data_3LZ1
# 
_entry.id   3LZ1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LZ1         
NDB   NA0476       
RCSB  RCSB057903   
WWPDB D_1000057903 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3LZ0 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3LZ1 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-01 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vasudevan, D.' 1 
'Chua, E.Y.D.'  2 
'Davey, C.A.'   3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            403 
_citation.page_first                1 
_citation.page_last                 10 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20800598 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.08.039 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vasudevan, D.' 1 
primary 'Chua, E.Y.'    2 
primary 'Davey, C.A.'   3 
# 
_cell.length_a           107.370 
_cell.length_b           109.660 
_cell.length_c           175.750 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3LZ1 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3LZ1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'       15303.930 2 ? ? ?                ? 
2 polymer     man 'Histone H4'         11263.231 2 ? ? ?                ? 
3 polymer     man 'Histone H2A'        12941.095 2 ? ? 'residues 2-120' ? 
4 polymer     man 'Histone H2B 1.1'    13848.097 2 ? ? ?                ? 
5 polymer     syn 'DNA (145-MER)'      44991.660 1 ? ? ?                ? 
6 polymer     syn 'DNA (145-MER)'      44520.383 1 ? ? ?                ? 
7 non-polymer syn 'MANGANESE (II) ION' 54.938    6 ? ? ?                ? 
8 non-polymer syn 'CHLORIDE ION'       35.453    2 ? ? ?                ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)
(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)
(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)
(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)
(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)
(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)
(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)
(DC)(DT)(DG)(DA)(DT)
;
;ATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTAC
GTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)
(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)
(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)
(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)
(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)
(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)
(DT)(DC)(DG)(DA)(DT)
;
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DA  n 
5 6   DT  n 
5 7   DG  n 
5 8   DT  n 
5 9   DA  n 
5 10  DT  n 
5 11  DA  n 
5 12  DT  n 
5 13  DA  n 
5 14  DT  n 
5 15  DC  n 
5 16  DT  n 
5 17  DG  n 
5 18  DA  n 
5 19  DC  n 
5 20  DA  n 
5 21  DC  n 
5 22  DG  n 
5 23  DT  n 
5 24  DG  n 
5 25  DC  n 
5 26  DC  n 
5 27  DT  n 
5 28  DG  n 
5 29  DG  n 
5 30  DA  n 
5 31  DG  n 
5 32  DA  n 
5 33  DC  n 
5 34  DT  n 
5 35  DA  n 
5 36  DG  n 
5 37  DG  n 
5 38  DG  n 
5 39  DA  n 
5 40  DG  n 
5 41  DT  n 
5 42  DA  n 
5 43  DA  n 
5 44  DT  n 
5 45  DC  n 
5 46  DC  n 
5 47  DC  n 
5 48  DC  n 
5 49  DT  n 
5 50  DT  n 
5 51  DG  n 
5 52  DG  n 
5 53  DC  n 
5 54  DG  n 
5 55  DG  n 
5 56  DT  n 
5 57  DT  n 
5 58  DA  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DC  n 
5 63  DG  n 
5 64  DC  n 
5 65  DG  n 
5 66  DG  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DA  n 
5 71  DC  n 
5 72  DA  n 
5 73  DG  n 
5 74  DC  n 
5 75  DG  n 
5 76  DC  n 
5 77  DG  n 
5 78  DT  n 
5 79  DA  n 
5 80  DC  n 
5 81  DG  n 
5 82  DT  n 
5 83  DG  n 
5 84  DC  n 
5 85  DG  n 
5 86  DT  n 
5 87  DT  n 
5 88  DT  n 
5 89  DA  n 
5 90  DA  n 
5 91  DG  n 
5 92  DC  n 
5 93  DG  n 
5 94  DG  n 
5 95  DT  n 
5 96  DG  n 
5 97  DC  n 
5 98  DT  n 
5 99  DA  n 
5 100 DG  n 
5 101 DA  n 
5 102 DG  n 
5 103 DC  n 
5 104 DT  n 
5 105 DG  n 
5 106 DT  n 
5 107 DC  n 
5 108 DT  n 
5 109 DA  n 
5 110 DC  n 
5 111 DG  n 
5 112 DA  n 
5 113 DC  n 
5 114 DC  n 
5 115 DA  n 
5 116 DA  n 
5 117 DT  n 
5 118 DT  n 
5 119 DG  n 
5 120 DA  n 
5 121 DG  n 
5 122 DC  n 
5 123 DG  n 
5 124 DG  n 
5 125 DC  n 
5 126 DC  n 
5 127 DT  n 
5 128 DC  n 
5 129 DG  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DC  n 
5 134 DC  n 
5 135 DG  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DT  n 
5 141 DC  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DG  n 
6 6   DA  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DC  n 
6 12  DG  n 
6 13  DG  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DC  n 
6 18  DG  n 
6 19  DA  n 
6 20  DG  n 
6 21  DG  n 
6 22  DC  n 
6 23  DC  n 
6 24  DG  n 
6 25  DC  n 
6 26  DT  n 
6 27  DC  n 
6 28  DA  n 
6 29  DA  n 
6 30  DT  n 
6 31  DT  n 
6 32  DG  n 
6 33  DG  n 
6 34  DT  n 
6 35  DC  n 
6 36  DG  n 
6 37  DT  n 
6 38  DA  n 
6 39  DG  n 
6 40  DA  n 
6 41  DC  n 
6 42  DA  n 
6 43  DG  n 
6 44  DC  n 
6 45  DT  n 
6 46  DC  n 
6 47  DT  n 
6 48  DA  n 
6 49  DG  n 
6 50  DC  n 
6 51  DA  n 
6 52  DC  n 
6 53  DC  n 
6 54  DG  n 
6 55  DC  n 
6 56  DT  n 
6 57  DT  n 
6 58  DA  n 
6 59  DA  n 
6 60  DA  n 
6 61  DC  n 
6 62  DG  n 
6 63  DC  n 
6 64  DA  n 
6 65  DC  n 
6 66  DG  n 
6 67  DT  n 
6 68  DA  n 
6 69  DC  n 
6 70  DG  n 
6 71  DC  n 
6 72  DG  n 
6 73  DC  n 
6 74  DT  n 
6 75  DG  n 
6 76  DT  n 
6 77  DC  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DG  n 
6 83  DC  n 
6 84  DG  n 
6 85  DT  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DA  n 
6 90  DA  n 
6 91  DC  n 
6 92  DC  n 
6 93  DG  n 
6 94  DC  n 
6 95  DC  n 
6 96  DA  n 
6 97  DA  n 
6 98  DG  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DA  n 
6 103 DT  n 
6 104 DT  n 
6 105 DA  n 
6 106 DC  n 
6 107 DT  n 
6 108 DC  n 
6 109 DC  n 
6 110 DC  n 
6 111 DT  n 
6 112 DA  n 
6 113 DG  n 
6 114 DT  n 
6 115 DC  n 
6 116 DT  n 
6 117 DC  n 
6 118 DC  n 
6 119 DA  n 
6 120 DG  n 
6 121 DG  n 
6 122 DC  n 
6 123 DA  n 
6 124 DC  n 
6 125 DG  n 
6 126 DT  n 
6 127 DG  n 
6 128 DT  n 
6 129 DC  n 
6 130 DA  n 
6 131 DG  n 
6 132 DA  n 
6 133 DT  n 
6 134 DA  n 
6 135 DT  n 
6 136 DA  n 
6 137 DT  n 
6 138 DA  n 
6 139 DC  n 
6 140 DA  n 
6 141 DT  n 
6 142 DC  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(pLysS)' ? ? ? ? ? ? ? plasmid ? ? ? pET3d ? ? 
2 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(pLysS)' ? ? ? ? ? ? ? plasmid ? ? ? pET3a ? ? 
3 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(pLysS)' ? ? ? ? ? ? ? plasmid ? ? ? pET3a ? ? 
4 1 sample ? ? ? 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(pLysS)' ? ? ? ? ? ? ? plasmid ? ? ? pET3a ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? ? ? ? 'Synthetic construct' 
6 1 sample ? ? ? ? ? 'Synthetic construct' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2   ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
2   ? 
4 UNP H2B11_XENLA  P02281 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2   ? 
5 PDB 3LZ1         3LZ1   5 
;ATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTAC
GTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
-72 ? 
6 PDB 3LZ1         3LZ1   6 
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGAT
;
-72 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3LZ1 A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3LZ1 B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3LZ1 C 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
4  4 3LZ1 D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 3LZ1 E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3LZ1 F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3LZ1 G 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
8  4 3LZ1 H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 3LZ1 I 1 ? 145 ? 3LZ1   -72 ? 72  ? -72 72  
10 6 3LZ1 J 1 ? 145 ? 3LZ1   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LZ1 ALA A 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 1 
4 3LZ1 THR D 32  ? UNP P02281 SER 33  'SEE REMARK 999' 29  2 
5 3LZ1 ALA E 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 3 
8 3LZ1 THR H 32  ? UNP P02281 SER 33  'SEE REMARK 999' 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3LZ1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
_exptl_crystal.density_percent_sol   53.35 
_exptl_crystal.density_Matthews      2.64 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    'Kcacodylate, KCl, MnCl2, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2009-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_wavelength_list        0.9 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
# 
_reflns.entry_id                     3LZ1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.500 
_reflns.d_resolution_low             93.04 
_reflns.number_all                   65509 
_reflns.number_obs                   65509 
_reflns.percent_possible_obs         90.600 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.080 
_reflns.pdbx_netI_over_sigmaI        7.800 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.600 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   61.90 
_reflns_shell.Rmerge_I_obs           0.384 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_Rsym_value        0.384 
_reflns_shell.pdbx_redundancy        2.10 
_reflns_shell.number_unique_all      6362 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3LZ1 
_refine.ls_d_res_high                            2.500 
_refine.ls_d_res_low                             93.040 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    89.970 
_refine.ls_number_reflns_obs                     65180 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.270 
_refine.ls_R_factor_R_work                       0.269 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.319 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  1317 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               109.400 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            8.930 
_refine.aniso_B[2][2]                            -9.660 
_refine.aniso_B[3][3]                            0.730 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.915 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.600 
_refine.pdbx_overall_ESU_R_Free                  0.359 
_refine.overall_SU_ML                            0.476 
_refine.overall_SU_B                             23.954 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'NCP146b (pdb code 1KX4)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                204.25 
_refine.B_iso_min                                39.82 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5959 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11906 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        93.040 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         12700 0.009  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      18400 1.476  2.548  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   743   5.983  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   266   33.432 21.353 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1145  21.065 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   83    19.248 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           2097  0.084  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7474  0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            5978  0.223  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          7850  0.310  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    465   0.165  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   34    0.193  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 2     0.263  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              3804  0.589  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             5995  1.064  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              12088 0.866  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             12405 1.600  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               53.790 
_refine_ls_shell.number_reflns_R_work             2789 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.503 
_refine_ls_shell.R_factor_R_free                  0.574 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             63 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2852 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LZ1 
_struct.title                     
'Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence (orientation 2)' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LZ1 
_struct_keywords.text            'nucleosome, 601-sequence DNA, NCP and Nucleosome core, STRUCTURAL PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 7 ? 
O N N 7 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ILE A 112 ? GLN A 85  ILE A 112 1 ? 28 
HELX_P HELX_P4  4  MET A 120 ? GLY A 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  5  ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  SER C 18  ? GLY C 22  ? SER C 18  GLY C 22  5 ? 5  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 12 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 103 ? ALA D 124 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? GLY E 132 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P23 23 ASN F 25  ? ILE F 29  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 ALA G 45  ? ASN G 73  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 30 ILE G 79  ? ASP G 90  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 103 ? ALA H 124 ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? I DG  100 N7  ? ? ? 1_555 P MN .   MN ? ? I DG  27  I MN 1007 1_555 ? ? ? ? ? ? ?               2.201 ? 
metalc2   metalc ? ? J DA  1   N7  ? ? ? 1_555 R MN .   MN ? ? J DA  -72 J MN 1008 1_555 ? ? ? ? ? ? ?               2.215 ? 
metalc3   metalc ? ? I DA  39  N7  ? ? ? 1_555 O MN .   MN ? ? I DA  -34 I MN 1005 1_555 ? ? ? ? ? ? ?               2.439 ? 
metalc4   metalc ? ? A ASP 77  OD1 ? ? ? 1_555 K MN .   MN ? ? A ASP 77  A MN 1001 1_555 ? ? ? ? ? ? ?               2.624 ? 
metalc5   metalc ? ? J DG  100 N7  ? ? ? 1_555 Q MN .   MN ? ? J DG  27  J MN 1006 1_555 ? ? ? ? ? ? ?               2.723 ? 
metalc6   metalc ? ? I DA  1   N7  ? ? ? 1_555 N MN .   MN ? ? I DA  -72 I MN 1002 1_555 ? ? ? ? ? ? ?               2.754 ? 
metalc7   metalc ? ? A ASP 77  OD2 ? ? ? 1_555 K MN .   MN ? ? A ASP 77  A MN 1001 1_555 ? ? ? ? ? ? ?               2.776 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT 145 N3 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT 145 O4 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA 144 N1 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA 144 N6 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG 143 N1 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DG  4   N1  ? ? ? 1_555 J DC 142 N3 ? ? I DG  -69 J DC 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DG  4   N2  ? ? ? 1_555 J DC 142 O2 ? ? I DG  -69 J DC 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DG  4   O6  ? ? ? 1_555 J DC 142 N4 ? ? I DG  -69 J DC 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT 141 N3 ? ? I DA  -68 J DT 68   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog10  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA 140 N1 ? ? I DT  -67 J DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA 140 N6 ? ? I DT  -67 J DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DG  7   N1  ? ? ? 1_555 J DC 139 N3 ? ? I DG  -66 J DC 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DG  7   N2  ? ? ? 1_555 J DC 139 O2 ? ? I DG  -66 J DC 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DG  7   O6  ? ? ? 1_555 J DC 139 N4 ? ? I DG  -66 J DC 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA 138 N1 ? ? I DT  -65 J DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA 138 N6 ? ? I DT  -65 J DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DA  9   N1  ? ? ? 1_555 J DT 137 N3 ? ? I DA  -64 J DT 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DA  9   N6  ? ? ? 1_555 J DT 137 O4 ? ? I DA  -64 J DT 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DT  10  N3  ? ? ? 1_555 J DA 136 N1 ? ? I DT  -63 J DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DT  10  O4  ? ? ? 1_555 J DA 136 N6 ? ? I DT  -63 J DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT 135 N3 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog22  hydrog ? ? I DT  12  N3  ? ? ? 1_555 J DA 134 N1 ? ? I DT  -61 J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DT  12  O4  ? ? ? 1_555 J DA 134 N6 ? ? I DT  -61 J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DA  13  N1  ? ? ? 1_555 J DT 133 N3 ? ? I DA  -60 J DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DA  13  N6  ? ? ? 1_555 J DT 133 O4 ? ? I DA  -60 J DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  15  N3  ? ? ? 1_555 J DA 130 N6 ? ? I DC  -58 J DA 57   1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog27  hydrog ? ? I DC  15  N3  ? ? ? 1_555 J DG 131 N1 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DC  15  N4  ? ? ? 1_555 J DG 131 O6 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DC  15  O2  ? ? ? 1_555 J DG 131 N2 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DT  16  N3  ? ? ? 1_555 J DA 130 N1 ? ? I DT  -57 J DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DT  16  O4  ? ? ? 1_555 J DA 130 N6 ? ? I DT  -57 J DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DG  17  N1  ? ? ? 1_555 J DC 129 N3 ? ? I DG  -56 J DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DG  17  N2  ? ? ? 1_555 J DC 129 O2 ? ? I DG  -56 J DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DG  17  O6  ? ? ? 1_555 J DC 129 N4 ? ? I DG  -56 J DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DA  18  N1  ? ? ? 1_555 J DT 128 N3 ? ? I DA  -55 J DT 55   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog36  hydrog ? ? I DC  19  O2  ? ? ? 1_555 J DG 127 N2 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog37  hydrog ? ? I DC  21  O2  ? ? ? 1_555 J DG 125 N2 ? ? I DC  -52 J DG 52   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog38  hydrog ? ? I DG  22  N1  ? ? ? 1_555 J DA 123 N1 ? ? I DG  -51 J DA 50   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog39  hydrog ? ? I DG  22  O6  ? ? ? 1_555 J DA 123 N6 ? ? I DG  -51 J DA 50   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog40  hydrog ? ? I DG  22  N1  ? ? ? 1_555 J DC 124 O2 ? ? I DG  -51 J DC 51   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog41  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J DC 122 N4 ? ? I DT  -50 J DC 49   1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog42  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA 123 N1 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J DA 123 N6 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DG  24  N1  ? ? ? 1_555 J DC 122 N3 ? ? I DG  -49 J DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DG  24  N2  ? ? ? 1_555 J DC 122 O2 ? ? I DG  -49 J DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DG  24  O6  ? ? ? 1_555 J DC 122 N4 ? ? I DG  -49 J DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG 121 N2 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog48  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J DG 120 N1 ? ? I DC  -47 J DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DG 120 O6 ? ? I DC  -47 J DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG 120 N2 ? ? I DC  -47 J DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DT  27  N3  ? ? ? 1_555 J DA 119 N1 ? ? I DT  -46 J DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DT  27  O4  ? ? ? 1_555 J DA 119 N6 ? ? I DT  -46 J DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DG  28  N1  ? ? ? 1_555 J DC 118 O2 ? ? I DG  -45 J DC 45   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog54  hydrog ? ? I DG  29  N1  ? ? ? 1_555 J DC 117 N3 ? ? I DG  -44 J DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DG  29  N2  ? ? ? 1_555 J DC 117 O2 ? ? I DG  -44 J DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DG  29  O6  ? ? ? 1_555 J DC 117 N4 ? ? I DG  -44 J DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT 116 N3 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT 116 O4 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DG  31  N1  ? ? ? 1_555 J DC 115 N3 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC 115 O2 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DG  31  O6  ? ? ? 1_555 J DC 115 N4 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  32  N1  ? ? ? 1_555 J DT 114 N3 ? ? I DA  -41 J DT 41   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog63  hydrog ? ? I DC  33  N3  ? ? ? 1_555 J DG 113 N1 ? ? I DC  -40 J DG 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DC  33  N4  ? ? ? 1_555 J DG 113 O6 ? ? I DC  -40 J DG 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DC  33  O2  ? ? ? 1_555 J DG 113 N2 ? ? I DC  -40 J DG 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA 112 N1 ? ? I DT  -39 J DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA 112 N6 ? ? I DT  -39 J DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT 111 N3 ? ? I DA  -38 J DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT 111 O4 ? ? I DA  -38 J DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  36  O6  ? ? ? 1_555 J DC 109 N4 ? ? I DG  -37 J DC 36   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog71  hydrog ? ? I DG  36  N1  ? ? ? 1_555 J DC 110 N3 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  36  N2  ? ? ? 1_555 J DC 110 O2 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  36  O6  ? ? ? 1_555 J DC 110 N4 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  37  N1  ? ? ? 1_555 J DC 109 N3 ? ? I DG  -36 J DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  37  N2  ? ? ? 1_555 J DC 109 O2 ? ? I DG  -36 J DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  37  O6  ? ? ? 1_555 J DC 109 N4 ? ? I DG  -36 J DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DG  38  N1  ? ? ? 1_555 J DC 108 N3 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DG  38  N2  ? ? ? 1_555 J DC 108 O2 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DG  38  O6  ? ? ? 1_555 J DC 108 N4 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DA  39  N6  ? ? ? 1_555 J DC 106 N3 ? ? I DA  -34 J DC 33   1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog81  hydrog ? ? I DA  39  N1  ? ? ? 1_555 J DT 107 N3 ? ? I DA  -34 J DT 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DA  39  N6  ? ? ? 1_555 J DT 107 O4 ? ? I DA  -34 J DT 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DA 105 N1 ? ? I DG  -33 J DA 32   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog84  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DA 105 N6 ? ? I DG  -33 J DA 32   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog85  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC 106 N3 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC 106 O2 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DC 106 N4 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DT  41  N3  ? ? ? 1_555 J DA 105 N1 ? ? I DT  -32 J DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DT  41  O4  ? ? ? 1_555 J DA 105 N6 ? ? I DT  -32 J DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT 104 N3 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog91  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT 103 N3 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT 103 O4 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DT  44  N3  ? ? ? 1_555 J DA 102 N1 ? ? I DT  -29 J DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DT  44  O4  ? ? ? 1_555 J DA 102 N6 ? ? I DT  -29 J DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  45  O2  ? ? ? 1_555 J DG 101 N2 ? ? I DC  -28 J DG 28   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog96  hydrog ? ? I DC  46  N3  ? ? ? 1_555 J DG 100 N1 ? ? I DC  -27 J DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  46  N4  ? ? ? 1_555 J DG 100 O6 ? ? I DC  -27 J DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  46  O2  ? ? ? 1_555 J DG 100 N2 ? ? I DC  -27 J DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  46  O2  ? ? ? 1_555 J DG 101 N2 ? ? I DC  -27 J DG 28   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog100 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG 99  N2 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog101 hydrog ? ? I DC  48  O2  ? ? ? 1_555 J DG 98  N2 ? ? I DC  -25 J DG 25   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog102 hydrog ? ? I DT  49  N3  ? ? ? 1_555 J DA 97  N1 ? ? I DT  -24 J DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DT  49  O4  ? ? ? 1_555 J DA 97  N6 ? ? I DT  -24 J DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DT  50  N3  ? ? ? 1_555 J DA 96  N1 ? ? I DT  -23 J DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DT  50  O4  ? ? ? 1_555 J DA 96  N6 ? ? I DT  -23 J DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DG  51  N1  ? ? ? 1_555 J DC 95  N3 ? ? I DG  -22 J DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DG  51  N2  ? ? ? 1_555 J DC 95  O2 ? ? I DG  -22 J DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DG  51  O6  ? ? ? 1_555 J DC 95  N4 ? ? I DG  -22 J DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DG  52  N1  ? ? ? 1_555 J DC 94  N3 ? ? I DG  -21 J DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DG  52  N2  ? ? ? 1_555 J DC 94  O2 ? ? I DG  -21 J DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DG  52  O6  ? ? ? 1_555 J DC 94  N4 ? ? I DG  -21 J DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DG  52  N2  ? ? ? 1_555 J DC 95  O2 ? ? I DG  -21 J DC 22   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog113 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG 93  N1 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG 93  O6 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG 93  N2 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DG  54  N1  ? ? ? 1_555 J DC 92  N3 ? ? I DG  -19 J DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DG  54  N2  ? ? ? 1_555 J DC 92  O2 ? ? I DG  -19 J DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DG  54  O6  ? ? ? 1_555 J DC 92  N4 ? ? I DG  -19 J DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  55  N1  ? ? ? 1_555 J DC 91  N3 ? ? I DG  -18 J DC 18   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog120 hydrog ? ? I DT  56  N3  ? ? ? 1_555 J DA 90  N1 ? ? I DT  -17 J DA 17   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog121 hydrog ? ? I DT  57  N3  ? ? ? 1_555 J DA 89  N1 ? ? I DT  -16 J DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DT  57  O4  ? ? ? 1_555 J DA 89  N6 ? ? I DT  -16 J DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DA  58  N6  ? ? ? 1_555 J DT 87  O4 ? ? I DA  -15 J DT 14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog124 hydrog ? ? I DA  58  N1  ? ? ? 1_555 J DT 88  N3 ? ? I DA  -15 J DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DA  58  N6  ? ? ? 1_555 J DT 88  O4 ? ? I DA  -15 J DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DA  59  N1  ? ? ? 1_555 J DT 87  N3 ? ? I DA  -14 J DT 14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog127 hydrog ? ? I DA  60  N1  ? ? ? 1_555 J DT 86  N3 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DA  60  N6  ? ? ? 1_555 J DT 86  O4 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT 85  N3 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT 85  O4 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DC  62  N3  ? ? ? 1_555 J DG 84  N1 ? ? I DC  -11 J DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DC  62  N4  ? ? ? 1_555 J DG 84  O6 ? ? I DC  -11 J DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DC  62  O2  ? ? ? 1_555 J DG 84  N2 ? ? I DC  -11 J DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC 83  N3 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC 83  O2 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC 83  N4 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  64  O2  ? ? ? 1_555 J DG 82  N2 ? ? I DC  -9  J DG 9    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog138 hydrog ? ? I DG  65  O6  ? ? ? 1_555 J DC 80  N4 ? ? I DG  -8  J DC 7    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog139 hydrog ? ? I DG  65  N1  ? ? ? 1_555 J DC 81  N3 ? ? I DG  -8  J DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DG  65  N2  ? ? ? 1_555 J DC 81  O2 ? ? I DG  -8  J DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DG  65  O6  ? ? ? 1_555 J DC 81  N4 ? ? I DG  -8  J DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  66  N1  ? ? ? 1_555 J DC 79  N3 ? ? I DG  -7  J DC 6    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog143 hydrog ? ? I DG  66  N1  ? ? ? 1_555 J DC 80  N3 ? ? I DG  -7  J DC 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DG  66  N2  ? ? ? 1_555 J DC 80  O2 ? ? I DG  -7  J DC 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DG  66  O6  ? ? ? 1_555 J DC 80  N4 ? ? I DG  -7  J DC 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DG  67  N1  ? ? ? 1_555 J DC 78  N3 ? ? I DG  -6  J DC 5    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog147 hydrog ? ? I DG  67  N1  ? ? ? 1_555 J DC 79  N3 ? ? I DG  -6  J DC 6    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog148 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC 78  N3 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog149 hydrog ? ? I DG  69  N1  ? ? ? 1_555 J DC 77  N3 ? ? I DG  -4  J DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG  69  N2  ? ? ? 1_555 J DC 77  O2 ? ? I DG  -4  J DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DG  69  O6  ? ? ? 1_555 J DC 77  N4 ? ? I DG  -4  J DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DA  70  N1  ? ? ? 1_555 J DT 76  N3 ? ? I DA  -3  J DT 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  70  N6  ? ? ? 1_555 J DT 76  O4 ? ? I DA  -3  J DT 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DC  71  N3  ? ? ? 1_555 J DG 75  N1 ? ? I DC  -2  J DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DC  71  N4  ? ? ? 1_555 J DG 75  O6 ? ? I DC  -2  J DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DC  71  O2  ? ? ? 1_555 J DG 75  N2 ? ? I DC  -2  J DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT 74  N3 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT 74  O4 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG  73  N1  ? ? ? 1_555 J DC 73  N3 ? ? I DG  0   J DC 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DG  73  N2  ? ? ? 1_555 J DC 73  O2 ? ? I DG  0   J DC 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DG  73  O6  ? ? ? 1_555 J DC 73  N4 ? ? I DG  0   J DC 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DC  74  N3  ? ? ? 1_555 J DG 72  N1 ? ? I DC  1   J DG -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DC  74  N4  ? ? ? 1_555 J DG 72  O6 ? ? I DC  1   J DG -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DC  74  O2  ? ? ? 1_555 J DG 72  N2 ? ? I DC  1   J DG -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DG  75  N1  ? ? ? 1_555 J DC 71  N3 ? ? I DG  2   J DC -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DG  75  N2  ? ? ? 1_555 J DC 71  O2 ? ? I DG  2   J DC -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DG  75  O6  ? ? ? 1_555 J DC 71  N4 ? ? I DG  2   J DC -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DC  76  N3  ? ? ? 1_555 J DG 70  N1 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DC  76  N4  ? ? ? 1_555 J DG 70  O6 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DC  76  O2  ? ? ? 1_555 J DG 70  N2 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC 69  N3 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC 69  O2 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC 69  N4 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DT  78  N3  ? ? ? 1_555 J DA 68  N1 ? ? I DT  5   J DA -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DT  78  O4  ? ? ? 1_555 J DA 68  N6 ? ? I DT  5   J DA -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DA  79  N1  ? ? ? 1_555 J DT 67  N3 ? ? I DA  6   J DT -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DA  79  N6  ? ? ? 1_555 J DT 67  O4 ? ? I DA  6   J DT -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  80  N3  ? ? ? 1_555 J DG 66  N1 ? ? I DC  7   J DG -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  80  N4  ? ? ? 1_555 J DG 66  O6 ? ? I DC  7   J DG -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DC  80  O2  ? ? ? 1_555 J DG 66  N2 ? ? I DC  7   J DG -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DG  81  O6  ? ? ? 1_555 J DC 65  N4 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog182 hydrog ? ? I DT  82  N3  ? ? ? 1_555 J DA 64  N1 ? ? I DT  9   J DA -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DT  82  O4  ? ? ? 1_555 J DA 64  N6 ? ? I DT  9   J DA -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DG  83  N1  ? ? ? 1_555 J DC 63  N3 ? ? I DG  10  J DC -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DG  83  N2  ? ? ? 1_555 J DC 63  O2 ? ? I DG  10  J DC -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DG  83  O6  ? ? ? 1_555 J DC 63  N4 ? ? I DG  10  J DC -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DC  84  N4  ? ? ? 1_555 J DG 62  O6 ? ? I DC  11  J DG -11  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog188 hydrog ? ? I DG  85  O6  ? ? ? 1_555 J DA 60  N6 ? ? I DG  12  J DA -13  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog189 hydrog ? ? I DG  85  N1  ? ? ? 1_555 J DC 61  N3 ? ? I DG  12  J DC -12  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog190 hydrog ? ? I DT  86  N3  ? ? ? 1_555 J DA 60  N1 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DT  86  O4  ? ? ? 1_555 J DA 60  N6 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J DA 59  N1 ? ? I DT  14  J DA -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J DA 59  N6 ? ? I DT  14  J DA -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DT  88  N3  ? ? ? 1_555 J DA 58  N1 ? ? I DT  15  J DA -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DT  88  O4  ? ? ? 1_555 J DA 58  N6 ? ? I DT  15  J DA -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DA  89  N1  ? ? ? 1_555 J DT 57  N3 ? ? I DA  16  J DT -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DA  89  N6  ? ? ? 1_555 J DT 57  O4 ? ? I DA  16  J DT -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  91  N1  ? ? ? 1_555 J DC 55  N3 ? ? I DG  18  J DC -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  91  N2  ? ? ? 1_555 J DC 55  O2 ? ? I DG  18  J DC -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DG  91  O6  ? ? ? 1_555 J DC 55  N4 ? ? I DG  18  J DC -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DC  92  N3  ? ? ? 1_555 J DG 54  N2 ? ? I DC  19  J DG -19  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog202 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DC 53  N3 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DG  93  N2  ? ? ? 1_555 J DC 53  O2 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DC 53  N4 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DG  94  N2  ? ? ? 1_555 J DC 52  O2 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog206 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J DA 51  N1 ? ? I DT  22  J DA -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DT  95  O4  ? ? ? 1_555 J DA 51  N6 ? ? I DT  22  J DA -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DG  96  N1  ? ? ? 1_555 J DC 50  N3 ? ? I DG  23  J DC -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog209 hydrog ? ? I DC  97  O2  ? ? ? 1_555 J DG 49  N2 ? ? I DC  24  J DG -24  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog210 hydrog ? ? I DT  98  N3  ? ? ? 1_555 J DA 48  N1 ? ? I DT  25  J DA -25  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog211 hydrog ? ? I DA  99  N1  ? ? ? 1_555 J DT 47  N3 ? ? I DA  26  J DT -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DA  99  N6  ? ? ? 1_555 J DT 47  O4 ? ? I DA  26  J DT -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DG  100 N1  ? ? ? 1_555 J DC 46  N3 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog214 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J DT 45  N3 ? ? I DA  28  J DT -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DA  101 N6  ? ? ? 1_555 J DT 45  O4 ? ? I DA  28  J DT -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  102 N1  ? ? ? 1_555 J DC 44  N3 ? ? I DG  29  J DC -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC 44  O2 ? ? I DG  29  J DC -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DG  102 O6  ? ? ? 1_555 J DC 44  N4 ? ? I DG  29  J DC -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DC  103 N3  ? ? ? 1_555 J DG 43  N1 ? ? I DC  30  J DG -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DC  103 N4  ? ? ? 1_555 J DG 43  O6 ? ? I DC  30  J DG -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DC  103 O2  ? ? ? 1_555 J DG 43  N2 ? ? I DC  30  J DG -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DC 41  N4 ? ? I DT  31  J DC -32  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog223 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA 42  N1 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA 42  N6 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DG  105 N1  ? ? ? 1_555 J DA 40  N1 ? ? I DG  32  J DA -33  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog226 hydrog ? ? I DG  105 O6  ? ? ? 1_555 J DA 40  N6 ? ? I DG  32  J DA -33  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog227 hydrog ? ? I DG  105 N1  ? ? ? 1_555 J DC 41  N3 ? ? I DG  32  J DC -32  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog228 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DA 38  N6 ? ? I DC  34  J DA -35  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog229 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG 39  N1 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG 39  O6 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG 39  N2 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DT  108 N3  ? ? ? 1_555 J DA 38  N1 ? ? I DT  35  J DA -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DT  108 O4  ? ? ? 1_555 J DA 38  N6 ? ? I DT  35  J DA -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT 37  N3 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT 37  O4 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DC  110 N3  ? ? ? 1_555 J DG 36  N1 ? ? I DC  37  J DG -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DC  110 N4  ? ? ? 1_555 J DG 36  O6 ? ? I DC  37  J DG -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DC  110 O2  ? ? ? 1_555 J DG 36  N2 ? ? I DC  37  J DG -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DG  111 N1  ? ? ? 1_555 J DC 35  N3 ? ? I DG  38  J DC -38  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog240 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT 34  N3 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT 34  O4 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG 33  N1 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG 33  O6 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG 33  N2 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DC  114 N3  ? ? ? 1_555 J DG 32  N1 ? ? I DC  41  J DG -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DC  114 N4  ? ? ? 1_555 J DG 32  O6 ? ? I DC  41  J DG -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DC  114 O2  ? ? ? 1_555 J DG 32  N2 ? ? I DC  41  J DG -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DA  115 N1  ? ? ? 1_555 J DT 31  N3 ? ? I DA  42  J DT -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DA  115 N6  ? ? ? 1_555 J DT 31  O4 ? ? I DA  42  J DT -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DA  116 N1  ? ? ? 1_555 J DT 30  N3 ? ? I DA  43  J DT -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DA  116 N6  ? ? ? 1_555 J DT 30  O4 ? ? I DA  43  J DT -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA 28  N6 ? ? I DT  44  J DA -45  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog253 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA 29  N1 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA 29  N6 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA 28  N1 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA 28  N6 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DG  119 O6  ? ? ? 1_555 J DT 26  N3 ? ? I DG  46  J DT -47  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog258 hydrog ? ? I DG  119 N1  ? ? ? 1_555 J DC 27  N3 ? ? I DG  46  J DC -46  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog259 hydrog ? ? I DA  120 N6  ? ? ? 1_555 J DC 25  N3 ? ? I DA  47  J DC -48  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog260 hydrog ? ? I DA  120 N1  ? ? ? 1_555 J DT 26  N3 ? ? I DA  47  J DT -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DA  120 N6  ? ? ? 1_555 J DT 26  O4 ? ? I DA  47  J DT -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DG 24  N1 ? ? I DG  48  J DG -49  1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog263 hydrog ? ? I DG  121 N1  ? ? ? 1_555 J DC 25  N3 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC 25  O2 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DC 25  N4 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DC  122 N3  ? ? ? 1_555 J DG 24  N1 ? ? I DC  49  J DG -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DC  122 N4  ? ? ? 1_555 J DG 24  O6 ? ? I DC  49  J DG -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DC  122 O2  ? ? ? 1_555 J DG 24  N2 ? ? I DC  49  J DG -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  123 N1  ? ? ? 1_555 J DC 23  N3 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  123 N2  ? ? ? 1_555 J DC 23  O2 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DG  123 O6  ? ? ? 1_555 J DC 23  N4 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DC 22  N3 ? ? I DG  51  J DC -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J DC 22  O2 ? ? I DG  51  J DC -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DC 22  N4 ? ? I DG  51  J DC -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DC  125 N3  ? ? ? 1_555 J DG 21  N1 ? ? I DC  52  J DG -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DC  125 N4  ? ? ? 1_555 J DG 21  O6 ? ? I DC  52  J DG -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DC  125 O2  ? ? ? 1_555 J DG 21  N2 ? ? I DC  52  J DG -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DC  126 N3  ? ? ? 1_555 J DG 20  N1 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DC  126 N4  ? ? ? 1_555 J DG 20  O6 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DC  126 O2  ? ? ? 1_555 J DG 20  N2 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA 19  N1 ? ? I DT  54  J DA -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA 19  N6 ? ? I DT  54  J DA -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG 18  N1 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG 18  O6 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG 18  N2 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DG  129 N1  ? ? ? 1_555 J DC 17  N3 ? ? I DG  56  J DC -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DG  129 N2  ? ? ? 1_555 J DC 17  O2 ? ? I DG  56  J DC -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  129 O6  ? ? ? 1_555 J DC 17  N4 ? ? I DG  56  J DC -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC 16  N3 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC 16  O2 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC 16  N4 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG 15  N1 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG 15  O6 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG 15  N2 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT 14  N3 ? ? I DA  59  J DT -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DA  132 N6  ? ? ? 1_555 J DT 14  O4 ? ? I DA  59  J DT -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DC  133 O2  ? ? ? 1_555 J DG 13  N2 ? ? I DC  60  J DG -60  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog298 hydrog ? ? I DC  134 N3  ? ? ? 1_555 J DG 12  N1 ? ? I DC  61  J DG -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DC  134 N4  ? ? ? 1_555 J DG 12  O6 ? ? I DC  61  J DG -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DC  134 O2  ? ? ? 1_555 J DG 12  N2 ? ? I DC  61  J DG -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DG  135 N1  ? ? ? 1_555 J DC 11  N3 ? ? I DG  62  J DC -62  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog302 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC 10  N3 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC 10  O2 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC 10  N4 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC 9   N3 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC 9   O2 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC 9   N4 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT 8   O4 ? ? I DA  65  J DT -65  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog309 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA 7   N1 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA 7   N6 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DT  140 N3  ? ? ? 1_555 J DA 6   N1 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DT  140 O4  ? ? ? 1_555 J DA 6   N6 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DC  141 N3  ? ? ? 1_555 J DG 5   N1 ? ? I DC  68  J DG -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DC  141 N4  ? ? ? 1_555 J DG 5   O6 ? ? I DC  68  J DG -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DC  141 O2  ? ? ? 1_555 J DG 5   N2 ? ? I DC  68  J DG -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA 4   N1 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog317 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC 3   N3 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC 3   O2 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC 3   N4 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT 2   N3 ? ? I DA  71  J DT -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT 2   O4 ? ? I DA  71  J DT -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA 1   N1 ? ? I DT  72  J DA -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA 1   N6 ? ? I DT  72  J DA -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
F 1 THR C 101 ? ILE C 102 ? THR C 101 ILE C 102 
F 2 LEU F 97  ? TYR F 98  ? LEU F 97  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN A 1001' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 1002' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 1005' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 1006' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 1007' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 1008' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL C 1101' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL G 1102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ASP A 77  ? ASP A 77  . ? 1_555 ? 
2  AC1 2 VAL H 48  ? VAL H 45  . ? 3_545 ? 
3  AC2 1 DA  I 1   ? DA  I -72 . ? 1_555 ? 
4  AC3 1 DA  I 39  ? DA  I -34 . ? 1_555 ? 
5  AC4 2 DG  J 99  ? DG  J 26  . ? 1_555 ? 
6  AC4 2 DG  J 100 ? DG  J 27  . ? 1_555 ? 
7  AC5 2 DA  I 99  ? DA  I 26  . ? 1_555 ? 
8  AC5 2 DG  I 100 ? DG  I 27  . ? 1_555 ? 
9  AC6 1 DA  J 1   ? DA  J -72 . ? 1_555 ? 
10 AC7 5 GLY C 44  ? GLY C 44  . ? 1_555 ? 
11 AC7 5 ALA C 45  ? ALA C 45  . ? 1_555 ? 
12 AC7 5 GLY C 46  ? GLY C 46  . ? 1_555 ? 
13 AC7 5 THR D 90  ? THR D 87  . ? 1_555 ? 
14 AC7 5 SER D 91  ? SER D 88  . ? 1_555 ? 
15 AC8 6 GLY G 44  ? GLY G 44  . ? 1_555 ? 
16 AC8 6 ALA G 45  ? ALA G 45  . ? 1_555 ? 
17 AC8 6 GLY G 46  ? GLY G 46  . ? 1_555 ? 
18 AC8 6 ALA G 47  ? ALA G 47  . ? 1_555 ? 
19 AC8 6 THR H 90  ? THR H 87  . ? 1_555 ? 
20 AC8 6 SER H 91  ? SER H 88  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3LZ1 
_atom_sites.fract_transf_matrix[1][1]   0.009314 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009119 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005690 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 38  ? 10.356  -21.550 87.986 1.00 107.93 ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1 38  ? 10.432  -21.099 86.591 1.00 107.87 ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1 38  ? 9.172   -20.339 86.122 1.00 107.69 ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1 38  ? 8.516   -19.661 86.929 1.00 107.56 ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1 38  ? 10.623  -22.412 85.805 1.00 107.98 ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 38  ? 10.082  -23.513 86.712 1.00 107.89 ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 38  ? 9.885   -22.944 88.104 1.00 107.82 ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1 39  ? 8.847   -20.455 84.831 1.00 107.27 ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1 39  ? 7.754   -19.686 84.226 1.00 106.80 ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1 39  ? 6.880   -20.527 83.285 1.00 105.97 ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1 39  ? 7.366   -21.461 82.636 1.00 106.13 ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1 39  ? 8.305   -18.458 83.492 1.00 107.10 ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 39  ? 7.252   -17.636 82.819 1.00 108.31 ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 39  ? 7.093   -17.607 81.450 1.00 109.30 ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 39  ? 6.291   -16.828 83.329 1.00 108.87 ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 39  ? 6.089   -16.804 81.145 1.00 109.78 ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 39  ? 5.587   -16.316 82.266 1.00 109.41 ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 40  ? 5.596   -20.174 83.216 1.00 104.64 ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1 40  ? 4.604   -20.935 82.463 1.00 103.17 ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1 40  ? 3.450   -20.042 81.974 1.00 102.08 ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1 40  ? 2.675   -19.513 82.778 1.00 101.94 ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1 40  ? 4.100   -22.106 83.321 1.00 103.09 ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 40  ? 2.802   -22.761 82.870 1.00 103.18 ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 40  ? 2.630   -24.130 83.521 1.00 103.16 ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 40  ? 3.492   -25.133 82.896 1.00 103.43 ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 40  ? 3.111   -25.955 81.920 1.00 103.46 ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 40  ? 1.873   -25.913 81.448 1.00 103.99 ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 40  ? 3.968   -26.826 81.411 1.00 103.57 ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 41  ? 3.357   -19.874 80.654 1.00 100.60 ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1 41  ? 2.244   -19.157 80.035 1.00 99.13  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1 41  ? 0.950   -19.918 80.229 1.00 98.28  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1 41  ? 0.898   -21.131 80.052 1.00 98.59  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1 41  ? 2.481   -18.930 78.540 1.00 98.97  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 41  ? 3.630   -17.997 78.243 1.00 98.66  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 41  ? 4.815   -18.477 77.691 1.00 98.31  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 41  ? 3.539   -16.634 78.523 1.00 98.43  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 41  ? 5.881   -17.627 77.427 1.00 98.32  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 41  ? 4.603   -15.776 78.261 1.00 98.23  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 41  ? 5.768   -16.283 77.715 1.00 98.30  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 41  ? 6.819   -15.444 77.454 1.00 98.49  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1 42  ? -0.089  -19.185 80.604 1.00 97.04  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1 42  ? -1.415  -19.732 80.820 1.00 95.72  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1 42  ? -1.997  -20.303 79.520 1.00 94.54  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1 42  ? -1.602  -19.884 78.434 1.00 94.42  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1 42  ? -2.317  -18.631 81.360 1.00 96.00  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 42  ? -1.853  -18.020 82.674 1.00 96.65  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 42  ? -2.836  -16.950 83.144 1.00 98.34  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 42  ? -4.185  -17.499 83.314 1.00 99.82  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 42  ? -5.291  -16.777 83.505 1.00 100.62 ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 42  ? -5.245  -15.449 83.561 1.00 100.68 ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 42  ? -6.457  -17.393 83.645 1.00 100.96 ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 43  ? -2.946  -21.260 79.626 1.00 93.33  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1 43  ? -3.479  -21.910 78.429 1.00 91.83  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1 43  ? -4.253  -20.941 77.545 1.00 90.37  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1 43  ? -5.082  -20.165 78.038 1.00 89.82  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1 43  ? -4.431  -22.969 78.998 1.00 91.93  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 43  ? -4.016  -23.146 80.415 1.00 92.39  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 43  ? -3.585  -21.791 80.845 1.00 93.24  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1 44  ? -3.958  -21.002 76.247 1.00 88.84  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1 44  ? -4.599  -20.166 75.239 1.00 86.57  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1 44  ? -3.792  -18.926 74.941 1.00 85.13  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1 44  ? -4.173  -18.117 74.097 1.00 84.84  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1 45  ? -2.671  -18.780 75.642 1.00 83.67  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1 45  ? -1.867  -17.582 75.555 1.00 82.11  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1 45  ? -0.934  -17.740 74.384 1.00 81.43  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1 45  ? -0.683  -16.786 73.650 1.00 81.42  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1 45  ? -1.077  -17.346 76.847 1.00 82.10  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 45  ? -1.987  -17.235 77.947 1.00 81.86  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 45  ? -0.247  -16.082 76.764 1.00 81.79  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 46  ? -0.432  -18.953 74.196 1.00 80.64  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 46  ? 0.506   -19.211 73.101 1.00 79.67  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 46  ? -0.270  -19.441 71.798 1.00 79.03  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1 46  ? 0.226   -19.150 70.709 1.00 78.77  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 46  ? 1.505   -20.362 73.424 1.00 79.56  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 46  ? 2.791   -20.207 72.607 1.00 79.08  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 46  ? 1.842   -20.365 74.897 1.00 78.34  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 47  ? -1.500  -19.929 71.925 1.00 78.30  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1 47  ? -2.372  -20.100 70.770 1.00 77.92  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1 47  ? -2.517  -18.766 70.065 1.00 77.62  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1 47  ? -2.138  -18.624 68.896 1.00 77.98  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1 47  ? -3.741  -20.635 71.190 1.00 78.06  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1 48  ? -3.051  -17.794 70.803 1.00 76.94  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1 48  ? -3.205  -16.409 70.367 1.00 75.92  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1 48  ? -1.928  -15.821 69.794 1.00 75.30  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1 48  ? -1.967  -15.062 68.840 1.00 75.45  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1 48  ? -3.684  -15.565 71.550 1.00 76.01  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 48  ? -5.178  -15.274 71.743 1.00 76.76  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 48  ? -6.063  -16.011 70.774 1.00 78.00  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 48  ? -5.626  -15.552 73.166 1.00 77.07  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 49  ? -0.790  -16.159 70.383 1.00 74.78  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1 49  ? 0.471   -15.681 69.865 1.00 74.28  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1 49  ? 0.688   -16.267 68.479 1.00 73.37  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1 49  ? 0.895   -15.534 67.520 1.00 72.86  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1 49  ? 1.616   -16.039 70.822 1.00 74.88  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 49  ? 3.028   -15.845 70.226 1.00 77.37  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 49  ? 3.956   -15.112 71.201 1.00 80.98  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 49  ? 4.701   -16.025 72.067 1.00 83.80  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 49  ? 4.330   -16.377 73.296 1.00 84.96  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 49  ? 3.202   -15.900 73.826 1.00 84.86  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 49  ? 5.092   -17.218 73.993 1.00 85.26  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 50  ? 0.615   -17.597 68.390 1.00 72.67  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1 50  ? 0.866   -18.326 67.150 1.00 72.01  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1 50  ? -0.064  -17.895 66.021 1.00 71.34  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1 50  ? 0.372   -17.768 64.882 1.00 70.90  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1 50  ? 0.736   -19.823 67.379 1.00 72.31  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 50  ? 1.884   -20.459 68.119 1.00 73.34  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 50  ? 1.544   -21.843 68.664 1.00 77.67  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 50  ? 0.453   -22.400 68.324 1.00 79.50  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 50  ? 2.370   -22.373 69.448 1.00 77.98  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 51  ? -1.341  -17.676 66.345 1.00 70.90  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1 51  ? -2.289  -17.148 65.383 1.00 70.33  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1 51  ? -1.680  -15.905 64.773 1.00 70.98  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1 51  ? -1.538  -15.826 63.553 1.00 71.91  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1 51  ? -3.590  -16.721 66.012 1.00 69.96  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 51  ? -4.343  -17.926 66.565 1.00 70.44  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 51  ? -4.407  -15.972 65.000 1.00 68.14  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 51  ? -5.812  -17.634 66.941 1.00 70.94  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 52  ? -1.297  -14.946 65.613 1.00 70.92  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 52  ? -0.735  -13.701 65.118 1.00 71.21  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 52  ? 0.535   -13.944 64.321 1.00 71.33  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1 52  ? 0.782   -13.248 63.341 1.00 71.83  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 52  ? -0.453  -12.721 66.248 1.00 71.70  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 52  ? -1.686  -12.245 66.963 1.00 72.62  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 52  ? -1.359  -11.190 67.980 1.00 75.11  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 52  ? -2.394  -11.194 69.007 1.00 78.52  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 52  ? -2.236  -11.649 70.250 1.00 79.86  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 52  ? -1.050  -12.109 70.656 1.00 78.24  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 52  ? -3.275  -11.620 71.096 1.00 80.07  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 53  ? 1.332   -14.930 64.718 1.00 70.93  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1 53  ? 2.515   -15.249 63.945 1.00 70.96  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1 53  ? 2.087   -15.625 62.530 1.00 71.13  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1 53  ? 2.398   -14.917 61.569 1.00 71.15  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1 53  ? 3.330   -16.364 64.614 1.00 70.84  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 53  ? 4.412   -16.967 63.748 1.00 70.94  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 53  ? 5.631   -17.392 64.573 1.00 73.30  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 53  ? 6.571   -18.197 63.779 1.00 73.32  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 53  ? 6.915   -19.454 64.060 1.00 74.28  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 53  ? 6.424   -20.079 65.135 1.00 74.09  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 53  ? 7.762   -20.092 63.269 1.00 73.58  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 54  ? 1.330   -16.712 62.413 1.00 71.30  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1 54  ? 1.056   -17.313 61.111 1.00 71.11  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1 54  ? 0.142   -16.464 60.225 1.00 71.15  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1 54  ? 0.160   -16.616 58.985 1.00 71.62  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1 54  ? 0.555   -18.747 61.278 1.00 71.29  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 54  ? 1.604   -19.613 61.928 1.00 71.15  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 54  ? 1.460   -20.062 63.242 1.00 71.03  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 54  ? 2.768   -19.941 61.240 1.00 71.08  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 54  ? 2.443   -20.834 63.838 1.00 70.86  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 54  ? 3.751   -20.709 61.825 1.00 70.97  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 54  ? 3.589   -21.147 63.117 1.00 71.22  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 54  ? 4.589   -21.908 63.668 1.00 72.42  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1 55  ? -0.623  -15.562 60.844 1.00 70.18  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1 55  ? -1.384  -14.567 60.083 1.00 69.36  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1 55  ? -0.515  -13.396 59.526 1.00 69.77  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1 55  ? -0.929  -12.699 58.607 1.00 69.83  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1 55  ? -2.600  -14.071 60.879 1.00 69.28  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 55  ? -3.606  -15.166 61.268 1.00 67.14  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 55  ? -5.004  -14.637 61.638 1.00 67.69  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 55  ? -5.178  -13.510 62.110 1.00 65.18  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 55  ? -6.006  -15.460 61.408 1.00 66.45  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 56  ? 0.684   -13.182 60.059 1.00 70.01  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1 56  ? 1.594   -12.190 59.465 1.00 70.48  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1 56  ? 2.303   -12.741 58.245 1.00 70.57  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1 56  ? 2.538   -12.016 57.295 1.00 70.58  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1 56  ? 2.645   -11.708 60.460 1.00 70.73  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 56  ? 2.275   -10.444 61.206 1.00 72.43  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 56  ? 2.987   -10.380 62.552 1.00 74.90  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 56  ? 2.230   -9.493  63.538 1.00 77.41  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 56  ? 2.390   -9.969  64.954 1.00 78.72  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1 57  ? 2.645   -14.025 58.269 1.00 71.20  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1 57  ? 3.422   -14.620 57.189 1.00 71.71  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1 57  ? 2.552   -15.321 56.141 1.00 72.21  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1 57  ? 1.311   -15.405 56.279 1.00 71.89  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1 57  ? 4.425   -15.595 57.748 1.00 71.56  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1 57  ? 3.724   -16.708 58.241 1.00 73.13  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1 58  ? 3.239   -15.826 55.111 1.00 72.52  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1 58  ? 2.636   -16.363 53.890 1.00 72.75  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1 58  ? 3.286   -17.684 53.463 1.00 73.06  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1 58  ? 2.831   -18.344 52.507 1.00 72.99  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1 58  ? 2.825   -15.378 52.745 1.00 72.82  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1 58  ? 4.218   -15.032 52.641 1.00 73.26  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 58  ? 1.991   -14.116 52.975 1.00 72.80  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1 59  ? 4.368   -18.042 54.166 1.00 73.00  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1 59  ? 5.138   -19.257 53.903 1.00 72.58  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1 59  ? 4.322   -20.465 54.300 1.00 72.32  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1 59  ? 3.563   -20.406 55.276 1.00 72.48  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1 59  ? 6.465   -19.245 54.662 1.00 72.05  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 59  ? 6.419   -18.454 55.935 1.00 73.07  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 59  ? 5.969   -19.282 57.093 1.00 74.66  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 59  ? 6.076   -20.498 56.945 1.00 76.51  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 59  ? 5.526   -18.748 58.143 1.00 74.40  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 60  ? 4.503   -21.547 53.536 1.00 71.91  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1 60  ? 3.704   -22.766 53.638 1.00 71.17  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1 60  ? 3.869   -23.436 54.981 1.00 71.57  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1 60  ? 4.944   -23.380 55.587 1.00 71.76  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1 60  ? 4.062   -23.739 52.516 1.00 70.45  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 60  ? 3.690   -23.293 51.104 1.00 68.73  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 60  ? 4.559   -23.980 50.104 1.00 66.08  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 60  ? 2.214   -23.523 50.797 1.00 66.76  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 61  ? 2.810   -24.091 55.437 1.00 71.56  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1 61  ? 2.781   -24.566 56.809 1.00 72.00  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1 61  ? 3.054   -26.054 56.929 1.00 72.24  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1 61  ? 3.655   -26.508 57.913 1.00 72.67  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1 61  ? 1.471   -24.151 57.488 1.00 72.02  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 61  ? 1.379   -22.616 57.616 1.00 71.81  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 61  ? 0.141   -22.139 58.374 1.00 70.95  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 61  ? 2.666   -22.016 58.228 1.00 72.03  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 62  ? 2.614   -26.802 55.920 1.00 71.97  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1 62  ? 2.907   -28.215 55.788 1.00 71.39  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1 62  ? 4.348   -28.306 55.308 1.00 71.72  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1 62  ? 4.825   -27.416 54.602 1.00 71.08  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1 62  ? 1.928   -28.862 54.790 1.00 70.85  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 62  ? 0.542   -28.924 55.410 1.00 70.70  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 62  ? 2.355   -30.272 54.380 1.00 70.85  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 62  ? -0.590  -29.046 54.381 1.00 69.46  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 63  ? 5.053   -29.359 55.711 1.00 72.48  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1 63  ? 6.435   -29.514 55.283 1.00 73.43  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1 63  ? 6.473   -30.044 53.886 1.00 73.28  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1 63  ? 5.549   -30.729 53.445 1.00 72.74  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1 63  ? 7.251   -30.371 56.234 1.00 73.90  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 63  ? 8.099   -29.533 57.167 1.00 77.16  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 63  ? 7.860   -29.909 58.605 1.00 83.72  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 63  ? 7.901   -31.361 58.801 1.00 90.24  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 63  ? 6.830   -32.144 58.983 1.00 93.90  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 63  ? 5.588   -31.633 59.001 1.00 94.47  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 63  ? 7.007   -33.458 59.144 1.00 95.13  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 64  ? 7.556   -29.701 53.198 1.00 73.64  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1 64  ? 7.605   -29.730 51.740 1.00 73.86  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1 64  ? 7.663   -31.159 51.277 1.00 72.42  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1 64  ? 7.066   -31.527 50.267 1.00 72.41  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1 64  ? 8.803   -28.896 51.233 1.00 74.16  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 64  ? 9.356   -29.284 49.842 1.00 76.11  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 64  ? 10.492  -28.340 49.366 1.00 75.94  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 64  ? 