? ? ? ? 368 SER B C   1 
ATOM 5769  O O   . SER B 1 367 ? 23.587  -4.765  92.674   1.00 10.00 ? ? ? ? ? ? 368 SER B O   1 
ATOM 5770  C CB  . SER B 1 367 ? 24.358  -7.947  91.944   1.00 10.00 ? ? ? ? ? ? 368 SER B CB  1 
ATOM 5771  O OG  . SER B 1 367 ? 23.137  -8.491  92.476   1.00 10.00 ? ? ? ? ? ? 368 SER B OG  1 
ATOM 5772  N N   . ILE B 1 368 ? 25.755  -5.229  92.795   1.00 10.00 ? ? ? ? ? ? 369 ILE B N   1 
ATOM 5773  C CA  . ILE B 1 368 ? 26.076  -4.235  93.800   1.00 10.00 ? ? ? ? ? ? 369 ILE B CA  1 
ATOM 5774  C C   . ILE B 1 368 ? 25.327  -2.910  93.677   1.00 10.00 ? ? ? ? ? ? 369 ILE B C   1 
ATOM 5775  O O   . ILE B 1 368 ? 25.146  -2.300  94.746   1.00 10.00 ? ? ? ? ? ? 369 ILE B O   1 
ATOM 5776  C CB  . ILE B 1 368 ? 27.617  -3.972  93.783   1.00 10.00 ? ? ? ? ? ? 369 ILE B CB  1 
ATOM 5777  C CG1 . ILE B 1 368 ? 27.956  -3.168  95.016   1.00 10.00 ? ? ? ? ? ? 369 ILE B CG1 1 
ATOM 5778  C CG2 . ILE B 1 368 ? 28.069  -3.246  92.547   1.00 10.00 ? ? ? ? ? ? 369 ILE B CG2 1 
ATOM 5779  C CD1 . ILE B 1 368 ? 29.376  -2.603  95.154   1.00 10.00 ? ? ? ? ? ? 369 ILE B CD1 1 
ATOM 5780  N N   . VAL B 1 369 ? 24.826  -2.467  92.489   1.00 10.00 ? ? ? ? ? ? 370 VAL B N   1 
ATOM 5781  C CA  . VAL B 1 369 ? 24.072  -1.215  92.352   1.00 10.00 ? ? ? ? ? ? 370 VAL B CA  1 
ATOM 5782  C C   . VAL B 1 369 ? 22.881  -1.269  93.275   1.00 10.00 ? ? ? ? ? ? 370 VAL B C   1 
ATOM 5783  O O   . VAL B 1 369 ? 22.505  -0.251  93.795   1.00 10.00 ? ? ? ? ? ? 370 VAL B O   1 
ATOM 5784  C CB  . VAL B 1 369 ? 23.326  -0.900  91.059   1.00 10.00 ? ? ? ? ? ? 370 VAL B CB  1 
ATOM 5785  C CG1 . VAL B 1 369 ? 23.637  0.497   90.680   1.00 10.00 ? ? ? ? ? ? 370 VAL B CG1 1 
ATOM 5786  C CG2 . VAL B 1 369 ? 23.609  -1.900  90.018   1.00 10.00 ? ? ? ? ? ? 370 VAL B CG2 1 
ATOM 5787  N N   . HIS B 1 370 ? 22.280  -2.421  93.535   1.00 10.00 ? ? ? ? ? ? 371 HIS B N   1 
ATOM 5788  C CA  . HIS B 1 370 ? 21.089  -2.503  94.361   1.00 10.00 ? ? ? ? ? ? 371 HIS B CA  1 
ATOM 5789  C C   . HIS B 1 370 ? 21.396  -2.291  95.820   1.00 10.00 ? ? ? ? ? ? 371 HIS B C   1 
ATOM 5790  O O   . HIS B 1 370 ? 20.570  -1.889  96.631   1.00 10.00 ? ? ? ? ? ? 371 HIS B O   1 
ATOM 5791  C CB  . HIS B 1 370 ? 20.375  -3.872  94.241   1.00 10.00 ? ? ? ? ? ? 371 HIS B CB  1 
ATOM 5792  C CG  . HIS B 1 370 ? 20.152  -4.338  92.802   1.00 10.00 ? ? ? ? ? ? 371 HIS B CG  1 
ATOM 5793  N ND1 . HIS B 1 370 ? 19.897  -3.620  91.706   1.00 10.00 ? ? ? ? ? ? 371 HIS B ND1 1 
ATOM 5794  C CD2 . HIS B 1 370 ? 20.274  -5.660  92.397   1.00 10.00 ? ? ? ? ? ? 371 HIS B CD2 1 
ATOM 5795  C CE1 . HIS B 1 370 ? 19.870  -4.442  90.674   1.00 10.00 ? ? ? ? ? ? 371 HIS B CE1 1 
ATOM 5796  N NE2 . HIS B 1 370 ? 20.099  -5.668  91.103   1.00 10.00 ? ? ? ? ? ? 371 HIS B NE2 1 
ATOM 5797  N N   . ARG B 1 371 ? 22.626  -2.526  96.170   1.00 10.00 ? ? ? ? ? ? 372 ARG B N   1 
ATOM 5798  C CA  . ARG B 1 371 ? 22.986  -2.486  97.549   1.00 10.00 ? ? ? ? ? ? 372 ARG B CA  1 
ATOM 5799  C C   . ARG B 1 371 ? 23.342  -1.071  97.799   1.00 10.00 ? ? ? ? ? ? 372 ARG B C   1 
ATOM 5800  O O   . ARG B 1 371 ? 22.834  -0.512  98.739   1.00 10.00 ? ? ? ? ? ? 372 ARG B O   1 
ATOM 5801  C CB  . ARG B 1 371 ? 24.179  -3.450  97.801   1.00 10.00 ? ? ? ? ? ? 372 ARG B CB  1 
ATOM 5802  C CG  . ARG B 1 371 ? 24.022  -4.937  97.321   1.00 10.00 ? ? ? ? ? ? 372 ARG B CG  1 
ATOM 5803  C CD  . ARG B 1 371 ? 23.459  -6.027  98.238   1.00 10.00 ? ? ? ? ? ? 372 ARG B CD  1 
ATOM 5804  N NE  . ARG B 1 371 ? 22.100  -5.798  98.691   1.00 10.00 ? ? ? ? ? ? 372 ARG B NE  1 
ATOM 5805  C CZ  . ARG B 1 371 ? 20.980  -6.101  98.022   1.00 10.00 ? ? ? ? ? ? 372 ARG B CZ  1 
ATOM 5806  N NH1 . ARG B 1 371 ? 21.012  -6.689  96.831   1.00 10.00 ? ? ? ? ? ? 372 ARG B NH1 1 
ATOM 5807  N NH2 . ARG B 1 371 ? 19.800  -5.735  98.540   1.00 10.00 ? ? ? ? ? ? 372 ARG B NH2 1 
ATOM 5808  N N   . LYS B 1 372 ? 24.167  -0.474  96.947   1.00 10.00 ? ? ? ? ? ? 373 LYS B N   1 
ATOM 5809  C CA  . LYS B 1 372 ? 24.735  0.788   97.325   1.00 10.00 ? ? ? ? ? ? 373 LYS B CA  1 
ATOM 5810  C C   . LYS B 1 372 ? 24.015  2.014   96.968   1.00 10.00 ? ? ? ? ? ? 373 LYS B C   1 
ATOM 5811  O O   . LYS B 1 372 ? 24.272  3.081   97.541   1.00 10.00 ? ? ? ? ? ? 373 LYS B O   1 
ATOM 5812  C CB  . LYS B 1 372 ? 26.110  0.944   96.783   1.00 10.00 ? ? ? ? ? ? 373 LYS B CB  1 
ATOM 5813  C CG  . LYS B 1 372 ? 27.086  -0.069  97.371   1.00 10.00 ? ? ? ? ? ? 373 LYS B CG  1 
ATOM 5814  C CD  . LYS B 1 372 ? 28.507  0.395   97.388   1.00 10.00 ? ? ? ? ? ? 373 LYS B CD  1 
ATOM 5815  C CE  . LYS B 1 372 ? 28.611  1.391   98.493   1.00 10.00 ? ? ? ? ? ? 373 LYS B CE  1 
ATOM 5816  N NZ  . LYS B 1 372 ? 30.011  1.718   98.578   1.00 10.00 ? ? ? ? ? ? 373 LYS B NZ  1 
ATOM 5817  N N   . CYS B 1 373 ? 23.063  1.855   96.072   1.00 10.00 ? ? ? ? ? ? 374 CYS B N   1 
ATOM 5818  C CA  . CYS B 1 373 ? 22.291  2.996   95.619   1.00 10.00 ? ? ? ? ? ? 374 CYS B CA  1 
ATOM 5819  C C   . CYS B 1 373 ? 20.852  2.871   96.164   1.00 10.00 ? ? ? ? ? ? 374 CYS B C   1 
ATOM 5820  O O   . CYS B 1 373 ? 19.901  2.636   95.391   1.00 10.00 ? ? ? ? ? ? 374 CYS B O   1 
ATOM 5821  C CB  . CYS B 1 373 ? 22.415  3.008   94.071   1.00 10.00 ? ? ? ? ? ? 374 CYS B CB  1 
ATOM 5822  S SG  . CYS B 1 373 ? 24.139  3.062   93.417   1.00 10.00 ? ? ? ? ? ? 374 CYS B SG  1 
ATOM 5823  N N   . PHE B 1 374 ? 20.853  2.795   97.561   1.00 10.00 ? ? ? ? ? ? 375 PHE B N   1 
ATOM 5824  C CA  . PHE B 1 374 ? 19.809  2.831   98.653   1.00 10.00 ? ? ? ? ? ? 375 PHE B CA  1 
ATOM 5825  C C   . PHE B 1 374 ? 19.693  2.059   99.998   1.00 10.00 ? ? ? ? ? ? 375 PHE B C   1 
ATOM 5826  O O   . PHE B 1 374 ? 18.747  2.241   100.798  1.00 10.00 ? ? ? ? ? ? 375 PHE B O   1 
ATOM 5827  C CB  . PHE B 1 374 ? 18.470  2.732   97.981   1.00 10.00 ? ? ? ? ? ? 375 PHE B CB  1 
ATOM 5828  C CG  . PHE B 1 374 ? 18.081  4.195   97.838   1.00 10.00 ? ? ? ? ? ? 375 PHE B CG  1 
ATOM 5829  C CD1 . PHE B 1 374 ? 19.035  5.203   97.783   1.00 10.00 ? ? ? ? ? ? 375 PHE B CD1 1 
ATOM 5830  C CD2 . PHE B 1 374 ? 16.737  4.488   97.759   1.00 10.00 ? ? ? ? ? ? 375 PHE B CD2 1 
ATOM 5831  C CE1 . PHE B 1 374 ? 18.652  6.486   97.649   1.00 10.00 ? ? ? ? ? ? 375 PHE B CE1 1 
ATOM 5832  C CE2 . PHE B 1 374 ? 16.351  5.792   97.619   1.00 10.00 ? ? ? ? ? ? 375 PHE B CE2 1 
ATOM 5833  C CZ  . PHE B 1 374 ? 17.311  6.789   97.566   1.00 10.00 ? ? ? ? ? ? 375 PHE B CZ  1 
ATOM 5834  O OXT . PHE B 1 374 ? 20.690  1.446   100.339  1.00 10.00 ? ? ? ? ? ? 375 PHE B OXT 1 
ATOM 5835  N N   . ASP C 1 1   ? -42.763 -11.557 64.503   1.00 10.00 ? ? ? ? ? ? 2   ASP C N   1 
ATOM 5836  C CA  . ASP C 1 1   ? -43.049 -12.645 63.535   1.00 10.00 ? ? ? ? ? ? 2   ASP C CA  1 
ATOM 5837  C C   . ASP C 1 1   ? -43.092 -12.278 62.010   1.00 10.00 ? ? ? ? ? ? 2   ASP C C   1 
ATOM 5838  O O   . ASP C 1 1   ? -44.114 -12.001 61.361   1.00 10.00 ? ? ? ? ? ? 2   ASP C O   1 
ATOM 5839  C CB  . ASP C 1 1   ? -44.367 -13.338 64.031   1.00 10.00 ? ? ? ? ? ? 2   ASP C CB  1 
ATOM 5840  C CG  . ASP C 1 1   ? -44.506 -13.690 65.544   1.00 10.00 ? ? ? ? ? ? 2   ASP C CG  1 
ATOM 5841  O OD1 . ASP C 1 1   ? -43.501 -13.554 66.273   1.00 10.00 ? ? ? ? ? ? 2   ASP C OD1 1 
ATOM 5842  O OD2 . ASP C 1 1   ? -45.609 -14.099 65.988   1.00 10.00 ? ? ? ? ? ? 2   ASP C OD2 1 
ATOM 5843  N N   . ASP C 1 2   ? -41.855 -12.287 61.462   1.00 10.00 ? ? ? ? ? ? 3   ASP C N   1 
ATOM 5844  C CA  . ASP C 1 2   ? -41.439 -12.012 60.070   1.00 10.00 ? ? ? ? ? ? 3   ASP C CA  1 
ATOM 5845  C C   . ASP C 1 2   ? -41.585 -10.570 59.643   1.00 10.00 ? ? ? ? ? ? 3   ASP C C   1 
ATOM 5846  O O   . ASP C 1 2   ? -40.663 -9.908  59.158   1.00 10.00 ? ? ? ? ? ? 3   ASP C O   1 
ATOM 5847  C CB  . ASP C 1 2   ? -42.203 -12.866 58.996   1.00 10.00 ? ? ? ? ? ? 3   ASP C CB  1 
ATOM 5848  C CG  . ASP C 1 2   ? -41.876 -12.597 57.488   1.00 10.00 ? ? ? ? ? ? 3   ASP C CG  1 
ATOM 5849  O OD1 . ASP C 1 2   ? -40.866 -11.929 57.154   1.00 10.00 ? ? ? ? ? ? 3   ASP C OD1 1 
ATOM 5850  O OD2 . ASP C 1 2   ? -42.673 -13.058 56.632   1.00 10.00 ? ? ? ? ? ? 3   ASP C OD2 1 
ATOM 5851  N N   . ASP C 1 3   ? -42.805 -10.110 59.677   1.00 10.00 ? ? ? ? ? ? 4   ASP C N   1 
ATOM 5852  C CA  . ASP C 1 3   ? -43.061 -8.760  59.301   1.00 10.00 ? ? ? ? ? ? 4   ASP C CA  1 
ATOM 5853  C C   . ASP C 1 3   ? -43.161 -8.323  60.737   1.00 10.00 ? ? ? ? ? ? 4   ASP C C   1 
ATOM 5854  O O   . ASP C 1 3   ? -43.960 -8.779  61.572   1.00 10.00 ? ? ? ? ? ? 4   ASP C O   1 
ATOM 5855  C CB  . ASP C 1 3   ? -44.351 -8.737  58.489   1.00 10.00 ? ? ? ? ? ? 4   ASP C CB  1 
ATOM 5856  C CG  . ASP C 1 3   ? -44.141 -8.675  56.967   1.00 10.00 ? ? ? ? ? ? 4   ASP C CG  1 
ATOM 5857  O OD1 . ASP C 1 3   ? -42.986 -8.637  56.483   1.00 10.00 ? ? ? ? ? ? 4   ASP C OD1 1 
ATOM 5858  O OD2 . ASP C 1 3   ? -45.171 -8.639  56.273   1.00 10.00 ? ? ? ? ? ? 4   ASP C OD2 1 
ATOM 5859  N N   . ILE C 1 4   ? -41.936 -7.808  60.863   1.00 10.00 ? ? ? ? ? ? 5   ILE C N   1 
ATOM 5860  C CA  . ILE C 1 4   ? -41.297 -7.191  61.998   1.00 10.00 ? ? ? ? ? ? 5   ILE C CA  1 
ATOM 5861  C C   . ILE C 1 4   ? -40.551 -8.153  62.892   1.00 10.00 ? ? ? ? ? ? 5   ILE C C   1 
ATOM 5862  O O   . ILE C 1 4   ? -40.899 -9.218  63.414   1.00 10.00 ? ? ? ? ? ? 5   ILE C O   1 
ATOM 5863  C CB  . ILE C 1 4   ? -42.293 -6.318  62.789   1.00 10.00 ? ? ? ? ? ? 5   ILE C CB  1 
ATOM 5864  C CG1 . ILE C 1 4   ? -42.200 -5.020  61.952   1.00 10.00 ? ? ? ? ? ? 5   ILE C CG1 1 
ATOM 5865  C CG2 . ILE C 1 4   ? -42.028 -6.091  64.289   1.00 10.00 ? ? ? ? ? ? 5   ILE C CG2 1 
ATOM 5866  C CD1 . ILE C 1 4   ? -40.747 -4.466  61.762   1.00 10.00 ? ? ? ? ? ? 5   ILE C CD1 1 
ATOM 5867  N N   . ALA C 1 5   ? -39.377 -7.690  62.462   1.00 10.00 ? ? ? ? ? ? 6   ALA C N   1 
ATOM 5868  C CA  . ALA C 1 5   ? -38.088 -8.291  62.647   1.00 10.00 ? ? ? ? ? ? 6   ALA C CA  1 
ATOM 5869  C C   . ALA C 1 5   ? -37.218 -7.296  61.865   1.00 10.00 ? ? ? ? ? ? 6   ALA C C   1 
ATOM 5870  O O   . ALA C 1 5   ? -37.599 -6.741  60.806   1.00 10.00 ? ? ? ? ? ? 6   ALA C O   1 
ATOM 5871  C CB  . ALA C 1 5   ? -37.946 -9.656  61.940   1.00 10.00 ? ? ? ? ? ? 6   ALA C CB  1 
ATOM 5872  N N   . ALA C 1 6   ? -36.088 -7.010  62.497   1.00 10.00 ? ? ? ? ? ? 7   ALA C N   1 
ATOM 5873  C CA  . ALA C 1 6   ? -35.027 -6.241  61.928   1.00 10.00 ? ? ? ? ? ? 7   ALA C CA  1 
ATOM 5874  C C   . ALA C 1 6   ? -34.443 -7.097  60.805   1.00 10.00 ? ? ? ? ? ? 7   ALA C C   1 
ATOM 5875  O O   . ALA C 1 6   ? -34.594 -8.327  60.778   1.00 10.00 ? ? ? ? ? ? 7   ALA C O   1 
ATOM 5876  C CB  . ALA C 1 6   ? -34.011 -6.001  63.018   1.00 10.00 ? ? ? ? ? ? 7   ALA C CB  1 
ATOM 5877  N N   . LEU C 1 7   ? -33.776 -6.474  59.855   1.00 10.00 ? ? ? ? ? ? 8   LEU C N   1 
ATOM 5878  C CA  . LEU C 1 7   ? -33.121 -7.190  58.779   1.00 10.00 ? ? ? ? ? ? 8   LEU C CA  1 
ATOM 5879  C C   . LEU C 1 7   ? -31.647 -7.183  59.149   1.00 10.00 ? ? ? ? ? ? 8   LEU C C   1 
ATOM 5880  O O   . LEU C 1 7   ? -31.117 -6.066  59.339   1.00 10.00 ? ? ? ? ? ? 8   LEU C O   1 
ATOM 5881  C CB  . LEU C 1 7   ? -33.253 -6.461  57.454   1.00 10.00 ? ? ? ? ? ? 8   LEU C CB  1 
ATOM 5882  C CG  . LEU C 1 7   ? -34.516 -5.718  57.092   1.00 10.00 ? ? ? ? ? ? 8   LEU C CG  1 
ATOM 5883  C CD1 . LEU C 1 7   ? -34.312 -5.051  55.759   1.00 10.00 ? ? ? ? ? ? 8   LEU C CD1 1 
ATOM 5884  C CD2 . LEU C 1 7   ? -35.674 -6.650  57.064   1.00 10.00 ? ? ? ? ? ? 8   LEU C CD2 1 
ATOM 5885  N N   . VAL C 1 8   ? -30.943 -8.300  59.320   1.00 10.00 ? ? ? ? ? ? 9   VAL C N   1 
ATOM 5886  C CA  . VAL C 1 8   ? -29.517 -8.176  59.580   1.00 10.00 ? ? ? ? ? ? 9   VAL C CA  1 
ATOM 5887  C C   . VAL C 1 8   ? -28.784 -8.089  58.221   1.00 10.00 ? ? ? ? ? ? 9   VAL C C   1 
ATOM 5888  O O   . VAL C 1 8   ? -29.011 -8.940  57.350   1.00 10.00 ? ? ? ? ? ? 9   VAL C O   1 
ATOM 5889  C CB  . VAL C 1 8   ? -29.010 -9.389  60.366   1.00 10.00 ? ? ? ? ? ? 9   VAL C CB  1 
ATOM 5890  C CG1 . VAL C 1 8   ? -27.634 -9.005  60.959   1.00 10.00 ? ? ? ? ? ? 9   VAL C CG1 1 
ATOM 5891  C CG2 . VAL C 1 8   ? -29.961 -9.806  61.434   1.00 10.00 ? ? ? ? ? ? 9   VAL C CG2 1 
ATOM 5892  N N   . VAL C 1 9   ? -27.904 -7.143  57.929   1.00 10.00 ? ? ? ? ? ? 10  VAL C N   1 
ATOM 5893  C CA  . VAL C 1 9   ? -27.190 -7.035  56.660   1.00 10.00 ? ? ? ? ? ? 10  VAL C CA  1 
ATOM 5894  C C   . VAL C 1 9   ? -25.725 -7.118  57.084   1.00 10.00 ? ? ? ? ? ? 10  VAL C C   1 
ATOM 5895  O O   . VAL C 1 9   ? -25.193 -6.282  57.856   1.00 10.00 ? ? ? ? ? ? 10  VAL C O   1 
ATOM 5896  C CB  . VAL C 1 9   ? -27.489 -5.659  55.976   1.00 10.00 ? ? ? ? ? ? 10  VAL C CB  1 
ATOM 5897  C CG1 . VAL C 1 9   ? -26.619 -5.392  54.786   1.00 10.00 ? ? ? ? ? ? 10  VAL C CG1 1 
ATOM 5898  C CG2 . VAL C 1 9   ? -28.903 -5.661  55.451   1.00 10.00 ? ? ? ? ? ? 10  VAL C CG2 1 
ATOM 5899  N N   . ASP C 1 10  ? -25.050 -8.162  56.611   1.00 10.00 ? ? ? ? ? ? 11  ASP C N   1 
ATOM 5900  C CA  . ASP C 1 10  ? -23.650 -8.309  56.921   1.00 10.00 ? ? ? ? ? ? 11  ASP C CA  1 
ATOM 5901  C C   . ASP C 1 10  ? -22.947 -7.990  55.651   1.00 10.00 ? ? ? ? ? ? 11  ASP C C   1 
ATOM 5902  O O   . ASP C 1 10  ? -23.222 -8.631  54.650   1.00 10.00 ? ? ? ? ? ? 11  ASP C O   1 
ATOM 5903  C CB  . ASP C 1 10  ? -23.329 -9.721  57.358   1.00 10.00 ? ? ? ? ? ? 11  ASP C CB  1 
ATOM 5904  C CG  . ASP C 1 10  ? -21.857 -9.961  57.677   1.00 10.00 ? ? ? ? ? ? 11  ASP C CG  1 
ATOM 5905  O OD1 . ASP C 1 10  ? -21.058 -9.045  57.861   1.00 10.00 ? ? ? ? ? ? 11  ASP C OD1 1 
ATOM 5906  O OD2 . ASP C 1 10  ? -21.511 -11.118 57.731   1.00 10.00 ? ? ? ? ? ? 11  ASP C OD2 1 
ATOM 5907  N N   . ASN C 1 11  ? -22.057 -7.011  55.713   1.00 10.00 ? ? ? ? ? ? 12  ASN C N   1 
ATOM 5908  C CA  . ASN C 1 11  ? -21.358 -6.444  54.549   1.00 10.00 ? ? ? ? ? ? 12  ASN C CA  1 
ATOM 5909  C C   . ASN C 1 11  ? -19.931 -6.862  54.485   1.00 10.00 ? ? ? ? ? ? 12  ASN C C   1 
ATOM 5910  O O   . ASN C 1 11  ? -19.088 -6.260  55.179   1.00 10.00 ? ? ? ? ? ? 12  ASN C O   1 
ATOM 5911  C CB  . ASN C 1 11  ? -21.278 -4.930  54.525   1.00 10.00 ? ? ? ? ? ? 12  ASN C CB  1 
ATOM 5912  C CG  . ASN C 1 11  ? -22.665 -4.390  54.589   1.00 10.00 ? ? ? ? ? ? 12  ASN C CG  1 
ATOM 5913  O OD1 . ASN C 1 11  ? -23.384 -4.370  53.586   1.00 10.00 ? ? ? ? ? ? 12  ASN C OD1 1 
ATOM 5914  N ND2 . ASN C 1 11  ? -23.061 -4.019  55.813   1.00 10.00 ? ? ? ? ? ? 12  ASN C ND2 1 
ATOM 5915  N N   . GLY C 1 12  ? -19.748 -7.945  53.729   1.00 10.00 ? ? ? ? ? ? 13  GLY C N   1 
ATOM 5916  C CA  . GLY C 1 12  ? -18.435 -8.484  53.510   1.00 10.00 ? ? ? ? ? ? 13  GLY C CA  1 
ATOM 5917  C C   . GLY C 1 12  ? -17.854 -8.027  52.178   1.00 10.00 ? ? ? ? ? ? 13  GLY C C   1 
ATOM 5918  O O   . GLY C 1 12  ? -18.551 -7.719  51.193   1.00 10.00 ? ? ? ? ? ? 13  GLY C O   1 
ATOM 5919  N N   . SER C 1 13  ? -16.518 -8.005  52.254   1.00 10.00 ? ? ? ? ? ? 14  SER C N   1 
ATOM 5920  C CA  . SER C 1 13  ? -15.617 -7.764  51.147   1.00 10.00 ? ? ? ? ? ? 14  SER C CA  1 
ATOM 5921  C C   . SER C 1 13  ? -15.839 -8.724  49.961   1.00 10.00 ? ? ? ? ? ? 14  SER C C   1 
ATOM 5922  O O   . SER C 1 13  ? -15.773 -8.352  48.802   1.00 10.00 ? ? ? ? ? ? 14  SER C O   1 
ATOM 5923  C CB  . SER C 1 13  ? -14.195 -7.905  51.656   1.00 10.00 ? ? ? ? ? ? 14  SER C CB  1 
ATOM 5924  O OG  . SER C 1 13  ? -13.862 -7.064  52.759   1.00 10.00 ? ? ? ? ? ? 14  SER C OG  1 
ATOM 5925  N N   . GLY C 1 14  ? -16.056 -9.997  50.195   1.00 10.00 ? ? ? ? ? ? 15  GLY C N   1 
ATOM 5926  C CA  . GLY C 1 14  ? -16.342 -10.900 49.117   1.00 10.00 ? ? ? ? ? ? 15  GLY C CA  1 
ATOM 5927  C C   . GLY C 1 14  ? -17.805 -11.256 48.987   1.00 10.00 ? ? ? ? ? ? 15  GLY C C   1 
ATOM 5928  O O   . GLY C 1 14  ? -18.294 -11.379 47.864   1.00 10.00 ? ? ? ? ? ? 15  GLY C O   1 
ATOM 5929  N N   . MET C 1 15  ? -18.506 -11.332 50.115   1.00 10.00 ? ? ? ? ? ? 16  MET C N   1 
ATOM 5930  C CA  . MET C 1 15  ? -19.865 -11.820 50.241   1.00 10.00 ? ? ? ? ? ? 16  MET C CA  1 
ATOM 5931  C C   . MET C 1 15  ? -20.757 -10.951 51.142   1.00 10.00 ? ? ? ? ? ? 16  MET C C   1 
ATOM 5932  O O   . MET C 1 15  ? -20.308 -10.384 52.132   1.00 10.00 ? ? ? ? ? ? 16  MET C O   1 
ATOM 5933  C CB  . MET C 1 15  ? -19.797 -13.225 50.810   1.00 10.00 ? ? ? ? ? ? 16  MET C CB  1 
ATOM 5934  C CG  . MET C 1 15  ? -19.156 -14.330 50.010   1.00 10.00 ? ? ? ? ? ? 16  MET C CG  1 
ATOM 5935  S SD  . MET C 1 15  ? -20.053 -14.500 48.433   1.00 10.00 ? ? ? ? ? ? 16  MET C SD  1 
ATOM 5936  C CE  . MET C 1 15  ? -21.499 -15.466 48.772   1.00 10.00 ? ? ? ? ? ? 16  MET C CE  1 
ATOM 5937  N N   . CYS C 1 16  ? -22.047 -10.821 50.869   1.00 10.00 ? ? ? ? ? ? 17  CYS C N   1 
ATOM 5938  C CA  . CYS C 1 16  ? -22.986 -10.102 51.713   1.00 10.00 ? ? ? ? ? ? 17  CYS C CA  1 
ATOM 5939  C C   . CYS C 1 16  ? -23.991 -11.156 52.104   1.00 10.00 ? ? ? ? ? ? 17  CYS C C   1 
ATOM 5940  O O   . CYS C 1 16  ? -24.318 -11.993 51.264   1.00 10.00 ? ? ? ? ? ? 17  CYS C O   1 
ATOM 5941  C CB  . CYS C 1 16  ? -23.788 -8.984  50.995   1.00 10.00 ? ? ? ? ? ? 17  CYS C CB  1 
ATOM 5942  S SG  . CYS C 1 16  ? -22.978 -7.415  50.542   1.00 10.00 ? ? ? ? ? ? 17  CYS C SG  1 
ATOM 5943  N N   . LYS C 1 17  ? -24.513 -11.171 53.320   1.00 10.00 ? ? ? ? ? ? 18  LYS C N   1 
ATOM 5944  C CA  . LYS C 1 17  ? -25.503 -12.141 53.775   1.00 10.00 ? ? ? ? ? ? 18  LYS C CA  1 
ATOM 5945  C C   . LYS C 1 17  ? -26.517 -11.246 54.481   1.00 10.00 ? ? ? ? ? ? 18  LYS C C   1 
ATOM 5946  O O   . LYS C 1 17  ? -26.155 -10.321 55.224   1.00 10.00 ? ? ? ? ? ? 18  LYS C O   1 
ATOM 5947  C CB  . LYS C 1 17  ? -24.939 -13.187 54.803   1.00 10.00 ? ? ? ? ? ? 18  LYS C CB  1 
ATOM 5948  C CG  . LYS C 1 17  ? -23.444 -13.241 55.215   1.00 10.00 ? ? ? ? ? ? 18  LYS C CG  1 
ATOM 5949  C CD  . LYS C 1 17  ? -22.440 -13.668 54.141   1.00 10.00 ? ? ? ? ? ? 18  LYS C CD  1 
ATOM 5950  C CE  . LYS C 1 17  ? -20.992 -13.567 54.580   1.00 10.00 ? ? ? ? ? ? 18  LYS C CE  1 
ATOM 5951  N NZ  . LYS C 1 17  ? -20.564 -12.200 54.441   1.00 10.00 ? ? ? ? ? ? 18  LYS C NZ  1 
ATOM 5952  N N   . ALA C 1 18  ? -27.796 -11.431 54.154   1.00 10.00 ? ? ? ? ? ? 19  ALA C N   1 
ATOM 5953  C CA  . ALA C 1 18  ? -28.878 -10.587 54.620   1.00 10.00 ? ? ? ? ? ? 19  ALA C CA  1 
ATOM 5954  C C   . ALA C 1 18  ? -30.101 -11.409 54.940   1.00 10.00 ? ? ? ? ? ? 19  ALA C C   1 
ATOM 5955  O O   . ALA C 1 18  ? -30.448 -12.358 54.241   1.00 10.00 ? ? ? ? ? ? 19  ALA C O   1 
ATOM 5956  C CB  . ALA C 1 18  ? -29.283 -9.589  53.590   1.00 10.00 ? ? ? ? ? ? 19  ALA C CB  1 
ATOM 5957  N N   . GLY C 1 19  ? -30.752 -11.130 56.040   1.00 10.00 ? ? ? ? ? ? 20  GLY C N   1 
ATOM 5958  C CA  . GLY C 1 19  ? -31.891 -11.926 56.410   1.00 10.00 ? ? ? ? ? ? 20  GLY C CA  1 
ATOM 5959  C C   . GLY C 1 19  ? -32.688 -11.230 57.483   1.00 10.00 ? ? ? ? ? ? 20  GLY C C   1 
ATOM 5960  O O   . GLY C 1 19  ? -32.587 -10.010 57.701   1.00 10.00 ? ? ? ? ? ? 20  GLY C O   1 
ATOM 5961  N N   . PHE C 1 20  ? -33.420 -12.077 58.184   1.00 10.00 ? ? ? ? ? ? 21  PHE C N   1 
ATOM 5962  C CA  . PHE C 1 20  ? -34.337 -11.564 59.152   1.00 10.00 ? ? ? ? ? ? 21  PHE C CA  1 
ATOM 5963  C C   . PHE C 1 20  ? -33.957 -12.068 60.523   1.00 10.00 ? ? ? ? ? ? 21  PHE C C   1 
ATOM 5964  O O   . PHE C 1 20  ? -33.617 -13.244 60.714   1.00 10.00 ? ? ? ? ? ? 21  PHE C O   1 
ATOM 5965  C CB  . PHE C 1 20  ? -35.754 -11.995 58.788   1.00 10.00 ? ? ? ? ? ? 21  PHE C CB  1 
ATOM 5966  C CG  . PHE C 1 20  ? -36.357 -11.347 57.552   1.00 10.00 ? ? ? ? ? ? 21  PHE C CG  1 
ATOM 5967  C CD1 . PHE C 1 20  ? -36.019 -10.090 57.122   1.00 10.00 ? ? ? ? ? ? 21  PHE C CD1 1 
ATOM 5968  C CD2 . PHE C 1 20  ? -37.258 -12.042 56.793   1.00 10.00 ? ? ? ? ? ? 21  PHE C CD2 1 
ATOM 5969  C CE1 . PHE C 1 20  ? -36.567 -9.562  55.959   1.00 10.00 ? ? ? ? ? ? 21  PHE C CE1 1 
ATOM 5970  C CE2 . PHE C 1 20  ? -37.804 -11.512 55.637   1.00 10.00 ? ? ? ? ? ? 21  PHE C CE2 1 
ATOM 5971  C CZ  . PHE C 1 20  ? -37.460 -10.264 55.211   1.00 10.00 ? ? ? ? ? ? 21  PHE C CZ  1 
ATOM 5972  N N   . ALA C 1 21  ? -33.989 -11.118 61.466   1.00 10.00 ? ? ? ? ? ? 22  ALA C N   1 
ATOM 5973  C CA  . ALA C 1 21  ? -33.672 -11.422 62.847   1.00 10.00 ? ? ? ? ? ? 22  ALA C CA  1 
ATOM 5974  C C   . ALA C 1 21  ? -34.733 -12.378 63.354   1.00 10.00 ? ? ? ? ? ? 22  ALA C C   1 
ATOM 5975  O O   . ALA C 1 21  ? -35.910 -12.305 62.980   1.00 10.00 ? ? ? ? ? ? 22  ALA C O   1 
ATOM 5976  C CB  . ALA C 1 21  ? -33.668 -10.167 63.694   1.00 10.00 ? ? ? ? ? ? 22  ALA C CB  1 
ATOM 5977  N N   . GLY C 1 22  ? -34.163 -13.335 64.108   1.00 10.00 ? ? ? ? ? ? 23  GLY C N   1 
ATOM 5978  C CA  . GLY C 1 22  ? -34.855 -14.488 64.635   1.00 10.00 ? ? ? ? ? ? 23  GLY C CA  1 
ATOM 5979  C C   . GLY C 1 22  ? -34.573 -15.715 63.780   1.00 10.00 ? ? ? ? ? ? 23  GLY C C   1 
ATOM 5980  O O   . GLY C 1 22  ? -35.028 -16.816 64.119   1.00 10.00 ? ? ? ? ? ? 23  GLY C O   1 
ATOM 5981  N N   . ASP C 1 23  ? -33.850 -15.593 62.657   1.00 10.00 ? ? ? ? ? ? 24  ASP C N   1 
ATOM 5982  C CA  . ASP C 1 23  ? -33.566 -16.731 61.788   1.00 10.00 ? ? ? ? ? ? 24  ASP C CA  1 
ATOM 5983  C C   . ASP C 1 23  ? -32.163 -17.314 61.964   1.00 10.00 ? ? ? ? ? ? 24  ASP C C   1 
ATOM 5984  O O   . ASP C 1 23  ? -31.110 -16.731 62.259   1.00 10.00 ? ? ? ? ? ? 24  ASP C O   1 
ATOM 5985  C CB  . ASP C 1 23  ? -33.695 -16.389 60.312   1.00 10.00 ? ? ? ? ? ? 24  ASP C CB  1 
ATOM 5986  C CG  . ASP C 1 23  ? -35.056 -16.044 59.707   1.00 10.00 ? ? ? ? ? ? 24  ASP C CG  1 
ATOM 5987  O OD1 . ASP C 1 23  ? -36.088 -16.481 60.193   1.00 10.00 ? ? ? ? ? ? 24  ASP C OD1 1 
ATOM 5988  O OD2 . ASP C 1 23  ? -35.086 -15.362 58.682   1.00 10.00 ? ? ? ? ? ? 24  ASP C OD2 1 
ATOM 5989  N N   . ASP C 1 24  ? -32.247 -18.602 61.731   1.00 10.00 ? ? ? ? ? ? 25  ASP C N   1 
ATOM 5990  C CA  . ASP C 1 24  ? -31.116 -19.492 61.777   1.00 10.00 ? ? ? ? ? ? 25  ASP C CA  1 
ATOM 5991  C C   . ASP C 1 24  ? -30.092 -19.192 60.668   1.00 10.00 ? ? ? ? ? ? 25  ASP C C   1 
ATOM 5992  O O   . ASP C 1 24  ? -28.907 -19.064 60.950   1.00 10.00 ? ? ? ? ? ? 25  ASP C O   1 
ATOM 5993  C CB  . ASP C 1 24  ? -31.768 -20.934 61.750   1.00 10.00 ? ? ? ? ? ? 25  ASP C CB  1 
ATOM 5994  C CG  . ASP C 1 24  ? -32.497 -21.335 63.080   1.00 10.00 ? ? ? ? ? ? 25  ASP C CG  1 
ATOM 5995  O OD1 . ASP C 1 24  ? -32.004 -21.006 64.157   1.00 10.00 ? ? ? ? ? ? 25  ASP C OD1 1 
ATOM 5996  O OD2 . ASP C 1 24  ? -33.538 -22.006 63.084   1.00 10.00 ? ? ? ? ? ? 25  ASP C OD2 1 
ATOM 5997  N N   . ALA C 1 25  ? -30.405 -19.002 59.393   1.00 10.00 ? ? ? ? ? ? 26  ALA C N   1 
ATOM 5998  C CA  . ALA C 1 25  ? -29.341 -18.746 58.417   1.00 10.00 ? ? ? ? ? ? 26  ALA C CA  1 
ATOM 5999  C C   . ALA C 1 25  ? -29.646 -17.544 57.544   1.00 10.00 ? ? ? ? ? ? 26  ALA C C   1 
ATOM 6000  O O   . ALA C 1 25  ? -30.809 -17.151 57.445   1.00 10.00 ? ? ? ? ? ? 26  ALA C O   1 
ATOM 6001  C CB  . ALA C 1 25  ? -29.183 -19.980 57.556   1.00 10.00 ? ? ? ? ? ? 26  ALA C CB  1 
ATOM 6002  N N   . PRO C 1 26  ? -28.695 -16.875 56.924   1.00 10.00 ? ? ? ? ? ? 27  PRO C N   1 
ATOM 6003  C CA  . PRO C 1 26  ? -28.942 -15.862 55.909   1.00 10.00 ? ? ? ? ? ? 27  PRO C CA  1 
ATOM 6004  C C   . PRO C 1 26  ? -29.905 -16.252 54.804   1.00 10.00 ? ? ? ? ? ? 27  PRO C C   1 
ATOM 6005  O O   . PRO C 1 26  ? -29.660 -17.312 54.226   1.00 10.00 ? ? ? ? ? ? 27  PRO C O   1 
ATOM 6006  C CB  . PRO C 1 26  ? -27.582 -15.535 55.361   1.00 10.00 ? ? ? ? ? ? 27  PRO C CB  1 
ATOM 6007  C CG  . PRO C 1 26  ? -26.749 -16.708 55.753   1.00 10.00 ? ? ? ? ? ? 27  PRO C CG  1 
ATOM 6008  C CD  . PRO C 1 26  ? -27.275 -17.007 57.151   1.00 10.00 ? ? ? ? ? ? 27  PRO C CD  1 
ATOM 6009  N N   . ARG C 1 27  ? -30.932 -15.462 54.456   1.00 10.00 ? ? ? ? ? ? 28  ARG C N   1 
ATOM 6010  C CA  . ARG C 1 27  ? -31.804 -15.794 53.336   1.00 10.00 ? ? ? ? ? ? 28  ARG C CA  1 
ATOM 6011  C C   . ARG C 1 27  ? -31.169 -15.421 52.012   1.00 10.00 ? ? ? ? ? ? 28  ARG C C   1 
ATOM 6012  O O   . ARG C 1 27  ? -31.492 -16.044 51.005   1.00 10.00 ? ? ? ? ? ? 28  ARG C O   1 
ATOM 6013  C CB  . ARG C 1 27  ? -33.149 -15.070 53.350   1.00 10.00 ? ? ? ? ? ? 28  ARG C CB  1 
ATOM 6014  C CG  . ARG C 1 27  ? -34.287 -15.575 54.218   1.00 10.00 ? ? ? ? ? ? 28  ARG C CG  1 
ATOM 6015  C CD  . ARG C 1 27  ? -35.003 -14.414 54.934   1.00 10.00 ? ? ? ? ? ? 28  ARG C CD  1 
ATOM 6016  N NE  . ARG C 1 27  ? -35.988 -14.935 55.886   1.00 10.00 ? ? ? ? ? ? 28  ARG C NE  1 
ATOM 6017  C CZ  . ARG C 1 27  ? -37.298 -15.074 55.573   1.00 10.00 ? ? ? ? ? ? 28  ARG C CZ  1 
ATOM 6018  N NH1 . ARG C 1 27  ? -37.779 -14.682 54.359   1.00 10.00 ? ? ? ? ? ? 28  ARG C NH1 1 
ATOM 6019  N NH2 . ARG C 1 27  ? -38.138 -15.563 56.515   1.00 10.00 ? ? ? ? ? ? 28  ARG C NH2 1 
ATOM 6020  N N   . ALA C 1 28  ? -30.340 -14.386 51.920   1.00 10.00 ? ? ? ? ? ? 29  ALA C N   1 
ATOM 6021  C CA  . ALA C 1 28  ? -29.740 -13.997 50.664   1.00 10.00 ? ? ? ? ? ? 29  ALA C CA  1 
ATOM 6022  C C   . ALA C 1 28  ? -28.261 -13.954 50.904   1.00 10.00 ? ? ? ? ? ? 29  ALA C C   1 
ATOM 6023  O O   . ALA C 1 28  ? -27.819 -13.124 51.721   1.00 10.00 ? ? ? ? ? ? 29  ALA C O   1 
ATOM 6024  C CB  . ALA C 1 28  ? -30.080 -12.616 50.227   1.00 10.00 ? ? ? ? ? ? 29  ALA C CB  1 
ATOM 6025  N N   . VAL C 1 29  ? -27.457 -14.826 50.279   1.00 10.00 ? ? ? ? ? ? 30  VAL C N   1 
ATOM 6026  C CA  . VAL C 1 29  ? -26.028 -14.636 50.422   1.00 10.00 ? ? ? ? ? ? 30  VAL C CA  1 
ATOM 6027  C C   . VAL C 1 29  ? -25.603 -14.169 49.036   1.00 10.00 ? ? ? ? ? ? 30  VAL C C   1 
ATOM 6028  O O   . VAL C 1 29  ? -26.101 -14.793 48.095   1.00 10.00 ? ? ? ? ? ? 30  VAL C O   1 
ATOM 6029  C CB  . VAL C 1 29  ? -25.488 -15.975 50.864   1.00 10.00 ? ? ? ? ? ? 30  VAL C CB  1 
ATOM 6030  C CG1 . VAL C 1 29  ? -24.014 -15.878 51.159   1.00 10.00 ? ? ? ? ? ? 30  VAL C CG1 1 
ATOM 6031  C CG2 . VAL C 1 29  ? -26.182 -16.386 52.137   1.00 10.00 ? ? ? ? ? ? 30  VAL C CG2 1 
ATOM 6032  N N   . PHE C 1 30  ? -24.857 -13.102 48.736   1.00 10.00 ? ? ? ? ? ? 31  PHE C N   1 
ATOM 6033  C CA  . PHE C 1 30  ? -24.541 -12.843 47.348   1.00 10.00 ? ? ? ? ? ? 31  PHE C CA  1 
ATOM 6034  C C   . PHE C 1 30  ? -23.181 -12.305 47.192   1.00 10.00 ? ? ? ? ? ? 31  PHE C C   1 
ATOM 6035  O O   . PHE C 1 30  ? -22.648 -11.876 48.197   1.00 10.00 ? ? ? ? ? ? 31  PHE C O   1 
ATOM 6036  C CB  . PHE C 1 30  ? -25.450 -11.845 46.653   1.00 10.00 ? ? ? ? ? ? 31  PHE C CB  1 
ATOM 6037  C CG  . PHE C 1 30  ? -25.990 -10.676 47.436   1.00 10.00 ? ? ? ? ? ? 31  PHE C CG  1 
ATOM 6038  C CD1 . PHE C 1 30  ? -27.055 -10.879 48.299   1.00 10.00 ? ? ? ? ? ? 31  PHE C CD1 1 
ATOM 6039  C CD2 . PHE C 1 30  ? -25.430 -9.424  47.282   1.00 10.00 ? ? ? ? ? ? 31  PHE C CD2 1 
ATOM 6040  C CE1 . PHE C 1 30  ? -27.578 -9.861  49.018   1.00 10.00 ? ? ? ? ? ? 31  PHE C CE1 1 
ATOM 6041  C CE2 . PHE C 1 30  ? -25.968 -8.389  48.021   1.00 10.00 ? ? ? ? ? ? 31  PHE C CE2 1 
ATOM 6042  C CZ  . PHE C 1 30  ? -27.028 -8.624  48.872   1.00 10.00 ? ? ? ? ? ? 31  PHE C CZ  1 
ATOM 6043  N N   . PRO C 1 31  ? -22.556 -12.411 46.010   1.00 10.00 ? ? ? ? ? ? 32  PRO C N   1 
ATOM 6044  C CA  . PRO C 1 31  ? -21.327 -11.714 45.617   1.00 10.00 ? ? ? ? ? ? 32  PRO C CA  1 
ATOM 6045  C C   . PRO C 1 31  ? -21.284 -10.189 45.826   1.00 10.00 ? ? ? ? ? ? 32  PRO C C   1 
ATOM 6046  O O   . PRO C 1 31  ? -22.210 -9.481  45.366   1.00 10.00 ? ? ? ? ? ? 32  PRO C O   1 
ATOM 6047  C CB  . PRO C 1 31  ? -21.182 -12.160 44.152   1.00 10.00 ? ? ? ? ? ? 32  PRO C CB  1 
ATOM 6048  C CG  . PRO C 1 31  ? -21.622 -13.602 44.169   1.00 10.00 ? ? ? ? ? ? 32  PRO C CG  1 
ATOM 6049  C CD  . PRO C 1 31  ? -22.835 -13.491 45.046   1.00 10.00 ? ? ? ? ? ? 32  PRO C CD  1 
ATOM 6050  N N   . SER C 1 32  ? -20.245 -9.624  46.481   1.00 10.00 ? ? ? ? ? ? 33  SER C N   1 
ATOM 6051  C CA  . SER C 1 32  ? -20.211 -8.166  46.646   1.00 10.00 ? ? ? ? ? ? 33  SER C CA  1 
ATOM 6052  C C   . SER C 1 32  ? -19.526 -7.414  45.493   1.00 10.00 ? ? ? ? ? ? 33  SER C C   1 
ATOM 6053  O O   . SER C 1 32  ? -18.436 -6.825  45.574   1.00 10.00 ? ? ? ? ? ? 33  SER C O   1 
ATOM 6054  C CB  . SER C 1 32  ? -19.523 -7.741  47.983   1.00 10.00 ? ? ? ? ? ? 33  SER C CB  1 
ATOM 6055  O OG  . SER C 1 32  ? -20.376 -7.814  49.127   1.00 10.00 ? ? ? ? ? ? 33  SER C OG  1 
ATOM 6056  N N   . ILE C 1 33  ? -24.755 -3.153  41.527   1.00 10.00 ? ? ? ? ? ? 34  ILE C N   1 
ATOM 6057  C CA  . ILE C 1 33  ? -24.769 -1.933  40.761   1.00 10.00 ? ? ? ? ? ? 34  ILE C CA  1 
ATOM 6058  C C   . ILE C 1 33  ? -25.441 -2.093  39.389   1.00 10.00 ? ? ? ? ? ? 34  ILE C C   1 
ATOM 6059  O O   . ILE C 1 33  ? -25.505 -3.213  38.842   1.00 10.00 ? ? ? ? ? ? 34  ILE C O   1 
ATOM 6060  C CB  . ILE C 1 33  ? -23.315 -1.399  40.592   1.00 10.00 ? ? ? ? ? ? 34  ILE C CB  1 
ATOM 6061  C CG1 . ILE C 1 33  ? -22.227 -1.955  41.514   1.00 10.00 ? ? ? ? ? ? 34  ILE C CG1 1 
ATOM 6062  C CG2 . ILE C 1 33  ? -23.449 0.052   41.013   1.00 10.00 ? ? ? ? ? ? 34  ILE C CG2 1 
ATOM 6063  C CD1 . ILE C 1 33  ? -21.546 -3.123  40.832   1.00 10.00 ? ? ? ? ? ? 34  ILE C CD1 1 
ATOM 6064  N N   . VAL C 1 34  ? -26.054 -0.987  38.919   1.00 10.00 ? ? ? ? ? ? 35  VAL C N   1 
ATOM 6065  C CA  . VAL C 1 34  ? -26.634 -0.834  37.576   1.00 10.00 ? ? ? ? ? ? 35  VAL C CA  1 
ATOM 6066  C C   . VAL C 1 34  ? -25.715 0.164   36.905   1.00 10.00 ? ? ? ? ? ? 35  VAL C C   1 
ATOM 6067  O O   . VAL C 1 34  ? -25.451 1.250   37.450   1.00 10.00 ? ? ? ? ? ? 35  VAL C O   1 
ATOM 6068  C CB  . VAL C 1 34  ? -28.057 -0.218  37.572   1.00 10.00 ? ? ? ? ? ? 35  VAL C CB  1 
ATOM 6069  C CG1 . VAL C 1 34  ? -28.443 0.244   36.188   1.00 10.00 ? ? ? ? ? ? 35  VAL C CG1 1 
ATOM 6070  C CG2 . VAL C 1 34  ? -29.089 -1.286  37.934   1.00 10.00 ? ? ? ? ? ? 35  VAL C CG2 1 
ATOM 6071  N N   . GLY C 1 35  ? -25.251 -0.123  35.702   1.00 10.00 ? ? ? ? ? ? 36  GLY C N   1 
ATOM 6072  C CA  . GLY C 1 35  ? -24.334 0.787   35.051   1.00 10.00 ? ? ? ? ? ? 36  GLY C CA  1 
ATOM 6073  C C   . GLY C 1 35  ? -24.837 1.208   33.699   1.00 10.00 ? ? ? ? ? ? 36  GLY C C   1 
ATOM 6074  O O   . GLY C 1 35  ? -24.979 0.363   32.807   1.00 10.00 ? ? ? ? ? ? 36  GLY C O   1 
ATOM 6075  N N   . ARG C 1 36  ? -25.136 2.489   33.528   1.00 10.00 ? ? ? ? ? ? 37  ARG C N   1 
ATOM 6076  C CA  . ARG C 1 36  ? -25.593 2.986   32.220   1.00 10.00 ? ? ? ? ? ? 37  ARG C CA  1 
ATOM 6077  C C   . ARG C 1 36  ? -24.416 3.728   31.538   1.00 10.00 ? ? ? ? ? ? 37  ARG C C   1 
ATOM 6078  O O   . ARG C 1 36  ? -23.665 4.464   32.181   1.00 10.00 ? ? ? ? ? ? 37  ARG C O   1 
ATOM 6079  C CB  . ARG C 1 36  ? -26.891 3.884   32.437   1.00 10.00 ? ? ? ? ? ? 37  ARG C CB  1 
ATOM 6080  C CG  . ARG C 1 36  ? -27.249 5.124   31.554   1.00 10.00 ? ? ? ? ? ? 37  ARG C CG  1 
ATOM 6081  C CD  . ARG C 1 36  ? -27.321 5.042   29.996   1.00 10.00 ? ? ? ? ? ? 37  ARG C CD  1 
ATOM 6082  N NE  . ARG C 1 36  ? -27.339 6.401   29.422   1.00 10.00 ? ? ? ? ? ? 37  ARG C NE  1 
ATOM 6083  C CZ  . ARG C 1 36  ? -26.825 6.799   28.222   1.00 10.00 ? ? ? ? ? ? 37  ARG C CZ  1 
ATOM 6084  N NH1 . ARG C 1 36  ? -26.207 5.968   27.351   1.00 10.00 ? ? ? ? ? ? 37  ARG C NH1 1 
ATOM 6085  N NH2 . ARG C 1 36  ? -26.907 8.111   27.911   1.00 10.00 ? ? ? ? ? ? 37  ARG C NH2 1 
ATOM 6086  N N   . PRO C 1 37  ? -24.153 3.461   30.246   1.00 10.00 ? ? ? ? ? ? 38  PRO C N   1 
ATOM 6087  C CA  . PRO C 1 37  ? -23.090 4.067   29.468   1.00 10.00 ? ? ? ? ? ? 38  PRO C CA  1 
ATOM 6088  C C   . PRO C 1 37  ? -22.827 5.540   29.579   1.00 10.00 ? ? ? ? ? ? 38  PRO C C   1 
ATOM 6089  O O   . PRO C 1 37  ? -21.674 5.877   29.396   1.00 10.00 ? ? ? ? ? ? 38  PRO C O   1 
ATOM 6090  C CB  . PRO C 1 37  ? -23.419 3.638   28.075   1.00 10.00 ? ? ? ? ? ? 38  PRO C CB  1 
ATOM 6091  C CG  . PRO C 1 37  ? -23.861 2.198   28.224   1.00 10.00 ? ? ? ? ? ? 38  PRO C CG  1 
ATOM 6092  C CD  . PRO C 1 37  ? -24.649 2.266   29.533   1.00 10.00 ? ? ? ? ? ? 38  PRO C CD  1 
ATOM 6093  N N   . ARG C 1 38  ? -23.741 6.478   29.866   1.00 10.00 ? ? ? ? ? ? 39  ARG C N   1 
ATOM 6094  C CA  . ARG C 1 38  ? -23.430 7.924   29.886   1.00 10.00 ? ? ? ? ? ? 39  ARG C CA  1 
ATOM 6095  C C   . ARG C 1 38  ? -22.581 8.381   28.663   1.00 10.00 ? ? ? ? ? ? 39  ARG C C   1 
ATOM 6096  O O   . ARG C 1 38  ? -21.666 9.226   28.717   1.00 10.00 ? ? ? ? ? ? 39  ARG C O   1 
ATOM 6097  C CB  . ARG C 1 38  ? -22.708 8.246   31.232   1.00 10.00 ? ? ? ? ? ? 39  ARG C CB  1 
ATOM 6098  C CG  . ARG C 1 38  ? -22.464 9.703   31.708   1.00 10.00 ? ? ? ? ? ? 39  ARG C CG  1 
ATOM 6099  C CD  . ARG C 1 38  ? -21.036 9.807   32.312   1.00 10.00 ? ? ? ? ? ? 39  ARG C CD  1 
ATOM 6100  N NE  . ARG C 1 38  ? -20.888 10.793  33.403   1.00 10.00 ? ? ? ? ? ? 39  ARG C NE  1 
ATOM 6101  C CZ  . ARG C 1 38  ? -19.762 11.510  33.615   1.00 10.00 ? ? ? ? ? ? 39  ARG C CZ  1 
ATOM 6102  N NH1 . ARG C 1 38  ? -18.676 11.392  32.840   1.00 10.00 ? ? ? ? ? ? 39  ARG C NH1 1 
ATOM 6103  N NH2 . ARG C 1 38  ? -19.725 12.360  34.643   1.00 10.00 ? ? ? ? ? ? 39  ARG C NH2 1 
ATOM 6104  N N   . HIS C 1 39  ? -22.891 7.680   27.546   1.00 10.00 ? ? ? ? ? ? 40  HIS C N   1 
ATOM 6105  C CA  . HIS C 1 39  ? -22.405 7.789   26.168   1.00 10.00 ? ? ? ? ? ? 40  HIS C CA  1 
ATOM 6106  C C   . HIS C 1 39  ? -23.046 6.602   25.510   1.00 10.00 ? ? ? ? ? ? 40  HIS C C   1 
ATOM 6107  O O   . HIS C 1 39  ? -22.666 5.482   25.846   1.00 10.00 ? ? ? ? ? ? 40  HIS C O   1 
ATOM 6108  C CB  . HIS C 1 39  ? -20.928 7.531   25.867   1.00 10.00 ? ? ? ? ? ? 40  HIS C CB  1 
ATOM 6109  C CG  . HIS C 1 39  ? -20.135 8.824   25.808   1.00 10.00 ? ? ? ? ? ? 40  HIS C CG  1 
ATOM 6110  N ND1 . HIS C 1 39  ? -18.902 9.040   26.251   1.00 10.00 ? ? ? ? ? ? 40  HIS C ND1 1 
ATOM 6111  C CD2 . HIS C 1 39  ? -20.637 10.023  25.390   1.00 10.00 ? ? ? ? ? ? 40  HIS C CD2 1 
ATOM 6112  C CE1 . HIS C 1 39  ? -18.651 10.316  26.155   1.00 10.00 ? ? ? ? ? ? 40  HIS C CE1 1 
ATOM 6113  N NE2 . HIS C 1 39  ? -19.700 10.894  25.631   1.00 10.00 ? ? ? ? ? ? 40  HIS C NE2 1 
ATOM 6114  N N   . GLN C 1 40  ? -24.070 6.849   24.679   1.00 10.00 ? ? ? ? ? ? 41  GLN C N   1 
ATOM 6115  C CA  . GLN C 1 40  ? -24.748 5.832   23.869   1.00 10.00 ? ? ? ? ? ? 41  GLN C CA  1 
ATOM 6116  C C   . GLN C 1 40  ? -23.722 4.754   23.486   1.00 10.00 ? ? ? ? ? ? 41  GLN C C   1 
ATOM 6117  O O   . GLN C 1 40  ? -22.704 5.015   22.799   1.00 10.00 ? ? ? ? ? ? 41  GLN C O   1 
ATOM 6118  C CB  . GLN C 1 40  ? -25.312 6.429   22.556   1.00 10.00 ? ? ? ? ? ? 41  GLN C CB  1 
ATOM 6119  C CG  . GLN C 1 40  ? -26.706 6.000   22.208   1.00 10.00 ? ? ? ? ? ? 41  GLN C CG  1 
ATOM 6120  C CD  . GLN C 1 40  ? -27.717 6.625   23.171   1.00 10.00 ? ? ? ? ? ? 41  GLN C CD  1 
ATOM 6121  O OE1 . GLN C 1 40  ? -28.168 6.061   24.189   1.00 10.00 ? ? ? ? ? ? 41  GLN C OE1 1 
ATOM 6122  N NE2 . GLN C 1 40  ? -28.057 7.864   22.828   1.00 10.00 ? ? ? ? ? ? 41  GLN C NE2 1 
ATOM 6123  N N   . GLY C 1 41  ? -24.001 3.622   24.132   1.00 10.00 ? ? ? ? ? ? 42  GLY C N   1 
ATOM 6124  C CA  . GLY C 1 41  ? -23.173 2.459   23.968   1.00 10.00 ? ? ? ? ? ? 42  GLY C CA  1 
ATOM 6125  C C   . GLY C 1 41  ? -24.025 1.365   23.366   1.00 10.00 ? ? ? ? ? ? 42  GLY C C   1 
ATOM 6126  O O   . GLY C 1 41  ? -25.190 1.599   22.990   1.00 10.00 ? ? ? ? ? ? 42  GLY C O   1 
ATOM 6127  N N   . VAL C 1 42  ? -23.310 0.211   23.312   1.00 10.00 ? ? ? ? ? ? 43  VAL C N   1 
ATOM 6128  C CA  . VAL C 1 42  ? -23.684 -1.187  22.916   1.00 10.00 ? ? ? ? ? ? 43  VAL C CA  1 
ATOM 6129  C C   . VAL C 1 42  ? -22.677 -1.896  21.980   1.00 10.00 ? ? ? ? ? ? 43  VAL C C   1 
ATOM 6130  O O   . VAL C 1 42  ? -22.257 -1.447  20.890   1.00 10.00 ? ? ? ? ? ? 43  VAL C O   1 
ATOM 6131  C CB  . VAL C 1 42  ? -25.142 -1.292  22.252   1.00 10.00 ? ? ? ? ? ? 43  VAL C CB  1 
ATOM 6132  C CG1 . VAL C 1 42  ? -25.502 -2.559  21.461   1.00 10.00 ? ? ? ? ? ? 43  VAL C CG1 1 
ATOM 6133  C CG2 . VAL C 1 42  ? -26.032 -1.264  23.468   1.00 10.00 ? ? ? ? ? ? 43  VAL C CG2 1 
ATOM 6134  N N   . MET C 1 43  ? -22.236 -3.028  22.530   1.00 10.00 ? ? ? ? ? ? 44  MET C N   1 
ATOM 6135  C CA  . MET C 1 43  ? -21.316 -3.907  21.827   1.00 10.00 ? ? ? ? ? ? 44  MET C CA  1 
ATOM 6136  C C   . MET C 1 43  ? -22.189 -4.575  20.757   1.00 10.00 ? ? ? ? ? ? 44  MET C C   1 
ATOM 6137  O O   . MET C 1 43  ? -23.378 -4.829  21.023   1.00 10.00 ? ? ? ? ? ? 44  MET C O   1 
ATOM 6138  C CB  . MET C 1 43  ? -20.758 -4.928  22.829   1.00 10.00 ? ? ? ? ? ? 44  MET C CB  1 
ATOM 6139  C CG  . MET C 1 43  ? -19.579 -5.733  22.354   1.00 10.00 ? ? ? ? ? ? 44  MET C CG  1 
ATOM 6140  S SD  . MET C 1 43  ? -19.963 -6.902  21.020   1.00 10.00 ? ? ? ? ? ? 44  MET C SD  1 
ATOM 6141  C CE  . MET C 1 43  ? -19.581 -8.312  22.070   1.00 10.00 ? ? ? ? ? ? 44  MET C CE  1 
ATOM 6142  N N   . VAL C 1 44  ? -21.697 -4.874  19.539   1.00 10.00 ? ? ? ? ? ? 45  VAL C N   1 
ATOM 6143  C CA  . VAL C 1 44  ? -22.498 -5.600  18.530   1.00 10.00 ? ? ? ? ? ? 45  VAL C CA  1 
ATOM 6144  C C   . VAL C 1 44  ? -22.244 -7.117  18.699   1.00 10.00 ? ? ? ? ? ? 45  VAL C C   1 
ATOM 6145  O O   . VAL C 1 44  ? -21.583 -7.899  18.008   1.00 10.00 ? ? ? ? ? ? 45  VAL C O   1 
ATOM 6146  C CB  . VAL C 1 44  ? -22.122 -5.046  17.132   1.00 10.00 ? ? ? ? ? ? 45  VAL C CB  1 
ATOM 6147  C CG1 . VAL C 1 44  ? -22.370 -6.022  15.983   1.00 10.00 ? ? ? ? ? ? 45  VAL C CG1 1 
ATOM 6148  C CG2 . VAL C 1 44  ? -22.973 -3.779  16.969   1.00 10.00 ? ? ? ? ? ? 45  VAL C CG2 1 
ATOM 6149  N N   . GLY C 1 45  ? -22.864 -7.459  19.816   1.00 10.00 ? ? ? ? ? ? 46  GLY C N   1 
ATOM 6150  C CA  . GLY C 1 45  ? -22.974 -8.776  20.406   1.00 10.00 ? ? ? ? ? ? 46  GLY C CA  1 
ATOM 6151  C C   . GLY C 1 45  ? -23.683 -8.537  21.734   1.00 10.00 ? ? ? ? ? ? 46  GLY C C   1 
ATOM 6152  O O   . GLY C 1 45  ? -23.196 -8.878  22.826   1.00 10.00 ? ? ? ? ? ? 46  GLY C O   1 
ATOM 6153  N N   . MET C 1 46  ? -24.735 -7.718  21.530   1.00 10.00 ? ? ? ? ? ? 47  MET C N   1 
ATOM 6154  C CA  . MET C 1 46  ? -25.758 -7.330  22.480   1.00 10.00 ? ? ? ? ? ? 47  MET C CA  1 
ATOM 6155  C C   . MET C 1 46  ? -26.711 -6.273  21.869   1.00 10.00 ? ? ? ? ? ? 47  MET C C   1 
ATOM 6156  O O   . MET C 1 46  ? -26.379 -5.532  20.913   1.00 10.00 ? ? ? ? ? ? 47  MET C O   1 
ATOM 6157  C CB  . MET C 1 46  ? -25.137 -6.789  23.805   1.00 10.00 ? ? ? ? ? ? 47  MET C CB  1 
ATOM 6158  C CG  . MET C 1 46  ? -24.283 -5.540  23.914   1.00 10.00 ? ? ? ? ? ? 47  MET C CG  1 
ATOM 6159  S SD  . MET C 1 46  ? -23.381 -5.567  25.500   1.00 10.00 ? ? ? ? ? ? 47  MET C SD  1 
ATOM 6160  C CE  . MET C 1 46  ? -22.413 -7.035  25.195   1.00 10.00 ? ? ? ? ? ? 47  MET C CE  1 
ATOM 6161  N N   . GLY C 1 47  ? -27.960 -6.319  22.415   1.00 10.00 ? ? ? ? ? ? 48  GLY C N   1 
ATOM 6162  C CA  . GLY C 1 47  ? -29.076 -5.483  21.970   1.00 10.00 ? ? ? ? ? ? 48  GLY C CA  1 
ATOM 6163  C C   . GLY C 1 47  ? -28.743 -4.034  22.300   1.00 10.00 ? ? ? ? ? ? 48  GLY C C   1 
ATOM 6164  O O   . GLY C 1 47  ? -27.694 -3.847  22.941   1.00 10.00 ? ? ? ? ? ? 48  GLY C O   1 
ATOM 6165  N N   . GLN C 1 48  ? -29.502 -2.965  21.949   1.00 10.00 ? ? ? ? ? ? 49  GLN C N   1 
ATOM 6166  C CA  . GLN C 1 48  ? -29.132 -1.638  22.452   1.00 10.00 ? ? ? ? ? ? 49  GLN C CA  1 
ATOM 6167  C C   . GLN C 1 48  ? -29.674 -1.748  23.889   1.00 10.00 ? ? ? ? ? ? 49  GLN C C   1 
ATOM 6168  O O   . GLN C 1 48  ? -30.897 -1.811  24.110   1.00 10.00 ? ? ? ? ? ? 49  GLN C O   1 
ATOM 6169  C CB  . GLN C 1 48  ? -29.819 -0.543  21.636   1.00 10.00 ? ? ? ? ? ? 49  GLN C CB  1 
ATOM 6170  C CG  . GLN C 1 48  ? -29.055 0.779   21.554   1.00 10.00 ? ? ? ? ? ? 49  GLN C CG  1 
ATOM 6171  C CD  . GLN C 1 48  ? -29.351 1.775   22.676   1.00 10.00 ? ? ? ? ? ? 49  GLN C CD  1 
ATOM 6172  O OE1 . GLN C 1 48  ? -29.273 1.384   23.832   1.00 10.00 ? ? ? ? ? ? 49  GLN C OE1 1 
ATOM 6173  N NE2 . GLN C 1 48  ? -29.732 3.046   22.474   1.00 10.00 ? ? ? ? ? ? 49  GLN C NE2 1 
ATOM 6174  N N   . LYS C 1 49  ? -28.669 -2.185  24.700   1.00 10.00 ? ? ? ? ? ? 50  LYS C N   1 
ATOM 6175  C CA  . LYS C 1 49  ? -28.590 -2.443  26.142   1.00 10.00 ? ? ? ? ? ? 50  LYS C CA  1 
ATOM 6176  C C   . LYS C 1 49  ? -27.779 -1.316  26.768   1.00 10.00 ? ? ? ? ? ? 50  LYS C C   1 
ATOM 6177  O O   . LYS C 1 49  ? -26.547 -1.229  26.644   1.00 10.00 ? ? ? ? ? ? 50  LYS C O   1 
ATOM 6178  C CB  . LYS C 1 49  ? -27.856 -3.754  26.416   1.00 10.00 ? ? ? ? ? ? 50  LYS C CB  1 
ATOM 6179  C CG  . LYS C 1 49  ? -28.726 -4.989  26.553   1.00 10.00 ? ? ? ? ? ? 50  LYS C CG  1 
ATOM 6180  C CD  . LYS C 1 49  ? -29.206 -5.136  28.001   1.00 10.00 ? ? ? ? ? ? 50  LYS C CD  1 
ATOM 6181  C CE  . LYS C 1 49  ? -28.011 -5.457  28.963   1.00 10.00 ? ? ? ? ? ? 50  LYS C CE  1 
ATOM 6182  N NZ  . LYS C 1 49  ? -28.349 -5.323  30.368   1.00 10.00 ? ? ? ? ? ? 50  LYS C NZ  1 
ATOM 6183  N N   . ASP C 1 50  ? -28.460 -0.387  27.422   1.00 10.00 ? ? ? ? ? ? 51  ASP C N   1 
ATOM 6184  C CA  . ASP C 1 50  ? -27.725 0.666   28.059   1.00 10.00 ? ? ? ? ? ? 51  ASP C CA  1 
ATOM 6185  C C   . ASP C 1 50  ? -27.885 0.628   29.574   1.00 10.00 ? ? ? ? ? ? 51  ASP C C   1 
ATOM 6186  O O   . ASP C 1 50  ? -27.737 1.668   30.207   1.00 10.00 ? ? ? ? ? ? 51  ASP C O   1 
ATOM 6187  C CB  . ASP C 1 50  ? -28.159 2.036   27.420   1.00 10.00 ? ? ? ? ? ? 51  ASP C CB  1 
ATOM 6188  C CG  . ASP C 1 50  ? -27.522 2.393   26.046   1.00 10.00 ? ? ? ? ? ? 51  ASP C CG  1 
ATOM 6189  O OD1 . ASP C 1 50  ? -26.731 1.618   25.479   1.00 10.00 ? ? ? ? ? ? 51  ASP C OD1 1 
ATOM 6190  O OD2 . ASP C 1 50  ? -27.830 3.463   25.519   1.00 10.00 ? ? ? ? ? ? 51  ASP C OD2 1 
ATOM 6191  N N   . SER C 1 51  ? -28.207 -0.513  30.209   1.00 10.00 ? ? ? ? ? ? 52  SER C N   1 
ATOM 6192  C CA  . SER C 1 51  ? -28.062 -0.654  31.655   1.00 10.00 ? ? ? ? ? ? 52  SER C CA  1 
ATOM 6193  C C   . SER C 1 51  ? -27.362 -1.984  31.749   1.00 10.00 ? ? ? ? ? ? 52  SER C C   1 
ATOM 6194  O O   . SER C 1 51  ? -27.921 -2.962  31.251   1.00 10.00 ? ? ? ? ? ? 52  SER C O   1 
ATOM 6195  C CB  . SER C 1 51  ? -29.387 -0.771  32.479   1.00 10.00 ? ? ? ? ? ? 52  SER C CB  1 
ATOM 6196  O OG  . SER C 1 51  ? -30.215 -1.947  32.369   1.00 10.00 ? ? ? ? ? ? 52  SER C OG  1 
ATOM 6197  N N   . TYR C 1 52  ? -26.129 -2.104  32.211   1.00 10.00 ? ? ? ? ? ? 53  TYR C N   1 
ATOM 6198  C CA  . TYR C 1 52  ? -25.548 -3.410  32.409   1.00 10.00 ? ? ? ? ? ? 53  TYR C CA  1 
ATOM 6199  C C   . TYR C 1 52  ? -25.771 -3.597  33.906   1.00 10.00 ? ? ? ? ? ? 53  TYR C C   1 
ATOM 6200  O O   . TYR C 1 52  ? -25.799 -2.615  34.643   1.00 10.00 ? ? ? ? ? ? 53  TYR C O   1 
ATOM 6201  C CB  . TYR C 1 52  ? -24.074 -3.307  31.892   1.00 10.00 ? ? ? ? ? ? 53  TYR C CB  1 
ATOM 6202  C CG  . TYR C 1 52  ? -24.067 -3.260  30.349   1.00 10.00 ? ? ? ? ? ? 53  TYR C CG  1 
ATOM 6203  C CD1 . TYR C 1 52  ? -24.642 -4.326  29.655   1.00 10.00 ? ? ? ? ? ? 53  TYR C CD1 1 
ATOM 6204  C CD2 . TYR C 1 52  ? -23.618 -2.174  29.621   1.00 10.00 ? ? ? ? ? ? 53  TYR C CD2 1 
ATOM 6205  C CE1 . TYR C 1 52  ? -24.811 -4.337  28.273   1.00 10.00 ? ? ? ? ? ? 53  TYR C CE1 1 
ATOM 6206  C CE2 . TYR C 1 52  ? -23.779 -2.175  28.225   1.00 10.00 ? ? ? ? ? ? 53  TYR C CE2 1 
ATOM 6207  C CZ  . TYR C 1 52  ? -24.386 -3.246  27.540   1.00 10.00 ? ? ? ? ? ? 53  TYR C CZ  1 
ATOM 6208  O OH  . TYR C 1 52  ? -24.674 -3.210  26.165   1.00 10.00 ? ? ? ? ? ? 53  TYR C OH  1 
ATOM 6209  N N   . VAL C 1 53  ? -26.029 -4.791  34.424   1.00 10.00 ? ? ? ? ? ? 54  VAL C N   1 
ATOM 6210  C CA  . VAL C 1 53  ? -26.363 -5.013  35.837   1.00 10.00 ? ? ? ? ? ? 54  VAL C CA  1 
ATOM 6211  C C   . VAL C 1 53  ? -25.396 -6.022  36.486   1.00 10.00 ? ? ? ? ? ? 54  VAL C C   1 
ATOM 6212  O O   . VAL C 1 53  ? -24.977 -7.004  35.837   1.00 10.00 ? ? ? ? ? ? 54  VAL C O   1 
ATOM 6213  C CB  . VAL C 1 53  ? -27.888 -5.513  35.895   1.00 10.00 ? ? ? ? ? ? 54  VAL C CB  1 
ATOM 6214  C CG1 . VAL C 1 53  ? -28.282 -6.088  37.242   1.00 10.00 ? ? ? ? ? ? 54  VAL C CG1 1 
ATOM 6215  C CG2 . VAL C 1 53  ? -28.816 -4.323  35.746   1.00 10.00 ? ? ? ? ? ? 54  VAL C CG2 1 
ATOM 6216  N N   . GLY C 1 54  ? -25.029 -5.887  37.760   1.00 10.00 ? ? ? ? ? ? 55  GLY C N   1 
ATOM 6217  C CA  . GLY C 1 54  ? -24.226 -6.903  38.408   1.00 10.00 ? ? ? ? ? ? 55  GLY C CA  1 
ATOM 6218  C C   . GLY C 1 54  ? -22.791 -6.886  37.927   1.00 10.00 ? ? ? ? ? ? 55  GLY C C   1 
ATOM 6219  O O   . GLY C 1 54  ? -22.143 -5.846  37.870   1.00 10.00 ? ? ? ? ? ? 55  GLY C O   1 
ATOM 6220  N N   . ASP C 1 55  ? -22.259 -8.058  37.552   1.00 10.00 ? ? ? ? ? ? 56  ASP C N   1 
ATOM 6221  C CA  . ASP C 1 55  ? -20.831 -8.262  37.132   1.00 10.00 ? ? ? ? ? ? 56  ASP C CA  1 
ATOM 6222  C C   . ASP C 1 55  ? -20.376 -7.963  35.686   1.00 10.00 ? ? ? ? ? ? 56  ASP C C   1 
ATOM 6223  O O   . ASP C 1 55  ? -19.242 -7.541  35.420   1.00 10.00 ? ? ? ? ? ? 56  ASP C O   1 
ATOM 6224  C CB  . ASP C 1 55  ? -20.401 -9.745  37.498   1.00 10.00 ? ? ? ? ? ? 56  ASP C CB  1 
ATOM 6225  C CG  . ASP C 1 55  ? -21.401 -10.879 37.261   1.00 10.00 ? ? ? ? ? ? 56  ASP C CG  1 
ATOM 6226  O OD1 . ASP C 1 55  ? -22.359 -10.769 36.460   1.00 10.00 ? ? ? ? ? ? 56  ASP C OD1 1 
ATOM 6227  O OD2 . ASP C 1 55  ? -21.181 -11.899 37.918   1.00 10.00 ? ? ? ? ? ? 56  ASP C OD2 1 
ATOM 6228  N N   . GLU C 1 56  ? -21.332 -8.079  34.756   1.00 10.00 ? ? ? ? ? ? 57  GLU C N   1 
ATOM 6229  C CA  . GLU C 1 56  ? -21.168 -7.627  33.384   1.00 10.00 ? ? ? ? ? ? 57  GLU C CA  1 
ATOM 6230  C C   . GLU C 1 56  ? -21.149 -6.110  33.338   1.00 10.00 ? ? ? ? ? ? 57  GLU C C   1 
ATOM 6231  O O   . GLU C 1 56  ? -21.227 -5.534  32.259   1.00 10.00 ? ? ? ? ? ? 57  GLU C O   1 
ATOM 6232  C CB  . GLU C 1 56  ? -22.312 -8.086  32.494   1.00 10.00 ? ? ? ? ? ? 57  GLU C CB  1 
ATOM 6233  C CG  . GLU C 1 56  ? -23.700 -7.609  32.903   1.00 10.00 ? ? ? ? ? ? 57  GLU C CG  1 
ATOM 6234  C CD  . GLU C 1 56  ? -24.841 -8.090  32.030   1.00 10.00 ? ? ? ? ? ? 57  GLU C CD  1 
ATOM 6235  O OE1 . GLU C 1 56  ? -24.866 -9.252  31.643   1.00 10.00 ? ? ? ? ? ? 57  GLU C OE1 1 
ATOM 6236  O OE2 . GLU C 1 56  ? -25.726 -7.290  31.758   1.00 10.00 ? ? ? ? ? ? 57  GLU C OE2 1 
ATOM 6237  N N   . ALA C 1 57  ? -21.202 -5.441  34.487   1.00 10.00 ? ? ? ? ? ? 58  ALA C N   1 
ATOM 6238  C CA  . ALA C 1 57  ? -21.099 -4.013  34.551   1.00 10.00 ? ? ? ? ? ? 58  ALA C CA  1 
ATOM 6239  C C   . ALA C 1 57  ? -19.908 -3.741  35.433   1.00 10.00 ? ? ? ? ? ? 58  ALA C C   1 
ATOM 6240  O O   . ALA C 1 57  ? -19.446 -2.623  35.601   1.00 10.00 ? ? ? ? ? ? 58  ALA C O   1 
ATOM 6241  C CB  . ALA C 1 57  ? -22.318 -3.435  35.180   1.00 10.00 ? ? ? ? ? ? 58  ALA C CB  1 
ATOM 6242  N N   . GLN C 1 58  ? -19.331 -4.729  36.056   1.00 10.00 ? ? ? ? ? ? 59  GLN C N   1 
ATOM 6243  C CA  . GLN C 1 58  ? -18.145 -4.515  36.849   1.00 10.00 ? ? ? ? ? ? 59  GLN C CA  1 
ATOM 6244  C C   . GLN C 1 58  ? -17.065 -4.388  35.752   1.00 10.00 ? ? ? ? ? ? 59  GLN C C   1 
ATOM 6245  O O   . GLN C 1 58  ? -16.289 -3.428  35.656   1.00 10.00 ? ? ? ? ? ? 59  GLN C O   1 
ATOM 6246  C CB  . GLN C 1 58  ? -18.000 -5.746  37.709   1.00 10.00 ? ? ? ? ? ? 59  GLN C CB  1 
ATOM 6247  C CG  . GLN C 1 58  ? -16.805 -5.864  38.593   1.00 10.00 ? ? ? ? ? ? 59  GLN C CG  1 
ATOM 6248  C CD  . GLN C 1 58  ? -16.913 -5.016  39.836   1.00 10.00 ? ? ? ? ? ? 59  GLN C CD  1 
ATOM 6249  O OE1 . GLN C 1 58  ? -16.660 -5.502  40.930   1.00 10.00 ? ? ? ? ? ? 59  GLN C OE1 1 
ATOM 6250  N NE2 . GLN C 1 58  ? -17.299 -3.754  39.834   1.00 10.00 ? ? ? ? ? ? 59  GLN C NE2 1 
ATOM 6251  N N   . SER C 1 59  ? -17.089 -5.305  34.769   1.00 10.00 ? ? ? ? ? ? 60  SER C N   1 
ATOM 6252  C CA  . SER C 1 59  ? -16.094 -5.410  33.706   1.00 10.00 ? ? ? ? ? ? 60  SER C CA  1 
ATOM 6253  C C   . SER C 1 59  ? -16.239 -4.461  32.521   1.00 10.00 ? ? ? ? ? ? 60  SER C C   1 
ATOM 6254  O O   . SER C 1 59  ? -15.940 -4.773  31.366   1.00 10.00 ? ? ? ? ? ? 60  SER C O   1 
ATOM 6255  C CB  . SER C 1 59  ? -16.155 -6.867  33.320   1.00 10.00 ? ? ? ? ? ? 60  SER C CB  1 
ATOM 6256  O OG  . SER C 1 59  ? -16.306 -7.644  34.519   1.00 10.00 ? ? ? ? ? ? 60  SER C OG  1 
ATOM 6257  N N   . LYS C 1 60  ? -16.743 -3.274  32.826   1.00 10.00 ? ? ? ? ? ? 61  LYS C N   1 
ATOM 6258  C CA  . LYS C 1 60  ? -16.907 -2.138  31.930   1.00 10.00 ? ? ? ? ? ? 61  LYS C CA  1 
ATOM 6259  C C   . LYS C 1 60  ? -17.142 -0.962  32.878   1.00 10.00 ? ? ? ? ? ? 61  LYS C C   1 
ATOM 6260  O O   . LYS C 1 60  ? -17.502 0.106   32.402   1.00 10.00 ? ? ? ? ? ? 61  LYS C O   1 
ATOM 6261  C CB  . LYS C 1 60  ? -18.133 -2.228  31.058   1.00 10.00 ? ? ? ? ? ? 61  LYS C CB  1 
ATOM 6262  C CG  . LYS C 1 60  ? -18.218 -3.389  30.079   1.00 10.00 ? ? ? ? ? ? 61  LYS C CG  1 
ATOM 6263  C CD  . LYS C 1 60  ? -19.385 -3.200  29.106   1.00 10.00 ? ? ? ? ? ? 61  LYS C CD  1 
ATOM 6264  C CE  . LYS C 1 60  ? -19.252 -4.111  27.889   1.00 10.00 ? ? ? ? ? ? 61  LYS C CE  1 
ATOM 6265  N NZ  . LYS C 1 60  ? -19.444 -5.524  28.215   1.00 10.00 ? ? ? ? ? ? 61  LYS C NZ  1 
ATOM 6266  N N   . ARG C 1 61  ? -16.869 -1.107  34.198   1.00 10.00 ? ? ? ? ? ? 62  ARG C N   1 
ATOM 6267  C CA  . ARG C 1 61  ? -17.117 -0.108  35.249   1.00 10.00 ? ? ? ? ? ? 62  ARG C CA  1 
ATOM 6268  C C   . ARG C 1 61  ? -16.377 1.185   34.979   1.00 10.00 ? ? ? ? ? ? 62  ARG C C   1 
ATOM 6269  O O   . ARG C 1 61  ? -16.861 2.300   35.158   1.00 10.00 ? ? ? ? ? ? 62  ARG C O   1 
ATOM 6270  C CB  . ARG C 1 61  ? -16.699 -0.724  36.594   1.00 10.00 ? ? ? ? ? ? 62  ARG C CB  1 
ATOM 6271  C CG  . ARG C 1 61  ? -15.851 -0.053  37.703   1.00 10.00 ? ? ? ? ? ? 62  ARG C CG  1 
ATOM 6272  C CD  . ARG C 1 61  ? -15.514 -1.165  38.770   1.00 10.00 ? ? ? ? ? ? 62  ARG C CD  1 
ATOM 6273  N NE  . ARG C 1 61  ? -15.158 -0.619  40.085   1.00 10.00 ? ? ? ? ? ? 62  ARG C NE  1 
ATOM 6274  C CZ  . ARG C 1 61  ? -15.948 -0.679  41.192   1.00 10.00 ? ? ? ? ? ? 62  ARG C CZ  1 
ATOM 6275  N NH1 . ARG C 1 61  ? -17.179 -1.280  41.248   1.00 10.00 ? ? ? ? ? ? 62  ARG C NH1 1 
ATOM 6276  N NH2 . ARG C 1 61  ? -15.534 0.048   42.247   1.00 10.00 ? ? ? ? ? ? 62  ARG C NH2 1 
ATOM 6277  N N   . GLY C 1 62  ? -15.162 0.940   34.472   1.00 10.00 ? ? ? ? ? ? 63  GLY C N   1 
ATOM 6278  C CA  . GLY C 1 62  ? -14.263 1.960   33.980   1.00 10.00 ? ? ? ? ? ? 63  GLY C CA  1 
ATOM 6279  C C   . GLY C 1 62  ? -14.911 2.682   32.820   1.00 10.00 ? ? ? ? ? ? 63  GLY C C   1 
ATOM 6280  O O   . GLY C 1 62  ? -14.780 3.887   32.786   1.00 10.00 ? ? ? ? ? ? 63  GLY C O   1 
ATOM 6281  N N   . ILE C 1 63  ? -15.602 2.058   31.867   1.00 10.00 ? ? ? ? ? ? 64  ILE C N   1 
ATOM 6282  C CA  . ILE C 1 63  ? -16.221 2.818   30.787   1.00 10.00 ? ? ? ? ? ? 64  ILE C CA  1 
ATOM 6283  C C   . ILE C 1 63  ? -17.651 3.215   31.052   1.00 10.00 ? ? ? ? ? ? 64  ILE C C   1 
ATOM 6284  O O   . ILE C 1 63  ? -18.222 3.852   30.165   1.00 10.00 ? ? ? ? ? ? 64  ILE C O   1 
ATOM 6285  C CB  . ILE C 1 63  ? -16.203 2.051   29.461   1.00 10.00 ? ? ? ? ? ? 64  ILE C CB  1 
ATOM 6286  C CG1 . ILE C 1 63  ? -16.854 0.707   29.555   1.00 10.00 ? ? ? ? ? ? 64  ILE C CG1 1 
ATOM 6287  C CG2 . ILE C 1 63  ? -14.728 1.912   29.045   1.00 10.00 ? ? ? ? ? ? 64  ILE C CG2 1 
ATOM 6288  C CD1 . ILE C 1 63  ? -16.757 -0.077  28.234   1.00 10.00 ? ? ? ? ? ? 64  ILE C CD1 1 
ATOM 6289  N N   . LEU C 1 64  ? -18.217 2.936   32.251   1.00 10.00 ? ? ? ? ? ? 65  LEU C N   1 
ATOM 6290  C CA  . LEU C 1 64  ? -19.641 3.155   32.501   1.00 10.00 ? ? ? ? ? ? 65  LEU C CA  1 
ATOM 6291  C C   . LEU C 1 64  ? -19.939 3.986   33.724   1.00 10.00 ? ? ? ? ? ? 65  LEU C C   1 
ATOM 6292  O O   . LEU C 1 64  ? -19.102 4.074   34.627   1.00 10.00 ? ? ? ? ? ? 65  LEU C O   1 
ATOM 6293  C CB  . LEU C 1 64  ? -20.382 1.837   32.697   1.00 10.00 ? ? ? ? ? ? 65  LEU C CB  1 
ATOM 6294  C CG  . LEU C 1 64  ? -20.424 0.744   31.624   1.00 10.00 ? ? ? ? ? ? 65  LEU C CG  1 
ATOM 6295  C CD1 . LEU C 1 64  ? -21.272 -0.406  32.092   1.00 10.00 ? ? ? ? ? ? 65  LEU C CD1 1 
ATOM 6296  C CD2 . LEU C 1 64  ? -21.038 1.288   30.363   1.00 10.00 ? ? ? ? ? ? 65  LEU C CD2 1 