10.972  -28.694 47.940 1.00 77.37  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 64  ? 11.558  -27.506 47.243 1.00 79.13  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 65  ? 8.347   -31.966 52.074 1.00 71.42  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 65  ? 8.752   -33.297 51.670 1.00 70.24  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 65  ? 7.646   -34.287 51.905 1.00 68.93  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1 65  ? 7.226   -34.923 50.949 1.00 69.19  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 65  ? 10.071  -33.715 52.360 1.00 70.12  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 65  ? 11.044  -34.593 51.566 1.00 70.31  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 65  ? 10.890  -34.426 50.051 1.00 69.31  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 65  ? 12.519  -34.342 52.013 1.00 70.73  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 66  ? 7.177   -34.431 53.168 1.00 67.78  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1 66  ? 5.962   -35.180 53.438 1.00 67.05  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1 66  ? 4.883   -34.891 52.403 1.00 66.22  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1 66  ? 4.314   -35.810 51.848 1.00 66.01  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1 66  ? 5.527   -34.639 54.803 1.00 67.06  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 66  ? 6.792   -34.380 55.504 1.00 67.29  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 66  ? 7.762   -33.915 54.422 1.00 67.92  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1 67  ? 4.649   -33.621 52.110 1.00 65.96  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1 67  ? 3.635   -33.254 51.139 1.00 66.01  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1 67  ? 3.777   -33.983 49.810 1.00 66.22  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1 67  ? 2.778   -34.501 49.269 1.00 65.95  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1 67  ? 3.569   -31.734 50.869 1.00 65.64  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 67  ? 2.338   -31.352 50.120 1.00 64.49  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 67  ? 1.124   -31.252 50.779 1.00 60.46  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 67  ? 2.366   -31.207 48.745 1.00 64.63  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 67  ? -0.018  -30.968 50.101 1.00 60.94  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 67  ? 1.194   -30.920 48.046 1.00 64.63  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 67  ? 0.000   -30.797 48.739 1.00 62.71  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 68  ? 5.009   -33.996 49.290 1.00 66.10  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1 68  ? 5.292   -34.521 47.972 1.00 66.20  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1 68  ? 4.988   -36.013 48.000 1.00 66.72  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1 68  ? 4.147   -36.519 47.215 1.00 67.13  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1 68  ? 6.753   -34.257 47.619 1.00 66.16  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 68  ? 7.019   -34.076 46.140 1.00 65.96  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 68  ? 8.460   -33.665 45.820 1.00 67.21  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 68  ? 9.407   -34.001 46.546 1.00 69.85  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 68  ? 8.633   -32.946 44.712 1.00 67.92  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 69  ? 5.628   -36.711 48.940 1.00 66.26  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1 69  ? 5.385   -38.132 49.127 1.00 65.96  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1 69  ? 3.893   -38.441 49.061 1.00 65.86  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1 69  ? 3.478   -39.359 48.345 1.00 66.08  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1 69  ? 6.018   -38.651 50.429 1.00 66.02  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 69  ? 7.545   -38.699 50.372 1.00 65.06  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 69  ? 8.165   -39.550 51.455 1.00 63.06  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 69  ? 8.506   -38.849 52.692 1.00 61.71  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 69  ? 7.674   -38.740 53.722 1.00 64.40  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 69  ? 6.441   -39.254 53.635 1.00 65.79  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 69  ? 8.051   -38.102 54.832 1.00 63.71  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 70  ? 3.088   -37.666 49.782 1.00 65.67  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 70  ? 1.639   -37.885 49.781 1.00 65.60  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 70  ? 1.081   -37.802 48.371 1.00 65.73  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1 70  ? 0.475   -38.756 47.895 1.00 65.65  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 70  ? 0.902   -36.896 50.695 1.00 65.43  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 70  ? -0.608  -37.166 50.723 1.00 65.26  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 70  ? -0.857  -38.510 51.343 1.00 66.14  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 70  ? -1.369  -36.106 51.485 1.00 64.25  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 71  ? 1.320   -36.670 47.703 1.00 65.93  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1 71  ? 0.811   -36.433 46.349 1.00 66.01  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1 71  ? 1.231   -37.527 45.384 1.00 66.37  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1 71  ? 0.400   -38.019 44.632 1.00 66.06  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1 71  ? 1.223   -35.047 45.766 1.00 66.19  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 71  ? 0.258   -34.635 44.686 1.00 65.66  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 71  ? 1.223   -33.984 46.828 1.00 65.42  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 72  ? 2.507   -37.917 45.400 1.00 66.97  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1 72  ? 2.929   -39.059 44.559 1.00 68.48  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1 72  ? 2.101   -40.344 44.811 1.00 68.38  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1 72  ? 1.585   -40.949 43.860 1.00 67.95  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1 72  ? 4.429   -39.344 44.667 1.00 68.63  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 72  ? 5.306   -38.238 44.101 1.00 70.65  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 72  ? 6.784   -38.610 44.235 1.00 73.43  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 72  ? 7.676   -37.484 43.975 1.00 75.21  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 72  ? 7.929   -36.980 42.769 1.00 75.93  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 72  ? 7.353   -37.483 41.682 1.00 76.57  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 72  ? 8.755   -35.954 42.654 1.00 77.08  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 73  ? 1.973   -40.735 46.079 1.00 68.26  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 73  ? 1.090   -41.827 46.443 1.00 68.70  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 73  ? -0.261  -41.692 45.728 1.00 69.93  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1 73  ? -0.487  -42.347 44.709 1.00 70.90  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 73  ? 0.905   -41.901 47.957 1.00 68.19  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 73  ? 0.369   -43.221 48.448 1.00 64.37  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 73  ? -0.223  -43.128 49.834 1.00 62.75  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 73  ? 0.537   -42.901 50.812 1.00 57.79  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 73  ? -1.475  -43.280 49.940 1.00 62.85  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 74  ? -1.142  -40.830 46.227 1.00 70.64  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1 74  ? -2.476  -40.638 45.624 1.00 71.23  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1 74  ? -2.493  -40.699 44.077 1.00 72.36  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1 74  ? -3.417  -41.264 43.477 1.00 73.18  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1 74  ? -3.094  -39.317 46.093 1.00 70.68  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 74  ? -3.136  -39.285 47.611 1.00 69.21  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 74  ? -4.506  -39.152 45.553 1.00 70.34  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 74  ? -2.512  -38.081 48.195 1.00 68.43  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 75  ? -1.479  -40.129 43.437 1.00 73.05  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 75  ? -1.440  -40.062 41.985 1.00 73.84  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 75  ? -1.079  -41.399 41.377 1.00 74.49  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1 75  ? -1.613  -41.773 40.336 1.00 75.29  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 75  ? -0.473  -38.992 41.527 1.00 73.87  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 76  ? -0.168  -42.109 42.031 1.00 74.95  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 76  ? 0.255   -43.463 41.638 1.00 75.15  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 76  ? -0.953  -44.376 41.561 1.00 75.01  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1 76  ? -1.157  -45.059 40.576 1.00 74.62  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 76  ? 1.218   -44.004 42.694 1.00 74.96  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 76  ? 2.257   -44.959 42.230 1.00 74.82  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 76  ? 3.282   -45.204 43.329 1.00 76.42  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 76  ? 2.957   -45.183 44.524 1.00 75.54  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 76  ? 4.533   -45.420 42.933 1.00 77.62  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 77  ? -1.750  -44.349 42.627 1.00 75.59  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1 77  ? -3.000  -45.095 42.752 1.00 76.06  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1 77  ? -4.108  -44.622 41.783 1.00 76.62  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1 77  ? -5.262  -44.987 41.939 1.00 76.91  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1 77  ? -3.489  -45.024 44.214 1.00 75.76  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 77  ? -2.918  -46.145 45.100 1.00 76.06  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 77  ? -2.582  -47.251 44.599 1.00 78.00  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 77  ? -2.827  -45.937 46.323 1.00 74.70  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 78  ? -3.752  -43.801 40.800 1.00 77.72  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1 78  ? -4.660  -43.362 39.728 1.00 78.73  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1 78  ? -4.060  -43.775 38.398 1.00 79.11  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1 78  ? -4.764  -44.172 37.461 1.00 79.41  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1 78  ? -4.782  -41.828 39.695 1.00 79.18  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 78  ? -5.975  -41.280 40.428 1.00 80.35  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 78  ? -5.804  -40.363 41.460 1.00 80.82  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 78  ? -7.271  -41.667 40.080 1.00 81.23  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 78  ? -6.902  -39.846 42.144 1.00 80.96  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 78  ? -8.377  -41.152 40.768 1.00 81.23  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 78  ? -8.184  -40.237 41.799 1.00 80.19  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 79  ? -2.745  -43.616 38.316 1.00 79.08  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1 79  ? -1.970  -44.030 37.182 1.00 79.48  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1 79  ? -0.541  -44.141 37.663 1.00 80.27  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1 79  ? -0.024  -43.266 38.367 1.00 80.37  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1 79  ? -2.077  -43.046 36.024 1.00 79.10  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 79  ? -1.266  -43.485 34.830 1.00 79.48  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 79  ? -1.553  -42.682 33.578 1.00 81.43  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 79  ? -0.461  -42.918 32.534 1.00 82.17  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 79  ? -0.282  -44.382 32.276 1.00 83.24  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1 80  ? 0.082   -45.252 37.304 1.00 80.98  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1 80  ? 1.440   -45.523 37.689 1.00 81.57  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1 80  ? 2.319   -44.716 36.762 1.00 82.08  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1 80  ? 1.838   -44.169 35.757 1.00 81.62  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1 80  ? 1.764   -47.031 37.559 1.00 81.67  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1 80  ? 1.156   -47.549 36.365 1.00 82.14  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 80  ? 1.244   -47.813 38.776 1.00 81.37  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1 81  ? 3.600   -44.633 37.121 1.00 82.90  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1 81  ? 4.640   -44.128 36.234 1.00 83.60  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1 81  ? 4.415   -42.672 35.818 1.00 83.53  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1 81  ? 4.611   -42.310 34.638 1.00 83.69  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1 81  ? 4.765   -45.034 35.006 1.00 84.33  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 81  ? 6.177   -45.058 34.441 1.00 87.49  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 81  ? 7.107   -45.464 35.201 1.00 89.43  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 81  ? 6.346   -44.673 33.246 1.00 88.97  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 82  ? 4.000   -41.851 36.798 1.00 83.12  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1 82  ? 3.833   -40.400 36.635 1.00 82.27  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1 82  ? 4.984   -39.639 37.267 1.00 82.27  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1 82  ? 5.425   -39.971 38.372 1.00 82.29  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1 82  ? 2.529   -39.914 37.264 1.00 81.74  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 82  ? 1.220   -40.339 36.609 1.00 81.71  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 82  ? 0.059   -39.730 37.339 1.00 81.28  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 82  ? 1.168   -39.950 35.143 1.00 82.77  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 83  ? 5.466   -38.620 36.555 1.00 81.99  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1 83  ? 6.438   -37.670 37.100 1.00 81.64  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1 83  ? 5.790   -36.286 37.342 1.00 80.33  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1 83  ? 4.737   -35.982 36.772 1.00 79.96  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1 83  ? 7.674   -37.589 36.185 1.00 81.66  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 83  ? 8.493   -38.895 36.147 1.00 82.77  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 83  ? 9.547   -38.919 35.026 1.00 83.06  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 83  ? 10.912  -38.623 35.490 1.00 85.77  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 83  ? 11.854  -38.029 34.748 1.00 86.91  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 83  ? 11.583  -37.637 33.499 1.00 87.54  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 83  ? 13.069  -37.805 35.254 1.00 86.40  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 84  ? 6.402   -35.468 38.202 1.00 78.90  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1 84  ? 5.902   -34.113 38.471 1.00 77.88  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1 84  ? 6.935   -33.003 38.252 1.00 77.33  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1 84  ? 8.037   -33.055 38.810 1.00 77.48  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1 84  ? 5.379   -34.003 39.905 1.00 77.66  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 84  ? 4.076   -34.740 40.153 1.00 78.18  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 84  ? 4.018   -36.136 40.133 1.00 77.26  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 84  ? 2.921   -34.043 40.447 1.00 77.59  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 84  ? 2.839   -36.813 40.380 1.00 76.32  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 84  ? 1.729   -34.727 40.688 1.00 78.40  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 84  ? 1.693   -36.114 40.658 1.00 76.95  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 85  ? 6.572   -32.001 37.447 1.00 76.39  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1 85  ? 7.201   -30.683 37.533 1.00 75.43  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1 85  ? 7.226   -30.171 38.980 1.00 74.57  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1 85  ? 6.199   -30.120 39.648 1.00 74.36  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1 85  ? 6.456   -29.698 36.659 1.00 75.57  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 85  ? 7.294   -29.148 35.546 1.00 77.05  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 85  ? 6.457   -28.702 34.391 1.00 78.11  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 85  ? 5.415   -28.080 34.582 1.00 79.30  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 85  ? 6.896   -29.023 33.175 1.00 77.56  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1 86  ? 8.400   -29.804 39.475 1.00 73.92  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1 86  ? 8.520   -29.480 40.889 1.00 73.68  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1 86  ? 7.538   -28.386 41.281 1.00 73.17  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1 86  ? 6.999   -28.405 42.379 1.00 73.48  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1 86  ? 9.959   -29.104 41.270 1.00 73.51  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1 86  ? 10.286  -27.823 40.781 1.00 74.54  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1 87  ? 7.310   -27.450 40.365 1.00 72.58  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1 87  ? 6.326   -26.391 40.537 1.00 72.37  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1 87  ? 4.862   -26.891 40.586 1.00 72.53  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1 87  ? 3.981   -26.169 41.051 1.00 72.35  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1 87  ? 6.473   -25.373 39.401 1.00 72.31  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1 87  ? 6.054   -25.919 38.155 1.00 71.01  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1 88  ? 4.608   -28.102 40.085 1.00 72.73  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1 88  ? 3.254   -28.674 40.064 1.00 72.78  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1 88  ? 2.903   -29.230 41.430 1.00 72.95  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1 88  ? 1.735   -29.181 41.829 1.00 73.44  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1 88  ? 3.121   -29.740 39.018 1.00 72.44  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1 89  ? 3.898   -29.758 42.144 1.00 72.28  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1 89  ? 3.690   -30.142 43.531 1.00 71.99  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1 89  ? 3.311   -28.839 44.206 1.00 72.17  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1 89  ? 2.184   -28.690 44.731 1.00 71.68  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1 89  ? 4.977   -30.718 44.193 1.00 72.03  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 89  ? 4.908   -30.649 45.714 1.00 71.90  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 89  ? 5.212   -32.139 43.757 1.00 71.64  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1 90  ? 4.254   -27.890 44.149 1.00 71.73  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1 90  ? 4.083   -26.563 44.751 1.00 71.09  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1 90  ? 2.728   -25.904 44.452 1.00 69.51  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1 90  ? 2.192   -25.188 45.283 1.00 69.24  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1 90  ? 5.227   -25.654 44.348 1.00 71.25  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1 90  ? 5.919   -25.056 45.538 1.00 74.26  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1 90  ? 6.512   -26.307 46.706 1.00 78.92  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1 90  ? 8.210   -26.529 46.138 1.00 79.65  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1 91  ? 2.168   -26.173 43.286 1.00 68.20  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1 91  ? 0.848   -25.642 42.951 1.00 67.52  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1 91  ? -0.243  -26.288 43.811 1.00 67.04  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1 91  ? -0.938  -25.602 44.538 1.00 67.25  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1 91  ? 0.569   -25.819 41.487 1.00 67.20  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1 92  ? -0.348  -27.612 43.751 1.00 66.51  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1 92  ? -1.212  -28.404 44.617 1.00 65.67  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1 92  ? -1.095  -28.060 46.086 1.00 65.57  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1 92  ? -2.116  -28.017 46.778 1.00 65.94  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1 92  ? -0.888  -29.885 44.468 1.00 66.10  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 92  ? -1.378  -30.677 43.259 1.00 66.51  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 92  ? -0.440  -31.837 42.975 1.00 65.03  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 92  ? -2.802  -31.170 43.494 1.00 67.89  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 93  ? 0.124   -27.843 46.585 1.00 65.13  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1 93  ? 0.276   -27.470 48.000 1.00 64.98  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1 93  ? -0.318  -26.098 48.298 1.00 65.39  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1 93  ? -1.124  -25.949 49.247 1.00 66.03  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1 93  ? 1.726   -27.542 48.498 1.00 64.71  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 93  ? 1.804   -27.300 49.993 1.00 62.73  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 93  ? 3.134   -27.663 50.582 1.00 62.28  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 93  ? 3.908   -28.375 49.972 1.00 64.31  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 93  ? 3.404   -27.182 51.788 1.00 62.58  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 94  ? 0.073   -25.107 47.492 1.00 64.68  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1 94  ? -0.512  -23.788 47.586 1.00 64.53  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1 94  ? -2.030  -23.889 47.610 1.00 64.36  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1 94  ? -2.698  -23.245 48.405 1.00 64.53  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1 94  ? -0.076  -22.914 46.419 1.00 64.97  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 94  ? 1.323   -22.277 46.554 1.00 65.04  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 94  ? 1.433   -21.337 47.740 1.00 67.20  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 94  ? 2.554   -20.867 47.993 1.00 67.73  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 94  ? 0.416   -21.077 48.437 1.00 68.02  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 95  ? -2.570  -24.734 46.761 1.00 63.92  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1 95  ? -3.999  -24.814 46.613 1.00 63.94  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1 95  ? -4.597  -25.534 47.814 1.00 64.34  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1 95  ? -5.741  -25.260 48.217 1.00 64.26  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1 95  ? -4.350  -25.522 45.305 1.00 63.00  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1 96  ? -3.807  -26.431 48.400 1.00 64.73  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1 96  ? -4.304  -27.310 49.468 1.00 64.92  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1 96  ? -4.448  -26.543 50.774 1.00 64.81  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1 96  ? -5.528  -26.543 51.406 1.00 64.97  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1 96  ? -3.395  -28.537 49.645 1.00 65.27  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1 96  ? -3.589  -29.475 48.581 1.00 65.06  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1 97  ? -3.351  -25.879 51.147 1.00 63.84  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1 97  ? -3.287  -25.039 52.331 1.00 62.82  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1 97  ? -4.347  -23.923 52.281 1.00 61.45  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1 97  ? -5.222  -23.883 53.141 1.00 62.00  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1 97  ? -1.867  -24.517 52.560 1.00 62.75  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 97  ? -0.801  -25.598 52.459 1.00 65.05  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 97  ? 0.416   -25.370 53.386 1.00 68.76  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 97  ? 0.373   -24.461 54.265 1.00 69.17  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 97  ? 1.418   -26.125 53.243 1.00 69.24  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 98  ? -4.315  -23.053 51.284 1.00 59.48  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1 98  ? -5.406  -22.094 51.113 1.00 59.10  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1 98  ? -6.786  -22.661 51.519 1.00 58.81  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1 98  ? -7.553  -22.004 52.214 1.00 58.05  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1 98  ? -5.462  -21.581 49.681 1.00 58.60  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1 99  ? -7.053  -23.892 51.095 1.00 59.03  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1 99  ? -8.349  -24.530 51.236 1.00 59.44  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1 99  ? -8.614  -24.875 52.666 1.00 59.44  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1 99  ? -9.757  -24.746 53.155 1.00 60.98  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1 99  ? -8.385  -25.820 50.415 1.00 59.43  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 99  ? -9.504  -26.766 50.791 1.00 59.32  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 99  ? -10.823 -26.487 50.440 1.00 58.66  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 99  ? -9.240  -27.950 51.492 1.00 59.57  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 99  ? -11.845 -27.337 50.781 1.00 57.02  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 99  ? -10.269 -28.823 51.839 1.00 58.46  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 99  ? -11.566 -28.496 51.473 1.00 58.45  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 99  ? -12.594 -29.326 51.799 1.00 59.44  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1 100 ? -7.563  -25.352 53.325 1.00 58.59  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1 100 ? -7.696  -25.878 54.660 1.00 56.94  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1 100 ? -7.693  -24.715 55.585 1.00 56.12  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1 100 ? -8.379  -24.718 56.603 1.00 57.48  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1 100 ? -6.592  -26.870 54.988 1.00 56.82  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 100 ? -6.663  -28.295 54.407 1.00 57.52  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 100 ? -5.368  -29.057 54.709 1.00 60.15  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 100 ? -7.802  -29.076 54.989 1.00 59.23  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 101 ? -6.971  -23.676 55.217 1.00 54.73  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1 101 ? -7.002  -22.480 56.028 1.00 53.33  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1 101 ? -8.365  -21.810 55.858 1.00 53.27  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1 101 ? -8.925  -21.308 56.786 1.00 52.31  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1 101 ? -5.827  -21.553 55.740 1.00 51.98  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 101 ? -5.841  -20.415 56.664 1.00 50.91  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 101 ? -4.532  -22.282 55.928 1.00 50.82  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1 102 ? -8.905  -21.825 54.654 1.00 55.09  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1 102 ? -10.257 -21.314 54.437 1.00 55.75  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1 102 ? -11.188 -22.186 55.262 1.00 56.59  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1 102 ? -12.041 -21.666 55.946 1.00 56.06  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1 102 ? -10.612 -21.367 52.976 1.00 55.63  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1 103 ? -10.967 -23.505 55.229 1.00 57.94  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1 103 ? -11.752 -24.457 56.014 1.00 60.20  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1 103 ? -11.784 -24.223 57.535 1.00 61.96  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1 103 ? -12.866 -24.044 58.143 1.00 62.23  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1 103 ? -11.316 -25.891 55.737 1.00 60.04  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1 103 ? -12.348 -26.869 56.362 1.00 60.16  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1 103 ? -13.694 -26.858 55.640 1.00 57.31  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1 103 ? -11.802 -28.265 56.443 1.00 57.61  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1 104 ? -10.602 -24.247 58.150 1.00 63.33  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1 104 ? -10.492 -23.889 59.532 1.00 64.30  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1 104 ? -11.255 -22.603 59.842 1.00 65.61  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1 104 ? -12.057 -22.591 60.792 1.00 66.73  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1 104 ? -9.031  -23.815 59.927 1.00 64.50  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1 104 ? -8.357  -25.158 59.925 1.00 64.87  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1 104 ? -7.155  -25.352 59.257 1.00 63.54  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1 104 ? -8.952  -26.247 60.576 1.00 64.39  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1 104 ? -6.548  -26.596 59.262 1.00 62.90  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1 104 ? -8.351  -27.483 60.587 1.00 63.14  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1 104 ? -7.151  -27.662 59.932 1.00 63.18  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1 105 ? -11.048 -21.543 59.048 1.00 65.83  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1 105 ? -11.873 -20.328 59.140 1.00 66.51  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1 105 ? -13.348 -20.660 59.411 1.00 67.43  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1 105 ? -13.878 -20.295 60.442 1.00 67.89  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1 105 ? -11.804 -19.521 57.851 1.00 66.08  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1 105 ? -11.276 -18.122 57.955 1.00 66.46  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1 105 ? -10.531 -17.701 56.679 1.00 68.92  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1 105 ? -11.204 -17.366 55.665 1.00 69.15  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1 105 ? -9.273  -17.723 56.692 1.00 67.77  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1 106 ? -13.988 -21.364 58.481 1.00 68.13  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 106 ? -15.423 -21.615 58.548 1.00 69.01  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 106 ? -15.774 -22.676 59.583 1.00 69.23  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1 106 ? -16.889 -22.675 60.112 1.00 69.89  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 106 ? -15.998 -22.010 57.177 1.00 68.95  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 106 ? -15.585 -21.060 56.052 1.00 69.39  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 106 ? -15.474 -19.823 56.255 1.00 70.36  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 106 ? -15.396 -21.560 54.927 1.00 71.71  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1 107 ? -14.849 -23.593 59.859 1.00 68.94  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1 107 ? -15.032 -24.509 60.993 1.00 68.46  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1 107 ? -15.089 -23.664 62.251 1.00 67.95  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1 107 ? -16.028 -23.730 63.041 1.00 68.21  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1 107 ? -13.860 -25.476 61.150 1.00 68.43  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1 107 ? -13.562 -26.078 59.890 1.00 68.86  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 107 ? -14.184 -26.556 62.157 1.00 68.27  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1 108 ? -14.075 -22.836 62.419 1.00 67.32  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1 108 ? -13.969 -22.046 63.620 1.00 66.16  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1 108 ? -15.238 -21.248 63.907 1.00 66.16  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1 108 ? -15.543 -20.985 65.051 1.00 66.46  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1 108 ? -12.753 -21.138 63.543 1.00 64.96  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 108 ? -12.324 -20.633 64.885 1.00 61.08  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 108 ? -12.264 -19.453 65.091 1.00 56.85  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 108 ? -12.010 -21.523 65.797 1.00 60.37  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 109 ? -15.964 -20.872 62.865 1.00 66.36  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1 109 ? -17.181 -20.096 63.026 1.00 66.63  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1 109 ? -18.254 -20.998 63.569 1.00 66.95  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1 109 ? -19.156 -20.557 64.258 1.00 67.33  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1 109 ? -17.640 -19.500 61.693 1.00 66.44  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 109 ? -16.997 -18.213 61.168 1.00 65.58  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 109 ? -17.868 -17.632 60.083 1.00 63.50  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 109 ? -16.770 -17.166 62.260 1.00 64.20  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1 110 ? -18.129 -22.278 63.265 1.00 67.72  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1 110 ? -19.127 -23.263 63.658 1.00 68.18  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1 110 ? -19.052 -23.607 65.154 1.00 68.73  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1 110 ? -20.085 -23.753 65.818 1.00 69.49  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1 110 ? -19.008 -24.501 62.767 1.00 67.93  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1 110 ? -19.643 -24.200 61.089 1.00 66.22  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1 111 ? -17.827 -23.712 65.666 1.00 68.91  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1 111 ? -17.544 -23.816 67.086 1.00 68.47  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1 111 ? -18.148 -22.642 67.813 1.00 68.88  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1 111 ? -18.894 -22.818 68.776 1.00 69.14  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1 111 ? -16.048 -23.825 67.295 1.00 68.97  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1 112 ? -17.837 -21.434 67.346 1.00 68.92  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1 112 ? -18.354 -20.221 67.961 1.00 69.14  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1 112 ? -19.879 -20.125 67.824 1.00 69.46  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1 112 ? -20.510 -19.229 68.384 1.00 69.77  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1 112 ? -17.728 -18.967 67.342 1.00 69.08  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1 112 ? -16.247 -18.862 67.689 1.00 68.76  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1 112 ? -18.434 -17.715 67.825 1.00 69.06  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1 112 ? -15.552 -17.784 66.900 1.00 68.16  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1 113 ? -20.480 -21.027 67.071 1.00 69.43  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1 113 ? -21.910 -20.934 66.881 1.00 69.81  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1 113 ? -22.577 -21.679 68.006 1.00 69.76  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1 113 ? -23.632 -21.270 68.488 1.00 69.59  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1 113 ? -22.325 -21.511 65.534 1.00 69.92  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1 113 ? -23.775 -21.342 65.235 1.00 69.67  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1 113 ? -24.355 -20.105 65.069 1.00 70.26  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1 113 ? -24.759 -22.252 65.047 1.00 69.78  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1 113 ? -25.642 -20.259 64.805 1.00 70.50  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1 113 ? -25.911 -21.553 64.780 1.00 69.87  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1 114 ? -21.927 -22.766 68.414 1.00 69.63  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 114 ? -22.423 -23.652 69.450 1.00 70.05  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 114 ? -21.847 -23.258 70.814 1.00 70.43  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1 114 ? -21.627 -24.106 71.700 1.00 70.27  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 114 ? -22.090 -25.091 69.114 1.00 70.13  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1 115 ? -21.608 -21.952 70.951 1.00 70.84  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1 115 ? -21.139 -21.321 72.183 1.00 70.98  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1 115 ? -19.842 -21.950 72.718 1.00 70.65  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1 115 ? -19.455 -21.731 73.874 1.00 70.69  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1 115 ? -22.269 -21.311 73.211 1.00 71.01  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1 115 ? -23.481 -20.493 72.746 1.00 72.96  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1 115 ? -24.784 -21.278 72.966 1.00 77.19  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1 115 ? -24.936 -22.462 71.963 1.00 78.27  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1 115 ? -25.121 -23.812 72.628 1.00 77.63  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1 116 ? -19.183 -22.718 71.850 1.00 70.04  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1 116 ? -17.885 -23.309 72.124 1.00 69.81  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1 116 ? -16.759 -22.420 71.596 1.00 69.65  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1 116 ? -17.026 -21.383 70.991 1.00 69.75  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1 116 ? -17.790 -24.678 71.470 1.00 69.93  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1 116 ? -18.487 -25.770 72.195 1.00 69.31  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1 116 ? -18.072 -27.102 71.614 1.00 72.22  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1 116 ? -18.849 -27.462 70.427 1.00 73.56  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1 116 ? -18.450 -27.303 69.165 1.00 73.05  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1 116 ? -17.257 -26.783 68.892 1.00 71.95  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1 116 ? -19.260 -27.669 68.170 1.00 72.96  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1 117 ? -15.515 -22.841 71.827 1.00 69.37  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1 117 ? -14.313 -22.099 71.437 1.00 69.28  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1 117 ? -13.321 -23.087 70.827 1.00 69.85  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1 117 ? -12.316 -22.713 70.198 1.00 70.36  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1 117 ? -13.700 -21.374 72.666 1.00 69.10  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1 117 ? -12.273 -21.821 72.955 1.00 69.55  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1 117 ? -13.755 -19.892 72.485 1.00 69.20  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1 118 ? -13.647 -24.362 71.010 1.00 69.98  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1 118 ? -12.842 -25.493 70.596 1.00 69.64  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1 118 ? -13.449 -26.120 69.331 1.00 70.18  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1 118 ? -14.621 -26.508 69.339 1.00 70.47  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1 118 ? -12.877 -26.554 71.719 1.00 69.35  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 118 ? -12.514 -25.961 72.981 1.00 67.54  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 118 ? -11.975 -27.693 71.385 1.00 69.59  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1 119 ? -12.666 -26.236 68.258 1.00 70.36  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1 119 ? -13.148 -26.873 67.004 1.00 70.27  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1 119 ? -13.170 -28.410 67.073 1.00 70.44  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1 119 ? -12.330 -29.036 67.722 1.00 71.20  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1 119 ? -12.373 -26.402 65.721 1.00 70.11  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 119 ? -10.948 -26.953 65.691 1.00 70.11  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 119 ? -12.360 -24.890 65.602 1.00 69.63  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 119 ? -10.251 -26.740 64.379 1.00 70.16  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1 120 ? -14.132 -29.015 66.392 1.00 70.23  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1 120 ? -14.386 -30.444 66.531 1.00 69.80  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1 120 ? -14.719 -31.024 65.170 1.00 68.44  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1 120 ? -15.227 -30.315 64.313 1.00 68.00  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1 120 ? -15.568 -30.672 67.495 1.00 69.95  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1 120 ? -15.217 -30.548 68.979 1.00 70.62  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1 120 ? -16.661 -30.496 70.077 1.00 71.95  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1 120 ? -16.942 -32.248 70.375 1.00 70.55  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1 121 ? -14.456 -32.324 64.967 1.00 67.85  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1 121 ? -14.892 -32.903 63.730 1.00 67.74  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1 121 ? -16.308 -32.439 63.359 1.00 68.38  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1 121 ? -16.493 -31.923 62.246 1.00 68.93  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1 121 ? -14.875 -34.389 64.040 1.00 67.67  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 121 ? -13.773 -34.535 64.958 1.00 66.70  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 121 ? -13.794 -33.328 65.817 1.00 67.53  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1 122 ? -17.292 -32.583 64.257 1.00 68.09  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1 122 ? -18.654 -32.207 63.885 1.00 67.54  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1 122 ? -18.729 -30.809 63.315 1.00 66.94  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1 122 ? -19.457 -30.601 62.355 1.00 67.54  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1 122 ? -19.692 -32.421 65.000 1.00 68.59  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1 122 ? -19.585 -31.551 66.239 1.00 68.76  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1 122 ? -20.949 -31.405 66.859 1.00 69.18  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1 122 ? -20.858 -31.107 68.343 1.00 71.00  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1 122 ? -20.526 -32.352 69.116 1.00 70.83  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1 123 ? -17.963 -29.867 63.849 1.00 65.98  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1 123 ? -17.896 -28.535 63.224 1.00 65.95  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1 123 ? -17.480 -28.628 61.752 1.00 65.97  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1 123 ? -18.324 -28.403 60.869 1.00 65.89  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1 123 ? -16.971 -27.589 63.976 1.00 65.92  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1 123 ? -17.382 -27.394 65.424 1.00 66.68  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1 123 ? -18.592 -27.102 65.652 1.00 64.54  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1 123 ? -16.482 -27.523 66.318 1.00 66.34  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1 124 ? -16.209 -28.990 61.480 1.00 65.21  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1 124 ? -15.771 -29.309 60.105 1.00 64.16  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1 124 ? -16.926 -29.876 59.254 1.00 64.17  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1 124 ? -17.175 -29.420 58.139 1.00 63.83  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1 124 ? -14.602 -30.296 60.080 1.00 63.47  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1 124 ? -13.288 -29.592 60.458 1.00 65.01  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1 124 ? -14.463 -30.866 58.726 1.00 63.13  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1 124 ? -11.978 -30.486 60.432 1.00 64.09  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1 125 ? -17.638 -30.851 59.807 1.00 64.19  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1 125 ? -18.683 -31.558 59.085 1.00 64.59  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1 125 ? -19.835 -30.658 58.658 1.00 64.72  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1 125 ? -20.313 -30.729 57.536 1.00 64.75  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1 125 ? -19.179 -32.717 59.923 1.00 64.79  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 125 ? -18.118 -33.801 60.105 1.00 65.45  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 125 ? -18.560 -34.925 61.013 1.00 66.41  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 125 ? -19.573 -34.830 61.727 1.00 69.14  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 125 ? -17.800 -35.998 61.001 1.00 66.32  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1 126 ? -20.248 -29.782 59.551 1.00 65.09  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1 126 ? -21.293 -28.831 59.245 1.00 65.41  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1 126 ? -20.847 -27.874 58.138 1.00 65.71  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1 126 ? -21.626 -27.571 57.221 1.00 66.11  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1 126 ? -21.694 -28.073 60.512 1.00 64.88  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 126 ? -22.821 -27.064 60.370 1.00 64.96  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 126 ? -24.182 -27.747 60.503 1.00 66.21  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 126 ? -22.654 -25.977 61.425 1.00 63.93  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1 127 ? -19.596 -27.411 58.216 1.00 65.69  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1 127 ? -19.063 -26.483 57.215 1.00 65.18  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1 127 ? -19.059 -27.099 55.802 1.00 65.25  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1 127 ? -19.389 -26.430 54.806 1.00 64.94  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1 127 ? -17.713 -26.056 57.595 1.00 64.88  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1 128 ? -18.708 -28.380 55.730 1.00 64.98  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1 128 ? -18.675 -29.081 54.477 1.00 64.87  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1 128 ? -20.100 -29.385 53.994 1.00 65.82  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1 128 ? -20.398 -29.190 52.814 1.00 66.02  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1 128 ? -17.784 -30.300 54.587 1.00 64.40  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1 128 ? -16.316 -29.911 54.816 1.00 65.04  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1 128 ? -15.281 -31.058 54.552 1.00 64.63  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1 128 ? -15.404 -31.666 53.216 1.00 63.09  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1 128 ? -15.697 -32.944 52.972 1.00 60.95  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1 128 ? -15.885 -33.792 53.972 1.00 60.89  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1 128 ? -15.774 -33.383 51.719 1.00 60.42  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1 129 ? -21.009 -29.805 54.875 1.00 66.50  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1 129 ? -22.380 -29.957 54.407 1.00 67.21  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1 129 ? -22.838 -28.642 53.784 1.00 67.54  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1 129 ? -23.433 -28.647 52.715 1.00 67.53  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1 129 ? -23.350 -30.418 55.497 1.00 67.68  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1 129 ? -24.848 -30.481 55.030 1.00 69.09  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1 129 ? -25.338 -31.916 54.810 1.00 72.85  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1 129 ? -25.285 -32.394 53.411 1.00 75.23  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1 129 ? -25.167 -33.685 53.055 1.00 74.84  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1 129 ? -25.058 -34.643 53.981 1.00 74.48  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1 129 ? -25.132 -34.022 51.776 1.00 73.51  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1 130 ? -22.509 -27.516 54.418 1.00 68.02  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1 130 ? -23.044 -26.202 53.995 1.00 68.42  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1 130 ? -22.354 -25.636 52.742 1.00 69.47  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1 130 ? -23.015 -25.150 51.834 1.00 68.88  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1 130 ? -23.094 -25.197 55.198 1.00 68.27  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 130 ? -24.255 -25.572 56.151 1.00 68.60  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 130 ? -23.219 -23.764 54.729 1.00 66.59  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 130 ? -24.254 -24.852 57.508 1.00 67.94  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 131 ? -21.021 -25.720 52.696 1.00 71.23  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1 131 ? -20.269 -25.480 51.471 1.00 72.44  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1 131 ? -20.854 -26.316 50.303 1.00 74.34  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1 131 ? -20.692 -25.992 49.116 1.00 74.37  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1 131 ? -18.816 -25.847 51.695 1.00 72.07  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 131 ? -18.066 -24.889 52.609 1.00 71.33  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 131 ? -16.603 -25.250 52.634 1.00 67.83  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 131 ? -15.725 -24.218 53.185 1.00 68.13  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 131 ? -14.391 -24.220 53.037 1.00 67.77  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 131 ? -13.802 -25.176 52.339 1.00 66.29  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 131 ? -13.636 -23.258 53.555 1.00 66.97  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1 132 ? -21.568 -27.379 50.650 1.00 76.06  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1 132 ? -22.074 -28.283 49.651 1.00 78.30  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1 132 ? -20.963 -29.135 49.094 1.00 79.93  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1 132 ? -20.993 -29.501 47.927 1.00 80.68  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1 133 ? -19.969 -29.434 49.924 1.00 81.49  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1 133 ? -18.965 -30.426 49.595 1.00 82.77  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1 133 ? -19.509 -31.851 49.879 1.00 84.42  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1 133 ? -20.475 -32.028 50.651 1.00 84.57  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1 133 ? -17.686 -30.158 50.399 1.00 82.82  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1 133 ? -16.957 -28.830 50.067 1.00 83.05  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1 133 ? -15.606 -28.654 50.794 1.00 81.94  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1 133 ? -15.080 -29.634 51.342 1.00 80.45  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1 133 ? -15.067 -27.530 50.821 1.00 80.25  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1 134 ? -18.904 -32.858 49.238 1.00 86.14  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1 134 ? -19.154 -34.284 49.566 1.00 87.61  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1 134 ? -17.854 -35.092 49.694 1.00 87.84  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1 134 ? -16.926 -34.951 48.884 1.00 88.05  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1 134 ? -20.085 -34.964 48.544 1.00 88.09  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1 134 ? -21.587 -34.612 48.663 1.00 90.60  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1 134 ? -22.033 -33.641 47.556 1.00 94.58  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1 134 ? -23.481 -33.400 47.556 1.00 97.30  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1 134 ? -24.159 -32.795 46.576 1.00 98.27  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1 134 ? -23.528 -32.362 45.487 1.00 98.03  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1 134 ? -25.478 -32.625 46.684 1.00 98.41  ? 134  ARG A NH2   1 
ATOM   803   N  N     . LYS B 2 20  ? 10.085  -47.353 44.351 1.00 76.60  ? 20   LYS B N     1 
ATOM   804   C  CA    . LYS B 2 20  ? 9.891   -48.098 45.628 1.00 77.12  ? 20   LYS B CA    1 
ATOM   805   C  C     . LYS B 2 20  ? 8.551   -47.787 46.314 1.00 77.18  ? 20   LYS B C     1 
ATOM   806   O  O     . LYS B 2 20  ? 8.050   -46.670 46.252 1.00 77.68  ? 20   LYS B O     1 
ATOM   807   C  CB    . LYS B 2 20  ? 11.065  -47.846 46.577 1.00 77.24  ? 20   LYS B CB    1 
ATOM   808   C  CG    . LYS B 2 20  ? 10.678  -47.482 48.021 1.00 77.35  ? 20   LYS B CG    1 
ATOM   809   C  CD    . LYS B 2 20  ? 10.691  -48.666 48.972 1.00 76.43  ? 20   LYS B CD    1 
ATOM   810   C  CE    . LYS B 2 20  ? 10.524  -48.154 50.406 1.00 76.66  ? 20   LYS B CE    1 
ATOM   811   N  NZ    . LYS B 2 20  ? 10.486  -49.236 51.433 1.00 75.50  ? 20   LYS B NZ    1 
ATOM   812   N  N     . VAL B 2 21  ? 8.003   -48.779 47.006 1.00 76.90  ? 21   VAL B N     1 
ATOM   813   C  CA    . VAL B 2 21  ? 6.593   -48.767 47.375 1.00 76.31  ? 21   VAL B CA    1 
ATOM   814   C  C     . VAL B 2 21  ? 6.309   -47.672 48.384 1.00 76.27  ? 21   VAL B C     1 
ATOM   815   O  O     . VAL B 2 21  ? 7.185   -47.357 49.200 1.00 76.44  ? 21   VAL B O     1 
ATOM   816   C  CB    . VAL B 2 21  ? 6.109   -50.184 47.830 1.00 76.05  ? 21   VAL B CB    1 
ATOM   817   C  CG1   . VAL B 2 21  ? 6.995   -50.735 48.928 1.00 76.27  ? 21   VAL B CG1   1 
ATOM   818   C  CG2   . VAL B 2 21  ? 4.619   -50.183 48.225 1.00 75.22  ? 21   VAL B CG2   1 
ATOM   819   N  N     . LEU B 2 22  ? 5.102   -47.094 48.287 1.00 75.44  ? 22   LEU B N     1 
ATOM   820   C  CA    . LEU B 2 22  ? 4.669   -45.938 49.078 1.00 74.55  ? 22   LEU B CA    1 
ATOM   821   C  C     . LEU B 2 22  ? 3.394   -46.209 49.850 1.00 74.29  ? 22   LEU B C     1 
ATOM   822   O  O     . LEU B 2 22  ? 2.342   -46.514 49.265 1.00 74.11  ? 22   LEU B O     1 
ATOM   823   C  CB    . LEU B 2 22  ? 4.409   -44.743 48.167 1.00 74.72  ? 22   LEU B CB    1 
ATOM   824   C  CG    . LEU B 2 22  ? 5.590   -44.048 47.501 1.00 74.45  ? 22   LEU B CG    1 
ATOM   825   C  CD1   . LEU B 2 22  ? 5.038   -43.146 46.427 1.00 74.55  ? 22   LEU B CD1   1 
ATOM   826   C  CD2   . LEU B 2 22  ? 6.405   -43.259 48.507 1.00 73.10  ? 22   LEU B CD2   1 
ATOM   827   N  N     . ARG B 2 23  ? 3.479   -46.013 51.162 1.00 74.02  ? 23   ARG B N     1 
ATOM   828   C  CA    . ARG B 2 23  ? 2.467   -46.484 52.102 1.00 73.54  ? 23   ARG B CA    1 
ATOM   829   C  C     . ARG B 2 23  ? 2.370   -45.523 53.293 1.00 73.38  ? 23   ARG B C     1 
ATOM   830   O  O     . ARG B 2 23  ? 3.397   -45.066 53.808 1.00 73.02  ? 23   ARG B O     1 
ATOM   831   C  CB    . ARG B 2 23  ? 2.867   -47.891 52.567 1.00 73.81  ? 23   ARG B CB    1 
ATOM   832   C  CG    . ARG B 2 23  ? 1.831   -48.673 53.369 1.00 73.92  ? 23   ARG B CG    1 
ATOM   833   C  CD    . ARG B 2 23  ? 2.037   -50.196 53.232 1.00 73.00  ? 23   ARG B CD    1 
ATOM   834   N  NE    . ARG B 2 23  ? 2.748   -50.804 54.359 1.00 71.90  ? 23   ARG B NE    1 
ATOM   835   C  CZ    . ARG B 2 23  ? 4.079   -50.902 54.465 1.00 71.43  ? 23   ARG B CZ    1 
ATOM   836   N  NH1   . ARG B 2 23  ? 4.905   -50.419 53.526 1.00 68.14  ? 23   ARG B NH1   1 
ATOM   837   N  NH2   . ARG B 2 23  ? 4.590   -51.482 55.532 1.00 69.88  ? 23   ARG B NH2   1 
ATOM   838   N  N     . ASP B 2 24  ? 1.133   -45.217 53.702 1.00 73.00  ? 24   ASP B N     1 
ATOM   839   C  CA    . ASP B 2 24  ? 0.817   -44.420 54.901 1.00 72.70  ? 24   ASP B CA    1 
ATOM   840   C  C     . ASP B 2 24  ? 1.174   -42.933 54.869 1.00 72.74  ? 24   ASP B C     1 
ATOM   841   O  O     . ASP B 2 24  ? 1.062   -42.249 55.905 1.00 72.87  ? 24   ASP B O     1 
ATOM   842   C  CB    . ASP B 2 24  ? 1.457   -45.033 56.135 1.00 72.93  ? 24   ASP B CB    1 
ATOM   843   C  CG    . ASP B 2 24  ? 0.609   -44.871 57.370 1.00 74.64  ? 24   ASP B CG    1 
ATOM   844   O  OD1   . ASP B 2 24  ? -0.630  -44.659 57.224 1.00 76.07  ? 24   ASP B OD1   1 
ATOM   845   O  OD2   . ASP B 2 24  ? 1.182   -44.984 58.484 1.00 75.48  ? 24   ASP B OD2   1 
ATOM   846   N  N     . ASN B 2 25  ? 1.571   -42.415 53.706 1.00 72.25  ? 25   ASN B N     1 
ATOM   847   C  CA    . ASN B 2 25  ? 2.103   -41.043 53.610 1.00 71.99  ? 25   ASN B CA    1 
ATOM   848   C  C     . ASN B 2 25  ? 1.264   -39.865 54.151 1.00 71.39  ? 25   ASN B C     1 
ATOM   849   O  O     . ASN B 2 25  ? 1.831   -38.841 54.539 1.00 71.27  ? 25   ASN B O     1 
ATOM   850   C  CB    . ASN B 2 25  ? 2.561   -40.755 52.192 1.00 72.23  ? 25   ASN B CB    1 
ATOM   851   C  CG    . ASN B 2 25  ? 3.680   -41.660 51.766 1.00 73.87  ? 25   ASN B CG    1 
ATOM   852   O  OD1   . ASN B 2 25  ? 4.772   -41.630 52.356 1.00 77.00  ? 25   ASN B OD1   1 
ATOM   853   N  ND2   . ASN B 2 25  ? 3.431   -42.478 50.741 1.00 73.07  ? 25   ASN B ND2   1 
ATOM   854   N  N     . ILE B 2 26  ? -0.061  -40.005 54.160 1.00 70.90  ? 26   ILE B N     1 
ATOM   855   C  CA    . ILE B 2 26  ? -0.949  -39.049 54.828 1.00 70.33  ? 26   ILE B CA    1 
ATOM   856   C  C     . ILE B 2 26  ? -0.457  -38.744 56.254 1.00 70.67  ? 26   ILE B C     1 
ATOM   857   O  O     . ILE B 2 26  ? -0.554  -37.622 56.724 1.00 70.73  ? 26   ILE B O     1 
ATOM   858   C  CB    . ILE B 2 26  ? -2.428  -39.531 54.829 1.00 69.69  ? 26   ILE B CB    1 
ATOM   859   C  CG1   . ILE B 2 26  ? -3.355  -38.554 55.543 1.00 68.84  ? 26   ILE B CG1   1 
ATOM   860   C  CG2   . ILE B 2 26  ? -2.580  -40.840 55.549 1.00 70.56  ? 26   ILE B CG2   1 
ATOM   861   C  CD1   . ILE B 2 26  ? -3.609  -37.249 54.820 1.00 66.45  ? 26   ILE B CD1   1 
ATOM   862   N  N     . GLN B 2 27  ? 0.104   -39.724 56.944 1.00 71.30  ? 27   GLN B N     1 
ATOM   863   C  CA    . GLN B 2 27  ? 0.603   -39.442 58.300 1.00 72.03  ? 27   GLN B CA    1 
ATOM   864   C  C     . GLN B 2 27  ? 1.874   -38.547 58.262 1.00 71.93  ? 27   GLN B C     1 
ATOM   865   O  O     . GLN B 2 27  ? 2.483   -38.228 59.297 1.00 72.10  ? 27   GLN B O     1 
ATOM   866   C  CB    . GLN B 2 27  ? 0.794   -40.746 59.108 1.00 72.05  ? 27   GLN B CB    1 
ATOM   867   C  CG    . GLN B 2 27  ? -0.508  -41.549 59.284 1.00 72.01  ? 27   GLN B CG    1 
ATOM   868   C  CD    . GLN B 2 27  ? -1.482  -40.932 60.303 1.00 72.84  ? 27   GLN B CD    1 
ATOM   869   O  OE1   . GLN B 2 27  ? -1.056  -40.326 61.287 1.00 73.84  ? 27   GLN B OE1   1 
ATOM   870   N  NE2   . GLN B 2 27  ? -2.798  -41.108 60.075 1.00 71.38  ? 27   GLN B NE2   1 
ATOM   871   N  N     . GLY B 2 28  ? 2.251   -38.137 57.054 1.00 71.40  ? 28   GLY B N     1 
ATOM   872   C  CA    . GLY B 2 28  ? 3.287   -37.135 56.881 1.00 71.16  ? 28   GLY B CA    1 
ATOM   873   C  C     . GLY B 2 28  ? 2.758   -35.767 57.270 1.00 70.97  ? 28   GLY B C     1 
ATOM   874   O  O     . GLY B 2 28  ? 3.541   -34.877 57.633 1.00 71.50  ? 28   GLY B O     1 
ATOM   875   N  N     . ILE B 2 29  ? 1.427   -35.610 57.191 1.00 69.98  ? 29   ILE B N     1 
ATOM   876   C  CA    . ILE B 2 29  ? 0.722   -34.404 57.597 1.00 68.30  ? 29   ILE B CA    1 
ATOM   877   C  C     . ILE B 2 29  ? 0.649   -34.407 59.126 1.00 68.15  ? 29   ILE B C     1 
ATOM   878   O  O     . ILE B 2 29  ? -0.417  -34.577 59.731 1.00 68.16  ? 29   ILE B O     1 
ATOM   879   C  CB    . ILE B 2 29  ? -0.707  -34.350 56.969 1.00 68.58  ? 29   ILE B CB    1 
ATOM   880   C  CG1   . ILE B 2 29  ? -0.703  -34.820 55.500 1.00 66.66  ? 29   ILE B CG1   1 
ATOM   881   C  CG2   . ILE B 2 29  ? -1.377  -32.951 57.158 1.00 68.45  ? 29   ILE B CG2   1 
ATOM   882   C  CD1   . ILE B 2 29  ? -0.373  -33.791 54.478 1.00 63.84  ? 29   ILE B CD1   1 
ATOM   883   N  N     . THR B 2 30  ? 1.810   -34.233 59.743 1.00 67.44  ? 30   THR B N     1 
ATOM   884   C  CA    . THR B 2 30  ? 1.966   -34.199 61.189 1.00 67.08  ? 30   THR B CA    1 
ATOM   885   C  C     . THR B 2 30  ? 0.944   -33.300 61.873 1.00 66.95  ? 30   THR B C     1 
ATOM   886   O  O     . THR B 2 30  ? 0.391   -32.427 61.247 1.00 66.38  ? 30   THR B O     1 
ATOM   887   C  CB    . THR B 2 30  ? 3.384   -33.707 61.550 1.00 67.24  ? 30   THR B CB    1 
ATOM   888   O  OG1   . THR B 2 30  ? 3.562   -32.364 61.077 1.00 66.37  ? 30   THR B OG1   1 
ATOM   889   C  CG2   . THR B 2 30  ? 4.446   -34.609 60.895 1.00 66.92  ? 30   THR B CG2   1 
ATOM   890   N  N     . LYS B 2 31  ? 0.737   -33.512 63.169 1.00 67.67  ? 31   LYS B N     1 
ATOM   891   C  CA    . LYS B 2 31  ? -0.189  -32.726 64.000 1.00 68.26  ? 31   LYS B CA    1 
ATOM   892   C  C     . LYS B 2 31  ? 0.188   -31.240 64.214 1.00 68.56  ? 31   LYS B C     1 
ATOM   893   O  O     . LYS B 2 31  ? -0.692  -30.383 64.206 1.00 69.11  ? 31   LYS B O     1 
ATOM   894   C  CB    . LYS B 2 31  ? -0.388  -33.435 65.339 1.00 68.39  ? 31   LYS B CB    1 
ATOM   895   C  CG    . LYS B 2 31  ? -1.068  -32.625 66.430 1.00 69.86  ? 31   LYS B CG    1 
ATOM   896   C  CD    . LYS B 2 31  ? -1.510  -33.522 67.581 1.00 71.75  ? 31   LYS B CD    1 
ATOM   897   C  CE    . LYS B 2 31  ? -1.152  -32.897 68.929 1.00 74.21  ? 31   LYS B CE    1 
ATOM   898   N  NZ    . LYS B 2 31  ? -1.909  -33.527 70.064 1.00 75.84  ? 31   LYS B NZ    1 
ATOM   899   N  N     . PRO B 2 32  ? 1.483   -30.922 64.429 1.00 68.65  ? 32   PRO B N     1 
ATOM   900   C  CA    . PRO B 2 32  ? 1.828   -29.515 64.445 1.00 68.43  ? 32   PRO B CA    1 
ATOM   901   C  C     . PRO B 2 32  ? 1.369   -28.763 63.193 1.00 68.75  ? 32   PRO B C     1 
ATOM   902   O  O     . PRO B 2 32  ? 0.810   -27.664 63.321 1.00 69.14  ? 32   PRO B O     1 
ATOM   903   C  CB    . PRO B 2 32  ? 3.352   -29.532 64.497 1.00 68.12  ? 32   PRO B CB    1 
ATOM   904   C  CG    . PRO B 2 32  ? 3.734   -30.888 64.116 1.00 68.77  ? 32   PRO B CG    1 
ATOM   905   C  CD    . PRO B 2 32  ? 2.672   -31.744 64.676 1.00 68.53  ? 32   PRO B CD    1 
ATOM   906   N  N     . ALA B 2 33  ? 1.609   -29.322 62.004 1.00 68.22  ? 33   ALA B N     1 
ATOM   907   C  CA    . ALA B 2 33  ? 1.264   -28.625 60.775 1.00 67.83  ? 33   ALA B CA    1 
ATOM   908   C  C     . ALA B 2 33  ? -0.251  -28.390 60.735 1.00 67.85  ? 33   ALA B C     1 
ATOM   909   O  O     . ALA B 2 33  ? -0.720  -27.255 60.744 1.00 67.69  ? 33   ALA B O     1 
ATOM   910   C  CB    . ALA B 2 33  ? 1.733   -29.398 59.582 1.00 67.58  ? 33   ALA B CB    1 
ATOM   911   N  N     . ILE B 2 34  ? -1.010  -29.473 60.751 1.00 68.04  ? 34   ILE B N     1 
ATOM   912   C  CA    . ILE B 2 34  ? -2.464  -29.403 60.828 1.00 68.16  ? 34   ILE B CA    1 
ATOM   913   C  C     . ILE B 2 34  ? -2.880  -28.380 61.882 1.00 68.58  ? 34   ILE B C     1 
ATOM   914   O  O     . ILE B 2 34  ? -4.009  -27.898 61.863 1.00 68.71  ? 34   ILE B O     1 
ATOM   915   C  CB    . ILE B 2 34  ? -3.079  -30.787 61.179 1.00 68.28  ? 34   ILE B CB    1 
ATOM   916   C  CG1   . ILE B 2 34  ? -2.434  -31.893 60.345 1.00 67.04  ? 34   ILE B CG1   1 
ATOM   917   C  CG2   . ILE B 2 34  ? -4.598  -30.784 60.969 1.00 67.19  ? 34   ILE B CG2   1 
ATOM   918   C  CD1   . ILE B 2 34  ? -2.677  -33.291 60.879 1.00 68.24  ? 34   ILE B CD1   1 
ATOM   919   N  N     . ARG B 2 35  ? -1.960  -28.067 62.798 1.00 68.15  ? 35   ARG B N     1 
ATOM   920   C  CA    . ARG B 2 35  ? -2.171  -27.037 63.806 1.00 68.43  ? 35   ARG B CA    1 
ATOM   921   C  C     . ARG B 2 35  ? -1.887  -25.641 63.208 1.00 67.61  ? 35   ARG B C     1 
ATOM   922   O  O     . ARG B 2 35  ? -2.793  -24.778 63.156 1.00 67.41  ? 35   ARG B O     1 
ATOM   923   C  CB    . ARG B 2 35  ? -1.277  -27.324 65.019 1.00 68.35  ? 35   ARG B CB    1 
ATOM   924   C  CG    . ARG B 2 35  ? -0.834  -26.098 65.842 1.00 70.45  ? 35   ARG B CG    1 
ATOM   925   C  CD    . ARG B 2 35  ? 0.230   -26.407 66.952 1.00 70.75  ? 35   ARG B CD    1 
ATOM   926   N  NE    . ARG B 2 35  ? 0.035   -27.714 67.579 1.00 75.65  ? 35   ARG B NE    1 
ATOM   927   C  CZ    . ARG B 2 35  ? -1.109  -28.141 68.125 1.00 77.86  ? 35   ARG B CZ    1 
ATOM   928   N  NH1   . ARG B 2 35  ? -2.198  -27.369 68.132 1.00 77.05  ? 35   ARG B NH1   1 
ATOM   929   N  NH2   . ARG B 2 35  ? -1.169  -29.364 68.647 1.00 78.87  ? 35   ARG B NH2   1 
ATOM   930   N  N     . ARG B 2 36  ? -0.637  -25.431 62.767 1.00 65.80  ? 36   ARG B N     1 
ATOM   931   C  CA    . ARG B 2 36  ? -0.229  -24.195 62.128 1.00 64.20  ? 36   ARG B CA    1 
ATOM   932   C  C     . ARG B 2 36  ? -1.276  -23.659 61.116 1.00 63.91  ? 36   ARG B C     1 
ATOM   933   O  O     . ARG B 2 36  ? -1.671  -22.495 61.184 1.00 63.99  ? 36   ARG B O     1 
ATOM   934   C  CB    . ARG B 2 36  ? 1.147   -24.354 61.484 1.00 64.11  ? 36   ARG B CB    1 
ATOM   935   C  CG    . ARG B 2 36  ? 2.216   -24.792 62.458 1.00 63.47  ? 36   ARG B CG    1 
ATOM   936   C  CD    . ARG B 2 36  ? 3.617   -24.545 61.957 1.00 63.26  ? 36   ARG B CD    1 
ATOM   937   N  NE    . ARG B 2 36  ? 4.031   -25.413 60.852 1.00 64.10  ? 36   ARG B NE    1 
ATOM   938   C  CZ    . ARG B 2 36  ? 4.337   -26.701 60.980 1.00 64.14  ? 36   ARG B CZ    1 
ATOM   939   N  NH1   . ARG B 2 36  ? 4.229   -27.293 62.169 1.00 64.96  ? 36   ARG B NH1   1 
ATOM   940   N  NH2   . ARG B 2 36  ? 4.719   -27.407 59.917 1.00 61.19  ? 36   ARG B NH2   1 
ATOM   941   N  N     . LEU B 2 37  ? -1.731  -24.496 60.192 1.00 63.02  ? 37   LEU B N     1 
ATOM   942   C  CA    . LEU B 2 37  ? -2.850  -24.126 59.322 1.00 62.27  ? 37   LEU B CA    1 
ATOM   943   C  C     . LEU B 2 37  ? -4.080  -23.605 60.103 1.00 62.25  ? 37   LEU B C     1 
ATOM   944   O  O     . LEU B 2 37  ? -4.610  -22.538 59.810 1.00 62.16  ? 37   LEU B O     1 
ATOM   945   C  CB    . LEU B 2 37  ? -3.257  -25.308 58.469 1.00 61.82  ? 37   LEU B CB    1 
ATOM   946   C  CG    . LEU B 2 37  ? -2.317  -25.798 57.379 1.00 60.96  ? 37   LEU B CG    1 
ATOM   947   C  CD1   . LEU B 2 37  ? -2.591  -27.287 57.101 1.00 59.91  ? 37   LEU B CD1   1 
ATOM   948   C  CD2   . LEU B 2 37  ? -2.483  -25.008 56.108 1.00 61.22  ? 37   LEU B CD2   1 
ATOM   949   N  N     . ALA B 2 38  ? -4.521  -24.343 61.116 1.00 62.58  ? 38   ALA B N     1 
ATOM   950   C  CA    . ALA B 2 38  ? -5.660  -23.898 61.937 1.00 62.30  ? 38   ALA B CA    1 
ATOM   951   C  C     . ALA B 2 38  ? -5.450  -22.535 62.597 1.00 62.63  ? 38   ALA B C     1 
ATOM   952   O  O     . ALA B 2 38  ? -6.429  -21.890 63.005 1.00 62.85  ? 38   ALA B O     1 
ATOM   953   C  CB    . ALA B 2 38  ? -6.012  -24.940 62.982 1.00 61.73  ? 38   ALA B CB    1 
ATOM   954   N  N     . ARG B 2 39  ? -4.187  -22.102 62.710 1.00 62.19  ? 39   ARG B N     1 
ATOM   955   C  CA    . ARG B 2 39  ? -3.886  -20.858 63.413 1.00 61.90  ? 39   ARG B CA    1 
ATOM   956   C  C     . ARG B 2 39  ? -3.976  -19.708 62.448 1.00 61.60  ? 39   ARG B C     1 
ATOM   957   O  O     . ARG B 2 39  ? -4.544  -18.679 62.763 1.00 61.77  ? 39   ARG B O     1 
ATOM   958   C  CB    . ARG B 2 39  ? -2.507  -20.896 64.081 1.00 61.89  ? 39   ARG B CB    1 
ATOM   959   C  CG    . ARG B 2 39  ? -2.361  -21.934 65.165 1.00 62.24  ? 39   ARG B CG    1 
ATOM   960   C  CD    . ARG B 2 39  ? -2.604  -21.387 66.565 1.00 63.24  ? 39   ARG B CD    1 
ATOM   961   N  NE    . ARG B 2 39  ? -2.376  -22.459 67.534 1.00 66.69  ? 39   ARG B NE    1 
ATOM   962   C  CZ    . ARG B 2 39  ? -3.345  -23.080 68.209 1.00 68.84  ? 39   ARG B CZ    1 
ATOM   963   N  NH1   . ARG B 2 39  ? -4.612  -22.708 68.061 1.00 71.40  ? 39   ARG B NH1   1 
ATOM   964   N  NH2   . ARG B 2 39  ? -3.054  -24.059 69.050 1.00 68.38  ? 39   ARG B NH2   1 
ATOM   965   N  N     . ARG B 2 40  ? -3.390  -19.871 61.276 1.00 61.57  ? 40   ARG B N     1 
ATOM   966   C  CA    . ARG B 2 40  ? -3.644  -18.958 60.194 1.00 61.90  ? 40   ARG B CA    1 
ATOM   967   C  C     . ARG B 2 40  ? -5.149  -18.942 60.002 1.00 62.75  ? 40   ARG B C     1 
ATOM   968   O  O     . ARG B 2 40  ? -5.703  -17.959 59.566 1.00 63.65  ? 40   ARG B O     1 
ATOM   969   C  CB    . ARG B 2 40  ? -2.965  -19.464 58.928 1.00 61.72  ? 40   ARG B CB    1 
ATOM   970   C  CG    . ARG B 2 40  ? -3.029  -18.555 57.713 1.00 59.75  ? 40   ARG B CG    1 
ATOM   971   C  CD    . ARG B 2 40  ? -1.917  -18.912 56.740 1.00 57.90  ? 40   ARG B CD    1 
ATOM   972   N  NE    . ARG B 2 40  ? -0.598  -18.553 57.276 1.00 57.60  ? 40   ARG B NE    1 