ATOM 6297  N N   . THR C 1 65  ? -21.125 4.600   33.831   1.00 10.00 ? ? ? ? ? ? 66  THR C N   1 
ATOM 6298  C CA  . THR C 1 65  ? -21.509 5.226   35.122   1.00 10.00 ? ? ? ? ? ? 66  THR C CA  1 
ATOM 6299  C C   . THR C 1 65  ? -22.490 4.317   35.921   1.00 10.00 ? ? ? ? ? ? 66  THR C C   1 
ATOM 6300  O O   . THR C 1 65  ? -23.574 3.875   35.493   1.00 10.00 ? ? ? ? ? ? 66  THR C O   1 
ATOM 6301  C CB  . THR C 1 65  ? -22.080 6.652   34.785   1.00 10.00 ? ? ? ? ? ? 66  THR C CB  1 
ATOM 6302  O OG1 . THR C 1 65  ? -20.937 7.518   34.868   1.00 10.00 ? ? ? ? ? ? 66  THR C OG1 1 
ATOM 6303  C CG2 . THR C 1 65  ? -23.220 7.120   35.689   1.00 10.00 ? ? ? ? ? ? 66  THR C CG2 1 
ATOM 6304  N N   . LEU C 1 66  ? -22.007 3.966   37.109   1.00 10.00 ? ? ? ? ? ? 67  LEU C N   1 
ATOM 6305  C CA  . LEU C 1 66  ? -22.680 3.049   37.992   1.00 10.00 ? ? ? ? ? ? 67  LEU C CA  1 
ATOM 6306  C C   . LEU C 1 66  ? -23.539 3.606   39.127   1.00 10.00 ? ? ? ? ? ? 67  LEU C C   1 
ATOM 6307  O O   . LEU C 1 66  ? -23.045 4.338   39.988   1.00 10.00 ? ? ? ? ? ? 67  LEU C O   1 
ATOM 6308  C CB  . LEU C 1 66  ? -21.630 2.162   38.576   1.00 10.00 ? ? ? ? ? ? 67  LEU C CB  1 
ATOM 6309  C CG  . LEU C 1 66  ? -20.690 1.381   37.729   1.00 10.00 ? ? ? ? ? ? 67  LEU C CG  1 
ATOM 6310  C CD1 . LEU C 1 66  ? -19.512 1.058   38.650   1.00 10.00 ? ? ? ? ? ? 67  LEU C CD1 1 
ATOM 6311  C CD2 . LEU C 1 66  ? -21.336 0.150   37.115   1.00 10.00 ? ? ? ? ? ? 67  LEU C CD2 1 
ATOM 6312  N N   . LYS C 1 67  ? -24.829 3.286   39.190   1.00 10.00 ? ? ? ? ? ? 68  LYS C N   1 
ATOM 6313  C CA  . LYS C 1 67  ? -25.717 3.644   40.296   1.00 10.00 ? ? ? ? ? ? 68  LYS C CA  1 
ATOM 6314  C C   . LYS C 1 67  ? -25.885 2.439   41.265   1.00 10.00 ? ? ? ? ? ? 68  LYS C C   1 
ATOM 6315  O O   . LYS C 1 67  ? -26.157 1.290   40.869   1.00 10.00 ? ? ? ? ? ? 68  LYS C O   1 
ATOM 6316  C CB  . LYS C 1 67  ? -27.126 4.030   39.784   1.00 10.00 ? ? ? ? ? ? 68  LYS C CB  1 
ATOM 6317  C CG  . LYS C 1 67  ? -27.491 5.474   39.328   1.00 10.00 ? ? ? ? ? ? 68  LYS C CG  1 
ATOM 6318  C CD  . LYS C 1 67  ? -28.911 5.611   38.696   1.00 10.00 ? ? ? ? ? ? 68  LYS C CD  1 
ATOM 6319  C CE  . LYS C 1 67  ? -29.056 5.131   37.250   1.00 10.00 ? ? ? ? ? ? 68  LYS C CE  1 
ATOM 6320  N NZ  . LYS C 1 67  ? -28.421 3.843   36.964   1.00 10.00 ? ? ? ? ? ? 68  LYS C NZ  1 
ATOM 6321  N N   . TYR C 1 68  ? -25.774 2.711   42.575   1.00 10.00 ? ? ? ? ? ? 69  TYR C N   1 
ATOM 6322  C CA  . TYR C 1 68  ? -25.939 1.773   43.677   1.00 10.00 ? ? ? ? ? ? 69  TYR C CA  1 
ATOM 6323  C C   . TYR C 1 68  ? -27.350 1.929   44.244   1.00 10.00 ? ? ? ? ? ? 69  TYR C C   1 
ATOM 6324  O O   . TYR C 1 68  ? -27.660 2.970   44.845   1.00 10.00 ? ? ? ? ? ? 69  TYR C O   1 
ATOM 6325  C CB  . TYR C 1 68  ? -24.975 2.072   44.798   1.00 10.00 ? ? ? ? ? ? 69  TYR C CB  1 
ATOM 6326  C CG  . TYR C 1 68  ? -23.548 1.716   44.458   1.00 10.00 ? ? ? ? ? ? 69  TYR C CG  1 
ATOM 6327  C CD1 . TYR C 1 68  ? -22.787 2.517   43.606   1.00 10.00 ? ? ? ? ? ? 69  TYR C CD1 1 
ATOM 6328  C CD2 . TYR C 1 68  ? -23.054 0.564   45.020   1.00 10.00 ? ? ? ? ? ? 69  TYR C CD2 1 
ATOM 6329  C CE1 . TYR C 1 68  ? -21.488 2.135   43.297   1.00 10.00 ? ? ? ? ? ? 69  TYR C CE1 1 
ATOM 6330  C CE2 . TYR C 1 68  ? -21.767 0.185   44.727   1.00 10.00 ? ? ? ? ? ? 69  TYR C CE2 1 
ATOM 6331  C CZ  . TYR C 1 68  ? -21.005 0.973   43.873   1.00 10.00 ? ? ? ? ? ? 69  TYR C CZ  1 
ATOM 6332  O OH  . TYR C 1 68  ? -19.728 0.554   43.613   1.00 10.00 ? ? ? ? ? ? 69  TYR C OH  1 
ATOM 6333  N N   . PRO C 1 69  ? -17.209 -2.554  45.997   1.00 10.00 ? ? ? ? ? ? 70  PRO C N   1 
ATOM 6334  C CA  . PRO C 1 69  ? -17.382 -1.449  46.916   1.00 10.00 ? ? ? ? ? ? 70  PRO C CA  1 
ATOM 6335  C C   . PRO C 1 69  ? -16.548 -1.611  48.176   1.00 10.00 ? ? ? ? ? ? 70  PRO C C   1 
ATOM 6336  O O   . PRO C 1 69  ? -15.914 -0.675  48.644   1.00 10.00 ? ? ? ? ? ? 70  PRO C O   1 
ATOM 6337  C CB  . PRO C 1 69  ? -18.851 -1.468  47.207   1.00 10.00 ? ? ? ? ? ? 70  PRO C CB  1 
ATOM 6338  C CG  . PRO C 1 69  ? -19.509 -2.527  46.323   1.00 10.00 ? ? ? ? ? ? 70  PRO C CG  1 
ATOM 6339  C CD  . PRO C 1 69  ? -18.360 -3.460  46.047   1.00 10.00 ? ? ? ? ? ? 70  PRO C CD  1 
ATOM 6340  N N   . ILE C 1 70  ? -16.604 -2.796  48.783   1.00 10.00 ? ? ? ? ? ? 71  ILE C N   1 
ATOM 6341  C CA  . ILE C 1 70  ? -16.073 -3.013  50.098   1.00 10.00 ? ? ? ? ? ? 71  ILE C CA  1 
ATOM 6342  C C   . ILE C 1 70  ? -14.706 -3.560  49.814   1.00 10.00 ? ? ? ? ? ? 71  ILE C C   1 
ATOM 6343  O O   . ILE C 1 70  ? -14.564 -4.428  48.955   1.00 10.00 ? ? ? ? ? ? 71  ILE C O   1 
ATOM 6344  C CB  . ILE C 1 70  ? -16.999 -4.012  50.830   1.00 10.00 ? ? ? ? ? ? 71  ILE C CB  1 
ATOM 6345  C CG1 . ILE C 1 70  ? -18.451 -3.602  50.847   1.00 10.00 ? ? ? ? ? ? 71  ILE C CG1 1 
ATOM 6346  C CG2 . ILE C 1 70  ? -16.630 -4.026  52.254   1.00 10.00 ? ? ? ? ? ? 71  ILE C CG2 1 
ATOM 6347  C CD1 . ILE C 1 70  ? -19.446 -4.803  50.951   1.00 10.00 ? ? ? ? ? ? 71  ILE C CD1 1 
ATOM 6348  N N   . GLU C 1 71  ? -13.709 -3.140  50.571   1.00 10.00 ? ? ? ? ? ? 72  GLU C N   1 
ATOM 6349  C CA  . GLU C 1 71  ? -12.334 -3.467  50.292   1.00 10.00 ? ? ? ? ? ? 72  GLU C CA  1 
ATOM 6350  C C   . GLU C 1 71  ? -11.519 -3.546  51.569   1.00 10.00 ? ? ? ? ? ? 72  GLU C C   1 
ATOM 6351  O O   . GLU C 1 71  ? -11.397 -2.557  52.283   1.00 10.00 ? ? ? ? ? ? 72  GLU C O   1 
ATOM 6352  C CB  . GLU C 1 71  ? -11.881 -2.386  49.389   1.00 10.00 ? ? ? ? ? ? 72  GLU C CB  1 
ATOM 6353  C CG  . GLU C 1 71  ? -10.459 -2.451  48.929   1.00 10.00 ? ? ? ? ? ? 72  GLU C CG  1 
ATOM 6354  C CD  . GLU C 1 71  ? -10.257 -1.522  47.756   1.00 10.00 ? ? ? ? ? ? 72  GLU C CD  1 
ATOM 6355  O OE1 . GLU C 1 71  ? -10.956 -1.737  46.735   1.00 10.00 ? ? ? ? ? ? 72  GLU C OE1 1 
ATOM 6356  O OE2 . GLU C 1 71  ? -9.429  -0.601  47.888   1.00 10.00 ? ? ? ? ? ? 72  GLU C OE2 1 
ATOM 6357  N N   . HIS C 1 72  ? -12.398 0.236   53.283   1.00 10.00 ? ? ? ? ? ? 73  HIS C N   1 
ATOM 6358  C CA  . HIS C 1 72  ? -12.330 -0.134  54.736   1.00 10.00 ? ? ? ? ? ? 73  HIS C CA  1 
ATOM 6359  C C   . HIS C 1 72  ? -13.370 -0.952  55.383   1.00 10.00 ? ? ? ? ? ? 73  HIS C C   1 
ATOM 6360  O O   . HIS C 1 72  ? -13.111 -1.498  56.503   1.00 10.00 ? ? ? ? ? ? 73  HIS C O   1 
ATOM 6361  C CB  . HIS C 1 72  ? -11.339 0.632   55.659   1.00 10.00 ? ? ? ? ? ? 73  HIS C CB  1 
ATOM 6362  C CG  . HIS C 1 72  ? -10.014 0.145   54.999   1.00 10.00 ? ? ? ? ? ? 73  HIS C CG  1 
ATOM 6363  N ND1 . HIS C 1 72  ? -9.629  -1.109  55.378   1.00 10.00 ? ? ? ? ? ? 73  HIS C ND1 1 
ATOM 6364  C CD2 . HIS C 1 72  ? -9.111  0.591   54.152   1.00 10.00 ? ? ? ? ? ? 73  HIS C CD2 1 
ATOM 6365  C CE1 . HIS C 1 72  ? -8.532  -1.438  54.795   1.00 10.00 ? ? ? ? ? ? 73  HIS C CE1 1 
ATOM 6366  N NE2 . HIS C 1 72  ? -8.139  -0.404  53.996   1.00 10.00 ? ? ? ? ? ? 73  HIS C NE2 1 
ATOM 6367  N N   . GLY C 1 73  ? -12.472 -4.843  54.059   1.00 10.00 ? ? ? ? ? ? 74  GLY C N   1 
ATOM 6368  C CA  . GLY C 1 73  ? -13.545 -4.596  55.002   1.00 10.00 ? ? ? ? ? ? 74  GLY C CA  1 
ATOM 6369  C C   . GLY C 1 73  ? -14.155 -3.203  54.985   1.00 10.00 ? ? ? ? ? ? 74  GLY C C   1 
ATOM 6370  O O   . GLY C 1 73  ? -15.271 -3.064  55.495   1.00 10.00 ? ? ? ? ? ? 74  GLY C O   1 
ATOM 6371  N N   . ILE C 1 74  ? -13.467 -2.193  54.414   1.00 10.00 ? ? ? ? ? ? 75  ILE C N   1 
ATOM 6372  C CA  . ILE C 1 74  ? -13.851 -0.789  54.445   1.00 10.00 ? ? ? ? ? ? 75  ILE C CA  1 
ATOM 6373  C C   . ILE C 1 74  ? -14.501 -0.370  53.128   1.00 10.00 ? ? ? ? ? ? 75  ILE C C   1 
ATOM 6374  O O   . ILE C 1 74  ? -14.054 -0.851  52.091   1.00 10.00 ? ? ? ? ? ? 75  ILE C O   1 
ATOM 6375  C CB  . ILE C 1 74  ? -12.594 0.039   54.715   1.00 10.00 ? ? ? ? ? ? 75  ILE C CB  1 
ATOM 6376  C CG1 . ILE C 1 74  ? -11.815 -0.507  55.915   1.00 10.00 ? ? ? ? ? ? 75  ILE C CG1 1 
ATOM 6377  C CG2 . ILE C 1 74  ? -13.020 1.505   54.872   1.00 10.00 ? ? ? ? ? ? 75  ILE C CG2 1 
ATOM 6378  C CD1 . ILE C 1 74  ? -12.498 -0.647  57.276   1.00 10.00 ? ? ? ? ? ? 75  ILE C CD1 1 
ATOM 6379  N N   . VAL C 1 75  ? -15.508 0.520   53.060   1.00 10.00 ? ? ? ? ? ? 76  VAL C N   1 
ATOM 6380  C CA  . VAL C 1 75  ? -16.194 0.847   51.811   1.00 10.00 ? ? ? ? ? ? 76  VAL C CA  1 
ATOM 6381  C C   . VAL C 1 75  ? -15.425 2.001   51.210   1.00 10.00 ? ? ? ? ? ? 76  VAL C C   1 
ATOM 6382  O O   . VAL C 1 75  ? -15.098 2.998   51.875   1.00 10.00 ? ? ? ? ? ? 76  VAL C O   1 
ATOM 6383  C CB  . VAL C 1 75  ? -17.688 1.205   52.093   1.00 10.00 ? ? ? ? ? ? 76  VAL C CB  1 
ATOM 6384  C CG1 . VAL C 1 75  ? -18.403 1.795   50.888   1.00 10.00 ? ? ? ? ? ? 76  VAL C CG1 1 
ATOM 6385  C CG2 . VAL C 1 75  ? -18.426 -0.091  52.434   1.00 10.00 ? ? ? ? ? ? 76  VAL C CG2 1 
ATOM 6386  N N   . THR C 1 76  ? -15.007 1.693   49.965   1.00 10.00 ? ? ? ? ? ? 77  THR C N   1 
ATOM 6387  C CA  . THR C 1 76  ? -14.230 2.611   49.139   1.00 10.00 ? ? ? ? ? ? 77  THR C CA  1 
ATOM 6388  C C   . THR C 1 76  ? -15.140 3.336   48.160   1.00 10.00 ? ? ? ? ? ? 77  THR C C   1 
ATOM 6389  O O   . THR C 1 76  ? -14.848 4.448   47.709   1.00 10.00 ? ? ? ? ? ? 77  THR C O   1 
ATOM 6390  C CB  . THR C 1 76  ? -13.124 1.855   48.351   1.00 10.00 ? ? ? ? ? ? 77  THR C CB  1 
ATOM 6391  O OG1 . THR C 1 76  ? -13.676 0.792   47.543   1.00 10.00 ? ? ? ? ? ? 77  THR C OG1 1 
ATOM 6392  C CG2 . THR C 1 76  ? -12.115 1.302   49.353   1.00 10.00 ? ? ? ? ? ? 77  THR C CG2 1 
ATOM 6393  N N   . ASN C 1 77  ? -16.289 2.761   47.827   1.00 10.00 ? ? ? ? ? ? 78  ASN C N   1 
ATOM 6394  C CA  . ASN C 1 77  ? -17.140 3.340   46.831   1.00 10.00 ? ? ? ? ? ? 78  ASN C CA  1 
ATOM 6395  C C   . ASN C 1 77  ? -18.528 3.462   47.386   1.00 10.00 ? ? ? ? ? ? 78  ASN C C   1 
ATOM 6396  O O   . ASN C 1 77  ? -19.249 2.482   47.566   1.00 10.00 ? ? ? ? ? ? 78  ASN C O   1 
ATOM 6397  C CB  . ASN C 1 77  ? -17.121 2.454   45.574   1.00 10.00 ? ? ? ? ? ? 78  ASN C CB  1 
ATOM 6398  C CG  . ASN C 1 77  ? -17.695 3.222   44.391   1.00 10.00 ? ? ? ? ? ? 78  ASN C CG  1 
ATOM 6399  O OD1 . ASN C 1 77  ? -18.867 3.021   44.087   1.00 10.00 ? ? ? ? ? ? 78  ASN C OD1 1 
ATOM 6400  N ND2 . ASN C 1 77  ? -17.020 4.186   43.759   1.00 10.00 ? ? ? ? ? ? 78  ASN C ND2 1 
ATOM 6401  N N   . TRP C 1 78  ? -18.942 4.668   47.679   1.00 10.00 ? ? ? ? ? ? 79  TRP C N   1 
ATOM 6402  C CA  . TRP C 1 78  ? -20.243 4.832   48.276   1.00 10.00 ? ? ? ? ? ? 79  TRP C CA  1 
ATOM 6403  C C   . TRP C 1 78  ? -21.458 4.742   47.378   1.00 10.00 ? ? ? ? ? ? 79  TRP C C   1 
ATOM 6404  O O   . TRP C 1 78  ? -22.471 4.269   47.875   1.00 10.00 ? ? ? ? ? ? 79  TRP C O   1 
ATOM 6405  C CB  . TRP C 1 78  ? -20.212 6.140   49.021   1.00 10.00 ? ? ? ? ? ? 79  TRP C CB  1 
ATOM 6406  C CG  . TRP C 1 78  ? -19.509 5.963   50.363   1.00 10.00 ? ? ? ? ? ? 79  TRP C CG  1 
ATOM 6407  C CD1 . TRP C 1 78  ? -18.257 6.447   50.616   1.00 10.00 ? ? ? ? ? ? 79  TRP C CD1 1 
ATOM 6408  C CD2 . TRP C 1 78  ? -20.013 5.203   51.365   1.00 10.00 ? ? ? ? ? ? 79  TRP C CD2 1 
ATOM 6409  N NE1 . TRP C 1 78  ? -17.940 5.965   51.772   1.00 10.00 ? ? ? ? ? ? 79  TRP C NE1 1 
ATOM 6410  C CE2 . TRP C 1 78  ? -18.959 5.213   52.256   1.00 10.00 ? ? ? ? ? ? 79  TRP C CE2 1 
ATOM 6411  C CE3 . TRP C 1 78  ? -21.189 4.519   51.591   1.00 10.00 ? ? ? ? ? ? 79  TRP C CE3 1 
ATOM 6412  C CZ2 . TRP C 1 78  ? -19.079 4.497   53.437   1.00 10.00 ? ? ? ? ? ? 79  TRP C CZ2 1 
ATOM 6413  C CZ3 . TRP C 1 78  ? -21.304 3.810   52.764   1.00 10.00 ? ? ? ? ? ? 79  TRP C CZ3 1 
ATOM 6414  C CH2 . TRP C 1 78  ? -20.255 3.804   53.667   1.00 10.00 ? ? ? ? ? ? 79  TRP C CH2 1 
ATOM 6415  N N   . ASP C 1 79  ? -21.517 5.084   46.090   1.00 10.00 ? ? ? ? ? ? 80  ASP C N   1 
ATOM 6416  C CA  . ASP C 1 79  ? -22.783 4.915   45.392   1.00 10.00 ? ? ? ? ? ? 80  ASP C CA  1 
ATOM 6417  C C   . ASP C 1 79  ? -22.902 3.467   44.982   1.00 10.00 ? ? ? ? ? ? 80  ASP C C   1 
ATOM 6418  O O   . ASP C 1 79  ? -24.029 2.970   44.885   1.00 10.00 ? ? ? ? ? ? 80  ASP C O   1 
ATOM 6419  C CB  . ASP C 1 79  ? -22.920 5.739   44.118   1.00 10.00 ? ? ? ? ? ? 80  ASP C CB  1 
ATOM 6420  C CG  . ASP C 1 79  ? -22.265 7.110   44.022   1.00 10.00 ? ? ? ? ? ? 80  ASP C CG  1 
ATOM 6421  O OD1 . ASP C 1 79  ? -21.784 7.688   45.005   1.00 10.00 ? ? ? ? ? ? 80  ASP C OD1 1 
ATOM 6422  O OD2 . ASP C 1 79  ? -22.193 7.592   42.896   1.00 10.00 ? ? ? ? ? ? 80  ASP C OD2 1 
ATOM 6423  N N   . ASP C 1 80  ? -21.799 2.748   44.721   1.00 10.00 ? ? ? ? ? ? 81  ASP C N   1 
ATOM 6424  C CA  . ASP C 1 80  ? -21.982 1.340   44.436   1.00 10.00 ? ? ? ? ? ? 81  ASP C CA  1 
ATOM 6425  C C   . ASP C 1 80  ? -22.296 0.531   45.701   1.00 10.00 ? ? ? ? ? ? 81  ASP C C   1 
ATOM 6426  O O   . ASP C 1 80  ? -23.116 -0.402  45.648   1.00 10.00 ? ? ? ? ? ? 81  ASP C O   1 
ATOM 6427  C CB  . ASP C 1 80  ? -20.740 0.873   43.591   1.00 10.00 ? ? ? ? ? ? 81  ASP C CB  1 
ATOM 6428  C CG  . ASP C 1 80  ? -21.069 1.340   42.128   1.00 10.00 ? ? ? ? ? ? 81  ASP C CG  1 
ATOM 6429  O OD1 . ASP C 1 80  ? -22.037 0.831   41.552   1.00 10.00 ? ? ? ? ? ? 81  ASP C OD1 1 
ATOM 6430  O OD2 . ASP C 1 80  ? -20.443 2.236   41.539   1.00 10.00 ? ? ? ? ? ? 81  ASP C OD2 1 
ATOM 6431  N N   . MET C 1 81  ? -21.824 0.885   46.898   1.00 10.00 ? ? ? ? ? ? 82  MET C N   1 
ATOM 6432  C CA  . MET C 1 81  ? -22.424 0.280   48.103   1.00 10.00 ? ? ? ? ? ? 82  MET C CA  1 
ATOM 6433  C C   . MET C 1 81  ? -23.929 0.670   48.137   1.00 10.00 ? ? ? ? ? ? 82  MET C C   1 
ATOM 6434  O O   . MET C 1 81  ? -24.781 -0.204  48.320   1.00 10.00 ? ? ? ? ? ? 82  MET C O   1 
ATOM 6435  C CB  . MET C 1 81  ? -21.722 0.786   49.375   1.00 10.00 ? ? ? ? ? ? 82  MET C CB  1 
ATOM 6436  C CG  . MET C 1 81  ? -21.999 -0.048  50.640   1.00 10.00 ? ? ? ? ? ? 82  MET C CG  1 
ATOM 6437  S SD  . MET C 1 81  ? -21.205 -1.677  50.938   1.00 10.00 ? ? ? ? ? ? 82  MET C SD  1 
ATOM 6438  C CE  . MET C 1 81  ? -22.606 -2.764  50.890   1.00 10.00 ? ? ? ? ? ? 82  MET C CE  1 
ATOM 6439  N N   . GLU C 1 82  ? -24.353 1.901   47.820   1.00 10.00 ? ? ? ? ? ? 83  GLU C N   1 
ATOM 6440  C CA  . GLU C 1 82  ? -25.760 2.243   47.858   1.00 10.00 ? ? ? ? ? ? 83  GLU C CA  1 
ATOM 6441  C C   . GLU C 1 82  ? -26.559 1.361   46.963   1.00 10.00 ? ? ? ? ? ? 83  GLU C C   1 
ATOM 6442  O O   . GLU C 1 82  ? -27.610 0.871   47.372   1.00 10.00 ? ? ? ? ? ? 83  GLU C O   1 
ATOM 6443  C CB  . GLU C 1 82  ? -26.041 3.641   47.421   1.00 10.00 ? ? ? ? ? ? 83  GLU C CB  1 
ATOM 6444  C CG  . GLU C 1 82  ? -25.676 4.795   48.378   1.00 10.00 ? ? ? ? ? ? 83  GLU C CG  1 
ATOM 6445  C CD  . GLU C 1 82  ? -26.331 6.145   48.060   1.00 10.00 ? ? ? ? ? ? 83  GLU C CD  1 
ATOM 6446  O OE1 . GLU C 1 82  ? -27.414 6.149   47.457   1.00 10.00 ? ? ? ? ? ? 83  GLU C OE1 1 
ATOM 6447  O OE2 . GLU C 1 82  ? -25.747 7.175   48.438   1.00 10.00 ? ? ? ? ? ? 83  GLU C OE2 1 
ATOM 6448  N N   . LYS C 1 83  ? -26.035 1.079   45.790   1.00 10.00 ? ? ? ? ? ? 84  LYS C N   1 
ATOM 6449  C CA  . LYS C 1 83  ? -26.666 0.095   44.920   1.00 10.00 ? ? ? ? ? ? 84  LYS C CA  1 
ATOM 6450  C C   . LYS C 1 83  ? -26.875 -1.258  45.607   1.00 10.00 ? ? ? ? ? ? 84  LYS C C   1 
ATOM 6451  O O   . LYS C 1 83  ? -27.992 -1.810  45.572   1.00 10.00 ? ? ? ? ? ? 84  LYS C O   1 
ATOM 6452  C CB  . LYS C 1 83  ? -25.856 -0.236  43.668   1.00 10.00 ? ? ? ? ? ? 84  LYS C CB  1 
ATOM 6453  C CG  . LYS C 1 83  ? -25.237 0.861   42.799   1.00 10.00 ? ? ? ? ? ? 84  LYS C CG  1 
ATOM 6454  C CD  . LYS C 1 83  ? -26.176 1.997   42.365   1.00 10.00 ? ? ? ? ? ? 84  LYS C CD  1 
ATOM 6455  C CE  . LYS C 1 83  ? -25.628 2.731   41.117   1.00 10.00 ? ? ? ? ? ? 84  LYS C CE  1 
ATOM 6456  N NZ  . LYS C 1 83  ? -25.726 1.900   39.923   1.00 10.00 ? ? ? ? ? ? 84  LYS C NZ  1 
ATOM 6457  N N   . ILE C 1 84  ? -25.843 -1.789  46.272   1.00 10.00 ? ? ? ? ? ? 85  ILE C N   1 
ATOM 6458  C CA  . ILE C 1 84  ? -25.926 -3.113  46.849   1.00 10.00 ? ? ? ? ? ? 85  ILE C CA  1 
ATOM 6459  C C   . ILE C 1 84  ? -27.057 -3.191  47.832   1.00 10.00 ? ? ? ? ? ? 85  ILE C C   1 
ATOM 6460  O O   . ILE C 1 84  ? -27.892 -4.105  47.760   1.00 10.00 ? ? ? ? ? ? 85  ILE C O   1 
ATOM 6461  C CB  . ILE C 1 84  ? -24.568 -3.470  47.512   1.00 10.00 ? ? ? ? ? ? 85  ILE C CB  1 
ATOM 6462  C CG1 . ILE C 1 84  ? -23.607 -3.882  46.407   1.00 10.00 ? ? ? ? ? ? 85  ILE C CG1 1 
ATOM 6463  C CG2 . ILE C 1 84  ? -24.700 -4.601  48.517   1.00 10.00 ? ? ? ? ? ? 85  ILE C CG2 1 
ATOM 6464  C CD1 . ILE C 1 84  ? -22.364 -4.621  46.886   1.00 10.00 ? ? ? ? ? ? 85  ILE C CD1 1 
ATOM 6465  N N   . TRP C 1 85  ? -27.128 -2.166  48.684   1.00 10.00 ? ? ? ? ? ? 86  TRP C N   1 
ATOM 6466  C CA  . TRP C 1 85  ? -28.155 -2.133  49.716   1.00 10.00 ? ? ? ? ? ? 86  TRP C CA  1 
ATOM 6467  C C   . TRP C 1 85  ? -29.510 -2.051  49.051   1.00 10.00 ? ? ? ? ? ? 86  TRP C C   1 
ATOM 6468  O O   . TRP C 1 85  ? -30.287 -2.960  49.293   1.00 10.00 ? ? ? ? ? ? 86  TRP C O   1 
ATOM 6469  C CB  . TRP C 1 85  ? -27.916 -0.943  50.698   1.00 10.00 ? ? ? ? ? ? 86  TRP C CB  1 
ATOM 6470  C CG  . TRP C 1 85  ? -26.808 -1.231  51.714   1.00 10.00 ? ? ? ? ? ? 86  TRP C CG  1 
ATOM 6471  C CD1 . TRP C 1 85  ? -26.535 -2.526  52.057   1.00 10.00 ? ? ? ? ? ? 86  TRP C CD1 1 
ATOM 6472  C CD2 . TRP C 1 85  ? -25.939 -0.341  52.306   1.00 10.00 ? ? ? ? ? ? 86  TRP C CD2 1 
ATOM 6473  N NE1 . TRP C 1 85  ? -25.497 -2.482  52.831   1.00 10.00 ? ? ? ? ? ? 86  TRP C NE1 1 
ATOM 6474  C CE2 . TRP C 1 85  ? -25.109 -1.213  53.008   1.00 10.00 ? ? ? ? ? ? 86  TRP C CE2 1 
ATOM 6475  C CE3 . TRP C 1 85  ? -25.693 1.019   52.376   1.00 10.00 ? ? ? ? ? ? 86  TRP C CE3 1 
ATOM 6476  C CZ2 . TRP C 1 85  ? -24.030 -0.793  53.777   1.00 10.00 ? ? ? ? ? ? 86  TRP C CZ2 1 
ATOM 6477  C CZ3 . TRP C 1 85  ? -24.623 1.450   53.144   1.00 10.00 ? ? ? ? ? ? 86  TRP C CZ3 1 
ATOM 6478  C CH2 . TRP C 1 85  ? -23.798 0.552   53.835   1.00 10.00 ? ? ? ? ? ? 86  TRP C CH2 1 
ATOM 6479  N N   . HIS C 1 86  ? -29.839 -1.093  48.194   1.00 10.00 ? ? ? ? ? ? 87  HIS C N   1 
ATOM 6480  C CA  . HIS C 1 86  ? -31.083 -1.077  47.420   1.00 10.00 ? ? ? ? ? ? 87  HIS C CA  1 
ATOM 6481  C C   . HIS C 1 86  ? -31.481 -2.451  46.888   1.00 10.00 ? ? ? ? ? ? 87  HIS C C   1 
ATOM 6482  O O   . HIS C 1 86  ? -32.622 -2.833  47.047   1.00 10.00 ? ? ? ? ? ? 87  HIS C O   1 
ATOM 6483  C CB  . HIS C 1 86  ? -30.902 -0.108  46.250   1.00 10.00 ? ? ? ? ? ? 87  HIS C CB  1 
ATOM 6484  C CG  . HIS C 1 86  ? -32.175 0.344   45.543   1.00 10.00 ? ? ? ? ? ? 87  HIS C CG  1 
ATOM 6485  N ND1 . HIS C 1 86  ? -32.775 1.557   45.541   1.00 10.00 ? ? ? ? ? ? 87  HIS C ND1 1 
ATOM 6486  C CD2 . HIS C 1 86  ? -32.926 -0.485  44.733   1.00 10.00 ? ? ? ? ? ? 87  HIS C CD2 1 
ATOM 6487  C CE1 . HIS C 1 86  ? -33.842 1.490   44.768   1.00 10.00 ? ? ? ? ? ? 87  HIS C CE1 1 
ATOM 6488  N NE2 . HIS C 1 86  ? -33.903 0.258   44.300   1.00 10.00 ? ? ? ? ? ? 87  HIS C NE2 1 
ATOM 6489  N N   . HIS C 1 87  ? -30.580 -3.205  46.262   1.00 10.00 ? ? ? ? ? ? 88  HIS C N   1 
ATOM 6490  C CA  . HIS C 1 87  ? -30.752 -4.598  45.813   1.00 10.00 ? ? ? ? ? ? 88  HIS C CA  1 
ATOM 6491  C C   . HIS C 1 87  ? -31.004 -5.582  46.981   1.00 10.00 ? ? ? ? ? ? 88  HIS C C   1 
ATOM 6492  O O   . HIS C 1 87  ? -31.806 -6.527  46.837   1.00 10.00 ? ? ? ? ? ? 88  HIS C O   1 
ATOM 6493  C CB  . HIS C 1 87  ? -29.484 -5.055  45.016   1.00 10.00 ? ? ? ? ? ? 88  HIS C CB  1 
ATOM 6494  C CG  . HIS C 1 87  ? -29.535 -6.498  44.488   1.00 10.00 ? ? ? ? ? ? 88  HIS C CG  1 
ATOM 6495  N ND1 . HIS C 1 87  ? -30.301 -7.013  43.528   1.00 10.00 ? ? ? ? ? ? 88  HIS C ND1 1 
ATOM 6496  C CD2 . HIS C 1 87  ? -28.864 -7.554  45.046   1.00 10.00 ? ? ? ? ? ? 88  HIS C CD2 1 
ATOM 6497  C CE1 . HIS C 1 87  ? -30.144 -8.309  43.503   1.00 10.00 ? ? ? ? ? ? 88  HIS C CE1 1 
ATOM 6498  N NE2 . HIS C 1 87  ? -29.275 -8.616  44.424   1.00 10.00 ? ? ? ? ? ? 88  HIS C NE2 1 
ATOM 6499  N N   . THR C 1 88  ? -30.299 -5.488  48.105   1.00 10.00 ? ? ? ? ? ? 89  THR C N   1 
ATOM 6500  C CA  . THR C 1 88  ? -30.609 -6.262  49.314   1.00 10.00 ? ? ? ? ? ? 89  THR C CA  1 
ATOM 6501  C C   . THR C 1 88  ? -32.134 -6.159  49.649   1.00 10.00 ? ? ? ? ? ? 89  THR C C   1 
ATOM 6502  O O   . THR C 1 88  ? -32.885 -7.161  49.684   1.00 10.00 ? ? ? ? ? ? 89  THR C O   1 
ATOM 6503  C CB  . THR C 1 88  ? -29.790 -5.698  50.531   1.00 10.00 ? ? ? ? ? ? 89  THR C CB  1 
ATOM 6504  O OG1 . THR C 1 88  ? -28.425 -5.657  50.128   1.00 10.00 ? ? ? ? ? ? 89  THR C OG1 1 
ATOM 6505  C CG2 . THR C 1 88  ? -29.997 -6.484  51.808   1.00 10.00 ? ? ? ? ? ? 89  THR C CG2 1 
ATOM 6506  N N   . PHE C 1 89  ? -32.658 -4.927  49.819   1.00 10.00 ? ? ? ? ? ? 90  PHE C N   1 
ATOM 6507  C CA  . PHE C 1 89  ? -34.051 -4.732  50.265   1.00 10.00 ? ? ? ? ? ? 90  PHE C CA  1 
ATOM 6508  C C   . PHE C 1 89  ? -35.075 -4.994  49.167   1.00 10.00 ? ? ? ? ? ? 90  PHE C C   1 
ATOM 6509  O O   . PHE C 1 89  ? -35.896 -5.914  49.229   1.00 10.00 ? ? ? ? ? ? 90  PHE C O   1 
ATOM 6510  C CB  . PHE C 1 89  ? -34.248 -3.291  50.817   1.00 10.00 ? ? ? ? ? ? 90  PHE C CB  1 
ATOM 6511  C CG  . PHE C 1 89  ? -33.249 -2.834  51.887   1.00 10.00 ? ? ? ? ? ? 90  PHE C CG  1 
ATOM 6512  C CD1 . PHE C 1 89  ? -33.119 -3.506  53.088   1.00 10.00 ? ? ? ? ? ? 90  PHE C CD1 1 
ATOM 6513  C CD2 . PHE C 1 89  ? -32.483 -1.719  51.664   1.00 10.00 ? ? ? ? ? ? 90  PHE C CD2 1 
ATOM 6514  C CE1 . PHE C 1 89  ? -32.223 -3.050  54.046   1.00 10.00 ? ? ? ? ? ? 90  PHE C CE1 1 
ATOM 6515  C CE2 . PHE C 1 89  ? -31.603 -1.285  52.613   1.00 10.00 ? ? ? ? ? ? 90  PHE C CE2 1 
ATOM 6516  C CZ  . PHE C 1 89  ? -31.462 -1.935  53.809   1.00 10.00 ? ? ? ? ? ? 90  PHE C CZ  1 
ATOM 6517  N N   . TYR C 1 90  ? -34.930 -4.239  48.084   1.00 10.00 ? ? ? ? ? ? 91  TYR C N   1 
ATOM 6518  C CA  . TYR C 1 90  ? -35.861 -4.267  46.970   1.00 10.00 ? ? ? ? ? ? 91  TYR C CA  1 
ATOM 6519  C C   . TYR C 1 90  ? -35.757 -5.427  46.030   1.00 10.00 ? ? ? ? ? ? 91  TYR C C   1 
ATOM 6520  O O   . TYR C 1 90  ? -36.644 -5.586  45.209   1.00 10.00 ? ? ? ? ? ? 91  TYR C O   1 
ATOM 6521  C CB  . TYR C 1 90  ? -35.723 -3.016  46.139   1.00 10.00 ? ? ? ? ? ? 91  TYR C CB  1 
ATOM 6522  C CG  . TYR C 1 90  ? -35.986 -1.765  46.961   1.00 10.00 ? ? ? ? ? ? 91  TYR C CG  1 
ATOM 6523  C CD1 . TYR C 1 90  ? -37.260 -1.366  47.308   1.00 10.00 ? ? ? ? ? ? 91  TYR C CD1 1 
ATOM 6524  C CD2 . TYR C 1 90  ? -34.899 -1.013  47.319   1.00 10.00 ? ? ? ? ? ? 91  TYR C CD2 1 
ATOM 6525  C CE1 . TYR C 1 90  ? -37.410 -0.191  48.009   1.00 10.00 ? ? ? ? ? ? 91  TYR C CE1 1 
ATOM 6526  C CE2 . TYR C 1 90  ? -35.033 0.144   48.022   1.00 10.00 ? ? ? ? ? ? 91  TYR C CE2 1 
ATOM 6527  C CZ  . TYR C 1 90  ? -36.292 0.541   48.355   1.00 10.00 ? ? ? ? ? ? 91  TYR C CZ  1 
ATOM 6528  O OH  . TYR C 1 90  ? -36.385 1.710   49.069   1.00 10.00 ? ? ? ? ? ? 91  TYR C OH  1 
ATOM 6529  N N   . ASN C 1 91  ? -34.728 -6.243  46.015   1.00 10.00 ? ? ? ? ? ? 92  ASN C N   1 
ATOM 6530  C CA  . ASN C 1 91  ? -34.708 -7.354  45.077   1.00 10.00 ? ? ? ? ? ? 92  ASN C CA  1 
ATOM 6531  C C   . ASN C 1 91  ? -34.405 -8.650  45.801   1.00 10.00 ? ? ? ? ? ? 92  ASN C C   1 
ATOM 6532  O O   . ASN C 1 91  ? -34.974 -9.667  45.420   1.00 10.00 ? ? ? ? ? ? 92  ASN C O   1 
ATOM 6533  C CB  . ASN C 1 91  ? -33.656 -7.131  43.969   1.00 10.00 ? ? ? ? ? ? 92  ASN C CB  1 
ATOM 6534  C CG  . ASN C 1 91  ? -33.832 -5.905  43.079   1.00 10.00 ? ? ? ? ? ? 92  ASN C CG  1 
ATOM 6535  O OD1 . ASN C 1 91  ? -32.881 -5.361  42.521   1.00 10.00 ? ? ? ? ? ? 92  ASN C OD1 1 
ATOM 6536  N ND2 . ASN C 1 91  ? -35.007 -5.371  42.914   1.00 10.00 ? ? ? ? ? ? 92  ASN C ND2 1 
ATOM 6537  N N   . GLU C 1 92  ? -33.545 -8.669  46.836   1.00 10.00 ? ? ? ? ? ? 93  GLU C N   1 
ATOM 6538  C CA  . GLU C 1 92  ? -33.283 -9.919  47.494   1.00 10.00 ? ? ? ? ? ? 93  GLU C CA  1 
ATOM 6539  C C   . GLU C 1 92  ? -34.254 -10.247 48.626   1.00 10.00 ? ? ? ? ? ? 93  GLU C C   1 
ATOM 6540  O O   . GLU C 1 92  ? -34.856 -11.324 48.640   1.00 10.00 ? ? ? ? ? ? 93  GLU C O   1 
ATOM 6541  C CB  . GLU C 1 92  ? -31.861 -9.888  47.966   1.00 10.00 ? ? ? ? ? ? 93  GLU C CB  1 
ATOM 6542  C CG  . GLU C 1 92  ? -31.127 -11.156 47.441   1.00 10.00 ? ? ? ? ? ? 93  GLU C CG  1 
ATOM 6543  C CD  . GLU C 1 92  ? -30.807 -11.332 45.936   1.00 10.00 ? ? ? ? ? ? 93  GLU C CD  1 
ATOM 6544  O OE1 . GLU C 1 92  ? -31.662 -11.752 45.140   1.00 10.00 ? ? ? ? ? ? 93  GLU C OE1 1 
ATOM 6545  O OE2 . GLU C 1 92  ? -29.673 -11.081 45.543   1.00 10.00 ? ? ? ? ? ? 93  GLU C OE2 1 
ATOM 6546  N N   . LEU C 1 93  ? -34.490 -9.385  49.602   1.00 10.00 ? ? ? ? ? ? 94  LEU C N   1 
ATOM 6547  C CA  . LEU C 1 93  ? -35.374 -9.796  50.667   1.00 10.00 ? ? ? ? ? ? 94  LEU C CA  1 
ATOM 6548  C C   . LEU C 1 93  ? -36.810 -9.415  50.361   1.00 10.00 ? ? ? ? ? ? 94  LEU C C   1 
ATOM 6549  O O   . LEU C 1 93  ? -37.736 -9.985  50.949   1.00 10.00 ? ? ? ? ? ? 94  LEU C O   1 
ATOM 6550  C CB  . LEU C 1 93  ? -34.827 -9.173  51.936   1.00 10.00 ? ? ? ? ? ? 94  LEU C CB  1 
ATOM 6551  C CG  . LEU C 1 93  ? -33.488 -9.747  52.415   1.00 10.00 ? ? ? ? ? ? 94  LEU C CG  1 
ATOM 6552  C CD1 . LEU C 1 93  ? -32.821 -8.735  53.332   1.00 10.00 ? ? ? ? ? ? 94  LEU C CD1 1 
ATOM 6553  C CD2 . LEU C 1 93  ? -33.708 -11.095 53.088   1.00 10.00 ? ? ? ? ? ? 94  LEU C CD2 1 
ATOM 6554  N N   . ARG C 1 94  ? -36.977 -8.463  49.404   1.00 10.00 ? ? ? ? ? ? 95  ARG C N   1 
ATOM 6555  C CA  . ARG C 1 94  ? -38.277 -7.966  48.866   1.00 10.00 ? ? ? ? ? ? 95  ARG C CA  1 
ATOM 6556  C C   . ARG C 1 94  ? -39.088 -7.235  49.981   1.00 10.00 ? ? ? ? ? ? 95  ARG C C   1 
ATOM 6557  O O   . ARG C 1 94  ? -40.300 -7.390  50.221   1.00 10.00 ? ? ? ? ? ? 95  ARG C O   1 
ATOM 6558  C CB  . ARG C 1 94  ? -39.071 -9.158  48.299   1.00 10.00 ? ? ? ? ? ? 95  ARG C CB  1 
ATOM 6559  C CG  . ARG C 1 94  ? -38.355 -10.077 47.256   1.00 10.00 ? ? ? ? ? ? 95  ARG C CG  1 
ATOM 6560  C CD  . ARG C 1 94  ? -38.483 -9.554  45.852   1.00 10.00 ? ? ? ? ? ? 95  ARG C CD  1 
ATOM 6561  N NE  . ARG C 1 94  ? -39.909 -9.481  45.556   1.00 10.00 ? ? ? ? ? ? 95  ARG C NE  1 
ATOM 6562  C CZ  . ARG C 1 94  ? -40.389 -8.571  44.702   1.00 10.00 ? ? ? ? ? ? 95  ARG C CZ  1 
ATOM 6563  N NH1 . ARG C 1 94  ? -39.566 -7.703  44.063   1.00 10.00 ? ? ? ? ? ? 95  ARG C NH1 1 
ATOM 6564  N NH2 . ARG C 1 94  ? -41.716 -8.472  44.573   1.00 10.00 ? ? ? ? ? ? 95  ARG C NH2 1 
ATOM 6565  N N   . VAL C 1 95  ? -38.323 -6.319  50.588   1.00 10.00 ? ? ? ? ? ? 96  VAL C N   1 
ATOM 6566  C CA  . VAL C 1 95  ? -38.654 -5.623  51.796   1.00 10.00 ? ? ? ? ? ? 96  VAL C CA  1 
ATOM 6567  C C   . VAL C 1 95  ? -38.705 -4.104  51.541   1.00 10.00 ? ? ? ? ? ? 96  VAL C C   1 
ATOM 6568  O O   . VAL C 1 95  ? -38.248 -3.543  50.527   1.00 10.00 ? ? ? ? ? ? 96  VAL C O   1 
ATOM 6569  C CB  . VAL C 1 95  ? -37.553 -6.103  52.841   1.00 10.00 ? ? ? ? ? ? 96  VAL C CB  1 
ATOM 6570  C CG1 . VAL C 1 95  ? -36.630 -4.992  53.358   1.00 10.00 ? ? ? ? ? ? 96  VAL C CG1 1 
ATOM 6571  C CG2 . VAL C 1 95  ? -38.322 -6.819  53.942   1.00 10.00 ? ? ? ? ? ? 96  VAL C CG2 1 
ATOM 6572  N N   . ALA C 1 96  ? -39.282 -3.441  52.534   1.00 10.00 ? ? ? ? ? ? 97  ALA C N   1 
ATOM 6573  C CA  . ALA C 1 96  ? -39.427 -2.025  52.486   1.00 10.00 ? ? ? ? ? ? 97  ALA C CA  1 
ATOM 6574  C C   . ALA C 1 96  ? -38.603 -1.508  53.626   1.00 10.00 ? ? ? ? ? ? 97  ALA C C   1 
ATOM 6575  O O   . ALA C 1 96  ? -38.772 -1.949  54.756   1.00 10.00 ? ? ? ? ? ? 97  ALA C O   1 
ATOM 6576  C CB  . ALA C 1 96  ? -40.879 -1.705  52.674   1.00 10.00 ? ? ? ? ? ? 97  ALA C CB  1 
ATOM 6577  N N   . PRO C 1 97  ? -37.666 -0.628  53.362   1.00 10.00 ? ? ? ? ? ? 98  PRO C N   1 
ATOM 6578  C CA  . PRO C 1 97  ? -36.751 -0.133  54.363   1.00 10.00 ? ? ? ? ? ? 98  PRO C CA  1 
ATOM 6579  C C   . PRO C 1 97  ? -37.406 0.651   55.467   1.00 10.00 ? ? ? ? ? ? 98  PRO C C   1 
ATOM 6580  O O   . PRO C 1 97  ? -37.009 0.451   56.619   1.00 10.00 ? ? ? ? ? ? 98  PRO C O   1 
ATOM 6581  C CB  . PRO C 1 97  ? -35.721 0.672   53.593   1.00 10.00 ? ? ? ? ? ? 98  PRO C CB  1 
ATOM 6582  C CG  . PRO C 1 97  ? -35.663 -0.110  52.291   1.00 10.00 ? ? ? ? ? ? 98  PRO C CG  1 
ATOM 6583  C CD  . PRO C 1 97  ? -37.132 -0.362  52.033   1.00 10.00 ? ? ? ? ? ? 98  PRO C CD  1 
ATOM 6584  N N   . GLU C 1 98  ? -38.501 1.387   55.189   1.00 10.00 ? ? ? ? ? ? 99  GLU C N   1 
ATOM 6585  C CA  . GLU C 1 98  ? -39.154 2.261   56.185   1.00 10.00 ? ? ? ? ? ? 99  GLU C CA  1 
ATOM 6586  C C   . GLU C 1 98  ? -40.070 1.703   57.279   1.00 10.00 ? ? ? ? ? ? 99  GLU C C   1 
ATOM 6587  O O   . GLU C 1 98  ? -40.702 2.432   58.059   1.00 10.00 ? ? ? ? ? ? 99  GLU C O   1 
ATOM 6588  C CB  . GLU C 1 98  ? -39.939 3.336   55.468   1.00 10.00 ? ? ? ? ? ? 99  GLU C CB  1 
ATOM 6589  C CG  . GLU C 1 98  ? -40.892 2.900   54.403   1.00 10.00 ? ? ? ? ? ? 99  GLU C CG  1 
ATOM 6590  C CD  . GLU C 1 98  ? -40.296 2.853   53.016   1.00 10.00 ? ? ? ? ? ? 99  GLU C CD  1 
ATOM 6591  O OE1 . GLU C 1 98  ? -39.081 2.983   52.837   1.00 10.00 ? ? ? ? ? ? 99  GLU C OE1 1 
ATOM 6592  O OE2 . GLU C 1 98  ? -41.073 2.689   52.078   1.00 10.00 ? ? ? ? ? ? 99  GLU C OE2 1 
ATOM 6593  N N   . GLU C 1 99  ? -40.040 0.374   57.356   1.00 10.00 ? ? ? ? ? ? 100 GLU C N   1 
ATOM 6594  C CA  . GLU C 1 99  ? -40.848 -0.430  58.250   1.00 10.00 ? ? ? ? ? ? 100 GLU C CA  1 
ATOM 6595  C C   . GLU C 1 99  ? -40.001 -1.399  59.102   1.00 10.00 ? ? ? ? ? ? 100 GLU C C   1 
ATOM 6596  O O   . GLU C 1 99  ? -40.544 -2.156  59.919   1.00 10.00 ? ? ? ? ? ? 100 GLU C O   1 
ATOM 6597  C CB  . GLU C 1 99  ? -41.808 -1.218  57.385   1.00 10.00 ? ? ? ? ? ? 100 GLU C CB  1 
ATOM 6598  C CG  . GLU C 1 99  ? -42.721 -0.403  56.515   1.00 10.00 ? ? ? ? ? ? 100 GLU C CG  1 
ATOM 6599  C CD  . GLU C 1 99  ? -43.415 -1.123  55.368   1.00 10.00 ? ? ? ? ? ? 100 GLU C CD  1 
ATOM 6600  O OE1 . GLU C 1 99  ? -43.884 -2.266  55.517   1.00 10.00 ? ? ? ? ? ? 100 GLU C OE1 1 
ATOM 6601  O OE2 . GLU C 1 99  ? -43.507 -0.503  54.299   1.00 10.00 ? ? ? ? ? ? 100 GLU C OE2 1 
ATOM 6602  N N   . HIS C 1 100 ? -38.671 -1.506  58.889   1.00 10.00 ? ? ? ? ? ? 101 HIS C N   1 
ATOM 6603  C CA  . HIS C 1 100 ? -37.808 -2.494  59.559   1.00 10.00 ? ? ? ? ? ? 101 HIS C CA  1 
ATOM 6604  C C   . HIS C 1 100 ? -36.593 -1.757  60.052   1.00 10.00 ? ? ? ? ? ? 101 HIS C C   1 
ATOM 6605  O O   . HIS C 1 100 ? -36.054 -0.874  59.376   1.00 10.00 ? ? ? ? ? ? 101 HIS C O   1 
ATOM 6606  C CB  . HIS C 1 100 ? -37.299 -3.591  58.631   1.00 10.00 ? ? ? ? ? ? 101 HIS C CB  1 
ATOM 6607  C CG  . HIS C 1 100 ? -38.420 -4.472  58.103   1.00 10.00 ? ? ? ? ? ? 101 HIS C CG  1 
ATOM 6608  N ND1 . HIS C 1 100 ? -38.852 -5.623  58.614   1.00 10.00 ? ? ? ? ? ? 101 HIS C ND1 1 
ATOM 6609  C CD2 . HIS C 1 100 ? -39.236 -4.161  57.033   1.00 10.00 ? ? ? ? ? ? 101 HIS C CD2 1 
ATOM 6610  C CE1 . HIS C 1 100 ? -39.910 -6.010  57.915   1.00 10.00 ? ? ? ? ? ? 101 HIS C CE1 1 
ATOM 6611  N NE2 . HIS C 1 100 ? -40.138 -5.125  56.968   1.00 10.00 ? ? ? ? ? ? 101 HIS C NE2 1 
ATOM 6612  N N   . PRO C 1 101 ? -36.189 -1.984  61.287   1.00 10.00 ? ? ? ? ? ? 102 PRO C N   1 
ATOM 6613  C CA  . PRO C 1 101 ? -34.905 -1.514  61.705   1.00 10.00 ? ? ? ? ? ? 102 PRO C CA  1 
ATOM 6614  C C   . PRO C 1 101 ? -33.812 -2.363  61.058   1.00 10.00 ? ? ? ? ? ? 102 PRO C C   1 
ATOM 6615  O O   . PRO C 1 101 ? -34.045 -3.537  60.738   1.00 10.00 ? ? ? ? ? ? 102 PRO C O   1 
ATOM 6616  C CB  . PRO C 1 101 ? -35.067 -1.561  63.238   1.00 10.00 ? ? ? ? ? ? 102 PRO C CB  1 
ATOM 6617  C CG  . PRO C 1 101 ? -36.070 -2.630  63.495   1.00 10.00 ? ? ? ? ? ? 102 PRO C CG  1 
ATOM 6618  C CD  . PRO C 1 101 ? -37.049 -2.289  62.421   1.00 10.00 ? ? ? ? ? ? 102 PRO C CD  1 
ATOM 6619  N N   . VAL C 1 102 ? -32.646 -1.791  60.776   1.00 10.00 ? ? ? ? ? ? 103 VAL C N   1 
ATOM 6620  C CA  . VAL C 1 102 ? -31.560 -2.606  60.255   1.00 10.00 ? ? ? ? ? ? 103 VAL C CA  1 
ATOM 6621  C C   . VAL C 1 102 ? -30.332 -2.714  61.167   1.00 10.00 ? ? ? ? ? ? 103 VAL C C   1 
ATOM 6622  O O   . VAL C 1 102 ? -29.937 -1.759  61.870   1.00 10.00 ? ? ? ? ? ? 103 VAL C O   1 
ATOM 6623  C CB  . VAL C 1 102 ? -31.104 -2.078  58.922   1.00 10.00 ? ? ? ? ? ? 103 VAL C CB  1 
ATOM 6624  C CG1 . VAL C 1 102 ? -32.281 -2.173  57.960   1.00 10.00 ? ? ? ? ? ? 103 VAL C CG1 1 
ATOM 6625  C CG2 . VAL C 1 102 ? -30.595 -0.656  59.048   1.00 10.00 ? ? ? ? ? ? 103 VAL C CG2 1 
ATOM 6626  N N   . LEU C 1 103 ? -29.748 -3.912  61.293   1.00 10.00 ? ? ? ? ? ? 104 LEU C N   1 
ATOM 6627  C CA  . LEU C 1 103 ? -28.509 -3.962  62.008   1.00 10.00 ? ? ? ? ? ? 104 LEU C CA  1 
ATOM 6628  C C   . LEU C 1 103 ? -27.522 -4.090  60.866   1.00 10.00 ? ? ? ? ? ? 104 LEU C C   1 
ATOM 6629  O O   . LEU C 1 103 ? -27.618 -5.032  60.073   1.00 10.00 ? ? ? ? ? ? 104 LEU C O   1 
ATOM 6630  C CB  . LEU C 1 103 ? -28.468 -5.169  62.952   1.00 10.00 ? ? ? ? ? ? 104 LEU C CB  1 
ATOM 6631  C CG  . LEU C 1 103 ? -27.152 -5.302  63.821   1.00 10.00 ? ? ? ? ? ? 104 LEU C CG  1 
ATOM 6632  C CD1 . LEU C 1 103 ? -27.497 -5.464  65.300   1.00 10.00 ? ? ? ? ? ? 104 LEU C CD1 1 
ATOM 6633  C CD2 . LEU C 1 103 ? -26.312 -6.481  63.315   1.00 10.00 ? ? ? ? ? ? 104 LEU C CD2 1 
ATOM 6634  N N   . LEU C 1 104 ? -26.593 -3.181  60.640   1.00 10.00 ? ? ? ? ? ? 105 LEU C N   1 
ATOM 6635  C CA  . LEU C 1 104 ? -25.648 -3.322  59.526   1.00 10.00 ? ? ? ? ? ? 105 LEU C CA  1 
ATOM 6636  C C   . LEU C 1 104 ? -24.362 -3.799  60.143   1.00 10.00 ? ? ? ? ? ? 105 LEU C C   1 
ATOM 6637  O O   . LEU C 1 104 ? -24.084 -3.274  61.218   1.00 10.00 ? ? ? ? ? ? 105 LEU C O   1 
ATOM 6638  C CB  . LEU C 1 104 ? -25.310 -2.016  58.865   1.00 10.00 ? ? ? ? ? ? 105 LEU C CB  1 
ATOM 6639  C CG  . LEU C 1 104 ? -26.335 -1.171  58.243   1.00 10.00 ? ? ? ? ? ? 105 LEU C CG  1 
ATOM 6640  C CD1 . LEU C 1 104 ? -25.616 0.057   57.826   1.00 10.00 ? ? ? ? ? ? 105 LEU C CD1 1 
ATOM 6641  C CD2 . LEU C 1 104 ? -26.914 -1.768  56.993   1.00 10.00 ? ? ? ? ? ? 105 LEU C CD2 1 
ATOM 6642  N N   . THR C 1 105 ? -23.542 -4.724  59.687   1.00 10.00 ? ? ? ? ? ? 106 THR C N   1 
ATOM 6643  C CA  . THR C 1 105 ? -22.308 -4.877  60.441   1.00 10.00 ? ? ? ? ? ? 106 THR C CA  1 
ATOM 6644  C C   . THR C 1 105 ? -21.193 -4.024  59.887   1.00 10.00 ? ? ? ? ? ? 106 THR C C   1 
ATOM 6645  O O   . THR C 1 105 ? -21.289 -3.474  58.791   1.00 10.00 ? ? ? ? ? ? 106 THR C O   1 
ATOM 6646  C CB  . THR C 1 105 ? -21.920 -6.330  60.478   1.00 10.00 ? ? ? ? ? ? 106 THR C CB  1 
ATOM 6647  O OG1 . THR C 1 105 ? -21.828 -6.768  59.125   1.00 10.00 ? ? ? ? ? ? 106 THR C OG1 1 
ATOM 6648  C CG2 . THR C 1 105 ? -22.911 -7.167  61.239   1.00 10.00 ? ? ? ? ? ? 106 THR C CG2 1 
ATOM 6649  N N   . GLU C 1 106 ? -20.096 -3.904  60.599   1.00 10.00 ? ? ? ? ? ? 107 GLU C N   1 
ATOM 6650  C CA  . GLU C 1 106 ? -18.979 -3.097  60.154   1.00 10.00 ? ? ? ? ? ? 107 GLU C CA  1 
ATOM 6651  C C   . GLU C 1 106 ? -17.604 -3.675  60.543   1.00 10.00 ? ? ? ? ? ? 107 GLU C C   1 
ATOM 6652  O O   . GLU C 1 106 ? -17.517 -4.556  61.395   1.00 10.00 ? ? ? ? ? ? 107 GLU C O   1 
ATOM 6653  C CB  . GLU C 1 106 ? -19.122 -1.713  60.739   1.00 10.00 ? ? ? ? ? ? 107 GLU C CB  1 
ATOM 6654  C CG  . GLU C 1 106 ? -19.170 -1.733  62.283   1.00 10.00 ? ? ? ? ? ? 107 GLU C CG  1 
ATOM 6655  C CD  . GLU C 1 106 ? -18.618 -0.503  62.959   1.00 10.00 ? ? ? ? ? ? 107 GLU C CD  1 
ATOM 6656  O OE1 . GLU C 1 106 ? -18.287 0.468   62.305   1.00 10.00 ? ? ? ? ? ? 107 GLU C OE1 1 
ATOM 6657  O OE2 . GLU C 1 106 ? -18.492 -0.528  64.163   1.00 10.00 ? ? ? ? ? ? 107 GLU C OE2 1 
ATOM 6658  N N   . ALA C 1 107 ? -16.538 -3.308  59.854   1.00 10.00 ? ? ? ? ? ? 108 ALA C N   1 
ATOM 6659  C CA  . ALA C 1 107 ? -15.192 -3.722  60.168   1.00 10.00 ? ? ? ? ? ? 108 ALA C CA  1 
ATOM 6660  C C   . ALA C 1 107 ? -14.747 -3.262  61.537   1.00 10.00 ? ? ? ? ? ? 108 ALA C C   1 
ATOM 6661  O O   . ALA C 1 107 ? -15.061 -2.133  61.919   1.00 10.00 ? ? ? ? ? ? 108 ALA C O   1 
ATOM 6662  C CB  . ALA C 1 107 ? -14.206 -3.140  59.172   1.00 10.00 ? ? ? ? ? ? 108 ALA C CB  1 
ATOM 6663  N N   . PRO C 1 108 ? -14.011 -4.067  62.316   1.00 10.00 ? ? ? ? ? ? 109 PRO C N   1 
ATOM 6664  C CA  . PRO C 1 108 ? -13.191 -3.606  63.442   1.00 10.00 ? ? ? ? ? ? 109 PRO C CA  1 
ATOM 6665  C C   . PRO C 1 108 ? -12.332 -2.453  62.964   1.00 10.00 ? ? ? ? ? ? 109 PRO C C   1 
ATOM 6666  O O   . PRO C 1 108 ? -11.671 -2.563  61.908   1.00 10.00 ? ? ? ? ? ? 109 PRO C O   1 
ATOM 6667  C CB  . PRO C 1 108 ? -12.337 -4.772  63.830   1.00 10.00 ? ? ? ? ? ? 109 PRO C CB  1 
ATOM 6668  C CG  . PRO C 1 108 ? -13.059 -5.970  63.253   1.00 10.00 ? ? ? ? ? ? 109 PRO C CG  1 
ATOM 6669  C CD  . PRO C 1 108 ? -13.763 -5.480  62.012   1.00 10.00 ? ? ? ? ? ? 109 PRO C CD  1 
ATOM 6670  N N   . LEU C 1 109 ? -12.232 -1.422  63.782   1.00 10.00 ? ? ? ? ? ? 110 LEU C N   1 
ATOM 6671  C CA  . LEU C 1 109 ? -11.488 -0.214  63.440   1.00 10.00 ? ? ? ? ? ? 110 LEU C CA  1 
ATOM 6672  C C   . LEU C 1 109 ? -11.999 0.540   62.166   1.00 10.00 ? ? ? ? ? ? 110 LEU C C   1 
ATOM 6673  O O   . LEU C 1 109 ? -11.247 1.256   61.483   1.00 10.00 ? ? ? ? ? ? 110 LEU C O   1 
ATOM 6674  C CB  . LEU C 1 109 ? -9.993  -0.569  63.282   1.00 10.00 ? ? ? ? ? ? 110 LEU C CB  1 
ATOM 6675  C CG  . LEU C 1 109 ? -8.987  -0.851  64.410   1.00 10.00 ? ? ? ? ? ? 110 LEU C CG  1 
ATOM 6676  C CD1 . LEU C 1 109 ? -7.914  -1.735  63.810   1.00 10.00 ? ? ? ? ? ? 110 LEU C CD1 1 
ATOM 6677  C CD2 . LEU C 1 109 ? -8.263  0.378   64.921   1.00 10.00 ? ? ? ? ? ? 110 LEU C CD2 1 
ATOM 6678  N N   . ASN C 1 110 ? -13.300 0.456   61.807   1.00 10.00 ? ? ? ? ? ? 111 ASN C N   1 
ATOM 6679  C CA  . ASN C 1 110 ? -13.864 1.138   60.621   1.00 10.00 ? ? ? ? ? ? 111 ASN C CA  1 
ATOM 6680  C C   . ASN C 1 110 ? -13.721 2.653   60.758   1.00 10.00 ? ? ? ? ? ? 111 ASN C C   1 
ATOM 6681  O O   . ASN C 1 110 ? -14.076 3.189   61.829   1.00 10.00 ? ? ? ? ? ? 111 ASN C O   1 
ATOM 6682  C CB  . ASN C 1 110 ? -15.314 0.753   60.509   1.00 10.00 ? ? ? ? ? ? 111 ASN C CB  1 
ATOM 6683  C CG  . ASN C 1 110 ? -16.120 1.355   59.377   1.00 10.00 ? ? ? ? ? ? 111 ASN C CG  1 
ATOM 6684  O OD1 . ASN C 1 110 ? -15.662 1.683   58.296   1.00 10.00 ? ? ? ? ? ? 111 ASN C OD1 1 
ATOM 6685  N ND2 . ASN C 1 110 ? -17.423 1.441   59.505   1.00 10.00 ? ? ? ? ? ? 111 ASN C ND2 1 
ATOM 6686  N N   . PRO C 1 111 ? -13.162 3.396   59.801   1.00 10.00 ? ? ? ? ? ? 112 PRO C N   1 
ATOM 6687  C CA  . PRO C 1 111 ? -13.011 4.835   59.903   1.00 10.00 ? ? ? ? ? ? 112 PRO C CA  1 
ATOM 6688  C C   . PRO C 1 111 ? -14.245 5.615   60.353   1.00 10.00 ? ? ? ? ? ? 112 PRO C C   1 
ATOM 6689  O O   . PRO C 1 111 ? -15.363 5.268   60.008   1.00 10.00 ? ? ? ? ? ? 112 PRO C O   1 
ATOM 6690  C CB  . PRO C 1 111 ? -12.504 5.190   58.531   1.00 10.00 ? ? ? ? ? ? 112 PRO C CB  1 
ATOM 6691  C CG  . PRO C 1 111 ? -11.648 3.984   58.185   1.00 10.00 ? ? ? ? ? ? 112 PRO C CG  1 
ATOM 6692  C CD  . PRO C 1 111 ? -12.562 2.868   58.585   1.00 10.00 ? ? ? ? ? ? 112 PRO C CD  1 
ATOM 6693  N N   . LYS C 1 112 ? -14.088 6.647   61.177   1.00 10.00 ? ? ? ? ? ? 113 LYS C N   1 
ATOM 6694  C CA  . LYS C 1 112 ? -15.120 7.555   61.682   1.00 10.00 ? ? ? ? ? ? 113 LYS C CA  1 
ATOM 6695  C C   . LYS C 1 112 ? -16.169 7.973   60.692   1.00 10.00 ? ? ? ? ? ? 113 LYS C C   1 
ATOM 6696  O O   . LYS C 1 112 ? -17.359 7.810   60.941   1.00 10.00 ? ? ? ? ? ? 113 LYS C O   1 
ATOM 6697  C CB  . LYS C 1 112 ? -14.598 8.892   62.152   1.00 10.00 ? ? ? ? ? ? 113 LYS C CB  1 
ATOM 6698  C CG  . LYS C 1 112 ? -13.628 8.930   63.277   1.00 10.00 ? ? ? ? ? ? 113 LYS C CG  1 
ATOM 6699  C CD  . LYS C 1 112 ? -14.367 8.774   64.580   1.00 10.00 ? ? ? ? ? ? 113 LYS C CD  1 
ATOM 6700  C CE  . LYS C 1 112 ? -13.670 9.762   65.501   1.00 10.00 ? ? ? ? ? ? 113 LYS C CE  1 
ATOM 6701  N NZ  . LYS C 1 112 ? -12.288 9.422   65.831   1.00 10.00 ? ? ? ? ? ? 113 LYS C NZ  1 
ATOM 6702  N N   . ALA C 1 113 ? -15.722 8.564   59.594   1.00 10.00 ? ? ? ? ? ? 114 ALA C N   1 
ATOM 6703  C CA  . ALA C 1 113 ? -16.589 9.109   58.581   1.00 10.00 ? ? ? ? ? ? 114 ALA C CA  1 
ATOM 6704  C C   . ALA C 1 113 ? -17.354 8.038   57.830   1.00 10.00 ? ? ? ? ? ? 114 ALA C C   1 
ATOM 6705  O O   . ALA C 1 113 ? -18.384 8.321   57.232   1.00 10.00 ? ? ? ? ? ? 114 ALA C O   1 
ATOM 6706  C CB  . ALA C 1 113 ? -15.736 9.909   57.639   1.00 10.00 ? ? ? ? ? ? 114 ALA C CB  1 
ATOM 6707  N N   . ASN C 1 114 ? -16.875 6.806   57.864   1.00 10.00 ? ? ? ? ? ? 115 ASN C N   1 
ATOM 6708  C CA  . ASN C 1 114 ? -17.574 5.702   57.257   1.00 10.00 ? ? ? ? ? ? 115 ASN C CA  1 
ATOM 6709  C C   . ASN C 1 114 ? -18.746 5.384   58.078   1.00 10.00 ? ? ? ? ? ? 115 ASN C C   1 
ATOM 6710  O O   . ASN C 1 114 ? -19.806 5.270   57.498   1.00 10.00 ? ? ? ? ? ? 115 ASN C O   1 
ATOM 6711  C CB  . ASN C 1 114 ? -16.762 4.425   57.161   1.00 10.00 ? ? ? ? ? ? 115 ASN C CB  1 
ATOM 6712  C CG  . ASN C 1 114 ? -15.594 4.704   56.227   1.00 10.00 ? ? ? ? ? ? 115 ASN C CG  1 
ATOM 6713  O OD1 . ASN C 1 114 ? -14.899 5.695   56.433   1.00 10.00 ? ? ? ? ? ? 115 ASN C OD1 1 
ATOM 6714  N ND2 . ASN C 1 114 ? -15.237 3.994   55.177   1.00 10.00 ? ? ? ? ? ? 115 ASN C ND2 1 
ATOM 6715  N N   . ARG C 1 115 ? -18.600 5.283   59.397   1.00 10.00 ? ? ? ? ? ? 116 ARG C N   1 
ATOM 6716  C CA  . ARG C 1 115 ? -19.700 4.970   60.314   1.00 10.00 ? ? ? ? ? ? 116 ARG C CA  1 
ATOM 6717  C C   . ARG C 1 115 ? -20.795 5.994   60.142   1.00 10.00 ? ? ? ? ? ? 116 ARG C C   1 
ATOM 6718  O O   . ARG C 1 115 ? -21.973 5.680   59.994   1.00 10.00 ? ? ? ? ? ? 116 ARG C O   1 
ATOM 6719  C CB  . ARG C 1 115 ? -19.186 5.012   61.703   1.00 10.00 ? ? ? ? ? ? 116 ARG C CB  1 
ATOM 6720  C CG  . ARG C 1 115 ? -18.336 3.813   61.959   1.00 10.00 ? ? ? ? ? ? 116 ARG C CG  1 
ATOM 6721  C CD  . ARG C 1 115 ? -17.542 3.807   63.273   1.00 10.00 ? ? ? ? ? ? 116 ARG C CD  1 
ATOM 6722  N NE  . ARG C 1 115 ? -18.140 4.047   64.599   1.00 10.00 ? ? ? ? ? ? 116 ARG C NE  1 
ATOM 6723  C CZ  . ARG C 1 115 ? -19.011 3.289   65.275   1.00 10.00 ? ? ? ? ? ? 116 ARG C CZ  1 
ATOM 6724  N NH1 . ARG C 1 115 ? -19.530 2.157   64.830   1.00 10.00 ? ? ? ? ? ? 116 ARG C NH1 1 
ATOM 6725  N NH2 . ARG C 1 115 ? -19.256 3.606   66.545   1.00 10.00 ? ? ? ? ? ? 116 ARG C NH2 1 
ATOM 6726  N N   . GLU C 1 116 ? -20.404 7.256   60.046   1.00 10.00 ? ? ? ? ? ? 117 GLU C N   1 
ATOM 6727  C CA  . GLU C 1 116 ? -21.338 8.348   59.811   1.00 10.00 ? ? ? ? ? ? 117 GLU C CA  1 
ATOM 6728  C C   . GLU C 1 116 ? -21.884 8.208   58.425   1.00 10.00 ? ? ? ? ? ? 117 GLU C C   1 
ATOM 6729  O O   . GLU C 1 116 ? -23.108 8.248   58.367   1.00 10.00 ? ? ? ? ? ? 117 GLU C O   1 
ATOM 6730  C CB  . GLU C 1 116 ? -20.725 9.745   59.864   1.00 10.00 ? ? ? ? ? ? 117 GLU C CB  1 
ATOM 6731  C CG  . GLU C 1 116 ? -19.891 10.028  61.096   1.00 10.00 ? ? ? ? ? ? 117 GLU C CG  1 
ATOM 6732  C CD  . GLU C 1 116 ? -19.541 11.457  61.383   1.00 10.00 ? ? ? ? ? ? 117 GLU C CD  1 
ATOM 6733  O OE1 . GLU C 1 116 ? -20.058 12.364  60.734   1.00 10.00 ? ? ? ? ? ? 117 GLU C OE1 1 
ATOM 6734  O OE2 . GLU C 1 116 ? -18.761 11.648  62.308   1.00 10.00 ? ? ? ? ? ? 117 GLU C OE2 1 
ATOM 6735  N N   . LYS C 1 117 ? -21.155 7.979   57.324   1.00 10.00 ? ? ? ? ? ? 118 LYS C N   1 
ATOM 6736  C CA  . LYS C 1 117 ? -21.856 7.901   56.062   1.00 10.00 ? ? ? ? ? ? 118 LYS C CA  1 
ATOM 6737  C C   . LYS C 1 117 ? -22.828 6.753   56.033   1.00 10.00 ? ? ? ? ? ? 118 LYS C C   1 
ATOM 6738  O O   . LYS C 1 117 ? -23.897 6.954   55.462   1.00 10.00 ? ? ? ? ? ? 118 LYS C O   1 
ATOM 6739  C CB  . LYS C 1 117 ? -20.933 7.742   54.885   1.00 10.00 ? ? ? ? ? ? 118 LYS C CB  1 
ATOM 6740  C CG  . LYS C 1 117 ? -21.688 8.181   53.633   1.00 10.00 ? ? ? ? ? ? 118 LYS C CG  1 
ATOM 6741  C CD  . LYS C 1 117 ? -20.744 9.004   52.765   1.00 10.00 ? ? ? ? ? ? 118 LYS C CD  1 
ATOM 6742  C CE  . LYS C 1 117 ? -21.365 9.473   51.446   1.00 10.00 ? ? ? ? ? ? 118 LYS C CE  1 
ATOM 6743  N NZ  . LYS C 1 117 ? -22.050 8.420   50.702   1.00 10.00 ? ? ? ? ? ? 118 LYS C NZ  1 
ATOM 6744  N N   . MET C 1 118 ? -22.608 5.607   56.670   1.00 10.00 ? ? ? ? ? ? 119 MET C N   1 
ATOM 6745  C CA  . MET C 1 118 ? -23.624 4.593   56.600   1.00 10.00 ? ? ? ? ? ? 119 MET C CA  1 
ATOM 6746  C C   . MET C 1 118 ? -24.783 4.911   57.512   1.00 10.00 ? ? ? ? ? ? 119 MET C C   1 
ATOM 6747  O O   . MET C 1 118 ? -25.864 4.399   57.209   1.00 10.00 ? ? ? ? ? ? 119 MET C O   1 
ATOM 6748  C CB  . MET C 1 118 ? -23.046 3.258   56.928   1.00 10.00 ? ? ? ? ? ? 119 MET C CB  1 
ATOM 6749  C CG  . MET C 1 118 ? -22.922 2.775   58.337   1.00 10.00 ? ? ? ? ? ? 119 MET C CG  1 
ATOM 6750  S SD  . MET C 1 118 ? -22.316 1.058   58.246   1.00 10.00 ? ? ? ? ? ? 119 MET C SD  1 
ATOM 6751  C CE  . MET C 1 118 ? -20.627 1.576   58.170   1.00 10.00 ? ? ? ? ? ? 119 MET C CE  1 
ATOM 6752  N N   . THR C 1 119 ? -24.645 5.741   58.576   1.00 10.00 ? ? ? ? ? ? 120 THR C N   1 
ATOM 6753  C CA  . THR C 1 119 ? -25.791 6.251   59.350   1.00 10.00 ? ? ? ? ? ? 120 THR C CA  1 
ATOM 6754  C C   . THR C 1 119 ? -26.679 7.219   58.523   1.00 10.00 ? ? ? ? ? ? 120 THR C C   1 
ATOM 6755  O O   . THR C 1 119 ? -27.919 7.136   58.443   1.00 10.00 ? ? ? ? ? ? 120 THR C O   1 
ATOM 6756  C CB  . THR C 1 119 ? -25.309 7.001   60.583   1.00 10.00 ? ? ? ? ? ? 120 THR C CB  1 
ATOM 6757  O OG1 . THR C 1 119 ? -24.473 6.112   61.314   1.00 10.00 ? ? ? ? ? ? 120 THR C OG1 1 
ATOM 6758  C CG2 . THR C 1 119 ? -26.476 7.458   61.452   1.00 10.00 ? ? ? ? ? ? 120 THR C CG2 1 
ATOM 6759  N N   . GLN C 1 120 ? -25.968 8.145   57.900   1.00 10.00 ? ? ? ? ? ? 121 GLN C N   1 
ATOM 6760  C CA  . GLN C 1 120 ? -26.434 9.086   56.910   1.00 10.00 ? ? ? ? ? ? 121 GLN C CA  1 
ATOM 6761  C C   . GLN C 1 120 ? -27.320 8.434   55.873   1.00 10.00 ? ? ? ? ? ? 121 GLN C C   1 
ATOM 6762  O O   . GLN C 1 120 ? -28.521 8.728   55.933   1.00 10.00 ? ? ? ? ? ? 121 GLN C O   1 
ATOM 6763  C CB  . GLN C 1 120 ? -25.210 9.662   56.258   1.00 10.00 ? ? ? ? ? ? 121 GLN C CB  1 
ATOM 6764  C CG  . GLN C 1 120 ? -25.338 10.728  55.238   1.00 10.00 ? ? ? ? ? ? 121 GLN C CG  1 
ATOM 6765  C CD  . GLN C 1 120 ? -24.989 11.980  55.974   1.00 10.00 ? ? ? ? ? ? 121 GLN C CD  1 
ATOM 6766  O OE1 . GLN C 1 120 ? -23.901 12.209  56.535   1.00 10.00 ? ? ? ? ? ? 121 GLN C OE1 1 
ATOM 6767  N NE2 . GLN C 1 120 ? -26.056 12.762  55.969   1.00 10.00 ? ? ? ? ? ? 121 GLN C NE2 1 
ATOM 6768  N N   . ILE C 1 121 ? -26.771 7.576   54.960   1.00 10.00 ? ? ? ? ? ? 122 ILE C N   1 
ATOM 6769  C CA  . ILE C 1 121 ? -27.500 6.869   53.885   1.00 10.00 ? ? ? ? ? ? 122 ILE C CA  1 
ATOM 6770  C C   . ILE C 1 121 ? -28.749 6.129   54.387   1.00 10.00 ? ? ? ? ? ? 122 ILE C C   1 
ATOM 6771  O O   . ILE C 1 121 ? -29.903 6.316   53.928   1.00 10.00 ? ? ? ? ? ? 122 ILE C O   1 
ATOM 6772  C CB  . ILE C 1 121 ? -26.528 5.831   53.146   1.00 10.00 ? ? ? ? ? ? 122 ILE C CB  1 
ATOM 6773  C CG1 . ILE C 1 121 ? -25.617 6.650   52.257   1.00 10.00 ? ? ? ? ? ? 122 ILE C CG1 1 
ATOM 6774  C CG2 . ILE C 1 121 ? -27.247 4.759   52.277   1.00 10.00 ? ? ? ? ? ? 122 ILE C CG2 1 
ATOM 6775  C CD1 . ILE C 1 121 ? -24.352 5.890   51.912   1.00 10.00 ? ? ? ? ? ? 122 ILE C CD1 1 
ATOM 6776  N N   . MET C 1 122 ? -28.489 5.286   55.390   1.00 10.00 ? ? ? ? ? ? 123 MET C N   1 
ATOM 6777  C CA  . MET C 1 122 ? -29.539 4.475   55.940   1.00 10.00 ? ? ? ? ? ? 123 MET C CA  1 
ATOM 6778  C C   . MET C 1 122 ? -30.654 5.360   56.358   1.00 10.00 ? ? ? ? ? ? 123 MET C C   1 
ATOM 6779  O O   . MET C 1 122 ? -31.742 5.105   55.844   1.00 10.00 ? ? ? ? ? ? 123 MET C O   1 
ATOM 6780  C CB  . MET C 1 122 ? -28.994 3.669   57.094   1.00 10.00 ? ? ? ? ? ? 123 MET C CB  1 
ATOM 6781  C CG  . MET C 1 122 ? -28.250 2.443   56.543   1.00 10.00 ? ? ? ? ? ? 123 MET C CG  1 
ATOM 6782  S SD  . MET C 1 122 ? -29.390 1.187   55.912   1.00 10.00 ? ? ? ? ? ? 123 MET C SD  1 
ATOM 6783  C CE  . MET C 1 122 ? -28.597 0.830   54.374   1.00 10.00 ? ? ? ? ? ? 123 MET C CE  1 
ATOM 6784  N N   . PHE C 1 123 ? -30.426 6.482   57.061   1.00 10.00 ? ? ? ? ? ? 124 PHE C N   1 
ATOM 6785  C CA  . PHE C 1 123 ? -31.566 7.297   57.496   1.00 10.00 ? ? ? ? ? ? 124 PHE C CA  1 
ATOM 6786  C C   . PHE C 1 123 ? -32.231 8.193   56.488   1.00 10.00 ? ? ? ? ? ? 124 PHE C C   1 
ATOM 6787  O O   . PHE C 1 123 ? -33.450 8.133   56.329   1.00 10.00 ? ? ? ? ? ? 124 PHE C O   1 
ATOM 6788  C CB  . PHE C 1 123 ? -31.234 8.197   58.693   1.00 10.00 ? ? ? ? ? ? 124 PHE C CB  1 
ATOM 6789  C CG  . PHE C 1 123 ? -31.310 7.399   59.965   1.00 10.00 ? ? ? ? ? ? 124 PHE C CG  1 
ATOM 6790  C CD1 . PHE C 1 123 ? -32.461 6.762   60.295   1.00 10.00 ? ? ? ? ? ? 124 PHE C CD1 1 
ATOM 6791  C CD2 . PHE C 1 123 ? -30.208 7.287   60.743   1.00 10.00 ? ? ? ? ? ? 124 PHE C CD2 1 
ATOM 6792  C CE1 . PHE C 1 123 ? -32.502 6.010   61.408   1.00 10.00 ? ? ? ? ? ? 124 PHE C CE1 1 
ATOM 6793  C CE2 . PHE C 1 123 ? -30.254 6.527   61.866   1.00 10.00 ? ? ? ? ? ? 124 PHE C CE2 1 
ATOM 6794  C CZ  . PHE C 1 123 ? -31.400 5.897   62.188   1.00 10.00 ? ? ? ? ? ? 124 PHE C CZ  1 
ATOM 6795  N N   . GLU C 1 124 ? -31.432 8.976   55.789   1.00 10.00 ? ? ? ? ? ? 125 GLU C N   1 
ATOM 6796  C CA  . GLU C 1 124 ? -31.931 9.914   54.805   1.00 10.00 ? ? ? ? ? ? 125 GLU C CA  1 
ATOM 6797  C C   . GLU C 1 124 ? -32.336 9.303   53.467   1.00 10.00 ? ? ? ? ? ? 125 GLU C C   1 
ATOM 6798  O O   . GLU C 1 124 ? -33.372 9.685   52.908   1.00 10.00 ? ? ? ? ? ? 125 GLU C O   1 
ATOM 6799  C CB  . GLU C 1 124 ? -30.870 10.952  54.579   1.00 10.00 ? ? ? ? ? ? 125 GLU C CB  1 
ATOM 6800  C CG  . GLU C 1 124 ? -30.580 11.777  55.801   1.00 10.00 ? ? ? ? ? ? 125 GLU C CG  1 
ATOM 6801  C CD  . GLU C 1 124 ? -29.472 12.778  55.563   1.00 10.00 ? ? ? ? ? ? 125 GLU C CD  1 
ATOM 6802  O OE1 . GLU C 1 124 ? -28.934 12.848  54.458   1.00 10.00 ? ? ? ? ? ? 125 GLU C OE1 1 
ATOM 6803  O OE2 . GLU C 1 124 ? -29.103 13.497  56.487   1.00 10.00 ? ? ? ? ? ? 125 GLU C OE2 1 
ATOM 6804  N N   . THR C 1 125 ? -31.497 8.381   52.949   1.00 10.00 ? ? ? ? ? ? 126 THR C N   1 
ATOM 6805  C CA  . THR C 1 125 ? -31.695 7.726   51.672   1.00 10.00 ? ? ? ? ? ? 126 THR C CA  1 
ATOM 6806  C C   . THR C 1 125 ? -32.601 6.558   51.830   1.00 10.00 ? ? ? ? ? ? 126 THR C C   1 
ATOM 6807  O O   . THR C 1 125 ? -33.369 6.398   50.903   1.00 10.00 ? ? ? ? ? ? 126 THR C O   1 
ATOM 6808  C CB  . THR C 1 125 ? -30.361 7.258   51.108   1.00 10.00 ? ? ? ? ? ? 126 THR C CB  1 
ATOM 6809  O OG1 . THR C 1 125 ? -29.520 8.444   51.117   1.00 10.00 ? ? ? ? ? ? 126 THR C OG1 1 
ATOM 6810  C CG2 . THR C 1 125 ? -30.500 6.536   49.742   1.00 10.00 ? ? ? ? ? ? 126 THR C CG2 1 
ATOM 6811  N N   . PHE C 1 126 ? -32.573 5.703   52.869   1.00 10.00 ? ? ? ? ? ? 127 PHE C N   1 
ATOM 6812  C CA  . PHE C 1 126 ? -33.559 4.613   52.940   1.00 10.00 ? ? ? ? ? ? 127 PHE C CA  1 
ATOM 6813  C C   . PHE C 1 126 ? -34.681 4.785   53.937   1.00 10.00 ? ? ? ? ? ? 127 PHE C C   1 
ATOM 6814  O O   . PHE C 1 126 ? -35.637 3.997   53.953   1.00 10.00 ? ? ? ? ? ? 127 PHE C O   1 
ATOM 6815  C CB  . PHE C 1 126 ? -32.877 3.272   53.222   1.00 10.00 ? ? ? ? ? ? 127 PHE C CB  1 
ATOM 6816  C CG  . PHE C 1 126 ? -32.061 2.841   52.011   1.00 10.00 ? ? ? ? ? ? 127 PHE C CG  1 
ATOM 6817  C CD1 . PHE C 1 126 ? -32.682 2.531   50.814   1.00 10.00 ? ? ? ? ? ? 127 PHE C CD1 1 
ATOM 6818  C CD2 . PHE C 1 126 ? -30.679 2.781   52.083   1.00 10.00 ? ? ? ? ? ? 127 PHE C CD2 1 
ATOM 6819  C CE1 . PHE C 1 126 ? -31.900 2.175   49.724   1.00 10.00 ? ? ? ? ? ? 127 PHE C CE1 1 
ATOM 6820  C CE2 . PHE C 1 126 ? -29.898 2.420   50.986   1.00 10.00 ? ? ? ? ? ? 127 PHE C CE2 1 
ATOM 6821  C CZ  . PHE C 1 126 ? -30.511 2.118   49.799   1.00 10.00 ? ? ? ? ? ? 127 PHE C CZ  1 
ATOM 6822  N N   . ASN C 1 127 ? -34.611 5.862   54.732   1.00 10.00 ? ? ? ? ? ? 128 ASN C N   1 
ATOM 6823  C CA  . ASN C 1 127 ? -35.646 6.257   55.684   1.00 10.00 ? ? ? ? ? ? 128 ASN C CA  1 
ATOM 6824  C C   . ASN C 1 127 ? -35.979 5.090   56.566   1.00 10.00 ? ? ? ? ? ? 128 ASN C C   1 
ATOM 6825  O O   . ASN C 1 127 ? -37.058 4.505   56.527   1.00 10.00 ? ? ? ? ? ? 128 ASN C O   1 
ATOM 6826  C CB  . ASN C 1 127 ? -36.933 6.746   54.955   1.00 10.00 ? ? ? ? ? ? 128 ASN C CB  1 
ATOM 6827  C CG  . ASN C 1 127 ? -38.043 7.344   55.858   1.00 10.00 ? ? ? ? ? ? 128 ASN C CG  1 
ATOM 6828  O OD1 . ASN C 1 127 ? -37.895 8.431   56.434   1.00 10.00 ? ? ? ? ? ? 128 ASN C OD1 1 
ATOM 6829  N ND2 . ASN C 1 127 ? -39.194 6.688   56.064   1.00 10.00 ? ? ? ? ? ? 128 ASN C ND2 1 
ATOM 6830  N N   . THR C 1 128 ? -34.968 4.795   57.374   1.00 10.00 ? ? ? ? ? ? 129 THR C N   1 
ATOM 6831  C CA  . THR C 1 128 ? -34.959 3.612   58.239   1.00 10.00 ? ? ? ? ? ? 129 THR C CA  1 
ATOM 6832  C C   . THR C 1 128 ? -35.534 4.015   59.586   1.00 10.00 ? ? ? ? ? ? 129 THR C C   1 
ATOM 6833  O O   . THR C 1 128 ? -35.068 5.038   60.103   1.00 10.00 ? ? ? ? ? ? 129 THR C O   1 
ATOM 6834  C CB  . THR C 1 128 ? -33.471 3.015   58.450   1.00 10.00 ? ? ? ? ? ? 129 THR C CB  1 
ATOM 6835  O OG1 . THR C 1 128 ? -32.579 2.995   57.315   1.00 10.00 ? ? ? ? ? ? 129 THR C OG1 1 
ATOM 6836  C CG2 . THR C 1 128 ? -33.697 1.556   58.719   1.00 10.00 ? ? ? ? ? ? 129 THR C CG2 1 
ATOM 6837  N N   . PRO C 1 129 ? -36.482 3.283   60.194   1.00 10.00 ? ? ? ? ? ? 130 PRO C N   1 
ATOM 6838  C CA  . PRO C 1 129 ? -37.066 3.590   61.466   1.00 10.00 ? ? ? ? ? ? 130 PRO C CA  1 
ATOM 6839  C C   . PRO C 1 129 ? -35.982 3.721   62.519   1.00 10.00 ? ? ? ? ? ? 130 PRO C C   1 
ATOM 6840  O O   . PRO C 1 129 ? -36.104 4.586   63.398   1.00 10.00 ? ? ? ? ? ? 130 PRO C O   1 
ATOM 6841  C CB  . PRO C 1 129 ? -38.003 2.471   61.826   1.00 10.00 ? ? ? ? ? ? 130 PRO C CB  1 
ATOM 6842  C CG  . PRO C 1 129 ? -38.218 1.717   60.577   1.00 10.00 ? ? ? ? ? ? 130 PRO C CG  1 
ATOM 6843  C CD  . PRO C 1 129 ? -36.933 1.968   59.827   1.00 10.00 ? ? ? ? ? ? 130 PRO C CD  1 
ATOM 6844  N N   . ALA C 1 130 ? -34.922 2.884   62.392   1.00 10.00 ? ? ? ? ? ? 131 ALA C N   1 
ATOM 6845  C CA  . ALA C 1 130 ? -33.825 2.729   63.341   1.00 10.00 ? ? ? ? ? ? 131 ALA C CA  1 
ATOM 6846  C C   . ALA C 1 130 ? -32.705 1.897   62.761   1.00 10.00 ? ? ? ? ? ? 131 ALA C C   1 
ATOM 6847  O O   . ALA C 1 130 ? -32.872 1.084   61.850   1.00 10.00 ? ? ? ? ? ? 131 ALA C O   1 
ATOM 6848  C CB  . ALA C 1 130 ? -34.279 2.012   64.585   1.00 10.00 ? ? ? ? ? ? 131 ALA C CB  1 
ATOM 6849  N N   . MET C 1 131 ? -31.560 2.047   63.380   1.00 10.00 ? ? ? ? ? ? 132 MET C N   1 
ATOM 6850  C CA  . MET C 1 131 ? -30.455 1.267   62.958   1.00 10.00 ? ? ? ? ? ? 132 MET C CA  1 
ATOM 6851  C C   . MET C 1 131 ? -29.398 1.156   64.038   1.00 10.00 ? ? ? ? ? ? 132 MET C C   1 
ATOM 6852  O O   . MET C 1 131 ? -29.390 1.903   65.018   1.00 10.00 ? ? ? ? ? ? 132 MET C O   1 
ATOM 6853  C CB  . MET C 1 131 ? -29.915 1.895   61.607   1.00 10.00 ? ? ? ? ? ? 132 MET C CB  1 
ATOM 6854  C CG  . MET C 1 131 ? -29.116 3.188   61.372   1.00 10.00 ? ? ? ? ? ? 132 MET C CG  1 
ATOM 6855  S SD  . MET C 1 131 ? -27.320 3.152   61.600   1.00 10.00 ? ? ? ? ? ? 132 MET C SD  1 
ATOM 6856  C CE  . MET C 1 131 ? -27.164 2.203   60.136   1.00 10.00 ? ? ? ? ? ? 132 MET C CE  1 
ATOM 6857  N N   . TYR C 1 132 ? -28.566 0.108   63.896   1.00 10.00 ? ? ? ? ? ? 133 TYR C N   1 
ATOM 6858  C CA  . TYR C 1 132 ? -27.400 -0.110  64.716   1.00 10.00 ? ? ? ? ? ? 133 TYR C CA  1 
ATOM 6859  C C   . TYR C 1 132 ? -26.304 -0.692  63.784   1.00 10.00 ? ? ? ? ? ? 133 TYR C C   1 
ATOM 6860  O O   . TYR C 1 132 ? -26.558 -1.334  62.739   1.00 10.00 ? ? ? ? ? ? 133 TYR C O   1 
ATOM 6861  C CB  . TYR C 1 132 ? -27.813 -1.044  65.827   1.00 10.00 ? ? ? ? ? ? 133 TYR C CB  1 
ATOM 6862  C CG  . TYR C 1 132 ? -26.806 -1.122  66.942   1.00 10.00 ? ? ? ? ? ? 133 TYR C CG  1 
ATOM 6863  C CD1 . TYR C 1 132 ? -26.789 -0.178  67.940   1.00 10.00 ? ? ? ? ? ? 133 TYR C CD1 1 
ATOM 6864  C CD2 . TYR C 1 132 ? -25.889 -2.146  66.933   1.00 10.00 ? ? ? ? ? ? 133 TYR C CD2 1 
ATOM 6865  C CE1 . TYR C 1 132 ? -25.836 -0.265  68.930   1.00 10.00 ? ? ? ? ? ? 133 TYR C CE1 1 
ATOM 6866  C CE2 . TYR C 1 132 ? -24.952 -2.237  67.913   1.00 10.00 ? ? ? ? ? ? 133 TYR C CE2 1 
ATOM 6867  C CZ  . TYR C 1 132 ? -24.924 -1.297  68.902   1.00 10.00 ? ? ? ? ? ? 133 TYR C CZ  1 
ATOM 6868  O OH  . TYR C 1 132 ? -23.944 -1.428  69.876   1.00 10.00 ? ? ? ? ? ? 133 TYR C OH  1 
ATOM 6869  N N   . VAL C 1 133 ? -25.064 -0.391  64.185   1.00 10.00 ? ? ? ? ? ? 134 VAL C N   1 
ATOM 6870  C CA  . VAL C 1 133 ? -23.885 -0.820  63.506   1.00 10.00 ? ? ? ? ? ? 134 VAL C CA  1 
ATOM 6871  C C   . VAL C 1 133 ? -23.051 -1.557  64.566   1.00 10.00 ? ? ? ? ? ? 134 VAL C C   1 
ATOM 6872  O O   . VAL C 1 133 ? -22.463 -1.021  65.496   1.00 10.00 ? ? ? ? ? ? 134 VAL C O   1 
ATOM 6873  C CB  . VAL C 1 133 ? -23.053 0.349   62.974   1.00 10.00 ? ? ? ? ? ? 134 VAL C CB  1 
ATOM 6874  C CG1 . VAL C 1 133 ? -22.219 -0.266  61.934   1.00 10.00 ? ? ? ? ? ? 134 VAL C CG1 1 
ATOM 6875  C CG2 . VAL C 1 133 ? -23.786 1.452   62.262   1.00 10.00 ? ? ? ? ? ? 134 VAL C CG2 1 
ATOM 6876  N N   . ALA C 1 134 ? -22.968 -2.860  64.417   1.00 10.00 ? ? ? ? ? ? 135 ALA C N   1 
ATOM 6877  C CA  . ALA C 1 134 ? -22.098 -3.702  65.206   1.00 10.00 ? ? ? ? ? ? 135 ALA C CA  1 
ATOM 6878  C C   . ALA C 1 134 ? -20.799 -4.163  64.443   1.00 10.00 ? ? ? ? ? ? 135 ALA C C   1 
ATOM 6879  O O   . ALA C 1 134 ? -20.743 -4.406  63.214   1.00 10.00 ? ? ? ? ? ? 135 ALA C O   1 
ATOM 6880  C CB  . ALA C 1 134 ? -23.009 -4.866  65.653   1.00 10.00 ? ? ? ? ? ? 135 ALA C CB  1 
ATOM 6881  N N   . ILE C 1 135 ? -19.665 -4.220  65.155   1.00 10.00 ? ? ? ? ? ? 136 ILE C N   1 
ATOM 6882  C CA  . ILE C 1 135 ? -18.398 -4.730  64.642   1.00 10.00 ? ? ? ? ? ? 136 ILE C CA  1 
ATOM 6883  C C   . ILE C 1 135 ? -18.618 -6.193  64.360   1.00 10.00 ? ? ? ? ? ? 136 ILE C C   1 
ATOM 6884  O O   . ILE C 1 135 ? -19.255 -6.860  65.173   1.00 10.00 ? ? ? ? ? ? 136 ILE C O   1 
ATOM 6885  C CB  . ILE C 1 135 ? -17.350 -4.540  65.696   1.00 10.00 ? ? ? ? ? ? 136 ILE C CB  1 
ATOM 6886  C CG1 . ILE C 1 135 ? -16.992 -3.053  65.746   1.00 10.00 ? ? ? ? ? ? 136 ILE C CG1 1 
ATOM 6887  C CG2 . ILE C 1 135 ? -16.154 -5.439  65.423   1.00 10.00 ? ? ? ? ? ? 136 ILE C CG2 1 
ATOM 6888  C CD1 . ILE C 1 135 ? -16.230 -2.575  67.056   1.00 10.00 ? ? ? ? ? ? 136 ILE C CD1 1 
ATOM 6889  N N   . GLN C 1 136 ? -18.052 -6.788  63.317   1.00 10.00 ? ? ? ? ? ? 137 GLN C N   1 
ATOM 6890  C CA  . GLN C 1 136 ? -18.369 -8.200  62.982   1.00 10.00 ? ? ? ? ? ? 137 GLN C CA  1 
ATOM 6891  C C   . GLN C 1 136 ? -17.908 -9.247  63.940   1.00 10.00 ? ? ? ? ? ? 137 GLN C C   1 
ATOM 6892  O O   . GLN C 1 136 ? -18.683 -10.144 64.181   1.00 10.00 ? ? ? ? ? ? 137 GLN C O   1 
ATOM 6893  C CB  . GLN C 1 136 ? -17.805 -8.561  61.650   1.00 10.00 ? ? ? ? ? ? 137 GLN C CB  1 
ATOM 6894  C CG  . GLN C 1 136 ? -18.359 -7.593  60.636   1.00 10.00 ? ? ? ? ? ? 137 GLN C CG  1 
ATOM 6895  C CD  . GLN C 1 136 ? -17.409 -7.372  59.502   1.00 10.00 ? ? ? ? ? ? 137 GLN C CD  1 
ATOM 6896  O OE1 . GLN C 1 136 ? -16.646 -8.297  59.169   1.00 10.00 ? ? ? ? ? ? 137 GLN C OE1 1 
ATOM 6897  N NE2 . GLN C 1 136 ? -17.502 -6.246  58.807   1.00 10.00 ? ? ? ? ? ? 137 GLN C NE2 1 
ATOM 6898  N N   . ALA C 1 137 ? -16.676 -9.149  64.510   1.00 10.00 ? ? ? ? ? ? 138 ALA C N   1 
ATOM 6899  C CA  . ALA C 1 137 ? -16.124 -10.105 65.444   1.00 10.00 ? ? ? ? ? ? 138 ALA C CA  1 
ATOM 6900  C C   . ALA C 1 137 ? -16.944 -10.220 66.716   1.00 10.00 ? ? ? ? ? ? 138 ALA C C   1 
ATOM 6901  O O   . ALA C 1 137 ? -17.108 -11.299 67.294   1.00 10.00 ? ? ? ? ? ? 138 ALA C O   1 
ATOM 6902  C CB  . ALA C 1 137 ? -14.747 -9.672  65.769   1.00 10.00 ? ? ? ? ? ? 138 ALA C CB  1 
ATOM 6903  N N   . VAL C 1 138 ? -17.538 -9.144  67.199   1.00 10.00 ? ? ? ? ? ? 139 VAL C N   1 
ATOM 6904  C CA  . VAL C 1 138 ? -18.354 -9.170  68.401   1.00 10.00 ? ? ? ? ? ? 139 VAL C CA  1 
ATOM 6905  C C   . VAL C 1 138 ? -19.630 -9.987  68.198   1.00 10.00 ? ? ? ? ? ? 139 VAL C C   1 
ATOM 6906  O O   . VAL C 1 138 ? -20.117 -10.564 69.170   1.00 10.00 ? ? ? ? ? ? 139 VAL C O   1 
ATOM 6907  C CB  . VAL C 1 138 ? -18.617 -7.665  68.816   1.00 10.00 ? ? ? ? ? ? 139 VAL C CB  1 
ATOM 6908  C CG1 . VAL C 1 138 ? -19.641 -7.563  69.905   1.00 10.00 ? ? ? ? ? ? 139 VAL C CG1 1 
ATOM 6909  C CG2 . VAL C 1 138 ? -17.363 -7.051  69.432   1.00 10.00 ? ? ? ? ? ? 139 VAL C CG2 1 
ATOM 6910  N N   . LEU C 1 139 ? -20.207 -10.108 66.998   1.00 10.00 ? ? ? ? ? ? 140 LEU C N   1 
ATOM 6911  C CA  . LEU C 1 139 ? -21.417 -10.927 66.741   1.00 10.00 ? ? ? ? ? ? 140 LEU C CA  1 
ATOM 6912  C C   . LEU C 1 139 ? -20.996 -12.382 66.541   1.00 10.00 ? ? ? ? ? ? 140 LEU C C   1 
ATOM 6913  O O   . LEU C 1 139 ? -21.779 -13.291 66.875   1.00 10.00 ? ? ? ? ? ? 140 LEU C O   1 
ATOM 6914  C CB  . LEU C 1 139 ? -22.183 -10.541 65.483   1.00 10.00 ? ? ? ? ? ? 140 LEU C CB  1 
ATOM 6915  C CG  . LEU C 1 139 ? -22.879 -9.195  65.335   1.00 10.00 ? ? ? ? ? ? 140 LEU C CG  1 
ATOM 6916  C CD1 . LEU C 1 139 ? -21.889 -8.118  65.565   1.00 10.00 ? ? ? ? ? ? 140 LEU C CD1 1 
ATOM 6917  C CD2 . LEU C 1 139 ? -23.353 -8.957  63.915   1.00 10.00 ? ? ? ? ? ? 140 LEU C CD2 1 
ATOM 6918  N N   . SER C 1 140 ? -19.796 -12.653 65.994   1.00 10.00 ? ? ? ? ? ? 141 SER C N   1 
ATOM 6919  C CA  . SER C 1 140 ? -19.220 -13.992 66.049   1.00 10.00 ? ? ? ? ? ? 141 SER C CA  1 
ATOM 6920  C C   . SER C 1 140 ? -19.172 -14.519 67.495   1.00 10.00 ? ? ? ? ? ? 141 SER C C   1 
ATOM 6921  O O   . SER C 1 140 ? -19.568 -15.667 67.749   1.00 10.00 ? ? ? ? ? ? 141 SER C O   1 
ATOM 6922  C CB  . SER C 1 140 ? -17.799 -13.983 65.533   1.00 10.00 ? ? ? ? ? ? 141 SER C CB  1 
ATOM 6923  O OG  . SER C 1 140 ? -17.751 -13.581 64.164   1.00 10.00 ? ? ? ? ? ? 141 SER C OG  1 
ATOM 6924  N N   . LEU C 1 141 ? -18.710 -13.707 68.466   1.00 10.00 ? ? ? ? ? ? 142 LEU C N   1 
ATOM 6925  C CA  . LEU C 1 141 ? -18.669 -14.108 69.861   1.00 10.00 ? ? ? ? ? ? 142 LEU C CA  1 
ATOM 6926  C C   . LEU C 1 141 ? -20.023 -14.390 70.568   1.00 10.00 ? ? ? ? ? ? 142 LEU C C   1 
ATOM 6927  O O   . LEU C 1 141 ? -20.268 -15.433 71.223   1.00 10.00 ? ? ? ? ? ? 142 LEU C O   1 
ATOM 6928  C CB  . LEU C 1 141 ? -17.926 -13.033 70.584   1.00 10.00 ? ? ? ? ? ? 142 LEU C CB  1 
ATOM 6929  C CG  . LEU C 1 141 ? -17.338 -13.507 71.880   1.00 10.00 ? ? ? ? ? ? 142 LEU C CG  1 
ATOM 6930  C CD1 . LEU C 1 141 ? -16.128 -14.419 71.600   1.00 10.00 ? ? ? ? ? ? 142 LEU C CD1 1 
ATOM 6931  C CD2 . LEU C 1 141 ? -16.962 -12.310 72.700   1.00 10.00 ? ? ? ? ? ? 142 LEU C CD2 1 
ATOM 6932  N N   . TYR C 1 142 ? -20.959 -13.450 70.411   1.00 10.00 ? ? ? ? ? ? 143 TYR C N   1 
ATOM 6933  C CA  . TYR C 1 142 ? -22.278 -13.611 70.970   1.00 10.00 ? ? ? ? ? ? 143 TYR C CA  1 
ATOM 6934  C C   . TYR C 1 142 ? -22.909 -14.877 70.411   1.00 10.00 ? ? ? ? ? ? 143 TYR C C   1 
ATOM 6935  O O   . TYR C 1 142 ? -23.485 -15.641 71.189   1.00 10.00 ? ? ? ? ? ? 143 TYR C O   1 
ATOM 6936  C CB  . TYR C 1 142 ? -23.179 -12.388 70.633   1.00 10.00 ? ? ? ? ? ? 143 TYR C CB  1 
ATOM 6937  C CG  . TYR C 1 142 ? -24.249 -12.204 71.724   1.00 10.00 ? ? ? ? ? ? 143 TYR C CG  1 
ATOM 6938  C CD1 . TYR C 1 142 ? -25.280 -13.143 71.890   1.00 10.00 ? ? ? ? ? ? 143 TYR C CD1 1 
ATOM 6939  C CD2 . TYR C 1 142 ? -24.160 -11.137 72.620   1.00 10.00 ? ? ? ? ? ? 143 TYR C CD2 1 
ATOM 6940  C CE1 . TYR C 1 142 ? -26.200 -13.026 72.931   1.00 10.00 ? ? ? ? ? ? 143 TYR C CE1 1 
ATOM 6941  C CE2 . TYR C 1 142 ? -25.089 -11.019 73.667   1.00 10.00 ? ? ? ? ? ? 143 TYR C CE2 1 
ATOM 6942  C CZ  . TYR C 1 142 ? -26.105 -11.968 73.832   1.00 10.00 ? ? ? ? ? ? 143 TYR C CZ  1 
ATOM 6943  O OH  . TYR C 1 142 ? -27.004 -11.875 74.899   1.00 10.00 ? ? ? ? ? ? 143 TYR C OH  1 
ATOM 6944  N N   . ALA C 1 143 ? -22.792 -15.153 69.102   1.00 10.00 ? ? ? ? ? ? 144 ALA C N   1 
ATOM 6945  C CA  . ALA C 1 143 ? -23.365 -16.360 68.514   1.00 10.00 ? ? ? ? ? ? 144 ALA C CA  1 
ATOM 6946  C C   . ALA C 1 143 ? -22.720 -17.676 69.013   1.00 10.00 ? ? ? ? ? ? 144 ALA C C   1 
ATOM 6947  O O   . ALA C 1 143 ? -23.271 -18.759 68.798   1.00 10.00 ? ? ? ? ? ? 144 ALA C O   1 
ATOM 6948  C CB  . ALA C 1 143 ? -23.253 -16.237 66.986   1.00 10.00 ? ? ? ? ? ? 144 ALA C CB  1 
ATOM 6949  N N   . SER C 1 144 ? -21.536 -17.670 69.647   1.00 10.00 ? ? ? ? ? ? 145 SER C N   1 
ATOM 6950  C CA  . SER C 1 144 ? -20.949 -18.875 70.237   1.00 10.00 ? ? ? ? ? ? 145 SER C CA  1 
ATOM 6951  C C   . SER C 1 144 ? -21.381 -19.013 71.684   1.00 10.00 ? ? ? ? ? ? 145 SER C C   1 
ATOM 6952  O O   . SER C 1 144 ? -21.052 -19.981 72.373   1.00 10.00 ? ? ? ? ? ? 145 SER C O   1 
ATOM 6953  C CB  . SER C 1 144 ? -19.426 -18.850 70.233   1.00 10.00 ? ? ? ? ? ? 145 SER C CB  1 
ATOM 6954  O OG  . SER C 1 144 ? -18.824 -17.849 71.041   1.00 10.00 ? ? ? ? ? ? 145 SER C OG  1 
ATOM 6955  N N   . GLY C 1 145 ? -20.573 -21.013 71.710   1.00 10.00 ? ? ? ? ? ? 146 GLY C N   1 
ATOM 6956  C CA  . GLY C 1 145 ? -21.238 -21.499 72.896   1.00 10.00 ? ? ? ? ? ? 146 GLY C CA  1 
ATOM 6957  C C   . GLY C 1 145 ? -20.480 -21.015 74.076   1.00 10.00 ? ? ? ? ? ? 146 GLY C C   1 
ATOM 6958  O O   . GLY C 1 145 ? -20.223 -21.761 75.013   1.00 10.00 ? ? ? ? ? ? 146 GLY C O   1 
ATOM 6959  N N   . ARG C 1 146 ? -20.129 -19.752 74.074   1.00 10.00 ? ? ? ? ? ? 147 ARG C N   1 
ATOM 6960  C CA  . ARG C 1 146 ? -19.273 -19.303 75.117   1.00 10.00 ? ? ? ? ? ? 147 ARG C CA  1 
ATOM 6961  C C   . ARG C 1 146 ? -19.659 -17.880 75.425   1.00 10.00 ? ? ? ? ? ? 147 ARG C C   1 
ATOM 6962  O O   . ARG C 1 146 ? -20.350 -17.179 74.686   1.00 10.00 ? ? ? ? ? ? 147 ARG C O   1 
ATOM 6963  C CB  . ARG C 1 146 ? -17.921 -19.525 74.545   1.00 10.00 ? ? ? ? ? ? 147 ARG C CB  1 
ATOM 6964  C CG  . ARG C 1 146 ? -16.653 -19.158 75.207   1.00 10.00 ? ? ? ? ? ? 147 ARG C CG  1 
ATOM 6965  C CD  . ARG C 1 146 ? -15.745 -19.770 74.177   1.00 10.00 ? ? ? ? ? ? 147 ARG C CD  1 
ATOM 6966  N NE  . ARG C 1 146 ? -15.450 -21.129 74.573   1.00 10.00 ? ? ? ? ? ? 147 ARG C NE  1 
ATOM 6967  C CZ  . ARG C 1 146 ? -15.386 -22.154 73.739   1.00 10.00 ? ? ? ? ? ? 147 ARG C CZ  1 
ATOM 6968  N NH1 . ARG C 1 146 ? -15.595 -22.041 72.436   1.00 10.00 ? ? ? ? ? ? 147 ARG C NH1 1 
ATOM 6969  N NH2 . ARG C 1 146 ? -15.115 -23.338 74.254   1.00 10.00 ? ? ? ? ? ? 147 ARG C NH2 1 
ATOM 6970  N N   . THR C 1 147 ? -19.265 -17.532 76.635   1.00 10.00 ? ? ? ? ? ? 148 THR C N   1 
ATOM 6971  C CA  . THR C 1 147 ? -19.610 -16.276 77.267   1.00 10.00 ? ? ? ? ? ? 148 THR C CA  1 
ATOM 6972  C C   . THR C 1 147 ? -18.420 -15.449 77.770   1.00 10.00 ? ? ? ? ? ? 148 THR C C   1 
ATOM 6973  O O   . THR C 1 147 ? -18.486 -14.215 77.909   1.00 10.00 ? ? ? ? ? ? 148 THR C O   1 
ATOM 6974  C CB  . THR C 1 147 ? -20.615 -16.713 78.339   1.00 10.00 ? ? ? ? ? ? 148 THR C CB  1 
ATOM 6975  O OG1 . THR C 1 147 ? -20.194 -18.020 78.793   1.00 10.00 ? ? ? ? ? ? 148 THR C OG1 1 
ATOM 6976  C CG2 . THR C 1 147 ? -22.047 -16.660 77.797   1.00 10.00 ? ? ? ? ? ? 148 THR C CG2 1 
ATOM 6977  N N   . THR C 1 148 ? -17.281 -16.075 77.965   1.00 10.00 ? ? ? ? ? ? 149 THR C N   1 
ATOM 6978  C CA  . THR C 1 148 ? -16.102 -15.356 78.380   1.00 10.00 ? ? ? ? ? ? 149 THR C CA  1 
ATOM 6979  C C   . THR C 1 148 ? -15.024 -15.759 77.344   1.00 10.00 ? ? ? ? ? ? 149 THR C C   1 
ATOM 6980  O O   . THR C 1 148 ? -15.063 -16.901 76.854   1.00 10.00 ? ? ? ? ? ? 149 THR C O   1 
ATOM 6981  C CB  . THR C 1 148 ? -15.756 -15.797 79.811   1.00 10.00 ? ? ? ? ? ? 149 THR C CB  1 
ATOM 6982  O OG1 . THR C 1 148 ? -16.954 -16.153 80.490   1.00 10.00 ? ? ? ? ? ? 149 THR C OG1 1 
ATOM 6983  C CG2 . THR C 1 148 ? -15.181 -14.671 80.602   1.00 10.00 ? ? ? ? ? ? 149 THR C CG2 1 
ATOM 6984  N N   . GLY C 1 149 ? -14.078 -14.941 76.924   1.00 10.00 ? ? ? ? ? ? 150 GLY C N   1 
ATOM 6985  C CA  . GLY C 1 149 ? -13.173 -15.371 75.904   1.00 10.00 ? ? ? ? ? ? 150 GLY C CA  1 
ATOM 6986  C C   . GLY C 1 149 ? -12.689 -14.130 75.240   1.00 10.00 ? ? ? ? ? ? 150 GLY C C   1 
ATOM 6987  O O   . GLY C 1 149 ? -12.963 -13.046 75.748   1.00 10.00 ? ? ? ? ? ? 150 GLY C O   1 
ATOM 6988  N N   . ILE C 1 150 ? -11.943 -14.228 74.168   1.00 10.00 ? ? ? ? ? ? 151 ILE C N   1 
ATOM 6989  C CA  . ILE C 1 150 ? -11.541 -13.076 73.365   1.00 10.00 ? ? ? ? ? ? 151 ILE C CA  1 
ATOM 6990  C C   . ILE C 1 150 ? -11.621 -13.639 71.959   1.00 10.00 ? ? ? ? ? ? 151 ILE C C   1 
ATOM 6991  O O   . ILE C 1 150 ? -11.355 -14.825 71.711   1.00 10.00 ? ? ? ? ? ? 151 ILE C O   1 
ATOM 6992  C CB  . ILE C 1 150 ? -10.085 -12.564 73.723   1.00 10.00 ? ? ? ? ? ? 151 ILE C CB  1 
ATOM 6993  C CG1 . ILE C 1 150 ? -9.470  -11.636 72.665   1.00 10.00 ? ? ? ? ? ? 151 ILE C CG1 1 
ATOM 6994  C CG2 . ILE C 1 150 ? -9.252  -13.796 73.985   1.00 10.00 ? ? ? ? ? ? 151 ILE C CG2 1 
ATOM 6995  C CD1 . ILE C 1 150 ? -8.331  -10.761 73.244   1.00 10.00 ? ? ? ? ? ? 151 ILE C CD1 1 
ATOM 6996  N N   . VAL C 1 151 ? -12.166 -12.801 71.085   1.00 10.00 ? ? ? ? ? ? 152 VAL C N   1 
ATOM 6997  C CA  . VAL C 1 151 ? -12.395 -13.156 69.702   1.00 10.00 ? ? ? ? ? ? 152 VAL C CA  1 
ATOM 6998  C C   . VAL C 1 151 ? -11.375 -12.357 68.938   1.00 10.00 ? ? ? ? ? ? 152 VAL C C   1 
ATOM 6999  O O   . VAL C 1 151 ? -10.942 -11.273 69.353   1.00 10.00 ? ? ? ? ? ? 152 VAL C O   1 
ATOM 7000  C CB  . VAL C 1 151 ? -13.832 -12.776 69.330   1.00 10.00 ? ? ? ? ? ? 152 VAL C CB  1 
ATOM 7001  C CG1 . VAL C 1 151 ? -14.193 -13.176 67.940   1.00 10.00 ? ? ? ? ? ? 152 VAL C CG1 1 
ATOM 7002  C CG2 . VAL C 1 151 ? -14.783 -13.555 70.204   1.00 10.00 ? ? ? ? ? ? 152 VAL C CG2 1 
ATOM 7003  N N   . MET C 1 152 ? -10.923 -12.903 67.832   1.00 10.00 ? ? ? ? ? ? 153 MET C N   1 
ATOM 7004  C CA  . MET C 1 152 ? -10.000 -12.176 67.001   1.00 10.00 ? ? ? ? ? ? 153 MET C CA  1 
ATOM 7005  C C   . MET C 1 152 ? -10.763 -12.117 65.696   1.00 10.00 ? ? ? ? ? ? 153 MET C C   1 
ATOM 7006  O O   . MET C 1 152 ? -10.955 -13.148 65.043   1.00 10.00 ? ? ? ? ? ? 153 MET C O   1 
ATOM 7007  C CB  . MET C 1 152 ? -8.744  -13.002 66.969   1.00 10.00 ? ? ? ? ? ? 153 MET C CB  1 
ATOM 7008  C CG  . MET C 1 152 ? -7.522  -12.222 66.558   1.00 10.00 ? ? ? ? ? ? 153 MET C CG  1 
ATOM 7009  S SD  . MET C 1 152 ? -7.521  -11.614 64.852   1.00 10.00 ? ? ? ? ? ? 153 MET C SD  1 
ATOM 7010  C CE  . MET C 1 152 ? -6.929  -13.087 64.093   1.00 10.00 ? ? ? ? ? ? 153 MET C CE  1 
ATOM 7011  N N   . ASP C 1 153 ? -11.256 -10.966 65.290   1.00 10.00 ? ? ? ? ? ? 154 ASP C N   1 
ATOM 7012  C CA  . ASP C 1 153 ? -12.194 -10.931 64.180   1.00 10.00 ? ? ? ? ? ? 154 ASP C CA  1 
ATOM 7013  C C   . ASP C 1 153 ? -11.552 -10.321 62.973   1.00 10.00 ? ? ? ? ? ? 154 ASP C C   1 
ATOM 7014  O O   . ASP C 1 153 ? -11.150 -9.160  63.086   1.00 10.00 ? ? ? ? ? ? 154 ASP C O   1 
ATOM 7015  C CB  . ASP C 1 153 ? -13.383 -10.145 64.671   1.00 10.00 ? ? ? ? ? ? 154 ASP C CB  1 
ATOM 7016  C CG  . ASP C 1 153 ? -14.644 -10.229 63.839   1.00 10.00 ? ? ? ? ? ? 154 ASP C CG  1 
ATOM 7017  O OD1 . ASP C 1 153 ? -14.687 -9.593  62.792   1.00 10.00 ? ? ? ? ? ? 154 ASP C OD1 1 
ATOM 7018  O OD2 . ASP C 1 153 ? -15.591 -10.910 64.238   1.00 10.00 ? ? ? ? ? ? 154 ASP C OD2 1 
ATOM 7019  N N   . SER C 1 154 ? -11.415 -11.018 61.850   1.00 10.00 ? ? ? ? ? ? 155 SER C N   1 
ATOM 7020  C CA  . SER C 1 154 ? -10.736 -10.430 60.712   1.00 10.00 ? ? ? ? ? ? 155 SER C CA  1 
ATOM 7021  C C   . SER C 1 154 ? -11.584 -10.544 59.479   1.00 10.00 ? ? ? ? ? ? 155 SER C C   1 
ATOM 7022  O O   . SER C 1 154 ? -11.723 -11.614 58.860   1.00 10.00 ? ? ? ? ? ? 155 SER C O   1 
ATOM 7023  C CB  . SER C 1 154 ? -9.374  -11.132 60.475   1.00 10.00 ? ? ? ? ? ? 155 SER C CB  1 
ATOM 7024  O OG  . SER C 1 154 ? -8.398  -10.365 59.741   1.00 10.00 ? ? ? ? ? ? 155 SER C OG  1 
ATOM 7025  N N   . GLY C 1 155 ? -12.105 -9.375  59.160   1.00 10.00 ? ? ? ? ? ? 156 GLY C N   1 
ATOM 7026  C CA  . GLY C 1 155 ? -12.962 -9.245  57.993   1.00 10.00 ? ? ? ? ? ? 156 GLY C CA  1 
ATOM 7027  C C   . GLY C 1 155 ? -12.256 -8.726  56.733   1.00 10.00 ? ? ? ? ? ? 156 GLY C C   1 
ATOM 7028  O O   . GLY C 1 155 ? -11.181 -9.212  56.327   1.00 10.00 ? ? ? ? ? ? 156 GLY C O   1 
ATOM 7029  N N   . ASP C 1 156 ? -12.804 -7.682  56.095   1.00 10.00 ? ? ? ? ? ? 157 ASP C N   1 
ATOM 7030  C CA  . ASP C 1 156 ? -12.228 -7.156  54.857   1.00 10.00 ? ? ? ? ? ? 157 ASP C CA  1 
ATOM 7031  C C   . ASP C 1 156 ? -11.556 -5.836  55.128   1.00 10.00 ? ? ? ? ? ? 157 ASP C C   1 
ATOM 7032  O O   . ASP C 1 156 ? -10.516 -5.526  54.526   1.00 10.00 ? ? ? ? ? ? 157 ASP C O   1 
ATOM 7033  C CB  . ASP C 1 156 ? -13.334 -6.972  53.846   1.00 10.00 ? ? ? ? ? ? 157 ASP C CB  1 
ATOM 7034  C CG  . ASP C 1 156 ? -12.992 -6.780  52.377   1.00 10.00 ? ? ? ? ? ? 157 ASP C CG  1 
ATOM 7035  O OD1 . ASP C 1 156 ? -12.824 -7.785  51.698   1.00 10.00 ? ? ? ? ? ? 157 ASP C OD1 1 
ATOM 7036  O OD2 . ASP C 1 156 ? -12.963 -5.638  51.913   1.00 10.00 ? ? ? ? ? ? 157 ASP C OD2 1 
ATOM 7037  N N   . GLY C 1 157 ? -12.119 -5.067  56.058   1.00 10.00 ? ? ? ? ? ? 158 GLY C N   1 
ATOM 7038  C CA  . GLY C 1 157 ? -11.571 -3.772  56.317   1.00 10.00 ? ? ? ? ? ? 158 GLY C CA  1 
ATOM 7039  C C   . GLY C 1 157 ? -10.955 -3.657  57.684   1.00 10.00 ? ? ? ? ? ? 158 GLY C C   1 
ATOM 7040  O O   . GLY C 1 157 ? -10.224 -2.677  57.882   1.00 10.00 ? ? ? ? ? ? 158 GLY C O   1 
ATOM 7041  N N   . VAL C 1 158 ? -11.200 -4.502  58.694   1.00 10.00 ? ? ? ? ? ? 159 VAL C N   1 
ATOM 7042  C CA  . VAL C 1 158 ? -10.553 -4.373  59.994   1.00 10.00 ? ? ? ? ? ? 159 VAL C CA  1 
ATOM 7043  C C   . VAL C 1 158 ? -10.400 -5.711  60.712   1.00 10.00 ? ? ? ? ? ? 159 VAL C C   1 
ATOM 7044  O O   . VAL C 1 158 ? -10.940 -6.768  60.341   1.00 10.00 ? ? ? ? ? ? 159 VAL C O   1 
ATOM 7045  C CB  . VAL C 1 158 ? -11.387 -3.360  60.787   1.00 10.00 ? ? ? ? ? ? 159 VAL C CB  1 
ATOM 7046  C CG1 . VAL C 1 158 ? -12.613 -4.040  61.280   1.00 10.00 ? ? ? ? ? ? 159 VAL C CG1 1 
ATOM 7047  C CG2 . VAL C 1 158 ? -10.600 -2.760  61.912   1.00 10.00 ? ? ? ? ? ? 159 VAL C CG2 1 
ATOM 7048  N N   . THR C 1 159 ? -9.560  -5.626  61.735   1.00 10.00 ? ? ? ? ? ? 160 THR C N   1 
ATOM 7049  C CA  . THR C 1 159 ? -9.322  -6.712  62.649   1.00 10.00 ? ? ? ? ? ? 160 THR C CA  1 
ATOM 7050  C C   . THR C 1 159 ? -9.405  -6.093  64.032   1.00 10.00 ? ? ? ? ? ? 160 THR C C   1 
ATOM 7051  O O   . THR C 1 159 ? -9.021  -4.947  64.320   1.00 10.00 ? ? ? ? ? ? 160 THR C O   1 
ATOM 7052  C CB  . THR C 1 159 ? -7.924  -7.330  62.395   1.00 10.00 ? ? ? ? ? ? 160 THR C CB  1 
ATOM 7053  O OG1 . THR C 1 159 ? -7.793  -7.873  61.079   1.00 10.00 ? ? ? ? ? ? 160 THR C OG1 1 
ATOM 7054  C CG2 . THR C 1 159 ? -7.748  -8.503  63.300   1.00 10.00 ? ? ? ? ? ? 160 THR C CG2 1 
ATOM 7055  N N   . HIS C 1 160 ? -10.069 -6.802  64.907   1.00 10.00 ? ? ? ? ? ? 161 HIS C N   1 
ATOM 7056  C CA  . HIS C 1 160 ? -10.040 -6.400  66.308   1.00 10.00 ? ? ? ? ? ? 161 HIS C CA  1 
ATOM 7057  C C   . HIS C 1 160 ? -9.891  -7.619  67.172   1.00 10.00 ? ? ? ? ? ? 161 HIS C C   1 
ATOM 7058  O O   . HIS C 1 160 ? -10.308 -8.737  66.800   1.00 10.00 ? ? ? ? ? ? 161 HIS C O   1 
ATOM 7059  C CB  . HIS C 1 160 ? -11.292 -5.794  66.868   1.00 10.00 ? ? ? ? ? ? 161 HIS C CB  1 
ATOM 7060  C CG  . HIS C 1 160 ? -11.680 -4.427  66.405   1.00 10.00 ? ? ? ? ? ? 161 HIS C CG  1 
ATOM 7061  N ND1 . HIS C 1 160 ? -12.199 -4.064  65.243   1.00 10.00 ? ? ? ? ? ? 161 HIS C ND1 1 
ATOM 7062  C CD2 . HIS C 1 160 ? -11.579 -3.332  67.213   1.00 10.00 ? ? ? ? ? ? 161 HIS C CD2 1 
ATOM 7063  C CE1 . HIS C 1 160 ? -12.427 -2.779  65.308   1.00 10.00 ? ? ? ? ? ? 161 HIS C CE1 1 
ATOM 7064  N NE2 . HIS C 1 160 ? -12.053 -2.349  66.492   1.00 10.00 ? ? ? ? ? ? 161 HIS C NE2 1 
ATOM 7065  N N   . THR C 1 161 ? -9.257  -7.350  68.299   1.00 10.00 ? ? ? ? ? ? 162 THR C N   1 
ATOM 7066  C CA  . THR C 1 161 ? -9.181  -8.321  69.360   1.00 10.00 ? ? ? ? ? ? 162 THR C CA  1 
ATOM 7067  C C   . THR C 1 161 ? -10.100 -7.701  70.450   1.00 10.00 ? ? ? ? ? ? 162 THR C C   1 
ATOM 7068  O O   . THR C 1 161 ? -10.011 -6.502  70.776   1.00 10.00 ? ? ? ? ? ? 162 THR C O   1 
ATOM 7069  C CB  . THR C 1 161 ? -7.695  -8.431  69.643   1.00 10.00 ? ? ? ? ? ? 162 THR C CB  1 
ATOM 7070  O OG1 . THR C 1 161 ? -7.054  -7.165  69.704   1.00 10.00 ? ? ? ? ? ? 162 THR C OG1 1 
ATOM 7071  C CG2 . THR C 1 161 ? -7.129  -9.259  68.525   1.00 10.00 ? ? ? ? ? ? 162 THR C CG2 1 
ATOM 7072  N N   . VAL C 1 162 ? -11.087 -8.475  70.943   1.00 10.00 ? ? ? ? ? ? 163 VAL C N   1 
ATOM 7073  C CA  . VAL C 1 162 ? -12.131 -7.979  71.808   1.00 10.00 ? ? ? ? ? ? 163 VAL C CA  1 
ATOM 7074  C C   . VAL C 1 162 ? -12.057 -8.913  72.989   1.00 10.00 ? ? ? ? ? ? 163 VAL C C   1 
ATOM 7075  O O   . VAL C 1 162 ? -12.343 -10.089 72.732   1.00 10.00 ? ? ? ? ? ? 163 VAL C O   1 
ATOM 7076  C CB  . VAL C 1 162 ? -13.496 -8.076  71.000   1.00 10.00 ? ? ? ? ? ? 163 VAL C CB  1 
ATOM 7077  C CG1 . VAL C 1 162 ? -14.715 -7.636  71.780   1.00 10.00 ? ? ? ? ? ? 163 VAL C CG1 1 
ATOM 7078  C CG2 . VAL C 1 162 ? -13.501 -7.042  69.889   1.00 10.00 ? ? ? ? ? ? 163 VAL C CG2 1 
ATOM 7079  N N   . PRO C 1 163 ? -11.689 -8.582  74.239   1.00 10.00 ? ? ? ? ? ? 164 PRO C N   1 
ATOM 7080  C CA  . PRO C 1 163 ? -11.947 -9.433  75.395   1.00 10.00 ? ? ? ? ? ? 164 PRO C CA  1 
ATOM 7081  C C   . PRO C 1 163 ? -13.401 -9.337  75.900   1.00 10.00 ? ? ? ? ? ? 164 PRO C C   1 
ATOM 7082  O O   . PRO C 1 163 ? -13.925 -8.243  76.048   1.00 10.00 ? ? ? ? ? ? 164 PRO C O   1 
ATOM 7083  C CB  . PRO C 1 163 ? -10.901 -8.983  76.395   1.00 10.00 ? ? ? ? ? ? 164 PRO C CB  1 
ATOM 7084  C CG  . PRO C 1 163 ? -10.020 -8.017  75.691   1.00 10.00 ? ? ? ? ? ? 164 PRO C CG  1 
ATOM 7085  C CD  . PRO C 1 163 ? -10.920 -7.420  74.650   1.00 10.00 ? ? ? ? ? ? 164 PRO C CD  1 
ATOM 7086  N N   . ILE C 1 164 ? -14.105 -10.429 76.125   1.00 10.00 ? ? ? ? ? ? 165 ILE C N   1 
ATOM 7087  C CA  . ILE C 1 164 ? -15.486 -10.455 76.541   1.00 10.00 ? ? ? ? ? ? 165 ILE C CA  1 
ATOM 7088  C C   . ILE C 1 164 ? -15.583 -11.187 77.887   1.00 10.00 ? ? ? ? ? ? 165 ILE C C   1 
ATOM 7089  O O   . ILE C 1 164 ? -15.160 -12.335 78.011   1.00 10.00 ? ? ? ? ? ? 165 ILE C O   1 
ATOM 7090  C CB  . ILE C 1 164 ? -16.298 -11.173 75.450   1.00 10.00 ? ? ? ? ? ? 165 ILE C CB  1 
ATOM 7091  C CG1 . ILE C 1 164 ? -16.292 -10.227 74.278   1.00 10.00 ? ? ? ? ? ? 165 ILE C CG1 1 
ATOM 7092  C CG2 . ILE C 1 164 ? -17.717 -11.598 75.885   1.00 10.00 ? ? ? ? ? ? 165 ILE C CG2 1 
ATOM 7093  C CD1 . ILE C 1 164 ? -16.331 -11.010 72.959   1.00 10.00 ? ? ? ? ? ? 165 ILE C CD1 1 
ATOM 7094  N N   . TYR C 1 165 ? -16.123 -10.542 78.923   1.00 10.00 ? ? ? ? ? ? 166 TYR C N   1 
ATOM 7095  C CA  . TYR C 1 165 ? -16.396 -11.120 80.229   1.00 10.00 ? ? ? ? ? ? 166 TYR C CA  1 
ATOM 7096  C C   . TYR C 1 165 ? -17.918 -11.200 80.345   1.00 10.00 ? ? ? ? ? ? 166 TYR C C   1 
ATOM 7097  O O   . TYR C 1 165 ? -18.632 -10.192 80.326   1.00 10.00 ? ? ? ? ? ? 166 TYR C O   1 
ATOM 7098  C CB  . TYR C 1 165 ? -15.863 -10.218 81.331   1.00 10.00 ? ? ? ? ? ? 166 TYR C CB  1 
ATOM 7099  C CG  . TYR C 1 165 ? -16.204 -10.627 82.760   1.00 10.00 ? ? ? ? ? ? 166 TYR C CG  1 
ATOM 7100  C CD1 . TYR C 1 165 ? -16.256 -11.956 83.082   1.00 10.00 ? ? ? ? ? ? 166 TYR C CD1 1 
ATOM 7101  C CD2 . TYR C 1 165 ? -16.478 -9.670  83.713   1.00 10.00 ? ? ? ? ? ? 166 TYR C CD2 1 
ATOM 7102  C CE1 . TYR C 1 165 ? -16.582 -12.365 84.341   1.00 10.00 ? ? ? ? ? ? 166 TYR C CE1 1 
ATOM 7103  C CE2 . TYR C 1 165 ? -16.802 -10.071 84.980   1.00 10.00 ? ? ? ? ? ? 166 TYR C CE2 1 
ATOM 7104  C CZ  . TYR C 1 165 ? -16.840 -11.415 85.270   1.00 10.00 ? ? ? ? ? ? 166 TYR C CZ  1 
ATOM 7105  O OH  . TYR C 1 165 ? -17.067 -11.864 86.534   1.00 10.00 ? ? ? ? ? ? 166 TYR C OH  1 
ATOM 7106  N N   . GLU C 1 166 ? -18.396 -12.431 80.390   1.00 10.00 ? ? ? ? ? ? 167 GLU C N   1 
ATOM 7107  C CA  . GLU C 1 166 ? -19.778 -12.740 80.544   1.00 10.00 ? ? ? ? ? ? 167 GLU C CA  1 
ATOM 7108  C C   . GLU C 1 166 ? -20.719 -12.125 79.507   1.00 10.00 ? ? ? ? ? ? 167 GLU C C   1 
ATOM 7109  O O   . GLU C 1 166 ? -21.812 -11.700 79.862   1.00 10.00 ? ? ? ? ? ? 167 GLU C O   1 
ATOM 7110  C CB  . GLU C 1 166 ? -20.142 -12.328 81.940   1.00 10.00 ? ? ? ? ? ? 167 GLU C CB  1 
ATOM 7111  C CG  . GLU C 1 166 ? -19.602 -13.154 83.070   1.00 10.00 ? ? ? ? ? ? 167 GLU C CG  1 
ATOM 7112  C CD  . GLU C 1 166 ? -20.044 -14.604 83.086   1.00 10.00 ? ? ? ? ? ? 167 GLU C CD  1 
ATOM 7113  O OE1 . GLU C 1 166 ? -21.038 -14.961 82.436   1.00 10.00 ? ? ? ? ? ? 167 GLU C OE1 1 
ATOM 7114  O OE2 . GLU C 1 166 ? -19.375 -15.389 83.769   1.00 10.00 ? ? ? ? ? ? 167 GLU C OE2 1 
ATOM 7115  N N   . GLY C 1 167 ? -20.406 -12.130 78.214   1.00 10.00 ? ? ? ? ? ? 168 GLY C N   1 
ATOM 7116  C CA  . GLY C 1 167 ? -21.236 -11.529 77.179   1.00 10.00 ? ? ? ? ? ? 168 GLY C CA  1 
ATOM 7117  C C   . GLY C 1 167 ? -21.050 -10.016 76.969   1.00 10.00 ? ? ? ? ? ? 168 GLY C C   1 
ATOM 7118  O O   . GLY C 1 167 ? -21.810 -9.345  76.251   1.00 10.00 ? ? ? ? ? ? 168 GLY C O   1 
ATOM 7119  N N   . TYR C 1 168 ? -20.008 -9.439  77.554   1.00 10.00 ? ? ? ? ? ? 169 TYR C N   1 
ATOM 7120  C CA  . TYR C 1 168 ? -19.826 -8.007  77.575   1.00 10.00 ? ? ? ? ? ? 169 TYR C CA  1 
ATOM 7121  C C   . TYR C 1 168 ? -18.402 -7.784  77.155   1.00 10.00 ? ? ? ? ? ? 169 TYR C C   1 
ATOM 7122  O O   . TYR C 1 168 ? -17.471 -8.313  77.763   1.00 10.00 ? ? ? ? ? ? 169 TYR C O   1 
ATOM 7123  C CB  . TYR C 1 168 ? -20.041 -7.420  79.007   1.00 10.00 ? ? ? ? ? ? 169 TYR C CB  1 
ATOM 7124  C CG  . TYR C 1 168 ? -21.477 -7.561  79.566   1.00 10.00 ? ? ? ? ? ? 169 TYR C CG  1 
ATOM 7125  C CD1 . TYR C 1 168 ? -22.484 -6.749  79.090   1.00 10.00 ? ? ? ? ? ? 169 TYR C CD1 1 
ATOM 7126  C CD2 . TYR C 1 168 ? -21.781 -8.568  80.477   1.00 10.00 ? ? ? ? ? ? 169 TYR C CD2 1 
ATOM 7127  C CE1 . TYR C 1 168 ? -23.770 -6.930  79.483   1.00 10.00 ? ? ? ? ? ? 169 TYR C CE1 1 
ATOM 7128  C CE2 . TYR C 1 168 ? -23.079 -8.763  80.881   1.00 10.00 ? ? ? ? ? ? 169 TYR C CE2 1 
ATOM 7129  C CZ  . TYR C 1 168 ? -24.048 -7.930  80.368   1.00 10.00 ? ? ? ? ? ? 169 TYR C CZ  1 
ATOM 7130  O OH  . TYR C 1 168 ? -25.364 -8.083  80.783   1.00 10.00 ? ? ? ? ? ? 169 TYR C OH  1 
ATOM 7131  N N   . ALA C 1 169 ? -18.273 -7.044  76.072   1.00 10.00 ? ? ? ? ? ? 170 ALA C N   1 
ATOM 7132  C CA  . ALA C 1 169 ? -17.004 -6.709  75.465   1.00 10.00 ? ? ? ? ? ? 170 ALA C CA  1 
ATOM 7133  C C   . ALA C 1 169 ? -16.322 -5.726  76.380   1.00 10.00 ? ? ? ? ? ? 170 ALA C C   1 
ATOM 7134  O O   . ALA C 1 169 ? -17.000 -4.838  76.899   1.00 10.00 ? ? ? ? ? ? 170 ALA C O   1 
ATOM 7135  C CB  . ALA C 1 169 ? -17.183 -6.036  74.109   1.00 10.00 ? ? ? ? ? ? 170 ALA C CB  1 
ATOM 7136  N N   . LEU C 1 170 ? -15.007 -5.778  76.552   1.00 10.00 ? ? ? ? ? ? 171 LEU C N   1 
ATOM 7137  C CA  . LEU C 1 170 ? -14.407 -4.853  77.464   1.00 10.00 ? ? ? ? ? ? 171 LEU C CA  1 
ATOM 7138  C C   . LEU C 1 170 ? -13.760 -3.724  76.664   1.00 10.00 ? ? ? ? ? ? 171 LEU C C   1 
ATOM 7139  O O   . LEU C 1 170 ? -12.559 -3.778  76.402   1.00 10.00 ? ? ? ? ? ? 171 LEU C O   1 
ATOM 7140  C CB  . LEU C 1 170 ? -13.432 -5.684  78.351   1.00 10.00 ? ? ? ? ? ? 171 LEU C CB  1 
ATOM 7141  C CG  . LEU C 1 170 ? -14.041 -6.901  79.154   1.00 10.00 ? ? ? ? ? ? 171 LEU C CG  1 
ATOM 7142  C CD1 . LEU C 1 170 ? -12.909 -7.637  79.868   1.00 10.00 ? ? ? ? ? ? 171 LEU C CD1 1 
ATOM 7143  C CD2 . LEU C 1 170 ? -15.114 -6.449  80.129   1.00 10.00 ? ? ? ? ? ? 171 LEU C CD2 1 
ATOM 7144  N N   . PRO C 1 171 ? -14.433 -2.612  76.346   1.00 10.00 ? ? ? ? ? ? 172 PRO C N   1 
ATOM 7145  C CA  . PRO C 1 171 ? -13.995 -1.587  75.400   1.00 10.00 ? ? ? ? ? ? 172 PRO C CA  1 
ATOM 7146  C C   . PRO C 1 171 ? -12.597 -1.015  75.632   1.00 10.00 ? ? ? ? ? ? 172 PRO C C   1 
ATOM 7147  O O   . PRO C 1 171 ? -11.887 -0.661  74.684   1.00 10.00 ? ? ? ? ? ? 172 PRO C O   1 
ATOM 7148  C CB  . PRO C 1 171 ? -15.015 -0.515  75.468   1.00 10.00 ? ? ? ? ? ? 172 PRO C CB  1 
ATOM 7149  C CG  . PRO C 1 171 ? -16.148 -1.309  75.953   1.00 10.00 ? ? ? ? ? ? 172 PRO C CG  1 
ATOM 7150  C CD  . PRO C 1 171 ? -15.589 -2.136  77.054   1.00 10.00 ? ? ? ? ? ? 172 PRO C CD  1 
ATOM 7151  N N   . HIS C 1 172 ? -12.132 -0.847  76.872   1.00 10.00 ? ? ? ? ? ? 173 HIS C N   1 
ATOM 7152  C CA  . HIS C 1 172 ? -10.736 -0.428  77.053   1.00 10.00 ? ? ? ? ? ? 173 HIS C CA  1 
ATOM 7153  C C   . HIS C 1 172 ? -9.650  -1.372  76.463   1.00 10.00 ? ? ? ? ? ? 173 HIS C C   1 
ATOM 7154  O O   . HIS C 1 172 ? -8.559  -0.939  76.049   1.00 10.00 ? ? ? ? ? ? 173 HIS C O   1 
ATOM 7155  C CB  . HIS C 1 172 ? -10.492 -0.250  78.546   1.00 10.00 ? ? ? ? ? ? 173 HIS C CB  1 
ATOM 7156  C CG  . HIS C 1 172 ? -10.780 -1.554  79.259   1.00 10.00 ? ? ? ? ? ? 173 HIS C CG  1 
ATOM 7157  N ND1 . HIS C 1 172 ? -11.951 -2.201  79.365   1.00 10.00 ? ? ? ? ? ? 173 HIS C ND1 1 
ATOM 7158  C CD2 . HIS C 1 172 ? -9.807  -2.251  79.942   1.00 10.00 ? ? ? ? ? ? 173 HIS C CD2 1 
ATOM 7159  C CE1 . HIS C 1 172 ? -11.687 -3.280  80.107   1.00 10.00 ? ? ? ? ? ? 173 HIS C CE1 1 
ATOM 7160  N NE2 . HIS C 1 172 ? -10.410 -3.301  80.449   1.00 10.00 ? ? ? ? ? ? 173 HIS C NE2 1 
ATOM 7161  N N   . ALA C 1 173 ? -9.914  -2.690  76.446   1.00 10.00 ? ? ? ? ? ? 174 ALA C N   1 
ATOM 7162  C CA  . ALA C 1 173 ? -8.890  -3.620  76.031   1.00 10.00 ? ? ? ? ? ? 174 ALA C CA  1 
ATOM 7163  C C   . ALA C 1 173 ? -9.092  -4.005  74.587   1.00 10.00 ? ? ? ? ? ? 174 ALA C C   1 
ATOM 7164  O O   . ALA C 1 173 ? -8.316  -4.833  74.111   1.00 10.00 ? ? ? ? ? ? 174 ALA C O   1 
ATOM 7165  C CB  . ALA C 1 173 ? -8.924  -4.870  76.901   1.00 10.00 ? ? ? ? ? ? 174 ALA C CB  1 
ATOM 7166  N N   . ILE C 1 174 ? -10.096 -3.445  73.867   1.00 10.00 ? ? ? ? ? ? 175 ILE C N   1 
ATOM 7167  C CA  . ILE C 1 174 ? -10.344 -3.723  72.453   1.00 10.00 ? ? ? ? ? ? 175 ILE C CA  1 
ATOM 7168  C C   . ILE C 1 174 ? -9.242  -2.978  71.698   1.00 10.00 ? ? ? ? ? ? 175 ILE C C   1 
ATOM 7169  O O   . ILE C 1 174 ? -8.827  -1.853  72.024   1.00 10.00 ? ? ? ? ? ? 175 ILE C O   1 
ATOM 7170  C CB  . ILE C 1 174 ? -11.737 -3.212  71.985   1.00 10.00 ? ? ? ? ? ? 175 ILE C CB  1 
ATOM 7171  C CG1 . ILE C 1 174 ? -12.844 -4.109  72.526   1.00 10.00 ? ? ? ? ? ? 175 ILE C CG1 1 
ATOM 7172  C CG2 . ILE C 1 174 ? -11.857 -3.311  70.466   1.00 10.00 ? ? ? ? ? ? 175 ILE C CG2 1 
ATOM 7173  C CD1 . ILE C 1 174 ? -14.243 -3.575  72.170   1.00 10.00 ? ? ? ? ? ? 175 ILE C CD1 1 
ATOM 7174  N N   . LEU C 1 175 ? -8.714  -3.658  70.692   1.00 10.00 ? ? ? ? ? ? 176 LEU C N   1 
ATOM 7175  C CA  . LEU C 1 175 ? -7.617  -3.159  69.883   1.00 10.00 ? ? ? ? ? ? 176 LEU C CA  1 
ATOM 7176  C C   . LEU C 1 175 ? -8.057  -3.424  68.443   1.00 10.00 ? ? ? ? ? ? 176 LEU C C   1 
ATOM 7177  O O   . LEU C 1 175 ? -8.740  -4.412  68.127   1.00 10.00 ? ? ? ? ? ? 176 LEU C O   1 
ATOM 7178  C CB  . LEU C 1 175 ? -6.334  -3.923  70.352   1.00 10.00 ? ? ? ? ? ? 176 LEU C CB  1 
ATOM 7179  C CG  . LEU C 1 175 ? -5.655  -3.574  71.683   1.00 10.00 ? ? ? ? ? ? 176 LEU C CG  1 
ATOM 7180  C CD1 . LEU C 1 175 ? -4.555  -4.504  72.065   1.00 10.00 ? ? ? ? ? ? 176 LEU C CD1 1 
ATOM 7181  C CD2 . LEU C 1 175 ? -4.867  -2.356  71.496   1.00 10.00 ? ? ? ? ? ? 176 LEU C CD2 1 
ATOM 7182  N N   . ARG C 1 176 ? -7.779  -2.439  67.600   1.00 10.00 ? ? ? ? ? ? 177 ARG C N   1 
ATOM 7183  C CA  . ARG C 1 176 ? -8.172  -2.369  66.183   1.00 10.00 ? ? ? ? ? ? 177 ARG C CA  1 
ATOM 7184  C C   . ARG C 1 176 ? -6.940  -2.330  65.329   1.00 10.00 ? ? ? ? ? ? 177 ARG C C   1 
ATOM 7185  O O   . ARG C 1 176 ? -6.033  -1.549  65.632   1.00 10.00 ? ? ? ? ? ? 177 ARG C O   1 
ATOM 7186  C CB  . ARG C 1 176 ? -9.024  -1.096  65.915   1.00 10.00 ? ? ? ? ? ? 177 ARG C CB  1 
ATOM 7187  C CG  . ARG C 1 176 ? -8.848  -0.327  64.619   1.00 10.00 ? ? ? ? ? ? 177 ARG C CG  1 
ATOM 7188  C CD  . ARG C 1 176 ? -10.197 0.114   64.085   1.00 10.00 ? ? ? ? ? ? 177 ARG C CD  1 
ATOM 7189  N NE  . ARG C 1 176 ? -10.138 1.282   63.198   1.00 10.00 ? ? ? ? ? ? 177 ARG C NE  1 
ATOM 7190  C CZ  . ARG C 1 176 ? -11.260 1.745   62.603   1.00 10.00 ? ? ? ? ? ? 177 ARG C CZ  1 
ATOM 7191  N NH1 . ARG C 1 176 ? -12.419 1.076   62.740   1.00 10.00 ? ? ? ? ? ? 177 ARG C NH1 1 
ATOM 7192  N NH2 . ARG C 1 176 ? -11.245 2.833   61.808   1.00 10.00 ? ? ? ? ? ? 177 ARG C NH2 1 
ATOM 7193  N N   . LEU C 1 177 ? -6.981  -3.125  64.263   1.00 10.00 ? ? ? ? ? ? 178 LEU C N   1 
ATOM 7194  C CA  . LEU C 1 177 ? -5.880  -3.259  63.320   1.00 10.00 ? ? ? ? ? ? 178 LEU C CA  1 
ATOM 7195  C C   . LEU C 1 177 ? -6.501  -3.119  61.954   1.00 10.00 ? ? ? ? ? ? 178 LEU C C   1 
ATOM 7196  O O   . LEU C 1 177 ? -7.438  -3.820  61.535   1.00 10.00 ? ? ? ? ? ? 178 LEU C O   1 
ATOM 7197  C CB  . LEU C 1 177 ? -5.205  -4.628  63.396   1.00 10.00 ? ? ? ? ? ? 178 LEU C CB  1 
ATOM 7198  C CG  . LEU C 1 177 ? -3.683  -4.675  63.384   1.00 10.00 ? ? ? ? ? ? 178 LEU C CG  1 
ATOM 7199  C CD1 . LEU C 1 177 ? -3.246  -5.892  64.164   1.00 10.00 ? ? ? ? ? ? 178 LEU C CD1 1 
ATOM 7200  C CD2 . LEU C 1 177 ? -3.162  -4.633  61.960   1.00 10.00 ? ? ? ? ? ? 178 LEU C CD2 1 
ATOM 7201  N N   . ASP C 1 178 ? -5.906  -2.152  61.282   1.00 10.00 ? ? ? ? ? ? 179 ASP C N   1 
ATOM 7202  C CA  . ASP C 1 178 ? -6.397  -1.853  59.975   1.00 10.00 ? ? ? ? ? ? 179 ASP C CA  1 
ATOM 7203  C C   . ASP C 1 178 ? -5.548  -2.531  58.914   1.00 10.00 ? ? ? ? ? ? 179 ASP C C   1 
ATOM 7204  O O   . ASP C 1 178 ? -4.675  -1.989  58.219   1.00 10.00 ? ? ? ? ? ? 179 ASP C O   1 
ATOM 7205  C CB  . ASP C 1 178 ? -6.467  -0.299  59.912   1.00 10.00 ? ? ? ? ? ? 179 ASP C CB  1 
ATOM 7206  C CG  . ASP C 1 178 ? -7.754  0.298   60.560   1.00 10.00 ? ? ? ? ? ? 179 ASP C CG  1 
ATOM 7207  O OD1 . ASP C 1 178 ? -8.579  -0.460  61.081   1.00 10.00 ? ? ? ? ? ? 179 ASP C OD1 1 
ATOM 7208  O OD2 . ASP C 1 178 ? -7.950  1.521   60.552   1.00 10.00 ? ? ? ? ? ? 179 ASP C OD2 1 
ATOM 7209  N N   . LEU C 1 179 ? -5.818  -3.818  58.884   1.00 10.00 ? ? ? ? ? ? 180 LEU C N   1 
ATOM 7210  C CA  . LEU C 1 179 ? -5.200  -4.715  57.943   1.00 10.00 ? ? ? ? ? ? 180 LEU C CA  1 
ATOM 7211  C C   . LEU C 1 179 ? -6.079  -5.955  58.038   1.00 10.00 ? ? ? ? ? ? 180 LEU C C   1 
ATOM 7212  O O   . LEU C 1 179 ? -6.253  -6.549  59.106   1.00 10.00 ? ? ? ? ? ? 180 LEU C O   1 
ATOM 7213  C CB  . LEU C 1 179 ? -3.757  -4.950  58.377   1.00 10.00 ? ? ? ? ? ? 180 LEU C CB  1 
ATOM 7214  C CG  . LEU C 1 179 ? -3.131  -6.318  58.358   1.00 10.00 ? ? ? ? ? ? 180 LEU C CG  1 
ATOM 7215  C CD1 . LEU C 1 179 ? -2.970  -6.868  56.969   1.00 10.00 ? ? ? ? ? ? 180 LEU C CD1 1 
ATOM 7216  C CD2 . LEU C 1 179 ? -1.749  -6.182  58.916   1.00 10.00 ? ? ? ? ? ? 180 LEU C CD2 1 
ATOM 7217  N N   . ALA C 1 180 ? -6.715  -6.285  56.929   1.00 10.00 ? ? ? ? ? ? 181 ALA C N   1 
ATOM 7218  C CA  . ALA C 1 180 ? -7.613  -7.415  56.875   1.00 10.00 ? ? ? ? ? ? 181 ALA C CA  1 
ATOM 7219  C C   . ALA C 1 180 ? -7.673  -7.877  55.426   1.00 10.00 ? ? ? ? ? ? 181 ALA C C   1 
ATOM 7220  O O   . ALA C 1 180 ? -6.850  -7.328  54.680   1.00 10.00 ? ? ? ? ? ? 181 ALA C O   1 
ATOM 7221  C CB  . ALA C 1 180 ? -8.968  -6.987  57.284   1.00 10.00 ? ? ? ? ? ? 181 ALA C CB  1 
ATOM 7222  N N   . GLY C 1 181 ? -8.607  -8.754  54.997   1.00 10.00 ? ? ? ? ? ? 182 GLY C N   1 
ATOM 7223  C CA  . GLY C 1 181 ? -8.703  -9.293  53.652   1.00 10.00 ? ? ? ? ? ? 182 GLY C CA  1 
ATOM 7224  C C   . GLY C 1 181 ? -8.362  -8.404  52.434   1.00 10.00 ? ? ? ? ? ? 182 GLY C C   1 
ATOM 7225  O O   . GLY C 1 181 ? -7.736  -8.870  51.465   1.00 10.00 ? ? ? ? ? ? 182 GLY C O   1 
ATOM 7226  N N   . ARG C 1 182 ? -8.700  -7.123  52.385   1.00 10.00 ? ? ? ? ? ? 183 ARG C N   1 
ATOM 7227  C CA  . ARG C 1 182 ? -8.420  -6.312  51.210   1.00 10.00 ? ? ? ? ? ? 183 ARG C CA  1 
ATOM 7228  C C   . ARG C 1 182 ? -6.926  -6.011  51.114   1.00 10.00 ? ? ? ? ? ? 183 ARG C C   1 
ATOM 7229  O O   . ARG C 1 182 ? -6.313  -5.977  50.041   1.00 10.00 ? ? ? ? ? ? 183 ARG C O   1 
ATOM 7230  C CB  . ARG C 1 182 ? -9.234  -5.038  51.327   1.00 10.00 ? ? ? ? ? ? 183 ARG C CB  1 
ATOM 7231  C CG  . ARG C 1 182 ? -9.894  -4.469  50.094   1.00 10.00 ? ? ? ? ? ? 183 ARG C CG  1 
ATOM 7232  C CD  . ARG C 1 182 ? -10.941 -3.440  50.630   1.00 10.00 ? ? ? ? ? ? 183 ARG C CD  1 
ATOM 7233  N NE  . ARG C 1 182 ? -10.351 -2.276  51.328   1.00 10.00 ? ? ? ? ? ? 183 ARG C NE  1 
ATOM 7234  C CZ  . ARG C 1 182 ? -10.534 -0.971  50.956   1.00 10.00 ? ? ? ? ? ? 183 ARG C CZ  1 
ATOM 7235  N NH1 . ARG C 1 182 ? -11.298 -0.581  49.899   1.00 10.00 ? ? ? ? ? ? 183 ARG C NH1 1 
ATOM 7236  N NH2 . ARG C 1 182 ? -9.867  -0.020  51.633   1.00 10.00 ? ? ? ? ? ? 183 ARG C NH2 1 
ATOM 7237  N N   . ASP C 1 183 ? -6.314  -5.848  52.280   1.00 10.00 ? ? ? ? ? ? 184 ASP C N   1 
ATOM 7238  C CA  . ASP C 1 183 ? -4.903  -5.581  52.379   1.00 10.00 ? ? ? ? ? ? 184 ASP C CA  1 
ATOM 7239  C C   . ASP C 1 183 ? -4.146  -6.758  51.831   1.00 10.00 ? ? ? ? ? ? 184 ASP C C   1 
ATOM 7240  O O   . ASP C 1 183 ? -3.156  -6.575  51.128   1.00 10.00 ? ? ? ? ? ? 184 ASP C O   1 
ATOM 7241  C CB  . ASP C 1 183 ? -4.557  -5.342  53.825   1.00 10.00 ? ? ? ? ? ? 184 ASP C CB  1 
ATOM 7242  C CG  . ASP C 1 183 ? -5.229  -4.070  54.316   1.00 10.00 ? ? ? ? ? ? 184 ASP C CG  1 
ATOM 7243  O OD1 . ASP C 1 183 ? -6.424  -4.102  54.617   1.00 10.00 ? ? ? ? ? ? 184 ASP C OD1 1 
ATOM 7244  O OD2 . ASP C 1 183 ? -4.536  -3.058  54.371   1.00 10.00 ? ? ? ? ? ? 184 ASP C OD2 1 
ATOM 7245  N N   . LEU C 1 184 ? -4.666  -7.964  52.031   1.00 10.00 ? ? ? ? ? ? 185 LEU C N   1 
ATOM 7246  C CA  . LEU C 1 184 ? -4.058  -9.186  51.582   1.00 10.00 ? ? ? ? ? ? 185 LEU C CA  1 
ATOM 7247  C C   . LEU C 1 184 ? -4.366  -9.483  50.132   1.00 10.00 ? ? ? ? ? ? 185 LEU C C   1 
ATOM 7248  O O   . LEU C 1 184 ? -3.510  -10.059 49.462   1.00 10.00 ? ? ? ? ? ? 185 LEU C O   1 
ATOM 7249  C CB  . LEU C 1 184 ? -4.533  -10.259 52.495   1.00 10.00 ? ? ? ? ? ? 185 LEU C CB  1 
ATOM 7250  C CG  . LEU C 1 184 ? -3.579  -10.785 53.571   1.00 10.00 ? ? ? ? ? ? 185 LEU C CG  1 
ATOM 7251  C CD1 . LEU C 1 184 ? -2.875  -9.777  54.409   1.00 10.00 ? ? ? ? ? ? 185 LEU C CD1 1 
ATOM 7252  C CD2 . LEU C 1 184 ? -4.472  -11.532 54.508   1.00 10.00 ? ? ? ? ? ? 185 LEU C CD2 1 
ATOM 7253  N N   . THR C 1 185 ? -5.507  -9.134  49.546   1.00 10.00 ? ? ? ? ? ? 186 THR C N   1 
ATOM 7254  C CA  . THR C 1 185 ? -5.732  -9.261  48.098   1.00 10.00 ? ? ? ? ? ? 186 THR C CA  1 
ATOM 7255  C C   . THR C 1 185 ? -4.813  -8.349  47.300   1.00 10.00 ? ? ? ? ? ? 186 THR C C   1 
ATOM 7256  O O   . THR C 1 185 ? -4.229  -8.731  46.293   1.00 10.00 ? ? ? ? ? ? 186 THR C O   1 
ATOM 7257  C CB  . THR C 1 185 ? -7.189  -8.920  47.764   1.00 10.00 ? ? ? ? ? ? 186 THR C CB  1 
ATOM 7258  O OG1 . THR C 1 185 ? -7.988  -9.869  48.482   1.00 10.00 ? ? ? ? ? ? 186 THR C OG1 1 
ATOM 7259  C CG2 . THR C 1 185 ? -7.502  -9.000  46.297   1.00 10.00 ? ? ? ? ? ? 186 THR C CG2 1 
ATOM 7260  N N   . ASP C 1 186 ? -4.660  -7.142  47.801   1.00 10.00 ? ? ? ? ? ? 187 ASP C N   1 
ATOM 7261  C CA  . ASP C 1 186 ? -3.789  -6.150  47.253   1.00 10.00 ? ? ? ? ? ? 187 ASP C CA  1 
ATOM 7262  C C   . ASP C 1 186 ? -2.308  -6.451  47.227   1.00 10.00 ? ? ? ? ? ? 187 ASP C C   1 
ATOM 7263  O O   . ASP C 1 186 ? -1.593  -6.035  46.308   1.00 10.00 ? ? ? ? ? ? 187 ASP C O   1 
ATOM 7264  C CB  . ASP C 1 186 ? -3.954  -4.889  48.011   1.00 10.00 ? ? ? ? ? ? 187 ASP C CB  1 
ATOM 7265  C CG  . ASP C 1 186 ? -5.132  -4.105  47.577   1.00 10.00 ? ? ? ? ? ? 187 ASP C CG  1 
ATOM 7266  O OD1 . ASP C 1 186 ? -5.823  -4.495  46.648   1.00 10.00 ? ? ? ? ? ? 187 ASP C OD1 1 
ATOM 7267  O OD2 . ASP C 1 186 ? -5.368  -3.069  48.176   1.00 10.00 ? ? ? ? ? ? 187 ASP C OD2 1 
ATOM 7268  N N   . TYR C 1 187 ? -1.835  -7.048  48.324   1.00 10.00 ? ? ? ? ? ? 188 TYR C N   1 
ATOM 7269  C CA  . TYR C 1 187 ? -0.439  -7.386  48.450   1.00 10.00 ? ? ? ? ? ? 188 TYR C CA  1 
ATOM 7270  C C   . TYR C 1 187 ? -0.107  -8.615  47.635   1.00 10.00 ? ? ? ? ? ? 188 TYR C C   1 
ATOM 7271  O O   . TYR C 1 187 ? 1.030   -8.760  47.186   1.00 10.00 ? ? ? ? ? ? 188 TYR C O   1 
ATOM 7272  C CB  . TYR C 1 187 ? -0.178  -7.587  49.900   1.00 10.00 ? ? ? ? ? ? 188 TYR C CB  1 
ATOM 7273  C CG  . TYR C 1 187 ? 1.210   -8.030  50.204   1.00 10.00 ? ? ? ? ? ? 188 TYR C CG  1 
ATOM 7274  C CD1 . TYR C 1 187 ? 2.290   -7.229  49.947   1.00 10.00 ? ? ? ? ? ? 188 TYR C CD1 1 
ATOM 7275  C CD2 . TYR C 1 187 ? 1.345   -9.254  50.773   1.00 10.00 ? ? ? ? ? ? 188 TYR C CD2 1 
ATOM 7276  C CE1 . TYR C 1 187 ? 3.558   -7.680  50.284   1.00 10.00 ? ? ? ? ? ? 188 TYR C CE1 1 
ATOM 7277  C CE2 . TYR C 1 187 ? 2.601   -9.709  51.111   1.00 10.00 ? ? ? ? ? ? 188 TYR C CE2 1 
ATOM 7278  C CZ  . TYR C 1 187 ? 3.708   -8.929  50.871   1.00 10.00 ? ? ? ? ? ? 188 TYR C CZ  1 
ATOM 7279  O OH  . TYR C 1 187 ? 4.956   -9.425  51.248   1.00 10.00 ? ? ? ? ? ? 188 TYR C OH  1 
ATOM 7280  N N   . LEU C 1 188 ? -1.082  -9.482  47.423   1.00 10.00 ? ? ? ? ? ? 189 LEU C N   1 
ATOM 7281  C CA  . LEU C 1 188 ? -0.915  -10.658 46.600   1.00 10.00 ? ? ? ? ? ? 189 LEU C CA  1 
ATOM 7282  C C   . LEU C 1 188 ? -0.698  -10.216 45.158   1.00 10.00 ? ? ? ? ? ? 189 LEU C C   1 
ATOM 7283  O O   . LEU C 1 188 ? 0.224   -10.703 44.504   1.00 10.00 ? ? ? ? ? ? 189 LEU C O   1 
ATOM 7284  C CB  . LEU C 1 188 ? -2.165  -11.526 46.686   1.00 10.00 ? ? ? ? ? ? 189 LEU C CB  1 
ATOM 7285  C CG  . LEU C 1 188 ? -2.232  -12.693 45.709   1.00 10.00 ? ? ? ? ? ? 189 LEU C CG  1 
ATOM 7286  C CD1 . LEU C 1 188 ? -1.346  -13.812 46.222   1.00 10.00 ? ? ? ? ? ? 189 LEU C CD1 1 
ATOM 7287  C CD2 . LEU C 1 188 ? -3.666  -13.152 45.526   1.00 10.00 ? ? ? ? ? ? 189 LEU C CD2 1 
ATOM 7288  N N   . MET C 1 189 ? -1.541  -9.307  44.631   1.00 10.00 ? ? ? ? ? ? 190 MET C N   1 
ATOM 7289  C CA  . MET C 1 189 ? -1.503  -8.804  43.240   1.00 10.00 ? ? ? ? ? ? 190 MET C CA  1 
ATOM 7290  C C   . MET C 1 189 ? -0.185  -8.120  42.941   1.00 10.00 ? ? ? ? ? ? 190 MET C C   1 
ATOM 7291  O O   . MET C 1 189 ? 0.315   -8.322  41.838   1.00 10.00 ? ? ? ? ? ? 190 MET C O   1 
ATOM 7292  C CB  . MET C 1 189 ? -2.657  -7.792  42.979   1.00 10.00 ? ? ? ? ? ? 190 MET C CB  1 
ATOM 7293  C CG  . MET C 1 189 ? -2.841  -6.925  41.744   1.00 10.00 ? ? ? ? ? ? 190 MET C CG  1 
ATOM 7294  S SD  . MET C 1 189 ? -4.582  -6.355  41.635   1.00 10.00 ? ? ? ? ? ? 190 MET C SD  1 
ATOM 7295  C CE  . MET C 1 189 ? -4.863  -5.490  43.171   1.00 10.00 ? ? ? ? ? ? 190 MET C CE  1 
ATOM 7296  N N   . LYS C 1 190 ? 0.369   -7.342  43.894   1.00 10.00 ? ? ? ? ? ? 191 LYS C N   1 
ATOM 7297  C CA  . LYS C 1 190 ? 1.668   -6.700  43.761   1.00 10.00 ? ? ? ? ? ? 191 LYS C CA  1 
ATOM 7298  C C   . LYS C 1 190 ? 2.720   -7.765  43.793   1.00 10.00 ? ? ? ? ? ? 191 LYS C C   1 
ATOM 7299  O O   . LYS C 1 190 ? 3.541   -7.693  42.893   1.00 10.00 ? ? ? ? ? ? 191 LYS C O   1 
ATOM 7300  C CB  . LYS C 1 190 ? 2.021   -5.713  44.890   1.00 10.00 ? ? ? ? ? ? 191 LYS C CB  1 
ATOM 7301  C CG  . LYS C 1 190 ? 3.058   -4.712  44.383   1.00 10.00 ? ? ? ? ? ? 191 LYS C CG  1 
ATOM 7302  C CD  . LYS C 1 190 ? 3.361   -3.592  45.370   1.00 10.00 ? ? ? ? ? ? 191 LYS C CD  1 
ATOM 7303  C CE  . LYS C 1 190 ? 4.321   -3.928  46.523   1.00 10.00 ? ? ? ? ? ? 191 LYS C CE  1 
ATOM 7304  N NZ  . LYS C 1 190 ? 3.966   -5.155  47.229   1.00 10.00 ? ? ? ? ? ? 191 LYS C NZ  1 
ATOM 7305  N N   . ILE C 1 191 ? 2.756   -8.756  44.666   1.00 10.00 ? ? ? ? ? ? 192 ILE C N   1 
ATOM 7306  C CA  . ILE C 1 191 ? 3.862   -9.677  44.557   1.00 10.00 ? ? ? ? ? ? 192 ILE C CA  1 
ATOM 7307  C C   . ILE C 1 191 ? 3.659   -10.479 43.257   1.00 10.00 ? ? ? ? ? ? 192 ILE C C   1 
ATOM 7308  O O   . ILE C 1 191 ? 4.638   -10.675 42.541   1.00 10.00 ? ? ? ? ? ? 192 ILE C O   1 
ATOM 7309  C CB  . ILE C 1 191 ? 3.995   -10.579 45.917   1.00 10.00 ? ? ? ? ? ? 192 ILE C CB  1 
ATOM 7310  C CG1 . ILE C 1 191 ? 2.783   -11.404 46.441   1.00 10.00 ? ? ? ? ? ? 192 ILE C CG1 1 
ATOM 7311  C CG2 . ILE C 1 191 ? 4.332   -9.518  46.934   1.00 10.00 ? ? ? ? ? ? 192 ILE C CG2 1 
ATOM 7312  C CD1 . ILE C 1 191 ? 2.760   -12.171 47.827   1.00 10.00 ? ? ? ? ? ? 192 ILE C CD1 1 
ATOM 7313  N N   . LEU C 1 192 ? 2.455   -10.807 42.794   1.00 10.00 ? ? ? ? ? ? 193 LEU C N   1 
ATOM 7314  C CA  . LEU C 1 192 ? 2.228   -11.508 41.514   1.00 10.00 ? ? ? ? ? ? 193 LEU C CA  1 
ATOM 7315  C C   . LEU C 1 192 ? 2.628   -10.694 40.239   1.00 10.00 ? ? ? ? ? ? 193 LEU C C   1 
ATOM 7316  O O   . LEU C 1 192 ? 3.272   -11.201 39.315   1.00 10.00 ? ? ? ? ? ? 193 LEU C O   1 
ATOM 7317  C CB  . LEU C 1 192 ? 0.744   -11.899 41.513   1.00 10.00 ? ? ? ? ? ? 193 LEU C CB  1 
ATOM 7318  C CG  . LEU C 1 192 ? 0.354   -13.326 41.234   1.00 10.00 ? ? ? ? ? ? 193 LEU C CG  1 
ATOM 7319  C CD1 . LEU C 1 192 ? 1.256   -14.212 42.032   1.00 10.00 ? ? ? ? ? ? 193 LEU C CD1 1 
ATOM 7320  C CD2 . LEU C 1 192 ? -1.096  -13.586 41.577   1.00 10.00 ? ? ? ? ? ? 193 LEU C CD2 1 
ATOM 7321  N N   . THR C 1 193 ? 2.323   -9.400  40.178   1.00 10.00 ? ? ? ? ? ? 194 THR C N   1 
ATOM 7322  C CA  . THR C 1 193 ? 2.707   -8.424  39.144   1.00 10.00 ? ? ? ? ? ? 194 THR C CA  1 
ATOM 7323  C C   . THR C 1 193 ? 4.217   -8.129  39.200   1.00 10.00 ? ? ? ? ? ? 194 THR C C   1 
ATOM 7324  O O   . THR C 1 193 ? 4.858   -7.720  38.222   1.00 10.00 ? ? ? ? ? ? 194 THR C O   1 
ATOM 7325  C CB  . THR C 1 193 ? 1.835   -7.090  39.376   1.00 10.00 ? ? ? ? ? ? 194 THR C CB  1 
ATOM 7326  O OG1 . THR C 1 193 ? 0.554   -7.369  38.827   1.00 10.00 ? ? ? ? ? ? 194 THR C OG1 1 
ATOM 7327  C CG2 . THR C 1 193 ? 2.379   -5.815  38.770   1.00 10.00 ? ? ? ? ? ? 194 THR C CG2 1 
ATOM 7328  N N   . GLU C 1 194 ? 4.831   -8.283  40.385   1.00 10.00 ? ? ? ? ? ? 195 GLU C N   1 
ATOM 7329  C CA  . GLU C 1 194 ? 6.272   -8.106  40.525   1.00 10.00 ? ? ? ? ? ? 195 GLU C CA  1 
ATOM 7330  C C   . GLU C 1 194 ? 6.902   -9.251  39.765   1.00 10.00 ? ? ? ? ? ? 195 GLU C C   1 
ATOM 7331  O O   . GLU C 1 194 ? 7.891   -9.010  39.068   1.00 10.00 ? ? ? ? ? ? 195 GLU C O   1 
ATOM 7332  C CB  . GLU C 1 194 ? 6.719   -8.126  42.009   1.00 10.00 ? ? ? ? ? ? 195 GLU C CB  1 
ATOM 7333  C CG  . GLU C 1 194 ? 6.463   -6.727  42.586   1.00 10.00 ? ? ? ? ? ? 195 GLU C CG  1 
ATOM 7334  C CD  . GLU C 1 194 ? 6.965   -6.398  43.984   1.00 10.00 ? ? ? ? ? ? 195 GLU C CD  1 
ATOM 7335  O OE1 . GLU C 1 194 ? 6.995   -7.303  44.831   1.00 10.00 ? ? ? ? ? ? 195 GLU C OE1 1 
ATOM 7336  O OE2 . GLU C 1 194 ? 7.324   -5.221  44.211   1.00 10.00 ? ? ? ? ? ? 195 GLU C OE2 1 
ATOM 7337  N N   . ARG C 1 195 ? 6.278   -10.437 39.724   1.00 10.00 ? ? ? ? ? ? 196 ARG C N   1 
ATOM 7338  C CA  . ARG C 1 195 ? 6.807   -11.544 38.944   1.00 10.00 ? ? ? ? ? ? 196 ARG C CA  1 
ATOM 7339  C C   . ARG C 1 195 ? 6.522   -11.324 37.433   1.00 10.00 ? ? ? ? ? ? 196 ARG C C   1 
ATOM 7340  O O   . ARG C 1 195 ? 6.505   -12.248 36.625   1.00 10.00 ? ? ? ? ? ? 196 ARG C O   1 
ATOM 7341  C CB  . ARG C 1 195 ? 6.159   -12.825 39.558   1.00 10.00 ? ? ? ? ? ? 196 ARG C CB  1 
ATOM 7342  C CG  . ARG C 1 195 ? 6.947   -14.123 39.330   1.00 10.00 ? ? ? ? ? ? 196 ARG C CG  1 
ATOM 7343  C CD  . ARG C 1 195 ? 6.594   -15.324 40.183   1.00 10.00 ? ? ? ? ? ? 196 ARG C CD  1 
ATOM 7344  N NE  . ARG C 1 195 ? 6.166   -16.493 39.432   1.00 10.00 ? ? ? ? ? ? 196 ARG C NE  1 
ATOM 7345  C CZ  . ARG C 1 195 ? 6.151   -17.741 39.968   1.00 10.00 ? ? ? ? ? ? 196 ARG C CZ  1 
ATOM 7346  N NH1 . ARG C 1 195 ? 6.507   -18.035 41.223   1.00 10.00 ? ? ? ? ? ? 196 ARG C NH1 1 
ATOM 7347  N NH2 . ARG C 1 195 ? 5.854   -18.798 39.210   1.00 10.00 ? ? ? ? ? ? 196 ARG C NH2 1 
ATOM 7348  N N   . GLY C 1 196 ? 6.334   -10.080 36.980   1.00 10.00 ? ? ? ? ? ? 197 GLY C N   1 
ATOM 7349  C CA  . GLY C 1 196 ? 5.954   -9.766  35.620   1.00 10.00 ? ? ? ? ? ? 197 GLY C CA  1 
ATOM 7350  C C   . GLY C 1 196 ? 4.609   -10.392 35.187   1.00 10.00 ? ? ? ? ? ? 197 GLY C C   1 
ATOM 7351  O O   . GLY C 1 196 ? 4.507   -11.022 34.115   1.00 10.00 ? ? ? ? ? ? 197 GLY C O   1 
ATOM 7352  N N   . TYR C 1 197 ? 3.562   -10.301 36.015   1.00 10.00 ? ? ? ? ? ? 198 TYR C N   1 