ATOM   973   C  CZ    . ARG B 2 40  ? 0.562   -18.887 56.718 1.00 60.94  ? 40   ARG B CZ    1 
ATOM   974   N  NH1   . ARG B 2 40  ? 0.604   -19.623 55.606 1.00 58.49  ? 40   ARG B NH1   1 
ATOM   975   N  NH2   . ARG B 2 40  ? 1.706   -18.492 57.281 1.00 64.01  ? 40   ARG B NH2   1 
ATOM   976   N  N     . GLY B 2 41  ? -5.820  -20.026 60.354 1.00 63.48  ? 41   GLY B N     1 
ATOM   977   C  CA    . GLY B 2 41  ? -7.273  -20.084 60.198 1.00 64.64  ? 41   GLY B CA    1 
ATOM   978   C  C     . GLY B 2 41  ? -8.057  -19.409 61.307 1.00 65.17  ? 41   GLY B C     1 
ATOM   979   O  O     . GLY B 2 41  ? -9.294  -19.341 61.246 1.00 65.27  ? 41   GLY B O     1 
ATOM   980   N  N     . GLY B 2 42  ? -7.356  -18.930 62.330 1.00 65.54  ? 42   GLY B N     1 
ATOM   981   C  CA    . GLY B 2 42  ? -8.006  -18.194 63.419 1.00 67.21  ? 42   GLY B CA    1 
ATOM   982   C  C     . GLY B 2 42  ? -8.613  -19.061 64.512 1.00 68.45  ? 42   GLY B C     1 
ATOM   983   O  O     . GLY B 2 42  ? -9.368  -18.583 65.350 1.00 68.41  ? 42   GLY B O     1 
ATOM   984   N  N     . VAL B 2 43  ? -8.261  -20.340 64.496 1.00 69.88  ? 43   VAL B N     1 
ATOM   985   C  CA    . VAL B 2 43  ? -8.604  -21.294 65.536 1.00 70.77  ? 43   VAL B CA    1 
ATOM   986   C  C     . VAL B 2 43  ? -7.567  -21.282 66.673 1.00 71.92  ? 43   VAL B C     1 
ATOM   987   O  O     . VAL B 2 43  ? -6.333  -21.346 66.440 1.00 71.79  ? 43   VAL B O     1 
ATOM   988   C  CB    . VAL B 2 43  ? -8.627  -22.696 64.964 1.00 70.78  ? 43   VAL B CB    1 
ATOM   989   C  CG1   . VAL B 2 43  ? -9.016  -23.706 66.040 1.00 71.48  ? 43   VAL B CG1   1 
ATOM   990   C  CG2   . VAL B 2 43  ? -9.551  -22.760 63.724 1.00 71.27  ? 43   VAL B CG2   1 
ATOM   991   N  N     . LYS B 2 44  ? -8.106  -21.221 67.893 1.00 72.63  ? 44   LYS B N     1 
ATOM   992   C  CA    . LYS B 2 44  ? -7.355  -21.152 69.128 1.00 73.22  ? 44   LYS B CA    1 
ATOM   993   C  C     . LYS B 2 44  ? -7.382  -22.500 69.843 1.00 73.96  ? 44   LYS B C     1 
ATOM   994   O  O     . LYS B 2 44  ? -6.352  -22.956 70.364 1.00 74.59  ? 44   LYS B O     1 
ATOM   995   C  CB    . LYS B 2 44  ? -7.960  -20.079 70.016 1.00 73.08  ? 44   LYS B CB    1 
ATOM   996   C  CG    . LYS B 2 44  ? -7.527  -20.165 71.450 1.00 74.04  ? 44   LYS B CG    1 
ATOM   997   C  CD    . LYS B 2 44  ? -7.984  -18.952 72.240 1.00 74.99  ? 44   LYS B CD    1 
ATOM   998   C  CE    . LYS B 2 44  ? -7.772  -19.152 73.741 1.00 74.36  ? 44   LYS B CE    1 
ATOM   999   N  NZ    . LYS B 2 44  ? -7.754  -17.829 74.400 1.00 74.28  ? 44   LYS B NZ    1 
ATOM   1000  N  N     . ARG B 2 45  ? -8.551  -23.145 69.863 1.00 74.31  ? 45   ARG B N     1 
ATOM   1001  C  CA    . ARG B 2 45  ? -8.681  -24.418 70.554 1.00 74.34  ? 45   ARG B CA    1 
ATOM   1002  C  C     . ARG B 2 45  ? -9.076  -25.596 69.663 1.00 74.30  ? 45   ARG B C     1 
ATOM   1003  O  O     . ARG B 2 45  ? -10.197 -25.667 69.149 1.00 74.45  ? 45   ARG B O     1 
ATOM   1004  C  CB    . ARG B 2 45  ? -9.631  -24.281 71.738 1.00 74.80  ? 45   ARG B CB    1 
ATOM   1005  C  CG    . ARG B 2 45  ? -9.354  -25.283 72.847 1.00 75.44  ? 45   ARG B CG    1 
ATOM   1006  C  CD    . ARG B 2 45  ? -9.578  -24.646 74.210 1.00 78.18  ? 45   ARG B CD    1 
ATOM   1007  N  NE    . ARG B 2 45  ? -9.248  -25.585 75.269 1.00 80.93  ? 45   ARG B NE    1 
ATOM   1008  C  CZ    . ARG B 2 45  ? -10.028 -26.597 75.637 1.00 82.88  ? 45   ARG B CZ    1 
ATOM   1009  N  NH1   . ARG B 2 45  ? -11.202 -26.797 75.042 1.00 83.79  ? 45   ARG B NH1   1 
ATOM   1010  N  NH2   . ARG B 2 45  ? -9.636  -27.411 76.604 1.00 83.99  ? 45   ARG B NH2   1 
ATOM   1011  N  N     . ILE B 2 46  ? -8.146  -26.542 69.537 1.00 73.91  ? 46   ILE B N     1 
ATOM   1012  C  CA    . ILE B 2 46  ? -8.288  -27.704 68.662 1.00 73.41  ? 46   ILE B CA    1 
ATOM   1013  C  C     . ILE B 2 46  ? -8.574  -29.009 69.425 1.00 73.54  ? 46   ILE B C     1 
ATOM   1014  O  O     . ILE B 2 46  ? -7.723  -29.498 70.175 1.00 74.11  ? 46   ILE B O     1 
ATOM   1015  C  CB    . ILE B 2 46  ? -7.003  -27.892 67.812 1.00 73.12  ? 46   ILE B CB    1 
ATOM   1016  C  CG1   . ILE B 2 46  ? -6.726  -26.653 66.959 1.00 72.32  ? 46   ILE B CG1   1 
ATOM   1017  C  CG2   . ILE B 2 46  ? -7.106  -29.148 66.949 1.00 73.54  ? 46   ILE B CG2   1 
ATOM   1018  C  CD1   . ILE B 2 46  ? -5.342  -26.628 66.322 1.00 73.41  ? 46   ILE B CD1   1 
ATOM   1019  N  N     . SER B 2 47  ? -9.758  -29.577 69.207 1.00 73.19  ? 47   SER B N     1 
ATOM   1020  C  CA    . SER B 2 47  ? -10.119 -30.901 69.728 1.00 72.86  ? 47   SER B CA    1 
ATOM   1021  C  C     . SER B 2 47  ? -9.291  -32.024 69.114 1.00 72.65  ? 47   SER B C     1 
ATOM   1022  O  O     . SER B 2 47  ? -9.039  -32.025 67.922 1.00 72.97  ? 47   SER B O     1 
ATOM   1023  C  CB    . SER B 2 47  ? -11.604 -31.180 69.455 1.00 73.07  ? 47   SER B CB    1 
ATOM   1024  O  OG    . SER B 2 47  ? -11.820 -32.549 69.158 1.00 72.78  ? 47   SER B OG    1 
ATOM   1025  N  N     . GLY B 2 48  ? -8.911  -33.005 69.918 1.00 72.67  ? 48   GLY B N     1 
ATOM   1026  C  CA    . GLY B 2 48  ? -8.027  -34.087 69.464 1.00 73.07  ? 48   GLY B CA    1 
ATOM   1027  C  C     . GLY B 2 48  ? -8.489  -34.864 68.240 1.00 73.35  ? 48   GLY B C     1 
ATOM   1028  O  O     . GLY B 2 48  ? -7.669  -35.340 67.440 1.00 73.06  ? 48   GLY B O     1 
ATOM   1029  N  N     . LEU B 2 49  ? -9.806  -34.985 68.084 1.00 73.60  ? 49   LEU B N     1 
ATOM   1030  C  CA    . LEU B 2 49  ? -10.367 -35.739 66.968 1.00 73.63  ? 49   LEU B CA    1 
ATOM   1031  C  C     . LEU B 2 49  ? -10.382 -34.976 65.625 1.00 73.69  ? 49   LEU B C     1 
ATOM   1032  O  O     . LEU B 2 49  ? -10.795 -35.515 64.594 1.00 73.74  ? 49   LEU B O     1 
ATOM   1033  C  CB    . LEU B 2 49  ? -11.747 -36.275 67.338 1.00 73.66  ? 49   LEU B CB    1 
ATOM   1034  C  CG    . LEU B 2 49  ? -11.773 -37.501 68.262 1.00 73.44  ? 49   LEU B CG    1 
ATOM   1035  C  CD1   . LEU B 2 49  ? -13.181 -38.131 68.229 1.00 72.86  ? 49   LEU B CD1   1 
ATOM   1036  C  CD2   . LEU B 2 49  ? -10.676 -38.543 67.932 1.00 71.20  ? 49   LEU B CD2   1 
ATOM   1037  N  N     . ILE B 2 50  ? -9.911  -33.730 65.654 1.00 73.43  ? 50   ILE B N     1 
ATOM   1038  C  CA    . ILE B 2 50  ? -9.741  -32.915 64.467 1.00 73.13  ? 50   ILE B CA    1 
ATOM   1039  C  C     . ILE B 2 50  ? -8.661  -33.466 63.532 1.00 73.42  ? 50   ILE B C     1 
ATOM   1040  O  O     . ILE B 2 50  ? -8.928  -33.653 62.343 1.00 73.68  ? 50   ILE B O     1 
ATOM   1041  C  CB    . ILE B 2 50  ? -9.424  -31.456 64.858 1.00 73.26  ? 50   ILE B CB    1 
ATOM   1042  C  CG1   . ILE B 2 50  ? -10.693 -30.748 65.362 1.00 73.48  ? 50   ILE B CG1   1 
ATOM   1043  C  CG2   . ILE B 2 50  ? -8.762  -30.690 63.711 1.00 72.29  ? 50   ILE B CG2   1 
ATOM   1044  C  CD1   . ILE B 2 50  ? -11.722 -30.447 64.277 1.00 72.54  ? 50   ILE B CD1   1 
ATOM   1045  N  N     . TYR B 2 51  ? -7.465  -33.756 64.061 1.00 73.47  ? 51   TYR B N     1 
ATOM   1046  C  CA    . TYR B 2 51  ? -6.315  -34.109 63.214 1.00 73.09  ? 51   TYR B CA    1 
ATOM   1047  C  C     . TYR B 2 51  ? -6.649  -35.176 62.186 1.00 73.44  ? 51   TYR B C     1 
ATOM   1048  O  O     . TYR B 2 51  ? -6.341  -34.984 61.014 1.00 74.18  ? 51   TYR B O     1 
ATOM   1049  C  CB    . TYR B 2 51  ? -5.067  -34.447 64.039 1.00 73.34  ? 51   TYR B CB    1 
ATOM   1050  C  CG    . TYR B 2 51  ? -4.815  -33.389 65.088 1.00 73.73  ? 51   TYR B CG    1 
ATOM   1051  C  CD1   . TYR B 2 51  ? -4.327  -32.140 64.732 1.00 74.69  ? 51   TYR B CD1   1 
ATOM   1052  C  CD2   . TYR B 2 51  ? -5.127  -33.614 66.430 1.00 73.26  ? 51   TYR B CD2   1 
ATOM   1053  C  CE1   . TYR B 2 51  ? -4.140  -31.149 65.678 1.00 75.26  ? 51   TYR B CE1   1 
ATOM   1054  C  CE2   . TYR B 2 51  ? -4.943  -32.632 67.387 1.00 73.22  ? 51   TYR B CE2   1 
ATOM   1055  C  CZ    . TYR B 2 51  ? -4.446  -31.397 67.011 1.00 74.74  ? 51   TYR B CZ    1 
ATOM   1056  O  OH    . TYR B 2 51  ? -4.248  -30.389 67.953 1.00 74.97  ? 51   TYR B OH    1 
ATOM   1057  N  N     . GLU B 2 52  ? -7.328  -36.258 62.586 1.00 73.12  ? 52   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2 52  ? -7.642  -37.320 61.630 1.00 72.82  ? 52   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2 52  ? -8.658  -36.865 60.615 1.00 72.34  ? 52   GLU B C     1 
ATOM   1060  O  O     . GLU B 2 52  ? -8.525  -37.168 59.426 1.00 72.80  ? 52   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2 52  ? -8.096  -38.625 62.290 1.00 73.14  ? 52   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2 52  ? -6.967  -39.655 62.575 1.00 75.91  ? 52   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2 52  ? -6.113  -40.041 61.348 1.00 80.04  ? 52   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2 52  ? -6.673  -40.335 60.253 1.00 81.13  ? 52   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2 52  ? -4.863  -40.060 61.489 1.00 81.23  ? 52   GLU B OE2   1 
ATOM   1066  N  N     . GLU B 2 53  ? -9.665  -36.126 61.055 1.00 71.45  ? 53   GLU B N     1 
ATOM   1067  C  CA    . GLU B 2 53  ? -10.632 -35.605 60.096 1.00 70.93  ? 53   GLU B CA    1 
ATOM   1068  C  C     . GLU B 2 53  ? -9.930  -34.723 59.030 1.00 70.20  ? 53   GLU B C     1 
ATOM   1069  O  O     . GLU B 2 53  ? -10.242 -34.794 57.828 1.00 69.87  ? 53   GLU B O     1 
ATOM   1070  C  CB    . GLU B 2 53  ? -11.740 -34.843 60.797 1.00 70.42  ? 53   GLU B CB    1 
ATOM   1071  C  CG    . GLU B 2 53  ? -12.998 -34.824 59.991 1.00 72.67  ? 53   GLU B CG    1 
ATOM   1072  C  CD    . GLU B 2 53  ? -14.039 -35.837 60.464 1.00 75.07  ? 53   GLU B CD    1 
ATOM   1073  O  OE1   . GLU B 2 53  ? -13.662 -36.843 61.101 1.00 76.64  ? 53   GLU B OE1   1 
ATOM   1074  O  OE2   . GLU B 2 53  ? -15.242 -35.622 60.197 1.00 74.33  ? 53   GLU B OE2   1 
ATOM   1075  N  N     . THR B 2 54  ? -8.950  -33.926 59.458 1.00 69.03  ? 54   THR B N     1 
ATOM   1076  C  CA    . THR B 2 54  ? -8.332  -33.004 58.518 1.00 67.62  ? 54   THR B CA    1 
ATOM   1077  C  C     . THR B 2 54  ? -7.583  -33.776 57.452 1.00 67.54  ? 54   THR B C     1 
ATOM   1078  O  O     . THR B 2 54  ? -7.607  -33.417 56.274 1.00 67.62  ? 54   THR B O     1 
ATOM   1079  C  CB    . THR B 2 54  ? -7.405  -31.995 59.181 1.00 67.65  ? 54   THR B CB    1 
ATOM   1080  O  OG1   . THR B 2 54  ? -8.011  -31.482 60.370 1.00 63.01  ? 54   THR B OG1   1 
ATOM   1081  C  CG2   . THR B 2 54  ? -7.140  -30.846 58.219 1.00 66.64  ? 54   THR B CG2   1 
ATOM   1082  N  N     . ARG B 2 55  ? -6.953  -34.859 57.876 1.00 66.79  ? 55   ARG B N     1 
ATOM   1083  C  CA    . ARG B 2 55  ? -6.263  -35.747 56.964 1.00 66.46  ? 55   ARG B CA    1 
ATOM   1084  C  C     . ARG B 2 55  ? -7.240  -36.388 55.991 1.00 66.14  ? 55   ARG B C     1 
ATOM   1085  O  O     . ARG B 2 55  ? -6.943  -36.553 54.802 1.00 65.90  ? 55   ARG B O     1 
ATOM   1086  C  CB    . ARG B 2 55  ? -5.524  -36.817 57.753 1.00 66.31  ? 55   ARG B CB    1 
ATOM   1087  C  CG    . ARG B 2 55  ? -4.300  -36.299 58.464 1.00 67.01  ? 55   ARG B CG    1 
ATOM   1088  C  CD    . ARG B 2 55  ? -3.526  -37.444 58.988 1.00 68.51  ? 55   ARG B CD    1 
ATOM   1089  N  NE    . ARG B 2 55  ? -2.620  -37.082 60.067 1.00 70.33  ? 55   ARG B NE    1 
ATOM   1090  C  CZ    . ARG B 2 55  ? -2.953  -37.050 61.352 1.00 70.79  ? 55   ARG B CZ    1 
ATOM   1091  N  NH1   . ARG B 2 55  ? -4.201  -37.331 61.749 1.00 69.30  ? 55   ARG B NH1   1 
ATOM   1092  N  NH2   . ARG B 2 55  ? -2.025  -36.722 62.241 1.00 70.86  ? 55   ARG B NH2   1 
ATOM   1093  N  N     . GLY B 2 56  ? -8.421  -36.733 56.495 1.00 65.69  ? 56   GLY B N     1 
ATOM   1094  C  CA    . GLY B 2 56  ? -9.412  -37.368 55.661 1.00 65.05  ? 56   GLY B CA    1 
ATOM   1095  C  C     . GLY B 2 56  ? -9.789  -36.401 54.575 1.00 65.10  ? 56   GLY B C     1 
ATOM   1096  O  O     . GLY B 2 56  ? -9.903  -36.773 53.422 1.00 65.29  ? 56   GLY B O     1 
ATOM   1097  N  N     . VAL B 2 57  ? -9.947  -35.142 54.972 1.00 65.24  ? 57   VAL B N     1 
ATOM   1098  C  CA    . VAL B 2 57  ? -10.461 -34.073 54.139 1.00 64.77  ? 57   VAL B CA    1 
ATOM   1099  C  C     . VAL B 2 57  ? -9.440  -33.676 53.089 1.00 64.72  ? 57   VAL B C     1 
ATOM   1100  O  O     . VAL B 2 57  ? -9.768  -33.499 51.911 1.00 64.82  ? 57   VAL B O     1 
ATOM   1101  C  CB    . VAL B 2 57  ? -10.833 -32.882 55.035 1.00 65.08  ? 57   VAL B CB    1 
ATOM   1102  C  CG1   . VAL B 2 57  ? -10.611 -31.553 54.332 1.00 65.53  ? 57   VAL B CG1   1 
ATOM   1103  C  CG2   . VAL B 2 57  ? -12.295 -33.009 55.527 1.00 65.93  ? 57   VAL B CG2   1 
ATOM   1104  N  N     . LEU B 2 58  ? -8.184  -33.573 53.513 1.00 64.37  ? 58   LEU B N     1 
ATOM   1105  C  CA    . LEU B 2 58  ? -7.116  -33.225 52.615 1.00 63.44  ? 58   LEU B CA    1 
ATOM   1106  C  C     . LEU B 2 58  ? -7.012  -34.291 51.538 1.00 63.56  ? 58   LEU B C     1 
ATOM   1107  O  O     . LEU B 2 58  ? -6.714  -33.988 50.372 1.00 64.10  ? 58   LEU B O     1 
ATOM   1108  C  CB    . LEU B 2 58  ? -5.822  -33.114 53.403 1.00 63.75  ? 58   LEU B CB    1 
ATOM   1109  C  CG    . LEU B 2 58  ? -4.520  -32.862 52.657 1.00 63.47  ? 58   LEU B CG    1 
ATOM   1110  C  CD1   . LEU B 2 58  ? -4.559  -31.525 51.960 1.00 64.91  ? 58   LEU B CD1   1 
ATOM   1111  C  CD2   . LEU B 2 58  ? -3.434  -32.840 53.651 1.00 64.36  ? 58   LEU B CD2   1 
ATOM   1112  N  N     . LYS B 2 59  ? -7.281  -35.541 51.918 1.00 62.98  ? 59   LYS B N     1 
ATOM   1113  C  CA    . LYS B 2 59  ? -7.247  -36.647 50.977 1.00 62.11  ? 59   LYS B CA    1 
ATOM   1114  C  C     . LYS B 2 59  ? -8.350  -36.529 49.913 1.00 62.07  ? 59   LYS B C     1 
ATOM   1115  O  O     . LYS B 2 59  ? -8.040  -36.565 48.711 1.00 62.50  ? 59   LYS B O     1 
ATOM   1116  C  CB    . LYS B 2 59  ? -7.324  -37.972 51.724 1.00 62.31  ? 59   LYS B CB    1 
ATOM   1117  C  CG    . LYS B 2 59  ? -6.808  -39.145 50.938 1.00 62.81  ? 59   LYS B CG    1 
ATOM   1118  C  CD    . LYS B 2 59  ? -6.407  -40.298 51.829 1.00 64.48  ? 59   LYS B CD    1 
ATOM   1119  C  CE    . LYS B 2 59  ? -6.496  -41.645 51.073 1.00 66.07  ? 59   LYS B CE    1 
ATOM   1120  N  NZ    . LYS B 2 59  ? -7.947  -42.108 50.872 1.00 67.51  ? 59   LYS B NZ    1 
ATOM   1121  N  N     . VAL B 2 60  ? -9.617  -36.361 50.334 1.00 60.96  ? 60   VAL B N     1 
ATOM   1122  C  CA    . VAL B 2 60  ? -10.714 -36.184 49.385 1.00 59.40  ? 60   VAL B CA    1 
ATOM   1123  C  C     . VAL B 2 60  ? -10.362 -35.000 48.511 1.00 59.39  ? 60   VAL B C     1 
ATOM   1124  O  O     . VAL B 2 60  ? -10.740 -34.953 47.326 1.00 59.30  ? 60   VAL B O     1 
ATOM   1125  C  CB    . VAL B 2 60  ? -12.073 -35.872 50.056 1.00 59.46  ? 60   VAL B CB    1 
ATOM   1126  C  CG1   . VAL B 2 60  ? -13.123 -35.491 49.001 1.00 58.68  ? 60   VAL B CG1   1 
ATOM   1127  C  CG2   . VAL B 2 60  ? -12.571 -37.018 50.887 1.00 58.59  ? 60   VAL B CG2   1 
ATOM   1128  N  N     . PHE B 2 61  ? -9.640  -34.035 49.093 1.00 58.97  ? 61   PHE B N     1 
ATOM   1129  C  CA    . PHE B 2 61  ? -9.234  -32.853 48.330 1.00 58.70  ? 61   PHE B CA    1 
ATOM   1130  C  C     . PHE B 2 61  ? -8.208  -33.184 47.234 1.00 58.42  ? 61   PHE B C     1 
ATOM   1131  O  O     . PHE B 2 61  ? -8.465  -32.900 46.045 1.00 59.12  ? 61   PHE B O     1 
ATOM   1132  C  CB    . PHE B 2 61  ? -8.750  -31.706 49.224 1.00 58.84  ? 61   PHE B CB    1 
ATOM   1133  C  CG    . PHE B 2 61  ? -8.433  -30.440 48.460 1.00 58.75  ? 61   PHE B CG    1 
ATOM   1134  C  CD1   . PHE B 2 61  ? -9.461  -29.615 48.004 1.00 57.57  ? 61   PHE B CD1   1 
ATOM   1135  C  CD2   . PHE B 2 61  ? -7.098  -30.101 48.158 1.00 57.73  ? 61   PHE B CD2   1 
ATOM   1136  C  CE1   . PHE B 2 61  ? -9.178  -28.450 47.270 1.00 57.87  ? 61   PHE B CE1   1 
ATOM   1137  C  CE2   . PHE B 2 61  ? -6.789  -28.968 47.424 1.00 55.84  ? 61   PHE B CE2   1 
ATOM   1138  C  CZ    . PHE B 2 61  ? -7.843  -28.123 46.976 1.00 59.91  ? 61   PHE B CZ    1 
ATOM   1139  N  N     . LEU B 2 62  ? -7.085  -33.790 47.601 1.00 56.91  ? 62   LEU B N     1 
ATOM   1140  C  CA    . LEU B 2 62  ? -6.065  -34.126 46.580 1.00 56.65  ? 62   LEU B CA    1 
ATOM   1141  C  C     . LEU B 2 62  ? -6.556  -35.198 45.568 1.00 56.98  ? 62   LEU B C     1 
ATOM   1142  O  O     . LEU B 2 62  ? -6.157  -35.241 44.366 1.00 55.15  ? 62   LEU B O     1 
ATOM   1143  C  CB    . LEU B 2 62  ? -4.770  -34.572 47.256 1.00 55.36  ? 62   LEU B CB    1 
ATOM   1144  C  CG    . LEU B 2 62  ? -4.234  -33.429 48.074 1.00 52.59  ? 62   LEU B CG    1 
ATOM   1145  C  CD1   . LEU B 2 62  ? -3.408  -33.897 49.206 1.00 50.33  ? 62   LEU B CD1   1 
ATOM   1146  C  CD2   . LEU B 2 62  ? -3.435  -32.531 47.179 1.00 54.03  ? 62   LEU B CD2   1 
ATOM   1147  N  N     . GLU B 2 63  ? -7.457  -36.052 46.050 1.00 57.18  ? 63   GLU B N     1 
ATOM   1148  C  CA    . GLU B 2 63  ? -7.974  -37.056 45.162 1.00 58.04  ? 63   GLU B CA    1 
ATOM   1149  C  C     . GLU B 2 63  ? -8.836  -36.341 44.137 1.00 57.05  ? 63   GLU B C     1 
ATOM   1150  O  O     . GLU B 2 63  ? -9.090  -36.885 43.083 1.00 56.97  ? 63   GLU B O     1 
ATOM   1151  C  CB    . GLU B 2 63  ? -8.758  -38.129 45.902 1.00 58.79  ? 63   GLU B CB    1 
ATOM   1152  C  CG    . GLU B 2 63  ? -7.942  -39.177 46.668 1.00 60.12  ? 63   GLU B CG    1 
ATOM   1153  C  CD    . GLU B 2 63  ? -8.829  -40.009 47.613 1.00 60.92  ? 63   GLU B CD    1 
ATOM   1154  O  OE1   . GLU B 2 63  ? -10.083 -39.833 47.588 1.00 63.18  ? 63   GLU B OE1   1 
ATOM   1155  O  OE2   . GLU B 2 63  ? -8.271  -40.845 48.375 1.00 64.60  ? 63   GLU B OE2   1 
ATOM   1156  N  N     . ASN B 2 64  ? -9.244  -35.105 44.389 1.00 56.33  ? 64   ASN B N     1 
ATOM   1157  C  CA    . ASN B 2 64  ? -9.933  -34.427 43.297 1.00 57.72  ? 64   ASN B CA    1 
ATOM   1158  C  C     . ASN B 2 64  ? -9.073  -33.638 42.336 1.00 58.29  ? 64   ASN B C     1 
ATOM   1159  O  O     . ASN B 2 64  ? -9.247  -33.711 41.108 1.00 58.30  ? 64   ASN B O     1 
ATOM   1160  C  CB    . ASN B 2 64  ? -11.166 -33.651 43.772 1.00 57.59  ? 64   ASN B CB    1 
ATOM   1161  C  CG    . ASN B 2 64  ? -12.175 -34.557 44.426 1.00 57.23  ? 64   ASN B CG    1 
ATOM   1162  O  OD1   . ASN B 2 64  ? -12.164 -35.774 44.196 1.00 54.25  ? 64   ASN B OD1   1 
ATOM   1163  N  ND2   . ASN B 2 64  ? -13.038 -33.990 45.267 1.00 58.48  ? 64   ASN B ND2   1 
ATOM   1164  N  N     . VAL B 2 65  ? -8.152  -32.860 42.883 1.00 58.91  ? 65   VAL B N     1 
ATOM   1165  C  CA    . VAL B 2 65  ? -7.349  -32.040 42.018 1.00 59.43  ? 65   VAL B CA    1 
ATOM   1166  C  C     . VAL B 2 65  ? -6.479  -32.954 41.157 1.00 59.75  ? 65   VAL B C     1 
ATOM   1167  O  O     . VAL B 2 65  ? -6.251  -32.630 39.992 1.00 60.91  ? 65   VAL B O     1 
ATOM   1168  C  CB    . VAL B 2 65  ? -6.521  -31.037 42.805 1.00 60.07  ? 65   VAL B CB    1 
ATOM   1169  C  CG1   . VAL B 2 65  ? -5.756  -30.110 41.871 1.00 59.71  ? 65   VAL B CG1   1 
ATOM   1170  C  CG2   . VAL B 2 65  ? -7.422  -30.246 43.726 1.00 58.98  ? 65   VAL B CG2   1 
ATOM   1171  N  N     . ILE B 2 66  ? -6.043  -34.104 41.688 1.00 59.31  ? 66   ILE B N     1 
ATOM   1172  C  CA    . ILE B 2 66  ? -5.146  -34.963 40.908 1.00 59.07  ? 66   ILE B CA    1 
ATOM   1173  C  C     . ILE B 2 66  ? -5.863  -35.941 39.974 1.00 59.99  ? 66   ILE B C     1 
ATOM   1174  O  O     . ILE B 2 66  ? -5.372  -36.234 38.878 1.00 59.39  ? 66   ILE B O     1 
ATOM   1175  C  CB    . ILE B 2 66  ? -4.034  -35.630 41.746 1.00 58.65  ? 66   ILE B CB    1 
ATOM   1176  C  CG1   . ILE B 2 66  ? -3.617  -34.729 42.894 1.00 56.11  ? 66   ILE B CG1   1 
ATOM   1177  C  CG2   . ILE B 2 66  ? -2.800  -35.768 40.890 1.00 59.35  ? 66   ILE B CG2   1 
ATOM   1178  C  CD1   . ILE B 2 66  ? -3.104  -35.443 44.088 1.00 51.48  ? 66   ILE B CD1   1 
ATOM   1179  N  N     . ARG B 2 67  ? -7.040  -36.427 40.372 1.00 61.11  ? 67   ARG B N     1 
ATOM   1180  C  CA    . ARG B 2 67  ? -7.876  -37.120 39.406 1.00 62.04  ? 67   ARG B CA    1 
ATOM   1181  C  C     . ARG B 2 67  ? -8.059  -36.247 38.170 1.00 61.98  ? 67   ARG B C     1 
ATOM   1182  O  O     . ARG B 2 67  ? -7.979  -36.737 37.048 1.00 62.85  ? 67   ARG B O     1 
ATOM   1183  C  CB    . ARG B 2 67  ? -9.217  -37.522 39.981 1.00 62.45  ? 67   ARG B CB    1 
ATOM   1184  C  CG    . ARG B 2 67  ? -10.091 -38.287 38.979 1.00 65.95  ? 67   ARG B CG    1 
ATOM   1185  C  CD    . ARG B 2 67  ? -11.484 -38.560 39.554 1.00 72.41  ? 67   ARG B CD    1 
ATOM   1186  N  NE    . ARG B 2 67  ? -11.339 -39.394 40.754 1.00 78.10  ? 67   ARG B NE    1 
ATOM   1187  C  CZ    . ARG B 2 67  ? -11.426 -38.953 42.010 1.00 79.15  ? 67   ARG B CZ    1 
ATOM   1188  N  NH1   . ARG B 2 67  ? -11.697 -37.668 42.258 1.00 78.33  ? 67   ARG B NH1   1 
ATOM   1189  N  NH2   . ARG B 2 67  ? -11.253 -39.812 43.018 1.00 78.69  ? 67   ARG B NH2   1 
ATOM   1190  N  N     . ASP B 2 68  ? -8.243  -34.946 38.368 1.00 61.82  ? 68   ASP B N     1 
ATOM   1191  C  CA    . ASP B 2 68  ? -8.377  -34.027 37.241 1.00 61.45  ? 68   ASP B CA    1 
ATOM   1192  C  C     . ASP B 2 68  ? -7.036  -33.645 36.575 1.00 61.78  ? 68   ASP B C     1 
ATOM   1193  O  O     . ASP B 2 68  ? -6.910  -33.724 35.352 1.00 60.96  ? 68   ASP B O     1 
ATOM   1194  C  CB    . ASP B 2 68  ? -9.122  -32.792 37.685 1.00 61.10  ? 68   ASP B CB    1 
ATOM   1195  C  CG    . ASP B 2 68  ? -10.642 -32.959 37.639 1.00 60.59  ? 68   ASP B CG    1 
ATOM   1196  O  OD1   . ASP B 2 68  ? -11.183 -34.094 37.669 1.00 58.37  ? 68   ASP B OD1   1 
ATOM   1197  O  OD2   . ASP B 2 68  ? -11.302 -31.899 37.597 1.00 59.13  ? 68   ASP B OD2   1 
ATOM   1198  N  N     . ALA B 2 69  ? -6.048  -33.221 37.364 1.00 62.30  ? 69   ALA B N     1 
ATOM   1199  C  CA    . ALA B 2 69  ? -4.726  -32.869 36.819 1.00 63.05  ? 69   ALA B CA    1 
ATOM   1200  C  C     . ALA B 2 69  ? -4.272  -33.971 35.906 1.00 63.59  ? 69   ALA B C     1 
ATOM   1201  O  O     . ALA B 2 69  ? -3.939  -33.757 34.764 1.00 63.37  ? 69   ALA B O     1 
ATOM   1202  C  CB    . ALA B 2 69  ? -3.717  -32.688 37.933 1.00 63.07  ? 69   ALA B CB    1 
ATOM   1203  N  N     . VAL B 2 70  ? -4.340  -35.182 36.434 1.00 65.50  ? 70   VAL B N     1 
ATOM   1204  C  CA    . VAL B 2 70  ? -3.902  -36.389 35.752 1.00 66.32  ? 70   VAL B CA    1 
ATOM   1205  C  C     . VAL B 2 70  ? -4.652  -36.647 34.460 1.00 67.02  ? 70   VAL B C     1 
ATOM   1206  O  O     . VAL B 2 70  ? -4.023  -36.980 33.468 1.00 68.16  ? 70   VAL B O     1 
ATOM   1207  C  CB    . VAL B 2 70  ? -3.943  -37.574 36.703 1.00 65.98  ? 70   VAL B CB    1 
ATOM   1208  C  CG1   . VAL B 2 70  ? -3.995  -38.883 35.942 1.00 67.47  ? 70   VAL B CG1   1 
ATOM   1209  C  CG2   . VAL B 2 70  ? -2.718  -37.505 37.628 1.00 65.64  ? 70   VAL B CG2   1 
ATOM   1210  N  N     . THR B 2 71  ? -5.969  -36.477 34.452 1.00 67.59  ? 71   THR B N     1 
ATOM   1211  C  CA    . THR B 2 71  ? -6.717  -36.574 33.209 1.00 68.17  ? 71   THR B CA    1 
ATOM   1212  C  C     . THR B 2 71  ? -6.140  -35.674 32.117 1.00 69.35  ? 71   THR B C     1 
ATOM   1213  O  O     . THR B 2 71  ? -5.784  -36.149 31.041 1.00 69.88  ? 71   THR B O     1 
ATOM   1214  C  CB    . THR B 2 71  ? -8.165  -36.263 33.425 1.00 67.79  ? 71   THR B CB    1 
ATOM   1215  O  OG1   . THR B 2 71  ? -8.696  -37.211 34.356 1.00 68.46  ? 71   THR B OG1   1 
ATOM   1216  C  CG2   . THR B 2 71  ? -8.934  -36.358 32.110 1.00 67.47  ? 71   THR B CG2   1 
ATOM   1217  N  N     . TYR B 2 72  ? -6.027  -34.383 32.397 1.00 70.45  ? 72   TYR B N     1 
ATOM   1218  C  CA    . TYR B 2 72  ? -5.302  -33.485 31.520 1.00 71.66  ? 72   TYR B CA    1 
ATOM   1219  C  C     . TYR B 2 72  ? -3.935  -34.070 31.095 1.00 72.95  ? 72   TYR B C     1 
ATOM   1220  O  O     . TYR B 2 72  ? -3.550  -33.940 29.925 1.00 73.51  ? 72   TYR B O     1 
ATOM   1221  C  CB    . TYR B 2 72  ? -5.156  -32.093 32.163 1.00 71.60  ? 72   TYR B CB    1 
ATOM   1222  C  CG    . TYR B 2 72  ? -6.459  -31.298 32.191 1.00 71.48  ? 72   TYR B CG    1 
ATOM   1223  C  CD1   . TYR B 2 72  ? -7.096  -30.953 33.396 1.00 70.84  ? 72   TYR B CD1   1 
ATOM   1224  C  CD2   . TYR B 2 72  ? -7.055  -30.898 31.012 1.00 71.24  ? 72   TYR B CD2   1 
ATOM   1225  C  CE1   . TYR B 2 72  ? -8.298  -30.225 33.400 1.00 69.84  ? 72   TYR B CE1   1 
ATOM   1226  C  CE2   . TYR B 2 72  ? -8.243  -30.168 31.007 1.00 72.36  ? 72   TYR B CE2   1 
ATOM   1227  C  CZ    . TYR B 2 72  ? -8.862  -29.835 32.190 1.00 71.62  ? 72   TYR B CZ    1 
ATOM   1228  O  OH    . TYR B 2 72  ? -10.055 -29.125 32.096 1.00 71.74  ? 72   TYR B OH    1 
ATOM   1229  N  N     . THR B 2 73  ? -3.223  -34.741 32.007 1.00 73.55  ? 73   THR B N     1 
ATOM   1230  C  CA    . THR B 2 73  ? -1.916  -35.298 31.660 1.00 74.48  ? 73   THR B CA    1 
ATOM   1231  C  C     . THR B 2 73  ? -2.037  -36.492 30.724 1.00 76.02  ? 73   THR B C     1 
ATOM   1232  O  O     . THR B 2 73  ? -1.235  -36.649 29.794 1.00 76.05  ? 73   THR B O     1 
ATOM   1233  C  CB    . THR B 2 73  ? -1.112  -35.727 32.883 1.00 74.15  ? 73   THR B CB    1 
ATOM   1234  O  OG1   . THR B 2 73  ? -1.509  -34.960 34.020 1.00 73.31  ? 73   THR B OG1   1 
ATOM   1235  C  CG2   . THR B 2 73  ? 0.333   -35.488 32.624 1.00 73.12  ? 73   THR B CG2   1 
ATOM   1236  N  N     . GLU B 2 74  ? -3.028  -37.342 30.996 1.00 77.47  ? 74   GLU B N     1 
ATOM   1237  C  CA    . GLU B 2 74  ? -3.372  -38.453 30.113 1.00 79.01  ? 74   GLU B CA    1 
ATOM   1238  C  C     . GLU B 2 74  ? -3.801  -37.910 28.759 1.00 79.58  ? 74   GLU B C     1 
ATOM   1239  O  O     . GLU B 2 74  ? -3.423  -38.445 27.715 1.00 80.03  ? 74   GLU B O     1 
ATOM   1240  C  CB    . GLU B 2 74  ? -4.507  -39.296 30.693 1.00 78.80  ? 74   GLU B CB    1 
ATOM   1241  C  CG    . GLU B 2 74  ? -4.087  -40.335 31.733 1.00 79.62  ? 74   GLU B CG    1 
ATOM   1242  C  CD    . GLU B 2 74  ? -5.288  -40.932 32.494 1.00 80.31  ? 74   GLU B CD    1 
ATOM   1243  O  OE1   . GLU B 2 74  ? -6.467  -40.698 32.101 1.00 80.82  ? 74   GLU B OE1   1 
ATOM   1244  O  OE2   . GLU B 2 74  ? -5.048  -41.638 33.499 1.00 82.02  ? 74   GLU B OE2   1 
ATOM   1245  N  N     . HIS B 2 75  ? -4.582  -36.837 28.766 1.00 80.12  ? 75   HIS B N     1 
ATOM   1246  C  CA    . HIS B 2 75  ? -5.063  -36.315 27.499 1.00 80.71  ? 75   HIS B CA    1 
ATOM   1247  C  C     . HIS B 2 75  ? -3.920  -35.708 26.686 1.00 80.83  ? 75   HIS B C     1 
ATOM   1248  O  O     . HIS B 2 75  ? -3.790  -35.980 25.506 1.00 81.67  ? 75   HIS B O     1 
ATOM   1249  C  CB    . HIS B 2 75  ? -6.228  -35.350 27.668 1.00 80.16  ? 75   HIS B CB    1 
ATOM   1250  C  CG    . HIS B 2 75  ? -6.797  -34.886 26.373 1.00 80.41  ? 75   HIS B CG    1 
ATOM   1251  N  ND1   . HIS B 2 75  ? -6.023  -34.322 25.385 1.00 80.58  ? 75   HIS B ND1   1 
ATOM   1252  C  CD2   . HIS B 2 75  ? -8.064  -34.894 25.899 1.00 82.56  ? 75   HIS B CD2   1 
ATOM   1253  C  CE1   . HIS B 2 75  ? -6.786  -33.996 24.360 1.00 82.34  ? 75   HIS B CE1   1 
ATOM   1254  N  NE2   . HIS B 2 75  ? -8.031  -34.339 24.643 1.00 83.45  ? 75   HIS B NE2   1 
ATOM   1255  N  N     . ALA B 2 76  ? -3.085  -34.905 27.318 1.00 80.86  ? 76   ALA B N     1 
ATOM   1256  C  CA    . ALA B 2 76  ? -1.921  -34.369 26.642 1.00 81.13  ? 76   ALA B CA    1 
ATOM   1257  C  C     . ALA B 2 76  ? -0.861  -35.443 26.347 1.00 81.48  ? 76   ALA B C     1 
ATOM   1258  O  O     . ALA B 2 76  ? 0.291   -35.109 26.056 1.00 81.74  ? 76   ALA B O     1 
ATOM   1259  C  CB    . ALA B 2 76  ? -1.317  -33.249 27.477 1.00 81.28  ? 76   ALA B CB    1 
ATOM   1260  N  N     . LYS B 2 77  ? -1.243  -36.720 26.446 1.00 81.68  ? 77   LYS B N     1 
ATOM   1261  C  CA    . LYS B 2 77  ? -0.337  -37.857 26.183 1.00 81.84  ? 77   LYS B CA    1 
ATOM   1262  C  C     . LYS B 2 77  ? 1.051   -37.678 26.814 1.00 81.60  ? 77   LYS B C     1 
ATOM   1263  O  O     . LYS B 2 77  ? 2.062   -37.692 26.111 1.00 81.73  ? 77   LYS B O     1 
ATOM   1264  C  CB    . LYS B 2 77  ? -0.174  -38.078 24.677 1.00 82.04  ? 77   LYS B CB    1 
ATOM   1265  C  CG    . LYS B 2 77  ? -1.432  -38.511 23.922 1.00 83.72  ? 77   LYS B CG    1 
ATOM   1266  C  CD    . LYS B 2 77  ? -1.380  -37.962 22.488 1.00 85.44  ? 77   LYS B CD    1 
ATOM   1267  C  CE    . LYS B 2 77  ? -2.072  -38.869 21.481 1.00 85.55  ? 77   LYS B CE    1 
ATOM   1268  N  NZ    . LYS B 2 77  ? -1.913  -38.318 20.099 1.00 85.52  ? 77   LYS B NZ    1 
ATOM   1269  N  N     . ARG B 2 78  ? 1.094   -37.506 28.132 1.00 81.06  ? 78   ARG B N     1 
ATOM   1270  C  CA    . ARG B 2 78  ? 2.344   -37.226 28.830 1.00 80.25  ? 78   ARG B CA    1 
ATOM   1271  C  C     . ARG B 2 78  ? 2.557   -38.184 30.001 1.00 79.66  ? 78   ARG B C     1 
ATOM   1272  O  O     . ARG B 2 78  ? 1.603   -38.754 30.513 1.00 79.18  ? 78   ARG B O     1 
ATOM   1273  C  CB    . ARG B 2 78  ? 2.345   -35.773 29.321 1.00 80.42  ? 78   ARG B CB    1 
ATOM   1274  C  CG    . ARG B 2 78  ? 2.581   -34.731 28.225 1.00 81.02  ? 78   ARG B CG    1 
ATOM   1275  C  CD    . ARG B 2 78  ? 2.882   -33.321 28.780 1.00 80.61  ? 78   ARG B CD    1 
ATOM   1276  N  NE    . ARG B 2 78  ? 1.643   -32.577 28.939 1.00 82.54  ? 78   ARG B NE    1 
ATOM   1277  C  CZ    . ARG B 2 78  ? 1.149   -32.152 30.099 1.00 84.32  ? 78   ARG B CZ    1 
ATOM   1278  N  NH1   . ARG B 2 78  ? 1.808   -32.337 31.236 1.00 84.71  ? 78   ARG B NH1   1 
ATOM   1279  N  NH2   . ARG B 2 78  ? -0.012  -31.517 30.118 1.00 86.09  ? 78   ARG B NH2   1 
ATOM   1280  N  N     . LYS B 2 79  ? 3.812   -38.359 30.409 1.00 79.38  ? 79   LYS B N     1 
ATOM   1281  C  CA    . LYS B 2 79  ? 4.160   -39.104 31.618 1.00 79.40  ? 79   LYS B CA    1 
ATOM   1282  C  C     . LYS B 2 79  ? 4.590   -38.117 32.709 1.00 79.09  ? 79   LYS B C     1 
ATOM   1283  O  O     . LYS B 2 79  ? 5.056   -38.520 33.789 1.00 79.28  ? 79   LYS B O     1 
ATOM   1284  C  CB    . LYS B 2 79  ? 5.310   -40.106 31.379 1.00 79.77  ? 79   LYS B CB    1 
ATOM   1285  C  CG    . LYS B 2 79  ? 5.376   -40.815 30.016 1.00 80.80  ? 79   LYS B CG    1 
ATOM   1286  C  CD    . LYS B 2 79  ? 6.045   -42.186 30.111 1.00 80.51  ? 79   LYS B CD    1 
ATOM   1287  C  CE    . LYS B 2 79  ? 5.012   -43.293 30.382 1.00 84.13  ? 79   LYS B CE    1 
ATOM   1288  N  NZ    . LYS B 2 79  ? 5.599   -44.650 30.645 1.00 83.59  ? 79   LYS B NZ    1 
ATOM   1289  N  N     . THR B 2 80  ? 4.476   -36.821 32.424 1.00 78.56  ? 80   THR B N     1 
ATOM   1290  C  CA    . THR B 2 80  ? 4.849   -35.809 33.412 1.00 77.98  ? 80   THR B CA    1 
ATOM   1291  C  C     . THR B 2 80  ? 3.706   -34.859 33.626 1.00 76.99  ? 80   THR B C     1 
ATOM   1292  O  O     . THR B 2 80  ? 3.182   -34.295 32.666 1.00 77.03  ? 80   THR B O     1 
ATOM   1293  C  CB    . THR B 2 80  ? 6.085   -34.984 33.006 1.00 78.25  ? 80   THR B CB    1 
ATOM   1294  O  OG1   . THR B 2 80  ? 7.031   -35.808 32.301 1.00 79.18  ? 80   THR B OG1   1 
ATOM   1295  C  CG2   . THR B 2 80  ? 6.734   -34.388 34.251 1.00 78.45  ? 80   THR B CG2   1 
ATOM   1296  N  N     . VAL B 2 81  ? 3.321   -34.715 34.891 1.00 75.85  ? 81   VAL B N     1 
ATOM   1297  C  CA    . VAL B 2 81  ? 2.272   -33.786 35.327 1.00 74.19  ? 81   VAL B CA    1 
ATOM   1298  C  C     . VAL B 2 81  ? 2.879   -32.400 35.509 1.00 73.11  ? 81   VAL B C     1 
ATOM   1299  O  O     . VAL B 2 81  ? 3.846   -32.224 36.248 1.00 73.14  ? 81   VAL B O     1 
ATOM   1300  C  CB    . VAL B 2 81  ? 1.617   -34.241 36.661 1.00 74.22  ? 81   VAL B CB    1 
ATOM   1301  C  CG1   . VAL B 2 81  ? 0.439   -33.353 37.012 1.00 73.49  ? 81   VAL B CG1   1 
ATOM   1302  C  CG2   . VAL B 2 81  ? 1.187   -35.682 36.574 1.00 73.08  ? 81   VAL B CG2   1 
ATOM   1303  N  N     . THR B 2 82  ? 2.294   -31.424 34.829 1.00 71.90  ? 82   THR B N     1 
ATOM   1304  C  CA    . THR B 2 82  ? 2.853   -30.085 34.741 1.00 70.52  ? 82   THR B CA    1 
ATOM   1305  C  C     . THR B 2 82  ? 2.110   -29.115 35.641 1.00 69.97  ? 82   THR B C     1 
ATOM   1306  O  O     . THR B 2 82  ? 0.939   -29.340 35.995 1.00 70.20  ? 82   THR B O     1 
ATOM   1307  C  CB    . THR B 2 82  ? 2.790   -29.564 33.277 1.00 70.84  ? 82   THR B CB    1 
ATOM   1308  O  OG1   . THR B 2 82  ? 1.539   -29.933 32.666 1.00 69.67  ? 82   THR B OG1   1 
ATOM   1309  C  CG2   . THR B 2 82  ? 3.924   -30.157 32.463 1.00 70.14  ? 82   THR B CG2   1 
ATOM   1310  N  N     . ALA B 2 83  ? 2.766   -28.015 35.998 1.00 68.68  ? 83   ALA B N     1 
ATOM   1311  C  CA    . ALA B 2 83  ? 2.092   -27.003 36.804 1.00 67.28  ? 83   ALA B CA    1 
ATOM   1312  C  C     . ALA B 2 83  ? 0.743   -26.619 36.178 1.00 66.51  ? 83   ALA B C     1 
ATOM   1313  O  O     . ALA B 2 83  ? -0.215  -26.370 36.894 1.00 65.85  ? 83   ALA B O     1 
ATOM   1314  C  CB    . ALA B 2 83  ? 2.965   -25.803 37.024 1.00 66.54  ? 83   ALA B CB    1 
ATOM   1315  N  N     . MET B 2 84  ? 0.667   -26.624 34.849 1.00 65.76  ? 84   MET B N     1 
ATOM   1316  C  CA    . MET B 2 84  ? -0.545  -26.221 34.153 1.00 65.26  ? 84   MET B CA    1 
ATOM   1317  C  C     . MET B 2 84  ? -1.706  -27.200 34.251 1.00 65.41  ? 84   MET B C     1 
ATOM   1318  O  O     . MET B 2 84  ? -2.867  -26.802 34.151 1.00 65.16  ? 84   MET B O     1 
ATOM   1319  C  CB    . MET B 2 84  ? -0.257  -25.952 32.685 1.00 64.84  ? 84   MET B CB    1 
ATOM   1320  C  CG    . MET B 2 84  ? 0.558   -24.700 32.446 1.00 66.37  ? 84   MET B CG    1 
ATOM   1321  S  SD    . MET B 2 84  ? -0.121  -23.184 33.168 1.00 65.53  ? 84   MET B SD    1 
ATOM   1322  C  CE    . MET B 2 84  ? -1.754  -23.151 32.386 1.00 65.97  ? 84   MET B CE    1 
ATOM   1323  N  N     . ASP B 2 85  ? -1.406  -28.489 34.392 1.00 65.62  ? 85   ASP B N     1 
ATOM   1324  C  CA    . ASP B 2 85  ? -2.472  -29.468 34.492 1.00 65.01  ? 85   ASP B CA    1 
ATOM   1325  C  C     . ASP B 2 85  ? -3.120  -29.272 35.840 1.00 64.90  ? 85   ASP B C     1 
ATOM   1326  O  O     . ASP B 2 85  ? -4.353  -29.265 35.966 1.00 65.33  ? 85   ASP B O     1 
ATOM   1327  C  CB    . ASP B 2 85  ? -1.930  -30.872 34.356 1.00 65.36  ? 85   ASP B CB    1 
ATOM   1328  C  CG    . ASP B 2 85  ? -1.510  -31.213 32.932 1.00 66.03  ? 85   ASP B CG    1 
ATOM   1329  O  OD1   . ASP B 2 85  ? -1.661  -30.387 31.999 1.00 65.86  ? 85   ASP B OD1   1 
ATOM   1330  O  OD2   . ASP B 2 85  ? -1.021  -32.341 32.747 1.00 67.38  ? 85   ASP B OD2   1 
ATOM   1331  N  N     . VAL B 2 86  ? -2.282  -29.072 36.849 1.00 64.27  ? 86   VAL B N     1 
ATOM   1332  C  CA    . VAL B 2 86  ? -2.764  -28.708 38.170 1.00 63.91  ? 86   VAL B CA    1 
ATOM   1333  C  C     . VAL B 2 86  ? -3.659  -27.452 38.123 1.00 64.53  ? 86   VAL B C     1 
ATOM   1334  O  O     . VAL B 2 86  ? -4.784  -27.460 38.652 1.00 64.93  ? 86   VAL B O     1 
ATOM   1335  C  CB    . VAL B 2 86  ? -1.584  -28.585 39.169 1.00 63.30  ? 86   VAL B CB    1 
ATOM   1336  C  CG1   . VAL B 2 86  ? -1.974  -27.901 40.422 1.00 61.15  ? 86   VAL B CG1   1 
ATOM   1337  C  CG2   . VAL B 2 86  ? -1.088  -29.957 39.509 1.00 63.15  ? 86   VAL B CG2   1 
ATOM   1338  N  N     . VAL B 2 87  ? -3.185  -26.393 37.469 1.00 64.39  ? 87   VAL B N     1 
ATOM   1339  C  CA    . VAL B 2 87  ? -3.874  -25.112 37.540 1.00 64.59  ? 87   VAL B CA    1 
ATOM   1340  C  C     . VAL B 2 87  ? -5.221  -25.169 36.839 1.00 65.22  ? 87   VAL B C     1 
ATOM   1341  O  O     . VAL B 2 87  ? -6.178  -24.500 37.250 1.00 65.76  ? 87   VAL B O     1 
ATOM   1342  C  CB    . VAL B 2 87  ? -3.048  -24.013 36.953 1.00 64.20  ? 87   VAL B CB    1 
ATOM   1343  C  CG1   . VAL B 2 87  ? -3.906  -22.780 36.677 1.00 63.85  ? 87   VAL B CG1   1 
ATOM   1344  C  CG2   . VAL B 2 87  ? -1.895  -23.695 37.896 1.00 65.83  ? 87   VAL B CG2   1 
ATOM   1345  N  N     . TYR B 2 88  ? -5.276  -25.963 35.782 1.00 65.19  ? 88   TYR B N     1 
ATOM   1346  C  CA    . TYR B 2 88  ? -6.482  -26.179 35.047 1.00 65.65  ? 88   TYR B CA    1 
ATOM   1347  C  C     . TYR B 2 88  ? -7.497  -26.984 35.867 1.00 65.92  ? 88   TYR B C     1 
ATOM   1348  O  O     . TYR B 2 88  ? -8.732  -26.783 35.754 1.00 65.74  ? 88   TYR B O     1 
ATOM   1349  C  CB    . TYR B 2 88  ? -6.142  -26.954 33.800 1.00 66.40  ? 88   TYR B CB    1 
ATOM   1350  C  CG    . TYR B 2 88  ? -5.525  -26.148 32.698 1.00 68.15  ? 88   TYR B CG    1 
ATOM   1351  C  CD1   . TYR B 2 88  ? -4.749  -26.764 31.731 1.00 68.97  ? 88   TYR B CD1   1 
ATOM   1352  C  CD2   . TYR B 2 88  ? -5.737  -24.768 32.595 1.00 69.89  ? 88   TYR B CD2   1 
ATOM   1353  C  CE1   . TYR B 2 88  ? -4.201  -26.032 30.690 1.00 70.22  ? 88   TYR B CE1   1 
ATOM   1354  C  CE2   . TYR B 2 88  ? -5.172  -24.024 31.557 1.00 68.81  ? 88   TYR B CE2   1 
ATOM   1355  C  CZ    . TYR B 2 88  ? -4.410  -24.666 30.609 1.00 68.82  ? 88   TYR B CZ    1 
ATOM   1356  O  OH    . TYR B 2 88  ? -3.842  -23.961 29.563 1.00 69.60  ? 88   TYR B OH    1 
ATOM   1357  N  N     . ALA B 2 89  ? -6.971  -27.908 36.677 1.00 65.41  ? 89   ALA B N     1 
ATOM   1358  C  CA    . ALA B 2 89  ? -7.810  -28.763 37.486 1.00 64.63  ? 89   ALA B CA    1 
ATOM   1359  C  C     . ALA B 2 89  ? -8.518  -27.877 38.493 1.00 64.40  ? 89   ALA B C     1 
ATOM   1360  O  O     . ALA B 2 89  ? -9.750  -27.738 38.442 1.00 64.87  ? 89   ALA B O     1 
ATOM   1361  C  CB    . ALA B 2 89  ? -6.997  -29.809 38.161 1.00 65.11  ? 89   ALA B CB    1 
ATOM   1362  N  N     . LEU B 2 90  ? -7.740  -27.224 39.354 1.00 63.11  ? 90   LEU B N     1 
ATOM   1363  C  CA    . LEU B 2 90  ? -8.263  -26.221 40.274 1.00 62.12  ? 90   LEU B CA    1 
ATOM   1364  C  C     . LEU B 2 90  ? -9.356  -25.328 39.649 1.00 63.23  ? 90   LEU B C     1 
ATOM   1365  O  O     . LEU B 2 90  ? -10.490 -25.269 40.173 1.00 62.98  ? 90   LEU B O     1 
ATOM   1366  C  CB    . LEU B 2 90  ? -7.127  -25.411 40.865 1.00 61.20  ? 90   LEU B CB    1 
ATOM   1367  C  CG    . LEU B 2 90  ? -6.064  -26.286 41.563 1.00 59.29  ? 90   LEU B CG    1 
ATOM   1368  C  CD1   . LEU B 2 90  ? -4.739  -25.605 41.668 1.00 56.29  ? 90   LEU B CD1   1 
ATOM   1369  C  CD2   . LEU B 2 90  ? -6.539  -26.788 42.925 1.00 55.46  ? 90   LEU B CD2   1 
ATOM   1370  N  N     . LYS B 2 91  ? -9.047  -24.680 38.522 1.00 63.39  ? 91   LYS B N     1 
ATOM   1371  C  CA    . LYS B 2 91  ? -10.029 -23.823 37.859 1.00 64.07  ? 91   LYS B CA    1 
ATOM   1372  C  C     . LYS B 2 91  ? -11.343 -24.584 37.586 1.00 64.52  ? 91   LYS B C     1 
ATOM   1373  O  O     . LYS B 2 91  ? -12.433 -24.049 37.835 1.00 64.59  ? 91   LYS B O     1 
ATOM   1374  C  CB    . LYS B 2 91  ? -9.461  -23.160 36.579 1.00 63.95  ? 91   LYS B CB    1 
ATOM   1375  C  CG    . LYS B 2 91  ? -10.526 -22.478 35.677 1.00 64.02  ? 91   LYS B CG    1 
ATOM   1376  C  CD    . LYS B 2 91  ? -10.112 -21.086 35.170 1.00 65.80  ? 91   LYS B CD    1 
ATOM   1377  C  CE    . LYS B 2 91  ? -9.452  -21.107 33.784 1.00 68.69  ? 91   LYS B CE    1 
ATOM   1378  N  NZ    . LYS B 2 91  ? -7.930  -21.290 33.768 1.00 68.87  ? 91   LYS B NZ    1 
ATOM   1379  N  N     . ARG B 2 92  ? -11.218 -25.821 37.082 1.00 64.70  ? 92   ARG B N     1 
ATOM   1380  C  CA    . ARG B 2 92  ? -12.345 -26.724 36.854 1.00 64.50  ? 92   ARG B CA    1 
ATOM   1381  C  C     . ARG B 2 92  ? -13.268 -26.792 38.062 1.00 64.36  ? 92   ARG B C     1 
ATOM   1382  O  O     . ARG B 2 92  ? -14.502 -26.695 37.919 1.00 65.12  ? 92   ARG B O     1 
ATOM   1383  C  CB    . ARG B 2 92  ? -11.847 -28.145 36.609 1.00 65.07  ? 92   ARG B CB    1 
ATOM   1384  C  CG    . ARG B 2 92  ? -11.979 -28.674 35.203 1.00 65.60  ? 92   ARG B CG    1 
ATOM   1385  C  CD    . ARG B 2 92  ? -12.371 -30.134 35.229 1.00 63.03  ? 92   ARG B CD    1 
ATOM   1386  N  NE    . ARG B 2 92  ? -13.818 -30.238 35.135 1.00 64.50  ? 92   ARG B NE    1 
ATOM   1387  C  CZ    . ARG B 2 92  ? -14.611 -30.752 36.070 1.00 66.73  ? 92   ARG B CZ    1 
ATOM   1388  N  NH1   . ARG B 2 92  ? -14.091 -31.262 37.184 1.00 66.16  ? 92   ARG B NH1   1 
ATOM   1389  N  NH2   . ARG B 2 92  ? -15.937 -30.781 35.881 1.00 66.64  ? 92   ARG B NH2   1 
ATOM   1390  N  N     . GLN B 2 93  ? -12.660 -26.994 39.232 1.00 63.11  ? 93   GLN B N     1 
ATOM   1391  C  CA    . GLN B 2 93  ? -13.368 -27.178 40.498 1.00 61.99  ? 93   GLN B CA    1 
ATOM   1392  C  C     . GLN B 2 93  ? -13.545 -25.859 41.226 1.00 60.98  ? 93   GLN B C     1 
ATOM   1393  O  O     . GLN B 2 93  ? -13.621 -25.841 42.446 1.00 61.13  ? 93   GLN B O     1 
ATOM   1394  C  CB    . GLN B 2 93  ? -12.549 -28.061 41.439 1.00 62.42  ? 93   GLN B CB    1 
ATOM   1395  C  CG    . GLN B 2 93  ? -11.699 -29.132 40.777 1.00 62.57  ? 93   GLN B CG    1 
ATOM   1396  C  CD    . GLN B 2 93  ? -12.239 -30.513 41.022 1.00 63.06  ? 93   GLN B CD    1 
ATOM   1397  O  OE1   . GLN B 2 93  ? -12.984 -30.736 41.981 1.00 65.14  ? 93   GLN B OE1   1 
ATOM   1398  N  NE2   . GLN B 2 93  ? -11.887 -31.451 40.151 1.00 61.93  ? 93   GLN B NE2   1 
ATOM   1399  N  N     . GLY B 2 94  ? -13.561 -24.757 40.498 1.00 59.61  ? 94   GLY B N     1 
ATOM   1400  C  CA    . GLY B 2 94  ? -13.772 -23.465 41.117 1.00 59.25  ? 94   GLY B CA    1 
ATOM   1401  C  C     . GLY B 2 94  ? -12.874 -23.162 42.292 1.00 58.83  ? 94   GLY B C     1 
ATOM   1402  O  O     . GLY B 2 94  ? -13.336 -22.642 43.290 1.00 58.76  ? 94   GLY B O     1 
ATOM   1403  N  N     . ARG B 2 95  ? -11.592 -23.508 42.172 1.00 58.97  ? 95   ARG B N     1 
ATOM   1404  C  CA    . ARG B 2 95  ? -10.568 -23.095 43.120 1.00 58.50  ? 95   ARG B CA    1 
ATOM   1405  C  C     . ARG B 2 95  ? -9.417  -22.465 42.342 1.00 58.88  ? 95   ARG B C     1 
ATOM   1406  O  O     . ARG B 2 95  ? -8.237  -22.859 42.500 1.00 58.69  ? 95   ARG B O     1 
ATOM   1407  C  CB    . ARG B 2 95  ? -10.086 -24.275 43.957 1.00 58.44  ? 95   ARG B CB    1 
ATOM   1408  C  CG    . ARG B 2 95  ? -11.223 -25.060 44.599 1.00 60.15  ? 95   ARG B CG    1 
ATOM   1409  C  CD    . ARG B 2 95  ? -10.911 -25.598 45.988 1.00 61.13  ? 95   ARG B CD    1 
ATOM   1410  N  NE    . ARG B 2 95  ? -9.870  -24.827 46.684 1.00 65.35  ? 95   ARG B NE    1 
ATOM   1411  C  CZ    . ARG B 2 95  ? -10.073 -23.817 47.536 1.00 66.65  ? 95   ARG B CZ    1 
ATOM   1412  N  NH1   . ARG B 2 95  ? -11.313 -23.390 47.849 1.00 66.78  ? 95   ARG B NH1   1 
ATOM   1413  N  NH2   . ARG B 2 95  ? -9.018  -23.240 48.097 1.00 64.95  ? 95   ARG B NH2   1 
ATOM   1414  N  N     . THR B 2 96  ? -9.754  -21.467 41.515 1.00 58.73  ? 96   THR B N     1 
ATOM   1415  C  CA    . THR B 2 96  ? -8.767  -20.840 40.623 1.00 58.67  ? 96   THR B CA    1 
ATOM   1416  C  C     . THR B 2 96  ? -7.509  -20.421 41.392 1.00 58.36  ? 96   THR B C     1 
ATOM   1417  O  O     . THR B 2 96  ? -7.603  -19.795 42.452 1.00 57.98  ? 96   THR B O     1 
ATOM   1418  C  CB    . THR B 2 96  ? -9.355  -19.619 39.884 1.00 58.80  ? 96   THR B CB    1 
ATOM   1419  O  OG1   . THR B 2 96  ? -10.408 -20.043 39.012 1.00 58.41  ? 96   THR B OG1   1 
ATOM   1420  C  CG2   . THR B 2 96  ? -8.282  -18.943 39.066 1.00 57.78  ? 96   THR B CG2   1 
ATOM   1421  N  N     . LEU B 2 97  ? -6.344  -20.773 40.861 1.00 58.39  ? 97   LEU B N     1 
ATOM   1422  C  CA    . LEU B 2 97  ? -5.060  -20.406 41.499 1.00 58.55  ? 97   LEU B CA    1 
ATOM   1423  C  C     . LEU B 2 97  ? -4.230  -19.507 40.599 1.00 59.11  ? 97   LEU B C     1 
ATOM   1424  O  O     . LEU B 2 97  ? -3.938  -19.864 39.441 1.00 59.38  ? 97   LEU B O     1 
ATOM   1425  C  CB    . LEU B 2 97  ? -4.222  -21.644 41.857 1.00 57.64  ? 97   LEU B CB    1 
ATOM   1426  C  CG    . LEU B 2 97  ? -2.883  -21.280 42.516 1.00 56.46  ? 97   LEU B CG    1 
ATOM   1427  C  CD1   . LEU B 2 97  ? -2.951  -21.349 44.009 1.00 55.47  ? 97   LEU B CD1   1 
ATOM   1428  C  CD2   . LEU B 2 97  ? -1.763  -22.137 42.052 1.00 54.19  ? 97   LEU B CD2   1 
ATOM   1429  N  N     . TYR B 2 98  ? -3.845  -18.355 41.139 1.00 59.43  ? 98   TYR B N     1 
ATOM   1430  C  CA    . TYR B 2 98  ? -2.871  -17.484 40.488 1.00 60.00  ? 98   TYR B CA    1 
ATOM   1431  C  C     . TYR B 2 98  ? -1.481  -17.761 41.047 1.00 60.34  ? 98   TYR B C     1 
ATOM   1432  O  O     . TYR B 2 98  ? -1.349  -18.119 42.230 1.00 60.02  ? 98   TYR B O     1 
ATOM   1433  C  CB    . TYR B 2 98  ? -3.178  -16.038 40.768 1.00 60.03  ? 98   TYR B CB    1 
ATOM   1434  C  CG    . TYR B 2 98  ? -4.448  -15.504 40.189 1.00 60.99  ? 98   TYR B CG    1 
ATOM   1435  C  CD1   . TYR B 2 98  ? -5.254  -16.269 39.356 1.00 61.89  ? 98   TYR B CD1   1 
ATOM   1436  C  CD2   . TYR B 2 98  ? -4.826  -14.196 40.453 1.00 61.08  ? 98   TYR B CD2   1 
ATOM   1437  C  CE1   . TYR B 2 98  ? -6.436  -15.737 38.816 1.00 63.31  ? 98   TYR B CE1   1 
ATOM   1438  C  CE2   . TYR B 2 98  ? -5.986  -13.663 39.926 1.00 63.71  ? 98   TYR B CE2   1 
ATOM   1439  C  CZ    . TYR B 2 98  ? -6.789  -14.429 39.101 1.00 62.33  ? 98   TYR B CZ    1 
ATOM   1440  O  OH    . TYR B 2 98  ? -7.928  -13.865 38.584 1.00 60.67  ? 98   TYR B OH    1 
ATOM   1441  N  N     . GLY B 2 99  ? -0.470  -17.604 40.191 1.00 60.30  ? 99   GLY B N     1 
ATOM   1442  C  CA    . GLY B 2 99  ? 0.918   -17.641 40.604 1.00 61.27  ? 99   GLY B CA    1 
ATOM   1443  C  C     . GLY B 2 99  ? 1.780   -18.648 39.875 1.00 62.20  ? 99   GLY B C     1 
ATOM   1444  O  O     . GLY B 2 99  ? 3.008   -18.652 40.063 1.00 61.96  ? 99   GLY B O     1 
ATOM   1445  N  N     . PHE B 2 100 ? 1.144   -19.493 39.048 1.00 62.32  ? 100  PHE B N     1 
ATOM   1446  C  CA    . PHE B 2 100 ? 1.810   -20.645 38.453 1.00 62.27  ? 100  PHE B CA    1 
ATOM   1447  C  C     . PHE B 2 100 ? 1.606   -20.824 36.955 1.00 63.04  ? 100  PHE B C     1 
ATOM   1448  O  O     . PHE B 2 100 ? 1.845   -21.908 36.425 1.00 63.92  ? 100  PHE B O     1 
ATOM   1449  C  CB    . PHE B 2 100 ? 1.388   -21.920 39.183 1.00 61.99  ? 100  PHE B CB    1 
ATOM   1450  C  CG    . PHE B 2 100 ? 2.066   -22.103 40.504 1.00 62.09  ? 100  PHE B CG    1 
ATOM   1451  C  CD1   . PHE B 2 100 ? 1.501   -21.603 41.662 1.00 60.63  ? 100  PHE B CD1   1 
ATOM   1452  C  CD2   . PHE B 2 100 ? 3.296   -22.763 40.585 1.00 62.14  ? 100  PHE B CD2   1 
ATOM   1453  C  CE1   . PHE B 2 100 ? 2.128   -21.752 42.878 1.00 61.00  ? 100  PHE B CE1   1 
ATOM   1454  C  CE2   . PHE B 2 100 ? 3.942   -22.919 41.803 1.00 61.67  ? 100  PHE B CE2   1 
ATOM   1455  C  CZ    . PHE B 2 100 ? 3.352   -22.412 42.955 1.00 62.10  ? 100  PHE B CZ    1 
ATOM   1456  N  N     . GLY B 2 101 ? 1.198   -19.771 36.263 1.00 63.75  ? 101  GLY B N     1 
ATOM   1457  C  CA    . GLY B 2 101 ? 0.844   -19.863 34.851 1.00 64.50  ? 101  GLY B CA    1 
ATOM   1458  C  C     . GLY B 2 101 ? -0.666  -19.832 34.730 1.00 65.53  ? 101  GLY B C     1 
ATOM   1459  O  O     . GLY B 2 101 ? -1.380  -19.849 35.753 1.00 65.42  ? 101  GLY B O     1 
ATOM   1460  N  N     . GLY B 2 102 ? -1.160  -19.771 33.492 1.00 66.41  ? 102  GLY B N     1 
ATOM   1461  C  CA    . GLY B 2 102 ? -2.613  -19.774 33.239 1.00 67.30  ? 102  GLY B CA    1 
ATOM   1462  C  C     . GLY B 2 102 ? -3.214  -18.445 32.798 1.00 68.04  ? 102  GLY B C     1 
ATOM   1463  O  O     . GLY B 2 102 ? -4.059  -18.437 31.911 1.00 68.45  ? 102  GLY B O     1 
ATOM   1464  O  OXT   . GLY B 2 102 ? -2.910  -17.342 33.285 1.00 68.53  ? 102  GLY B OXT   1 
ATOM   1465  N  N     . THR C 3 16  ? -29.489 -41.957 7.480  1.00 100.43 ? 16   THR C N     1 
ATOM   1466  C  CA    . THR C 3 16  ? -29.019 -41.058 8.580  1.00 100.46 ? 16   THR C CA    1 
ATOM   1467  C  C     . THR C 3 16  ? -27.630 -41.469 9.106  1.00 100.46 ? 16   THR C C     1 
ATOM   1468  O  O     . THR C 3 16  ? -26.778 -41.944 8.344  1.00 100.65 ? 16   THR C O     1 
ATOM   1469  C  CB    . THR C 3 16  ? -30.029 -41.020 9.756  1.00 100.39 ? 16   THR C CB    1 
ATOM   1470  O  OG1   . THR C 3 16  ? -30.175 -42.335 10.305 1.00 100.48 ? 16   THR C OG1   1 
ATOM   1471  C  CG2   . THR C 3 16  ? -31.388 -40.511 9.301  1.00 100.36 ? 16   THR C CG2   1 
ATOM   1472  N  N     . ARG C 3 17  ? -27.414 -41.255 10.403 1.00 100.24 ? 17   ARG C N     1 
ATOM   1473  C  CA    . ARG C 3 17  ? -26.213 -41.701 11.110 1.00 99.97  ? 17   ARG C CA    1 
ATOM   1474  C  C     . ARG C 3 17  ? -26.579 -42.200 12.504 1.00 99.82  ? 17   ARG C C     1 
ATOM   1475  O  O     . ARG C 3 17  ? -25.825 -42.963 13.115 1.00 99.69  ? 17   ARG C O     1 
ATOM   1476  C  CB    . ARG C 3 17  ? -25.188 -40.576 11.219 1.00 99.83  ? 17   ARG C CB    1 
ATOM   1477  C  CG    . ARG C 3 17  ? -24.298 -40.423 10.015 1.00 99.31  ? 17   ARG C CG    1 
ATOM   1478  C  CD    . ARG C 3 17  ? -23.473 -39.159 10.120 1.00 98.52  ? 17   ARG C CD    1 
ATOM   1479  N  NE    . ARG C 3 17  ? -24.283 -37.957 9.921  1.00 98.03  ? 17   ARG C NE    1 
ATOM   1480  C  CZ    . ARG C 3 17  ? -23.843 -36.712 10.096 1.00 97.77  ? 17   ARG C CZ    1 
ATOM   1481  N  NH1   . ARG C 3 17  ? -22.594 -36.477 10.485 1.00 97.53  ? 17   ARG C NH1   1 
ATOM   1482  N  NH2   . ARG C 3 17  ? -24.657 -35.694 9.883  1.00 97.41  ? 17   ARG C NH2   1 
ATOM   1483  N  N     . SER C 3 18  ? -27.733 -41.751 13.001 1.00 99.55  ? 18   SER C N     1 
ATOM   1484  C  CA    . SER C 3 18  ? -28.312 -42.289 14.230 1.00 99.43  ? 18   SER C CA    1 
ATOM   1485  C  C     . SER C 3 18  ? -28.445 -43.796 14.055 1.00 99.22  ? 18   SER C C     1 
ATOM   1486  O  O     . SER C 3 18  ? -27.997 -44.576 14.900 1.00 99.27  ? 18   SER C O     1 
ATOM   1487  C  CB    . SER C 3 18  ? -29.672 -41.642 14.534 1.00 99.51  ? 18   SER C CB    1 
ATOM   1488  O  OG    . SER C 3 18  ? -29.568 -40.228 14.648 1.00 99.54  ? 18   SER C OG    1 
ATOM   1489  N  N     . SER C 3 19  ? -29.036 -44.177 12.927 1.00 98.97  ? 19   SER C N     1 
ATOM   1490  C  CA    . SER C 3 19  ? -29.102 -45.559 12.461 1.00 98.71  ? 19   SER C CA    1 
ATOM   1491  C  C     . SER C 3 19  ? -27.717 -46.200 12.413 1.00 98.26  ? 19   SER C C     1 
ATOM   1492  O  O     . SER C 3 19  ? -27.460 -47.205 13.076 1.00 98.13  ? 19   SER C O     1 
ATOM   1493  C  CB    . SER C 3 19  ? -29.695 -45.569 11.056 1.00 98.72  ? 19   SER C CB    1 
ATOM   1494  O  OG    . SER C 3 19  ? -28.942 -44.691 10.224 1.00 99.24  ? 19   SER C OG    1 
ATOM   1495  N  N     . ARG C 3 20  ? -26.826 -45.596 11.632 1.00 97.88  ? 20   ARG C N     1 
ATOM   1496  C  CA    . ARG C 3 20  ? -25.494 -46.143 11.395 1.00 97.70  ? 20   ARG C CA    1 
ATOM   1497  C  C     . ARG C 3 20  ? -24.670 -46.321 12.677 1.00 97.25  ? 20   ARG C C     1 
ATOM   1498  O  O     . ARG C 3 20  ? -23.624 -46.972 12.664 1.00 97.11  ? 20   ARG C O     1 
ATOM   1499  C  CB    . ARG C 3 20  ? -24.727 -45.251 10.418 1.00 98.04  ? 20   ARG C CB    1 
ATOM   1500  C  CG    . ARG C 3 20  ? -25.340 -45.096 9.035  1.00 98.93  ? 20   ARG C CG    1 
ATOM   1501  C  CD    . ARG C 3 20  ? -24.251 -44.655 8.059  1.00 101.40 ? 20   ARG C CD    1 
ATOM   1502  N  NE    . ARG C 3 20  ? -24.772 -44.090 6.814  1.00 102.81 ? 20   ARG C NE    1 
ATOM   1503  C  CZ    . ARG C 3 20  ? -24.823 -44.733 5.648  1.00 103.90 ? 20   ARG C CZ    1 
ATOM   1504  N  NH1   . ARG C 3 20  ? -24.398 -45.989 5.544  1.00 104.34 ? 20   ARG C NH1   1 
ATOM   1505  N  NH2   . ARG C 3 20  ? -25.309 -44.117 4.577  1.00 104.77 ? 20   ARG C NH2   1 
ATOM   1506  N  N     . ALA C 3 21  ? -25.146 -45.725 13.769 1.00 96.81  ? 21   ALA C N     1 
ATOM   1507  C  CA    . ALA C 3 21  ? -24.468 -45.775 15.068 1.00 96.13  ? 21   ALA C CA    1 
ATOM   1508  C  C     . ALA C 3 21  ? -25.353 -46.428 16.131 1.00 95.73  ? 21   ALA C C     1 
ATOM   1509  O  O     . ALA C 3 21  ? -24.960 -46.557 17.294 1.00 95.47  ? 21   ALA C O     1 
ATOM   1510  C  CB    . ALA C 3 21  ? -24.078 -44.383 15.495 1.00 96.12  ? 21   ALA C CB    1 
ATOM   1511  N  N     . GLY C 3 22  ? -26.556 -46.825 15.714 1.00 95.41  ? 22   GLY C N     1 
ATOM   1512  C  CA    . GLY C 3 22  ? -27.513 -47.522 16.579 1.00 94.75  ? 22   GLY C CA    1 
ATOM   1513  C  C     . GLY C 3 22  ? -28.170 -46.589 17.563 1.00 94.16  ? 22   GLY C C     1 
ATOM   1514  O  O     . GLY C 3 22  ? -28.807 -47.021 18.521 1.00 94.00  ? 22   GLY C O     1 
ATOM   1515  N  N     . LEU C 3 23  ? -28.011 -45.299 17.308 1.00 93.74  ? 23   LEU C N     1 
ATOM   1516  C  CA    . LEU C 3 23  ? -28.461 -44.281 18.225 1.00 93.55  ? 23   LEU C CA    1 
ATOM   1517  C  C     . LEU C 3 23  ? -29.859 -43.802 17.885 1.00 93.43  ? 23   LEU C C     1 
ATOM   1518  O  O     . LEU C 3 23  ? -30.293 -43.883 16.739 1.00 93.54  ? 23   LEU C O     1 
ATOM   1519  C  CB    . LEU C 3 23  ? -27.469 -43.108 18.257 1.00 93.39  ? 23   LEU C CB    1 
ATOM   1520  C  CG    . LEU C 3 23  ? -26.119 -43.421 18.916 1.00 93.24  ? 23   LEU C CG    1 
ATOM   1521  C  CD1   . LEU C 3 23  ? -25.069 -42.378 18.582 1.00 93.31  ? 23   LEU C CD1   1 
ATOM   1522  C  CD2   . LEU C 3 23  ? -26.270 -43.568 20.418 1.00 93.02  ? 23   LEU C CD2   1 
ATOM   1523  N  N     . GLN C 3 24  ? -30.555 -43.311 18.905 1.00 93.13  ? 24   GLN C N     1 
ATOM   1524  C  CA    . GLN C 3 24  ? -31.862 -42.706 18.745 1.00 92.80  ? 24   GLN C CA    1 
ATOM   1525  C  C     . GLN C 3 24  ? -31.721 -41.193 18.651 1.00 92.49  ? 24   GLN C C     1 
ATOM   1526  O  O     . GLN C 3 24  ? -32.638 -40.491 18.208 1.00 92.77  ? 24   GLN C O     1 
ATOM   1527  C  CB    . GLN C 3 24  ? -32.748 -43.079 19.931 1.00 92.98  ? 24   GLN C CB    1 
ATOM   1528  C  CG    . GLN C 3 24  ? -32.710 -44.559 20.283 1.00 93.54  ? 24   GLN C CG    1 
ATOM   1529  C  CD    . GLN C 3 24  ? -32.840 -45.446 19.059 1.00 94.32  ? 24   GLN C CD    1 
ATOM   1530  O  OE1   . GLN C 3 24  ? -33.772 -45.298 18.258 1.00 94.37  ? 24   GLN C OE1   1 
ATOM   1531  N  NE2   . GLN C 3 24  ? -31.896 -46.370 18.903 1.00 94.10  ? 24   GLN C NE2   1 
ATOM   1532  N  N     . PHE C 3 25  ? -30.559 -40.698 19.060 1.00 91.72  ? 25   PHE C N     1 
ATOM   1533  C  CA    . PHE C 3 25  ? -30.338 -39.265 19.184 1.00 91.08  ? 25   PHE C CA    1 
ATOM   1534  C  C     . PHE C 3 25  ? -29.697 -38.671 17.931 1.00 90.59  ? 25   PHE C C     1 
ATOM   1535  O  O     . PHE C 3 25  ? -28.744 -39.247 17.383 1.00 90.80  ? 25   PHE C O     1 
ATOM   1536  C  CB    . PHE C 3 25  ? -29.544 -38.944 20.467 1.00 91.00  ? 25   PHE C CB    1 
ATOM   1537  C  CG    . PHE C 3 25  ? -30.424 -38.620 21.654 1.00 90.78  ? 25   PHE C CG    1 
ATOM   1538  C  CD1   . PHE C 3 25  ? -31.680 -39.223 21.803 1.00 90.27  ? 25   PHE C CD1   1 
ATOM   1539  C  CD2   . PHE C 3 25  ? -30.008 -37.710 22.616 1.00 89.87  ? 25   PHE C CD2   1 
ATOM   1540  C  CE1   . PHE C 3 25  ? -32.494 -38.922 22.887 1.00 88.86  ? 25   PHE C CE1   1 
ATOM   1541  C  CE2   . PHE C 3 25  ? -30.819 -37.403 23.695 1.00 88.96  ? 25   PHE C CE2   1 
ATOM   1542  C  CZ    . PHE C 3 25  ? -32.067 -38.009 23.825 1.00 89.51  ? 25   PHE C CZ    1 
ATOM   1543  N  N     . PRO C 3 26  ? -30.223 -37.512 17.481 1.00 89.72  ? 26   PRO C N     1 
ATOM   1544  C  CA    . PRO C 3 26  ? -29.906 -36.938 16.185 1.00 88.83  ? 26   PRO C CA    1 
ATOM   1545  C  C     . PRO C 3 26  ? -28.426 -36.613 16.028 1.00 88.10  ? 26   PRO C C     1 
ATOM   1546  O  O     . PRO C 3 26  ? -27.986 -35.531 16.393 1.00 87.93  ? 26   PRO C O     1 
ATOM   1547  C  CB    . PRO C 3 26  ? -30.783 -35.679 16.137 1.00 88.70  ? 26   PRO C CB    1 
ATOM   1548  C  CG    . PRO C 3 26  ? -31.067 -35.358 17.529 1.00 88.97  ? 26   PRO C CG    1 
ATOM   1549  C  CD    . PRO C 3 26  ? -31.161 -36.660 18.233 1.00 89.58  ? 26   PRO C CD    1 
ATOM   1550  N  N     . VAL C 3 27  ? -27.688 -37.568 15.471 1.00 87.68  ? 27   VAL C N     1 
ATOM   1551  C  CA    . VAL C 3 27  ? -26.262 -37.437 15.161 1.00 87.29  ? 27   VAL C CA    1 
ATOM   1552  C  C     . VAL C 3 27  ? -25.937 -36.266 14.223 1.00 87.38  ? 27   VAL C C     1 
ATOM   1553  O  O     . VAL C 3 27  ? -24.821 -35.737 14.251 1.00 87.74  ? 27   VAL C O     1 
ATOM   1554  C  CB    . VAL C 3 27  ? -25.710 -38.741 14.552 1.00 87.14  ? 27   VAL C CB    1 
ATOM   1555  C  CG1   . VAL C 3 27  ? -24.210 -38.643 14.335 1.00 86.80  ? 27   VAL C CG1   1 
ATOM   1556  C  CG2   . VAL C 3 27  ? -26.023 -39.906 15.455 1.00 86.59  ? 27   VAL C CG2   1 
ATOM   1557  N  N     . GLY C 3 28  ? -26.904 -35.873 13.396 1.00 87.24  ? 28   GLY C N     1 
ATOM   1558  C  CA    . GLY C 3 28  ? -26.773 -34.701 12.522 1.00 86.71  ? 28   GLY C CA    1 
ATOM   1559  C  C     . GLY C 3 28  ? -26.856 -33.410 13.313 1.00 86.45  ? 28   GLY C C     1 
ATOM   1560  O  O     . GLY C 3 28  ? -25.873 -32.671 13.398 1.00 86.31  ? 28   GLY C O     1 
ATOM   1561  N  N     . ARG C 3 29  ? -28.031 -33.152 13.899 1.00 86.20  ? 29   ARG C N     1 
ATOM   1562  C  CA    . ARG C 3 29  ? -28.245 -32.038 14.838 1.00 85.85  ? 29   ARG C CA    1 
ATOM   1563  C  C     . ARG C 3 29  ? -26.973 -31.713 15.616 1.00 85.91  ? 29   ARG C C     1 
ATOM   1564  O  O     . ARG C 3 29  ? -26.491 -30.580 15.588 1.00 85.86  ? 29   ARG C O     1 
ATOM   1565  C  CB    . ARG C 3 29  ? -29.330 -32.407 15.839 1.00 85.56  ? 29   ARG C CB    1 
ATOM   1566  C  CG    . ARG C 3 29  ? -30.209 -31.268 16.307 1.00 85.71  ? 29   ARG C CG    1 
ATOM   1567  C  CD    . ARG C 3 29  ? -31.568 -31.307 15.607 1.00 86.58  ? 29   ARG C CD    1 
ATOM   1568  N  NE    . ARG C 3 29  ? -32.684 -31.255 16.552 1.00 86.59  ? 29   ARG C NE    1 
ATOM   1569  C  CZ    . ARG C 3 29  ? -33.974 -31.213 16.202 1.00 87.50  ? 29   ARG C CZ    1 
ATOM   1570  N  NH1   . ARG C 3 29  ? -34.335 -31.204 14.923 1.00 87.04  ? 29   ARG C NH1   1 
ATOM   1571  N  NH2   . ARG C 3 29  ? -34.917 -31.169 17.137 1.00 87.33  ? 29   ARG C NH2   1 
ATOM   1572  N  N     . VAL C 3 30  ? -26.426 -32.726 16.287 1.00 85.72  ? 30   VAL C N     1 
ATOM   1573  C  CA    . VAL C 3 30  ? -25.267 -32.560 17.161 1.00 85.63  ? 30   VAL C CA    1 
ATOM   1574  C  C     . VAL C 3 30  ? -24.050 -31.997 16.428 1.00 85.88  ? 30   VAL C C     1 
ATOM   1575  O  O     . VAL C 3 30  ? -23.359 -31.123 16.954 1.00 86.05  ? 30   VAL C O     1 
ATOM   1576  C  CB    . VAL C 3 30  ? -24.892 -33.879 17.878 1.00 85.47  ? 30   VAL C CB    1 
ATOM   1577  C  CG1   . VAL C 3 30  ? -23.593 -33.712 18.652 1.00 85.19  ? 30   VAL C CG1   1 
ATOM   1578  C  CG2   . VAL C 3 30  ? -26.010 -34.312 18.816 1.00 84.90  ? 30   VAL C CG2   1 
ATOM   1579  N  N     . HIS C 3 31  ? -23.800 -32.491 15.219 1.00 85.97  ? 31   HIS C N     1 
ATOM   1580  C  CA    . HIS C 3 31  ? -22.668 -32.038 14.423 1.00 85.97  ? 31   HIS C CA    1 
ATOM   1581  C  C     . HIS C 3 31  ? -22.871 -30.584 14.020 1.00 85.90  ? 31   HIS C C     1 
ATOM   1582  O  O     . HIS C 3 31  ? -21.911 -29.818 13.916 1.00 86.02  ? 31   HIS C O     1 
ATOM   1583  C  CB    . HIS C 3 31  ? -22.502 -32.920 13.188 1.00 86.07  ? 31   HIS C CB    1 
ATOM   1584  C  CG    . HIS C 3 31  ? -21.164 -32.798 12.528 1.00 86.82  ? 31   HIS C CG    1 
ATOM   1585  N  ND1   . HIS C 3 31  ? -19.980 -32.803 13.233 1.00 87.63  ? 31   HIS C ND1   1 
ATOM   1586  C  CD2   . HIS C 3 31  ? -20.821 -32.698 11.222 1.00 88.01  ? 31   HIS C CD2   1 
ATOM   1587  C  CE1   . HIS C 3 31  ? -18.966 -32.697 12.392 1.00 87.75  ? 31   HIS C CE1   1 
ATOM   1588  N  NE2   . HIS C 3 31  ? -19.448 -32.631 11.165 1.00 87.44  ? 31   HIS C NE2   1 
ATOM   1589  N  N     . ARG C 3 32  ? -24.126 -30.205 13.808 1.00 85.54  ? 32   ARG C N     1 
ATOM   1590  C  CA    . ARG C 3 32  ? -24.448 -28.844 13.427 1.00 85.47  ? 32   ARG C CA    1 
ATOM   1591  C  C     . ARG C 3 32  ? -24.140 -27.918 14.591 1.00 85.63  ? 32   ARG C C     1 
ATOM   1592  O  O     . ARG C 3 32  ? -23.509 -26.874 14.414 1.00 85.74  ? 32   ARG C O     1 
ATOM   1593  C  CB    . ARG C 3 32  ? -25.924 -28.751 13.038 1.00 85.56  ? 32   ARG C CB    1 
ATOM   1594  C  CG    . ARG C 3 32  ? -26.454 -27.358 12.734 1.00 84.48  ? 32   ARG C CG    1 
ATOM   1595  C  CD    . ARG C 3 32  ? -27.967 -27.417 12.582 1.00 82.11  ? 32   ARG C CD    1 
ATOM   1596  N  NE    . ARG C 3 32  ? -28.644 -27.252 13.859 1.00 81.46  ? 32   ARG C NE    1 
ATOM   1597  C  CZ    . ARG C 3 32  ? -29.881 -27.662 14.139 1.00 81.34  ? 32   ARG C CZ    1 
ATOM   1598  N  NH1   . ARG C 3 32  ? -30.612 -28.309 13.242 1.00 82.32  ? 32   ARG C NH1   1 
ATOM   1599  N  NH2   . ARG C 3 32  ? -30.387 -27.436 15.343 1.00 80.15  ? 32   ARG C NH2   1 
ATOM   1600  N  N     . LEU C 3 33  ? -24.566 -28.331 15.783 1.00 85.66  ? 33   LEU C N     1 
ATOM   1601  C  CA    . LEU C 3 33  ? -24.479 -27.510 16.986 1.00 85.55  ? 33   LEU C CA    1 
ATOM   1602  C  C     . LEU C 3 33  ? -23.053 -27.301 17.470 1.00 85.68  ? 33   LEU C C     1 
ATOM   1603  O  O     . LEU C 3 33  ? -22.688 -26.222 17.922 1.00 85.58  ? 33   LEU C O     1 
ATOM   1604  C  CB    . LEU C 3 33  ? -25.374 -28.086 18.081 1.00 85.18  ? 33   LEU C CB    1 
ATOM   1605  C  CG    . LEU C 3 33  ? -26.851 -27.783 17.812 1.00 84.99  ? 33   LEU C CG    1 
ATOM   1606  C  CD1   . LEU C 3 33  ? -27.775 -28.597 18.690 1.00 84.52  ? 33   LEU C CD1   1 
ATOM   1607  C  CD2   . LEU C 3 33  ? -27.126 -26.305 17.989 1.00 85.69  ? 33   LEU C CD2   1 
ATOM   1608  N  N     . LEU C 3 34  ? -22.243 -28.333 17.348 1.00 86.34  ? 34   LEU C N     1 
ATOM   1609  C  CA    . LEU C 3 34  ? -20.851 -28.235 17.707 1.00 87.48  ? 34   LEU C CA    1 
ATOM   1610  C  C     . LEU C 3 34  ? -20.128 -27.207 16.855 1.00 88.33  ? 34   LEU C C     1 
ATOM   1611  O  O     . LEU C 3 34  ? -19.276 -26.470 17.359 1.00 88.93  ? 34   LEU C O     1 
ATOM   1612  C  CB    . LEU C 3 34  ? -20.176 -29.593 17.555 1.00 87.54  ? 34   LEU C CB    1 
ATOM   1613  C  CG    . LEU C 3 34  ? -20.546 -30.656 18.590 1.00 87.84  ? 34   LEU C CG    1 
ATOM   1614  C  CD1   . LEU C 3 34  ? -19.906 -32.009 18.242 1.00 88.01  ? 34   LEU C CD1   1 
ATOM   1615  C  CD2   . LEU C 3 34  ? -20.159 -30.190 20.004 1.00 87.79  ? 34   LEU C CD2   1 
ATOM   1616  N  N     . ARG C 3 35  ? -20.471 -27.164 15.564 1.00 89.13  ? 35   ARG C N     1 
ATOM   1617  C  CA    . ARG C 3 35  ? -19.790 -26.306 14.588 1.00 89.37  ? 35   ARG C CA    1 
ATOM   1618  C  C     . ARG C 3 35  ? -20.215 -24.868 14.742 1.00 89.37  ? 35   ARG C C     1 
ATOM   1619  O  O     . ARG C 3 35  ? -19.377 -23.967 14.787 1.00 89.45  ? 35   ARG C O     1 
ATOM   1620  C  CB    . ARG C 3 35  ? -20.098 -26.770 13.173 1.00 89.56  ? 35   ARG C CB    1 
ATOM   1621  C  CG    . ARG C 3 35  ? -19.232 -27.918 12.699 1.00 91.25  ? 35   ARG C CG    1 
ATOM   1622  C  CD    . ARG C 3 35  ? -19.873 -28.632 11.526 1.00 93.64  ? 35   ARG C CD    1 
ATOM   1623  N  NE    . ARG C 3 35  ? -18.877 -29.037 10.544 1.00 95.96  ? 35   ARG C NE    1 
ATOM   1624  C  CZ    . ARG C 3 35  ? -19.127 -29.849 9.523  1.00 97.43  ? 35   ARG C CZ    1 
ATOM   1625  N  NH1   . ARG C 3 35  ? -20.340 -30.361 9.371  1.00 97.71  ? 35   ARG C NH1   1 
ATOM   1626  N  NH2   . ARG C 3 35  ? -18.165 -30.153 8.658  1.00 97.95  ? 35   ARG C NH2   1 
ATOM   1627  N  N     . LYS C 3 36  ? -21.524 -24.667 14.830 1.00 89.42  ? 36   LYS C N     1 
ATOM   1628  C  CA    . LYS C 3 36  ? -22.097 -23.334 14.917 1.00 89.67  ? 36   LYS C CA    1 
ATOM   1629  C  C     . LYS C 3 36  ? -21.986 -22.720 16.305 1.00 88.87  ? 36   LYS C C     1 
ATOM   1630  O  O     . LYS C 3 36  ? -21.982 -21.494 16.428 1.00 89.35  ? 36   LYS C O     1 
ATOM   1631  C  CB    . LYS C 3 36  ? -23.549 -23.337 14.436 1.00 89.98  ? 36   LYS C CB    1 
ATOM   1632  C  CG    . LYS C 3 36  ? -23.692 -23.230 12.904 1.00 91.04  ? 36   LYS C CG    1 
ATOM   1633  C  CD    . LYS C 3 36  ? -25.130 -23.517 12.471 1.00 91.15  ? 36   LYS C CD    1 
ATOM   1634  C  CE    . LYS C 3 36  ? -25.479 -22.825 11.156 1.00 93.73  ? 36   LYS C CE    1 
ATOM   1635  N  NZ    . LYS C 3 36  ? -26.965 -22.819 10.947 1.00 95.07  ? 36   LYS C NZ    1 
ATOM   1636  N  N     . GLY C 3 37  ? -21.873 -23.566 17.331 1.00 87.93  ? 37   GLY C N     1 
ATOM   1637  C  CA    . GLY C 3 37  ? -21.772 -23.119 18.724 1.00 86.34  ? 37   GLY C CA    1 
ATOM   1638  C  C     . GLY C 3 37  ? -20.394 -22.693 19.201 1.00 85.24  ? 37   GLY C C     1 
ATOM   1639  O  O     . GLY C 3 37  ? -20.180 -22.523 20.399 1.00 85.20  ? 37   GLY C O     1 
ATOM   1640  N  N     . ASN C 3 38  ? -19.454 -22.535 18.275 1.00 84.36  ? 38   ASN C N     1 
ATOM   1641  C  CA    . ASN C 3 38  ? -18.186 -21.842 18.559 1.00 83.95  ? 38   ASN C CA    1 
ATOM   1642  C  C     . ASN C 3 38  ? -17.272 -22.491 19.600 1.00 83.22  ? 38   ASN C C     1 
ATOM   1643  O  O     . ASN C 3 38  ? -16.717 -21.819 20.473 1.00 82.99  ? 38   ASN C O     1 
ATOM   1644  C  CB    . ASN C 3 38  ? -18.440 -20.361 18.912 1.00 84.08  ? 38   ASN C CB    1 
ATOM   1645  C  CG    . ASN C 3 38  ? -18.789 -19.524 17.693 1.00 84.68  ? 38   ASN C CG    1 
ATOM   1646  O  OD1   . ASN C 3 38  ? -17.905 -19.122 16.925 1.00 84.77  ? 38   ASN C OD1   1 
ATOM   1647  N  ND2   . ASN C 3 38  ? -20.085 -19.257 17.505 1.00 84.48  ? 38   ASN C ND2   1 
ATOM   1648  N  N     . TYR C 3 39  ? -17.105 -23.801 19.488 1.00 82.81  ? 39   TYR C N     1 
ATOM   1649  C  CA    . TYR C 3 39  ? -16.236 -24.538 20.398 1.00 82.26  ? 39   TYR C CA    1 
ATOM   1650  C  C     . TYR C 3 39  ? -14.835 -24.732 19.833 1.00 82.58  ? 39   TYR C C     1 
ATOM   1651  O  O     . TYR C 3 39  ? -13.862 -24.707 20.577 1.00 82.31  ? 39   TYR C O     1 
ATOM   1652  C  CB    . TYR C 3 39  ? -16.865 -25.871 20.762 1.00 81.57  ? 39   TYR C CB    1 
ATOM   1653  C  CG    . TYR C 3 39  ? -18.264 -25.746 21.314 1.00 80.46  ? 39   TYR C CG    1 
ATOM   1654  C  CD1   . TYR C 3 39  ? -19.365 -25.906 20.496 1.00 79.60  ? 39   TYR C CD1   1 
ATOM   1655  C  CD2   . TYR C 3 39  ? -18.484 -25.465 22.654 1.00 79.89  ? 39   TYR C CD2   1 
ATOM   1656  C  CE1   . TYR C 3 39  ? -20.648 -25.798 20.995 1.00 79.01  ? 39   TYR C CE1   1 
ATOM   1657  C  CE2   . TYR C 3 39  ? -19.763 -25.343 23.157 1.00 79.15  ? 39   TYR C CE2   1 
ATOM   1658  C  CZ    . TYR C 3 39  ? -20.836 -25.517 22.320 1.00 79.39  ? 39   TYR C CZ    1 
ATOM   1659  O  OH    . TYR C 3 39  ? -22.111 -25.400 22.802 1.00 80.47  ? 39   TYR C OH    1 
ATOM   1660  N  N     . ALA C 3 40  ? -14.736 -24.920 18.518 1.00 83.36  ? 40   ALA C N     1 
ATOM   1661  C  CA    . ALA C 3 40  ? -13.433 -24.995 17.846 1.00 84.11  ? 40   ALA C CA    1 
ATOM   1662  C  C     . ALA C 3 40  ? -13.510 -24.653 16.377 1.00 84.43  ? 40   ALA C C     1 
ATOM   1663  O  O     . ALA C 3 40  ? -14.592 -24.658 15.783 1.00 84.46  ? 40   ALA C O     1 
ATOM   1664  C  CB    . ALA C 3 40  ? -12.813 -26.366 18.016 1.00 84.33  ? 40   ALA C CB    1 
ATOM   1665  N  N     . GLU C 3 41  ? -12.342 -24.374 15.804 1.00 85.00  ? 41   GLU C N     1 
ATOM   1666  C  CA    . GLU C 3 41  ? -12.199 -24.105 14.378 1.00 85.75  ? 41   GLU C CA    1 
ATOM   1667  C  C     . GLU C 3 41  ? -12.734 -25.252 13.517 1.00 86.19  ? 41   GLU C C     1 
ATOM   1668  O  O     . GLU C 3 41  ? -13.487 -25.012 12.579 1.00 86.60  ? 41   GLU C O     1 
ATOM   1669  C  CB    . GLU C 3 41  ? -10.739 -23.839 14.034 1.00 85.67  ? 41   GLU C CB    1 
ATOM   1670  C  CG    . GLU C 3 41  ? -10.561 -23.164 12.697 1.00 86.86  ? 41   GLU C CG    1 
ATOM   1671  C  CD    . GLU C 3 41  ? -9.228  -23.488 12.062 1.00 88.73  ? 41   GLU C CD    1 
ATOM   1672  O  OE1   . GLU C 3 41  ? -8.187  -23.325 12.745 1.00 89.23  ? 41   GLU C OE1   1 
ATOM   1673  O  OE2   . GLU C 3 41  ? -9.226  -23.908 10.876 1.00 89.43  ? 41   GLU C OE2   1 
ATOM   1674  N  N     . ARG C 3 42  ? -12.341 -26.486 13.845 1.00 86.60  ? 42   ARG C N     1 
ATOM   1675  C  CA    . ARG C 3 42  ? -12.818 -27.696 13.156 1.00 86.95  ? 42   ARG C CA    1 
ATOM   1676  C  C     . ARG C 3 42  ? -13.388 -28.774 14.102 1.00 86.67  ? 42   ARG C C     1 
ATOM   1677  O  O     . ARG C 3 42  ? -13.075 -28.805 15.304 1.00 86.63  ? 42   ARG C O     1 
ATOM   1678  C  CB    . ARG C 3 42  ? -11.728 -28.279 12.247 1.00 86.85  ? 42   ARG C CB    1 
ATOM   1679  C  CG    . ARG C 3 42  ? -10.314 -28.229 12.822 1.00 87.84  ? 42   ARG C CG    1 
ATOM   1680  C  CD    . ARG C 3 42  ? -9.260  -28.793 11.849 1.00 88.23  ? 42   ARG C CD    1 
ATOM   1681  N  NE    . ARG C 3 42  ? -9.234  -28.066 10.576 1.00 90.73  ? 42   ARG C NE    1 
ATOM   1682  C  CZ    . ARG C 3 42  ? -9.770  -28.516 9.442  1.00 91.62  ? 42   ARG C CZ    1 
ATOM   1683  N  NH1   . ARG C 3 42  ? -10.361 -29.706 9.410  1.00 92.64  ? 42   ARG C NH1   1 
ATOM   1684  N  NH2   . ARG C 3 42  ? -9.710  -27.782 8.338  1.00 91.48  ? 42   ARG C NH2   1 
ATOM   1685  N  N     . VAL C 3 43  ? -14.230 -29.648 13.540 1.00 86.33  ? 43   VAL C N     1 
ATOM   1686  C  CA    . VAL C 3 43  ? -14.982 -30.655 14.304 1.00 85.97  ? 43   VAL C CA    1 
ATOM   1687  C  C     . VAL C 3 43  ? -14.965 -32.047 13.656 1.00 85.84  ? 43   VAL C C     1 
ATOM   1688  O  O     . VAL C 3 43  ? -15.600 -32.276 12.618 1.00 85.69  ? 43   VAL C O     1 
ATOM   1689  C  CB    . VAL C 3 43  ? -16.469 -30.225 14.509 1.00 85.96  ? 43   VAL C CB    1 
ATOM   1690  C  CG1   . VAL C 3 43  ? -17.263 -31.307 15.255 1.00 85.60  ? 43   VAL C CG1   1 
ATOM   1691  C  CG2   . VAL C 3 43  ? -16.560 -28.899 15.239 1.00 85.45  ? 43   VAL C CG2   1 
ATOM   1692  N  N     . GLY C 3 44  ? -14.267 -32.978 14.297 1.00 85.66  ? 44   GLY C N     1 
ATOM   1693  C  CA    . GLY C 3 44  ? -14.214 -34.375 13.853 1.00 85.59  ? 44   GLY C CA    1 
ATOM   1694  C  C     . GLY C 3 44  ? -15.541 -35.067 13.547 1.00 85.63  ? 44   GLY C C     1 
ATOM   1695  O  O     . GLY C 3 44  ? -16.627 -34.548 13.837 1.00 85.44  ? 44   GLY C O     1 
ATOM   1696  N  N     . ALA C 3 45  ? -15.449 -36.252 12.945 1.00 85.75  ? 45   ALA C N     1 
ATOM   1697  C  CA    . ALA C 3 45  ? -16.640 -37.018 12.564 1.00 85.60  ? 45   ALA C CA    1 
ATOM   1698  C  C     . ALA C 3 45  ? -17.121 -37.937 13.681 1.00 85.39  ? 45   ALA C C     1 
ATOM   1699  O  O     . ALA C 3 45  ? -18.319 -38.198 13.793 1.00 85.80  ? 45   ALA C O     1 
ATOM   1700  C  CB    . ALA C 3 45  ? -16.397 -37.809 11.282 1.00 85.50  ? 45   ALA C CB    1 
ATOM   1701  N  N     . GLY C 3 46  ? -16.195 -38.425 14.503 1.00 84.73  ? 46   GLY C N     1 
ATOM   1702  C  CA    . GLY C 3 46  ? -16.553 -39.296 15.609 1.00 84.20  ? 46   GLY C CA    1 
ATOM   1703  C  C     . GLY C 3 46  ? -17.323 -38.572 16.694 1.00 84.01  ? 46   GLY C C     1 
ATOM   1704  O  O     . GLY C 3 46  ? -18.217 -39.147 17.319 1.00 84.10  ? 46   GLY C O     1 
ATOM   1705  N  N     . ALA C 3 47  ? -16.989 -37.297 16.898 1.00 83.58  ? 47   ALA C N     1 
ATOM   1706  C  CA    . ALA C 3 47  ? -17.462 -36.534 18.058 1.00 82.84  ? 47   ALA C CA    1 
ATOM   1707  C  C     . ALA C 3 47  ? -18.995 -36.325 18.155 1.00 82.26  ? 47   ALA C C     1 
ATOM   1708  O  O     . ALA C 3 47  ? -19.579 -36.551 19.217 1.00 82.26  ? 47   ALA C O     1 
ATOM   1709  C  CB    . ALA C 3 47  ? -16.697 -35.223 18.179 1.00 82.66  ? 47   ALA C CB    1 
ATOM   1710  N  N     . PRO C 3 48  ? -19.657 -35.923 17.060 1.00 81.69  ? 48   PRO C N     1 
ATOM   1711  C  CA    . PRO C 3 48  ? -21.124 -35.828 17.182 1.00 81.43  ? 48   PRO C CA    1 
ATOM   1712  C  C     . PRO C 3 48  ? -21.734 -37.184 17.485 1.00 81.06  ? 48   PRO C C     1 
ATOM   1713  O  O     . PRO C 3 48  ? -22.858 -37.275 17.992 1.00 80.82  ? 48   PRO C O     1 
ATOM   1714  C  CB    . PRO C 3 48  ? -21.580 -35.363 15.794 1.00 81.28  ? 48   PRO C CB    1 