ATOM 7353  C CA  . TYR C 1 197 ? 2.241   -10.781 35.647   1.00 10.00 ? ? ? ? ? ? 198 TYR C CA  1 
ATOM 7354  C C   . TYR C 1 197 ? 1.435   -9.535  35.389   1.00 10.00 ? ? ? ? ? ? 198 TYR C C   1 
ATOM 7355  O O   . TYR C 1 197 ? 1.802   -8.400  35.722   1.00 10.00 ? ? ? ? ? ? 198 TYR C O   1 
ATOM 7356  C CB  . TYR C 1 197 ? 1.529   -11.547 36.728   1.00 10.00 ? ? ? ? ? ? 198 TYR C CB  1 
ATOM 7357  C CG  . TYR C 1 197 ? 2.002   -12.971 36.848   1.00 10.00 ? ? ? ? ? ? 198 TYR C CG  1 
ATOM 7358  C CD1 . TYR C 1 197 ? 2.107   -13.813 35.773   1.00 10.00 ? ? ? ? ? ? 198 TYR C CD1 1 
ATOM 7359  C CD2 . TYR C 1 197 ? 2.290   -13.443 38.094   1.00 10.00 ? ? ? ? ? ? 198 TYR C CD2 1 
ATOM 7360  C CE1 . TYR C 1 197 ? 2.491   -15.120 35.980   1.00 10.00 ? ? ? ? ? ? 198 TYR C CE1 1 
ATOM 7361  C CE2 . TYR C 1 197 ? 2.674   -14.742 38.319   1.00 10.00 ? ? ? ? ? ? 198 TYR C CE2 1 
ATOM 7362  C CZ  . TYR C 1 197 ? 2.764   -15.567 37.255   1.00 10.00 ? ? ? ? ? ? 198 TYR C CZ  1 
ATOM 7363  O OH  . TYR C 1 197 ? 3.096   -16.878 37.519   1.00 10.00 ? ? ? ? ? ? 198 TYR C OH  1 
ATOM 7364  N N   . SER C 1 198 ? 0.268   -9.794  34.824   1.00 10.00 ? ? ? ? ? ? 199 SER C N   1 
ATOM 7365  C CA  . SER C 1 198 ? -0.494  -8.709  34.251   1.00 10.00 ? ? ? ? ? ? 199 SER C CA  1 
ATOM 7366  C C   . SER C 1 198 ? -1.952  -8.864  34.677   1.00 10.00 ? ? ? ? ? ? 199 SER C C   1 
ATOM 7367  O O   . SER C 1 198 ? -2.651  -9.765  34.184   1.00 10.00 ? ? ? ? ? ? 199 SER C O   1 
ATOM 7368  C CB  . SER C 1 198 ? -0.244  -8.845  32.725   1.00 10.00 ? ? ? ? ? ? 199 SER C CB  1 
ATOM 7369  O OG  . SER C 1 198 ? 1.138   -9.094  32.354   1.00 10.00 ? ? ? ? ? ? 199 SER C OG  1 
ATOM 7370  N N   . PHE C 1 199 ? -2.441  -8.041  35.624   1.00 10.00 ? ? ? ? ? ? 200 PHE C N   1 
ATOM 7371  C CA  . PHE C 1 199 ? -3.846  -8.151  36.036   1.00 10.00 ? ? ? ? ? ? 200 PHE C CA  1 
ATOM 7372  C C   . PHE C 1 199 ? -4.561  -6.936  35.538   1.00 10.00 ? ? ? ? ? ? 200 PHE C C   1 
ATOM 7373  O O   . PHE C 1 199 ? -5.348  -6.269  36.219   1.00 10.00 ? ? ? ? ? ? 200 PHE C O   1 
ATOM 7374  C CB  . PHE C 1 199 ? -3.980  -8.272  37.576   1.00 10.00 ? ? ? ? ? ? 200 PHE C CB  1 
ATOM 7375  C CG  . PHE C 1 199 ? -3.521  -9.675  37.934   1.00 10.00 ? ? ? ? ? ? 200 PHE C CG  1 
ATOM 7376  C CD1 . PHE C 1 199 ? -4.300  -10.752 37.552   1.00 10.00 ? ? ? ? ? ? 200 PHE C CD1 1 
ATOM 7377  C CD2 . PHE C 1 199 ? -2.310  -9.834  38.558   1.00 10.00 ? ? ? ? ? ? 200 PHE C CD2 1 
ATOM 7378  C CE1 . PHE C 1 199 ? -3.843  -12.014 37.800   1.00 10.00 ? ? ? ? ? ? 200 PHE C CE1 1 
ATOM 7379  C CE2 . PHE C 1 199 ? -1.858  -11.089 38.799   1.00 10.00 ? ? ? ? ? ? 200 PHE C CE2 1 
ATOM 7380  C CZ  . PHE C 1 199 ? -2.622  -12.169 38.421   1.00 10.00 ? ? ? ? ? ? 200 PHE C CZ  1 
ATOM 7381  N N   . THR C 1 200 ? -4.350  -6.769  34.234   1.00 10.00 ? ? ? ? ? ? 201 THR C N   1 
ATOM 7382  C CA  . THR C 1 200 ? -4.746  -5.493  33.697   1.00 10.00 ? ? ? ? ? ? 201 THR C CA  1 
ATOM 7383  C C   . THR C 1 200 ? -6.230  -5.252  33.488   1.00 10.00 ? ? ? ? ? ? 201 THR C C   1 
ATOM 7384  O O   . THR C 1 200 ? -6.572  -4.066  33.489   1.00 10.00 ? ? ? ? ? ? 201 THR C O   1 
ATOM 7385  C CB  . THR C 1 200 ? -3.853  -5.225  32.362   1.00 10.00 ? ? ? ? ? ? 201 THR C CB  1 
ATOM 7386  O OG1 . THR C 1 200 ? -3.718  -6.359  31.483   1.00 10.00 ? ? ? ? ? ? 201 THR C OG1 1 
ATOM 7387  C CG2 . THR C 1 200 ? -2.460  -4.786  32.860   1.00 10.00 ? ? ? ? ? ? 201 THR C CG2 1 
ATOM 7388  N N   . THR C 1 201 ? -7.147  -6.220  33.393   1.00 10.00 ? ? ? ? ? ? 202 THR C N   1 
ATOM 7389  C CA  . THR C 1 201 ? -8.526  -5.821  33.114   1.00 10.00 ? ? ? ? ? ? 202 THR C CA  1 
ATOM 7390  C C   . THR C 1 201 ? -9.671  -6.062  34.092   1.00 10.00 ? ? ? ? ? ? 202 THR C C   1 
ATOM 7391  O O   . THR C 1 201 ? -10.236 -7.161  34.132   1.00 10.00 ? ? ? ? ? ? 202 THR C O   1 
ATOM 7392  C CB  . THR C 1 201 ? -8.862  -6.404  31.715   1.00 10.00 ? ? ? ? ? ? 202 THR C CB  1 
ATOM 7393  O OG1 . THR C 1 201 ? -7.892  -5.734  30.912   1.00 10.00 ? ? ? ? ? ? 202 THR C OG1 1 
ATOM 7394  C CG2 . THR C 1 201 ? -10.280 -6.166  31.141   1.00 10.00 ? ? ? ? ? ? 202 THR C CG2 1 
ATOM 7395  N N   . THR C 1 202 ? -10.020 -5.003  34.845   1.00 10.00 ? ? ? ? ? ? 203 THR C N   1 
ATOM 7396  C CA  . THR C 1 202 ? -11.148 -4.881  35.807   1.00 10.00 ? ? ? ? ? ? 203 THR C CA  1 
ATOM 7397  C C   . THR C 1 202 ? -11.654 -6.127  36.547   1.00 10.00 ? ? ? ? ? ? 203 THR C C   1 
ATOM 7398  O O   . THR C 1 202 ? -11.419 -6.225  37.754   1.00 10.00 ? ? ? ? ? ? 203 THR C O   1 
ATOM 7399  C CB  . THR C 1 202 ? -12.455 -4.191  35.131   1.00 10.00 ? ? ? ? ? ? 203 THR C CB  1 
ATOM 7400  O OG1 . THR C 1 202 ? -12.178 -3.601  33.841   1.00 10.00 ? ? ? ? ? ? 203 THR C OG1 1 
ATOM 7401  C CG2 . THR C 1 202 ? -12.966 -3.124  36.111   1.00 10.00 ? ? ? ? ? ? 203 THR C CG2 1 
ATOM 7402  N N   . ALA C 1 203 ? -12.292 -7.078  35.826   1.00 10.00 ? ? ? ? ? ? 204 ALA C N   1 
ATOM 7403  C CA  . ALA C 1 203 ? -12.797 -8.347  36.332   1.00 10.00 ? ? ? ? ? ? 204 ALA C CA  1 
ATOM 7404  C C   . ALA C 1 203 ? -11.551 -8.934  36.917   1.00 10.00 ? ? ? ? ? ? 204 ALA C C   1 
ATOM 7405  O O   . ALA C 1 203 ? -11.509 -9.028  38.138   1.00 10.00 ? ? ? ? ? ? 204 ALA C O   1 
ATOM 7406  C CB  . ALA C 1 203 ? -13.218 -9.361  35.286   1.00 10.00 ? ? ? ? ? ? 204 ALA C CB  1 
ATOM 7407  N N   . GLU C 1 204 ? -10.477 -9.122  36.122   1.00 10.00 ? ? ? ? ? ? 205 GLU C N   1 
ATOM 7408  C CA  . GLU C 1 204 ? -9.286  -9.751  36.653   1.00 10.00 ? ? ? ? ? ? 205 GLU C CA  1 
ATOM 7409  C C   . GLU C 1 204 ? -8.578  -9.030  37.825   1.00 10.00 ? ? ? ? ? ? 205 GLU C C   1 
ATOM 7410  O O   . GLU C 1 204 ? -7.661  -9.639  38.396   1.00 10.00 ? ? ? ? ? ? 205 GLU C O   1 
ATOM 7411  C CB  . GLU C 1 204 ? -8.328  -10.055 35.458   1.00 10.00 ? ? ? ? ? ? 205 GLU C CB  1 
ATOM 7412  C CG  . GLU C 1 204 ? -7.472  -9.030  34.756   1.00 10.00 ? ? ? ? ? ? 205 GLU C CG  1 
ATOM 7413  C CD  . GLU C 1 204 ? -6.533  -9.637  33.699   1.00 10.00 ? ? ? ? ? ? 205 GLU C CD  1 
ATOM 7414  O OE1 . GLU C 1 204 ? -5.422  -10.054 34.027   1.00 10.00 ? ? ? ? ? ? 205 GLU C OE1 1 
ATOM 7415  O OE2 . GLU C 1 204 ? -6.894  -9.709  32.531   1.00 10.00 ? ? ? ? ? ? 205 GLU C OE2 1 
ATOM 7416  N N   . ARG C 1 205 ? -9.038  -7.868  38.330   1.00 10.00 ? ? ? ? ? ? 206 ARG C N   1 
ATOM 7417  C CA  . ARG C 1 205 ? -8.542  -7.303  39.606   1.00 10.00 ? ? ? ? ? ? 206 ARG C CA  1 
ATOM 7418  C C   . ARG C 1 205 ? -9.205  -8.058  40.784   1.00 10.00 ? ? ? ? ? ? 206 ARG C C   1 
ATOM 7419  O O   . ARG C 1 205 ? -8.774  -8.159  41.942   1.00 10.00 ? ? ? ? ? ? 206 ARG C O   1 
ATOM 7420  C CB  . ARG C 1 205 ? -8.889  -5.802  39.775   1.00 10.00 ? ? ? ? ? ? 206 ARG C CB  1 
ATOM 7421  C CG  . ARG C 1 205 ? -7.878  -5.085  40.707   1.00 10.00 ? ? ? ? ? ? 206 ARG C CG  1 
ATOM 7422  C CD  . ARG C 1 205 ? -8.271  -4.579  42.133   1.00 10.00 ? ? ? ? ? ? 206 ARG C CD  1 
ATOM 7423  N NE  . ARG C 1 205 ? -8.778  -5.511  43.159   1.00 10.00 ? ? ? ? ? ? 206 ARG C NE  1 
ATOM 7424  C CZ  . ARG C 1 205 ? -8.772  -5.146  44.452   1.00 10.00 ? ? ? ? ? ? 206 ARG C CZ  1 
ATOM 7425  N NH1 . ARG C 1 205 ? -8.291  -3.966  44.841   1.00 10.00 ? ? ? ? ? ? 206 ARG C NH1 1 
ATOM 7426  N NH2 . ARG C 1 205 ? -9.370  -5.896  45.366   1.00 10.00 ? ? ? ? ? ? 206 ARG C NH2 1 
ATOM 7427  N N   . GLU C 1 206 ? -10.380 -8.535  40.462   1.00 10.00 ? ? ? ? ? ? 207 GLU C N   1 
ATOM 7428  C CA  . GLU C 1 206 ? -11.117 -9.442  41.300   1.00 10.00 ? ? ? ? ? ? 207 GLU C CA  1 
ATOM 7429  C C   . GLU C 1 206 ? -10.618 -10.859 41.059   1.00 10.00 ? ? ? ? ? ? 207 GLU C C   1 
ATOM 7430  O O   . GLU C 1 206 ? -11.058 -11.767 41.744   1.00 10.00 ? ? ? ? ? ? 207 GLU C O   1 
ATOM 7431  C CB  . GLU C 1 206 ? -12.611 -9.346  40.965   1.00 10.00 ? ? ? ? ? ? 207 GLU C CB  1 
ATOM 7432  C CG  . GLU C 1 206 ? -13.466 -8.952  42.168   1.00 10.00 ? ? ? ? ? ? 207 GLU C CG  1 
ATOM 7433  C CD  . GLU C 1 206 ? -13.220 -9.848  43.400   1.00 10.00 ? ? ? ? ? ? 207 GLU C CD  1 
ATOM 7434  O OE1 . GLU C 1 206 ? -13.794 -10.946 43.456   1.00 10.00 ? ? ? ? ? ? 207 GLU C OE1 1 
ATOM 7435  O OE2 . GLU C 1 206 ? -12.438 -9.438  44.276   1.00 10.00 ? ? ? ? ? ? 207 GLU C OE2 1 
ATOM 7436  N N   . ILE C 1 207 ? -9.682  -11.172 40.171   1.00 10.00 ? ? ? ? ? ? 208 ILE C N   1 
ATOM 7437  C CA  . ILE C 1 207 ? -9.221  -12.555 40.016   1.00 10.00 ? ? ? ? ? ? 208 ILE C CA  1 
ATOM 7438  C C   . ILE C 1 207 ? -8.071  -12.891 40.989   1.00 10.00 ? ? ? ? ? ? 208 ILE C C   1 
ATOM 7439  O O   . ILE C 1 207 ? -7.736  -14.061 41.258   1.00 10.00 ? ? ? ? ? ? 208 ILE C O   1 
ATOM 7440  C CB  . ILE C 1 207 ? -8.867  -12.729 38.500   1.00 10.00 ? ? ? ? ? ? 208 ILE C CB  1 
ATOM 7441  C CG1 . ILE C 1 207 ? -9.762  -13.870 38.051   1.00 10.00 ? ? ? ? ? ? 208 ILE C CG1 1 
ATOM 7442  C CG2 . ILE C 1 207 ? -7.386  -12.991 38.157   1.00 10.00 ? ? ? ? ? ? 208 ILE C CG2 1 
ATOM 7443  C CD1 . ILE C 1 207 ? -11.124 -13.353 37.540   1.00 10.00 ? ? ? ? ? ? 208 ILE C CD1 1 
ATOM 7444  N N   . VAL C 1 208 ? -7.458  -11.858 41.586   1.00 10.00 ? ? ? ? ? ? 209 VAL C N   1 
ATOM 7445  C CA  . VAL C 1 208 ? -6.502  -12.101 42.650   1.00 10.00 ? ? ? ? ? ? 209 VAL C CA  1 
ATOM 7446  C C   . VAL C 1 208 ? -7.261  -12.550 43.907   1.00 10.00 ? ? ? ? ? ? 209 VAL C C   1 
ATOM 7447  O O   . VAL C 1 208 ? -6.759  -13.447 44.581   1.00 10.00 ? ? ? ? ? ? 209 VAL C O   1 
ATOM 7448  C CB  . VAL C 1 208 ? -5.633  -10.835 42.922   1.00 10.00 ? ? ? ? ? ? 209 VAL C CB  1 
ATOM 7449  C CG1 . VAL C 1 208 ? -4.687  -10.693 41.717   1.00 10.00 ? ? ? ? ? ? 209 VAL C CG1 1 
ATOM 7450  C CG2 . VAL C 1 208 ? -6.450  -9.556  43.071   1.00 10.00 ? ? ? ? ? ? 209 VAL C CG2 1 
ATOM 7451  N N   . ARG C 1 209 ? -8.495  -12.066 44.173   1.00 10.00 ? ? ? ? ? ? 210 ARG C N   1 
ATOM 7452  C CA  . ARG C 1 209 ? -9.348  -12.454 45.302   1.00 10.00 ? ? ? ? ? ? 210 ARG C CA  1 
ATOM 7453  C C   . ARG C 1 209 ? -9.493  -13.948 45.294   1.00 10.00 ? ? ? ? ? ? 210 ARG C C   1 
ATOM 7454  O O   . ARG C 1 209 ? -9.371  -14.556 46.326   1.00 10.00 ? ? ? ? ? ? 210 ARG C O   1 
ATOM 7455  C CB  . ARG C 1 209 ? -10.761 -11.842 45.187   1.00 10.00 ? ? ? ? ? ? 210 ARG C CB  1 
ATOM 7456  C CG  . ARG C 1 209 ? -11.660 -11.761 46.446   1.00 10.00 ? ? ? ? ? ? 210 ARG C CG  1 
ATOM 7457  C CD  . ARG C 1 209 ? -13.213 -12.047 46.324   1.00 10.00 ? ? ? ? ? ? 210 ARG C CD  1 
ATOM 7458  N NE  . ARG C 1 209 ? -13.518 -13.356 45.710   1.00 10.00 ? ? ? ? ? ? 210 ARG C NE  1 
ATOM 7459  C CZ  . ARG C 1 209 ? -14.448 -14.266 46.093   1.00 10.00 ? ? ? ? ? ? 210 ARG C CZ  1 
ATOM 7460  N NH1 . ARG C 1 209 ? -15.286 -14.132 47.134   1.00 10.00 ? ? ? ? ? ? 210 ARG C NH1 1 
ATOM 7461  N NH2 . ARG C 1 209 ? -14.507 -15.427 45.436   1.00 10.00 ? ? ? ? ? ? 210 ARG C NH2 1 
ATOM 7462  N N   . ASP C 1 210 ? -9.735  -14.616 44.177   1.00 10.00 ? ? ? ? ? ? 211 ASP C N   1 
ATOM 7463  C CA  . ASP C 1 210 ? -9.858  -16.083 44.154   1.00 10.00 ? ? ? ? ? ? 211 ASP C CA  1 
ATOM 7464  C C   . ASP C 1 210 ? -8.518  -16.800 44.287   1.00 10.00 ? ? ? ? ? ? 211 ASP C C   1 
ATOM 7465  O O   . ASP C 1 210 ? -8.512  -17.896 44.836   1.00 10.00 ? ? ? ? ? ? 211 ASP C O   1 
ATOM 7466  C CB  . ASP C 1 210 ? -10.433 -16.678 42.864   1.00 10.00 ? ? ? ? ? ? 211 ASP C CB  1 
ATOM 7467  C CG  . ASP C 1 210 ? -11.791 -16.153 42.506   1.00 10.00 ? ? ? ? ? ? 211 ASP C CG  1 
ATOM 7468  O OD1 . ASP C 1 210 ? -11.892 -15.024 41.959   1.00 10.00 ? ? ? ? ? ? 211 ASP C OD1 1 
ATOM 7469  O OD2 . ASP C 1 210 ? -12.730 -16.895 42.800   1.00 10.00 ? ? ? ? ? ? 211 ASP C OD2 1 
ATOM 7470  N N   . ILE C 1 211 ? -7.377  -16.309 43.781   1.00 10.00 ? ? ? ? ? ? 212 ILE C N   1 
ATOM 7471  C CA  . ILE C 1 211 ? -6.102  -17.005 44.009   1.00 10.00 ? ? ? ? ? ? 212 ILE C CA  1 
ATOM 7472  C C   . ILE C 1 211 ? -5.844  -16.975 45.544   1.00 10.00 ? ? ? ? ? ? 212 ILE C C   1 
ATOM 7473  O O   . ILE C 1 211 ? -5.626  -17.998 46.209   1.00 10.00 ? ? ? ? ? ? 212 ILE C O   1 
ATOM 7474  C CB  . ILE C 1 211 ? -4.979  -16.264 43.193   1.00 10.00 ? ? ? ? ? ? 212 ILE C CB  1 
ATOM 7475  C CG1 . ILE C 1 211 ? -5.267  -16.287 41.709   1.00 10.00 ? ? ? ? ? ? 212 ILE C CG1 1 
ATOM 7476  C CG2 . ILE C 1 211 ? -3.662  -16.950 43.398   1.00 10.00 ? ? ? ? ? ? 212 ILE C CG2 1 
ATOM 7477  C CD1 . ILE C 1 211 ? -4.669  -15.071 41.025   1.00 10.00 ? ? ? ? ? ? 212 ILE C CD1 1 
ATOM 7478  N N   . LYS C 1 212 ? -6.034  -15.794 46.143   1.00 10.00 ? ? ? ? ? ? 213 LYS C N   1 
ATOM 7479  C CA  . LYS C 1 212 ? -5.800  -15.495 47.528   1.00 10.00 ? ? ? ? ? ? 213 LYS C CA  1 
ATOM 7480  C C   . LYS C 1 212 ? -6.618  -16.440 48.311   1.00 10.00 ? ? ? ? ? ? 213 LYS C C   1 
ATOM 7481  O O   . LYS C 1 212 ? -6.071  -17.149 49.147   1.00 10.00 ? ? ? ? ? ? 213 LYS C O   1 
ATOM 7482  C CB  . LYS C 1 212 ? -6.247  -14.107 47.874   1.00 10.00 ? ? ? ? ? ? 213 LYS C CB  1 
ATOM 7483  C CG  . LYS C 1 212 ? -5.751  -13.649 49.205   1.00 10.00 ? ? ? ? ? ? 213 LYS C CG  1 
ATOM 7484  C CD  . LYS C 1 212 ? -6.443  -12.410 49.636   1.00 10.00 ? ? ? ? ? ? 213 LYS C CD  1 
ATOM 7485  C CE  . LYS C 1 212 ? -7.794  -12.844 50.113   1.00 10.00 ? ? ? ? ? ? 213 LYS C CE  1 
ATOM 7486  N NZ  . LYS C 1 212 ? -8.675  -11.705 50.190   1.00 10.00 ? ? ? ? ? ? 213 LYS C NZ  1 
ATOM 7487  N N   . GLU C 1 213 ? -7.892  -16.514 47.997   1.00 10.00 ? ? ? ? ? ? 214 GLU C N   1 
ATOM 7488  C CA  . GLU C 1 213 ? -8.683  -17.352 48.840   1.00 10.00 ? ? ? ? ? ? 214 GLU C CA  1 
ATOM 7489  C C   . GLU C 1 213 ? -8.427  -18.776 48.449   1.00 10.00 ? ? ? ? ? ? 214 GLU C C   1 
ATOM 7490  O O   . GLU C 1 213 ? -8.555  -19.612 49.342   1.00 10.00 ? ? ? ? ? ? 214 GLU C O   1 
ATOM 7491  C CB  . GLU C 1 213 ? -10.175 -17.066 48.710   1.00 10.00 ? ? ? ? ? ? 214 GLU C CB  1 
ATOM 7492  C CG  . GLU C 1 213 ? -10.596 -15.643 49.103   1.00 10.00 ? ? ? ? ? ? 214 GLU C CG  1 
ATOM 7493  C CD  . GLU C 1 213 ? -12.019 -15.298 48.661   1.00 10.00 ? ? ? ? ? ? 214 GLU C CD  1 
ATOM 7494  O OE1 . GLU C 1 213 ? -12.715 -16.154 48.121   1.00 10.00 ? ? ? ? ? ? 214 GLU C OE1 1 
ATOM 7495  O OE2 . GLU C 1 213 ? -12.437 -14.162 48.861   1.00 10.00 ? ? ? ? ? ? 214 GLU C OE2 1 
ATOM 7496  N N   . LYS C 1 214 ? -8.036  -19.123 47.210   1.00 10.00 ? ? ? ? ? ? 215 LYS C N   1 
ATOM 7497  C CA  . LYS C 1 214 ? -7.926  -20.531 46.889   1.00 10.00 ? ? ? ? ? ? 215 LYS C CA  1 
ATOM 7498  C C   . LYS C 1 214 ? -6.627  -21.205 47.159   1.00 10.00 ? ? ? ? ? ? 215 LYS C C   1 
ATOM 7499  O O   . LYS C 1 214 ? -6.614  -22.400 47.404   1.00 10.00 ? ? ? ? ? ? 215 LYS C O   1 
ATOM 7500  C CB  . LYS C 1 214 ? -8.233  -20.827 45.437   1.00 10.00 ? ? ? ? ? ? 215 LYS C CB  1 
ATOM 7501  C CG  . LYS C 1 214 ? -9.702  -21.209 45.212   1.00 10.00 ? ? ? ? ? ? 215 LYS C CG  1 
ATOM 7502  C CD  . LYS C 1 214 ? -10.625 -20.012 44.972   1.00 10.00 ? ? ? ? ? ? 215 LYS C CD  1 
ATOM 7503  C CE  . LYS C 1 214 ? -11.774 -20.436 44.051   1.00 10.00 ? ? ? ? ? ? 215 LYS C CE  1 
ATOM 7504  N NZ  . LYS C 1 214 ? -12.600 -19.300 43.690   1.00 10.00 ? ? ? ? ? ? 215 LYS C NZ  1 
ATOM 7505  N N   . LEU C 1 215 ? -5.515  -20.497 47.138   1.00 10.00 ? ? ? ? ? ? 216 LEU C N   1 
ATOM 7506  C CA  . LEU C 1 215 ? -4.208  -21.129 47.233   1.00 10.00 ? ? ? ? ? ? 216 LEU C CA  1 
ATOM 7507  C C   . LEU C 1 215 ? -3.467  -20.654 48.461   1.00 10.00 ? ? ? ? ? ? 216 LEU C C   1 
ATOM 7508  O O   . LEU C 1 215 ? -2.545  -21.375 48.862   1.00 10.00 ? ? ? ? ? ? 216 LEU C O   1 
ATOM 7509  C CB  . LEU C 1 215 ? -3.368  -20.817 45.948   1.00 10.00 ? ? ? ? ? ? 216 LEU C CB  1 
ATOM 7510  C CG  . LEU C 1 215 ? -4.093  -21.160 44.620   1.00 10.00 ? ? ? ? ? ? 216 LEU C CG  1 
ATOM 7511  C CD1 . LEU C 1 215 ? -3.469  -20.349 43.543   1.00 10.00 ? ? ? ? ? ? 216 LEU C CD1 1 
ATOM 7512  C CD2 . LEU C 1 215 ? -4.107  -22.667 44.340   1.00 10.00 ? ? ? ? ? ? 216 LEU C CD2 1 
ATOM 7513  N N   . CYS C 1 216 ? -3.770  -19.484 49.085   1.00 10.00 ? ? ? ? ? ? 217 CYS C N   1 
ATOM 7514  C CA  . CYS C 1 216 ? -3.008  -19.092 50.258   1.00 10.00 ? ? ? ? ? ? 217 CYS C CA  1 
ATOM 7515  C C   . CYS C 1 216 ? -3.175  -20.000 51.452   1.00 10.00 ? ? ? ? ? ? 217 CYS C C   1 
ATOM 7516  O O   . CYS C 1 216 ? -4.091  -20.805 51.527   1.00 10.00 ? ? ? ? ? ? 217 CYS C O   1 
ATOM 7517  C CB  . CYS C 1 216 ? -3.335  -17.701 50.626   1.00 10.00 ? ? ? ? ? ? 217 CYS C CB  1 
ATOM 7518  S SG  . CYS C 1 216 ? -2.483  -16.816 49.304   1.00 10.00 ? ? ? ? ? ? 217 CYS C SG  1 
ATOM 7519  N N   . TYR C 1 217 ? -2.108  -19.899 52.236   1.00 10.00 ? ? ? ? ? ? 218 TYR C N   1 
ATOM 7520  C CA  . TYR C 1 217 ? -1.726  -20.760 53.326   1.00 10.00 ? ? ? ? ? ? 218 TYR C CA  1 
ATOM 7521  C C   . TYR C 1 217 ? -0.951  -19.857 54.293   1.00 10.00 ? ? ? ? ? ? 218 TYR C C   1 
ATOM 7522  O O   . TYR C 1 217 ? -0.301  -18.873 53.898   1.00 10.00 ? ? ? ? ? ? 218 TYR C O   1 
ATOM 7523  C CB  . TYR C 1 217 ? -0.725  -21.870 52.880   1.00 10.00 ? ? ? ? ? ? 218 TYR C CB  1 
ATOM 7524  C CG  . TYR C 1 217 ? -1.191  -23.162 52.254   1.00 10.00 ? ? ? ? ? ? 218 TYR C CG  1 
ATOM 7525  C CD1 . TYR C 1 217 ? -2.225  -23.260 51.333   1.00 10.00 ? ? ? ? ? ? 218 TYR C CD1 1 
ATOM 7526  C CD2 . TYR C 1 217 ? -0.593  -24.322 52.701   1.00 10.00 ? ? ? ? ? ? 218 TYR C CD2 1 
ATOM 7527  C CE1 . TYR C 1 217 ? -2.672  -24.504 50.867   1.00 10.00 ? ? ? ? ? ? 218 TYR C CE1 1 
ATOM 7528  C CE2 . TYR C 1 217 ? -1.027  -25.567 52.242   1.00 10.00 ? ? ? ? ? ? 218 TYR C CE2 1 
ATOM 7529  C CZ  . TYR C 1 217 ? -2.069  -25.671 51.329   1.00 10.00 ? ? ? ? ? ? 218 TYR C CZ  1 
ATOM 7530  O OH  . TYR C 1 217 ? -2.477  -26.944 50.888   1.00 10.00 ? ? ? ? ? ? 218 TYR C OH  1 
ATOM 7531  N N   . VAL C 1 218 ? -0.972  -20.264 55.563   1.00 10.00 ? ? ? ? ? ? 219 VAL C N   1 
ATOM 7532  C CA  . VAL C 1 218 ? -0.189  -19.660 56.609   1.00 10.00 ? ? ? ? ? ? 219 VAL C CA  1 
ATOM 7533  C C   . VAL C 1 218 ? 0.821   -20.750 56.952   1.00 10.00 ? ? ? ? ? ? 219 VAL C C   1 
ATOM 7534  O O   . VAL C 1 218 ? 0.518   -21.934 57.113   1.00 10.00 ? ? ? ? ? ? 219 VAL C O   1 
ATOM 7535  C CB  . VAL C 1 218 ? -1.041  -19.333 57.850   1.00 10.00 ? ? ? ? ? ? 219 VAL C CB  1 
ATOM 7536  C CG1 . VAL C 1 218 ? -0.143  -18.686 58.897   1.00 10.00 ? ? ? ? ? ? 219 VAL C CG1 1 
ATOM 7537  C CG2 . VAL C 1 218 ? -2.159  -18.375 57.503   1.00 10.00 ? ? ? ? ? ? 219 VAL C CG2 1 
ATOM 7538  N N   . ALA C 1 219 ? 2.065   -20.284 56.990   1.00 10.00 ? ? ? ? ? ? 220 ALA C N   1 
ATOM 7539  C CA  . ALA C 1 219 ? 3.254   -21.063 57.280   1.00 10.00 ? ? ? ? ? ? 220 ALA C CA  1 
ATOM 7540  C C   . ALA C 1 219 ? 3.444   -21.131 58.773   1.00 10.00 ? ? ? ? ? ? 220 ALA C C   1 
ATOM 7541  O O   . ALA C 1 219 ? 3.134   -20.121 59.393   1.00 10.00 ? ? ? ? ? ? 220 ALA C O   1 
ATOM 7542  C CB  . ALA C 1 219 ? 4.521   -20.417 56.696   1.00 10.00 ? ? ? ? ? ? 220 ALA C CB  1 
ATOM 7543  N N   . LEU C 1 220 ? 3.972   -22.245 59.331   1.00 10.00 ? ? ? ? ? ? 221 LEU C N   1 
ATOM 7544  C CA  . LEU C 1 220 ? 4.264   -22.425 60.761   1.00 10.00 ? ? ? ? ? ? 221 LEU C CA  1 
ATOM 7545  C C   . LEU C 1 220 ? 5.555   -21.740 61.061   1.00 10.00 ? ? ? ? ? ? 221 LEU C C   1 
ATOM 7546  O O   . LEU C 1 220 ? 5.738   -21.043 62.051   1.00 10.00 ? ? ? ? ? ? 221 LEU C O   1 
ATOM 7547  C CB  . LEU C 1 220 ? 4.445   -23.877 61.175   1.00 10.00 ? ? ? ? ? ? 221 LEU C CB  1 
ATOM 7548  C CG  . LEU C 1 220 ? 3.412   -24.566 62.072   1.00 10.00 ? ? ? ? ? ? 221 LEU C CG  1 
ATOM 7549  C CD1 . LEU C 1 220 ? 4.084   -25.793 62.629   1.00 10.00 ? ? ? ? ? ? 221 LEU C CD1 1 
ATOM 7550  C CD2 . LEU C 1 220 ? 2.980   -23.705 63.275   1.00 10.00 ? ? ? ? ? ? 221 LEU C CD2 1 
ATOM 7551  N N   . ASP C 1 221 ? 6.496   -21.973 60.183   1.00 10.00 ? ? ? ? ? ? 222 ASP C N   1 
ATOM 7552  C CA  . ASP C 1 221 ? 7.725   -21.268 60.350   1.00 10.00 ? ? ? ? ? ? 222 ASP C CA  1 
ATOM 7553  C C   . ASP C 1 221 ? 7.994   -20.609 59.007   1.00 10.00 ? ? ? ? ? ? 222 ASP C C   1 
ATOM 7554  O O   . ASP C 1 221 ? 8.554   -21.288 58.131   1.00 10.00 ? ? ? ? ? ? 222 ASP C O   1 
ATOM 7555  C CB  . ASP C 1 221 ? 8.837   -22.255 60.750   1.00 10.00 ? ? ? ? ? ? 222 ASP C CB  1 
ATOM 7556  C CG  . ASP C 1 221 ? 9.891   -21.558 61.615   1.00 10.00 ? ? ? ? ? ? 222 ASP C CG  1 
ATOM 7557  O OD1 . ASP C 1 221 ? 10.452  -20.534 61.199   1.00 10.00 ? ? ? ? ? ? 222 ASP C OD1 1 
ATOM 7558  O OD2 . ASP C 1 221 ? 10.120  -22.026 62.746   1.00 10.00 ? ? ? ? ? ? 222 ASP C OD2 1 
ATOM 7559  N N   . PHE C 1 222 ? 7.597   -19.323 58.819   1.00 10.00 ? ? ? ? ? ? 223 PHE C N   1 
ATOM 7560  C CA  . PHE C 1 222 ? 7.868   -18.628 57.555   1.00 10.00 ? ? ? ? ? ? 223 PHE C CA  1 
ATOM 7561  C C   . PHE C 1 222 ? 9.259   -18.956 56.999   1.00 10.00 ? ? ? ? ? ? 223 PHE C C   1 
ATOM 7562  O O   . PHE C 1 222 ? 9.366   -19.477 55.895   1.00 10.00 ? ? ? ? ? ? 223 PHE C O   1 
ATOM 7563  C CB  . PHE C 1 222 ? 7.787   -17.129 57.734   1.00 10.00 ? ? ? ? ? ? 223 PHE C CB  1 
ATOM 7564  C CG  . PHE C 1 222 ? 7.804   -16.311 56.458   1.00 10.00 ? ? ? ? ? ? 223 PHE C CG  1 
ATOM 7565  C CD1 . PHE C 1 222 ? 6.920   -16.584 55.431   1.00 10.00 ? ? ? ? ? ? 223 PHE C CD1 1 
ATOM 7566  C CD2 . PHE C 1 222 ? 8.746   -15.321 56.308   1.00 10.00 ? ? ? ? ? ? 223 PHE C CD2 1 
ATOM 7567  C CE1 . PHE C 1 222 ? 6.974   -15.882 54.239   1.00 10.00 ? ? ? ? ? ? 223 PHE C CE1 1 
ATOM 7568  C CE2 . PHE C 1 222 ? 8.804   -14.622 55.111   1.00 10.00 ? ? ? ? ? ? 223 PHE C CE2 1 
ATOM 7569  C CZ  . PHE C 1 222 ? 7.920   -14.901 54.071   1.00 10.00 ? ? ? ? ? ? 223 PHE C CZ  1 
ATOM 7570  N N   . GLU C 1 223 ? 10.288  -18.809 57.850   1.00 10.00 ? ? ? ? ? ? 224 GLU C N   1 
ATOM 7571  C CA  . GLU C 1 223 ? 11.709  -19.061 57.561   1.00 10.00 ? ? ? ? ? ? 224 GLU C CA  1 
ATOM 7572  C C   . GLU C 1 223 ? 11.969  -20.466 57.024   1.00 10.00 ? ? ? ? ? ? 224 GLU C C   1 
ATOM 7573  O O   . GLU C 1 223 ? 12.299  -20.570 55.837   1.00 10.00 ? ? ? ? ? ? 224 GLU C O   1 
ATOM 7574  C CB  . GLU C 1 223 ? 12.417  -18.728 58.865   1.00 10.00 ? ? ? ? ? ? 224 GLU C CB  1 
ATOM 7575  C CG  . GLU C 1 223 ? 13.735  -19.314 59.352   1.00 10.00 ? ? ? ? ? ? 224 GLU C CG  1 
ATOM 7576  C CD  . GLU C 1 223 ? 14.030  -18.898 60.823   1.00 10.00 ? ? ? ? ? ? 224 GLU C CD  1 
ATOM 7577  O OE1 . GLU C 1 223 ? 13.163  -19.096 61.692   1.00 10.00 ? ? ? ? ? ? 224 GLU C OE1 1 
ATOM 7578  O OE2 . GLU C 1 223 ? 15.112  -18.362 61.118   1.00 10.00 ? ? ? ? ? ? 224 GLU C OE2 1 
ATOM 7579  N N   . GLN C 1 224 ? 11.712  -21.557 57.741   1.00 10.00 ? ? ? ? ? ? 225 GLN C N   1 
ATOM 7580  C CA  . GLN C 1 224 ? 11.907  -22.834 57.137   1.00 10.00 ? ? ? ? ? ? 225 GLN C CA  1 
ATOM 7581  C C   . GLN C 1 224 ? 10.860  -23.044 56.064   1.00 10.00 ? ? ? ? ? ? 225 GLN C C   1 
ATOM 7582  O O   . GLN C 1 224 ? 10.967  -23.982 55.267   1.00 10.00 ? ? ? ? ? ? 225 GLN C O   1 
ATOM 7583  C CB  . GLN C 1 224 ? 11.810  -23.900 58.173   1.00 10.00 ? ? ? ? ? ? 225 GLN C CB  1 
ATOM 7584  C CG  . GLN C 1 224 ? 12.779  -25.094 57.926   1.00 10.00 ? ? ? ? ? ? 225 GLN C CG  1 
ATOM 7585  C CD  . GLN C 1 224 ? 12.181  -26.384 57.351   1.00 10.00 ? ? ? ? ? ? 225 GLN C CD  1 
ATOM 7586  O OE1 . GLN C 1 224 ? 10.981  -26.435 57.052   1.00 10.00 ? ? ? ? ? ? 225 GLN C OE1 1 
ATOM 7587  N NE2 . GLN C 1 224 ? 12.942  -27.478 57.205   1.00 10.00 ? ? ? ? ? ? 225 GLN C NE2 1 
ATOM 7588  N N   . GLU C 1 225 ? 9.829   -22.223 55.891   1.00 10.00 ? ? ? ? ? ? 226 GLU C N   1 
ATOM 7589  C CA  . GLU C 1 225 ? 8.896   -22.430 54.803   1.00 10.00 ? ? ? ? ? ? 226 GLU C CA  1 
ATOM 7590  C C   . GLU C 1 225 ? 9.422   -21.810 53.538   1.00 10.00 ? ? ? ? ? ? 226 GLU C C   1 
ATOM 7591  O O   . GLU C 1 225 ? 9.144   -22.299 52.452   1.00 10.00 ? ? ? ? ? ? 226 GLU C O   1 
ATOM 7592  C CB  . GLU C 1 225 ? 7.611   -21.803 55.085   1.00 10.00 ? ? ? ? ? ? 226 GLU C CB  1 
ATOM 7593  C CG  . GLU C 1 225 ? 6.558   -22.269 54.148   1.00 10.00 ? ? ? ? ? ? 226 GLU C CG  1 
ATOM 7594  C CD  . GLU C 1 225 ? 6.071   -23.665 54.418   1.00 10.00 ? ? ? ? ? ? 226 GLU C CD  1 
ATOM 7595  O OE1 . GLU C 1 225 ? 6.032   -24.063 55.579   1.00 10.00 ? ? ? ? ? ? 226 GLU C OE1 1 
ATOM 7596  O OE2 . GLU C 1 225 ? 5.696   -24.363 53.473   1.00 10.00 ? ? ? ? ? ? 226 GLU C OE2 1 
ATOM 7597  N N   . MET C 1 226 ? 10.201  -20.751 53.613   1.00 10.00 ? ? ? ? ? ? 227 MET C N   1 
ATOM 7598  C CA  . MET C 1 226 ? 10.695  -20.143 52.396   1.00 10.00 ? ? ? ? ? ? 227 MET C CA  1 
ATOM 7599  C C   . MET C 1 226 ? 11.707  -21.055 51.692   1.00 10.00 ? ? ? ? ? ? 227 MET C C   1 
ATOM 7600  O O   . MET C 1 226 ? 11.747  -21.177 50.455   1.00 10.00 ? ? ? ? ? ? 227 MET C O   1 
ATOM 7601  C CB  . MET C 1 226 ? 11.302  -18.793 52.739   1.00 10.00 ? ? ? ? ? ? 227 MET C CB  1 
ATOM 7602  C CG  . MET C 1 226 ? 10.314  -17.642 52.892   1.00 10.00 ? ? ? ? ? ? 227 MET C CG  1 
ATOM 7603  S SD  . MET C 1 226 ? 9.387   -17.149 51.398   1.00 10.00 ? ? ? ? ? ? 227 MET C SD  1 
ATOM 7604  C CE  . MET C 1 226 ? 10.718  -16.820 50.274   1.00 10.00 ? ? ? ? ? ? 227 MET C CE  1 
ATOM 7605  N N   . ALA C 1 227 ? 12.540  -21.792 52.423   1.00 10.00 ? ? ? ? ? ? 228 ALA C N   1 
ATOM 7606  C CA  . ALA C 1 227 ? 13.459  -22.758 51.820   1.00 10.00 ? ? ? ? ? ? 228 ALA C CA  1 
ATOM 7607  C C   . ALA C 1 227 ? 12.781  -24.089 51.537   1.00 10.00 ? ? ? ? ? ? 228 ALA C C   1 
ATOM 7608  O O   . ALA C 1 227 ? 13.377  -24.997 50.957   1.00 10.00 ? ? ? ? ? ? 228 ALA C O   1 
ATOM 7609  C CB  . ALA C 1 227 ? 14.614  -23.029 52.729   1.00 10.00 ? ? ? ? ? ? 228 ALA C CB  1 
ATOM 7610  N N   . THR C 1 228 ? 11.534  -24.171 51.980   1.00 10.00 ? ? ? ? ? ? 229 THR C N   1 
ATOM 7611  C CA  . THR C 1 228 ? 10.617  -25.217 51.590   1.00 10.00 ? ? ? ? ? ? 229 THR C CA  1 
ATOM 7612  C C   . THR C 1 228 ? 9.555   -24.546 50.666   1.00 10.00 ? ? ? ? ? ? 229 THR C C   1 
ATOM 7613  O O   . THR C 1 228 ? 8.323   -24.611 50.824   1.00 10.00 ? ? ? ? ? ? 229 THR C O   1 
ATOM 7614  C CB  . THR C 1 228 ? 9.996   -25.819 52.851   1.00 10.00 ? ? ? ? ? ? 229 THR C CB  1 
ATOM 7615  O OG1 . THR C 1 228 ? 11.088  -26.233 53.656   1.00 10.00 ? ? ? ? ? ? 229 THR C OG1 1 
ATOM 7616  C CG2 . THR C 1 228 ? 9.077   -27.023 52.556   1.00 10.00 ? ? ? ? ? ? 229 THR C CG2 1 
ATOM 7617  N N   . ALA C 1 229 ? 10.157  -23.726 49.783   1.00 10.00 ? ? ? ? ? ? 230 ALA C N   1 
ATOM 7618  C CA  . ALA C 1 229 ? 9.588   -23.148 48.586   1.00 10.00 ? ? ? ? ? ? 230 ALA C CA  1 
ATOM 7619  C C   . ALA C 1 229 ? 10.846  -23.441 47.749   1.00 10.00 ? ? ? ? ? ? 230 ALA C C   1 
ATOM 7620  O O   . ALA C 1 229 ? 10.706  -24.177 46.778   1.00 10.00 ? ? ? ? ? ? 230 ALA C O   1 
ATOM 7621  C CB  . ALA C 1 229 ? 9.415   -21.638 48.596   1.00 10.00 ? ? ? ? ? ? 230 ALA C CB  1 
ATOM 7622  N N   . ALA C 1 230 ? 12.101  -23.007 48.049   1.00 10.00 ? ? ? ? ? ? 231 ALA C N   1 
ATOM 7623  C CA  . ALA C 1 230 ? 13.256  -23.360 47.206   1.00 10.00 ? ? ? ? ? ? 231 ALA C CA  1 
ATOM 7624  C C   . ALA C 1 230 ? 13.438  -24.870 47.025   1.00 10.00 ? ? ? ? ? ? 231 ALA C C   1 
ATOM 7625  O O   . ALA C 1 230 ? 14.007  -25.245 46.013   1.00 10.00 ? ? ? ? ? ? 231 ALA C O   1 
ATOM 7626  C CB  . ALA C 1 230 ? 14.560  -22.814 47.781   1.00 10.00 ? ? ? ? ? ? 231 ALA C CB  1 
ATOM 7627  N N   . SER C 1 231 ? 12.984  -25.787 47.911   1.00 10.00 ? ? ? ? ? ? 232 SER C N   1 
ATOM 7628  C CA  . SER C 1 231 ? 12.993  -27.228 47.663   1.00 10.00 ? ? ? ? ? ? 232 SER C CA  1 
ATOM 7629  C C   . SER C 1 231 ? 11.639  -27.571 47.020   1.00 10.00 ? ? ? ? ? ? 232 SER C C   1 
ATOM 7630  O O   . SER C 1 231 ? 10.888  -28.452 47.444   1.00 10.00 ? ? ? ? ? ? 232 SER C O   1 
ATOM 7631  C CB  . SER C 1 231 ? 13.126  -27.905 48.981   1.00 10.00 ? ? ? ? ? ? 232 SER C CB  1 
ATOM 7632  O OG  . SER C 1 231 ? 11.987  -27.494 49.749   1.00 10.00 ? ? ? ? ? ? 232 SER C OG  1 
ATOM 7633  N N   . SER C 1 232 ? 11.351  -26.831 45.970   1.00 10.00 ? ? ? ? ? ? 233 SER C N   1 
ATOM 7634  C CA  . SER C 1 232 ? 10.080  -26.787 45.326   1.00 10.00 ? ? ? ? ? ? 233 SER C CA  1 
ATOM 7635  C C   . SER C 1 232 ? 9.360   -28.098 45.113   1.00 10.00 ? ? ? ? ? ? 233 SER C C   1 
ATOM 7636  O O   . SER C 1 232 ? 8.821   -28.641 46.076   1.00 10.00 ? ? ? ? ? ? 233 SER C O   1 
ATOM 7637  C CB  . SER C 1 232 ? 10.334  -25.989 44.028   1.00 10.00 ? ? ? ? ? ? 233 SER C CB  1 
ATOM 7638  O OG  . SER C 1 232 ? 10.947  -24.729 44.324   1.00 10.00 ? ? ? ? ? ? 233 SER C OG  1 
ATOM 7639  N N   . SER C 1 233 ? 9.401   -28.669 43.912   1.00 10.00 ? ? ? ? ? ? 234 SER C N   1 
ATOM 7640  C CA  . SER C 1 233 ? 8.557   -29.776 43.480   1.00 10.00 ? ? ? ? ? ? 234 SER C CA  1 
ATOM 7641  C C   . SER C 1 233 ? 7.063   -29.401 43.728   1.00 10.00 ? ? ? ? ? ? 234 SER C C   1 
ATOM 7642  O O   . SER C 1 233 ? 6.430   -28.740 42.879   1.00 10.00 ? ? ? ? ? ? 234 SER C O   1 
ATOM 7643  C CB  . SER C 1 233 ? 8.972   -31.099 44.224   1.00 10.00 ? ? ? ? ? ? 234 SER C CB  1 
ATOM 7644  O OG  . SER C 1 233 ? 10.181  -30.973 44.958   1.00 10.00 ? ? ? ? ? ? 234 SER C OG  1 
ATOM 7645  N N   . SER C 1 234 ? 6.554   -29.617 44.952   1.00 10.00 ? ? ? ? ? ? 235 SER C N   1 
ATOM 7646  C CA  . SER C 1 234 ? 5.150   -29.517 45.302   1.00 10.00 ? ? ? ? ? ? 235 SER C CA  1 
ATOM 7647  C C   . SER C 1 234 ? 4.510   -28.169 45.677   1.00 10.00 ? ? ? ? ? ? 235 SER C C   1 
ATOM 7648  O O   . SER C 1 234 ? 3.303   -28.095 45.938   1.00 10.00 ? ? ? ? ? ? 235 SER C O   1 
ATOM 7649  C CB  . SER C 1 234 ? 5.028   -30.577 46.393   1.00 10.00 ? ? ? ? ? ? 235 SER C CB  1 
ATOM 7650  O OG  . SER C 1 234 ? 5.804   -31.775 46.111   1.00 10.00 ? ? ? ? ? ? 235 SER C OG  1 
ATOM 7651  N N   . LEU C 1 235 ? 5.243   -27.058 45.706   1.00 10.00 ? ? ? ? ? ? 236 LEU C N   1 
ATOM 7652  C CA  . LEU C 1 235 ? 4.654   -25.793 46.158   1.00 10.00 ? ? ? ? ? ? 236 LEU C CA  1 
ATOM 7653  C C   . LEU C 1 235 ? 4.011   -24.933 45.058   1.00 10.00 ? ? ? ? ? ? 236 LEU C C   1 
ATOM 7654  O O   . LEU C 1 235 ? 3.099   -24.137 45.350   1.00 10.00 ? ? ? ? ? ? 236 LEU C O   1 
ATOM 7655  C CB  . LEU C 1 235 ? 5.707   -24.919 46.871   1.00 10.00 ? ? ? ? ? ? 236 LEU C CB  1 
ATOM 7656  C CG  . LEU C 1 235 ? 6.466   -25.343 48.172   1.00 10.00 ? ? ? ? ? ? 236 LEU C CG  1 
ATOM 7657  C CD1 . LEU C 1 235 ? 5.451   -25.314 49.315   1.00 10.00 ? ? ? ? ? ? 236 LEU C CD1 1 
ATOM 7658  C CD2 . LEU C 1 235 ? 7.200   -26.713 48.010   1.00 10.00 ? ? ? ? ? ? 236 LEU C CD2 1 
ATOM 7659  N N   . GLU C 1 236 ? 4.455   -25.009 43.787   1.00 10.00 ? ? ? ? ? ? 237 GLU C N   1 
ATOM 7660  C CA  . GLU C 1 236 ? 3.860   -24.105 42.830   1.00 10.00 ? ? ? ? ? ? 237 GLU C CA  1 
ATOM 7661  C C   . GLU C 1 236 ? 2.535   -24.772 42.441   1.00 10.00 ? ? ? ? ? ? 237 GLU C C   1 
ATOM 7662  O O   . GLU C 1 236 ? 2.359   -25.995 42.292   1.00 10.00 ? ? ? ? ? ? 237 GLU C O   1 
ATOM 7663  C CB  . GLU C 1 236 ? 4.802   -23.864 41.579   1.00 10.00 ? ? ? ? ? ? 237 GLU C CB  1 
ATOM 7664  C CG  . GLU C 1 236 ? 6.299   -23.381 41.658   1.00 10.00 ? ? ? ? ? ? 237 GLU C CG  1 
ATOM 7665  C CD  . GLU C 1 236 ? 6.826   -21.922 41.868   1.00 10.00 ? ? ? ? ? ? 237 GLU C CD  1 
ATOM 7666  O OE1 . GLU C 1 236 ? 6.460   -20.949 41.172   1.00 10.00 ? ? ? ? ? ? 237 GLU C OE1 1 
ATOM 7667  O OE2 . GLU C 1 236 ? 7.715   -21.760 42.727   1.00 10.00 ? ? ? ? ? ? 237 GLU C OE2 1 
ATOM 7668  N N   . LYS C 1 237 ? 1.512   -23.936 42.416   1.00 10.00 ? ? ? ? ? ? 238 LYS C N   1 
ATOM 7669  C CA  . LYS C 1 237 ? 0.221   -24.351 41.872   1.00 10.00 ? ? ? ? ? ? 238 LYS C CA  1 
ATOM 7670  C C   . LYS C 1 237 ? -0.168  -23.356 40.774   1.00 10.00 ? ? ? ? ? ? 238 LYS C C   1 
ATOM 7671  O O   . LYS C 1 237 ? 0.318   -22.215 40.730   1.00 10.00 ? ? ? ? ? ? 238 LYS C O   1 
ATOM 7672  C CB  . LYS C 1 237 ? -0.877  -24.335 42.935   1.00 10.00 ? ? ? ? ? ? 238 LYS C CB  1 
ATOM 7673  C CG  . LYS C 1 237 ? -1.290  -25.657 43.557   1.00 10.00 ? ? ? ? ? ? 238 LYS C CG  1 
ATOM 7674  C CD  . LYS C 1 237 ? -0.229  -26.200 44.469   1.00 10.00 ? ? ? ? ? ? 238 LYS C CD  1 
ATOM 7675  C CE  . LYS C 1 237 ? -0.740  -27.489 45.108   1.00 10.00 ? ? ? ? ? ? 238 LYS C CE  1 
ATOM 7676  N NZ  . LYS C 1 237 ? 0.360   -28.223 45.715   1.00 10.00 ? ? ? ? ? ? 238 LYS C NZ  1 
ATOM 7677  N N   . SER C 1 238 ? -1.028  -23.779 39.858   1.00 10.00 ? ? ? ? ? ? 239 SER C N   1 
ATOM 7678  C CA  . SER C 1 238 ? -1.483  -22.905 38.786   1.00 10.00 ? ? ? ? ? ? 239 SER C CA  1 
ATOM 7679  C C   . SER C 1 238 ? -2.982  -22.518 38.810   1.00 10.00 ? ? ? ? ? ? 239 SER C C   1 
ATOM 7680  O O   . SER C 1 238 ? -3.932  -23.251 39.195   1.00 10.00 ? ? ? ? ? ? 239 SER C O   1 
ATOM 7681  C CB  . SER C 1 238 ? -1.131  -23.566 37.432   1.00 10.00 ? ? ? ? ? ? 239 SER C CB  1 
ATOM 7682  O OG  . SER C 1 238 ? 0.277   -23.610 37.184   1.00 10.00 ? ? ? ? ? ? 239 SER C OG  1 
ATOM 7683  N N   . TYR C 1 239 ? -3.080  -21.258 38.362   1.00 10.00 ? ? ? ? ? ? 240 TYR C N   1 
ATOM 7684  C CA  . TYR C 1 239 ? -4.349  -20.623 38.163   1.00 10.00 ? ? ? ? ? ? 240 TYR C CA  1 
ATOM 7685  C C   . TYR C 1 239 ? -4.488  -20.138 36.704   1.00 10.00 ? ? ? ? ? ? 240 TYR C C   1 
ATOM 7686  O O   . TYR C 1 239 ? -3.573  -19.652 36.015   1.00 10.00 ? ? ? ? ? ? 240 TYR C O   1 
ATOM 7687  C CB  . TYR C 1 239 ? -4.449  -19.501 39.123   1.00 10.00 ? ? ? ? ? ? 240 TYR C CB  1 
ATOM 7688  C CG  . TYR C 1 239 ? -5.910  -19.272 39.423   1.00 10.00 ? ? ? ? ? ? 240 TYR C CG  1 
ATOM 7689  C CD1 . TYR C 1 239 ? -6.653  -18.459 38.589   1.00 10.00 ? ? ? ? ? ? 240 TYR C CD1 1 
ATOM 7690  C CD2 . TYR C 1 239 ? -6.489  -19.852 40.520   1.00 10.00 ? ? ? ? ? ? 240 TYR C CD2 1 
ATOM 7691  C CE1 . TYR C 1 239 ? -7.982  -18.211 38.835   1.00 10.00 ? ? ? ? ? ? 240 TYR C CE1 1 
ATOM 7692  C CE2 . TYR C 1 239 ? -7.821  -19.598 40.771   1.00 10.00 ? ? ? ? ? ? 240 TYR C CE2 1 
ATOM 7693  C CZ  . TYR C 1 239 ? -8.551  -18.778 39.930   1.00 10.00 ? ? ? ? ? ? 240 TYR C CZ  1 
ATOM 7694  O OH  . TYR C 1 239 ? -9.864  -18.470 40.203   1.00 10.00 ? ? ? ? ? ? 240 TYR C OH  1 
ATOM 7695  N N   . GLU C 1 240 ? -5.721  -20.334 36.233   1.00 10.00 ? ? ? ? ? ? 241 GLU C N   1 
ATOM 7696  C CA  . GLU C 1 240 ? -6.116  -20.128 34.862   1.00 10.00 ? ? ? ? ? ? 241 GLU C CA  1 
ATOM 7697  C C   . GLU C 1 240 ? -6.882  -18.841 34.754   1.00 10.00 ? ? ? ? ? ? 241 GLU C C   1 
ATOM 7698  O O   . GLU C 1 240 ? -7.883  -18.650 35.437   1.00 10.00 ? ? ? ? ? ? 241 GLU C O   1 
ATOM 7699  C CB  . GLU C 1 240 ? -7.013  -21.266 34.421   1.00 10.00 ? ? ? ? ? ? 241 GLU C CB  1 
ATOM 7700  C CG  . GLU C 1 240 ? -7.213  -21.377 32.912   1.00 10.00 ? ? ? ? ? ? 241 GLU C CG  1 
ATOM 7701  C CD  . GLU C 1 240 ? -8.567  -21.927 32.474   1.00 10.00 ? ? ? ? ? ? 241 GLU C CD  1 
ATOM 7702  O OE1 . GLU C 1 240 ? -8.779  -23.145 32.631   1.00 10.00 ? ? ? ? ? ? 241 GLU C OE1 1 
ATOM 7703  O OE2 . GLU C 1 240 ? -9.373  -21.110 31.980   1.00 10.00 ? ? ? ? ? ? 241 GLU C OE2 1 
ATOM 7704  N N   . LEU C 1 241 ? -6.404  -17.968 33.908   1.00 10.00 ? ? ? ? ? ? 242 LEU C N   1 
ATOM 7705  C CA  . LEU C 1 241 ? -7.169  -16.786 33.563   1.00 10.00 ? ? ? ? ? ? 242 LEU C CA  1 
ATOM 7706  C C   . LEU C 1 241 ? -8.448  -17.134 32.749   1.00 10.00 ? ? ? ? ? ? 242 LEU C C   1 
ATOM 7707  O O   . LEU C 1 241 ? -8.512  -18.103 31.975   1.00 10.00 ? ? ? ? ? ? 242 LEU C O   1 
ATOM 7708  C CB  . LEU C 1 241 ? -6.292  -15.829 32.751   1.00 10.00 ? ? ? ? ? ? 242 LEU C CB  1 
ATOM 7709  C CG  . LEU C 1 241 ? -5.082  -15.119 33.373   1.00 10.00 ? ? ? ? ? ? 242 LEU C CG  1 
ATOM 7710  C CD1 . LEU C 1 241 ? -5.505  -14.387 34.628   1.00 10.00 ? ? ? ? ? ? 242 LEU C CD1 1 
ATOM 7711  C CD2 . LEU C 1 241 ? -3.999  -16.123 33.702   1.00 10.00 ? ? ? ? ? ? 242 LEU C CD2 1 
ATOM 7712  N N   . PRO C 1 242 ? -9.539  -16.363 32.868   1.00 10.00 ? ? ? ? ? ? 243 PRO C N   1 
ATOM 7713  C CA  . PRO C 1 242 ? -10.608 -16.262 31.858   1.00 10.00 ? ? ? ? ? ? 243 PRO C CA  1 
ATOM 7714  C C   . PRO C 1 242 ? -10.013 -16.193 30.443   1.00 10.00 ? ? ? ? ? ? 243 PRO C C   1 
ATOM 7715  O O   . PRO C 1 242 ? -10.355 -16.982 29.566   1.00 10.00 ? ? ? ? ? ? 243 PRO C O   1 
ATOM 7716  C CB  . PRO C 1 242 ? -11.386 -15.011 32.295   1.00 10.00 ? ? ? ? ? ? 243 PRO C CB  1 
ATOM 7717  C CG  . PRO C 1 242 ? -10.522 -14.402 33.409   1.00 10.00 ? ? ? ? ? ? 243 PRO C CG  1 
ATOM 7718  C CD  . PRO C 1 242 ? -9.921  -15.649 34.079   1.00 10.00 ? ? ? ? ? ? 243 PRO C CD  1 
ATOM 7719  N N   . ASP C 1 243 ? -9.053  -15.299 30.241   1.00 10.00 ? ? ? ? ? ? 244 ASP C N   1 
ATOM 7720  C CA  . ASP C 1 243 ? -8.220  -15.193 29.051   1.00 10.00 ? ? ? ? ? ? 244 ASP C CA  1 
ATOM 7721  C C   . ASP C 1 243 ? -7.649  -16.523 28.525   1.00 10.00 ? ? ? ? ? ? 244 ASP C C   1 
ATOM 7722  O O   . ASP C 1 243 ? -7.001  -16.478 27.486   1.00 10.00 ? ? ? ? ? ? 244 ASP C O   1 
ATOM 7723  C CB  . ASP C 1 243 ? -7.136  -14.179 29.482   1.00 10.00 ? ? ? ? ? ? 244 ASP C CB  1 
ATOM 7724  C CG  . ASP C 1 243 ? -5.850  -13.928 28.690   1.00 10.00 ? ? ? ? ? ? 244 ASP C CG  1 
ATOM 7725  O OD1 . ASP C 1 243 ? -5.067  -14.848 28.491   1.00 10.00 ? ? ? ? ? ? 244 ASP C OD1 1 
ATOM 7726  O OD2 . ASP C 1 243 ? -5.605  -12.779 28.300   1.00 10.00 ? ? ? ? ? ? 244 ASP C OD2 1 
ATOM 7727  N N   . GLY C 1 244 ? -7.765  -17.718 29.149   1.00 10.00 ? ? ? ? ? ? 245 GLY C N   1 
ATOM 7728  C CA  . GLY C 1 244 ? -7.130  -18.963 28.679   1.00 10.00 ? ? ? ? ? ? 245 GLY C CA  1 
ATOM 7729  C C   . GLY C 1 244 ? -5.739  -19.194 29.297   1.00 10.00 ? ? ? ? ? ? 245 GLY C C   1 
ATOM 7730  O O   . GLY C 1 244 ? -5.347  -20.338 29.524   1.00 10.00 ? ? ? ? ? ? 245 GLY C O   1 
ATOM 7731  N N   . GLN C 1 245 ? -5.000  -18.090 29.539   1.00 10.00 ? ? ? ? ? ? 246 GLN C N   1 
ATOM 7732  C CA  . GLN C 1 245 ? -3.649  -18.022 30.105   1.00 10.00 ? ? ? ? ? ? 246 GLN C CA  1 
ATOM 7733  C C   . GLN C 1 245 ? -3.372  -18.714 31.456   1.00 10.00 ? ? ? ? ? ? 246 GLN C C   1 
ATOM 7734  O O   . GLN C 1 245 ? -4.323  -18.925 32.234   1.00 10.00 ? ? ? ? ? ? 246 GLN C O   1 
ATOM 7735  C CB  . GLN C 1 245 ? -3.292  -16.552 30.248   1.00 10.00 ? ? ? ? ? ? 246 GLN C CB  1 
ATOM 7736  C CG  . GLN C 1 245 ? -2.068  -16.001 29.520   1.00 10.00 ? ? ? ? ? ? 246 GLN C CG  1 
ATOM 7737  C CD  . GLN C 1 245 ? -0.740  -16.330 30.195   1.00 10.00 ? ? ? ? ? ? 246 GLN C CD  1 
ATOM 7738  O OE1 . GLN C 1 245 ? -0.188  -17.441 30.119   1.00 10.00 ? ? ? ? ? ? 246 GLN C OE1 1 
ATOM 7739  N NE2 . GLN C 1 245 ? -0.187  -15.356 30.896   1.00 10.00 ? ? ? ? ? ? 246 GLN C NE2 1 
ATOM 7740  N N   . VAL C 1 246 ? -2.075  -18.939 31.828   1.00 10.00 ? ? ? ? ? ? 247 VAL C N   1 
ATOM 7741  C CA  . VAL C 1 246 ? -1.744  -19.547 33.105   1.00 10.00 ? ? ? ? ? ? 247 VAL C CA  1 
ATOM 7742  C C   . VAL C 1 246 ? -0.923  -18.711 34.107   1.00 10.00 ? ? ? ? ? ? 247 VAL C C   1 
ATOM 7743  O O   . VAL C 1 246 ? -0.101  -17.841 33.792   1.00 10.00 ? ? ? ? ? ? 247 VAL C O   1 
ATOM 7744  C CB  . VAL C 1 246 ? -1.063  -20.845 32.773   1.00 10.00 ? ? ? ? ? ? 247 VAL C CB  1 
ATOM 7745  C CG1 . VAL C 1 246 ? 0.454   -20.661 32.582   1.00 10.00 ? ? ? ? ? ? 247 VAL C CG1 1 
ATOM 7746  C CG2 . VAL C 1 246 ? -1.481  -21.828 33.863   1.00 10.00 ? ? ? ? ? ? 247 VAL C CG2 1 
ATOM 7747  N N   . ILE C 1 247 ? -1.137  -18.976 35.382   1.00 10.00 ? ? ? ? ? ? 248 ILE C N   1 
ATOM 7748  C CA  . ILE C 1 247 ? -0.500  -18.255 36.466   1.00 10.00 ? ? ? ? ? ? 248 ILE C CA  1 
ATOM 7749  C C   . ILE C 1 247 ? 0.231   -19.385 37.136   1.00 10.00 ? ? ? ? ? ? 248 ILE C C   1 
ATOM 7750  O O   . ILE C 1 247 ? -0.269  -20.524 37.144   1.00 10.00 ? ? ? ? ? ? 248 ILE C O   1 
ATOM 7751  C CB  . ILE C 1 247 ? -1.570  -17.686 37.442   1.00 10.00 ? ? ? ? ? ? 248 ILE C CB  1 
ATOM 7752  C CG1 . ILE C 1 247 ? -2.504  -16.772 36.719   1.00 10.00 ? ? ? ? ? ? 248 ILE C CG1 1 
ATOM 7753  C CG2 . ILE C 1 247 ? -0.968  -16.803 38.495   1.00 10.00 ? ? ? ? ? ? 248 ILE C CG2 1 
ATOM 7754  C CD1 . ILE C 1 247 ? -3.774  -16.472 37.548   1.00 10.00 ? ? ? ? ? ? 248 ILE C CD1 1 
ATOM 7755  N N   . THR C 1 248 ? 1.396   -19.107 37.674   1.00 10.00 ? ? ? ? ? ? 249 THR C N   1 
ATOM 7756  C CA  . THR C 1 248 ? 1.936   -20.069 38.603   1.00 10.00 ? ? ? ? ? ? 249 THR C CA  1 
ATOM 7757  C C   . THR C 1 248 ? 2.385   -19.315 39.843   1.00 10.00 ? ? ? ? ? ? 249 THR C C   1 
ATOM 7758  O O   . THR C 1 248 ? 2.960   -18.221 39.774   1.00 10.00 ? ? ? ? ? ? 249 THR C O   1 
ATOM 7759  C CB  . THR C 1 248 ? 3.066   -20.870 37.920   1.00 10.00 ? ? ? ? ? ? 249 THR C CB  1 
ATOM 7760  O OG1 . THR C 1 248 ? 2.382   -21.537 36.854   1.00 10.00 ? ? ? ? ? ? 249 THR C OG1 1 
ATOM 7761  C CG2 . THR C 1 248 ? 3.761   -21.942 38.782   1.00 10.00 ? ? ? ? ? ? 249 THR C CG2 1 
ATOM 7762  N N   . ILE C 1 249 ? 1.977   -19.879 40.993   1.00 10.00 ? ? ? ? ? ? 250 ILE C N   1 
ATOM 7763  C CA  . ILE C 1 249 ? 2.210   -19.296 42.301   1.00 10.00 ? ? ? ? ? ? 250 ILE C CA  1 
ATOM 7764  C C   . ILE C 1 249 ? 2.912   -20.305 43.185   1.00 10.00 ? ? ? ? ? ? 250 ILE C C   1 
ATOM 7765  O O   . ILE C 1 249 ? 2.674   -21.498 43.186   1.00 10.00 ? ? ? ? ? ? 250 ILE C O   1 
ATOM 7766  C CB  . ILE C 1 249 ? 0.888   -18.879 42.936   1.00 10.00 ? ? ? ? ? ? 250 ILE C CB  1 
ATOM 7767  C CG1 . ILE C 1 249 ? 0.213   -17.921 42.006   1.00 10.00 ? ? ? ? ? ? 250 ILE C CG1 1 
ATOM 7768  C CG2 . ILE C 1 249 ? 1.061   -18.087 44.195   1.00 10.00 ? ? ? ? ? ? 250 ILE C CG2 1 
ATOM 7769  C CD1 . ILE C 1 249 ? -0.971  -18.683 41.352   1.00 10.00 ? ? ? ? ? ? 250 ILE C CD1 1 
ATOM 7770  N N   . GLY C 1 250 ? 3.913   -19.778 43.833   1.00 10.00 ? ? ? ? ? ? 251 GLY C N   1 
ATOM 7771  C CA  . GLY C 1 250 ? 4.720   -20.571 44.718   1.00 10.00 ? ? ? ? ? ? 251 GLY C CA  1 
ATOM 7772  C C   . GLY C 1 250 ? 4.906   -19.855 46.043   1.00 10.00 ? ? ? ? ? ? 251 GLY C C   1 
ATOM 7773  O O   . GLY C 1 250 ? 3.913   -19.754 46.788   1.00 10.00 ? ? ? ? ? ? 251 GLY C O   1 
ATOM 7774  N N   . ASN C 1 251 ? 6.062   -19.200 46.308   1.00 10.00 ? ? ? ? ? ? 252 ASN C N   1 
ATOM 7775  C CA  . ASN C 1 251 ? 6.309   -18.679 47.654   1.00 10.00 ? ? ? ? ? ? 252 ASN C CA  1 
ATOM 7776  C C   . ASN C 1 251 ? 5.300   -17.636 48.147   1.00 10.00 ? ? ? ? ? ? 252 ASN C C   1 
ATOM 7777  O O   . ASN C 1 251 ? 5.045   -17.437 49.342   1.00 10.00 ? ? ? ? ? ? 252 ASN C O   1 
ATOM 7778  C CB  . ASN C 1 251 ? 7.727   -18.097 47.754   1.00 10.00 ? ? ? ? ? ? 252 ASN C CB  1 
ATOM 7779  C CG  . ASN C 1 251 ? 7.978   -16.696 47.241   1.00 10.00 ? ? ? ? ? ? 252 ASN C CG  1 
ATOM 7780  O OD1 . ASN C 1 251 ? 7.145   -16.037 46.622   1.00 10.00 ? ? ? ? ? ? 252 ASN C OD1 1 
ATOM 7781  N ND2 . ASN C 1 251 ? 9.179   -16.216 47.471   1.00 10.00 ? ? ? ? ? ? 252 ASN C ND2 1 
ATOM 7782  N N   . GLU C 1 252 ? 4.673   -17.045 47.149   1.00 10.00 ? ? ? ? ? ? 253 GLU C N   1 
ATOM 7783  C CA  . GLU C 1 252 ? 3.586   -16.124 47.309   1.00 10.00 ? ? ? ? ? ? 253 GLU C CA  1 
ATOM 7784  C C   . GLU C 1 252 ? 2.390   -16.597 48.134   1.00 10.00 ? ? ? ? ? ? 253 GLU C C   1 
ATOM 7785  O O   . GLU C 1 252 ? 1.830   -15.841 48.934   1.00 10.00 ? ? ? ? ? ? 253 GLU C O   1 
ATOM 7786  C CB  . GLU C 1 252 ? 3.137   -15.726 45.895   1.00 10.00 ? ? ? ? ? ? 253 GLU C CB  1 
ATOM 7787  C CG  . GLU C 1 252 ? 4.212   -14.985 45.145   1.00 10.00 ? ? ? ? ? ? 253 GLU C CG  1 
ATOM 7788  C CD  . GLU C 1 252 ? 4.687   -15.622 43.845   1.00 10.00 ? ? ? ? ? ? 253 GLU C CD  1 
ATOM 7789  O OE1 . GLU C 1 252 ? 4.740   -16.854 43.727   1.00 10.00 ? ? ? ? ? ? 253 GLU C OE1 1 
ATOM 7790  O OE2 . GLU C 1 252 ? 5.020   -14.835 42.961   1.00 10.00 ? ? ? ? ? ? 253 GLU C OE2 1 
ATOM 7791  N N   . ARG C 1 253 ? 1.990   -17.850 47.969   1.00 10.00 ? ? ? ? ? ? 254 ARG C N   1 
ATOM 7792  C CA  . ARG C 1 253 ? 0.838   -18.408 48.658   1.00 10.00 ? ? ? ? ? ? 254 ARG C CA  1 
ATOM 7793  C C   . ARG C 1 253 ? 0.860   -18.242 50.166   1.00 10.00 ? ? ? ? ? ? 254 ARG C C   1 
ATOM 7794  O O   . ARG C 1 253 ? -0.181  -17.961 50.760   1.00 10.00 ? ? ? ? ? ? 254 ARG C O   1 
ATOM 7795  C CB  . ARG C 1 253 ? 0.727   -19.864 48.406   1.00 10.00 ? ? ? ? ? ? 254 ARG C CB  1 
ATOM 7796  C CG  . ARG C 1 253 ? 0.276   -20.216 47.062   1.00 10.00 ? ? ? ? ? ? 254 ARG C CG  1 
ATOM 7797  C CD  . ARG C 1 253 ? 0.668   -21.641 47.083   1.00 10.00 ? ? ? ? ? ? 254 ARG C CD  1 
ATOM 7798  N NE  . ARG C 1 253 ? -0.478  -22.458 47.281   1.00 10.00 ? ? ? ? ? ? 254 ARG C NE  1 
ATOM 7799  C CZ  . ARG C 1 253 ? -0.341  -23.772 47.502   1.00 10.00 ? ? ? ? ? ? 254 ARG C CZ  1 
ATOM 7800  N NH1 . ARG C 1 253 ? 0.861   -24.383 47.556   1.00 10.00 ? ? ? ? ? ? 254 ARG C NH1 1 
ATOM 7801  N NH2 . ARG C 1 253 ? -1.435  -24.533 47.604   1.00 10.00 ? ? ? ? ? ? 254 ARG C NH2 1 
ATOM 7802  N N   . PHE C 1 254 ? 2.020   -18.473 50.815   1.00 10.00 ? ? ? ? ? ? 255 PHE C N   1 
ATOM 7803  C CA  . PHE C 1 254 ? 2.145   -18.331 52.270   1.00 10.00 ? ? ? ? ? ? 255 PHE C CA  1 
ATOM 7804  C C   . PHE C 1 254 ? 2.659   -16.930 52.652   1.00 10.00 ? ? ? ? ? ? 255 PHE C C   1 
ATOM 7805  O O   . PHE C 1 254 ? 2.327   -16.430 53.722   1.00 10.00 ? ? ? ? ? ? 255 PHE C O   1 
ATOM 7806  C CB  . PHE C 1 254 ? 3.076   -19.481 52.828   1.00 10.00 ? ? ? ? ? ? 255 PHE C CB  1 
ATOM 7807  C CG  . PHE C 1 254 ? 4.570   -19.527 52.465   1.00 10.00 ? ? ? ? ? ? 255 PHE C CG  1 
ATOM 7808  C CD1 . PHE C 1 254 ? 5.463   -18.622 53.036   1.00 10.00 ? ? ? ? ? ? 255 PHE C CD1 1 
ATOM 7809  C CD2 . PHE C 1 254 ? 4.993   -20.440 51.515   1.00 10.00 ? ? ? ? ? ? 255 PHE C CD2 1 
ATOM 7810  C CE1 . PHE C 1 254 ? 6.766   -18.609 52.645   1.00 10.00 ? ? ? ? ? ? 255 PHE C CE1 1 
ATOM 7811  C CE2 . PHE C 1 254 ? 6.303   -20.410 51.146   1.00 10.00 ? ? ? ? ? ? 255 PHE C CE2 1 
ATOM 7812  C CZ  . PHE C 1 254 ? 7.169   -19.501 51.699   1.00 10.00 ? ? ? ? ? ? 255 PHE C CZ  1 
ATOM 7813  N N   . ARG C 1 255 ? 3.449   -16.270 51.778   1.00 10.00 ? ? ? ? ? ? 256 ARG C N   1 
ATOM 7814  C CA  . ARG C 1 255 ? 3.957   -14.908 51.912   1.00 10.00 ? ? ? ? ? ? 256 ARG C CA  1 
ATOM 7815  C C   . ARG C 1 255 ? 2.801   -13.891 51.935   1.00 10.00 ? ? ? ? ? ? 256 ARG C C   1 
ATOM 7816  O O   . ARG C 1 255 ? 2.961   -12.759 52.374   1.00 10.00 ? ? ? ? ? ? 256 ARG C O   1 
ATOM 7817  C CB  . ARG C 1 255 ? 4.878   -14.485 50.728   1.00 10.00 ? ? ? ? ? ? 256 ARG C CB  1 
ATOM 7818  C CG  . ARG C 1 255 ? 6.294   -15.014 50.463   1.00 10.00 ? ? ? ? ? ? 256 ARG C CG  1 
ATOM 7819  C CD  . ARG C 1 255 ? 7.050   -13.874 49.765   1.00 10.00 ? ? ? ? ? ? 256 ARG C CD  1 
ATOM 7820  N NE  . ARG C 1 255 ? 6.909   -13.804 48.305   1.00 10.00 ? ? ? ? ? ? 256 ARG C NE  1 
ATOM 7821  C CZ  . ARG C 1 255 ? 7.233   -12.715 47.573   1.00 10.00 ? ? ? ? ? ? 256 ARG C CZ  1 
ATOM 7822  N NH1 . ARG C 1 255 ? 7.698   -11.582 48.083   1.00 10.00 ? ? ? ? ? ? 256 ARG C NH1 1 
ATOM 7823  N NH2 . ARG C 1 255 ? 7.084   -12.773 46.285   1.00 10.00 ? ? ? ? ? ? 256 ARG C NH2 1 
ATOM 7824  N N   . CYS C 1 256 ? 1.636   -14.201 51.389   1.00 10.00 ? ? ? ? ? ? 257 CYS C N   1 
ATOM 7825  C CA  . CYS C 1 256 ? 0.486   -13.290 51.420   1.00 10.00 ? ? ? ? ? ? 257 CYS C CA  1 
ATOM 7826  C C   . CYS C 1 256 ? -0.042  -13.229 52.877   1.00 10.00 ? ? ? ? ? ? 257 CYS C C   1 
ATOM 7827  O O   . CYS C 1 256 ? 0.279   -12.222 53.546   1.00 10.00 ? ? ? ? ? ? 257 CYS C O   1 
ATOM 7828  C CB  . CYS C 1 256 ? -0.537  -13.843 50.400   1.00 10.00 ? ? ? ? ? ? 257 CYS C CB  1 
ATOM 7829  S SG  . CYS C 1 256 ? -1.934  -12.772 50.078   1.00 10.00 ? ? ? ? ? ? 257 CYS C SG  1 
ATOM 7830  N N   . PRO C 1 257 ? -0.707  -14.252 53.494   1.00 10.00 ? ? ? ? ? ? 258 PRO C N   1 
ATOM 7831  C CA  . PRO C 1 257 ? -1.206  -14.180 54.859   1.00 10.00 ? ? ? ? ? ? 258 PRO C CA  1 
ATOM 7832  C C   . PRO C 1 257 ? -0.142  -13.776 55.841   1.00 10.00 ? ? ? ? ? ? 258 PRO C C   1 
ATOM 7833  O O   . PRO C 1 257 ? -0.501  -13.171 56.839   1.00 10.00 ? ? ? ? ? ? 258 PRO C O   1 
ATOM 7834  C CB  . PRO C 1 257 ? -1.754  -15.533 55.189   1.00 10.00 ? ? ? ? ? ? 258 PRO C CB  1 
ATOM 7835  C CG  . PRO C 1 257 ? -2.026  -16.106 53.827   1.00 10.00 ? ? ? ? ? ? 258 PRO C CG  1 
ATOM 7836  C CD  . PRO C 1 257 ? -0.820  -15.645 53.057   1.00 10.00 ? ? ? ? ? ? 258 PRO C CD  1 
ATOM 7837  N N   . GLU C 1 258 ? 1.157   -13.981 55.638   1.00 10.00 ? ? ? ? ? ? 259 GLU C N   1 
ATOM 7838  C CA  . GLU C 1 258 ? 2.214   -13.522 56.544   1.00 10.00 ? ? ? ? ? ? 259 GLU C CA  1 
ATOM 7839  C C   . GLU C 1 258 ? 2.267   -12.046 56.899   1.00 10.00 ? ? ? ? ? ? 259 GLU C C   1 
ATOM 7840  O O   . GLU C 1 258 ? 2.903   -11.603 57.869   1.00 10.00 ? ? ? ? ? ? 259 GLU C O   1 
ATOM 7841  C CB  . GLU C 1 258 ? 3.535   -13.909 55.943   1.00 10.00 ? ? ? ? ? ? 259 GLU C CB  1 
ATOM 7842  C CG  . GLU C 1 258 ? 3.886   -15.315 56.297   1.00 10.00 ? ? ? ? ? ? 259 GLU C CG  1 
ATOM 7843  C CD  . GLU C 1 258 ? 4.422   -15.382 57.698   1.00 10.00 ? ? ? ? ? ? 259 GLU C CD  1 
ATOM 7844  O OE1 . GLU C 1 258 ? 5.244   -14.552 58.078   1.00 10.00 ? ? ? ? ? ? 259 GLU C OE1 1 
ATOM 7845  O OE2 . GLU C 1 258 ? 4.005   -16.283 58.392   1.00 10.00 ? ? ? ? ? ? 259 GLU C OE2 1 
ATOM 7846  N N   . ALA C 1 259 ? 1.638   -11.237 56.069   1.00 10.00 ? ? ? ? ? ? 260 ALA C N   1 
ATOM 7847  C CA  . ALA C 1 259 ? 1.524   -9.830  56.373   1.00 10.00 ? ? ? ? ? ? 260 ALA C CA  1 
ATOM 7848  C C   . ALA C 1 259 ? 0.614   -9.623  57.591   1.00 10.00 ? ? ? ? ? ? 260 ALA C C   1 
ATOM 7849  O O   . ALA C 1 259 ? 0.652   -8.581  58.239   1.00 10.00 ? ? ? ? ? ? 260 ALA C O   1 
ATOM 7850  C CB  . ALA C 1 259 ? 0.966   -9.130  55.148   1.00 10.00 ? ? ? ? ? ? 260 ALA C CB  1 
ATOM 7851  N N   . LEU C 1 260 ? -0.219  -10.580 57.952   1.00 10.00 ? ? ? ? ? ? 261 LEU C N   1 
ATOM 7852  C CA  . LEU C 1 260 ? -0.993  -10.524 59.167   1.00 10.00 ? ? ? ? ? ? 261 LEU C CA  1 
ATOM 7853  C C   . LEU C 1 260 ? -0.132  -10.618 60.418   1.00 10.00 ? ? ? ? ? ? 261 LEU C C   1 
ATOM 7854  O O   . LEU C 1 260 ? -0.407  -10.045 61.476   1.00 10.00 ? ? ? ? ? ? 261 LEU C O   1 
ATOM 7855  C CB  . LEU C 1 260 ? -1.985  -11.656 59.148   1.00 10.00 ? ? ? ? ? ? 261 LEU C CB  1 
ATOM 7856  C CG  . LEU C 1 260 ? -3.236  -11.478 58.306   1.00 10.00 ? ? ? ? ? ? 261 LEU C CG  1 
ATOM 7857  C CD1 . LEU C 1 260 ? -4.035  -12.796 58.196   1.00 10.00 ? ? ? ? ? ? 261 LEU C CD1 1 
ATOM 7858  C CD2 . LEU C 1 260 ? -4.067  -10.376 58.978   1.00 10.00 ? ? ? ? ? ? 261 LEU C CD2 1 
ATOM 7859  N N   . PHE C 1 261 ? 0.917   -11.427 60.358   1.00 10.00 ? ? ? ? ? ? 262 PHE C N   1 
ATOM 7860  C CA  . PHE C 1 261 ? 1.804   -11.660 61.487   1.00 10.00 ? ? ? ? ? ? 262 PHE C CA  1 
ATOM 7861  C C   . PHE C 1 261 ? 2.951   -10.680 61.580   1.00 10.00 ? ? ? ? ? ? 262 PHE C C   1 
ATOM 7862  O O   . PHE C 1 261 ? 3.428   -10.411 62.690   1.00 10.00 ? ? ? ? ? ? 262 PHE C O   1 
ATOM 7863  C CB  . PHE C 1 261 ? 2.350   -13.082 61.423   1.00 10.00 ? ? ? ? ? ? 262 PHE C CB  1 
ATOM 7864  C CG  . PHE C 1 261 ? 1.226   -14.003 61.819   1.00 10.00 ? ? ? ? ? ? 262 PHE C CG  1 
ATOM 7865  C CD1 . PHE C 1 261 ? 0.888   -14.119 63.144   1.00 10.00 ? ? ? ? ? ? 262 PHE C CD1 1 
ATOM 7866  C CD2 . PHE C 1 261 ? 0.501   -14.664 60.866   1.00 10.00 ? ? ? ? ? ? 262 PHE C CD2 1 
ATOM 7867  C CE1 . PHE C 1 261 ? -0.176  -14.882 63.516   1.00 10.00 ? ? ? ? ? ? 262 PHE C CE1 1 
ATOM 7868  C CE2 . PHE C 1 261 ? -0.575  -15.433 61.253   1.00 10.00 ? ? ? ? ? ? 262 PHE C CE2 1 
ATOM 7869  C CZ  . PHE C 1 261 ? -0.911  -15.540 62.575   1.00 10.00 ? ? ? ? ? ? 262 PHE C CZ  1 
ATOM 7870  N N   . GLN C 1 262 ? 3.367   -10.192 60.415   1.00 10.00 ? ? ? ? ? ? 263 GLN C N   1 
ATOM 7871  C CA  . GLN C 1 262 ? 4.442   -9.249  60.239   1.00 10.00 ? ? ? ? ? ? 263 GLN C CA  1 
ATOM 7872  C C   . GLN C 1 262 ? 3.951   -8.124  59.324   1.00 10.00 ? ? ? ? ? ? 263 GLN C C   1 
ATOM 7873  O O   . GLN C 1 262 ? 4.126   -8.175  58.113   1.00 10.00 ? ? ? ? ? ? 263 GLN C O   1 
ATOM 7874  C CB  . GLN C 1 262 ? 5.618   -9.932  59.592   1.00 10.00 ? ? ? ? ? ? 263 GLN C CB  1 
ATOM 7875  C CG  . GLN C 1 262 ? 5.829   -11.347 60.096   1.00 10.00 ? ? ? ? ? ? 263 GLN C CG  1 
ATOM 7876  C CD  . GLN C 1 262 ? 7.139   -11.884 59.628   1.00 10.00 ? ? ? ? ? ? 263 GLN C CD  1 
ATOM 7877  O OE1 . GLN C 1 262 ? 8.080   -11.125 59.481   1.00 10.00 ? ? ? ? ? ? 263 GLN C OE1 1 
ATOM 7878  N NE2 . GLN C 1 262 ? 7.261   -13.175 59.416   1.00 10.00 ? ? ? ? ? ? 263 GLN C NE2 1 
ATOM 7879  N N   . PRO C 1 263 ? 3.333   -7.054  59.754   1.00 10.00 ? ? ? ? ? ? 264 PRO C N   1 
ATOM 7880  C CA  . PRO C 1 263 ? 2.817   -6.034  58.859   1.00 10.00 ? ? ? ? ? ? 264 PRO C CA  1 
ATOM 7881  C C   . PRO C 1 263 ? 3.917   -5.128  58.334   1.00 10.00 ? ? ? ? ? ? 264 PRO C C   1 
ATOM 7882  O O   . PRO C 1 263 ? 3.659   -4.092  57.725   1.00 10.00 ? ? ? ? ? ? 264 PRO C O   1 
ATOM 7883  C CB  . PRO C 1 263 ? 1.769   -5.322  59.696   1.00 10.00 ? ? ? ? ? ? 264 PRO C CB  1 
ATOM 7884  C CG  . PRO C 1 263 ? 1.436   -6.351  60.751   1.00 10.00 ? ? ? ? ? ? 264 PRO C CG  1 
ATOM 7885  C CD  . PRO C 1 263 ? 2.797   -6.904  61.085   1.00 10.00 ? ? ? ? ? ? 264 PRO C CD  1 
ATOM 7886  N N   . SER C 1 264 ? 5.184   -5.471  58.560   1.00 10.00 ? ? ? ? ? ? 265 SER C N   1 
ATOM 7887  C CA  . SER C 1 264 ? 6.324   -4.804  57.966   1.00 10.00 ? ? ? ? ? ? 265 SER C CA  1 
ATOM 7888  C C   . SER C 1 264 ? 6.295   -5.217  56.520   1.00 10.00 ? ? ? ? ? ? 265 SER C C   1 
ATOM 7889  O O   . SER C 1 264 ? 6.617   -4.391  55.678   1.00 10.00 ? ? ? ? ? ? 265 SER C O   1 
ATOM 7890  C CB  . SER C 1 264 ? 7.629   -5.262  58.622   1.00 10.00 ? ? ? ? ? ? 265 SER C CB  1 
ATOM 7891  O OG  . SER C 1 264 ? 7.525   -6.585  59.174   1.00 10.00 ? ? ? ? ? ? 265 SER C OG  1 
ATOM 7892  N N   . PHE C 1 265 ? 5.844   -6.443  56.205   1.00 10.00 ? ? ? ? ? ? 266 PHE C N   1 
ATOM 7893  C CA  . PHE C 1 265 ? 5.701   -6.893  54.833   1.00 10.00 ? ? ? ? ? ? 266 PHE C CA  1 
ATOM 7894  C C   . PHE C 1 265 ? 4.863   -5.929  54.078   1.00 10.00 ? ? ? ? ? ? 266 PHE C C   1 
ATOM 7895  O O   . PHE C 1 265 ? 5.172   -5.666  52.947   1.00 10.00 ? ? ? ? ? ? 266 PHE C O   1 
ATOM 7896  C CB  . PHE C 1 265 ? 4.984   -8.178  54.677   1.00 10.00 ? ? ? ? ? ? 266 PHE C CB  1 
ATOM 7897  C CG  . PHE C 1 265 ? 5.808   -9.403  55.004   1.00 10.00 ? ? ? ? ? ? 266 PHE C CG  1 
ATOM 7898  C CD1 . PHE C 1 265 ? 6.831   -9.335  55.909   1.00 10.00 ? ? ? ? ? ? 266 PHE C CD1 1 
ATOM 7899  C CD2 . PHE C 1 265 ? 5.499   -10.572 54.345   1.00 10.00 ? ? ? ? ? ? 266 PHE C CD2 1 
ATOM 7900  C CE1 . PHE C 1 265 ? 7.550   -10.456 56.152   1.00 10.00 ? ? ? ? ? ? 266 PHE C CE1 1 
ATOM 7901  C CE2 . PHE C 1 265 ? 6.233   -11.686 54.601   1.00 10.00 ? ? ? ? ? ? 266 PHE C CE2 1 
ATOM 7902  C CZ  . PHE C 1 265 ? 7.249   -11.608 55.497   1.00 10.00 ? ? ? ? ? ? 266 PHE C CZ  1 
ATOM 7903  N N   . LEU C 1 266 ? 3.818   -5.412  54.682   1.00 10.00 ? ? ? ? ? ? 267 LEU C N   1 
ATOM 7904  C CA  . LEU C 1 266 ? 3.015   -4.366  54.086   1.00 10.00 ? ? ? ? ? ? 267 LEU C CA  1 
ATOM 7905  C C   . LEU C 1 266 ? 3.588   -2.947  54.259   1.00 10.00 ? ? ? ? ? ? 267 LEU C C   1 
ATOM 7906  O O   . LEU C 1 266 ? 3.010   -1.991  53.731   1.00 10.00 ? ? ? ? ? ? 267 LEU C O   1 
ATOM 7907  C CB  . LEU C 1 266 ? 1.608   -4.419  54.691   1.00 10.00 ? ? ? ? ? ? 267 LEU C CB  1 
ATOM 7908  C CG  . LEU C 1 266 ? 0.869   -5.703  54.510   1.00 10.00 ? ? ? ? ? ? 267 LEU C CG  1 
ATOM 7909  C CD1 . LEU C 1 266 ? -0.592  -5.465  54.660   1.00 10.00 ? ? ? ? ? ? 267 LEU C CD1 1 
ATOM 7910  C CD2 . LEU C 1 266 ? 1.047   -6.195  53.096   1.00 10.00 ? ? ? ? ? ? 267 LEU C CD2 1 
ATOM 7911  N N   . GLY C 1 267 ? 4.676   -2.675  54.972   1.00 10.00 ? ? ? ? ? ? 268 GLY C N   1 
ATOM 7912  C CA  . GLY C 1 267 ? 5.165   -1.310  55.044   1.00 10.00 ? ? ? ? ? ? 268 GLY C CA  1 
ATOM 7913  C C   . GLY C 1 267 ? 4.542   -0.571  56.206   1.00 10.00 ? ? ? ? ? ? 268 GLY C C   1 
ATOM 7914  O O   . GLY C 1 267 ? 4.782   0.614   56.392   1.00 10.00 ? ? ? ? ? ? 268 GLY C O   1 
ATOM 7915  N N   . MET C 1 268 ? 3.849   -1.342  57.055   1.00 10.00 ? ? ? ? ? ? 269 MET C N   1 
ATOM 7916  C CA  . MET C 1 268 ? 3.207   -0.904  58.286   1.00 10.00 ? ? ? ? ? ? 269 MET C CA  1 
ATOM 7917  C C   . MET C 1 268 ? 4.015   -1.211  59.534   1.00 10.00 ? ? ? ? ? ? 269 MET C C   1 
ATOM 7918  O O   . MET C 1 268 ? 4.606   -2.276  59.753   1.00 10.00 ? ? ? ? ? ? 269 MET C O   1 
ATOM 7919  C CB  . MET C 1 268 ? 1.889   -1.575  58.492   1.00 10.00 ? ? ? ? ? ? 269 MET C CB  1 
ATOM 7920  C CG  . MET C 1 268 ? 0.898   -1.285  57.413   1.00 10.00 ? ? ? ? ? ? 269 MET C CG  1 
ATOM 7921  S SD  . MET C 1 268 ? -0.448  -2.370  57.878   1.00 10.00 ? ? ? ? ? ? 269 MET C SD  1 
ATOM 7922  C CE  . MET C 1 268 ? -1.732  -1.669  56.858   1.00 10.00 ? ? ? ? ? ? 269 MET C CE  1 
ATOM 7923  N N   . GLU C 1 269 ? 3.955   -0.203  60.389   1.00 10.00 ? ? ? ? ? ? 270 GLU C N   1 
ATOM 7924  C CA  . GLU C 1 269 ? 4.617   -0.289  61.662   1.00 10.00 ? ? ? ? ? ? 270 GLU C CA  1 
ATOM 7925  C C   . GLU C 1 269 ? 3.863   -1.228  62.597   1.00 10.00 ? ? ? ? ? ? 270 GLU C C   1 
ATOM 7926  O O   . GLU C 1 269 ? 4.401   -1.580  63.641   1.00 10.00 ? ? ? ? ? ? 270 GLU C O   1 
ATOM 7927  C CB  . GLU C 1 269 ? 4.716   1.116   62.292   1.00 10.00 ? ? ? ? ? ? 270 GLU C CB  1 
ATOM 7928  C CG  . GLU C 1 269 ? 5.868   2.082   61.927   1.00 10.00 ? ? ? ? ? ? 270 GLU C CG  1 
ATOM 7929  C CD  . GLU C 1 269 ? 5.916   2.752   60.542   1.00 10.00 ? ? ? ? ? ? 270 GLU C CD  1 
ATOM 7930  O OE1 . GLU C 1 269 ? 5.133   2.413   59.638   1.00 10.00 ? ? ? ? ? ? 270 GLU C OE1 1 
ATOM 7931  O OE2 . GLU C 1 269 ? 6.759   3.643   60.366   1.00 10.00 ? ? ? ? ? ? 270 GLU C OE2 1 
ATOM 7932  N N   . SER C 1 270 ? 2.619   -1.643  62.320   1.00 10.00 ? ? ? ? ? ? 271 SER C N   1 
ATOM 7933  C CA  . SER C 1 270 ? 1.838   -2.417  63.275   1.00 10.00 ? ? ? ? ? ? 271 SER C CA  1 
ATOM 7934  C C   . SER C 1 270 ? 2.403   -3.777  63.645   1.00 10.00 ? ? ? ? ? ? 271 SER C C   1 
ATOM 7935  O O   . SER C 1 270 ? 3.037   -4.502  62.873   1.00 10.00 ? ? ? ? ? ? 271 SER C O   1 
ATOM 7936  C CB  . SER C 1 270 ? 0.421   -2.653  62.746   1.00 10.00 ? ? ? ? ? ? 271 SER C CB  1 
ATOM 7937  O OG  . SER C 1 270 ? -0.150  -1.477  62.184   1.00 10.00 ? ? ? ? ? ? 271 SER C OG  1 
ATOM 7938  N N   . CYS C 1 271 ? 2.113   -4.094  64.898   1.00 10.00 ? ? ? ? ? ? 272 CYS C N   1 
ATOM 7939  C CA  . CYS C 1 271 ? 2.299   -5.408  65.471   1.00 10.00 ? ? ? ? ? ? 272 CYS C CA  1 
ATOM 7940  C C   . CYS C 1 271 ? 1.471   -6.348  64.629   1.00 10.00 ? ? ? ? ? ? 272 CYS C C   1 
ATOM 7941  O O   . CYS C 1 271 ? 0.518   -5.896  64.002   1.00 10.00 ? ? ? ? ? ? 272 CYS C O   1 
ATOM 7942  C CB  . CYS C 1 271 ? 1.746   -5.446  66.906   1.00 10.00 ? ? ? ? ? ? 272 CYS C CB  1 
ATOM 7943  S SG  . CYS C 1 271 ? 2.811   -4.629  68.112   1.00 10.00 ? ? ? ? ? ? 272 CYS C SG  1 
ATOM 7944  N N   . GLY C 1 272 ? 1.760   -7.628  64.580   1.00 10.00 ? ? ? ? ? ? 273 GLY C N   1 
ATOM 7945  C CA  . GLY C 1 272 ? 0.854   -8.517  63.909   1.00 10.00 ? ? ? ? ? ? 273 GLY C CA  1 
ATOM 7946  C C   . GLY C 1 272 ? -0.217  -8.983  64.864   1.00 10.00 ? ? ? ? ? ? 273 GLY C C   1 
ATOM 7947  O O   . GLY C 1 272 ? -0.138  -8.945  66.093   1.00 10.00 ? ? ? ? ? ? 273 GLY C O   1 
ATOM 7948  N N   . ILE C 1 273 ? -1.139  -9.688  64.245   1.00 10.00 ? ? ? ? ? ? 274 ILE C N   1 
ATOM 7949  C CA  . ILE C 1 273 ? -2.271  -10.291 64.915   1.00 10.00 ? ? ? ? ? ? 274 ILE C CA  1 
ATOM 7950  C C   . ILE C 1 273 ? -2.058  -11.109 66.196   1.00 10.00 ? ? ? ? ? ? 274 ILE C C   1 
ATOM 7951  O O   . ILE C 1 273 ? -2.930  -11.232 67.064   1.00 10.00 ? ? ? ? ? ? 274 ILE C O   1 
ATOM 7952  C CB  . ILE C 1 273 ? -2.969  -11.059 63.723   1.00 10.00 ? ? ? ? ? ? 274 ILE C CB  1 
ATOM 7953  C CG1 . ILE C 1 273 ? -4.375  -10.492 63.813   1.00 10.00 ? ? ? ? ? ? 274 ILE C CG1 1 
ATOM 7954  C CG2 . ILE C 1 273 ? -2.910  -12.601 63.683   1.00 10.00 ? ? ? ? ? ? 274 ILE C CG2 1 
ATOM 7955  C CD1 . ILE C 1 273 ? -4.359  -8.974  63.545   1.00 10.00 ? ? ? ? ? ? 274 ILE C CD1 1 
ATOM 7956  N N   . HIS C 1 274 ? -0.847  -11.634 66.346   1.00 10.00 ? ? ? ? ? ? 275 HIS C N   1 
ATOM 7957  C CA  . HIS C 1 274 ? -0.547  -12.523 67.469   1.00 10.00 ? ? ? ? ? ? 275 HIS C CA  1 
ATOM 7958  C C   . HIS C 1 274 ? -0.178  -11.733 68.721   1.00 10.00 ? ? ? ? ? ? 275 HIS C C   1 
ATOM 7959  O O   . HIS C 1 274 ? -0.403  -12.126 69.860   1.00 10.00 ? ? ? ? ? ? 275 HIS C O   1 
ATOM 7960  C CB  . HIS C 1 274 ? 0.603   -13.501 67.072   1.00 10.00 ? ? ? ? ? ? 275 HIS C CB  1 
ATOM 7961  C CG  . HIS C 1 274 ? 1.904   -12.851 66.589   1.00 10.00 ? ? ? ? ? ? 275 HIS C CG  1 
ATOM 7962  N ND1 . HIS C 1 274 ? 2.148   -12.152 65.461   1.00 10.00 ? ? ? ? ? ? 275 HIS C ND1 1 
ATOM 7963  C CD2 . HIS C 1 274 ? 3.082   -12.933 67.286   1.00 10.00 ? ? ? ? ? ? 275 HIS C CD2 1 
ATOM 7964  C CE1 . HIS C 1 274 ? 3.421   -11.823 65.469   1.00 10.00 ? ? ? ? ? ? 275 HIS C CE1 1 
ATOM 7965  N NE2 . HIS C 1 274 ? 3.970   -12.293 66.564   1.00 10.00 ? ? ? ? ? ? 275 HIS C NE2 1 
ATOM 7966  N N   . GLU C 1 275 ? 0.337   -10.549 68.478   1.00 10.00 ? ? ? ? ? ? 276 GLU C N   1 
ATOM 7967  C CA  . GLU C 1 275 ? 0.735   -9.655  69.526   1.00 10.00 ? ? ? ? ? ? 276 GLU C CA  1 
ATOM 7968  C C   . GLU C 1 275 ? -0.430  -8.851  70.012   1.00 10.00 ? ? ? ? ? ? 276 GLU C C   1 
ATOM 7969  O O   . GLU C 1 275 ? -0.482  -8.502  71.164   1.00 10.00 ? ? ? ? ? ? 276 GLU C O   1 
ATOM 7970  C CB  . GLU C 1 275 ? 1.726   -8.726  69.024   1.00 10.00 ? ? ? ? ? ? 276 GLU C CB  1 
ATOM 7971  C CG  . GLU C 1 275 ? 2.906   -9.503  68.630   1.00 10.00 ? ? ? ? ? ? 276 GLU C CG  1 
ATOM 7972  C CD  . GLU C 1 275 ? 4.081   -8.874  69.319   1.00 10.00 ? ? ? ? ? ? 276 GLU C CD  1 
ATOM 7973  O OE1 . GLU C 1 275 ? 4.247   -9.081  70.523   1.00 10.00 ? ? ? ? ? ? 276 GLU C OE1 1 
ATOM 7974  O OE2 . GLU C 1 275 ? 4.825   -8.174  68.642   1.00 10.00 ? ? ? ? ? ? 276 GLU C OE2 1 
ATOM 7975  N N   . THR C 1 276 ? -1.338  -8.489  69.138   1.00 10.00 ? ? ? ? ? ? 277 THR C N   1 
ATOM 7976  C CA  . THR C 1 276 ? -2.497  -7.715  69.463   1.00 10.00 ? ? ? ? ? ? 277 THR C CA  1 
ATOM 7977  C C   . THR C 1 276 ? -3.401  -8.601  70.311   1.00 10.00 ? ? ? ? ? ? 277 THR C C   1 
ATOM 7978  O O   . THR C 1 276 ? -3.758  -8.044  71.356   1.00 10.00 ? ? ? ? ? ? 277 THR C O   1 
ATOM 7979  C CB  . THR C 1 276 ? -3.020  -7.267  68.094   1.00 10.00 ? ? ? ? ? ? 277 THR C CB  1 
ATOM 7980  O OG1 . THR C 1 276 ? -1.933  -6.462  67.680   1.00 10.00 ? ? ? ? ? ? 277 THR C OG1 1 
ATOM 7981  C CG2 . THR C 1 276 ? -4.272  -6.413  67.985   1.00 10.00 ? ? ? ? ? ? 277 THR C CG2 1 
ATOM 7982  N N   . THR C 1 277 ? -3.799  -9.883  70.029   1.00 10.00 ? ? ? ? ? ? 278 THR C N   1 
ATOM 7983  C CA  . THR C 1 277 ? -4.512  -10.731 70.990   1.00 10.00 ? ? ? ? ? ? 278 THR C CA  1 
ATOM 7984  C C   . THR C 1 277 ? -3.825  -10.644 72.371   1.00 10.00 ? ? ? ? ? ? 278 THR C C   1 
ATOM 7985  O O   . THR C 1 277 ? -4.374  -10.220 73.385   1.00 10.00 ? ? ? ? ? ? 278 THR C O   1 
ATOM 7986  C CB  . THR C 1 277 ? -4.488  -12.137 70.383   1.00 10.00 ? ? ? ? ? ? 278 THR C CB  1 
ATOM 7987  O OG1 . THR C 1 277 ? -5.146  -11.968 69.133   1.00 10.00 ? ? ? ? ? ? 278 THR C OG1 1 
ATOM 7988  C CG2 . THR C 1 277 ? -5.149  -13.241 71.217   1.00 10.00 ? ? ? ? ? ? 278 THR C CG2 1 
ATOM 7989  N N   . PHE C 1 278 ? -2.519  -10.866 72.457   1.00 10.00 ? ? ? ? ? ? 279 PHE C N   1 
ATOM 7990  C CA  . PHE C 1 278 ? -1.756  -10.748 73.706   1.00 10.00 ? ? ? ? ? ? 279 PHE C CA  1 
ATOM 7991  C C   . PHE C 1 278 ? -1.789  -9.358  74.332   1.00 10.00 ? ? ? ? ? ? 279 PHE C C   1 
ATOM 7992  O O   . PHE C 1 278 ? -1.657  -9.226  75.551   1.00 10.00 ? ? ? ? ? ? 279 PHE C O   1 
ATOM 7993  C CB  . PHE C 1 278 ? -0.287  -11.187 73.424   1.00 10.00 ? ? ? ? ? ? 279 PHE C CB  1 
ATOM 7994  C CG  . PHE C 1 278 ? 0.674   -11.050 74.605   1.00 10.00 ? ? ? ? ? ? 279 PHE C CG  1 
ATOM 7995  C CD1 . PHE C 1 278 ? 1.371   -9.849  74.802   1.00 10.00 ? ? ? ? ? ? 279 PHE C CD1 1 
ATOM 7996  C CD2 . PHE C 1 278 ? 0.852   -12.105 75.483   1.00 10.00 ? ? ? ? ? ? 279 PHE C CD2 1 
ATOM 7997  C CE1 . PHE C 1 278 ? 2.236   -9.708  75.877   1.00 10.00 ? ? ? ? ? ? 279 PHE C CE1 1 
ATOM 7998  C CE2 . PHE C 1 278 ? 1.726   -11.931 76.543   1.00 10.00 ? ? ? ? ? ? 279 PHE C CE2 1 
ATOM 7999  C CZ  . PHE C 1 278 ? 2.418   -10.742 76.747   1.00 10.00 ? ? ? ? ? ? 279 PHE C CZ  1 
ATOM 8000  N N   . ASN C 1 279 ? -1.931  -8.276  73.619   1.00 10.00 ? ? ? ? ? ? 280 ASN C N   1 
ATOM 8001  C CA  . ASN C 1 279 ? -1.868  -7.006  74.296   1.00 10.00 ? ? ? ? ? ? 280 ASN C CA  1 
ATOM 8002  C C   . ASN C 1 279 ? -3.253  -6.629  74.752   1.00 10.00 ? ? ? ? ? ? 280 ASN C C   1 
ATOM 8003  O O   . ASN C 1 279 ? -3.304  -5.720  75.568   1.00 10.00 ? ? ? ? ? ? 280 ASN C O   1 
ATOM 8004  C CB  . ASN C 1 279 ? -1.407  -5.830  73.453   1.00 10.00 ? ? ? ? ? ? 280 ASN C CB  1 
ATOM 8005  C CG  . ASN C 1 279 ? 0.031   -5.803  72.962   1.00 10.00 ? ? ? ? ? ? 280 ASN C CG  1 
ATOM 8006  O OD1 . ASN C 1 279 ? 0.348   -5.017  72.061   1.00 10.00 ? ? ? ? ? ? 280 ASN C OD1 1 
ATOM 8007  N ND2 . ASN C 1 279 ? 0.960   -6.616  73.465   1.00 10.00 ? ? ? ? ? ? 280 ASN C ND2 1 
ATOM 8008  N N   . SER C 1 280 ? -4.362  -7.228  74.280   1.00 10.00 ? ? ? ? ? ? 281 SER C N   1 
ATOM 8009  C CA  . SER C 1 280 ? -5.703  -6.952  74.804   1.00 10.00 ? ? ? ? ? ? 281 SER C CA  1 
ATOM 8010  C C   . SER C 1 280 ? -5.816  -7.724  76.107   1.00 10.00 ? ? ? ? ? ? 281 SER C C   1 
ATOM 8011  O O   . SER C 1 280 ? -6.105  -7.165  77.140   1.00 10.00 ? ? ? ? ? ? 281 SER C O   1 
ATOM 8012  C CB  . SER C 1 280 ? -6.793  -7.412  73.798   1.00 10.00 ? ? ? ? ? ? 281 SER C CB  1 
ATOM 8013  O OG  . SER C 1 280 ? -6.840  -6.549  72.673   1.00 10.00 ? ? ? ? ? ? 281 SER C OG  1 
ATOM 8014  N N   . ILE C 1 281 ? -5.521  -8.999  76.114   1.00 10.00 ? ? ? ? ? ? 282 ILE C N   1 
ATOM 8015  C CA  . ILE C 1 281 ? -5.402  -9.849  77.295   1.00 10.00 ? ? ? ? ? ? 282 ILE C CA  1 
ATOM 8016  C C   . ILE C 1 281 ? -4.612  -9.138  78.365   1.00 10.00 ? ? ? ? ? ? 282 ILE C C   1 
ATOM 8017  O O   . ILE C 1 281 ? -5.048  -9.181  79.494   1.00 10.00 ? ? ? ? ? ? 282 ILE C O   1 
ATOM 8018  C CB  . ILE C 1 281 ? -4.677  -11.166 76.943   1.00 10.00 ? ? ? ? ? ? 282 ILE C CB  1 
ATOM 8019  C CG1 . ILE C 1 281 ? -5.674  -12.077 76.324   1.00 10.00 ? ? ? ? ? ? 282 ILE C CG1 1 
ATOM 8020  C CG2 . ILE C 1 281 ? -4.028  -11.792 78.136   1.00 10.00 ? ? ? ? ? ? 282 ILE C CG2 1 
ATOM 8021  C CD1 . ILE C 1 281 ? -5.101  -13.352 75.756   1.00 10.00 ? ? ? ? ? ? 282 ILE C CD1 1 
ATOM 8022  N N   . MET C 1 282 ? -3.523  -8.458  78.131   1.00 10.00 ? ? ? ? ? ? 283 MET C N   1 
ATOM 8023  C CA  . MET C 1 282 ? -2.838  -7.836  79.222   1.00 10.00 ? ? ? ? ? ? 283 MET C CA  1 
ATOM 8024  C C   . MET C 1 282 ? -3.494  -6.617  79.849   1.00 10.00 ? ? ? ? ? ? 283 MET C C   1 
ATOM 8025  O O   . MET C 1 282 ? -3.116  -6.163  80.932   1.00 10.00 ? ? ? ? ? ? 283 MET C O   1 
ATOM 8026  C CB  . MET C 1 282 ? -1.498  -7.538  78.688   1.00 10.00 ? ? ? ? ? ? 283 MET C CB  1 
ATOM 8027  C CG  . MET C 1 282 ? -0.855  -8.905  78.465   1.00 10.00 ? ? ? ? ? ? 283 MET C CG  1 
ATOM 8028  S SD  . MET C 1 282 ? -0.354  -9.747  79.994   1.00 10.00 ? ? ? ? ? ? 283 MET C SD  1 
ATOM 8029  C CE  . MET C 1 282 ? 0.503   -8.305  80.641   1.00 10.00 ? ? ? ? ? ? 283 MET C CE  1 
ATOM 8030  N N   . LYS C 1 283 ? -4.491  -6.076  79.163   1.00 10.00 ? ? ? ? ? ? 284 LYS C N   1 
ATOM 8031  C CA  . LYS C 1 283 ? -5.230  -4.880  79.513   1.00 10.00 ? ? ? ? ? ? 284 LYS C CA  1 
ATOM 8032  C C   . LYS C 1 283 ? -6.485  -5.208  80.306   1.00 10.00 ? ? ? ? ? ? 284 LYS C C   1 
ATOM 8033  O O   . LYS C 1 283 ? -7.230  -4.337  80.785   1.00 10.00 ? ? ? ? ? ? 284 LYS C O   1 
ATOM 8034  C CB  . LYS C 1 283 ? -5.605  -4.147  78.222   1.00 10.00 ? ? ? ? ? ? 284 LYS C CB  1 
ATOM 8035  C CG  . LYS C 1 283 ? -4.553  -3.158  77.725   1.00 10.00 ? ? ? ? ? ? 284 LYS C CG  1 
ATOM 8036  C CD  . LYS C 1 283 ? -5.012  -2.555  76.427   1.00 10.00 ? ? ? ? ? ? 284 LYS C CD  1 
ATOM 8037  C CE  . LYS C 1 283 ? -4.373  -1.196  76.289   1.00 10.00 ? ? ? ? ? ? 284 LYS C CE  1 
ATOM 8038  N NZ  . LYS C 1 283 ? -5.057  -0.248  77.153   1.00 10.00 ? ? ? ? ? ? 284 LYS C NZ  1 
ATOM 8039  N N   . CYS C 1 284 ? -6.810  -6.488  80.392   1.00 10.00 ? ? ? ? ? ? 285 CYS C N   1 
ATOM 8040  C CA  . CYS C 1 284 ? -7.991  -6.918  81.128   1.00 10.00 ? ? ? ? ? ? 285 CYS C CA  1 
ATOM 8041  C C   . CYS C 1 284 ? -7.731  -7.197  82.637   1.00 10.00 ? ? ? ? ? ? 285 CYS C C   1 
ATOM 8042  O O   . CYS C 1 284 ? -6.617  -7.246  83.163   1.00 10.00 ? ? ? ? ? ? 285 CYS C O   1 
ATOM 8043  C CB  . CYS C 1 284 ? -8.506  -8.169  80.444   1.00 10.00 ? ? ? ? ? ? 285 CYS C CB  1 
ATOM 8044  S SG  . CYS C 1 284 ? -8.978  -8.013  78.716   1.00 10.00 ? ? ? ? ? ? 285 CYS C SG  1 
ATOM 8045  N N   . ASP C 1 285 ? -8.812  -7.395  83.361   1.00 10.00 ? ? ? ? ? ? 286 ASP C N   1 
ATOM 8046  C CA  . ASP C 1 285 ? -8.827  -7.809  84.739   1.00 10.00 ? ? ? ? ? ? 286 ASP C CA  1 
ATOM 8047  C C   . ASP C 1 285 ? -7.963  -9.023  84.924   1.00 10.00 ? ? ? ? ? ? 286 ASP C C   1 
ATOM 8048  O O   . ASP C 1 285 ? -8.233  -10.086 84.380   1.00 10.00 ? ? ? ? ? ? 286 ASP C O   1 
ATOM 8049  C CB  . ASP C 1 285 ? -10.237 -8.181  85.171   1.00 10.00 ? ? ? ? ? ? 286 ASP C CB  1 
ATOM 8050  C CG  . ASP C 1 285 ? -10.431 -8.057  86.665   1.00 10.00 ? ? ? ? ? ? 286 ASP C CG  1 
ATOM 8051  O OD1 . ASP C 1 285 ? -9.715  -8.651  87.478   1.00 10.00 ? ? ? ? ? ? 286 ASP C OD1 1 
ATOM 8052  O OD2 . ASP C 1 285 ? -11.351 -7.340  87.027   1.00 10.00 ? ? ? ? ? ? 286 ASP C OD2 1 
ATOM 8053  N N   . VAL C 1 286 ? -7.060  -8.879  85.872   1.00 10.00 ? ? ? ? ? ? 287 VAL C N   1 
ATOM 8054  C CA  . VAL C 1 286 ? -6.144  -9.911  86.286   1.00 10.00 ? ? ? ? ? ? 287 VAL C CA  1 
ATOM 8055  C C   . VAL C 1 286 ? -6.831  -11.237 86.485   1.00 10.00 ? ? ? ? ? ? 287 VAL C C   1 
ATOM 8056  O O   . VAL C 1 286 ? -6.268  -12.253 86.129   1.00 10.00 ? ? ? ? ? ? 287 VAL C O   1 
ATOM 8057  C CB  . VAL C 1 286 ? -5.481  -9.393  87.560   1.00 10.00 ? ? ? ? ? ? 287 VAL C CB  1 
ATOM 8058  C CG1 . VAL C 1 286 ? -4.593  -10.411 88.182   1.00 10.00 ? ? ? ? ? ? 287 VAL C CG1 1 
ATOM 8059  C CG2 . VAL C 1 286 ? -4.537  -8.296  87.225   1.00 10.00 ? ? ? ? ? ? 287 VAL C CG2 1 
ATOM 8060  N N   . ASP C 1 287 ? -8.077  -11.281 86.960   1.00 10.00 ? ? ? ? ? ? 288 ASP C N   1 
ATOM 8061  C CA  . ASP C 1 287 ? -8.755  -12.563 87.265   1.00 10.00 ? ? ? ? ? ? 288 ASP C CA  1 
ATOM 8062  C C   . ASP C 1 287 ? -9.558  -13.130 86.058   1.00 10.00 ? ? ? ? ? ? 288 ASP C C   1 
ATOM 8063  O O   . ASP C 1 287 ? -10.305 -14.127 86.216   1.00 10.00 ? ? ? ? ? ? 288 ASP C O   1 
ATOM 8064  C CB  . ASP C 1 287 ? -9.742  -12.435 88.514   1.00 10.00 ? ? ? ? ? ? 288 ASP C CB  1 
ATOM 8065  C CG  . ASP C 1 287 ? -9.264  -11.862 89.885   1.00 10.00 ? ? ? ? ? ? 288 ASP C CG  1 
ATOM 8066  O OD1 . ASP C 1 287 ? -8.561  -12.551 90.660   1.00 10.00 ? ? ? ? ? ? 288 ASP C OD1 1 
ATOM 8067  O OD2 . ASP C 1 287 ? -9.638  -10.712 90.185   1.00 10.00 ? ? ? ? ? ? 288 ASP C OD2 1 
ATOM 8068  N N   . ILE C 1 288 ? -9.532  -12.554 84.834   1.00 10.00 ? ? ? ? ? ? 289 ILE C N   1 
ATOM 8069  C CA  . ILE C 1 288 ? -10.213 -13.238 83.767   1.00 10.00 ? ? ? ? ? ? 289 ILE C CA  1 
ATOM 8070  C C   . ILE C 1 288 ? -9.215  -13.633 82.736   1.00 10.00 ? ? ? ? ? ? 289 ILE C C   1 
ATOM 8071  O O   . ILE C 1 288 ? -9.480  -14.512 81.948   1.00 10.00 ? ? ? ? ? ? 289 ILE C O   1 
ATOM 8072  C CB  . ILE C 1 288 ? -11.342 -12.383 83.170   1.00 10.00 ? ? ? ? ? ? 289 ILE C CB  1 
ATOM 8073  C CG1 . ILE C 1 288 ? -11.019 -10.971 82.794   1.00 10.00 ? ? ? ? ? ? 289 ILE C CG1 1 
ATOM 8074  C CG2 . ILE C 1 288 ? -12.363 -12.348 84.283   1.00 10.00 ? ? ? ? ? ? 289 ILE C CG2 1 
ATOM 8075  C CD1 . ILE C 1 288 ? -12.257 -10.085 82.572   1.00 10.00 ? ? ? ? ? ? 289 ILE C CD1 1 
ATOM 8076  N N   . ARG C 1 289 ? -7.978  -13.170 82.749   1.00 10.00 ? ? ? ? ? ? 290 ARG C N   1 
ATOM 8077  C CA  . ARG C 1 289 ? -6.955  -13.497 81.765   1.00 10.00 ? ? ? ? ? ? 290 ARG C CA  1 
ATOM 8078  C C   . ARG C 1 289 ? -6.830  -14.982 81.488   1.00 10.00 ? ? ? ? ? ? 290 ARG C C   1 
ATOM 8079  O O   . ARG C 1 289 ? -6.797  -15.425 80.334   1.00 10.00 ? ? ? ? ? ? 290 ARG C O   1 
ATOM 8080  C CB  . ARG C 1 289 ? -5.580  -12.984 82.212   1.00 10.00 ? ? ? ? ? ? 290 ARG C CB  1 
ATOM 8081  C CG  . ARG C 1 289 ? -5.495  -11.501 82.246   1.00 10.00 ? ? ? ? ? ? 290 ARG C CG  1 
ATOM 8082  C CD  . ARG C 1 289 ? -4.126  -10.985 82.573   1.00 10.00 ? ? ? ? ? ? 290 ARG C CD  1 
ATOM 8083  N NE  . ARG C 1 289 ? -4.345  -9.564  82.745   1.00 10.00 ? ? ? ? ? ? 290 ARG C NE  1 
ATOM 8084  C CZ  . ARG C 1 289 ? -3.437  -8.706  83.207   1.00 10.00 ? ? ? ? ? ? 290 ARG C CZ  1 
ATOM 8085  N NH1 . ARG C 1 289 ? -2.205  -9.024  83.569   1.00 10.00 ? ? ? ? ? ? 290 ARG C NH1 1 
ATOM 8086  N NH2 . ARG C 1 289 ? -3.783  -7.443  83.344   1.00 10.00 ? ? ? ? ? ? 290 ARG C NH2 1 
ATOM 8087  N N   . LYS C 1 290 ? -6.868  -15.786 82.546   1.00 10.00 ? ? ? ? ? ? 291 LYS C N   1 
ATOM 8088  C CA  . LYS C 1 290 ? -6.715  -17.216 82.362   1.00 10.00 ? ? ? ? ? ? 291 LYS C CA  1 
ATOM 8089  C C   . LYS C 1 290 ? -7.889  -17.725 81.561   1.00 10.00 ? ? ? ? ? ? 291 LYS C C   1 
ATOM 8090  O O   . LYS C 1 290 ? -7.795  -18.739 80.877   1.00 10.00 ? ? ? ? ? ? 291 LYS C O   1 
ATOM 8091  C CB  . LYS C 1 290 ? -6.659  -17.971 83.689   1.00 10.00 ? ? ? ? ? ? 291 LYS C CB  1 
ATOM 8092  C CG  . LYS C 1 290 ? -7.810  -17.888 84.724   1.00 10.00 ? ? ? ? ? ? 291 LYS C CG  1 
ATOM 8093  C CD  . LYS C 1 290 ? -7.945  -16.598 85.609   1.00 10.00 ? ? ? ? ? ? 291 LYS C CD  1 
ATOM 8094  C CE  . LYS C 1 290 ? -6.706  -16.089 86.399   1.00 10.00 ? ? ? ? ? ? 291 LYS C CE  1 
ATOM 8095  N NZ  . LYS C 1 290 ? -6.298  -14.774 85.895   1.00 10.00 ? ? ? ? ? ? 291 LYS C NZ  1 
ATOM 8096  N N   . ASP C 1 291 ? -9.012  -17.029 81.606   1.00 10.00 ? ? ? ? ? ? 292 ASP C N   1 
ATOM 8097  C CA  . ASP C 1 291 ? -10.160 -17.433 80.856   1.00 10.00 ? ? ? ? ? ? 292 ASP C CA  1 
ATOM 8098  C C   . ASP C 1 291 ? -10.002 -17.019 79.421   1.00 10.00 ? ? ? ? ? ? 292 ASP C C   1 
ATOM 8099  O O   . ASP C 1 291 ? -10.352 -17.785 78.523   1.00 10.00 ? ? ? ? ? ? 292 ASP C O   1 
ATOM 8100  C CB  . ASP C 1 291 ? -11.439 -16.817 81.471   1.00 10.00 ? ? ? ? ? ? 292 ASP C CB  1 
ATOM 8101  C CG  . ASP C 1 291 ? -11.909 -17.532 82.726   1.00 10.00 ? ? ? ? ? ? 292 ASP C CG  1 
ATOM 8102  O OD1 . ASP C 1 291 ? -12.084 -18.750 82.703   1.00 10.00 ? ? ? ? ? ? 292 ASP C OD1 1 
ATOM 8103  O OD2 . ASP C 1 291 ? -12.098 -16.865 83.737   1.00 10.00 ? ? ? ? ? ? 292 ASP C OD2 1 
ATOM 8104  N N   . LEU C 1 292 ? -9.477  -15.820 79.207   1.00 10.00 ? ? ? ? ? ? 293 LEU C N   1 
ATOM 8105  C CA  . LEU C 1 292 ? -9.246  -15.308 77.856   1.00 10.00 ? ? ? ? ? ? 293 LEU C CA  1 
ATOM 8106  C C   . LEU C 1 292 ? -8.168  -16.157 77.098   1.00 10.00 ? ? ? ? ? ? 293 LEU C C   1 
ATOM 8107  O O   . LEU C 1 292 ? -8.352  -16.491 75.908   1.00 10.00 ? ? ? ? ? ? 293 LEU C O   1 
ATOM 8108  C CB  . LEU C 1 292 ? -8.825  -13.882 77.987   1.00 10.00 ? ? ? ? ? ? 293 LEU C CB  1 
ATOM 8109  C CG  . LEU C 1 292 ? -9.714  -12.927 78.686   1.00 10.00 ? ? ? ? ? ? 293 LEU C CG  1 
ATOM 8110  C CD1 . LEU C 1 292 ? -9.142  -11.557 78.481   1.00 10.00 ? ? ? ? ? ? 293 LEU C CD1 1 
ATOM 8111  C CD2 . LEU C 1 292 ? -11.104 -12.995 78.138   1.00 10.00 ? ? ? ? ? ? 293 LEU C CD2 1 
ATOM 8112  N N   . TYR C 1 293 ? -7.070  -16.664 77.702   1.00 10.00 ? ? ? ? ? ? 294 TYR C N   1 
ATOM 8113  C CA  . TYR C 1 293 ? -6.204  -17.604 76.989   1.00 10.00 ? ? ? ? ? ? 294 TYR C CA  1 
ATOM 8114  C C   . TYR C 1 293 ? -6.807  -18.949 76.647   1.00 10.00 ? ? ? ? ? ? 294 TYR C C   1 
ATOM 8115  O O   . TYR C 1 293 ? -6.401  -19.625 75.713   1.00 10.00 ? ? ? ? ? ? 294 TYR C O   1 
ATOM 8116  C CB  . TYR C 1 293 ? -4.970  -17.893 77.775   1.00 10.00 ? ? ? ? ? ? 294 TYR C CB  1 
ATOM 8117  C CG  . TYR C 1 293 ? -3.996  -16.755 77.767   1.00 10.00 ? ? ? ? ? ? 294 TYR C CG  1 
ATOM 8118  C CD1 . TYR C 1 293 ? -3.107  -16.585 76.730   1.00 10.00 ? ? ? ? ? ? 294 TYR C CD1 1 
ATOM 8119  C CD2 . TYR C 1 293 ? -3.957  -15.935 78.858   1.00 10.00 ? ? ? ? ? ? 294 TYR C CD2 1 
ATOM 8120  C CE1 . TYR C 1 293 ? -2.162  -15.579 76.806   1.00 10.00 ? ? ? ? ? ? 294 TYR C CE1 1 
ATOM 8121  C CE2 . TYR C 1 293 ? -3.004  -14.936 78.935   1.00 10.00 ? ? ? ? ? ? 294 TYR C CE2 1 
ATOM 8122  C CZ  . TYR C 1 293 ? -2.110  -14.766 77.915   1.00 10.00 ? ? ? ? ? ? 294 TYR C CZ  1 
ATOM 8123  O OH  . TYR C 1 293 ? -1.131  -13.795 78.060   1.00 10.00 ? ? ? ? ? ? 294 TYR C OH  1 
ATOM 8124  N N   . ALA C 1 294 ? -7.730  -19.458 77.432   1.00 10.00 ? ? ? ? ? ? 295 ALA C N   1 
ATOM 8125  C CA  . ALA C 1 294 ? -8.354  -20.748 77.188   1.00 10.00 ? ? ? ? ? ? 295 ALA C CA  1 
ATOM 8126  C C   . ALA C 1 294 ? -9.427  -20.679 76.128   1.00 10.00 ? ? ? ? ? ? 295 ALA C C   1 
ATOM 8127  O O   . ALA C 1 294 ? -9.929  -21.712 75.679   1.00 10.00 ? ? ? ? ? ? 295 ALA C O   1 
ATOM 8128  C CB  . ALA C 1 294 ? -9.024  -21.239 78.437   1.00 10.00 ? ? ? ? ? ? 295 ALA C CB  1 
ATOM 8129  N N   . ASN C 1 295 ? -9.820  -19.443 75.762   1.00 10.00 ? ? ? ? ? ? 296 ASN C N   1 
ATOM 8130  C CA  . ASN C 1 295 ? -10.923 -19.212 74.843   1.00 10.00 ? ? ? ? ? ? 296 ASN C CA  1 
ATOM 8131  C C   . ASN C 1 295 ? -10.539 -18.119 73.857   1.00 10.00 ? ? ? ? ? ? 296 ASN C C   1 
ATOM 8132  O O   . ASN C 1 295 ? -10.968 -16.969 73.936   1.00 10.00 ? ? ? ? ? ? 296 ASN C O   1 
ATOM 8133  C CB  . ASN C 1 295 ? -12.123 -18.819 75.666   1.00 10.00 ? ? ? ? ? ? 296 ASN C CB  1 
ATOM 8134  C CG  . ASN C 1 295 ? -12.576 -19.889 76.647   1.00 10.00 ? ? ? ? ? ? 296 ASN C CG  1 
ATOM 8135  O OD1 . ASN C 1 295 ? -13.302 -20.825 76.305   1.00 10.00 ? ? ? ? ? ? 296 ASN C OD1 1 
ATOM 8136  N ND2 . ASN C 1 295 ? -12.148 -19.830 77.902   1.00 10.00 ? ? ? ? ? ? 296 ASN C ND2 1 
ATOM 8137  N N   . THR C 1 296 ? -9.576  -18.420 72.998   1.00 10.00 ? ? ? ? ? ? 297 THR C N   1 
ATOM 8138  C CA  . THR C 1 296 ? -9.211  -17.503 71.953   1.00 10.00 ? ? ? ? ? ? 297 THR C CA  1 
ATOM 8139  C C   . THR C 1 296 ? -9.970  -18.084 70.780   1.00 10.00 ? ? ? ? ? ? 297 THR C C   1 
ATOM 8140  O O   . THR C 1 296 ? -9.758  -19.255 70.440   1.00 10.00 ? ? ? ? ? ? 297 THR C O   1 
ATOM 8141  C CB  . THR C 1 296 ? -7.709  -17.548 71.814   1.00 10.00 ? ? ? ? ? ? 297 THR C CB  1 
ATOM 8142  O OG1 . THR C 1 296 ? -7.216  -17.039 73.020   1.00 10.00 ? ? ? ? ? ? 297 THR C OG1 1 
ATOM 8143  C CG2 . THR C 1 296 ? -7.121  -16.590 70.823   1.00 10.00 ? ? ? ? ? ? 297 THR C CG2 1 
ATOM 8144  N N   . VAL C 1 297 ? -10.942 -17.337 70.228   1.00 10.00 ? ? ? ? ? ? 298 VAL C N   1 
ATOM 8145  C CA  . VAL C 1 297 ? -11.800 -17.758 69.110   1.00 10.00 ? ? ? ? ? ? 298 VAL C CA  1 
ATOM 8146  C C   . VAL C 1 297 ? -11.467 -16.848 67.932   1.00 10.00 ? ? ? ? ? ? 298 VAL C C   1 
ATOM 8147  O O   . VAL C 1 297 ? -11.242 -15.624 68.087   1.00 10.00 ? ? ? ? ? ? 298 VAL C O   1 
ATOM 8148  C CB  . VAL C 1 297 ? -13.326 -17.603 69.453   1.00 10.00 ? ? ? ? ? ? 298 VAL C CB  1 
ATOM 8149  C CG1 . VAL C 1 297 ? -14.115 -18.191 68.288   1.00 10.00 ? ? ? ? ? ? 298 VAL C CG1 1 
ATOM 8150  C CG2 . VAL C 1 297 ? -13.690 -18.236 70.842   1.00 10.00 ? ? ? ? ? ? 298 VAL C CG2 1 
ATOM 8151  N N   . LEU C 1 298 ? -11.389 -17.434 66.743   1.00 10.00 ? ? ? ? ? ? 299 LEU C N   1 
ATOM 8152  C CA  . LEU C 1 298 ? -11.082 -16.623 65.578   1.00 10.00 ? ? ? ? ? ? 299 LEU C CA  1 
ATOM 8153  C C   . LEU C 1 298 ? -12.378 -16.481 64.801   1.00 10.00 ? ? ? ? ? ? 299 LEU C C   1 
ATOM 8154  O O   . LEU C 1 298 ? -13.164 -17.452 64.783   1.00 10.00 ? ? ? ? ? ? 299 LEU C O   1 
ATOM 8155  C CB  . LEU C 1 298 ? -9.982  -17.314 64.716   1.00 10.00 ? ? ? ? ? ? 299 LEU C CB  1 
ATOM 8156  C CG  . LEU C 1 298 ? -8.703  -17.879 65.360   1.00 10.00 ? ? ? ? ? ? 299 LEU C CG  1 
ATOM 8157  C CD1 . LEU C 1 298 ? -7.726  -18.314 64.272   1.00 10.00 ? ? ? ? ? ? 299 LEU C CD1 1 
ATOM 8158  C CD2 . LEU C 1 298 ? -8.044  -16.831 66.245   1.00 10.00 ? ? ? ? ? ? 299 LEU C CD2 1 
ATOM 8159  N N   . SER C 1 299 ? -12.690 -15.318 64.234   1.00 10.00 ? ? ? ? ? ? 300 SER C N   1 
ATOM 8160  C CA  . SER C 1 299 ? -13.866 -15.309 63.400   1.00 10.00 ? ? ? ? ? ? 300 SER C CA  1 
ATOM 8161  C C   . SER C 1 299 ? -13.672 -14.433 62.204   1.00 10.00 ? ? ? ? ? ? 300 SER C C   1 
ATOM 8162  O O   . SER C 1 299 ? -12.736 -13.630 62.278   1.00 10.00 ? ? ? ? ? ? 300 SER C O   1 
ATOM 8163  C CB  . SER C 1 299 ? -15.007 -14.838 64.191   1.00 10.00 ? ? ? ? ? ? 300 SER C CB  1 
ATOM 8164  O OG  . SER C 1 299 ? -15.019 -13.462 64.547   1.00 10.00 ? ? ? ? ? ? 300 SER C OG  1 
ATOM 8165  N N   . GLY C 1 300 ? -14.414 -14.490 61.104   1.00 10.00 ? ? ? ? ? ? 301 GLY C N   1 
ATOM 8166  C CA  . GLY C 1 300 ? -14.202 -13.582 59.944   1.00 10.00 ? ? ? ? ? ? 301 GLY C CA  1 
ATOM 8167  C C   . GLY C 1 300 ? -13.612 -14.286 58.738   1.00 10.00 ? ? ? ? ? ? 301 GLY C C   1 
ATOM 8168  O O   . GLY C 1 300 ? -12.931 -15.293 58.966   1.00 10.00 ? ? ? ? ? ? 301 GLY C O   1 
ATOM 8169  N N   . GLY C 1 301 ? -13.812 -13.850 57.487   1.00 10.00 ? ? ? ? ? ? 302 GLY C N   1 
ATOM 8170  C CA  . GLY C 1 301 ? -13.236 -14.460 56.285   1.00 10.00 ? ? ? ? ? ? 302 GLY C CA  1 
ATOM 8171  C C   . GLY C 1 301 ? -11.701 -14.526 56.288   1.00 10.00 ? ? ? ? ? ? 302 GLY C C   1 
ATOM 8172  O O   . GLY C 1 301 ? -11.109 -15.569 56.004   1.00 10.00 ? ? ? ? ? ? 302 GLY C O   1 
ATOM 8173  N N   . THR C 1 302 ? -10.951 -13.526 56.730   1.00 10.00 ? ? ? ? ? ? 303 THR C N   1 
ATOM 8174  C CA  . THR C 1 302 ? -9.499  -13.580 56.703   1.00 10.00 ? ? ? ? ? ? 303 THR C CA  1 
ATOM 8175  C C   . THR C 1 302 ? -8.979  -14.593 57.749   1.00 10.00 ? ? ? ? ? ? 303 THR C C   1 
ATOM 8176  O O   . THR C 1 302 ? -7.763  -14.768 57.908   1.00 10.00 ? ? ? ? ? ? 303 THR C O   1 
ATOM 8177  C CB  . THR C 1 302 ? -9.036  -12.060 56.886   1.00 10.00 ? ? ? ? ? ? 303 THR C CB  1 
ATOM 8178  O OG1 . THR C 1 302 ? -9.453  -11.367 55.714   1.00 10.00 ? ? ? ? ? ? 303 THR C OG1 1 
ATOM 8179  C CG2 . THR C 1 302 ? -7.543  -11.793 56.963   1.00 10.00 ? ? ? ? ? ? 303 THR C CG2 1 
ATOM 8180  N N   . THR C 1 303 ? -9.802  -15.348 58.523   1.00 10.00 ? ? ? ? ? ? 304 THR C N   1 
ATOM 8181  C CA  . THR C 1 303 ? -9.253  -16.324 59.492   1.00 10.00 ? ? ? ? ? ? 304 THR C CA  1 
ATOM 8182  C C   . THR C 1 303 ? -9.372  -17.715 58.883   1.00 10.00 ? ? ? ? ? ? 304 THR C C   1 
ATOM 8183  O O   . THR C 1 303 ? -9.125  -18.746 59.498   1.00 10.00 ? ? ? ? ? ? 304 THR C O   1 
ATOM 8184  C CB  . THR C 1 303 ? -9.996  -16.378 60.905   1.00 10.00 ? ? ? ? ? ? 304 THR C CB  1 
ATOM 8185  O OG1 . THR C 1 303 ? -11.304 -16.830 60.690   1.00 10.00 ? ? ? ? ? ? 304 THR C OG1 1 
ATOM 8186  C CG2 . THR C 1 303 ? -10.057 -15.065 61.612   1.00 10.00 ? ? ? ? ? ? 304 THR C CG2 1 
ATOM 8187  N N   . MET C 1 304 ? -9.756  -17.749 57.623   1.00 10.00 ? ? ? ? ? ? 305 MET C N   1 
ATOM 8188  C CA  . MET C 1 304 ? -9.996  -19.019 57.000   1.00 10.00 ? ? ? ? ? ? 305 MET C CA  1 
ATOM 8189  C C   . MET C 1 304 ? -8.751  -19.706 56.431   1.00 10.00 ? ? ? ? ? ? 305 MET C C   1 
ATOM 8190  O O   . MET C 1 304 ? -8.835  -20.814 55.908   1.00 10.00 ? ? ? ? ? ? 305 MET C O   1 
ATOM 8191  C CB  . MET C 1 304 ? -11.053 -18.745 55.949   1.00 10.00 ? ? ? ? ? ? 305 MET C CB  1 
ATOM 8192  C CG  . MET C 1 304 ? -12.372 -18.356 56.528   1.00 10.00 ? ? ? ? ? ? 305 MET C CG  1 
ATOM 8193  S SD  . MET C 1 304 ? -13.093 -19.842 57.234   1.00 10.00 ? ? ? ? ? ? 305 MET C SD  1 
ATOM 8194  C CE  . MET C 1 304 ? -14.057 -20.266 55.807   1.00 10.00 ? ? ? ? ? ? 305 MET C CE  1 
ATOM 8195  N N   . TYR C 1 305 ? -7.580  -19.094 56.500   1.00 10.00 ? ? ? ? ? ? 306 TYR C N   1 
ATOM 8196  C CA  . TYR C 1 305 ? -6.370  -19.615 55.913   1.00 10.00 ? ? ? ? ? ? 306 TYR C CA  1 
ATOM 8197  C C   . TYR C 1 305 ? -5.933  -20.902 56.530   1.00 10.00 ? ? ? ? ? ? 306 TYR C C   1 
ATOM 8198  O O   . TYR C 1 305 ? -5.803  -20.874 57.754   1.00 10.00 ? ? ? ? ? ? 306 TYR C O   1 
ATOM 8199  C CB  . TYR C 1 305 ? -5.261  -18.659 56.105   1.00 10.00 ? ? ? ? ? ? 306 TYR C CB  1 
ATOM 8200  C CG  . TYR C 1 305 ? -5.445  -17.396 55.330   1.00 10.00 ? ? ? ? ? ? 306 TYR C CG  1 
ATOM 8201  C CD1 . TYR C 1 305 ? -5.665  -17.457 53.964   1.00 10.00 ? ? ? ? ? ? 306 TYR C CD1 1 
ATOM 8202  C CD2 . TYR C 1 305 ? -5.319  -16.207 55.953   1.00 10.00 ? ? ? ? ? ? 306 TYR C CD2 1 
ATOM 8203  C CE1 . TYR C 1 305 ? -5.747  -16.309 53.194   1.00 10.00 ? ? ? ? ? ? 306 TYR C CE1 1 
ATOM 8204  C CE2 . TYR C 1 305 ? -5.404  -15.056 55.199   1.00 10.00 ? ? ? ? ? ? 306 TYR C CE2 1 
ATOM 8205  C CZ  . TYR C 1 305 ? -5.612  -15.129 53.841   1.00 10.00 ? ? ? ? ? ? 306 TYR C CZ  1 
ATOM 8206  O OH  . TYR C 1 305 ? -5.682  -13.993 53.116   1.00 10.00 ? ? ? ? ? ? 306 TYR C OH  1 
ATOM 8207  N N   . PRO C 1 306 ? -5.633  -22.006 55.825   1.00 10.00 ? ? ? ? ? ? 307 PRO C N   1 
ATOM 8208  C CA  . PRO C 1 306 ? -4.939  -23.158 56.356   1.00 10.00 ? ? ? ? ? ? 307 PRO C CA  1 
ATOM 8209  C C   . PRO C 1 306 ? -3.651  -22.707 57.032   1.00 10.00 ? ? ? ? ? ? 307 PRO C C   1 
ATOM 8210  O O   . PRO C 1 306 ? -2.971  -21.775 56.572   1.00 10.00 ? ? ? ? ? ? 307 PRO C O   1 
ATOM 8211  C CB  . PRO C 1 306 ? -4.754  -24.040 55.160   1.00 10.00 ? ? ? ? ? ? 307 PRO C CB  1 
ATOM 8212  C CG  . PRO C 1 306 ? -6.041  -23.815 54.443   1.00 10.00 ? ? ? ? ? ? 307 PRO C CG  1 
ATOM 8213  C CD  . PRO C 1 306 ? -6.062  -22.291 54.457   1.00 10.00 ? ? ? ? ? ? 307 PRO C CD  1 
ATOM 8214  N N   . GLY C 1 307 ? -3.456  -23.365 58.205   1.00 10.00 ? ? ? ? ? ? 308 GLY C N   1 
ATOM 8215  C CA  . GLY C 1 307 ? -2.414  -23.091 59.178   1.00 10.00 ? ? ? ? ? ? 308 GLY C CA  1 
ATOM 8216  C C   . GLY C 1 307 ? -2.695  -21.962 60.182   1.00 10.00 ? ? ? ? ? ? 308 GLY C C   1 
ATOM 8217  O O   . GLY C 1 307 ? -1.923  -21.826 61.158   1.00 10.00 ? ? ? ? ? ? 308 GLY C O   1 
ATOM 8218  N N   . ILE C 1 308 ? -3.780  -21.155 60.111   1.00 10.00 ? ? ? ? ? ? 309 ILE C N   1 
ATOM 8219  C CA  . ILE C 1 308 ? -3.842  -20.000 61.013   1.00 10.00 ? ? ? ? ? ? 309 ILE C CA  1 
ATOM 8220  C C   . ILE C 1 308 ? -4.106  -20.369 62.457   1.00 10.00 ? ? ? ? ? ? 309 ILE C C   1 
ATOM 8221  O O   . ILE C 1 308 ? -3.544  -19.702 63.336   1.00 10.00 ? ? ? ? ? ? 309 ILE C O   1 
ATOM 8222  C CB  . ILE C 1 308 ? -4.888  -18.962 60.511   1.00 10.00 ? ? ? ? ? ? 309 ILE C CB  1 
ATOM 8223  C CG1 . ILE C 1 308 ? -4.367  -17.646 61.036   1.00 10.00 ? ? ? ? ? ? 309 ILE C CG1 1 
ATOM 8224  C CG2 . ILE C 1 308 ? -6.314  -19.233 60.920   1.00 10.00 ? ? ? ? ? ? 309 ILE C CG2 1 
ATOM 8225  C CD1 . ILE C 1 308 ? -5.040  -16.431 60.419   1.00 10.00 ? ? ? ? ? ? 309 ILE C CD1 1 
ATOM 8226  N N   . ALA C 1 309 ? -4.882  -21.417 62.750   1.00 10.00 ? ? ? ? ? ? 310 ALA C N   1 
ATOM 8227  C CA  . ALA C 1 309 ? -5.077  -21.869 64.130   1.00 10.00 ? ? ? ? ? ? 310 ALA C CA  1 
ATOM 8228  C C   . ALA C 1 309 ? -3.780  -22.309 64.746   1.00 10.00 ? ? ? ? ? ? 310 ALA C C   1 
ATOM 8229  O O   . ALA C 1 309 ? -3.444  -21.805 65.808   1.00 10.00 ? ? ? ? ? ? 310 ALA C O   1 
ATOM 8230  C CB  . ALA C 1 309 ? -6.032  -23.054 64.204   1.00 10.00 ? ? ? ? ? ? 310 ALA C CB  1 
ATOM 8231  N N   . ASP C 1 310 ? -3.052  -23.233 64.108   1.00 10.00 ? ? ? ? ? ? 311 ASP C N   1 
ATOM 8232  C CA  . ASP C 1 310 ? -1.721  -23.667 64.563   1.00 10.00 ? ? ? ? ? ? 311 ASP C CA  1 
ATOM 8233  C C   . ASP C 1 310 ? -0.715  -22.560 64.721   1.00 10.00 ? ? ? ? ? ? 311 ASP C C   1 
ATOM 8234  O O   . ASP C 1 310 ? 0.050   -22.580 65.674   1.00 10.00 ? ? ? ? ? ? 311 ASP C O   1 
ATOM 8235  C CB  . ASP C 1 310 ? -0.970  -24.588 63.637   1.00 10.00 ? ? ? ? ? ? 311 ASP C CB  1 
ATOM 8236  C CG  . ASP C 1 310 ? -1.679  -25.866 63.324   1.00 10.00 ? ? ? ? ? ? 311 ASP C CG  1 
ATOM 8237  O OD1 . ASP C 1 310 ? -1.487  -26.805 64.078   1.00 10.00 ? ? ? ? ? ? 311 ASP C OD1 1 
ATOM 8238  O OD2 . ASP C 1 310 ? -2.403  -25.913 62.340   1.00 10.00 ? ? ? ? ? ? 311 ASP C OD2 1 
ATOM 8239  N N   . ARG C 1 311 ? -0.631  -21.646 63.785   1.00 10.00 ? ? ? ? ? ? 312 ARG C N   1 
ATOM 8240  C CA  . ARG C 1 311 ? 0.335   -20.591 63.880   1.00 10.00 ? ? ? ? ? ? 312 ARG C CA  1 
ATOM 8241  C C   . ARG C 1 311 ? -0.093  -19.586 64.915   1.00 10.00 ? ? ? ? ? ? 312 ARG C C   1 
ATOM 8242  O O   . ARG C 1 311 ? 0.782   -18.975 65.513   1.00 10.00 ? ? ? ? ? ? 312 ARG C O   1 
ATOM 8243  C CB  . ARG C 1 311 ? 0.458   -19.965 62.534   1.00 10.00 ? ? ? ? ? ? 312 ARG C CB  1 
ATOM 8244  C CG  . ARG C 1 311 ? 1.278   -18.743 62.527   1.00 10.00 ? ? ? ? ? ? 312 ARG C CG  1 
ATOM 8245  C CD  . ARG C 1 311 ? 2.682   -19.096 62.850   1.00 10.00 ? ? ? ? ? ? 312 ARG C CD  1 
ATOM 8246  N NE  . ARG C 1 311 ? 3.366   -17.840 62.907   1.00 10.00 ? ? ? ? ? ? 312 ARG C NE  1 
ATOM 8247  C CZ  . ARG C 1 311 ? 3.755   -17.247 61.796   1.00 10.00 ? ? ? ? ? ? 312 ARG C CZ  1 
ATOM 8248  N NH1 . ARG C 1 311 ? 3.507   -17.860 60.655   1.00 10.00 ? ? ? ? ? ? 312 ARG C NH1 1 
ATOM 8249  N NH2 . ARG C 1 311 ? 4.252   -15.998 61.804   1.00 10.00 ? ? ? ? ? ? 312 ARG C NH2 1 
ATOM 8250  N N   . MET C 1 312 ? -1.377  -19.320 65.124   1.00 10.00 ? ? ? ? ? ? 313 MET C N   1 
ATOM 8251  C CA  . MET C 1 312 ? -1.830  -18.449 66.181   1.00 10.00 ? ? ? ? ? ? 313 MET C CA  1 
ATOM 8252  C C   . MET C 1 312 ? -1.441  -19.139 67.484   1.00 10.00 ? ? ? ? ? ? 313 MET C C   1 
ATOM 8253  O O   . MET C 1 312 ? -0.720  -18.532 68.263   1.00 10.00 ? ? ? ? ? ? 313 MET C O   1 
ATOM 8254  C CB  . MET C 1 312 ? -3.342  -18.258 66.039   1.00 10.00 ? ? ? ? ? ? 313 MET C CB  1 
ATOM 8255  C CG  . MET C 1 312 ? -3.521  -16.971 65.296   1.00 10.00 ? ? ? ? ? ? 313 MET C CG  1 
ATOM 8256  S SD  . MET C 1 312 ? -3.063  -15.650 66.457   1.00 10.00 ? ? ? ? ? ? 313 MET C SD  1 
ATOM 8257  C CE  . MET C 1 312 ? -4.650  -14.850 66.545   1.00 10.00 ? ? ? ? ? ? 313 MET C CE  1 
ATOM 8258  N N   . GLN C 1 313 ? -1.777  -20.401 67.732   1.00 10.00 ? ? ? ? ? ? 314 GLN C N   1 
ATOM 8259  C CA  . GLN C 1 313 ? -1.378  -21.173 68.899   1.00 10.00 ? ? ? ? ? ? 314 GLN C CA  1 
ATOM 8260  C C   . GLN C 1 313 ? 0.108   -21.082 69.135   1.00 10.00 ? ? ? ? ? ? 314 GLN C C   1 
ATOM 8261  O O   . GLN C 1 313 ? 0.450   -20.459 70.135   1.00 10.00 ? ? ? ? ? ? 314 GLN C O   1 
ATOM 8262  C CB  . GLN C 1 313 ? -1.827  -22.600 68.676   1.00 10.00 ? ? ? ? ? ? 314 GLN C CB  1 
ATOM 8263  C CG  . GLN C 1 313 ? -1.222  -23.704 69.481   1.00 10.00 ? ? ? ? ? ? 314 GLN C CG  1 
ATOM 8264  C CD  . GLN C 1 313 ? -1.513  -23.774 70.960   1.00 10.00 ? ? ? ? ? ? 314 GLN C CD  1 
ATOM 8265  O OE1 . GLN C 1 313 ? -0.600  -24.000 71.772   1.00 10.00 ? ? ? ? ? ? 314 GLN C OE1 1 
ATOM 8266  N NE2 . GLN C 1 313 ? -2.797  -23.659 71.303   1.00 10.00 ? ? ? ? ? ? 314 GLN C NE2 1 
ATOM 8267  N N   . LYS C 1 314 ? 0.993   -21.550 68.251   1.00 10.00 ? ? ? ? ? ? 315 LYS C N   1 
ATOM 8268  C CA  . LYS C 1 314 ? 2.442   -21.453 68.345   1.00 10.00 ? ? ? ? ? ? 315 LYS C CA  1 
ATOM 8269  C C   . LYS C 1 314 ? 2.908   -20.088 68.811   1.00 10.00 ? ? ? ? ? ? 315 LYS C C   1 
ATOM 8270  O O   . LYS C 1 314 ? 3.785   -19.952 69.673   1.00 10.00 ? ? ? ? ? ? 315 LYS C O   1 
ATOM 8271  C CB  . LYS C 1 314 ? 2.918   -21.817 66.954   1.00 10.00 ? ? ? ? ? ? 315 LYS C CB  1 
ATOM 8272  C CG  . LYS C 1 314 ? 4.362   -21.926 66.482   1.00 10.00 ? ? ? ? ? ? 315 LYS C CG  1 
ATOM 8273  C CD  . LYS C 1 314 ? 5.051   -20.621 66.130   1.00 10.00 ? ? ? ? ? ? 315 LYS C CD  1 
ATOM 8274  C CE  . LYS C 1 314 ? 6.365   -20.861 65.405   1.00 10.00 ? ? ? ? ? ? 315 LYS C CE  1 
ATOM 8275  N NZ  . LYS C 1 314 ? 6.539   -19.752 64.477   1.00 10.00 ? ? ? ? ? ? 315 LYS C NZ  1 
ATOM 8276  N N   . GLU C 1 315 ? 2.274   -19.032 68.326   1.00 10.00 ? ? ? ? ? ? 316 GLU C N   1 
ATOM 8277  C CA  . GLU C 1 315 ? 2.734   -17.690 68.642   1.00 10.00 ? ? ? ? ? ? 316 GLU C CA  1 
ATOM 8278  C C   . GLU C 1 315 ? 2.242   -17.124 69.951   1.00 10.00 ? ? ? ? ? ? 316 GLU C C   1 
ATOM 8279  O O   . GLU C 1 315 ? 2.951   -16.343 70.598   1.00 10.00 ? ? ? ? ? ? 316 GLU C O   1 
ATOM 8280  C CB  . GLU C 1 315 ? 2.348   -16.759 67.502   1.00 10.00 ? ? ? ? ? ? 316 GLU C CB  1 
ATOM 8281  C CG  . GLU C 1 315 ? 2.971   -17.146 66.182   1.00 10.00 ? ? ? ? ? ? 316 GLU C CG  1 
ATOM 8282  C CD  . GLU C 1 315 ? 4.463   -16.881 66.006   1.00 10.00 ? ? ? ? ? ? 316 GLU C CD  1 
ATOM 8283  O OE1 . GLU C 1 315 ? 5.262   -16.900 66.942   1.00 10.00 ? ? ? ? ? ? 316 GLU C OE1 1 
ATOM 8284  O OE2 . GLU C 1 315 ? 4.841   -16.626 64.873   1.00 10.00 ? ? ? ? ? ? 316 GLU C OE2 1 
ATOM 8285  N N   . ILE C 1 316 ? 1.030   -17.482 70.356   1.00 10.00 ? ? ? ? ? ? 317 ILE C N   1 
ATOM 8286  C CA  . ILE C 1 316 ? 0.537   -16.998 71.623   1.00 10.00 ? ? ? ? ? ? 317 ILE C CA  1 
ATOM 8287  C C   . ILE C 1 316 ? 1.206   -17.828 72.684   1.00 10.00 ? ? ? ? ? ? 317 ILE C C   1 
ATOM 8288  O O   . ILE C 1 316 ? 1.584   -17.291 73.728   1.00 10.00 ? ? ? ? ? ? 317 ILE C O   1 
ATOM 8289  C CB  . ILE C 1 316 ? -0.967  -17.117 71.635   1.00 10.00 ? ? ? ? ? ? 317 ILE C CB  1 
ATOM 8290  C CG1 . ILE C 1 316 ? -1.525  -15.944 70.825   1.00 10.00 ? ? ? ? ? ? 317 ILE C CG1 1 
ATOM 8291  C CG2 . ILE C 1 316 ? -1.511  -16.989 73.030   1.00 10.00 ? ? ? ? ? ? 317 ILE C CG2 1 
ATOM 8292  C CD1 . ILE C 1 316 ? -2.992  -16.044 70.406   1.00 10.00 ? ? ? ? ? ? 317 ILE C CD1 1 
ATOM 8293  N N   . THR C 1 317 ? 1.430   -19.113 72.434   1.00 10.00 ? ? ? ? ? ? 318 THR C N   1 
ATOM 8294  C CA  . THR C 1 317 ? 2.223   -19.933 73.324   1.00 10.00 ? ? ? ? ? ? 318 THR C CA  1 
ATOM 8295  C C   . THR C 1 317 ? 3.626   -19.406 73.581   1.00 10.00 ? ? ? ? ? ? 318 THR C C   1 
ATOM 8296  O O   . THR C 1 317 ? 4.183   -19.647 74.649   1.00 10.00 ? ? ? ? ? ? 318 THR C O   1 
ATOM 8297  C CB  . THR C 1 317 ? 2.266   -21.329 72.735   1.00 10.00 ? ? ? ? ? ? 318 THR C CB  1 
ATOM 8298  O OG1 . THR C 1 317 ? 0.899   -21.727 72.523   1.00 10.00 ? ? ? ? ? ? 318 THR C OG1 1 
ATOM 8299  C CG2 . THR C 1 317 ? 2.967   -22.306 73.658   1.00 10.00 ? ? ? ? ? ? 318 THR C CG2 1 
ATOM 8300  N N   . ALA C 1 318 ? 4.267   -18.698 72.652   1.00 10.00 ? ? ? ? ? ? 319 ALA C N   1 
ATOM 8301  C CA  . ALA C 1 318 ? 5.573   -18.120 72.936   1.00 10.00 ? ? ? ? ? ? 319 ALA C CA  1 
ATOM 8302  C C   . ALA C 1 318 ? 5.477   -16.871 73.819   1.00 10.00 ? ? ? ? ? ? 319 ALA C C   1 
ATOM 8303  O O   . ALA C 1 318 ? 6.292   -16.725 74.737   1.00 10.00 ? ? ? ? ? ? 319 ALA C O   1 
ATOM 8304  C CB  . ALA C 1 318 ? 6.240   -17.747 71.652   1.00 10.00 ? ? ? ? ? ? 319 ALA C CB  1 
ATOM 8305  N N   . LEU C 1 319 ? 4.535   -15.931 73.603   1.00 10.00 ? ? ? ? ? ? 320 LEU C N   1 
ATOM 8306  C CA  . LEU C 1 319 ? 4.429   -14.759 74.482   1.00 10.00 ? ? ? ? ? ? 320 LEU C CA  1 
ATOM 8307  C C   . LEU C 1 319 ? 3.817   -15.017 75.891   1.00 10.00 ? ? ? ? ? ? 320 LEU C C   1 
ATOM 8308  O O   . LEU C 1 319 ? 4.083   -14.304 76.869   1.00 10.00 ? ? ? ? ? ? 320 LEU C O   1 
ATOM 8309  C CB  . LEU C 1 319 ? 3.603   -13.746 73.772   1.00 10.00 ? ? ? ? ? ? 320 LEU C CB  1 
ATOM 8310  C CG  . LEU C 1 319 ? 4.086   -13.259 72.432   1.00 10.00 ? ? ? ? ? ? 320 LEU C CG  1 
ATOM 8311  C CD1 . LEU C 1 319 ? 2.959   -13.224 71.417   1.00 10.00 ? ? ? ? ? ? 320 LEU C CD1 1 
ATOM 8312  C CD2 . LEU C 1 319 ? 4.656   -11.869 72.609   1.00 10.00 ? ? ? ? ? ? 320 LEU C CD2 1 
ATOM 8313  N N   . ALA C 1 320 ? 2.948   -16.035 76.002   1.00 10.00 ? ? ? ? ? ? 321 ALA C N   1 
ATOM 8314  C CA  . ALA C 1 320 ? 2.145   -16.281 77.185   1.00 10.00 ? ? ? ? ? ? 321 ALA C CA  1 
ATOM 8315  C C   . ALA C 1 320 ? 2.981   -16.819 78.314   1.00 10.00 ? ? ? ? ? ? 321 ALA C C   1 
ATOM 8316  O O   . ALA C 1 320 ? 3.884   -17.624 78.011   1.00 10.00 ? ? ? ? ? ? 321 ALA C O   1 
ATOM 8317  C CB  . ALA C 1 320 ? 1.107   -17.315 76.916   1.00 10.00 ? ? ? ? ? ? 321 ALA C CB  1 
ATOM 8318  N N   . PRO C 1 321 ? 2.713   -16.503 79.618   1.00 10.00 ? ? ? ? ? ? 322 PRO C N   1 
ATOM 8319  C CA  . PRO C 1 321 ? 3.406   -17.127 80.773   1.00 10.00 ? ? ? ? ? ? 322 PRO C CA  1 
ATOM 8320  C C   . PRO C 1 321 ? 3.530   -18.655 80.572   1.00 10.00 ? ? ? ? ? ? 322 PRO C C   1 
ATOM 8321  O O   . PRO C 1 321 ? 2.621   -19.330 80.043   1.00 10.00 ? ? ? ? ? ? 322 PRO C O   1 
ATOM 8322  C CB  . PRO C 1 321 ? 2.556   -16.722 81.953   1.00 10.00 ? ? ? ? ? ? 322 PRO C CB  1 
ATOM 8323  C CG  . PRO C 1 321 ? 2.030   -15.360 81.529   1.00 10.00 ? ? ? ? ? ? 322 PRO C CG  1 
ATOM 8324  C CD  . PRO C 1 321 ? 1.674   -15.573 80.062   1.00 10.00 ? ? ? ? ? ? 322 PRO C CD  1 
ATOM 8325  N N   . SER C 1 322 ? 4.639   -19.225 81.059   1.00 10.00 ? ? ? ? ? ? 323 SER C N   1 
ATOM 8326  C CA  . SER C 1 322 ? 5.022   -20.609 80.723   1.00 10.00 ? ? ? ? ? ? 323 SER C CA  1 
ATOM 8327  C C   . SER C 1 322 ? 4.102   -21.785 81.138   1.00 10.00 ? ? ? ? ? ? 323 SER C C   1 
ATOM 8328  O O   . SER C 1 322 ? 4.365   -22.976 80.937   1.00 10.00 ? ? ? ? ? ? 323 SER C O   1 
ATOM 8329  C CB  . SER C 1 322 ? 6.493   -20.692 81.265   1.00 10.00 ? ? ? ? ? ? 323 SER C CB  1 
ATOM 8330  O OG  . SER C 1 322 ? 7.287   -19.530 80.876   1.00 10.00 ? ? ? ? ? ? 323 SER C OG  1 
ATOM 8331  N N   . THR C 1 323 ? 2.941   -21.414 81.648   1.00 10.00 ? ? ? ? ? ? 324 THR C N   1 
ATOM 8332  C CA  . THR C 1 323 ? 1.985   -22.315 82.198   1.00 10.00 ? ? ? ? ? ? 324 THR C CA  1 
ATOM 8333  C C   . THR C 1 323 ? 0.622   -22.209 81.570   1.00 10.00 ? ? ? ? ? ? 324 THR C C   1 
ATOM 8334  O O   . THR C 1 323 ? -0.095  -23.211 81.684   1.00 10.00 ? ? ? ? ? ? 324 THR C O   1 
ATOM 8335  C CB  . THR C 1 323 ? 1.844   -22.047 83.700   1.00 10.00 ? ? ? ? ? ? 324 THR C CB  1 
ATOM 8336  O OG1 . THR C 1 323 ? 2.475   -20.783 83.984   1.00 10.00 ? ? ? ? ? ? 324 THR C OG1 1 
ATOM 8337  C CG2 . THR C 1 323 ? 2.428   -23.203 84.524   1.00 10.00 ? ? ? ? ? ? 324 THR C CG2 1 
ATOM 8338  N N   . MET C 1 324 ? 0.244   -21.102 80.889   1.00 10.00 ? ? ? ? ? ? 325 MET C N   1 
ATOM 8339  C CA  . MET C 1 324 ? -1.151  -20.901 80.500   1.00 10.00 ? ? ? ? ? ? 325 MET C CA  1 
ATOM 8340  C C   . MET C 1 324 ? -1.651  -22.030 79.636   1.00 10.00 ? ? ? ? ? ? 325 MET C C   1 
ATOM 8341  O O   . MET C 1 324 ? -0.884  -22.468 78.796   1.00 10.00 ? ? ? ? ? ? 325 MET C O   1 
ATOM 8342  C CB  . MET C 1 324 ? -1.328  -19.656 79.721   1.00 10.00 ? ? ? ? ? ? 325 MET C CB  1 
ATOM 8343  C CG  . MET C 1 324 ? -0.879  -18.458 80.473   1.00 10.00 ? ? ? ? ? ? 325 MET C CG  1 
ATOM 8344  S SD  . MET C 1 324 ? -2.028  -18.038 81.810   1.00 10.00 ? ? ? ? ? ? 325 MET C SD  1 
ATOM 8345  C CE  . MET C 1 324 ? -0.874  -17.728 83.125   1.00 10.00 ? ? ? ? ? ? 325 MET C CE  1 
ATOM 8346  N N   . LYS C 1 325 ? -2.842  -22.591 79.803   1.00 10.00 ? ? ? ? ? ? 326 LYS C N   1 
ATOM 8347  C CA  . LYS C 1 325 ? -3.360  -23.596 78.897   1.00 10.00 ? ? ? ? ? ? 326 LYS C CA  1 
ATOM 8348  C C   . LYS C 1 325 ? -3.805  -22.659 77.805   1.00 10.00 ? ? ? ? ? ? 326 LYS C C   1 
ATOM 8349  O O   . LYS C 1 325 ? -4.503  -21.730 78.177   1.00 10.00 ? ? ? ? ? ? 326 LYS C O   1 
ATOM 8350  C CB  . LYS C 1 325 ? -4.582  -24.301 79.459   1.00 10.00 ? ? ? ? ? ? 326 LYS C CB  1 
ATOM 8351  C CG  . LYS C 1 325 ? -5.096  -25.393 78.538   1.00 10.00 ? ? ? ? ? ? 326 LYS C CG  1 
ATOM 8352  C CD  . LYS C 1 325 ? -6.041  -26.322 79.297   1.00 10.00 ? ? ? ? ? ? 326 LYS C CD  1 
ATOM 8353  C CE  . LYS C 1 325 ? -7.484  -25.814 79.474   1.00 10.00 ? ? ? ? ? ? 326 LYS C CE  1 
ATOM 8354  N NZ  . LYS C 1 325 ? -8.185  -25.805 78.199   1.00 10.00 ? ? ? ? ? ? 326 LYS C NZ  1 
ATOM 8355  N N   . ILE C 1 326 ? -3.404  -22.770 76.537   1.00 10.00 ? ? ? ? ? ? 327 ILE C N   1 
ATOM 8356  C CA  . ILE C 1 326 ? -3.858  -21.855 75.524   1.00 10.00 ? ? ? ? ? ? 327 ILE C CA  1 
ATOM 8357  C C   . ILE C 1 326 ? -4.667  -22.663 74.538   1.00 10.00 ? ? ? ? ? ? 327 ILE C C   1 
ATOM 8358  O O   . ILE C 1 326 ? -4.197  -23.626 73.938   1.00 10.00 ? ? ? ? ? ? 327 ILE C O   1 
ATOM 8359  C CB  . ILE C 1 326 ? -2.650  -21.191 74.878   1.00 10.00 ? ? ? ? ? ? 327 ILE C CB  1 
ATOM 8360  C CG1 . ILE C 1 326 ? -1.964  -20.322 75.887   1.00 10.00 ? ? ? ? ? ? 327 ILE C CG1 1 
ATOM 8361  C CG2 . ILE C 1 326 ? -3.067  -20.237 73.786   1.00 10.00 ? ? ? ? ? ? 327 ILE C CG2 1 
ATOM 8362  C CD1 . ILE C 1 326 ? -0.760  -19.627 75.311   1.00 10.00 ? ? ? ? ? ? 327 ILE C CD1 1 
ATOM 8363  N N   . LYS C 1 327 ? -5.917  -22.306 74.333   1.00 10.00 ? ? ? ? ? ? 328 LYS C N   1 
ATOM 8364  C CA  . LYS C 1 327 ? -6.798  -23.105 73.516   1.00 10.00 ? ? ? ? ? ? 328 LYS C CA  1 
ATOM 8365  C C   . LYS C 1 327 ? -7.290  -22.094 72.504   1.00 10.00 ? ? ? ? ? ? 328 LYS C C   1 
ATOM 8366  O O   . LYS C 1 327 ? -7.909  -21.094 72.858   1.00 10.00 ? ? ? ? ? ? 328 LYS C O   1 
ATOM 8367  C CB  . LYS C 1 327 ? -7.817  -23.638 74.501   1.00 10.00 ? ? ? ? ? ? 328 LYS C CB  1 
ATOM 8368  C CG  . LYS C 1 327 ? -8.838  -24.667 74.062   1.00 10.00 ? ? ? ? ? ? 328 LYS C CG  1 
ATOM 8369  C CD  . LYS C 1 327 ? -9.299  -25.275 75.368   1.00 10.00 ? ? ? ? ? ? 328 LYS C CD  1 
ATOM 8370  C CE  . LYS C 1 327 ? -9.868  -26.671 75.289   1.00 10.00 ? ? ? ? ? ? 328 LYS C CE  1 
ATOM 8371  N NZ  . LYS C 1 327 ? -11.108 -26.725 74.526   1.00 10.00 ? ? ? ? ? ? 328 LYS C NZ  1 
ATOM 8372  N N   . ILE C 1 328 ? -6.836  -22.234 71.267   1.00 10.00 ? ? ? ? ? ? 329 ILE C N   1 
ATOM 8373  C CA  . ILE C 1 328 ? -7.221  -21.341 70.174   1.00 10.00 ? ? ? ? ? ? 329 ILE C CA  1 
ATOM 8374  C C   . ILE C 1 328 ? -8.474  -22.050 69.639   1.00 10.00 ? ? ? ? ? ? 329 ILE C C   1 
ATOM 8375  O O   . ILE C 1 328 ? -8.410  -23.285 69.654   1.00 10.00 ? ? ? ? ? ? 329 ILE C O   1 
ATOM 8376  C CB  . ILE C 1 328 ? -6.023  -21.268 69.184   1.00 10.00 ? ? ? ? ? ? 329 ILE C CB  1 
ATOM 8377  C CG1 . ILE C 1 328 ? -5.286  -20.008 69.416   1.00 10.00 ? ? ? ? ? ? 329 ILE C CG1 1 
ATOM 8378  C CG2 . ILE C 1 328 ? -6.450  -21.067 67.740   1.00 10.00 ? ? ? ? ? ? 329 ILE C CG2 1 
ATOM 8379  C CD1 . ILE C 1 328 ? -4.620  -19.809 70.751   1.00 10.00 ? ? ? ? ? ? 329 ILE C CD1 1 
ATOM 8380  N N   . ILE C 1 329 ? -9.606  -21.442 69.204   1.00 10.00 ? ? ? ? ? ? 330 ILE C N   1 
ATOM 8381  C CA  . ILE C 1 329 ? -10.822 -22.172 68.841   1.00 10.00 ? ? ? ? ? ? 330 ILE C CA  1 
ATOM 8382  C C   . ILE C 1 329 ? -11.053 -21.689 67.438   1.00 10.00 ? ? ? ? ? ? 330 ILE C C   1 
ATOM 8383  O O   . ILE C 1 329 ? -10.961 -20.480 67.196   1.00 10.00 ? ? ? ? ? ? 330 ILE C O   1 
ATOM 8384  C CB  . ILE C 1 329 ? -12.066 -21.795 69.746   1.00 10.00 ? ? ? ? ? ? 330 ILE C CB  1 
ATOM 8385  C CG1 . ILE C 1 329 ? -12.051 -22.501 71.098   1.00 10.00 ? ? ? ? ? ? 330 ILE C CG1 1 
ATOM 8386  C CG2 . ILE C 1 329 ? -13.360 -22.217 69.033   1.00 10.00 ? ? ? ? ? ? 330 ILE C CG2 1 
ATOM 8387  C CD1 . ILE C 1 329 ? -11.298 -21.768 72.189   1.00 10.00 ? ? ? ? ? ? 330 ILE C CD1 1 
ATOM 8388  N N   . ALA C 1 330 ? -11.348 -22.566 66.501   1.00 10.00 ? ? ? ? ? ? 331 ALA C N   1 
ATOM 8389  C CA  . ALA C 1 330 ? -11.496 -22.095 65.149   1.00 10.00 ? ? ? ? ? ? 331 ALA C CA  1 
ATOM 8390  C C   . ALA C 1 330 ? -12.524 -23.017 64.558   1.00 10.00 ? ? ? ? ? ? 331 ALA C C   1 
ATOM 8391  O O   . ALA C 1 330 ? -12.216 -24.029 63.885   1.00 10.00 ? ? ? ? ? ? 331 ALA C O   1 
ATOM 8392  C CB  . ALA C 1 330 ? -10.202 -22.199 64.360   1.00 10.00 ? ? ? ? ? ? 331 ALA C CB  1 
ATOM 8393  N N   . PRO C 1 331 ? -13.805 -22.687 64.902   1.00 10.00 ? ? ? ? ? ? 332 PRO C N   1 
ATOM 8394  C CA  . PRO C 1 331 ? -14.951 -23.466 64.479   1.00 10.00 ? ? ? ? ? ? 332 PRO C CA  1 
ATOM 8395  C C   . PRO C 1 331 ? -14.968 -23.418 62.960   1.00 10.00 ? ? ? ? ? ? 332 PRO C C   1 
ATOM 8396  O O   . PRO C 1 331 ? -14.785 -22.361 62.360   1.00 10.00 ? ? ? ? ? ? 332 PRO C O   1 
ATOM 8397  C CB  . PRO C 1 331 ? -16.123 -22.795 65.158   1.00 10.00 ? ? ? ? ? ? 332 PRO C CB  1 
ATOM 8398  C CG  . PRO C 1 331 ? -15.726 -21.355 65.219   1.00 10.00 ? ? ? ? ? ? 332 PRO C CG  1 
ATOM 8399  C CD  . PRO C 1 331 ? -14.262 -21.450 65.555   1.00 10.00 ? ? ? ? ? ? 332 PRO C CD  1 
ATOM 8400  N N   . PRO C 1 332 ? -15.215 -24.523 62.283   1.00 10.00 ? ? ? ? ? ? 333 PRO C N   1 
ATOM 8401  C CA  . PRO C 1 332 ? -15.165 -24.567 60.850   1.00 10.00 ? ? ? ? ? ? 333 PRO C CA  1 
ATOM 8402  C C   . PRO C 1 332 ? -16.222 -23.686 60.192   1.00 10.00 ? ? ? ? ? ? 333 PRO C C   1 
ATOM 8403  O O   . PRO C 1 332 ? -16.143 -23.515 58.979   1.00 10.00 ? ? ? ? ? ? 333 PRO C O   1 
ATOM 8404  C CB  . PRO C 1 332 ? -15.269 -26.065 60.565   1.00 10.00 ? ? ? ? ? ? 333 PRO C CB  1 
ATOM 8405  C CG  . PRO C 1 332 ? -16.058 -26.668 61.706   1.00 10.00 ? ? ? ? ? ? 333 PRO C CG  1 
ATOM 8406  C CD  . PRO C 1 332 ? -15.503 -25.836 62.861   1.00 10.00 ? ? ? ? ? ? 333 PRO C CD  1 
ATOM 8407  N N   . GLU C 1 333 ? -17.187 -23.055 60.891   1.00 10.00 ? ? ? ? ? ? 334 GLU C N   1 
ATOM 8408  C CA  . GLU C 1 333 ? -18.165 -22.236 60.204   1.00 10.00 ? ? ? ? ? ? 334 GLU C CA  1 
ATOM 8409  C C   . GLU C 1 333 ? -17.988 -20.780 60.440   1.00 10.00 ? ? ? ? ? ? 334 GLU C C   1 