ATOM   1715  C  CG    . PRO C 3 48  ? -20.442 -35.681 14.887 1.00 81.96  ? 48   PRO C CG    1 
ATOM   1716  C  CD    . PRO C 3 48  ? -19.190 -35.550 15.716 1.00 81.76  ? 48   PRO C CD    1 
ATOM   1717  N  N     . VAL C 3 49  ? -20.976 -38.228 17.169 1.00 80.48  ? 49   VAL C N     1 
ATOM   1718  C  CA    . VAL C 3 49  ? -21.420 -39.586 17.398 1.00 79.97  ? 49   VAL C CA    1 
ATOM   1719  C  C     . VAL C 3 49  ? -21.100 -39.974 18.835 1.00 79.39  ? 49   VAL C C     1 
ATOM   1720  O  O     . VAL C 3 49  ? -21.974 -40.446 19.558 1.00 79.51  ? 49   VAL C O     1 
ATOM   1721  C  CB    . VAL C 3 49  ? -20.796 -40.566 16.379 1.00 80.01  ? 49   VAL C CB    1 
ATOM   1722  C  CG1   . VAL C 3 49  ? -20.917 -41.991 16.863 1.00 80.34  ? 49   VAL C CG1   1 
ATOM   1723  C  CG2   . VAL C 3 49  ? -21.467 -40.403 15.028 1.00 79.42  ? 49   VAL C CG2   1 
ATOM   1724  N  N     . TYR C 3 50  ? -19.862 -39.750 19.259 1.00 78.52  ? 50   TYR C N     1 
ATOM   1725  C  CA    . TYR C 3 50  ? -19.505 -40.032 20.632 1.00 77.78  ? 50   TYR C CA    1 
ATOM   1726  C  C     . TYR C 3 50  ? -20.457 -39.313 21.574 1.00 77.69  ? 50   TYR C C     1 
ATOM   1727  O  O     . TYR C 3 50  ? -21.046 -39.936 22.461 1.00 77.28  ? 50   TYR C O     1 
ATOM   1728  C  CB    . TYR C 3 50  ? -18.076 -39.603 20.916 1.00 77.71  ? 50   TYR C CB    1 
ATOM   1729  C  CG    . TYR C 3 50  ? -17.465 -40.233 22.144 1.00 77.13  ? 50   TYR C CG    1 
ATOM   1730  C  CD1   . TYR C 3 50  ? -16.361 -41.068 22.033 1.00 78.30  ? 50   TYR C CD1   1 
ATOM   1731  C  CD2   . TYR C 3 50  ? -17.970 -39.985 23.412 1.00 76.13  ? 50   TYR C CD2   1 
ATOM   1732  C  CE1   . TYR C 3 50  ? -15.766 -41.641 23.157 1.00 78.81  ? 50   TYR C CE1   1 
ATOM   1733  C  CE2   . TYR C 3 50  ? -17.394 -40.559 24.543 1.00 77.80  ? 50   TYR C CE2   1 
ATOM   1734  C  CZ    . TYR C 3 50  ? -16.288 -41.385 24.407 1.00 78.50  ? 50   TYR C CZ    1 
ATOM   1735  O  OH    . TYR C 3 50  ? -15.700 -41.959 25.512 1.00 78.00  ? 50   TYR C OH    1 
ATOM   1736  N  N     . LEU C 3 51  ? -20.614 -38.006 21.360 1.00 77.63  ? 51   LEU C N     1 
ATOM   1737  C  CA    . LEU C 3 51  ? -21.410 -37.163 22.247 1.00 77.79  ? 51   LEU C CA    1 
ATOM   1738  C  C     . LEU C 3 51  ? -22.918 -37.484 22.218 1.00 77.94  ? 51   LEU C C     1 
ATOM   1739  O  O     . LEU C 3 51  ? -23.510 -37.721 23.266 1.00 77.94  ? 51   LEU C O     1 
ATOM   1740  C  CB    . LEU C 3 51  ? -21.133 -35.673 21.992 1.00 77.76  ? 51   LEU C CB    1 
ATOM   1741  C  CG    . LEU C 3 51  ? -22.094 -34.604 22.554 1.00 78.01  ? 51   LEU C CG    1 
ATOM   1742  C  CD1   . LEU C 3 51  ? -22.448 -34.783 24.034 1.00 76.91  ? 51   LEU C CD1   1 
ATOM   1743  C  CD2   . LEU C 3 51  ? -21.483 -33.244 22.332 1.00 77.40  ? 51   LEU C CD2   1 
ATOM   1744  N  N     . ALA C 3 52  ? -23.525 -37.517 21.035 1.00 77.94  ? 52   ALA C N     1 
ATOM   1745  C  CA    . ALA C 3 52  ? -24.933 -37.892 20.913 1.00 78.15  ? 52   ALA C CA    1 
ATOM   1746  C  C     . ALA C 3 52  ? -25.253 -39.158 21.710 1.00 78.37  ? 52   ALA C C     1 
ATOM   1747  O  O     . ALA C 3 52  ? -26.373 -39.321 22.226 1.00 78.03  ? 52   ALA C O     1 
ATOM   1748  C  CB    . ALA C 3 52  ? -25.300 -38.086 19.458 1.00 78.26  ? 52   ALA C CB    1 
ATOM   1749  N  N     . ALA C 3 53  ? -24.253 -40.036 21.807 1.00 78.35  ? 53   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3 53  ? -24.394 -41.327 22.469 1.00 78.74  ? 53   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3 53  ? -24.429 -41.143 23.969 1.00 79.03  ? 53   ALA C C     1 
ATOM   1752  O  O     . ALA C 3 53  ? -25.191 -41.812 24.678 1.00 79.68  ? 53   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3 53  ? -23.240 -42.237 22.092 1.00 78.63  ? 53   ALA C CB    1 
ATOM   1754  N  N     . VAL C 3 54  ? -23.575 -40.235 24.437 1.00 79.00  ? 54   VAL C N     1 
ATOM   1755  C  CA    . VAL C 3 54  ? -23.403 -39.945 25.852 1.00 78.38  ? 54   VAL C CA    1 
ATOM   1756  C  C     . VAL C 3 54  ? -24.627 -39.198 26.324 1.00 78.32  ? 54   VAL C C     1 
ATOM   1757  O  O     . VAL C 3 54  ? -25.115 -39.438 27.409 1.00 78.14  ? 54   VAL C O     1 
ATOM   1758  C  CB    . VAL C 3 54  ? -22.124 -39.124 26.108 1.00 77.97  ? 54   VAL C CB    1 
ATOM   1759  C  CG1   . VAL C 3 54  ? -21.885 -38.964 27.585 1.00 77.87  ? 54   VAL C CG1   1 
ATOM   1760  C  CG2   . VAL C 3 54  ? -20.930 -39.799 25.466 1.00 77.17  ? 54   VAL C CG2   1 
ATOM   1761  N  N     . LEU C 3 55  ? -25.131 -38.305 25.488 1.00 78.95  ? 55   LEU C N     1 
ATOM   1762  C  CA    . LEU C 3 55  ? -26.410 -37.667 25.752 1.00 79.72  ? 55   LEU C CA    1 
ATOM   1763  C  C     . LEU C 3 55  ? -27.495 -38.716 25.790 1.00 80.59  ? 55   LEU C C     1 
ATOM   1764  O  O     . LEU C 3 55  ? -28.314 -38.722 26.714 1.00 80.38  ? 55   LEU C O     1 
ATOM   1765  C  CB    . LEU C 3 55  ? -26.735 -36.610 24.702 1.00 79.53  ? 55   LEU C CB    1 
ATOM   1766  C  CG    . LEU C 3 55  ? -25.906 -35.329 24.776 1.00 78.66  ? 55   LEU C CG    1 
ATOM   1767  C  CD1   . LEU C 3 55  ? -26.174 -34.485 23.576 1.00 78.50  ? 55   LEU C CD1   1 
ATOM   1768  C  CD2   . LEU C 3 55  ? -26.202 -34.554 26.027 1.00 79.02  ? 55   LEU C CD2   1 
ATOM   1769  N  N     . GLU C 3 56  ? -27.470 -39.628 24.813 1.00 81.90  ? 56   GLU C N     1 
ATOM   1770  C  CA    . GLU C 3 56  ? -28.461 -40.709 24.769 1.00 83.20  ? 56   GLU C CA    1 
ATOM   1771  C  C     . GLU C 3 56  ? -28.333 -41.631 25.981 1.00 83.54  ? 56   GLU C C     1 
ATOM   1772  O  O     . GLU C 3 56  ? -29.338 -41.931 26.635 1.00 83.45  ? 56   GLU C O     1 
ATOM   1773  C  CB    . GLU C 3 56  ? -28.428 -41.503 23.455 1.00 83.40  ? 56   GLU C CB    1 
ATOM   1774  C  CG    . GLU C 3 56  ? -29.790 -42.092 23.077 1.00 83.80  ? 56   GLU C CG    1 
ATOM   1775  C  CD    . GLU C 3 56  ? -29.693 -43.416 22.332 1.00 85.58  ? 56   GLU C CD    1 
ATOM   1776  O  OE1   . GLU C 3 56  ? -29.185 -43.425 21.194 1.00 85.59  ? 56   GLU C OE1   1 
ATOM   1777  O  OE2   . GLU C 3 56  ? -30.139 -44.453 22.881 1.00 86.50  ? 56   GLU C OE2   1 
ATOM   1778  N  N     . TYR C 3 57  ? -27.108 -42.056 26.293 1.00 84.16  ? 57   TYR C N     1 
ATOM   1779  C  CA    . TYR C 3 57  ? -26.896 -42.858 27.488 1.00 84.91  ? 57   TYR C CA    1 
ATOM   1780  C  C     . TYR C 3 57  ? -27.575 -42.225 28.705 1.00 85.54  ? 57   TYR C C     1 
ATOM   1781  O  O     . TYR C 3 57  ? -28.408 -42.864 29.348 1.00 85.65  ? 57   TYR C O     1 
ATOM   1782  C  CB    . TYR C 3 57  ? -25.415 -43.103 27.784 1.00 84.83  ? 57   TYR C CB    1 
ATOM   1783  C  CG    . TYR C 3 57  ? -25.228 -43.677 29.174 1.00 85.70  ? 57   TYR C CG    1 
ATOM   1784  C  CD1   . TYR C 3 57  ? -25.854 -44.876 29.545 1.00 86.46  ? 57   TYR C CD1   1 
ATOM   1785  C  CD2   . TYR C 3 57  ? -24.469 -43.014 30.130 1.00 85.56  ? 57   TYR C CD2   1 
ATOM   1786  C  CE1   . TYR C 3 57  ? -25.718 -45.395 30.817 1.00 85.87  ? 57   TYR C CE1   1 
ATOM   1787  C  CE2   . TYR C 3 57  ? -24.322 -43.536 31.407 1.00 85.58  ? 57   TYR C CE2   1 
ATOM   1788  C  CZ    . TYR C 3 57  ? -24.954 -44.723 31.742 1.00 85.48  ? 57   TYR C CZ    1 
ATOM   1789  O  OH    . TYR C 3 57  ? -24.822 -45.245 33.008 1.00 85.75  ? 57   TYR C OH    1 
ATOM   1790  N  N     . LEU C 3 58  ? -27.230 -40.967 28.990 1.00 86.19  ? 58   LEU C N     1 
ATOM   1791  C  CA    . LEU C 3 58  ? -27.648 -40.291 30.221 1.00 86.79  ? 58   LEU C CA    1 
ATOM   1792  C  C     . LEU C 3 58  ? -29.135 -40.008 30.273 1.00 87.09  ? 58   LEU C C     1 
ATOM   1793  O  O     . LEU C 3 58  ? -29.743 -40.081 31.346 1.00 87.45  ? 58   LEU C O     1 
ATOM   1794  C  CB    . LEU C 3 58  ? -26.882 -38.984 30.436 1.00 86.77  ? 58   LEU C CB    1 
ATOM   1795  C  CG    . LEU C 3 58  ? -25.374 -39.041 30.678 1.00 87.34  ? 58   LEU C CG    1 
ATOM   1796  C  CD1   . LEU C 3 58  ? -24.779 -37.650 30.586 1.00 87.58  ? 58   LEU C CD1   1 
ATOM   1797  C  CD2   . LEU C 3 58  ? -25.024 -39.680 32.008 1.00 87.51  ? 58   LEU C CD2   1 
ATOM   1798  N  N     . THR C 3 59  ? -29.725 -39.672 29.131 1.00 87.38  ? 59   THR C N     1 
ATOM   1799  C  CA    . THR C 3 59  ? -31.174 -39.450 29.096 1.00 87.68  ? 59   THR C CA    1 
ATOM   1800  C  C     . THR C 3 59  ? -31.904 -40.763 29.398 1.00 88.10  ? 59   THR C C     1 
ATOM   1801  O  O     . THR C 3 59  ? -32.990 -40.762 29.960 1.00 87.86  ? 59   THR C O     1 
ATOM   1802  C  CB    . THR C 3 59  ? -31.659 -38.775 27.784 1.00 87.34  ? 59   THR C CB    1 
ATOM   1803  O  OG1   . THR C 3 59  ? -33.064 -38.983 27.621 1.00 87.70  ? 59   THR C OG1   1 
ATOM   1804  C  CG2   . THR C 3 59  ? -30.979 -39.355 26.600 1.00 87.37  ? 59   THR C CG2   1 
ATOM   1805  N  N     . ALA C 3 60  ? -31.265 -41.880 29.071 1.00 88.86  ? 60   ALA C N     1 
ATOM   1806  C  CA    . ALA C 3 60  ? -31.805 -43.185 29.395 1.00 89.60  ? 60   ALA C CA    1 
ATOM   1807  C  C     . ALA C 3 60  ? -31.770 -43.445 30.904 1.00 90.28  ? 60   ALA C C     1 
ATOM   1808  O  O     . ALA C 3 60  ? -32.791 -43.824 31.493 1.00 90.50  ? 60   ALA C O     1 
ATOM   1809  C  CB    . ALA C 3 60  ? -31.059 -44.260 28.641 1.00 89.59  ? 60   ALA C CB    1 
ATOM   1810  N  N     . GLU C 3 61  ? -30.609 -43.217 31.522 1.00 90.78  ? 61   GLU C N     1 
ATOM   1811  C  CA    . GLU C 3 61  ? -30.424 -43.432 32.962 1.00 91.28  ? 61   GLU C CA    1 
ATOM   1812  C  C     . GLU C 3 61  ? -31.428 -42.656 33.802 1.00 91.33  ? 61   GLU C C     1 
ATOM   1813  O  O     . GLU C 3 61  ? -31.894 -43.149 34.825 1.00 91.26  ? 61   GLU C O     1 
ATOM   1814  C  CB    . GLU C 3 61  ? -29.004 -43.059 33.393 1.00 91.39  ? 61   GLU C CB    1 
ATOM   1815  C  CG    . GLU C 3 61  ? -28.553 -43.728 34.696 1.00 92.29  ? 61   GLU C CG    1 
ATOM   1816  C  CD    . GLU C 3 61  ? -27.981 -45.124 34.489 1.00 93.82  ? 61   GLU C CD    1 
ATOM   1817  O  OE1   . GLU C 3 61  ? -27.859 -45.558 33.316 1.00 94.77  ? 61   GLU C OE1   1 
ATOM   1818  O  OE2   . GLU C 3 61  ? -27.650 -45.787 35.503 1.00 94.12  ? 61   GLU C OE2   1 
ATOM   1819  N  N     . ILE C 3 62  ? -31.741 -41.441 33.368 1.00 91.66  ? 62   ILE C N     1 
ATOM   1820  C  CA    . ILE C 3 62  ? -32.742 -40.615 34.030 1.00 92.50  ? 62   ILE C CA    1 
ATOM   1821  C  C     . ILE C 3 62  ? -34.149 -41.159 33.785 1.00 92.69  ? 62   ILE C C     1 
ATOM   1822  O  O     . ILE C 3 62  ? -34.920 -41.339 34.726 1.00 92.72  ? 62   ILE C O     1 
ATOM   1823  C  CB    . ILE C 3 62  ? -32.686 -39.139 33.543 1.00 92.93  ? 62   ILE C CB    1 
ATOM   1824  C  CG1   . ILE C 3 62  ? -31.316 -38.514 33.830 1.00 93.47  ? 62   ILE C CG1   1 
ATOM   1825  C  CG2   . ILE C 3 62  ? -33.838 -38.290 34.166 1.00 92.82  ? 62   ILE C CG2   1 
ATOM   1826  C  CD1   . ILE C 3 62  ? -31.259 -37.733 35.143 1.00 95.00  ? 62   ILE C CD1   1 
ATOM   1827  N  N     . LEU C 3 63  ? -34.476 -41.404 32.519 1.00 93.01  ? 63   LEU C N     1 
ATOM   1828  C  CA    . LEU C 3 63  ? -35.787 -41.913 32.144 1.00 93.41  ? 63   LEU C CA    1 
ATOM   1829  C  C     . LEU C 3 63  ? -36.043 -43.252 32.825 1.00 94.07  ? 63   LEU C C     1 
ATOM   1830  O  O     . LEU C 3 63  ? -37.163 -43.526 33.267 1.00 93.95  ? 63   LEU C O     1 
ATOM   1831  C  CB    . LEU C 3 63  ? -35.906 -42.035 30.623 1.00 93.18  ? 63   LEU C CB    1 
ATOM   1832  C  CG    . LEU C 3 63  ? -35.931 -40.731 29.811 1.00 92.37  ? 63   LEU C CG    1 
ATOM   1833  C  CD1   . LEU C 3 63  ? -35.592 -41.020 28.367 1.00 92.36  ? 63   LEU C CD1   1 
ATOM   1834  C  CD2   . LEU C 3 63  ? -37.258 -39.986 29.903 1.00 91.41  ? 63   LEU C CD2   1 
ATOM   1835  N  N     . GLU C 3 64  ? -34.989 -44.061 32.916 1.00 94.87  ? 64   GLU C N     1 
ATOM   1836  C  CA    . GLU C 3 64  ? -34.979 -45.279 33.718 1.00 95.93  ? 64   GLU C CA    1 
ATOM   1837  C  C     . GLU C 3 64  ? -35.607 -45.034 35.097 1.00 96.31  ? 64   GLU C C     1 
ATOM   1838  O  O     . GLU C 3 64  ? -36.758 -45.394 35.340 1.00 96.17  ? 64   GLU C O     1 
ATOM   1839  C  CB    . GLU C 3 64  ? -33.532 -45.766 33.866 1.00 95.98  ? 64   GLU C CB    1 
ATOM   1840  C  CG    . GLU C 3 64  ? -33.311 -46.920 34.831 1.00 97.52  ? 64   GLU C CG    1 
ATOM   1841  C  CD    . GLU C 3 64  ? -33.417 -48.262 34.151 1.00 100.67 ? 64   GLU C CD    1 
ATOM   1842  O  OE1   . GLU C 3 64  ? -34.376 -48.458 33.365 1.00 102.51 ? 64   GLU C OE1   1 
ATOM   1843  O  OE2   . GLU C 3 64  ? -32.543 -49.124 34.400 1.00 101.58 ? 64   GLU C OE2   1 
ATOM   1844  N  N     . LEU C 3 65  ? -34.846 -44.377 35.971 1.00 97.00  ? 65   LEU C N     1 
ATOM   1845  C  CA    . LEU C 3 65  ? -35.168 -44.272 37.392 1.00 97.44  ? 65   LEU C CA    1 
ATOM   1846  C  C     . LEU C 3 65  ? -36.373 -43.392 37.673 1.00 97.92  ? 65   LEU C C     1 
ATOM   1847  O  O     . LEU C 3 65  ? -37.033 -43.565 38.693 1.00 98.09  ? 65   LEU C O     1 
ATOM   1848  C  CB    . LEU C 3 65  ? -33.953 -43.771 38.182 1.00 97.29  ? 65   LEU C CB    1 
ATOM   1849  C  CG    . LEU C 3 65  ? -32.638 -44.542 38.052 1.00 96.80  ? 65   LEU C CG    1 
ATOM   1850  C  CD1   . LEU C 3 65  ? -31.472 -43.654 38.438 1.00 96.67  ? 65   LEU C CD1   1 
ATOM   1851  C  CD2   . LEU C 3 65  ? -32.640 -45.832 38.875 1.00 96.89  ? 65   LEU C CD2   1 
ATOM   1852  N  N     . ALA C 3 66  ? -36.649 -42.444 36.784 1.00 98.62  ? 66   ALA C N     1 
ATOM   1853  C  CA    . ALA C 3 66  ? -37.862 -41.636 36.892 1.00 99.58  ? 66   ALA C CA    1 
ATOM   1854  C  C     . ALA C 3 66  ? -39.077 -42.508 36.617 1.00 100.34 ? 66   ALA C C     1 
ATOM   1855  O  O     . ALA C 3 66  ? -40.012 -42.531 37.411 1.00 100.63 ? 66   ALA C O     1 
ATOM   1856  C  CB    . ALA C 3 66  ? -37.823 -40.453 35.942 1.00 99.53  ? 66   ALA C CB    1 
ATOM   1857  N  N     . GLY C 3 67  ? -39.055 -43.225 35.492 1.00 101.13 ? 67   GLY C N     1 
ATOM   1858  C  CA    . GLY C 3 67  ? -40.091 -44.204 35.171 1.00 101.99 ? 67   GLY C CA    1 
ATOM   1859  C  C     . GLY C 3 67  ? -40.326 -45.140 36.343 1.00 102.70 ? 67   GLY C C     1 
ATOM   1860  O  O     . GLY C 3 67  ? -41.435 -45.184 36.889 1.00 102.72 ? 67   GLY C O     1 
ATOM   1861  N  N     . ASN C 3 68  ? -39.279 -45.879 36.728 1.00 103.26 ? 68   ASN C N     1 
ATOM   1862  C  CA    . ASN C 3 68  ? -39.261 -46.622 37.988 1.00 103.87 ? 68   ASN C CA    1 
ATOM   1863  C  C     . ASN C 3 68  ? -40.085 -45.844 39.017 1.00 104.56 ? 68   ASN C C     1 
ATOM   1864  O  O     . ASN C 3 68  ? -41.109 -46.332 39.493 1.00 104.57 ? 68   ASN C O     1 
ATOM   1865  C  CB    . ASN C 3 68  ? -37.821 -46.807 38.501 1.00 103.53 ? 68   ASN C CB    1 
ATOM   1866  C  CG    . ASN C 3 68  ? -37.102 -47.996 37.866 1.00 103.09 ? 68   ASN C CG    1 
ATOM   1867  O  OD1   . ASN C 3 68  ? -36.928 -48.066 36.652 1.00 103.08 ? 68   ASN C OD1   1 
ATOM   1868  N  ND2   . ASN C 3 68  ? -36.654 -48.923 38.701 1.00 102.52 ? 68   ASN C ND2   1 
ATOM   1869  N  N     . ALA C 3 69  ? -39.652 -44.614 39.305 1.00 105.51 ? 69   ALA C N     1 
ATOM   1870  C  CA    . ALA C 3 69  ? -40.315 -43.735 40.274 1.00 106.36 ? 69   ALA C CA    1 
ATOM   1871  C  C     . ALA C 3 69  ? -41.808 -43.547 40.010 1.00 106.91 ? 69   ALA C C     1 
ATOM   1872  O  O     . ALA C 3 69  ? -42.603 -43.594 40.936 1.00 106.91 ? 69   ALA C O     1 
ATOM   1873  C  CB    . ALA C 3 69  ? -39.610 -42.384 40.342 1.00 106.29 ? 69   ALA C CB    1 
ATOM   1874  N  N     . ALA C 3 70  ? -42.186 -43.348 38.752 1.00 107.84 ? 70   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3 70  ? -43.599 -43.206 38.402 1.00 108.80 ? 70   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3 70  ? -44.381 -44.502 38.660 1.00 109.45 ? 70   ALA C C     1 
ATOM   1877  O  O     . ALA C 3 70  ? -45.540 -44.448 39.080 1.00 109.46 ? 70   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3 70  ? -43.758 -42.745 36.960 1.00 108.78 ? 70   ALA C CB    1 
ATOM   1879  N  N     . ARG C 3 71  ? -43.749 -45.654 38.413 1.00 110.08 ? 71   ARG C N     1 
ATOM   1880  C  CA    . ARG C 3 71  ? -44.331 -46.935 38.816 1.00 110.84 ? 71   ARG C CA    1 
ATOM   1881  C  C     . ARG C 3 71  ? -44.478 -46.910 40.329 1.00 110.97 ? 71   ARG C C     1 
ATOM   1882  O  O     . ARG C 3 71  ? -45.594 -46.992 40.841 1.00 111.17 ? 71   ARG C O     1 
ATOM   1883  C  CB    . ARG C 3 71  ? -43.476 -48.140 38.382 1.00 110.92 ? 71   ARG C CB    1 
ATOM   1884  C  CG    . ARG C 3 71  ? -43.685 -48.610 36.939 1.00 111.49 ? 71   ARG C CG    1 
ATOM   1885  C  CD    . ARG C 3 71  ? -42.721 -49.743 36.565 1.00 111.62 ? 71   ARG C CD    1 
ATOM   1886  N  NE    . ARG C 3 71  ? -42.508 -49.841 35.113 1.00 113.55 ? 71   ARG C NE    1 
ATOM   1887  C  CZ    . ARG C 3 71  ? -41.576 -50.598 34.525 1.00 114.36 ? 71   ARG C CZ    1 
ATOM   1888  N  NH1   . ARG C 3 71  ? -40.748 -51.342 35.253 1.00 114.98 ? 71   ARG C NH1   1 
ATOM   1889  N  NH2   . ARG C 3 71  ? -41.462 -50.612 33.200 1.00 114.53 ? 71   ARG C NH2   1 
ATOM   1890  N  N     . ASP C 3 72  ? -43.351 -46.760 41.029 1.00 111.12 ? 72   ASP C N     1 
ATOM   1891  C  CA    . ASP C 3 72  ? -43.316 -46.693 42.494 1.00 111.22 ? 72   ASP C CA    1 
ATOM   1892  C  C     . ASP C 3 72  ? -44.393 -45.765 43.030 1.00 111.27 ? 72   ASP C C     1 
ATOM   1893  O  O     . ASP C 3 72  ? -45.067 -46.089 44.005 1.00 111.39 ? 72   ASP C O     1 
ATOM   1894  C  CB    . ASP C 3 72  ? -41.947 -46.209 42.992 1.00 111.25 ? 72   ASP C CB    1 
ATOM   1895  C  CG    . ASP C 3 72  ? -40.789 -47.073 42.493 1.00 111.87 ? 72   ASP C CG    1 
ATOM   1896  O  OD1   . ASP C 3 72  ? -41.004 -48.274 42.196 1.00 112.10 ? 72   ASP C OD1   1 
ATOM   1897  O  OD2   . ASP C 3 72  ? -39.654 -46.543 42.400 1.00 111.86 ? 72   ASP C OD2   1 
ATOM   1898  N  N     . ASN C 3 73  ? -44.561 -44.621 42.371 1.00 111.40 ? 73   ASN C N     1 
ATOM   1899  C  CA    . ASN C 3 73  ? -45.501 -43.586 42.812 1.00 111.40 ? 73   ASN C CA    1 
ATOM   1900  C  C     . ASN C 3 73  ? -46.852 -43.706 42.100 1.00 111.25 ? 73   ASN C C     1 
ATOM   1901  O  O     . ASN C 3 73  ? -47.656 -42.771 42.109 1.00 111.03 ? 73   ASN C O     1 
ATOM   1902  C  CB    . ASN C 3 73  ? -44.894 -42.176 42.631 1.00 111.59 ? 73   ASN C CB    1 
ATOM   1903  C  CG    . ASN C 3 73  ? -43.636 -41.931 43.505 1.00 111.46 ? 73   ASN C CG    1 
ATOM   1904  O  OD1   . ASN C 3 73  ? -43.561 -40.934 44.224 1.00 111.00 ? 73   ASN C OD1   1 
ATOM   1905  N  ND2   . ASN C 3 73  ? -42.653 -42.829 43.426 1.00 111.28 ? 73   ASN C ND2   1 
ATOM   1906  N  N     . LYS C 3 74  ? -47.069 -44.867 41.478 1.00 111.26 ? 74   LYS C N     1 
ATOM   1907  C  CA    . LYS C 3 74  ? -48.358 -45.287 40.892 1.00 111.34 ? 74   LYS C CA    1 
ATOM   1908  C  C     . LYS C 3 74  ? -48.984 -44.335 39.861 1.00 111.19 ? 74   LYS C C     1 
ATOM   1909  O  O     . LYS C 3 74  ? -50.098 -43.842 40.043 1.00 111.35 ? 74   LYS C O     1 
ATOM   1910  C  CB    . LYS C 3 74  ? -49.358 -45.680 41.995 1.00 111.45 ? 74   LYS C CB    1 
ATOM   1911  C  CG    . LYS C 3 74  ? -49.180 -47.119 42.479 1.00 111.80 ? 74   LYS C CG    1 
ATOM   1912  C  CD    . LYS C 3 74  ? -49.548 -47.287 43.949 1.00 112.07 ? 74   LYS C CD    1 
ATOM   1913  C  CE    . LYS C 3 74  ? -49.207 -48.695 44.431 1.00 112.20 ? 74   LYS C CE    1 
ATOM   1914  N  NZ    . LYS C 3 74  ? -49.164 -48.784 45.915 1.00 112.47 ? 74   LYS C NZ    1 
ATOM   1915  N  N     . LYS C 3 75  ? -48.250 -44.103 38.776 1.00 110.86 ? 75   LYS C N     1 
ATOM   1916  C  CA    . LYS C 3 75  ? -48.687 -43.261 37.669 1.00 110.42 ? 75   LYS C CA    1 
ATOM   1917  C  C     . LYS C 3 75  ? -48.053 -43.805 36.396 1.00 110.14 ? 75   LYS C C     1 
ATOM   1918  O  O     . LYS C 3 75  ? -46.923 -44.315 36.429 1.00 110.07 ? 75   LYS C O     1 
ATOM   1919  C  CB    . LYS C 3 75  ? -48.212 -41.818 37.870 1.00 110.47 ? 75   LYS C CB    1 
ATOM   1920  C  CG    . LYS C 3 75  ? -48.863 -41.039 39.008 1.00 110.68 ? 75   LYS C CG    1 
ATOM   1921  C  CD    . LYS C 3 75  ? -50.110 -40.304 38.542 1.00 111.46 ? 75   LYS C CD    1 
ATOM   1922  C  CE    . LYS C 3 75  ? -50.124 -38.845 39.018 1.00 112.09 ? 75   LYS C CE    1 
ATOM   1923  N  NZ    . LYS C 3 75  ? -50.255 -38.701 40.500 1.00 111.90 ? 75   LYS C NZ    1 
ATOM   1924  N  N     . THR C 3 76  ? -48.765 -43.701 35.275 1.00 109.59 ? 76   THR C N     1 
ATOM   1925  C  CA    . THR C 3 76  ? -48.191 -44.126 33.995 1.00 109.13 ? 76   THR C CA    1 
ATOM   1926  C  C     . THR C 3 76  ? -47.402 -42.991 33.318 1.00 108.69 ? 76   THR C C     1 
ATOM   1927  O  O     . THR C 3 76  ? -46.559 -43.247 32.449 1.00 108.81 ? 76   THR C O     1 
ATOM   1928  C  CB    . THR C 3 76  ? -49.241 -44.766 33.012 1.00 109.26 ? 76   THR C CB    1 
ATOM   1929  O  OG1   . THR C 3 76  ? -50.109 -43.760 32.471 1.00 109.17 ? 76   THR C OG1   1 
ATOM   1930  C  CG2   . THR C 3 76  ? -50.069 -45.839 33.709 1.00 109.16 ? 76   THR C CG2   1 
ATOM   1931  N  N     . ARG C 3 77  ? -47.665 -41.747 33.727 1.00 107.71 ? 77   ARG C N     1 
ATOM   1932  C  CA    . ARG C 3 77  ? -46.970 -40.593 33.150 1.00 106.84 ? 77   ARG C CA    1 
ATOM   1933  C  C     . ARG C 3 77  ? -46.051 -39.854 34.117 1.00 105.78 ? 77   ARG C C     1 
ATOM   1934  O  O     . ARG C 3 77  ? -46.442 -39.541 35.246 1.00 105.60 ? 77   ARG C O     1 
ATOM   1935  C  CB    . ARG C 3 77  ? -47.957 -39.622 32.514 1.00 107.24 ? 77   ARG C CB    1 
ATOM   1936  C  CG    . ARG C 3 77  ? -48.182 -39.869 31.027 1.00 108.45 ? 77   ARG C CG    1 
ATOM   1937  C  CD    . ARG C 3 77  ? -49.572 -39.424 30.580 1.00 110.37 ? 77   ARG C CD    1 
ATOM   1938  N  NE    . ARG C 3 77  ? -49.944 -38.115 31.119 1.00 111.11 ? 77   ARG C NE    1 
ATOM   1939  C  CZ    . ARG C 3 77  ? -51.118 -37.530 30.913 1.00 111.39 ? 77   ARG C CZ    1 
ATOM   1940  N  NH1   . ARG C 3 77  ? -52.036 -38.127 30.164 1.00 111.96 ? 77   ARG C NH1   1 
ATOM   1941  N  NH2   . ARG C 3 77  ? -51.370 -36.343 31.446 1.00 111.56 ? 77   ARG C NH2   1 
ATOM   1942  N  N     . ILE C 3 78  ? -44.836 -39.573 33.635 1.00 104.36 ? 78   ILE C N     1 
ATOM   1943  C  CA    . ILE C 3 78  ? -43.778 -38.890 34.386 1.00 102.68 ? 78   ILE C CA    1 
ATOM   1944  C  C     . ILE C 3 78  ? -44.000 -37.384 34.455 1.00 101.80 ? 78   ILE C C     1 
ATOM   1945  O  O     . ILE C 3 78  ? -44.006 -36.708 33.427 1.00 101.70 ? 78   ILE C O     1 
ATOM   1946  C  CB    . ILE C 3 78  ? -42.403 -39.114 33.727 1.00 102.50 ? 78   ILE C CB    1 
ATOM   1947  C  CG1   . ILE C 3 78  ? -42.082 -40.606 33.642 1.00 102.01 ? 78   ILE C CG1   1 
ATOM   1948  C  CG2   . ILE C 3 78  ? -41.312 -38.333 34.468 1.00 102.58 ? 78   ILE C CG2   1 
ATOM   1949  C  CD1   . ILE C 3 78  ? -40.869 -40.926 32.779 1.00 101.90 ? 78   ILE C CD1   1 
ATOM   1950  N  N     . ILE C 3 79  ? -44.181 -36.864 35.664 1.00 100.62 ? 79   ILE C N     1 
ATOM   1951  C  CA    . ILE C 3 79  ? -44.160 -35.420 35.878 1.00 99.57  ? 79   ILE C CA    1 
ATOM   1952  C  C     . ILE C 3 79  ? -42.840 -35.018 36.524 1.00 98.62  ? 79   ILE C C     1 
ATOM   1953  O  O     . ILE C 3 79  ? -42.113 -35.882 37.013 1.00 98.81  ? 79   ILE C O     1 
ATOM   1954  C  CB    . ILE C 3 79  ? -45.362 -34.907 36.709 1.00 99.59  ? 79   ILE C CB    1 
ATOM   1955  C  CG1   . ILE C 3 79  ? -45.670 -35.840 37.881 1.00 99.54  ? 79   ILE C CG1   1 
ATOM   1956  C  CG2   . ILE C 3 79  ? -46.568 -34.683 35.801 1.00 99.92  ? 79   ILE C CG2   1 
ATOM   1957  C  CD1   . ILE C 3 79  ? -46.668 -35.264 38.892 1.00 99.80  ? 79   ILE C CD1   1 
ATOM   1958  N  N     . PRO C 3 80  ? -42.517 -33.711 36.517 1.00 97.62  ? 80   PRO C N     1 
ATOM   1959  C  CA    . PRO C 3 80  ? -41.249 -33.229 37.048 1.00 96.90  ? 80   PRO C CA    1 
ATOM   1960  C  C     . PRO C 3 80  ? -40.825 -33.884 38.361 1.00 96.16  ? 80   PRO C C     1 
ATOM   1961  O  O     . PRO C 3 80  ? -39.643 -34.222 38.521 1.00 96.34  ? 80   PRO C O     1 
ATOM   1962  C  CB    . PRO C 3 80  ? -41.517 -31.744 37.258 1.00 97.03  ? 80   PRO C CB    1 
ATOM   1963  C  CG    . PRO C 3 80  ? -42.438 -31.402 36.163 1.00 97.17  ? 80   PRO C CG    1 
ATOM   1964  C  CD    . PRO C 3 80  ? -43.330 -32.598 35.993 1.00 97.56  ? 80   PRO C CD    1 
ATOM   1965  N  N     . ARG C 3 81  ? -41.769 -34.079 39.280 1.00 94.86  ? 81   ARG C N     1 
ATOM   1966  C  CA    . ARG C 3 81  ? -41.446 -34.713 40.550 1.00 93.84  ? 81   ARG C CA    1 
ATOM   1967  C  C     . ARG C 3 81  ? -40.657 -36.008 40.365 1.00 93.32  ? 81   ARG C C     1 
ATOM   1968  O  O     . ARG C 3 81  ? -39.612 -36.196 40.993 1.00 93.21  ? 81   ARG C O     1 
ATOM   1969  C  CB    . ARG C 3 81  ? -42.697 -34.958 41.380 1.00 93.71  ? 81   ARG C CB    1 
ATOM   1970  C  CG    . ARG C 3 81  ? -42.467 -35.925 42.525 1.00 93.76  ? 81   ARG C CG    1 
ATOM   1971  C  CD    . ARG C 3 81  ? -42.985 -35.383 43.836 1.00 94.26  ? 81   ARG C CD    1 
ATOM   1972  N  NE    . ARG C 3 81  ? -42.029 -34.463 44.443 1.00 94.25  ? 81   ARG C NE    1 
ATOM   1973  C  CZ    . ARG C 3 81  ? -41.429 -34.663 45.613 1.00 94.75  ? 81   ARG C CZ    1 
ATOM   1974  N  NH1   . ARG C 3 81  ? -41.688 -35.751 46.330 1.00 94.24  ? 81   ARG C NH1   1 
ATOM   1975  N  NH2   . ARG C 3 81  ? -40.575 -33.759 46.074 1.00 94.95  ? 81   ARG C NH2   1 
ATOM   1976  N  N     . HIS C 3 82  ? -41.153 -36.880 39.486 1.00 92.51  ? 82   HIS C N     1 
ATOM   1977  C  CA    . HIS C 3 82  ? -40.549 -38.190 39.253 1.00 91.65  ? 82   HIS C CA    1 
ATOM   1978  C  C     . HIS C 3 82  ? -39.130 -38.048 38.775 1.00 90.77  ? 82   HIS C C     1 
ATOM   1979  O  O     . HIS C 3 82  ? -38.305 -38.936 38.988 1.00 91.04  ? 82   HIS C O     1 
ATOM   1980  C  CB    . HIS C 3 82  ? -41.356 -39.000 38.243 1.00 91.90  ? 82   HIS C CB    1 
ATOM   1981  C  CG    . HIS C 3 82  ? -42.773 -39.228 38.660 1.00 92.91  ? 82   HIS C CG    1 
ATOM   1982  N  ND1   . HIS C 3 82  ? -43.846 -38.740 37.948 1.00 93.68  ? 82   HIS C ND1   1 
ATOM   1983  C  CD2   . HIS C 3 82  ? -43.292 -39.862 39.738 1.00 94.01  ? 82   HIS C CD2   1 
ATOM   1984  C  CE1   . HIS C 3 82  ? -44.967 -39.082 38.559 1.00 94.74  ? 82   HIS C CE1   1 
ATOM   1985  N  NE2   . HIS C 3 82  ? -44.658 -39.758 39.651 1.00 94.70  ? 82   HIS C NE2   1 
ATOM   1986  N  N     . LEU C 3 83  ? -38.841 -36.926 38.132 1.00 89.46  ? 83   LEU C N     1 
ATOM   1987  C  CA    . LEU C 3 83  ? -37.472 -36.632 37.754 1.00 88.31  ? 83   LEU C CA    1 
ATOM   1988  C  C     . LEU C 3 83  ? -36.670 -36.336 39.015 1.00 87.77  ? 83   LEU C C     1 
ATOM   1989  O  O     . LEU C 3 83  ? -35.723 -37.059 39.326 1.00 87.34  ? 83   LEU C O     1 
ATOM   1990  C  CB    . LEU C 3 83  ? -37.414 -35.487 36.742 1.00 87.89  ? 83   LEU C CB    1 
ATOM   1991  C  CG    . LEU C 3 83  ? -38.024 -35.806 35.376 1.00 86.88  ? 83   LEU C CG    1 
ATOM   1992  C  CD1   . LEU C 3 83  ? -38.105 -34.559 34.539 1.00 86.24  ? 83   LEU C CD1   1 
ATOM   1993  C  CD2   . LEU C 3 83  ? -37.257 -36.903 34.639 1.00 86.01  ? 83   LEU C CD2   1 
ATOM   1994  N  N     . GLN C 3 84  ? -37.096 -35.315 39.760 1.00 87.11  ? 84   GLN C N     1 
ATOM   1995  C  CA    . GLN C 3 84  ? -36.457 -34.940 41.027 1.00 86.74  ? 84   GLN C CA    1 
ATOM   1996  C  C     . GLN C 3 84  ? -36.226 -36.148 41.945 1.00 86.47  ? 84   GLN C C     1 
ATOM   1997  O  O     . GLN C 3 84  ? -35.099 -36.384 42.398 1.00 86.91  ? 84   GLN C O     1 
ATOM   1998  C  CB    . GLN C 3 84  ? -37.256 -33.844 41.749 1.00 86.57  ? 84   GLN C CB    1 
ATOM   1999  C  CG    . GLN C 3 84  ? -36.740 -33.493 43.140 1.00 86.51  ? 84   GLN C CG    1 
ATOM   2000  C  CD    . GLN C 3 84  ? -35.692 -32.387 43.153 1.00 86.57  ? 84   GLN C CD    1 
ATOM   2001  O  OE1   . GLN C 3 84  ? -34.943 -32.195 42.194 1.00 86.82  ? 84   GLN C OE1   1 
ATOM   2002  N  NE2   . GLN C 3 84  ? -35.633 -31.657 44.260 1.00 85.89  ? 84   GLN C NE2   1 
ATOM   2003  N  N     . LEU C 3 85  ? -37.279 -36.922 42.196 1.00 85.66  ? 85   LEU C N     1 
ATOM   2004  C  CA    . LEU C 3 85  ? -37.151 -38.135 42.989 1.00 84.75  ? 85   LEU C CA    1 
ATOM   2005  C  C     . LEU C 3 85  ? -36.055 -39.027 42.425 1.00 84.22  ? 85   LEU C C     1 
ATOM   2006  O  O     . LEU C 3 85  ? -35.173 -39.462 43.163 1.00 84.33  ? 85   LEU C O     1 
ATOM   2007  C  CB    . LEU C 3 85  ? -38.485 -38.872 43.081 1.00 84.69  ? 85   LEU C CB    1 
ATOM   2008  C  CG    . LEU C 3 85  ? -39.569 -38.153 43.894 1.00 84.59  ? 85   LEU C CG    1 
ATOM   2009  C  CD1   . LEU C 3 85  ? -40.889 -38.878 43.781 1.00 84.55  ? 85   LEU C CD1   1 
ATOM   2010  C  CD2   . LEU C 3 85  ? -39.176 -38.013 45.356 1.00 83.94  ? 85   LEU C CD2   1 
ATOM   2011  N  N     . ALA C 3 86  ? -36.076 -39.256 41.113 1.00 83.65  ? 86   ALA C N     1 
ATOM   2012  C  CA    . ALA C 3 86  ? -35.072 -40.114 40.474 1.00 83.11  ? 86   ALA C CA    1 
ATOM   2013  C  C     . ALA C 3 86  ? -33.670 -39.582 40.685 1.00 82.83  ? 86   ALA C C     1 
ATOM   2014  O  O     . ALA C 3 86  ? -32.744 -40.349 40.954 1.00 82.86  ? 86   ALA C O     1 
ATOM   2015  C  CB    . ALA C 3 86  ? -35.344 -40.240 39.007 1.00 83.04  ? 86   ALA C CB    1 
ATOM   2016  N  N     . VAL C 3 87  ? -33.545 -38.259 40.579 1.00 82.40  ? 87   VAL C N     1 
ATOM   2017  C  CA    . VAL C 3 87  ? -32.269 -37.569 40.560 1.00 81.80  ? 87   VAL C CA    1 
ATOM   2018  C  C     . VAL C 3 87  ? -31.664 -37.477 41.944 1.00 81.58  ? 87   VAL C C     1 
ATOM   2019  O  O     . VAL C 3 87  ? -30.511 -37.861 42.145 1.00 81.38  ? 87   VAL C O     1 
ATOM   2020  C  CB    . VAL C 3 87  ? -32.409 -36.140 39.979 1.00 81.98  ? 87   VAL C CB    1 
ATOM   2021  C  CG1   . VAL C 3 87  ? -31.079 -35.364 40.099 1.00 81.52  ? 87   VAL C CG1   1 
ATOM   2022  C  CG2   . VAL C 3 87  ? -32.871 -36.196 38.530 1.00 81.41  ? 87   VAL C CG2   1 
ATOM   2023  N  N     . ARG C 3 88  ? -32.444 -36.956 42.888 1.00 81.15  ? 88   ARG C N     1 
ATOM   2024  C  CA    . ARG C 3 88  ? -31.951 -36.709 44.236 1.00 80.88  ? 88   ARG C CA    1 
ATOM   2025  C  C     . ARG C 3 88  ? -31.705 -38.019 44.966 1.00 81.21  ? 88   ARG C C     1 
ATOM   2026  O  O     . ARG C 3 88  ? -30.797 -38.112 45.795 1.00 81.74  ? 88   ARG C O     1 
ATOM   2027  C  CB    . ARG C 3 88  ? -32.906 -35.803 45.025 1.00 80.55  ? 88   ARG C CB    1 
ATOM   2028  C  CG    . ARG C 3 88  ? -33.266 -34.482 44.329 1.00 79.20  ? 88   ARG C CG    1 
ATOM   2029  C  CD    . ARG C 3 88  ? -32.035 -33.675 43.968 1.00 75.74  ? 88   ARG C CD    1 
ATOM   2030  N  NE    . ARG C 3 88  ? -32.294 -32.599 43.012 1.00 73.20  ? 88   ARG C NE    1 
ATOM   2031  C  CZ    . ARG C 3 88  ? -31.340 -32.007 42.286 1.00 73.08  ? 88   ARG C CZ    1 
ATOM   2032  N  NH1   . ARG C 3 88  ? -30.064 -32.388 42.400 1.00 70.56  ? 88   ARG C NH1   1 
ATOM   2033  N  NH2   . ARG C 3 88  ? -31.655 -31.038 41.434 1.00 71.45  ? 88   ARG C NH2   1 
ATOM   2034  N  N     . ASN C 3 89  ? -32.489 -39.045 44.648 1.00 81.14  ? 89   ASN C N     1 
ATOM   2035  C  CA    . ASN C 3 89  ? -32.225 -40.357 45.214 1.00 80.83  ? 89   ASN C CA    1 
ATOM   2036  C  C     . ASN C 3 89  ? -31.020 -41.055 44.624 1.00 80.92  ? 89   ASN C C     1 
ATOM   2037  O  O     . ASN C 3 89  ? -30.443 -41.913 45.273 1.00 81.53  ? 89   ASN C O     1 
ATOM   2038  C  CB    . ASN C 3 89  ? -33.457 -41.227 45.173 1.00 80.47  ? 89   ASN C CB    1 
ATOM   2039  C  CG    . ASN C 3 89  ? -34.445 -40.850 46.256 1.00 80.57  ? 89   ASN C CG    1 
ATOM   2040  O  OD1   . ASN C 3 89  ? -34.116 -40.846 47.448 1.00 79.63  ? 89   ASN C OD1   1 
ATOM   2041  N  ND2   . ASN C 3 89  ? -35.662 -40.522 45.851 1.00 81.60  ? 89   ASN C ND2   1 
ATOM   2042  N  N     . ASP C 3 90  ? -30.617 -40.675 43.416 1.00 80.88  ? 90   ASP C N     1 
ATOM   2043  C  CA    . ASP C 3 90  ? -29.387 -41.217 42.836 1.00 80.90  ? 90   ASP C CA    1 
ATOM   2044  C  C     . ASP C 3 90  ? -28.148 -40.435 43.285 1.00 80.46  ? 90   ASP C C     1 
ATOM   2045  O  O     . ASP C 3 90  ? -28.048 -39.226 43.117 1.00 79.76  ? 90   ASP C O     1 
ATOM   2046  C  CB    . ASP C 3 90  ? -29.459 -41.303 41.306 1.00 81.11  ? 90   ASP C CB    1 
ATOM   2047  C  CG    . ASP C 3 90  ? -28.306 -42.105 40.717 1.00 82.53  ? 90   ASP C CG    1 
ATOM   2048  O  OD1   . ASP C 3 90  ? -28.220 -42.249 39.470 1.00 83.67  ? 90   ASP C OD1   1 
ATOM   2049  O  OD2   . ASP C 3 90  ? -27.474 -42.599 41.512 1.00 84.02  ? 90   ASP C OD2   1 
ATOM   2050  N  N     . GLU C 3 91  ? -27.203 -41.152 43.866 1.00 80.67  ? 91   GLU C N     1 
ATOM   2051  C  CA    . GLU C 3 91  ? -26.001 -40.529 44.415 1.00 80.91  ? 91   GLU C CA    1 
ATOM   2052  C  C     . GLU C 3 91  ? -25.145 -39.887 43.314 1.00 80.21  ? 91   GLU C C     1 
ATOM   2053  O  O     . GLU C 3 91  ? -24.683 -38.756 43.465 1.00 80.11  ? 91   GLU C O     1 
ATOM   2054  C  CB    . GLU C 3 91  ? -25.204 -41.562 45.201 1.00 81.37  ? 91   GLU C CB    1 
ATOM   2055  C  CG    . GLU C 3 91  ? -24.084 -41.014 46.039 1.00 83.84  ? 91   GLU C CG    1 
ATOM   2056  C  CD    . GLU C 3 91  ? -22.765 -41.672 45.693 1.00 88.51  ? 91   GLU C CD    1 
ATOM   2057  O  OE1   . GLU C 3 91  ? -22.580 -41.987 44.490 1.00 90.07  ? 91   GLU C OE1   1 
ATOM   2058  O  OE2   . GLU C 3 91  ? -21.913 -41.860 46.606 1.00 89.97  ? 91   GLU C OE2   1 
ATOM   2059  N  N     . GLU C 3 92  ? -24.976 -40.597 42.199 1.00 79.55  ? 92   GLU C N     1 
ATOM   2060  C  CA    . GLU C 3 92  ? -24.184 -40.101 41.073 1.00 78.68  ? 92   GLU C CA    1 
ATOM   2061  C  C     . GLU C 3 92  ? -24.877 -39.035 40.243 1.00 77.67  ? 92   GLU C C     1 
ATOM   2062  O  O     . GLU C 3 92  ? -24.217 -38.127 39.759 1.00 77.42  ? 92   GLU C O     1 
ATOM   2063  C  CB    . GLU C 3 92  ? -23.739 -41.246 40.174 1.00 79.04  ? 92   GLU C CB    1 
ATOM   2064  C  CG    . GLU C 3 92  ? -22.644 -42.103 40.797 1.00 81.09  ? 92   GLU C CG    1 
ATOM   2065  C  CD    . GLU C 3 92  ? -21.679 -42.648 39.764 1.00 83.74  ? 92   GLU C CD    1 
ATOM   2066  O  OE1   . GLU C 3 92  ? -22.151 -43.056 38.672 1.00 85.21  ? 92   GLU C OE1   1 
ATOM   2067  O  OE2   . GLU C 3 92  ? -20.457 -42.672 40.042 1.00 83.26  ? 92   GLU C OE2   1 
ATOM   2068  N  N     . LEU C 3 93  ? -26.195 -39.144 40.064 1.00 76.76  ? 93   LEU C N     1 
ATOM   2069  C  CA    . LEU C 3 93  ? -26.931 -38.169 39.252 1.00 75.81  ? 93   LEU C CA    1 
ATOM   2070  C  C     . LEU C 3 93  ? -27.141 -36.885 40.012 1.00 75.64  ? 93   LEU C C     1 
ATOM   2071  O  O     . LEU C 3 93  ? -27.113 -35.805 39.425 1.00 76.04  ? 93   LEU C O     1 
ATOM   2072  C  CB    . LEU C 3 93  ? -28.293 -38.699 38.786 1.00 76.01  ? 93   LEU C CB    1 
ATOM   2073  C  CG    . LEU C 3 93  ? -28.462 -39.641 37.584 1.00 75.38  ? 93   LEU C CG    1 
ATOM   2074  C  CD1   . LEU C 3 93  ? -29.932 -39.984 37.415 1.00 74.55  ? 93   LEU C CD1   1 
ATOM   2075  C  CD2   . LEU C 3 93  ? -27.900 -39.072 36.287 1.00 73.49  ? 93   LEU C CD2   1 
ATOM   2076  N  N     . ASN C 3 94  ? -27.369 -37.002 41.318 1.00 75.27  ? 94   ASN C N     1 
ATOM   2077  C  CA    . ASN C 3 94  ? -27.599 -35.835 42.166 1.00 74.33  ? 94   ASN C CA    1 
ATOM   2078  C  C     . ASN C 3 94  ? -26.375 -34.975 42.220 1.00 73.49  ? 94   ASN C C     1 
ATOM   2079  O  O     . ASN C 3 94  ? -26.480 -33.760 42.311 1.00 73.65  ? 94   ASN C O     1 
ATOM   2080  C  CB    . ASN C 3 94  ? -27.992 -36.221 43.597 1.00 74.54  ? 94   ASN C CB    1 
ATOM   2081  C  CG    . ASN C 3 94  ? -28.093 -35.012 44.508 1.00 74.76  ? 94   ASN C CG    1 
ATOM   2082  O  OD1   . ASN C 3 94  ? -29.073 -34.257 44.449 1.00 74.86  ? 94   ASN C OD1   1 
ATOM   2083  N  ND2   . ASN C 3 94  ? -27.052 -34.786 45.318 1.00 73.06  ? 94   ASN C ND2   1 
ATOM   2084  N  N     . LYS C 3 95  ? -25.212 -35.604 42.179 1.00 72.91  ? 95   LYS C N     1 
ATOM   2085  C  CA    . LYS C 3 95  ? -23.987 -34.852 42.136 1.00 72.73  ? 95   LYS C CA    1 
ATOM   2086  C  C     . LYS C 3 95  ? -24.051 -34.058 40.871 1.00 72.53  ? 95   LYS C C     1 
ATOM   2087  O  O     . LYS C 3 95  ? -24.123 -32.836 40.907 1.00 72.33  ? 95   LYS C O     1 
ATOM   2088  C  CB    . LYS C 3 95  ? -22.785 -35.761 42.104 1.00 72.67  ? 95   LYS C CB    1 
ATOM   2089  C  CG    . LYS C 3 95  ? -21.547 -35.117 42.653 1.00 74.49  ? 95   LYS C CG    1 
ATOM   2090  C  CD    . LYS C 3 95  ? -20.356 -36.055 42.551 1.00 77.12  ? 95   LYS C CD    1 
ATOM   2091  C  CE    . LYS C 3 95  ? -20.602 -37.448 43.166 1.00 78.24  ? 95   LYS C CE    1 
ATOM   2092  N  NZ    . LYS C 3 95  ? -19.352 -38.305 43.152 1.00 77.83  ? 95   LYS C NZ    1 
ATOM   2093  N  N     . LEU C 3 96  ? -24.099 -34.771 39.750 1.00 72.59  ? 96   LEU C N     1 
ATOM   2094  C  CA    . LEU C 3 96  ? -24.063 -34.149 38.432 1.00 72.15  ? 96   LEU C CA    1 
ATOM   2095  C  C     . LEU C 3 96  ? -24.928 -32.902 38.407 1.00 72.11  ? 96   LEU C C     1 
ATOM   2096  O  O     . LEU C 3 96  ? -24.448 -31.829 38.067 1.00 72.69  ? 96   LEU C O     1 
ATOM   2097  C  CB    . LEU C 3 96  ? -24.497 -35.152 37.359 1.00 72.10  ? 96   LEU C CB    1 
ATOM   2098  C  CG    . LEU C 3 96  ? -24.529 -34.760 35.875 1.00 72.12  ? 96   LEU C CG    1 
ATOM   2099  C  CD1   . LEU C 3 96  ? -23.244 -34.064 35.402 1.00 70.40  ? 96   LEU C CD1   1 
ATOM   2100  C  CD2   . LEU C 3 96  ? -24.820 -35.985 35.021 1.00 71.73  ? 96   LEU C CD2   1 
ATOM   2101  N  N     . LEU C 3 97  ? -26.193 -33.047 38.787 1.00 71.94  ? 97   LEU C N     1 
ATOM   2102  C  CA    . LEU C 3 97  ? -27.110 -31.923 38.869 1.00 71.77  ? 97   LEU C CA    1 
ATOM   2103  C  C     . LEU C 3 97  ? -27.135 -31.361 40.300 1.00 71.90  ? 97   LEU C C     1 
ATOM   2104  O  O     . LEU C 3 97  ? -28.206 -31.043 40.861 1.00 71.63  ? 97   LEU C O     1 
ATOM   2105  C  CB    . LEU C 3 97  ? -28.503 -32.347 38.425 1.00 71.83  ? 97   LEU C CB    1 
ATOM   2106  C  CG    . LEU C 3 97  ? -28.708 -33.222 37.189 1.00 72.18  ? 97   LEU C CG    1 
ATOM   2107  C  CD1   . LEU C 3 97  ? -30.088 -33.771 37.241 1.00 72.99  ? 97   LEU C CD1   1 
ATOM   2108  C  CD2   . LEU C 3 97  ? -28.538 -32.461 35.897 1.00 73.81  ? 97   LEU C CD2   1 
ATOM   2109  N  N     . GLY C 3 98  ? -25.934 -31.250 40.874 1.00 71.73  ? 98   GLY C N     1 
ATOM   2110  C  CA    . GLY C 3 98  ? -25.711 -30.643 42.181 1.00 71.53  ? 98   GLY C CA    1 
ATOM   2111  C  C     . GLY C 3 98  ? -26.031 -29.162 42.249 1.00 71.41  ? 98   GLY C C     1 
ATOM   2112  O  O     . GLY C 3 98  ? -26.334 -28.654 43.318 1.00 71.42  ? 98   GLY C O     1 
ATOM   2113  N  N     . ARG C 3 99  ? -25.973 -28.469 41.115 1.00 71.53  ? 99   ARG C N     1 
ATOM   2114  C  CA    . ARG C 3 99  ? -26.335 -27.052 41.064 1.00 71.84  ? 99   ARG C CA    1 
ATOM   2115  C  C     . ARG C 3 99  ? -27.603 -26.744 40.251 1.00 71.33  ? 99   ARG C C     1 
ATOM   2116  O  O     . ARG C 3 99  ? -27.791 -25.613 39.813 1.00 71.35  ? 99   ARG C O     1 
ATOM   2117  C  CB    . ARG C 3 99  ? -25.177 -26.237 40.504 1.00 72.01  ? 99   ARG C CB    1 
ATOM   2118  C  CG    . ARG C 3 99  ? -23.920 -26.322 41.315 1.00 74.88  ? 99   ARG C CG    1 
ATOM   2119  C  CD    . ARG C 3 99  ? -24.093 -25.537 42.567 1.00 80.30  ? 99   ARG C CD    1 
ATOM   2120  N  NE    . ARG C 3 99  ? -22.938 -25.653 43.441 1.00 85.28  ? 99   ARG C NE    1 
ATOM   2121  C  CZ    . ARG C 3 99  ? -22.891 -25.137 44.664 1.00 87.04  ? 99   ARG C CZ    1 
ATOM   2122  N  NH1   . ARG C 3 99  ? -23.950 -24.476 45.134 1.00 86.98  ? 99   ARG C NH1   1 
ATOM   2123  N  NH2   . ARG C 3 99  ? -21.793 -25.284 45.405 1.00 87.19  ? 99   ARG C NH2   1 
ATOM   2124  N  N     . VAL C 3 100 ? -28.476 -27.723 40.049 1.00 71.13  ? 100  VAL C N     1 
ATOM   2125  C  CA    . VAL C 3 100 ? -29.666 -27.470 39.220 1.00 71.18  ? 100  VAL C CA    1 
ATOM   2126  C  C     . VAL C 3 100 ? -30.925 -27.543 40.023 1.00 71.01  ? 100  VAL C C     1 
ATOM   2127  O  O     . VAL C 3 100 ? -31.267 -28.586 40.560 1.00 70.98  ? 100  VAL C O     1 
ATOM   2128  C  CB    . VAL C 3 100 ? -29.826 -28.457 38.020 1.00 71.30  ? 100  VAL C CB    1 
ATOM   2129  C  CG1   . VAL C 3 100 ? -31.188 -28.276 37.387 1.00 71.09  ? 100  VAL C CG1   1 
ATOM   2130  C  CG2   . VAL C 3 100 ? -28.715 -28.282 36.983 1.00 70.42  ? 100  VAL C CG2   1 
ATOM   2131  N  N     . THR C 3 101 ? -31.628 -26.434 40.103 1.00 71.45  ? 101  THR C N     1 
ATOM   2132  C  CA    . THR C 3 101 ? -32.992 -26.492 40.614 1.00 72.09  ? 101  THR C CA    1 
ATOM   2133  C  C     . THR C 3 101 ? -33.947 -26.972 39.501 1.00 72.36  ? 101  THR C C     1 
ATOM   2134  O  O     . THR C 3 101 ? -34.042 -26.332 38.464 1.00 73.39  ? 101  THR C O     1 
ATOM   2135  C  CB    . THR C 3 101 ? -33.421 -25.154 41.228 1.00 71.70  ? 101  THR C CB    1 
ATOM   2136  O  OG1   . THR C 3 101 ? -34.765 -24.872 40.843 1.00 71.30  ? 101  THR C OG1   1 
ATOM   2137  C  CG2   . THR C 3 101 ? -32.518 -24.019 40.752 1.00 71.65  ? 101  THR C CG2   1 
ATOM   2138  N  N     . ILE C 3 102 ? -34.607 -28.111 39.703 1.00 72.54  ? 102  ILE C N     1 
ATOM   2139  C  CA    . ILE C 3 102 ? -35.603 -28.650 38.749 1.00 72.64  ? 102  ILE C CA    1 
ATOM   2140  C  C     . ILE C 3 102 ? -37.017 -28.123 39.052 1.00 73.66  ? 102  ILE C C     1 
ATOM   2141  O  O     . ILE C 3 102 ? -37.607 -28.484 40.072 1.00 73.51  ? 102  ILE C O     1 
ATOM   2142  C  CB    . ILE C 3 102 ? -35.664 -30.218 38.817 1.00 72.81  ? 102  ILE C CB    1 
ATOM   2143  C  CG1   . ILE C 3 102 ? -34.391 -30.855 38.246 1.00 71.33  ? 102  ILE C CG1   1 
ATOM   2144  C  CG2   . ILE C 3 102 ? -36.931 -30.755 38.131 1.00 70.94  ? 102  ILE C CG2   1 
ATOM   2145  C  CD1   . ILE C 3 102 ? -34.345 -32.356 38.348 1.00 71.28  ? 102  ILE C CD1   1 
ATOM   2146  N  N     . ALA C 3 103 ? -37.561 -27.280 38.179 1.00 74.94  ? 103  ALA C N     1 
ATOM   2147  C  CA    . ALA C 3 103 ? -38.924 -26.733 38.365 1.00 76.57  ? 103  ALA C CA    1 
ATOM   2148  C  C     . ALA C 3 103 ? -39.984 -27.786 38.742 1.00 77.73  ? 103  ALA C C     1 
ATOM   2149  O  O     . ALA C 3 103 ? -40.047 -28.872 38.151 1.00 77.87  ? 103  ALA C O     1 
ATOM   2150  C  CB    . ALA C 3 103 ? -39.373 -25.947 37.135 1.00 76.36  ? 103  ALA C CB    1 
ATOM   2151  N  N     . GLN C 3 104 ? -40.800 -27.454 39.740 1.00 79.01  ? 104  GLN C N     1 
ATOM   2152  C  CA    . GLN C 3 104 ? -41.855 -28.341 40.221 1.00 80.71  ? 104  GLN C CA    1 
ATOM   2153  C  C     . GLN C 3 104 ? -41.334 -29.706 40.673 1.00 81.91  ? 104  GLN C C     1 
ATOM   2154  O  O     . GLN C 3 104 ? -41.942 -30.740 40.394 1.00 82.61  ? 104  GLN C O     1 
ATOM   2155  C  CB    . GLN C 3 104 ? -42.955 -28.503 39.161 1.00 80.57  ? 104  GLN C CB    1 
ATOM   2156  C  CG    . GLN C 3 104 ? -43.877 -27.301 39.036 1.00 81.27  ? 104  GLN C CG    1 
ATOM   2157  C  CD    . GLN C 3 104 ? -44.588 -26.973 40.346 1.00 82.15  ? 104  GLN C CD    1 
ATOM   2158  O  OE1   . GLN C 3 104 ? -45.077 -27.868 41.048 1.00 82.54  ? 104  GLN C OE1   1 
ATOM   2159  N  NE2   . GLN C 3 104 ? -44.644 -25.684 40.682 1.00 81.49  ? 104  GLN C NE2   1 
ATOM   2160  N  N     . GLY C 3 105 ? -40.219 -29.713 41.387 1.00 83.04  ? 105  GLY C N     1 
ATOM   2161  C  CA    . GLY C 3 105 ? -39.636 -30.966 41.836 1.00 84.45  ? 105  GLY C CA    1 
ATOM   2162  C  C     . GLY C 3 105 ? -39.939 -31.289 43.284 1.00 85.47  ? 105  GLY C C     1 
ATOM   2163  O  O     . GLY C 3 105 ? -39.973 -32.464 43.676 1.00 85.95  ? 105  GLY C O     1 
ATOM   2164  N  N     . GLY C 3 106 ? -40.158 -30.253 44.086 1.00 85.96  ? 106  GLY C N     1 
ATOM   2165  C  CA    . GLY C 3 106 ? -40.271 -30.435 45.525 1.00 86.63  ? 106  GLY C CA    1 
ATOM   2166  C  C     . GLY C 3 106 ? -38.935 -30.858 46.107 1.00 87.20  ? 106  GLY C C     1 
ATOM   2167  O  O     . GLY C 3 106 ? -37.882 -30.663 45.494 1.00 86.95  ? 106  GLY C O     1 
ATOM   2168  N  N     . VAL C 3 107 ? -38.991 -31.439 47.300 1.00 87.87  ? 107  VAL C N     1 
ATOM   2169  C  CA    . VAL C 3 107 ? -37.809 -31.961 47.982 1.00 88.22  ? 107  VAL C CA    1 
ATOM   2170  C  C     . VAL C 3 107 ? -38.045 -33.419 48.352 1.00 88.49  ? 107  VAL C C     1 
ATOM   2171  O  O     . VAL C 3 107 ? -39.184 -33.891 48.340 1.00 88.79  ? 107  VAL C O     1 
ATOM   2172  C  CB    . VAL C 3 107 ? -37.514 -31.162 49.257 1.00 88.16  ? 107  VAL C CB    1 
ATOM   2173  C  CG1   . VAL C 3 107 ? -37.004 -29.777 48.897 1.00 88.44  ? 107  VAL C CG1   1 
ATOM   2174  C  CG2   . VAL C 3 107 ? -38.767 -31.070 50.139 1.00 88.40  ? 107  VAL C CG2   1 
ATOM   2175  N  N     . LEU C 3 108 ? -36.976 -34.139 48.666 1.00 88.76  ? 108  LEU C N     1 
ATOM   2176  C  CA    . LEU C 3 108 ? -37.119 -35.464 49.241 1.00 89.21  ? 108  LEU C CA    1 
ATOM   2177  C  C     . LEU C 3 108 ? -37.643 -35.281 50.649 1.00 89.96  ? 108  LEU C C     1 
ATOM   2178  O  O     . LEU C 3 108 ? -37.387 -34.244 51.262 1.00 89.99  ? 108  LEU C O     1 
ATOM   2179  C  CB    . LEU C 3 108 ? -35.780 -36.188 49.288 1.00 88.92  ? 108  LEU C CB    1 
ATOM   2180  C  CG    . LEU C 3 108 ? -35.290 -36.773 47.974 1.00 88.51  ? 108  LEU C CG    1 
ATOM   2181  C  CD1   . LEU C 3 108 ? -33.941 -37.455 48.174 1.00 88.38  ? 108  LEU C CD1   1 
ATOM   2182  C  CD2   . LEU C 3 108 ? -36.313 -37.745 47.439 1.00 88.53  ? 108  LEU C CD2   1 
ATOM   2183  N  N     . PRO C 3 109 ? -38.403 -36.265 51.163 1.00 90.76  ? 109  PRO C N     1 
ATOM   2184  C  CA    . PRO C 3 109 ? -38.815 -36.161 52.552 1.00 91.22  ? 109  PRO C CA    1 
ATOM   2185  C  C     . PRO C 3 109 ? -37.678 -36.602 53.464 1.00 91.67  ? 109  PRO C C     1 
ATOM   2186  O  O     . PRO C 3 109 ? -37.176 -37.723 53.345 1.00 91.67  ? 109  PRO C O     1 
ATOM   2187  C  CB    . PRO C 3 109 ? -40.009 -37.125 52.647 1.00 91.14  ? 109  PRO C CB    1 
ATOM   2188  C  CG    . PRO C 3 109 ? -40.259 -37.615 51.229 1.00 91.20  ? 109  PRO C CG    1 
ATOM   2189  C  CD    . PRO C 3 109 ? -38.951 -37.478 50.534 1.00 90.96  ? 109  PRO C CD    1 
ATOM   2190  N  N     . ASN C 3 110 ? -37.267 -35.686 54.334 1.00 92.21  ? 110  ASN C N     1 
ATOM   2191  C  CA    . ASN C 3 110 ? -36.262 -35.919 55.354 1.00 92.81  ? 110  ASN C CA    1 
ATOM   2192  C  C     . ASN C 3 110 ? -36.655 -35.030 56.526 1.00 93.12  ? 110  ASN C C     1 
ATOM   2193  O  O     . ASN C 3 110 ? -36.804 -33.817 56.362 1.00 93.01  ? 110  ASN C O     1 
ATOM   2194  C  CB    . ASN C 3 110 ? -34.869 -35.542 54.830 1.00 93.12  ? 110  ASN C CB    1 
ATOM   2195  C  CG    . ASN C 3 110 ? -33.784 -35.635 55.902 1.00 93.73  ? 110  ASN C CG    1 
ATOM   2196  O  OD1   . ASN C 3 110 ? -33.339 -36.730 56.248 1.00 94.49  ? 110  ASN C OD1   1 
ATOM   2197  N  ND2   . ASN C 3 110 ? -33.346 -34.478 56.421 1.00 93.50  ? 110  ASN C ND2   1 
ATOM   2198  N  N     . ILE C 3 111 ? -36.848 -35.647 57.692 1.00 93.63  ? 111  ILE C N     1 
ATOM   2199  C  CA    . ILE C 3 111 ? -37.308 -34.963 58.907 1.00 94.22  ? 111  ILE C CA    1 
ATOM   2200  C  C     . ILE C 3 111 ? -36.292 -35.239 59.997 1.00 94.59  ? 111  ILE C C     1 
ATOM   2201  O  O     . ILE C 3 111 ? -36.255 -36.337 60.544 1.00 94.73  ? 111  ILE C O     1 
ATOM   2202  C  CB    . ILE C 3 111 ? -38.699 -35.480 59.401 1.00 94.13  ? 111  ILE C CB    1 
ATOM   2203  C  CG1   . ILE C 3 111 ? -39.670 -35.731 58.238 1.00 94.57  ? 111  ILE C CG1   1 
ATOM   2204  C  CG2   . ILE C 3 111 ? -39.303 -34.526 60.407 1.00 93.96  ? 111  ILE C CG2   1 
ATOM   2205  C  CD1   . ILE C 3 111 ? -39.539 -37.147 57.589 1.00 94.98  ? 111  ILE C CD1   1 
ATOM   2206  N  N     . GLN C 3 112 ? -35.476 -34.239 60.312 1.00 95.10  ? 112  GLN C N     1 
ATOM   2207  C  CA    . GLN C 3 112 ? -34.327 -34.410 61.202 1.00 95.56  ? 112  GLN C CA    1 
ATOM   2208  C  C     . GLN C 3 112 ? -34.650 -35.066 62.538 1.00 95.82  ? 112  GLN C C     1 
ATOM   2209  O  O     . GLN C 3 112 ? -35.490 -34.566 63.276 1.00 96.09  ? 112  GLN C O     1 
ATOM   2210  C  CB    . GLN C 3 112 ? -33.666 -33.058 61.448 1.00 95.68  ? 112  GLN C CB    1 
ATOM   2211  C  CG    . GLN C 3 112 ? -32.695 -32.646 60.361 1.00 96.29  ? 112  GLN C CG    1 
ATOM   2212  C  CD    . GLN C 3 112 ? -31.409 -33.437 60.418 1.00 96.76  ? 112  GLN C CD    1 
ATOM   2213  O  OE1   . GLN C 3 112 ? -30.723 -33.460 61.450 1.00 96.64  ? 112  GLN C OE1   1 
ATOM   2214  N  NE2   . GLN C 3 112 ? -31.072 -34.095 59.311 1.00 96.72  ? 112  GLN C NE2   1 
ATOM   2215  N  N     . SER C 3 113 ? -33.980 -36.184 62.829 1.00 96.19  ? 113  SER C N     1 
ATOM   2216  C  CA    . SER C 3 113 ? -34.100 -36.913 64.104 1.00 96.65  ? 113  SER C CA    1 
ATOM   2217  C  C     . SER C 3 113 ? -34.672 -36.109 65.274 1.00 97.09  ? 113  SER C C     1 
ATOM   2218  O  O     . SER C 3 113 ? -35.862 -36.199 65.559 1.00 97.26  ? 113  SER C O     1 
ATOM   2219  C  CB    . SER C 3 113 ? -32.749 -37.503 64.520 1.00 96.64  ? 113  SER C CB    1 
ATOM   2220  O  OG    . SER C 3 113 ? -32.567 -38.795 63.985 1.00 96.81  ? 113  SER C OG    1 
ATOM   2221  N  N     . VAL C 3 114 ? -33.826 -35.319 65.934 1.00 97.52  ? 114  VAL C N     1 
ATOM   2222  C  CA    . VAL C 3 114 ? -34.201 -34.600 67.157 1.00 98.03  ? 114  VAL C CA    1 
ATOM   2223  C  C     . VAL C 3 114 ? -35.463 -33.752 67.041 1.00 98.65  ? 114  VAL C C     1 
ATOM   2224  O  O     . VAL C 3 114 ? -35.947 -33.205 68.034 1.00 99.04  ? 114  VAL C O     1 
ATOM   2225  C  CB    . VAL C 3 114 ? -33.059 -33.713 67.686 1.00 97.93  ? 114  VAL C CB    1 
ATOM   2226  C  CG1   . VAL C 3 114 ? -32.186 -34.496 68.655 1.00 98.44  ? 114  VAL C CG1   1 
ATOM   2227  C  CG2   . VAL C 3 114 ? -32.250 -33.128 66.541 1.00 97.52  ? 114  VAL C CG2   1 
ATOM   2228  N  N     . LEU C 3 115 ? -35.997 -33.640 65.833 1.00 99.30  ? 115  LEU C N     1 
ATOM   2229  C  CA    . LEU C 3 115 ? -37.256 -32.947 65.637 1.00 99.91  ? 115  LEU C CA    1 
ATOM   2230  C  C     . LEU C 3 115 ? -38.424 -33.884 65.923 1.00 100.47 ? 115  LEU C C     1 
ATOM   2231  O  O     . LEU C 3 115 ? -39.478 -33.438 66.387 1.00 100.78 ? 115  LEU C O     1 
ATOM   2232  C  CB    . LEU C 3 115 ? -37.337 -32.350 64.228 1.00 99.81  ? 115  LEU C CB    1 
ATOM   2233  C  CG    . LEU C 3 115 ? -36.215 -31.380 63.839 1.00 99.34  ? 115  LEU C CG    1 
ATOM   2234  C  CD1   . LEU C 3 115 ? -36.409 -30.859 62.436 1.00 99.64  ? 115  LEU C CD1   1 
ATOM   2235  C  CD2   . LEU C 3 115 ? -36.125 -30.223 64.809 1.00 99.81  ? 115  LEU C CD2   1 
ATOM   2236  N  N     . LEU C 3 116 ? -38.218 -35.177 65.665 1.00 101.10 ? 116  LEU C N     1 
ATOM   2237  C  CA    . LEU C 3 116 ? -39.220 -36.220 65.923 1.00 101.99 ? 116  LEU C CA    1 
ATOM   2238  C  C     . LEU C 3 116 ? -39.621 -36.315 67.407 1.00 102.74 ? 116  LEU C C     1 
ATOM   2239  O  O     . LEU C 3 116 ? -38.783 -36.096 68.295 1.00 102.96 ? 116  LEU C O     1 
ATOM   2240  C  CB    . LEU C 3 116 ? -38.717 -37.584 65.441 1.00 101.75 ? 116  LEU C CB    1 
ATOM   2241  C  CG    . LEU C 3 116 ? -38.412 -37.773 63.956 1.00 101.93 ? 116  LEU C CG    1 
ATOM   2242  C  CD1   . LEU C 3 116 ? -37.449 -38.943 63.758 1.00 102.30 ? 116  LEU C CD1   1 
ATOM   2243  C  CD2   . LEU C 3 116 ? -39.683 -37.954 63.133 1.00 101.72 ? 116  LEU C CD2   1 
ATOM   2244  N  N     . PRO C 3 117 ? -40.901 -36.659 67.679 1.00 103.29 ? 117  PRO C N     1 
ATOM   2245  C  CA    . PRO C 3 117 ? -41.405 -36.746 69.058 1.00 103.61 ? 117  PRO C CA    1 
ATOM   2246  C  C     . PRO C 3 117 ? -40.730 -37.859 69.853 1.00 103.85 ? 117  PRO C C     1 
ATOM   2247  O  O     . PRO C 3 117 ? -40.212 -38.809 69.265 1.00 103.80 ? 117  PRO C O     1 
ATOM   2248  C  CB    . PRO C 3 117 ? -42.894 -37.066 68.870 1.00 103.74 ? 117  PRO C CB    1 
ATOM   2249  C  CG    . PRO C 3 117 ? -42.988 -37.695 67.509 1.00 103.67 ? 117  PRO C CG    1 
ATOM   2250  C  CD    . PRO C 3 117 ? -41.943 -37.001 66.689 1.00 103.37 ? 117  PRO C CD    1 
ATOM   2251  N  N     . LYS C 3 118 ? -40.738 -37.738 71.179 1.00 104.20 ? 118  LYS C N     1 
ATOM   2252  C  CA    . LYS C 3 118 ? -40.131 -38.746 72.039 1.00 104.40 ? 118  LYS C CA    1 
ATOM   2253  C  C     . LYS C 3 118 ? -41.188 -39.668 72.641 1.00 104.33 ? 118  LYS C C     1 
ATOM   2254  O  O     . LYS C 3 118 ? -41.251 -40.852 72.304 1.00 104.34 ? 118  LYS C O     1 
ATOM   2255  C  CB    . LYS C 3 118 ? -39.283 -38.086 73.134 1.00 104.56 ? 118  LYS C CB    1 
ATOM   2256  C  CG    . LYS C 3 118 ? -38.256 -39.013 73.813 1.00 105.41 ? 118  LYS C CG    1 
ATOM   2257  C  CD    . LYS C 3 118 ? -37.145 -39.469 72.852 1.00 106.68 ? 118  LYS C CD    1 
ATOM   2258  C  CE    . LYS C 3 118 ? -37.572 -40.685 72.027 1.00 107.04 ? 118  LYS C CE    1 
ATOM   2259  N  NZ    . LYS C 3 118 ? -36.632 -40.962 70.914 1.00 107.25 ? 118  LYS C NZ    1 
ATOM   2260  N  N     . LYS D 4 31  ? -45.456 -19.245 11.973 1.00 115.71 ? 28   LYS D N     1 
ATOM   2261  C  CA    . LYS D 4 31  ? -45.489 -19.805 13.361 1.00 115.82 ? 28   LYS D CA    1 
ATOM   2262  C  C     . LYS D 4 31  ? -44.190 -20.585 13.633 1.00 115.70 ? 28   LYS D C     1 
ATOM   2263  O  O     . LYS D 4 31  ? -44.166 -21.826 13.558 1.00 115.79 ? 28   LYS D O     1 
ATOM   2264  C  CB    . LYS D 4 31  ? -46.726 -20.697 13.556 1.00 115.93 ? 28   LYS D CB    1 
ATOM   2265  C  CG    . LYS D 4 31  ? -47.901 -20.413 12.594 1.00 116.41 ? 28   LYS D CG    1 
ATOM   2266  C  CD    . LYS D 4 31  ? -48.634 -19.097 12.894 1.00 116.61 ? 28   LYS D CD    1 
ATOM   2267  C  CE    . LYS D 4 31  ? -49.823 -18.879 11.955 1.00 116.39 ? 28   LYS D CE    1 
ATOM   2268  N  NZ    . LYS D 4 31  ? -49.453 -18.919 10.509 1.00 116.36 ? 28   LYS D NZ    1 
ATOM   2269  N  N     . THR D 4 32  ? -43.133 -19.833 13.966 1.00 115.20 ? 29   THR D N     1 
ATOM   2270  C  CA    . THR D 4 32  ? -41.721 -20.288 13.987 1.00 114.60 ? 29   THR D CA    1 
ATOM   2271  C  C     . THR D 4 32  ? -41.426 -21.718 14.447 1.00 114.15 ? 29   THR D C     1 
ATOM   2272  O  O     . THR D 4 32  ? -42.084 -22.259 15.345 1.00 114.22 ? 29   THR D O     1 
ATOM   2273  C  CB    . THR D 4 32  ? -40.829 -19.316 14.784 1.00 114.70 ? 29   THR D CB    1 
ATOM   2274  O  OG1   . THR D 4 32  ? -41.138 -17.975 14.397 1.00 114.87 ? 29   THR D OG1   1 
ATOM   2275  C  CG2   . THR D 4 32  ? -39.345 -19.585 14.517 1.00 114.60 ? 29   THR D CG2   1 
ATOM   2276  N  N     . ARG D 4 33  ? -40.378 -22.279 13.846 1.00 113.37 ? 30   ARG D N     1 
ATOM   2277  C  CA    . ARG D 4 33  ? -40.107 -23.711 13.842 1.00 112.55 ? 30   ARG D CA    1 
ATOM   2278  C  C     . ARG D 4 33  ? -39.094 -24.154 14.905 1.00 111.75 ? 30   ARG D C     1 
ATOM   2279  O  O     . ARG D 4 33  ? -38.220 -24.983 14.617 1.00 111.96 ? 30   ARG D O     1 
ATOM   2280  C  CB    . ARG D 4 33  ? -39.584 -24.086 12.453 1.00 112.59 ? 30   ARG D CB    1 
ATOM   2281  C  CG    . ARG D 4 33  ? -39.935 -25.478 11.979 1.00 113.07 ? 30   ARG D CG    1 
ATOM   2282  C  CD    . ARG D 4 33  ? -38.812 -26.017 11.122 1.00 113.98 ? 30   ARG D CD    1 
ATOM   2283  N  NE    . ARG D 4 33  ? -37.660 -26.395 11.940 1.00 114.33 ? 30   ARG D NE    1 
ATOM   2284  C  CZ    . ARG D 4 33  ? -36.390 -26.158 11.624 1.00 114.54 ? 30   ARG D CZ    1 
ATOM   2285  N  NH1   . ARG D 4 33  ? -36.075 -25.512 10.505 1.00 114.33 ? 30   ARG D NH1   1 
ATOM   2286  N  NH2   . ARG D 4 33  ? -35.429 -26.554 12.445 1.00 114.57 ? 30   ARG D NH2   1 
ATOM   2287  N  N     . LYS D 4 34  ? -39.209 -23.623 16.124 1.00 110.41 ? 31   LYS D N     1 
ATOM   2288  C  CA    . LYS D 4 34  ? -38.213 -23.899 17.176 1.00 109.13 ? 31   LYS D CA    1 
ATOM   2289  C  C     . LYS D 4 34  ? -38.022 -25.390 17.509 1.00 107.83 ? 31   LYS D C     1 
ATOM   2290  O  O     . LYS D 4 34  ? -38.984 -26.122 17.766 1.00 107.81 ? 31   LYS D O     1 
ATOM   2291  C  CB    . LYS D 4 34  ? -38.455 -23.049 18.441 1.00 109.53 ? 31   LYS D CB    1 
ATOM   2292  C  CG    . LYS D 4 34  ? -39.913 -22.669 18.737 1.00 110.62 ? 31   LYS D CG    1 
ATOM   2293  C  CD    . LYS D 4 34  ? -40.667 -23.799 19.429 1.00 112.23 ? 31   LYS D CD    1 
ATOM   2294  C  CE    . LYS D 4 34  ? -42.171 -23.681 19.206 1.00 113.11 ? 31   LYS D CE    1 
ATOM   2295  N  NZ    . LYS D 4 34  ? -42.799 -25.034 19.035 1.00 113.26 ? 31   LYS D NZ    1 
ATOM   2296  N  N     . GLU D 4 35  ? -36.761 -25.820 17.488 1.00 106.04 ? 32   GLU D N     1 
ATOM   2297  C  CA    . GLU D 4 35  ? -36.382 -27.226 17.648 1.00 104.28 ? 32   GLU D CA    1 
ATOM   2298  C  C     . GLU D 4 35  ? -36.311 -27.693 19.096 1.00 103.05 ? 32   GLU D C     1 
ATOM   2299  O  O     . GLU D 4 35  ? -36.338 -26.881 20.022 1.00 103.09 ? 32   GLU D O     1 
ATOM   2300  C  CB    . GLU D 4 35  ? -35.000 -27.450 17.054 1.00 104.38 ? 32   GLU D CB    1 
ATOM   2301  C  CG    . GLU D 4 35  ? -34.813 -27.022 15.628 1.00 104.48 ? 32   GLU D CG    1 
ATOM   2302  C  CD    . GLU D 4 35  ? -33.412 -27.330 15.154 1.00 105.14 ? 32   GLU D CD    1 
ATOM   2303  O  OE1   . GLU D 4 35  ? -32.525 -27.451 16.031 1.00 104.44 ? 32   GLU D OE1   1 
ATOM   2304  O  OE2   . GLU D 4 35  ? -33.195 -27.453 13.922 1.00 105.24 ? 32   GLU D OE2   1 
ATOM   2305  N  N     . SER D 4 36  ? -36.183 -29.007 19.281 1.00 101.24 ? 33   SER D N     1 
ATOM   2306  C  CA    . SER D 4 36  ? -35.880 -29.588 20.589 1.00 99.57  ? 33   SER D CA    1 
ATOM   2307  C  C     . SER D 4 36  ? -35.444 -31.038 20.428 1.00 98.48  ? 33   SER D C     1 
ATOM   2308  O  O     . SER D 4 36  ? -35.257 -31.504 19.308 1.00 98.06  ? 33   SER D O     1 
ATOM   2309  C  CB    . SER D 4 36  ? -37.081 -29.485 21.541 1.00 99.51  ? 33   SER D CB    1 
ATOM   2310  O  OG    . SER D 4 36  ? -37.921 -30.620 21.434 1.00 99.46  ? 33   SER D OG    1 
ATOM   2311  N  N     . TYR D 4 37  ? -35.281 -31.737 21.553 1.00 97.32  ? 34   TYR D N     1 
ATOM   2312  C  CA    . TYR D 4 37  ? -34.957 -33.166 21.569 1.00 96.07  ? 34   TYR D CA    1 
ATOM   2313  C  C     . TYR D 4 37  ? -36.167 -34.045 21.889 1.00 95.82  ? 34   TYR D C     1 
ATOM   2314  O  O     . TYR D 4 37  ? -36.041 -35.269 21.957 1.00 95.67  ? 34   TYR D O     1 
ATOM   2315  C  CB    . TYR D 4 37  ? -33.865 -33.460 22.592 1.00 95.49  ? 34   TYR D CB    1 
ATOM   2316  C  CG    . TYR D 4 37  ? -32.512 -32.871 22.291 1.00 94.34  ? 34   TYR D CG    1 
ATOM   2317  C  CD1   . TYR D 4 37  ? -32.125 -31.649 22.834 1.00 93.66  ? 34   TYR D CD1   1 
ATOM   2318  C  CD2   . TYR D 4 37  ? -31.607 -33.549 21.490 1.00 93.10  ? 34   TYR D CD2   1 
ATOM   2319  C  CE1   . TYR D 4 37  ? -30.875 -31.110 22.567 1.00 93.83  ? 34   TYR D CE1   1 
ATOM   2320  C  CE2   . TYR D 4 37  ? -30.361 -33.022 21.213 1.00 93.06  ? 34   TYR D CE2   1 
ATOM   2321  C  CZ    . TYR D 4 37  ? -29.996 -31.806 21.751 1.00 94.01  ? 34   TYR D CZ    1 
ATOM   2322  O  OH    . TYR D 4 37  ? -28.744 -31.299 21.475 1.00 94.26  ? 34   TYR D OH    1 
ATOM   2323  N  N     . ALA D 4 38  ? -37.328 -33.414 22.065 1.00 95.61  ? 35   ALA D N     1 
ATOM   2324  C  CA    . ALA D 4 38  ? -38.561 -34.070 22.534 1.00 95.64  ? 35   ALA D CA    1 
ATOM   2325  C  C     . ALA D 4 38  ? -38.815 -35.490 22.025 1.00 95.83  ? 35   ALA D C     1 
ATOM   2326  O  O     . ALA D 4 38  ? -39.034 -36.405 22.817 1.00 95.99  ? 35   ALA D O     1 
ATOM   2327  C  CB    . ALA D 4 38  ? -39.770 -33.185 22.247 1.00 95.55  ? 35   ALA D CB    1 
ATOM   2328  N  N     . ILE D 4 39  ? -38.776 -35.668 20.708 1.00 96.18  ? 36   ILE D N     1 
ATOM   2329  C  CA    . ILE D 4 39  ? -39.155 -36.936 20.076 1.00 96.43  ? 36   ILE D CA    1 
ATOM   2330  C  C     . ILE D 4 39  ? -38.162 -38.069 20.337 1.00 96.74  ? 36   ILE D C     1 
ATOM   2331  O  O     . ILE D 4 39  ? -38.556 -39.242 20.365 1.00 96.77  ? 36   ILE D O     1 
ATOM   2332  C  CB    . ILE D 4 39  ? -39.397 -36.782 18.534 1.00 96.65  ? 36   ILE D CB    1 
ATOM   2333  C  CG1   . ILE D 4 39  ? -38.114 -36.329 17.809 1.00 96.30  ? 36   ILE D CG1   1 
ATOM   2334  C  CG2   . ILE D 4 39  ? -40.581 -35.833 18.263 1.00 96.18  ? 36   ILE D CG2   1 
ATOM   2335  C  CD1   . ILE D 4 39  ? -38.115 -36.598 16.325 1.00 96.29  ? 36   ILE D CD1   1 
ATOM   2336  N  N     . TYR D 4 40  ? -36.887 -37.716 20.519 1.00 96.92  ? 37   TYR D N     1 
ATOM   2337  C  CA    . TYR D 4 40  ? -35.828 -38.703 20.755 1.00 97.12  ? 37   TYR D CA    1 
ATOM   2338  C  C     . TYR D 4 40  ? -35.817 -39.150 22.209 1.00 97.19  ? 37   TYR D C     1 
ATOM   2339  O  O     . TYR D 4 40  ? -35.541 -40.313 22.521 1.00 97.17  ? 37   TYR D O     1 
ATOM   2340  C  CB    . TYR D 4 40  ? -34.466 -38.130 20.402 1.00 97.24  ? 37   TYR D CB    1 
ATOM   2341  C  CG    . TYR D 4 40  ? -34.440 -37.276 19.170 1.00 97.68  ? 37   TYR D CG    1 
ATOM   2342  C  CD1   . TYR D 4 40  ? -34.581 -35.895 19.262 1.00 97.69  ? 37   TYR D CD1   1 
ATOM   2343  C  CD2   . TYR D 4 40  ? -34.256 -37.843 17.909 1.00 98.14  ? 37   TYR D CD2   1 
ATOM   2344  C  CE1   . TYR D 4 40  ? -34.551 -35.094 18.133 1.00 97.88  ? 37   TYR D CE1   1 
ATOM   2345  C  CE2   . TYR D 4 40  ? -34.222 -37.053 16.771 1.00 98.16  ? 37   TYR D CE2   1 
ATOM   2346  C  CZ    . TYR D 4 40  ? -34.370 -35.677 16.893 1.00 97.82  ? 37   TYR D CZ    1 
ATOM   2347  O  OH    . TYR D 4 40  ? -34.332 -34.884 15.776 1.00 97.84  ? 37   TYR D OH    1 
ATOM   2348  N  N     . VAL D 4 41  ? -36.099 -38.202 23.095 1.00 97.30  ? 38   VAL D N     1 
ATOM   2349  C  CA    . VAL D 4 41  ? -36.352 -38.492 24.490 1.00 97.37  ? 38   VAL D CA    1 
ATOM   2350  C  C     . VAL D 4 41  ? -37.378 -39.625 24.558 1.00 97.64  ? 38   VAL D C     1 
ATOM   2351  O  O     . VAL D 4 41  ? -37.088 -40.679 25.117 1.00 97.93  ? 38   VAL D O     1 
ATOM   2352  C  CB    . VAL D 4 41  ? -36.822 -37.221 25.235 1.00 97.37  ? 38   VAL D CB    1 
ATOM   2353  C  CG1   . VAL D 4 41  ? -37.371 -37.559 26.606 1.00 97.83  ? 38   VAL D CG1   1 
ATOM   2354  C  CG2   . VAL D 4 41  ? -35.673 -36.223 25.354 1.00 96.66  ? 38   VAL D CG2   1 
ATOM   2355  N  N     . TYR D 4 42  ? -38.548 -39.413 23.953 1.00 97.82  ? 39   TYR D N     1 
ATOM   2356  C  CA    . TYR D 4 42  ? -39.574 -40.451 23.790 1.00 98.13  ? 39   TYR D CA    1 
ATOM   2357  C  C     . TYR D 4 42  ? -39.064 -41.806 23.289 1.00 98.15  ? 39   TYR D C     1 
ATOM   2358  O  O     . TYR D 4 42  ? -39.202 -42.820 23.972 1.00 97.82  ? 39   TYR D O     1 
ATOM   2359  C  CB    . TYR D 4 42  ? -40.648 -39.961 22.828 1.00 98.55  ? 39   TYR D CB    1 
ATOM   2360  C  CG    . TYR D 4 42  ? -41.950 -39.609 23.490 1.00 98.96  ? 39   TYR D CG    1 
ATOM   2361  C  CD1   . TYR D 4 42  ? -42.341 -38.279 23.635 1.00 99.07  ? 39   TYR D CD1   1 
ATOM   2362  C  CD2   . TYR D 4 42  ? -42.799 -40.610 23.962 1.00 99.09  ? 39   TYR D CD2   1 
ATOM   2363  C  CE1   . TYR D 4 42  ? -43.543 -37.950 24.242 1.00 99.41  ? 39   TYR D CE1   1 
ATOM   2364  C  CE2   . TYR D 4 42  ? -44.002 -40.297 24.571 1.00 99.75  ? 39   TYR D CE2   1 
ATOM   2365  C  CZ    . TYR D 4 42  ? -44.372 -38.964 24.707 1.00 99.63  ? 39   TYR D CZ    1 
ATOM   2366  O  OH    . TYR D 4 42  ? -45.574 -38.649 25.302 1.00 99.74  ? 39   TYR D OH    1 
ATOM   2367  N  N     . LYS D 4 43  ? -38.495 -41.820 22.087 1.00 98.31  ? 40   LYS D N     1 
ATOM   2368  C  CA    . LYS D 4 43  ? -37.872 -43.022 21.546 1.00 98.73  ? 40   LYS D CA    1 
ATOM   2369  C  C     . LYS D 4 43  ? -36.958 -43.716 22.564 1.00 98.85  ? 40   LYS D C     1 
ATOM   2370  O  O     . LYS D 4 43  ? -36.935 -44.946 22.646 1.00 99.21  ? 40   LYS D O     1 
ATOM   2371  C  CB    . LYS D 4 43  ? -37.103 -42.706 20.259 1.00 98.86  ? 40   LYS D CB    1 
ATOM   2372  C  CG    . LYS D 4 43  ? -38.000 -42.351 19.087 1.00 99.25  ? 40   LYS D CG    1 
ATOM   2373  C  CD    . LYS D 4 43  ? -37.197 -42.067 17.829 1.00 99.67  ? 40   LYS D CD    1 
ATOM   2374  C  CE    . LYS D 4 43  ? -38.094 -41.483 16.749 1.00 100.16 ? 40   LYS D CE    1 
ATOM   2375  N  NZ    . LYS D 4 43  ? -37.327 -40.969 15.582 1.00 100.53 ? 40   LYS D NZ    1 
ATOM   2376  N  N     . VAL D 4 44  ? -36.216 -42.938 23.345 1.00 98.86  ? 41   VAL D N     1 
ATOM   2377  C  CA    . VAL D 4 44  ? -35.387 -43.524 24.393 1.00 98.97  ? 41   VAL D CA    1 
ATOM   2378  C  C     . VAL D 4 44  ? -36.244 -43.991 25.570 1.00 99.11  ? 41   VAL D C     1 
ATOM   2379  O  O     . VAL D 4 44  ? -35.978 -45.048 26.152 1.00 99.07  ? 41   VAL D O     1 
ATOM   2380  C  CB    . VAL D 4 44  ? -34.257 -42.580 24.833 1.00 98.97  ? 41   VAL D CB    1 
ATOM   2381  C  CG1   . VAL D 4 44  ? -33.593 -43.082 26.100 1.00 99.01  ? 41   VAL D CG1   1 
ATOM   2382  C  CG2   . VAL D 4 44  ? -33.225 -42.481 23.730 1.00 98.80  ? 41   VAL D CG2   1 
ATOM   2383  N  N     . LEU D 4 45  ? -37.282 -43.217 25.889 1.00 99.34  ? 42   LEU D N     1 
ATOM   2384  C  CA    . LEU D 4 45  ? -38.274 -43.604 26.896 1.00 99.47  ? 42   LEU D CA    1 
ATOM   2385  C  C     . LEU D 4 45  ? -38.882 -44.969 26.575 1.00 100.04 ? 42   LEU D C     1 
ATOM   2386  O  O     . LEU D 4 45  ? -39.019 -45.815 27.465 1.00 100.28 ? 42   LEU D O     1 
ATOM   2387  C  CB    . LEU D 4 45  ? -39.373 -42.538 27.032 1.00 99.25  ? 42   LEU D CB    1 
ATOM   2388  C  CG    . LEU D 4 45  ? -40.509 -42.809 28.027 1.00 98.82  ? 42   LEU D CG    1 
ATOM   2389  C  CD1   . LEU D 4 45  ? -39.971 -43.085 29.423 1.00 98.36  ? 42   LEU D CD1   1 
ATOM   2390  C  CD2   . LEU D 4 45  ? -41.505 -41.665 28.063 1.00 98.97  ? 42   LEU D CD2   1 
ATOM   2391  N  N     . LYS D 4 46  ? -39.229 -45.184 25.306 1.00 100.45 ? 43   LYS D N     1 
ATOM   2392  C  CA    . LYS D 4 46  ? -39.757 -46.472 24.861 1.00 100.99 ? 43   LYS D CA    1 
ATOM   2393  C  C     . LYS D 4 46  ? -38.712 -47.577 25.010 1.00 101.60 ? 43   LYS D C     1 
ATOM   2394  O  O     . LYS D 4 46  ? -39.023 -48.675 25.488 1.00 101.72 ? 43   LYS D O     1 
ATOM   2395  C  CB    . LYS D 4 46  ? -40.262 -46.388 23.419 1.00 100.80 ? 43   LYS D CB    1 
ATOM   2396  C  CG    . LYS D 4 46  ? -41.301 -45.296 23.190 1.00 100.72 ? 43   LYS D CG    1 
ATOM   2397  C  CD    . LYS D 4 46  ? -42.355 -45.278 24.295 1.00 100.31 ? 43   LYS D CD    1 
ATOM   2398  C  CE    . LYS D 4 46  ? -43.234 -44.059 24.203 1.00 99.50  ? 43   LYS D CE    1 
ATOM   2399  N  NZ    . LYS D 4 46  ? -44.293 -44.130 25.236 1.00 99.95  ? 43   LYS D NZ    1 
ATOM   2400  N  N     . GLN D 4 47  ? -37.473 -47.266 24.628 1.00 102.15 ? 44   GLN D N     1 
ATOM   2401  C  CA    . GLN D 4 47  ? -36.351 -48.185 24.789 1.00 102.73 ? 44   GLN D CA    1 
ATOM   2402  C  C     . GLN D 4 47  ? -36.163 -48.683 26.222 1.00 103.01 ? 44   GLN D C     1 
ATOM   2403  O  O     . GLN D 4 47  ? -35.704 -49.802 26.421 1.00 103.19 ? 44   GLN D O     1 
ATOM   2404  C  CB    . GLN D 4 47  ? -35.055 -47.537 24.314 1.00 102.90 ? 44   GLN D CB    1 
ATOM   2405  C  CG    . GLN D 4 47  ? -34.659 -47.858 22.885 1.00 103.56 ? 44   GLN D CG    1 
ATOM   2406  C  CD    . GLN D 4 47  ? -33.170 -47.638 22.628 1.00 104.74 ? 44   GLN D CD    1 
ATOM   2407  O  OE1   . GLN D 4 47  ? -32.468 -47.005 23.427 1.00 105.37 ? 44   GLN D OE1   1 
ATOM   2408  N  NE2   . GLN D 4 47  ? -32.682 -48.162 21.509 1.00 105.22 ? 44   GLN D NE2   1 
ATOM   2409  N  N     . VAL D 4 48  ? -36.502 -47.858 27.213 1.00 103.44 ? 45   VAL D N     1 
ATOM   2410  C  CA    . VAL D 4 48  ? -36.327 -48.247 28.621 1.00 103.75 ? 45   VAL D CA    1 
ATOM   2411  C  C     . VAL D 4 48  ? -37.615 -48.677 29.303 1.00 103.96 ? 45   VAL D C     1 
ATOM   2412  O  O     . VAL D 4 48  ? -37.632 -49.708 29.981 1.00 104.25 ? 45   VAL D O     1 
ATOM   2413  C  CB    . VAL D 4 48  ? -35.635 -47.153 29.490 1.00 103.70 ? 45   VAL D CB    1 
ATOM   2414  C  CG1   . VAL D 4 48  ? -34.168 -46.982 29.087 1.00 103.84 ? 45   VAL D CG1   1 
ATOM   2415  C  CG2   . VAL D 4 48  ? -36.396 -45.828 29.440 1.00 103.55 ? 45   VAL D CG2   1 
ATOM   2416  N  N     . HIS D 4 49  ? -38.675 -47.887 29.128 1.00 104.02 ? 46   HIS D N     1 
ATOM   2417  C  CA    . HIS D 4 49  ? -39.958 -48.126 29.790 1.00 104.33 ? 46   HIS D CA    1 
ATOM   2418  C  C     . HIS D 4 49  ? -41.096 -48.134 28.781 1.00 104.50 ? 46   HIS D C     1 
ATOM   2419  O  O     . HIS D 4 49  ? -41.891 -47.192 28.755 1.00 104.56 ? 46   HIS D O     1 
ATOM   2420  C  CB    . HIS D 4 49  ? -40.218 -47.046 30.839 1.00 104.26 ? 46   HIS D CB    1 
ATOM   2421  C  CG    . HIS D 4 49  ? -39.723 -47.393 32.207 1.00 104.85 ? 46   HIS D CG    1 
ATOM   2422  N  ND1   . HIS D 4 49  ? -38.437 -47.830 32.449 1.00 105.82 ? 46   HIS D ND1   1 
ATOM   2423  C  CD2   . HIS D 4 49  ? -40.336 -47.344 33.413 1.00 105.12 ? 46   HIS D CD2   1 
ATOM   2424  C  CE1   . HIS D 4 49  ? -38.285 -48.050 33.743 1.00 105.56 ? 46   HIS D CE1   1 
ATOM   2425  N  NE2   . HIS D 4 49  ? -39.422 -47.759 34.350 1.00 105.39 ? 46   HIS D NE2   1 
ATOM   2426  N  N     . PRO D 4 50  ? -41.196 -49.207 27.965 1.00 104.68 ? 47   PRO D N     1 
ATOM   2427  C  CA    . PRO D 4 50  ? -42.100 -49.245 26.811 1.00 104.78 ? 47   PRO D CA    1 
ATOM   2428  C  C     . PRO D 4 50  ? -43.531 -48.802 27.129 1.00 104.97 ? 47   PRO D C     1 
ATOM   2429  O  O     . PRO D 4 50  ? -44.104 -48.006 26.388 1.00 105.01 ? 47   PRO D O     1 
ATOM   2430  C  CB    . PRO D 4 50  ? -42.073 -50.719 26.402 1.00 104.88 ? 47   PRO D CB    1 
ATOM   2431  C  CG    . PRO D 4 50  ? -40.733 -51.195 26.828 1.00 104.57 ? 47   PRO D CG    1 
ATOM   2432  C  CD    . PRO D 4 50  ? -40.468 -50.482 28.121 1.00 104.72 ? 47   PRO D CD    1 
ATOM   2433  N  N     . ASP D 4 51  ? -44.091 -49.301 28.226 1.00 105.17 ? 48   ASP D N     1 
ATOM   2434  C  CA    . ASP D 4 51  ? -45.450 -48.949 28.617 1.00 105.42 ? 48   ASP D CA    1 
ATOM   2435  C  C     . ASP D 4 51  ? -45.469 -47.803 29.630 1.00 105.45 ? 48   ASP D C     1 
ATOM   2436  O  O     . ASP D 4 51  ? -45.965 -47.971 30.747 1.00 105.76 ? 48   ASP D O     1 
ATOM   2437  C  CB    . ASP D 4 51  ? -46.186 -50.187 29.175 1.00 105.68 ? 48   ASP D CB    1 
ATOM   2438  C  CG    . ASP D 4 51  ? -47.318 -50.694 28.251 1.00 106.05 ? 48   ASP D CG    1 
ATOM   2439  O  OD1   . ASP D 4 51  ? -47.214 -50.587 27.004 1.00 106.04 ? 48   ASP D OD1   1 
ATOM   2440  O  OD2   . ASP D 4 51  ? -48.321 -51.218 28.788 1.00 105.92 ? 48   ASP D OD2   1 
ATOM   2441  N  N     . THR D 4 52  ? -44.930 -46.642 29.245 1.00 105.35 ? 49   THR D N     1 
ATOM   2442  C  CA    . THR D 4 52  ? -44.912 -45.446 30.120 1.00 105.34 ? 49   THR D CA    1 
ATOM   2443  C  C     . THR D 4 52  ? -44.907 -44.133 29.316 1.00 105.05 ? 49   THR D C     1 
ATOM   2444  O  O     . THR D 4 52  ? -44.369 -44.078 28.212 1.00 105.15 ? 49   THR D O     1 
ATOM   2445  C  CB    . THR D 4 52  ? -43.693 -45.445 31.101 1.00 105.50 ? 49   THR D CB    1 
ATOM   2446  O  OG1   . THR D 4 52  ? -43.203 -46.781 31.288 1.00 106.24 ? 49   THR D OG1   1 
ATOM   2447  C  CG2   . THR D 4 52  ? -44.069 -44.855 32.458 1.00 105.16 ? 49   THR D CG2   1 
ATOM   2448  N  N     . GLY D 4 53  ? -45.497 -43.080 29.879 1.00 104.79 ? 50   GLY D N     1 
ATOM   2449  C  CA    . GLY D 4 53  ? -45.580 -41.775 29.201 1.00 104.41 ? 50   GLY D CA    1 
ATOM   2450  C  C     . GLY D 4 53  ? -44.996 -40.592 29.971 1.00 103.99 ? 50   GLY D C     1 
ATOM   2451  O  O     . GLY D 4 53  ? -44.505 -40.750 31.094 1.00 104.07 ? 50   GLY D O     1 
ATOM   2452  N  N     . ILE D 4 54  ? -45.066 -39.402 29.367 1.00 103.31 ? 51   ILE D N     1 
ATOM   2453  C  CA    . ILE D 4 54  ? -44.440 -38.189 29.915 1.00 102.59 ? 51   ILE D CA    1 
ATOM   2454  C  C     . ILE D 4 54  ? -45.372 -36.964 29.838 1.00 102.17 ? 51   ILE D C     1 
ATOM   2455  O  O     . ILE D 4 54  ? -46.361 -36.970 29.103 1.00 102.15 ? 51   ILE D O     1 
ATOM   2456  C  CB    . ILE D 4 54  ? -43.068 -37.905 29.222 1.00 102.45 ? 51   ILE D CB    1 
ATOM   2457  C  CG1   . ILE D 4 54  ? -42.137 -37.101 30.140 1.00 102.72 ? 51   ILE D CG1   1 