ATOM 8410  O O   . GLU C 1 333 ? -18.908 -19.987 60.247   1.00 10.00 ? ? ? ? ? ? 334 GLU C O   1 
ATOM 8411  C CB  . GLU C 1 333 ? -19.582 -22.602 60.614   1.00 10.00 ? ? ? ? ? ? 334 GLU C CB  1 
ATOM 8412  C CG  . GLU C 1 333 ? -20.167 -23.900 60.004   1.00 10.00 ? ? ? ? ? ? 334 GLU C CG  1 
ATOM 8413  C CD  . GLU C 1 333 ? -19.604 -25.221 60.536   1.00 10.00 ? ? ? ? ? ? 334 GLU C CD  1 
ATOM 8414  O OE1 . GLU C 1 333 ? -18.934 -25.247 61.586   1.00 10.00 ? ? ? ? ? ? 334 GLU C OE1 1 
ATOM 8415  O OE2 . GLU C 1 333 ? -19.865 -26.239 59.879   1.00 10.00 ? ? ? ? ? ? 334 GLU C OE2 1 
ATOM 8416  N N   . ARG C 1 334 ? -16.747 -20.446 60.761   1.00 10.00 ? ? ? ? ? ? 335 ARG C N   1 
ATOM 8417  C CA  . ARG C 1 334 ? -16.309 -19.115 61.169   1.00 10.00 ? ? ? ? ? ? 335 ARG C CA  1 
ATOM 8418  C C   . ARG C 1 334 ? -16.293 -17.924 60.211   1.00 10.00 ? ? ? ? ? ? 335 ARG C C   1 
ATOM 8419  O O   . ARG C 1 334 ? -16.133 -16.782 60.668   1.00 10.00 ? ? ? ? ? ? 335 ARG C O   1 
ATOM 8420  C CB  . ARG C 1 334 ? -14.931 -19.297 61.799   1.00 10.00 ? ? ? ? ? ? 335 ARG C CB  1 
ATOM 8421  C CG  . ARG C 1 334 ? -13.726 -18.874 61.022   1.00 10.00 ? ? ? ? ? ? 335 ARG C CG  1 
ATOM 8422  C CD  . ARG C 1 334 ? -12.517 -19.561 61.581   1.00 10.00 ? ? ? ? ? ? 335 ARG C CD  1 
ATOM 8423  N NE  . ARG C 1 334 ? -12.538 -20.922 61.094   1.00 10.00 ? ? ? ? ? ? 335 ARG C NE  1 
ATOM 8424  C CZ  . ARG C 1 334 ? -11.442 -21.470 60.640   1.00 10.00 ? ? ? ? ? ? 335 ARG C CZ  1 
ATOM 8425  N NH1 . ARG C 1 334 ? -10.287 -20.821 60.599   1.00 10.00 ? ? ? ? ? ? 335 ARG C NH1 1 
ATOM 8426  N NH2 . ARG C 1 334 ? -11.510 -22.708 60.210   1.00 10.00 ? ? ? ? ? ? 335 ARG C NH2 1 
ATOM 8427  N N   . LYS C 1 335 ? -18.652 -20.107 58.954   1.00 10.00 ? ? ? ? ? ? 336 LYS C N   1 
ATOM 8428  C CA  . LYS C 1 335 ? -18.634 -19.317 57.715   1.00 10.00 ? ? ? ? ? ? 336 LYS C CA  1 
ATOM 8429  C C   . LYS C 1 335 ? -19.750 -18.271 57.945   1.00 10.00 ? ? ? ? ? ? 336 LYS C C   1 
ATOM 8430  O O   . LYS C 1 335 ? -19.665 -17.137 57.507   1.00 10.00 ? ? ? ? ? ? 336 LYS C O   1 
ATOM 8431  C CB  . LYS C 1 335 ? -18.939 -20.286 56.524   1.00 10.00 ? ? ? ? ? ? 336 LYS C CB  1 
ATOM 8432  C CG  . LYS C 1 335 ? -18.552 -19.999 55.054   1.00 10.00 ? ? ? ? ? ? 336 LYS C CG  1 
ATOM 8433  C CD  . LYS C 1 335 ? -19.469 -19.040 54.257   1.00 10.00 ? ? ? ? ? ? 336 LYS C CD  1 
ATOM 8434  C CE  . LYS C 1 335 ? -18.958 -17.588 53.984   1.00 10.00 ? ? ? ? ? ? 336 LYS C CE  1 
ATOM 8435  N NZ  . LYS C 1 335 ? -20.003 -16.737 53.440   1.00 10.00 ? ? ? ? ? ? 336 LYS C NZ  1 
ATOM 8436  N N   . TYR C 1 336 ? -20.821 -18.577 58.701   1.00 10.00 ? ? ? ? ? ? 337 TYR C N   1 
ATOM 8437  C CA  . TYR C 1 336 ? -21.910 -17.653 58.981   1.00 10.00 ? ? ? ? ? ? 337 TYR C CA  1 
ATOM 8438  C C   . TYR C 1 336 ? -22.020 -16.975 60.367   1.00 10.00 ? ? ? ? ? ? 337 TYR C C   1 
ATOM 8439  O O   . TYR C 1 336 ? -23.016 -16.292 60.655   1.00 10.00 ? ? ? ? ? ? 337 TYR C O   1 
ATOM 8440  C CB  . TYR C 1 336 ? -23.161 -18.454 58.599   1.00 10.00 ? ? ? ? ? ? 337 TYR C CB  1 
ATOM 8441  C CG  . TYR C 1 336 ? -23.290 -18.495 57.103   1.00 10.00 ? ? ? ? ? ? 337 TYR C CG  1 
ATOM 8442  C CD1 . TYR C 1 336 ? -22.826 -17.420 56.391   1.00 10.00 ? ? ? ? ? ? 337 TYR C CD1 1 
ATOM 8443  C CD2 . TYR C 1 336 ? -23.750 -19.594 56.448   1.00 10.00 ? ? ? ? ? ? 337 TYR C CD2 1 
ATOM 8444  C CE1 . TYR C 1 336 ? -22.781 -17.421 55.022   1.00 10.00 ? ? ? ? ? ? 337 TYR C CE1 1 
ATOM 8445  C CE2 . TYR C 1 336 ? -23.717 -19.611 55.068   1.00 10.00 ? ? ? ? ? ? 337 TYR C CE2 1 
ATOM 8446  C CZ  . TYR C 1 336 ? -23.221 -18.529 54.379   1.00 10.00 ? ? ? ? ? ? 337 TYR C CZ  1 
ATOM 8447  O OH  . TYR C 1 336 ? -23.076 -18.525 53.017   1.00 10.00 ? ? ? ? ? ? 337 TYR C OH  1 
ATOM 8448  N N   . SER C 1 337 ? -21.021 -17.097 61.256   1.00 10.00 ? ? ? ? ? ? 338 SER C N   1 
ATOM 8449  C CA  . SER C 1 337 ? -20.988 -16.494 62.593   1.00 10.00 ? ? ? ? ? ? 338 SER C CA  1 
ATOM 8450  C C   . SER C 1 337 ? -21.400 -15.029 62.620   1.00 10.00 ? ? ? ? ? ? 338 SER C C   1 
ATOM 8451  O O   . SER C 1 337 ? -22.376 -14.721 63.294   1.00 10.00 ? ? ? ? ? ? 338 SER C O   1 
ATOM 8452  C CB  . SER C 1 337 ? -19.593 -16.579 63.224   1.00 10.00 ? ? ? ? ? ? 338 SER C CB  1 
ATOM 8453  O OG  . SER C 1 337 ? -19.303 -17.939 63.490   1.00 10.00 ? ? ? ? ? ? 338 SER C OG  1 
ATOM 8454  N N   . VAL C 1 338 ? -20.807 -14.123 61.878   1.00 10.00 ? ? ? ? ? ? 339 VAL C N   1 
ATOM 8455  C CA  . VAL C 1 338 ? -21.203 -12.754 61.982   1.00 10.00 ? ? ? ? ? ? 339 VAL C CA  1 
ATOM 8456  C C   . VAL C 1 338 ? -22.708 -12.584 61.708   1.00 10.00 ? ? ? ? ? ? 339 VAL C C   1 
ATOM 8457  O O   . VAL C 1 338 ? -23.413 -11.982 62.520   1.00 10.00 ? ? ? ? ? ? 339 VAL C O   1 
ATOM 8458  C CB  . VAL C 1 338 ? -20.307 -11.999 61.018   1.00 10.00 ? ? ? ? ? ? 339 VAL C CB  1 
ATOM 8459  C CG1 . VAL C 1 338 ? -20.714 -10.523 60.961   1.00 10.00 ? ? ? ? ? ? 339 VAL C CG1 1 
ATOM 8460  C CG2 . VAL C 1 338 ? -18.853 -12.155 61.482   1.00 10.00 ? ? ? ? ? ? 339 VAL C CG2 1 
ATOM 8461  N N   . TRP C 1 339 ? -23.316 -13.245 60.728   1.00 10.00 ? ? ? ? ? ? 340 TRP C N   1 
ATOM 8462  C CA  . TRP C 1 339 ? -24.716 -13.044 60.487   1.00 10.00 ? ? ? ? ? ? 340 TRP C CA  1 
ATOM 8463  C C   . TRP C 1 339 ? -25.539 -13.682 61.607   1.00 10.00 ? ? ? ? ? ? 340 TRP C C   1 
ATOM 8464  O O   . TRP C 1 339 ? -26.478 -13.018 62.058   1.00 10.00 ? ? ? ? ? ? 340 TRP C O   1 
ATOM 8465  C CB  . TRP C 1 339 ? -25.094 -13.624 59.119   1.00 10.00 ? ? ? ? ? ? 340 TRP C CB  1 
ATOM 8466  C CG  . TRP C 1 339 ? -26.485 -13.194 58.717   1.00 10.00 ? ? ? ? ? ? 340 TRP C CG  1 
ATOM 8467  C CD1 . TRP C 1 339 ? -26.740 -12.036 58.032   1.00 10.00 ? ? ? ? ? ? 340 TRP C CD1 1 
ATOM 8468  C CD2 . TRP C 1 339 ? -27.626 -13.819 59.124   1.00 10.00 ? ? ? ? ? ? 340 TRP C CD2 1 
ATOM 8469  N NE1 . TRP C 1 339 ? -28.054 -11.917 58.040   1.00 10.00 ? ? ? ? ? ? 340 TRP C NE1 1 
ATOM 8470  C CE2 . TRP C 1 339 ? -28.606 -12.963 58.687   1.00 10.00 ? ? ? ? ? ? 340 TRP C CE2 1 
ATOM 8471  C CE3 . TRP C 1 339 ? -27.899 -14.988 59.821   1.00 10.00 ? ? ? ? ? ? 340 TRP C CE3 1 
ATOM 8472  C CZ2 . TRP C 1 339 ? -29.897 -13.310 58.986   1.00 10.00 ? ? ? ? ? ? 340 TRP C CZ2 1 
ATOM 8473  C CZ3 . TRP C 1 339 ? -29.192 -15.328 60.105   1.00 10.00 ? ? ? ? ? ? 340 TRP C CZ3 1 
ATOM 8474  C CH2 . TRP C 1 339 ? -30.175 -14.480 59.689   1.00 10.00 ? ? ? ? ? ? 340 TRP C CH2 1 
ATOM 8475  N N   . ILE C 1 340 ? -25.307 -14.860 62.183   1.00 10.00 ? ? ? ? ? ? 341 ILE C N   1 
ATOM 8476  C CA  . ILE C 1 340 ? -26.252 -15.407 63.163   1.00 10.00 ? ? ? ? ? ? 341 ILE C CA  1 
ATOM 8477  C C   . ILE C 1 340 ? -26.062 -14.790 64.528   1.00 10.00 ? ? ? ? ? ? 341 ILE C C   1 
ATOM 8478  O O   . ILE C 1 340 ? -26.964 -14.854 65.370   1.00 10.00 ? ? ? ? ? ? 341 ILE C O   1 
ATOM 8479  C CB  . ILE C 1 340 ? -26.115 -16.926 63.271   1.00 10.00 ? ? ? ? ? ? 341 ILE C CB  1 
ATOM 8480  C CG1 . ILE C 1 340 ? -26.246 -17.585 61.875   1.00 10.00 ? ? ? ? ? ? 341 ILE C CG1 1 
ATOM 8481  C CG2 . ILE C 1 340 ? -27.215 -17.448 64.197   1.00 10.00 ? ? ? ? ? ? 341 ILE C CG2 1 
ATOM 8482  C CD1 . ILE C 1 340 ? -25.137 -18.584 61.544   1.00 10.00 ? ? ? ? ? ? 341 ILE C CD1 1 
ATOM 8483  N N   . GLY C 1 341 ? -24.935 -14.138 64.772   1.00 10.00 ? ? ? ? ? ? 342 GLY C N   1 
ATOM 8484  C CA  . GLY C 1 341 ? -24.779 -13.375 65.999   1.00 10.00 ? ? ? ? ? ? 342 GLY C CA  1 
ATOM 8485  C C   . GLY C 1 341 ? -25.623 -12.105 66.025   1.00 10.00 ? ? ? ? ? ? 342 GLY C C   1 
ATOM 8486  O O   . GLY C 1 341 ? -26.073 -11.664 67.082   1.00 10.00 ? ? ? ? ? ? 342 GLY C O   1 
ATOM 8487  N N   . GLY C 1 342 ? -25.771 -11.476 64.872   1.00 10.00 ? ? ? ? ? ? 343 GLY C N   1 
ATOM 8488  C CA  . GLY C 1 342 ? -26.616 -10.323 64.649   1.00 10.00 ? ? ? ? ? ? 343 GLY C CA  1 
ATOM 8489  C C   . GLY C 1 342 ? -28.079 -10.724 64.620   1.00 10.00 ? ? ? ? ? ? 343 GLY C C   1 
ATOM 8490  O O   . GLY C 1 342 ? -28.874 -10.093 65.295   1.00 10.00 ? ? ? ? ? ? 343 GLY C O   1 
ATOM 8491  N N   . SER C 1 343 ? -28.515 -11.729 63.853   1.00 10.00 ? ? ? ? ? ? 344 SER C N   1 
ATOM 8492  C CA  . SER C 1 343 ? -29.839 -12.292 63.995   1.00 10.00 ? ? ? ? ? ? 344 SER C CA  1 
ATOM 8493  C C   . SER C 1 343 ? -30.311 -12.600 65.412   1.00 10.00 ? ? ? ? ? ? 344 SER C C   1 
ATOM 8494  O O   . SER C 1 343 ? -31.519 -12.517 65.603   1.00 10.00 ? ? ? ? ? ? 344 SER C O   1 
ATOM 8495  C CB  . SER C 1 343 ? -29.918 -13.562 63.203   1.00 10.00 ? ? ? ? ? ? 344 SER C CB  1 
ATOM 8496  O OG  . SER C 1 343 ? -31.134 -14.267 63.464   1.00 10.00 ? ? ? ? ? ? 344 SER C OG  1 
ATOM 8497  N N   . ILE C 1 344 ? -29.481 -13.032 66.367   1.00 10.00 ? ? ? ? ? ? 345 ILE C N   1 
ATOM 8498  C CA  . ILE C 1 344 ? -29.791 -13.338 67.777   1.00 10.00 ? ? ? ? ? ? 345 ILE C CA  1 
ATOM 8499  C C   . ILE C 1 344 ? -30.061 -12.051 68.530   1.00 10.00 ? ? ? ? ? ? 345 ILE C C   1 
ATOM 8500  O O   . ILE C 1 344 ? -31.069 -11.829 69.220   1.00 10.00 ? ? ? ? ? ? 345 ILE C O   1 
ATOM 8501  C CB  . ILE C 1 344 ? -28.593 -14.079 68.513   1.00 10.00 ? ? ? ? ? ? 345 ILE C CB  1 
ATOM 8502  C CG1 . ILE C 1 344 ? -28.564 -15.494 68.032   1.00 10.00 ? ? ? ? ? ? 345 ILE C CG1 1 
ATOM 8503  C CG2 . ILE C 1 344 ? -28.719 -14.129 70.033   1.00 10.00 ? ? ? ? ? ? 345 ILE C CG2 1 
ATOM 8504  C CD1 . ILE C 1 344 ? -27.340 -16.245 68.611   1.00 10.00 ? ? ? ? ? ? 345 ILE C CD1 1 
ATOM 8505  N N   . LEU C 1 345 ? -29.022 -11.218 68.380   1.00 10.00 ? ? ? ? ? ? 346 LEU C N   1 
ATOM 8506  C CA  . LEU C 1 345 ? -28.946 -9.911  69.007   1.00 10.00 ? ? ? ? ? ? 346 LEU C CA  1 
ATOM 8507  C C   . LEU C 1 345 ? -30.135 -9.097  68.568   1.00 10.00 ? ? ? ? ? ? 346 LEU C C   1 
ATOM 8508  O O   . LEU C 1 345 ? -30.975 -8.877  69.422   1.00 10.00 ? ? ? ? ? ? 346 LEU C O   1 
ATOM 8509  C CB  . LEU C 1 345 ? -27.582 -9.312  68.607   1.00 10.00 ? ? ? ? ? ? 346 LEU C CB  1 
ATOM 8510  C CG  . LEU C 1 345 ? -26.893 -8.149  69.345   1.00 10.00 ? ? ? ? ? ? 346 LEU C CG  1 
ATOM 8511  C CD1 . LEU C 1 345 ? -27.021 -6.921  68.437   1.00 10.00 ? ? ? ? ? ? 346 LEU C CD1 1 
ATOM 8512  C CD2 . LEU C 1 345 ? -27.404 -8.050  70.818   1.00 10.00 ? ? ? ? ? ? 346 LEU C CD2 1 
ATOM 8513  N N   . ALA C 1 346 ? -30.361 -8.776  67.299   1.00 10.00 ? ? ? ? ? ? 347 ALA C N   1 
ATOM 8514  C CA  . ALA C 1 346 ? -31.492 -7.972  66.899   1.00 10.00 ? ? ? ? ? ? 347 ALA C CA  1 
ATOM 8515  C C   . ALA C 1 346 ? -32.871 -8.595  67.087   1.00 10.00 ? ? ? ? ? ? 347 ALA C C   1 
ATOM 8516  O O   . ALA C 1 346 ? -33.851 -8.008  66.592   1.00 10.00 ? ? ? ? ? ? 347 ALA C O   1 
ATOM 8517  C CB  . ALA C 1 346 ? -31.355 -7.597  65.443   1.00 10.00 ? ? ? ? ? ? 347 ALA C CB  1 
ATOM 8518  N N   . SER C 1 347 ? -32.969 -9.800  67.687   1.00 10.00 ? ? ? ? ? ? 348 SER C N   1 
ATOM 8519  C CA  . SER C 1 347 ? -34.252 -10.397 67.985   1.00 10.00 ? ? ? ? ? ? 348 SER C CA  1 
ATOM 8520  C C   . SER C 1 347 ? -34.555 -10.271 69.452   1.00 10.00 ? ? ? ? ? ? 348 SER C C   1 
ATOM 8521  O O   . SER C 1 347 ? -35.727 -10.405 69.811   1.00 10.00 ? ? ? ? ? ? 348 SER C O   1 
ATOM 8522  C CB  . SER C 1 347 ? -34.309 -11.890 67.608   1.00 10.00 ? ? ? ? ? ? 348 SER C CB  1 
ATOM 8523  O OG  . SER C 1 347 ? -33.124 -12.625 67.843   1.00 10.00 ? ? ? ? ? ? 348 SER C OG  1 
ATOM 8524  N N   . LEU C 1 348 ? -33.574 -10.045 70.330   1.00 10.00 ? ? ? ? ? ? 349 LEU C N   1 
ATOM 8525  C CA  . LEU C 1 348 ? -33.844 -9.923  71.766   1.00 10.00 ? ? ? ? ? ? 349 LEU C CA  1 
ATOM 8526  C C   . LEU C 1 348 ? -34.638 -8.624  72.050   1.00 10.00 ? ? ? ? ? ? 349 LEU C C   1 
ATOM 8527  O O   . LEU C 1 348 ? -34.399 -7.596  71.389   1.00 10.00 ? ? ? ? ? ? 349 LEU C O   1 
ATOM 8528  C CB  . LEU C 1 348 ? -32.510 -9.927  72.519   1.00 10.00 ? ? ? ? ? ? 349 LEU C CB  1 
ATOM 8529  C CG  . LEU C 1 348 ? -31.615 -11.147 72.322   1.00 10.00 ? ? ? ? ? ? 349 LEU C CG  1 
ATOM 8530  C CD1 . LEU C 1 348 ? -30.197 -10.837 72.751   1.00 10.00 ? ? ? ? ? ? 349 LEU C CD1 1 
ATOM 8531  C CD2 . LEU C 1 348 ? -32.136 -12.301 73.146   1.00 10.00 ? ? ? ? ? ? 349 LEU C CD2 1 
ATOM 8532  N N   . SER C 1 349 ? -35.599 -8.605  72.996   1.00 10.00 ? ? ? ? ? ? 350 SER C N   1 
ATOM 8533  C CA  . SER C 1 349 ? -36.340 -7.394  73.265   1.00 10.00 ? ? ? ? ? ? 350 SER C CA  1 
ATOM 8534  C C   . SER C 1 349 ? -35.423 -6.407  73.891   1.00 10.00 ? ? ? ? ? ? 350 SER C C   1 
ATOM 8535  O O   . SER C 1 349 ? -35.710 -5.210  73.846   1.00 10.00 ? ? ? ? ? ? 350 SER C O   1 
ATOM 8536  C CB  . SER C 1 349 ? -37.469 -7.596  74.197   1.00 10.00 ? ? ? ? ? ? 350 SER C CB  1 
ATOM 8537  O OG  . SER C 1 349 ? -38.735 -7.545  73.513   1.00 10.00 ? ? ? ? ? ? 350 SER C OG  1 
ATOM 8538  N N   . THR C 1 350 ? -34.325 -6.928  74.462   1.00 10.00 ? ? ? ? ? ? 351 THR C N   1 
ATOM 8539  C CA  . THR C 1 350 ? -33.150 -6.184  74.941   1.00 10.00 ? ? ? ? ? ? 351 THR C CA  1 
ATOM 8540  C C   . THR C 1 350 ? -32.681 -5.087  73.938   1.00 10.00 ? ? ? ? ? ? 351 THR C C   1 
ATOM 8541  O O   . THR C 1 350 ? -32.520 -3.905  74.219   1.00 10.00 ? ? ? ? ? ? 351 THR C O   1 
ATOM 8542  C CB  . THR C 1 350 ? -32.056 -7.310  75.179   1.00 10.00 ? ? ? ? ? ? 351 THR C CB  1 
ATOM 8543  O OG1 . THR C 1 350 ? -32.675 -8.252  76.051   1.00 10.00 ? ? ? ? ? ? 351 THR C OG1 1 
ATOM 8544  C CG2 . THR C 1 350 ? -30.712 -6.818  75.680   1.00 10.00 ? ? ? ? ? ? 351 THR C CG2 1 
ATOM 8545  N N   . PHE C 1 351 ? -32.575 -5.495  72.683   1.00 10.00 ? ? ? ? ? ? 352 PHE C N   1 
ATOM 8546  C CA  . PHE C 1 351 ? -31.941 -4.723  71.669   1.00 10.00 ? ? ? ? ? ? 352 PHE C CA  1 
ATOM 8547  C C   . PHE C 1 351 ? -32.706 -3.492  71.261   1.00 10.00 ? ? ? ? ? ? 352 PHE C C   1 
ATOM 8548  O O   . PHE C 1 351 ? -32.101 -2.492  70.896   1.00 10.00 ? ? ? ? ? ? 352 PHE C O   1 
ATOM 8549  C CB  . PHE C 1 351 ? -31.717 -5.650  70.491   1.00 10.00 ? ? ? ? ? ? 352 PHE C CB  1 
ATOM 8550  C CG  . PHE C 1 351 ? -30.706 -4.999  69.559   1.00 10.00 ? ? ? ? ? ? 352 PHE C CG  1 
ATOM 8551  C CD1 . PHE C 1 351 ? -29.409 -4.794  69.997   1.00 10.00 ? ? ? ? ? ? 352 PHE C CD1 1 
ATOM 8552  C CD2 . PHE C 1 351 ? -31.083 -4.546  68.332   1.00 10.00 ? ? ? ? ? ? 352 PHE C CD2 1 
ATOM 8553  C CE1 . PHE C 1 351 ? -28.500 -4.136  69.224   1.00 10.00 ? ? ? ? ? ? 352 PHE C CE1 1 
ATOM 8554  C CE2 . PHE C 1 351 ? -30.151 -3.895  67.589   1.00 10.00 ? ? ? ? ? ? 352 PHE C CE2 1 
ATOM 8555  C CZ  . PHE C 1 351 ? -28.879 -3.683  68.013   1.00 10.00 ? ? ? ? ? ? 352 PHE C CZ  1 
ATOM 8556  N N   . GLN C 1 352 ? -34.037 -3.487  71.318   1.00 10.00 ? ? ? ? ? ? 353 GLN C N   1 
ATOM 8557  C CA  . GLN C 1 352 ? -34.779 -2.324  70.866   1.00 10.00 ? ? ? ? ? ? 353 GLN C CA  1 
ATOM 8558  C C   . GLN C 1 352 ? -34.381 -1.116  71.686   1.00 10.00 ? ? ? ? ? ? 353 GLN C C   1 
ATOM 8559  O O   . GLN C 1 352 ? -34.504 0.000   71.229   1.00 10.00 ? ? ? ? ? ? 353 GLN C O   1 
ATOM 8560  C CB  . GLN C 1 352 ? -36.306 -2.572  70.946   1.00 10.00 ? ? ? ? ? ? 353 GLN C CB  1 
ATOM 8561  C CG  . GLN C 1 352 ? -37.196 -1.610  70.031   1.00 10.00 ? ? ? ? ? ? 353 GLN C CG  1 
ATOM 8562  C CD  . GLN C 1 352 ? -36.999 -1.374  68.495   1.00 10.00 ? ? ? ? ? ? 353 GLN C CD  1 
ATOM 8563  O OE1 . GLN C 1 352 ? -36.999 -0.258  67.977   1.00 10.00 ? ? ? ? ? ? 353 GLN C OE1 1 
ATOM 8564  N NE2 . GLN C 1 352 ? -36.831 -2.369  67.647   1.00 10.00 ? ? ? ? ? ? 353 GLN C NE2 1 
ATOM 8565  N N   . GLN C 1 353 ? -33.798 -1.282  72.858   1.00 10.00 ? ? ? ? ? ? 354 GLN C N   1 
ATOM 8566  C CA  . GLN C 1 353 ? -33.281 -0.163  73.585   1.00 10.00 ? ? ? ? ? ? 354 GLN C CA  1 
ATOM 8567  C C   . GLN C 1 353 ? -31.821 -0.444  73.304   1.00 10.00 ? ? ? ? ? ? 354 GLN C C   1 
ATOM 8568  O O   . GLN C 1 353 ? -31.184 -1.216  74.024   1.00 10.00 ? ? ? ? ? ? 354 GLN C O   1 
ATOM 8569  C CB  . GLN C 1 353 ? -33.492 -0.250  75.105   1.00 10.00 ? ? ? ? ? ? 354 GLN C CB  1 
ATOM 8570  C CG  . GLN C 1 353 ? -34.483 -1.276  75.662   1.00 10.00 ? ? ? ? ? ? 354 GLN C CG  1 
ATOM 8571  C CD  . GLN C 1 353 ? -35.887 -1.137  75.068   1.00 10.00 ? ? ? ? ? ? 354 GLN C CD  1 
ATOM 8572  O OE1 . GLN C 1 353 ? -36.475 -0.039  75.056   1.00 10.00 ? ? ? ? ? ? 354 GLN C OE1 1 
ATOM 8573  N NE2 . GLN C 1 353 ? -36.409 -2.267  74.548   1.00 10.00 ? ? ? ? ? ? 354 GLN C NE2 1 
ATOM 8574  N N   . MET C 1 354 ? -31.318 0.038   72.188   1.00 10.00 ? ? ? ? ? ? 355 MET C N   1 
ATOM 8575  C CA  . MET C 1 354 ? -29.917 -0.085  71.839   1.00 10.00 ? ? ? ? ? ? 355 MET C CA  1 
ATOM 8576  C C   . MET C 1 354 ? -29.733 0.553   70.484   1.00 10.00 ? ? ? ? ? ? 355 MET C C   1 
ATOM 8577  O O   . MET C 1 354 ? -28.611 0.922   70.174   1.00 10.00 ? ? ? ? ? ? 355 MET C O   1 
ATOM 8578  C CB  . MET C 1 354 ? -29.495 -1.512  71.752   1.00 10.00 ? ? ? ? ? ? 355 MET C CB  1 
ATOM 8579  C CG  . MET C 1 354 ? -28.066 -1.753  72.047   1.00 10.00 ? ? ? ? ? ? 355 MET C CG  1 
ATOM 8580  S SD  . MET C 1 354 ? -27.907 -3.538  72.344   1.00 10.00 ? ? ? ? ? ? 355 MET C SD  1 
ATOM 8581  C CE  . MET C 1 354 ? -28.549 -3.477  74.007   1.00 10.00 ? ? ? ? ? ? 355 MET C CE  1 
ATOM 8582  N N   . TRP C 1 355 ? -30.792 0.616   69.655   1.00 10.00 ? ? ? ? ? ? 356 TRP C N   1 
ATOM 8583  C CA  . TRP C 1 355 ? -30.787 1.271   68.355   1.00 10.00 ? ? ? ? ? ? 356 TRP C CA  1 
ATOM 8584  C C   . TRP C 1 355 ? -30.626 2.779   68.441   1.00 10.00 ? ? ? ? ? ? 356 TRP C C   1 
ATOM 8585  O O   . TRP C 1 355 ? -30.857 3.394   69.482   1.00 10.00 ? ? ? ? ? ? 356 TRP C O   1 
ATOM 8586  C CB  . TRP C 1 355 ? -32.061 1.199   67.587   1.00 10.00 ? ? ? ? ? ? 356 TRP C CB  1 
ATOM 8587  C CG  . TRP C 1 355 ? -32.660 -0.120  67.281   1.00 10.00 ? ? ? ? ? ? 356 TRP C CG  1 
ATOM 8588  C CD1 . TRP C 1 355 ? -33.754 -0.401  67.995   1.00 10.00 ? ? ? ? ? ? 356 TRP C CD1 1 
ATOM 8589  C CD2 . TRP C 1 355 ? -32.205 -1.102  66.407   1.00 10.00 ? ? ? ? ? ? 356 TRP C CD2 1 
ATOM 8590  N NE1 . TRP C 1 355 ? -34.014 -1.615  67.595   1.00 10.00 ? ? ? ? ? ? 356 TRP C NE1 1 
ATOM 8591  C CE2 . TRP C 1 355 ? -33.141 -2.094  66.662   1.00 10.00 ? ? ? ? ? ? 356 TRP C CE2 1 
ATOM 8592  C CE3 . TRP C 1 355 ? -31.197 -1.359  65.468   1.00 10.00 ? ? ? ? ? ? 356 TRP C CE3 1 
ATOM 8593  C CZ2 . TRP C 1 355 ? -33.061 -3.340  66.007   1.00 10.00 ? ? ? ? ? ? 356 TRP C CZ2 1 
ATOM 8594  C CZ3 . TRP C 1 355 ? -31.107 -2.592  64.814   1.00 10.00 ? ? ? ? ? ? 356 TRP C CZ3 1 
ATOM 8595  C CH2 . TRP C 1 355 ? -32.040 -3.587  65.085   1.00 10.00 ? ? ? ? ? ? 356 TRP C CH2 1 
ATOM 8596  N N   . ILE C 1 356 ? -30.355 3.379   67.289   1.00 10.00 ? ? ? ? ? ? 357 ILE C N   1 
ATOM 8597  C CA  . ILE C 1 356 ? -30.326 4.804   67.069   1.00 10.00 ? ? ? ? ? ? 357 ILE C CA  1 
ATOM 8598  C C   . ILE C 1 356 ? -31.619 4.931   66.270   1.00 10.00 ? ? ? ? ? ? 357 ILE C C   1 
ATOM 8599  O O   . ILE C 1 356 ? -31.820 4.201   65.280   1.00 10.00 ? ? ? ? ? ? 357 ILE C O   1 
ATOM 8600  C CB  . ILE C 1 356 ? -29.134 5.167   66.235   1.00 10.00 ? ? ? ? ? ? 357 ILE C CB  1 
ATOM 8601  C CG1 . ILE C 1 356 ? -27.860 4.664   66.875   1.00 10.00 ? ? ? ? ? ? 357 ILE C CG1 1 
ATOM 8602  C CG2 . ILE C 1 356 ? -29.128 6.665   66.067   1.00 10.00 ? ? ? ? ? ? 357 ILE C CG2 1 
ATOM 8603  C CD1 . ILE C 1 356 ? -26.647 4.574   65.935   1.00 10.00 ? ? ? ? ? ? 357 ILE C CD1 1 
ATOM 8604  N N   . SER C 1 357 ? -32.532 5.772   66.751   1.00 10.00 ? ? ? ? ? ? 358 SER C N   1 
ATOM 8605  C CA  . SER C 1 357 ? -33.823 5.918   66.130   1.00 10.00 ? ? ? ? ? ? 358 SER C CA  1 
ATOM 8606  C C   . SER C 1 357 ? -33.796 7.086   65.181   1.00 10.00 ? ? ? ? ? ? 358 SER C C   1 
ATOM 8607  O O   . SER C 1 357 ? -32.905 7.949   65.293   1.00 10.00 ? ? ? ? ? ? 358 SER C O   1 
ATOM 8608  C CB  . SER C 1 357 ? -34.883 6.180   67.182   1.00 10.00 ? ? ? ? ? ? 358 SER C CB  1 
ATOM 8609  O OG  . SER C 1 357 ? -34.621 7.253   68.108   1.00 10.00 ? ? ? ? ? ? 358 SER C OG  1 
ATOM 8610  N N   . LYS C 1 358 ? -34.828 7.160   64.319   1.00 10.00 ? ? ? ? ? ? 359 LYS C N   1 
ATOM 8611  C CA  . LYS C 1 358 ? -35.021 8.253   63.357   1.00 10.00 ? ? ? ? ? ? 359 LYS C CA  1 
ATOM 8612  C C   . LYS C 1 358 ? -34.994 9.519   64.149   1.00 10.00 ? ? ? ? ? ? 359 LYS C C   1 
ATOM 8613  O O   . LYS C 1 358 ? -34.146 10.357  63.872   1.00 10.00 ? ? ? ? ? ? 359 LYS C O   1 
ATOM 8614  C CB  . LYS C 1 358 ? -36.350 8.154   62.649   1.00 10.00 ? ? ? ? ? ? 359 LYS C CB  1 
ATOM 8615  C CG  . LYS C 1 358 ? -36.232 8.434   61.141   1.00 10.00 ? ? ? ? ? ? 359 LYS C CG  1 
ATOM 8616  C CD  . LYS C 1 358 ? -35.570 9.734   60.616   1.00 10.00 ? ? ? ? ? ? 359 LYS C CD  1 
ATOM 8617  C CE  . LYS C 1 358 ? -35.475 9.641   59.077   1.00 10.00 ? ? ? ? ? ? 359 LYS C CE  1 
ATOM 8618  N NZ  . LYS C 1 358 ? -34.769 10.772  58.507   1.00 10.00 ? ? ? ? ? ? 359 LYS C NZ  1 
ATOM 8619  N N   . GLN C 1 359 ? -35.819 9.596   65.211   1.00 10.00 ? ? ? ? ? ? 360 GLN C N   1 
ATOM 8620  C CA  . GLN C 1 359 ? -35.813 10.727  66.148   1.00 10.00 ? ? ? ? ? ? 360 GLN C CA  1 
ATOM 8621  C C   . GLN C 1 359 ? -34.414 11.176  66.590   1.00 10.00 ? ? ? ? ? ? 360 GLN C C   1 
ATOM 8622  O O   . GLN C 1 359 ? -34.041 12.367  66.480   1.00 10.00 ? ? ? ? ? ? 360 GLN C O   1 
ATOM 8623  C CB  . GLN C 1 359 ? -36.566 10.416  67.445   1.00 10.00 ? ? ? ? ? ? 360 GLN C CB  1 
ATOM 8624  C CG  . GLN C 1 359 ? -37.469 9.165   67.548   1.00 10.00 ? ? ? ? ? ? 360 GLN C CG  1 
ATOM 8625  C CD  . GLN C 1 359 ? -37.894 8.802   68.989   1.00 10.00 ? ? ? ? ? ? 360 GLN C CD  1 
ATOM 8626  O OE1 . GLN C 1 359 ? -39.077 8.879   69.325   1.00 10.00 ? ? ? ? ? ? 360 GLN C OE1 1 
ATOM 8627  N NE2 . GLN C 1 359 ? -37.021 8.361   69.912   1.00 10.00 ? ? ? ? ? ? 360 GLN C NE2 1 
ATOM 8628  N N   . GLU C 1 360 ? -33.586 10.212  67.036   1.00 10.00 ? ? ? ? ? ? 361 GLU C N   1 
ATOM 8629  C CA  . GLU C 1 360 ? -32.259 10.554  67.546   1.00 10.00 ? ? ? ? ? ? 361 GLU C CA  1 
ATOM 8630  C C   . GLU C 1 360 ? -31.354 11.072  66.477   1.00 10.00 ? ? ? ? ? ? 361 GLU C C   1 
ATOM 8631  O O   . GLU C 1 360 ? -30.592 12.003  66.703   1.00 10.00 ? ? ? ? ? ? 361 GLU C O   1 
ATOM 8632  C CB  . GLU C 1 360 ? -31.611 9.348   68.189   1.00 10.00 ? ? ? ? ? ? 361 GLU C CB  1 
ATOM 8633  C CG  . GLU C 1 360 ? -32.469 8.975   69.407   1.00 10.00 ? ? ? ? ? ? 361 GLU C CG  1 
ATOM 8634  C CD  . GLU C 1 360 ? -32.038 7.778   70.263   1.00 10.00 ? ? ? ? ? ? 361 GLU C CD  1 
ATOM 8635  O OE1 . GLU C 1 360 ? -30.833 7.712   70.603   1.00 10.00 ? ? ? ? ? ? 361 GLU C OE1 1 
ATOM 8636  O OE2 . GLU C 1 360 ? -32.936 6.960   70.605   1.00 10.00 ? ? ? ? ? ? 361 GLU C OE2 1 
ATOM 8637  N N   . TYR C 1 361 ? -31.473 10.508  65.292   1.00 10.00 ? ? ? ? ? ? 362 TYR C N   1 
ATOM 8638  C CA  . TYR C 1 361 ? -30.653 10.937  64.185   1.00 10.00 ? ? ? ? ? ? 362 TYR C CA  1 
ATOM 8639  C C   . TYR C 1 361 ? -30.933 12.411  63.874   1.00 10.00 ? ? ? ? ? ? 362 TYR C C   1 
ATOM 8640  O O   . TYR C 1 361 ? -30.023 13.165  63.534   1.00 10.00 ? ? ? ? ? ? 362 TYR C O   1 
ATOM 8641  C CB  . TYR C 1 361 ? -30.958 10.041  62.948   1.00 10.00 ? ? ? ? ? ? 362 TYR C CB  1 
ATOM 8642  C CG  . TYR C 1 361 ? -30.136 10.467  61.726   1.00 10.00 ? ? ? ? ? ? 362 TYR C CG  1 
ATOM 8643  C CD1 . TYR C 1 361 ? -28.755 10.350  61.715   1.00 10.00 ? ? ? ? ? ? 362 TYR C CD1 1 
ATOM 8644  C CD2 . TYR C 1 361 ? -30.777 11.049  60.650   1.00 10.00 ? ? ? ? ? ? 362 TYR C CD2 1 
ATOM 8645  C CE1 . TYR C 1 361 ? -28.018 10.812  60.651   1.00 10.00 ? ? ? ? ? ? 362 TYR C CE1 1 
ATOM 8646  C CE2 . TYR C 1 361 ? -30.035 11.522  59.592   1.00 10.00 ? ? ? ? ? ? 362 TYR C CE2 1 
ATOM 8647  C CZ  . TYR C 1 361 ? -28.673 11.401  59.611   1.00 10.00 ? ? ? ? ? ? 362 TYR C CZ  1 
ATOM 8648  O OH  . TYR C 1 361 ? -27.968 11.963  58.589   1.00 10.00 ? ? ? ? ? ? 362 TYR C OH  1 
ATOM 8649  N N   . ASP C 1 362 ? -32.198 12.831  63.945   1.00 10.00 ? ? ? ? ? ? 363 ASP C N   1 
ATOM 8650  C CA  . ASP C 1 362 ? -32.595 14.221  63.713   1.00 10.00 ? ? ? ? ? ? 363 ASP C CA  1 
ATOM 8651  C C   . ASP C 1 362 ? -32.011 15.139  64.746   1.00 10.00 ? ? ? ? ? ? 363 ASP C C   1 
ATOM 8652  O O   . ASP C 1 362 ? -31.510 16.215  64.451   1.00 10.00 ? ? ? ? ? ? 363 ASP C O   1 
ATOM 8653  C CB  . ASP C 1 362 ? -34.068 14.455  63.834   1.00 10.00 ? ? ? ? ? ? 363 ASP C CB  1 
ATOM 8654  C CG  . ASP C 1 362 ? -34.763 14.044  62.599   1.00 10.00 ? ? ? ? ? ? 363 ASP C CG  1 
ATOM 8655  O OD1 . ASP C 1 362 ? -34.328 14.556  61.574   1.00 10.00 ? ? ? ? ? ? 363 ASP C OD1 1 
ATOM 8656  O OD2 . ASP C 1 362 ? -35.712 13.256  62.667   1.00 10.00 ? ? ? ? ? ? 363 ASP C OD2 1 
ATOM 8657  N N   . GLU C 1 363 ? -32.236 14.633  65.978   1.00 10.00 ? ? ? ? ? ? 364 GLU C N   1 
ATOM 8658  C CA  . GLU C 1 363 ? -31.789 15.278  67.185   1.00 10.00 ? ? ? ? ? ? 364 GLU C CA  1 
ATOM 8659  C C   . GLU C 1 363 ? -30.301 15.529  66.973   1.00 10.00 ? ? ? ? ? ? 364 GLU C C   1 
ATOM 8660  O O   . GLU C 1 363 ? -29.944 16.715  66.902   1.00 10.00 ? ? ? ? ? ? 364 GLU C O   1 
ATOM 8661  C CB  . GLU C 1 363 ? -32.095 14.329  68.399   1.00 10.00 ? ? ? ? ? ? 364 GLU C CB  1 
ATOM 8662  C CG  . GLU C 1 363 ? -31.464 14.498  69.812   1.00 10.00 ? ? ? ? ? ? 364 GLU C CG  1 
ATOM 8663  C CD  . GLU C 1 363 ? -31.422 13.192  70.663   1.00 10.00 ? ? ? ? ? ? 364 GLU C CD  1 
ATOM 8664  O OE1 . GLU C 1 363 ? -32.486 12.591  70.956   1.00 10.00 ? ? ? ? ? ? 364 GLU C OE1 1 
ATOM 8665  O OE2 . GLU C 1 363 ? -30.312 12.774  71.018   1.00 10.00 ? ? ? ? ? ? 364 GLU C OE2 1 
ATOM 8666  N N   . SER C 1 364 ? -29.486 14.489  66.707   1.00 10.00 ? ? ? ? ? ? 365 SER C N   1 
ATOM 8667  C CA  . SER C 1 364 ? -28.049 14.683  66.759   1.00 10.00 ? ? ? ? ? ? 365 SER C CA  1 
ATOM 8668  C C   . SER C 1 364 ? -27.394 14.931  65.430   1.00 10.00 ? ? ? ? ? ? 365 SER C C   1 
ATOM 8669  O O   . SER C 1 364 ? -26.563 15.833  65.256   1.00 10.00 ? ? ? ? ? ? 365 SER C O   1 
ATOM 8670  C CB  . SER C 1 364 ? -27.438 13.479  67.404   1.00 10.00 ? ? ? ? ? ? 365 SER C CB  1 
ATOM 8671  O OG  . SER C 1 364 ? -28.261 12.880  68.384   1.00 10.00 ? ? ? ? ? ? 365 SER C OG  1 
ATOM 8672  N N   . GLY C 1 365 ? -27.752 14.129  64.456   1.00 10.00 ? ? ? ? ? ? 366 GLY C N   1 
ATOM 8673  C CA  . GLY C 1 365 ? -27.113 14.207  63.171   1.00 10.00 ? ? ? ? ? ? 366 GLY C CA  1 
ATOM 8674  C C   . GLY C 1 365 ? -26.488 12.852  62.951   1.00 10.00 ? ? ? ? ? ? 366 GLY C C   1 
ATOM 8675  O O   . GLY C 1 365 ? -26.953 11.925  63.621   1.00 10.00 ? ? ? ? ? ? 366 GLY C O   1 
ATOM 8676  N N   . PRO C 1 366 ? -25.495 12.644  62.063   1.00 10.00 ? ? ? ? ? ? 367 PRO C N   1 
ATOM 8677  C CA  . PRO C 1 366 ? -24.764 11.374  61.906   1.00 10.00 ? ? ? ? ? ? 367 PRO C CA  1 
ATOM 8678  C C   . PRO C 1 366 ? -23.722 10.962  62.962   1.00 10.00 ? ? ? ? ? ? 367 PRO C C   1 
ATOM 8679  O O   . PRO C 1 366 ? -23.402 9.791   63.158   1.00 10.00 ? ? ? ? ? ? 367 PRO C O   1 
ATOM 8680  C CB  . PRO C 1 366 ? -24.181 11.490  60.499   1.00 10.00 ? ? ? ? ? ? 367 PRO C CB  1 
ATOM 8681  C CG  . PRO C 1 366 ? -24.024 12.968  60.315   1.00 10.00 ? ? ? ? ? ? 367 PRO C CG  1 
ATOM 8682  C CD  . PRO C 1 366 ? -25.324 13.457  60.872   1.00 10.00 ? ? ? ? ? ? 367 PRO C CD  1 
ATOM 8683  N N   . SER C 1 367 ? -23.197 11.956  63.677   1.00 10.00 ? ? ? ? ? ? 368 SER C N   1 
ATOM 8684  C CA  . SER C 1 367 ? -22.218 11.789  64.725   1.00 10.00 ? ? ? ? ? ? 368 SER C CA  1 
ATOM 8685  C C   . SER C 1 367 ? -22.705 10.776  65.759   1.00 10.00 ? ? ? ? ? ? 368 SER C C   1 
ATOM 8686  O O   . SER C 1 367 ? -21.940 9.884   66.104   1.00 10.00 ? ? ? ? ? ? 368 SER C O   1 
ATOM 8687  C CB  . SER C 1 367 ? -21.985 13.157  65.374   1.00 10.00 ? ? ? ? ? ? 368 SER C CB  1 
ATOM 8688  O OG  . SER C 1 367 ? -20.674 13.417  65.906   1.00 10.00 ? ? ? ? ? ? 368 SER C OG  1 
ATOM 8689  N N   . ILE C 1 368 ? -23.950 10.818  66.225   1.00 10.00 ? ? ? ? ? ? 369 ILE C N   1 
ATOM 8690  C CA  . ILE C 1 368 ? -24.484 9.920   67.230   1.00 10.00 ? ? ? ? ? ? 369 ILE C CA  1 
ATOM 8691  C C   . ILE C 1 368 ? -24.049 8.462   67.107   1.00 10.00 ? ? ? ? ? ? 369 ILE C C   1 
ATOM 8692  O O   . ILE C 1 368 ? -24.008 7.827   68.176   1.00 10.00 ? ? ? ? ? ? 369 ILE C O   1 
ATOM 8693  C CB  . ILE C 1 368 ? -26.045 10.005  67.213   1.00 10.00 ? ? ? ? ? ? 369 ILE C CB  1 
ATOM 8694  C CG1 . ILE C 1 368 ? -26.555 9.297   68.446   1.00 10.00 ? ? ? ? ? ? 369 ILE C CG1 1 
ATOM 8695  C CG2 . ILE C 1 368 ? -26.647 9.398   65.977   1.00 10.00 ? ? ? ? ? ? 369 ILE C CG2 1 
ATOM 8696  C CD1 . ILE C 1 368 ? -28.064 9.061   68.584   1.00 10.00 ? ? ? ? ? ? 369 ILE C CD1 1 
ATOM 8697  N N   . VAL C 1 369 ? -23.658 7.918   65.919   1.00 10.00 ? ? ? ? ? ? 370 VAL C N   1 
ATOM 8698  C CA  . VAL C 1 369 ? -23.201 6.530   65.782   1.00 10.00 ? ? ? ? ? ? 370 VAL C CA  1 
ATOM 8699  C C   . VAL C 1 369 ? -22.028 6.318   66.705   1.00 10.00 ? ? ? ? ? ? 370 VAL C C   1 
ATOM 8700  O O   . VAL C 1 369 ? -21.888 5.242   67.225   1.00 10.00 ? ? ? ? ? ? 370 VAL C O   1 
ATOM 8701  C CB  . VAL C 1 369 ? -22.543 6.057   64.489   1.00 10.00 ? ? ? ? ? ? 370 VAL C CB  1 
ATOM 8702  C CG1 . VAL C 1 369 ? -23.157 4.764   64.110   1.00 10.00 ? ? ? ? ? ? 370 VAL C CG1 1 
ATOM 8703  C CG2 . VAL C 1 369 ? -22.598 7.095   63.448   1.00 10.00 ? ? ? ? ? ? 370 VAL C CG2 1 
ATOM 8704  N N   . HIS C 1 370 ? -21.186 7.308   66.965   1.00 10.00 ? ? ? ? ? ? 371 HIS C N   1 
ATOM 8705  C CA  . HIS C 1 370 ? -20.007 7.124   67.791   1.00 10.00 ? ? ? ? ? ? 371 HIS C CA  1 
ATOM 8706  C C   . HIS C 1 370 ? -20.353 6.985   69.250   1.00 10.00 ? ? ? ? ? ? 371 HIS C C   1 
ATOM 8707  O O   . HIS C 1 370 ? -19.637 6.410   70.061   1.00 10.00 ? ? ? ? ? ? 371 HIS C O   1 
ATOM 8708  C CB  . HIS C 1 370 ? -19.007 8.300   67.671   1.00 10.00 ? ? ? ? ? ? 371 HIS C CB  1 
ATOM 8709  C CG  . HIS C 1 370 ? -18.685 8.705   66.232   1.00 10.00 ? ? ? ? ? ? 371 HIS C CG  1 
ATOM 8710  N ND1 . HIS C 1 370 ? -18.596 7.948   65.136   1.00 10.00 ? ? ? ? ? ? 371 HIS C ND1 1 
ATOM 8711  C CD2 . HIS C 1 370 ? -18.511 10.020  65.827   1.00 10.00 ? ? ? ? ? ? 371 HIS C CD2 1 
ATOM 8712  C CE1 . HIS C 1 370 ? -18.388 8.744   64.104   1.00 10.00 ? ? ? ? ? ? 371 HIS C CE1 1 
ATOM 8713  N NE2 . HIS C 1 370 ? -18.339 9.990   64.533   1.00 10.00 ? ? ? ? ? ? 371 HIS C NE2 1 
ATOM 8714  N N   . ARG C 1 371 ? -21.501 7.487   69.600   1.00 10.00 ? ? ? ? ? ? 372 ARG C N   1 
ATOM 8715  C CA  . ARG C 1 371 ? -21.860 7.528   70.979   1.00 10.00 ? ? ? ? ? ? 372 ARG C CA  1 
ATOM 8716  C C   . ARG C 1 371 ? -22.522 6.227   71.229   1.00 10.00 ? ? ? ? ? ? 372 ARG C C   1 
ATOM 8717  O O   . ARG C 1 371 ? -22.150 5.569   72.169   1.00 10.00 ? ? ? ? ? ? 372 ARG C O   1 
ATOM 8718  C CB  . ARG C 1 371 ? -22.809 8.733   71.231   1.00 10.00 ? ? ? ? ? ? 372 ARG C CB  1 
ATOM 8719  C CG  . ARG C 1 371 ? -22.326 10.148  70.751   1.00 10.00 ? ? ? ? ? ? 372 ARG C CG  1 
ATOM 8720  C CD  . ARG C 1 371 ? -21.535 11.086  71.668   1.00 10.00 ? ? ? ? ? ? 372 ARG C CD  1 
ATOM 8721  N NE  . ARG C 1 371 ? -20.260 10.561  72.121   1.00 10.00 ? ? ? ? ? ? 372 ARG C NE  1 
ATOM 8722  C CZ  . ARG C 1 371 ? -19.101 10.608  71.452   1.00 10.00 ? ? ? ? ? ? 372 ARG C CZ  1 
ATOM 8723  N NH1 . ARG C 1 371 ? -19.002 11.188  70.261   1.00 10.00 ? ? ? ? ? ? 372 ARG C NH1 1 
ATOM 8724  N NH2 . ARG C 1 371 ? -18.032 9.989   71.970   1.00 10.00 ? ? ? ? ? ? 372 ARG C NH2 1 
ATOM 8725  N N   . LYS C 1 372 ? -23.458 5.828   70.377   1.00 10.00 ? ? ? ? ? ? 373 LYS C N   1 
ATOM 8726  C CA  . LYS C 1 372 ? -24.293 4.724   70.755   1.00 10.00 ? ? ? ? ? ? 373 LYS C CA  1 
ATOM 8727  C C   . LYS C 1 372 ? -23.862 3.369   70.398   1.00 10.00 ? ? ? ? ? ? 373 LYS C C   1 
ATOM 8728  O O   . LYS C 1 372 ? -24.351 2.386   70.971   1.00 10.00 ? ? ? ? ? ? 373 LYS C O   1 
ATOM 8729  C CB  . LYS C 1 372 ? -25.667 4.877   70.213   1.00 10.00 ? ? ? ? ? ? 373 LYS C CB  1 
ATOM 8730  C CG  . LYS C 1 372 ? -26.394 6.082   70.801   1.00 10.00 ? ? ? ? ? ? 373 LYS C CG  1 
ATOM 8731  C CD  . LYS C 1 372 ? -27.883 5.945   70.818   1.00 10.00 ? ? ? ? ? ? 373 LYS C CD  1 
ATOM 8732  C CE  . LYS C 1 372 ? -28.206 4.997   71.923   1.00 10.00 ? ? ? ? ? ? 373 LYS C CE  1 
ATOM 8733  N NZ  . LYS C 1 372 ? -29.643 4.990   72.008   1.00 10.00 ? ? ? ? ? ? 373 LYS C NZ  1 
ATOM 8734  N N   . CYS C 1 373 ? -22.899 3.313   69.502   1.00 10.00 ? ? ? ? ? ? 374 CYS C N   1 
ATOM 8735  C CA  . CYS C 1 373 ? -22.399 2.028   69.049   1.00 10.00 ? ? ? ? ? ? 374 CYS C CA  1 
ATOM 8736  C C   . CYS C 1 373 ? -20.969 1.831   69.594   1.00 10.00 ? ? ? ? ? ? 374 CYS C C   1 
ATOM 8737  O O   . CYS C 1 373 ? -19.989 1.849   68.821   1.00 10.00 ? ? ? ? ? ? 374 CYS C O   1 
ATOM 8738  C CB  . CYS C 1 373 ? -22.524 2.044   67.501   1.00 10.00 ? ? ? ? ? ? 374 CYS C CB  1 
ATOM 8739  S SG  . CYS C 1 373 ? -24.217 2.375   66.847   1.00 10.00 ? ? ? ? ? ? 374 CYS C SG  1 
ATOM 8740  N N   . PHE C 1 374 ? -20.953 1.906   70.991   1.00 10.00 ? ? ? ? ? ? 375 PHE C N   1 
ATOM 8741  C CA  . PHE C 1 374 ? -19.943 1.638   72.083   1.00 10.00 ? ? ? ? ? ? 375 PHE C CA  1 
ATOM 8742  C C   . PHE C 1 374 ? -19.658 2.366   73.428   1.00 10.00 ? ? ? ? ? ? 375 PHE C C   1 
ATOM 8743  O O   . PHE C 1 374 ? -18.776 1.978   74.228   1.00 10.00 ? ? ? ? ? ? 375 PHE C O   1 
ATOM 8744  C CB  . PHE C 1 374 ? -18.615 1.438   71.411   1.00 10.00 ? ? ? ? ? ? 375 PHE C CB  1 
ATOM 8745  C CG  . PHE C 1 374 ? -18.561 -0.075  71.268   1.00 10.00 ? ? ? ? ? ? 375 PHE C CG  1 
ATOM 8746  C CD1 . PHE C 1 374 ? -19.715 -0.846  71.213   1.00 10.00 ? ? ? ? ? ? 375 PHE C CD1 1 
ATOM 8747  C CD2 . PHE C 1 374 ? -17.315 -0.659  71.189   1.00 10.00 ? ? ? ? ? ? 375 PHE C CD2 1 
ATOM 8748  C CE1 . PHE C 1 374 ? -19.627 -2.182  71.079   1.00 10.00 ? ? ? ? ? ? 375 PHE C CE1 1 
ATOM 8749  C CE2 . PHE C 1 374 ? -17.229 -2.017  71.049   1.00 10.00 ? ? ? ? ? ? 375 PHE C CE2 1 
ATOM 8750  C CZ  . PHE C 1 374 ? -18.386 -2.776  70.996   1.00 10.00 ? ? ? ? ? ? 375 PHE C CZ  1 
ATOM 8751  O OXT . PHE C 1 374 ? -20.494 3.184   73.769   1.00 10.00 ? ? ? ? ? ? 375 PHE C OXT 1 
ATOM 8752  N N   . ASP D 1 1   ? 44.261  1.773   37.933   1.00 10.00 ? ? ? ? ? ? 2   ASP D N   1 
ATOM 8753  C CA  . ASP D 1 1   ? 44.782  2.770   36.965   1.00 10.00 ? ? ? ? ? ? 2   ASP D CA  1 
ATOM 8754  C C   . ASP D 1 1   ? 44.743  2.403   35.440   1.00 10.00 ? ? ? ? ? ? 2   ASP D C   1 
ATOM 8755  O O   . ASP D 1 1   ? 45.677  1.906   34.791   1.00 10.00 ? ? ? ? ? ? 2   ASP D O   1 
ATOM 8756  C CB  . ASP D 1 1   ? 46.221  3.153   37.461   1.00 10.00 ? ? ? ? ? ? 2   ASP D CB  1 
ATOM 8757  C CG  . ASP D 1 1   ? 46.435  3.465   38.974   1.00 10.00 ? ? ? ? ? ? 2   ASP D CG  1 
ATOM 8758  O OD1 . ASP D 1 1   ? 45.425  3.556   39.703   1.00 10.00 ? ? ? ? ? ? 2   ASP D OD1 1 
ATOM 8759  O OD2 . ASP D 1 1   ? 47.601  3.619   39.418   1.00 10.00 ? ? ? ? ? ? 2   ASP D OD2 1 
ATOM 8760  N N   . ASP D 1 2   ? 43.539  2.686   34.892   1.00 10.00 ? ? ? ? ? ? 3   ASP D N   1 
ATOM 8761  C CA  . ASP D 1 2   ? 43.072  2.510   33.500   1.00 10.00 ? ? ? ? ? ? 3   ASP D CA  1 
ATOM 8762  C C   . ASP D 1 2   ? 42.894  1.072   33.073   1.00 10.00 ? ? ? ? ? ? 3   ASP D C   1 
ATOM 8763  O O   . ASP D 1 2   ? 41.848  0.632   32.588   1.00 10.00 ? ? ? ? ? ? 3   ASP D O   1 
ATOM 8764  C CB  . ASP D 1 2   ? 44.006  3.173   32.426   1.00 10.00 ? ? ? ? ? ? 3   ASP D CB  1 
ATOM 8765  C CG  . ASP D 1 2   ? 43.628  2.984   30.918   1.00 10.00 ? ? ? ? ? ? 3   ASP D CG  1 
ATOM 8766  O OD1 . ASP D 1 2   ? 42.494  2.556   30.584   1.00 10.00 ? ? ? ? ? ? 3   ASP D OD1 1 
ATOM 8767  O OD2 . ASP D 1 2   ? 44.507  3.256   30.062   1.00 10.00 ? ? ? ? ? ? 3   ASP D OD2 1 
ATOM 8768  N N   . ASP D 1 3   ? 43.982  0.352   33.107   1.00 10.00 ? ? ? ? ? ? 4   ASP D N   1 
ATOM 8769  C CA  . ASP D 1 3   ? 43.931  -1.021  32.731   1.00 10.00 ? ? ? ? ? ? 4   ASP D CA  1 
ATOM 8770  C C   . ASP D 1 3   ? 43.931  -1.469  34.167   1.00 10.00 ? ? ? ? ? ? 4   ASP D C   1 
ATOM 8771  O O   . ASP D 1 3   ? 44.812  -1.202  35.002   1.00 10.00 ? ? ? ? ? ? 4   ASP D O   1 
ATOM 8772  C CB  . ASP D 1 3   ? 45.183  -1.330  31.919   1.00 10.00 ? ? ? ? ? ? 4   ASP D CB  1 
ATOM 8773  C CG  . ASP D 1 3   ? 44.965  -1.344  30.397   1.00 10.00 ? ? ? ? ? ? 4   ASP D CG  1 
ATOM 8774  O OD1 . ASP D 1 3   ? 43.831  -1.124  29.913   1.00 10.00 ? ? ? ? ? ? 4   ASP D OD1 1 
ATOM 8775  O OD2 . ASP D 1 3   ? 45.962  -1.608  29.703   1.00 10.00 ? ? ? ? ? ? 4   ASP D OD2 1 
ATOM 8776  N N   . ILE D 1 4   ? 42.623  -1.700  34.293   1.00 10.00 ? ? ? ? ? ? 5   ILE D N   1 
ATOM 8777  C CA  . ILE D 1 4   ? 41.863  -2.159  35.428   1.00 10.00 ? ? ? ? ? ? 5   ILE D CA  1 
ATOM 8778  C C   . ILE D 1 4   ? 41.349  -1.055  36.322   1.00 10.00 ? ? ? ? ? ? 5   ILE D C   1 
ATOM 8779  O O   . ILE D 1 4   ? 41.925  -0.094  36.844   1.00 10.00 ? ? ? ? ? ? 5   ILE D O   1 
ATOM 8780  C CB  . ILE D 1 4   ? 42.640  -3.231  36.219   1.00 10.00 ? ? ? ? ? ? 5   ILE D CB  1 
ATOM 8781  C CG1 . ILE D 1 4   ? 42.261  -4.476  35.382   1.00 10.00 ? ? ? ? ? ? 5   ILE D CG1 1 
ATOM 8782  C CG2 . ILE D 1 4   ? 42.331  -3.394  37.719   1.00 10.00 ? ? ? ? ? ? 5   ILE D CG2 1 
ATOM 8783  C CD1 . ILE D 1 4   ? 40.721  -4.694  35.192   1.00 10.00 ? ? ? ? ? ? 5   ILE D CD1 1 
ATOM 8784  N N   . ALA D 1 5   ? 40.102  -1.246  35.892   1.00 10.00 ? ? ? ? ? ? 6   ALA D N   1 
ATOM 8785  C CA  . ALA D 1 5   ? 38.978  -0.374  36.077   1.00 10.00 ? ? ? ? ? ? 6   ALA D CA  1 
ATOM 8786  C C   . ALA D 1 5   ? 37.909  -1.151  35.295   1.00 10.00 ? ? ? ? ? ? 6   ALA D C   1 
ATOM 8787  O O   . ALA D 1 5   ? 38.157  -1.776  34.236   1.00 10.00 ? ? ? ? ? ? 6   ALA D O   1 
ATOM 8788  C CB  . ALA D 1 5   ? 39.143  0.989   35.370   1.00 10.00 ? ? ? ? ? ? 6   ALA D CB  1 
ATOM 8789  N N   . ALA D 1 6   ? 36.743  -1.179  35.927   1.00 10.00 ? ? ? ? ? ? 7   ALA D N   1 
ATOM 8790  C CA  . ALA D 1 6   ? 35.538  -1.693  35.358   1.00 10.00 ? ? ? ? ? ? 7   ALA D CA  1 
ATOM 8791  C C   . ALA D 1 6   ? 35.159  -0.729  34.235   1.00 10.00 ? ? ? ? ? ? 7   ALA D C   1 
ATOM 8792  O O   . ALA D 1 6   ? 35.579  0.438   34.208   1.00 10.00 ? ? ? ? ? ? 7   ALA D O   1 
ATOM 8793  C CB  . ALA D 1 6   ? 34.494  -1.702  36.448   1.00 10.00 ? ? ? ? ? ? 7   ALA D CB  1 
ATOM 8794  N N   . LEU D 1 7   ? 34.370  -1.188  33.285   1.00 10.00 ? ? ? ? ? ? 8   LEU D N   1 
ATOM 8795  C CA  . LEU D 1 7   ? 33.891  -0.345  32.209   1.00 10.00 ? ? ? ? ? ? 8   LEU D CA  1 
ATOM 8796  C C   . LEU D 1 7   ? 32.452  -0.024  32.579   1.00 10.00 ? ? ? ? ? ? 8   LEU D C   1 
ATOM 8797  O O   . LEU D 1 7   ? 31.687  -0.995  32.769   1.00 10.00 ? ? ? ? ? ? 8   LEU D O   1 
ATOM 8798  C CB  . LEU D 1 7   ? 33.857  -1.085  30.884   1.00 10.00 ? ? ? ? ? ? 8   LEU D CB  1 
ATOM 8799  C CG  . LEU D 1 7   ? 34.924  -2.089  30.522   1.00 10.00 ? ? ? ? ? ? 8   LEU D CG  1 
ATOM 8800  C CD1 . LEU D 1 7   ? 34.577  -2.694  29.189   1.00 10.00 ? ? ? ? ? ? 8   LEU D CD1 1 
ATOM 8801  C CD2 . LEU D 1 7   ? 36.260  -1.438  30.494   1.00 10.00 ? ? ? ? ? ? 8   LEU D CD2 1 
ATOM 8802  N N   . VAL D 1 8   ? 32.013  1.221   32.750   1.00 10.00 ? ? ? ? ? ? 9   VAL D N   1 
ATOM 8803  C CA  . VAL D 1 8   ? 30.596  1.418   33.010   1.00 10.00 ? ? ? ? ? ? 9   VAL D CA  1 
ATOM 8804  C C   . VAL D 1 8   ? 29.861  1.495   31.651   1.00 10.00 ? ? ? ? ? ? 9   VAL D C   1 
ATOM 8805  O O   . VAL D 1 8   ? 30.272  2.275   30.780   1.00 10.00 ? ? ? ? ? ? 9   VAL D O   1 
ATOM 8806  C CB  . VAL D 1 8   ? 30.371  2.713   33.796   1.00 10.00 ? ? ? ? ? ? 9   VAL D CB  1 
ATOM 8807  C CG1 . VAL D 1 8   ? 28.944  2.643   34.389   1.00 10.00 ? ? ? ? ? ? 9   VAL D CG1 1 
ATOM 8808  C CG2 . VAL D 1 8   ? 31.391  2.908   34.864   1.00 10.00 ? ? ? ? ? ? 9   VAL D CG2 1 
ATOM 8809  N N   . VAL D 1 9   ? 28.793  0.768   31.359   1.00 10.00 ? ? ? ? ? ? 10  VAL D N   1 
ATOM 8810  C CA  . VAL D 1 9   ? 28.073  0.822   30.090   1.00 10.00 ? ? ? ? ? ? 10  VAL D CA  1 
ATOM 8811  C C   . VAL D 1 9   ? 26.663  1.227   30.514   1.00 10.00 ? ? ? ? ? ? 10  VAL D C   1 
ATOM 8812  O O   . VAL D 1 9   ? 25.959  0.531   31.286   1.00 10.00 ? ? ? ? ? ? 10  VAL D O   1 
ATOM 8813  C CB  . VAL D 1 9   ? 28.059  -0.587  29.406   1.00 10.00 ? ? ? ? ? ? 10  VAL D CB  1 
ATOM 8814  C CG1 . VAL D 1 9   ? 27.152  -0.654  28.216   1.00 10.00 ? ? ? ? ? ? 10  VAL D CG1 1 
ATOM 8815  C CG2 . VAL D 1 9   ? 29.438  -0.898  28.881   1.00 10.00 ? ? ? ? ? ? 10  VAL D CG2 1 
ATOM 8816  N N   . ASP D 1 10  ? 26.237  2.395   30.041   1.00 10.00 ? ? ? ? ? ? 11  ASP D N   1 
ATOM 8817  C CA  . ASP D 1 10  ? 24.905  2.850   30.351   1.00 10.00 ? ? ? ? ? ? 11  ASP D CA  1 
ATOM 8818  C C   . ASP D 1 10  ? 24.149  2.695   29.081   1.00 10.00 ? ? ? ? ? ? 11  ASP D C   1 
ATOM 8819  O O   . ASP D 1 10  ? 24.558  3.259   28.080   1.00 10.00 ? ? ? ? ? ? 11  ASP D O   1 
ATOM 8820  C CB  . ASP D 1 10  ? 24.905  4.298   30.788   1.00 10.00 ? ? ? ? ? ? 11  ASP D CB  1 
ATOM 8821  C CG  . ASP D 1 10  ? 23.523  4.859   31.107   1.00 10.00 ? ? ? ? ? ? 11  ASP D CG  1 
ATOM 8822  O OD1 . ASP D 1 10  ? 22.541  4.143   31.291   1.00 10.00 ? ? ? ? ? ? 11  ASP D OD1 1 
ATOM 8823  O OD2 . ASP D 1 10  ? 23.443  6.064   31.161   1.00 10.00 ? ? ? ? ? ? 11  ASP D OD2 1 
ATOM 8824  N N   . ASN D 1 11  ? 23.064  1.938   29.143   1.00 10.00 ? ? ? ? ? ? 12  ASN D N   1 
ATOM 8825  C CA  . ASN D 1 11  ? 22.256  1.541   27.979   1.00 10.00 ? ? ? ? ? ? 12  ASN D CA  1 
ATOM 8826  C C   . ASN D 1 11  ? 20.957  2.264   27.915   1.00 10.00 ? ? ? ? ? ? 12  ASN D C   1 
ATOM 8827  O O   . ASN D 1 11  ? 20.001  1.865   28.609   1.00 10.00 ? ? ? ? ? ? 12  ASN D O   1 
ATOM 8828  C CB  . ASN D 1 11  ? 21.841  0.082   27.955   1.00 10.00 ? ? ? ? ? ? 12  ASN D CB  1 
ATOM 8829  C CG  . ASN D 1 11  ? 23.074  -0.753  28.019   1.00 10.00 ? ? ? ? ? ? 12  ASN D CG  1 
ATOM 8830  O OD1 . ASN D 1 11  ? 23.770  -0.932  27.016   1.00 10.00 ? ? ? ? ? ? 12  ASN D OD1 1 
ATOM 8831  N ND2 . ASN D 1 11  ? 23.378  -1.203  29.243   1.00 10.00 ? ? ? ? ? ? 12  ASN D ND2 1 
ATOM 8832  N N   . GLY D 1 12  ? 21.019  3.362   27.159   1.00 10.00 ? ? ? ? ? ? 13  GLY D N   1 
ATOM 8833  C CA  . GLY D 1 12  ? 19.859  4.178   26.940   1.00 10.00 ? ? ? ? ? ? 13  GLY D CA  1 
ATOM 8834  C C   . GLY D 1 12  ? 19.191  3.862   25.608   1.00 10.00 ? ? ? ? ? ? 13  GLY D C   1 
ATOM 8835  O O   . GLY D 1 12  ? 19.802  3.406   24.623   1.00 10.00 ? ? ? ? ? ? 13  GLY D O   1 
ATOM 8836  N N   . SER D 1 13  ? 17.883  4.137   25.684   1.00 10.00 ? ? ? ? ? ? 14  SER D N   1 
ATOM 8837  C CA  . SER D 1 13  ? 16.951  4.103   24.577   1.00 10.00 ? ? ? ? ? ? 14  SER D CA  1 
ATOM 8838  C C   . SER D 1 13  ? 17.381  4.989   23.391   1.00 10.00 ? ? ? ? ? ? 14  SER D C   1 
ATOM 8839  O O   . SER D 1 13  ? 17.234  4.641   22.232   1.00 10.00 ? ? ? ? ? ? 14  SER D O   1 
ATOM 8840  C CB  . SER D 1 13  ? 15.596  4.556   25.086   1.00 10.00 ? ? ? ? ? ? 14  SER D CB  1 
ATOM 8841  O OG  . SER D 1 13  ? 15.085  3.810   26.189   1.00 10.00 ? ? ? ? ? ? 14  SER D OG  1 
ATOM 8842  N N   . GLY D 1 14  ? 17.875  6.182   23.625   1.00 10.00 ? ? ? ? ? ? 15  GLY D N   1 
ATOM 8843  C CA  . GLY D 1 14  ? 18.354  6.998   22.547   1.00 10.00 ? ? ? ? ? ? 15  GLY D CA  1 
ATOM 8844  C C   . GLY D 1 14  ? 19.860  7.021   22.417   1.00 10.00 ? ? ? ? ? ? 15  GLY D C   1 
ATOM 8845  O O   . GLY D 1 14  ? 20.364  7.033   21.294   1.00 10.00 ? ? ? ? ? ? 15  GLY D O   1 
ATOM 8846  N N   . MET D 1 15  ? 20.560  6.940   23.545   1.00 10.00 ? ? ? ? ? ? 16  MET D N   1 
ATOM 8847  C CA  . MET D 1 15  ? 21.993  7.114   23.671   1.00 10.00 ? ? ? ? ? ? 16  MET D CA  1 
ATOM 8848  C C   . MET D 1 15  ? 22.670  6.069   24.572   1.00 10.00 ? ? ? ? ? ? 16  MET D C   1 
ATOM 8849  O O   . MET D 1 15  ? 22.107  5.615   25.562   1.00 10.00 ? ? ? ? ? ? 16  MET D O   1 
ATOM 8850  C CB  . MET D 1 15  ? 22.239  8.499   24.240   1.00 10.00 ? ? ? ? ? ? 16  MET D CB  1 
ATOM 8851  C CG  . MET D 1 15  ? 21.860  9.719   23.440   1.00 10.00 ? ? ? ? ? ? 16  MET D CG  1 
ATOM 8852  S SD  . MET D 1 15  ? 22.772  9.685   21.863   1.00 10.00 ? ? ? ? ? ? 16  MET D SD  1 
ATOM 8853  C CE  . MET D 1 15  ? 24.397  10.306  22.202   1.00 10.00 ? ? ? ? ? ? 16  MET D CE  1 
ATOM 8854  N N   . CYS D 1 16  ? 23.900  5.655   24.299   1.00 10.00 ? ? ? ? ? ? 17  CYS D N   1 
ATOM 8855  C CA  . CYS D 1 16  ? 24.656  4.746   25.143   1.00 10.00 ? ? ? ? ? ? 17  CYS D CA  1 
ATOM 8856  C C   . CYS D 1 16  ? 25.869  5.550   25.534   1.00 10.00 ? ? ? ? ? ? 17  CYS D C   1 
ATOM 8857  O O   . CYS D 1 16  ? 26.374  6.294   24.694   1.00 10.00 ? ? ? ? ? ? 17  CYS D O   1 
ATOM 8858  C CB  . CYS D 1 16  ? 25.189  3.477   24.425   1.00 10.00 ? ? ? ? ? ? 17  CYS D CB  1 
ATOM 8859  S SG  . CYS D 1 16  ? 24.051  2.127   23.972   1.00 10.00 ? ? ? ? ? ? 17  CYS D SG  1 
ATOM 8860  N N   . LYS D 1 17  ? 26.382  5.448   26.750   1.00 10.00 ? ? ? ? ? ? 18  LYS D N   1 
ATOM 8861  C CA  . LYS D 1 17  ? 27.562  6.175   27.205   1.00 10.00 ? ? ? ? ? ? 18  LYS D CA  1 
ATOM 8862  C C   . LYS D 1 17  ? 28.353  5.077   27.911   1.00 10.00 ? ? ? ? ? ? 18  LYS D C   1 
ATOM 8863  O O   . LYS D 1 17  ? 27.794  4.255   28.654   1.00 10.00 ? ? ? ? ? ? 18  LYS D O   1 
ATOM 8864  C CB  . LYS D 1 17  ? 27.245  7.320   28.233   1.00 10.00 ? ? ? ? ? ? 18  LYS D CB  1 
ATOM 8865  C CG  . LYS D 1 17  ? 25.799  7.704   28.645   1.00 10.00 ? ? ? ? ? ? 18  LYS D CG  1 
ATOM 8866  C CD  . LYS D 1 17  ? 24.915  8.344   27.571   1.00 10.00 ? ? ? ? ? ? 18  LYS D CD  1 
ATOM 8867  C CE  . LYS D 1 17  ? 23.481  8.567   28.010   1.00 10.00 ? ? ? ? ? ? 18  LYS D CE  1 
ATOM 8868  N NZ  . LYS D 1 17  ? 22.760  7.329   27.871   1.00 10.00 ? ? ? ? ? ? 18  LYS D NZ  1 
ATOM 8869  N N   . ALA D 1 18  ? 29.641  4.973   27.584   1.00 10.00 ? ? ? ? ? ? 19  ALA D N   1 
ATOM 8870  C CA  . ALA D 1 18  ? 30.508  3.910   28.050   1.00 10.00 ? ? ? ? ? ? 19  ALA D CA  1 
ATOM 8871  C C   . ALA D 1 18  ? 31.883  4.440   28.370   1.00 10.00 ? ? ? ? ? ? 19  ALA D C   1 
ATOM 8872  O O   . ALA D 1 18  ? 32.432  5.288   27.671   1.00 10.00 ? ? ? ? ? ? 19  ALA D O   1 
ATOM 8873  C CB  . ALA D 1 18  ? 30.682  2.847   27.020   1.00 10.00 ? ? ? ? ? ? 19  ALA D CB  1 
ATOM 8874  N N   . GLY D 1 19  ? 32.456  4.024   29.470   1.00 10.00 ? ? ? ? ? ? 20  GLY D N   1 
ATOM 8875  C CA  . GLY D 1 19  ? 33.743  4.547   29.840   1.00 10.00 ? ? ? ? ? ? 20  GLY D CA  1 
ATOM 8876  C C   . GLY D 1 19  ? 34.365  3.691   30.913   1.00 10.00 ? ? ? ? ? ? 20  GLY D C   1 
ATOM 8877  O O   . GLY D 1 19  ? 33.996  2.523   31.131   1.00 10.00 ? ? ? ? ? ? 20  GLY D O   1 
ATOM 8878  N N   . PHE D 1 20  ? 35.268  4.354   31.614   1.00 10.00 ? ? ? ? ? ? 21  PHE D N   1 
ATOM 8879  C CA  . PHE D 1 20  ? 36.048  3.650   32.582   1.00 10.00 ? ? ? ? ? ? 21  PHE D CA  1 
ATOM 8880  C C   . PHE D 1 20  ? 35.789  4.226   33.953   1.00 10.00 ? ? ? ? ? ? 21  PHE D C   1 
ATOM 8881  O O   . PHE D 1 20  ? 35.719  5.448   34.144   1.00 10.00 ? ? ? ? ? ? 21  PHE D O   1 
ATOM 8882  C CB  . PHE D 1 20  ? 37.525  3.756   32.218   1.00 10.00 ? ? ? ? ? ? 21  PHE D CB  1 
ATOM 8883  C CG  . PHE D 1 20  ? 37.969  2.990   30.982   1.00 10.00 ? ? ? ? ? ? 21  PHE D CG  1 
ATOM 8884  C CD1 . PHE D 1 20  ? 37.360  1.839   30.552   1.00 10.00 ? ? ? ? ? ? 21  PHE D CD1 1 
ATOM 8885  C CD2 . PHE D 1 20  ? 39.002  3.467   30.223   1.00 10.00 ? ? ? ? ? ? 21  PHE D CD2 1 
ATOM 8886  C CE1 . PHE D 1 20  ? 37.777  1.203   29.389   1.00 10.00 ? ? ? ? ? ? 21  PHE D CE1 1 
ATOM 8887  C CE2 . PHE D 1 20  ? 39.417  2.830   29.067   1.00 10.00 ? ? ? ? ? ? 21  PHE D CE2 1 
ATOM 8888  C CZ  . PHE D 1 20  ? 38.804  1.689   28.641   1.00 10.00 ? ? ? ? ? ? 21  PHE D CZ  1 
ATOM 8889  N N   . ALA D 1 21  ? 35.609  3.293   34.896   1.00 10.00 ? ? ? ? ? ? 22  ALA D N   1 
ATOM 8890  C CA  . ALA D 1 21  ? 35.367  3.659   36.277   1.00 10.00 ? ? ? ? ? ? 22  ALA D CA  1 
ATOM 8891  C C   . ALA D 1 21  ? 36.615  4.356   36.784   1.00 10.00 ? ? ? ? ? ? 22  ALA D C   1 
ATOM 8892  O O   . ALA D 1 21  ? 37.746  4.023   36.410   1.00 10.00 ? ? ? ? ? ? 22  ALA D O   1 
ATOM 8893  C CB  . ALA D 1 21  ? 35.085  2.437   37.124   1.00 10.00 ? ? ? ? ? ? 22  ALA D CB  1 
ATOM 8894  N N   . GLY D 1 22  ? 36.271  5.416   37.538   1.00 10.00 ? ? ? ? ? ? 23  GLY D N   1 
ATOM 8895  C CA  . GLY D 1 22  ? 37.202  6.386   38.065   1.00 10.00 ? ? ? ? ? ? 23  GLY D CA  1 
ATOM 8896  C C   . GLY D 1 22  ? 37.199  7.645   37.210   1.00 10.00 ? ? ? ? ? ? 23  GLY D C   1 
ATOM 8897  O O   . GLY D 1 22  ? 37.887  8.617   37.549   1.00 10.00 ? ? ? ? ? ? 23  GLY D O   1 
ATOM 8898  N N   . ASP D 1 23  ? 36.468  7.687   36.087   1.00 10.00 ? ? ? ? ? ? 24  ASP D N   1 
ATOM 8899  C CA  . ASP D 1 23  ? 36.443  8.860   35.218   1.00 10.00 ? ? ? ? ? ? 24  ASP D CA  1 
ATOM 8900  C C   . ASP D 1 23  ? 35.205  9.740   35.394   1.00 10.00 ? ? ? ? ? ? 24  ASP D C   1 
ATOM 8901  O O   . ASP D 1 23  ? 34.049  9.405   35.689   1.00 10.00 ? ? ? ? ? ? 24  ASP D O   1 
ATOM 8902  C CB  . ASP D 1 23  ? 36.493  8.497   33.742   1.00 10.00 ? ? ? ? ? ? 24  ASP D CB  1 
ATOM 8903  C CG  . ASP D 1 23  ? 37.743  7.859   33.137   1.00 10.00 ? ? ? ? ? ? 24  ASP D CG  1 
ATOM 8904  O OD1 . ASP D 1 23  ? 38.847  8.056   33.623   1.00 10.00 ? ? ? ? ? ? 24  ASP D OD1 1 
ATOM 8905  O OD2 . ASP D 1 23  ? 37.621  7.187   32.112   1.00 10.00 ? ? ? ? ? ? 24  ASP D OD2 1 
ATOM 8906  N N   . ASP D 1 24  ? 35.573  10.976  35.161   1.00 10.00 ? ? ? ? ? ? 25  ASP D N   1 
ATOM 8907  C CA  . ASP D 1 24  ? 34.668  12.095  35.207   1.00 10.00 ? ? ? ? ? ? 25  ASP D CA  1 
ATOM 8908  C C   . ASP D 1 24  ? 33.603  12.030  34.098   1.00 10.00 ? ? ? ? ? ? 25  ASP D C   1 
ATOM 8909  O O   . ASP D 1 24  ? 32.418  12.169  34.380   1.00 10.00 ? ? ? ? ? ? 25  ASP D O   1 
ATOM 8910  C CB  . ASP D 1 24  ? 35.623  13.357  35.180   1.00 10.00 ? ? ? ? ? ? 25  ASP D CB  1 
ATOM 8911  C CG  . ASP D 1 24  ? 36.423  13.586  36.510   1.00 10.00 ? ? ? ? ? ? 25  ASP D CG  1 
ATOM 8912  O OD1 . ASP D 1 24  ? 35.869  13.375  37.587   1.00 10.00 ? ? ? ? ? ? 25  ASP D OD1 1 
ATOM 8913  O OD2 . ASP D 1 24  ? 37.588  14.009  36.514   1.00 10.00 ? ? ? ? ? ? 25  ASP D OD2 1 
ATOM 8914  N N   . ALA D 1 25  ? 33.866  11.775  32.823   1.00 10.00 ? ? ? ? ? ? 26  ALA D N   1 
ATOM 8915  C CA  . ALA D 1 25  ? 32.771  11.762  31.847   1.00 10.00 ? ? ? ? ? ? 26  ALA D CA  1 
ATOM 8916  C C   . ALA D 1 25  ? 32.801  10.523  30.974   1.00 10.00 ? ? ? ? ? ? 26  ALA D C   1 
ATOM 8917  O O   . ALA D 1 25  ? 33.848  9.881   30.875   1.00 10.00 ? ? ? ? ? ? 26  ALA D O   1 
ATOM 8918  C CB  . ALA D 1 25  ? 32.891  13.000  30.986   1.00 10.00 ? ? ? ? ? ? 26  ALA D CB  1 
ATOM 8919  N N   . PRO D 1 26  ? 31.726  10.082  30.354   1.00 10.00 ? ? ? ? ? ? 27  PRO D N   1 
ATOM 8920  C CA  . PRO D 1 26  ? 31.742  9.039   29.339   1.00 10.00 ? ? ? ? ? ? 27  PRO D CA  1 
ATOM 8921  C C   . PRO D 1 26  ? 32.767  9.205   28.234   1.00 10.00 ? ? ? ? ? ? 27  PRO D C   1 
ATOM 8922  O O   . PRO D 1 26  ? 32.764  10.294  27.656   1.00 10.00 ? ? ? ? ? ? 27  PRO D O   1 
ATOM 8923  C CB  . PRO D 1 26  ? 30.343  9.022   28.791   1.00 10.00 ? ? ? ? ? ? 27  PRO D CB  1 
ATOM 8924  C CG  . PRO D 1 26  ? 29.791  10.351  29.183   1.00 10.00 ? ? ? ? ? ? 27  PRO D CG  1 
ATOM 8925  C CD  . PRO D 1 26  ? 30.371  10.526  30.581   1.00 10.00 ? ? ? ? ? ? 27  PRO D CD  1 
ATOM 8926  N N   . ARG D 1 27  ? 33.593  8.207   27.886   1.00 10.00 ? ? ? ? ? ? 28  ARG D N   1 
ATOM 8927  C CA  . ARG D 1 27  ? 34.517  8.337   26.766   1.00 10.00 ? ? ? ? ? ? 28  ARG D CA  1 
ATOM 8928  C C   . ARG D 1 27  ? 33.815  8.115   25.442   1.00 10.00 ? ? ? ? ? ? 28  ARG D C   1 
ATOM 8929  O O   . ARG D 1 27  ? 34.269  8.651   24.435   1.00 10.00 ? ? ? ? ? ? 28  ARG D O   1 
ATOM 8930  C CB  . ARG D 1 27  ? 35.667  7.332   26.780   1.00 10.00 ? ? ? ? ? ? 28  ARG D CB  1 
ATOM 8931  C CG  . ARG D 1 27  ? 36.889  7.573   27.648   1.00 10.00 ? ? ? ? ? ? 28  ARG D CG  1 
ATOM 8932  C CD  . ARG D 1 27  ? 37.330  6.281   28.364   1.00 10.00 ? ? ? ? ? ? 28  ARG D CD  1 
ATOM 8933  N NE  . ARG D 1 27  ? 38.406  6.571   29.316   1.00 10.00 ? ? ? ? ? ? 28  ARG D NE  1 
ATOM 8934  C CZ  . ARG D 1 27  ? 39.714  6.415   29.003   1.00 10.00 ? ? ? ? ? ? 28  ARG D CZ  1 
ATOM 8935  N NH1 . ARG D 1 27  ? 40.096  5.926   27.789   1.00 10.00 ? ? ? ? ? ? 28  ARG D NH1 1 
ATOM 8936  N NH2 . ARG D 1 27  ? 40.642  6.705   29.945   1.00 10.00 ? ? ? ? ? ? 28  ARG D NH2 1 
ATOM 8937  N N   . ALA D 1 28  ? 32.777  7.289   25.350   1.00 10.00 ? ? ? ? ? ? 29  ALA D N   1 
ATOM 8938  C CA  . ALA D 1 28  ? 32.106  7.043   24.094   1.00 10.00 ? ? ? ? ? ? 29  ALA D CA  1 
ATOM 8939  C C   . ALA D 1 28  ? 30.655  7.330   24.334   1.00 10.00 ? ? ? ? ? ? 29  ALA D C   1 
ATOM 8940  O O   . ALA D 1 28  ? 30.038  6.619   25.151   1.00 10.00 ? ? ? ? ? ? 29  ALA D O   1 
ATOM 8941  C CB  . ALA D 1 28  ? 32.131  5.621   23.657   1.00 10.00 ? ? ? ? ? ? 29  ALA D CB  1 
ATOM 8942  N N   . VAL D 1 29  ? 30.063  8.359   23.709   1.00 10.00 ? ? ? ? ? ? 30  VAL D N   1 
ATOM 8943  C CA  . VAL D 1 29  ? 28.628  8.491   23.852   1.00 10.00 ? ? ? ? ? ? 30  VAL D CA  1 
ATOM 8944  C C   . VAL D 1 29  ? 28.110  8.130   22.466   1.00 10.00 ? ? ? ? ? ? 30  VAL D C   1 
ATOM 8945  O O   . VAL D 1 29  ? 28.735  8.627   21.525   1.00 10.00 ? ? ? ? ? ? 30  VAL D O   1 
ATOM 8946  C CB  . VAL D 1 29  ? 28.399  9.916   24.294   1.00 10.00 ? ? ? ? ? ? 30  VAL D CB  1 
ATOM 8947  C CG1 . VAL D 1 29  ? 26.940  10.149  24.589   1.00 10.00 ? ? ? ? ? ? 30  VAL D CG1 1 
ATOM 8948  C CG2 . VAL D 1 29  ? 29.167  10.162  25.567   1.00 10.00 ? ? ? ? ? ? 30  VAL D CG2 1 
ATOM 8949  N N   . PHE D 1 30  ? 27.146  7.255   22.166   1.00 10.00 ? ? ? ? ? ? 31  PHE D N   1 
ATOM 8950  C CA  . PHE D 1 30  ? 26.780  7.072   20.778   1.00 10.00 ? ? ? ? ? ? 31  PHE D CA  1 
ATOM 8951  C C   . PHE D 1 30  ? 25.334  6.850   20.622   1.00 10.00 ? ? ? ? ? ? 31  PHE D C   1 
ATOM 8952  O O   . PHE D 1 30  ? 24.719  6.551   21.627   1.00 10.00 ? ? ? ? ? ? 31  PHE D O   1 
ATOM 8953  C CB  . PHE D 1 30  ? 27.445  5.898   20.083   1.00 10.00 ? ? ? ? ? ? 31  PHE D CB  1 
ATOM 8954  C CG  . PHE D 1 30  ? 27.712  4.638   20.866   1.00 10.00 ? ? ? ? ? ? 31  PHE D CG  1 
ATOM 8955  C CD1 . PHE D 1 30  ? 28.796  4.599   21.729   1.00 10.00 ? ? ? ? ? ? 31  PHE D CD1 1 
ATOM 8956  C CD2 . PHE D 1 30  ? 26.888  3.542   20.712   1.00 10.00 ? ? ? ? ? ? 31  PHE D CD2 1 
ATOM 8957  C CE1 . PHE D 1 30  ? 29.079  3.490   22.448   1.00 10.00 ? ? ? ? ? ? 31  PHE D CE1 1 
ATOM 8958  C CE2 . PHE D 1 30  ? 27.183  2.413   21.451   1.00 10.00 ? ? ? ? ? ? 31  PHE D CE2 1 
ATOM 8959  C CZ  . PHE D 1 30  ? 28.268  2.406   22.302   1.00 10.00 ? ? ? ? ? ? 31  PHE D CZ  1 
ATOM 8960  N N   . PRO D 1 31  ? 24.749  7.092   19.440   1.00 10.00 ? ? ? ? ? ? 32  PRO D N   1 
ATOM 8961  C CA  . PRO D 1 31  ? 23.396  6.685   19.047   1.00 10.00 ? ? ? ? ? ? 32  PRO D CA  1 
ATOM 8962  C C   . PRO D 1 31  ? 23.015  5.209   19.256   1.00 10.00 ? ? ? ? ? ? 32  PRO D C   1 
ATOM 8963  O O   . PRO D 1 31  ? 23.761  4.312   18.796   1.00 10.00 ? ? ? ? ? ? 32  PRO D O   1 
ATOM 8964  C CB  . PRO D 1 31  ? 23.354  7.153   17.582   1.00 10.00 ? ? ? ? ? ? 32  PRO D CB  1 
ATOM 8965  C CG  . PRO D 1 31  ? 24.103  8.461   17.599   1.00 10.00 ? ? ? ? ? ? 32  PRO D CG  1 
ATOM 8966  C CD  . PRO D 1 31  ? 25.261  8.083   18.476   1.00 10.00 ? ? ? ? ? ? 32  PRO D CD  1 
ATOM 8967  N N   . SER D 1 32  ? 21.877  4.888   19.911   1.00 10.00 ? ? ? ? ? ? 33  SER D N   1 
ATOM 8968  C CA  . SER D 1 32  ? 21.520  3.473   20.076   1.00 10.00 ? ? ? ? ? ? 33  SER D CA  1 
ATOM 8969  C C   . SER D 1 32  ? 20.685  2.893   18.923   1.00 10.00 ? ? ? ? ? ? 33  SER D C   1 
ATOM 8970  O O   . SER D 1 32  ? 19.491  2.561   19.004   1.00 10.00 ? ? ? ? ? ? 33  SER D O   1 
ATOM 8971  C CB  . SER D 1 32  ? 20.755  3.212   21.413   1.00 10.00 ? ? ? ? ? ? 33  SER D CB  1 
ATOM 8972  O OG  . SER D 1 32  ? 21.602  3.094   22.557   1.00 10.00 ? ? ? ? ? ? 33  SER D OG  1 
ATOM 8973  N N   . ILE D 1 33  ? 24.837  -2.423  14.957   1.00 10.00 ? ? ? ? ? ? 34  ILE D N   1 
ATOM 8974  C CA  . ILE D 1 33  ? 24.579  -3.615  14.191   1.00 10.00 ? ? ? ? ? ? 34  ILE D CA  1 
ATOM 8975  C C   . ILE D 1 33  ? 25.270  -3.609  12.819   1.00 10.00 ? ? ? ? ? ? 34  ILE D C   1 
ATOM 8976  O O   . ILE D 1 33  ? 25.582  -2.530  12.272   1.00 10.00 ? ? ? ? ? ? 34  ILE D O   1 
ATOM 8977  C CB  . ILE D 1 33  ? 23.043  -3.813  14.022   1.00 10.00 ? ? ? ? ? ? 34  ILE D CB  1 
ATOM 8978  C CG1 . ILE D 1 33  ? 22.106  -3.030  14.944   1.00 10.00 ? ? ? ? ? ? 34  ILE D CG1 1 
ATOM 8979  C CG2 . ILE D 1 33  ? 22.852  -5.258  14.443   1.00 10.00 ? ? ? ? ? ? 34  ILE D CG2 1 
ATOM 8980  C CD1 . ILE D 1 33  ? 21.701  -1.739  14.262   1.00 10.00 ? ? ? ? ? ? 34  ILE D CD1 1 
ATOM 8981  N N   . VAL D 1 34  ? 25.623  -4.824  12.349   1.00 10.00 ? ? ? ? ? ? 35  VAL D N   1 
ATOM 8982  C CA  . VAL D 1 34  ? 26.154  -5.102  11.006   1.00 10.00 ? ? ? ? ? ? 35  VAL D CA  1 
ATOM 8983  C C   . VAL D 1 34  ? 25.037  -5.870  10.335   1.00 10.00 ? ? ? ? ? ? 35  VAL D C   1 
ATOM 8984  O O   . VAL D 1 34  ? 24.538  -6.871  10.880   1.00 10.00 ? ? ? ? ? ? 35  VAL D O   1 
ATOM 8985  C CB  . VAL D 1 34  ? 27.405  -6.018  11.002   1.00 10.00 ? ? ? ? ? ? 35  VAL D CB  1 
ATOM 8986  C CG1 . VAL D 1 34  ? 27.679  -6.554  9.618    1.00 10.00 ? ? ? ? ? ? 35  VAL D CG1 1 
ATOM 8987  C CG2 . VAL D 1 34  ? 28.648  -5.205  11.364   1.00 10.00 ? ? ? ? ? ? 35  VAL D CG2 1 
ATOM 8988  N N   . GLY D 1 35  ? 24.648  -5.488  9.132    1.00 10.00 ? ? ? ? ? ? 36  GLY D N   1 
ATOM 8989  C CA  . GLY D 1 35  ? 23.551  -6.171  8.481    1.00 10.00 ? ? ? ? ? ? 36  GLY D CA  1 
ATOM 8990  C C   . GLY D 1 35  ? 23.949  -6.693  7.129    1.00 10.00 ? ? ? ? ? ? 36  GLY D C   1 
ATOM 8991  O O   . GLY D 1 35  ? 24.274  -5.901  6.237    1.00 10.00 ? ? ? ? ? ? 36  GLY D O   1 
ATOM 8992  N N   . ARG D 1 36  ? 23.955  -8.008  6.958    1.00 10.00 ? ? ? ? ? ? 37  ARG D N   1 
ATOM 8993  C CA  . ARG D 1 36  ? 24.291  -8.594  5.650    1.00 10.00 ? ? ? ? ? ? 37  ARG D CA  1 
ATOM 8994  C C   . ARG D 1 36  ? 22.979  -9.056  4.968    1.00 10.00 ? ? ? ? ? ? 37  ARG D C   1 
ATOM 8995  O O   . ARG D 1 36  ? 22.083  -9.608  5.611    1.00 10.00 ? ? ? ? ? ? 37  ARG D O   1 
ATOM 8996  C CB  . ARG D 1 36  ? 25.357  -9.759  5.867    1.00 10.00 ? ? ? ? ? ? 37  ARG D CB  1 
ATOM 8997  C CG  . ARG D 1 36  ? 25.431  -11.047 4.984    1.00 10.00 ? ? ? ? ? ? 37  ARG D CG  1 
ATOM 8998  C CD  . ARG D 1 36  ? 25.519  -10.983 3.426    1.00 10.00 ? ? ? ? ? ? 37  ARG D CD  1 
ATOM 8999  N NE  . ARG D 1 36  ? 25.235  -12.313 2.852    1.00 10.00 ? ? ? ? ? ? 37  ARG D NE  1 
ATOM 9000  C CZ  . ARG D 1 36  ? 24.645  -12.586 1.652    1.00 10.00 ? ? ? ? ? ? 37  ARG D CZ  1 
ATOM 9001  N NH1 . ARG D 1 36  ? 24.227  -11.639 0.781    1.00 10.00 ? ? ? ? ? ? 37  ARG D NH1 1 
ATOM 9002  N NH2 . ARG D 1 36  ? 24.434  -13.884 1.341    1.00 10.00 ? ? ? ? ? ? 37  ARG D NH2 1 
ATOM 9003  N N   . PRO D 1 37  ? 22.781  -8.738  3.676    1.00 10.00 ? ? ? ? ? ? 38  PRO D N   1 
ATOM 9004  C CA  . PRO D 1 37  ? 21.611  -9.093  2.898    1.00 10.00 ? ? ? ? ? ? 38  PRO D CA  1 
ATOM 9005  C C   . PRO D 1 37  ? 21.027  -10.471 3.009    1.00 10.00 ? ? ? ? ? ? 38  PRO D C   1 
ATOM 9006  O O   . PRO D 1 37  ? 19.828  -10.543 2.826    1.00 10.00 ? ? ? ? ? ? 38  PRO D O   1 
ATOM 9007  C CB  . PRO D 1 37  ? 22.026  -8.747  1.505    1.00 10.00 ? ? ? ? ? ? 38  PRO D CB  1 
ATOM 9008  C CG  . PRO D 1 37  ? 22.777  -7.442  1.654    1.00 10.00 ? ? ? ? ? ? 38  PRO D CG  1 
ATOM 9009  C CD  . PRO D 1 37  ? 23.531  -7.684  2.963    1.00 10.00 ? ? ? ? ? ? 38  PRO D CD  1 
ATOM 9010  N N   . ARG D 1 38  ? 21.709  -11.589 3.296    1.00 10.00 ? ? ? ? ? ? 39  ARG D N   1 
ATOM 9011  C CA  . ARG D 1 38  ? 21.086  -12.930 3.316    1.00 10.00 ? ? ? ? ? ? 39  ARG D CA  1 
ATOM 9012  C C   . ARG D 1 38  ? 20.156  -13.186 2.093    1.00 10.00 ? ? ? ? ? ? 39  ARG D C   1 
ATOM 9013  O O   . ARG D 1 38  ? 19.076  -13.807 2.147    1.00 10.00 ? ? ? ? ? ? 39  ARG D O   1 
ATOM 9014  C CB  . ARG D 1 38  ? 20.310  -13.083 4.662    1.00 10.00 ? ? ? ? ? ? 39  ARG D CB  1 
ATOM 9015  C CG  . ARG D 1 38  ? 19.749  -14.449 5.138    1.00 10.00 ? ? ? ? ? ? 39  ARG D CG  1 
ATOM 9016  C CD  . ARG D 1 38  ? 18.333  -14.233 5.742    1.00 10.00 ? ? ? ? ? ? 39  ARG D CD  1 
ATOM 9017  N NE  . ARG D 1 38  ? 17.970  -15.162 6.833    1.00 10.00 ? ? ? ? ? ? 39  ARG D NE  1 
ATOM 9018  C CZ  . ARG D 1 38  ? 16.713  -15.611 7.045    1.00 10.00 ? ? ? ? ? ? 39  ARG D CZ  1 
ATOM 9019  N NH1 . ARG D 1 38  ? 15.680  -15.255 6.270    1.00 10.00 ? ? ? ? ? ? 39  ARG D NH1 1 
ATOM 9020  N NH2 . ARG D 1 38  ? 16.488  -16.432 8.073    1.00 10.00 ? ? ? ? ? ? 39  ARG D NH2 1 
ATOM 9021  N N   . HIS D 1 39  ? 20.614  -12.571 0.976    1.00 10.00 ? ? ? ? ? ? 40  HIS D N   1 
ATOM 9022  C CA  . HIS D 1 39  ? 20.116  -12.570 -0.402   1.00 10.00 ? ? ? ? ? ? 40  HIS D CA  1 
ATOM 9023  C C   . HIS D 1 39  ? 21.004  -11.554 -1.060   1.00 10.00 ? ? ? ? ? ? 40  HIS D C   1 
ATOM 9024  O O   . HIS D 1 39  ? 20.883  -10.379 -0.724   1.00 10.00 ? ? ? ? ? ? 40  HIS D O   1 
ATOM 9025  C CB  . HIS D 1 39  ? 18.733  -11.990 -0.703   1.00 10.00 ? ? ? ? ? ? 40  HIS D CB  1 
ATOM 9026  C CG  . HIS D 1 39  ? 17.673  -13.075 -0.762   1.00 10.00 ? ? ? ? ? ? 40  HIS D CG  1 
ATOM 9027  N ND1 . HIS D 1 39  ? 16.423  -13.012 -0.319   1.00 10.00 ? ? ? ? ? ? 40  HIS D ND1 1 
ATOM 9028  C CD2 . HIS D 1 39  ? 17.896  -14.355 -1.180   1.00 10.00 ? ? ? ? ? ? 40  HIS D CD2 1 
ATOM 9029  C CE1 . HIS D 1 39  ? 15.894  -14.200 -0.415   1.00 10.00 ? ? ? ? ? ? 40  HIS D CE1 1 
ATOM 9030  N NE2 . HIS D 1 39  ? 16.789  -14.996 -0.939   1.00 10.00 ? ? ? ? ? ? 40  HIS D NE2 1 
ATOM 9031  N N   . GLN D 1 40  ? 21.948  -12.023 -1.891   1.00 10.00 ? ? ? ? ? ? 41  GLN D N   1 
ATOM 9032  C CA  . GLN D 1 40  ? 22.835  -11.182 -2.701   1.00 10.00 ? ? ? ? ? ? 41  GLN D CA  1 
ATOM 9033  C C   . GLN D 1 40  ? 22.074  -9.903  -3.084   1.00 10.00 ? ? ? ? ? ? 41  GLN D C   1 
ATOM 9034  O O   . GLN D 1 40  ? 21.023  -9.932  -3.771   1.00 10.00 ? ? ? ? ? ? 41  GLN D O   1 
ATOM 9035  C CB  . GLN D 1 40  ? 23.253  -11.889 -4.014   1.00 10.00 ? ? ? ? ? ? 41  GLN D CB  1 
ATOM 9036  C CG  . GLN D 1 40  ? 24.707  -11.781 -4.362   1.00 10.00 ? ? ? ? ? ? 41  GLN D CG  1 
ATOM 9037  C CD  . GLN D 1 40  ? 25.554  -12.614 -3.399   1.00 10.00 ? ? ? ? ? ? 41  GLN D CD  1 
ATOM 9038  O OE1 . GLN D 1 40  ? 26.118  -12.165 -2.381   1.00 10.00 ? ? ? ? ? ? 41  GLN D OE1 1 
ATOM 9039  N NE2 . GLN D 1 40  ? 25.611  -13.898 -3.742   1.00 10.00 ? ? ? ? ? ? 41  GLN D NE2 1 
ATOM 9040  N N   . GLY D 1 41  ? 22.598  -8.861  -2.438   1.00 10.00 ? ? ? ? ? ? 42  GLY D N   1 
ATOM 9041  C CA  . GLY D 1 41  ? 22.049  -7.543  -2.602   1.00 10.00 ? ? ? ? ? ? 42  GLY D CA  1 
ATOM 9042  C C   . GLY D 1 41  ? 23.123  -6.666  -3.204   1.00 10.00 ? ? ? ? ? ? 42  GLY D C   1 
ATOM 9043  O O   . GLY D 1 41  ? 24.206  -7.152  -3.580   1.00 10.00 ? ? ? ? ? ? 42  GLY D O   1 
ATOM 9044  N N   . VAL D 1 42  ? 22.681  -5.382  -3.258   1.00 10.00 ? ? ? ? ? ? 43  VAL D N   1 
ATOM 9045  C CA  . VAL D 1 42  ? 23.356  -4.102  -3.654   1.00 10.00 ? ? ? ? ? ? 43  VAL D CA  1 
ATOM 9046  C C   . VAL D 1 42  ? 22.532  -3.187  -4.590   1.00 10.00 ? ? ? ? ? ? 43  VAL D C   1 
ATOM 9047  O O   . VAL D 1 42  ? 22.022  -3.532  -5.680   1.00 10.00 ? ? ? ? ? ? 43  VAL D O   1 
ATOM 9048  C CB  . VAL D 1 42  ? 24.801  -4.324  -4.318   1.00 10.00 ? ? ? ? ? ? 43  VAL D CB  1 
ATOM 9049  C CG1 . VAL D 1 42  ? 25.434  -3.168  -5.109   1.00 10.00 ? ? ? ? ? ? 43  VAL D CG1 1 
ATOM 9050  C CG2 . VAL D 1 42  ? 25.663  -4.548  -3.102   1.00 10.00 ? ? ? ? ? ? 43  VAL D CG2 1 
ATOM 9051  N N   . MET D 1 43  ? 22.353  -1.985  -4.040   1.00 10.00 ? ? ? ? ? ? 44  MET D N   1 
ATOM 9052  C CA  . MET D 1 43  ? 21.652  -0.924  -4.743   1.00 10.00 ? ? ? ? ? ? 44  MET D CA  1 
ATOM 9053  C C   . MET D 1 43  ? 22.651  -0.467  -5.813   1.00 10.00 ? ? ? ? ? ? 44  MET D C   1 
ATOM 9054  O O   . MET D 1 43  ? 23.866  -0.483  -5.547   1.00 10.00 ? ? ? ? ? ? 44  MET D O   1 
ATOM 9055  C CB  . MET D 1 43  ? 21.334  0.195   -3.741   1.00 10.00 ? ? ? ? ? ? 44  MET D CB  1 
ATOM 9056  C CG  . MET D 1 43  ? 20.363  1.242   -4.216   1.00 10.00 ? ? ? ? ? ? 44  MET D CG  1 
ATOM 9057  S SD  . MET D 1 43  ? 20.997  2.297   -5.550   1.00 10.00 ? ? ? ? ? ? 44  MET D SD  1 
ATOM 9058  C CE  . MET D 1 43  ? 20.938  3.756   -4.500   1.00 10.00 ? ? ? ? ? ? 44  MET D CE  1 
ATOM 9059  N N   . VAL D 1 44  ? 22.238  -0.065  -7.031   1.00 10.00 ? ? ? ? ? ? 45  VAL D N   1 
ATOM 9060  C CA  . VAL D 1 44  ? 23.180  0.464   -8.040   1.00 10.00 ? ? ? ? ? ? 45  VAL D CA  1 
ATOM 9061  C C   . VAL D 1 44  ? 23.269  2.000   -7.871   1.00 10.00 ? ? ? ? ? ? 45  VAL D C   1 
ATOM 9062  O O   . VAL D 1 44  ? 22.798  2.909   -8.562   1.00 10.00 ? ? ? ? ? ? 45  VAL D O   1 
ATOM 9063  C CB  . VAL D 1 44  ? 22.690  0.008   -9.438   1.00 10.00 ? ? ? ? ? ? 45  VAL D CB  1 
ATOM 9064  C CG1 . VAL D 1 44  ? 23.148  0.904   -10.587  1.00 10.00 ? ? ? ? ? ? 45  VAL D CG1 1 
ATOM 9065  C CG2 . VAL D 1 44  ? 23.239  -1.417  -9.601   1.00 10.00 ? ? ? ? ? ? 45  VAL D CG2 1 
ATOM 9066  N N   . GLY D 1 45  ? 23.949  2.196   -6.754   1.00 10.00 ? ? ? ? ? ? 46  GLY D N   1 
ATOM 9067  C CA  . GLY D 1 45  ? 24.350  3.455   -6.164   1.00 10.00 ? ? ? ? ? ? 46  GLY D CA  1 
ATOM 9068  C C   . GLY D 1 45  ? 24.987  3.065   -4.836   1.00 10.00 ? ? ? ? ? ? 46  GLY D C   1 
ATOM 9069  O O   . GLY D 1 45  ? 24.588  3.506   -3.744   1.00 10.00 ? ? ? ? ? ? 46  GLY D O   1 
ATOM 9070  N N   . MET D 1 46  ? 25.832  2.033   -5.040   1.00 10.00 ? ? ? ? ? ? 47  MET D N   1 
ATOM 9071  C CA  . MET D 1 46  ? 26.743  1.427   -4.090   1.00 10.00 ? ? ? ? ? ? 47  MET D CA  1 
ATOM 9072  C C   . MET D 1 46  ? 27.437  0.185   -4.701   1.00 10.00 ? ? ? ? ? ? 47  MET D C   1 
ATOM 9073  O O   . MET D 1 46  ? 26.949  -0.464  -5.657   1.00 10.00 ? ? ? ? ? ? 47  MET D O   1 
ATOM 9074  C CB  . MET D 1 46  ? 26.017  1.037   -2.765   1.00 10.00 ? ? ? ? ? ? 47  MET D CB  1 
ATOM 9075  C CG  . MET D 1 46  ? 24.907  0.009   -2.656   1.00 10.00 ? ? ? ? ? ? 47  MET D CG  1 
ATOM 9076  S SD  . MET D 1 46  ? 24.034  0.236   -1.070   1.00 10.00 ? ? ? ? ? ? 47  MET D SD  1 
ATOM 9077  C CE  . MET D 1 46  ? 23.416  1.883   -1.375   1.00 10.00 ? ? ? ? ? ? 47  MET D CE  1 
ATOM 9078  N N   . GLY D 1 47  ? 28.665  -0.048  -4.155   1.00 10.00 ? ? ? ? ? ? 48  GLY D N   1 
ATOM 9079  C CA  . GLY D 1 47  ? 29.568  -1.111  -4.600   1.00 10.00 ? ? ? ? ? ? 48  GLY D CA  1 
ATOM 9080  C C   . GLY D 1 47  ? 28.921  -2.449  -4.270   1.00 10.00 ? ? ? ? ? ? 48  GLY D C   1 
ATOM 9081  O O   . GLY D 1 47  ? 27.857  -2.399  -3.629   1.00 10.00 ? ? ? ? ? ? 48  GLY D O   1 
ATOM 9082  N N   . GLN D 1 48  ? 29.423  -3.661  -4.621   1.00 10.00 ? ? ? ? ? ? 49  GLN D N   1 
ATOM 9083  C CA  . GLN D 1 48  ? 28.768  -4.872  -4.118   1.00 10.00 ? ? ? ? ? ? 49  GLN D CA  1 
ATOM 9084  C C   . GLN D 1 48  ? 29.322  -4.885  -2.681   1.00 10.00 ? ? ? ? ? ? 49  GLN D C   1 
ATOM 9085  O O   . GLN D 1 48  ? 30.528  -5.095  -2.460   1.00 10.00 ? ? ? ? ? ? 49  GLN D O   1 
ATOM 9086  C CB  . GLN D 1 48  ? 29.195  -6.092  -4.934   1.00 10.00 ? ? ? ? ? ? 49  GLN D CB  1 
ATOM 9087  C CG  . GLN D 1 48  ? 28.156  -7.212  -5.016   1.00 10.00 ? ? ? ? ? ? 49  GLN D CG  1 
ATOM 9088  C CD  . GLN D 1 48  ? 28.224  -8.248  -3.894   1.00 10.00 ? ? ? ? ? ? 49  GLN D CD  1 
ATOM 9089  O OE1 . GLN D 1 48  ? 28.235  -7.850  -2.738   1.00 10.00 ? ? ? ? ? ? 49  GLN D OE1 1 
ATOM 9090  N NE2 . GLN D 1 48  ? 28.314  -9.573  -4.096   1.00 10.00 ? ? ? ? ? ? 49  GLN D NE2 1 
ATOM 9091  N N   . LYS D 1 49  ? 28.439  -4.236  -1.870   1.00 10.00 ? ? ? ? ? ? 50  LYS D N   1 
ATOM 9092  C CA  . LYS D 1 49  ? 28.418  -3.966  -0.428   1.00 10.00 ? ? ? ? ? ? 50  LYS D CA  1 
ATOM 9093  C C   . LYS D 1 49  ? 27.377  -4.886  0.198    1.00 10.00 ? ? ? ? ? ? 50  LYS D C   1 
ATOM 9094  O O   . LYS D 1 49  ? 26.157  -4.697  0.074    1.00 10.00 ? ? ? ? ? ? 50  LYS D O   1 
ATOM 9095  C CB  . LYS D 1 49  ? 27.994  -2.526  -0.154   1.00 10.00 ? ? ? ? ? ? 50  LYS D CB  1 
ATOM 9096  C CG  . LYS D 1 49  ? 29.116  -1.514  -0.017   1.00 10.00 ? ? ? ? ? ? 50  LYS D CG  1 
ATOM 9097  C CD  . LYS D 1 49  ? 29.618  -1.478  1.431    1.00 10.00 ? ? ? ? ? ? 50  LYS D CD  1 
ATOM 9098  C CE  . LYS D 1 49  ? 28.524  -0.899  2.393    1.00 10.00 ? ? ? ? ? ? 50  LYS D CE  1 
ATOM 9099  N NZ  . LYS D 1 49  ? 28.823  -1.105  3.798    1.00 10.00 ? ? ? ? ? ? 50  LYS D NZ  1 
ATOM 9100  N N   . ASP D 1 50  ? 27.836  -5.942  0.852    1.00 10.00 ? ? ? ? ? ? 51  ASP D N   1 
ATOM 9101  C CA  . ASP D 1 50  ? 26.885  -6.806  1.489    1.00 10.00 ? ? ? ? ? ? 51  ASP D CA  1 
ATOM 9102  C C   . ASP D 1 50  ? 27.049  -6.804  3.004    1.00 10.00 ? ? ? ? ? ? 51  ASP D C   1 
ATOM 9103  O O   . ASP D 1 50  ? 26.674  -7.786  3.637    1.00 10.00 ? ? ? ? ? ? 51  ASP D O   1 
ATOM 9104  C CB  . ASP D 1 50  ? 27.004  -8.238  0.850    1.00 10.00 ? ? ? ? ? ? 51  ASP D CB  1 
ATOM 9105  C CG  . ASP D 1 50  ? 26.303  -8.445  -0.524   1.00 10.00 ? ? ? ? ? ? 51  ASP D CG  1 
ATOM 9106  O OD1 . ASP D 1 50  ? 25.704  -7.514  -1.091   1.00 10.00 ? ? ? ? ? ? 51  ASP D OD1 1 
ATOM 9107  O OD2 . ASP D 1 50  ? 26.366  -9.557  -1.051   1.00 10.00 ? ? ? ? ? ? 51  ASP D OD2 1 
ATOM 9108  N N   . SER D 1 51  ? 27.616  -5.763  3.639    1.00 10.00 ? ? ? ? ? ? 52  SER D N   1 
ATOM 9109  C CA  . SER D 1 51  ? 27.507  -5.593  5.085    1.00 10.00 ? ? ? ? ? ? 52  SER D CA  1 
ATOM 9110  C C   . SER D 1 51  ? 27.120  -4.141  5.179    1.00 10.00 ? ? ? ? ? ? 52  SER D C   1 
ATOM 9111  O O   . SER D 1 51  ? 27.882  -3.312  4.681    1.00 10.00 ? ? ? ? ? ? 52  SER D O   1 
ATOM 9112  C CB  . SER D 1 51  ? 28.825  -5.774  5.909    1.00 10.00 ? ? ? ? ? ? 52  SER D CB  1 
ATOM 9113  O OG  . SER D 1 51  ? 29.893  -4.811  5.799    1.00 10.00 ? ? ? ? ? ? 52  SER D OG  1 
ATOM 9114  N N   . TYR D 1 52  ? 25.944  -3.751  5.641    1.00 10.00 ? ? ? ? ? ? 53  TYR D N   1 
ATOM 9115  C CA  . TYR D 1 52  ? 25.667  -2.348  5.839    1.00 10.00 ? ? ? ? ? ? 53  TYR D CA  1 
ATOM 9116  C C   . TYR D 1 52  ? 25.926  -2.215  7.336    1.00 10.00 ? ? ? ? ? ? 53  TYR D C   1 
ATOM 9117  O O   . TYR D 1 52  ? 25.736  -3.180  8.073    1.00 10.00 ? ? ? ? ? ? 53  TYR D O   1 
ATOM 9118  C CB  . TYR D 1 52  ? 24.207  -2.121  5.322    1.00 10.00 ? ? ? ? ? ? 53  TYR D CB  1 
ATOM 9119  C CG  . TYR D 1 52  ? 24.190  -2.165  3.779    1.00 10.00 ? ? ? ? ? ? 53  TYR D CG  1 
ATOM 9120  C CD1 . TYR D 1 52  ? 24.987  -1.254  3.085    1.00 10.00 ? ? ? ? ? ? 53  TYR D CD1 1 
ATOM 9121  C CD2 . TYR D 1 52  ? 23.511  -3.125  3.051    1.00 10.00 ? ? ? ? ? ? 53  TYR D CD2 1 
ATOM 9122  C CE1 . TYR D 1 52  ? 25.155  -1.281  1.703    1.00 10.00 ? ? ? ? ? ? 53  TYR D CE1 1 
ATOM 9123  C CE2 . TYR D 1 52  ? 23.669  -3.160  1.655    1.00 10.00 ? ? ? ? ? ? 53  TYR D CE2 1 
ATOM 9124  C CZ  . TYR D 1 52  ? 24.498  -2.250  0.970    1.00 10.00 ? ? ? ? ? ? 53  TYR D CZ  1 
ATOM 9125  O OH  . TYR D 1 52  ? 24.771  -2.349  -0.405   1.00 10.00 ? ? ? ? ? ? 53  TYR D OH  1 
ATOM 9126  N N   . VAL D 1 53  ? 26.443  -1.109  7.854    1.00 10.00 ? ? ? ? ? ? 54  VAL D N   1 
ATOM 9127  C CA  . VAL D 1 53  ? 26.818  -0.967  9.267    1.00 10.00 ? ? ? ? ? ? 54  VAL D CA  1 
ATOM 9128  C C   . VAL D 1 53  ? 26.099  0.232   9.916    1.00 10.00 ? ? ? ? ? ? 54  VAL D C   1 
ATOM 9129  O O   . VAL D 1 53  ? 25.909  1.282   9.267    1.00 10.00 ? ? ? ? ? ? 54  VAL D O   1 
ATOM 9130  C CB  . VAL D 1 53  ? 28.416  -0.817  9.325    1.00 10.00 ? ? ? ? ? ? 54  VAL D CB  1 
ATOM 9131  C CG1 . VAL D 1 53  ? 28.928  -0.345  10.672   1.00 10.00 ? ? ? ? ? ? 54  VAL D CG1 1 
ATOM 9132  C CG2 . VAL D 1 53  ? 29.056  -2.184  9.176    1.00 10.00 ? ? ? ? ? ? 54  VAL D CG2 1 
ATOM 9133  N N   . GLY D 1 54  ? 25.712  0.182   11.190   1.00 10.00 ? ? ? ? ? ? 55  GLY D N   1 
ATOM 9134  C CA  . GLY D 1 54  ? 25.154  1.350   11.838   1.00 10.00 ? ? ? ? ? ? 55  GLY D CA  1 
ATOM 9135  C C   . GLY D 1 54  ? 23.751  1.653   11.357   1.00 10.00 ? ? ? ? ? ? 55  GLY D C   1 
ATOM 9136  O O   . GLY D 1 54  ? 22.889  0.783   11.300   1.00 10.00 ? ? ? ? ? ? 55  GLY D O   1 
ATOM 9137  N N   . ASP D 1 55  ? 23.493  2.914   10.982   1.00 10.00 ? ? ? ? ? ? 56  ASP D N   1 
ATOM 9138  C CA  . ASP D 1 55  ? 22.145  3.430   10.562   1.00 10.00 ? ? ? ? ? ? 56  ASP D CA  1 
ATOM 9139  C C   . ASP D 1 55  ? 21.636  3.239   9.116    1.00 10.00 ? ? ? ? ? ? 56  ASP D C   1 
ATOM 9140  O O   . ASP D 1 55  ? 20.436  3.080   8.850    1.00 10.00 ? ? ? ? ? ? 56  ASP D O   1 
ATOM 9141  C CB  . ASP D 1 55  ? 22.056  4.971   10.928   1.00 10.00 ? ? ? ? ? ? 56  ASP D CB  1 
ATOM 9142  C CG  . ASP D 1 55  ? 23.282  5.855   10.691   1.00 10.00 ? ? ? ? ? ? 56  ASP D CG  1 
ATOM 9143  O OD1 . ASP D 1 55  ? 24.192  5.535   9.890    1.00 10.00 ? ? ? ? ? ? 56  ASP D OD1 1 
ATOM 9144  O OD2 . ASP D 1 55  ? 23.295  6.898   11.348   1.00 10.00 ? ? ? ? ? ? 56  ASP D OD2 1 
ATOM 9145  N N   . GLU D 1 56  ? 22.594  3.141   8.186    1.00 10.00 ? ? ? ? ? ? 57  GLU D N   1 
ATOM 9146  C CA  . GLU D 1 56  ? 22.333  2.736   6.814    1.00 10.00 ? ? ? ? ? ? 57  GLU D CA  1 
ATOM 9147  C C   . GLU D 1 56  ? 21.978  1.261   6.768    1.00 10.00 ? ? ? ? ? ? 57  GLU D C   1 
ATOM 9148  O O   . GLU D 1 56  ? 21.926  0.682   5.689    1.00 10.00 ? ? ? ? ? ? 57  GLU D O   1 
ATOM 9149  C CB  . GLU D 1 56  ? 23.550  2.930   5.924    1.00 10.00 ? ? ? ? ? ? 57  GLU D CB  1 
ATOM 9150  C CG  . GLU D 1 56  ? 24.798  2.157   6.333    1.00 10.00 ? ? ? ? ? ? 57  GLU D CG  1 
ATOM 9151  C CD  . GLU D 1 56  ? 26.017  2.372   5.460    1.00 10.00 ? ? ? ? ? ? 57  GLU D CD  1 
ATOM 9152  O OE1 . GLU D 1 56  ? 26.300  3.499   5.073    1.00 10.00 ? ? ? ? ? ? 57  GLU D OE1 1 
ATOM 9153  O OE2 . GLU D 1 56  ? 26.703  1.396   5.188    1.00 10.00 ? ? ? ? ? ? 57  GLU D OE2 1 
ATOM 9154  N N   . ALA D 1 57  ? 21.881  0.597   7.917    1.00 10.00 ? ? ? ? ? ? 58  ALA D N   1 
ATOM 9155  C CA  . ALA D 1 57  ? 21.463  -0.772  7.981    1.00 10.00 ? ? ? ? ? ? 58  ALA D CA  1 
ATOM 9156  C C   . ALA D 1 57  ? 20.241  -0.774  8.863    1.00 10.00 ? ? ? ? ? ? 58  ALA D C   1 
ATOM 9157  O O   . ALA D 1 57  ? 19.543  -1.761  9.031    1.00 10.00 ? ? ? ? ? ? 58  ALA D O   1 
ATOM 9158  C CB  . ALA D 1 57  ? 22.524  -1.606  8.610    1.00 10.00 ? ? ? ? ? ? 58  ALA D CB  1 
ATOM 9159  N N   . GLN D 1 58  ? 19.898  0.319   9.486    1.00 10.00 ? ? ? ? ? ? 59  GLN D N   1 
ATOM 9160  C CA  . GLN D 1 58  ? 18.695  0.373   10.279   1.00 10.00 ? ? ? ? ? ? 59  GLN D CA  1 
ATOM 9161  C C   . GLN D 1 58  ? 17.613  0.489   9.182    1.00 10.00 ? ? ? ? ? ? 59  GLN D C   1 
ATOM 9162  O O   . GLN D 1 58  ? 16.644  -0.275  9.086    1.00 10.00 ? ? ? ? ? ? 59  GLN D O   1 
ATOM 9163  C CB  . GLN D 1 58  ? 18.826  1.606   11.139   1.00 10.00 ? ? ? ? ? ? 59  GLN D CB  1 
ATOM 9164  C CG  . GLN D 1 58  ? 17.688  1.986   12.023   1.00 10.00 ? ? ? ? ? ? 59  GLN D CG  1 
ATOM 9165  C CD  . GLN D 1 58  ? 17.604  1.136   13.266   1.00 10.00 ? ? ? ? ? ? 59  GLN D CD  1 
ATOM 9166  O OE1 . GLN D 1 58  ? 17.466  1.665   14.360   1.00 10.00 ? ? ? ? ? ? 59  GLN D OE1 1 
ATOM 9167  N NE2 . GLN D 1 58  ? 17.701  -0.181  13.264   1.00 10.00 ? ? ? ? ? ? 59  GLN D NE2 1 
ATOM 9168  N N   . SER D 1 59  ? 17.840  1.378   8.199    1.00 10.00 ? ? ? ? ? ? 60  SER D N   1 
ATOM 9169  C CA  . SER D 1 59  ? 16.893  1.701   7.136    1.00 10.00 ? ? ? ? ? ? 60  SER D CA  1 
ATOM 9170  C C   . SER D 1 59  ? 16.824  0.744   5.951    1.00 10.00 ? ? ? ? ? ? 60  SER D C   1 
ATOM 9171  O O   . SER D 1 59  ? 16.602  1.114   4.796    1.00 10.00 ? ? ? ? ? ? 60  SER D O   1 
ATOM 9172  C CB  . SER D 1 59  ? 17.276  3.108   6.750    1.00 10.00 ? ? ? ? ? ? 60  SER D CB  1 
ATOM 9173  O OG  . SER D 1 59  ? 17.596  3.832   7.949    1.00 10.00 ? ? ? ? ? ? 60  SER D OG  1 
ATOM 9174  N N   . LYS D 1 60  ? 17.052  -0.525  6.256    1.00 10.00 ? ? ? ? ? ? 61  LYS D N   1 
ATOM 9175  C CA  . LYS D 1 60  ? 16.959  -1.670  5.360    1.00 10.00 ? ? ? ? ? ? 61  LYS D CA  1 
ATOM 9176  C C   . LYS D 1 60  ? 16.928  -2.869  6.308    1.00 10.00 ? ? ? ? ? ? 61  LYS D C   1 
ATOM 9177  O O   . LYS D 1 60  ? 17.041  -3.989  5.832    1.00 10.00 ? ? ? ? ? ? 61  LYS D O   1 
ATOM 9178  C CB  . LYS D 1 60  ? 18.175  -1.854  4.488    1.00 10.00 ? ? ? ? ? ? 61  LYS D CB  1 
ATOM 9179  C CG  . LYS D 1 60  ? 18.516  -0.741  3.509    1.00 10.00 ? ? ? ? ? ? 61  LYS D CG  1 
ATOM 9180  C CD  . LYS D 1 60  ? 19.612  -1.185  2.536    1.00 10.00 ? ? ? ? ? ? 61  LYS D CD  1 
ATOM 9181  C CE  . LYS D 1 60  ? 19.685  -0.266  1.319    1.00 10.00 ? ? ? ? ? ? 61  LYS D CE  1 
ATOM 9182  N NZ  . LYS D 1 60  ? 20.185  1.068   1.645    1.00 10.00 ? ? ? ? ? ? 61  LYS D NZ  1 
ATOM 9183  N N   . ARG D 1 61  ? 16.694  -2.666  7.628    1.00 10.00 ? ? ? ? ? ? 62  ARG D N   1 
ATOM 9184  C CA  . ARG D 1 61  ? 16.714  -3.696  8.679    1.00 10.00 ? ? ? ? ? ? 62  ARG D CA  1 
ATOM 9185  C C   . ARG D 1 61  ? 15.705  -4.792  8.409    1.00 10.00 ? ? ? ? ? ? 62  ARG D C   1 
ATOM 9186  O O   . ARG D 1 61  ? 15.929  -5.987  8.588    1.00 10.00 ? ? ? ? ? ? 62  ARG D O   1 
ATOM 9187  C CB  . ARG D 1 61  ? 16.443  -3.003  10.024   1.00 10.00 ? ? ? ? ? ? 62  ARG D CB  1 
ATOM 9188  C CG  . ARG D 1 61  ? 15.467  -3.468  11.133   1.00 10.00 ? ? ? ? ? ? 62  ARG D CG  1 
ATOM 9189  C CD  . ARG D 1 61  ? 15.386  -2.309  12.200   1.00 10.00 ? ? ? ? ? ? 62  ARG D CD  1 
ATOM 9190  N NE  . ARG D 1 61  ? 14.917  -2.763  13.515   1.00 10.00 ? ? ? ? ? ? 62  ARG D NE  1 
ATOM 9191  C CZ  . ARG D 1 61  ? 15.700  -2.879  14.622   1.00 10.00 ? ? ? ? ? ? 62  ARG D CZ  1 
ATOM 9192  N NH1 . ARG D 1 61  ? 17.034  -2.566  14.678   1.00 10.00 ? ? ? ? ? ? 62  ARG D NH1 1 
ATOM 9193  N NH2 . ARG D 1 61  ? 15.135  -3.496  15.677   1.00 10.00 ? ? ? ? ? ? 62  ARG D NH2 1 
ATOM 9194  N N   . GLY D 1 62  ? 14.575  -4.283  7.902    1.00 10.00 ? ? ? ? ? ? 63  GLY D N   1 
ATOM 9195  C CA  . GLY D 1 62  ? 13.472  -5.078  7.410    1.00 10.00 ? ? ? ? ? ? 63  GLY D CA  1 
ATOM 9196  C C   . GLY D 1 62  ? 13.943  -5.927  6.250    1.00 10.00 ? ? ? ? ? ? 63  GLY D C   1 
ATOM 9197  O O   . GLY D 1 62  ? 13.548  -7.072  6.216    1.00 10.00 ? ? ? ? ? ? 63  GLY D O   1 
ATOM 9198  N N   . ILE D 1 63  ? 14.755  -5.471  5.297    1.00 10.00 ? ? ? ? ? ? 64  ILE D N   1 
ATOM 9199  C CA  . ILE D 1 63  ? 15.190  -6.349  4.217    1.00 10.00 ? ? ? ? ? ? 64  ILE D CA  1 
ATOM 9200  C C   . ILE D 1 63  ? 16.496  -7.054  4.482    1.00 10.00 ? ? ? ? ? ? 64  ILE D C   1 
ATOM 9201  O O   . ILE D 1 63  ? 16.912  -7.802  3.595    1.00 10.00 ? ? ? ? ? ? 64  ILE D O   1 
ATOM 9202  C CB  . ILE D 1 63  ? 15.343  -5.598  2.891    1.00 10.00 ? ? ? ? ? ? 64  ILE D CB  1 
ATOM 9203  C CG1 . ILE D 1 63  ? 16.277  -4.432  2.985    1.00 10.00 ? ? ? ? ? ? 64  ILE D CG1 1 
ATOM 9204  C CG2 . ILE D 1 63  ? 13.936  -5.135  2.475    1.00 10.00 ? ? ? ? ? ? 64  ILE D CG2 1 
ATOM 9205  C CD1 . ILE D 1 63  ? 16.356  -3.646  1.664    1.00 10.00 ? ? ? ? ? ? 64  ILE D CD1 1 
ATOM 9206  N N   . LEU D 1 64  ? 17.110  -6.908  5.681    1.00 10.00 ? ? ? ? ? ? 65  LEU D N   1 
ATOM 9207  C CA  . LEU D 1 64  ? 18.450  -7.438  5.931    1.00 10.00 ? ? ? ? ? ? 65  LEU D CA  1 
ATOM 9208  C C   . LEU D 1 64  ? 18.556  -8.314  7.154    1.00 10.00 ? ? ? ? ? ? 65  LEU D C   1 
ATOM 9209  O O   . LEU D 1 64  ? 17.720  -8.214  8.057    1.00 10.00 ? ? ? ? ? ? 65  LEU D O   1 
ATOM 9210  C CB  . LEU D 1 64  ? 19.465  -6.317  6.127    1.00 10.00 ? ? ? ? ? ? 65  LEU D CB  1 
ATOM 9211  C CG  . LEU D 1 64  ? 19.749  -5.261  5.054    1.00 10.00 ? ? ? ? ? ? 65  LEU D CG  1 
ATOM 9212  C CD1 . LEU D 1 64  ? 20.831  -4.328  5.522    1.00 10.00 ? ? ? ? ? ? 65  LEU D CD1 1 
ATOM 9213  C CD2 . LEU D 1 64  ? 20.227  -5.927  3.793    1.00 10.00 ? ? ? ? ? ? 65  LEU D CD2 1 
ATOM 9214  N N   . THR D 1 65  ? 19.576  -9.176  7.261    1.00 10.00 ? ? ? ? ? ? 66  THR D N   1 
ATOM 9215  C CA  . THR D 1 65  ? 19.812  -9.872  8.552    1.00 10.00 ? ? ? ? ? ? 66  THR D CA  1 
ATOM 9216  C C   . THR D 1 65  ? 20.970  -9.203  9.351    1.00 10.00 ? ? ? ? ? ? 66  THR D C   1 
ATOM 9217  O O   . THR D 1 65  ? 22.125  -9.013  8.923    1.00 10.00 ? ? ? ? ? ? 66  THR D O   1 
ATOM 9218  C CB  . THR D 1 65  ? 20.052  -11.389 8.215    1.00 10.00 ? ? ? ? ? ? 66  THR D CB  1 
ATOM 9219  O OG1 . THR D 1 65  ? 18.745  -11.980 8.298    1.00 10.00 ? ? ? ? ? ? 66  THR D OG1 1 
ATOM 9220  C CG2 . THR D 1 65  ? 21.059  -12.099 9.119    1.00 10.00 ? ? ? ? ? ? 66  THR D CG2 1 
ATOM 9221  N N   . LEU D 1 66  ? 20.577  -8.754  10.539   1.00 10.00 ? ? ? ? ? ? 67  LEU D N   1 
ATOM 9222  C CA  . LEU D 1 66  ? 21.437  -8.010  11.422   1.00 10.00 ? ? ? ? ? ? 67  LEU D CA  1 
ATOM 9223  C C   . LEU D 1 66  ? 22.151  -8.744  12.557   1.00 10.00 ? ? ? ? ? ? 67  LEU D C   1 
ATOM 9224  O O   . LEU D 1 66  ? 21.507  -9.348  13.418   1.00 10.00 ? ? ? ? ? ? 67  LEU D O   1 
ATOM 9225  C CB  . LEU D 1 66  ? 20.610  -6.911  12.006   1.00 10.00 ? ? ? ? ? ? 67  LEU D CB  1 
ATOM 9226  C CG  . LEU D 1 66  ? 19.867  -5.941  11.159   1.00 10.00 ? ? ? ? ? ? 67  LEU D CG  1 
ATOM 9227  C CD1 . LEU D 1 66  ? 18.789  -5.365  12.080   1.00 10.00 ? ? ? ? ? ? 67  LEU D CD1 1 
ATOM 9228  C CD2 . LEU D 1 66  ? 20.770  -4.884  10.545   1.00 10.00 ? ? ? ? ? ? 67  LEU D CD2 1 
ATOM 9229  N N   . LYS D 1 67  ? 23.479  -8.718  12.620   1.00 10.00 ? ? ? ? ? ? 68  LYS D N   1 
ATOM 9230  C CA  . LYS D 1 67  ? 24.266  -9.264  13.726   1.00 10.00 ? ? ? ? ? ? 68  LYS D CA  1 
ATOM 9231  C C   . LYS D 1 67  ? 24.697  -8.127  14.695   1.00 10.00 ? ? ? ? ? ? 68  LYS D C   1 
ATOM 9232  O O   . LYS D 1 67  ? 25.218  -7.067  14.299   1.00 10.00 ? ? ? ? ? ? 68  LYS D O   1 
ATOM 9233  C CB  . LYS D 1 67  ? 25.554  -9.953  13.214   1.00 10.00 ? ? ? ? ? ? 68  LYS D CB  1 
ATOM 9234  C CG  . LYS D 1 67  ? 25.589  -11.442 12.758   1.00 10.00 ? ? ? ? ? ? 68  LYS D CG  1 
ATOM 9235  C CD  . LYS D 1 67  ? 26.943  -11.891 12.126   1.00 10.00 ? ? ? ? ? ? 68  LYS D CD  1 
ATOM 9236  C CE  . LYS D 1 67  ? 27.192  -11.455 10.680   1.00 10.00 ? ? ? ? ? ? 68  LYS D CE  1 
ATOM 9237  N NZ  . LYS D 1 67  ? 26.858  -10.058 10.394   1.00 10.00 ? ? ? ? ? ? 68  LYS D NZ  1 
ATOM 9238  N N   . TYR D 1 68  ? 24.528  -8.367  16.005   1.00 10.00 ? ? ? ? ? ? 69  TYR D N   1 
ATOM 9239  C CA  . TYR D 1 68  ? 24.898  -7.489  17.107   1.00 10.00 ? ? ? ? ? ? 69  TYR D CA  1 
ATOM 9240  C C   . TYR D 1 68  ? 26.238  -7.954  17.674   1.00 10.00 ? ? ? ? ? ? 69  TYR D C   1 
ATOM 9241  O O   . TYR D 1 68  ? 26.310  -9.038  18.275   1.00 10.00 ? ? ? ? ? ? 69  TYR D O   1 
ATOM 9242  C CB  . TYR D 1 68  ? 23.892  -7.566  18.228   1.00 10.00 ? ? ? ? ? ? 69  TYR D CB  1 
ATOM 9243  C CG  . TYR D 1 68  ? 22.579  -6.902  17.888   1.00 10.00 ? ? ? ? ? ? 69  TYR D CG  1 
ATOM 9244  C CD1 . TYR D 1 68  ? 21.659  -7.514  17.036   1.00 10.00 ? ? ? ? ? ? 69  TYR D CD1 1 
ATOM 9245  C CD2 . TYR D 1 68  ? 22.353  -5.670  18.450   1.00 10.00 ? ? ? ? ? ? 69  TYR D CD2 1 
ATOM 9246  C CE1 . TYR D 1 68  ? 20.477  -6.853  16.727   1.00 10.00 ? ? ? ? ? ? 69  TYR D CE1 1 
ATOM 9247  C CE2 . TYR D 1 68  ? 21.182  -5.014  18.157   1.00 10.00 ? ? ? ? ? ? 69  TYR D CE2 1 
ATOM 9248  C CZ  . TYR D 1 68  ? 20.264  -5.613  17.303   1.00 10.00 ? ? ? ? ? ? 69  TYR D CZ  1 
ATOM 9249  O OH  . TYR D 1 68  ? 19.113  -4.921  17.043   1.00 10.00 ? ? ? ? ? ? 69  TYR D OH  1 
ATOM 9250  N N   . PRO D 1 69  ? 17.347  -1.331  19.427   1.00 10.00 ? ? ? ? ? ? 70  PRO D N   1 
ATOM 9251  C CA  . PRO D 1 69  ? 17.270  -2.447  20.346   1.00 10.00 ? ? ? ? ? ? 70  PRO D CA  1 
ATOM 9252  C C   . PRO D 1 69  ? 16.493  -2.104  21.606   1.00 10.00 ? ? ? ? ? ? 70  PRO D C   1 
ATOM 9253  O O   . PRO D 1 69  ? 15.667  -2.876  22.074   1.00 10.00 ? ? ? ? ? ? 70  PRO D O   1 
ATOM 9254  C CB  . PRO D 1 69  ? 18.706  -2.755  20.637   1.00 10.00 ? ? ? ? ? ? 70  PRO D CB  1 
ATOM 9255  C CG  . PRO D 1 69  ? 19.583  -1.868  19.753   1.00 10.00 ? ? ? ? ? ? 70  PRO D CG  1 
ATOM 9256  C CD  . PRO D 1 69  ? 18.669  -0.704  19.477   1.00 10.00 ? ? ? ? ? ? 70  PRO D CD  1 
ATOM 9257  N N   . ILE D 1 70  ? 16.810  -0.961  22.213   1.00 10.00 ? ? ? ? ? ? 71  ILE D N   1 
ATOM 9258  C CA  . ILE D 1 70  ? 16.341  -0.631  23.528   1.00 10.00 ? ? ? ? ? ? 71  ILE D CA  1 
ATOM 9259  C C   . ILE D 1 70  ? 15.129  0.206   23.244   1.00 10.00 ? ? ? ? ? ? 71  ILE D C   1 
ATOM 9260  O O   . ILE D 1 70  ? 15.183  1.084   22.385   1.00 10.00 ? ? ? ? ? ? 71  ILE D O   1 
ATOM 9261  C CB  . ILE D 1 70  ? 17.466  0.137   24.260   1.00 10.00 ? ? ? ? ? ? 71  ILE D CB  1 
ATOM 9262  C CG1 . ILE D 1 70  ? 18.790  -0.585  24.277   1.00 10.00 ? ? ? ? ? ? 71  ILE D CG1 1 
ATOM 9263  C CG2 . ILE D 1 70  ? 17.108  0.233   25.684   1.00 10.00 ? ? ? ? ? ? 71  ILE D CG2 1 
ATOM 9264  C CD1 . ILE D 1 70  ? 20.027  0.365   24.381   1.00 10.00 ? ? ? ? ? ? 71  ILE D CD1 1 
ATOM 9265  N N   . GLU D 1 71  ? 14.064  0.018   24.001   1.00 10.00 ? ? ? ? ? ? 72  GLU D N   1 
ATOM 9266  C CA  . GLU D 1 71  ? 12.796  0.642   23.722   1.00 10.00 ? ? ? ? ? ? 72  GLU D CA  1 
ATOM 9267  C C   . GLU D 1 71  ? 12.018  0.899   24.999   1.00 10.00 ? ? ? ? ? ? 72  GLU D C   1 
ATOM 9268  O O   . GLU D 1 71  ? 11.680  -0.037  25.713   1.00 10.00 ? ? ? ? ? ? 72  GLU D O   1 
ATOM 9269  C CB  . GLU D 1 71  ? 12.115  -0.312  22.819   1.00 10.00 ? ? ? ? ? ? 72  GLU D CB  1 
ATOM 9270  C CG  . GLU D 1 71  ? 10.742  0.067   22.359   1.00 10.00 ? ? ? ? ? ? 72  GLU D CG  1 
ATOM 9271  C CD  . GLU D 1 71  ? 10.338  -0.794  21.186   1.00 10.00 ? ? ? ? ? ? 72  GLU D CD  1 
ATOM 9272  O OE1 . GLU D 1 71  ? 11.069  -0.740  20.165   1.00 10.00 ? ? ? ? ? ? 72  GLU D OE1 1 
ATOM 9273  O OE2 . GLU D 1 71  ? 9.327   -1.508  21.318   1.00 10.00 ? ? ? ? ? ? 72  GLU D OE2 1 
ATOM 9274  N N   . HIS D 1 72  ? 12.036  -2.983  26.713   1.00 10.00 ? ? ? ? ? ? 73  HIS D N   1 
ATOM 9275  C CA  . HIS D 1 72  ? 12.052  -2.607  28.166   1.00 10.00 ? ? ? ? ? ? 73  HIS D CA  1 
ATOM 9276  C C   . HIS D 1 72  ? 13.248  -2.041  28.813   1.00 10.00 ? ? ? ? ? ? 73  HIS D C   1 
ATOM 9277  O O   . HIS D 1 72  ? 13.117  -1.451  29.933   1.00 10.00 ? ? ? ? ? ? 73  HIS D O   1 
ATOM 9278  C CB  . HIS D 1 72  ? 10.916  -3.134  29.089   1.00 10.00 ? ? ? ? ? ? 73  HIS D CB  1 
ATOM 9279  C CG  . HIS D 1 72  ? 9.732   -2.365  28.429   1.00 10.00 ? ? ? ? ? ? 73  HIS D CG  1 
ATOM 9280  N ND1 . HIS D 1 72  ? 9.635   -1.057  28.808   1.00 10.00 ? ? ? ? ? ? 73  HIS D ND1 1 
ATOM 9281  C CD2 . HIS D 1 72  ? 8.753   -2.599  27.582   1.00 10.00 ? ? ? ? ? ? 73  HIS D CD2 1 
ATOM 9282  C CE1 . HIS D 1 72  ? 8.638   -0.492  28.225   1.00 10.00 ? ? ? ? ? ? 73  HIS D CE1 1 
ATOM 9283  N NE2 . HIS D 1 72  ? 8.025   -1.413  27.426   1.00 10.00 ? ? ? ? ? ? 73  HIS D NE2 1 
ATOM 9284  N N   . GLY D 1 73  ? 13.236  1.953   27.489   1.00 10.00 ? ? ? ? ? ? 74  GLY D N   1 
ATOM 9285  C CA  . GLY D 1 73  ? 14.227  1.473   28.432   1.00 10.00 ? ? ? ? ? ? 74  GLY D CA  1 
ATOM 9286  C C   . GLY D 1 73  ? 14.513  -0.021  28.415   1.00 10.00 ? ? ? ? ? ? 74  GLY D C   1 
ATOM 9287  O O   . GLY D 1 73  ? 15.570  -0.404  28.925   1.00 10.00 ? ? ? ? ? ? 74  GLY D O   1 
ATOM 9288  N N   . ILE D 1 74  ? 13.617  -0.852  27.844   1.00 10.00 ? ? ? ? ? ? 75  ILE D N   1 
ATOM 9289  C CA  . ILE D 1 74  ? 13.680  -2.307  27.875   1.00 10.00 ? ? ? ? ? ? 75  ILE D CA  1 
ATOM 9290  C C   . ILE D 1 74  ? 14.221  -2.859  26.558   1.00 10.00 ? ? ? ? ? ? 75  ILE D C   1 
ATOM 9291  O O   . ILE D 1 74  ? 13.892  -2.291  25.521   1.00 10.00 ? ? ? ? ? ? 75  ILE D O   1 
ATOM 9292  C CB  . ILE D 1 74  ? 12.271  -2.835  28.145   1.00 10.00 ? ? ? ? ? ? 75  ILE D CB  1 
ATOM 9293  C CG1 . ILE D 1 74  ? 11.632  -2.129  29.345   1.00 10.00 ? ? ? ? ? ? 75  ILE D CG1 1 
ATOM 9294  C CG2 . ILE D 1 74  ? 12.361  -4.359  28.302   1.00 10.00 ? ? ? ? ? ? 75  ILE D CG2 1 
ATOM 9295  C CD1 . ILE D 1 74  ? 12.329  -2.145  30.706   1.00 10.00 ? ? ? ? ? ? 75  ILE D CD1 1 
ATOM 9296  N N   . VAL D 1 75  ? 15.005  -3.951  26.490   1.00 10.00 ? ? ? ? ? ? 76  VAL D N   1 
ATOM 9297  C CA  . VAL D 1 75  ? 15.601  -4.422  25.241   1.00 10.00 ? ? ? ? ? ? 76  VAL D CA  1 
ATOM 9298  C C   . VAL D 1 75  ? 14.595  -5.376  24.640   1.00 10.00 ? ? ? ? ? ? 76  VAL D C   1 
ATOM 9299  O O   . VAL D 1 75  ? 14.055  -6.276  25.305   1.00 10.00 ? ? ? ? ? ? 76  VAL D O   1 
ATOM 9300  C CB  . VAL D 1 75  ? 16.979  -5.103  25.523   1.00 10.00 ? ? ? ? ? ? 76  VAL D CB  1 
ATOM 9301  C CG1 . VAL D 1 75  ? 17.545  -5.837  24.318   1.00 10.00 ? ? ? ? ? ? 76  VAL D CG1 1 
ATOM 9302  C CG2 . VAL D 1 75  ? 17.986  -4.003  25.864   1.00 10.00 ? ? ? ? ? ? 76  VAL D CG2 1 
ATOM 9303  N N   . THR D 1 76  ? 14.257  -4.984  23.395   1.00 10.00 ? ? ? ? ? ? 77  THR D N   1 
ATOM 9304  C CA  . THR D 1 76  ? 13.295  -5.706  22.569   1.00 10.00 ? ? ? ? ? ? 77  THR D CA  1 
ATOM 9305  C C   . THR D 1 76  ? 14.021  -6.615  21.590   1.00 10.00 ? ? ? ? ? ? 77  THR D C   1 
ATOM 9306  O O   . THR D 1 76  ? 13.490  -7.634  21.139   1.00 10.00 ? ? ? ? ? ? 77  THR D O   1 
ATOM 9307  C CB  . THR D 1 76  ? 12.384  -4.723  21.781   1.00 10.00 ? ? ? ? ? ? 77  THR D CB  1 
ATOM 9308  O OG1 . THR D 1 76  ? 13.158  -3.809  20.973   1.00 10.00 ? ? ? ? ? ? 77  THR D OG1 1 
ATOM 9309  C CG2 . THR D 1 76  ? 11.523  -3.960  22.783   1.00 10.00 ? ? ? ? ? ? 77  THR D CG2 1 
ATOM 9310  N N   . ASN D 1 77  ? 15.269  -6.309  21.257   1.00 10.00 ? ? ? ? ? ? 78  ASN D N   1 
ATOM 9311  C CA  . ASN D 1 77  ? 15.970  -7.063  20.261   1.00 10.00 ? ? ? ? ? ? 78  ASN D CA  1 
ATOM 9312  C C   . ASN D 1 77  ? 17.296  -7.490  20.816   1.00 10.00 ? ? ? ? ? ? 78  ASN D C   1 
ATOM 9313  O O   . ASN D 1 77  ? 18.217  -6.695  20.996   1.00 10.00 ? ? ? ? ? ? 78  ASN D O   1 
ATOM 9314  C CB  . ASN D 1 77  ? 16.149  -6.195  19.004   1.00 10.00 ? ? ? ? ? ? 78  ASN D CB  1 
ATOM 9315  C CG  . ASN D 1 77  ? 16.538  -7.071  17.821   1.00 10.00 ? ? ? ? ? ? 78  ASN D CG  1 
ATOM 9316  O OD1 . ASN D 1 77  ? 17.725  -7.135  17.517   1.00 10.00 ? ? ? ? ? ? 78  ASN D OD1 1 
ATOM 9317  N ND2 . ASN D 1 77  ? 15.666  -7.861  17.189   1.00 10.00 ? ? ? ? ? ? 78  ASN D ND2 1 
ATOM 9318  N N   . TRP D 1 78  ? 17.433  -8.757  21.109   1.00 10.00 ? ? ? ? ? ? 79  TRP D N   1 
ATOM 9319  C CA  . TRP D 1 78  ? 18.664  -9.206  21.706   1.00 10.00 ? ? ? ? ? ? 79  TRP D CA  1 
ATOM 9320  C C   . TRP D 1 78  ? 19.869  -9.388  20.808   1.00 10.00 ? ? ? ? ? ? 79  TRP D C   1 
ATOM 9321  O O   . TRP D 1 78  ? 20.962  -9.153  21.305   1.00 10.00 ? ? ? ? ? ? 79  TRP D O   1 
ATOM 9322  C CB  . TRP D 1 78  ? 18.344  -10.475 22.451   1.00 10.00 ? ? ? ? ? ? 79  TRP D CB  1 
ATOM 9323  C CG  . TRP D 1 78  ? 17.698  -10.146 23.793   1.00 10.00 ? ? ? ? ? ? 79  TRP D CG  1 
ATOM 9324  C CD1 . TRP D 1 78  ? 16.370  -10.340 24.046   1.00 10.00 ? ? ? ? ? ? 79  TRP D CD1 1 
ATOM 9325  C CD2 . TRP D 1 78  ? 18.358  -9.517  24.795   1.00 10.00 ? ? ? ? ? ? 79  TRP D CD2 1 
ATOM 9326  N NE1 . TRP D 1 78  ? 16.168  -9.799  25.202   1.00 10.00 ? ? ? ? ? ? 79  TRP D NE1 1 
ATOM 9327  C CE2 . TRP D 1 78  ? 17.328  -9.293  25.686   1.00 10.00 ? ? ? ? ? ? 79  TRP D CE2 1 
ATOM 9328  C CE3 . TRP D 1 78  ? 19.656  -9.112  25.021   1.00 10.00 ? ? ? ? ? ? 79  TRP D CE3 1 
ATOM 9329  C CZ2 . TRP D 1 78  ? 17.604  -8.621  26.867   1.00 10.00 ? ? ? ? ? ? 79  TRP D CZ2 1 
ATOM 9330  C CZ3 . TRP D 1 78  ? 19.926  -8.446  26.194   1.00 10.00 ? ? ? ? ? ? 79  TRP D CZ3 1 
ATOM 9331  C CH2 . TRP D 1 78  ? 18.904  -8.207  27.097   1.00 10.00 ? ? ? ? ? ? 79  TRP D CH2 1 
ATOM 9332  N N   . ASP D 1 79  ? 19.850  -9.735  19.520   1.00 10.00 ? ? ? ? ? ? 80  ASP D N   1 
ATOM 9333  C CA  . ASP D 1 79  ? 21.123  -9.851  18.822   1.00 10.00 ? ? ? ? ? ? 80  ASP D CA  1 
ATOM 9334  C C   . ASP D 1 79  ? 21.560  -8.466  18.412   1.00 10.00 ? ? ? ? ? ? 80  ASP D C   1 
ATOM 9335  O O   . ASP D 1 79  ? 22.769  -8.231  18.315   1.00 10.00 ? ? ? ? ? ? 80  ASP D O   1 
ATOM 9336  C CB  . ASP D 1 79  ? 21.073  -10.685 17.548   1.00 10.00 ? ? ? ? ? ? 80  ASP D CB  1 
ATOM 9337  C CG  . ASP D 1 79  ? 20.130  -11.876 17.452   1.00 10.00 ? ? ? ? ? ? 80  ASP D CG  1 
ATOM 9338  O OD1 . ASP D 1 79  ? 19.532  -12.334 18.435   1.00 10.00 ? ? ? ? ? ? 80  ASP D OD1 1 
ATOM 9339  O OD2 . ASP D 1 79  ? 19.953  -12.331 16.326   1.00 10.00 ? ? ? ? ? ? 80  ASP D OD2 1 
ATOM 9340  N N   . ASP D 1 80  ? 20.644  -7.520  18.151   1.00 10.00 ? ? ? ? ? ? 81  ASP D N   1 
ATOM 9341  C CA  . ASP D 1 80  ? 21.136  -6.188  17.866   1.00 10.00 ? ? ? ? ? ? 81  ASP D CA  1 
ATOM 9342  C C   . ASP D 1 80  ? 21.621  -5.468  19.131   1.00 10.00 ? ? ? ? ? ? 81  ASP D C   1 
ATOM 9343  O O   . ASP D 1 80  ? 22.628  -4.742  19.078   1.00 10.00 ? ? ? ? ? ? 81  ASP D O   1 
ATOM 9344  C CB  . ASP D 1 80  ? 20.029  -5.457  17.021   1.00 10.00 ? ? ? ? ? ? 81  ASP D CB  1 
ATOM 9345  C CG  . ASP D 1 80  ? 20.245  -5.985  15.558   1.00 10.00 ? ? ? ? ? ? 81  ASP D CG  1 
ATOM 9346  O OD1 . ASP D 1 80  ? 21.302  -5.704  14.982   1.00 10.00 ? ? ? ? ? ? 81  ASP D OD1 1 
ATOM 9347  O OD2 . ASP D 1 80  ? 19.436  -6.720  14.969   1.00 10.00 ? ? ? ? ? ? 81  ASP D OD2 1 
ATOM 9348  N N   . MET D 1 81  ? 21.083  -5.709  20.328   1.00 10.00 ? ? ? ? ? ? 82  MET D N   1 
ATOM 9349  C CA  . MET D 1 81  ? 21.802  -5.253  21.533   1.00 10.00 ? ? ? ? ? ? 82  MET D CA  1 
ATOM 9350  C C   . MET D 1 81  ? 23.183  -5.967  21.567   1.00 10.00 ? ? ? ? ? ? 82  MET D C   1 
ATOM 9351  O O   . MET D 1 81  ? 24.207  -5.304  21.750   1.00 10.00 ? ? ? ? ? ? 82  MET D O   1 
ATOM 9352  C CB  . MET D 1 81  ? 21.005  -5.590  22.805   1.00 10.00 ? ? ? ? ? ? 82  MET D CB  1 
ATOM 9353  C CG  . MET D 1 81  ? 21.460  -4.838  24.070   1.00 10.00 ? ? ? ? ? ? 82  MET D CG  1 
ATOM 9354  S SD  . MET D 1 81  ? 21.048  -3.074  24.368   1.00 10.00 ? ? ? ? ? ? 82  MET D SD  1 
ATOM 9355  C CE  . MET D 1 81  ? 22.655  -2.325  24.320   1.00 10.00 ? ? ? ? ? ? 82  MET D CE  1 
ATOM 9356  N N   . GLU D 1 82  ? 23.323  -7.261  21.250   1.00 10.00 ? ? ? ? ? ? 83  GLU D N   1 
ATOM 9357  C CA  . GLU D 1 82  ? 24.619  -7.908  21.288   1.00 10.00 ? ? ? ? ? ? 83  GLU D CA  1 
ATOM 9358  C C   . GLU D 1 82  ? 25.593  -7.225  20.393   1.00 10.00 ? ? ? ? ? ? 83  GLU D C   1 
ATOM 9359  O O   . GLU D 1 82  ? 26.727  -6.980  20.802   1.00 10.00 ? ? ? ? ? ? 83  GLU D O   1 
ATOM 9360  C CB  . GLU D 1 82  ? 24.582  -9.333  20.851   1.00 10.00 ? ? ? ? ? ? 83  GLU D CB  1 
ATOM 9361  C CG  . GLU D 1 82  ? 23.970  -10.377 21.808   1.00 10.00 ? ? ? ? ? ? 83  GLU D CG  1 
ATOM 9362  C CD  . GLU D 1 82  ? 24.309  -11.839 21.490   1.00 10.00 ? ? ? ? ? ? 83  GLU D CD  1 
ATOM 9363  O OE1 . GLU D 1 82  ? 25.364  -12.083 20.887   1.00 10.00 ? ? ? ? ? ? 83  GLU D OE1 1 
ATOM 9364  O OE2 . GLU D 1 82  ? 23.511  -12.713 21.868   1.00 10.00 ? ? ? ? ? ? 83  GLU D OE2 1 
ATOM 9365  N N   . LYS D 1 83  ? 25.145  -6.834  19.220   1.00 10.00 ? ? ? ? ? ? 84  LYS D N   1 
ATOM 9366  C CA  . LYS D 1 83  ? 25.979  -6.014  18.350   1.00 10.00 ? ? ? ? ? ? 84  LYS D CA  1 
ATOM 9367  C C   . LYS D 1 83  ? 26.483  -4.742  19.037   1.00 10.00 ? ? ? ? ? ? 84  LYS D C   1 
ATOM 9368  O O   . LYS D 1 83  ? 27.695  -4.451  19.002   1.00 10.00 ? ? ? ? ? ? 84  LYS D O   1 
ATOM 9369  C CB  . LYS D 1 83  ? 25.263  -5.512  17.098   1.00 10.00 ? ? ? ? ? ? 84  LYS D CB  1 
ATOM 9370  C CG  . LYS D 1 83  ? 24.416  -6.444  16.229   1.00 10.00 ? ? ? ? ? ? 84  LYS D CG  1 
ATOM 9371  C CD  . LYS D 1 83  ? 25.079  -7.760  15.795   1.00 10.00 ? ? ? ? ? ? 84  LYS D CD  1 
ATOM 9372  C CE  . LYS D 1 83  ? 24.382  -8.354  14.547   1.00 10.00 ? ? ? ? ? ? 84  LYS D CE  1 
ATOM 9373  N NZ  . LYS D 1 83  ? 24.662  -7.565  13.353   1.00 10.00 ? ? ? ? ? ? 84  LYS D NZ  1 
ATOM 9374  N N   . ILE D 1 84  ? 25.595  -3.994  19.702   1.00 10.00 ? ? ? ? ? ? 85  ILE D N   1 
ATOM 9375  C CA  . ILE D 1 84  ? 25.970  -2.722  20.279   1.00 10.00 ? ? ? ? ? ? 85  ILE D CA  1 
ATOM 9376  C C   . ILE D 1 84  ? 27.090  -2.897  21.262   1.00 10.00 ? ? ? ? ? ? 85  ILE D C   1 
ATOM 9377  O O   . ILE D 1 84  ? 28.107  -2.191  21.190   1.00 10.00 ? ? ? ? ? ? 85  ILE D O   1 
ATOM 9378  C CB  . ILE D 1 84  ? 24.725  -2.072  20.942   1.00 10.00 ? ? ? ? ? ? 85  ILE D CB  1 
ATOM 9379  C CG1 . ILE D 1 84  ? 23.880  -1.458  19.837   1.00 10.00 ? ? ? ? ? ? 85  ILE D CG1 1 
ATOM 9380  C CG2 . ILE D 1 84  ? 25.105  -0.999  21.947   1.00 10.00 ? ? ? ? ? ? 85  ILE D CG2 1 
ATOM 9381  C CD1 . ILE D 1 84  ? 22.832  -0.460  20.316   1.00 10.00 ? ? ? ? ? ? 85  ILE D CD1 1 
ATOM 9382  N N   . TRP D 1 85  ? 26.931  -3.912  22.114   1.00 10.00 ? ? ? ? ? ? 86  TRP D N   1 
ATOM 9383  C CA  . TRP D 1 85  ? 27.926  -4.172  23.146   1.00 10.00 ? ? ? ? ? ? 86  TRP D CA  1 
ATOM 9384  C C   . TRP D 1 85  ? 29.229  -4.553  22.481   1.00 10.00 ? ? ? ? ? ? 86  TRP D C   1 
ATOM 9385  O O   . TRP D 1 85  ? 30.188  -3.839  22.723   1.00 10.00 ? ? ? ? ? ? 86  TRP D O   1 
ATOM 9386  C CB  . TRP D 1 85  ? 27.428  -5.279  24.128   1.00 10.00 ? ? ? ? ? ? 86  TRP D CB  1 
ATOM 9387  C CG  . TRP D 1 85  ? 26.412  -4.753  25.144   1.00 10.00 ? ? ? ? ? ? 86  TRP D CG  1 
ATOM 9388  C CD1 . TRP D 1 85  ? 26.434  -3.430  25.487   1.00 10.00 ? ? ? ? ? ? 86  TRP D CD1 1 
ATOM 9389  C CD2 . TRP D 1 85  ? 25.368  -5.427  25.736   1.00 10.00 ? ? ? ? ? ? 86  TRP D CD2 1 
ATOM 9390  N NE1 . TRP D 1 85  ? 25.411  -3.242  26.261   1.00 10.00 ? ? ? ? ? ? 86  TRP D NE1 1 
ATOM 9391  C CE2 . TRP D 1 85  ? 24.752  -4.393  26.438   1.00 10.00 ? ? ? ? ? ? 86  TRP D CE2 1 
ATOM 9392  C CE3 . TRP D 1 85  ? 24.826  -6.699  25.806   1.00 10.00 ? ? ? ? ? ? 86  TRP D CE3 1 
ATOM 9393  C CZ2 . TRP D 1 85  ? 23.607  -4.563  27.207   1.00 10.00 ? ? ? ? ? ? 86  TRP D CZ2 1 
ATOM 9394  C CZ3 . TRP D 1 85  ? 23.687  -6.882  26.574   1.00 10.00 ? ? ? ? ? ? 86  TRP D CZ3 1 
ATOM 9395  C CH2 . TRP D 1 85  ? 23.081  -5.823  27.265   1.00 10.00 ? ? ? ? ? ? 86  TRP D CH2 1 
ATOM 9396  N N   . HIS D 1 86  ? 29.337  -5.560  21.624   1.00 10.00 ? ? ? ? ? ? 87  HIS D N   1 
ATOM 9397  C CA  . HIS D 1 86  ? 30.546  -5.852  20.850   1.00 10.00 ? ? ? ? ? ? 87  HIS D CA  1 
ATOM 9398  C C   . HIS D 1 86  ? 31.240  -4.601  20.318   1.00 10.00 ? ? ? ? ? ? 87  HIS D C   1 
ATOM 9399  O O   . HIS D 1 86  ? 32.436  -4.482  20.477   1.00 10.00 ? ? ? ? ? ? 87  HIS D O   1 
ATOM 9400  C CB  . HIS D 1 86  ? 30.154  -6.757  19.680   1.00 10.00 ? ? ? ? ? ? 87  HIS D CB  1 
ATOM 9401  C CG  . HIS D 1 86  ? 31.295  -7.480  18.973   1.00 10.00 ? ? ? ? ? ? 87  HIS D CG  1 
ATOM 9402  N ND1 . HIS D 1 86  ? 31.611  -8.796  18.971   1.00 10.00 ? ? ? ? ? ? 87  HIS D ND1 1 
ATOM 9403  C CD2 . HIS D 1 86  ? 32.212  -6.839  18.163   1.00 10.00 ? ? ? ? ? ? 87  HIS D CD2 1 
ATOM 9404  C CE1 . HIS D 1 86  ? 32.666  -8.968  18.198   1.00 10.00 ? ? ? ? ? ? 87  HIS D CE1 1 
ATOM 9405  N NE2 . HIS D 1 86  ? 33.000  -7.780  17.730   1.00 10.00 ? ? ? ? ? ? 87  HIS D NE2 1 
ATOM 9406  N N   . HIS D 1 87  ? 30.528  -3.665  19.692   1.00 10.00 ? ? ? ? ? ? 88  HIS D N   1 
ATOM 9407  C CA  . HIS D 1 87  ? 31.005  -2.346  19.243   1.00 10.00 ? ? ? ? ? ? 88  HIS D CA  1 
ATOM 9408  C C   . HIS D 1 87  ? 31.470  -1.442  20.411   1.00 10.00 ? ? ? ? ? ? 88  HIS D C   1 
ATOM 9409  O O   . HIS D 1 87  ? 32.462  -0.699  20.267   1.00 10.00 ? ? ? ? ? ? 88  HIS D O   1 
ATOM 9410  C CB  . HIS D 1 87  ? 29.870  -1.618  18.446   1.00 10.00 ? ? ? ? ? ? 88  HIS D CB  1 
ATOM 9411  C CG  . HIS D 1 87  ? 30.241  -0.223  17.918   1.00 10.00 ? ? ? ? ? ? 88  HIS D CG  1 
ATOM 9412  N ND1 . HIS D 1 87  ? 31.102  0.109   16.958   1.00 10.00 ? ? ? ? ? ? 88  HIS D ND1 1 
ATOM 9413  C CD2 . HIS D 1 87  ? 29.820  0.956   18.476   1.00 10.00 ? ? ? ? ? ? 88  HIS D CD2 1 
ATOM 9414  C CE1 . HIS D 1 87  ? 31.236  1.408   16.933   1.00 10.00 ? ? ? ? ? ? 88  HIS D CE1 1 
ATOM 9415  N NE2 . HIS D 1 87  ? 30.458  1.900   17.854   1.00 10.00 ? ? ? ? ? ? 88  HIS D NE2 1 
ATOM 9416  N N   . THR D 1 88  ? 30.761  -1.378  21.535   1.00 10.00 ? ? ? ? ? ? 89  THR D N   1 
ATOM 9417  C CA  . THR D 1 88  ? 31.235  -0.691  22.744   1.00 10.00 ? ? ? ? ? ? 89  THR D CA  1 
ATOM 9418  C C   . THR D 1 88  ? 32.700  -1.131  23.079   1.00 10.00 ? ? ? ? ? ? 89  THR D C   1 
ATOM 9419  O O   . THR D 1 88  ? 33.654  -0.321  23.114   1.00 10.00 ? ? ? ? ? ? 89  THR D O   1 
ATOM 9420  C CB  . THR D 1 88  ? 30.311  -1.060  23.961   1.00 10.00 ? ? ? ? ? ? 89  THR D CB  1 
ATOM 9421  O OG1 . THR D 1 88  ? 28.971  -0.797  23.558   1.00 10.00 ? ? ? ? ? ? 89  THR D OG1 1 
ATOM 9422  C CG2 . THR D 1 88  ? 30.687  -0.339  25.238   1.00 10.00 ? ? ? ? ? ? 89  THR D CG2 1 
ATOM 9423  N N   . PHE D 1 89  ? 32.937  -2.448  23.249   1.00 10.00 ? ? ? ? ? ? 90  PHE D N   1 
ATOM 9424  C CA  . PHE D 1 89  ? 34.252  -2.948  23.695   1.00 10.00 ? ? ? ? ? ? 90  PHE D CA  1 
ATOM 9425  C C   . PHE D 1 89  ? 35.308  -2.919  22.597   1.00 10.00 ? ? ? ? ? ? 90  PHE D C   1 
ATOM 9426  O O   . PHE D 1 89  ? 36.313  -2.205  22.659   1.00 10.00 ? ? ? ? ? ? 90  PHE D O   1 
ATOM 9427  C CB  . PHE D 1 89  ? 34.123  -4.396  24.247   1.00 10.00 ? ? ? ? ? ? 90  PHE D CB  1 
ATOM 9428  C CG  . PHE D 1 89  ? 33.048  -4.620  25.317   1.00 10.00 ? ? ? ? ? ? 90  PHE D CG  1 
ATOM 9429  C CD1 . PHE D 1 89  ? 33.071  -3.936  26.518   1.00 10.00 ? ? ? ? ? ? 90  PHE D CD1 1 
ATOM 9430  C CD2 . PHE D 1 89  ? 32.054  -5.537  25.094   1.00 10.00 ? ? ? ? ? ? 90  PHE D CD2 1 
ATOM 9431  C CE1 . PHE D 1 89  ? 32.096  -4.181  27.476   1.00 10.00 ? ? ? ? ? ? 90  PHE D CE1 1 
ATOM 9432  C CE2 . PHE D 1 89  ? 31.100  -5.765  26.043   1.00 10.00 ? ? ? ? ? ? 90  PHE D CE2 1 
ATOM 9433  C CZ  . PHE D 1 89  ? 31.106  -5.100  27.239   1.00 10.00 ? ? ? ? ? ? 90  PHE D CZ  1 
ATOM 9434  N N   . TYR D 1 90  ? 34.999  -3.623  21.514   1.00 10.00 ? ? ? ? ? ? 91  TYR D N   1 
ATOM 9435  C CA  . TYR D 1 90  ? 35.913  -3.803  20.400   1.00 10.00 ? ? ? ? ? ? 91  TYR D CA  1 
ATOM 9436  C C   . TYR D 1 90  ? 36.070  -2.648  19.460   1.00 10.00 ? ? ? ? ? ? 91  TYR D C   1 
ATOM 9437  O O   . TYR D 1 90  ? 36.970  -2.691  18.639   1.00 10.00 ? ? ? ? ? ? 91  TYR D O   1 
ATOM 9438  C CB  . TYR D 1 90  ? 35.501  -4.992  19.569   1.00 10.00 ? ? ? ? ? ? 91  TYR D CB  1 
ATOM 9439  C CG  . TYR D 1 90  ? 35.479  -6.270  20.391   1.00 10.00 ? ? ? ? ? ? 91  TYR D CG  1 
ATOM 9440  C CD1 . TYR D 1 90  ? 36.633  -6.942  20.738   1.00 10.00 ? ? ? ? ? ? 91  TYR D CD1 1 
ATOM 9441  C CD2 . TYR D 1 90  ? 34.253  -6.762  20.749   1.00 10.00 ? ? ? ? ? ? 91  TYR D CD2 1 
ATOM 9442  C CE1 . TYR D 1 90  ? 36.518  -8.121  21.439   1.00 10.00 ? ? ? ? ? ? 91  TYR D CE1 1 
ATOM 9443  C CE2 . TYR D 1 90  ? 34.127  -7.920  21.452   1.00 10.00 ? ? ? ? ? ? 91  TYR D CE2 1 
ATOM 9444  C CZ  . TYR D 1 90  ? 35.266  -8.586  21.785   1.00 10.00 ? ? ? ? ? ? 91  TYR D CZ  1 
ATOM 9445  O OH  . TYR D 1 90  ? 35.097  -9.747  22.499   1.00 10.00 ? ? ? ? ? ? 91  TYR D OH  1 
ATOM 9446  N N   . ASN D 1 91  ? 35.248  -1.624  19.445   1.00 10.00 ? ? ? ? ? ? 92  ASN D N   1 
ATOM 9447  C CA  . ASN D 1 91  ? 35.474  -0.537  18.507   1.00 10.00 ? ? ? ? ? ? 92  ASN D CA  1 
ATOM 9448  C C   . ASN D 1 91  ? 35.467  0.794   19.231   1.00 10.00 ? ? ? ? ? ? 92  ASN D C   1 
ATOM 9449  O O   . ASN D 1 91  ? 36.247  1.660   18.850   1.00 10.00 ? ? ? ? ? ? 92  ASN D O   1 
ATOM 9450  C CB  . ASN D 1 91  ? 34.400  -0.521  17.399   1.00 10.00 ? ? ? ? ? ? 92  ASN D CB  1 
ATOM 9451  C CG  . ASN D 1 91  ? 34.298  -1.756  16.509   1.00 10.00 ? ? ? ? ? ? 92  ASN D CG  1 
ATOM 9452  O OD1 . ASN D 1 91  ? 33.251  -2.074  15.951   1.00 10.00 ? ? ? ? ? ? 92  ASN D OD1 1 
ATOM 9453  N ND2 . ASN D 1 91  ? 35.325  -2.537  16.344   1.00 10.00 ? ? ? ? ? ? 92  ASN D ND2 1 
ATOM 9454  N N   . GLU D 1 92  ? 34.633  1.004   20.266   1.00 10.00 ? ? ? ? ? ? 93  GLU D N   1 
ATOM 9455  C CA  . GLU D 1 92  ? 34.655  2.280   20.924   1.00 10.00 ? ? ? ? ? ? 93  GLU D CA  1 
ATOM 9456  C C   . GLU D 1 92  ? 35.674  2.384   22.056   1.00 10.00 ? ? ? ? ? ? 93  GLU D C   1 
ATOM 9457  O O   . GLU D 1 92  ? 36.500  3.301   22.070   1.00 10.00 ? ? ? ? ? ? 93  GLU D O   1 
ATOM 9458  C CB  . GLU D 1 92  ? 33.262  2.566   21.396   1.00 10.00 ? ? ? ? ? ? 93  GLU D CB  1 
ATOM 9459  C CG  . GLU D 1 92  ? 32.827  3.966   20.871   1.00 10.00 ? ? ? ? ? ? 93  GLU D CG  1 
ATOM 9460  C CD  . GLU D 1 92  ? 32.554  4.208   19.366   1.00 10.00 ? ? ? ? ? ? 93  GLU D CD  1 
ATOM 9461  O OE1 . GLU D 1 92  ? 33.481  4.427   18.570   1.00 10.00 ? ? ? ? ? ? 93  GLU D OE1 1 
ATOM 9462  O OE2 . GLU D 1 92  ? 31.393  4.215   18.973   1.00 10.00 ? ? ? ? ? ? 93  GLU D OE2 1 
ATOM 9463  N N   . LEU D 1 93  ? 35.713  1.492   23.032   1.00 10.00 ? ? ? ? ? ? 94  LEU D N   1 
ATOM 9464  C CA  . LEU D 1 93  ? 36.666  1.696   24.097   1.00 10.00 ? ? ? ? ? ? 94  LEU D CA  1 
ATOM 9465  C C   . LEU D 1 93  ? 37.982  1.005   23.791   1.00 10.00 ? ? ? ? ? ? 94  LEU D C   1 