ATOM   2458  C  CG2   . ILE D 4 54  ? -43.265 -37.212 27.886 1.00 102.36 ? 51   ILE D CG2   1 
ATOM   2459  C  CD1   . ILE D 4 54  ? -40.659 -37.139 29.745 1.00 102.41 ? 51   ILE D CD1   1 
ATOM   2460  N  N     . SER D 4 55  ? -45.065 -35.928 30.616 1.00 101.58 ? 52   SER D N     1 
ATOM   2461  C  CA    . SER D 4 55  ? -45.823 -34.679 30.571 1.00 100.96 ? 52   SER D CA    1 
ATOM   2462  C  C     . SER D 4 55  ? -44.988 -33.586 29.913 1.00 100.62 ? 52   SER D C     1 
ATOM   2463  O  O     . SER D 4 55  ? -43.762 -33.689 29.845 1.00 100.70 ? 52   SER D O     1 
ATOM   2464  C  CB    . SER D 4 55  ? -46.281 -34.250 31.973 1.00 101.04 ? 52   SER D CB    1 
ATOM   2465  O  OG    . SER D 4 55  ? -45.250 -33.628 32.720 1.00 100.52 ? 52   SER D OG    1 
ATOM   2466  N  N     . SER D 4 56  ? -45.657 -32.548 29.420 1.00 100.02 ? 53   SER D N     1 
ATOM   2467  C  CA    . SER D 4 56  ? -44.982 -31.416 28.792 1.00 99.38  ? 53   SER D CA    1 
ATOM   2468  C  C     . SER D 4 56  ? -44.014 -30.790 29.781 1.00 99.00  ? 53   SER D C     1 
ATOM   2469  O  O     . SER D 4 56  ? -42.845 -30.552 29.455 1.00 98.86  ? 53   SER D O     1 
ATOM   2470  C  CB    . SER D 4 56  ? -46.001 -30.365 28.353 1.00 99.39  ? 53   SER D CB    1 
ATOM   2471  O  OG    . SER D 4 56  ? -46.776 -29.942 29.459 1.00 99.13  ? 53   SER D OG    1 
ATOM   2472  N  N     . LYS D 4 57  ? -44.515 -30.551 30.995 1.00 98.17  ? 54   LYS D N     1 
ATOM   2473  C  CA    . LYS D 4 57  ? -43.736 -29.950 32.071 1.00 97.32  ? 54   LYS D CA    1 
ATOM   2474  C  C     . LYS D 4 57  ? -42.445 -30.698 32.413 1.00 96.56  ? 54   LYS D C     1 
ATOM   2475  O  O     . LYS D 4 57  ? -41.446 -30.071 32.758 1.00 96.54  ? 54   LYS D O     1 
ATOM   2476  C  CB    . LYS D 4 57  ? -44.602 -29.754 33.309 1.00 97.46  ? 54   LYS D CB    1 
ATOM   2477  C  CG    . LYS D 4 57  ? -45.312 -28.414 33.308 1.00 98.34  ? 54   LYS D CG    1 
ATOM   2478  C  CD    . LYS D 4 57  ? -46.197 -28.251 34.526 1.00 99.72  ? 54   LYS D CD    1 
ATOM   2479  C  CE    . LYS D 4 57  ? -46.521 -26.785 34.744 1.00 100.73 ? 54   LYS D CE    1 
ATOM   2480  N  NZ    . LYS D 4 57  ? -47.043 -26.547 36.117 1.00 101.99 ? 54   LYS D NZ    1 
ATOM   2481  N  N     . ALA D 4 58  ? -42.472 -32.026 32.306 1.00 95.47  ? 55   ALA D N     1 
ATOM   2482  C  CA    . ALA D 4 58  ? -41.286 -32.847 32.508 1.00 94.47  ? 55   ALA D CA    1 
ATOM   2483  C  C     . ALA D 4 58  ? -40.445 -32.887 31.244 1.00 93.96  ? 55   ALA D C     1 
ATOM   2484  O  O     . ALA D 4 58  ? -39.231 -33.088 31.300 1.00 93.78  ? 55   ALA D O     1 
ATOM   2485  C  CB    . ALA D 4 58  ? -41.678 -34.242 32.914 1.00 94.48  ? 55   ALA D CB    1 
ATOM   2486  N  N     . MET D 4 59  ? -41.101 -32.691 30.104 1.00 93.25  ? 56   MET D N     1 
ATOM   2487  C  CA    . MET D 4 59  ? -40.433 -32.767 28.811 1.00 92.49  ? 56   MET D CA    1 
ATOM   2488  C  C     . MET D 4 59  ? -39.438 -31.641 28.649 1.00 91.55  ? 56   MET D C     1 
ATOM   2489  O  O     . MET D 4 59  ? -38.333 -31.844 28.140 1.00 91.64  ? 56   MET D O     1 
ATOM   2490  C  CB    . MET D 4 59  ? -41.449 -32.710 27.676 1.00 92.96  ? 56   MET D CB    1 
ATOM   2491  C  CG    . MET D 4 59  ? -40.864 -32.955 26.292 1.00 93.88  ? 56   MET D CG    1 
ATOM   2492  S  SD    . MET D 4 59  ? -40.058 -34.558 26.189 1.00 97.22  ? 56   MET D SD    1 
ATOM   2493  C  CE    . MET D 4 59  ? -38.348 -34.059 26.113 1.00 97.20  ? 56   MET D CE    1 
ATOM   2494  N  N     . SER D 4 60  ? -39.833 -30.447 29.079 1.00 90.25  ? 57   SER D N     1 
ATOM   2495  C  CA    . SER D 4 60  ? -38.924 -29.323 29.043 1.00 88.97  ? 57   SER D CA    1 
ATOM   2496  C  C     . SER D 4 60  ? -37.734 -29.640 29.941 1.00 88.00  ? 57   SER D C     1 
ATOM   2497  O  O     . SER D 4 60  ? -36.585 -29.426 29.540 1.00 88.10  ? 57   SER D O     1 
ATOM   2498  C  CB    . SER D 4 60  ? -39.608 -28.024 29.459 1.00 89.00  ? 57   SER D CB    1 
ATOM   2499  O  OG    . SER D 4 60  ? -38.747 -26.922 29.204 1.00 89.76  ? 57   SER D OG    1 
ATOM   2500  N  N     . ILE D 4 61  ? -38.003 -30.202 31.122 1.00 86.22  ? 58   ILE D N     1 
ATOM   2501  C  CA    . ILE D 4 61  ? -36.926 -30.574 32.028 1.00 84.86  ? 58   ILE D CA    1 
ATOM   2502  C  C     . ILE D 4 61  ? -35.933 -31.506 31.353 1.00 84.04  ? 58   ILE D C     1 
ATOM   2503  O  O     . ILE D 4 61  ? -34.726 -31.323 31.479 1.00 83.71  ? 58   ILE D O     1 
ATOM   2504  C  CB    . ILE D 4 61  ? -37.426 -31.199 33.325 1.00 84.79  ? 58   ILE D CB    1 
ATOM   2505  C  CG1   . ILE D 4 61  ? -38.473 -30.295 33.958 1.00 84.81  ? 58   ILE D CG1   1 
ATOM   2506  C  CG2   . ILE D 4 61  ? -36.270 -31.350 34.303 1.00 84.36  ? 58   ILE D CG2   1 
ATOM   2507  C  CD1   . ILE D 4 61  ? -39.161 -30.911 35.122 1.00 85.17  ? 58   ILE D CD1   1 
ATOM   2508  N  N     . MET D 4 62  ? -36.450 -32.487 30.619 1.00 83.15  ? 59   MET D N     1 
ATOM   2509  C  CA    . MET D 4 62  ? -35.607 -33.396 29.865 1.00 82.03  ? 59   MET D CA    1 
ATOM   2510  C  C     . MET D 4 62  ? -34.881 -32.683 28.738 1.00 81.40  ? 59   MET D C     1 
ATOM   2511  O  O     . MET D 4 62  ? -33.731 -33.000 28.442 1.00 81.20  ? 59   MET D O     1 
ATOM   2512  C  CB    . MET D 4 62  ? -36.417 -34.549 29.330 1.00 82.17  ? 59   MET D CB    1 
ATOM   2513  C  CG    . MET D 4 62  ? -36.754 -35.578 30.383 1.00 83.08  ? 59   MET D CG    1 
ATOM   2514  S  SD    . MET D 4 62  ? -35.291 -36.321 31.120 1.00 86.37  ? 59   MET D SD    1 
ATOM   2515  C  CE    . MET D 4 62  ? -34.574 -37.220 29.758 1.00 84.85  ? 59   MET D CE    1 
ATOM   2516  N  N     . ASN D 4 63  ? -35.524 -31.698 28.128 1.00 80.38  ? 60   ASN D N     1 
ATOM   2517  C  CA    . ASN D 4 63  ? -34.823 -30.920 27.128 1.00 79.43  ? 60   ASN D CA    1 
ATOM   2518  C  C     . ASN D 4 63  ? -33.768 -29.982 27.733 1.00 79.08  ? 60   ASN D C     1 
ATOM   2519  O  O     . ASN D 4 63  ? -32.642 -29.888 27.222 1.00 78.60  ? 60   ASN D O     1 
ATOM   2520  C  CB    . ASN D 4 63  ? -35.794 -30.152 26.252 1.00 79.32  ? 60   ASN D CB    1 
ATOM   2521  C  CG    . ASN D 4 63  ? -35.196 -29.812 24.921 1.00 79.03  ? 60   ASN D CG    1 
ATOM   2522  O  OD1   . ASN D 4 63  ? -34.901 -30.701 24.128 1.00 79.37  ? 60   ASN D OD1   1 
ATOM   2523  N  ND2   . ASN D 4 63  ? -34.986 -28.523 24.669 1.00 78.73  ? 60   ASN D ND2   1 
ATOM   2524  N  N     . SER D 4 64  ? -34.129 -29.297 28.819 1.00 78.45  ? 61   SER D N     1 
ATOM   2525  C  CA    . SER D 4 64  ? -33.193 -28.422 29.512 1.00 78.09  ? 61   SER D CA    1 
ATOM   2526  C  C     . SER D 4 64  ? -31.980 -29.236 29.912 1.00 77.78  ? 61   SER D C     1 
ATOM   2527  O  O     . SER D 4 64  ? -30.822 -28.842 29.665 1.00 78.04  ? 61   SER D O     1 
ATOM   2528  C  CB    . SER D 4 64  ? -33.835 -27.779 30.733 1.00 77.97  ? 61   SER D CB    1 
ATOM   2529  O  OG    . SER D 4 64  ? -34.892 -26.918 30.347 1.00 78.77  ? 61   SER D OG    1 
ATOM   2530  N  N     . PHE D 4 65  ? -32.260 -30.401 30.482 1.00 76.91  ? 62   PHE D N     1 
ATOM   2531  C  CA    . PHE D 4 65  ? -31.225 -31.301 30.906 1.00 76.34  ? 62   PHE D CA    1 
ATOM   2532  C  C     . PHE D 4 65  ? -30.258 -31.568 29.775 1.00 76.20  ? 62   PHE D C     1 
ATOM   2533  O  O     . PHE D 4 65  ? -29.052 -31.472 29.963 1.00 75.87  ? 62   PHE D O     1 
ATOM   2534  C  CB    . PHE D 4 65  ? -31.839 -32.595 31.417 1.00 76.29  ? 62   PHE D CB    1 
ATOM   2535  C  CG    . PHE D 4 65  ? -30.841 -33.693 31.662 1.00 76.39  ? 62   PHE D CG    1 
ATOM   2536  C  CD1   . PHE D 4 65  ? -29.900 -33.587 32.669 1.00 76.49  ? 62   PHE D CD1   1 
ATOM   2537  C  CD2   . PHE D 4 65  ? -30.864 -34.851 30.897 1.00 76.64  ? 62   PHE D CD2   1 
ATOM   2538  C  CE1   . PHE D 4 65  ? -29.000 -34.611 32.903 1.00 77.00  ? 62   PHE D CE1   1 
ATOM   2539  C  CE2   . PHE D 4 65  ? -29.966 -35.878 31.129 1.00 76.28  ? 62   PHE D CE2   1 
ATOM   2540  C  CZ    . PHE D 4 65  ? -29.034 -35.758 32.132 1.00 76.29  ? 62   PHE D CZ    1 
ATOM   2541  N  N     . VAL D 4 66  ? -30.797 -31.872 28.596 1.00 76.36  ? 63   VAL D N     1 
ATOM   2542  C  CA    . VAL D 4 66  ? -29.962 -32.255 27.452 1.00 76.19  ? 63   VAL D CA    1 
ATOM   2543  C  C     . VAL D 4 66  ? -29.053 -31.123 26.964 1.00 76.11  ? 63   VAL D C     1 
ATOM   2544  O  O     . VAL D 4 66  ? -27.864 -31.343 26.719 1.00 75.56  ? 63   VAL D O     1 
ATOM   2545  C  CB    . VAL D 4 66  ? -30.786 -32.830 26.287 1.00 76.01  ? 63   VAL D CB    1 
ATOM   2546  C  CG1   . VAL D 4 66  ? -29.860 -33.244 25.153 1.00 75.70  ? 63   VAL D CG1   1 
ATOM   2547  C  CG2   . VAL D 4 66  ? -31.562 -34.032 26.759 1.00 75.39  ? 63   VAL D CG2   1 
ATOM   2548  N  N     . ASN D 4 67  ? -29.610 -29.918 26.846 1.00 76.12  ? 64   ASN D N     1 
ATOM   2549  C  CA    . ASN D 4 67  ? -28.825 -28.774 26.421 1.00 76.21  ? 64   ASN D CA    1 
ATOM   2550  C  C     . ASN D 4 67  ? -27.717 -28.451 27.429 1.00 76.47  ? 64   ASN D C     1 
ATOM   2551  O  O     . ASN D 4 67  ? -26.566 -28.172 27.038 1.00 76.33  ? 64   ASN D O     1 
ATOM   2552  C  CB    . ASN D 4 67  ? -29.712 -27.566 26.224 1.00 76.28  ? 64   ASN D CB    1 
ATOM   2553  C  CG    . ASN D 4 67  ? -30.858 -27.818 25.250 1.00 78.01  ? 64   ASN D CG    1 
ATOM   2554  O  OD1   . ASN D 4 67  ? -30.646 -28.067 24.053 1.00 79.45  ? 64   ASN D OD1   1 
ATOM   2555  N  ND2   . ASN D 4 67  ? -32.090 -27.723 25.759 1.00 78.82  ? 64   ASN D ND2   1 
ATOM   2556  N  N     . ASP D 4 68  ? -28.064 -28.500 28.721 1.00 76.41  ? 65   ASP D N     1 
ATOM   2557  C  CA    . ASP D 4 68  ? -27.100 -28.238 29.782 1.00 76.36  ? 65   ASP D CA    1 
ATOM   2558  C  C     . ASP D 4 68  ? -25.924 -29.210 29.686 1.00 76.32  ? 65   ASP D C     1 
ATOM   2559  O  O     . ASP D 4 68  ? -24.751 -28.811 29.747 1.00 76.00  ? 65   ASP D O     1 
ATOM   2560  C  CB    . ASP D 4 68  ? -27.778 -28.314 31.151 1.00 76.55  ? 65   ASP D CB    1 
ATOM   2561  C  CG    . ASP D 4 68  ? -26.786 -28.503 32.304 1.00 78.13  ? 65   ASP D CG    1 
ATOM   2562  O  OD1   . ASP D 4 68  ? -25.583 -28.168 32.152 1.00 80.82  ? 65   ASP D OD1   1 
ATOM   2563  O  OD2   . ASP D 4 68  ? -27.209 -29.011 33.370 1.00 76.95  ? 65   ASP D OD2   1 
ATOM   2564  N  N     . VAL D 4 69  ? -26.239 -30.489 29.520 1.00 76.05  ? 66   VAL D N     1 
ATOM   2565  C  CA    . VAL D 4 69  ? -25.198 -31.482 29.468 1.00 76.07  ? 66   VAL D CA    1 
ATOM   2566  C  C     . VAL D 4 69  ? -24.350 -31.281 28.218 1.00 76.07  ? 66   VAL D C     1 
ATOM   2567  O  O     . VAL D 4 69  ? -23.119 -31.406 28.283 1.00 76.15  ? 66   VAL D O     1 
ATOM   2568  C  CB    . VAL D 4 69  ? -25.748 -32.898 29.530 1.00 76.18  ? 66   VAL D CB    1 
ATOM   2569  C  CG1   . VAL D 4 69  ? -24.604 -33.885 29.684 1.00 76.61  ? 66   VAL D CG1   1 
ATOM   2570  C  CG2   . VAL D 4 69  ? -26.678 -33.042 30.706 1.00 76.62  ? 66   VAL D CG2   1 
ATOM   2571  N  N     . PHE D 4 70  ? -25.008 -30.956 27.102 1.00 75.66  ? 67   PHE D N     1 
ATOM   2572  C  CA    . PHE D 4 70  ? -24.335 -30.641 25.842 1.00 75.40  ? 67   PHE D CA    1 
ATOM   2573  C  C     . PHE D 4 70  ? -23.286 -29.518 25.990 1.00 75.55  ? 67   PHE D C     1 
ATOM   2574  O  O     . PHE D 4 70  ? -22.120 -29.682 25.562 1.00 75.03  ? 67   PHE D O     1 
ATOM   2575  C  CB    . PHE D 4 70  ? -25.373 -30.252 24.805 1.00 75.57  ? 67   PHE D CB    1 
ATOM   2576  C  CG    . PHE D 4 70  ? -24.814 -30.019 23.434 1.00 75.88  ? 67   PHE D CG    1 
ATOM   2577  C  CD1   . PHE D 4 70  ? -25.076 -30.919 22.407 1.00 75.85  ? 67   PHE D CD1   1 
ATOM   2578  C  CD2   . PHE D 4 70  ? -24.060 -28.879 23.152 1.00 75.89  ? 67   PHE D CD2   1 
ATOM   2579  C  CE1   . PHE D 4 70  ? -24.568 -30.701 21.123 1.00 76.34  ? 67   PHE D CE1   1 
ATOM   2580  C  CE2   . PHE D 4 70  ? -23.546 -28.655 21.882 1.00 75.57  ? 67   PHE D CE2   1 
ATOM   2581  C  CZ    . PHE D 4 70  ? -23.794 -29.570 20.866 1.00 76.01  ? 67   PHE D CZ    1 
ATOM   2582  N  N     . GLU D 4 71  ? -23.691 -28.395 26.597 1.00 75.14  ? 68   GLU D N     1 
ATOM   2583  C  CA    . GLU D 4 71  ? -22.779 -27.274 26.778 1.00 75.32  ? 68   GLU D CA    1 
ATOM   2584  C  C     . GLU D 4 71  ? -21.570 -27.680 27.602 1.00 74.70  ? 68   GLU D C     1 
ATOM   2585  O  O     . GLU D 4 71  ? -20.433 -27.411 27.211 1.00 74.20  ? 68   GLU D O     1 
ATOM   2586  C  CB    . GLU D 4 71  ? -23.452 -26.102 27.474 1.00 76.01  ? 68   GLU D CB    1 
ATOM   2587  C  CG    . GLU D 4 71  ? -24.361 -25.221 26.619 1.00 79.27  ? 68   GLU D CG    1 
ATOM   2588  C  CD    . GLU D 4 71  ? -25.551 -24.671 27.442 1.00 83.18  ? 68   GLU D CD    1 
ATOM   2589  O  OE1   . GLU D 4 71  ? -25.399 -24.517 28.682 1.00 83.27  ? 68   GLU D OE1   1 
ATOM   2590  O  OE2   . GLU D 4 71  ? -26.640 -24.421 26.859 1.00 85.45  ? 68   GLU D OE2   1 
ATOM   2591  N  N     . ARG D 4 72  ? -21.822 -28.323 28.744 1.00 74.08  ? 69   ARG D N     1 
ATOM   2592  C  CA    . ARG D 4 72  ? -20.761 -28.621 29.695 1.00 73.84  ? 69   ARG D CA    1 
ATOM   2593  C  C     . ARG D 4 72  ? -19.688 -29.515 29.074 1.00 73.88  ? 69   ARG D C     1 
ATOM   2594  O  O     . ARG D 4 72  ? -18.487 -29.307 29.291 1.00 73.05  ? 69   ARG D O     1 
ATOM   2595  C  CB    . ARG D 4 72  ? -21.323 -29.278 30.934 1.00 73.45  ? 69   ARG D CB    1 
ATOM   2596  C  CG    . ARG D 4 72  ? -22.244 -28.406 31.750 1.00 74.52  ? 69   ARG D CG    1 
ATOM   2597  C  CD    . ARG D 4 72  ? -22.196 -28.859 33.209 1.00 74.60  ? 69   ARG D CD    1 
ATOM   2598  N  NE    . ARG D 4 72  ? -23.515 -29.067 33.797 1.00 71.89  ? 69   ARG D NE    1 
ATOM   2599  C  CZ    . ARG D 4 72  ? -23.761 -29.926 34.785 1.00 73.07  ? 69   ARG D CZ    1 
ATOM   2600  N  NH1   . ARG D 4 72  ? -22.797 -30.680 35.297 1.00 71.35  ? 69   ARG D NH1   1 
ATOM   2601  N  NH2   . ARG D 4 72  ? -24.987 -30.047 35.261 1.00 75.02  ? 69   ARG D NH2   1 
ATOM   2602  N  N     . ILE D 4 73  ? -20.134 -30.504 28.291 1.00 73.85  ? 70   ILE D N     1 
ATOM   2603  C  CA    . ILE D 4 73  ? -19.219 -31.434 27.642 1.00 73.39  ? 70   ILE D CA    1 
ATOM   2604  C  C     . ILE D 4 73  ? -18.492 -30.707 26.515 1.00 72.94  ? 70   ILE D C     1 
ATOM   2605  O  O     . ILE D 4 73  ? -17.248 -30.698 26.456 1.00 72.80  ? 70   ILE D O     1 
ATOM   2606  C  CB    . ILE D 4 73  ? -19.937 -32.716 27.142 1.00 73.82  ? 70   ILE D CB    1 
ATOM   2607  C  CG1   . ILE D 4 73  ? -20.651 -33.426 28.306 1.00 73.99  ? 70   ILE D CG1   1 
ATOM   2608  C  CG2   . ILE D 4 73  ? -18.935 -33.679 26.473 1.00 73.63  ? 70   ILE D CG2   1 
ATOM   2609  C  CD1   . ILE D 4 73  ? -21.308 -34.759 27.929 1.00 73.10  ? 70   ILE D CD1   1 
ATOM   2610  N  N     . ALA D 4 74  ? -19.278 -30.059 25.657 1.00 72.10  ? 71   ALA D N     1 
ATOM   2611  C  CA    . ALA D 4 74  ? -18.745 -29.281 24.544 1.00 71.24  ? 71   ALA D CA    1 
ATOM   2612  C  C     . ALA D 4 74  ? -17.713 -28.240 25.004 1.00 70.87  ? 71   ALA D C     1 
ATOM   2613  O  O     . ALA D 4 74  ? -16.625 -28.137 24.422 1.00 71.26  ? 71   ALA D O     1 
ATOM   2614  C  CB    . ALA D 4 74  ? -19.882 -28.621 23.803 1.00 71.27  ? 71   ALA D CB    1 
ATOM   2615  N  N     . GLY D 4 75  ? -18.067 -27.493 26.059 1.00 69.98  ? 72   GLY D N     1 
ATOM   2616  C  CA    . GLY D 4 75  ? -17.239 -26.451 26.639 1.00 68.10  ? 72   GLY D CA    1 
ATOM   2617  C  C     . GLY D 4 75  ? -15.947 -26.973 27.200 1.00 67.72  ? 72   GLY D C     1 
ATOM   2618  O  O     . GLY D 4 75  ? -14.905 -26.352 27.007 1.00 67.24  ? 72   GLY D O     1 
ATOM   2619  N  N     . GLU D 4 76  ? -16.010 -28.113 27.894 1.00 67.75  ? 73   GLU D N     1 
ATOM   2620  C  CA    . GLU D 4 76  ? -14.813 -28.784 28.432 1.00 68.07  ? 73   GLU D CA    1 
ATOM   2621  C  C     . GLU D 4 76  ? -13.904 -29.208 27.307 1.00 67.75  ? 73   GLU D C     1 
ATOM   2622  O  O     . GLU D 4 76  ? -12.701 -29.011 27.358 1.00 67.30  ? 73   GLU D O     1 
ATOM   2623  C  CB    . GLU D 4 76  ? -15.180 -30.037 29.223 1.00 68.26  ? 73   GLU D CB    1 
ATOM   2624  C  CG    . GLU D 4 76  ? -15.374 -29.812 30.711 1.00 71.07  ? 73   GLU D CG    1 
ATOM   2625  C  CD    . GLU D 4 76  ? -14.103 -29.344 31.449 1.00 73.34  ? 73   GLU D CD    1 
ATOM   2626  O  OE1   . GLU D 4 76  ? -12.979 -29.346 30.862 1.00 72.34  ? 73   GLU D OE1   1 
ATOM   2627  O  OE2   . GLU D 4 76  ? -14.264 -28.972 32.637 1.00 73.11  ? 73   GLU D OE2   1 
ATOM   2628  N  N     . ALA D 4 77  ? -14.526 -29.811 26.299 1.00 67.78  ? 74   ALA D N     1 
ATOM   2629  C  CA    . ALA D 4 77  ? -13.871 -30.234 25.089 1.00 67.85  ? 74   ALA D CA    1 
ATOM   2630  C  C     . ALA D 4 77  ? -13.144 -29.068 24.449 1.00 67.94  ? 74   ALA D C     1 
ATOM   2631  O  O     . ALA D 4 77  ? -11.961 -29.169 24.109 1.00 67.50  ? 74   ALA D O     1 
ATOM   2632  C  CB    . ALA D 4 77  ? -14.897 -30.792 24.141 1.00 68.04  ? 74   ALA D CB    1 
ATOM   2633  N  N     . SER D 4 78  ? -13.864 -27.958 24.312 1.00 67.77  ? 75   SER D N     1 
ATOM   2634  C  CA    . SER D 4 78  ? -13.291 -26.729 23.793 1.00 68.12  ? 75   SER D CA    1 
ATOM   2635  C  C     . SER D 4 78  ? -11.987 -26.275 24.475 1.00 68.51  ? 75   SER D C     1 
ATOM   2636  O  O     . SER D 4 78  ? -11.015 -25.951 23.784 1.00 68.21  ? 75   SER D O     1 
ATOM   2637  C  CB    . SER D 4 78  ? -14.321 -25.624 23.815 1.00 67.56  ? 75   SER D CB    1 
ATOM   2638  O  OG    . SER D 4 78  ? -13.763 -24.483 23.205 1.00 69.32  ? 75   SER D OG    1 
ATOM   2639  N  N     . ARG D 4 79  ? -11.969 -26.251 25.812 1.00 69.17  ? 76   ARG D N     1 
ATOM   2640  C  CA    . ARG D 4 79  ? -10.786 -25.833 26.546 1.00 69.96  ? 76   ARG D CA    1 
ATOM   2641  C  C     . ARG D 4 79  ? -9.639  -26.808 26.326 1.00 70.94  ? 76   ARG D C     1 
ATOM   2642  O  O     . ARG D 4 79  ? -8.505  -26.391 26.070 1.00 70.64  ? 76   ARG D O     1 
ATOM   2643  C  CB    . ARG D 4 79  ? -11.072 -25.721 28.024 1.00 69.83  ? 76   ARG D CB    1 
ATOM   2644  C  CG    . ARG D 4 79  ? -11.846 -24.494 28.425 1.00 69.85  ? 76   ARG D CG    1 
ATOM   2645  C  CD    . ARG D 4 79  ? -12.454 -24.719 29.803 1.00 67.49  ? 76   ARG D CD    1 
ATOM   2646  N  NE    . ARG D 4 79  ? -13.899 -24.534 29.743 1.00 66.00  ? 76   ARG D NE    1 
ATOM   2647  C  CZ    . ARG D 4 79  ? -14.788 -25.292 30.380 1.00 65.91  ? 76   ARG D CZ    1 
ATOM   2648  N  NH1   . ARG D 4 79  ? -14.375 -26.309 31.138 1.00 63.56  ? 76   ARG D NH1   1 
ATOM   2649  N  NH2   . ARG D 4 79  ? -16.097 -25.037 30.252 1.00 65.11  ? 76   ARG D NH2   1 
ATOM   2650  N  N     . LEU D 4 80  ? -9.965  -28.101 26.422 1.00 72.03  ? 77   LEU D N     1 
ATOM   2651  C  CA    . LEU D 4 80  ? -9.052  -29.206 26.141 1.00 72.89  ? 77   LEU D CA    1 
ATOM   2652  C  C     . LEU D 4 80  ? -8.234  -28.976 24.865 1.00 73.90  ? 77   LEU D C     1 
ATOM   2653  O  O     . LEU D 4 80  ? -6.990  -28.961 24.902 1.00 74.08  ? 77   LEU D O     1 
ATOM   2654  C  CB    . LEU D 4 80  ? -9.847  -30.507 26.012 1.00 72.75  ? 77   LEU D CB    1 
ATOM   2655  C  CG    . LEU D 4 80  ? -9.706  -31.721 26.944 1.00 72.08  ? 77   LEU D CG    1 
ATOM   2656  C  CD1   . LEU D 4 80  ? -8.563  -31.560 27.932 1.00 69.69  ? 77   LEU D CD1   1 
ATOM   2657  C  CD2   . LEU D 4 80  ? -11.020 -32.058 27.651 1.00 70.57  ? 77   LEU D CD2   1 
ATOM   2658  N  N     . ALA D 4 81  ? -8.934  -28.791 23.747 1.00 74.85  ? 78   ALA D N     1 
ATOM   2659  C  CA    . ALA D 4 81  ? -8.304  -28.391 22.495 1.00 76.49  ? 78   ALA D CA    1 
ATOM   2660  C  C     . ALA D 4 81  ? -7.331  -27.217 22.693 1.00 77.81  ? 78   ALA D C     1 
ATOM   2661  O  O     . ALA D 4 81  ? -6.111  -27.378 22.523 1.00 77.95  ? 78   ALA D O     1 
ATOM   2662  C  CB    . ALA D 4 81  ? -9.352  -28.036 21.482 1.00 76.47  ? 78   ALA D CB    1 
ATOM   2663  N  N     . HIS D 4 82  ? -7.868  -26.058 23.082 1.00 79.00  ? 79   HIS D N     1 
ATOM   2664  C  CA    . HIS D 4 82  ? -7.056  -24.876 23.355 1.00 80.80  ? 79   HIS D CA    1 
ATOM   2665  C  C     . HIS D 4 82  ? -5.805  -25.153 24.188 1.00 81.70  ? 79   HIS D C     1 
ATOM   2666  O  O     . HIS D 4 82  ? -4.690  -24.827 23.787 1.00 81.72  ? 79   HIS D O     1 
ATOM   2667  C  CB    . HIS D 4 82  ? -7.889  -23.821 24.053 1.00 80.99  ? 79   HIS D CB    1 
ATOM   2668  C  CG    . HIS D 4 82  ? -8.832  -23.118 23.140 1.00 83.40  ? 79   HIS D CG    1 
ATOM   2669  N  ND1   . HIS D 4 82  ? -8.404  -22.220 22.186 1.00 84.66  ? 79   HIS D ND1   1 
ATOM   2670  C  CD2   . HIS D 4 82  ? -10.182 -23.191 23.019 1.00 85.30  ? 79   HIS D CD2   1 
ATOM   2671  C  CE1   . HIS D 4 82  ? -9.452  -21.768 21.518 1.00 86.11  ? 79   HIS D CE1   1 
ATOM   2672  N  NE2   . HIS D 4 82  ? -10.543 -22.340 22.004 1.00 85.63  ? 79   HIS D NE2   1 
ATOM   2673  N  N     . TYR D 4 83  ? -6.005  -25.760 25.351 1.00 82.90  ? 80   TYR D N     1 
ATOM   2674  C  CA    . TYR D 4 83  ? -4.918  -26.063 26.261 1.00 83.96  ? 80   TYR D CA    1 
ATOM   2675  C  C     . TYR D 4 83  ? -3.798  -26.792 25.535 1.00 84.46  ? 80   TYR D C     1 
ATOM   2676  O  O     . TYR D 4 83  ? -2.611  -26.620 25.857 1.00 84.33  ? 80   TYR D O     1 
ATOM   2677  C  CB    . TYR D 4 83  ? -5.428  -26.925 27.416 1.00 84.33  ? 80   TYR D CB    1 
ATOM   2678  C  CG    . TYR D 4 83  ? -6.424  -26.241 28.346 1.00 85.42  ? 80   TYR D CG    1 
ATOM   2679  C  CD1   . TYR D 4 83  ? -7.219  -26.992 29.219 1.00 85.74  ? 80   TYR D CD1   1 
ATOM   2680  C  CD2   . TYR D 4 83  ? -6.580  -24.852 28.352 1.00 84.79  ? 80   TYR D CD2   1 
ATOM   2681  C  CE1   . TYR D 4 83  ? -8.114  -26.376 30.083 1.00 85.16  ? 80   TYR D CE1   1 
ATOM   2682  C  CE2   . TYR D 4 83  ? -7.478  -24.240 29.204 1.00 85.02  ? 80   TYR D CE2   1 
ATOM   2683  C  CZ    . TYR D 4 83  ? -8.239  -25.004 30.063 1.00 84.89  ? 80   TYR D CZ    1 
ATOM   2684  O  OH    . TYR D 4 83  ? -9.135  -24.391 30.900 1.00 85.68  ? 80   TYR D OH    1 
ATOM   2685  N  N     . ASN D 4 84  ? -4.191  -27.592 24.544 1.00 84.81  ? 81   ASN D N     1 
ATOM   2686  C  CA    . ASN D 4 84  ? -3.257  -28.451 23.838 1.00 85.04  ? 81   ASN D CA    1 
ATOM   2687  C  C     . ASN D 4 84  ? -2.877  -27.914 22.472 1.00 85.12  ? 81   ASN D C     1 
ATOM   2688  O  O     . ASN D 4 84  ? -2.450  -28.670 21.603 1.00 85.23  ? 81   ASN D O     1 
ATOM   2689  C  CB    . ASN D 4 84  ? -3.811  -29.875 23.748 1.00 85.14  ? 81   ASN D CB    1 
ATOM   2690  C  CG    . ASN D 4 84  ? -3.887  -30.552 25.107 1.00 85.33  ? 81   ASN D CG    1 
ATOM   2691  O  OD1   . ASN D 4 84  ? -2.863  -30.867 25.712 1.00 85.42  ? 81   ASN D OD1   1 
ATOM   2692  N  ND2   . ASN D 4 84  ? -5.102  -30.774 25.593 1.00 85.34  ? 81   ASN D ND2   1 
ATOM   2693  N  N     . LYS D 4 85  ? -3.022  -26.602 22.297 1.00 85.29  ? 82   LYS D N     1 
ATOM   2694  C  CA    . LYS D 4 85  ? -2.615  -25.918 21.066 1.00 85.48  ? 82   LYS D CA    1 
ATOM   2695  C  C     . LYS D 4 85  ? -3.024  -26.721 19.836 1.00 84.97  ? 82   LYS D C     1 
ATOM   2696  O  O     . LYS D 4 85  ? -2.180  -27.073 19.001 1.00 84.79  ? 82   LYS D O     1 
ATOM   2697  C  CB    . LYS D 4 85  ? -1.103  -25.663 21.061 1.00 85.38  ? 82   LYS D CB    1 
ATOM   2698  C  CG    . LYS D 4 85  ? -0.643  -24.651 22.095 1.00 86.33  ? 82   LYS D CG    1 
ATOM   2699  C  CD    . LYS D 4 85  ? 0.853   -24.387 21.994 1.00 86.95  ? 82   LYS D CD    1 
ATOM   2700  C  CE    . LYS D 4 85  ? 1.253   -23.183 22.861 1.00 90.20  ? 82   LYS D CE    1 
ATOM   2701  N  NZ    . LYS D 4 85  ? 2.320   -22.339 22.232 1.00 90.43  ? 82   LYS D NZ    1 
ATOM   2702  N  N     . ARG D 4 86  ? -4.319  -27.021 19.754 1.00 84.32  ? 83   ARG D N     1 
ATOM   2703  C  CA    . ARG D 4 86  ? -4.872  -27.846 18.692 1.00 84.40  ? 83   ARG D CA    1 
ATOM   2704  C  C     . ARG D 4 86  ? -6.268  -27.351 18.335 1.00 83.92  ? 83   ARG D C     1 
ATOM   2705  O  O     . ARG D 4 86  ? -6.968  -26.793 19.186 1.00 84.18  ? 83   ARG D O     1 
ATOM   2706  C  CB    . ARG D 4 86  ? -4.898  -29.322 19.112 1.00 84.41  ? 83   ARG D CB    1 
ATOM   2707  C  CG    . ARG D 4 86  ? -3.587  -30.089 18.826 1.00 85.27  ? 83   ARG D CG    1 
ATOM   2708  C  CD    . ARG D 4 86  ? -3.666  -31.576 19.194 1.00 85.80  ? 83   ARG D CD    1 
ATOM   2709  N  NE    . ARG D 4 86  ? -4.435  -32.383 18.231 1.00 90.23  ? 83   ARG D NE    1 
ATOM   2710  C  CZ    . ARG D 4 86  ? -5.777  -32.434 18.148 1.00 91.69  ? 83   ARG D CZ    1 
ATOM   2711  N  NH1   . ARG D 4 86  ? -6.554  -31.713 18.959 1.00 91.22  ? 83   ARG D NH1   1 
ATOM   2712  N  NH2   . ARG D 4 86  ? -6.356  -33.207 17.234 1.00 91.49  ? 83   ARG D NH2   1 
ATOM   2713  N  N     . SER D 4 87  ? -6.673  -27.573 17.085 1.00 83.09  ? 84   SER D N     1 
ATOM   2714  C  CA    . SER D 4 87  ? -7.824  -26.898 16.493 1.00 82.02  ? 84   SER D CA    1 
ATOM   2715  C  C     . SER D 4 87  ? -9.035  -27.780 16.291 1.00 81.59  ? 84   SER D C     1 
ATOM   2716  O  O     . SER D 4 87  ? -10.022 -27.344 15.707 1.00 81.83  ? 84   SER D O     1 
ATOM   2717  C  CB    . SER D 4 87  ? -7.433  -26.381 15.122 1.00 82.22  ? 84   SER D CB    1 
ATOM   2718  O  OG    . SER D 4 87  ? -6.041  -26.489 14.925 1.00 82.89  ? 84   SER D OG    1 
ATOM   2719  N  N     . THR D 4 88  ? -8.974  -29.029 16.731 1.00 80.96  ? 85   THR D N     1 
ATOM   2720  C  CA    . THR D 4 88  ? -10.058 -29.949 16.428 1.00 79.89  ? 85   THR D CA    1 
ATOM   2721  C  C     . THR D 4 88  ? -10.633 -30.613 17.671 1.00 79.74  ? 85   THR D C     1 
ATOM   2722  O  O     . THR D 4 88  ? -9.895  -31.087 18.536 1.00 79.29  ? 85   THR D O     1 
ATOM   2723  C  CB    . THR D 4 88  ? -9.638  -31.039 15.421 1.00 79.83  ? 85   THR D CB    1 
ATOM   2724  O  OG1   . THR D 4 88  ? -8.509  -30.602 14.654 1.00 78.46  ? 85   THR D OG1   1 
ATOM   2725  C  CG2   . THR D 4 88  ? -10.805 -31.367 14.498 1.00 79.79  ? 85   THR D CG2   1 
ATOM   2726  N  N     . ILE D 4 89  ? -11.966 -30.640 17.735 1.00 79.62  ? 86   ILE D N     1 
ATOM   2727  C  CA    . ILE D 4 89  ? -12.693 -31.352 18.778 1.00 79.26  ? 86   ILE D CA    1 
ATOM   2728  C  C     . ILE D 4 89  ? -13.088 -32.700 18.226 1.00 79.46  ? 86   ILE D C     1 
ATOM   2729  O  O     . ILE D 4 89  ? -14.014 -32.806 17.420 1.00 80.02  ? 86   ILE D O     1 
ATOM   2730  C  CB    . ILE D 4 89  ? -13.949 -30.588 19.241 1.00 78.83  ? 86   ILE D CB    1 
ATOM   2731  C  CG1   . ILE D 4 89  ? -13.546 -29.358 20.053 1.00 78.36  ? 86   ILE D CG1   1 
ATOM   2732  C  CG2   . ILE D 4 89  ? -14.830 -31.482 20.102 1.00 79.14  ? 86   ILE D CG2   1 
ATOM   2733  C  CD1   . ILE D 4 89  ? -14.692 -28.471 20.406 1.00 75.58  ? 86   ILE D CD1   1 
ATOM   2734  N  N     . THR D 4 90  ? -12.373 -33.730 18.656 1.00 79.59  ? 87   THR D N     1 
ATOM   2735  C  CA    . THR D 4 90  ? -12.627 -35.085 18.199 1.00 79.68  ? 87   THR D CA    1 
ATOM   2736  C  C     . THR D 4 90  ? -13.373 -35.884 19.264 1.00 79.89  ? 87   THR D C     1 
ATOM   2737  O  O     . THR D 4 90  ? -13.652 -35.384 20.371 1.00 80.15  ? 87   THR D O     1 
ATOM   2738  C  CB    . THR D 4 90  ? -11.324 -35.824 17.926 1.00 79.65  ? 87   THR D CB    1 
ATOM   2739  O  OG1   . THR D 4 90  ? -10.919 -36.496 19.124 1.00 79.52  ? 87   THR D OG1   1 
ATOM   2740  C  CG2   . THR D 4 90  ? -10.238 -34.856 17.478 1.00 79.30  ? 87   THR D CG2   1 
ATOM   2741  N  N     . SER D 4 91  ? -13.668 -37.140 18.934 1.00 79.46  ? 88   SER D N     1 
ATOM   2742  C  CA    . SER D 4 91  ? -14.291 -38.048 19.878 1.00 79.00  ? 88   SER D CA    1 
ATOM   2743  C  C     . SER D 4 91  ? -13.409 -38.241 21.113 1.00 78.57  ? 88   SER D C     1 
ATOM   2744  O  O     . SER D 4 91  ? -13.930 -38.508 22.193 1.00 78.66  ? 88   SER D O     1 
ATOM   2745  C  CB    . SER D 4 91  ? -14.595 -39.393 19.214 1.00 79.03  ? 88   SER D CB    1 
ATOM   2746  O  OG    . SER D 4 91  ? -13.392 -40.093 18.937 1.00 79.37  ? 88   SER D OG    1 
ATOM   2747  N  N     . ARG D 4 92  ? -12.090 -38.099 20.942 1.00 77.92  ? 89   ARG D N     1 
ATOM   2748  C  CA    . ARG D 4 92  ? -11.119 -38.208 22.030 1.00 77.15  ? 89   ARG D CA    1 
ATOM   2749  C  C     . ARG D 4 92  ? -11.252 -37.041 23.001 1.00 77.52  ? 89   ARG D C     1 
ATOM   2750  O  O     . ARG D 4 92  ? -11.321 -37.244 24.212 1.00 77.66  ? 89   ARG D O     1 
ATOM   2751  C  CB    . ARG D 4 92  ? -9.693  -38.284 21.470 1.00 77.14  ? 89   ARG D CB    1 
ATOM   2752  C  CG    . ARG D 4 92  ? -8.573  -37.995 22.465 1.00 76.18  ? 89   ARG D CG    1 
ATOM   2753  C  CD    . ARG D 4 92  ? -7.376  -38.819 22.126 1.00 77.00  ? 89   ARG D CD    1 
ATOM   2754  N  NE    . ARG D 4 92  ? -6.503  -39.071 23.276 1.00 77.69  ? 89   ARG D NE    1 
ATOM   2755  C  CZ    . ARG D 4 92  ? -5.309  -38.510 23.452 1.00 77.23  ? 89   ARG D CZ    1 
ATOM   2756  N  NH1   . ARG D 4 92  ? -4.832  -37.654 22.564 1.00 76.52  ? 89   ARG D NH1   1 
ATOM   2757  N  NH2   . ARG D 4 92  ? -4.593  -38.802 24.525 1.00 78.41  ? 89   ARG D NH2   1 
ATOM   2758  N  N     . GLU D 4 93  ? -11.263 -35.820 22.477 1.00 77.84  ? 90   GLU D N     1 
ATOM   2759  C  CA    . GLU D 4 93  ? -11.609 -34.666 23.294 1.00 78.20  ? 90   GLU D CA    1 
ATOM   2760  C  C     . GLU D 4 93  ? -12.926 -34.949 23.985 1.00 77.96  ? 90   GLU D C     1 
ATOM   2761  O  O     . GLU D 4 93  ? -12.960 -35.047 25.207 1.00 78.50  ? 90   GLU D O     1 
ATOM   2762  C  CB    . GLU D 4 93  ? -11.721 -33.386 22.461 1.00 78.42  ? 90   GLU D CB    1 
ATOM   2763  C  CG    . GLU D 4 93  ? -10.418 -32.615 22.328 1.00 79.36  ? 90   GLU D CG    1 
ATOM   2764  C  CD    . GLU D 4 93  ? -9.428  -33.288 21.410 1.00 80.75  ? 90   GLU D CD    1 
ATOM   2765  O  OE1   . GLU D 4 93  ? -9.866  -33.828 20.376 1.00 81.06  ? 90   GLU D OE1   1 
ATOM   2766  O  OE2   . GLU D 4 93  ? -8.213  -33.271 21.721 1.00 81.74  ? 90   GLU D OE2   1 
ATOM   2767  N  N     . ILE D 4 94  ? -13.992 -35.140 23.206 1.00 77.38  ? 91   ILE D N     1 
ATOM   2768  C  CA    . ILE D 4 94  ? -15.315 -35.372 23.777 1.00 76.95  ? 91   ILE D CA    1 
ATOM   2769  C  C     . ILE D 4 94  ? -15.238 -36.407 24.871 1.00 76.80  ? 91   ILE D C     1 
ATOM   2770  O  O     . ILE D 4 94  ? -15.991 -36.351 25.844 1.00 77.12  ? 91   ILE D O     1 
ATOM   2771  C  CB    . ILE D 4 94  ? -16.348 -35.847 22.731 1.00 76.98  ? 91   ILE D CB    1 
ATOM   2772  C  CG1   . ILE D 4 94  ? -16.767 -34.699 21.793 1.00 77.37  ? 91   ILE D CG1   1 
ATOM   2773  C  CG2   . ILE D 4 94  ? -17.565 -36.447 23.410 1.00 76.35  ? 91   ILE D CG2   1 
ATOM   2774  C  CD1   . ILE D 4 94  ? -17.322 -33.423 22.472 1.00 75.94  ? 91   ILE D CD1   1 
ATOM   2775  N  N     . GLN D 4 95  ? -14.316 -37.350 24.717 1.00 76.19  ? 92   GLN D N     1 
ATOM   2776  C  CA    . GLN D 4 95  ? -14.218 -38.436 25.664 1.00 75.51  ? 92   GLN D CA    1 
ATOM   2777  C  C     . GLN D 4 95  ? -13.706 -37.929 26.992 1.00 75.03  ? 92   GLN D C     1 
ATOM   2778  O  O     . GLN D 4 95  ? -14.422 -38.002 27.990 1.00 75.38  ? 92   GLN D O     1 
ATOM   2779  C  CB    . GLN D 4 95  ? -13.346 -39.574 25.145 1.00 75.68  ? 92   GLN D CB    1 
ATOM   2780  C  CG    . GLN D 4 95  ? -13.158 -40.682 26.153 1.00 75.70  ? 92   GLN D CG    1 
ATOM   2781  C  CD    . GLN D 4 95  ? -12.530 -41.890 25.566 1.00 75.49  ? 92   GLN D CD    1 
ATOM   2782  O  OE1   . GLN D 4 95  ? -11.310 -42.064 25.627 1.00 77.33  ? 92   GLN D OE1   1 
ATOM   2783  N  NE2   . GLN D 4 95  ? -13.345 -42.741 24.976 1.00 75.44  ? 92   GLN D NE2   1 
ATOM   2784  N  N     . THR D 4 96  ? -12.483 -37.413 27.008 1.00 73.93  ? 93   THR D N     1 
ATOM   2785  C  CA    . THR D 4 96  ? -11.883 -36.981 28.270 1.00 73.01  ? 93   THR D CA    1 
ATOM   2786  C  C     . THR D 4 96  ? -12.730 -35.908 28.972 1.00 72.63  ? 93   THR D C     1 
ATOM   2787  O  O     . THR D 4 96  ? -12.838 -35.912 30.187 1.00 72.49  ? 93   THR D O     1 
ATOM   2788  C  CB    . THR D 4 96  ? -10.393 -36.569 28.137 1.00 72.43  ? 93   THR D CB    1 
ATOM   2789  O  OG1   . THR D 4 96  ? -10.207 -35.303 28.763 1.00 71.95  ? 93   THR D OG1   1 
ATOM   2790  C  CG2   . THR D 4 96  ? -9.995  -36.430 26.700 1.00 72.24  ? 93   THR D CG2   1 
ATOM   2791  N  N     . ALA D 4 97  ? -13.339 -35.020 28.191 1.00 72.37  ? 94   ALA D N     1 
ATOM   2792  C  CA    . ALA D 4 97  ? -14.334 -34.059 28.673 1.00 72.29  ? 94   ALA D CA    1 
ATOM   2793  C  C     . ALA D 4 97  ? -15.402 -34.699 29.581 1.00 72.50  ? 94   ALA D C     1 
ATOM   2794  O  O     . ALA D 4 97  ? -15.682 -34.219 30.685 1.00 72.39  ? 94   ALA D O     1 
ATOM   2795  C  CB    . ALA D 4 97  ? -14.994 -33.419 27.496 1.00 72.32  ? 94   ALA D CB    1 
ATOM   2796  N  N     . VAL D 4 98  ? -15.986 -35.782 29.078 1.00 72.52  ? 95   VAL D N     1 
ATOM   2797  C  CA    . VAL D 4 98  ? -16.865 -36.684 29.810 1.00 72.47  ? 95   VAL D CA    1 
ATOM   2798  C  C     . VAL D 4 98  ? -16.242 -37.205 31.097 1.00 72.69  ? 95   VAL D C     1 
ATOM   2799  O  O     . VAL D 4 98  ? -16.941 -37.323 32.117 1.00 73.10  ? 95   VAL D O     1 
ATOM   2800  C  CB    . VAL D 4 98  ? -17.231 -37.881 28.900 1.00 72.50  ? 95   VAL D CB    1 
ATOM   2801  C  CG1   . VAL D 4 98  ? -17.590 -39.113 29.696 1.00 72.23  ? 95   VAL D CG1   1 
ATOM   2802  C  CG2   . VAL D 4 98  ? -18.348 -37.493 27.931 1.00 73.48  ? 95   VAL D CG2   1 
ATOM   2803  N  N     . ARG D 4 99  ? -14.944 -37.526 31.064 1.00 72.44  ? 96   ARG D N     1 
ATOM   2804  C  CA    . ARG D 4 99  ? -14.288 -38.093 32.243 1.00 72.57  ? 96   ARG D CA    1 
ATOM   2805  C  C     . ARG D 4 99  ? -14.018 -37.031 33.299 1.00 71.95  ? 96   ARG D C     1 
ATOM   2806  O  O     . ARG D 4 99  ? -13.800 -37.346 34.465 1.00 72.36  ? 96   ARG D O     1 
ATOM   2807  C  CB    . ARG D 4 99  ? -13.030 -38.912 31.894 1.00 72.24  ? 96   ARG D CB    1 
ATOM   2808  C  CG    . ARG D 4 99  ? -13.347 -40.257 31.206 1.00 73.87  ? 96   ARG D CG    1 
ATOM   2809  C  CD    . ARG D 4 99  ? -12.254 -41.332 31.327 1.00 74.61  ? 96   ARG D CD    1 
ATOM   2810  N  NE    . ARG D 4 99  ? -11.042 -40.982 30.580 1.00 82.22  ? 96   ARG D NE    1 
ATOM   2811  C  CZ    . ARG D 4 99  ? -9.909  -40.488 31.110 1.00 84.32  ? 96   ARG D CZ    1 
ATOM   2812  N  NH1   . ARG D 4 99  ? -9.784  -40.278 32.422 1.00 83.96  ? 96   ARG D NH1   1 
ATOM   2813  N  NH2   . ARG D 4 99  ? -8.880  -40.197 30.314 1.00 85.78  ? 96   ARG D NH2   1 
ATOM   2814  N  N     . LEU D 4 100 ? -14.049 -35.768 32.899 1.00 71.44  ? 97   LEU D N     1 
ATOM   2815  C  CA    . LEU D 4 100 ? -13.924 -34.684 33.847 1.00 70.92  ? 97   LEU D CA    1 
ATOM   2816  C  C     . LEU D 4 100 ? -15.319 -34.222 34.277 1.00 71.56  ? 97   LEU D C     1 
ATOM   2817  O  O     . LEU D 4 100 ? -15.495 -33.642 35.348 1.00 71.58  ? 97   LEU D O     1 
ATOM   2818  C  CB    . LEU D 4 100 ? -13.144 -33.533 33.241 1.00 70.18  ? 97   LEU D CB    1 
ATOM   2819  C  CG    . LEU D 4 100 ? -11.712 -33.786 32.757 1.00 69.75  ? 97   LEU D CG    1 
ATOM   2820  C  CD1   . LEU D 4 100 ? -11.421 -32.891 31.591 1.00 68.63  ? 97   LEU D CD1   1 
ATOM   2821  C  CD2   . LEU D 4 100 ? -10.659 -33.575 33.838 1.00 67.92  ? 97   LEU D CD2   1 
ATOM   2822  N  N     . LEU D 4 101 ? -16.331 -34.489 33.468 1.00 71.95  ? 98   LEU D N     1 
ATOM   2823  C  CA    . LEU D 4 101 ? -17.636 -33.966 33.827 1.00 72.61  ? 98   LEU D CA    1 
ATOM   2824  C  C     . LEU D 4 101 ? -18.523 -34.909 34.608 1.00 72.81  ? 98   LEU D C     1 
ATOM   2825  O  O     . LEU D 4 101 ? -19.512 -34.474 35.196 1.00 72.62  ? 98   LEU D O     1 
ATOM   2826  C  CB    . LEU D 4 101 ? -18.398 -33.439 32.618 1.00 72.78  ? 98   LEU D CB    1 
ATOM   2827  C  CG    . LEU D 4 101 ? -19.163 -32.203 33.090 1.00 73.11  ? 98   LEU D CG    1 
ATOM   2828  C  CD1   . LEU D 4 101 ? -18.448 -30.946 32.593 1.00 73.07  ? 98   LEU D CD1   1 
ATOM   2829  C  CD2   . LEU D 4 101 ? -20.618 -32.261 32.647 1.00 73.98  ? 98   LEU D CD2   1 
ATOM   2830  N  N     . LEU D 4 102 ? -18.172 -36.191 34.613 1.00 73.43  ? 99   LEU D N     1 
ATOM   2831  C  CA    . LEU D 4 102 ? -19.060 -37.212 35.164 1.00 73.35  ? 99   LEU D CA    1 
ATOM   2832  C  C     . LEU D 4 102 ? -18.439 -37.987 36.323 1.00 73.55  ? 99   LEU D C     1 
ATOM   2833  O  O     . LEU D 4 102 ? -17.217 -38.225 36.336 1.00 73.29  ? 99   LEU D O     1 
ATOM   2834  C  CB    . LEU D 4 102 ? -19.528 -38.152 34.055 1.00 73.21  ? 99   LEU D CB    1 
ATOM   2835  C  CG    . LEU D 4 102 ? -20.326 -37.463 32.947 1.00 73.36  ? 99   LEU D CG    1 
ATOM   2836  C  CD1   . LEU D 4 102 ? -20.375 -38.303 31.699 1.00 72.96  ? 99   LEU D CD1   1 
ATOM   2837  C  CD2   . LEU D 4 102 ? -21.734 -37.149 33.416 1.00 74.53  ? 99   LEU D CD2   1 
ATOM   2838  N  N     . PRO D 4 103 ? -19.282 -38.349 37.310 1.00 73.67  ? 100  PRO D N     1 
ATOM   2839  C  CA    . PRO D 4 103 ? -18.965 -39.181 38.480 1.00 74.25  ? 100  PRO D CA    1 
ATOM   2840  C  C     . PRO D 4 103 ? -18.578 -40.625 38.152 1.00 75.05  ? 100  PRO D C     1 
ATOM   2841  O  O     . PRO D 4 103 ? -19.394 -41.383 37.602 1.00 74.55  ? 100  PRO D O     1 
ATOM   2842  C  CB    . PRO D 4 103 ? -20.272 -39.157 39.296 1.00 73.82  ? 100  PRO D CB    1 
ATOM   2843  C  CG    . PRO D 4 103 ? -20.966 -37.928 38.837 1.00 73.09  ? 100  PRO D CG    1 
ATOM   2844  C  CD    . PRO D 4 103 ? -20.676 -37.882 37.368 1.00 73.46  ? 100  PRO D CD    1 
ATOM   2845  N  N     . GLY D 4 104 ? -17.335 -40.980 38.511 1.00 75.86  ? 101  GLY D N     1 
ATOM   2846  C  CA    . GLY D 4 104 ? -16.788 -42.344 38.414 1.00 76.50  ? 101  GLY D CA    1 
ATOM   2847  C  C     . GLY D 4 104 ? -17.585 -43.399 37.660 1.00 77.31  ? 101  GLY D C     1 
ATOM   2848  O  O     . GLY D 4 104 ? -17.076 -43.970 36.686 1.00 77.60  ? 101  GLY D O     1 
ATOM   2849  N  N     . GLU D 4 105 ? -18.823 -43.664 38.096 1.00 77.30  ? 102  GLU D N     1 
ATOM   2850  C  CA    . GLU D 4 105 ? -19.606 -44.761 37.532 1.00 77.85  ? 102  GLU D CA    1 
ATOM   2851  C  C     . GLU D 4 105 ? -20.363 -44.319 36.301 1.00 77.79  ? 102  GLU D C     1 
ATOM   2852  O  O     . GLU D 4 105 ? -20.485 -45.058 35.319 1.00 77.92  ? 102  GLU D O     1 
ATOM   2853  C  CB    . GLU D 4 105 ? -20.572 -45.332 38.573 1.00 78.18  ? 102  GLU D CB    1 
ATOM   2854  C  CG    . GLU D 4 105 ? -21.125 -46.717 38.276 1.00 80.00  ? 102  GLU D CG    1 
ATOM   2855  C  CD    . GLU D 4 105 ? -20.035 -47.776 38.152 1.00 83.12  ? 102  GLU D CD    1 
ATOM   2856  O  OE1   . GLU D 4 105 ? -18.890 -47.526 38.626 1.00 83.69  ? 102  GLU D OE1   1 
ATOM   2857  O  OE2   . GLU D 4 105 ? -20.325 -48.858 37.573 1.00 84.24  ? 102  GLU D OE2   1 
ATOM   2858  N  N     . LEU D 4 106 ? -20.865 -43.096 36.352 1.00 77.86  ? 103  LEU D N     1 
ATOM   2859  C  CA    . LEU D 4 106 ? -21.729 -42.589 35.302 1.00 77.49  ? 103  LEU D CA    1 
ATOM   2860  C  C     . LEU D 4 106 ? -20.923 -42.336 34.047 1.00 77.26  ? 103  LEU D C     1 
ATOM   2861  O  O     . LEU D 4 106 ? -21.394 -42.596 32.936 1.00 77.27  ? 103  LEU D O     1 
ATOM   2862  C  CB    . LEU D 4 106 ? -22.427 -41.331 35.783 1.00 77.31  ? 103  LEU D CB    1 
ATOM   2863  C  CG    . LEU D 4 106 ? -23.825 -41.108 35.224 1.00 77.87  ? 103  LEU D CG    1 
ATOM   2864  C  CD1   . LEU D 4 106 ? -24.647 -42.398 35.169 1.00 78.00  ? 103  LEU D CD1   1 
ATOM   2865  C  CD2   . LEU D 4 106 ? -24.537 -40.027 36.048 1.00 78.33  ? 103  LEU D CD2   1 
ATOM   2866  N  N     . ALA D 4 107 ? -19.695 -41.856 34.255 1.00 77.07  ? 104  ALA D N     1 
ATOM   2867  C  CA    . ALA D 4 107 ? -18.678 -41.687 33.223 1.00 76.64  ? 104  ALA D CA    1 
ATOM   2868  C  C     . ALA D 4 107 ? -18.305 -43.016 32.597 1.00 76.96  ? 104  ALA D C     1 
ATOM   2869  O  O     . ALA D 4 107 ? -18.222 -43.143 31.372 1.00 76.65  ? 104  ALA D O     1 
ATOM   2870  C  CB    . ALA D 4 107 ? -17.459 -41.087 33.837 1.00 76.83  ? 104  ALA D CB    1 
ATOM   2871  N  N     . LYS D 4 108 ? -18.076 -44.002 33.462 1.00 77.35  ? 105  LYS D N     1 
ATOM   2872  C  CA    . LYS D 4 108 ? -17.650 -45.334 33.056 1.00 77.69  ? 105  LYS D CA    1 
ATOM   2873  C  C     . LYS D 4 108 ? -18.546 -45.855 31.947 1.00 77.60  ? 105  LYS D C     1 
ATOM   2874  O  O     . LYS D 4 108 ? -18.085 -46.175 30.856 1.00 77.45  ? 105  LYS D O     1 
ATOM   2875  C  CB    . LYS D 4 108 ? -17.694 -46.264 34.257 1.00 77.61  ? 105  LYS D CB    1 
ATOM   2876  C  CG    . LYS D 4 108 ? -16.388 -46.980 34.530 1.00 78.89  ? 105  LYS D CG    1 
ATOM   2877  C  CD    . LYS D 4 108 ? -16.613 -48.315 35.272 1.00 80.80  ? 105  LYS D CD    1 
ATOM   2878  C  CE    . LYS D 4 108 ? -16.947 -48.114 36.762 1.00 80.59  ? 105  LYS D CE    1 
ATOM   2879  N  NZ    . LYS D 4 108 ? -17.437 -49.372 37.400 1.00 81.04  ? 105  LYS D NZ    1 
ATOM   2880  N  N     . HIS D 4 109 ? -19.839 -45.897 32.227 1.00 78.17  ? 106  HIS D N     1 
ATOM   2881  C  CA    . HIS D 4 109 ? -20.822 -46.331 31.247 1.00 78.81  ? 106  HIS D CA    1 
ATOM   2882  C  C     . HIS D 4 109 ? -20.853 -45.444 30.015 1.00 78.91  ? 106  HIS D C     1 
ATOM   2883  O  O     . HIS D 4 109 ? -20.804 -45.942 28.894 1.00 78.74  ? 106  HIS D O     1 
ATOM   2884  C  CB    . HIS D 4 109 ? -22.204 -46.400 31.882 1.00 78.96  ? 106  HIS D CB    1 
ATOM   2885  C  CG    . HIS D 4 109 ? -22.372 -47.538 32.837 1.00 80.36  ? 106  HIS D CG    1 
ATOM   2886  N  ND1   . HIS D 4 109 ? -23.029 -47.408 34.041 1.00 82.42  ? 106  HIS D ND1   1 
ATOM   2887  C  CD2   . HIS D 4 109 ? -21.961 -48.827 32.770 1.00 81.76  ? 106  HIS D CD2   1 
ATOM   2888  C  CE1   . HIS D 4 109 ? -23.021 -48.569 34.673 1.00 82.83  ? 106  HIS D CE1   1 
ATOM   2889  N  NE2   . HIS D 4 109 ? -22.376 -49.446 33.925 1.00 82.94  ? 106  HIS D NE2   1 
ATOM   2890  N  N     . ALA D 4 110 ? -20.945 -44.131 30.236 1.00 79.37  ? 107  ALA D N     1 
ATOM   2891  C  CA    . ALA D 4 110 ? -20.915 -43.142 29.157 1.00 79.39  ? 107  ALA D CA    1 
ATOM   2892  C  C     . ALA D 4 110 ? -19.813 -43.443 28.130 1.00 79.68  ? 107  ALA D C     1 
ATOM   2893  O  O     . ALA D 4 110 ? -20.106 -43.634 26.945 1.00 79.76  ? 107  ALA D O     1 
ATOM   2894  C  CB    . ALA D 4 110 ? -20.754 -41.755 29.724 1.00 79.24  ? 107  ALA D CB    1 
ATOM   2895  N  N     . VAL D 4 111 ? -18.563 -43.517 28.592 1.00 79.87  ? 108  VAL D N     1 
ATOM   2896  C  CA    . VAL D 4 111 ? -17.423 -43.819 27.726 1.00 79.81  ? 108  VAL D CA    1 
ATOM   2897  C  C     . VAL D 4 111 ? -17.713 -45.098 26.949 1.00 80.49  ? 108  VAL D C     1 
ATOM   2898  O  O     . VAL D 4 111 ? -17.652 -45.120 25.720 1.00 80.31  ? 108  VAL D O     1 
ATOM   2899  C  CB    . VAL D 4 111 ? -16.104 -43.939 28.530 1.00 79.34  ? 108  VAL D CB    1 
ATOM   2900  C  CG1   . VAL D 4 111 ? -14.953 -44.309 27.634 1.00 78.76  ? 108  VAL D CG1   1 
ATOM   2901  C  CG2   . VAL D 4 111 ? -15.792 -42.641 29.209 1.00 79.19  ? 108  VAL D CG2   1 
ATOM   2902  N  N     . SER D 4 112 ? -18.051 -46.153 27.679 1.00 81.61  ? 109  SER D N     1 
ATOM   2903  C  CA    . SER D 4 112 ? -18.470 -47.408 27.075 1.00 82.81  ? 109  SER D CA    1 
ATOM   2904  C  C     . SER D 4 112 ? -19.413 -47.116 25.919 1.00 83.62  ? 109  SER D C     1 
ATOM   2905  O  O     . SER D 4 112 ? -19.012 -47.245 24.769 1.00 83.85  ? 109  SER D O     1 
ATOM   2906  C  CB    . SER D 4 112 ? -19.131 -48.310 28.124 1.00 82.90  ? 109  SER D CB    1 
ATOM   2907  O  OG    . SER D 4 112 ? -19.749 -49.441 27.543 1.00 82.78  ? 109  SER D OG    1 
ATOM   2908  N  N     . GLU D 4 113 ? -20.635 -46.673 26.228 1.00 84.80  ? 110  GLU D N     1 
ATOM   2909  C  CA    . GLU D 4 113 ? -21.668 -46.379 25.219 1.00 86.18  ? 110  GLU D CA    1 
ATOM   2910  C  C     . GLU D 4 113 ? -21.146 -45.479 24.097 1.00 86.93  ? 110  GLU D C     1 
ATOM   2911  O  O     . GLU D 4 113 ? -21.573 -45.581 22.939 1.00 87.17  ? 110  GLU D O     1 
ATOM   2912  C  CB    . GLU D 4 113 ? -22.874 -45.699 25.867 1.00 86.28  ? 110  GLU D CB    1 
ATOM   2913  C  CG    . GLU D 4 113 ? -23.571 -46.500 26.952 1.00 87.51  ? 110  GLU D CG    1 
ATOM   2914  C  CD    . GLU D 4 113 ? -24.706 -47.339 26.411 1.00 89.65  ? 110  GLU D CD    1 
ATOM   2915  O  OE1   . GLU D 4 113 ? -25.874 -47.077 26.775 1.00 89.88  ? 110  GLU D OE1   1 
ATOM   2916  O  OE2   . GLU D 4 113 ? -24.435 -48.262 25.613 1.00 92.30  ? 110  GLU D OE2   1 
ATOM   2917  N  N     . GLY D 4 114 ? -20.220 -44.597 24.458 1.00 87.66  ? 111  GLY D N     1 
ATOM   2918  C  CA    . GLY D 4 114 ? -19.593 -43.688 23.512 1.00 88.51  ? 111  GLY D CA    1 
ATOM   2919  C  C     . GLY D 4 114 ? -18.637 -44.384 22.572 1.00 89.09  ? 111  GLY D C     1 
ATOM   2920  O  O     . GLY D 4 114 ? -18.765 -44.243 21.366 1.00 89.11  ? 111  GLY D O     1 
ATOM   2921  N  N     . THR D 4 115 ? -17.681 -45.135 23.112 1.00 89.77  ? 112  THR D N     1 
ATOM   2922  C  CA    . THR D 4 115 ? -16.728 -45.855 22.265 1.00 90.79  ? 112  THR D CA    1 
ATOM   2923  C  C     . THR D 4 115 ? -17.461 -46.880 21.364 1.00 91.61  ? 112  THR D C     1 
ATOM   2924  O  O     . THR D 4 115 ? -17.116 -47.052 20.187 1.00 91.44  ? 112  THR D O     1 
ATOM   2925  C  CB    . THR D 4 115 ? -15.579 -46.518 23.087 1.00 90.77  ? 112  THR D CB    1 
ATOM   2926  O  OG1   . THR D 4 115 ? -15.136 -45.631 24.125 1.00 90.61  ? 112  THR D OG1   1 
ATOM   2927  C  CG2   . THR D 4 115 ? -14.391 -46.849 22.194 1.00 90.19  ? 112  THR D CG2   1 
ATOM   2928  N  N     . LYS D 4 116 ? -18.488 -47.524 21.923 1.00 92.62  ? 113  LYS D N     1 
ATOM   2929  C  CA    . LYS D 4 116 ? -19.336 -48.467 21.188 1.00 93.50  ? 113  LYS D CA    1 
ATOM   2930  C  C     . LYS D 4 116 ? -20.002 -47.822 19.982 1.00 94.17  ? 113  LYS D C     1 
ATOM   2931  O  O     . LYS D 4 116 ? -19.769 -48.245 18.855 1.00 94.40  ? 113  LYS D O     1 
ATOM   2932  C  CB    . LYS D 4 116 ? -20.401 -49.086 22.105 1.00 93.48  ? 113  LYS D CB    1 
ATOM   2933  C  CG    . LYS D 4 116 ? -21.476 -49.902 21.366 1.00 93.81  ? 113  LYS D CG    1 
ATOM   2934  C  CD    . LYS D 4 116 ? -22.518 -50.512 22.307 1.00 93.57  ? 113  LYS D CD    1 
ATOM   2935  C  CE    . LYS D 4 116 ? -23.648 -49.548 22.613 1.00 93.92  ? 113  LYS D CE    1 
ATOM   2936  N  NZ    . LYS D 4 116 ? -24.601 -50.114 23.614 1.00 94.56  ? 113  LYS D NZ    1 
ATOM   2937  N  N     . ALA D 4 117 ? -20.823 -46.799 20.216 1.00 95.20  ? 114  ALA D N     1 
ATOM   2938  C  CA    . ALA D 4 117 ? -21.584 -46.159 19.130 1.00 96.05  ? 114  ALA D CA    1 
ATOM   2939  C  C     . ALA D 4 117 ? -20.679 -45.652 18.008 1.00 96.48  ? 114  ALA D C     1 
ATOM   2940  O  O     . ALA D 4 117 ? -21.072 -45.654 16.842 1.00 96.21  ? 114  ALA D O     1 
ATOM   2941  C  CB    . ALA D 4 117 ? -22.465 -45.028 19.667 1.00 95.99  ? 114  ALA D CB    1 
ATOM   2942  N  N     . VAL D 4 118 ? -19.469 -45.233 18.377 1.00 97.32  ? 115  VAL D N     1 
ATOM   2943  C  CA    . VAL D 4 118 ? -18.486 -44.748 17.414 1.00 98.24  ? 115  VAL D CA    1 
ATOM   2944  C  C     . VAL D 4 118 ? -18.042 -45.880 16.497 1.00 98.98  ? 115  VAL D C     1 
ATOM   2945  O  O     . VAL D 4 118 ? -18.312 -45.822 15.292 1.00 99.37  ? 115  VAL D O     1 
ATOM   2946  C  CB    . VAL D 4 118 ? -17.264 -44.053 18.093 1.00 98.29  ? 115  VAL D CB    1 
ATOM   2947  C  CG1   . VAL D 4 118 ? -16.160 -43.759 17.078 1.00 97.92  ? 115  VAL D CG1   1 
ATOM   2948  C  CG2   . VAL D 4 118 ? -17.693 -42.766 18.764 1.00 98.26  ? 115  VAL D CG2   1 
ATOM   2949  N  N     . THR D 4 119 ? -17.382 -46.905 17.054 1.00 99.59  ? 116  THR D N     1 
ATOM   2950  C  CA    . THR D 4 119 ? -16.942 -48.044 16.237 1.00 100.14 ? 116  THR D CA    1 
ATOM   2951  C  C     . THR D 4 119 ? -18.072 -48.587 15.367 1.00 100.50 ? 116  THR D C     1 
ATOM   2952  O  O     . THR D 4 119 ? -17.882 -48.789 14.170 1.00 100.44 ? 116  THR D O     1 
ATOM   2953  C  CB    . THR D 4 119 ? -16.283 -49.173 17.053 1.00 100.05 ? 116  THR D CB    1 
ATOM   2954  O  OG1   . THR D 4 119 ? -16.689 -49.036 18.461 1.00 99.98  ? 116  THR D OG1   1 
ATOM   2955  C  CG2   . THR D 4 119 ? -14.708 -49.026 16.940 1.00 100.44 ? 116  THR D CG2   1 
ATOM   2956  N  N     . LYS D 4 120 ? -19.251 -48.768 15.959 1.00 101.23 ? 117  LYS D N     1 
ATOM   2957  C  CA    . LYS D 4 120 ? -20.421 -49.268 15.232 1.00 102.15 ? 117  LYS D CA    1 
ATOM   2958  C  C     . LYS D 4 120 ? -20.781 -48.400 14.026 1.00 102.68 ? 117  LYS D C     1 
ATOM   2959  O  O     . LYS D 4 120 ? -21.196 -48.903 12.982 1.00 102.85 ? 117  LYS D O     1 
ATOM   2960  C  CB    . LYS D 4 120 ? -21.632 -49.400 16.157 1.00 102.07 ? 117  LYS D CB    1 
ATOM   2961  C  CG    . LYS D 4 120 ? -22.506 -50.579 15.783 1.00 102.93 ? 117  LYS D CG    1 
ATOM   2962  C  CD    . LYS D 4 120 ? -23.973 -50.376 16.090 1.00 103.84 ? 117  LYS D CD    1 
ATOM   2963  C  CE    . LYS D 4 120 ? -24.779 -51.551 15.533 1.00 104.97 ? 117  LYS D CE    1 
ATOM   2964  N  NZ    . LYS D 4 120 ? -26.240 -51.263 15.456 1.00 105.61 ? 117  LYS D NZ    1 
ATOM   2965  N  N     . TYR D 4 121 ? -20.622 -47.092 14.189 1.00 103.53 ? 118  TYR D N     1 
ATOM   2966  C  CA    . TYR D 4 121 ? -20.862 -46.130 13.125 1.00 104.11 ? 118  TYR D CA    1 
ATOM   2967  C  C     . TYR D 4 121 ? -19.772 -46.230 12.077 1.00 104.84 ? 118  TYR D C     1 
ATOM   2968  O  O     . TYR D 4 121 ? -20.067 -46.141 10.885 1.00 105.27 ? 118  TYR D O     1 
ATOM   2969  C  CB    . TYR D 4 121 ? -20.937 -44.720 13.710 1.00 103.82 ? 118  TYR D CB    1 
ATOM   2970  C  CG    . TYR D 4 121 ? -20.679 -43.575 12.752 1.00 103.39 ? 118  TYR D CG    1 
ATOM   2971  C  CD1   . TYR D 4 121 ? -21.724 -43.010 12.020 1.00 102.78 ? 118  TYR D CD1   1 
ATOM   2972  C  CD2   . TYR D 4 121 ? -19.395 -43.026 12.611 1.00 102.63 ? 118  TYR D CD2   1 
ATOM   2973  C  CE1   . TYR D 4 121 ? -21.497 -41.946 11.156 1.00 102.25 ? 118  TYR D CE1   1 
ATOM   2974  C  CE2   . TYR D 4 121 ? -19.158 -41.963 11.745 1.00 101.96 ? 118  TYR D CE2   1 
ATOM   2975  C  CZ    . TYR D 4 121 ? -20.218 -41.429 11.023 1.00 102.39 ? 118  TYR D CZ    1 
ATOM   2976  O  OH    . TYR D 4 121 ? -20.012 -40.379 10.167 1.00 102.80 ? 118  TYR D OH    1 
ATOM   2977  N  N     . THR D 4 122 ? -18.524 -46.419 12.509 1.00 105.35 ? 119  THR D N     1 
ATOM   2978  C  CA    . THR D 4 122 ? -17.420 -46.553 11.557 1.00 106.24 ? 119  THR D CA    1 
ATOM   2979  C  C     . THR D 4 122 ? -17.381 -47.918 10.858 1.00 106.85 ? 119  THR D C     1 
ATOM   2980  O  O     . THR D 4 122 ? -16.579 -48.122 9.942  1.00 106.93 ? 119  THR D O     1 
ATOM   2981  C  CB    . THR D 4 122 ? -16.044 -46.186 12.163 1.00 106.11 ? 119  THR D CB    1 
ATOM   2982  O  OG1   . THR D 4 122 ? -16.029 -46.482 13.562 1.00 106.73 ? 119  THR D OG1   1 
ATOM   2983  C  CG2   . THR D 4 122 ? -15.779 -44.715 11.992 1.00 106.34 ? 119  THR D CG2   1 
ATOM   2984  N  N     . SER D 4 123 ? -18.242 -48.844 11.293 1.00 107.56 ? 120  SER D N     1 
ATOM   2985  C  CA    . SER D 4 123 ? -18.500 -50.077 10.548 1.00 108.36 ? 120  SER D CA    1 
ATOM   2986  C  C     . SER D 4 123 ? -19.162 -49.670 9.240  1.00 108.95 ? 120  SER D C     1 
ATOM   2987  O  O     . SER D 4 123 ? -18.552 -49.745 8.167  1.00 109.05 ? 120  SER D O     1 
ATOM   2988  C  CB    . SER D 4 123 ? -19.445 -51.014 11.314 1.00 108.33 ? 120  SER D CB    1 
ATOM   2989  O  OG    . SER D 4 123 ? -18.853 -51.547 12.485 1.00 108.55 ? 120  SER D OG    1 
ATOM   2990  N  N     . ALA D 4 124 ? -20.413 -49.219 9.357  1.00 109.60 ? 121  ALA D N     1 
ATOM   2991  C  CA    . ALA D 4 124 ? -21.204 -48.727 8.232  1.00 109.98 ? 121  ALA D CA    1 
ATOM   2992  C  C     . ALA D 4 124 ? -20.562 -47.484 7.620  1.00 110.31 ? 121  ALA D C     1 
ATOM   2993  O  O     . ALA D 4 124 ? -19.747 -46.812 8.266  1.00 110.21 ? 121  ALA D O     1 
ATOM   2994  C  CB    . ALA D 4 124 ? -22.638 -48.431 8.681  1.00 109.82 ? 121  ALA D CB    1 
ATOM   2995  N  N     . LYS D 4 125 ? -20.926 -47.201 6.367  1.00 110.76 ? 122  LYS D N     1 
ATOM   2996  C  CA    . LYS D 4 125 ? -20.404 -46.051 5.614  1.00 111.09 ? 122  LYS D CA    1 
ATOM   2997  C  C     . LYS D 4 125 ? -21.293 -45.763 4.406  1.00 111.19 ? 122  LYS D C     1 
ATOM   2998  O  O     . LYS D 4 125 ? -21.734 -44.630 4.203  1.00 111.28 ? 122  LYS D O     1 
ATOM   2999  C  CB    . LYS D 4 125 ? -18.957 -46.299 5.154  1.00 111.11 ? 122  LYS D CB    1 
ATOM   3000  C  CG    . LYS D 4 125 ? -18.461 -45.349 4.068  1.00 111.04 ? 122  LYS D CG    1 
ATOM   3001  C  CD    . LYS D 4 125 ? -17.787 -46.123 2.937  1.00 110.88 ? 122  LYS D CD    1 
ATOM   3002  C  CE    . LYS D 4 125 ? -17.557 -45.237 1.724  1.00 110.41 ? 122  LYS D CE    1 
ATOM   3003  N  NZ    . LYS D 4 125 ? -17.305 -46.036 0.502  1.00 109.80 ? 122  LYS D NZ    1 
ATOM   3004  O  OXT   . LYS D 4 125 ? -21.579 -46.658 3.605  1.00 111.25 ? 122  LYS D OXT   1 
ATOM   3005  N  N     . HIS E 1 39  ? -60.264 -31.775 70.644 1.00 117.81 ? 39   HIS E N     1 
ATOM   3006  C  CA    . HIS E 1 39  ? -59.374 -31.276 71.740 1.00 117.84 ? 39   HIS E CA    1 
ATOM   3007  C  C     . HIS E 1 39  ? -58.181 -30.455 71.220 1.00 117.61 ? 39   HIS E C     1 
ATOM   3008  O  O     . HIS E 1 39  ? -58.327 -29.642 70.301 1.00 117.56 ? 39   HIS E O     1 
ATOM   3009  C  CB    . HIS E 1 39  ? -58.892 -32.437 72.632 1.00 117.92 ? 39   HIS E CB    1 
ATOM   3010  C  CG    . HIS E 1 39  ? -58.283 -33.582 71.875 1.00 118.29 ? 39   HIS E CG    1 
ATOM   3011  N  ND1   . HIS E 1 39  ? -57.545 -33.412 70.720 1.00 118.27 ? 39   HIS E ND1   1 
ATOM   3012  C  CD2   . HIS E 1 39  ? -58.286 -34.914 72.126 1.00 118.31 ? 39   HIS E CD2   1 
ATOM   3013  C  CE1   . HIS E 1 39  ? -57.135 -34.591 70.286 1.00 118.43 ? 39   HIS E CE1   1 
ATOM   3014  N  NE2   . HIS E 1 39  ? -57.570 -35.518 71.121 1.00 118.50 ? 39   HIS E NE2   1 
ATOM   3015  N  N     . ARG E 1 40  ? -57.010 -30.683 71.816 1.00 117.31 ? 40   ARG E N     1 
ATOM   3016  C  CA    . ARG E 1 40  ? -55.813 -29.884 71.560 1.00 116.89 ? 40   ARG E CA    1 
ATOM   3017  C  C     . ARG E 1 40  ? -54.611 -30.762 71.216 1.00 116.53 ? 40   ARG E C     1 
ATOM   3018  O  O     . ARG E 1 40  ? -54.336 -31.754 71.902 1.00 116.48 ? 40   ARG E O     1 
ATOM   3019  C  CB    . ARG E 1 40  ? -55.490 -29.027 72.787 1.00 116.87 ? 40   ARG E CB    1 
ATOM   3020  C  CG    . ARG E 1 40  ? -54.630 -27.813 72.506 1.00 116.83 ? 40   ARG E CG    1 
ATOM   3021  C  CD    . ARG E 1 40  ? -55.478 -26.585 72.204 1.00 116.99 ? 40   ARG E CD    1 
ATOM   3022  N  NE    . ARG E 1 40  ? -54.653 -25.451 71.786 1.00 117.11 ? 40   ARG E NE    1 
ATOM   3023  C  CZ    . ARG E 1 40  ? -54.002 -24.638 72.616 1.00 116.92 ? 40   ARG E CZ    1 
ATOM   3024  N  NH1   . ARG E 1 40  ? -54.064 -24.814 73.929 1.00 117.13 ? 40   ARG E NH1   1 
ATOM   3025  N  NH2   . ARG E 1 40  ? -53.282 -23.640 72.131 1.00 117.18 ? 40   ARG E NH2   1 
ATOM   3026  N  N     . TYR E 1 41  ? -53.897 -30.383 70.156 1.00 116.02 ? 41   TYR E N     1 
ATOM   3027  C  CA    . TYR E 1 41  ? -52.674 -31.074 69.747 1.00 115.38 ? 41   TYR E CA    1 
ATOM   3028  C  C     . TYR E 1 41  ? -51.437 -30.444 70.382 1.00 115.14 ? 41   TYR E C     1 
ATOM   3029  O  O     . TYR E 1 41  ? -51.274 -29.219 70.371 1.00 115.03 ? 41   TYR E O     1 
ATOM   3030  C  CB    . TYR E 1 41  ? -52.549 -31.111 68.218 1.00 115.15 ? 41   TYR E CB    1 
ATOM   3031  C  CG    . TYR E 1 41  ? -53.276 -32.270 67.559 1.00 114.70 ? 41   TYR E CG    1 
ATOM   3032  C  CD1   . TYR E 1 41  ? -54.371 -32.047 66.723 1.00 114.41 ? 41   TYR E CD1   1 
ATOM   3033  C  CD2   . TYR E 1 41  ? -52.868 -33.590 67.773 1.00 114.23 ? 41   TYR E CD2   1 
ATOM   3034  C  CE1   . TYR E 1 41  ? -55.043 -33.108 66.120 1.00 113.96 ? 41   TYR E CE1   1 
ATOM   3035  C  CE2   . TYR E 1 41  ? -53.535 -34.654 67.173 1.00 114.09 ? 41   TYR E CE2   1 
ATOM   3036  C  CZ    . TYR E 1 41  ? -54.619 -34.404 66.350 1.00 114.05 ? 41   TYR E CZ    1 
ATOM   3037  O  OH    . TYR E 1 41  ? -55.274 -35.452 65.754 1.00 114.36 ? 41   TYR E OH    1 
ATOM   3038  N  N     . ARG E 1 42  ? -50.572 -31.295 70.931 1.00 114.91 ? 42   ARG E N     1 
ATOM   3039  C  CA    . ARG E 1 42  ? -49.385 -30.852 71.672 1.00 114.83 ? 42   ARG E CA    1 
ATOM   3040  C  C     . ARG E 1 42  ? -48.452 -30.007 70.802 1.00 114.48 ? 42   ARG E C     1 
ATOM   3041  O  O     . ARG E 1 42  ? -47.935 -30.504 69.798 1.00 114.61 ? 42   ARG E O     1 
ATOM   3042  C  CB    . ARG E 1 42  ? -48.615 -32.054 72.232 1.00 114.86 ? 42   ARG E CB    1 
ATOM   3043  C  CG    . ARG E 1 42  ? -49.436 -33.031 73.079 1.00 115.15 ? 42   ARG E CG    1 
ATOM   3044  C  CD    . ARG E 1 42  ? -48.529 -34.042 73.767 1.00 115.21 ? 42   ARG E CD    1 
ATOM   3045  N  NE    . ARG E 1 42  ? -47.582 -33.370 74.658 1.00 116.32 ? 42   ARG E NE    1 
ATOM   3046  C  CZ    . ARG E 1 42  ? -46.450 -33.899 75.121 1.00 116.74 ? 42   ARG E CZ    1 
ATOM   3047  N  NH1   . ARG E 1 42  ? -46.080 -35.133 74.786 1.00 116.10 ? 42   ARG E NH1   1 
ATOM   3048  N  NH2   . ARG E 1 42  ? -45.678 -33.178 75.927 1.00 117.22 ? 42   ARG E NH2   1 
ATOM   3049  N  N     . PRO E 1 43  ? -48.227 -28.734 71.190 1.00 114.08 ? 43   PRO E N     1 
ATOM   3050  C  CA    . PRO E 1 43  ? -47.400 -27.779 70.445 1.00 113.71 ? 43   PRO E CA    1 
ATOM   3051  C  C     . PRO E 1 43  ? -46.208 -28.426 69.742 1.00 113.30 ? 43   PRO E C     1 
ATOM   3052  O  O     . PRO E 1 43  ? -45.327 -28.999 70.399 1.00 113.13 ? 43   PRO E O     1 
ATOM   3053  C  CB    . PRO E 1 43  ? -46.914 -26.799 71.528 1.00 113.66 ? 43   PRO E CB    1 
ATOM   3054  C  CG    . PRO E 1 43  ? -47.656 -27.165 72.793 1.00 114.11 ? 43   PRO E CG    1 
ATOM   3055  C  CD    . PRO E 1 43  ? -48.757 -28.120 72.414 1.00 114.14 ? 43   PRO E CD    1 
ATOM   3056  N  N     . GLY E 1 44  ? -46.210 -28.344 68.412 1.00 112.82 ? 44   GLY E N     1 
ATOM   3057  C  CA    . GLY E 1 44  ? -45.133 -28.879 67.591 1.00 112.20 ? 44   GLY E CA    1 
ATOM   3058  C  C     . GLY E 1 44  ? -45.443 -30.203 66.928 1.00 111.82 ? 44   GLY E C     1 
ATOM   3059  O  O     . GLY E 1 44  ? -44.538 -30.884 66.459 1.00 111.90 ? 44   GLY E O     1 
ATOM   3060  N  N     . THR E 1 45  ? -46.717 -30.576 66.873 1.00 111.45 ? 45   THR E N     1 
ATOM   3061  C  CA    . THR E 1 45  ? -47.083 -31.891 66.355 1.00 111.04 ? 45   THR E CA    1 
ATOM   3062  C  C     . THR E 1 45  ? -47.835 -31.786 65.037 1.00 110.83 ? 45   THR E C     1 
ATOM   3063  O  O     . THR E 1 45  ? -47.860 -32.730 64.237 1.00 110.75 ? 45   THR E O     1 
ATOM   3064  C  CB    . THR E 1 45  ? -47.853 -32.707 67.396 1.00 111.01 ? 45   THR E CB    1 
ATOM   3065  O  OG1   . THR E 1 45  ? -47.157 -32.627 68.646 1.00 110.59 ? 45   THR E OG1   1 
ATOM   3066  C  CG2   . THR E 1 45  ? -47.939 -34.174 66.981 1.00 111.24 ? 45   THR E CG2   1 
ATOM   3067  N  N     . VAL E 1 46  ? -48.439 -30.625 64.815 1.00 110.61 ? 46   VAL E N     1 
ATOM   3068  C  CA    . VAL E 1 46  ? -48.937 -30.267 63.490 1.00 110.32 ? 46   VAL E CA    1 
ATOM   3069  C  C     . VAL E 1 46  ? -47.754 -29.747 62.672 1.00 110.19 ? 46   VAL E C     1 
ATOM   3070  O  O     . VAL E 1 46  ? -47.732 -29.877 61.445 1.00 110.20 ? 46   VAL E O     1 
ATOM   3071  C  CB    . VAL E 1 46  ? -50.036 -29.193 63.548 1.00 110.21 ? 46   VAL E CB    1 
ATOM   3072  C  CG1   . VAL E 1 46  ? -50.916 -29.276 62.307 1.00 110.08 ? 46   VAL E CG1   1 
ATOM   3073  C  CG2   . VAL E 1 46  ? -50.876 -29.357 64.802 1.00 110.16 ? 46   VAL E CG2   1 
ATOM   3074  N  N     . ALA E 1 47  ? -46.773 -29.169 63.372 1.00 109.85 ? 47   ALA E N     1 
ATOM   3075  C  CA    . ALA E 1 47  ? -45.506 -28.760 62.769 1.00 109.32 ? 47   ALA E CA    1 
ATOM   3076  C  C     . ALA E 1 47  ? -44.893 -29.939 62.036 1.00 108.89 ? 47   ALA E C     1 
ATOM   3077  O  O     . ALA E 1 47  ? -44.582 -29.846 60.850 1.00 108.94 ? 47   ALA E O     1 
ATOM   3078  C  CB    . ALA E 1 47  ? -44.550 -28.242 63.830 1.00 109.38 ? 47   ALA E CB    1 
ATOM   3079  N  N     . LEU E 1 48  ? -44.743 -31.054 62.742 1.00 108.33 ? 48   LEU E N     1 
ATOM   3080  C  CA    . LEU E 1 48  ? -44.243 -32.274 62.132 1.00 107.91 ? 48   LEU E CA    1 
ATOM   3081  C  C     . LEU E 1 48  ? -45.161 -32.752 61.006 1.00 107.83 ? 48   LEU E C     1 
ATOM   3082  O  O     . LEU E 1 48  ? -44.684 -33.204 59.965 1.00 107.81 ? 48   LEU E O     1 
ATOM   3083  C  CB    . LEU E 1 48  ? -44.033 -33.356 63.190 1.00 107.74 ? 48   LEU E CB    1 
ATOM   3084  C  CG    . LEU E 1 48  ? -42.754 -33.160 64.005 1.00 107.36 ? 48   LEU E CG    1 
ATOM   3085  C  CD1   . LEU E 1 48  ? -42.935 -33.603 65.433 1.00 107.43 ? 48   LEU E CD1   1 
ATOM   3086  C  CD2   . LEU E 1 48  ? -41.595 -33.892 63.364 1.00 107.29 ? 48   LEU E CD2   1 
ATOM   3087  N  N     . ARG E 1 49  ? -46.471 -32.624 61.202 1.00 107.75 ? 49   ARG E N     1 
ATOM   3088  C  CA    . ARG E 1 49  ? -47.439 -33.035 60.184 1.00 107.56 ? 49   ARG E CA    1 
ATOM   3089  C  C     . ARG E 1 49  ? -47.366 -32.203 58.905 1.00 107.15 ? 49   ARG E C     1 
ATOM   3090  O  O     . ARG E 1 49  ? -47.463 -32.749 57.806 1.00 107.30 ? 49   ARG E O     1 
ATOM   3091  C  CB    . ARG E 1 49  ? -48.862 -33.036 60.739 1.00 107.80 ? 49   ARG E CB    1 
ATOM   3092  C  CG    . ARG E 1 49  ? -49.307 -34.378 61.331 1.00 108.40 ? 49   ARG E CG    1 
ATOM   3093  C  CD    . ARG E 1 49  ? -50.781 -34.666 61.009 1.00 108.44 ? 49   ARG E CD    1 
ATOM   3094  N  NE    . ARG E 1 49  ? -51.644 -33.539 61.367 1.00 108.54 ? 49   ARG E NE    1 
ATOM   3095  C  CZ    . ARG E 1 49  ? -52.263 -33.408 62.538 1.00 108.48 ? 49   ARG E CZ    1 
ATOM   3096  N  NH1   . ARG E 1 49  ? -52.134 -34.347 63.469 1.00 108.31 ? 49   ARG E NH1   1 
ATOM   3097  N  NH2   . ARG E 1 49  ? -53.021 -32.342 62.773 1.00 108.00 ? 49   ARG E NH2   1 
ATOM   3098  N  N     . GLU E 1 50  ? -47.193 -30.892 59.053 1.00 106.56 ? 50   GLU E N     1 
ATOM   3099  C  CA    . GLU E 1 50  ? -47.039 -29.992 57.910 1.00 106.17 ? 50   GLU E CA    1 
ATOM   3100  C  C     . GLU E 1 50  ? -45.748 -30.251 57.129 1.00 105.95 ? 50   GLU E C     1 
ATOM   3101  O  O     . GLU E 1 50  ? -45.761 -30.215 55.905 1.00 106.05 ? 50   GLU E O     1 
ATOM   3102  C  CB    . GLU E 1 50  ? -47.098 -28.528 58.346 1.00 106.23 ? 50   GLU E CB    1 
ATOM   3103  C  CG    . GLU E 1 50  ? -48.469 -28.050 58.786 1.00 105.99 ? 50   GLU E CG    1 
ATOM   3104  C  CD    . GLU E 1 50  ? -48.469 -26.615 59.288 1.00 106.13 ? 50   GLU E CD    1 
ATOM   3105  O  OE1   . GLU E 1 50  ? -49.572 -26.046 59.428 1.00 106.58 ? 50   GLU E OE1   1 
ATOM   3106  O  OE2   . GLU E 1 50  ? -47.381 -26.053 59.544 1.00 105.76 ? 50   GLU E OE2   1 
ATOM   3107  N  N     . ILE E 1 51  ? -44.642 -30.506 57.829 1.00 105.60 ? 51   ILE E N     1 
ATOM   3108  C  CA    . ILE E 1 51  ? -43.392 -30.883 57.164 1.00 105.28 ? 51   ILE E CA    1 
ATOM   3109  C  C     . ILE E 1 51  ? -43.674 -32.044 56.213 1.00 105.56 ? 51   ILE E C     1 
ATOM   3110  O  O     . ILE E 1 51  ? -43.333 -31.980 55.028 1.00 105.68 ? 51   ILE E O     1 
ATOM   3111  C  CB    . ILE E 1 51  ? -42.263 -31.260 58.169 1.00 105.03 ? 51   ILE E CB    1 
ATOM   3112  C  CG1   . ILE E 1 51  ? -41.704 -30.012 58.855 1.00 104.47 ? 51   ILE E CG1   1 
ATOM   3113  C  CG2   . ILE E 1 51  ? -41.127 -31.993 57.472 1.00 104.31 ? 51   ILE E CG2   1 
ATOM   3114  C  CD1   . ILE E 1 51  ? -40.982 -30.285 60.160 1.00 102.69 ? 51   ILE E CD1   1 
ATOM   3115  N  N     . ARG E 1 52  ? -44.332 -33.081 56.729 1.00 105.68 ? 52   ARG E N     1 
ATOM   3116  C  CA    . ARG E 1 52  ? -44.651 -34.277 55.946 1.00 105.91 ? 52   ARG E CA    1 
ATOM   3117  C  C     . ARG E 1 52  ? -45.437 -33.931 54.694 1.00 105.74 ? 52   ARG E C     1 
ATOM   3118  O  O     . ARG E 1 52  ? -45.197 -34.490 53.623 1.00 105.61 ? 52   ARG E O     1 
ATOM   3119  C  CB    . ARG E 1 52  ? -45.445 -35.276 56.789 1.00 106.05 ? 52   ARG E CB    1 
ATOM   3120  C  CG    . ARG E 1 52  ? -44.756 -35.643 58.085 1.00 107.18 ? 52   ARG E CG    1 
ATOM   3121  C  CD    . ARG E 1 52  ? -45.261 -36.950 58.688 1.00 108.94 ? 52   ARG E CD    1 
ATOM   3122  N  NE    . ARG E 1 52  ? -44.586 -37.221 59.961 1.00 110.12 ? 52   ARG E NE    1 
ATOM   3123  C  CZ    . ARG E 1 52  ? -43.356 -37.724 60.075 1.00 110.45 ? 52   ARG E CZ    1 
ATOM   3124  N  NH1   . ARG E 1 52  ? -42.649 -38.030 58.986 1.00 110.17 ? 52   ARG E NH1   1 
ATOM   3125  N  NH2   . ARG E 1 52  ? -42.832 -37.926 61.282 1.00 109.96 ? 52   ARG E NH2   1 
ATOM   3126  N  N     . ARG E 1 53  ? -46.360 -32.989 54.849 1.00 105.75 ? 53   ARG E N     1 
ATOM   3127  C  CA    . ARG E 1 53  ? -47.289 -32.587 53.803 1.00 105.89 ? 53   ARG E CA    1 
ATOM   3128  C  C     . ARG E 1 53  ? -46.612 -31.842 52.653 1.00 105.92 ? 53   ARG E C     1 
ATOM   3129  O  O     . ARG E 1 53  ? -46.906 -32.109 51.473 1.00 106.10 ? 53   ARG E O     1 
ATOM   3130  C  CB    . ARG E 1 53  ? -48.396 -31.731 54.420 1.00 105.91 ? 53   ARG E CB    1 
ATOM   3131  C  CG    . ARG E 1 53  ? -49.085 -30.776 53.475 1.00 106.23 ? 53   ARG E CG    1 
ATOM   3132  C  CD    . ARG E 1 53  ? -49.963 -29.852 54.268 1.00 107.40 ? 53   ARG E CD    1 
ATOM   3133  N  NE    . ARG E 1 53  ? -50.815 -29.017 53.426 1.00 107.96 ? 53   ARG E NE    1 
ATOM   3134  C  CZ    . ARG E 1 53  ? -51.870 -28.348 53.880 1.00 108.12 ? 53   ARG E CZ    1 
ATOM   3135  N  NH1   . ARG E 1 53  ? -52.203 -28.429 55.165 1.00 107.97 ? 53   ARG E NH1   1 
ATOM   3136  N  NH2   . ARG E 1 53  ? -52.597 -27.603 53.053 1.00 107.81 ? 53   ARG E NH2   1 
ATOM   3137  N  N     . TYR E 1 54  ? -45.712 -30.920 53.002 1.00 105.62 ? 54   TYR E N     1 
ATOM   3138  C  CA    . TYR E 1 54  ? -45.082 -30.034 52.026 1.00 105.29 ? 54   TYR E CA    1 
ATOM   3139  C  C     . TYR E 1 54  ? -43.941 -30.678 51.272 1.00 104.90 ? 54   TYR E C     1 
ATOM   3140  O  O     . TYR E 1 54  ? -43.664 -30.316 50.130 1.00 104.87 ? 54   TYR E O     1 
ATOM   3141  C  CB    . TYR E 1 54  ? -44.644 -28.735 52.681 1.00 105.52 ? 54   TYR E CB    1 
ATOM   3142  C  CG    . TYR E 1 54  ? -45.826 -27.863 52.976 1.00 106.31 ? 54   TYR E CG    1 
ATOM   3143  C  CD1   . TYR E 1 54  ? -46.175 -27.539 54.286 1.00 107.19 ? 54   TYR E CD1   1 
ATOM   3144  C  CD2   . TYR E 1 54  ? -46.632 -27.394 51.940 1.00 107.10 ? 54   TYR E CD2   1 
ATOM   3145  C  CE1   . TYR E 1 54  ? -47.294 -26.741 54.554 1.00 107.43 ? 54   TYR E CE1   1 
ATOM   3146  C  CE2   . TYR E 1 54  ? -47.745 -26.599 52.191 1.00 107.25 ? 54   TYR E CE2   1 
ATOM   3147  C  CZ    . TYR E 1 54  ? -48.073 -26.276 53.495 1.00 107.07 ? 54   TYR E CZ    1 
ATOM   3148  O  OH    . TYR E 1 54  ? -49.179 -25.489 53.728 1.00 106.97 ? 54   TYR E OH    1 
ATOM   3149  N  N     . GLN E 1 55  ? -43.293 -31.641 51.907 1.00 104.49 ? 55   GLN E N     1 
ATOM   3150  C  CA    . GLN E 1 55  ? -42.220 -32.373 51.258 1.00 104.28 ? 55   GLN E CA    1 
ATOM   3151  C  C     . GLN E 1 55  ? -42.801 -33.416 50.311 1.00 104.23 ? 55   GLN E C     1 
ATOM   3152  O  O     . GLN E 1 55  ? -42.112 -33.894 49.402 1.00 104.47 ? 55   GLN E O     1 
ATOM   3153  C  CB    . GLN E 1 55  ? -41.296 -33.002 52.298 1.00 104.13 ? 55   GLN E CB    1 
ATOM   3154  C  CG    . GLN E 1 55  ? -40.782 -31.991 53.307 1.00 103.51 ? 55   GLN E CG    1 
ATOM   3155  C  CD    . GLN E 1 55  ? -39.773 -32.568 54.262 1.00 103.40 ? 55   GLN E CD    1 
ATOM   3156  O  OE1   . GLN E 1 55  ? -39.869 -33.723 54.672 1.00 103.98 ? 55   GLN E OE1   1 
ATOM   3157  N  NE2   . GLN E 1 55  ? -38.791 -31.759 54.632 1.00 103.74 ? 55   GLN E NE2   1 
ATOM   3158  N  N     . LYS E 1 56  ? -44.072 -33.754 50.522 1.00 103.81 ? 56   LYS E N     1 
ATOM   3159  C  CA    . LYS E 1 56  ? -44.787 -34.651 49.620 1.00 103.71 ? 56   LYS E CA    1 
ATOM   3160  C  C     . LYS E 1 56  ? -45.347 -33.935 48.396 1.00 103.24 ? 56   LYS E C     1 
ATOM   3161  O  O     . LYS E 1 56  ? -45.556 -34.553 47.357 1.00 102.99 ? 56   LYS E O     1 
ATOM   3162  C  CB    . LYS E 1 56  ? -45.892 -35.421 50.355 1.00 103.89 ? 56   LYS E CB    1 
ATOM   3163  C  CG    . LYS E 1 56  ? -45.495 -36.860 50.663 1.00 104.86 ? 56   LYS E CG    1 
ATOM   3164  C  CD    . LYS E 1 56  ? -46.152 -37.390 51.930 1.00 106.39 ? 56   LYS E CD    1 
ATOM   3165  C  CE    . LYS E 1 56  ? -45.130 -38.114 52.823 1.00 106.30 ? 56   LYS E CE    1 
ATOM   3166  N  NZ    . LYS E 1 56  ? -44.156 -37.159 53.439 1.00 105.37 ? 56   LYS E NZ    1 
ATOM   3167  N  N     . SER E 1 57  ? -45.575 -32.632 48.524 1.00 102.83 ? 57   SER E N     1 
ATOM   3168  C  CA    . SER E 1 57  ? -46.162 -31.848 47.450 1.00 102.46 ? 57   SER E CA    1 
ATOM   3169  C  C     . SER E 1 57  ? -45.106 -31.024 46.727 1.00 102.31 ? 57   SER E C     1 
ATOM   3170  O  O     . SER E 1 57  ? -44.042 -30.741 47.281 1.00 102.32 ? 57   SER E O     1 
ATOM   3171  C  CB    . SER E 1 57  ? -47.254 -30.931 48.008 1.00 102.50 ? 57   SER E CB    1 
ATOM   3172  O  OG    . SER E 1 57  ? -46.716 -29.710 48.485 1.00 102.47 ? 57   SER E OG    1 
ATOM   3173  N  N     . THR E 1 58  ? -45.415 -30.626 45.496 1.00 102.09 ? 58   THR E N     1 
ATOM   3174  C  CA    . THR E 1 58  ? -44.491 -29.830 44.689 1.00 101.94 ? 58   THR E CA    1 
ATOM   3175  C  C     . THR E 1 58  ? -45.048 -28.455 44.351 1.00 101.77 ? 58   THR E C     1 
ATOM   3176  O  O     . THR E 1 58  ? -44.421 -27.689 43.620 1.00 101.78 ? 58   THR E O     1 
ATOM   3177  C  CB    . THR E 1 58  ? -44.127 -30.541 43.379 1.00 101.91 ? 58   THR E CB    1 
ATOM   3178  O  OG1   . THR E 1 58  ? -45.328 -30.897 42.693 1.00 102.76 ? 58   THR E OG1   1 
ATOM   3179  C  CG2   . THR E 1 58  ? -43.320 -31.793 43.652 1.00 101.36 ? 58   THR E CG2   1 
ATOM   3180  N  N     . GLU E 1 59  ? -46.221 -28.143 44.891 1.00 101.82 ? 59   GLU E N     1 
ATOM   3181  C  CA    . GLU E 1 59  ? -46.887 -26.869 44.607 1.00 101.84 ? 59   GLU E CA    1 
ATOM   3182  C  C     . GLU E 1 59  ? -46.166 -25.676 45.234 1.00 101.68 ? 59   GLU E C     1 
ATOM   3183  O  O     . GLU E 1 59  ? -45.541 -25.809 46.289 1.00 101.81 ? 59   GLU E O     1 
ATOM   3184  C  CB    . GLU E 1 59  ? -48.377 -26.909 44.995 1.00 101.79 ? 59   GLU E CB    1 
ATOM   3185  C  CG    . GLU E 1 59  ? -48.797 -28.062 45.918 1.00 102.53 ? 59   GLU E CG    1 
ATOM   3186  C  CD    . GLU E 1 59  ? -48.982 -27.643 47.375 1.00 103.23 ? 59   GLU E CD    1 
ATOM   3187  O  OE1   . GLU E 1 59  ? -48.894 -26.435 47.674 1.00 103.72 ? 59   GLU E OE1   1 
ATOM   3188  O  OE2   . GLU E 1 59  ? -49.237 -28.526 48.224 1.00 103.05 ? 59   GLU E OE2   1 
ATOM   3189  N  N     . LEU E 1 60  ? -46.242 -24.526 44.566 1.00 101.42 ? 60   LEU E N     1 
ATOM   3190  C  CA    . LEU E 1 60  ? -45.584 -23.303 45.030 1.00 101.26 ? 60   LEU E CA    1 
ATOM   3191  C  C     . LEU E 1 60  ? -46.282 -22.731 46.244 1.00 101.29 ? 60   LEU E C     1 
ATOM   3192  O  O     . LEU E 1 60  ? -47.495 -22.874 46.395 1.00 101.26 ? 60   LEU E O     1 
ATOM   3193  C  CB    . LEU E 1 60  ? -45.513 -22.259 43.916 1.00 101.25 ? 60   LEU E CB    1 
ATOM   3194  C  CG    . LEU E 1 60  ? -44.722 -22.671 42.670 1.00 101.23 ? 60   LEU E CG    1 
ATOM   3195  C  CD1   . LEU E 1 60  ? -44.593 -21.505 41.710 1.00 100.83 ? 60   LEU E CD1   1 
ATOM   3196  C  CD2   . LEU E 1 60  ? -43.344 -23.243 43.034 1.00 101.17 ? 60   LEU E CD2   1 
ATOM   3197  N  N     . LEU E 1 61  ? -45.513 -22.077 47.105 1.00 101.36 ? 61   LEU E N     1 
ATOM   3198  C  CA    . LEU E 1 61  ? -45.998 -21.765 48.446 1.00 101.55 ? 61   LEU E CA    1 
ATOM   3199  C  C     . LEU E 1 61  ? -46.273 -20.290 48.701 1.00 101.78 ? 61   LEU E C     1 