ATOM 9466  O O   . LEU D 1 93  ? 39.011  1.356   24.379   1.00 10.00 ? ? ? ? ? ? 94  LEU D O   1 
ATOM 9467  C CB  . LEU D 1 93  ? 35.994  1.210   25.366   1.00 10.00 ? ? ? ? ? ? 94  LEU D CB  1 
ATOM 9468  C CG  . LEU D 1 93  ? 34.816  2.067   25.845   1.00 10.00 ? ? ? ? ? ? 94  LEU D CG  1 
ATOM 9469  C CD1 . LEU D 1 93  ? 33.942  1.229   26.762   1.00 10.00 ? ? ? ? ? ? 94  LEU D CD1 1 
ATOM 9470  C CD2 . LEU D 1 93  ? 35.330  3.333   26.518   1.00 10.00 ? ? ? ? ? ? 94  LEU D CD2 1 
ATOM 9471  N N   . ARG D 1 94  ? 37.933  0.040   22.834   1.00 10.00 ? ? ? ? ? ? 95  ARG D N   1 
ATOM 9472  C CA  . ARG D 1 94  ? 39.090  -0.733  22.296   1.00 10.00 ? ? ? ? ? ? 95  ARG D CA  1 
ATOM 9473  C C   . ARG D 1 94  ? 39.719  -1.626  23.411   1.00 10.00 ? ? ? ? ? ? 95  ARG D C   1 
ATOM 9474  O O   . ARG D 1 94  ? 40.935  -1.743  23.651   1.00 10.00 ? ? ? ? ? ? 95  ARG D O   1 
ATOM 9475  C CB  . ARG D 1 94  ? 40.130  0.254   21.729   1.00 10.00 ? ? ? ? ? ? 95  ARG D CB  1 
ATOM 9476  C CG  . ARG D 1 94  ? 39.635  1.308   20.686   1.00 10.00 ? ? ? ? ? ? 95  ARG D CG  1 
ATOM 9477  C CD  . ARG D 1 94  ? 39.644  0.770   19.282   1.00 10.00 ? ? ? ? ? ? 95  ARG D CD  1 
ATOM 9478  N NE  . ARG D 1 94  ? 41.018  0.382   18.986   1.00 10.00 ? ? ? ? ? ? 95  ARG D NE  1 
ATOM 9479  C CZ  . ARG D 1 94  ? 41.284  -0.612  18.132   1.00 10.00 ? ? ? ? ? ? 95  ARG D CZ  1 
ATOM 9480  N NH1 . ARG D 1 94  ? 40.289  -1.275  17.493   1.00 10.00 ? ? ? ? ? ? 95  ARG D NH1 1 
ATOM 9481  N NH2 . ARG D 1 94  ? 42.556  -1.003  18.003   1.00 10.00 ? ? ? ? ? ? 95  ARG D NH2 1 
ATOM 9482  N N   . VAL D 1 95  ? 38.769  -2.348  24.018   1.00 10.00 ? ? ? ? ? ? 96  VAL D N   1 
ATOM 9483  C CA  . VAL D 1 95  ? 38.938  -3.101  25.226   1.00 10.00 ? ? ? ? ? ? 96  VAL D CA  1 
ATOM 9484  C C   . VAL D 1 95  ? 38.650  -4.593  24.971   1.00 10.00 ? ? ? ? ? ? 96  VAL D C   1 
ATOM 9485  O O   . VAL D 1 95  ? 38.080  -5.039  23.957   1.00 10.00 ? ? ? ? ? ? 96  VAL D O   1 
ATOM 9486  C CB  . VAL D 1 95  ? 37.970  -2.389  26.271   1.00 10.00 ? ? ? ? ? ? 96  VAL D CB  1 
ATOM 9487  C CG1 . VAL D 1 95  ? 36.824  -3.266  26.788   1.00 10.00 ? ? ? ? ? ? 96  VAL D CG1 1 
ATOM 9488  C CG2 . VAL D 1 95  ? 38.880  -1.861  27.372   1.00 10.00 ? ? ? ? ? ? 96  VAL D CG2 1 
ATOM 9489  N N   . ALA D 1 96  ? 39.065  -5.368  25.964   1.00 10.00 ? ? ? ? ? ? 97  ALA D N   1 
ATOM 9490  C CA  . ALA D 1 96  ? 38.893  -6.781  25.916   1.00 10.00 ? ? ? ? ? ? 97  ALA D CA  1 
ATOM 9491  C C   . ALA D 1 96  ? 37.974  -7.102  27.056   1.00 10.00 ? ? ? ? ? ? 97  ALA D C   1 
ATOM 9492  O O   . ALA D 1 96  ? 38.237  -6.710  28.186   1.00 10.00 ? ? ? ? ? ? 97  ALA D O   1 
ATOM 9493  C CB  . ALA D 1 96  ? 40.237  -7.415  26.104   1.00 10.00 ? ? ? ? ? ? 97  ALA D CB  1 
ATOM 9494  N N   . PRO D 1 97  ? 36.865  -7.752  26.792   1.00 10.00 ? ? ? ? ? ? 98  PRO D N   1 
ATOM 9495  C CA  . PRO D 1 97  ? 35.863  -8.032  27.793   1.00 10.00 ? ? ? ? ? ? 98  PRO D CA  1 
ATOM 9496  C C   . PRO D 1 97  ? 36.328  -8.941  28.897   1.00 10.00 ? ? ? ? ? ? 98  PRO D C   1 
ATOM 9497  O O   . PRO D 1 97  ? 35.985  -8.658  30.049   1.00 10.00 ? ? ? ? ? ? 98  PRO D O   1 
ATOM 9498  C CB  . PRO D 1 97  ? 34.680  -8.587  27.023   1.00 10.00 ? ? ? ? ? ? 98  PRO D CB  1 
ATOM 9499  C CG  . PRO D 1 97  ? 34.797  -7.812  25.721   1.00 10.00 ? ? ? ? ? ? 98  PRO D CG  1 
ATOM 9500  C CD  . PRO D 1 97  ? 36.286  -7.892  25.463   1.00 10.00 ? ? ? ? ? ? 98  PRO D CD  1 
ATOM 9501  N N   . GLU D 1 98  ? 37.231  -9.902  28.619   1.00 10.00 ? ? ? ? ? ? 99  GLU D N   1 
ATOM 9502  C CA  . GLU D 1 98  ? 37.675  -10.899 29.615   1.00 10.00 ? ? ? ? ? ? 99  GLU D CA  1 
ATOM 9503  C C   . GLU D 1 98  ? 38.692  -10.559 30.709   1.00 10.00 ? ? ? ? ? ? 99  GLU D C   1 
ATOM 9504  O O   . GLU D 1 98  ? 39.146  -11.410 31.489   1.00 10.00 ? ? ? ? ? ? 99  GLU D O   1 
ATOM 9505  C CB  . GLU D 1 98  ? 38.202  -12.122 28.898   1.00 10.00 ? ? ? ? ? ? 99  GLU D CB  1 
ATOM 9506  C CG  . GLU D 1 98  ? 39.227  -11.909 27.833   1.00 10.00 ? ? ? ? ? ? 99  GLU D CG  1 
ATOM 9507  C CD  . GLU D 1 98  ? 38.656  -11.730 26.446   1.00 10.00 ? ? ? ? ? ? 99  GLU D CD  1 
ATOM 9508  O OE1 . GLU D 1 98  ? 37.443  -11.587 26.267   1.00 10.00 ? ? ? ? ? ? 99  GLU D OE1 1 
ATOM 9509  O OE2 . GLU D 1 98  ? 39.451  -11.743 25.508   1.00 10.00 ? ? ? ? ? ? 99  GLU D OE2 1 
ATOM 9510  N N   . GLU D 1 99  ? 38.957  -9.256  30.786   1.00 10.00 ? ? ? ? ? ? 100 GLU D N   1 
ATOM 9511  C CA  . GLU D 1 99  ? 39.924  -8.651  31.680   1.00 10.00 ? ? ? ? ? ? 100 GLU D CA  1 
ATOM 9512  C C   . GLU D 1 99  ? 39.313  -7.519  32.532   1.00 10.00 ? ? ? ? ? ? 100 GLU D C   1 
ATOM 9513  O O   . GLU D 1 99  ? 40.010  -6.901  33.349   1.00 10.00 ? ? ? ? ? ? 100 GLU D O   1 
ATOM 9514  C CB  . GLU D 1 99  ? 41.034  -8.096  30.815   1.00 10.00 ? ? ? ? ? ? 100 GLU D CB  1 
ATOM 9515  C CG  . GLU D 1 99  ? 41.744  -9.093  29.945   1.00 10.00 ? ? ? ? ? ? 100 GLU D CG  1 
ATOM 9516  C CD  . GLU D 1 99  ? 42.581  -8.546  28.798   1.00 10.00 ? ? ? ? ? ? 100 GLU D CD  1 
ATOM 9517  O OE1 . GLU D 1 99  ? 43.291  -7.536  28.947   1.00 10.00 ? ? ? ? ? ? 100 GLU D OE1 1 
ATOM 9518  O OE2 . GLU D 1 99  ? 42.532  -9.171  27.729   1.00 10.00 ? ? ? ? ? ? 100 GLU D OE2 1 
ATOM 9519  N N   . HIS D 1 100 ? 38.040  -7.119  32.319   1.00 10.00 ? ? ? ? ? ? 101 HIS D N   1 
ATOM 9520  C CA  . HIS D 1 100 ? 37.418  -5.964  32.989   1.00 10.00 ? ? ? ? ? ? 101 HIS D CA  1 
ATOM 9521  C C   . HIS D 1 100 ? 36.070  -6.412  33.482   1.00 10.00 ? ? ? ? ? ? 101 HIS D C   1 
ATOM 9522  O O   . HIS D 1 100 ? 35.348  -7.154  32.806   1.00 10.00 ? ? ? ? ? ? 101 HIS D O   1 
ATOM 9523  C CB  . HIS D 1 100 ? 37.166  -4.781  32.061   1.00 10.00 ? ? ? ? ? ? 101 HIS D CB  1 
ATOM 9524  C CG  . HIS D 1 100 ? 38.453  -4.171  31.533   1.00 10.00 ? ? ? ? ? ? 101 HIS D CG  1 
ATOM 9525  N ND1 . HIS D 1 100 ? 39.130  -3.145  32.044   1.00 10.00 ? ? ? ? ? ? 101 HIS D ND1 1 
ATOM 9526  C CD2 . HIS D 1 100 ? 39.180  -4.656  30.463   1.00 10.00 ? ? ? ? ? ? 101 HIS D CD2 1 
ATOM 9527  C CE1 . HIS D 1 100 ? 40.249  -3.002  31.345   1.00 10.00 ? ? ? ? ? ? 101 HIS D CE1 1 
ATOM 9528  N NE2 . HIS D 1 100 ? 40.274  -3.916  30.398   1.00 10.00 ? ? ? ? ? ? 101 HIS D NE2 1 
ATOM 9529  N N   . PRO D 1 101 ? 35.726  -6.102  34.717   1.00 10.00 ? ? ? ? ? ? 102 PRO D N   1 
ATOM 9530  C CA  . PRO D 1 101 ? 34.369  -6.275  35.135   1.00 10.00 ? ? ? ? ? ? 102 PRO D CA  1 
ATOM 9531  C C   . PRO D 1 101 ? 33.492  -5.205  34.488   1.00 10.00 ? ? ? ? ? ? 102 PRO D C   1 
ATOM 9532  O O   . PRO D 1 101 ? 33.980  -4.111  34.168   1.00 10.00 ? ? ? ? ? ? 102 PRO D O   1 
ATOM 9533  C CB  . PRO D 1 101 ? 34.538  -6.265  36.668   1.00 10.00 ? ? ? ? ? ? 102 PRO D CB  1 
ATOM 9534  C CG  . PRO D 1 101 ? 35.754  -5.445  36.925   1.00 10.00 ? ? ? ? ? ? 102 PRO D CG  1 
ATOM 9535  C CD  . PRO D 1 101 ? 36.632  -5.995  35.851   1.00 10.00 ? ? ? ? ? ? 102 PRO D CD  1 
ATOM 9536  N N   . VAL D 1 102 ? 32.229  -5.503  34.206   1.00 10.00 ? ? ? ? ? ? 103 VAL D N   1 
ATOM 9537  C CA  . VAL D 1 102 ? 31.351  -4.468  33.685   1.00 10.00 ? ? ? ? ? ? 103 VAL D CA  1 
ATOM 9538  C C   . VAL D 1 102 ? 30.177  -4.089  34.597   1.00 10.00 ? ? ? ? ? ? 103 VAL D C   1 
ATOM 9539  O O   . VAL D 1 102 ? 29.580  -4.933  35.300   1.00 10.00 ? ? ? ? ? ? 103 VAL D O   1 
ATOM 9540  C CB  . VAL D 1 102 ? 30.789  -4.881  32.352   1.00 10.00 ? ? ? ? ? ? 103 VAL D CB  1 
ATOM 9541  C CG1 . VAL D 1 102 ? 31.957  -5.050  31.390   1.00 10.00 ? ? ? ? ? ? 103 VAL D CG1 1 
ATOM 9542  C CG2 . VAL D 1 102 ? 29.977  -6.154  32.478   1.00 10.00 ? ? ? ? ? ? 103 VAL D CG2 1 
ATOM 9543  N N   . LEU D 1 103 ? 29.874  -2.792  34.723   1.00 10.00 ? ? ? ? ? ? 104 LEU D N   1 
ATOM 9544  C CA  . LEU D 1 103 ? 28.677  -2.468  35.438   1.00 10.00 ? ? ? ? ? ? 104 LEU D CA  1 
ATOM 9545  C C   . LEU D 1 103 ? 27.743  -2.123  34.296   1.00 10.00 ? ? ? ? ? ? 104 LEU D C   1 
ATOM 9546  O O   . LEU D 1 103 ? 28.046  -1.227  33.503   1.00 10.00 ? ? ? ? ? ? 104 LEU D O   1 
ATOM 9547  C CB  . LEU D 1 103 ? 28.905  -1.281  36.382   1.00 10.00 ? ? ? ? ? ? 104 LEU D CB  1 
ATOM 9548  C CG  . LEU D 1 103 ? 27.651  -0.860  37.251   1.00 10.00 ? ? ? ? ? ? 104 LEU D CG  1 
ATOM 9549  C CD1 . LEU D 1 103 ? 28.024  -0.778  38.730   1.00 10.00 ? ? ? ? ? ? 104 LEU D CD1 1 
ATOM 9550  C CD2 . LEU D 1 103 ? 27.095  0.477   36.745   1.00 10.00 ? ? ? ? ? ? 104 LEU D CD2 1 
ATOM 9551  N N   . LEU D 1 104 ? 26.636  -2.804  34.070   1.00 10.00 ? ? ? ? ? ? 105 LEU D N   1 
ATOM 9552  C CA  . LEU D 1 104 ? 25.745  -2.456  32.956   1.00 10.00 ? ? ? ? ? ? 105 LEU D CA  1 
ATOM 9553  C C   . LEU D 1 104 ? 24.598  -1.705  33.573   1.00 10.00 ? ? ? ? ? ? 105 LEU D C   1 
ATOM 9554  O O   . LEU D 1 104 ? 24.210  -2.156  34.648   1.00 10.00 ? ? ? ? ? ? 105 LEU D O   1 
ATOM 9555  C CB  . LEU D 1 104 ? 25.126  -3.655  32.295   1.00 10.00 ? ? ? ? ? ? 105 LEU D CB  1 
ATOM 9556  C CG  . LEU D 1 104 ? 25.938  -4.706  31.673   1.00 10.00 ? ? ? ? ? ? 105 LEU D CG  1 
ATOM 9557  C CD1 . LEU D 1 104 ? 24.964  -5.744  31.256   1.00 10.00 ? ? ? ? ? ? 105 LEU D CD1 1 
ATOM 9558  C CD2 . LEU D 1 104 ? 26.634  -4.253  30.423   1.00 10.00 ? ? ? ? ? ? 105 LEU D CD2 1 
ATOM 9559  N N   . THR D 1 105 ? 24.003  -0.621  33.117   1.00 10.00 ? ? ? ? ? ? 106 THR D N   1 
ATOM 9560  C CA  . THR D 1 105 ? 22.834  -0.198  33.871   1.00 10.00 ? ? ? ? ? ? 106 THR D CA  1 
ATOM 9561  C C   . THR D 1 105 ? 21.557  -0.783  33.317   1.00 10.00 ? ? ? ? ? ? 106 THR D C   1 
ATOM 9562  O O   . THR D 1 105 ? 21.529  -1.341  32.221   1.00 10.00 ? ? ? ? ? ? 106 THR D O   1 
ATOM 9563  C CB  . THR D 1 105 ? 22.778  1.305   33.908   1.00 10.00 ? ? ? ? ? ? 106 THR D CB  1 
ATOM 9564  O OG1 . THR D 1 105 ? 22.786  1.752   32.555   1.00 10.00 ? ? ? ? ? ? 106 THR D OG1 1 
ATOM 9565  C CG2 . THR D 1 105 ? 23.930  1.900   34.669   1.00 10.00 ? ? ? ? ? ? 106 THR D CG2 1 
ATOM 9566  N N   . GLU D 1 106 ? 20.461  -0.656  34.029   1.00 10.00 ? ? ? ? ? ? 107 GLU D N   1 
ATOM 9567  C CA  . GLU D 1 106 ? 19.193  -1.195  33.584   1.00 10.00 ? ? ? ? ? ? 107 GLU D CA  1 
ATOM 9568  C C   . GLU D 1 106 ? 17.980  -0.326  33.973   1.00 10.00 ? ? ? ? ? ? 107 GLU D C   1 
ATOM 9569  O O   . GLU D 1 106 ? 18.091  0.552   34.825   1.00 10.00 ? ? ? ? ? ? 107 GLU D O   1 
ATOM 9570  C CB  . GLU D 1 106 ? 19.025  -2.577  34.169   1.00 10.00 ? ? ? ? ? ? 107 GLU D CB  1 
ATOM 9571  C CG  . GLU D 1 106 ? 19.076  -2.567  35.713   1.00 10.00 ? ? ? ? ? ? 107 GLU D CG  1 
ATOM 9572  C CD  . GLU D 1 106 ? 18.265  -3.644  36.389   1.00 10.00 ? ? ? ? ? ? 107 GLU D CD  1 
ATOM 9573  O OE1 . GLU D 1 106 ? 17.727  -4.517  35.735   1.00 10.00 ? ? ? ? ? ? 107 GLU D OE1 1 
ATOM 9574  O OE2 . GLU D 1 106 ? 18.148  -3.592  37.593   1.00 10.00 ? ? ? ? ? ? 107 GLU D OE2 1 
ATOM 9575  N N   . ALA D 1 107 ? 16.859  -0.447  33.284   1.00 10.00 ? ? ? ? ? ? 108 ALA D N   1 
ATOM 9576  C CA  . ALA D 1 107 ? 15.639  0.255   33.598   1.00 10.00 ? ? ? ? ? ? 108 ALA D CA  1 
ATOM 9577  C C   . ALA D 1 107 ? 15.103  -0.095  34.967   1.00 10.00 ? ? ? ? ? ? 108 ALA D C   1 
ATOM 9578  O O   . ALA D 1 107 ? 15.158  -1.265  35.349   1.00 10.00 ? ? ? ? ? ? 108 ALA D O   1 
ATOM 9579  C CB  . ALA D 1 107 ? 14.549  -0.093  32.602   1.00 10.00 ? ? ? ? ? ? 108 ALA D CB  1 
ATOM 9580  N N   . PRO D 1 108 ? 14.564  0.854   35.746   1.00 10.00 ? ? ? ? ? ? 109 PRO D N   1 
ATOM 9581  C CA  . PRO D 1 108 ? 13.662  0.586   36.872   1.00 10.00 ? ? ? ? ? ? 109 PRO D CA  1 
ATOM 9582  C C   . PRO D 1 108 ? 12.569  -0.347  36.394   1.00 10.00 ? ? ? ? ? ? 109 PRO D C   1 
ATOM 9583  O O   . PRO D 1 108 ? 11.949  -0.093  35.338   1.00 10.00 ? ? ? ? ? ? 109 PRO D O   1 
ATOM 9584  C CB  . PRO D 1 108 ? 13.089  1.913   37.260   1.00 10.00 ? ? ? ? ? ? 109 PRO D CB  1 
ATOM 9585  C CG  . PRO D 1 108 ? 14.058  2.921   36.683   1.00 10.00 ? ? ? ? ? ? 109 PRO D CG  1 
ATOM 9586  C CD  . PRO D 1 108 ? 14.637  2.287   35.442   1.00 10.00 ? ? ? ? ? ? 109 PRO D CD  1 
ATOM 9587  N N   . LEU D 1 109 ? 12.243  -1.330  37.212   1.00 10.00 ? ? ? ? ? ? 110 LEU D N   1 
ATOM 9588  C CA  . LEU D 1 109 ? 11.249  -2.343  36.870   1.00 10.00 ? ? ? ? ? ? 110 LEU D CA  1 
ATOM 9589  C C   . LEU D 1 109 ? 11.580  -3.191  35.596   1.00 10.00 ? ? ? ? ? ? 110 LEU D C   1 
ATOM 9590  O O   . LEU D 1 109 ? 10.687  -3.723  34.913   1.00 10.00 ? ? ? ? ? ? 110 LEU D O   1 
ATOM 9591  C CB  . LEU D 1 109 ? 9.870   -1.664  36.712   1.00 10.00 ? ? ? ? ? ? 110 LEU D CB  1 
ATOM 9592  C CG  . LEU D 1 109 ? 8.951   -1.165  37.840   1.00 10.00 ? ? ? ? ? ? 110 LEU D CG  1 
ATOM 9593  C CD1 . LEU D 1 109 ? 8.102   -0.066  37.240   1.00 10.00 ? ? ? ? ? ? 110 LEU D CD1 1 
ATOM 9594  C CD2 . LEU D 1 109 ? 7.972   -2.204  38.351   1.00 10.00 ? ? ? ? ? ? 110 LEU D CD2 1 
ATOM 9595  N N   . ASN D 1 110 ? 12.867  -3.398  35.237   1.00 10.00 ? ? ? ? ? ? 111 ASN D N   1 
ATOM 9596  C CA  . ASN D 1 110 ? 13.265  -4.188  34.051   1.00 10.00 ? ? ? ? ? ? 111 ASN D CA  1 
ATOM 9597  C C   . ASN D 1 110 ? 12.789  -5.634  34.188   1.00 10.00 ? ? ? ? ? ? 111 ASN D C   1 
ATOM 9598  O O   . ASN D 1 110 ? 13.017  -6.235  35.259   1.00 10.00 ? ? ? ? ? ? 111 ASN D O   1 
ATOM 9599  C CB  . ASN D 1 110 ? 14.765  -4.135  33.939   1.00 10.00 ? ? ? ? ? ? 111 ASN D CB  1 
ATOM 9600  C CG  . ASN D 1 110 ? 15.416  -4.901  32.807   1.00 10.00 ? ? ? ? ? ? 111 ASN D CG  1 
ATOM 9601  O OD1 . ASN D 1 110 ? 14.898  -5.119  31.726   1.00 10.00 ? ? ? ? ? ? 111 ASN D OD1 1 
ATOM 9602  N ND2 . ASN D 1 110 ? 16.668  -5.274  32.935   1.00 10.00 ? ? ? ? ? ? 111 ASN D ND2 1 
ATOM 9603  N N   . PRO D 1 111 ? 12.079  -6.234  33.231   1.00 10.00 ? ? ? ? ? ? 112 PRO D N   1 
ATOM 9604  C CA  . PRO D 1 111 ? 11.612  -7.603  33.333   1.00 10.00 ? ? ? ? ? ? 112 PRO D CA  1 
ATOM 9605  C C   . PRO D 1 111 ? 12.643  -8.638  33.783   1.00 10.00 ? ? ? ? ? ? 112 PRO D C   1 
ATOM 9606  O O   . PRO D 1 111 ? 13.810  -8.548  33.438   1.00 10.00 ? ? ? ? ? ? 112 PRO D O   1 
ATOM 9607  C CB  . PRO D 1 111 ? 11.039  -7.837  31.961   1.00 10.00 ? ? ? ? ? ? 112 PRO D CB  1 
ATOM 9608  C CG  . PRO D 1 111 ? 10.472  -6.471  31.615   1.00 10.00 ? ? ? ? ? ? 112 PRO D CG  1 
ATOM 9609  C CD  . PRO D 1 111 ? 11.611  -5.586  32.015   1.00 10.00 ? ? ? ? ? ? 112 PRO D CD  1 
ATOM 9610  N N   . LYS D 1 112 ? 12.260  -9.609  34.607   1.00 10.00 ? ? ? ? ? ? 113 LYS D N   1 
ATOM 9611  C CA  . LYS D 1 112 ? 13.064  -10.724 35.112   1.00 10.00 ? ? ? ? ? ? 113 LYS D CA  1 
ATOM 9612  C C   . LYS D 1 112 ? 13.995  -11.364 34.122   1.00 10.00 ? ? ? ? ? ? 113 LYS D C   1 
ATOM 9613  O O   . LYS D 1 112 ? 15.191  -11.470 34.371   1.00 10.00 ? ? ? ? ? ? 113 LYS D O   1 
ATOM 9614  C CB  . LYS D 1 112 ? 12.259  -11.912 35.582   1.00 10.00 ? ? ? ? ? ? 113 LYS D CB  1 
ATOM 9615  C CG  . LYS D 1 112 ? 11.305  -11.734 36.707   1.00 10.00 ? ? ? ? ? ? 113 LYS D CG  1 
ATOM 9616  C CD  . LYS D 1 112 ? 12.060  -11.745 38.010   1.00 10.00 ? ? ? ? ? ? 113 LYS D CD  1 
ATOM 9617  C CE  . LYS D 1 112 ? 11.161  -12.554 38.931   1.00 10.00 ? ? ? ? ? ? 113 LYS D CE  1 
ATOM 9618  N NZ  . LYS D 1 112 ? 9.889   -11.916 39.261   1.00 10.00 ? ? ? ? ? ? 113 LYS D NZ  1 
ATOM 9619  N N   . ALA D 1 113 ? 13.428  -11.842 33.024   1.00 10.00 ? ? ? ? ? ? 114 ALA D N   1 
ATOM 9620  C CA  . ALA D 1 113 ? 14.153  -12.565 32.011   1.00 10.00 ? ? ? ? ? ? 114 ALA D CA  1 
ATOM 9621  C C   . ALA D 1 113 ? 15.136  -11.691 31.260   1.00 10.00 ? ? ? ? ? ? 114 ALA D C   1 
ATOM 9622  O O   . ALA D 1 113 ? 16.078  -12.195 30.662   1.00 10.00 ? ? ? ? ? ? 114 ALA D O   1 
ATOM 9623  C CB  . ALA D 1 113 ? 13.143  -13.156 31.069   1.00 10.00 ? ? ? ? ? ? 114 ALA D CB  1 
ATOM 9624  N N   . ASN D 1 114 ? 14.943  -10.383 31.294   1.00 10.00 ? ? ? ? ? ? 115 ASN D N   1 
ATOM 9625  C CA  . ASN D 1 114 ? 15.868  -9.462  30.687   1.00 10.00 ? ? ? ? ? ? 115 ASN D CA  1 
ATOM 9626  C C   . ASN D 1 114 ? 17.083  -9.413  31.508   1.00 10.00 ? ? ? ? ? ? 115 ASN D C   1 
ATOM 9627  O O   . ASN D 1 114 ? 18.142  -9.537  30.928   1.00 10.00 ? ? ? ? ? ? 115 ASN D O   1 
ATOM 9628  C CB  . ASN D 1 114 ? 15.361  -8.037  30.591   1.00 10.00 ? ? ? ? ? ? 115 ASN D CB  1 
ATOM 9629  C CG  . ASN D 1 114 ? 14.160  -8.050  29.657   1.00 10.00 ? ? ? ? ? ? 115 ASN D CG  1 
ATOM 9630  O OD1 . ASN D 1 114 ? 13.262  -8.861  29.863   1.00 10.00 ? ? ? ? ? ? 115 ASN D OD1 1 
ATOM 9631  N ND2 . ASN D 1 114 ? 13.970  -7.278  28.607   1.00 10.00 ? ? ? ? ? ? 115 ASN D ND2 1 
ATOM 9632  N N   . ARG D 1 115 ? 16.962  -9.281  32.827   1.00 10.00 ? ? ? ? ? ? 116 ARG D N   1 
ATOM 9633  C CA  . ARG D 1 115 ? 18.105  -9.221  33.744   1.00 10.00 ? ? ? ? ? ? 116 ARG D CA  1 
ATOM 9634  C C   . ARG D 1 115 ? 18.944  -10.462 33.572   1.00 10.00 ? ? ? ? ? ? 116 ARG D C   1 
ATOM 9635  O O   . ARG D 1 115 ? 20.163  -10.418 33.424   1.00 10.00 ? ? ? ? ? ? 116 ARG D O   1 
ATOM 9636  C CB  . ARG D 1 115 ? 17.594  -9.148  35.133   1.00 10.00 ? ? ? ? ? ? 116 ARG D CB  1 
ATOM 9637  C CG  . ARG D 1 115 ? 17.032  -7.789  35.389   1.00 10.00 ? ? ? ? ? ? 116 ARG D CG  1 
ATOM 9638  C CD  . ARG D 1 115 ? 16.258  -7.608  36.703   1.00 10.00 ? ? ? ? ? ? 116 ARG D CD  1 
ATOM 9639  N NE  . ARG D 1 115 ? 16.789  -7.974  38.029   1.00 10.00 ? ? ? ? ? ? 116 ARG D NE  1 
ATOM 9640  C CZ  . ARG D 1 115 ? 17.806  -7.428  38.705   1.00 10.00 ? ? ? ? ? ? 116 ARG D CZ  1 
ATOM 9641  N NH1 . ARG D 1 115 ? 18.563  -6.440  38.260   1.00 10.00 ? ? ? ? ? ? 116 ARG D NH1 1 
ATOM 9642  N NH2 . ARG D 1 115 ? 17.974  -7.792  39.975   1.00 10.00 ? ? ? ? ? ? 116 ARG D NH2 1 
ATOM 9643  N N   . GLU D 1 116 ? 18.284  -11.606 33.476   1.00 10.00 ? ? ? ? ? ? 117 GLU D N   1 
ATOM 9644  C CA  . GLU D 1 116 ? 18.952  -12.878 33.241   1.00 10.00 ? ? ? ? ? ? 117 GLU D CA  1 
ATOM 9645  C C   . GLU D 1 116 ? 19.515  -12.863 31.855   1.00 10.00 ? ? ? ? ? ? 117 GLU D C   1 
ATOM 9646  O O   . GLU D 1 116 ? 20.699  -13.173 31.797   1.00 10.00 ? ? ? ? ? ? 117 GLU D O   1 
ATOM 9647  C CB  . GLU D 1 116 ? 18.044  -14.104 33.294   1.00 10.00 ? ? ? ? ? ? 117 GLU D CB  1 
ATOM 9648  C CG  . GLU D 1 116 ? 17.168  -14.195 34.526   1.00 10.00 ? ? ? ? ? ? 117 GLU D CG  1 
ATOM 9649  C CD  . GLU D 1 116 ? 16.509  -15.510 34.813   1.00 10.00 ? ? ? ? ? ? 117 GLU D CD  1 
ATOM 9650  O OE1 . GLU D 1 116 ? 16.812  -16.509 34.164   1.00 10.00 ? ? ? ? ? ? 117 GLU D OE1 1 
ATOM 9651  O OE2 . GLU D 1 116 ? 15.706  -15.524 35.738   1.00 10.00 ? ? ? ? ? ? 117 GLU D OE2 1 
ATOM 9652  N N   . LYS D 1 117 ? 18.855  -12.478 30.754   1.00 10.00 ? ? ? ? ? ? 118 LYS D N   1 
ATOM 9653  C CA  . LYS D 1 117 ? 19.556  -12.557 29.492   1.00 10.00 ? ? ? ? ? ? 118 LYS D CA  1 
ATOM 9654  C C   . LYS D 1 117 ? 20.758  -11.653 29.463   1.00 10.00 ? ? ? ? ? ? 118 LYS D C   1 
ATOM 9655  O O   . LYS D 1 117 ? 21.756  -12.087 28.892   1.00 10.00 ? ? ? ? ? ? 118 LYS D O   1 
ATOM 9656  C CB  . LYS D 1 117 ? 18.691  -12.197 28.315   1.00 10.00 ? ? ? ? ? ? 118 LYS D CB  1 
ATOM 9657  C CG  . LYS D 1 117 ? 19.329  -12.793 27.063   1.00 10.00 ? ? ? ? ? ? 118 LYS D CG  1 
ATOM 9658  C CD  . LYS D 1 117 ? 18.227  -13.386 26.195   1.00 10.00 ? ? ? ? ? ? 118 LYS D CD  1 
ATOM 9659  C CE  . LYS D 1 117 ? 18.728  -13.981 24.876   1.00 10.00 ? ? ? ? ? ? 118 LYS D CE  1 
ATOM 9660  N NZ  . LYS D 1 117 ? 19.629  -13.106 24.132   1.00 10.00 ? ? ? ? ? ? 118 LYS D NZ  1 
ATOM 9661  N N   . MET D 1 118 ? 20.798  -10.487 30.100   1.00 10.00 ? ? ? ? ? ? 119 MET D N   1 
ATOM 9662  C CA  . MET D 1 118 ? 22.014  -9.724  30.030   1.00 10.00 ? ? ? ? ? ? 119 MET D CA  1 
ATOM 9663  C C   . MET D 1 118 ? 23.074  -10.292 30.942   1.00 10.00 ? ? ? ? ? ? 119 MET D C   1 
ATOM 9664  O O   . MET D 1 118 ? 24.241  -10.032 30.639   1.00 10.00 ? ? ? ? ? ? 119 MET D O   1 
ATOM 9665  C CB  . MET D 1 118 ? 21.747  -8.294  30.358   1.00 10.00 ? ? ? ? ? ? 119 MET D CB  1 
ATOM 9666  C CG  . MET D 1 118 ? 21.734  -7.795  31.767   1.00 10.00 ? ? ? ? ? ? 119 MET D CG  1 
ATOM 9667  S SD  . MET D 1 118 ? 21.524  -5.987  31.676   1.00 10.00 ? ? ? ? ? ? 119 MET D SD  1 
ATOM 9668  C CE  . MET D 1 118 ? 19.762  -6.117  31.600   1.00 10.00 ? ? ? ? ? ? 119 MET D CE  1 
ATOM 9669  N N   . THR D 1 119 ? 22.754  -11.071 32.006   1.00 10.00 ? ? ? ? ? ? 120 THR D N   1 
ATOM 9670  C CA  . THR D 1 119 ? 23.759  -11.822 32.780   1.00 10.00 ? ? ? ? ? ? 120 THR D CA  1 
ATOM 9671  C C   . THR D 1 119 ? 24.410  -12.963 31.953   1.00 10.00 ? ? ? ? ? ? 120 THR D C   1 
ATOM 9672  O O   . THR D 1 119 ? 25.638  -13.157 31.873   1.00 10.00 ? ? ? ? ? ? 120 THR D O   1 
ATOM 9673  C CB  . THR D 1 119 ? 23.122  -12.446 34.013   1.00 10.00 ? ? ? ? ? ? 120 THR D CB  1 
ATOM 9674  O OG1 . THR D 1 119 ? 22.505  -11.394 34.744   1.00 10.00 ? ? ? ? ? ? 120 THR D OG1 1 
ATOM 9675  C CG2 . THR D 1 119 ? 24.158  -13.151 34.882   1.00 10.00 ? ? ? ? ? ? 120 THR D CG2 1 
ATOM 9676  N N   . GLN D 1 120 ? 23.511  -13.708 31.330   1.00 10.00 ? ? ? ? ? ? 121 GLN D N   1 
ATOM 9677  C CA  . GLN D 1 120 ? 23.756  -14.729 30.340   1.00 10.00 ? ? ? ? ? ? 121 GLN D CA  1 
ATOM 9678  C C   . GLN D 1 120 ? 24.765  -14.291 29.303   1.00 10.00 ? ? ? ? ? ? 121 GLN D C   1 
ATOM 9679  O O   . GLN D 1 120 ? 25.871  -14.844 29.363   1.00 10.00 ? ? ? ? ? ? 121 GLN D O   1 
ATOM 9680  C CB  . GLN D 1 120 ? 22.435  -15.019 29.688   1.00 10.00 ? ? ? ? ? ? 121 GLN D CB  1 
ATOM 9681  C CG  . GLN D 1 120 ? 22.324  -16.086 28.668   1.00 10.00 ? ? ? ? ? ? 121 GLN D CG  1 
ATOM 9682  C CD  . GLN D 1 120 ? 21.705  -17.230 29.404   1.00 10.00 ? ? ? ? ? ? 121 GLN D CD  1 
ATOM 9683  O OE1 . GLN D 1 120 ? 20.593  -17.212 29.965   1.00 10.00 ? ? ? ? ? ? 121 GLN D OE1 1 
ATOM 9684  N NE2 . GLN D 1 120 ? 22.572  -18.230 29.399   1.00 10.00 ? ? ? ? ? ? 121 GLN D NE2 1 
ATOM 9685  N N   . ILE D 1 121 ? 24.420  -13.331 28.390   1.00 10.00 ? ? ? ? ? ? 122 ILE D N   1 
ATOM 9686  C CA  . ILE D 1 121 ? 25.288  -12.804 27.315   1.00 10.00 ? ? ? ? ? ? 122 ILE D CA  1 
ATOM 9687  C C   . ILE D 1 121 ? 26.671  -12.360 27.817   1.00 10.00 ? ? ? ? ? ? 122 ILE D C   1 
ATOM 9688  O O   . ILE D 1 121 ? 27.754  -12.798 27.358   1.00 10.00 ? ? ? ? ? ? 122 ILE D O   1 
ATOM 9689  C CB  . ILE D 1 121 ? 24.571  -11.577 26.576   1.00 10.00 ? ? ? ? ? ? 122 ILE D CB  1 
ATOM 9690  C CG1 . ILE D 1 121 ? 23.501  -12.172 25.687   1.00 10.00 ? ? ? ? ? ? 122 ILE D CG1 1 
ATOM 9691  C CG2 . ILE D 1 121 ? 25.510  -10.690 25.707   1.00 10.00 ? ? ? ? ? ? 122 ILE D CG2 1 
ATOM 9692  C CD1 . ILE D 1 121 ? 22.436  -11.150 25.342   1.00 10.00 ? ? ? ? ? ? 122 ILE D CD1 1 
ATOM 9693  N N   . MET D 1 122 ? 26.603  -11.480 28.820   1.00 10.00 ? ? ? ? ? ? 123 MET D N   1 
ATOM 9694  C CA  . MET D 1 122 ? 27.808  -10.923 29.370   1.00 10.00 ? ? ? ? ? ? 123 MET D CA  1 
ATOM 9695  C C   . MET D 1 122 ? 28.699  -12.034 29.788   1.00 10.00 ? ? ? ? ? ? 123 MET D C   1 
ATOM 9696  O O   . MET D 1 122 ? 29.816  -12.026 29.274   1.00 10.00 ? ? ? ? ? ? 123 MET D O   1 
ATOM 9697  C CB  . MET D 1 122 ? 27.456  -10.016 30.524   1.00 10.00 ? ? ? ? ? ? 123 MET D CB  1 
ATOM 9698  C CG  . MET D 1 122 ? 27.002  -8.655  29.973   1.00 10.00 ? ? ? ? ? ? 123 MET D CG  1 
ATOM 9699  S SD  . MET D 1 122 ? 28.392  -7.684  29.342   1.00 10.00 ? ? ? ? ? ? 123 MET D SD  1 
ATOM 9700  C CE  . MET D 1 122 ? 27.699  -7.160  27.804   1.00 10.00 ? ? ? ? ? ? 123 MET D CE  1 
ATOM 9701  N N   . PHE D 1 123 ? 28.227  -13.076 30.491   1.00 10.00 ? ? ? ? ? ? 124 PHE D N   1 
ATOM 9702  C CA  . PHE D 1 123 ? 29.158  -14.125 30.926   1.00 10.00 ? ? ? ? ? ? 124 PHE D CA  1 
ATOM 9703  C C   . PHE D 1 123 ? 29.606  -15.146 29.918   1.00 10.00 ? ? ? ? ? ? 124 PHE D C   1 
ATOM 9704  O O   . PHE D 1 123 ? 30.809  -15.358 29.759   1.00 10.00 ? ? ? ? ? ? 124 PHE D O   1 
ATOM 9705  C CB  . PHE D 1 123 ? 28.634  -14.928 32.123   1.00 10.00 ? ? ? ? ? ? 124 PHE D CB  1 
ATOM 9706  C CG  . PHE D 1 123 ? 28.885  -14.166 33.395   1.00 10.00 ? ? ? ? ? ? 124 PHE D CG  1 
ATOM 9707  C CD1 . PHE D 1 123 ? 30.149  -13.802 33.725   1.00 10.00 ? ? ? ? ? ? 124 PHE D CD1 1 
ATOM 9708  C CD2 . PHE D 1 123 ? 27.835  -13.813 34.173   1.00 10.00 ? ? ? ? ? ? 124 PHE D CD2 1 
ATOM 9709  C CE1 . PHE D 1 123 ? 30.356  -13.078 34.838   1.00 10.00 ? ? ? ? ? ? 124 PHE D CE1 1 
ATOM 9710  C CE2 . PHE D 1 123 ? 28.049  -13.082 35.296   1.00 10.00 ? ? ? ? ? ? 124 PHE D CE2 1 
ATOM 9711  C CZ  . PHE D 1 123 ? 29.307  -12.723 35.618   1.00 10.00 ? ? ? ? ? ? 124 PHE D CZ  1 
ATOM 9712  N N   . GLU D 1 124 ? 28.654  -15.732 29.219   1.00 10.00 ? ? ? ? ? ? 125 GLU D N   1 
ATOM 9713  C CA  . GLU D 1 124 ? 28.933  -16.758 28.235   1.00 10.00 ? ? ? ? ? ? 125 GLU D CA  1 
ATOM 9714  C C   . GLU D 1 124 ? 29.463  -16.251 26.897   1.00 10.00 ? ? ? ? ? ? 125 GLU D C   1 
ATOM 9715  O O   . GLU D 1 124 ? 30.388  -16.854 26.338   1.00 10.00 ? ? ? ? ? ? 125 GLU D O   1 
ATOM 9716  C CB  . GLU D 1 124 ? 27.667  -17.534 28.009   1.00 10.00 ? ? ? ? ? ? 125 GLU D CB  1 
ATOM 9717  C CG  . GLU D 1 124 ? 27.201  -18.274 29.231   1.00 10.00 ? ? ? ? ? ? 125 GLU D CG  1 
ATOM 9718  C CD  . GLU D 1 124 ? 25.899  -19.003 28.993   1.00 10.00 ? ? ? ? ? ? 125 GLU D CD  1 
ATOM 9719  O OE1 . GLU D 1 124 ? 25.359  -18.952 27.888   1.00 10.00 ? ? ? ? ? ? 125 GLU D OE1 1 
ATOM 9720  O OE2 . GLU D 1 124 ? 25.379  -19.622 29.917   1.00 10.00 ? ? ? ? ? ? 125 GLU D OE2 1 
ATOM 9721  N N   . THR D 1 125 ? 28.849  -15.166 26.379   1.00 10.00 ? ? ? ? ? ? 126 THR D N   1 
ATOM 9722  C CA  . THR D 1 125 ? 29.188  -14.571 25.102   1.00 10.00 ? ? ? ? ? ? 126 THR D CA  1 
ATOM 9723  C C   . THR D 1 125 ? 30.331  -13.634 25.260   1.00 10.00 ? ? ? ? ? ? 126 THR D C   1 
ATOM 9724  O O   . THR D 1 125 ? 31.116  -13.648 24.333   1.00 10.00 ? ? ? ? ? ? 126 THR D O   1 
ATOM 9725  C CB  . THR D 1 125 ? 27.992  -13.819 24.538   1.00 10.00 ? ? ? ? ? ? 126 THR D CB  1 
ATOM 9726  O OG1 . THR D 1 125 ? 26.908  -14.788 24.547   1.00 10.00 ? ? ? ? ? ? 126 THR D OG1 1 
ATOM 9727  C CG2 . THR D 1 125 ? 28.287  -13.146 23.172   1.00 10.00 ? ? ? ? ? ? 126 THR D CG2 1 
ATOM 9728  N N   . PHE D 1 126 ? 30.493  -12.794 26.299   1.00 10.00 ? ? ? ? ? ? 127 PHE D N   1 
ATOM 9729  C CA  . PHE D 1 126 ? 31.697  -11.950 26.370   1.00 10.00 ? ? ? ? ? ? 127 PHE D CA  1 
ATOM 9730  C C   . PHE D 1 126 ? 32.753  -12.367 27.367   1.00 10.00 ? ? ? ? ? ? 127 PHE D C   1 
ATOM 9731  O O   . PHE D 1 126 ? 33.859  -11.811 27.383   1.00 10.00 ? ? ? ? ? ? 127 PHE D O   1 
ATOM 9732  C CB  . PHE D 1 126 ? 31.330  -10.491 26.652   1.00 10.00 ? ? ? ? ? ? 127 PHE D CB  1 
ATOM 9733  C CG  . PHE D 1 126 ? 30.630  -9.889  25.441   1.00 10.00 ? ? ? ? ? ? 127 PHE D CG  1 
ATOM 9734  C CD1 . PHE D 1 126 ? 31.304  -9.725  24.244   1.00 10.00 ? ? ? ? ? ? 127 PHE D CD1 1 
ATOM 9735  C CD2 . PHE D 1 126 ? 29.295  -9.524  25.513   1.00 10.00 ? ? ? ? ? ? 127 PHE D CD2 1 
ATOM 9736  C CE1 . PHE D 1 126 ? 30.620  -9.204  23.154   1.00 10.00 ? ? ? ? ? ? 127 PHE D CE1 1 
ATOM 9737  C CE2 . PHE D 1 126 ? 28.614  -8.999  24.416   1.00 10.00 ? ? ? ? ? ? 127 PHE D CE2 1 
ATOM 9738  C CZ  . PHE D 1 126 ? 29.279  -8.841  23.229   1.00 10.00 ? ? ? ? ? ? 127 PHE D CZ  1 
ATOM 9739  N N   . ASN D 1 127 ? 32.445  -13.402 28.162   1.00 10.00 ? ? ? ? ? ? 128 ASN D N   1 
ATOM 9740  C CA  . ASN D 1 127 ? 33.367  -14.017 29.114   1.00 10.00 ? ? ? ? ? ? 128 ASN D CA  1 
ATOM 9741  C C   . ASN D 1 127 ? 33.951  -12.952 29.996   1.00 10.00 ? ? ? ? ? ? 128 ASN D C   1 
ATOM 9742  O O   . ASN D 1 127 ? 35.132  -12.622 29.957   1.00 10.00 ? ? ? ? ? ? 128 ASN D O   1 
ATOM 9743  C CB  . ASN D 1 127 ? 34.513  -14.779 28.385   1.00 10.00 ? ? ? ? ? ? 128 ASN D CB  1 
ATOM 9744  C CG  . ASN D 1 127 ? 35.463  -15.609 29.288   1.00 10.00 ? ? ? ? ? ? 128 ASN D CG  1 
ATOM 9745  O OD1 . ASN D 1 127 ? 35.077  -16.635 29.864   1.00 10.00 ? ? ? ? ? ? 128 ASN D OD1 1 
ATOM 9746  N ND2 . ASN D 1 127 ? 36.730  -15.225 29.494   1.00 10.00 ? ? ? ? ? ? 128 ASN D ND2 1 
ATOM 9747  N N   . THR D 1 128 ? 33.030  -12.441 30.804   1.00 10.00 ? ? ? ? ? ? 129 THR D N   1 
ATOM 9748  C CA  . THR D 1 128 ? 33.284  -11.285 31.669   1.00 10.00 ? ? ? ? ? ? 129 THR D CA  1 
ATOM 9749  C C   . THR D 1 128 ? 33.755  -11.805 33.016   1.00 10.00 ? ? ? ? ? ? 129 THR D C   1 
ATOM 9750  O O   . THR D 1 128 ? 33.074  -12.700 33.533   1.00 10.00 ? ? ? ? ? ? 129 THR D O   1 
ATOM 9751  C CB  . THR D 1 128 ? 31.965  -10.373 31.880   1.00 10.00 ? ? ? ? ? ? 129 THR D CB  1 
ATOM 9752  O OG1 . THR D 1 128 ? 31.100  -10.154 30.745   1.00 10.00 ? ? ? ? ? ? 129 THR D OG1 1 
ATOM 9753  C CG2 . THR D 1 128 ? 32.510  -8.999  32.149   1.00 10.00 ? ? ? ? ? ? 129 THR D CG2 1 
ATOM 9754  N N   . PRO D 1 129 ? 34.842  -11.302 33.624   1.00 10.00 ? ? ? ? ? ? 130 PRO D N   1 
ATOM 9755  C CA  . PRO D 1 129 ? 35.344  -11.731 34.896   1.00 10.00 ? ? ? ? ? ? 130 PRO D CA  1 
ATOM 9756  C C   . PRO D 1 129 ? 34.257  -11.618 35.949   1.00 10.00 ? ? ? ? ? ? 130 PRO D C   1 
ATOM 9757  O O   . PRO D 1 129 ? 34.184  -12.489 36.828   1.00 10.00 ? ? ? ? ? ? 130 PRO D O   1 
ATOM 9758  C CB  . PRO D 1 129 ? 36.505  -10.848 35.256   1.00 10.00 ? ? ? ? ? ? 130 PRO D CB  1 
ATOM 9759  C CG  . PRO D 1 129 ? 36.882  -10.161 34.007   1.00 10.00 ? ? ? ? ? ? 130 PRO D CG  1 
ATOM 9760  C CD  . PRO D 1 129 ? 35.573  -10.120 33.257   1.00 10.00 ? ? ? ? ? ? 130 PRO D CD  1 
ATOM 9761  N N   . ALA D 1 130 ? 33.410  -10.567 35.822   1.00 10.00 ? ? ? ? ? ? 131 ALA D N   1 
ATOM 9762  C CA  . ALA D 1 130 ? 32.374  -10.172 36.771   1.00 10.00 ? ? ? ? ? ? 131 ALA D CA  1 
ATOM 9763  C C   . ALA D 1 130 ? 31.467  -9.112  36.191   1.00 10.00 ? ? ? ? ? ? 131 ALA D C   1 
ATOM 9764  O O   . ALA D 1 130 ? 31.811  -8.357  35.280   1.00 10.00 ? ? ? ? ? ? 131 ALA D O   1 
ATOM 9765  C CB  . ALA D 1 130 ? 32.976  -9.573  38.015   1.00 10.00 ? ? ? ? ? ? 131 ALA D CB  1 
ATOM 9766  N N   . MET D 1 131 ? 30.317  -9.004  36.810   1.00 10.00 ? ? ? ? ? ? 132 MET D N   1 
ATOM 9767  C CA  . MET D 1 131 ? 29.413  -7.998  36.388   1.00 10.00 ? ? ? ? ? ? 132 MET D CA  1 
ATOM 9768  C C   . MET D 1 131 ? 28.407  -7.655  37.468   1.00 10.00 ? ? ? ? ? ? 132 MET D C   1 
ATOM 9769  O O   . MET D 1 131 ? 28.233  -8.382  38.448   1.00 10.00 ? ? ? ? ? ? 132 MET D O   1 
ATOM 9770  C CB  . MET D 1 131 ? 28.747  -8.490  35.037   1.00 10.00 ? ? ? ? ? ? 132 MET D CB  1 
ATOM 9771  C CG  . MET D 1 131 ? 27.681  -9.574  34.802   1.00 10.00 ? ? ? ? ? ? 132 MET D CG  1 
ATOM 9772  S SD  . MET D 1 131 ? 25.938  -9.140  35.030   1.00 10.00 ? ? ? ? ? ? 132 MET D SD  1 
ATOM 9773  C CE  . MET D 1 131 ? 25.997  -8.180  33.566   1.00 10.00 ? ? ? ? ? ? 132 MET D CE  1 
ATOM 9774  N N   . TYR D 1 132 ? 27.829  -6.448  37.326   1.00 10.00 ? ? ? ? ? ? 133 TYR D N   1 
ATOM 9775  C CA  . TYR D 1 132 ? 26.740  -5.977  38.146   1.00 10.00 ? ? ? ? ? ? 133 TYR D CA  1 
ATOM 9776  C C   . TYR D 1 132 ? 25.800  -5.167  37.214   1.00 10.00 ? ? ? ? ? ? 133 TYR D C   1 
ATOM 9777  O O   . TYR D 1 132 ? 26.192  -4.597  36.169   1.00 10.00 ? ? ? ? ? ? 133 TYR D O   1 
ATOM 9778  C CB  . TYR D 1 132 ? 27.350  -5.158  39.257   1.00 10.00 ? ? ? ? ? ? 133 TYR D CB  1 
ATOM 9779  C CG  . TYR D 1 132 ? 26.386  -4.859  40.372   1.00 10.00 ? ? ? ? ? ? 133 TYR D CG  1 
ATOM 9780  C CD1 . TYR D 1 132 ? 26.160  -5.775  41.370   1.00 10.00 ? ? ? ? ? ? 133 TYR D CD1 1 
ATOM 9781  C CD2 . TYR D 1 132 ? 25.719  -3.656  40.363   1.00 10.00 ? ? ? ? ? ? 133 TYR D CD2 1 
ATOM 9782  C CE1 . TYR D 1 132 ? 25.250  -5.479  42.360   1.00 10.00 ? ? ? ? ? ? 133 TYR D CE1 1 
ATOM 9783  C CE2 . TYR D 1 132 ? 24.826  -3.360  41.343   1.00 10.00 ? ? ? ? ? ? 133 TYR D CE2 1 
ATOM 9784  C CZ  . TYR D 1 132 ? 24.590  -4.270  42.332   1.00 10.00 ? ? ? ? ? ? 133 TYR D CZ  1 
ATOM 9785  O OH  . TYR D 1 132 ? 23.663  -3.924  43.306   1.00 10.00 ? ? ? ? ? ? 133 TYR D OH  1 
ATOM 9786  N N   . VAL D 1 133 ? 24.525  -5.184  37.615   1.00 10.00 ? ? ? ? ? ? 134 VAL D N   1 
ATOM 9787  C CA  . VAL D 1 133 ? 23.470  -4.505  36.936   1.00 10.00 ? ? ? ? ? ? 134 VAL D CA  1 
ATOM 9788  C C   . VAL D 1 133 ? 22.821  -3.601  37.996   1.00 10.00 ? ? ? ? ? ? 134 VAL D C   1 
ATOM 9789  O O   . VAL D 1 133 ? 22.129  -3.993  38.926   1.00 10.00 ? ? ? ? ? ? 134 VAL D O   1 
ATOM 9790  C CB  . VAL D 1 133 ? 22.400  -5.459  36.404   1.00 10.00 ? ? ? ? ? ? 134 VAL D CB  1 
ATOM 9791  C CG1 . VAL D 1 133 ? 21.723  -4.675  35.364   1.00 10.00 ? ? ? ? ? ? 134 VAL D CG1 1 
ATOM 9792  C CG2 . VAL D 1 133 ? 22.869  -6.698  35.692   1.00 10.00 ? ? ? ? ? ? 134 VAL D CG2 1 
ATOM 9793  N N   . ALA D 1 134 ? 23.029  -2.312  37.847   1.00 10.00 ? ? ? ? ? ? 135 ALA D N   1 
ATOM 9794  C CA  . ALA D 1 134 ? 22.369  -1.297  38.636   1.00 10.00 ? ? ? ? ? ? 135 ALA D CA  1 
ATOM 9795  C C   . ALA D 1 134 ? 21.205  -0.559  37.873   1.00 10.00 ? ? ? ? ? ? 135 ALA D C   1 
ATOM 9796  O O   . ALA D 1 134 ? 21.203  -0.310  36.644   1.00 10.00 ? ? ? ? ? ? 135 ALA D O   1 
ATOM 9797  C CB  . ALA D 1 134 ? 23.515  -0.365  39.083   1.00 10.00 ? ? ? ? ? ? 135 ALA D CB  1 
ATOM 9798  N N   . ILE D 1 135 ? 20.111  -0.252  38.585   1.00 10.00 ? ? ? ? ? ? 136 ILE D N   1 
ATOM 9799  C CA  . ILE D 1 135 ? 18.989  0.526   38.072   1.00 10.00 ? ? ? ? ? ? 136 ILE D CA  1 
ATOM 9800  C C   . ILE D 1 135 ? 19.529  1.904   37.790   1.00 10.00 ? ? ? ? ? ? 136 ILE D C   1 
ATOM 9801  O O   . ILE D 1 135 ? 20.298  2.413   38.603   1.00 10.00 ? ? ? ? ? ? 136 ILE D O   1 
ATOM 9802  C CB  . ILE D 1 135 ? 17.925  0.574   39.126   1.00 10.00 ? ? ? ? ? ? 136 ILE D CB  1 
ATOM 9803  C CG1 . ILE D 1 135 ? 17.245  -0.796  39.176   1.00 10.00 ? ? ? ? ? ? 136 ILE D CG1 1 
ATOM 9804  C CG2 . ILE D 1 135 ? 16.958  1.716   38.853   1.00 10.00 ? ? ? ? ? ? 136 ILE D CG2 1 
ATOM 9805  C CD1 . ILE D 1 135 ? 16.396  -1.093  40.486   1.00 10.00 ? ? ? ? ? ? 136 ILE D CD1 1 
ATOM 9806  N N   . GLN D 1 136 ? 19.108  2.610   36.747   1.00 10.00 ? ? ? ? ? ? 137 GLN D N   1 
ATOM 9807  C CA  . GLN D 1 136 ? 19.731  3.916   36.412   1.00 10.00 ? ? ? ? ? ? 137 GLN D CA  1 
ATOM 9808  C C   . GLN D 1 136 ? 19.514  5.039   37.370   1.00 10.00 ? ? ? ? ? ? 137 GLN D C   1 
ATOM 9809  O O   . GLN D 1 136 ? 20.469  5.742   37.611   1.00 10.00 ? ? ? ? ? ? 137 GLN D O   1 
ATOM 9810  C CB  . GLN D 1 136 ? 19.261  4.394   35.080   1.00 10.00 ? ? ? ? ? ? 137 GLN D CB  1 
ATOM 9811  C CG  . GLN D 1 136 ? 19.586  3.326   34.066   1.00 10.00 ? ? ? ? ? ? 137 GLN D CG  1 
ATOM 9812  C CD  . GLN D 1 136 ? 18.611  3.322   32.932   1.00 10.00 ? ? ? ? ? ? 137 GLN D CD  1 
ATOM 9813  O OE1 . GLN D 1 136 ? 18.073  4.393   32.599   1.00 10.00 ? ? ? ? ? ? 137 GLN D OE1 1 
ATOM 9814  N NE2 . GLN D 1 136 ? 18.452  2.204   32.237   1.00 10.00 ? ? ? ? ? ? 137 GLN D NE2 1 
ATOM 9815  N N   . ALA D 1 137 ? 18.291  5.217   37.940   1.00 10.00 ? ? ? ? ? ? 138 ALA D N   1 
ATOM 9816  C CA  . ALA D 1 137 ? 17.965  6.272   38.874   1.00 10.00 ? ? ? ? ? ? 138 ALA D CA  1 
ATOM 9817  C C   . ALA D 1 137 ? 18.791  6.203   40.146   1.00 10.00 ? ? ? ? ? ? 138 ALA D C   1 
ATOM 9818  O O   . ALA D 1 137 ? 19.190  7.218   40.724   1.00 10.00 ? ? ? ? ? ? 138 ALA D O   1 
ATOM 9819  C CB  . ALA D 1 137 ? 16.527  6.156   39.199   1.00 10.00 ? ? ? ? ? ? 138 ALA D CB  1 
ATOM 9820  N N   . VAL D 1 138 ? 19.131  5.022   40.629   1.00 10.00 ? ? ? ? ? ? 139 VAL D N   1 
ATOM 9821  C CA  . VAL D 1 138 ? 19.932  4.866   41.831   1.00 10.00 ? ? ? ? ? ? 139 VAL D CA  1 
ATOM 9822  C C   . VAL D 1 138 ? 21.358  5.378   41.628   1.00 10.00 ? ? ? ? ? ? 139 VAL D C   1 
ATOM 9823  O O   . VAL D 1 138 ? 21.961  5.833   42.600   1.00 10.00 ? ? ? ? ? ? 139 VAL D O   1 
ATOM 9824  C CB  . VAL D 1 138 ? 19.854  3.339   42.246   1.00 10.00 ? ? ? ? ? ? 139 VAL D CB  1 
ATOM 9825  C CG1 . VAL D 1 138 ? 20.830  3.013   43.335   1.00 10.00 ? ? ? ? ? ? 139 VAL D CG1 1 
ATOM 9826  C CG2 . VAL D 1 138 ? 18.495  3.019   42.862   1.00 10.00 ? ? ? ? ? ? 139 VAL D CG2 1 
ATOM 9827  N N   . LEU D 1 139 ? 21.947  5.369   40.428   1.00 10.00 ? ? ? ? ? ? 140 LEU D N   1 
ATOM 9828  C CA  . LEU D 1 139 ? 23.309  5.898   40.171   1.00 10.00 ? ? ? ? ? ? 140 LEU D CA  1 
ATOM 9829  C C   . LEU D 1 139 ? 23.221  7.411   39.971   1.00 10.00 ? ? ? ? ? ? 140 LEU D C   1 
ATOM 9830  O O   . LEU D 1 139 ? 24.186  8.123   40.305   1.00 10.00 ? ? ? ? ? ? 140 LEU D O   1 
ATOM 9831  C CB  . LEU D 1 139 ? 23.970  5.351   38.913   1.00 10.00 ? ? ? ? ? ? 140 LEU D CB  1 
ATOM 9832  C CG  . LEU D 1 139 ? 24.349  3.885   38.765   1.00 10.00 ? ? ? ? ? ? 140 LEU D CG  1 
ATOM 9833  C CD1 . LEU D 1 139 ? 23.145  3.055   38.995   1.00 10.00 ? ? ? ? ? ? 140 LEU D CD1 1 
ATOM 9834  C CD2 . LEU D 1 139 ? 24.759  3.548   37.345   1.00 10.00 ? ? ? ? ? ? 140 LEU D CD2 1 
ATOM 9835  N N   . SER D 1 140 ? 22.112  7.941   39.424   1.00 10.00 ? ? ? ? ? ? 141 SER D N   1 
ATOM 9836  C CA  . SER D 1 140 ? 21.847  9.374   39.479   1.00 10.00 ? ? ? ? ? ? 141 SER D CA  1 
ATOM 9837  C C   . SER D 1 140 ? 21.918  9.899   40.925   1.00 10.00 ? ? ? ? ? ? 141 SER D C   1 
ATOM 9838  O O   . SER D 1 140 ? 22.558  10.930  41.179   1.00 10.00 ? ? ? ? ? ? 141 SER D O   1 
ATOM 9839  C CB  . SER D 1 140 ? 20.460  9.681   38.963   1.00 10.00 ? ? ? ? ? ? 141 SER D CB  1 
ATOM 9840  O OG  . SER D 1 140 ? 20.324  9.300   37.594   1.00 10.00 ? ? ? ? ? ? 141 SER D OG  1 
ATOM 9841  N N   . LEU D 1 141 ? 21.286  9.210   41.896   1.00 10.00 ? ? ? ? ? ? 142 LEU D N   1 
ATOM 9842  C CA  . LEU D 1 141 ? 21.336  9.610   43.291   1.00 10.00 ? ? ? ? ? ? 142 LEU D CA  1 
ATOM 9843  C C   . LEU D 1 141 ? 22.719  9.584   43.998   1.00 10.00 ? ? ? ? ? ? 142 LEU D C   1 
ATOM 9844  O O   . LEU D 1 141 ? 23.189  10.547  44.653   1.00 10.00 ? ? ? ? ? ? 142 LEU D O   1 
ATOM 9845  C CB  . LEU D 1 141 ? 20.373  8.727   44.014   1.00 10.00 ? ? ? ? ? ? 142 LEU D CB  1 
ATOM 9846  C CG  . LEU D 1 141 ? 19.904  9.320   45.310   1.00 10.00 ? ? ? ? ? ? 142 LEU D CG  1 
ATOM 9847  C CD1 . LEU D 1 141 ? 18.927  10.478  45.030   1.00 10.00 ? ? ? ? ? ? 142 LEU D CD1 1 
ATOM 9848  C CD2 . LEU D 1 141 ? 19.272  8.236   46.130   1.00 10.00 ? ? ? ? ? ? 142 LEU D CD2 1 
ATOM 9849  N N   . TYR D 1 142 ? 23.422  8.460   43.841   1.00 10.00 ? ? ? ? ? ? 143 TYR D N   1 
ATOM 9850  C CA  . TYR D 1 142 ? 24.744  8.324   44.400   1.00 10.00 ? ? ? ? ? ? 143 TYR D CA  1 
ATOM 9851  C C   . TYR D 1 142 ? 25.641  9.418   43.841   1.00 10.00 ? ? ? ? ? ? 143 TYR D C   1 
ATOM 9852  O O   . TYR D 1 142 ? 26.372  10.036  44.619   1.00 10.00 ? ? ? ? ? ? 143 TYR D O   1 
ATOM 9853  C CB  . TYR D 1 142 ? 25.352  6.932   44.063   1.00 10.00 ? ? ? ? ? ? 143 TYR D CB  1 
ATOM 9854  C CG  . TYR D 1 142 ? 26.353  6.515   45.154   1.00 10.00 ? ? ? ? ? ? 143 TYR D CG  1 
ATOM 9855  C CD1 . TYR D 1 142 ? 27.567  7.201   45.320   1.00 10.00 ? ? ? ? ? ? 143 TYR D CD1 1 
ATOM 9856  C CD2 . TYR D 1 142 ? 26.030  5.494   46.050   1.00 10.00 ? ? ? ? ? ? 143 TYR D CD2 1 
ATOM 9857  C CE1 . TYR D 1 142 ? 28.439  6.883   46.361   1.00 10.00 ? ? ? ? ? ? 143 TYR D CE1 1 
ATOM 9858  C CE2 . TYR D 1 142 ? 26.909  5.173   47.097   1.00 10.00 ? ? ? ? ? ? 143 TYR D CE2 1 
ATOM 9859  C CZ  . TYR D 1 142 ? 28.111  5.872   47.262   1.00 10.00 ? ? ? ? ? ? 143 TYR D CZ  1 
ATOM 9860  O OH  . TYR D 1 142 ? 28.967  5.582   48.329   1.00 10.00 ? ? ? ? ? ? 143 TYR D OH  1 
ATOM 9861  N N   . ALA D 1 143 ? 25.588  9.714   42.532   1.00 10.00 ? ? ? ? ? ? 144 ALA D N   1 
ATOM 9862  C CA  . ALA D 1 143 ? 26.414  10.763  41.944   1.00 10.00 ? ? ? ? ? ? 144 ALA D CA  1 
ATOM 9863  C C   . ALA D 1 143 ? 26.077  12.189  42.443   1.00 10.00 ? ? ? ? ? ? 144 ALA D C   1 
ATOM 9864  O O   . ALA D 1 143 ? 26.855  13.123  42.228   1.00 10.00 ? ? ? ? ? ? 144 ALA D O   1 
ATOM 9865  C CB  . ALA D 1 143 ? 26.278  10.668  40.416   1.00 10.00 ? ? ? ? ? ? 144 ALA D CB  1 
ATOM 9866  N N   . SER D 1 144 ? 24.922  12.446  43.077   1.00 10.00 ? ? ? ? ? ? 145 SER D N   1 
ATOM 9867  C CA  . SER D 1 144 ? 24.618  13.752  43.667   1.00 10.00 ? ? ? ? ? ? 145 SER D CA  1 
ATOM 9868  C C   . SER D 1 144 ? 25.069  13.790  45.114   1.00 10.00 ? ? ? ? ? ? 145 SER D C   1 
ATOM 9869  O O   . SER D 1 144 ? 24.963  14.807  45.803   1.00 10.00 ? ? ? ? ? ? 145 SER D O   1 
ATOM 9870  C CB  . SER D 1 144 ? 23.127  14.066  43.663   1.00 10.00 ? ? ? ? ? ? 145 SER D CB  1 
ATOM 9871  O OG  . SER D 1 144 ? 22.318  13.223  44.471   1.00 10.00 ? ? ? ? ? ? 145 SER D OG  1 
ATOM 9872  N N   . GLY D 1 145 ? 24.725  15.920  45.140   1.00 10.00 ? ? ? ? ? ? 146 GLY D N   1 
ATOM 9873  C CA  . GLY D 1 145 ? 25.482  16.246  46.326   1.00 10.00 ? ? ? ? ? ? 146 GLY D CA  1 
ATOM 9874  C C   . GLY D 1 145 ? 24.635  15.942  47.506   1.00 10.00 ? ? ? ? ? ? 146 GLY D C   1 
ATOM 9875  O O   . GLY D 1 145 ? 24.551  16.726  48.443   1.00 10.00 ? ? ? ? ? ? 146 GLY D O   1 
ATOM 9876  N N   . ARG D 1 146 ? 24.013  14.788  47.504   1.00 10.00 ? ? ? ? ? ? 147 ARG D N   1 
ATOM 9877  C CA  . ARG D 1 146 ? 23.078  14.542  48.547   1.00 10.00 ? ? ? ? ? ? 147 ARG D CA  1 
ATOM 9878  C C   . ARG D 1 146 ? 23.139  13.068  48.855   1.00 10.00 ? ? ? ? ? ? 147 ARG D C   1 
ATOM 9879  O O   . ARG D 1 146 ? 23.656  12.232  48.116   1.00 10.00 ? ? ? ? ? ? 147 ARG D O   1 
ATOM 9880  C CB  . ARG D 1 146 ? 21.810  15.058  47.975   1.00 10.00 ? ? ? ? ? ? 147 ARG D CB  1 
ATOM 9881  C CG  . ARG D 1 146 ? 20.492  14.981  48.637   1.00 10.00 ? ? ? ? ? ? 147 ARG D CG  1 
ATOM 9882  C CD  . ARG D 1 146 ? 19.742  15.780  47.607   1.00 10.00 ? ? ? ? ? ? 147 ARG D CD  1 
ATOM 9883  N NE  . ARG D 1 146 ? 19.756  17.171  48.003   1.00 10.00 ? ? ? ? ? ? 147 ARG D NE  1 
ATOM 9884  C CZ  . ARG D 1 146 ? 19.921  18.184  47.169   1.00 10.00 ? ? ? ? ? ? 147 ARG D CZ  1 
ATOM 9885  N NH1 . ARG D 1 146 ? 20.101  18.028  45.866   1.00 10.00 ? ? ? ? ? ? 147 ARG D NH1 1 
ATOM 9886  N NH2 . ARG D 1 146 ? 19.920  19.399  47.684   1.00 10.00 ? ? ? ? ? ? 147 ARG D NH2 1 
ATOM 9887  N N   . THR D 1 147 ? 22.677  12.817  50.065   1.00 10.00 ? ? ? ? ? ? 148 THR D N   1 
ATOM 9888  C CA  . THR D 1 147 ? 22.735  11.515  50.697   1.00 10.00 ? ? ? ? ? ? 148 THR D CA  1 
ATOM 9889  C C   . THR D 1 147 ? 21.390  10.973  51.200   1.00 10.00 ? ? ? ? ? ? 148 THR D C   1 
ATOM 9890  O O   . THR D 1 147 ? 21.181  9.755   51.339   1.00 10.00 ? ? ? ? ? ? 148 THR D O   1 
ATOM 9891  C CB  . THR D 1 147 ? 23.811  11.718  51.769   1.00 10.00 ? ? ? ? ? ? 148 THR D CB  1 
ATOM 9892  O OG1 . THR D 1 147 ? 23.692  13.086  52.223   1.00 10.00 ? ? ? ? ? ? 148 THR D OG1 1 
ATOM 9893  C CG2 . THR D 1 147 ? 25.196  11.348  51.227   1.00 10.00 ? ? ? ? ? ? 148 THR D CG2 1 
ATOM 9894  N N   . THR D 1 148 ? 20.420  11.836  51.395   1.00 10.00 ? ? ? ? ? ? 149 THR D N   1 
ATOM 9895  C CA  . THR D 1 148 ? 19.110  11.397  51.810   1.00 10.00 ? ? ? ? ? ? 149 THR D CA  1 
ATOM 9896  C C   . THR D 1 148 ? 18.149  12.030  50.774   1.00 10.00 ? ? ? ? ? ? 149 THR D C   1 
ATOM 9897  O O   . THR D 1 148 ? 18.440  13.134  50.284   1.00 10.00 ? ? ? ? ? ? 149 THR D O   1 
ATOM 9898  C CB  . THR D 1 148 ? 18.871  11.904  53.241   1.00 10.00 ? ? ? ? ? ? 149 THR D CB  1 
ATOM 9899  O OG1 . THR D 1 148 ? 20.118  11.985  53.920   1.00 10.00 ? ? ? ? ? ? 149 THR D OG1 1 
ATOM 9900  C CG2 . THR D 1 148 ? 18.060  10.933  54.032   1.00 10.00 ? ? ? ? ? ? 149 THR D CG2 1 
ATOM 9901  N N   . GLY D 1 149 ? 17.045  11.442  50.354   1.00 10.00 ? ? ? ? ? ? 150 GLY D N   1 
ATOM 9902  C CA  . GLY D 1 149 ? 16.257  12.062  49.334   1.00 10.00 ? ? ? ? ? ? 150 GLY D CA  1 
ATOM 9903  C C   . GLY D 1 149 ? 15.510  10.960  48.670   1.00 10.00 ? ? ? ? ? ? 150 GLY D C   1 
ATOM 9904  O O   . GLY D 1 149 ? 15.536  9.842   49.178   1.00 10.00 ? ? ? ? ? ? 150 GLY D O   1 
ATOM 9905  N N   . ILE D 1 150 ? 14.804  11.221  47.598   1.00 10.00 ? ? ? ? ? ? 151 ILE D N   1 
ATOM 9906  C CA  . ILE D 1 150 ? 14.156  10.187  46.795   1.00 10.00 ? ? ? ? ? ? 151 ILE D CA  1 
ATOM 9907  C C   . ILE D 1 150 ? 14.359  10.718  45.389   1.00 10.00 ? ? ? ? ? ? 151 ILE D C   1 
ATOM 9908  O O   . ILE D 1 150 ? 14.364  11.934  45.141   1.00 10.00 ? ? ? ? ? ? 151 ILE D O   1 
ATOM 9909  C CB  . ILE D 1 150 ? 12.623  10.011  47.153   1.00 10.00 ? ? ? ? ? ? 151 ILE D CB  1 
ATOM 9910  C CG1 . ILE D 1 150 ? 11.818  9.243   46.095   1.00 10.00 ? ? ? ? ? ? 151 ILE D CG1 1 
ATOM 9911  C CG2 . ILE D 1 150 ? 12.085  11.397  47.415   1.00 10.00 ? ? ? ? ? ? 151 ILE D CG2 1 
ATOM 9912  C CD1 . ILE D 1 150 ? 10.512  8.642   46.674   1.00 10.00 ? ? ? ? ? ? 151 ILE D CD1 1 
ATOM 9913  N N   . VAL D 1 151 ? 14.704  9.779   44.515   1.00 10.00 ? ? ? ? ? ? 152 VAL D N   1 
ATOM 9914  C CA  . VAL D 1 151 ? 15.007  10.075  43.132   1.00 10.00 ? ? ? ? ? ? 152 VAL D CA  1 
ATOM 9915  C C   . VAL D 1 151 ? 13.835  9.523   42.368   1.00 10.00 ? ? ? ? ? ? 152 VAL D C   1 
ATOM 9916  O O   . VAL D 1 151 ? 13.172  8.562   42.783   1.00 10.00 ? ? ? ? ? ? 152 VAL D O   1 
ATOM 9917  C CB  . VAL D 1 151 ? 16.323  9.385   42.760   1.00 10.00 ? ? ? ? ? ? 152 VAL D CB  1 
ATOM 9918  C CG1 . VAL D 1 151 ? 16.765  9.695   41.370   1.00 10.00 ? ? ? ? ? ? 152 VAL D CG1 1 
ATOM 9919  C CG2 . VAL D 1 151 ? 17.424  9.934   43.634   1.00 10.00 ? ? ? ? ? ? 152 VAL D CG2 1 
ATOM 9920  N N   . MET D 1 152 ? 13.515  10.155  41.262   1.00 10.00 ? ? ? ? ? ? 153 MET D N   1 
ATOM 9921  C CA  . MET D 1 152 ? 12.454  9.651   40.431   1.00 10.00 ? ? ? ? ? ? 153 MET D CA  1 
ATOM 9922  C C   . MET D 1 152 ? 13.185  9.424   39.126   1.00 10.00 ? ? ? ? ? ? 153 MET D C   1 
ATOM 9923  O O   . MET D 1 152 ? 13.601  10.388  38.473   1.00 10.00 ? ? ? ? ? ? 153 MET D O   1 
ATOM 9924  C CB  . MET D 1 152 ? 11.413  10.735  40.399   1.00 10.00 ? ? ? ? ? ? 153 MET D CB  1 
ATOM 9925  C CG  . MET D 1 152 ? 10.049  10.246  39.988   1.00 10.00 ? ? ? ? ? ? 153 MET D CG  1 
ATOM 9926  S SD  . MET D 1 152 ? 9.913   9.654   38.282   1.00 10.00 ? ? ? ? ? ? 153 MET D SD  1 
ATOM 9927  C CE  . MET D 1 152 ? 9.662   11.222  37.523   1.00 10.00 ? ? ? ? ? ? 153 MET D CE  1 
ATOM 9928  N N   . ASP D 1 153 ? 13.410  8.192   38.720   1.00 10.00 ? ? ? ? ? ? 154 ASP D N   1 
ATOM 9929  C CA  . ASP D 1 153 ? 14.317  7.951   37.610   1.00 10.00 ? ? ? ? ? ? 154 ASP D CA  1 
ATOM 9930  C C   . ASP D 1 153 ? 13.555  7.498   36.403   1.00 10.00 ? ? ? ? ? ? 154 ASP D C   1 
ATOM 9931  O O   . ASP D 1 153 ? 12.906  6.455   36.516   1.00 10.00 ? ? ? ? ? ? 154 ASP D O   1 
ATOM 9932  C CB  . ASP D 1 153 ? 15.301  6.920   38.101   1.00 10.00 ? ? ? ? ? ? 154 ASP D CB  1 
ATOM 9933  C CG  . ASP D 1 153 ? 16.550  6.722   37.269   1.00 10.00 ? ? ? ? ? ? 154 ASP D CG  1 
ATOM 9934  O OD1 . ASP D 1 153 ? 16.451  6.092   36.222   1.00 10.00 ? ? ? ? ? ? 154 ASP D OD1 1 
ATOM 9935  O OD2 . ASP D 1 153 ? 17.625  7.176   37.668   1.00 10.00 ? ? ? ? ? ? 154 ASP D OD2 1 
ATOM 9936  N N   . SER D 1 154 ? 13.576  8.208   35.280   1.00 10.00 ? ? ? ? ? ? 155 SER D N   1 
ATOM 9937  C CA  . SER D 1 154 ? 12.784  7.785   34.142   1.00 10.00 ? ? ? ? ? ? 155 SER D CA  1 
ATOM 9938  C C   . SER D 1 154 ? 13.636  7.708   32.909   1.00 10.00 ? ? ? ? ? ? 155 SER D C   1 
ATOM 9939  O O   . SER D 1 154 ? 14.009  8.721   32.290   1.00 10.00 ? ? ? ? ? ? 155 SER D O   1 
ATOM 9940  C CB  . SER D 1 154 ? 11.612  8.773   33.905   1.00 10.00 ? ? ? ? ? ? 155 SER D CB  1 
ATOM 9941  O OG  . SER D 1 154 ? 10.490  8.241   33.171   1.00 10.00 ? ? ? ? ? ? 155 SER D OG  1 
ATOM 9942  N N   . GLY D 1 155 ? 13.885  6.452   32.590   1.00 10.00 ? ? ? ? ? ? 156 GLY D N   1 
ATOM 9943  C CA  . GLY D 1 155 ? 14.691  6.136   31.423   1.00 10.00 ? ? ? ? ? ? 156 GLY D CA  1 
ATOM 9944  C C   . GLY D 1 155 ? 13.888  5.786   30.163   1.00 10.00 ? ? ? ? ? ? 156 GLY D C   1 
ATOM 9945  O O   . GLY D 1 155 ? 12.948  6.500   29.757   1.00 10.00 ? ? ? ? ? ? 156 GLY D O   1 
ATOM 9946  N N   . ASP D 1 156 ? 14.190  4.647   29.525   1.00 10.00 ? ? ? ? ? ? 157 ASP D N   1 
ATOM 9947  C CA  . ASP D 1 156 ? 13.512  4.262   28.287   1.00 10.00 ? ? ? ? ? ? 157 ASP D CA  1 
ATOM 9948  C C   . ASP D 1 156 ? 12.563  3.124   28.558   1.00 10.00 ? ? ? ? ? ? 157 ASP D C   1 
ATOM 9949  O O   . ASP D 1 156 ? 11.481  3.053   27.956   1.00 10.00 ? ? ? ? ? ? 157 ASP D O   1 
ATOM 9950  C CB  . ASP D 1 156 ? 14.549  3.837   27.276   1.00 10.00 ? ? ? ? ? ? 157 ASP D CB  1 
ATOM 9951  C CG  . ASP D 1 156 ? 14.174  3.725   25.807   1.00 10.00 ? ? ? ? ? ? 157 ASP D CG  1 
ATOM 9952  O OD1 . ASP D 1 156 ? 14.232  4.743   25.128   1.00 10.00 ? ? ? ? ? ? 157 ASP D OD1 1 
ATOM 9953  O OD2 . ASP D 1 156 ? 13.891  2.618   25.343   1.00 10.00 ? ? ? ? ? ? 157 ASP D OD2 1 
ATOM 9954  N N   . GLY D 1 157 ? 12.942  2.249   29.488   1.00 10.00 ? ? ? ? ? ? 158 GLY D N   1 
ATOM 9955  C CA  . GLY D 1 157 ? 12.119  1.109   29.747   1.00 10.00 ? ? ? ? ? ? 158 GLY D CA  1 
ATOM 9956  C C   . GLY D 1 157 ? 11.493  1.133   31.114   1.00 10.00 ? ? ? ? ? ? 158 GLY D C   1 
ATOM 9957  O O   . GLY D 1 157 ? 10.563  0.340   31.312   1.00 10.00 ? ? ? ? ? ? 158 GLY D O   1 
ATOM 9958  N N   . VAL D 1 158 ? 11.920  1.903   32.124   1.00 10.00 ? ? ? ? ? ? 159 VAL D N   1 
ATOM 9959  C CA  . VAL D 1 158 ? 11.261  1.921   33.424   1.00 10.00 ? ? ? ? ? ? 159 VAL D CA  1 
ATOM 9960  C C   . VAL D 1 158 ? 11.408  3.259   34.142   1.00 10.00 ? ? ? ? ? ? 159 VAL D C   1 
ATOM 9961  O O   . VAL D 1 158 ? 12.170  4.170   33.771   1.00 10.00 ? ? ? ? ? ? 159 VAL D O   1 
ATOM 9962  C CB  . VAL D 1 158 ? 11.849  0.748   34.217   1.00 10.00 ? ? ? ? ? ? 159 VAL D CB  1 
ATOM 9963  C CG1 . VAL D 1 158 ? 13.196  1.139   34.710   1.00 10.00 ? ? ? ? ? ? 159 VAL D CG1 1 
ATOM 9964  C CG2 . VAL D 1 158 ? 10.949  0.337   35.342   1.00 10.00 ? ? ? ? ? ? 159 VAL D CG2 1 
ATOM 9965  N N   . THR D 1 159 ? 10.570  3.362   35.165   1.00 10.00 ? ? ? ? ? ? 160 THR D N   1 
ATOM 9966  C CA  . THR D 1 159 ? 10.580  4.474   36.079   1.00 10.00 ? ? ? ? ? ? 160 THR D CA  1 
ATOM 9967  C C   . THR D 1 159 ? 10.523  3.852   37.462   1.00 10.00 ? ? ? ? ? ? 160 THR D C   1 
ATOM 9968  O O   . THR D 1 159 ? 9.895   2.821   37.750   1.00 10.00 ? ? ? ? ? ? 160 THR D O   1 
ATOM 9969  C CB  . THR D 1 159 ? 9.354   5.388   35.825   1.00 10.00 ? ? ? ? ? ? 160 THR D CB  1 
ATOM 9970  O OG1 . THR D 1 159 ? 9.347   5.946   34.509   1.00 10.00 ? ? ? ? ? ? 160 THR D OG1 1 
ATOM 9971  C CG2 . THR D 1 159 ? 9.443   6.570   36.730   1.00 10.00 ? ? ? ? ? ? 160 THR D CG2 1 
ATOM 9972  N N   . HIS D 1 160 ? 11.328  4.396   38.337   1.00 10.00 ? ? ? ? ? ? 161 HIS D N   1 
ATOM 9973  C CA  . HIS D 1 160 ? 11.210  4.011   39.738   1.00 10.00 ? ? ? ? ? ? 161 HIS D CA  1 
ATOM 9974  C C   . HIS D 1 160 ? 11.336  5.232   40.602   1.00 10.00 ? ? ? ? ? ? 161 HIS D C   1 
ATOM 9975  O O   . HIS D 1 160 ? 11.991  6.230   40.230   1.00 10.00 ? ? ? ? ? ? 161 HIS D O   1 
ATOM 9976  C CB  . HIS D 1 160 ? 12.297  3.142   40.298   1.00 10.00 ? ? ? ? ? ? 161 HIS D CB  1 
ATOM 9977  C CG  . HIS D 1 160 ? 12.371  1.723   39.835   1.00 10.00 ? ? ? ? ? ? 161 HIS D CG  1 
ATOM 9978  N ND1 . HIS D 1 160 ? 12.797  1.254   38.673   1.00 10.00 ? ? ? ? ? ? 161 HIS D ND1 1 
ATOM 9979  C CD2 . HIS D 1 160 ? 12.030  0.677   40.643   1.00 10.00 ? ? ? ? ? ? 161 HIS D CD2 1 
ATOM 9980  C CE1 . HIS D 1 160 ? 12.734  -0.050  38.738   1.00 10.00 ? ? ? ? ? ? 161 HIS D CE1 1 
ATOM 9981  N NE2 . HIS D 1 160 ? 12.273  -0.386  39.922   1.00 10.00 ? ? ? ? ? ? 161 HIS D NE2 1 
ATOM 9982  N N   . THR D 1 161 ? 10.658  5.110   41.729   1.00 10.00 ? ? ? ? ? ? 162 THR D N   1 
ATOM 9983  C CA  . THR D 1 161 ? 10.800  6.075   42.790   1.00 10.00 ? ? ? ? ? ? 162 THR D CA  1 
ATOM 9984  C C   . THR D 1 161 ? 11.558  5.266   43.880   1.00 10.00 ? ? ? ? ? ? 162 THR D C   1 
ATOM 9985  O O   . THR D 1 161 ? 11.205  4.117   44.206   1.00 10.00 ? ? ? ? ? ? 162 THR D O   1 
ATOM 9986  C CB  . THR D 1 161 ? 9.375   6.511   43.073   1.00 10.00 ? ? ? ? ? ? 162 THR D CB  1 
ATOM 9987  O OG1 . THR D 1 161 ? 8.469   5.420   43.134   1.00 10.00 ? ? ? ? ? ? 162 THR D OG1 1 
ATOM 9988  C CG2 . THR D 1 161 ? 9.008   7.445   41.955   1.00 10.00 ? ? ? ? ? ? 162 THR D CG2 1 
ATOM 9989  N N   . VAL D 1 162 ? 12.692  5.801   44.373   1.00 10.00 ? ? ? ? ? ? 163 VAL D N   1 
ATOM 9990  C CA  . VAL D 1 162 ? 13.600  5.086   45.238   1.00 10.00 ? ? ? ? ? ? 163 VAL D CA  1 
ATOM 9991  C C   . VAL D 1 162 ? 13.736  6.013   46.419   1.00 10.00 ? ? ? ? ? ? 163 VAL D C   1 
ATOM 9992  O O   . VAL D 1 162 ? 14.276  7.096   46.162   1.00 10.00 ? ? ? ? ? ? 163 VAL D O   1 
ATOM 9993  C CB  . VAL D 1 162 ? 14.952  4.877   44.430   1.00 10.00 ? ? ? ? ? ? 163 VAL D CB  1 
ATOM 9994  C CG1 . VA