ATOM   3200  O  O     . LEU E 1 61  ? -47.139 -19.956 49.504 1.00 101.98 ? 61   LEU E O     1 
ATOM   3201  C  CB    . LEU E 1 61  ? -45.079 -22.376 49.516 1.00 101.34 ? 61   LEU E CB    1 
ATOM   3202  C  CG    . LEU E 1 61  ? -44.820 -23.883 49.371 1.00 100.78 ? 61   LEU E CG    1 
ATOM   3203  C  CD1   . LEU E 1 61  ? -43.836 -24.373 50.406 1.00 100.55 ? 61   LEU E CD1   1 
ATOM   3204  C  CD2   . LEU E 1 61  ? -46.110 -24.694 49.438 1.00 100.39 ? 61   LEU E CD2   1 
ATOM   3205  N  N     . ILE E 1 62  ? -45.545 -19.410 48.026 1.00 102.12 ? 62   ILE E N     1 
ATOM   3206  C  CA    . ILE E 1 62  ? -45.902 -17.995 48.009 1.00 102.64 ? 62   ILE E CA    1 
ATOM   3207  C  C     . ILE E 1 62  ? -46.936 -17.828 46.916 1.00 103.17 ? 62   ILE E C     1 
ATOM   3208  O  O     . ILE E 1 62  ? -46.686 -18.221 45.773 1.00 103.28 ? 62   ILE E O     1 
ATOM   3209  C  CB    . ILE E 1 62  ? -44.708 -17.085 47.656 1.00 102.57 ? 62   ILE E CB    1 
ATOM   3210  C  CG1   . ILE E 1 62  ? -43.592 -17.206 48.698 1.00 102.40 ? 62   ILE E CG1   1 
ATOM   3211  C  CG2   . ILE E 1 62  ? -45.179 -15.636 47.494 1.00 102.13 ? 62   ILE E CG2   1 
ATOM   3212  C  CD1   . ILE E 1 62  ? -42.235 -16.755 48.195 1.00 101.77 ? 62   ILE E CD1   1 
ATOM   3213  N  N     . ARG E 1 63  ? -48.091 -17.254 47.249 1.00 103.74 ? 63   ARG E N     1 
ATOM   3214  C  CA    . ARG E 1 63  ? -49.134 -17.047 46.243 1.00 104.16 ? 63   ARG E CA    1 
ATOM   3215  C  C     . ARG E 1 63  ? -48.691 -16.033 45.188 1.00 104.02 ? 63   ARG E C     1 
ATOM   3216  O  O     . ARG E 1 63  ? -48.075 -15.012 45.505 1.00 104.06 ? 63   ARG E O     1 
ATOM   3217  C  CB    . ARG E 1 63  ? -50.454 -16.645 46.882 1.00 104.46 ? 63   ARG E CB    1 
ATOM   3218  C  CG    . ARG E 1 63  ? -51.145 -17.770 47.646 1.00 105.66 ? 63   ARG E CG    1 
ATOM   3219  C  CD    . ARG E 1 63  ? -52.133 -17.200 48.650 1.00 108.07 ? 63   ARG E CD    1 
ATOM   3220  N  NE    . ARG E 1 63  ? -51.834 -15.802 48.983 1.00 111.00 ? 63   ARG E NE    1 
ATOM   3221  C  CZ    . ARG E 1 63  ? -50.801 -15.388 49.723 1.00 113.10 ? 63   ARG E CZ    1 
ATOM   3222  N  NH1   . ARG E 1 63  ? -49.929 -16.259 50.227 1.00 113.92 ? 63   ARG E NH1   1 
ATOM   3223  N  NH2   . ARG E 1 63  ? -50.632 -14.089 49.957 1.00 113.89 ? 63   ARG E NH2   1 
ATOM   3224  N  N     . LYS E 1 64  ? -49.031 -16.337 43.940 1.00 103.81 ? 64   LYS E N     1 
ATOM   3225  C  CA    . LYS E 1 64  ? -48.420 -15.740 42.755 1.00 103.57 ? 64   LYS E CA    1 
ATOM   3226  C  C     . LYS E 1 64  ? -48.401 -14.219 42.688 1.00 103.31 ? 64   LYS E C     1 
ATOM   3227  O  O     . LYS E 1 64  ? -47.418 -13.639 42.238 1.00 103.60 ? 64   LYS E O     1 
ATOM   3228  C  CB    . LYS E 1 64  ? -49.068 -16.311 41.488 1.00 103.56 ? 64   LYS E CB    1 
ATOM   3229  C  CG    . LYS E 1 64  ? -49.121 -17.845 41.462 1.00 103.92 ? 64   LYS E CG    1 
ATOM   3230  C  CD    . LYS E 1 64  ? -49.506 -18.400 40.084 1.00 103.89 ? 64   LYS E CD    1 
ATOM   3231  C  CE    . LYS E 1 64  ? -49.485 -19.933 40.074 1.00 104.00 ? 64   LYS E CE    1 
ATOM   3232  N  NZ    . LYS E 1 64  ? -49.777 -20.503 38.728 1.00 103.69 ? 64   LYS E NZ    1 
ATOM   3233  N  N     . LEU E 1 65  ? -49.467 -13.571 43.139 1.00 103.04 ? 65   LEU E N     1 
ATOM   3234  C  CA    . LEU E 1 65  ? -49.640 -12.147 42.855 1.00 102.80 ? 65   LEU E CA    1 
ATOM   3235  C  C     . LEU E 1 65  ? -48.872 -11.181 43.758 1.00 102.68 ? 65   LEU E C     1 
ATOM   3236  O  O     . LEU E 1 65  ? -48.336 -10.190 43.253 1.00 102.94 ? 65   LEU E O     1 
ATOM   3237  C  CB    . LEU E 1 65  ? -51.120 -11.759 42.788 1.00 102.89 ? 65   LEU E CB    1 
ATOM   3238  C  CG    . LEU E 1 65  ? -51.365 -10.648 41.769 1.00 102.70 ? 65   LEU E CG    1 
ATOM   3239  C  CD1   . LEU E 1 65  ? -51.952 -11.237 40.495 1.00 102.37 ? 65   LEU E CD1   1 
ATOM   3240  C  CD2   . LEU E 1 65  ? -52.264 -9.569  42.349 1.00 102.61 ? 65   LEU E CD2   1 
ATOM   3241  N  N     . PRO E 1 66  ? -48.828 -11.434 45.084 1.00 102.56 ? 66   PRO E N     1 
ATOM   3242  C  CA    . PRO E 1 66  ? -47.943 -10.603 45.911 1.00 102.62 ? 66   PRO E CA    1 
ATOM   3243  C  C     . PRO E 1 66  ? -46.528 -10.697 45.365 1.00 102.69 ? 66   PRO E C     1 
ATOM   3244  O  O     . PRO E 1 66  ? -45.857 -9.674  45.166 1.00 102.59 ? 66   PRO E O     1 
ATOM   3245  C  CB    . PRO E 1 66  ? -47.993 -11.273 47.285 1.00 102.53 ? 66   PRO E CB    1 
ATOM   3246  C  CG    . PRO E 1 66  ? -49.226 -12.077 47.288 1.00 102.78 ? 66   PRO E CG    1 
ATOM   3247  C  CD    . PRO E 1 66  ? -49.548 -12.443 45.881 1.00 102.60 ? 66   PRO E CD    1 
ATOM   3248  N  N     . PHE E 1 67  ? -46.113 -11.936 45.100 1.00 102.72 ? 67   PHE E N     1 
ATOM   3249  C  CA    . PHE E 1 67  ? -44.827 -12.227 44.505 1.00 102.94 ? 67   PHE E CA    1 
ATOM   3250  C  C     . PHE E 1 67  ? -44.669 -11.477 43.195 1.00 103.00 ? 67   PHE E C     1 
ATOM   3251  O  O     . PHE E 1 67  ? -43.675 -10.767 42.983 1.00 103.06 ? 67   PHE E O     1 
ATOM   3252  C  CB    . PHE E 1 67  ? -44.667 -13.728 44.264 1.00 102.96 ? 67   PHE E CB    1 
ATOM   3253  C  CG    . PHE E 1 67  ? -43.280 -14.116 43.844 1.00 103.46 ? 67   PHE E CG    1 
ATOM   3254  C  CD1   . PHE E 1 67  ? -42.294 -14.354 44.796 1.00 103.61 ? 67   PHE E CD1   1 
ATOM   3255  C  CD2   . PHE E 1 67  ? -42.947 -14.216 42.497 1.00 103.98 ? 67   PHE E CD2   1 
ATOM   3256  C  CE1   . PHE E 1 67  ? -41.003 -14.700 44.414 1.00 103.39 ? 67   PHE E CE1   1 
ATOM   3257  C  CE2   . PHE E 1 67  ? -41.659 -14.560 42.107 1.00 103.81 ? 67   PHE E CE2   1 
ATOM   3258  C  CZ    . PHE E 1 67  ? -40.685 -14.802 43.070 1.00 103.45 ? 67   PHE E CZ    1 
ATOM   3259  N  N     . GLN E 1 68  ? -45.657 -11.633 42.322 1.00 102.88 ? 68   GLN E N     1 
ATOM   3260  C  CA    . GLN E 1 68  ? -45.622 -10.967 41.036 1.00 102.97 ? 68   GLN E CA    1 
ATOM   3261  C  C     . GLN E 1 68  ? -45.424 -9.465  41.211 1.00 102.78 ? 68   GLN E C     1 
ATOM   3262  O  O     . GLN E 1 68  ? -44.596 -8.868  40.522 1.00 102.73 ? 68   GLN E O     1 
ATOM   3263  C  CB    . GLN E 1 68  ? -46.889 -11.249 40.234 1.00 103.16 ? 68   GLN E CB    1 
ATOM   3264  C  CG    . GLN E 1 68  ? -46.690 -11.098 38.731 1.00 103.51 ? 68   GLN E CG    1 
ATOM   3265  C  CD    . GLN E 1 68  ? -47.934 -10.622 38.028 1.00 104.06 ? 68   GLN E CD    1 
ATOM   3266  O  OE1   . GLN E 1 68  ? -49.055 -10.915 38.456 1.00 104.70 ? 68   GLN E OE1   1 
ATOM   3267  N  NE2   . GLN E 1 68  ? -47.750 -9.874  36.940 1.00 104.02 ? 68   GLN E NE2   1 
ATOM   3268  N  N     . ARG E 1 69  ? -46.162 -8.862  42.143 1.00 102.40 ? 69   ARG E N     1 
ATOM   3269  C  CA    . ARG E 1 69  ? -46.007 -7.434  42.392 1.00 102.24 ? 69   ARG E CA    1 
ATOM   3270  C  C     . ARG E 1 69  ? -44.662 -7.081  43.011 1.00 101.75 ? 69   ARG E C     1 
ATOM   3271  O  O     . ARG E 1 69  ? -44.127 -5.998  42.767 1.00 101.59 ? 69   ARG E O     1 
ATOM   3272  C  CB    . ARG E 1 69  ? -47.171 -6.863  43.203 1.00 102.32 ? 69   ARG E CB    1 
ATOM   3273  C  CG    . ARG E 1 69  ? -48.128 -6.024  42.342 1.00 102.76 ? 69   ARG E CG    1 
ATOM   3274  C  CD    . ARG E 1 69  ? -49.315 -5.473  43.124 1.00 102.60 ? 69   ARG E CD    1 
ATOM   3275  N  NE    . ARG E 1 69  ? -50.232 -6.520  43.584 1.00 102.54 ? 69   ARG E NE    1 
ATOM   3276  C  CZ    . ARG E 1 69  ? -50.228 -7.037  44.812 1.00 102.26 ? 69   ARG E CZ    1 
ATOM   3277  N  NH1   . ARG E 1 69  ? -49.351 -6.616  45.719 1.00 101.72 ? 69   ARG E NH1   1 
ATOM   3278  N  NH2   . ARG E 1 69  ? -51.102 -7.981  45.133 1.00 102.15 ? 69   ARG E NH2   1 
ATOM   3279  N  N     . LEU E 1 70  ? -44.106 -7.998  43.791 1.00 101.39 ? 70   LEU E N     1 
ATOM   3280  C  CA    . LEU E 1 70  ? -42.776 -7.783  44.340 1.00 101.33 ? 70   LEU E CA    1 
ATOM   3281  C  C     . LEU E 1 70  ? -41.720 -7.749  43.233 1.00 101.42 ? 70   LEU E C     1 
ATOM   3282  O  O     . LEU E 1 70  ? -40.802 -6.917  43.258 1.00 101.43 ? 70   LEU E O     1 
ATOM   3283  C  CB    . LEU E 1 70  ? -42.429 -8.847  45.382 1.00 101.13 ? 70   LEU E CB    1 
ATOM   3284  C  CG    . LEU E 1 70  ? -40.984 -8.841  45.899 1.00 100.52 ? 70   LEU E CG    1 
ATOM   3285  C  CD1   . LEU E 1 70  ? -40.559 -7.491  46.477 1.00 98.96  ? 70   LEU E CD1   1 
ATOM   3286  C  CD2   . LEU E 1 70  ? -40.819 -9.941  46.921 1.00 100.58 ? 70   LEU E CD2   1 
ATOM   3287  N  N     . VAL E 1 71  ? -41.866 -8.652  42.266 1.00 101.41 ? 71   VAL E N     1 
ATOM   3288  C  CA    . VAL E 1 71  ? -40.934 -8.760  41.144 1.00 101.22 ? 71   VAL E CA    1 
ATOM   3289  C  C     . VAL E 1 71  ? -40.924 -7.488  40.300 1.00 101.16 ? 71   VAL E C     1 
ATOM   3290  O  O     . VAL E 1 71  ? -39.870 -6.985  39.938 1.00 100.97 ? 71   VAL E O     1 
ATOM   3291  C  CB    . VAL E 1 71  ? -41.273 -9.974  40.261 1.00 101.23 ? 71   VAL E CB    1 
ATOM   3292  C  CG1   . VAL E 1 71  ? -40.202 -10.185 39.216 1.00 101.26 ? 71   VAL E CG1   1 
ATOM   3293  C  CG2   . VAL E 1 71  ? -41.424 -11.220 41.113 1.00 100.80 ? 71   VAL E CG2   1 
ATOM   3294  N  N     . ARG E 1 72  ? -42.112 -6.970  40.012 1.00 101.62 ? 72   ARG E N     1 
ATOM   3295  C  CA    . ARG E 1 72  ? -42.277 -5.753  39.212 1.00 101.90 ? 72   ARG E CA    1 
ATOM   3296  C  C     . ARG E 1 72  ? -41.677 -4.527  39.896 1.00 101.94 ? 72   ARG E C     1 
ATOM   3297  O  O     . ARG E 1 72  ? -41.004 -3.716  39.249 1.00 101.91 ? 72   ARG E O     1 
ATOM   3298  C  CB    . ARG E 1 72  ? -43.756 -5.528  38.901 1.00 101.93 ? 72   ARG E CB    1 
ATOM   3299  C  CG    . ARG E 1 72  ? -44.400 -6.726  38.228 1.00 102.32 ? 72   ARG E CG    1 
ATOM   3300  C  CD    . ARG E 1 72  ? -45.724 -6.391  37.579 1.00 103.21 ? 72   ARG E CD    1 
ATOM   3301  N  NE    . ARG E 1 72  ? -46.017 -7.321  36.491 1.00 103.92 ? 72   ARG E NE    1 
ATOM   3302  C  CZ    . ARG E 1 72  ? -45.575 -7.184  35.242 1.00 104.29 ? 72   ARG E CZ    1 
ATOM   3303  N  NH1   . ARG E 1 72  ? -44.816 -6.147  34.903 1.00 103.89 ? 72   ARG E NH1   1 
ATOM   3304  N  NH2   . ARG E 1 72  ? -45.895 -8.088  34.326 1.00 104.67 ? 72   ARG E NH2   1 
ATOM   3305  N  N     . GLU E 1 73  ? -41.918 -4.410  41.202 1.00 101.96 ? 73   GLU E N     1 
ATOM   3306  C  CA    . GLU E 1 73  ? -41.305 -3.371  42.015 1.00 102.15 ? 73   GLU E CA    1 
ATOM   3307  C  C     . GLU E 1 73  ? -39.785 -3.384  41.841 1.00 102.32 ? 73   GLU E C     1 
ATOM   3308  O  O     . GLU E 1 73  ? -39.202 -2.394  41.388 1.00 102.37 ? 73   GLU E O     1 
ATOM   3309  C  CB    . GLU E 1 73  ? -41.669 -3.544  43.493 1.00 102.08 ? 73   GLU E CB    1 
ATOM   3310  C  CG    . GLU E 1 73  ? -41.480 -2.269  44.305 1.00 102.41 ? 73   GLU E CG    1 
ATOM   3311  C  CD    . GLU E 1 73  ? -41.255 -2.509  45.785 1.00 102.89 ? 73   GLU E CD    1 
ATOM   3312  O  OE1   . GLU E 1 73  ? -41.848 -3.454  46.350 1.00 102.39 ? 73   GLU E OE1   1 
ATOM   3313  O  OE2   . GLU E 1 73  ? -40.482 -1.728  46.387 1.00 103.99 ? 73   GLU E OE2   1 
ATOM   3314  N  N     . ILE E 1 74  ? -39.163 -4.518  42.169 1.00 102.49 ? 74   ILE E N     1 
ATOM   3315  C  CA    . ILE E 1 74  ? -37.701 -4.655  42.175 1.00 102.68 ? 74   ILE E CA    1 
ATOM   3316  C  C     . ILE E 1 74  ? -37.059 -4.330  40.825 1.00 102.86 ? 74   ILE E C     1 
ATOM   3317  O  O     . ILE E 1 74  ? -35.965 -3.749  40.772 1.00 102.87 ? 74   ILE E O     1 
ATOM   3318  C  CB    . ILE E 1 74  ? -37.265 -6.064  42.621 1.00 102.54 ? 74   ILE E CB    1 
ATOM   3319  C  CG1   . ILE E 1 74  ? -37.647 -6.297  44.082 1.00 102.57 ? 74   ILE E CG1   1 
ATOM   3320  C  CG2   . ILE E 1 74  ? -35.762 -6.245  42.435 1.00 102.93 ? 74   ILE E CG2   1 
ATOM   3321  C  CD1   . ILE E 1 74  ? -37.092 -7.583  44.684 1.00 102.76 ? 74   ILE E CD1   1 
ATOM   3322  N  N     . ALA E 1 75  ? -37.750 -4.703  39.749 1.00 102.97 ? 75   ALA E N     1 
ATOM   3323  C  CA    . ALA E 1 75  ? -37.261 -4.506  38.387 1.00 103.11 ? 75   ALA E CA    1 
ATOM   3324  C  C     . ALA E 1 75  ? -37.371 -3.057  37.925 1.00 103.32 ? 75   ALA E C     1 
ATOM   3325  O  O     . ALA E 1 75  ? -36.462 -2.552  37.256 1.00 103.22 ? 75   ALA E O     1 
ATOM   3326  C  CB    . ALA E 1 75  ? -37.991 -5.420  37.427 1.00 103.12 ? 75   ALA E CB    1 
ATOM   3327  N  N     . GLN E 1 76  ? -38.477 -2.396  38.279 1.00 103.52 ? 76   GLN E N     1 
ATOM   3328  C  CA    . GLN E 1 76  ? -38.677 -0.990  37.921 1.00 103.72 ? 76   GLN E CA    1 
ATOM   3329  C  C     . GLN E 1 76  ? -37.511 -0.140  38.416 1.00 103.73 ? 76   GLN E C     1 
ATOM   3330  O  O     . GLN E 1 76  ? -37.106 0.812   37.749 1.00 103.68 ? 76   GLN E O     1 
ATOM   3331  C  CB    . GLN E 1 76  ? -40.022 -0.466  38.445 1.00 103.81 ? 76   GLN E CB    1 
ATOM   3332  C  CG    . GLN E 1 76  ? -40.420 0.967   37.994 1.00 104.19 ? 76   GLN E CG    1 
ATOM   3333  C  CD    . GLN E 1 76  ? -40.445 1.196   36.466 1.00 105.00 ? 76   GLN E CD    1 
ATOM   3334  O  OE1   . GLN E 1 76  ? -40.329 0.262   35.662 1.00 105.75 ? 76   GLN E OE1   1 
ATOM   3335  N  NE2   . GLN E 1 76  ? -40.601 2.458   36.071 1.00 104.58 ? 76   GLN E NE2   1 
ATOM   3336  N  N     . ASP E 1 77  ? -36.960 -0.518  39.569 1.00 103.90 ? 77   ASP E N     1 
ATOM   3337  C  CA    . ASP E 1 77  ? -35.765 0.116   40.122 1.00 104.04 ? 77   ASP E CA    1 
ATOM   3338  C  C     . ASP E 1 77  ? -34.566 0.032   39.177 1.00 103.90 ? 77   ASP E C     1 
ATOM   3339  O  O     . ASP E 1 77  ? -33.707 0.906   39.191 1.00 104.08 ? 77   ASP E O     1 
ATOM   3340  C  CB    . ASP E 1 77  ? -35.417 -0.482  41.493 1.00 104.13 ? 77   ASP E CB    1 
ATOM   3341  C  CG    . ASP E 1 77  ? -36.419 -0.087  42.590 1.00 105.25 ? 77   ASP E CG    1 
ATOM   3342  O  OD1   . ASP E 1 77  ? -37.482 0.502   42.273 1.00 106.16 ? 77   ASP E OD1   1 
ATOM   3343  O  OD2   . ASP E 1 77  ? -36.144 -0.370  43.782 1.00 106.13 ? 77   ASP E OD2   1 
ATOM   3344  N  N     . PHE E 1 78  ? -34.515 -1.004  38.348 1.00 103.79 ? 78   PHE E N     1 
ATOM   3345  C  CA    . PHE E 1 78  ? -33.401 -1.170  37.417 1.00 103.74 ? 78   PHE E CA    1 
ATOM   3346  C  C     . PHE E 1 78  ? -33.681 -0.572  36.048 1.00 104.04 ? 78   PHE E C     1 
ATOM   3347  O  O     . PHE E 1 78  ? -32.781 -0.023  35.419 1.00 103.89 ? 78   PHE E O     1 
ATOM   3348  C  CB    . PHE E 1 78  ? -33.026 -2.643  37.267 1.00 103.60 ? 78   PHE E CB    1 
ATOM   3349  C  CG    . PHE E 1 78  ? -32.385 -3.237  38.488 1.00 102.92 ? 78   PHE E CG    1 
ATOM   3350  C  CD1   . PHE E 1 78  ? -31.045 -3.010  38.764 1.00 102.22 ? 78   PHE E CD1   1 
ATOM   3351  C  CD2   . PHE E 1 78  ? -33.121 -4.035  39.352 1.00 102.15 ? 78   PHE E CD2   1 
ATOM   3352  C  CE1   . PHE E 1 78  ? -30.451 -3.560  39.888 1.00 102.07 ? 78   PHE E CE1   1 
ATOM   3353  C  CE2   . PHE E 1 78  ? -32.537 -4.584  40.476 1.00 102.10 ? 78   PHE E CE2   1 
ATOM   3354  C  CZ    . PHE E 1 78  ? -31.195 -4.349  40.742 1.00 102.42 ? 78   PHE E CZ    1 
ATOM   3355  N  N     . LYS E 1 79  ? -34.918 -0.703  35.578 1.00 104.61 ? 79   LYS E N     1 
ATOM   3356  C  CA    . LYS E 1 79  ? -35.311 -0.111  34.302 1.00 105.29 ? 79   LYS E CA    1 
ATOM   3357  C  C     . LYS E 1 79  ? -36.809 0.133   34.197 1.00 105.54 ? 79   LYS E C     1 
ATOM   3358  O  O     . LYS E 1 79  ? -37.623 -0.684  34.637 1.00 105.43 ? 79   LYS E O     1 
ATOM   3359  C  CB    . LYS E 1 79  ? -34.826 -0.958  33.128 1.00 105.49 ? 79   LYS E CB    1 
ATOM   3360  C  CG    . LYS E 1 79  ? -34.513 -0.150  31.882 1.00 106.57 ? 79   LYS E CG    1 
ATOM   3361  C  CD    . LYS E 1 79  ? -35.649 -0.171  30.858 1.00 108.47 ? 79   LYS E CD    1 
ATOM   3362  C  CE    . LYS E 1 79  ? -35.438 0.917   29.798 1.00 109.30 ? 79   LYS E CE    1 
ATOM   3363  N  NZ    . LYS E 1 79  ? -36.275 0.716   28.575 1.00 109.78 ? 79   LYS E NZ    1 
ATOM   3364  N  N     . THR E 1 80  ? -37.150 1.262   33.581 1.00 106.13 ? 80   THR E N     1 
ATOM   3365  C  CA    . THR E 1 80  ? -38.535 1.748   33.487 1.00 106.51 ? 80   THR E CA    1 
ATOM   3366  C  C     . THR E 1 80  ? -39.331 1.165   32.316 1.00 106.51 ? 80   THR E C     1 
ATOM   3367  O  O     . THR E 1 80  ? -38.757 0.788   31.287 1.00 106.33 ? 80   THR E O     1 
ATOM   3368  C  CB    . THR E 1 80  ? -38.561 3.282   33.376 1.00 106.51 ? 80   THR E CB    1 
ATOM   3369  O  OG1   . THR E 1 80  ? -37.714 3.683   32.293 1.00 107.10 ? 80   THR E OG1   1 
ATOM   3370  C  CG2   . THR E 1 80  ? -38.054 3.928   34.660 1.00 106.55 ? 80   THR E CG2   1 
ATOM   3371  N  N     . ASP E 1 81  ? -40.655 1.103   32.492 1.00 106.75 ? 81   ASP E N     1 
ATOM   3372  C  CA    . ASP E 1 81  ? -41.601 0.714   31.428 1.00 106.98 ? 81   ASP E CA    1 
ATOM   3373  C  C     . ASP E 1 81  ? -41.242 -0.667  30.874 1.00 106.82 ? 81   ASP E C     1 
ATOM   3374  O  O     . ASP E 1 81  ? -40.784 -0.794  29.729 1.00 106.94 ? 81   ASP E O     1 
ATOM   3375  C  CB    . ASP E 1 81  ? -41.635 1.793   30.313 1.00 107.18 ? 81   ASP E CB    1 
ATOM   3376  C  CG    . ASP E 1 81  ? -42.907 1.743   29.445 1.00 107.72 ? 81   ASP E CG    1 
ATOM   3377  O  OD1   . ASP E 1 81  ? -42.818 2.146   28.264 1.00 107.76 ? 81   ASP E OD1   1 
ATOM   3378  O  OD2   . ASP E 1 81  ? -43.989 1.323   29.927 1.00 108.41 ? 81   ASP E OD2   1 
ATOM   3379  N  N     . LEU E 1 82  ? -41.428 -1.692  31.709 1.00 106.50 ? 82   LEU E N     1 
ATOM   3380  C  CA    . LEU E 1 82  ? -41.037 -3.069  31.375 1.00 106.11 ? 82   LEU E CA    1 
ATOM   3381  C  C     . LEU E 1 82  ? -42.197 -4.036  31.458 1.00 106.01 ? 82   LEU E C     1 
ATOM   3382  O  O     . LEU E 1 82  ? -43.128 -3.828  32.229 1.00 106.23 ? 82   LEU E O     1 
ATOM   3383  C  CB    . LEU E 1 82  ? -39.917 -3.569  32.297 1.00 105.89 ? 82   LEU E CB    1 
ATOM   3384  C  CG    . LEU E 1 82  ? -38.471 -3.216  31.935 1.00 105.66 ? 82   LEU E CG    1 
ATOM   3385  C  CD1   . LEU E 1 82  ? -37.552 -3.554  33.085 1.00 104.88 ? 82   LEU E CD1   1 
ATOM   3386  C  CD2   . LEU E 1 82  ? -38.022 -3.921  30.661 1.00 104.73 ? 82   LEU E CD2   1 
ATOM   3387  N  N     . ARG E 1 83  ? -42.129 -5.099  30.663 1.00 105.78 ? 83   ARG E N     1 
ATOM   3388  C  CA    . ARG E 1 83  ? -43.116 -6.176  30.715 1.00 105.49 ? 83   ARG E CA    1 
ATOM   3389  C  C     . ARG E 1 83  ? -42.437 -7.524  30.963 1.00 104.59 ? 83   ARG E C     1 
ATOM   3390  O  O     . ARG E 1 83  ? -41.312 -7.753  30.529 1.00 104.51 ? 83   ARG E O     1 
ATOM   3391  C  CB    . ARG E 1 83  ? -43.916 -6.236  29.413 1.00 105.95 ? 83   ARG E CB    1 
ATOM   3392  C  CG    . ARG E 1 83  ? -44.556 -4.924  28.993 1.00 107.81 ? 83   ARG E CG    1 
ATOM   3393  C  CD    . ARG E 1 83  ? -44.987 -4.971  27.531 1.00 110.74 ? 83   ARG E CD    1 
ATOM   3394  N  NE    . ARG E 1 83  ? -45.442 -3.665  27.056 1.00 112.43 ? 83   ARG E NE    1 
ATOM   3395  C  CZ    . ARG E 1 83  ? -46.718 -3.325  26.899 1.00 113.54 ? 83   ARG E CZ    1 
ATOM   3396  N  NH1   . ARG E 1 83  ? -47.685 -4.200  27.173 1.00 113.72 ? 83   ARG E NH1   1 
ATOM   3397  N  NH2   . ARG E 1 83  ? -47.027 -2.108  26.460 1.00 113.89 ? 83   ARG E NH2   1 
ATOM   3398  N  N     . PHE E 1 84  ? -43.133 -8.418  31.651 1.00 103.57 ? 84   PHE E N     1 
ATOM   3399  C  CA    . PHE E 1 84  ? -42.585 -9.724  31.977 1.00 102.56 ? 84   PHE E CA    1 
ATOM   3400  C  C     . PHE E 1 84  ? -43.381 -10.823 31.324 1.00 101.88 ? 84   PHE E C     1 
ATOM   3401  O  O     . PHE E 1 84  ? -44.610 -10.818 31.386 1.00 102.09 ? 84   PHE E O     1 
ATOM   3402  C  CB    . PHE E 1 84  ? -42.620 -9.936  33.487 1.00 102.56 ? 84   PHE E CB    1 
ATOM   3403  C  CG    . PHE E 1 84  ? -41.508 -9.254  34.224 1.00 102.46 ? 84   PHE E CG    1 
ATOM   3404  C  CD1   . PHE E 1 84  ? -41.547 -7.888  34.467 1.00 102.05 ? 84   PHE E CD1   1 
ATOM   3405  C  CD2   . PHE E 1 84  ? -40.422 -9.985  34.688 1.00 102.19 ? 84   PHE E CD2   1 
ATOM   3406  C  CE1   . PHE E 1 84  ? -40.519 -7.260  35.155 1.00 101.82 ? 84   PHE E CE1   1 
ATOM   3407  C  CE2   . PHE E 1 84  ? -39.392 -9.365  35.374 1.00 101.94 ? 84   PHE E CE2   1 
ATOM   3408  C  CZ    . PHE E 1 84  ? -39.442 -7.999  35.606 1.00 101.88 ? 84   PHE E CZ    1 
ATOM   3409  N  N     . GLN E 1 85  ? -42.691 -11.776 30.712 1.00 101.05 ? 85   GLN E N     1 
ATOM   3410  C  CA    . GLN E 1 85  ? -43.360 -12.996 30.279 1.00 100.43 ? 85   GLN E CA    1 
ATOM   3411  C  C     . GLN E 1 85  ? -43.868 -13.751 31.507 1.00 100.01 ? 85   GLN E C     1 
ATOM   3412  O  O     . GLN E 1 85  ? -43.177 -13.830 32.526 1.00 100.28 ? 85   GLN E O     1 
ATOM   3413  C  CB    . GLN E 1 85  ? -42.430 -13.869 29.438 1.00 100.33 ? 85   GLN E CB    1 
ATOM   3414  C  CG    . GLN E 1 85  ? -42.218 -13.334 28.033 1.00 100.33 ? 85   GLN E CG    1 
ATOM   3415  C  CD    . GLN E 1 85  ? -41.170 -14.099 27.236 1.00 100.66 ? 85   GLN E CD    1 
ATOM   3416  O  OE1   . GLN E 1 85  ? -40.340 -14.830 27.793 1.00 100.40 ? 85   GLN E OE1   1 
ATOM   3417  N  NE2   . GLN E 1 85  ? -41.197 -13.920 25.917 1.00 100.63 ? 85   GLN E NE2   1 
ATOM   3418  N  N     . SER E 1 86  ? -45.087 -14.279 31.425 1.00 99.29  ? 86   SER E N     1 
ATOM   3419  C  CA    . SER E 1 86  ? -45.668 -15.044 32.537 1.00 98.21  ? 86   SER E CA    1 
ATOM   3420  C  C     . SER E 1 86  ? -44.798 -16.242 32.908 1.00 97.36  ? 86   SER E C     1 
ATOM   3421  O  O     . SER E 1 86  ? -44.820 -16.697 34.042 1.00 97.38  ? 86   SER E O     1 
ATOM   3422  C  CB    . SER E 1 86  ? -47.087 -15.504 32.204 1.00 98.29  ? 86   SER E CB    1 
ATOM   3423  O  OG    . SER E 1 86  ? -47.090 -16.433 31.131 1.00 98.63  ? 86   SER E OG    1 
ATOM   3424  N  N     . SER E 1 87  ? -44.035 -16.748 31.947 1.00 96.41  ? 87   SER E N     1 
ATOM   3425  C  CA    . SER E 1 87  ? -43.043 -17.770 32.237 1.00 95.51  ? 87   SER E CA    1 
ATOM   3426  C  C     . SER E 1 87  ? -41.840 -17.155 32.927 1.00 94.67  ? 87   SER E C     1 
ATOM   3427  O  O     . SER E 1 87  ? -41.150 -17.839 33.671 1.00 94.58  ? 87   SER E O     1 
ATOM   3428  C  CB    . SER E 1 87  ? -42.588 -18.483 30.966 1.00 95.70  ? 87   SER E CB    1 
ATOM   3429  O  OG    . SER E 1 87  ? -41.597 -17.728 30.289 1.00 95.74  ? 87   SER E OG    1 
ATOM   3430  N  N     . ALA E 1 88  ? -41.582 -15.874 32.673 1.00 93.79  ? 88   ALA E N     1 
ATOM   3431  C  CA    . ALA E 1 88  ? -40.453 -15.193 33.302 1.00 93.41  ? 88   ALA E CA    1 
ATOM   3432  C  C     . ALA E 1 88  ? -40.674 -15.101 34.795 1.00 93.08  ? 88   ALA E C     1 
ATOM   3433  O  O     . ALA E 1 88  ? -39.745 -15.301 35.573 1.00 93.41  ? 88   ALA E O     1 
ATOM   3434  C  CB    . ALA E 1 88  ? -40.238 -13.817 32.719 1.00 93.36  ? 88   ALA E CB    1 
ATOM   3435  N  N     . VAL E 1 89  ? -41.911 -14.825 35.192 1.00 92.53  ? 89   VAL E N     1 
ATOM   3436  C  CA    . VAL E 1 89  ? -42.245 -14.726 36.608 1.00 91.84  ? 89   VAL E CA    1 
ATOM   3437  C  C     . VAL E 1 89  ? -42.232 -16.109 37.272 1.00 91.66  ? 89   VAL E C     1 
ATOM   3438  O  O     . VAL E 1 89  ? -41.714 -16.269 38.389 1.00 91.75  ? 89   VAL E O     1 
ATOM   3439  C  CB    . VAL E 1 89  ? -43.589 -13.984 36.832 1.00 91.88  ? 89   VAL E CB    1 
ATOM   3440  C  CG1   . VAL E 1 89  ? -43.831 -13.716 38.308 1.00 91.76  ? 89   VAL E CG1   1 
ATOM   3441  C  CG2   . VAL E 1 89  ? -43.608 -12.666 36.068 1.00 91.47  ? 89   VAL E CG2   1 
ATOM   3442  N  N     . MET E 1 90  ? -42.770 -17.112 36.580 1.00 91.16  ? 90   MET E N     1 
ATOM   3443  C  CA    . MET E 1 90  ? -42.772 -18.468 37.119 1.00 90.90  ? 90   MET E CA    1 
ATOM   3444  C  C     . MET E 1 90  ? -41.361 -18.952 37.350 1.00 90.30  ? 90   MET E C     1 
ATOM   3445  O  O     . MET E 1 90  ? -41.065 -19.460 38.422 1.00 90.33  ? 90   MET E O     1 
ATOM   3446  C  CB    . MET E 1 90  ? -43.544 -19.451 36.234 1.00 91.24  ? 90   MET E CB    1 
ATOM   3447  C  CG    . MET E 1 90  ? -45.014 -19.109 36.062 1.00 93.13  ? 90   MET E CG    1 
ATOM   3448  S  SD    . MET E 1 90  ? -45.619 -18.016 37.372 1.00 97.95  ? 90   MET E SD    1 
ATOM   3449  C  CE    . MET E 1 90  ? -46.022 -19.224 38.649 1.00 96.49  ? 90   MET E CE    1 
ATOM   3450  N  N     . ALA E 1 91  ? -40.496 -18.766 36.351 1.00 89.82  ? 91   ALA E N     1 
ATOM   3451  C  CA    . ALA E 1 91  ? -39.080 -19.140 36.444 1.00 89.15  ? 91   ALA E CA    1 
ATOM   3452  C  C     . ALA E 1 91  ? -38.457 -18.541 37.698 1.00 88.78  ? 91   ALA E C     1 
ATOM   3453  O  O     . ALA E 1 91  ? -37.935 -19.267 38.560 1.00 88.58  ? 91   ALA E O     1 
ATOM   3454  C  CB    . ALA E 1 91  ? -38.323 -18.693 35.204 1.00 88.96  ? 91   ALA E CB    1 
ATOM   3455  N  N     . LEU E 1 92  ? -38.550 -17.218 37.808 1.00 88.27  ? 92   LEU E N     1 
ATOM   3456  C  CA    . LEU E 1 92  ? -38.116 -16.513 39.001 1.00 87.79  ? 92   LEU E CA    1 
ATOM   3457  C  C     . LEU E 1 92  ? -38.658 -17.166 40.258 1.00 87.83  ? 92   LEU E C     1 
ATOM   3458  O  O     . LEU E 1 92  ? -37.880 -17.497 41.161 1.00 87.85  ? 92   LEU E O     1 
ATOM   3459  C  CB    . LEU E 1 92  ? -38.545 -15.058 38.943 1.00 87.49  ? 92   LEU E CB    1 
ATOM   3460  C  CG    . LEU E 1 92  ? -37.644 -14.205 38.063 1.00 87.55  ? 92   LEU E CG    1 
ATOM   3461  C  CD1   . LEU E 1 92  ? -38.356 -12.919 37.721 1.00 87.60  ? 92   LEU E CD1   1 
ATOM   3462  C  CD2   . LEU E 1 92  ? -36.307 -13.926 38.743 1.00 86.95  ? 92   LEU E CD2   1 
ATOM   3463  N  N     . GLN E 1 93  ? -39.978 -17.383 40.307 1.00 87.56  ? 93   GLN E N     1 
ATOM   3464  C  CA    . GLN E 1 93  ? -40.604 -17.958 41.497 1.00 87.28  ? 93   GLN E CA    1 
ATOM   3465  C  C     . GLN E 1 93  ? -40.062 -19.318 41.867 1.00 87.08  ? 93   GLN E C     1 
ATOM   3466  O  O     . GLN E 1 93  ? -39.762 -19.564 43.027 1.00 87.35  ? 93   GLN E O     1 
ATOM   3467  C  CB    . GLN E 1 93  ? -42.118 -18.035 41.362 1.00 87.78  ? 93   GLN E CB    1 
ATOM   3468  C  CG    . GLN E 1 93  ? -42.771 -18.630 42.599 1.00 87.52  ? 93   GLN E CG    1 
ATOM   3469  C  CD    . GLN E 1 93  ? -44.117 -18.042 42.896 1.00 86.80  ? 93   GLN E CD    1 
ATOM   3470  O  OE1   . GLN E 1 93  ? -44.455 -16.958 42.432 1.00 86.63  ? 93   GLN E OE1   1 
ATOM   3471  N  NE2   . GLN E 1 93  ? -44.896 -18.754 43.690 1.00 87.63  ? 93   GLN E NE2   1 
ATOM   3472  N  N     . GLU E 1 94  ? -39.941 -20.198 40.884 1.00 86.83  ? 94   GLU E N     1 
ATOM   3473  C  CA    . GLU E 1 94  ? -39.378 -21.518 41.113 1.00 86.93  ? 94   GLU E CA    1 
ATOM   3474  C  C     . GLU E 1 94  ? -37.960 -21.394 41.673 1.00 86.69  ? 94   GLU E C     1 
ATOM   3475  O  O     . GLU E 1 94  ? -37.620 -22.031 42.681 1.00 86.51  ? 94   GLU E O     1 
ATOM   3476  C  CB    . GLU E 1 94  ? -39.366 -22.339 39.817 1.00 87.22  ? 94   GLU E CB    1 
ATOM   3477  C  CG    . GLU E 1 94  ? -40.742 -22.664 39.224 1.00 87.79  ? 94   GLU E CG    1 
ATOM   3478  C  CD    . GLU E 1 94  ? -41.501 -23.740 39.988 1.00 89.15  ? 94   GLU E CD    1 
ATOM   3479  O  OE1   . GLU E 1 94  ? -40.863 -24.570 40.675 1.00 89.51  ? 94   GLU E OE1   1 
ATOM   3480  O  OE2   . GLU E 1 94  ? -42.749 -23.757 39.889 1.00 89.98  ? 94   GLU E OE2   1 
ATOM   3481  N  N     . ALA E 1 95  ? -37.158 -20.549 41.024 1.00 86.35  ? 95   ALA E N     1 
ATOM   3482  C  CA    . ALA E 1 95  ? -35.758 -20.339 41.392 1.00 86.25  ? 95   ALA E CA    1 
ATOM   3483  C  C     . ALA E 1 95  ? -35.610 -19.833 42.823 1.00 86.09  ? 95   ALA E C     1 
ATOM   3484  O  O     . ALA E 1 95  ? -34.730 -20.278 43.561 1.00 85.94  ? 95   ALA E O     1 
ATOM   3485  C  CB    . ALA E 1 95  ? -35.099 -19.373 40.417 1.00 86.12  ? 95   ALA E CB    1 
ATOM   3486  N  N     . SER E 1 96  ? -36.499 -18.919 43.199 1.00 86.08  ? 96   SER E N     1 
ATOM   3487  C  CA    . SER E 1 96  ? -36.461 -18.243 44.490 1.00 85.96  ? 96   SER E CA    1 
ATOM   3488  C  C     . SER E 1 96  ? -36.900 -19.161 45.606 1.00 85.97  ? 96   SER E C     1 
ATOM   3489  O  O     . SER E 1 96  ? -36.229 -19.276 46.625 1.00 86.31  ? 96   SER E O     1 
ATOM   3490  C  CB    . SER E 1 96  ? -37.358 -17.012 44.461 1.00 85.86  ? 96   SER E CB    1 
ATOM   3491  O  OG    . SER E 1 96  ? -37.114 -16.240 43.297 1.00 85.57  ? 96   SER E OG    1 
ATOM   3492  N  N     . GLU E 1 97  ? -38.031 -19.819 45.421 1.00 85.89  ? 97   GLU E N     1 
ATOM   3493  C  CA    . GLU E 1 97  ? -38.509 -20.733 46.435 1.00 85.62  ? 97   GLU E CA    1 
ATOM   3494  C  C     . GLU E 1 97  ? -37.480 -21.842 46.671 1.00 85.29  ? 97   GLU E C     1 
ATOM   3495  O  O     . GLU E 1 97  ? -36.874 -21.906 47.750 1.00 85.35  ? 97   GLU E O     1 
ATOM   3496  C  CB    . GLU E 1 97  ? -39.862 -21.294 46.048 1.00 85.76  ? 97   GLU E CB    1 
ATOM   3497  C  CG    . GLU E 1 97  ? -40.938 -20.234 45.942 1.00 85.63  ? 97   GLU E CG    1 
ATOM   3498  C  CD    . GLU E 1 97  ? -42.332 -20.792 46.179 1.00 85.62  ? 97   GLU E CD    1 
ATOM   3499  O  OE1   . GLU E 1 97  ? -42.487 -22.034 46.267 1.00 84.43  ? 97   GLU E OE1   1 
ATOM   3500  O  OE2   . GLU E 1 97  ? -43.269 -19.976 46.285 1.00 85.98  ? 97   GLU E OE2   1 
ATOM   3501  N  N     . ALA E 1 98  ? -37.247 -22.677 45.657 1.00 84.29  ? 98   ALA E N     1 
ATOM   3502  C  CA    . ALA E 1 98  ? -36.269 -23.754 45.770 1.00 83.15  ? 98   ALA E CA    1 
ATOM   3503  C  C     . ALA E 1 98  ? -35.047 -23.304 46.574 1.00 82.54  ? 98   ALA E C     1 
ATOM   3504  O  O     . ALA E 1 98  ? -34.573 -24.038 47.457 1.00 82.62  ? 98   ALA E O     1 
ATOM   3505  C  CB    . ALA E 1 98  ? -35.861 -24.251 44.398 1.00 83.20  ? 98   ALA E CB    1 
ATOM   3506  N  N     . TYR E 1 99  ? -34.565 -22.092 46.271 1.00 81.37  ? 99   TYR E N     1 
ATOM   3507  C  CA    . TYR E 1 99  ? -33.415 -21.476 46.942 1.00 79.93  ? 99   TYR E CA    1 
ATOM   3508  C  C     . TYR E 1 99  ? -33.616 -21.300 48.441 1.00 79.22  ? 99   TYR E C     1 
ATOM   3509  O  O     . TYR E 1 99  ? -32.692 -21.552 49.245 1.00 79.47  ? 99   TYR E O     1 
ATOM   3510  C  CB    . TYR E 1 99  ? -33.124 -20.098 46.339 1.00 79.86  ? 99   TYR E CB    1 
ATOM   3511  C  CG    . TYR E 1 99  ? -32.237 -19.228 47.204 1.00 79.10  ? 99   TYR E CG    1 
ATOM   3512  C  CD1   . TYR E 1 99  ? -30.847 -19.301 47.103 1.00 79.34  ? 99   TYR E CD1   1 
ATOM   3513  C  CD2   . TYR E 1 99  ? -32.783 -18.346 48.129 1.00 78.58  ? 99   TYR E CD2   1 
ATOM   3514  C  CE1   . TYR E 1 99  ? -30.023 -18.517 47.896 1.00 78.20  ? 99   TYR E CE1   1 
ATOM   3515  C  CE2   . TYR E 1 99  ? -31.973 -17.554 48.922 1.00 79.04  ? 99   TYR E CE2   1 
ATOM   3516  C  CZ    . TYR E 1 99  ? -30.591 -17.651 48.799 1.00 78.91  ? 99   TYR E CZ    1 
ATOM   3517  O  OH    . TYR E 1 99  ? -29.786 -16.879 49.585 1.00 79.31  ? 99   TYR E OH    1 
ATOM   3518  N  N     . LEU E 1 100 ? -34.812 -20.834 48.805 1.00 77.91  ? 100  LEU E N     1 
ATOM   3519  C  CA    . LEU E 1 100 ? -35.126 -20.468 50.182 1.00 76.05  ? 100  LEU E CA    1 
ATOM   3520  C  C     . LEU E 1 100 ? -35.288 -21.718 50.999 1.00 75.12  ? 100  LEU E C     1 
ATOM   3521  O  O     . LEU E 1 100 ? -35.042 -21.714 52.198 1.00 75.09  ? 100  LEU E O     1 
ATOM   3522  C  CB    . LEU E 1 100 ? -36.408 -19.645 50.245 1.00 75.95  ? 100  LEU E CB    1 
ATOM   3523  C  CG    . LEU E 1 100 ? -36.418 -18.170 49.826 1.00 75.70  ? 100  LEU E CG    1 
ATOM   3524  C  CD1   . LEU E 1 100 ? -37.857 -17.664 49.758 1.00 76.24  ? 100  LEU E CD1   1 
ATOM   3525  C  CD2   . LEU E 1 100 ? -35.603 -17.293 50.757 1.00 75.49  ? 100  LEU E CD2   1 
ATOM   3526  N  N     . VAL E 1 101 ? -35.699 -22.789 50.329 1.00 74.29  ? 101  VAL E N     1 
ATOM   3527  C  CA    . VAL E 1 101 ? -35.995 -24.064 50.977 1.00 73.53  ? 101  VAL E CA    1 
ATOM   3528  C  C     . VAL E 1 101 ? -34.656 -24.705 51.300 1.00 73.24  ? 101  VAL E C     1 
ATOM   3529  O  O     . VAL E 1 101 ? -34.321 -24.922 52.464 1.00 72.74  ? 101  VAL E O     1 
ATOM   3530  C  CB    . VAL E 1 101 ? -36.906 -24.933 50.075 1.00 73.21  ? 101  VAL E CB    1 
ATOM   3531  C  CG1   . VAL E 1 101 ? -37.089 -26.316 50.642 1.00 72.75  ? 101  VAL E CG1   1 
ATOM   3532  C  CG2   . VAL E 1 101 ? -38.257 -24.241 49.886 1.00 72.61  ? 101  VAL E CG2   1 
ATOM   3533  N  N     . ALA E 1 102 ? -33.878 -24.947 50.252 1.00 73.29  ? 102  ALA E N     1 
ATOM   3534  C  CA    . ALA E 1 102 ? -32.452 -25.198 50.379 1.00 73.00  ? 102  ALA E CA    1 
ATOM   3535  C  C     . ALA E 1 102 ? -31.891 -24.407 51.550 1.00 72.70  ? 102  ALA E C     1 
ATOM   3536  O  O     . ALA E 1 102 ? -31.321 -24.987 52.468 1.00 72.05  ? 102  ALA E O     1 
ATOM   3537  C  CB    . ALA E 1 102 ? -31.743 -24.823 49.093 1.00 73.19  ? 102  ALA E CB    1 
ATOM   3538  N  N     . LEU E 1 103 ? -32.099 -23.092 51.541 1.00 72.62  ? 103  LEU E N     1 
ATOM   3539  C  CA    . LEU E 1 103 ? -31.627 -22.260 52.651 1.00 72.90  ? 103  LEU E CA    1 
ATOM   3540  C  C     . LEU E 1 103 ? -32.172 -22.637 54.033 1.00 73.89  ? 103  LEU E C     1 
ATOM   3541  O  O     . LEU E 1 103 ? -31.411 -22.713 54.996 1.00 74.03  ? 103  LEU E O     1 
ATOM   3542  C  CB    . LEU E 1 103 ? -31.850 -20.774 52.386 1.00 71.96  ? 103  LEU E CB    1 
ATOM   3543  C  CG    . LEU E 1 103 ? -31.200 -19.822 53.391 1.00 69.44  ? 103  LEU E CG    1 
ATOM   3544  C  CD1   . LEU E 1 103 ? -29.686 -19.905 53.338 1.00 67.31  ? 103  LEU E CD1   1 
ATOM   3545  C  CD2   . LEU E 1 103 ? -31.651 -18.428 53.084 1.00 66.17  ? 103  LEU E CD2   1 
ATOM   3546  N  N     . PHE E 1 104 ? -33.473 -22.881 54.141 1.00 74.99  ? 104  PHE E N     1 
ATOM   3547  C  CA    . PHE E 1 104 ? -34.022 -23.265 55.432 1.00 76.00  ? 104  PHE E CA    1 
ATOM   3548  C  C     . PHE E 1 104 ? -33.420 -24.590 55.919 1.00 76.70  ? 104  PHE E C     1 
ATOM   3549  O  O     . PHE E 1 104 ? -33.055 -24.712 57.087 1.00 76.78  ? 104  PHE E O     1 
ATOM   3550  C  CB    . PHE E 1 104 ? -35.544 -23.292 55.384 1.00 76.41  ? 104  PHE E CB    1 
ATOM   3551  C  CG    . PHE E 1 104 ? -36.165 -21.928 55.480 1.00 77.39  ? 104  PHE E CG    1 
ATOM   3552  C  CD1   . PHE E 1 104 ? -36.958 -21.432 54.453 1.00 78.51  ? 104  PHE E CD1   1 
ATOM   3553  C  CD2   . PHE E 1 104 ? -35.940 -21.124 56.595 1.00 77.52  ? 104  PHE E CD2   1 
ATOM   3554  C  CE1   . PHE E 1 104 ? -37.525 -20.160 54.539 1.00 78.37  ? 104  PHE E CE1   1 
ATOM   3555  C  CE2   . PHE E 1 104 ? -36.493 -19.854 56.688 1.00 77.47  ? 104  PHE E CE2   1 
ATOM   3556  C  CZ    . PHE E 1 104 ? -37.290 -19.369 55.662 1.00 77.58  ? 104  PHE E CZ    1 
ATOM   3557  N  N     . GLU E 1 105 ? -33.291 -25.559 55.011 1.00 77.12  ? 105  GLU E N     1 
ATOM   3558  C  CA    . GLU E 1 105 ? -32.569 -26.795 55.280 1.00 77.78  ? 105  GLU E CA    1 
ATOM   3559  C  C     . GLU E 1 105 ? -31.251 -26.460 55.964 1.00 77.53  ? 105  GLU E C     1 
ATOM   3560  O  O     . GLU E 1 105 ? -31.032 -26.857 57.096 1.00 78.02  ? 105  GLU E O     1 
ATOM   3561  C  CB    . GLU E 1 105 ? -32.278 -27.553 53.974 1.00 77.73  ? 105  GLU E CB    1 
ATOM   3562  C  CG    . GLU E 1 105 ? -33.245 -28.671 53.581 1.00 78.89  ? 105  GLU E CG    1 
ATOM   3563  C  CD    . GLU E 1 105 ? -33.104 -29.079 52.099 1.00 79.64  ? 105  GLU E CD    1 
ATOM   3564  O  OE1   . GLU E 1 105 ? -31.947 -29.307 51.656 1.00 81.43  ? 105  GLU E OE1   1 
ATOM   3565  O  OE2   . GLU E 1 105 ? -34.146 -29.169 51.380 1.00 80.14  ? 105  GLU E OE2   1 
ATOM   3566  N  N     . ASP E 1 106 ? -30.385 -25.713 55.285 1.00 77.14  ? 106  ASP E N     1 
ATOM   3567  C  CA    . ASP E 1 106 ? -29.048 -25.450 55.798 1.00 77.10  ? 106  ASP E CA    1 
ATOM   3568  C  C     . ASP E 1 106 ? -29.104 -24.614 57.072 1.00 77.41  ? 106  ASP E C     1 
ATOM   3569  O  O     . ASP E 1 106 ? -28.235 -24.733 57.944 1.00 77.90  ? 106  ASP E O     1 
ATOM   3570  C  CB    . ASP E 1 106 ? -28.188 -24.721 54.770 1.00 76.72  ? 106  ASP E CB    1 
ATOM   3571  C  CG    . ASP E 1 106 ? -28.231 -25.358 53.410 1.00 76.19  ? 106  ASP E CG    1 
ATOM   3572  O  OD1   . ASP E 1 106 ? -28.368 -26.598 53.326 1.00 76.07  ? 106  ASP E OD1   1 
ATOM   3573  O  OD2   . ASP E 1 106 ? -28.117 -24.605 52.417 1.00 74.81  ? 106  ASP E OD2   1 
ATOM   3574  N  N     . THR E 1 107 ? -30.113 -23.754 57.161 1.00 77.02  ? 107  THR E N     1 
ATOM   3575  C  CA    . THR E 1 107 ? -30.308 -22.922 58.329 1.00 76.52  ? 107  THR E CA    1 
ATOM   3576  C  C     . THR E 1 107 ? -30.597 -23.843 59.501 1.00 76.38  ? 107  THR E C     1 
ATOM   3577  O  O     . THR E 1 107 ? -29.850 -23.884 60.492 1.00 76.13  ? 107  THR E O     1 
ATOM   3578  C  CB    . THR E 1 107 ? -31.481 -21.965 58.112 1.00 76.63  ? 107  THR E CB    1 
ATOM   3579  O  OG1   . THR E 1 107 ? -31.129 -21.004 57.107 1.00 76.45  ? 107  THR E OG1   1 
ATOM   3580  C  CG2   . THR E 1 107 ? -31.843 -21.245 59.404 1.00 77.00  ? 107  THR E CG2   1 
ATOM   3581  N  N     . ASN E 1 108 ? -31.681 -24.599 59.353 1.00 75.94  ? 108  ASN E N     1 
ATOM   3582  C  CA    . ASN E 1 108 ? -32.118 -25.573 60.334 1.00 75.31  ? 108  ASN E CA    1 
ATOM   3583  C  C     . ASN E 1 108 ? -30.994 -26.465 60.862 1.00 75.14  ? 108  ASN E C     1 
ATOM   3584  O  O     . ASN E 1 108 ? -31.055 -26.925 61.990 1.00 75.39  ? 108  ASN E O     1 
ATOM   3585  C  CB    . ASN E 1 108 ? -33.224 -26.427 59.730 1.00 74.95  ? 108  ASN E CB    1 
ATOM   3586  C  CG    . ASN E 1 108 ? -33.995 -27.193 60.765 1.00 74.47  ? 108  ASN E CG    1 
ATOM   3587  O  OD1   . ASN E 1 108 ? -34.057 -26.793 61.922 1.00 74.62  ? 108  ASN E OD1   1 
ATOM   3588  N  ND2   . ASN E 1 108 ? -34.600 -28.303 60.356 1.00 73.80  ? 108  ASN E ND2   1 
ATOM   3589  N  N     . LEU E 1 109 ? -29.962 -26.701 60.058 1.00 75.21  ? 109  LEU E N     1 
ATOM   3590  C  CA    . LEU E 1 109 ? -28.837 -27.514 60.522 1.00 74.92  ? 109  LEU E CA    1 
ATOM   3591  C  C     . LEU E 1 109 ? -27.953 -26.760 61.505 1.00 75.14  ? 109  LEU E C     1 
ATOM   3592  O  O     . LEU E 1 109 ? -27.373 -27.363 62.407 1.00 75.36  ? 109  LEU E O     1 
ATOM   3593  C  CB    . LEU E 1 109 ? -28.035 -28.090 59.354 1.00 74.56  ? 109  LEU E CB    1 
ATOM   3594  C  CG    . LEU E 1 109 ? -28.785 -29.204 58.602 1.00 73.62  ? 109  LEU E CG    1 
ATOM   3595  C  CD1   . LEU E 1 109 ? -28.692 -29.012 57.100 1.00 72.78  ? 109  LEU E CD1   1 
ATOM   3596  C  CD2   . LEU E 1 109 ? -28.343 -30.613 59.007 1.00 71.48  ? 109  LEU E CD2   1 
ATOM   3597  N  N     . CYS E 1 110 ? -27.868 -25.444 61.350 1.00 75.29  ? 110  CYS E N     1 
ATOM   3598  C  CA    . CYS E 1 110 ? -27.104 -24.632 62.293 1.00 75.77  ? 110  CYS E CA    1 
ATOM   3599  C  C     . CYS E 1 110 ? -27.845 -24.510 63.629 1.00 75.93  ? 110  CYS E C     1 
ATOM   3600  O  O     . CYS E 1 110 ? -27.229 -24.529 64.697 1.00 76.02  ? 110  CYS E O     1 
ATOM   3601  C  CB    . CYS E 1 110 ? -26.855 -23.235 61.737 1.00 75.82  ? 110  CYS E CB    1 
ATOM   3602  S  SG    . CYS E 1 110 ? -26.221 -23.177 60.088 1.00 75.54  ? 110  CYS E SG    1 
ATOM   3603  N  N     . ALA E 1 111 ? -29.168 -24.350 63.553 1.00 75.97  ? 111  ALA E N     1 
ATOM   3604  C  CA    . ALA E 1 111 ? -30.023 -24.367 64.734 1.00 75.42  ? 111  ALA E CA    1 
ATOM   3605  C  C     . ALA E 1 111 ? -29.677 -25.612 65.523 1.00 75.24  ? 111  ALA E C     1 
ATOM   3606  O  O     . ALA E 1 111 ? -29.215 -25.529 66.668 1.00 75.37  ? 111  ALA E O     1 
ATOM   3607  C  CB    . ALA E 1 111 ? -31.470 -24.384 64.331 1.00 75.50  ? 111  ALA E CB    1 
ATOM   3608  N  N     . ILE E 1 112 ? -29.847 -26.761 64.877 1.00 74.81  ? 112  ILE E N     1 
ATOM   3609  C  CA    . ILE E 1 112 ? -29.488 -28.041 65.470 1.00 74.63  ? 112  ILE E CA    1 
ATOM   3610  C  C     . ILE E 1 112 ? -28.032 -28.094 65.964 1.00 74.63  ? 112  ILE E C     1 
ATOM   3611  O  O     . ILE E 1 112 ? -27.748 -28.690 67.000 1.00 74.48  ? 112  ILE E O     1 
ATOM   3612  C  CB    . ILE E 1 112 ? -29.808 -29.195 64.511 1.00 74.39  ? 112  ILE E CB    1 
ATOM   3613  C  CG1   . ILE E 1 112 ? -31.303 -29.490 64.573 1.00 74.82  ? 112  ILE E CG1   1 
ATOM   3614  C  CG2   . ILE E 1 112 ? -29.042 -30.445 64.888 1.00 74.09  ? 112  ILE E CG2   1 
ATOM   3615  C  CD1   . ILE E 1 112 ? -31.905 -30.033 63.288 1.00 76.34  ? 112  ILE E CD1   1 
ATOM   3616  N  N     . HIS E 1 113 ? -27.116 -27.454 65.245 1.00 74.71  ? 113  HIS E N     1 
ATOM   3617  C  CA    . HIS E 1 113 ? -25.718 -27.495 65.646 1.00 74.98  ? 113  HIS E CA    1 
ATOM   3618  C  C     . HIS E 1 113 ? -25.529 -26.814 67.006 1.00 75.87  ? 113  HIS E C     1 
ATOM   3619  O  O     . HIS E 1 113 ? -24.590 -27.141 67.756 1.00 75.96  ? 113  HIS E O     1 
ATOM   3620  C  CB    . HIS E 1 113 ? -24.835 -26.832 64.596 1.00 74.64  ? 113  HIS E CB    1 
ATOM   3621  C  CG    . HIS E 1 113 ? -23.380 -26.918 64.905 1.00 72.89  ? 113  HIS E CG    1 
ATOM   3622  N  ND1   . HIS E 1 113 ? -22.665 -28.083 64.764 1.00 72.47  ? 113  HIS E ND1   1 
ATOM   3623  C  CD2   . HIS E 1 113 ? -22.505 -25.991 65.358 1.00 72.68  ? 113  HIS E CD2   1 
ATOM   3624  C  CE1   . HIS E 1 113 ? -21.404 -27.869 65.101 1.00 72.34  ? 113  HIS E CE1   1 
ATOM   3625  N  NE2   . HIS E 1 113 ? -21.282 -26.609 65.472 1.00 71.59  ? 113  HIS E NE2   1 
ATOM   3626  N  N     . ALA E 1 114 ? -26.433 -25.875 67.307 1.00 76.19  ? 114  ALA E N     1 
ATOM   3627  C  CA    . ALA E 1 114 ? -26.397 -25.094 68.539 1.00 76.66  ? 114  ALA E CA    1 
ATOM   3628  C  C     . ALA E 1 114 ? -27.350 -25.687 69.607 1.00 77.20  ? 114  ALA E C     1 
ATOM   3629  O  O     . ALA E 1 114 ? -27.902 -24.971 70.457 1.00 76.74  ? 114  ALA E O     1 
ATOM   3630  C  CB    . ALA E 1 114 ? -26.750 -23.657 68.232 1.00 76.69  ? 114  ALA E CB    1 
ATOM   3631  N  N     . LYS E 1 115 ? -27.529 -27.007 69.542 1.00 77.59  ? 115  LYS E N     1 
ATOM   3632  C  CA    . LYS E 1 115 ? -28.412 -27.762 70.431 1.00 77.98  ? 115  LYS E CA    1 
ATOM   3633  C  C     . LYS E 1 115 ? -29.836 -27.175 70.514 1.00 77.81  ? 115  LYS E C     1 
ATOM   3634  O  O     . LYS E 1 115 ? -30.619 -27.553 71.382 1.00 77.51  ? 115  LYS E O     1 
ATOM   3635  C  CB    . LYS E 1 115 ? -27.772 -27.946 71.817 1.00 78.04  ? 115  LYS E CB    1 
ATOM   3636  C  CG    . LYS E 1 115 ? -26.293 -28.317 71.788 1.00 79.36  ? 115  LYS E CG    1 
ATOM   3637  C  CD    . LYS E 1 115 ? -25.985 -29.823 71.907 1.00 80.33  ? 115  LYS E CD    1 
ATOM   3638  C  CE    . LYS E 1 115 ? -24.452 -30.018 72.175 1.00 80.46  ? 115  LYS E CE    1 
ATOM   3639  N  NZ    . LYS E 1 115 ? -23.988 -31.403 72.565 1.00 80.22  ? 115  LYS E NZ    1 
ATOM   3640  N  N     . ARG E 1 116 ? -30.151 -26.265 69.594 1.00 77.77  ? 116  ARG E N     1 
ATOM   3641  C  CA    . ARG E 1 116 ? -31.471 -25.641 69.500 1.00 78.07  ? 116  ARG E CA    1 
ATOM   3642  C  C     . ARG E 1 116 ? -32.457 -26.431 68.618 1.00 78.56  ? 116  ARG E C     1 
ATOM   3643  O  O     . ARG E 1 116 ? -32.131 -27.507 68.118 1.00 78.91  ? 116  ARG E O     1 
ATOM   3644  C  CB    . ARG E 1 116 ? -31.339 -24.205 69.001 1.00 77.86  ? 116  ARG E CB    1 
ATOM   3645  C  CG    . ARG E 1 116 ? -30.794 -23.264 70.042 1.00 77.62  ? 116  ARG E CG    1 
ATOM   3646  C  CD    . ARG E 1 116 ? -31.072 -21.823 69.688 1.00 78.33  ? 116  ARG E CD    1 
ATOM   3647  N  NE    . ARG E 1 116 ? -30.016 -21.213 68.880 1.00 79.24  ? 116  ARG E NE    1 
ATOM   3648  C  CZ    . ARG E 1 116 ? -30.030 -21.110 67.551 1.00 78.95  ? 116  ARG E CZ    1 
ATOM   3649  N  NH1   . ARG E 1 116 ? -31.043 -21.593 66.845 1.00 78.71  ? 116  ARG E NH1   1 
ATOM   3650  N  NH2   . ARG E 1 116 ? -29.023 -20.518 66.919 1.00 79.31  ? 116  ARG E NH2   1 
ATOM   3651  N  N     . VAL E 1 117 ? -33.670 -25.914 68.460 1.00 79.04  ? 117  VAL E N     1 
ATOM   3652  C  CA    . VAL E 1 117 ? -34.697 -26.570 67.645 1.00 79.59  ? 117  VAL E CA    1 
ATOM   3653  C  C     . VAL E 1 117 ? -35.509 -25.505 66.908 1.00 80.09  ? 117  VAL E C     1 
ATOM   3654  O  O     . VAL E 1 117 ? -36.291 -25.798 66.005 1.00 80.34  ? 117  VAL E O     1 
ATOM   3655  C  CB    . VAL E 1 117 ? -35.570 -27.536 68.500 1.00 79.59  ? 117  VAL E CB    1 
ATOM   3656  C  CG1   . VAL E 1 117 ? -37.077 -27.357 68.253 1.00 80.51  ? 117  VAL E CG1   1 
ATOM   3657  C  CG2   . VAL E 1 117 ? -35.145 -28.971 68.277 1.00 79.14  ? 117  VAL E CG2   1 
ATOM   3658  N  N     . THR E 1 118 ? -35.280 -24.258 67.296 1.00 80.73  ? 118  THR E N     1 
ATOM   3659  C  CA    . THR E 1 118 ? -35.886 -23.110 66.666 1.00 81.55  ? 118  THR E CA    1 
ATOM   3660  C  C     . THR E 1 118 ? -34.839 -22.471 65.767 1.00 82.08  ? 118  THR E C     1 
ATOM   3661  O  O     . THR E 1 118 ? -33.715 -22.242 66.201 1.00 82.13  ? 118  THR E O     1 
ATOM   3662  C  CB    . THR E 1 118 ? -36.307 -22.070 67.742 1.00 81.67  ? 118  THR E CB    1 
ATOM   3663  O  OG1   . THR E 1 118 ? -37.073 -22.705 68.774 1.00 81.92  ? 118  THR E OG1   1 
ATOM   3664  C  CG2   . THR E 1 118 ? -37.112 -20.925 67.133 1.00 82.14  ? 118  THR E CG2   1 
ATOM   3665  N  N     . ILE E 1 119 ? -35.195 -22.173 64.525 1.00 82.90  ? 119  ILE E N     1 
ATOM   3666  C  CA    . ILE E 1 119 ? -34.272 -21.460 63.649 1.00 83.96  ? 119  ILE E CA    1 
ATOM   3667  C  C     . ILE E 1 119 ? -34.321 -19.954 63.950 1.00 84.78  ? 119  ILE E C     1 
ATOM   3668  O  O     . ILE E 1 119 ? -35.365 -19.428 64.359 1.00 85.35  ? 119  ILE E O     1 
ATOM   3669  C  CB    . ILE E 1 119 ? -34.482 -21.809 62.145 1.00 83.98  ? 119  ILE E CB    1 
ATOM   3670  C  CG1   . ILE E 1 119 ? -35.606 -21.002 61.507 1.00 84.31  ? 119  ILE E CG1   1 
ATOM   3671  C  CG2   . ILE E 1 119 ? -34.775 -23.288 61.979 1.00 84.31  ? 119  ILE E CG2   1 
ATOM   3672  C  CD1   . ILE E 1 119 ? -35.685 -21.187 60.011 1.00 83.88  ? 119  ILE E CD1   1 
ATOM   3673  N  N     . MET E 1 120 ? -33.190 -19.272 63.788 1.00 85.25  ? 120  MET E N     1 
ATOM   3674  C  CA    . MET E 1 120 ? -33.063 -17.885 64.225 1.00 85.97  ? 120  MET E CA    1 
ATOM   3675  C  C     . MET E 1 120 ? -32.233 -17.100 63.235 1.00 85.80  ? 120  MET E C     1 
ATOM   3676  O  O     . MET E 1 120 ? -31.374 -17.678 62.568 1.00 85.96  ? 120  MET E O     1 
ATOM   3677  C  CB    . MET E 1 120 ? -32.409 -17.820 65.604 1.00 86.12  ? 120  MET E CB    1 
ATOM   3678  C  CG    . MET E 1 120 ? -33.365 -18.061 66.752 1.00 87.05  ? 120  MET E CG    1 
ATOM   3679  S  SD    . MET E 1 120 ? -32.571 -18.390 68.343 1.00 87.72  ? 120  MET E SD    1 
ATOM   3680  C  CE    . MET E 1 120 ? -34.018 -18.902 69.285 1.00 87.84  ? 120  MET E CE    1 
ATOM   3681  N  N     . PRO E 1 121 ? -32.473 -15.778 63.133 1.00 85.73  ? 121  PRO E N     1 
ATOM   3682  C  CA    . PRO E 1 121 ? -31.759 -15.009 62.123 1.00 85.46  ? 121  PRO E CA    1 
ATOM   3683  C  C     . PRO E 1 121 ? -30.259 -15.269 62.125 1.00 85.24  ? 121  PRO E C     1 
ATOM   3684  O  O     . PRO E 1 121 ? -29.626 -15.159 61.074 1.00 85.55  ? 121  PRO E O     1 
ATOM   3685  C  CB    . PRO E 1 121 ? -32.069 -13.558 62.508 1.00 85.53  ? 121  PRO E CB    1 
ATOM   3686  C  CG    . PRO E 1 121 ? -33.428 -13.640 63.086 1.00 85.64  ? 121  PRO E CG    1 
ATOM   3687  C  CD    . PRO E 1 121 ? -33.400 -14.921 63.898 1.00 85.84  ? 121  PRO E CD    1 
ATOM   3688  N  N     . LYS E 1 122 ? -29.705 -15.638 63.279 1.00 84.77  ? 122  LYS E N     1 
ATOM   3689  C  CA    . LYS E 1 122 ? -28.257 -15.810 63.408 1.00 84.45  ? 122  LYS E CA    1 
ATOM   3690  C  C     . LYS E 1 122 ? -27.752 -17.086 62.718 1.00 84.19  ? 122  LYS E C     1 
ATOM   3691  O  O     . LYS E 1 122 ? -26.550 -17.217 62.426 1.00 84.45  ? 122  LYS E O     1 
ATOM   3692  C  CB    . LYS E 1 122 ? -27.823 -15.756 64.877 1.00 84.34  ? 122  LYS E CB    1 
ATOM   3693  C  CG    . LYS E 1 122 ? -28.127 -17.003 65.680 1.00 84.93  ? 122  LYS E CG    1 
ATOM   3694  C  CD    . LYS E 1 122 ? -27.269 -17.083 66.932 1.00 86.93  ? 122  LYS E CD    1 
ATOM   3695  C  CE    . LYS E 1 122 ? -27.964 -16.440 68.134 1.00 88.57  ? 122  LYS E CE    1 
ATOM   3696  N  NZ    . LYS E 1 122 ? -27.181 -16.595 69.398 1.00 88.81  ? 122  LYS E NZ    1 
ATOM   3697  N  N     . ASP E 1 123 ? -28.671 -18.016 62.467 1.00 83.55  ? 123  ASP E N     1 
ATOM   3698  C  CA    . ASP E 1 123 ? -28.356 -19.254 61.759 1.00 83.16  ? 123  ASP E CA    1 
ATOM   3699  C  C     . ASP E 1 123 ? -28.203 -18.930 60.282 1.00 82.75  ? 123  ASP E C     1 
ATOM   3700  O  O     . ASP E 1 123 ? -27.135 -19.129 59.705 1.00 82.94  ? 123  ASP E O     1 
ATOM   3701  C  CB    . ASP E 1 123 ? -29.458 -20.304 61.959 1.00 83.21  ? 123  ASP E CB    1 
ATOM   3702  C  CG    . ASP E 1 123 ? -29.627 -20.729 63.420 1.00 83.35  ? 123  ASP E CG    1 
ATOM   3703  O  OD1   . ASP E 1 123 ? -28.621 -21.084 64.093 1.00 82.04  ? 123  ASP E OD1   1 
ATOM   3704  O  OD2   . ASP E 1 123 ? -30.792 -20.730 63.882 1.00 83.93  ? 123  ASP E OD2   1 
ATOM   3705  N  N     . ILE E 1 124 ? -29.283 -18.414 59.693 1.00 81.92  ? 124  ILE E N     1 
ATOM   3706  C  CA    . ILE E 1 124 ? -29.287 -17.844 58.349 1.00 80.89  ? 124  ILE E CA    1 
ATOM   3707  C  C     . ILE E 1 124 ? -27.988 -17.101 58.035 1.00 80.43  ? 124  ILE E C     1 
ATOM   3708  O  O     . ILE E 1 124 ? -27.384 -17.330 56.993 1.00 80.29  ? 124  ILE E O     1 
ATOM   3709  C  CB    . ILE E 1 124 ? -30.518 -16.913 58.155 1.00 80.97  ? 124  ILE E CB    1 
ATOM   3710  C  CG1   . ILE E 1 124 ? -31.815 -17.742 58.166 1.00 81.31  ? 124  ILE E CG1   1 
ATOM   3711  C  CG2   . ILE E 1 124 ? -30.409 -16.116 56.865 1.00 80.14  ? 124  ILE E CG2   1 
ATOM   3712  C  CD1   . ILE E 1 124 ? -33.093 -16.947 58.424 1.00 80.83  ? 124  ILE E CD1   1 
ATOM   3713  N  N     . GLN E 1 125 ? -27.561 -16.227 58.945 1.00 79.90  ? 125  GLN E N     1 
ATOM   3714  C  CA    . GLN E 1 125 ? -26.325 -15.459 58.771 1.00 79.57  ? 125  GLN E CA    1 
ATOM   3715  C  C     . GLN E 1 125 ? -25.095 -16.371 58.678 1.00 78.90  ? 125  GLN E C     1 
ATOM   3716  O  O     . GLN E 1 125 ? -24.251 -16.194 57.809 1.00 78.94  ? 125  GLN E O     1 
ATOM   3717  C  CB    . GLN E 1 125 ? -26.138 -14.441 59.897 1.00 79.67  ? 125  GLN E CB    1 
ATOM   3718  C  CG    . GLN E 1 125 ? -27.118 -13.282 59.890 1.00 80.38  ? 125  GLN E CG    1 
ATOM   3719  C  CD    . GLN E 1 125 ? -27.386 -12.747 61.294 1.00 82.53  ? 125  GLN E CD    1 
ATOM   3720  O  OE1   . GLN E 1 125 ? -26.509 -12.762 62.167 1.00 82.26  ? 125  GLN E OE1   1 
ATOM   3721  N  NE2   . GLN E 1 125 ? -28.614 -12.285 61.522 1.00 83.54  ? 125  GLN E NE2   1 
ATOM   3722  N  N     . LEU E 1 126 ? -25.004 -17.351 59.564 1.00 77.86  ? 126  LEU E N     1 
ATOM   3723  C  CA    . LEU E 1 126 ? -23.928 -18.328 59.484 1.00 76.69  ? 126  LEU E CA    1 
ATOM   3724  C  C     . LEU E 1 126 ? -24.051 -19.198 58.235 1.00 76.44  ? 126  LEU E C     1 
ATOM   3725  O  O     . LEU E 1 126 ? -23.040 -19.574 57.644 1.00 76.82  ? 126  LEU E O     1 
ATOM   3726  C  CB    . LEU E 1 126 ? -23.945 -19.220 60.716 1.00 76.25  ? 126  LEU E CB    1 
ATOM   3727  C  CG    . LEU E 1 126 ? -23.007 -20.409 60.728 1.00 74.62  ? 126  LEU E CG    1 
ATOM   3728  C  CD1   . LEU E 1 126 ? -21.685 -20.042 61.365 1.00 73.32  ? 126  LEU E CD1   1 
ATOM   3729  C  CD2   . LEU E 1 126 ? -23.676 -21.528 61.486 1.00 73.53  ? 126  LEU E CD2   1 
ATOM   3730  N  N     . ALA E 1 127 ? -25.281 -19.532 57.845 1.00 75.64  ? 127  ALA E N     1 
ATOM   3731  C  CA    . ALA E 1 127 ? -25.508 -20.411 56.703 1.00 74.83  ? 127  ALA E CA    1 
ATOM   3732  C  C     . ALA E 1 127 ? -25.011 -19.731 55.448 1.00 74.63  ? 127  ALA E C     1 
ATOM   3733  O  O     . ALA E 1 127 ? -24.304 -20.323 54.651 1.00 74.48  ? 127  ALA E O     1 
ATOM   3734  C  CB    . ALA E 1 127 ? -26.971 -20.744 56.568 1.00 74.68  ? 127  ALA E CB    1 
ATOM   3735  N  N     . ARG E 1 128 ? -25.380 -18.468 55.297 1.00 74.60  ? 128  ARG E N     1 
ATOM   3736  C  CA    . ARG E 1 128 ? -25.030 -17.697 54.136 1.00 74.17  ? 128  ARG E CA    1 
ATOM   3737  C  C     . ARG E 1 128 ? -23.574 -17.301 54.184 1.00 74.27  ? 128  ARG E C     1 
ATOM   3738  O  O     . ARG E 1 128 ? -22.915 -17.238 53.149 1.00 74.10  ? 128  ARG E O     1 
ATOM   3739  C  CB    . ARG E 1 128 ? -25.895 -16.460 54.058 1.00 74.02  ? 128  ARG E CB    1 
ATOM   3740  C  CG    . ARG E 1 128 ? -27.289 -16.719 53.555 1.00 74.09  ? 128  ARG E CG    1 
ATOM   3741  C  CD    . ARG E 1 128 ? -27.737 -15.561 52.691 1.00 74.11  ? 128  ARG E CD    1 
ATOM   3742  N  NE    . ARG E 1 128 ? -27.702 -14.305 53.425 1.00 73.67  ? 128  ARG E NE    1 
ATOM   3743  C  CZ    . ARG E 1 128 ? -27.469 -13.121 52.875 1.00 74.09  ? 128  ARG E CZ    1 
ATOM   3744  N  NH1   . ARG E 1 128 ? -27.226 -13.023 51.567 1.00 74.01  ? 128  ARG E NH1   1 
ATOM   3745  N  NH2   . ARG E 1 128 ? -27.464 -12.037 53.644 1.00 74.20  ? 128  ARG E NH2   1 
ATOM   3746  N  N     . ARG E 1 129 ? -23.070 -17.034 55.383 1.00 74.65  ? 129  ARG E N     1 
ATOM   3747  C  CA    . ARG E 1 129 ? -21.667 -16.699 55.538 1.00 74.99  ? 129  ARG E CA    1 
ATOM   3748  C  C     . ARG E 1 129 ? -20.847 -17.832 54.970 1.00 74.93  ? 129  ARG E C     1 
ATOM   3749  O  O     . ARG E 1 129 ? -19.951 -17.590 54.176 1.00 75.03  ? 129  ARG E O     1 
ATOM   3750  C  CB    . ARG E 1 129 ? -21.304 -16.395 56.996 1.00 74.98  ? 129  ARG E CB    1 
ATOM   3751  C  CG    . ARG E 1 129 ? -19.848 -16.674 57.418 1.00 77.84  ? 129  ARG E CG    1 
ATOM   3752  C  CD    . ARG E 1 129 ? -18.800 -15.961 56.559 1.00 81.46  ? 129  ARG E CD    1 
ATOM   3753  N  NE    . ARG E 1 129 ? -17.737 -15.335 57.346 1.00 85.26  ? 129  ARG E NE    1 
ATOM   3754  C  CZ    . ARG E 1 129 ? -17.875 -14.225 58.086 1.00 86.72  ? 129  ARG E CZ    1 
ATOM   3755  N  NH1   . ARG E 1 129 ? -19.050 -13.603 58.178 1.00 87.45  ? 129  ARG E NH1   1 
ATOM   3756  N  NH2   . ARG E 1 129 ? -16.834 -13.741 58.760 1.00 86.09  ? 129  ARG E NH2   1 
ATOM   3757  N  N     . ILE E 1 130 ? -21.191 -19.063 55.324 1.00 75.20  ? 130  ILE E N     1 
ATOM   3758  C  CA    . ILE E 1 130 ? -20.363 -20.204 54.956 1.00 75.99  ? 130  ILE E CA    1 
ATOM   3759  C  C     . ILE E 1 130 ? -20.528 -20.597 53.499 1.00 76.61  ? 130  ILE E C     1 
ATOM   3760  O  O     . ILE E 1 130 ? -19.559 -21.003 52.839 1.00 76.82  ? 130  ILE E O     1 
ATOM   3761  C  CB    . ILE E 1 130 ? -20.536 -21.371 55.937 1.00 76.20  ? 130  ILE E CB    1 
ATOM   3762  C  CG1   . ILE E 1 130 ? -19.621 -21.130 57.150 1.00 76.43  ? 130  ILE E CG1   1 
ATOM   3763  C  CG2   . ILE E 1 130 ? -20.163 -22.697 55.298 1.00 75.67  ? 130  ILE E CG2   1 
ATOM   3764  C  CD1   . ILE E 1 130 ? -20.210 -21.529 58.480 1.00 75.35  ? 130  ILE E CD1   1 
ATOM   3765  N  N     . ARG E 1 131 ? -21.746 -20.429 52.996 1.00 77.38  ? 131  ARG E N     1 
ATOM   3766  C  CA    . ARG E 1 131 ? -22.026 -20.545 51.575 1.00 77.81  ? 131  ARG E CA    1 
ATOM   3767  C  C     . ARG E 1 131 ? -21.180 -19.561 50.807 1.00 79.17  ? 131  ARG E C     1 
ATOM   3768  O  O     . ARG E 1 131 ? -20.794 -19.825 49.680 1.00 79.81  ? 131  ARG E O     1 
ATOM   3769  C  CB    . ARG E 1 131 ? -23.487 -20.239 51.299 1.00 77.53  ? 131  ARG E CB    1 
ATOM   3770  C  CG    . ARG E 1 131 ? -24.441 -21.342 51.659 1.00 75.05  ? 131  ARG E CG    1 
ATOM   3771  C  CD    . ARG E 1 131 ? -25.815 -20.809 51.512 1.00 73.08  ? 131  ARG E CD    1 
ATOM   3772  N  NE    . ARG E 1 131 ? -26.852 -21.836 51.445 1.00 72.18  ? 131  ARG E NE    1 
ATOM   3773  C  CZ    . ARG E 1 131 ? -27.956 -21.706 50.709 1.00 70.61  ? 131  ARG E CZ    1 
ATOM   3774  N  NH1   . ARG E 1 131 ? -28.117 -20.609 49.982 1.00 68.43  ? 131  ARG E NH1   1 
ATOM   3775  N  NH2   . ARG E 1 131 ? -28.887 -22.662 50.685 1.00 69.03  ? 131  ARG E NH2   1 
ATOM   3776  N  N     . GLY E 1 132 ? -20.879 -18.429 51.427 1.00 80.71  ? 132  GLY E N     1 
ATOM   3777  C  CA    . GLY E 1 132 ? -20.130 -17.369 50.772 1.00 82.44  ? 132  GLY E CA    1 
ATOM   3778  C  C     . GLY E 1 132 ? -21.050 -16.415 50.033 1.00 83.66  ? 132  GLY E C     1 
ATOM   3779  O  O     . GLY E 1 132 ? -20.605 -15.671 49.164 1.00 84.16  ? 132  GLY E O     1 
ATOM   3780  N  N     . GLU E 1 133 ? -22.336 -16.441 50.373 1.00 84.76  ? 133  GLU E N     1 
ATOM   3781  C  CA    . GLU E 1 133 ? -23.312 -15.535 49.782 1.00 85.88  ? 133  GLU E CA    1 
ATOM   3782  C  C     . GLU E 1 133 ? -23.108 -14.146 50.375 1.00 87.23  ? 133  GLU E C     1 
ATOM   3783  O  O     . GLU E 1 133 ? -22.654 -13.213 49.702 1.00 87.27  ? 133  GLU E O     1 
ATOM   3784  C  CB    . GLU E 1 133 ? -24.731 -16.019 50.084 1.00 85.47  ? 133  GLU E CB    1 
ATOM   3785  C  CG    . GLU E 1 133 ? -25.089 -17.369 49.495 1.00 84.94  ? 133  GLU E CG    1 
ATOM   3786  C  CD    . GLU E 1 133 ? -26.590 -17.626 49.524 1.00 84.19  ? 133  GLU E CD    1 
ATOM   3787  O  OE1   . GLU E 1 133 ? -27.329 -16.740 49.985 1.00 84.16  ? 133  GLU E OE1   1 
ATOM   3788  O  OE2   . GLU E 1 133 ? -27.036 -18.706 49.094 1.00 82.99  ? 133  GLU E OE2   1 
ATOM   3789  N  N     . ARG E 1 134 ? -23.466 -14.022 51.648 1.00 88.70  ? 134  ARG E N     1 
ATOM   3790  C  CA    . ARG E 1 134 ? -23.105 -12.872 52.447 1.00 90.28  ? 134  ARG E CA    1 
ATOM   3791  C  C     . ARG E 1 134 ? -21.569 -12.857 52.676 1.00 90.67  ? 134  ARG E C     1 
ATOM   3792  O  O     . ARG E 1 134 ? -20.881 -13.882 52.521 1.00 90.25  ? 134  ARG E O     1 
ATOM   3793  C  CB    . ARG E 1 134 ? -23.886 -12.911 53.772 1.00 90.67  ? 134  ARG E CB    1 
ATOM   3794  C  CG    . ARG E 1 134 ? -23.459 -11.905 54.864 1.00 93.68  ? 134  ARG E CG    1 
ATOM   3795  C  CD    . ARG E 1 134 ? -23.781 -10.421 54.512 1.00 97.03  ? 134  ARG E CD    1 
ATOM   3796  N  NE    . ARG E 1 134 ? -25.220 -10.142 54.494 1.00 99.57  ? 134  ARG E NE    1 
ATOM   3797  C  CZ    . ARG E 1 134 ? -25.776 -8.985  54.859 1.00 101.08 ? 134  ARG E CZ    1 
ATOM   3798  N  NH1   . ARG E 1 134 ? -25.017 -7.977  55.291 1.00 101.26 ? 134  ARG E NH1   1 
ATOM   3799  N  NH2   . ARG E 1 134 ? -27.100 -8.839  54.799 1.00 101.23 ? 134  ARG E NH2   1 
ATOM   3800  N  N     . ALA E 1 135 ? -21.061 -11.662 52.994 1.00 91.27  ? 135  ALA E N     1 
ATOM   3801  C  CA    . ALA E 1 135 ? -19.683 -11.415 53.400 1.00 91.46  ? 135  ALA E CA    1 
ATOM   3802  C  C     . ALA E 1 135 ? -19.286 -12.311 54.568 1.00 91.67  ? 135  ALA E C     1 
ATOM   3803  O  O     . ALA E 1 135 ? -18.885 -13.461 54.343 1.00 92.03  ? 135  ALA E O     1 
ATOM   3804  C  CB    . ALA E 1 135 ? -19.519 -9.943  53.776 1.00 91.57  ? 135  ALA E CB    1 
ATOM   3805  O  OXT   . ALA E 1 135 ? -19.363 -11.919 55.741 1.00 91.56  ? 135  ALA E OXT   1 
ATOM   3806  N  N     . ASN F 2 25  ? -45.611 -3.823  50.343 1.00 103.56 ? 25   ASN F N     1 
ATOM   3807  C  CA    . ASN F 2 25  ? -45.303 -4.514  49.054 1.00 103.57 ? 25   ASN F CA    1 
ATOM   3808  C  C     . ASN F 2 25  ? -44.409 -5.759  49.229 1.00 103.80 ? 25   ASN F C     1 
ATOM   3809  O  O     . ASN F 2 25  ? -44.841 -6.887  48.942 1.00 103.56 ? 25   ASN F O     1 
ATOM   3810  C  CB    . ASN F 2 25  ? -44.688 -3.525  48.061 1.00 103.54 ? 25   ASN F CB    1 
ATOM   3811  C  CG    . ASN F 2 25  ? -44.851 -3.964  46.618 1.00 103.34 ? 25   ASN F CG    1 
ATOM   3812  O  OD1   . ASN F 2 25  ? -45.277 -5.088  46.336 1.00 103.24 ? 25   ASN F OD1   1 
ATOM   3813  N  ND2   . ASN F 2 25  ? -44.507 -3.075  45.692 1.00 102.42 ? 25   ASN F ND2   1 
ATOM   3814  N  N     . ILE F 2 26  ? -43.171 -5.556  49.692 1.00 103.89 ? 26   ILE F N     1 
ATOM   3815  C  CA    . ILE F 2 26  ? -42.328 -6.681  50.098 1.00 103.97 ? 26   ILE F CA    1 
ATOM   3816  C  C     . ILE F 2 26  ? -43.054 -7.425  51.212 1.00 104.12 ? 26   ILE F C     1 
ATOM   3817  O  O     . ILE F 2 26  ? -43.269 -8.629  51.114 1.00 103.97 ? 26   ILE F O     1 
ATOM   3818  C  CB    . ILE F 2 26  ? -40.860 -6.250  50.515 1.00 103.99 ? 26   ILE F CB    1 
ATOM   3819  C  CG1   . ILE F 2 26  ? -39.822 -7.346  50.196 1.00 103.67 ? 26   ILE F CG1   1 
ATOM   3820  C  CG2   . ILE F 2 26  ? -40.759 -5.759  51.973 1.00 104.02 ? 26   ILE F CG2   1 
ATOM   3821  C  CD1   . ILE F 2 26  ? -39.919 -8.649  50.986 1.00 102.46 ? 26   ILE F CD1   1 
ATOM   3822  N  N     . GLN F 2 27  ? -43.470 -6.684  52.241 1.00 104.56 ? 27   GLN F N     1 
ATOM   3823  C  CA    . GLN F 2 27  ? -44.191 -7.236  53.388 1.00 104.91 ? 27   GLN F CA    1 
ATOM   3824  C  C     . GLN F 2 27  ? -45.429 -8.007  52.942 1.00 105.14 ? 27   GLN F C     1 
ATOM   3825  O  O     . GLN F 2 27  ? -46.130 -8.600  53.764 1.00 105.43 ? 27   GLN F O     1 
ATOM   3826  C  CB    . GLN F 2 27  ? -44.553 -6.131  54.389 1.00 104.82 ? 27   GLN F CB    1 
ATOM   3827  C  CG    . GLN F 2 27  ? -43.346 -5.511  55.117 1.00 105.16 ? 27   GLN F CG    1 
ATOM   3828  C  CD    . GLN F 2 27  ? -42.920 -6.282  56.377 1.00 105.86 ? 27   GLN F CD    1 
ATOM   3829  O  OE1   . GLN F 2 27  ? -43.002 -7.511  56.436 1.00 106.35 ? 27   GLN F OE1   1 
ATOM   3830  N  NE2   . GLN F 2 27  ? -42.457 -5.552  57.387 1.00 105.51 ? 27   GLN F NE2   1 
ATOM   3831  N  N     . GLY F 2 28  ? -45.673 -8.004  51.630 1.00 105.36 ? 28   GLY F N     1 
ATOM   3832  C  CA    . GLY F 2 28  ? -46.681 -8.855  50.999 1.00 105.57 ? 28   GLY F CA    1 
ATOM   3833  C  C     . GLY F 2 28  ? -46.262 -10.317 50.936 1.00 105.67 ? 28   GLY F C     1 
ATOM   3834  O  O     . GLY F 2 28  ? -47.061 -11.186 50.571 1.00 105.82 ? 28   GLY F O     1 
ATOM   3835  N  N     . ILE F 2 29  ? -44.997 -10.582 51.266 1.00 105.54 ? 29   ILE F N     1 
ATOM   3836  C  CA    . ILE F 2 29  ? -44.505 -11.943 51.441 1.00 105.10 ? 29   ILE F CA    1 
ATOM   3837  C  C     . ILE F 2 29  ? -44.989 -12.359 52.826 1.00 105.00 ? 29   ILE F C     1 
ATOM   3838  O  O     . ILE F 2 29  ? -44.367 -12.046 53.850 1.00 105.03 ? 29   ILE F O     1 
ATOM   3839  C  CB    . ILE F 2 29  ? -42.955 -12.032 51.283 1.00 104.94 ? 29   ILE F CB    1 
ATOM   3840  C  CG1   . ILE F 2 29  ? -42.517 -11.580 49.885 1.00 104.70 ? 29   ILE F CG1   1 
ATOM   3841  C  CG2   . ILE F 2 29  ? -42.443 -13.441 51.545 1.00 104.82 ? 29   ILE F CG2   1 
ATOM   3842  C  CD1   . ILE F 2 29  ? -43.133 -12.357 48.724 1.00 103.94 ? 29   ILE F CD1   1 
ATOM   3843  N  N     . THR F 2 30  ? -46.133 -13.036 52.840 1.00 104.74 ? 30   THR F N     1 
ATOM   3844  C  CA    . THR F 2 30  ? -46.870 -13.287 54.073 1.00 104.49 ? 30   THR F CA    1 
ATOM   3845  C  C     . THR F 2 30  ? -46.115 -14.242 54.997 1.00 104.35 ? 30   THR F C     1 
ATOM   3846  O  O     . THR F 2 30  ? -45.467 -15.191 54.536 1.00 104.46 ? 30   THR F O     1 
ATOM   3847  C  CB    . THR F 2 30  ? -48.322 -13.796 53.794 1.00 104.40 ? 30   THR F CB    1 
ATOM   3848  O  OG1   . THR F 2 30  ? -48.285 -15.096 53.195 1.00 104.82 ? 30   THR F OG1   1 
ATOM   3849  C  CG2   . THR F 2 30  ? -49.070 -12.851 52.861 1.00 104.14 ? 30   THR F CG2   1 
ATOM   3850  N  N     . LYS F 2 31  ? -46.186 -13.959 56.295 1.00 103.91 ? 31   LYS F N     1 
ATOM   3851  C  CA    . LYS F 2 31  ? -45.697 -14.857 57.335 1.00 103.65 ? 31   LYS F CA    1 
ATOM   3852  C  C     . LYS F 2 31  ? -46.082 -16.330 57.063 1.00 103.44 ? 31   LYS F C     1 
ATOM   3853  O  O     . LYS F 2 31  ? -45.205 -17.192 57.021 1.00 103.66 ? 31   LYS F O     1 
ATOM   3854  C  CB    . LYS F 2 31  ? -46.183 -14.371 58.711 1.00 103.72 ? 31   LYS F CB    1 
ATOM   3855  C  CG    . LYS F 2 31  ? -45.900 -15.291 59.894 1.00 104.05 ? 31   LYS F CG    1 
ATOM   3856  C  CD    . LYS F 2 31  ? -46.951 -15.121 60.989 1.00 105.02 ? 31   LYS F CD    1 
ATOM   3857  C  CE    . LYS F 2 31  ? -46.413 -15.482 62.375 1.00 105.55 ? 31   LYS F CE    1 
ATOM   3858  N  NZ    . LYS F 2 31  ? -45.815 -14.316 63.104 1.00 105.38 ? 31   LYS F NZ    1 
ATOM   3859  N  N     . PRO F 2 32  ? -47.382 -16.628 56.849 1.00 103.23 ? 32   PRO F N     1 
ATOM   3860  C  CA    . PRO F 2 32  ? -47.736 -18.028 56.575 1.00 103.04 ? 32   PRO F CA    1 
ATOM   3861  C  C     . PRO F 2 32  ? -46.987 -18.640 55.393 1.00 102.84 ? 32   PRO F C     1 
ATOM   3862  O  O     . PRO F 2 32  ? -46.617 -19.816 55.443 1.00 102.94 ? 32   PRO F O     1 
ATOM   3863  C  CB    . PRO F 2 32  ? -49.239 -17.962 56.259 1.00 102.97 ? 32   PRO F CB    1 
ATOM   3864  C  CG    . PRO F 2 32  ? -49.522 -16.528 55.983 1.00 103.04 ? 32   PRO F CG    1 
ATOM   3865  C  CD    . PRO F 2 32  ? -48.580 -15.768 56.847 1.00 103.13 ? 32   PRO F CD    1 
ATOM   3866  N  N     . ALA F 2 33  ? -46.782 -17.850 54.341 1.00 102.58 ? 33   ALA F N     1 
ATOM   3867  C  CA    . ALA F 2 33  ? -46.072 -18.313 53.152 1.00 102.30 ? 33   ALA F CA    1 
ATOM   3868  C  C     . ALA F 2 33  ? -44.642 -18.719 53.519 1.00 102.11 ? 33   ALA F C     1 
ATOM   3869  O  O     . ALA F 2 33  ? -44.195 -19.826 53.195 1.00 102.06 ? 33   ALA F O     1 
ATOM   3870  C  CB    . ALA F 2 33  ? -46.080 -17.236 52.078 1.00 102.25 ? 33   ALA F CB    1 
ATOM   3871  N  N     . ILE F 2 34  ? -43.953 -17.820 54.222 1.00 101.56 ? 34   ILE F N     1 
ATOM   3872  C  CA    . ILE F 2 34  ? -42.623 -18.073 54.757 1.00 100.96 ? 34   ILE F CA    1 
ATOM   3873  C  C     . ILE F 2 34  ? -42.616 -19.295 55.676 1.00 100.84 ? 34   ILE F C     1 
ATOM   3874  O  O     . ILE F 2 34  ? -41.642 -20.056 55.703 1.00 100.80 ? 34   ILE F O     1 
ATOM   3875  C  CB    . ILE F 2 34  ? -42.085 -16.829 55.496 1.00 100.91 ? 34   ILE F CB    1 
ATOM   3876  C  CG1   . ILE F 2 34  ? -42.031 -15.637 54.529 1.00 100.45 ? 34   ILE F CG1   1 
ATOM   3877  C  CG2   . ILE F 2 34  ? -40.711 -17.110 56.119 1.00 100.65 ? 34   ILE F CG2   1 
ATOM   3878  C  CD1   . ILE F 2 34  ? -41.808 -14.283 55.182 1.00 100.46 ? 34   ILE F CD1   1 
ATOM   3879  N  N     . ARG F 2 35  ? -43.708 -19.487 56.412 1.00 100.54 ? 35   ARG F N     1 
ATOM   3880  C  CA    . ARG F 2 35  ? -43.826 -20.626 57.311 1.00 100.53 ? 35   ARG F CA    1 
ATOM   3881  C  C     . ARG F 2 35  ? -43.840 -21.914 56.486 1.00 100.20 ? 35   ARG F C     1 
ATOM   3882  O  O     . ARG F 2 35  ? -43.120 -22.873 56.794 1.00 100.12 ? 35   ARG F O     1 
ATOM   3883  C  CB    . ARG F 2 35  ? -45.082 -20.506 58.183 1.00 100.42 ? 35   ARG F CB    1 
ATOM   3884  C  CG    . ARG F 2 35  ? -44.807 -20.555 59.688 1.00 100.96 ? 35   ARG F CG    1 
ATOM   3885  C  CD    . ARG F 2 35  ? -46.077 -20.292 60.533 1.00 101.17 ? 35   ARG F CD    1 
ATOM   3886  N  NE    . ARG F 2 35  ? -46.641 -21.536 61.063 1.00 102.29 ? 35   ARG F NE    1 
ATOM   3887  C  CZ    . ARG F 2 35  ? -47.503 -22.320 60.415 1.00 102.88 ? 35   ARG F CZ    1 
ATOM   3888  N  NH1   . ARG F 2 35  ? -47.935 -21.992 59.198 1.00 102.57 ? 35   ARG F NH1   1 
ATOM   3889  N  NH2   . ARG F 2 35  ? -47.938 -23.440 60.990 1.00 103.08 ? 35   ARG F NH2   1 
ATOM   3890  N  N     . ARG F 2 36  ? -44.640 -21.913 55.420 1.00 99.81  ? 36   ARG F N     1 
ATOM   3891  C  CA    . ARG F 2 36  ? -44.756 -23.072 54.536 1.00 99.43  ? 36   ARG F CA    1 
ATOM   3892  C  C     . ARG F 2 36  ? -43.409 -23.467 53.940 1.00 98.85  ? 36   ARG F C     1 
ATOM   3893  O  O     . ARG F 2 36  ? -43.064 -24.647 53.908 1.00 98.96  ? 36   ARG F O     1 
ATOM   3894  C  CB    . ARG F 2 36  ? -45.761 -22.806 53.416 1.00 99.47  ? 36   ARG F CB    1 
ATOM   3895  C  CG    . ARG F 2 36  ? -47.205 -22.731 53.883 1.00 100.03 ? 36   ARG F CG    1 
ATOM   3896  C  CD    . ARG F 2 36  ? -48.195 -22.756 52.707 1.00 99.78  ? 36   ARG F CD    1 
ATOM   3897  N  NE    . ARG F 2 36  ? -48.259 -21.498 51.958 1.00 100.34 ? 36   ARG F NE    1 
ATOM   3898  C  CZ    . ARG F 2 36  ? -48.869 -20.394 52.387 1.00 100.91 ? 36   ARG F CZ    1 
ATOM   3899  N  NH1   . ARG F 2 36  ? -49.459 -20.371 53.580 1.00 101.39 ? 36   ARG F NH1   1 
ATOM   3900  N  NH2   . ARG F 2 36  ? -48.880 -19.303 51.629 1.00 100.65 ? 36   ARG F NH2   1 
ATOM   3901  N  N     . LEU F 2 37  ? -42.652 -22.473 53.479 1.00 98.14  ? 37   LEU F N     1 
ATOM   3902  C  CA    . LEU F 2 37  ? -41.365 -22.714 52.830 1.00 97.21  ? 37   LEU F CA    1 
ATOM   3903  C  C     . LEU F 2 37  ? -40.411 -23.381 53.804 1.00 97.11  ? 37   LEU F C     1 
ATOM   3904  O  O     . LEU F 2 37  ? -39.768 -24.378 53.482 1.00 97.11  ? 37   LEU F O     1 
ATOM   3905  C  CB    . LEU F 2 37  ? -40.775 -21.414 52.291 1.00 96.77  ? 37   LEU F CB    1 
ATOM   3906  C  CG    . LEU F 2 37  ? -41.573 -20.734 51.179 1.00 95.86  ? 37   LEU F CG    1 
ATOM   3907  C  CD1   . LEU F 2 37  ? -41.185 -19.280 51.069 1.00 95.39  ? 37   LEU F CD1   1 
ATOM   3908  C  CD2   . LEU F 2 37  ? -41.409 -21.445 49.837 1.00 95.48  ? 37   LEU F CD2   1 
ATOM   3909  N  N     . ALA F 2 38  ? -40.351 -22.848 55.016 1.00 96.89  ? 38   ALA F N     1 
ATOM   3910  C  CA    . ALA F 2 38  ? -39.519 -23.443 56.043 1.00 96.56  ? 38   ALA F CA    1 
ATOM   3911  C  C     . ALA F 2 38  ? -39.972 -24.868 56.382 1.00 96.29  ? 38   ALA F C     1 
ATOM   3912  O  O     . ALA F 2 38  ? -39.144 -25.709 56.723 1.00 96.70  ? 38   ALA F O     1 
ATOM   3913  C  CB    . ALA F 2 38  ? -39.484 -22.556 57.277 1.00 96.57  ? 38   ALA F CB    1 
ATOM   3914  N  N     . ARG F 2 39  ? -41.271 -25.149 56.267 1.00 95.82  ? 39   ARG F N     1 
ATOM   3915  C  CA    . ARG F 2 39  ? -41.768 -26.505 56.515 1.00 95.41  ? 39   ARG F CA    1 
ATOM   3916  C  C     . ARG F 2 39  ? -41.265 -27.477 55.457 1.00 94.94  ? 39   ARG F C     1 
ATOM   3917  O  O     . ARG F 2 39  ? -40.778 -28.552 55.793 1.00 95.09  ? 39   ARG F O     1 
ATOM   3918  C  CB    . ARG F 2 39  ? -43.298 -26.552 56.595 1.00 95.62  ? 39   ARG F CB    1 
ATOM   3919  C  CG    . ARG F 2 39  ? -43.895 -26.001 57.885 1.00 96.20  ? 39   ARG F CG    1 
ATOM   3920  C  CD    . ARG F 2 39  ? -43.723 -26.955 59.068 1.00 96.74  ? 39   ARG F CD    1 
ATOM   3921  N  NE    . ARG F 2 39  ? -44.491 -26.522 60.236 1.00 97.81  ? 39   ARG F NE    1 
ATOM   3922  C  CZ    . ARG F 2 39  ? -44.120 -25.557 61.079 1.00 99.03  ? 39   ARG F CZ    1 
ATOM   3923  N  NH1   . ARG F 2 39  ? -42.982 -24.902 60.897 1.00 98.85  ? 39   ARG F NH1   1 
ATOM   3924  N  NH2   . ARG F 2 39  ? -44.898 -25.239 62.111 1.00 99.83  ? 39   ARG F NH2   1 
ATOM   3925  N  N     . ARG F 2 40  ? -41.387 -27.095 54.186 1.00 94.32  ? 40   ARG F N     1 
ATOM   3926  C  CA    . ARG F 2 40  ? -40.788 -27.843 53.081 1.00 93.93  ? 40   ARG F CA    1 
ATOM   3927  C  C     . ARG F 2 40  ? -39.275 -27.857 53.257 1.00 93.93  ? 40   ARG F C     1 
ATOM   3928  O  O     . ARG F 2 40  ? -38.582 -28.726 52.729 1.00 93.96  ? 40   ARG F O     1 
ATOM   3929  C  CB    . ARG F 2 40  ? -41.158 -27.191 51.749 1.00 93.84  ? 40   ARG F CB    1 
ATOM   3930  C  CG    . ARG F 2 40  ? -40.512 -27.796 50.518 1.00 93.38  ? 40   ARG F CG    1 
ATOM   3931  C  CD    . ARG F 2 40  ? -41.152 -27.252 49.263 1.00 94.37  ? 40   ARG F CD    1 
ATOM   3932  N  NE    . ARG F 2 40  ? -42.432 -27.901 48.973 1.00 95.59  ? 40   ARG F NE    1 
ATOM   3933  C  CZ    . ARG F 2 40  ? -43.390 -27.387 48.203 1.00 96.38  ? 40   ARG F CZ    1 
ATOM   3934  N  NH1   . ARG F 2 40  ? -43.227 -26.196 47.633 1.00 95.73  ? 40   ARG F NH1   1 
ATOM   3935  N  NH2   . ARG F 2 40  ? -44.520 -28.065 48.006 1.00 96.53  ? 40   ARG F NH2   1 
ATOM   3936  N  N     . GLY F 2 41  ? -38.779 -26.880 54.014 1.00 93.89  ? 41   GLY F N     1 
ATOM   3937  C  CA    . GLY F 2 41  ? -37.366 -26.775 54.351 1.00 93.77  ? 41   GLY F CA    1 
ATOM   3938  C  C     . GLY F 2 41  ? -36.924 -27.764 55.408 1.00 93.62  ? 41   GLY F C     1 
ATOM   3939  O  O     . GLY F 2 41  ? -35.727 -27.979 55.583 1.00 93.96  ? 41   GLY F O     1 
ATOM   3940  N  N     . GLY F 2 42  ? -37.883 -28.363 56.110 1.00 93.36  ? 42   GLY F N     1 
ATOM   3941  C  CA    . GLY F 2 42  ? -37.591 -29.315 57.185 1.00 93.31  ? 42   GLY F CA    1 
ATOM   3942  C  C     . GLY F 2 42  ? -37.596 -28.683 58.567 1.00 93.43  ? 42   GLY F C     1 
ATOM   3943  O  O     . GLY F 2 42  ? -37.357 -29.365 59.569 1.00 93.07  ? 42   GLY F O     1 
ATOM   3944  N  N     . VAL F 2 43  ? -37.885 -27.380 58.599 1.00 93.60  ? 43   VAL F N     1 
ATOM   3945  C  CA    . VAL F 2 43  ? -37.844 -26.536 59.799 1.00 94.13  ? 43   VAL F CA    1 
ATOM   3946  C  C     . VAL F 2 43  ? -39.078 -26.691 60.690 1.00 94.39  ? 43   VAL F C     1 
ATOM   3947  O  O     . VAL F 2 43  ? -40.206 -26.592 60.207 1.00 94.35  ? 43   VAL F O     1 
ATOM   3948  C  CB    . VAL F 2 43  ? -37.741 -25.056 59.388 1.00 94.18  ? 43   VAL F CB    1 
ATOM   3949  C  CG1   . VAL F 2 43  ? -38.090 -24.124 60.550 1.00 94.36  ? 43   VAL F CG1   1 
ATOM   3950  C  CG2   . VAL F 2 43  ? -36.359 -24.751 58.803 1.00 94.38  ? 43   VAL F CG2   1 
ATOM   3951  N  N     . LYS F 2 44  ? -38.862 -26.897 61.991 1.00 94.68  ? 44   LYS F N     1 
ATOM   3952  C  CA    . LYS F 2 44  ? -39.968 -27.171 62.910 1.00 95.00  ? 44   LYS F CA    1 
ATOM   3953  C  C     . LYS F 2 44  ? -40.451 -25.956 63.708 1.00 95.25  ? 44   LYS F C     1 
ATOM   3954  O  O     . LYS F 2 44  ? -41.664 -25.695 63.783 1.00 95.30  ? 44   LYS F O     1 
ATOM   3955  C  CB    . LYS F 2 44  ? -39.624 -28.321 63.856 1.00 95.02  ? 44   LYS F CB    1 
ATOM   3956  C  CG    . LYS F 2 44  ? -40.830 -28.831 64.628 1.00 95.73  ? 44   LYS F CG    1 
ATOM   3957  C  CD    . LYS F 2 44  ? -40.427 -29.696 65.808 1.00 97.24  ? 44   LYS F CD    1 
ATOM   3958  C  CE    . LYS F 2 44  ? -41.551 -29.774 66.840 1.00 97.33  ? 44   LYS F CE    1 
ATOM   3959  N  NZ    . LYS F 2 44  ? -41.592 -31.126 67.481 1.00 98.15  ? 44   LYS F NZ    1 
ATOM   3960  N  N     . ARG F 2 45  ? -39.513 -25.223 64.304 1.00 95.14  ? 45   ARG F N     1 
ATOM   3961  C  CA    . ARG F 2 45  ? -39.863 -24.088 65.149 1.00 95.24  ? 45   ARG F CA    1 
ATOM   3962  C  C     . ARG F 2 45  ? -39.263 -22.787 64.614 1.00 94.49  ? 45   ARG F C     1 
ATOM   3963  O  O     . ARG F 2 45  ? -38.089 -22.742 64.253 1.00 94.36  ? 45   ARG F O     1 
ATOM   3964  C  CB    . ARG F 2 45  ? -39.439 -24.354 66.602 1.00 95.35  ? 45   ARG F CB    1 
ATOM   3965  C  CG    . ARG F 2 45  ? -40.267 -23.584 67.643 1.00 96.34  ? 45   ARG F CG    1 
ATOM   3966  C  CD    . ARG F 2 45  ? -39.848 -23.907 69.080 1.00 96.62  ? 45   ARG F CD    1 
ATOM   3967  N  NE    . ARG F 2 45  ? -40.581 -23.110 70.067 1.00 99.99  ? 45   ARG F NE    1 
ATOM   3968  C  CZ    . ARG F 2 45  ? -40.325 -21.833 70.362 1.00 101.81 ? 45   ARG F CZ    1 
ATOM   3969  N  NH1   . ARG F 2 45  ? -39.347 -21.179 69.751 1.00 103.10 ? 45   ARG F NH1   1 
ATOM   3970  N  NH2   . ARG F 2 45  ? -41.053 -21.199 71.275 1.00 102.75 ? 45   ARG F NH2   1 
ATOM   3971  N  N     . ILE F 2 46  ? -40.070 -21.730 64.571 1.00 93.85  ? 46   ILE F N     1 
ATOM   3972  C  CA    . ILE F 2 46  ? -39.648 -20.472 63.946 1.00 93.38  ? 46   ILE F CA    1 
ATOM   3973  C  C     . ILE F 2 46  ? -39.724 -19.240 64.865 1.00 92.90  ? 46   ILE F C     1 
ATOM   3974  O  O     . ILE F 2 46  ? -40.811 -18.840 65.295 1.00 92.86  ? 46   ILE F O     1 
ATOM   3975  C  CB    . ILE F 2 46  ? -40.437 -20.207 62.620 1.00 93.43  ? 46   ILE F CB    1 
ATOM   3976  C  CG1   . ILE F 2 46  ? -40.152 -21.300 61.586 1.00 93.46  ? 46   ILE F CG1   1 
ATOM   3977  C  CG2   . ILE F 2 46  ? -40.114 -18.822 62.026 1.00 93.54  ? 46   ILE F CG2   1 
ATOM   3978  C  CD1   . ILE F 2 46  ? -40.990 -21.181 60.318 1.00 93.59  ? 46   ILE F CD1   1 
ATOM   3979  N  N     . SER F 2 47  ? -38.561 -18.641 65.133 1.00 92.19  ? 47   SER F N     1 
ATOM   3980  C  CA    . SER F 2 47  ? -38.460 -17.345 65.802 1.00 91.73  ? 47   SER F CA    1 
ATOM   3981  C  C     . SER F 2 47  ? -39.185 -16.252 65.021 1.00 91.56  ? 47   SER F C     1 
ATOM   3982  O  O     . SER F 2 47  ? -39.429 -16.398 63.833 1.00 91.90  ? 47   SER F O     1 
ATOM   3983  C  CB    . SER F 2 47  ? -36.987 -16.961 65.983 1.00 91.74  ? 47   SER F CB    1 
ATOM   3984  O  OG    . SER F 2 47  ? -36.810 -15.547 65.978 1.00 91.55  ? 47   SER F OG    1 
ATOM   3985  N  N     . GLY F 2 48  ? -39.500 -15.148 65.688 1.00 91.30  ? 48   GLY F N     1 
ATOM   3986  C  CA    . GLY F 2 48  ? -40.261 -14.064 65.079 1.00 91.12  ? 48   GLY F CA    1 
ATOM   3987  C  C     . GLY F 2 48  ? -39.492 -13.227 64.079 1.00 91.18  ? 48   GLY F C     1 
ATOM   3988  O  O     . GLY F 2 48  ? -40.054 -12.772 63.077 1.00 91.23  ? 48   GLY F O     1 
ATOM   3989  N  N     . LEU F 2 49  ? -38.204 -13.023 64.338 1.00 91.21  ? 49   LEU F N     1 
ATOM   3990  C  CA    . LEU F 2 49  ? -37.409 -12.110 63.514 1.00 91.26  ? 49   LEU F CA    1 
ATOM   3991  C  C     . LEU F 2 49  ? -36.951 -12.749 62.197 1.00 91.16  ? 49   LEU F C     1 
ATOM   3992  O  O     . LEU F 2 49  ? -36.561 -12.041 61.263 1.00 91.29  ? 49   LEU F O     1 
ATOM   3993  C  CB    . LEU F 2 49  ? -36.212 -11.550 64.286 1.00 91.37  ? 49   LEU F CB    1 
ATOM   3994  C  CG    . LEU F 2 49  ? -36.352 -11.137 65.748 1.00 90.90  ? 49   LEU F CG    1 
ATOM   3995  C  CD1   . LEU F 2 49  ? -36.177 -12.330 66.664 1.00 90.88  ? 49   LEU F CD1   1 
ATOM   3996  C  CD2   . LEU F 2 49  ? -35.294 -10.099 66.048 1.00 91.50  ? 49   LEU F CD2   1 
ATOM   3997  N  N     . ILE F 2 50  ? -36.992 -14.078 62.143 1.00 90.83  ? 50   ILE F N     1 
ATOM   3998  C  CA    . ILE F 2 50  ? -36.813 -14.831 60.909 1.00 90.76  ? 50   ILE F CA    1 
ATOM   3999  C  C     . ILE F 2 50  ? -37.554 -14.181 59.746 1.00 90.85  ? 50   ILE F C     1 
ATOM   4000  O  O     . ILE F 2 50  ? -36.949 -13.835 58.733 1.00 91.10  ? 50   ILE F O     1 
ATOM   4001  C  CB    . ILE F 2 50  ? -37.365 -16.268 61.064 1.00 90.97  ? 50   ILE F CB    1 
ATOM   4002  C  CG1   . ILE F 2 50  ? -36.518 -17.089 62.051 1.00 90.98  ? 50   ILE F CG1   1 
ATOM   4003  C  CG2   . ILE F 2 50  ? -37.521 -16.965 59.693 1.00 90.65  ? 50   ILE F CG2   1 
ATOM   4004  C  CD1   . ILE F 2 50  ? -35.135 -17.432 61.558 1.00 91.43  ? 50   ILE F CD1   1 
ATOM   4005  N  N     . TYR F 2 51  ? -38.865 -14.007 59.913 1.00 90.81  ? 51   TYR F N     1 
ATOM   4006  C  CA    . TYR F 2 51  ? -39.758 -13.526 58.851 1.00 90.39  ? 51   TYR F CA    1 
ATOM   4007  C  C     . TYR F 2 51  ? -39.191 -12.342 58.094 1.00 90.23  ? 51   TYR F C     1 
ATOM   4008  O  O     . TYR F 2 51  ? -39.085 -12.386 56.877 1.00 90.37  ? 51   TYR F O     1 
ATOM   4009  C  CB    . TYR F 2 51  ? -41.155 -13.225 59.415 1.00 90.38  ? 51   TYR F CB    1 
ATOM   4010  C  CG    . TYR F 2 51  ? -41.816 -14.470 59.960 1.00 90.26  ? 51   TYR F CG    1 
ATOM   4011  C  CD1   . TYR F 2 51  ? -41.855 -14.724 61.334 1.00 90.47  ? 51   TYR F CD1   1 
ATOM   4012  C  CD2   . TYR F 2 51  ? -42.353 -15.424 59.099 1.00 89.53  ? 51   TYR F CD2   1 
ATOM   4013  C  CE1   . TYR F 2 51  ? -42.438 -15.888 61.835 1.00 89.99  ? 51   TYR F CE1   1 
ATOM   4014  C  CE2   . TYR F 2 51  ? -42.926 -16.584 59.584 1.00 89.77  ? 51   TYR F CE2   1 
ATOM   4015  C  CZ    . TYR F 2 51  ? -42.973 -16.810 60.951 1.00 90.24  ? 51   TYR F CZ    1 
ATOM   4016  O  OH    . TYR F 2 51  ? -43.555 -17.969 61.419 1.00 90.84  ? 51   TYR F OH    1 
ATOM   4017  N  N     . GLU F 2 52  ? -38.804 -11.304 58.828 1.00 90.10  ? 52   GLU F N     1 
ATOM   4018  C  CA    . GLU F 2 52  ? -38.153 -10.135 58.249 1.00 89.87  ? 52   GLU F CA    1 
ATOM   4019  C  C     . GLU F 2 52  ? -36.804 -10.485 57.643 1.00 89.19  ? 52   GLU F C     1 
ATOM   4020  O  O     . GLU F 2 52  ? -36.452 -9.958  56.592 1.00 89.43  ? 52   GLU F O     1 
ATOM   4021  C  CB    . GLU F 2 52  ? -37.968 -9.031  59.298 1.00 90.29  ? 52   GLU F CB    1 
ATOM   4022  C  CG    . GLU F 2 52  ? -39.133 -8.062  59.411 1.00 91.78  ? 52   GLU F CG    1 
ATOM   4023  C  CD    . GLU F 2 52  ? -39.383 -7.307  58.120 1.00 93.89  ? 52   GLU F CD    1 
ATOM   4024  O  OE1   . GLU F 2 52  ? -38.615 -6.367  57.814 1.00 94.75  ? 52   GLU F OE1   1 
ATOM   4025  O  OE2   . GLU F 2 52  ? -40.352 -7.661  57.413 1.00 94.78  ? 52   GLU F OE2   1 
ATOM   4026  N  N     . GLU F 2 53  ? -36.048 -11.359 58.304 1.00 88.16  ? 53   GLU F N     1 
ATOM   4027  C  CA    . GLU F 2 53  ? -34.736 -11.753 57.791 1.00 87.32  ? 53   GLU F CA    1 
ATOM   4028  C  C     . GLU F 2 53  ? -34.870 -12.470 56.453 1.00 86.59  ? 53   GLU F C     1 
ATOM   4029  O  O     . GLU F 2 53  ? -34.144 -12.168 55.498 1.00 86.35  ? 53   GLU F O     1 
ATOM   4030  C  CB    . GLU F 2 53  ? -33.989 -12.613 58.804 1.00 87.13  ? 53   GLU F CB    1 
ATOM   4031  C  CG    . GLU F 2 53  ? -33.034 -11.818 59.656 1.00 87.88  ? 53   GLU F CG    1 
ATOM   4032  C  CD    . GLU F 2 53  ? -31.613 -11.806 59.110 1.00 88.78  ? 53   GLU F CD    1 
ATOM   4033  O  OE1   . GLU F 2 53  ? -30.675 -11.828 59.935 1.00 88.25  ? 53   GLU F OE1   1 
ATOM   4034  O  OE2   . GLU F 2 53  ? -31.429 -11.784 57.871 1.00 89.18  ? 53   GLU F OE2   1 
ATOM   4035  N  N     . THR F 2 54  ? -35.814 -13.404 56.395 1.00 85.53  ? 54   THR F N     1 
ATOM   4036  C  CA    . THR F 2 54  ? -36.188 -14.062 55.163 1.00 85.04  ? 54   THR F CA    1 
ATOM   4037  C  C     . THR F 2 54  ? -36.384 -13.040 54.045 1.00 84.53  ? 54   THR F C     1 
ATOM   4038  O  O     . THR F 2 54  ? -35.936 -13.253 52.909 1.00 84.47  ? 54   THR F O     1 
ATOM   4039  C  CB    . THR F 2 54  ? -37.484 -14.873 55.367 1.00 85.43  ? 54   THR F CB    1 
ATOM   4040  O  OG1   . THR F 2 54  ? -37.166 -16.141 55.958 1.00 85.77  ? 54   THR F OG1   1 
ATOM   4041  C  CG2   . THR F 2 54  ? -38.228 -15.102 54.049 1.00 85.23  ? 54   THR F CG2   1 
ATOM   4042  N  N     . ARG F 2 55  ? -37.028 -11.924 54.386 1.00 83.49  ? 55   ARG F N     1 
ATOM   4043  C  CA    . ARG F 2 55  ? -37.424 -10.922 53.411 1.00 82.69  ? 55   ARG F CA    1 
ATOM   4044  C  C     . ARG F 2 55  ? -36.246 -10.222 52.777 1.00 82.29  ? 55   ARG F C     1 
ATOM   4045  O  O     . ARG F 2 55  ? -36.130 -10.185 51.564 1.00 82.07  ? 55   ARG F O     1 
ATOM   4046  C  CB    . ARG F 2 55  ? -38.393 -9.920  54.024 1.00 82.59  ? 55   ARG F CB    1 
ATOM   4047  C  CG    . ARG F 2 55  ? -39.741 -10.525 54.302 1.00 82.52  ? 55   ARG F CG    1 
ATOM   4048  C  CD    . ARG F 2 55  ? -40.812 -9.489  54.622 1.00 82.83  ? 55   ARG F CD    1 
ATOM   4049  N  NE    . ARG F 2 55  ? -42.059 -10.174 54.950 1.00 82.63  ? 55   ARG F NE    1 
ATOM   4050  C  CZ    . ARG F 2 55  ? -42.519 -10.366 56.181 1.00 82.53  ? 55   ARG F CZ    1 
ATOM   4051  N  NH1   . ARG F 2 55  ? -41.869 -9.888  57.236 1.00 83.04  ? 55   ARG F NH1   1 
ATOM   4052  N  NH2   . ARG F 2 55  ? -43.656 -11.017 56.351 1.00 82.96  ? 55   ARG F NH2   1 
ATOM   4053  N  N     . GLY F 2 56  ? -35.366 -9.664  53.593 1.00 82.36  ? 56   GLY F N     1 
ATOM   4054  C  CA    . GLY F 2 56  ? -34.143 -9.037  53.069 1.00 82.62  ? 56   GLY F CA    1 
ATOM   4055  C  C     . GLY F 2 56  ? -33.380 -10.010 52.186 1.00 82.49  ? 56   GLY F C     1 
ATOM   4056  O  O     . GLY F 2 56  ? -32.988 -9.681  51.058 1.00 82.29  ? 56   GLY F O     1 
ATOM   4057  N  N     . VAL F 2 57  ? -33.215 -11.222 52.712 1.00 82.30  ? 57   VAL F N     1 
ATOM   4058  C  CA    . VAL F 2 57  ? -32.617 -12.337 52.000 1.00 82.00  ? 57   VAL F CA    1 
ATOM   4059  C  C     . VAL F 2 57  ? -33.249 -12.585 50.624 1.00 82.06  ? 57   VAL F C     1 
ATOM   4060  O  O     . VAL F 2 57  ? -32.530 -12.675 49.623 1.00 82.19  ? 57   VAL F O     1 
ATOM   4061  C  CB    . VAL F 2 57  ? -32.634 -13.598 52.873 1.00 81.65  ? 57   VAL F CB    1 
ATOM   4062  C  CG1   . VAL F 2 57  ? -32.553 -14.846 52.027 1.00 81.88  ? 57   VAL F CG1   1 
ATOM   4063  C  CG2   . VAL F 2 57  ? -31.477 -13.547 53.844 1.00 81.81  ? 57   VAL F CG2   1 
ATOM   4064  N  N     . LEU F 2 58  ? -34.578 -12.674 50.578 1.00 82.03  ? 58   LEU F N     1 
ATOM   4065  C  CA    . LEU F 2 58  ? -35.286 -12.936 49.327 1.00 82.00  ? 58   LEU F CA    1 
ATOM   4066  C  C     . LEU F 2 58  ? -35.133 -11.776 48.369 1.00 82.11  ? 58   LEU F C     1 
ATOM   4067  O  O     . LEU F 2 58  ? -34.981 -11.974 47.163 1.00 82.53  ? 58   LEU F O     1 
ATOM   4068  C  CB    . LEU F 2 58  ? -36.767 -13.197 49.588 1.00 82.04  ? 58   LEU F CB    1 
ATOM   4069  C  CG    . LEU F 2 58  ? -37.763 -13.196 48.419 1.00 82.13  ? 58   LEU F CG    1 
ATOM   4070  C  CD1   . LEU F 2 58  ? -37.448 -14.270 47.405 1.00 82.16  ? 58   LEU F CD1   1 
ATOM   4071  C  CD2   . LEU F 2 58  ? -39.183 -13.376 48.943 1.00 82.01  ? 58   LEU F CD2   1 
ATOM   4072  N  N     . LYS F 2 59  ? -35.189 -10.566 48.915 1.00 82.00  ? 59   LYS F N     1 
ATOM   4073  C  CA    . LYS F 2 59  ? -35.027 -9.346  48.142 1.00 81.95  ? 59   LYS F CA    1 
ATOM   4074  C  C     . LYS F 2 59  ? -33.665 -9.396  47.446 1.00 81.05  ? 59   LYS F C     1 
ATOM   4075  O  O     . LYS F 2 59  ? -33.594 -9.297  46.220 1.00 80.93  ? 59   LYS F O     1 
ATOM   4076  C  CB    . LYS F 2 59  ? -35.149 -8.124  49.076 1.00 82.57  ? 59   LYS F CB    1 
ATOM   4077  C  CG    . LYS F 2 59  ? -35.302 -6.736  48.415 1.00 82.79  ? 59   LYS F CG    1 
ATOM   4078  C  CD    . LYS F 2 59  ? -35.047 -5.644  49.463 1.00 83.21  ? 59   LYS F CD    1 
ATOM   4079  C  CE    . LYS F 2 59  ? -34.902 -4.220  48.877 1.00 85.53  ? 59   LYS F CE    1 
ATOM   4080  N  NZ    . LYS F 2 59  ? -36.173 -3.602  48.359 1.00 86.91  ? 59   LYS F NZ    1 
ATOM   4081  N  N     . VAL F 2 60  ? -32.606 -9.607  48.233 1.00 80.10  ? 60   VAL F N     1 
ATOM   4082  C  CA    . VAL F 2 60  ? -31.228 -9.664  47.725 1.00 79.14  ? 60   VAL F CA    1 
ATOM   4083  C  C     . VAL F 2 60  ? -31.129 -10.654 46.579 1.00 78.76  ? 60   VAL F C     1 
ATOM   4084  O  O     . VAL F 2 60  ? -30.479 -10.383 45.572 1.00 78.75  ? 60   VAL F O     1 
ATOM   4085  C  CB    . VAL F 2 60  ? -30.213 -10.053 48.833 1.00 78.82  ? 60   VAL F CB    1 
ATOM   4086  C  CG1   . VAL F 2 60  ? -28.886 -10.473 48.230 1.00 78.54  ? 60   VAL F CG1   1 
ATOM   4087  C  CG2   . VAL F 2 60  ? -30.000 -8.910  49.786 1.00 78.38  ? 60   VAL F CG2   1 
ATOM   4088  N  N     . PHE F 2 61  ? -31.796 -11.793 46.739 1.00 78.27  ? 61   PHE F N     1 
ATOM   4089  C  CA    . PHE F 2 61  ? -31.786 -12.841 45.737 1.00 78.13  ? 61   PHE F CA    1 
ATOM   4090  C  C     . PHE F 2 61  ? -32.375 -12.363 44.419 1.00 78.21  ? 61   PHE F C     1 
ATOM   4091  O  O     . PHE F 2 61  ? -31.729 -12.442 43.379 1.00 78.12  ? 61   PHE F O     1 
ATOM   4092  C  CB    . PHE F 2 61  ? -32.556 -14.047 46.242 1.00 78.34  ? 61   PHE F CB    1 
ATOM   4093  C  CG    . PHE F 2 61  ? -32.526 -15.216 45.310 1.00 78.82  ? 61   PHE F CG    1 
ATOM   4094  C  CD1   . PHE F 2 61  ? -31.382 -15.996 45.191 1.00 78.53  ? 61   PHE F CD1   1 
ATOM   4095  C  CD2   . PHE F 2 61  ? -33.645 -15.549 44.560 1.00 78.57  ? 61   PHE F CD2   1 
ATOM   4096  C  CE1   . PHE F 2 61  ? -31.347 -17.083 44.330 1.00 79.16  ? 61   PHE F CE1   1 
ATOM   4097  C  CE2   . PHE F 2 61  ? -33.620 -16.636 43.700 1.00 79.03  ? 61   PHE F CE2   1 
ATOM   4098  C  CZ    . PHE F 2 61  ? -32.467 -17.408 43.585 1.00 79.16  ? 61   PHE F CZ    1 
ATOM   4099  N  N     . LEU F 2 62  ? -33.603 -11.857 44.468 1.00 78.29  ? 62   LEU F N     1 
ATOM   4100  C  CA    . LEU F 2 62  ? -34.251 -11.351 43.269 1.00 77.97  ? 62   LEU F CA    1 
ATOM   4101  C  C     . LEU F 2 62  ? -33.473 -10.198 42.645 1.00 78.13  ? 62   LEU F C     1 
ATOM   4102  O  O     . LEU F 2 62  ? -33.248 -10.179 41.439 1.00 78.13  ? 62   LEU F O     1 
ATOM   4103  C  CB    . LEU F 2 62  ? -35.685 -10.943 43.565 1.00 77.35  ? 62   LEU F CB    1 
ATOM   4104  C  CG    . LEU F 2 62  ? -36.561 -12.132 43.927 1.00 76.96  ? 62   LEU F CG    1 
ATOM   4105  C  CD1   . LEU F 2 62  ? -37.804 -11.648 44.619 1.00 77.58  ? 62   LEU F CD1   1 
ATOM   4106  C  CD2   . LEU F 2 62  ? -36.919 -12.952 42.709 1.00 76.11  ? 62   LEU F CD2   1 
ATOM   4107  N  N     . GLU F 2 63  ? -33.052 -9.243  43.460 1.00 78.16  ? 63   GLU F N     1 
ATOM   4108  C  CA    . GLU F 2 63  ? -32.348 -8.114  42.913 1.00 78.86  ? 63   GLU F CA    1 
ATOM   4109  C  C     . GLU F 2 63  ? -31.230 -8.644  42.032 1.00 78.92  ? 63   GLU F C     1 
ATOM   4110  O  O     . GLU F 2 63  ? -31.226 -8.387  40.824 1.00 78.96  ? 63   GLU F O     1 
ATOM   4111  C  CB    . GLU F 2 63  ? -31.789 -7.209  44.004 1.00 78.95  ? 63   GLU F CB    1 
ATOM   4112  C  CG    . GLU F 2 63  ? -32.822 -6.577  44.929 1.00 79.51  ? 63   GLU F CG    1 
ATOM   4113  C  CD    . GLU F 2 63  ? -32.169 -5.844  46.101 1.00 80.15  ? 63   GLU F CD    1 
ATOM   4114  O  OE1   . GLU F 2 63  ? -30.938 -6.021  46.309 1.00 82.92  ? 63   GLU F OE1   1 
ATOM   4115  O  OE2   . GLU F 2 63  ? -32.873 -5.087  46.806 1.00 80.17  ? 63   GLU F OE2   1 
ATOM   4116  N  N     . ASN F 2 64  ? -30.308 -9.412  42.615 1.00 78.91  ? 64   ASN F N     1 
ATOM   4117  C  CA    . ASN F 2 64  ? -29.164 -9.897  41.849 1.00 79.26  ? 64   ASN F CA    1 
ATOM   4118  C  C     . ASN F 2 64  ? -29.597 -10.605 40.554 1.00 79.21  ? 64   ASN F C     1 
ATOM   4119  O  O     . ASN F 2 64  ? -29.076 -10.314 39.468 1.00 79.38  ? 64   ASN F O     1 
ATOM   4120  C  CB    . ASN F 2 64  ? -28.276 -10.799 42.702 1.00 79.40  ? 64   ASN F CB    1 
ATOM   4121  C  CG    . ASN F 2 64  ? -27.588 -10.051 43.837 1.00 79.69  ? 64   ASN F CG    1 
ATOM   4122  O  OD1   . ASN F 2 64  ? -26.805 -9.120  43.616 1.00 79.74  ? 64   ASN F OD1   1 
ATOM   4123  N  ND2   . ASN F 2 64  ? -27.858 -10.479 45.065 1.00 79.63  ? 64   ASN F ND2   1 
ATOM   4124  N  N     . VAL F 2 65  ? -30.578 -11.501 40.678 1.00 78.90  ? 65   VAL F N     1 
ATOM   4125  C  CA    . VAL F 2 65  ? -31.103 -12.262 39.538 1.00 78.55  ? 65   VAL F CA    1 
ATOM   4126  C  C     . VAL F 2 65  ? -31.777 -11.356 38.514 1.00 78.44  ? 65   VAL F C     1 
ATOM   4127  O  O     . VAL F 2 65  ? -31.609 -11.547 37.306 1.00 78.77  ? 65   VAL F O     1 
ATOM   4128  C  CB    . VAL F 2 65  ? -32.083 -13.367 39.978 1.00 78.41  ? 65   VAL F CB    1 
ATOM   4129  C  CG1   . VAL F 2 65  ? -32.742 -14.013 38.791 1.00 77.97  ? 65   VAL F CG1   1 
ATOM   4130  C  CG2   . VAL F 2 65  ? -31.354 -14.424 40.745 1.00 78.65  ? 65   VAL F CG2   1 
ATOM   4131  N  N     . ILE F 2 66  ? -32.515 -10.361 38.987 1.00 77.94  ? 66   ILE F N     1 
ATOM   4132  C  CA    . ILE F 2 66  ? -33.162 -9.422  38.076 1.00 77.52  ? 66   ILE F CA    1 
ATOM   4133  C  C     . ILE F 2 66  ? -32.189 -8.393  37.481 1.00 77.17  ? 66   ILE F C     1 
ATOM   4134  O  O     . ILE F 2 66  ? -32.353 -7.975  36.340 1.00 76.95  ? 66   ILE F O     1 
ATOM   4135  C  CB    . ILE F 2 66  ? -34.384 -8.765  38.721 1.00 77.37  ? 66   ILE F CB    1 
ATOM   4136  C  CG1   . ILE F 2 66  ? -35.444 -9.837  39.018 1.00 77.77  ? 66   ILE F CG1   1 
ATOM   4137  C  CG2   . ILE F 2 66  ? -34.948 -7.695  37.812 1.00 77.19  ? 66   ILE F CG2   1 
ATOM   4138  C  CD1   . ILE F 2 66  ? -36.558 -9.403  39.976 1.00 77.72  ? 66   ILE F CD1   1 
ATOM   4139  N  N     . ARG F 2 67  ? -31.178 -7.994  38.241 1.00 77.01  ? 67   ARG F N     1 
ATOM   4140  C  CA    . ARG F 2 67  ? -30.151 -7.096  37.711 1.00 77.32  ? 67   ARG F CA    1 
ATOM   4141  C  C     . ARG F 2 67  ? -29.491 -7.740  36.483 1.00 77.00  ? 67   ARG F C     1 
ATOM   4142  O  O     . ARG F 2 67  ? -29.430 -7.141  35.407 1.00 76.47  ? 67   ARG F O     1 
ATOM   4143  C  CB    . ARG F 2 67  ? -29.118 -6.773  38.791 1.00 77.19  ? 67   ARG F CB    1 
ATOM   4144  C  CG    . ARG F 2 67  ? -27.939 -5.921  38.330 1.00 77.41  ? 67   ARG F CG    1 
ATOM   4145  C  CD    . ARG F 2 67  ? -26.863 -5.831  39.428 1.00 78.23  ? 67   ARG F CD    1 
ATOM   4146  N  NE    . ARG F 2 67  ? -27.293 -4.914  40.490 1.00 81.34  ? 67   ARG F NE    1 
ATOM   4147  C  CZ    . ARG F 2 67  ? -27.836 -5.277  41.657 1.00 80.86  ? 67   ARG F CZ    1 
ATOM   4148  N  NH1   . ARG F 2 67  ? -28.002 -6.564  41.970 1.00 80.00  ? 67   ARG F NH1   1 
ATOM   4149  N  NH2   . ARG F 2 67  ? -28.209 -4.335  42.520 1.00 80.07  ? 67   ARG F NH2   1 
ATOM   4150  N  N     . ASP F 2 68  ? -29.017 -8.970  36.664 1.00 77.12  ? 68   ASP F N     1 
ATOM   4151  C  CA    . ASP F 2 68  ? -28.463 -9.764  35.578 1.00 77.41  ? 68   ASP F CA    1 
ATOM   4152  C  C     . ASP F 2 68  ? -29.509 -9.969  34.457 1.00 77.89  ? 68   ASP F C     1 
ATOM   4153  O  O     . ASP F 2 68  ? -29.216 -9.732  33.270 1.00 77.60  ? 68   ASP F O     1 
ATOM   4154  C  CB    . ASP F 2 68  ? -27.998 -11.115 36.115 1.00 77.12  ? 68   ASP F CB    1 
ATOM   4155  C  CG    . ASP F 2 68  ? -26.552 -11.106 36.647 1.00 77.61  ? 68   ASP F CG    1 
ATOM   4156  O  OD1   . ASP F 2 68  ? -25.924 -10.028 36.867 1.00 76.49  ? 68   ASP F OD1   1 
ATOM   4157  O  OD2   . ASP F 2 68  ? -26.042 -12.235 36.854 1.00 76.72  ? 68   ASP F OD2   1 
ATOM   4158  N  N     . ALA F 2 69  ? -30.720 -10.400 34.838 1.00 77.93  ? 69   ALA F N     1 
ATOM   4159  C  CA    . ALA F 2 69  ? -31.810 -10.618 33.878 1.00 78.07  ? 69   ALA F CA    1 
ATOM   4160  C  C     . ALA F 2 69  ? -32.025 -9.393  33.011 1.00 78.32  ? 69   ALA F C     1 
ATOM   4161  O  O     . ALA F 2 69  ? -31.899 -9.453  31.790 1.00 78.26  ? 69   ALA F O     1 
ATOM   4162  C  CB    . ALA F 2 69  ? -33.116 -11.004 34.587 1.00 77.71  ? 69   ALA F CB    1 
ATOM   4163  N  N     . VAL F 2 70  ? -32.336 -8.274  33.650 1.00 78.89  ? 70   VAL F N     1 
ATOM   4164  C  CA    . VAL F 2 70  ? -32.660 -7.068  32.917 1.00 79.57  ? 70   VAL F CA    1 
ATOM   4165  C  C     . VAL F 2 70  ? -31.519 -6.741  31.953 1.00 80.10  ? 70   VAL F C     1 
ATOM   4166  O  O     . VAL F 2 70  ? -31.753 -6.542  30.768 1.00 80.45  ? 70   VAL F O     1 
ATOM   4167  C  CB    . VAL F 2 70  ? -33.037 -5.917  33.872 1.00 79.51  ? 70   VAL F CB    1 
ATOM   4168  C  CG1   . VAL F 2 70  ? -32.822 -4.565  33.236 1.00 80.27  ? 70   VAL F CG1   1 
ATOM   4169  C  CG2   . VAL F 2 70  ? -34.493 -6.057  34.293 1.00 79.66  ? 70   VAL F CG2   1 
ATOM   4170  N  N     . THR F 2 71  ? -30.285 -6.751  32.446 1.00 80.61  ? 71   THR F N     1 
ATOM   4171  C  CA    . THR F 2 71  ? -29.120 -6.501  31.609 1.00 80.95  ? 71   THR F CA    1 
ATOM   4172  C  C     . THR F 2 71  ? -29.200 -7.236  30.284 1.00 81.52  ? 71   THR F C     1 
ATOM   4173  O  O     . THR F 2 71  ? -28.839 -6.684  29.253 1.00 81.63  ? 71   THR F O     1 
ATOM   4174  C  CB    . THR F 2 71  ? -27.866 -6.924  32.320 1.00 80.74  ? 71   THR F CB    1 
ATOM   4175  O  OG1   . THR F 2 71  ? -27.827 -6.275  33.593 1.00 81.59  ? 71   THR F OG1   1 
ATOM   4176  C  CG2   . THR F 2 71  ? -26.620 -6.572  31.505 1.00 80.36  ? 71   THR F CG2   1 
ATOM   4177  N  N     . TYR F 2 72  ? -29.679 -8.477  30.318 1.00 82.26  ? 72   TYR F N     1 
ATOM   4178  C  CA    . TYR F 2 72  ? -29.866 -9.251  29.101 1.00 82.97  ? 72   TYR F CA    1 
ATOM   4179  C  C     . TYR F 2 72  ? -30.944 -8.598  28.231 1.00 84.41  ? 72   TYR F C     1 
ATOM   4180  O  O     . TYR F 2 72  ? -30.726 -8.384  27.032 1.00 84.69  ? 72   TYR F O     1 
ATOM   4181  C  CB    . TYR F 2 72  ? -30.166 -10.734 29.408 1.00 82.12  ? 72   TYR F CB    1 
ATOM   4182  C  CG    . TYR F 2 72  ? -28.931 -11.544 29.806 1.00 80.98  ? 72   TYR F CG    1 
ATOM   4183  C  CD1   . TYR F 2 72  ? -28.909 -12.324 30.968 1.00 79.57  ? 72   TYR F CD1   1 
ATOM   4184  C  CD2   . TYR F 2 72  ? -27.783 -11.519 29.018 1.00 80.12  ? 72   TYR F CD2   1 
ATOM   4185  C  CE1   . TYR F 2 72  ? -27.771 -13.059 31.326 1.00 79.44  ? 72   TYR F CE1   1 
ATOM   4186  C  CE2   . TYR F 2 72  ? -26.648 -12.239 29.365 1.00 80.20  ? 72   TYR F CE2   1 
ATOM   4187  C  CZ    . TYR F 2 72  ? -26.636 -13.008 30.511 1.00 80.14  ? 72   TYR F CZ    1 
ATOM   4188  O  OH    . TYR F 2 72  ? -25.482 -13.704 30.815 1.00 78.65  ? 72   TYR F OH    1 
ATOM   4189  N  N     . THR F 2 73  ? -32.077 -8.245  28.842 1.00 85.59  ? 73   THR F N     1 
ATOM   4190  C  CA    . THR F 2 73  ? -33.137 -7.536  28.135 1.00 86.92  ? 73   THR F CA    1 
ATOM   4191  C  C     . THR F 2 73  ? -32.618 -6.234  27.533 1.00 87.88  ? 73   THR F C     1 
ATOM   4192  O  O     . THR F 2 73  ? -32.737 -6.023  26.329 1.00 88.10  ? 73   THR F O     1 
ATOM   4193  C  CB    . THR F 2 73  ? -34.349 -7.254  29.039 1.00 86.96  ? 73   THR F CB    1 
ATOM   4194  O  OG1   . THR F 2 73  ? -34.472 -8.303  30.006 1.00 87.82  ? 73   THR F OG1   1 
ATOM   4195  C  CG2   . THR F 2 73  ? -35.631 -7.187  28.209 1.00 86.49  ? 73   THR F CG2   1 
ATOM   4196  N  N     . GLU F 2 74  ? -32.019 -5.377  28.354 1.00 89.19  ? 74   GLU F N     1 
ATOM   4197  C  CA    . GLU F 2 74  ? -31.440 -4.124  27.855 1.00 90.62  ? 74   GLU F CA    1 
ATOM   4198  C  C     . GLU F 2 74  ? -30.517 -4.395  26.675 1.00 90.88  ? 74   GLU F C     1 
ATOM   4199  O  O     . GLU F 2 74  ? -30.410 -3.564  25.776 1.00 91.50  ? 74   GLU F O     1 
ATOM   4200  C  CB    . GLU F 2 74  ? -30.654 -3.369  28.939 1.00 91.13  ? 74   GLU F CB    1 
ATOM   4201  C  CG    . GLU F 2 74  ? -31.416 -3.051  30.237 1.00 93.87  ? 74   GLU F CG    1 
ATOM   4202  C  CD    . GLU F 2 74  ? -31.856 -1.598  30.339 1.00 97.53  ? 74   GLU F CD    1 
ATOM   4203  O  OE1   . GLU F 2 74  ? -31.315 -0.886  31.214 1.00 99.00  ? 74   GLU F OE1   1 
ATOM   4204  O  OE2   . GLU F 2 74  ? -32.732 -1.161  29.550 1.00 99.34  ? 74   GLU F OE2   1 
ATOM   4205  N  N     . HIS F 2 75  ? -29.852 -5.550  26.671 1.00 91.01  ? 75   HIS F N     1 
ATOM   4206  C  CA    . HIS F 2 75  ? -28.897 -5.856  25.606 1.00 91.33  ? 75   HIS F CA    1 
ATOM   4207  C  C     . HIS F 2 75  ? -29.574 -6.492  24.397 1.00 91.69  ? 75   HIS F C     1 
ATOM   4208  O  O     . HIS F 2 75  ? -29.013 -6.517  23.304 1.00 91.48  ? 75   HIS F O     1 
ATOM   4209  C  CB    . HIS F 2 75  ? -27.742 -6.724  26.114 1.00 91.16  ? 75   HIS F CB    1 
ATOM   4210  C  CG    . HIS F 2 75  ? -26.694 -6.985  25.081 1.00 90.84  ? 75   HIS F CG    1 
ATOM   4211  N  ND1   . HIS F 2 75  ? -26.747 -8.064  24.229 1.00 91.11  ? 75   HIS F ND1   1 
ATOM   4212  C  CD2   . HIS F 2 75  ? -25.584 -6.292  24.739 1.00 90.78  ? 75   HIS F CD2   1 
ATOM   4213  C  CE1   . HIS F 2 75  ? -25.704 -8.037  23.419 1.00 90.79  ? 75   HIS F CE1   1 
ATOM   4214  N  NE2   . HIS F 2 75  ? -24.981 -6.972  23.709 1.00 90.82  ? 75   HIS F NE2   1 
ATOM   4215  N  N     . ALA F 2 76  ? -30.781 -7.006  24.611 1.00 92.31  ? 76   ALA F N     1 
ATOM   4216  C  CA    . ALA F 2 76  ? -31.604 -7.566  23.542 1.00 92.57  ? 76   ALA F CA    1 
ATOM   4217  C  C     . ALA F 2 76  ? -32.521 -6.490  22.990 1.00 92.91  ? 76   ALA F C     1 
ATOM   4218  O  O     . ALA F 2 76  ? -33.389 -6.770  22.159 1.00 93.04  ? 76   ALA F O     1 
ATOM   4219  C  CB    . ALA F 2 76  ? -32.427 -8.723  24.066 1.00 92.54  ? 76   ALA F CB    1 
ATOM   4220  N  N     . LYS F 2 77  ? -32.326 -5.263  23.471 1.00 93.13  ? 77   LYS F N     1 
ATOM   4221  C  CA    . LYS F 2 77  ? -33.135 -4.114  23.079 1.00 93.48  ? 77   LYS F CA    1 
ATOM   4222  C  C     . LYS F 2 77  ? -34.627 -4.449  23.140 1.00 93.42  ? 77   LYS F C     1 
ATOM   4223  O  O     . LYS F 2 77  ? -35.353 -4.244  22.179 1.00 93.45  ? 77   LYS F O     1 
ATOM   4224  C  CB    . LYS F 2 77  ? -32.738 -3.609  21.679 1.00 93.40  ? 77   LYS F CB    1 
ATOM   4225  C  CG    . LYS F 2 77  ? -31.318 -3.065  21.565 1.00 93.45  ? 77   LYS F CG    1 
ATOM   4226  C  CD    . LYS F 2 77  ? -30.936 -2.857  20.105 1.00 93.92  ? 77   LYS F CD    1 
ATOM   4227  C  CE    . LYS F 2 77  ? -29.467 -2.456  19.934 1.00 95.35  ? 77   LYS F CE    1 
ATOM   4228  N  NZ    . LYS F 2 77  ? -28.992 -2.545  18.495 1.00 95.17  ? 77   LYS F NZ    1 
ATOM   4229  N  N     . ARG F 2 78  ? -35.072 -4.976  24.270 1.00 93.56  ? 78   ARG F N     1 
ATOM   4230  C  CA    . ARG F 2 78  ? -36.468 -5.328  24.425 1.00 94.15  ? 78   ARG F CA    1 
ATOM   4231  C  C     . ARG F 2 78  ? -37.089 -4.652  25.639 1.00 94.50  ? 78   ARG F C     1 
ATOM   4232  O  O     . ARG F 2 78  ? -36.424 -4.418  26.642 1.00 94.30  ? 78   ARG F O     1 
ATOM   4233  C  CB    . ARG F 2 78  ? -36.629 -6.846  24.510 1.00 94.23  ? 78   ARG F CB    1 
ATOM   4234  C  CG    . ARG F 2 78  ? -36.575 -7.565  23.152 1.00 94.60  ? 78   ARG F CG    1 
ATOM   4235  C  CD    . ARG F 2 78  ? -36.916 -9.053  23.270 1.00 94.53  ? 78   ARG F CD    1 
ATOM   4236  N  NE    . ARG F 2 78  ? -35.791 -9.854  23.766 1.00 96.51  ? 78   ARG F NE    1 
ATOM   4237  C  CZ    . ARG F 2 78  ? -35.589 -10.195 25.041 1.00 96.88  ? 78   ARG F CZ    1 
ATOM   4238  N  NH1   . ARG F 2 78  ? -36.430 -9.811  25.991 1.00 97.34  ? 78   ARG F NH1   1 
ATOM   4239  N  NH2   . ARG F 2 78  ? -34.532 -10.924 25.374 1.00 96.96  ? 78   ARG F NH2   1 
ATOM   4240  N  N     . LYS F 2 79  ? -38.372 -4.322  25.531 1.00 95.11  ? 79   LYS F N     1 
ATOM   4241  C  CA    . LYS F 2 79  ? -39.116 -3.753  26.653 1.00 95.50  ? 79   LYS F CA    1 
ATOM   4242  C  C     . LYS F 2 79  ? -39.773 -4.872  27.455 1.00 95.63  ? 79   LYS F C     1 
ATOM   4243  O  O     . LYS F 2 79  ? -40.447 -4.625  28.459 1.00 95.93  ? 79   LYS F O     1 
ATOM   4244  C  CB    . LYS F 2 79  ? -40.152 -2.724  26.178 1.00 95.55  ? 79   LYS F CB    1 
ATOM   4245  C  CG    . LYS F 2 79  ? -39.539 -1.416  25.685 1.00 96.06  ? 79   LYS F CG    1 
ATOM   4246  C  CD    . LYS F 2 79  ? -40.485 -0.246  25.883 1.00 97.41  ? 79   LYS F CD    1 
ATOM   4247  C  CE    . LYS F 2 79  ? -39.896 1.059   25.346 1.00 98.20  ? 79   LYS F CE    1 
ATOM   4248  N  NZ    . LYS F 2 79  ? -40.954 2.065   25.031 1.00 98.64  ? 79   LYS F NZ    1 
ATOM   4249  N  N     . THR F 2 80  ? -39.547 -6.108  27.022 1.00 95.61  ? 80   THR F N     1 
ATOM   4250  C  CA    . THR F 2 80  ? -40.138 -7.258  27.690 1.00 95.62  ? 80   THR F CA    1 
ATOM   4251  C  C     . THR F 2 80  ? -39.098 -8.310  28.100 1.00 95.46  ? 80   THR F C     1 
ATOM   4252  O  O     . THR F 2 80  ? -38.608 -9.078  27.269 1.00 95.45  ? 80   THR F O     1 
ATOM   4253  C  CB    . THR F 2 80  ? -41.281 -7.870  26.842 1.00 95.65  ? 80   THR F CB    1 
ATOM   4254  O  OG1   . THR F 2 80  ? -42.251 -6.853  26.557 1.00 95.53  ? 80   THR F OG1   1 
ATOM   4255  C  CG2   . THR F 2 80  ? -41.959 -9.011  27.581 1.00 95.95  ? 80   THR F CG2   1 
ATOM   4256  N  N     . VAL F 2 81  ? -38.763 -8.311  29.391 1.00 95.25  ? 81   VAL F N     1 
ATOM   4257  C  CA    . VAL F 2 81  ? -37.958 -9.366  30.012 1.00 94.91  ? 81   VAL F CA    1 
ATOM   4258  C  C     . VAL F 2 81  ? -38.583 -10.737 29.726 1.00 94.88  ? 81   VAL F C     1 
ATOM   4259  O  O     . VAL F 2 81  ? -39.776 -10.965 29.996 1.00 94.92  ? 81   VAL F O     1 
ATOM   4260  C  CB    . VAL F 2 81  ? -37.838 -9.151  31.541 1.00 94.72  ? 81   VAL F CB    1 
ATOM   4261  C  CG1   . VAL F 2 81  ? -37.263 -10.377 32.220 1.00 94.38  ? 81   VAL F CG1   1 
ATOM   4262  C  CG2   . VAL F 2 81  ? -36.991 -7.947  31.834 1.00 94.34  ? 81   VAL F CG2   1 
ATOM   4263  N  N     . THR F 2 82  ? -37.771 -11.634 29.169 1.00 94.49  ? 82   THR F N     1 
ATOM   4264  C  CA    . THR F 2 82  ? -38.234 -12.967 28.770 1.00 94.04  ? 82   THR F CA    1 
ATOM   4265  C  C     . THR F 2 82  ? -37.949 -13.991 29.856 1.00 93.18  ? 82   THR F C     1 
ATOM   4266  O  O     . THR F 2 82  ? -37.490 -13.636 30.938 1.00 93.29  ? 82   THR F O     1 
ATOM   4267  C  CB    . THR F 2 82  ? -37.553 -13.420 27.472 1.00 94.28  ? 82   THR F CB    1 
ATOM   4268  O  OG1   . THR F 2 82  ? -36.135 -13.236 27.593 1.00 95.20  ? 82   THR F OG1   1 
ATOM   4269  C  CG2   . THR F 2 82  ? -38.062 -12.608 26.292 1.00 94.63  ? 82   THR F CG2   1 
ATOM   4270  N  N     . ALA F 2 83  ? -38.237 -15.257 29.578 1.00 92.17  ? 83   ALA F N     1 
ATOM   4271  C  CA    . ALA F 2 83  ? -37.835 -16.330 30.482 1.00 91.20  ? 83   ALA F CA    1 
ATOM   4272  C  C     . ALA F 2 83  ? -36.345 -16.610 30.302 1.00 90.60  ? 83   ALA F C     1 
ATOM   4273  O  O     . ALA F 2 83  ? -35.631 -16.886 31.257 1.00 90.62  ? 83   ALA F O     1 
ATOM   4274  C  CB    . ALA F 2 83  ? -38.648 -17.579 30.235 1.00 90.89  ? 83   ALA F CB    1 
ATOM   4275  N  N     . MET F 2 84  ? -35.880 -16.496 29.069 1.00 89.72  ? 84   MET F N     1 
ATOM   4276  C  CA    . MET F 2 84  ? -34.519 -16.848 28.735 1.00 89.30  ? 84   MET F CA    1 
ATOM   4277  C  C     . MET F 2 84  ? -33.481 -15.911 29.358 1.00 89.00  ? 84   MET F C     1 
ATOM   4278  O  O     . MET F 2 84  ? -32.357 -16.324 29.642 1.00 88.39  ? 84   MET F O     1 
ATOM   4279  C  CB    . MET F 2 84  ? -34.370 -16.937 27.218 1.00 89.34  ? 84   MET F CB    1 
ATOM   4280  C  CG    . MET F 2 84  ? -35.291 -17.987 26.600 1.00 88.93  ? 84   MET F CG    1 
ATOM   4281  S  SD    . MET F 2 84  ? -35.022 -19.606 27.340 1.00 88.17  ? 84   MET F SD    1 
ATOM   4282  C  CE    . MET F 2 84  ? -33.303 -19.852 26.846 1.00 88.32  ? 84   MET F CE    1 
ATOM   4283  N  N     . ASP F 2 85  ? -33.873 -14.660 29.584 1.00 88.66  ? 85   ASP F N     1 
ATOM   4284  C  CA    . ASP F 2 85  ? -33.034 -13.728 30.322 1.00 88.33  ? 85   ASP F CA    1 
ATOM   4285  C  C     . ASP F 2 85  ? -32.915 -14.225 31.745 1.00 87.62  ? 85   ASP F C     1 
ATOM   4286  O  O     . ASP F 2 85  ? -31.803 -14.404 32.245 1.00 88.05  ? 85   ASP F O     1 
ATOM   4287  C  CB    . ASP F 2 85  ? -33.626 -12.326 30.297 1.00 88.80  ? 85   ASP F CB    1 
ATOM   4288  C  CG    . ASP F 2 85  ? -33.676 -11.738 28.898 1.00 90.16  ? 85   ASP F CG    1 
ATOM   4289  O  OD1   . ASP F 2 85  ? -33.177 -12.388 27.941 1.00 91.21  ? 85   ASP F OD1   1 
ATOM   4290  O  OD2   . ASP F 2 85  ? -34.216 -10.618 28.758 1.00 91.64  ? 85   ASP F OD2   1 
ATOM   4291  N  N     . VAL F 2 86  ? -34.060 -14.481 32.380 1.00 86.30  ? 86   VAL F N     1 
ATOM   4292  C  CA    . VAL F 2 86  ? -34.083 -15.087 33.704 1.00 85.00  ? 86   VAL F CA    1 
ATOM   4293  C  C     . VAL F 2 86  ? -33.188 -16.324 33.700 1.00 84.09  ? 86   VAL F C     1 
ATOM   4294  O  O     . VAL F 2 86  ? -32.127 -16.315 34.320 1.00 84.38  ? 86   VAL F O     1 
ATOM   4295  C  CB    . VAL F 2 86  ? -35.499 -15.475 34.148 1.00 85.20  ? 86   VAL F CB    1 
ATOM   4296  C  CG1   . VAL F 2 86  ? -35.482 -15.927 35.594 1.00 85.64  ? 86   VAL F CG1   1 
ATOM   4297  C  CG2   . VAL F 2 86  ? -36.474 -14.311 33.973 1.00 85.13  ? 86   VAL F CG2   1 
ATOM   4298  N  N     . VAL F 2 87  ? -33.591 -17.365 32.974 1.00 82.45  ? 87   VAL F N     1 
ATOM   4299  C  CA    . VAL F 2 87  ? -32.769 -18.570 32.831 1.00 80.89  ? 87   VAL F CA    1 
ATOM   4300  C  C     . VAL F 2 87  ? -31.271 -18.253 32.675 1.00 79.94  ? 87   VAL F C     1 
ATOM   4301  O  O     . VAL F 2 87  ? -30.447 -18.876 33.335 1.00 80.04  ? 87   VAL F O     1 
ATOM   4302  C  CB    . VAL F 2 87  ? -33.269 -19.515 31.689 1.00 80.71  ? 87   VAL F CB    1 
ATOM   4303  C  CG1   . VAL F 2 87  ? -32.226 -20.562 31.344 1.00 80.26  ? 87   VAL F CG1   1 
ATOM   4304  C  CG2   . VAL F 2 87  ? -34.554 -20.205 32.092 1.00 80.13  ? 87   VAL F CG2   1 
ATOM   4305  N  N     . TYR F 2 88  ? -30.917 -17.286 31.838 1.00 78.82  ? 88   TYR F N     1 
ATOM   4306  C  CA    . TYR F 2 88  ? -29.502 -16.975 31.661 1.00 78.33  ? 88   TYR F CA    1 
ATOM   4307  C  C     . TYR F 2 88  ? -28.904 -16.382 32.919 1.00 78.26  ? 88   TYR F C     1 
ATOM   4308  O  O     . TYR F 2 88  ? -27.711 -16.580 33.205 1.00 78.76  ? 88   TYR F O     1 
ATOM   4309  C  CB    . TYR F 2 88  ? -29.243 -16.018 30.496 1.00 77.96  ? 88   TYR F CB    1 
ATOM   4310  C  CG    . TYR F 2 88  ? -29.462 -16.611 29.140 1.00 77.11  ? 88   TYR F CG    1 
ATOM   4311  C  CD1   . TYR F 2 88  ? -29.811 -15.806 28.063 1.00 76.98  ? 88   TYR F CD1   1 
ATOM   4312  C  CD2   . TYR F 2 88  ? -29.352 -17.981 28.934 1.00 76.19  ? 88   TYR F CD2   1 
ATOM   4313  C  CE1   . TYR F 2 88  ? -30.041 -16.354 26.807 1.00 77.91  ? 88   TYR F CE1   1 
ATOM   4314  C  CE2   . TYR F 2 88  ? -29.582 -18.539 27.694 1.00 76.95  ? 88   TYR F CE2   1 
ATOM   4315  C  CZ    . TYR F 2 88  ? -29.923 -17.725 26.629 1.00 77.60  ? 88   TYR F CZ    1 
ATOM   4316  O  OH    . TYR F 2 88  ? -30.130 -18.289 25.388 1.00 78.19  ? 88   TYR F OH    1 
ATOM   4317  N  N     . ALA F 2 89  ? -29.725 -15.643 33.655 1.00 77.49  ? 89   ALA F N     1 
ATOM   4318  C  CA    . ALA F 2 89  ? -29.260 -14.977 34.854 1.00 76.95  ? 89   ALA F CA    1 
ATOM   4319  C  C     . ALA F 2 89  ? -28.915 -16.030 35.897 1.00 76.48  ? 89   ALA F C     1 
ATOM   4320  O  O     . ALA F 2 89  ? -27.834 -16.014 36.493 1.00 76.46  ? 89   ALA F O     1 
ATOM   4321  C  CB    . ALA F 2 89  ? -30.325 -14.032 35.367 1.00 77.05  ? 89   ALA F CB    1 
ATOM   4322  N  N     . LEU F 2 90  ? -29.833 -16.970 36.083 1.00 75.87  ? 90   LEU F N     1 
ATOM   4323  C  CA    . LEU F 2 90  ? -29.661 -18.032 37.048 1.00 74.99  ? 90   LEU F CA    1 
ATOM   4324  C  C     . LEU F 2 90  ? -28.390 -18.828 36.755 1.00 75.16  ? 90   LEU F C     1 
ATOM   4325  O  O     . LEU F 2 90  ? -27.648 -19.179 37.677 1.00 75.50  ? 90   LEU F O     1 
ATOM   4326  C  CB    . LEU F 2 90  ? -30.904 -18.901 37.079 1.00 74.16  ? 90   LEU F CB    1 
ATOM   4327  C  CG    . LEU F 2 90  ? -32.142 -18.086 37.488 1.00 73.88  ? 90   LEU F CG    1 
ATOM   4328  C  CD1   . LEU F 2 90  ? -33.478 -18.730 37.075 1.00 73.14  ? 90   LEU F CD1   1 
ATOM   4329  C  CD2   . LEU F 2 90  ? -32.122 -17.800 38.978 1.00 72.39  ? 90   LEU F CD2   1 
ATOM   4330  N  N     . LYS F 2 91  ? -28.112 -19.076 35.478 1.00 74.94  ? 91   LYS F N     1 
ATOM   4331  C  CA    . LYS F 2 91  ? -26.891 -19.784 35.104 1.00 74.98  ? 91   LYS F CA    1 
ATOM   4332  C  C     . LYS F 2 91  ? -25.661 -18.988 35.538 1.00 75.09  ? 91   LYS F C     1 
ATOM   4333  O  O     . LYS F 2 91  ? -24.829 -19.494 36.291 1.00 75.23  ? 91   LYS F O     1 
ATOM   4334  C  CB    . LYS F 2 91  ? -26.850 -20.056 33.610 1.00 75.07  ? 91   LYS F CB    1 
ATOM   4335  C  CG    . LYS F 2 91  ? -25.879 -21.146 33.227 1.00 75.54  ? 91   LYS F CG    1 
ATOM   4336  C  CD    . LYS F 2 91  ? -26.169 -21.651 31.825 1.00 77.12  ? 91   LYS F CD    1 
ATOM   4337  C  CE    . LYS F 2 91  ? -25.346 -22.876 31.494 1.00 78.38  ? 91   LYS F CE    1 
ATOM   4338  N  NZ    . LYS F 2 91  ? -26.186 -23.923 30.819 1.00 80.26  ? 91   LYS F NZ    1 
ATOM   4339  N  N     . ARG F 2 92  ? -25.568 -17.744 35.076 1.00 74.69  ? 92   ARG F N     1 
ATOM   4340  C  CA    . ARG F 2 92  ? -24.573 -16.801 35.562 1.00 74.55  ? 92   ARG F CA    1 
ATOM   4341  C  C     . ARG F 2 92  ? -24.290 -16.966 37.047 1.00 74.50  ? 92   ARG F C     1 
ATOM   4342  O  O     . ARG F 2 92  ? -23.130 -16.974 37.468 1.00 74.99  ? 92   ARG F O     1 
ATOM   4343  C  CB    . ARG F 2 92  ? -25.088 -15.383 35.383 1.00 74.55  ? 92   ARG F CB    1 
ATOM   4344  C  CG    . ARG F 2 92  ? -24.915 -14.809 34.029 1.00 74.59  ? 92   ARG F CG    1 
ATOM   4345  C  CD    . ARG F 2 92  ? -24.362 -13.405 34.171 1.00 73.68  ? 92   ARG F CD    1 
ATOM   4346  N  NE    . ARG F 2 92  ? -22.939 -13.438 34.521 1.00 73.30  ? 92   ARG F NE    1 
ATOM   4347  C  CZ    . ARG F 2 92  ? -22.450 -13.078 35.697 1.00 72.51  ? 92   ARG F CZ    1 
ATOM   4348  N  NH1   . ARG F 2 92  ? -23.248 -12.634 36.650 1.00 71.02  ? 92   ARG F NH1   1 
ATOM   4349  N  NH2   . ARG F 2 92  ? -21.147 -13.144 35.911 1.00 75.85  ? 92   ARG F NH2   1 
ATOM   4350  N  N     . GLN F 2 93  ? -25.361 -17.073 37.833 1.00 74.20  ? 93   GLN F N     1 
ATOM   4351  C  CA    . GLN F 2 93  ? -25.276 -17.020 39.290 1.00 73.92  ? 93   GLN F CA    1 
ATOM   4352  C  C     . GLN F 2 93  ? -25.152 -18.400 39.917 1.00 73.55  ? 93   GLN F C     1 
ATOM   4353  O  O     . GLN F 2 93  ? -25.174 -18.541 41.144 1.00 73.75  ? 93   GLN F O     1 
ATOM   4354  C  CB    . GLN F 2 93  ? -26.501 -16.314 39.865 1.00 74.14  ? 93   GLN F CB    1 
ATOM   4355  C  CG    . GLN F 2 93  ? -26.787 -14.948 39.258 1.00 75.06  ? 93   GLN F CG    1 
ATOM   4356  C  CD    . GLN F 2 93  ? -26.267 -13.805 40.099 1.00 76.30  ? 93   GLN F CD    1 
ATOM   4357  O  OE1   . GLN F 2 93  ? -25.790 -14.002 41.222 1.00 76.61  ? 93   GLN F OE1   1 
ATOM   4358  N  NE2   . GLN F 2 93  ? -26.367 -12.592 39.565 1.00 76.57  ? 93   GLN F NE2   1 
ATOM   4359  N  N     . GLY F 2 94  ? -25.031 -19.423 39.084 1.00 72.74  ? 94   GLY F N     1 
ATOM   4360  C  CA    . GLY F 2 94  ? -24.830 -20.758 39.599 1.00 72.39  ? 94   GLY F CA    1 
ATOM   4361  C  C     . GLY F 2 94  ? -26.057 -21.331 40.263 1.00 72.14  ? 94   GLY F C     1 
ATOM   4362  O  O     . GLY F 2 94  ? -25.946 -22.124 41.202 1.00 71.21  ? 94   GLY F O     1 
ATOM   4363  N  N     . ARG F 2 95  ? -27.224 -20.920 39.769 1.00 72.59  ? 95   ARG F N     1 
ATOM   4364  C  CA    . ARG F 2 95  ? -28.504 -21.424 40.261 1.00 73.38  ? 95   ARG F CA    1 
ATOM   4365  C  C     . ARG F 2 95  ? -29.384 -21.905 39.100 1.00 73.94  ? 95   ARG F C     1 
ATOM   4366  O  O     . ARG F 2 95  ? -30.585 -21.619 39.047 1.00 74.21  ? 95   ARG F O     1 
ATOM   4367  C  CB    . ARG F 2 95  ? -29.209 -20.379 41.135 1.00 73.56  ? 95   ARG F CB    1 
ATOM   4368  C  CG    . ARG F 2 95  ? -28.288 -19.674 42.165 1.00 74.05  ? 95   ARG F CG    1 
ATOM   4369  C  CD    . ARG F 2 95  ? -28.872 -19.602 43.602 1.00 75.61  ? 95   ARG F CD    1 
ATOM   4370  N  NE    . ARG F 2 95  ? -29.036 -20.910 44.276 1.00 76.05  ? 95   ARG F NE    1 
ATOM   4371  C  CZ    . ARG F 2 95  ? -30.173 -21.626 44.309 1.00 74.87  ? 95   ARG F CZ    1 
ATOM   4372  N  NH1   . ARG F 2 95  ? -31.285 -21.201 43.697 1.00 72.25  ? 95   ARG F NH1   1 
ATOM   4373  N  NH2   . ARG F 2 95  ? -30.200 -22.780 44.962 1.00 73.49  ? 95   ARG F NH2   1 
ATOM   4374  N  N     . THR F 2 96  ? -28.762 -22.669 38.195 1.00 74.68  ? 96   THR F N     1 
ATOM   4375  C  CA    . THR F 2 96  ? -29.380 -23.200 36.972 1.00 75.39  ? 96   THR F CA    1 
ATOM   4376  C  C     . THR F 2 96  ? -30.769 -23.772 37.192 1.00 75.95  ? 96   THR F C     1 
ATOM   4377  O  O     . THR F 2 96  ? -30.965 -24.561 38.112 1.00 76.81  ? 96   THR F O     1 
ATOM   4378  C  CB    . THR F 2 96  ? -28.518 -24.328 36.378 1.00 75.26  ? 96   THR F CB    1 
ATOM   4379  O  OG1   . THR F 2 96  ? -27.322 -23.777 35.821 1.00 75.44  ? 96   THR F OG1   1 
ATOM   4380  C  CG2   . THR F 2 96  ? -29.273 -25.051 35.278 1.00 75.32  ? 96   THR F CG2   1 
ATOM   4381  N  N     . LEU F 2 97  ? -31.716 -23.401 36.337 1.00 76.30  ? 97   LEU F N     1 
ATOM   4382  C  CA    . LEU F 2 97  ? -33.091 -23.901 36.444 1.00 76.54  ? 97   LEU F CA    1 
ATOM   4383  C  C     . LEU F 2 97  ? -33.610 -24.548 35.145 1.00 76.91  ? 97   LEU F C     1 
ATOM   4384  O  O     . LEU F 2 97  ? -33.389 -24.045 34.036 1.00 76.92  ? 97   LEU F O     1 
ATOM   4385  C  CB    . LEU F 2 97  ? -34.016 -22.780 36.897 1.00 76.49  ? 97   LEU F CB    1 
ATOM   4386  C  CG    . LEU F 2 97  ? -35.518 -22.915 36.673 1.00 77.15  ? 97   LEU F CG    1 
ATOM   4387  C  CD1   . LEU F 2 97  ? -36.194 -23.835 37.711 1.00 76.91  ? 97   LEU F CD1   1 
ATOM   4388  C  CD2   . LEU F 2 97  ? -36.146 -21.535 36.670 1.00 77.57  ? 97   LEU F CD2   1 
ATOM   4389  N  N     . TYR F 2 98  ? -34.313 -25.661 35.307 1.00 77.04  ? 98   TYR F N     1 
ATOM   4390  C  CA    . TYR F 2 98  ? -34.774 -26.472 34.195 1.00 77.19  ? 98   TYR F CA    1 
ATOM   4391  C  C     . TYR F 2 98  ? -36.267 -26.312 33.964 1.00 78.28  ? 98   TYR F C     1 
ATOM   4392  O  O     . TYR F 2 98  ? -37.058 -26.260 34.918 1.00 78.48  ? 98   TYR F O     1 
ATOM   4393  C  CB    . TYR F 2 98  ? -34.499 -27.937 34.492 1.00 76.30  ? 98   TYR F CB    1 
ATOM   4394  C  CG    . TYR F 2 98  ? -33.081 -28.381 34.220 1.00 75.33  ? 98   TYR F CG    1 
ATOM   4395  C  CD1   . TYR F 2 98  ? -32.097 -27.468 33.841 1.00 73.79  ? 98   TYR F CD1   1 
ATOM   4396  C  CD2   . TYR F 2 98  ? -32.718 -29.713 34.371 1.00 72.84  ? 98   TYR F CD2   1 
ATOM   4397  C  CE1   . TYR F 2 98  ? -30.812 -27.879 33.590 1.00 73.13  ? 98   TYR F CE1   1 
ATOM   4398  C  CE2   . TYR F 2 98  ? -31.433 -30.123 34.137 1.00 73.42  ? 98   TYR F CE2   1 
ATOM   4399  C  CZ    . TYR F 2 98  ? -30.490 -29.200 33.747 1.00 73.67  ? 98   TYR F CZ    1 
ATOM   4400  O  OH    . TYR F 2 98  ? -29.211 -29.610 33.518 1.00 75.11  ? 98   TYR F OH    1 
ATOM   4401  N  N     . GLY F 2 99  ? -36.649 -26.249 32.693 1.00 78.78  ? 99   GLY F N     1 
ATOM   4402  C  CA    . GLY F 2 99  ? -38.049 -26.294 32.331 1.00 79.44  ? 99   GLY F CA    1 
ATOM   4403  C  C     . GLY F 2 99  ? -38.617 -24.960 31.927 1.00 79.82  ? 99   GLY F C     1 
ATOM   4404  O  O     . GLY F 2 99  ? -39.803 -24.704 32.128 1.00 80.63  ? 99   GLY F O     1 
ATOM   4405  N  N     . PHE F 2 100 ? -37.779 -24.104 31.359 1.00 79.92  ? 100  PHE F N     1 
ATOM   4406  C  CA    . PHE F 2 100 ? -38.250 -22.854 30.799 1.00 79.84  ? 100  PHE F CA    1 
ATOM   4407  C  C     . PHE F 2 100 ? -37.462 -22.575 29.526 1.00 79.92  ? 100  PHE F C     1 
ATOM   4408  O  O     . PHE F 2 100 ? -37.130 -21.438 29.205 1.00 80.28  ? 100  PHE F O     1 
ATOM   4409  C  CB    . PHE F 2 100 ? -38.168 -21.730 31.843 1.00 79.72  ? 100  PHE F CB    1 
ATOM   4410  C  CG    . PHE F 2 100 ? -39.109 -21.930 33.018 1.00 80.22  ? 100  PHE F CG    1 
ATOM   4411  C  CD1   . PHE F 2 100 ? -38.663 -22.519 34.196 1.00 79.75  ? 100  PHE F CD1   1 
ATOM   4412  C  CD2   . PHE F 2 100 ? -40.466 -21.557 32.928 1.00 80.26  ? 100  PHE F CD2   1 
ATOM   4413  C  CE1   . PHE F 2 100 ? -39.549 -22.724 35.269 1.00 81.02  ? 100  PHE F CE1   1 
ATOM   4414  C  CE2   . PHE F 2 100 ? -41.356 -21.755 33.992 1.00 78.84  ? 100  PHE F CE2   1 
ATOM   4415  C  CZ    . PHE F 2 100 ? -40.906 -22.341 35.160 1.00 79.96  ? 100  PHE F CZ    1 
ATOM   4416  N  N     . GLY F 2 101 ? -37.197 -23.641 28.779 1.00 79.99  ? 101  GLY F N     1 
ATOM   4417  C  CA    . GLY F 2 101 ? -36.369 -23.552 27.583 1.00 80.15  ? 101  GLY F CA    1 
ATOM   4418  C  C     . GLY F 2 101 ? -34.924 -23.483 28.031 1.00 80.04  ? 101  GLY F C     1 
ATOM   4419  O  O     . GLY F 2 101 ? -34.407 -22.411 28.263 1.00 79.74  ? 101  GLY F O     1 
ATOM   4420  N  N     . GLY F 2 102 ? -34.293 -24.642 28.190 1.00 80.33  ? 102  GLY F N     1 
ATOM   4421  C  CA    . GLY F 2 102 ? -32.917 -24.716 28.680 1.00 80.61  ? 102  GLY F CA    1 
ATOM   4422  C  C     . GLY F 2 102 ? -31.930 -24.313 27.597 1.00 80.32  ? 102  GLY F C     1 
ATOM   4423  O  O     . GLY F 2 102 ? -31.676 -23.130 27.372 1.00 80.02  ? 102  GLY F O     1 
ATOM   4424  O  OXT   . GLY F 2 102 ? -31.378 -25.162 26.908 1.00 79.90  ? 102  GLY F OXT   1 
ATOM   4425  N  N     . ALA G 3 14  ? 0.315   8.166   15.103 1.00 103.66 ? 14   ALA G N     1 
ATOM   4426  C  CA    . ALA G 3 14  ? 1.003   6.936   15.597 1.00 103.74 ? 14   ALA G CA    1 
ATOM   4427  C  C     . ALA G 3 14  ? 0.512   5.653   14.898 1.00 103.76 ? 14   ALA G C     1 
ATOM   4428  O  O     . ALA G 3 14  ? -0.636  5.583   14.425 1.00 103.90 ? 14   ALA G O     1 
ATOM   4429  C  CB    . ALA G 3 14  ? 0.855   6.820   17.111 1.00 103.63 ? 14   ALA G CB    1 
ATOM   4430  N  N     . LYS G 3 15  ? 1.388   4.646   14.835 1.00 103.42 ? 15   LYS G N     1 
ATOM   4431  C  CA    . LYS G 3 15  ? 1.043   3.353   14.236 1.00 103.01 ? 15   LYS G CA    1 
ATOM   4432  C  C     . LYS G 3 15  ? 0.238   2.486   15.220 1.00 102.60 ? 15   LYS G C     1 
ATOM   4433  O  O     . LYS G 3 15  ? -0.954  2.227   14.987 1.00 102.71 ? 15   LYS G O     1 
ATOM   4434  C  CB    . LYS G 3 15  ? 2.291   2.617   13.719 1.00 103.12 ? 15   LYS G CB    1 
ATOM   4435  C  CG    . LYS G 3 15  ? 3.264   3.479   12.912 1.00 103.39 ? 15   LYS G CG    1 
ATOM   4436  C  CD    . LYS G 3 15  ? 2.829   3.698   11.455 1.00 104.13 ? 15   LYS G CD    1 
ATOM   4437  C  CE    . LYS G 3 15  ? 3.734   4.735   10.761 1.00 103.97 ? 15   LYS G CE    1 
ATOM   4438  N  NZ    . LYS G 3 15  ? 3.538   4.812   9.284  1.00 104.11 ? 15   LYS G NZ    1 
ATOM   4439  N  N     . THR G 3 16  ? 0.886   2.064   16.314 1.00 101.70 ? 16   THR G N     1 
ATOM   4440  C  CA    . THR G 3 16  ? 0.247   1.267   17.382 1.00 100.74 ? 16   THR G CA    1 
ATOM   4441  C  C     . THR G 3 16  ? -1.209  1.662   17.644 1.00 99.57  ? 16   THR G C     1 
ATOM   4442  O  O     . THR G 3 16  ? -1.497  2.821   17.970 1.00 99.54  ? 16   THR G O     1 
ATOM   4443  C  CB    . THR G 3 16  ? 1.029   1.355   18.731 1.00 100.96 ? 16   THR G CB    1 
ATOM   4444  O  OG1   . THR G 3 16  ? 1.432   2.711   18.976 1.00 101.81 ? 16   THR G OG1   1 
ATOM   4445  C  CG2   . THR G 3 16  ? 2.255   0.457   18.715 1.00 101.02 ? 16   THR G CG2   1 
ATOM   4446  N  N     . ARG G 3 17  ? -2.115  0.694   17.491 1.00 98.13  ? 17   ARG G N     1 
ATOM   4447  C  CA    . ARG G 3 17  ? -3.547  0.896   17.757 1.00 96.70  ? 17   ARG G CA    1 
ATOM   4448  C  C     . ARG G 3 17  ? -3.776  1.296   19.191 1.00 95.86  ? 17   ARG G C     1 
ATOM   4449  O  O     . ARG G 3 17  ? -4.798  1.893   19.523 1.00 95.64  ? 17   ARG G O     1 
ATOM   4450  C  CB    . ARG G 3 17  ? -4.329  -0.380  17.507 1.00 96.66  ? 17   ARG G CB    1 
ATOM   4451  C  CG    . ARG G 3 17  ? -4.657  -0.632  16.075 1.00 96.37  ? 17   ARG G CG    1 
ATOM   4452  C  CD    . ARG G 3 17  ? -5.616  -1.780  15.965 1.00 95.80  ? 17   ARG G CD    1 
ATOM   4453  N  NE    . ARG G 3 17  ? -4.951  -3.068  15.811 1.00 95.55  ? 17   ARG G NE    1 
ATOM   4454  C  CZ    . ARG G 3 17  ? -5.600  -4.216  15.634 1.00 95.60  ? 17   ARG G CZ    1 
ATOM   4455  N  NH1   . ARG G 3 17  ? -6.932  -4.236  15.599 1.00 95.23  ? 17   ARG G NH1   1 
ATOM   4456  N  NH2   . ARG G 3 17  ? -4.920  -5.344  15.495 1.00 95.59  ? 17   ARG G NH2   1 
ATOM   4457  N  N     . SER G 3 18  ? -2.814  0.937   20.038 1.00 94.96  ? 18   SER G N     1 
ATOM   4458  C  CA    . SER G 3 18  ? -2.819  1.308   21.437 1.00 93.82  ? 18   SER G CA    1 
ATOM   4459  C  C     . SER G 3 18  ? -2.747  2.812   21.547 1.00 93.25  ? 18   SER G C     1 
ATOM   4460  O  O     . SER G 3 18  ? -3.494  3.418   22.317 1.00 93.41  ? 18   SER G O     1 
ATOM   4461  C  CB    . SER G 3 18  ? -1.648  0.659   22.157 1.00 93.75  ? 18   SER G CB    1 
ATOM   4462  O  OG    . SER G 3 18  ? -1.719  -0.751  22.025 1.00 93.46  ? 18   SER G OG    1 
ATOM   4463  N  N     . SER G 3 19  ? -1.874  3.420   20.746 1.00 92.29  ? 19   SER G N     1 
ATOM   4464  C  CA    . SER G 3 19  ? -1.707  4.865   20.796 1.00 91.10  ? 19   SER G CA    1 
ATOM   4465  C  C     . SER G 3 19  ? -2.912  5.620   20.250 1.00 89.74  ? 19   SER G C     1 
ATOM   4466  O  O     . SER G 3 19  ? -3.323  6.608   20.838 1.00 89.56  ? 19   SER G O     1 
ATOM   4467  C  CB    . SER G 3 19  ? -0.419  5.307   20.115 1.00 91.42  ? 19   SER G CB    1 
ATOM   4468  O  OG    . SER G 3 19  ? 0.026   6.521   20.705 1.00 92.47  ? 19   SER G OG    1 
ATOM   4469  N  N     . ARG G 3 20  ? -3.483  5.156   19.144 1.00 88.34  ? 20   ARG G N     1 
ATOM   4470  C  CA    . ARG G 3 20  ? -4.766  5.694   18.677 1.00 87.22  ? 20   ARG G CA    1 
ATOM   4471  C  C     . ARG G 3 20  ? -5.782  5.698   19.809 1.00 85.91  ? 20   ARG G C     1 
ATOM   4472  O  O     . ARG G 3 20  ? -6.507  6.664   20.001 1.00 85.60  ? 20   ARG G O     1 
ATOM   4473  C  CB    . ARG G 3 20  ? -5.322  4.867   17.523 1.00 87.54  ? 20   ARG G CB    1 
ATOM   4474  C  CG    . ARG G 3 20  ? -4.569  5.017   16.227 1.00 89.42  ? 20   ARG G CG    1 
ATOM   4475  C  CD    . ARG G 3 20  ? -4.880  3.874   15.314 1.00 92.81  ? 20   ARG G CD    1 
ATOM   4476  N  NE    . ARG G 3 20  ? -4.300  4.063   13.991 1.00 97.29  ? 20   ARG G NE    1 
ATOM   4477  C  CZ    . ARG G 3 20  ? -4.136  3.085   13.101 1.00 99.76  ? 20   ARG G CZ    1 
ATOM   4478  N  NH1   . ARG G 3 20  ? -4.499  1.836   13.401 1.00 99.59  ? 20   ARG G NH1   1 
ATOM   4479  N  NH2   . ARG G 3 20  ? -3.601  3.352   11.911 1.00 100.62 ? 20   ARG G NH2   1 
ATOM   4480  N  N     . ALA G 3 21  ? -5.809  4.604   20.560 1.00 84.71  ? 21   ALA G N     1 
ATOM   4481  C  CA    . ALA G 3 21  ? -6.716  4.434   21.680 1.00 83.24  ? 21   ALA G CA    1 
ATOM   4482  C  C     . ALA G 3 21  ? -6.230  5.157   22.919 1.00 82.29  ? 21   ALA G C     1 
ATOM   4483  O  O     . ALA G 3 21  ? -6.976  5.294   23.882 1.00 82.38  ? 21   ALA G O     1 
ATOM   4484  C  CB    . ALA G 3 21  ? -6.875  2.979   21.977 1.00 83.27  ? 21   ALA G CB    1 
ATOM   4485  N  N     . GLY G 3 22  ? -4.983  5.615   22.896 1.00 81.29  ? 22   GLY G N     1 
ATOM   4486  C  CA    . GLY G 3 22  ? -4.379  6.240   24.066 1.00 80.28  ? 22   GLY G CA    1 
ATOM   4487  C  C     . GLY G 3 22  ? -4.362  5.272   25.226 1.00 79.57  ? 22   GLY G C     1 
ATOM   4488  O  O     . GLY G 3 22  ? -4.983  5.520   26.271 1.00 79.35  ? 22   GLY G O     1 
ATOM   4489  N  N     . LEU G 3 23  ? -3.669  4.153   25.008 1.00 78.97  ? 23   LEU G N     1 
ATOM   4490  C  CA    . LEU G 3 23  ? -3.607  3.046   25.956 1.00 78.15  ? 23   LEU G CA    1 
ATOM   4491  C  C     . LEU G 3 23  ? -2.233  2.420   26.049 1.00 78.00  ? 23   LEU G C     1 
ATOM   4492  O  O     . LEU G 3 23  ? -1.420  2.495   25.122 1.00 77.74  ? 23   LEU G O     1 
ATOM   4493  C  CB    . LEU G 3 23  ? -4.589  1.945   25.583 1.00 77.74  ? 23   LEU G CB    1 
ATOM   4494  C  CG    . LEU G 3 23  ? -6.094  2.169   25.694 1.00 77.76  ? 23   LEU G CG    1 
ATOM   4495  C  CD1   . LEU G 3 23  ? -6.795  0.902   25.245 1.00 77.88  ? 23   LEU G CD1   1 
ATOM   4496  C  CD2   . LEU G 3 23  ? -6.534  2.563   27.088 1.00 76.68  ? 23   LEU G CD2   1 
ATOM   4497  N  N     . GLN G 3 24  ? -2.010  1.772   27.188 1.00 78.04  ? 24   GLN G N     1 
ATOM   4498  C  CA    . GLN G 3 24  ? -0.815  0.983   27.446 1.00 77.68  ? 24   GLN G CA    1 
ATOM   4499  C  C     . GLN G 3 24  ? -0.949  -0.459  26.937 1.00 77.41  ? 24   GLN G C     1 
ATOM   4500  O  O     . GLN G 3 24  ? 0.006   -1.034  26.431 1.00 77.71  ? 24   GLN G O     1 
ATOM   4501  C  CB    . GLN G 3 24  ? -0.505  1.010   28.941 1.00 77.51  ? 24   GLN G CB    1 
ATOM   4502  C  CG    . GLN G 3 24  ? -0.469  2.429   29.528 1.00 77.77  ? 24   GLN G CG    1 
ATOM   4503  C  CD    . GLN G 3 24  ? 0.622   3.290   28.919 1.00 78.29  ? 24   GLN G CD    1 
ATOM   4504  O  OE1   . GLN G 3 24  ? 1.618   2.781   28.414 1.00 80.68  ? 24   GLN G OE1   1 
ATOM   4505  N  NE2   . GLN G 3 24  ? 0.442   4.596   28.969 1.00 78.51  ? 24   GLN G NE2   1 
ATOM   4506  N  N     . PHE G 3 25  ? -2.140  -1.031  27.038 1.00 77.06  ? 25   PHE G N     1 
ATOM   4507  C  CA    . PHE G 3 25  ? -2.329  -2.433  26.688 1.00 76.85  ? 25   PHE G CA    1 
ATOM   4508  C  C     . PHE G 3 25  ? -2.292  -2.670  25.182 1.00 77.11  ? 25   PHE G C     1 
ATOM   4509  O  O     . PHE G 3 25  ? -2.774  -1.831  24.416 1.00 77.26  ? 25   PHE G O     1 
ATOM   4510  C  CB    . PHE G 3 25  ? -3.606  -2.988  27.332 1.00 76.36  ? 25   PHE G CB    1 
ATOM   4511  C  CG    . PHE G 3 25  ? -3.390  -3.474  28.725 1.00 74.89  ? 25   PHE G CG    1 
ATOM   4512  C  CD1   . PHE G 3 25  ? -3.144  -2.584  29.752 1.00 74.82  ? 25   PHE G CD1   1 
ATOM   4513  C  CD2   . PHE G 3 25  ? -3.392  -4.824  29.010 1.00 73.43  ? 25   PHE G CD2   1 
ATOM   4514  C  CE1   . PHE G 3 25  ? -2.923  -3.041  31.046 1.00 74.31  ? 25   PHE G CE1   1 
ATOM   4515  C  CE2   . PHE G 3 25  ? -3.179  -5.281  30.296 1.00 71.69  ? 25   PHE G CE2   1 
ATOM   4516  C  CZ    . PHE G 3 25  ? -2.944  -4.390  31.305 1.00 73.65  ? 25   PHE G CZ    1 
ATOM   4517  N  N     . PRO G 3 26  ? -1.688  -3.803  24.749 1.00 77.10  ? 26   PRO G N     1 
ATOM   4518  C  CA    . PRO G 3 26  ? -1.517  -4.037  23.317 1.00 76.87  ? 26   PRO G CA    1 
ATOM   4519  C  C     . PRO G 3 26  ? -2.806  -4.504  22.622 1.00 76.60  ? 26   PRO G C     1 
ATOM   4520  O  O     . PRO G 3 26  ? -3.096  -5.699  22.593 1.00 76.63  ? 26   PRO G O     1 
ATOM   4521  C  CB    . PRO G 3 26  ? -0.405  -5.093  23.268 1.00 76.61  ? 26   PRO G CB    1 
ATOM   4522  C  CG    . PRO G 3 26  ? -0.538  -5.830  24.530 1.00 76.63  ? 26   PRO G CG    1 
ATOM   4523  C  CD    . PRO G 3 26  ? -1.111  -4.897  25.557 1.00 77.04  ? 26   PRO G CD    1 
ATOM   4524  N  N     . VAL G 3 27  ? -3.539  -3.544  22.055 1.00 76.42  ? 27   VAL G N     1 
ATOM   4525  C  CA    . VAL G 3 27  ? -4.828  -3.769  21.383 1.00 76.20  ? 27   VAL G CA    1 
ATOM   4526  C  C     . VAL G 3 27  ? -4.730  -4.810  20.272 1.00 76.31  ? 27   VAL G C     1 
ATOM   4527  O  O     . VAL G 3 27  ? -5.727  -5.492  19.965 1.00 76.82  ? 27   VAL G O     1 
ATOM   4528  C  CB    . VAL G 3 27  ? -5.404  -2.449  20.789 1.00 76.32  ? 27   VAL G CB    1 
ATOM   4529  C  CG1   . VAL G 3 27  ? -6.863  -2.620  20.341 1.00 76.10  ? 27   VAL G CG1   1 
ATOM   4530  C  CG2   . VAL G 3 27  ? -5.307  -1.318  21.805 1.00 76.31  ? 27   VAL G CG2   1 
ATOM   4531  N  N     . GLY G 3 28  ? -3.541  -4.931  19.674 1.00 75.56  ? 28   GLY G N     1 
ATOM   4532  C  CA    . GLY G 3 28  ? -3.282  -5.943  18.650 1.00 74.75  ? 28   GLY G CA    1 
ATOM   4533  C  C     . GLY G 3 28  ? -3.312  -7.339  19.239 1.00 74.51  ? 28   GLY G C     1 
ATOM   4534  O  O     . GLY G 3 28  ? -3.883  -8.263  18.647 1.00 74.55  ? 28   GLY G O     1 
ATOM   4535  N  N     . ARG G 3 29  ? -2.702  -7.489  20.419 1.00 74.21  ? 29   ARG G N     1 
ATOM   4536  C  CA    . ARG G 3 29  ? -2.671  -8.773  21.133 1.00 73.35  ? 29   ARG G CA    1 
ATOM   4537  C  C     . ARG G 3 29  ? -4.087  -9.191  21.545 1.00 73.57  ? 29   ARG G C     1 
ATOM   4538  O  O     . ARG G 3 29  ? -4.496  -10.326 21.342 1.00 73.19  ? 29   ARG G O     1 
ATOM   4539  C  CB    . ARG G 3 29  ? -1.739  -8.706  22.345 1.00 73.05  ? 29   ARG G CB    1 
ATOM   4540  C  CG    . ARG G 3 29  ? -1.172  -10.058 22.778 1.00 72.34  ? 29   ARG G CG    1 
ATOM   4541  C  CD    . ARG G 3 29  ? -0.132  -9.925  23.897 1.00 71.69  ? 29   ARG G CD    1 
ATOM   4542  N  NE    . ARG G 3 29  ? 1.216   -9.796  23.370 1.00 69.29  ? 29   ARG G NE    1 
ATOM   4543  C  CZ    . ARG G 3 29  ? 2.333   -9.919  24.090 1.00 72.36  ? 29   ARG G CZ    1 
ATOM   4544  N  NH1   . ARG G 3 29  ? 2.278   -10.173 25.395 1.00 73.15  ? 29   ARG G NH1   1 
ATOM   4545  N  NH2   . ARG G 3 29  ? 3.528   -9.786  23.508 1.00 72.53  ? 29   ARG G NH2   1 
ATOM   4546  N  N     . VAL G 3 30  ? -4.841  -8.251  22.087 1.00 73.96  ? 30   VAL G N     1 
ATOM   4547  C  CA    . VAL G 3 30  ? -6.201  -8.529  22.518 1.00 74.71  ? 30   VAL G CA    1 
ATOM   4548  C  C     . VAL G 3 30  ? -7.085  -8.884  21.320 1.00 75.75  ? 30   VAL G C     1 
ATOM   4549  O  O     . VAL G 3 30  ? -8.102  -9.565  21.467 1.00 75.56  ? 30   VAL G O     1 
ATOM   4550  C  CB    . VAL G 3 30  ? -6.787  -7.344  23.314 1.00 74.50  ? 30   VAL G CB    1 
ATOM   4551  C  CG1   . VAL G 3 30  ? -8.211  -7.632  23.743 1.00 74.77  ? 30   VAL G CG1   1 
ATOM   4552  C  CG2   . VAL G 3 30  ? -5.928  -7.037  24.530 1.00 73.16  ? 30   VAL G CG2   1 
ATOM   4553  N  N     . HIS G 3 31  ? -6.678  -8.445  20.131 1.00 77.11  ? 31   HIS G N     1 
ATOM   4554  C  CA    . HIS G 3 31  ? -7.436  -8.736  18.919 1.00 78.29  ? 31   HIS G CA    1 
ATOM   4555  C  C     . HIS G 3 31  ? -7.082  -10.136 18.445 1.00 78.70  ? 31   HIS G C     1 
ATOM   4556  O  O     . HIS G 3 31  ? -7.962  -10.919 18.077 1.00 79.13  ? 31   HIS G O     1 
ATOM   4557  C  CB    . HIS G 3 31  ? -7.123  -7.706  17.849 1.00 78.64  ? 31   HIS G CB    1 
ATOM   4558  C  CG    . HIS G 3 31  ? -8.040  -7.751  16.673 1.00 80.53  ? 31   HIS G CG    1 
ATOM   4559  N  ND1   . HIS G 3 31  ? -9.387  -7.475  16.768 1.00 82.95  ? 31   HIS G ND1   1 
ATOM   4560  C  CD2   . HIS G 3 31  ? -7.796  -8.001  15.365 1.00 82.11  ? 31   HIS G CD2   1 
ATOM   4561  C  CE1   . HIS G 3 31  ? -9.938  -7.565  15.569 1.00 84.20  ? 31   HIS G CE1   1 
ATOM   4562  N  NE2   . HIS G 3 31  ? -8.995  -7.892  14.701 1.00 83.85  ? 31   HIS G NE2   1 
ATOM   4563  N  N     . ARG G 3 32  ? -5.793  -10.462 18.479 1.00 78.71  ? 32   ARG G N     1 
ATOM   4564  C  CA    . ARG G 3 32  ? -5.356  -11.785 18.075 1.00 78.99  ? 32   ARG G CA    1 
ATOM   4565  C  C     . ARG G 3 32  ? -6.034  -12.825 18.956 1.00 79.28  ? 32   ARG G C     1 
ATOM   4566  O  O     . ARG G 3 32  ? -6.674  -13.737 18.438 1.00 79.45  ? 32   ARG G O     1 
ATOM   4567  C  CB    . ARG G 3 32  ? -3.835  -11.901 18.157 1.00 79.21  ? 32   ARG G CB    1 
ATOM   4568  C  CG    . ARG G 3 32  ? -3.283  -13.301 17.982 1.00 79.01  ? 32   ARG G CG    1 
ATOM   4569  C  CD    . ARG G 3 32  ? -1.828  -13.328 18.413 1.00 79.05  ? 32   ARG G CD    1 
ATOM   4570  N  NE    . ARG G 3 32  ? -1.674  -13.606 19.840 1.00 79.06  ? 32   ARG G NE    1 
ATOM   4571  C  CZ    . ARG G 3 32  ? -0.573  -13.355 20.557 1.00 78.73  ? 32   ARG G CZ    1 
ATOM   4572  N  NH1   . ARG G 3 32  ? 0.492   -12.785 20.009 1.00 77.30  ? 32   ARG G NH1   1 
ATOM   4573  N  NH2   . ARG G 3 32  ? -0.539  -13.660 21.848 1.00 79.20  ? 32   ARG G NH2   1 
ATOM   4574  N  N     . LEU G 3 33  ? -5.920  -12.667 20.278 1.00 79.28  ? 33   LEU G N     1 
ATOM   4575  C  CA    . LEU G 3 33  ? -6.463  -13.642 21.213 1.00 79.46  ? 33   LEU G CA    1 
ATOM   4576  C  C     . LEU G 3 33  ? -7.973  -13.817 21.021 1.00 80.21  ? 33   LEU G C     1 
ATOM   4577  O  O     . LEU G 3 33  ? -8.460  -14.943 20.904 1.00 80.87  ? 33   LEU G O     1 
ATOM   4578  C  CB    . LEU G 3 33  ? -6.167  -13.260 22.656 1.00 79.02  ? 33   LEU G CB    1 
ATOM   4579  C  CG    . LEU G 3 33  ? -4.803  -12.785 23.147 1.00 79.02  ? 33   LEU G CG    1 
ATOM   4580  C  CD1   . LEU G 3 33  ? -5.006  -11.983 24.423 1.00 78.79  ? 33   LEU G CD1   1 
ATOM   4581  C  CD2   . LEU G 3 33  ? -3.799  -13.901 23.379 1.00 78.24  ? 33   LEU G CD2   1 
ATOM   4582  N  N     . LEU G 3 34  ? -8.718  -12.723 20.966 1.00 80.67  ? 34   LEU G N     1 
ATOM   4583  C  CA    . LEU G 3 34  ? -10.164 -12.831 20.755 1.00 81.53  ? 34   LEU G CA    1 
ATOM   4584  C  C     . LEU G 3 34  ? -10.556 -13.685 19.550 1.00 82.48  ? 34   LEU G C     1 
ATOM   4585  O  O     . LEU G 3 34  ? -11.625 -14.303 19.553 1.00 82.57  ? 34   LEU G O     1 
ATOM   4586  C  CB    . LEU G 3 34  ? -10.801 -11.458 20.620 1.00 81.11  ? 34   LEU G CB    1 
ATOM   4587  C  CG    . LEU G 3 34  ? -11.287 -10.804 21.907 1.00 80.49  ? 34   LEU G CG    1 
ATOM   4588  C  CD1   . LEU G 3 34  ? -11.202 -9.323  21.743 1.00 80.26  ? 34   LEU G CD1   1 
ATOM   4589  C  CD2   . LEU G 3 34  ? -12.721 -11.215 22.274 1.00 80.38  ? 34   LEU G CD2   1 
ATOM   4590  N  N     . ARG G 3 35  ? -9.702  -13.721 18.525 1.00 83.55  ? 35   ARG G N     1 
ATOM   4591  C  CA    . ARG G 3 35  ? -9.995  -14.512 17.320 1.00 84.66  ? 35   ARG G CA    1 
ATOM   4592  C  C     . ARG G 3 35  ? -9.554  -15.969 17.449 1.00 84.59  ? 35   ARG G C     1 
ATOM   4593  O  O     . ARG G 3 35  ? -10.347 -16.888 17.212 1.00 84.86  ? 35   ARG G O     1 
ATOM   4594  C  CB    . ARG G 3 35  ? -9.424  -13.852 16.067 1.00 84.51  ? 35   ARG G CB    1 
ATOM   4595  C  CG    . ARG G 3 35  ? -10.264 -12.665 15.582 1.00 85.82  ? 35   ARG G CG    1 
ATOM   4596  C  CD    . ARG G 3 35  ? -9.776  -12.085 14.251 1.00 86.24  ? 35   ARG G CD    1 
ATOM   4597  N  NE    . ARG G 3 35  ? -8.715  -11.097 14.451 1.00 89.66  ? 35   ARG G NE    1 
ATOM   4598  C  CZ    . ARG G 3 35  ? -7.429  -11.395 14.644 1.00 90.84  ? 35   ARG G CZ    1 
ATOM   4599  N  NH1   . ARG G 3 35  ? -7.019  -12.658 14.664 1.00 90.79  ? 35   ARG G NH1   1 
ATOM   4600  N  NH2   . ARG G 3 35  ? -6.543  -10.425 14.818 1.00 92.39  ? 35   ARG G NH2   1 
ATOM   4601  N  N     . LYS G 3 36  ? -8.302  -16.171 17.848 1.00 84.61  ? 36   LYS G N     1 
ATOM   4602  C  CA    . LYS G 3 36  ? -7.781  -17.501 18.153 1.00 84.68  ? 36   LYS G CA    1 
ATOM   4603  C  C     . LYS G 3 36  ? -8.352  -17.978 19.497 1.00 84.57  ? 36   LYS G C     1 
ATOM   4604  O  O     . LYS G 3 36  ? -7.612  -18.459 20.364 1.00 84.70  ? 36   LYS G O     1 
ATOM   4605  C  CB    . LYS G 3 36  ? -6.245  -17.478 18.227 1.00 84.84  ? 36   LYS G CB    1 
ATOM   4606  C  CG    . LYS G 3 36  ? -5.553  -16.507 17.271 1.00 85.47  ? 36   LYS G CG    1 
ATOM   4607  C  CD    . LYS G 3 36  ? -5.001  -17.171 16.033 1.00 86.46  ? 36   LYS G CD    1 
ATOM   4608  C  CE    . LYS G 3 36  ? -4.540  -16.106 15.056 1.00 87.75  ? 36   LYS G CE    1 
ATOM   4609  N  NZ    . LYS G 3 36  ? -3.225  -16.462 14.423 1.00 89.91  ? 36   LYS G NZ    1 
ATOM   4610  N  N     . GLY G 3 37  ? -9.665  -17.849 19.667 1.00 84.01  ? 37   GLY G N     1 
ATOM   4611  C  CA    . GLY G 3 37  ? -10.286 -18.131 20.950 1.00 83.51  ? 37   GLY G CA    1 
ATOM   4612  C  C     . GLY G 3 37  ? -11.714 -18.611 20.835 1.00 83.22  ? 37   GLY G C     1 
ATOM   4613  O  O     . GLY G 3 37  ? -12.329 -18.992 21.827 1.00 83.10  ? 37   GLY G O     1 
ATOM   4614  N  N     . ASN G 3 38  ? -12.252 -18.588 19.624 1.00 82.93  ? 38   ASN G N     1 
ATOM   4615  C  CA    . ASN G 3 38  ? -13.517 -19.246 19.368 1.00 82.77  ? 38   ASN G CA    1 
ATOM   4616  C  C     . ASN G 3 38  ? -14.594 -18.723 20.308 1.00 82.12  ? 38   ASN G C     1 
ATOM   4617  O  O     . ASN G 3 38  ? -15.211 -19.490 21.054 1.00 82.01  ? 38   ASN G O     1 
ATOM   4618  C  CB    . ASN G 3 38  ? -13.343 -20.772 19.505 1.00 83.15  ? 38   ASN G CB    1 
ATOM   4619  C  CG    . ASN G 3 38  ? -12.271 -21.331 18.551 1.00 84.66  ? 38   ASN G CG    1 
ATOM   4620  O  OD1   . ASN G 3 38  ? -12.445 -21.322 17.321 1.00 86.67  ? 38   ASN G OD1   1 
ATOM   4621  N  ND2   . ASN G 3 38  ? -11.164 -21.812 19.114 1.00 83.68  ? 38   ASN G ND2   1 
ATOM   4622  N  N     . TYR G 3 39  ? -14.777 -17.404 20.293 1.00 81.50  ? 39   TYR G N     1 
ATOM   4623  C  CA    . TYR G 3 39  ? -15.826 -16.753 21.070 1.00 80.83  ? 39   TYR G CA    1 
ATOM   4624  C  C     . TYR G 3 39  ? -16.949 -16.381 20.110 1.00 81.46  ? 39   TYR G C     1 
ATOM   4625  O  O     . TYR G 3 39  ? -18.134 -16.331 20.485 1.00 81.28  ? 39   TYR G O     1 
ATOM   4626  C  CB    . TYR G 3 39  ? -15.303 -15.502 21.785 1.00 79.91  ? 39   TYR G CB    1 
ATOM   4627  C  CG    . TYR G 3 39  ? -14.088 -15.708 22.667 1.00 78.67  ? 39   TYR G CG    1 
ATOM   4628  C  CD1   . TYR G 3 39  ? -12.807 -15.447 22.193 1.00 76.94  ? 39   TYR G CD1   1 
ATOM   4629  C  CD2   . TYR G 3 39  ? -14.218 -16.161 23.976 1.00 77.35  ? 39   TYR G CD2   1 
ATOM   4630  C  CE1   . TYR G 3 39  ? -11.698 -15.637 22.992 1.00 76.65  ? 39   TYR G CE1   1 
ATOM   4631  C  CE2   . TYR G 3 39  ? -13.105 -16.366 24.780 1.00 76.67  ? 39   TYR G CE2   1 
ATOM   4632  C  CZ    . TYR G 3 39  ? -11.850 -16.098 24.280 1.00 77.17  ? 39   TYR G CZ    1 
ATOM   4633  O  OH    . TYR G 3 39  ? -10.744 -16.283 25.072 1.00 78.01  ? 39   TYR G OH    1 
ATOM   4634  N  N     . ALA G 3 40  ? -16.551 -16.114 18.866 1.00 82.20  ? 40   ALA G N     1 
ATOM   4635  C  CA    . ALA G 3 40  ? -17.477 -15.852 17.774 1.00 83.06  ? 40   ALA G CA    1 
ATOM   4636  C  C     . ALA G 3 40  ? -16.780 -15.949 16.427 1.00 83.86  ? 40   ALA G C     1 
ATOM   4637  O  O     . ALA G 3 40  ? -15.555 -15.806 16.317 1.00 83.85  ? 40   ALA G O     1 
ATOM   4638  C  CB    . ALA G 3 40  ? -18.110 -14.484 17.932 1.00 83.09  ? 40   ALA G CB    1 
ATOM   4639  N  N     . GLU G 3 41  ? -17.580 -16.199 15.402 1.00 84.97  ? 41   GLU G N     1 
ATOM   4640  C  CA    . GLU G 3 41  ? -17.129 -16.117 14.021 1.00 86.09  ? 41   GLU G CA    1 
ATOM   4641  C  C     . GLU G 3 41  ? -16.226 -14.905 13.847 1.00 86.05  ? 41   GLU G C     1 
ATOM   4642  O  O     . GLU G 3 41  ? -15.042 -15.014 13.519 1.00 86.17  ? 41   GLU G O     1 
ATOM   4643  C  CB    . GLU G 3 41  ? -18.340 -15.926 13.107 1.00 86.44  ? 41   GLU G CB    1 
ATOM   4644  C  CG    . GLU G 3 41  ? -19.351 -17.038 13.149 1.00 88.89  ? 41   GLU G CG    1 
ATOM   4645  C  CD    . GLU G 3 41  ? -19.085 -18.080 12.084 1.00 92.05  ? 41   GLU G CD    1 
ATOM   4646  O  OE1   . GLU G 3 41  ? -19.016 -17.695 10.883 1.00 93.19  ? 41   GLU G OE1   1 
ATOM   4647  O  OE2   . GLU G 3 41  ? -18.963 -19.276 12.454 1.00 92.27  ? 41   GLU G OE2   1 
ATOM   4648  N  N     . ARG G 3 42  ? -16.815 -13.743 14.086 1.00 86.04  ? 42   ARG G N     1 
ATOM   4649  C  CA    . ARG G 3 42  ? -16.180 -12.489 13.767 1.00 86.14  ? 42   ARG G CA    1 
ATOM   4650  C  C     . ARG G 3 42  ? -16.019 -11.642 15.029 1.00 85.54  ? 42   ARG G C     1 
ATOM   4651  O  O     . ARG G 3 42  ? -16.668 -11.890 16.059 1.00 85.63  ? 42   ARG G O     1 
ATOM   4652  C  CB    . ARG G 3 42  ? -16.998 -11.758 12.691 1.00 86.16  ? 42   ARG G CB    1 
ATOM   4653  C  CG    . ARG G 3 42  ? -16.917 -12.416 11.305 1.00 87.21  ? 42   ARG G CG    1 
ATOM   4654  C  CD    . ARG G 3 42  ? -18.093 -12.095 10.365 1.00 87.20  ? 42   ARG G CD    1 
ATOM   4655  N  NE    . ARG G 3 42  ? -18.412 -10.673 10.326 1.00 89.65  ? 42   ARG G NE    1 
ATOM   4656  C  CZ    . ARG G 3 42  ? -19.431 -10.122 10.985 1.00 91.21  ? 42   ARG G CZ    1 
ATOM   4657  N  NH1   . ARG G 3 42  ? -20.237 -10.880 11.720 1.00 91.87  ? 42   ARG G NH1   1 
ATOM   4658  N  NH2   . ARG G 3 42  ? -19.649 -8.811  10.914 1.00 91.89  ? 42   ARG G NH2   1 
ATOM   4659  N  N     . VAL G 3 43  ? -15.130 -10.661 14.947 1.00 84.51  ? 43   VAL G N     1 
ATOM   4660  C  CA    . VAL G 3 43  ? -14.881 -9.760  16.051 1.00 83.81  ? 43   VAL G CA    1 
ATOM   4661  C  C     . VAL G 3 43  ? -14.955 -8.334  15.546 1.00 83.17  ? 43   VAL G C     1 
ATOM   4662  O  O     . VAL G 3 43  ? -14.334 -8.013  14.538 1.00 83.53  ? 43   VAL G O     1 
ATOM   4663  C  CB    . VAL G 3 43  ? -13.470 -9.982  16.665 1.00 84.00  ? 43   VAL G CB    1 
ATOM   4664  C  CG1   . VAL G 3 43  ? -13.226 -9.005  17.826 1.00 83.40  ? 43   VAL G CG1   1 
ATOM   4665  C  CG2   . VAL G 3 43  ? -13.285 -11.431 17.114 1.00 83.24  ? 43   VAL G CG2   1 
ATOM   4666  N  N     . GLY G 3 44  ? -15.689 -7.480  16.255 1.00 82.33  ? 44   GLY G N     1 
ATOM   4667  C  CA    . GLY G 3 44  ? -15.691 -6.040  15.981 1.00 81.41  ? 44   GLY G CA    1 
ATOM   4668  C  C     . GLY G 3 44  ? -14.300 -5.440  16.088 1.00 80.94  ? 44   GLY G C     1 
ATOM   4669  O  O     . GLY G 3 44  ? -13.320 -6.149  16.350 1.00 81.50  ? 44   GLY G O     1 
ATOM   4670  N  N     . ALA G 3 45  ? -14.188 -4.136  15.884 1.00 80.07  ? 45   ALA G N     1 
ATOM   4671  C  CA    . ALA G 3 45  ? -12.878 -3.494  15.999 1.00 78.94  ? 45   ALA G CA    1 
ATOM   4672  C  C     . ALA G 3 45  ? -12.767 -2.665  17.257 1.00 77.94  ? 45   ALA G C     1 
ATOM   4673  O  O     . ALA G 3 45  ? -11.666 -2.279  17.642 1.00 78.09  ? 45   ALA G O     1 
ATOM   4674  C  CB    . ALA G 3 45  ? -12.577 -2.646  14.777 1.00 79.14  ? 45   ALA G CB    1 
ATOM   4675  N  N     . GLY G 3 46  ? -13.906 -2.385  17.883 1.00 76.58  ? 46   GLY G N     1 
ATOM   4676  C  CA    . GLY G 3 46  ? -13.941 -1.624  19.131 1.00 75.37  ? 46   GLY G CA    1 
ATOM   4677  C  C     . GLY G 3 46  ? -13.917 -2.500  20.372 1.00 74.43  ? 46   GLY G C     1 
ATOM   4678  O  O     . GLY G 3 46  ? -13.557 -2.052  21.467 1.00 73.90  ? 46   GLY G O     1 
ATOM   4679  N  N     . ALA G 3 47  ? -14.317 -3.754  20.191 1.00 73.91  ? 47   ALA G N     1 
ATOM   4680  C  CA    . ALA G 3 47  ? -14.321 -4.734  21.265 1.00 73.35  ? 47   ALA G CA    1 
ATOM   4681  C  C     . ALA G 3 47  ? -12.917 -4.996  21.871 1.00 72.83  ? 47   ALA G C     1 
ATOM   4682  O  O     . ALA G 3 47  ? -12.783 -4.964  23.097 1.00 73.43  ? 47   ALA G O     1 
ATOM   4683  C  CB    . ALA G 3 47  ? -15.022 -6.028  20.818 1.00 73.09  ? 47   ALA G CB    1 
ATOM   4684  N  N     . PRO G 3 48  ? -11.876 -5.211  21.040 1.00 72.06  ? 48   PRO G N     1 
ATOM   4685  C  CA    . PRO G 3 48  ? -10.507 -5.319  21.592 1.00 71.96  ? 48   PRO G CA    1 
ATOM   4686  C  C     . PRO G 3 48  ? -10.121 -4.085  22.361 1.00 71.70  ? 48   PRO G C     1 
ATOM   4687  O  O     . PRO G 3 48  ? -9.607  -4.197  23.472 1.00 71.61  ? 48   PRO G O     1 
ATOM   4688  C  CB    . PRO G 3 48  ? -9.608  -5.394  20.357 1.00 71.77  ? 48   PRO G CB    1 
ATOM   4689  C  CG    . PRO G 3 48  ? -10.490 -5.843  19.272 1.00 72.81  ? 48   PRO G CG    1 
ATOM   4690  C  CD    . PRO G 3 48  ? -11.888 -5.369  19.580 1.00 72.27  ? 48   PRO G CD    1 
ATOM   4691  N  N     . VAL G 3 49  ? -10.382 -2.920  21.759 1.00 71.44  ? 49   VAL G N     1 
ATOM   4692  C  CA    . VAL G 3 49  ? -10.042 -1.621  22.335 1.00 71.08  ? 49   VAL G CA    1 
ATOM   4693  C  C     . VAL G 3 49  ? -10.632 -1.520  23.716 1.00 70.91  ? 49   VAL G C     1 
ATOM   4694  O  O     . VAL G 3 49  ? -9.902  -1.312  24.692 1.00 71.06  ? 49   VAL G O     1 
ATOM   4695  C  CB    . VAL G 3 49  ? -10.600 -0.459  21.486 1.00 71.14  ? 49   VAL G CB    1 
ATOM   4696  C  CG1   . VAL G 3 49  ? -10.043 0.858   21.949 1.00 70.90  ? 49   VAL G CG1   1 
ATOM   4697  C  CG2   . VAL G 3 49  ? -10.272 -0.665  20.021 1.00 71.98  ? 49   VAL G CG2   1 
ATOM   4698  N  N     . TYR G 3 50  ? -11.954 -1.679  23.779 1.00 70.47  ? 50   TYR G N     1 
ATOM   4699  C  CA    . TYR G 3 50  ? -12.705 -1.660  25.017 1.00 70.54  ? 50   TYR G CA    1 
ATOM   4700  C  C     . TYR G 3 50  ? -12.071 -2.609  26.024 1.00 70.47  ? 50   TYR G C     1 
ATOM   4701  O  O     . TYR G 3 50  ? -11.559 -2.183  27.065 1.00 70.77  ? 50   TYR G O     1 
ATOM   4702  C  CB    . TYR G 3 50  ? -14.134 -2.088  24.733 1.00 71.02  ? 50   TYR G CB    1 
ATOM   4703  C  CG    . TYR G 3 50  ? -15.159 -1.672  25.753 1.00 71.65  ? 50   TYR G CG    1 
ATOM   4704  C  CD1   . TYR G 3 50  ? -16.294 -0.948  25.362 1.00 74.41  ? 50   TYR G CD1   1 
ATOM   4705  C  CD2   . TYR G 3 50  ? -15.033 -2.021  27.096 1.00 71.32  ? 50   TYR G CD2   1 
ATOM   4706  C  CE1   . TYR G 3 50  ? -17.288 -0.572  26.291 1.00 74.11  ? 50   TYR G CE1   1 
ATOM   4707  C  CE2   . TYR G 3 50  ? -16.010 -1.648  28.041 1.00 72.36  ? 50   TYR G CE2   1 
ATOM   4708  C  CZ    . TYR G 3 50  ? -17.133 -0.924  27.629 1.00 73.38  ? 50   TYR G CZ    1 
ATOM   4709  O  OH    . TYR G 3 50  ? -18.099 -0.552  28.535 1.00 72.55  ? 50   TYR G OH    1 
ATOM   4710  N  N     . LEU G 3 51  ? -12.086 -3.895  25.704 1.00 69.80  ? 51   LEU G N     1 
ATOM   4711  C  CA    . LEU G 3 51  ? -11.436 -4.888  26.544 1.00 69.41  ? 51   LEU G CA    1 
ATOM   4712  C  C     . LEU G 3 51  ? -9.979  -4.544  26.935 1.00 69.16  ? 51   LEU G C     1 
ATOM   4713  O  O     . LEU G 3 51  ? -9.603  -4.718  28.086 1.00 69.53  ? 51   LEU G O     1 
ATOM   4714  C  CB    . LEU G 3 51  ? -11.522 -6.268  25.874 1.00 69.72  ? 51   LEU G CB    1 
ATOM   4715  C  CG    . LEU G 3 51  ? -10.791 -7.513  26.403 1.00 69.89  ? 51   LEU G CG    1 
ATOM   4716  C  CD1   . LEU G 3 51  ? -11.003 -7.728  27.904 1.00 71.10  ? 51   LEU G CD1   1 
ATOM   4717  C  CD2   . LEU G 3 51  ? -11.239 -8.729  25.621 1.00 68.45  ? 51   LEU G CD2   1 
ATOM   4718  N  N     . ALA G 3 52  ? -9.159  -4.056  26.010 1.00 68.73  ? 52   ALA G N     1 
ATOM   4719  C  CA    . ALA G 3 52  ? -7.755  -3.792  26.360 1.00 68.63  ? 52   ALA G CA    1 
ATOM   4720  C  C     . ALA G 3 52  ? -7.683  -2.693  27.409 1.00 68.66  ? 52   ALA G C     1 
ATOM   4721  O  O     . ALA G 3 52  ? -6.795  -2.689  28.283 1.00 69.30  ? 52   ALA G O     1 
ATOM   4722  C  CB    . ALA G 3 52  ? -6.928  -3.435  25.135 1.00 68.66  ? 52   ALA G CB    1 
ATOM   4723  N  N     . ALA G 3 53  ? -8.652  -1.787  27.323 1.00 67.97  ? 53   ALA G N     1 
ATOM   4724  C  CA    . ALA G 3 53  ? -8.764  -0.644  28.207 1.00 67.37  ? 53   ALA G CA    1 
ATOM   4725  C  C     . ALA G 3 53  ? -9.298  -1.046  29.573 1.00 66.80  ? 53   ALA G C     1 
ATOM   4726  O  O     . ALA G 3 53  ? -8.846  -0.545  30.607 1.00 67.01  ? 53   ALA G O     1 
ATOM   4727  C  CB    . ALA G 3 53  ? -9.679  0.389   27.577 1.00 67.62  ? 53   ALA G CB    1 
ATOM   4728  N  N     . VAL G 3 54  ? -10.281 -1.936  29.571 1.00 65.90  ? 54   VAL G N     1 
ATOM   4729  C  CA    . VAL G 3 54  ? -10.840 -2.453  30.819 1.00 64.53  ? 54   VAL G CA    1 
ATOM   4730  C  C     . VAL G 3 54  ? -9.778  -3.240  31.553 1.00 64.08  ? 54   VAL G C     1 
ATOM   4731  O  O     . VAL G 3 54  ? -9.593  -3.065  32.746 1.00 64.40  ? 54   VAL G O     1 
ATOM   4732  C  CB    . VAL G 3 54  ? -12.018 -3.382  30.569 1.00 64.01  ? 54   VAL G CB    1 
ATOM   4733  C  CG1   . VAL G 3 54  ? -12.606 -3.848  31.880 1.00 61.71  ? 54   VAL G CG1   1 
ATOM   4734  C  CG2   . VAL G 3 54  ? -13.035 -2.680  29.716 1.00 63.44  ? 54   VAL G CG2   1 
ATOM   4735  N  N     . LEU G 3 55  ? -9.090  -4.120  30.842 1.00 63.56  ? 55   LEU G N     1 
ATOM   4736  C  CA    . LEU G 3 55  ? -7.941  -4.785  31.432 1.00 63.74  ? 55   LEU G CA    1 
ATOM   4737  C  C     . LEU G 3 55  ? -6.993  -3.775  32.085 1.00 63.61  ? 55   LEU G C     1 
ATOM   4738  O  O     . LEU G 3 55  ? -6.621  -3.969  33.217 1.00 63.81  ? 55   LEU G O     1 
ATOM   4739  C  CB    . LEU G 3 55  ? -7.231  -5.651  30.405 1.00 63.81  ? 55   LEU G CB    1 
ATOM   4740  C  CG    . LEU G 3 55  ? -7.922  -6.988  30.087 1.00 63.50  ? 55   LEU G CG    1 
ATOM   4741  C  CD1   . LEU G 3 55  ? -7.335  -7.623  28.841 1.00 62.97  ? 55   LEU G CD1   1 
ATOM   4742  C  CD2   . LEU G 3 55  ? -7.814  -7.945  31.236 1.00 61.07  ? 55   LEU G CD2   1 
ATOM   4743  N  N     . GLU G 3 56  ? -6.696  -2.669  31.398 1.00 64.02  ? 56   GLU G N     1 
ATOM   4744  C  CA    . GLU G 3 56  ? -5.835  -1.588  31.916 1.00 64.81  ? 56   GLU G CA    1 
ATOM   4745  C  C     . GLU G 3 56  ? -6.373  -0.926  33.180 1.00 64.69  ? 56   GLU G C     1 
ATOM   4746  O  O     . GLU G 3 56  ? -5.622  -0.690  34.143 1.00 64.55  ? 56   GLU G O     1 
ATOM   4747  C  CB    . GLU G 3 56  ? -5.558  -0.519  30.838 1.00 64.62  ? 56   GLU G CB    1 
ATOM   4748  C  CG    . GLU G 3 56  ? -4.460  0.485   31.234 1.00 65.85  ? 56   GLU G CG    1 
ATOM   4749  C  CD    . GLU G 3 56  ? -3.853  1.319   30.070 1.00 66.13  ? 56   GLU G CD    1 
ATOM   4750  O  OE1   . GLU G 3 56  ? -3.697  0.811   28.934 1.00 65.19  ? 56   GLU G OE1   1 
ATOM   4751  O  OE2   . GLU G 3 56  ? -3.500  2.505   30.318 1.00 69.09  ? 56   GLU G OE2   1 
ATOM   4752  N  N     . TYR G 3 57  ? -7.667  -0.621  33.174 1.00 64.80  ? 57   TYR G N     1 
ATOM   4753  C  CA    . TYR G 3 57  ? -8.282  -0.011  34.325 1.00 65.01  ? 57   TYR G CA    1 
ATOM   4754  C  C     . TYR G 3 57  ? -7.935  -0.864  35.534 1.00 65.17  ? 57   TYR G C     1 
ATOM   4755  O  O     . TYR G 3 57  ? -7.282  -0.389  36.473 1.00 65.27  ? 57   TYR G O     1 
ATOM   4756  C  CB    . TYR G 3 57  ? -9.788  0.073   34.119 1.00 65.93  ? 57   TYR G CB    1 
ATOM   4757  C  CG    . TYR G 3 57  ? -10.598 0.349   35.372 1.00 67.25  ? 57   TYR G CG    1 
ATOM   4758  C  CD1   . TYR G 3 57  ? -10.380 1.503   36.144 1.00 68.24  ? 57   TYR G CD1   1 
ATOM   4759  C  CD2   . TYR G 3 57  ? -11.600 -0.529  35.769 1.00 66.93  ? 57   TYR G CD2   1 
ATOM   4760  C  CE1   . TYR G 3 57  ? -11.135 1.757   37.284 1.00 68.37  ? 57   TYR G CE1   1 
ATOM   4761  C  CE2   . TYR G 3 57  ? -12.378 -0.284  36.908 1.00 67.23  ? 57   TYR G CE2   1 
ATOM   4762  C  CZ    . TYR G 3 57  ? -12.146 0.858   37.661 1.00 68.57  ? 57   TYR G CZ    1 
ATOM   4763  O  OH    . TYR G 3 57  ? -12.914 1.084   38.802 1.00 68.47  ? 57   TYR G OH    1 
ATOM   4764  N  N     . LEU G 3 58  ? -8.317  -2.144  35.465 1.00 64.76  ? 58   LEU G N     1 
ATOM   4765  C  CA    . LEU G 3 58  ? -8.176  -3.086  36.571 1.00 64.01  ? 58   LEU G CA    1 
ATOM   4766  C  C     . LEU G 3 58  ? -6.737  -3.326  37.035 1.00 63.79  ? 58   LEU G C     1 
ATOM   4767  O  O     . LEU G 3 58  ? -6.475  -3.267  38.240 1.00 63.64  ? 58   LEU G O     1 
ATOM   4768  C  CB    . LEU G 3 58  ? -8.853  -4.395  36.231 1.00 64.00  ? 58   LEU G CB    1 
ATOM   4769  C  CG    . LEU G 3 58  ? -10.345 -4.284  35.910 1.00 63.96  ? 58   LEU G CG    1 
ATOM   4770  C  CD1   . LEU G 3 58  ? -10.834 -5.578  35.304 1.00 63.59  ? 58   LEU G CD1   1 
ATOM   4771  C  CD2   . LEU G 3 58  ? -11.118 -3.987  37.150 1.00 63.78  ? 58   LEU G CD2   1 
ATOM   4772  N  N     . THR G 3 59  ? -5.802  -3.579  36.118 1.00 63.22  ? 59   THR G N     1 
ATOM   4773  C  CA    . THR G 3 59  ? -4.412  -3.755  36.568 1.00 63.18  ? 59   THR G CA    1 
ATOM   4774  C  C     . THR G 3 59  ? -3.932  -2.510  37.296 1.00 63.91  ? 59   THR G C     1 
ATOM   4775  O  O     . THR G 3 59  ? -3.239  -2.625  38.290 1.00 64.07  ? 59   THR G O     1 
ATOM   4776  C  CB    . THR G 3 59  ? -3.382  -4.174  35.471 1.00 62.83  ? 59   THR G CB    1 
ATOM   4777  O  OG1   . THR G 3 59  ? -2.486  -3.095  35.214 1.00 61.60  ? 59   THR G OG1   1 
ATOM   4778  C  CG2   . THR G 3 59  ? -4.043  -4.605  34.195 1.00 60.99  ? 59   THR G CG2   1 
ATOM   4779  N  N     . ALA G 3 60  ? -4.346  -1.331  36.820 1.00 64.77  ? 60   ALA G N     1 
ATOM   4780  C  CA    . ALA G 3 60  ? -4.095  -0.073  37.514 1.00 65.34  ? 60   ALA G CA    1 
ATOM   4781  C  C     . ALA G 3 60  ? -4.760  -0.011  38.889 1.00 66.28  ? 60   ALA G C     1 
ATOM   4782  O  O     . ALA G 3 60  ? -4.079  0.172   39.892 1.00 67.06  ? 60   ALA G O     1 
ATOM   4783  C  CB    . ALA G 3 60  ? -4.553  1.076   36.670 1.00 65.63  ? 60   ALA G CB    1 
ATOM   4784  N  N     . GLU G 3 61  ? -6.083  -0.167  38.932 1.00 66.96  ? 61   GLU G N     1 
ATOM   4785  C  CA    . GLU G 3 61  ? -6.838  -0.229  40.184 1.00 67.89  ? 61   GLU G CA    1 
ATOM   4786  C  C     . GLU G 3 61  ? -6.197  -1.128  41.242 1.00 68.38  ? 61   GLU G C     1 
ATOM   4787  O  O     . GLU G 3 61  ? -6.390  -0.894  42.420 1.00 68.95  ? 61   GLU G O     1 
ATOM   4788  C  CB    . GLU G 3 61  ? -8.270  -0.743  39.911 1.00 68.54  ? 61   GLU G CB    1 
ATOM   4789  C  CG    . GLU G 3 61  ? -9.287  -0.508  41.013 1.00 68.78  ? 61   GLU G CG    1 
ATOM   4790  C  CD    . GLU G 3 61  ? -9.794  0.934   41.058 1.00 72.16  ? 61   GLU G CD    1 
ATOM   4791  O  OE1   . GLU G 3 61  ? -9.835  1.625   40.000 1.00 72.01  ? 61   GLU G OE1   1 
ATOM   4792  O  OE2   . GLU G 3 61  ? -10.170 1.379   42.166 1.00 73.80  ? 61   GLU G OE2   1 
ATOM   4793  N  N     . ILE G 3 62  ? -5.490  -2.178  40.830 1.00 68.96  ? 62   ILE G N     1 
ATOM   4794  C  CA    . ILE G 3 62  ? -4.910  -3.139  41.776 1.00 69.65  ? 62   ILE G CA    1 
ATOM   4795  C  C     . ILE G 3 62  ? -3.496  -2.765  42.148 1.00 69.96  ? 62   ILE G C     1 
ATOM   4796  O  O     . ILE G 3 62  ? -3.132  -2.810  43.313 1.00 70.14  ? 62   ILE G O     1 
ATOM   4797  C  CB    . ILE G 3 62  ? -4.939  -4.612  41.242 1.00 70.12  ? 62   ILE G CB    1 
ATOM   4798  C  CG1   . ILE G 3 62  ? -6.379  -5.123  41.216 1.00 70.15  ? 62   ILE G CG1   1 
ATOM   4799  C  CG2   . ILE G 3 62  ? -4.047  -5.571  42.099 1.00 68.90  ? 62   ILE G CG2   1 
ATOM   4800  C  CD1   . ILE G 3 62  ? -6.507  -6.572  40.877 1.00 69.60  ? 62   ILE G CD1   1 
ATOM   4801  N  N     . LEU G 3 63  ? -2.698  -2.431  41.147 1.00 70.65  ? 63   LEU G N     1 
ATOM   4802  C  CA    . LEU G 3 63  ? -1.340  -1.950  41.370 1.00 71.82  ? 63   LEU G CA    1 
ATOM   4803  C  C     . LEU G 3 63  ? -1.317  -0.704  42.259 1.00 72.62  ? 63   LEU G C     1 
ATOM   4804  O  O     . LEU G 3 63  ? -0.322  -0.439  42.932 1.00 73.12  ? 63   LEU G O     1 
ATOM   4805  C  CB    . LEU G 3 63  ? -0.659  -1.641  40.038 1.00 71.64  ? 63   LEU G CB    1 
ATOM   4806  C  CG    . LEU G 3 63  ? -0.378  -2.841  39.137 1.00 71.23  ? 63   LEU G CG    1 
ATOM   4807  C  CD1   . LEU G 3 63  ? -0.263  -2.405  37.681 1.00 70.27  ? 63   LEU G CD1   1 
ATOM   4808  C  CD2   . LEU G 3 63  ? 0.864   -3.582  39.612 1.00 70.78  ? 63   LEU G CD2   1 
ATOM   4809  N  N     . GLU G 3 64  ? -2.414  0.052   42.263 1.00 73.27  ? 64   GLU G N     1 
ATOM   4810  C  CA    . GLU G 3 64  ? -2.511  1.242   43.103 1.00 73.54  ? 64   GLU G CA    1 
ATOM   4811  C  C     . GLU G 3 64  ? -2.559  0.781   44.544 1.00 73.03  ? 64   GLU G C     1 
ATOM   4812  O  O     . GLU G 3 64  ? -1.773  1.223   45.363 1.00 73.47  ? 64   GLU G O     1 
ATOM   4813  C  CB    . GLU G 3 64  ? -3.744  2.074   42.723 1.00 74.04  ? 64   GLU G CB    1 
ATOM   4814  C  CG    . GLU G 3 64  ? -4.040  3.311   43.602 1.00 76.15  ? 64   GLU G CG    1 
ATOM   4815  C  CD    . GLU G 3 64  ? -2.908  4.336   43.656 1.00 77.52  ? 64   GLU G CD    1 
ATOM   4816  O  OE1   . GLU G 3 64  ? -2.554  4.788   44.770 1.00 78.55  ? 64   GLU G OE1   1 
ATOM   4817  O  OE2   . GLU G 3 64  ? -2.379  4.701   42.592 1.00 78.60  ? 64   GLU G OE2   1 
ATOM   4818  N  N     . LEU G 3 65  ? -3.450  -0.155  44.833 1.00 72.51  ? 65   LEU G N     1 
ATOM   4819  C  CA    . LEU G 3 65  ? -3.614  -0.682  46.191 1.00 71.97  ? 65   LEU G CA    1 
ATOM   4820  C  C     . LEU G 3 65  ? -2.487  -1.590  46.680 1.00 71.49  ? 65   LEU G C     1 
ATOM   4821  O  O     . LEU G 3 65  ? -2.208  -1.640  47.881 1.00 70.99  ? 65   LEU G O     1 
ATOM   4822  C  CB    . LEU G 3 65  ? -4.949  -1.400  46.312 1.00 71.48  ? 65   LEU G CB    1 
ATOM   4823  C  CG    . LEU G 3 65  ? -6.039  -0.421  45.955 1.00 70.91  ? 65   LEU G CG    1 
ATOM   4824  C  CD1   . LEU G 3 65  ? -7.254  -1.155  45.416 1.00 72.08  ? 65   LEU G CD1   1 
ATOM   4825  C  CD2   . LEU G 3 65  ? -6.369  0.343   47.189 1.00 72.49  ? 65   LEU G CD2   1 
ATOM   4826  N  N     . ALA G 3 66  ? -1.865  -2.320  45.764 1.00 71.54  ? 66   ALA G N     1 
ATOM   4827  C  CA    . ALA G 3 66  ? -0.733  -3.173  46.132 1.00 71.96  ? 66   ALA G CA    1 
ATOM   4828  C  C     . ALA G 3 66  ? 0.462   -2.330  46.566 1.00 71.58  ? 66   ALA G C     1 
ATOM   4829  O  O     . ALA G 3 66  ? 1.003   -2.542  47.637 1.00 71.51  ? 66   ALA G O     1 
ATOM   4830  C  CB    . ALA G 3 66  ? -0.353  -4.120  45.004 1.00 72.03  ? 66   ALA G CB    1 
ATOM   4831  N  N     . GLY G 3 67  ? 0.836   -1.361  45.741 1.00 71.84  ? 67   GLY G N     1 
ATOM   4832  C  CA    . GLY G 3 67  ? 1.901   -0.393  46.063 1.00 71.86  ? 67   GLY G CA    1 
ATOM   4833  C  C     . GLY G 3 67  ? 1.723   0.357   47.371 1.00 71.51  ? 67   GLY G C     1 
ATOM   4834  O  O     . GLY G 3 67  ? 2.689   0.586   48.118 1.00 71.17  ? 67   GLY G O     1 
ATOM   4835  N  N     . ASN G 3 68  ? 0.487   0.736   47.661 1.00 71.63  ? 68   ASN G N     1 
ATOM   4836  C  CA    . ASN G 3 68  ? 0.189   1.297   48.964 1.00 72.01  ? 68   ASN G CA    1 
ATOM   4837  C  C     . ASN G 3 68  ? 0.419   0.255   50.027 1.00 72.42  ? 68   ASN G C     1 
ATOM   4838  O  O     . ASN G 3 68  ? 0.981   0.547   51.083 1.00 72.42  ? 68   ASN G O     1 
ATOM   4839  C  CB    . ASN G 3 68  ? -1.227  1.833   49.009 1.00 71.72  ? 68   ASN G CB    1 
ATOM   4840  C  CG    . ASN G 3 68  ? -1.397  3.018   48.105 1.00 72.23  ? 68   ASN G CG    1 
ATOM   4841  O  OD1   . ASN G 3 68  ? -0.398  3.636   47.697 1.00 71.61  ? 68   ASN G OD1   1 
ATOM   4842  N  ND2   . ASN G 3 68  ? -2.650  3.347   47.763 1.00 71.32  ? 68   ASN G ND2   1 
ATOM   4843  N  N     . ALA G 3 69  ? 0.021   -0.979  49.719 1.00 72.83  ? 69   ALA G N     1 
ATOM   4844  C  CA    . ALA G 3 69  ? 0.189   -2.067  50.655 1.00 72.98  ? 69   ALA G CA    1 
ATOM   4845  C  C     . ALA G 3 69  ? 1.670   -2.265  50.868 1.00 73.50  ? 69   ALA G C     1 
ATOM   4846  O  O     . ALA G 3 69  ? 2.097   -2.555  51.973 1.00 73.58  ? 69   ALA G O     1 
ATOM   4847  C  CB    . ALA G 3 69  ? -0.439  -3.299  50.135 1.00 72.33  ? 69   ALA G CB    1 
ATOM   4848  N  N     . ALA G 3 70  ? 2.451   -2.073  49.810 1.00 74.59  ? 70   ALA G N     1 
ATOM   4849  C  CA    . ALA G 3 70  ? 3.881   -2.299  49.861 1.00 75.75  ? 70   ALA G CA    1 
ATOM   4850  C  C     . ALA G 3 70  ? 4.502   -1.241  50.744 1.00 76.93  ? 70   ALA G C     1 
ATOM   4851  O  O     . ALA G 3 70  ? 5.328   -1.560  51.605 1.00 76.69  ? 70   ALA G O     1 
ATOM   4852  C  CB    . ALA G 3 70  ? 4.473   -2.249  48.479 1.00 75.54  ? 70   ALA G CB    1 
ATOM   4853  N  N     . ARG G 3 71  ? 4.056   0.007   50.538 1.00 78.45  ? 71   ARG G N     1 
ATOM   4854  C  CA    . ARG G 3 71  ? 4.597   1.201   51.204 1.00 79.65  ? 71   ARG G CA    1 
ATOM   4855  C  C     . ARG G 3 71  ? 4.536   1.081   52.726 1.00 79.98  ? 71   ARG G C     1 
ATOM   4856  O  O     . ARG G 3 71  ? 5.537   1.323   53.419 1.00 80.37  ? 71   ARG G O     1 
ATOM   4857  C  CB    . ARG G 3 71  ? 3.848   2.447   50.728 1.00 80.14  ? 71   ARG G CB    1 
ATOM   4858  C  CG    . ARG G 3 71  ? 4.286   3.766   51.354 1.00 82.71  ? 71   ARG G CG    1 
ATOM   4859  C  CD    . ARG G 3 71  ? 3.085   4.705   51.676 1.00 87.21  ? 71   ARG G CD    1 
ATOM   4860  N  NE    . ARG G 3 71  ? 3.561   5.999   52.200 1.00 91.84  ? 71   ARG G NE    1 
ATOM   4861  C  CZ    . ARG G 3 71  ? 2.881   7.156   52.216 1.00 92.77  ? 71   ARG G CZ    1 
ATOM   4862  N  NH1   . ARG G 3 71  ? 1.635   7.240   51.743 1.00 92.52  ? 71   ARG G NH1   1 
ATOM   4863  N  NH2   . ARG G 3 71  ? 3.464   8.247   52.715 1.00 92.03  ? 71   ARG G NH2   1 
ATOM   4864  N  N     . ASP G 3 72  ? 3.373   0.693   53.238 1.00 80.16  ? 72   ASP G N     1 
ATOM   4865  C  CA    . ASP G 3 72  ? 3.184   0.514   54.667 1.00 80.78  ? 72   ASP G CA    1 
ATOM   4866  C  C     . ASP G 3 72  ? 4.116   -0.584  55.185 1.00 81.25  ? 72   ASP G C     1 
ATOM   4867  O  O     . ASP G 3 72  ? 4.734   -0.448  56.241 1.00 81.47  ? 72   ASP G O     1 
ATOM   4868  C  CB    . ASP G 3 72  ? 1.723   0.187   54.981 1.00 80.97  ? 72   ASP G CB    1 
ATOM   4869  C  CG    . ASP G 3 72  ? 0.742   0.884   54.033 1.00 82.00  ? 72   ASP G CG    1 
ATOM   4870  O  OD1   . ASP G 3 72  ? 1.116   1.902   53.399 1.00 83.23  ? 72   ASP G OD1   1 
ATOM   4871  O  OD2   . ASP G 3 72  ? -0.406  0.404   53.907 1.00 83.21  ? 72   ASP G OD2   1 
ATOM   4872  N  N     . ASN G 3 73  ? 4.255   -1.665  54.429 1.00 81.68  ? 73   ASN G N     1 
ATOM   4873  C  CA    . ASN G 3 73  ? 5.193   -2.712  54.830 1.00 82.28  ? 73   ASN G CA    1 
ATOM   4874  C  C     . ASN G 3 73  ? 6.653   -2.327  54.450 1.00 82.16  ? 73   ASN G C     1 
ATOM   4875  O  O     . ASN G 3 73  ? 7.524   -3.192  54.296 1.00 82.21  ? 73   ASN G O     1 
ATOM   4876  C  CB    . ASN G 3 73  ? 4.766   -4.091  54.278 1.00 82.45  ? 73   ASN G CB    1 
ATOM   4877  C  CG    . ASN G 3 73  ? 3.302   -4.489  54.661 1.00 84.06  ? 73   ASN G CG    1 
ATOM   4878  O  OD1   . ASN G 3 73  ? 3.015   -5.672  54.886 1.00 85.40  ? 73   ASN G OD1   1 
ATOM   4879  N  ND2   . ASN G 3 73  ? 2.387   -3.513  54.700 1.00 83.64  ? 73   ASN G ND2   1 
ATOM   4880  N  N     . LYS G 3 74  ? 6.889   -1.016  54.316 1.00 81.76  ? 74   LYS G N     1 
ATOM   4881  C  CA    . LYS G 3 74  ? 8.205   -0.415  54.006 1.00 81.77  ? 74   LYS G CA    1 
ATOM   4882  C  C     . LYS G 3 74  ? 8.926   -0.927  52.760 1.00 80.91  ? 74   LYS G C     1 
ATOM   4883  O  O     . LYS G 3 74  ? 10.153  -1.047  52.781 1.00 81.06  ? 74   LYS G O     1 
ATOM   4884  C  CB    . LYS G 3 74  ? 9.175   -0.522  55.189 1.00 81.92  ? 74   LYS G CB    1 
ATOM   4885  C  CG    . LYS G 3 74  ? 8.709   0.140   56.471 1.00 84.80  ? 74   LYS G CG    1 
ATOM   4886  C  CD    . LYS G 3 74  ? 8.059   -0.884  57.411 1.00 88.07  ? 74   LYS G CD    1 
ATOM   4887  C  CE    . LYS G 3 74  ? 7.504   -0.222  58.656 1.00 89.29  ? 74   LYS G CE    1 
ATOM   4888  N  NZ    . LYS G 3 74  ? 6.306   -0.982  59.096 1.00 92.24  ? 74   LYS G NZ    1 
ATOM   4889  N  N     . LYS G 3 75  ? 8.212   -1.208  51.674 1.00 79.72  ? 75   LYS G N     1 
ATOM   4890  C  CA    . LYS G 3 75  ? 8.896   -1.893  50.582 1.00 78.92  ? 75   LYS G CA    1 
ATOM   4891  C  C     . LYS G 3 75  ? 8.833   -1.263  49.190 1.00 78.20  ? 75   LYS G C     1 
ATOM   4892  O  O     . LYS G 3 75  ? 7.797   -0.741  48.761 1.00 78.50  ? 75   LYS G O     1 
ATOM   4893  C  CB    . LYS G 3 75  ? 8.549   -3.388  50.562 1.00 79.16  ? 75   LYS G CB    1 
ATOM   4894  C  CG    . LYS G 3 75  ? 9.069   -4.126  51.789 1.00 79.39  ? 75   LYS G CG    1 
ATOM   4895  C  CD    . LYS G 3 75  ? 9.018   -5.635  51.656 1.00 81.63  ? 75   LYS G CD    1 
ATOM   4896  C  CE    . LYS G 3 75  ? 10.186  -6.322  52.406 1.00 82.89  ? 75   LYS G CE    1 
ATOM   4897  N  NZ    . LYS G 3 75  ? 10.748  -5.527  53.558 1.00 82.80  ? 75   LYS G NZ    1 
ATOM   4898  N  N     . THR G 3 76  ? 9.990   -1.336  48.528 1.00 76.56  ? 76   THR G N     1 
ATOM   4899  C  CA    . THR G 3 76  ? 10.258  -0.903  47.153 1.00 74.96  ? 76   THR G CA    1 
ATOM   4900  C  C     . THR G 3 76  ? 9.593   -1.793  46.103 1.00 74.18  ? 76   THR G C     1 
ATOM   4901  O  O     . THR G 3 76  ? 9.504   -1.419  44.931 1.00 74.52  ? 76   THR G O     1 
ATOM   4902  C  CB    . THR G 3 76  ? 11.816  -0.956  46.890 1.00 74.64  ? 76   THR G CB    1 
ATOM   4903  O  OG1   . THR G 3 76  ? 12.489  -0.048  47.763 1.00 74.78  ? 76   THR G OG1   1 
ATOM   4904  C  CG2   . THR G 3 76  ? 12.201  -0.616  45.462 1.00 73.58  ? 76   THR G CG2   1 
ATOM   4905  N  N     . ARG G 3 77  ? 9.168   -2.989  46.494 1.00 72.94  ? 77   ARG G N     1 
ATOM   4906  C  CA    . ARG G 3 77  ? 8.808   -3.996  45.503 1.00 71.48  ? 77   ARG G CA    1 
ATOM   4907  C  C     . ARG G 3 77  ? 7.598   -4.771  45.936 1.00 69.93  ? 77   ARG G C     1 
ATOM   4908  O  O     . ARG G 3 77  ? 7.611   -5.372  47.011 1.00 70.06  ? 77   ARG G O     1 
ATOM   4909  C  CB    . ARG G 3 77  ? 9.951   -4.972  45.309 1.00 71.97  ? 77   ARG G CB    1 
ATOM   4910  C  CG    . ARG G 3 77  ? 11.038  -4.564  44.353 1.00 74.23  ? 77   ARG G CG    1 
ATOM   4911  C  CD    . ARG G 3 77  ? 11.888  -5.791  44.093 1.00 78.90  ? 77   ARG G CD    1 
ATOM   4912  N  NE    . ARG G 3 77  ? 13.306  -5.472  43.963 1.00 83.23  ? 77   ARG G NE    1 
ATOM   4913  C  CZ    . ARG G 3 77  ? 14.297  -6.271  44.356 1.00 84.54  ? 77   ARG G CZ    1 
ATOM   4914  N  NH1   . ARG G 3 77  ? 14.036  -7.445  44.934 1.00 83.46  ? 77   ARG G NH1   1 
ATOM   4915  N  NH2   . ARG G 3 77  ? 15.556  -5.883  44.186 1.00 85.74  ? 77   ARG G NH2   1 
ATOM   4916  N  N     . ILE G 3 78  ? 6.574   -4.762  45.083 1.00 67.92  ? 78   ILE G N     1 
ATOM   4917  C  CA    . ILE G 3 78  ? 5.305   -5.469  45.293 1.00 66.06  ? 78   ILE G CA    1 
ATOM   4918  C  C     . ILE G 3 78  ? 5.445   -6.992  45.187 1.00 64.82  ? 78   ILE G C     1 
ATOM   4919  O  O     . ILE G 3 78  ? 5.668   -7.521  44.114 1.00 64.76  ? 78   ILE G O     1 
ATOM   4920  C  CB    . ILE G 3 78  ? 4.275   -4.996  44.250 1.00 66.26  ? 78   ILE G CB    1 
ATOM   4921  C  CG1   . ILE G 3 78  ? 3.987   -3.500  44.435 1.00 67.09  ? 78   ILE G CG1   1 
ATOM   4922  C  CG2   . ILE G 3 78  ? 2.989   -5.829  44.313 1.00 66.60  ? 78   ILE G CG2   1 
ATOM   4923  C  CD1   . ILE G 3 78  ? 3.101   -2.895  43.364 1.00 68.61  ? 78   ILE G CD1   1 
ATOM   4924  N  N     . ILE G 3 79  ? 5.316   -7.676  46.315 1.00 63.35  ? 79   ILE G N     1 
ATOM   4925  C  CA    . ILE G 3 79  ? 5.306   -9.134  46.407 1.00 62.10  ? 79   ILE G CA    1 
ATOM   4926  C  C     . ILE G 3 79  ? 3.840   -9.595  46.711 1.00 61.78  ? 79   ILE G C     1 
ATOM   4927  O  O     . ILE G 3 79  ? 3.047   -8.802  47.193 1.00 61.37  ? 79   ILE G O     1 
ATOM   4928  C  CB    . ILE G 3 79  ? 6.283   -9.578  47.517 1.00 61.58  ? 79   ILE G CB    1 
ATOM   4929  C  CG1   . ILE G 3 79  ? 5.694   -9.303  48.903 1.00 61.31  ? 79   ILE G CG1   1 
ATOM   4930  C  CG2   . ILE G 3 79  ? 7.599   -8.831  47.366 1.00 62.85  ? 79   ILE G CG2   1 
ATOM   4931  C  CD1   . ILE G 3 79  ? 6.601   -9.600  50.074 1.00 61.62  ? 79   ILE G CD1   1 
ATOM   4932  N  N     . PRO G 3 80  ? 3.470   -10.853 46.406 1.00 61.52  ? 80   PRO G N     1 
ATOM   4933  C  CA    . PRO G 3 80  ? 2.050   -11.259 46.510 1.00 61.99  ? 80   PRO G CA    1 
ATOM   4934  C  C     . PRO G 3 80  ? 1.286   -10.882 47.800 1.00 62.74  ? 80   PRO G C     1 
ATOM   4935  O  O     . PRO G 3 80  ? 0.157   -10.406 47.702 1.00 63.05  ? 80   PRO G O     1 
ATOM   4936  C  CB    . PRO G 3 80  ? 2.103   -12.771 46.303 1.00 61.66  ? 80   PRO G CB    1 
ATOM   4937  C  CG    . PRO G 3 80  ? 3.261   -12.950 45.408 1.00 61.32  ? 80   PRO G CG    1 
ATOM   4938  C  CD    . PRO G 3 80  ? 4.296   -11.958 45.893 1.00 61.47  ? 80   PRO G CD    1 
ATOM   4939  N  N     . ARG G 3 81  ? 1.879   -11.042 48.986 1.00 62.91  ? 81   ARG G N     1 
ATOM   4940  C  CA    . ARG G 3 81  ? 1.215   -10.565 50.199 1.00 62.78  ? 81   ARG G CA    1 
ATOM   4941  C  C     . ARG G 3 81  ? 0.638   -9.188  49.905 1.00 62.50  ? 81   ARG G C     1 
ATOM   4942  O  O     . ARG G 3 81  ? -0.494  -8.878  50.264 1.00 63.96  ? 81   ARG G O     1 
ATOM   4943  C  CB    . ARG G 3 81  ? 2.205   -10.460 51.346 1.00 62.98  ? 81   ARG G CB    1 
ATOM   4944  C  CG    . ARG G 3 81  ? 1.695   -9.672  52.555 1.00 65.31  ? 81   ARG G CG    1 
ATOM   4945  C  CD    . ARG G 3 81  ? 1.321   -10.557 53.759 1.00 68.20  ? 81   ARG G CD    1 
ATOM   4946  N  NE    . ARG G 3 81  ? -0.118  -10.727 53.922 1.00 69.30  ? 81   ARG G NE    1 
ATOM   4947  C  CZ    . ARG G 3 81  ? -0.719  -11.106 55.049 1.00 69.77  ? 81   ARG G CZ    1 
ATOM   4948  N  NH1   . ARG G 3 81  ? -0.024  -11.365 56.139 1.00 68.23  ? 81   ARG G NH1   1 
ATOM   4949  N  NH2   . ARG G 3 81  ? -2.037  -11.234 55.085 1.00 72.27  ? 81   ARG G NH2   1 
ATOM   4950  N  N     . HIS G 3 82  ? 1.418   -8.356  49.227 1.00 61.24  ? 82   HIS G N     1 
ATOM   4951  C  CA    . HIS G 3 82  ? 0.973   -7.016  48.886 1.00 59.18  ? 82   HIS G CA    1 
ATOM   4952  C  C     . HIS G 3 82  ? -0.215  -7.050  47.932 1.00 58.33  ? 82   HIS G C     1 
ATOM   4953  O  O     . HIS G 3 82  ? -1.054  -6.155  47.987 1.00 57.87  ? 82   HIS G O     1 
ATOM   4954  C  CB    . HIS G 3 82  ? 2.096   -6.212  48.266 1.00 57.87  ? 82   HIS G CB    1 
ATOM   4955  C  CG    . HIS G 3 82  ? 3.280   -6.055  49.157 1.00 58.80  ? 82   HIS G CG    1 
ATOM   4956  N  ND1   . HIS G 3 82  ? 4.569   -5.968  48.670 1.00 57.45  ? 82   HIS G ND1   1 
ATOM   4957  C  CD2   . HIS G 3 82  ? 3.375   -5.959  50.504 1.00 57.71  ? 82   HIS G CD2   1 
ATOM   4958  C  CE1   . HIS G 3 82  ? 5.405   -5.813  49.682 1.00 59.54  ? 82   HIS G CE1   1 
ATOM   4959  N  NE2   . HIS G 3 82  ? 4.708   -5.818  50.806 1.00 59.22  ? 82   HIS G NE2   1 
ATOM   4960  N  N     . LEU G 3 83  ? -0.277  -8.030  47.036 1.00 56.97  ? 83   LEU G N     1 
ATOM   4961  C  CA    . LEU G 3 83  ? -1.442  -8.067  46.157 1.00 57.39  ? 83   LEU G CA    1 
ATOM   4962  C  C     . LEU G 3 83  ? -2.637  -8.545  46.982 1.00 57.74  ? 83   LEU G C     1 
ATOM   4963  O  O     . LEU G 3 83  ? -3.720  -7.974  46.912 1.00 57.52  ? 83   LEU G O     1 
ATOM   4964  C  CB    . LEU G 3 83  ? -1.222  -8.953  44.934 1.00 57.15  ? 83   LEU G CB    1 
ATOM   4965  C  CG    . LEU G 3 83  ? -0.209  -8.505  43.863 1.00 55.17  ? 83   LEU G CG    1 
ATOM   4966  C  CD1   . LEU G 3 83  ? -0.057  -9.573  42.803 1.00 52.49  ? 83   LEU G CD1   1 
ATOM   4967  C  CD2   . LEU G 3 83  ? -0.579  -7.180  43.216 1.00 51.67  ? 83   LEU G CD2   1 
ATOM   4968  N  N     . GLN G 3 84  ? -2.381  -9.544  47.823 1.00 57.98  ? 84   GLN G N     1 
ATOM   4969  C  CA    . GLN G 3 84  ? -3.374  -10.132 48.674 1.00 58.61  ? 84   GLN G CA    1 
ATOM   4970  C  C     . GLN G 3 84  ? -4.020  -9.125  49.625 1.00 58.62  ? 84   GLN G C     1 
ATOM   4971  O  O     . GLN G 3 84  ? -5.253  -8.892  49.550 1.00 58.47  ? 84   GLN G O     1 
ATOM   4972  C  CB    . GLN G 3 84  ? -2.779  -11.293 49.444 1.00 58.73  ? 84   GLN G CB    1 
ATOM   4973  C  CG    . GLN G 3 84  ? -3.651  -11.712 50.605 1.00 61.00  ? 84   GLN G CG    1 
ATOM   4974  C  CD    . GLN G 3 84  ? -4.774  -12.660 50.227 1.00 63.02  ? 84   GLN G CD    1 
ATOM   4975  O  OE1   . GLN G 3 84  ? -5.031  -13.615 50.966 1.00 63.89  ? 84   GLN G OE1   1 
ATOM   4976  N  NE2   . GLN G 3 84  ? -5.441  -12.420 49.083 1.00 60.60  ? 84   GLN G NE2   1 
ATOM   4977  N  N     . LEU G 3 85  ? -3.202  -8.523  50.491 1.00 57.64  ? 85   LEU G N     1 
ATOM   4978  C  CA    . LEU G 3 85  ? -3.645  -7.371  51.292 1.00 57.28  ? 85   LEU G CA    1 
ATOM   4979  C  C     . LEU G 3 85  ? -4.492  -6.398  50.462 1.00 57.04  ? 85   LEU G C     1 
ATOM   4980  O  O     . LEU G 3 85  ? -5.612  -6.011  50.879 1.00 56.85  ? 85   LEU G O     1 
ATOM   4981  C  CB    . LEU G 3 85  ? -2.458  -6.629  51.921 1.00 56.85  ? 85   LEU G CB    1 
ATOM   4982  C  CG    . LEU G 3 85  ? -1.597  -7.458  52.887 1.00 57.40  ? 85   LEU G CG    1 
ATOM   4983  C  CD1   . LEU G 3 85  ? -0.522  -6.625  53.513 1.00 56.31  ? 85   LEU G CD1   1 
ATOM   4984  C  CD2   . LEU G 3 85  ? -2.450  -8.102  53.973 1.00 59.73  ? 85   LEU G CD2   1 
ATOM   4985  N  N     . ALA G 3 86  ? -3.965  -6.013  49.298 1.00 56.08  ? 86   ALA G N     1 
ATOM   4986  C  CA    . ALA G 3 86  ? -4.702  -5.186  48.381 1.00 56.27  ? 86   ALA G CA    1 
ATOM   4987  C  C     . ALA G 3 86  ? -6.130  -5.752  48.107 1.00 57.27  ? 86   ALA G C     1 
ATOM   4988  O  O     . ALA G 3 86  ? -7.116  -5.093  48.409 1.00 57.67  ? 86   ALA G O     1 
ATOM   4989  C  CB    . ALA G 3 86  ? -3.954  -5.058  47.145 1.00 55.78  ? 86   ALA G CB    1 
ATOM   4990  N  N     . VAL G 3 87  ? -6.219  -6.991  47.624 1.00 57.61  ? 87   VAL G N     1 
ATOM   4991  C  CA    . VAL G 3 87  ? -7.470  -7.586  47.198 1.00 58.44  ? 87   VAL G CA    1 
ATOM   4992  C  C     . VAL G 3 87  ? -8.560  -7.772  48.275 1.00 59.03  ? 87   VAL G C     1 
ATOM   4993  O  O     . VAL G 3 87  ? -9.721  -7.452  48.029 1.00 58.69  ? 87   VAL G O     1 
ATOM   4994  C  CB    . VAL G 3 87  ? -7.230  -8.930  46.460 1.00 58.98  ? 87   VAL G CB    1 
ATOM   4995  C  CG1   . VAL G 3 87  ? -8.512  -9.362  45.693 1.00 57.64  ? 87   VAL G CG1   1 
ATOM   4996  C  CG2   . VAL G 3 87  ? -6.023  -8.801  45.499 1.00 58.31  ? 87   VAL G CG2   1 
ATOM   4997  N  N     . ARG G 3 88  ? -8.194  -8.291  49.445 1.00 59.34  ? 88   ARG G N     1 
ATOM   4998  C  CA    . ARG G 3 88  ? -9.187  -8.644  50.443 1.00 60.22  ? 88   ARG G CA    1 
ATOM   4999  C  C     . ARG G 3 88  ? -9.580  -7.451  51.304 1.00 60.68  ? 88   ARG G C     1 
ATOM   5000  O  O     . ARG G 3 88  ? -10.555 -7.502  52.031 1.00 61.54  ? 88   ARG G O     1 
ATOM   5001  C  CB    . ARG G 3 88  ? -8.735  -9.830  51.300 1.00 59.98  ? 88   ARG G CB    1 
ATOM   5002  C  CG    . ARG G 3 88  ? -7.793  -10.801 50.601 1.00 60.98  ? 88   ARG G CG    1 
ATOM   5003  C  CD    . ARG G 3 88  ? -8.411  -12.134 50.132 1.00 59.94  ? 88   ARG G CD    1 
ATOM   5004  N  NE    . ARG G 3 88  ? -9.213  -12.077 48.899 1.00 58.84  ? 88   ARG G NE    1 
ATOM   5005  C  CZ    . ARG G 3 88  ? -9.079  -12.893 47.848 1.00 56.38  ? 88   ARG G CZ    1 
ATOM   5006  N  NH1   . ARG G 3 88  ? -8.148  -13.819 47.828 1.00 58.52  ? 88   ARG G NH1   1 
ATOM   5007  N  NH2   . ARG G 3 88  ? -9.873  -12.773 46.795 1.00 55.07  ? 88   ARG G NH2   1 
ATOM   5008  N  N     . ASN G 3 89  ? -8.843  -6.359  51.200 1.00 61.46  ? 89   ASN G N     1 
ATOM   5009  C  CA    . ASN G 3 89  ? -9.252  -5.109  51.856 1.00 61.73  ? 89   ASN G CA    1 
ATOM   5010  C  C     . ASN G 3 89  ? -10.232 -4.268  51.037 1.00 62.46  ? 89   ASN G C     1 
ATOM   5011  O  O     . ASN G 3 89  ? -10.946 -3.430  51.595 1.00 62.80  ? 89   ASN G O     1 
ATOM   5012  C  CB    . ASN G 3 89  ? -8.035  -4.281  52.221 1.00 60.78  ? 89   ASN G CB    1 
ATOM   5013  C  CG    . ASN G 3 89  ? -7.298  -4.855  53.389 1.00 59.53  ? 89   ASN G CG    1 
ATOM   5014  O  OD1   . ASN G 3 89  ? -7.883  -5.080  54.441 1.00 56.22  ? 89   ASN G OD1   1 
ATOM   5015  N  ND2   . ASN G 3 89  ? -6.002  -5.120  53.212 1.00 59.66  ? 89   ASN G ND2   1 
ATOM   5016  N  N     . ASP G 3 90  ? -10.251 -4.485  49.724 1.00 62.70  ? 90   ASP G N     1 
ATOM   5017  C  CA    . ASP G 3 90  ? -11.196 -3.817  48.870 1.00 63.63  ? 90   ASP G CA    1 
ATOM   5018  C  C     . ASP G 3 90  ? -12.479 -4.645  48.688 1.00 64.20  ? 90   ASP G C     1 
ATOM   5019  O  O     . ASP G 3 90  ? -12.482 -5.662  47.977 1.00 64.55  ? 90   ASP G O     1 
ATOM   5020  C  CB    . ASP G 3 90  ? -10.556 -3.568  47.533 1.00 63.81  ? 90   ASP G CB    1 
ATOM   5021  C  CG    . ASP G 3 90  ? -11.464 -2.806  46.592 1.00 65.41  ? 90   ASP G CG    1 
ATOM   5022  O  OD1   . ASP G 3 90  ? -11.631 -1.574  46.768 1.00 63.36  ? 90   ASP G OD1   1 
ATOM   5023  O  OD2   . ASP G 3 90  ? -11.999 -3.454  45.661 1.00 68.73  ? 90   ASP G OD2   1 
ATOM   5024  N  N     . GLU G 3 91  ? -13.566 -4.230  49.322 1.00 64.01  ? 91   GLU G N     1 
ATOM   5025  C  CA    . GLU G 3 91  ? -14.803 -4.996  49.216 1.00 65.30  ? 91   GLU G CA    1 
ATOM   5026  C  C     . GLU G 3 91  ? -14.968 -5.519  47.805 1.00 64.69  ? 91   GLU G C     1 
ATOM   5027  O  O     . GLU G 3 91  ? -15.116 -6.725  47.627 1.00 65.32  ? 91   GLU G O     1 
ATOM   5028  C  CB    . GLU G 3 91  ? -16.035 -4.191  49.657 1.00 64.88  ? 91   GLU G CB    1 
ATOM   5029  C  CG    . GLU G 3 91  ? -17.365 -4.743  49.167 1.00 67.19  ? 91   GLU G CG    1 
ATOM   5030  C  CD    . GLU G 3 91  ? -18.582 -3.998  49.766 1.00 68.43  ? 91   GLU G CD    1 
ATOM   5031  O  OE1   . GLU G 3 91  ? -19.283 -3.296  48.985 1.00 70.49  ? 91   GLU G OE1   1 
ATOM   5032  O  OE2   . GLU G 3 91  ? -18.824 -4.110  51.006 1.00 71.19  ? 91   GLU G OE2   1 
ATOM   5033  N  N     . GLU G 3 92  ? -14.876 -4.630  46.813 1.00 64.57  ? 92   GLU G N     1 
ATOM   5034  C  CA    . GLU G 3 92  ? -15.180 -4.952  45.405 1.00 64.47  ? 92   GLU G CA    1 
ATOM   5035  C  C     . GLU G 3 92  ? -14.197 -5.871  44.662 1.00 63.77  ? 92   GLU G C     1 
ATOM   5036  O  O     . GLU G 3 92  ? -14.625 -6.849  44.042 1.00 63.45  ? 92   GLU G O     1 
ATOM   5037  C  CB    . GLU G 3 92  ? -15.368 -3.670  44.606 1.00 64.98  ? 92   GLU G CB    1 
ATOM   5038  C  CG    . GLU G 3 92  ? -16.797 -3.149  44.601 1.00 68.09  ? 92   GLU G CG    1 
ATOM   5039  C  CD    . GLU G 3 92  ? -16.961 -1.979  43.653 1.00 72.05  ? 92   GLU G CD    1 
ATOM   5040  O  OE1   . GLU G 3 92  ? -15.923 -1.326  43.354 1.00 73.98  ? 92   GLU G OE1   1 
ATOM   5041  O  OE2   . GLU G 3 92  ? -18.107 -1.730  43.202 1.00 72.17  ? 92   GLU G OE2   1 
ATOM   5042  N  N     . LEU G 3 93  ? -12.901 -5.537  44.687 1.00 63.05  ? 93   LEU G N     1 
ATOM   5043  C  CA    . LEU G 3 93  ? -11.869 -6.417  44.124 1.00 62.53  ? 93   LEU G CA    1 
ATOM   5044  C  C     . LEU G 3 93  ? -11.995 -7.779  44.740 1.00 62.55  ? 93   LEU G C     1 
ATOM   5045  O  O     . LEU G 3 93  ? -12.027 -8.790  44.031 1.00 62.39  ? 93   LEU G O     1 
ATOM   5046  C  CB    . LEU G 3 93  ? -10.456 -5.890  44.375 1.00 62.31  ? 93   LEU G CB    1 
ATOM   5047  C  CG    . LEU G 3 93  ? -9.801  -4.993  43.316 1.00 62.43  ? 93   LEU G CG    1 
ATOM   5048  C  CD1   . LEU G 3 93  ? -8.382  -4.639  43.762 1.00 62.27  ? 93   LEU G CD1   1 
ATOM   5049  C  CD2   . LEU G 3 93  ? -9.782  -5.615  41.881 1.00 59.87  ? 93   LEU G CD2   1 
ATOM   5050  N  N     . ASN G 3 94  ? -12.112 -7.791  46.071 1.00 62.85  ? 94   ASN G N     1 
ATOM   5051  C  CA    . ASN G 3 94  ? -12.252 -9.025  46.835 1.00 62.85  ? 94   ASN G CA    1 
ATOM   5052  C  C     . ASN G 3 94  ? -13.366 -9.921  46.349 1.00 62.66  ? 94   ASN G C     1 
ATOM   5053  O  O     . ASN G 3 94  ? -13.260 -11.135 46.506 1.00 64.11  ? 94   ASN G O     1 
ATOM   5054  C  CB    . ASN G 3 94  ? -12.489 -8.740  48.317 1.00 62.83  ? 94   ASN G CB    1 
ATOM   5055  C  CG    . ASN G 3 94  ? -12.949 -9.981  49.080 1.00 63.01  ? 94   ASN G CG    1 
ATOM   5056  O  OD1   . ASN G 3 94  ? -12.145 -10.867 49.408 1.00 61.56  ? 94   ASN G OD1   1 
ATOM   5057  N  ND2   . ASN G 3 94  ? -14.251 -10.058 49.345 1.00 61.93  ? 94   ASN G ND2   1 
ATOM   5058  N  N     . LYS G 3 95  ? -14.434 -9.333  45.802 1.00 62.10  ? 95   LYS G N     1 
ATOM   5059  C  CA    . LYS G 3 95  ? -15.612 -10.085 45.372 1.00 61.29  ? 95   LYS G CA    1 
ATOM   5060  C  C     . LYS G 3 95  ? -15.341 -10.619 43.993 1.00 60.76  ? 95   LYS G C     1 
ATOM   5061  O  O     . LYS G 3 95  ? -15.557 -11.800 43.720 1.00 60.43  ? 95   LYS G O     1 
ATOM   5062  C  CB    . LYS G 3 95  ? -16.875 -9.220  45.349 1.00 61.60  ? 95   LYS G CB    1 
ATOM   5063  C  CG    . LYS G 3 95  ? -18.118 -9.966  44.887 1.00 62.68  ? 95   LYS G CG    1 
ATOM   5064  C  CD    . LYS G 3 95  ? -19.214 -8.974  44.585 1.00 67.00  ? 95   LYS G CD    1 
ATOM   5065  C  CE    . LYS G 3 95  ? -20.628 -9.630  44.435 1.00 69.52  ? 95   LYS G CE    1 
ATOM   5066  N  NZ    . LYS G 3 95  ? -21.700 -8.588  44.174 1.00 68.06  ? 95   LYS G NZ    1 
ATOM   5067  N  N     . LEU G 3 96  ? -14.853 -9.744  43.118 1.00 60.43  ? 96   LEU G N     1 
ATOM   5068  C  CA    . LEU G 3 96  ? -14.344 -10.192 41.813 1.00 59.71  ? 96   LEU G CA    1 
ATOM   5069  C  C     . LEU G 3 96  ? -13.405 -11.386 41.949 1.00 58.04  ? 96   LEU G C     1 
ATOM   5070  O  O     . LEU G 3 96  ? -13.468 -12.317 41.144 1.00 58.21  ? 96   LEU G O     1 
ATOM   5071  C  CB    . LEU G 3 96  ? -13.645 -9.058  41.071 1.00 59.75  ? 96   LEU G CB    1 
ATOM   5072  C  CG    . LEU G 3 96  ? -13.263 -9.360  39.619 1.00 61.05  ? 96   LEU G CG    1 
ATOM   5073  C  CD1   . LEU G 3 96  ? -14.487 -9.592  38.746 1.00 61.04  ? 96   LEU G CD1   1 
ATOM   5074  C  CD2   . LEU G 3 96  ? -12.390 -8.241  39.046 1.00 60.86  ? 96   LEU G CD2   1 
ATOM   5075  N  N     . LEU G 3 97  ? -12.550 -11.380 42.970 1.00 56.91  ? 97   LEU G N     1 
ATOM   5076  C  CA    . LEU G 3 97  ? -11.638 -12.520 43.173 1.00 55.91  ? 97   LEU G CA    1 
ATOM   5077  C  C     . LEU G 3 97  ? -12.048 -13.355 44.381 1.00 55.07  ? 97   LEU G C     1 
ATOM   5078  O  O     . LEU G 3 97  ? -11.183 -13.900 45.134 1.00 56.18  ? 97   LEU G O     1 
ATOM   5079  C  CB    . LEU G 3 97  ? -10.178 -12.076 43.294 1.00 55.30  ? 97   LEU G CB    1 
ATOM   5080  C  CG    . LEU G 3 97  ? -9.668  -11.034 42.325 1.00 55.32  ? 97   LEU G CG    1 
ATOM   5081  C  CD1   . LEU G 3 97  ? -8.128  -11.090 42.320 1.00 57.39  ? 97   LEU G CD1   1 
ATOM   5082  C  CD2   . LEU G 3 97  ? -10.196 -11.314 40.967 1.00 54.32  ? 97   LEU G CD2   1 
ATOM   5083  N  N     . GLY G 3 98  ? -13.359 -13.484 44.546 1.00 53.05  ? 98   GLY G N     1 
ATOM   5084  C  CA    . GLY G 3 98  ? -13.905 -14.178 45.675 1.00 50.34  ? 98   GLY G CA    1 
ATOM   5085  C  C     . GLY G 3 98  ? -13.625 -15.647 45.611 1.00 49.28  ? 98   GLY G C     1 
ATOM   5086  O  O     . GLY G 3 98  ? -13.660 -16.283 46.642 1.00 49.75  ? 98   GLY G O     1 
ATOM   5087  N  N     . ARG G 3 99  ? -13.374 -16.204 44.425 1.00 48.94  ? 99   ARG G N     1 
ATOM   5088  C  CA    . ARG G 3 99  ? -12.920 -17.603 44.314 1.00 50.05  ? 99   ARG G CA    1 
ATOM   5089  C  C     . ARG G 3 99  ? -11.438 -17.792 43.836 1.00 50.64  ? 99   ARG G C     1 
ATOM   5090  O  O     . ARG G 3 99  ? -11.139 -18.739 43.076 1.00 50.94  ? 99   ARG G O     1 
ATOM   5091  C  CB    . ARG G 3 99  ? -13.862 -18.462 43.477 1.00 49.56  ? 99   ARG G CB    1 
ATOM   5092  C  CG    . ARG G 3 99  ? -15.319 -18.176 43.781 1.00 56.25  ? 99   ARG G CG    1 
ATOM   5093  C  CD    . ARG G 3 99  ? -16.256 -19.416 43.719 1.00 63.19  ? 99   ARG G CD    1 
ATOM   5094  N  NE    . ARG G 3 99  ? -17.324 -19.267 44.719 1.00 67.17  ? 99   ARG G NE    1 
ATOM   5095  C  CZ    . ARG G 3 99  ? -17.198 -19.552 46.021 1.00 70.55  ? 99   ARG G CZ    1 
ATOM   5096  N  NH1   . ARG G 3 99  ? -16.049 -20.038 46.503 1.00 70.72  ? 99   ARG G NH1   1 
ATOM   5097  N  NH2   . ARG G 3 99  ? -18.229 -19.358 46.849 1.00 71.36  ? 99   ARG G NH2   1 
ATOM   5098  N  N     . VAL G 3 100 ? -10.496 -16.969 44.315 1.00 49.83  ? 100  VAL G N     1 
ATOM   5099  C  CA    . VAL G 3 100 ? -9.138  -17.081 43.731 1.00 51.06  ? 100  VAL G CA    1 
ATOM   5100  C  C     . VAL G 3 100 ? -7.967  -17.139 44.729 1.00 50.64  ? 100  VAL G C     1 
ATOM   5101  O  O     . VAL G 3 100 ? -7.736  -16.192 45.520 1.00 50.36  ? 100  VAL G O     1 
ATOM   5102  C  CB    . VAL G 3 100 ? -8.861  -15.964 42.704 1.00 50.47  ? 100  VAL G CB    1 
ATOM   5103  C  CG1   . VAL G 3 100 ? -7.398  -16.019 42.291 1.00 53.23  ? 100  VAL G CG1   1 
ATOM   5104  C  CG2   . VAL G 3 100 ? -9.727  -16.135 41.521 1.00 51.00  ? 100  VAL G CG2   1 
ATOM   5105  N  N     . THR G 3 101 ? -7.239  -18.241 44.731 1.00 50.86  ? 101  THR G N     1 
ATOM   5106  C  CA    . THR G 3 101 ? -6.056  -18.256 45.603 1.00 51.38  ? 101  THR G CA    1 
ATOM   5107  C  C     . THR G 3 101 ? -4.941  -17.486 44.952 1.00 50.22  ? 101  THR G C     1 
ATOM   5108  O  O     . THR G 3 101 ? -4.577  -17.776 43.830 1.00 51.08  ? 101  THR G O     1 
ATOM   5109  C  CB    . THR G 3 101 ? -5.582  -19.639 45.976 1.00 51.36  ? 101  THR G CB    1 
ATOM   5110  O  OG1   . THR G 3 101 ? -6.555  -20.190 46.843 1.00 54.89  ? 101  THR G OG1   1 
ATOM   5111  C  CG2   . THR G 3 101 ? -4.254  -19.561 46.778 1.00 51.01  ? 101  THR G CG2   1 
ATOM   5112  N  N     . ILE G 3 102 ? -4.463  -16.462 45.625 1.00 48.86  ? 102  ILE G N     1 
ATOM   5113  C  CA    . ILE G 3 102 ? -3.158  -15.927 45.247 1.00 48.62  ? 102  ILE G CA    1 
ATOM   5114  C  C     . ILE G 3 102 ? -2.026  -16.698 45.910 1.00 47.69  ? 102  ILE G C     1 
ATOM   5115  O  O     . ILE G 3 102 ? -1.853  -16.584 47.117 1.00 47.02  ? 102  ILE G O     1 
ATOM   5116  C  CB    . ILE G 3 102 ? -3.001  -14.477 45.676 1.00 48.20  ? 102  ILE G CB    1 
ATOM   5117  C  CG1   . ILE G 3 102 ? -3.946  -13.608 44.878 1.00 42.86  ? 102  ILE G CG1   1 
ATOM   5118  C  CG2   . ILE G 3 102 ? -1.466  -14.020 45.564 1.00 49.87  ? 102  ILE G CG2   1 
ATOM   5119  C  CD1   . ILE G 3 102 ? -3.925  -12.277 45.399 1.00 39.82  ? 102  ILE G CD1   1 
ATOM   5120  N  N     . ALA G 3 103 ? -1.266  -17.472 45.144 1.00 48.32  ? 103  ALA G N     1 
ATOM   5121  C  CA    . ALA G 3 103 ? 0.028   -18.045 45.679 1.00 49.84  ? 103  ALA G CA    1 
ATOM   5122  C  C     . ALA G 3 103 ? 0.777   -17.077 46.648 1.00 50.22  ? 103  ALA G C     1 
ATOM   5123  O  O     . ALA G 3 103 ? 0.917   -15.902 46.355 1.00 50.54  ? 103  ALA G O     1 
ATOM   5124  C  CB    . ALA G 3 103 ? 0.945   -18.444 44.546 1.00 49.12  ? 103  ALA G CB    1 
ATOM   5125  N  N     . GLN G 3 104 ? 1.210   -17.546 47.811 1.00 51.73  ? 104  GLN G N     1 
ATOM   5126  C  CA    . GLN G 3 104 ? 1.896   -16.665 48.787 1.00 53.35  ? 104  GLN G CA    1 
ATOM   5127  C  C     . GLN G 3 104 ? 1.075   -15.460 49.353 1.00 54.05  ? 104  GLN G C     1 
ATOM   5128  O  O     . GLN G 3 104 ? 1.565   -14.679 50.171 1.00 53.46  ? 104  GLN G O     1 
ATOM   5129  C  CB    . GLN G 3 104 ? 3.266   -16.234 48.232 1.00 53.75  ? 104  GLN G CB    1 
ATOM   5130  C  CG    . GLN G 3 104 ? 4.230   -17.422 48.076 1.00 55.47  ? 104  GLN G CG    1 
ATOM   5131  C  CD    . GLN G 3 104 ? 4.653   -17.992 49.450 1.00 61.05  ? 104  GLN G CD    1 
ATOM   5132  O  OE1   . GLN G 3 104 ? 5.238   -17.272 50.296 1.00 62.05  ? 104  GLN G OE1   1 
ATOM   5133  N  NE2   . GLN G 3 104 ? 4.333   -19.274 49.691 1.00 61.20  ? 104  GLN G NE2   1 
ATOM   5134  N  N     . GLY G 3 105 ? -0.193  -15.346 48.959 1.00 54.66  ? 105  GLY G N     1 
ATOM   5135  C  CA    . GLY G 3 105 ? -1.124  -14.412 49.600 1.00 55.22  ? 105  GLY G CA    1 
ATOM   5136  C  C     . GLY G 3 105 ? -1.322  -14.391 51.115 1.00 56.09  ? 105  GLY G C     1 
ATOM   5137  O  O     . GLY G 3 105 ? -1.612  -13.347 51.673 1.00 56.64  ? 105  GLY G O     1 
ATOM   5138  N  N     . GLY G 3 106 ? -1.194  -15.512 51.809 1.00 56.97  ? 106  GLY G N     1 
ATOM   5139  C  CA    . GLY G 3 106 ? -1.434  -15.505 53.251 1.00 58.42  ? 106  GLY G CA    1 
ATOM   5140  C  C     . GLY G 3 106 ? -2.905  -15.178 53.490 1.00 60.05  ? 106  GLY G C     1 
ATOM   5141  O  O     . GLY G 3 106 ? -3.706  -15.224 52.559 1.00 59.25  ? 106  GLY G O     1 
ATOM   5142  N  N     . VAL G 3 107 ? -3.270  -14.857 54.733 1.00 61.94  ? 107  VAL G N     1 
ATOM   5143  C  CA    . VAL G 3 107 ? -4.646  -14.417 55.035 1.00 63.69  ? 107  VAL G CA    1 
ATOM   5144  C  C     . VAL G 3 107 ? -4.640  -13.059 55.760 1.00 65.14  ? 107  VAL G C     1 
ATOM   5145  O  O     . VAL G 3 107 ? -3.579  -12.631 56.264 1.00 65.51  ? 107  VAL G O     1 
ATOM   5146  C  CB    . VAL G 3 107 ? -5.432  -15.461 55.845 1.00 63.44  ? 107  VAL G CB    1 
ATOM   5147  C  CG1   . VAL G 3 107 ? -5.237  -16.843 55.272 1.00 64.22  ? 107  VAL G CG1   1 
ATOM   5148  C  CG2   . VAL G 3 107 ? -5.027  -15.447 57.303 1.00 63.39  ? 107  VAL G CG2   1 
ATOM   5149  N  N     . LEU G 3 108 ? -5.797  -12.378 55.808 1.00 66.22  ? 108  LEU G N     1 
ATOM   5150  C  CA    . LEU G 3 108 ? -5.902  -11.113 56.577 1.00 67.06  ? 108  LEU G CA    1 
ATOM   5151  C  C     . LEU G 3 108 ? -5.911  -11.341 58.079 1.00 68.37  ? 108  LEU G C     1 
ATOM   5152  O  O     . LEU G 3 108 ? -6.595  -12.255 58.543 1.00 68.06  ? 108  LEU G O     1 
ATOM   5153  C  CB    . LEU G 3 108 ? -7.135  -10.305 56.203 1.00 66.30  ? 108  LEU G CB    1 
ATOM   5154  C  CG    . LEU G 3 108 ? -7.098  -9.624  54.850 1.00 65.14  ? 108  LEU G CG    1 
ATOM   5155  C  CD1   . LEU G 3 108 ? -8.329  -8.751  54.681 1.00 64.52  ? 108  LEU G CD1   1 
ATOM   5156  C  CD2   . LEU G 3 108 ? -5.802  -8.857  54.672 1.00 63.73  ? 108  LEU G CD2   1 
ATOM   5157  N  N     . PRO G 3 109 ? -5.143  -10.520 58.839 1.00 70.00  ? 109  PRO G N     1 
ATOM   5158  C  CA    . PRO G 3 109 ? -5.139  -10.651 60.292 1.00 71.38  ? 109  PRO G CA    1 
ATOM   5159  C  C     . PRO G 3 109 ? -6.494  -10.261 60.851 1.00 72.61  ? 109  PRO G C     1 
ATOM   5160  O  O     . PRO G 3 109 ? -6.878  -9.103  60.799 1.00 72.27  ? 109  PRO G O     1 
ATOM   5161  C  CB    . PRO G 3 109 ? -4.033  -9.683  60.742 1.00 70.79  ? 109  PRO G CB    1 
ATOM   5162  C  CG    . PRO G 3 109 ? -3.213  -9.438  59.528 1.00 70.55  ? 109  PRO G CG    1 
ATOM   5163  C  CD    . PRO G 3 109 ? -4.227  -9.447  58.417 1.00 70.16  ? 109  PRO G CD    1 
ATOM   5164  N  N     . ASN G 3 110 ? -7.207  -11.270 61.331 1.00 74.89  ? 110  ASN G N     1 
ATOM   5165  C  CA    . ASN G 3 110 ? -8.528  -11.143 61.913 1.00 77.60  ? 110  ASN G CA    1 
ATOM   5166  C  C     . ASN G 3 110 ? -8.654  -12.286 62.923 1.00 78.87  ? 110  ASN G C     1 
ATOM   5167  O  O     . ASN G 3 110 ? -8.553  -13.457 62.559 1.00 78.82  ? 110  ASN G O     1 
ATOM   5168  C  CB    . ASN G 3 110 ? -9.610  -11.215 60.813 1.00 77.97  ? 110  ASN G CB    1 
ATOM   5169  C  CG    . ASN G 3 110 ? -11.052 -11.186 61.366 1.00 80.30  ? 110  ASN G CG    1 
ATOM   5170  O  OD1   . ASN G 3 110 ? -11.302 -10.788 62.518 1.00 83.52  ? 110  ASN G OD1   1 
ATOM   5171  N  ND2   . ASN G 3 110 ? -12.011 -11.599 60.528 1.00 80.97  ? 110  ASN G ND2   1 
ATOM   5172  N  N     . ILE G 3 111 ? -8.809  -11.923 64.196 1.00 80.95  ? 111  ILE G N     1 
ATOM   5173  C  CA    . ILE G 3 111 ? -8.982  -12.873 65.299 1.00 82.88  ? 111  ILE G CA    1 
ATOM   5174  C  C     . ILE G 3 111 ? -10.350 -12.656 65.901 1.00 84.73  ? 111  ILE G C     1 
ATOM   5175  O  O     . ILE G 3 111 ? -10.693 -11.539 66.281 1.00 85.23  ? 111  ILE G O     1 
ATOM   5176  C  CB    . ILE G 3 111 ? -7.945  -12.677 66.431 1.00 82.50  ? 111  ILE G CB    1 
ATOM   5177  C  CG1   . ILE G 3 111 ? -6.533  -13.027 65.940 1.00 83.19  ? 111  ILE G CG1   1 
ATOM   5178  C  CG2   . ILE G 3 111 ? -8.329  -13.504 67.661 1.00 81.84  ? 111  ILE G CG2   1 
ATOM   5179  C  CD1   . ILE G 3 111 ? -5.423  -12.974 67.014 1.00 82.58  ? 111  ILE G CD1   1 
ATOM   5180  N  N     . GLN G 3 112 ? -11.122 -13.731 66.007 1.00 87.09  ? 112  GLN G N     1 
ATOM   5181  C  CA    . GLN G 3 112 ? -12.492 -13.648 66.508 1.00 88.87  ? 112  GLN G CA    1 
ATOM   5182  C  C     . GLN G 3 112 ? -12.501 -13.152 67.941 1.00 90.17  ? 112  GLN G C     1 
ATOM   5183  O  O     . GLN G 3 112 ? -11.583 -13.462 68.710 1.00 90.05  ? 112  GLN G O     1 
ATOM   5184  C  CB    . GLN G 3 112 ? -13.183 -15.009 66.397 1.00 88.97  ? 112  GLN G CB    1 
ATOM   5185  C  CG    . GLN G 3 112 ? -13.455 -15.437 64.962 1.00 88.76  ? 112  GLN G CG    1 
ATOM   5186  C  CD    . GLN G 3 112 ? -14.598 -14.661 64.339 1.00 89.67  ? 112  GLN G CD    1 
ATOM   5187  O  OE1   . GLN G 3 112 ? -15.744 -14.731 64.805 1.00 91.15  ? 112  GLN G OE1   1 
ATOM   5188  N  NE2   . GLN G 3 112 ? -14.298 -13.919 63.278 1.00 88.06  ? 112  GLN G NE2   1 
ATOM   5189  N  N     . SER G 3 113 ? -13.537 -12.373 68.272 1.00 91.88  ? 113  SER G N     1 
ATOM   5190  C  CA    . SER G 3 113 ? -13.704 -11.749 69.594 1.00 93.35  ? 113  SER G CA    1 
ATOM   5191  C  C     . SER G 3 113 ? -13.622 -12.730 70.753 1.00 94.41  ? 113  SER G C     1 
ATOM   5192  O  O     . SER G 3 113 ? -12.726 -12.634 71.590 1.00 94.56  ? 113  SER G O     1 
ATOM   5193  C  CB    . SER G 3 113 ? -15.040 -11.017 69.671 1.00 93.14  ? 113  SER G CB    1 
ATOM   5194  O  OG    . SER G 3 113 ? -14.954 -9.766  69.023 1.00 94.24  ? 113  SER G OG    1 
ATOM   5195  N  N     . VAL G 3 114 ? -14.565 -13.672 70.779 1.00 95.71  ? 114  VAL G N     1 
ATOM   5196  C  CA    . VAL G 3 114 ? -14.719 -14.642 71.866 1.00 96.90  ? 114  VAL G CA    1 
ATOM   5197  C  C     . VAL G 3 114 ? -13.449 -15.432 72.197 1.00 97.78  ? 114  VAL G C     1 
ATOM   5198  O  O     . VAL G 3 114 ? -13.420 -16.164 73.180 1.00 98.15  ? 114  VAL G O     1 
ATOM   5199  C  CB    . VAL G 3 114 ? -15.893 -15.627 71.583 1.00 96.90  ? 114  VAL G CB    1 
ATOM   5200  C  CG1   . VAL G 3 114 ? -17.189 -15.152 72.232 1.00 96.94  ? 114  VAL G CG1   1 
ATOM   5201  C  CG2   . VAL G 3 114 ? -16.086 -15.815 70.088 1.00 97.32  ? 114  VAL G CG2   1 
ATOM   5202  N  N     . LEU G 3 115 ? -12.406 -15.277 71.386 1.00 98.97  ? 115  LEU G N     1 
ATOM   5203  C  CA    . LEU G 3 115 ? -11.127 -15.960 71.624 1.00 100.27 ? 115  LEU G CA    1 
ATOM   5204  C  C     . LEU G 3 115 ? -10.125 -15.060 72.353 1.00 101.23 ? 115  LEU G C     1 
ATOM   5205  O  O     . LEU G 3 115 ? -9.042  -15.517 72.755 1.00 101.24 ? 115  LEU G O     1 
ATOM   5206  C  CB    . LEU G 3 115 ? -10.515 -16.461 70.306 1.00 100.19 ? 115  LEU G CB    1 
ATOM   5207  C  CG    . LEU G 3 115 ? -11.433 -17.005 69.207 1.00 100.04 ? 115  LEU G CG    1 
ATOM   5208  C  CD1   . LEU G 3 115 ? -10.619 -17.319 67.971 1.00 99.24  ? 115  LEU G CD1   1 
ATOM   5209  C  CD2   . LEU G 3 115 ? -12.224 -18.226 69.672 1.00 99.89  ? 115  LEU G CD2   1 
ATOM   5210  N  N     . LEU G 3 116 ? -10.496 -13.784 72.507 1.00 102.40 ? 116  LEU G N     1 
ATOM   5211  C  CA    . LEU G 3 116 ? -9.677  -12.778 73.191 1.00 103.29 ? 116  LEU G CA    1 
ATOM   5212  C  C     . LEU G 3 116 ? -9.919  -12.788 74.698 1.00 104.08 ? 116  LEU G C     1 
ATOM   5213  O  O     . LEU G 3 116 ? -11.071 -12.897 75.137 1.00 104.13 ? 116  LEU G O     1 
ATOM   5214  C  CB    . LEU G 3 116 ? -9.959  -11.377 72.638 1.00 103.04 ? 116  LEU G CB    1 
ATOM   5215  C  CG    . LEU G 3 116 ? -9.369  -11.000 71.278 1.00 103.31 ? 116  LEU G CG    1 
ATOM   5216  C  CD1   . LEU G 3 116 ? -10.085 -9.774  70.700 1.00 103.76 ? 116  LEU G CD1   1 
ATOM   5217  C  CD2   . LEU G 3 116 ? -7.861  -10.765 71.356 1.00 102.88 ? 116  LEU G CD2   1 
ATOM   5218  N  N     . PRO G 3 117 ? -8.830  -12.685 75.494 1.00 104.94 ? 117  PRO G N     1 
ATOM   5219  C  CA    . PRO G 3 117 ? -8.917  -12.561 76.959 1.00 105.63 ? 117  PRO G CA    1 
ATOM   5220  C  C     . PRO G 3 117 ? -9.703  -11.311 77.396 1.00 106.37 ? 117  PRO G C     1 
ATOM   5221  O  O     . PRO G 3 117 ? -9.663  -10.280 76.716 1.00 106.37 ? 117  PRO G O     1 
ATOM   5222  C  CB    . PRO G 3 117 ? -7.448  -12.459 77.392 1.00 105.64 ? 117  PRO G CB    1 
ATOM   5223  C  CG    . PRO G 3 117 ? -6.699  -12.048 76.148 1.00 105.35 ? 117  PRO G CG    1 
ATOM   5224  C  CD    . PRO G 3 117 ? -7.430  -12.695 75.027 1.00 104.81 ? 117  PRO G CD    1 
ATOM   5225  N  N     . LYS G 3 118 ? -10.408 -11.410 78.521 1.00 107.22 ? 118  LYS G N     1 
ATOM   5226  C  CA    . LYS G 3 118 ? -11.319 -10.342 78.966 1.00 108.19 ? 118  LYS G CA    1 
ATOM   5227  C  C     . LYS G 3 118 ? -10.745 -9.463  80.084 1.00 108.18 ? 118  LYS G C     1 
ATOM   5228  O  O     . LYS G 3 118 ? -9.656  -9.720  80.602 1.00 108.52 ? 118  LYS G O     1 
ATOM   5229  C  CB    . LYS G 3 118 ? -12.692 -10.922 79.367 1.00 108.23 ? 118  LYS G CB    1 
ATOM   5230  C  CG    . LYS G 3 118 ? -12.626 -12.197 80.228 1.00 108.88 ? 118  LYS G CG    1 
ATOM   5231  C  CD    . LYS G 3 118 ? -13.989 -12.874 80.329 1.00 108.98 ? 118  LYS G CD    1 
ATOM   5232  C  CE    . LYS G 3 118 ? -13.902 -14.222 81.044 1.00 109.97 ? 118  LYS G CE    1 
ATOM   5233  N  NZ    . LYS G 3 118 ? -15.260 -14.798 81.309 1.00 109.87 ? 118  LYS G NZ    1 
ATOM   5234  N  N     . THR H 4 32  ? 12.414  -20.462 23.458 1.00 99.52  ? 29   THR H N     1 
ATOM   5235  C  CA    . THR H 4 32  ? 11.225  -19.990 22.672 1.00 99.60  ? 29   THR H CA    1 
ATOM   5236  C  C     . THR H 4 32  ? 10.511  -18.805 23.325 1.00 99.67  ? 29   THR H C     1 
ATOM   5237  O  O     . THR H 4 32  ? 10.716  -18.521 24.511 1.00 99.71  ? 29   THR H O     1 
ATOM   5238  C  CB    . THR H 4 32  ? 10.185  -21.099 22.491 1.00 99.41  ? 29   THR H CB    1 
ATOM   5239  O  OG1   . THR H 4 32  ? 9.863   -21.640 23.772 1.00 99.55  ? 29   THR H OG1   1 
ATOM   5240  C  CG2   . THR H 4 32  ? 10.717  -22.197 21.601 1.00 99.53  ? 29   THR H CG2   1 
ATOM   5241  N  N     . ARG H 4 33  ? 9.662   -18.133 22.544 1.00 99.53  ? 30   ARG H N     1 
ATOM   5242  C  CA    . ARG H 4 33  ? 8.899   -16.979 23.022 1.00 99.36  ? 30   ARG H CA    1 
ATOM   5243  C  C     . ARG H 4 33  ? 7.782   -17.404 23.976 1.00 98.43  ? 30   ARG H C     1 
ATOM   5244  O  O     . ARG H 4 33  ? 6.883   -18.162 23.597 1.00 98.79  ? 30   ARG H O     1 
ATOM   5245  C  CB    . ARG H 4 33  ? 8.270   -16.204 21.851 1.00 99.79  ? 30   ARG H CB    1 
ATOM   5246  C  CG    . ARG H 4 33  ? 9.157   -16.003 20.624 1.00 102.26 ? 30   ARG H CG    1 
ATOM   5247  C  CD    . ARG H 4 33  ? 10.002  -14.730 20.693 1.00 105.09 ? 30   ARG H CD    1 
ATOM   5248  N  NE    . ARG H 4 33  ? 9.186   -13.514 20.653 1.00 107.36 ? 30   ARG H NE    1 
ATOM   5249  C  CZ    . ARG H 4 33  ? 9.608   -12.340 20.186 1.00 108.55 ? 30   ARG H CZ    1 
ATOM   5250  N  NH1   . ARG H 4 33  ? 10.842  -12.218 19.700 1.00 108.88 ? 30   ARG H NH1   1 
ATOM   5251  N  NH2   . ARG H 4 33  ? 8.795   -11.285 20.203 1.00 108.55 ? 30   ARG H NH2   1 
ATOM   5252  N  N     . LYS H 4 34  ? 7.852   -16.923 25.211 1.00 96.88  ? 31   LYS H N     1 
ATOM   5253  C  CA    . LYS H 4 34  ? 6.708   -16.949 26.101 1.00 95.59  ? 31   LYS H CA    1 
ATOM   5254  C  C     . LYS H 4 34  ? 6.177   -15.522 26.189 1.00 94.48  ? 31   LYS H C     1 
ATOM   5255  O  O     . LYS H 4 34  ? 6.793   -14.650 26.828 1.00 94.23  ? 31   LYS H O     1 
ATOM   5256  C  CB    . LYS H 4 34  ? 7.090   -17.474 27.490 1.00 95.89  ? 31   LYS H CB    1 
ATOM   5257  C  CG    . LYS H 4 34  ? 6.754   -18.940 27.737 1.00 96.82  ? 31   LYS H CG    1 
ATOM   5258  C  CD    . LYS H 4 34  ? 5.646   -19.156 28.801 1.00 97.04  ? 31   LYS H CD    1 
ATOM   5259  C  CE    . LYS H 4 34  ? 5.561   -20.656 29.180 1.00 97.14  ? 31   LYS H CE    1 
ATOM   5260  N  NZ    . LYS H 4 34  ? 5.098   -20.964 30.575 1.00 96.80  ? 31   LYS H NZ    1 
ATOM   5261  N  N     . GLU H 4 35  ? 5.044   -15.279 25.532 1.00 92.71  ? 32   GLU H N     1 
ATOM   5262  C  CA    . GLU H 4 35  ? 4.392   -13.980 25.626 1.00 90.84  ? 32   GLU H CA    1 
ATOM   5263  C  C     . GLU H 4 35  ? 3.818   -13.754 27.014 1.00 89.64  ? 32   GLU H C     1 
ATOM   5264  O  O     . GLU H 4 35  ? 3.521   -14.708 27.734 1.00 89.66  ? 32   GLU H O     1 
ATOM   5265  C  CB    . GLU H 4 35  ? 3.324   -13.817 24.559 1.00 90.82  ? 32   GLU H CB    1 
ATOM   5266  C  CG    . GLU H 4 35  ? 3.882   -13.281 23.258 1.00 91.11  ? 32   GLU H CG    1 
ATOM   5267  C  CD    . GLU H 4 35  ? 2.882   -13.369 22.127 1.00 91.99  ? 32   GLU H CD    1 
ATOM   5268  O  OE1   . GLU H 4 35  ? 1.673   -13.493 22.429 1.00 92.30  ? 32   GLU H OE1   1 
ATOM   5269  O  OE2   . GLU H 4 35  ? 3.302   -13.318 20.945 1.00 90.89  ? 32   GLU H OE2   1 
ATOM   5270  N  N     . SER H 4 36  ? 3.670   -12.481 27.373 1.00 88.04  ? 33   SER H N     1 
ATOM   5271  C  CA    . SER H 4 36  ? 3.348   -12.067 28.733 1.00 86.16  ? 33   SER H CA    1 
ATOM   5272  C  C     . SER H 4 36  ? 2.946   -10.601 28.735 1.00 85.20  ? 33   SER H C     1 
ATOM   5273  O  O     . SER H 4 36  ? 3.388   -9.826  27.876 1.00 84.98  ? 33   SER H O     1 
ATOM   5274  C  CB    . SER H 4 36  ? 4.572   -12.238 29.630 1.00 86.20  ? 33   SER H CB    1 
ATOM   5275  O  OG    . SER H 4 36  ? 4.325   -11.727 30.920 1.00 85.45  ? 33   SER H OG    1 
ATOM   5276  N  N     . TYR H 4 37  ? 2.109   -10.238 29.708 1.00 83.52  ? 34   TYR H N     1 
ATOM   5277  C  CA    . TYR H 4 37  ? 1.727   -8.860  29.958 1.00 81.62  ? 34   TYR H CA    1 
ATOM   5278  C  C     . TYR H 4 37  ? 2.729   -8.179  30.881 1.00 80.89  ? 34   TYR H C     1 
ATOM   5279  O  O     . TYR H 4 37  ? 2.395   -7.199  31.546 1.00 80.84  ? 34   TYR H O     1 
ATOM   5280  C  CB    . TYR H 4 37  ? 0.348   -8.810  30.602 1.00 81.55  ? 34   TYR H CB    1 
ATOM   5281  C  CG    . TYR H 4 37  ? -0.768  -9.315  29.729 1.00 80.80  ? 34   TYR H CG    1 
ATOM   5282  C  CD1   . TYR H 4 37  ? -1.238  -10.611 29.848 1.00 79.51  ? 34   TYR H CD1   1 
ATOM   5283  C  CD2   . TYR H 4 37  ? -1.367  -8.485  28.793 1.00 80.93  ? 34   TYR H CD2   1 
ATOM   5284  C  CE1   . TYR H 4 37  ? -2.267  -11.077 29.043 1.00 79.86  ? 34   TYR H CE1   1 
ATOM   5285  C  CE2   . TYR H 4 37  ? -2.395  -8.937  27.986 1.00 80.88  ? 34   TYR H CE2   1 
ATOM   5286  C  CZ    . TYR H 4 37  ? -2.832  -10.234 28.112 1.00 80.71  ? 34   TYR H CZ    1 
ATOM   5287  O  OH    . TYR H 4 37  ? -3.852  -10.670 27.304 1.00 82.43  ? 34   TYR H OH    1 
ATOM   5288  N  N     . ALA H 4 38  ? 3.961   -8.678  30.920 1.00 79.93  ? 35   ALA H N     1 
ATOM   5289  C  CA    . ALA H 4 38  ? 4.939   -8.163  31.880 1.00 79.25  ? 35   ALA H CA    1 
ATOM   5290  C  C     . ALA H 4 38  ? 5.361   -6.721  31.595 1.00 78.91  ? 35   ALA H C     1 
ATOM   5291  O  O     . ALA H 4 38  ? 5.715   -5.982  32.508 1.00 78.47  ? 35   ALA H O     1 
ATOM   5292  C  CB    . ALA H 4 38  ? 6.147   -9.077  31.976 1.00 79.04  ? 35   ALA H CB    1 
ATOM   5293  N  N     . ILE H 4 39  ? 5.303   -6.312  30.333 1.00 78.79  ? 36   ILE H N     1 
ATOM   5294  C  CA    . ILE H 4 39  ? 5.781   -4.983  29.985 1.00 78.73  ? 36   ILE H CA    1 
ATOM   5295  C  C     . ILE H 4 39  ? 4.709   -3.951  30.287 1.00 78.70  ? 36   ILE H C     1 
ATOM   5296  O  O     . ILE H 4 39  ? 4.990   -2.914  30.895 1.00 78.93  ? 36   ILE H O     1 
ATOM   5297  C  CB    . ILE H 4 39  ? 6.308   -4.868  28.516 1.00 78.93  ? 36   ILE H CB    1 
ATOM   5298  C  CG1   . ILE H 4 39  ? 5.327   -5.483  27.516 1.00 78.25  ? 36   ILE H CG1   1 
ATOM   5299  C  CG2   . ILE H 4 39  ? 7.706   -5.497  28.384 1.00 78.12  ? 36   ILE H CG2   1 
ATOM   5300  C  CD1   . ILE H 4 39  ? 5.625   -5.099  26.086 1.00 78.60  ? 36   ILE H CD1   1 
ATOM   5301  N  N     . TYR H 4 40  ? 3.483   -4.261  29.881 1.00 78.21  ? 37   TYR H N     1 
ATOM   5302  C  CA    . TYR H 4 40  ? 2.338   -3.403  30.125 1.00 77.86  ? 37   TYR H CA    1 
ATOM   5303  C  C     . TYR H 4 40  ? 2.104   -3.281  31.616 1.00 77.91  ? 37   TYR H C     1 
ATOM   5304  O  O     . TYR H 4 40  ? 1.982   -2.182  32.133 1.00 78.24  ? 37   TYR H O     1 
ATOM   5305  C  CB    . TYR H 4 40  ? 1.117   -3.958  29.399 1.00 77.63  ? 37   TYR H CB    1 
ATOM   5306  C  CG    . TYR H 4 40  ? 1.537   -4.561  28.084 1.00 77.78  ? 37   TYR H CG    1 
ATOM   5307  C  CD1   . TYR H 4 40  ? 1.559   -5.935  27.903 1.00 77.09  ? 37   TYR H CD1   1 
ATOM   5308  C  CD2   . TYR H 4 40  ? 1.993   -3.751  27.041 1.00 77.93  ? 37   TYR H CD2   1 
ATOM   5309  C  CE1   . TYR H 4 40  ? 1.984   -6.488  26.704 1.00 77.11  ? 37   TYR H CE1   1 
ATOM   5310  C  CE2   . TYR H 4 40  ? 2.411   -4.294  25.838 1.00 77.08  ? 37   TYR H CE2   1 
ATOM   5311  C  CZ    . TYR H 4 40  ? 2.407   -5.661  25.676 1.00 77.02  ? 37   TYR H CZ    1 
ATOM   5312  O  OH    . TYR H 4 40  ? 2.834   -6.203  24.487 1.00 77.18  ? 37   TYR H OH    1 
ATOM   5313  N  N     . VAL H 4 41  ? 2.085   -4.399  32.330 1.00 77.86  ? 38   VAL H N     1 
ATOM   5314  C  CA    . VAL H 4 41  ? 1.890   -4.299  33.761 1.00 77.78  ? 38   VAL H CA    1 
ATOM   5315  C  C     . VAL H 4 41  ? 2.958   -3.374  34.337 1.00 77.86  ? 38   VAL H C     1 
ATOM   5316  O  O     . VAL H 4 41  ? 2.646   -2.511  35.145 1.00 78.11  ? 38   VAL H O     1 
ATOM   5317  C  CB    . VAL H 4 41  ? 1.913   -5.654  34.452 1.00 77.77  ? 38   VAL H CB    1 
ATOM   5318  C  CG1   . VAL H 4 41  ? 2.053   -5.456  35.942 1.00 78.23  ? 38   VAL H CG1   1 
ATOM   5319  C  CG2   . VAL H 4 41  ? 0.641   -6.447  34.126 1.00 77.21  ? 38   VAL H CG2   1 
ATOM   5320  N  N     . TYR H 4 42  ? 4.206   -3.529  33.906 1.00 77.79  ? 39   TYR H N     1 
ATOM   5321  C  CA    . TYR H 4 42  ? 5.249   -2.611  34.345 1.00 78.10  ? 39   TYR H CA    1 
ATOM   5322  C  C     . TYR H 4 42  ? 4.849   -1.169  33.991 1.00 77.62  ? 39   TYR H C     1 
ATOM   5323  O  O     . TYR H 4 42  ? 4.776   -0.298  34.864 1.00 77.43  ? 39   TYR H O     1 
ATOM   5324  C  CB    . TYR H 4 42  ? 6.592   -2.933  33.692 1.00 78.75  ? 39   TYR H CB    1 
ATOM   5325  C  CG    . TYR H 4 42  ? 7.575   -3.706  34.534 1.00 79.34  ? 39   TYR H CG    1 
ATOM   5326  C  CD1   . TYR H 4 42  ? 7.874   -5.048  34.229 1.00 80.58  ? 39   TYR H CD1   1 
ATOM   5327  C  CD2   . TYR H 4 42  ? 8.252   -3.094  35.594 1.00 79.01  ? 39   TYR H CD2   1 
ATOM   5328  C  CE1   . TYR H 4 42  ? 8.801   -5.784  34.988 1.00 81.44  ? 39   TYR H CE1   1 
ATOM   5329  C  CE2   . TYR H 4 42  ? 9.174   -3.812  36.369 1.00 80.21  ? 39   TYR H CE2   1 
ATOM   5330  C  CZ    . TYR H 4 42  ? 9.452   -5.163  36.062 1.00 80.95  ? 39   TYR H CZ    1 
ATOM   5331  O  OH    . TYR H 4 42  ? 10.365  -5.892  36.809 1.00 79.91  ? 39   TYR H OH    1 
ATOM   5332  N  N     . LYS H 4 43  ? 4.581   -0.931  32.712 1.00 76.83  ? 40   LYS H N     1 
ATOM   5333  C  CA    . LYS H 4 43  ? 4.263   0.403   32.251 1.00 76.34  ? 40   LYS H CA    1 
ATOM   5334  C  C     . LYS H 4 43  ? 3.298   1.062   33.206 1.00 76.03  ? 40   LYS H C     1 
ATOM   5335  O  O     . LYS H 4 43  ? 3.646   2.087   33.804 1.00 76.81  ? 40   LYS H O     1 
ATOM   5336  C  CB    . LYS H 4 43  ? 3.725   0.383   30.829 1.00 76.21  ? 40   LYS H CB    1 
ATOM   5337  C  CG    . LYS H 4 43  ? 4.844   0.249   29.810 1.00 77.03  ? 40   LYS H CG    1 
ATOM   5338  C  CD    . LYS H 4 43  ? 4.321   0.248   28.397 1.00 78.73  ? 40   LYS H CD    1 
ATOM   5339  C  CE    . LYS H 4 43  ? 5.466   0.379   27.429 1.00 79.94  ? 40   LYS H CE    1 
ATOM   5340  N  NZ    . LYS H 4 43  ? 4.964   0.827   26.101 1.00 83.04  ? 40   LYS H NZ    1 
ATOM   5341  N  N     . VAL H 4 44  ? 2.129   0.445   33.391 1.00 75.10  ? 41   VAL H N     1 
ATOM   5342  C  CA    . VAL H 4 44  ? 1.065   0.964   34.257 1.00 74.21  ? 41   VAL H CA    1 
ATOM   5343  C  C     . VAL H 4 44  ? 1.498   1.137   35.720 1.00 74.39  ? 41   VAL H C     1 
ATOM   5344  O  O     . VAL H 4 44  ? 1.196   2.158   36.337 1.00 74.52  ? 41   VAL H O     1 
ATOM   5345  C  CB    . VAL H 4 44  ? -0.189  0.082   34.196 1.00 74.10  ? 41   VAL H CB    1 
ATOM   5346  C  CG1   . VAL H 4 44  ? -1.312  0.682   35.021 1.00 73.53  ? 41   VAL H CG1   1 
ATOM   5347  C  CG2   . VAL H 4 44  ? -0.640  -0.099  32.768 1.00 73.80  ? 41   VAL H CG2   1 
ATOM   5348  N  N     . LEU H 4 45  ? 2.206   0.159   36.283 1.00 74.42  ? 42   LEU H N     1 
ATOM   5349  C  CA    . LEU H 4 45  ? 2.823   0.357   37.604 1.00 74.18  ? 42   LEU H CA    1 
ATOM   5350  C  C     . LEU H 4 45  ? 3.666   1.628   37.613 1.00 74.10  ? 42   LEU H C     1 
ATOM   5351  O  O     . LEU H 4 45  ? 3.524   2.457   38.515 1.00 74.27  ? 42   LEU H O     1 
ATOM   5352  C  CB    . LEU H 4 45  ? 3.667   -0.847  38.032 1.00 74.38  ? 42   LEU H CB    1 
ATOM   5353  C  CG    . LEU H 4 45  ? 4.650   -0.737  39.218 1.00 74.32  ? 42   LEU H CG    1 
ATOM   5354  C  CD1   . LEU H 4 45  ? 3.979   -0.355  40.529 1.00 74.83  ? 42   LEU H CD1   1 
ATOM   5355  C  CD2   . LEU H 4 45  ? 5.407   -2.026  39.413 1.00 74.04  ? 42   LEU H CD2   1 
ATOM   5356  N  N     . LYS H 4 46  ? 4.523   1.805   36.609 1.00 73.87  ? 43   LYS H N     1 
ATOM   5357  C  CA    . LYS H 4 46  ? 5.436   2.953   36.637 1.00 73.78  ? 43   LYS H CA    1 
ATOM   5358  C  C     . LYS H 4 46  ? 4.682   4.256   36.495 1.00 73.13  ? 43   LYS H C     1 
ATOM   5359  O  O     . LYS H 4 46  ? 5.042   5.261   37.111 1.00 73.12  ? 43   LYS H O     1 
ATOM   5360  C  CB    . LYS H 4 46  ? 6.610   2.815   35.656 1.00 74.14  ? 43   LYS H CB    1 
ATOM   5361  C  CG    . LYS H 4 46  ? 7.695   1.866   36.175 1.00 74.38  ? 43   LYS H CG    1 
ATOM   5362  C  CD    . LYS H 4 46  ? 7.768   1.925   37.714 1.00 76.76  ? 43   LYS H CD    1 
ATOM   5363  C  CE    . LYS H 4 46  ? 9.100   1.388   38.266 1.00 78.35  ? 43   LYS H CE    1 
ATOM   5364  N  NZ    . LYS H 4 46  ? 10.222  2.376   38.139 1.00 79.69  ? 43   LYS H NZ    1 
ATOM   5365  N  N     . GLN H 4 47  ? 3.592   4.205   35.744 1.00 72.30  ? 44   GLN H N     1 
ATOM   5366  C  CA    . GLN H 4 47  ? 2.619   5.285   35.750 1.00 71.58  ? 44   GLN H CA    1 
ATOM   5367  C  C     . GLN H 4 47  ? 1.989   5.566   37.103 1.00 71.68  ? 44   GLN H C     1 
ATOM   5368  O  O     . GLN H 4 47  ? 1.584   6.672   37.351 1.00 72.82  ? 44   GLN H O     1 
ATOM   5369  C  CB    . GLN H 4 47  ? 1.513   5.016   34.737 1.00 70.78  ? 44   GLN H CB    1 
ATOM   5370  C  CG    . GLN H 4 47  ? 1.708   5.765   33.466 1.00 68.93  ? 44   GLN H CG    1 
ATOM   5371  C  CD    . GLN H 4 47  ? 0.691   5.428   32.423 1.00 66.41  ? 44   GLN H CD    1 
ATOM   5372  O  OE1   . GLN H 4 47  ? 0.168   4.322   32.395 1.00 68.62  ? 44   GLN H OE1   1 
ATOM   5373  N  NE2   . GLN H 4 47  ? 0.406   6.378   31.542 1.00 63.43  ? 44   GLN H NE2   1 
ATOM   5374  N  N     . VAL H 4 48  ? 1.886   4.587   37.982 1.00 72.28  ? 45   VAL H N     1 
ATOM   5375  C  CA    . VAL H 4 48  ? 1.017   4.759   39.158 1.00 72.74  ? 45   VAL H CA    1 
ATOM   5376  C  C     . VAL H 4 48  ? 1.780   4.815   40.460 1.00 73.10  ? 45   VAL H C     1 
ATOM   5377  O  O     . VAL H 4 48  ? 1.388   5.535   41.386 1.00 73.47  ? 45   VAL H O     1 
ATOM   5378  C  CB    . VAL H 4 48  ? -0.084  3.669   39.250 1.00 72.17  ? 45   VAL H CB    1 
ATOM   5379  C  CG1   . VAL H 4 48  ? -0.964  3.944   40.401 1.00 71.89  ? 45   VAL H CG1   1 
ATOM   5380  C  CG2   . VAL H 4 48  ? -0.934  3.692   38.028 1.00 72.85  ? 45   VAL H CG2   1 
ATOM   5381  N  N     . HIS H 4 49  ? 2.855   4.039   40.536 1.00 73.86  ? 46   HIS H N     1 
ATOM   5382  C  CA    . HIS H 4 49  ? 3.774   4.119   41.663 1.00 74.74  ? 46   HIS H CA    1 
ATOM   5383  C  C     . HIS H 4 49  ? 5.219   4.156   41.186 1.00 75.10  ? 46   HIS H C     1 
ATOM   5384  O  O     . HIS H 4 49  ? 5.966   3.208   41.422 1.00 75.61  ? 46   HIS H O     1 
ATOM   5385  C  CB    . HIS H 4 49  ? 3.533   2.972   42.654 1.00 74.51  ? 46   HIS H CB    1 
ATOM   5386  C  CG    . HIS H 4 49  ? 2.372   3.207   43.559 1.00 75.17  ? 46   HIS H CG    1 
ATOM   5387  N  ND1   . HIS H 4 49  ? 1.158   2.575   43.394 1.00 76.14  ? 46   HIS H ND1   1 
ATOM   5388  C  CD2   . HIS H 4 49  ? 2.223   4.038   44.617 1.00 76.71  ? 46   HIS H CD2   1 
ATOM   5389  C  CE1   . HIS H 4 49  ? 0.315   2.990   44.322 1.00 75.32  ? 46   HIS H CE1   1 
ATOM   5390  N  NE2   . HIS H 4 49  ? 0.935   3.878   45.078 1.00 76.77  ? 46   HIS H NE2   1 
ATOM   5391  N  N     . PRO H 4 50  ? 5.630   5.279   40.559 1.00 75.62  ? 47   PRO H N     1 
ATOM   5392  C  CA    . PRO H 4 50  ? 6.907   5.472   39.846 1.00 76.02  ? 47   PRO H CA    1 
ATOM   5393  C  C     . PRO H 4 50  ? 8.215   5.025   40.516 1.00 76.57  ? 47   PRO H C     1 
ATOM   5394  O  O     . PRO H 4 50  ? 9.191   4.836   39.808 1.00 77.52  ? 47   PRO H O     1 
ATOM   5395  C  CB    . PRO H 4 50  ? 6.939   6.971   39.577 1.00 75.88  ? 47   PRO H CB    1 
ATOM   5396  C  CG    . PRO H 4 50  ? 5.897   7.552   40.469 1.00 75.71  ? 47   PRO H CG    1 
ATOM   5397  C  CD    . PRO H 4 50  ? 4.840   6.515   40.528 1.00 75.71  ? 47   PRO H CD    1 
ATOM   5398  N  N     . ASP H 4 51  ? 8.274   4.849   41.829 1.00 76.81  ? 48   ASP H N     1 
ATOM   5399  C  CA    . ASP H 4 51  ? 9.516   4.302   42.406 1.00 77.26  ? 48   ASP H CA    1 
ATOM   5400  C  C     . ASP H 4 51  ? 9.287   2.922   43.012 1.00 77.26  ? 48   ASP H C     1 
ATOM   5401  O  O     . ASP H 4 51  ? 9.730   2.639   44.130 1.00 77.10  ? 48   ASP H O     1 
ATOM   5402  C  CB    . ASP H 4 51  ? 10.127  5.228   43.471 1.00 77.64  ? 48   ASP H CB    1 
ATOM   5403  C  CG    . ASP H 4 51  ? 10.127  6.687   43.063 1.00 78.70  ? 48   ASP H CG    1 
ATOM   5404  O  OD1   . ASP H 4 51  ? 10.474  6.985   41.896 1.00 80.09  ? 48   ASP H OD1   1 
ATOM   5405  O  OD2   . ASP H 4 51  ? 9.778   7.534   43.924 1.00 79.58  ? 48   ASP H OD2   1 
ATOM   5406  N  N     . THR H 4 52  ? 8.582   2.063   42.284 1.00 77.15  ? 49   THR H N     1 
ATOM   5407  C  CA    . THR H 4 52  ? 8.195   0.783   42.862 1.00 76.72  ? 49   THR H CA    1 
ATOM   5408  C  C     . THR H 4 52  ? 8.385   -0.394  41.917 1.00 77.36  ? 49   THR H C     1 
ATOM   5409  O  O     . THR H 4 52  ? 7.969   -0.361  40.741 1.00 77.69  ? 49   THR H O     1 
ATOM   5410  C  CB    . THR H 4 52  ? 6.769   0.813   43.416 1.00 76.25  ? 49   THR H CB    1 
ATOM   5411  O  OG1   . THR H 4 52  ? 6.451   2.151   43.827 1.00 74.66  ? 49   THR H OG1   1 
ATOM   5412  C  CG2   . THR H 4 52  ? 6.664   -0.122  44.611 1.00 75.25  ? 49   THR H CG2   1 
ATOM   5413  N  N     . GLY H 4 53  ? 9.030   -1.432  42.446 1.00 77.19  ? 50   GLY H N     1 
ATOM   5414  C  CA    . GLY H 4 53  ? 9.308   -2.634  41.679 1.00 77.20  ? 50   GLY H CA    1 
ATOM   5415  C  C     . GLY H 4 53  ? 8.330   -3.751  41.956 1.00 76.90  ? 50   GLY H C     1 
ATOM   5416  O  O     . GLY H 4 53  ? 7.560   -3.701  42.925 1.00 77.48  ? 50   GLY H O     1 
ATOM   5417  N  N     . ILE H 4 54  ? 8.360   -4.761  41.096 1.00 75.99  ? 51   ILE H N     1 
ATOM   5418  C  CA    . ILE H 4 54  ? 7.505   -5.913  41.265 1.00 74.90  ? 51   ILE H CA    1 
ATOM   5419  C  C     . ILE H 4 54  ? 8.361   -7.173  41.187 1.00 74.53  ? 51   ILE H C     1 
ATOM   5420  O  O     . ILE H 4 54  ? 9.297   -7.240  40.400 1.00 74.70  ? 51   ILE H O     1 
ATOM   5421  C  CB    . ILE H 4 54  ? 6.327   -5.875  40.249 1.00 74.99  ? 51   ILE H CB    1 
ATOM   5422  C  CG1   . ILE H 4 54  ? 5.270   -6.944  40.571 1.00 74.35  ? 51   ILE H CG1   1 
ATOM   5423  C  CG2   . ILE H 4 54  ? 6.827   -5.945  38.812 1.00 74.66  ? 51   ILE H CG2   1 
ATOM   5424  C  CD1   . ILE H 4 54  ? 3.934   -6.734  39.844 1.00 74.10  ? 51   ILE H CD1   1 
ATOM   5425  N  N     . SER H 4 55  ? 8.061   -8.145  42.043 1.00 74.27  ? 52   SER H N     1 
ATOM   5426  C  CA    . SER H 4 55  ? 8.802   -9.413  42.112 1.00 73.71  ? 52   SER H CA    1 
ATOM   5427  C  C     . SER H 4 55  ? 8.360   -10.381 41.048 1.00 73.47  ? 52   SER H C     1 
ATOM   5428  O  O     . SER H 4 55  ? 7.223   -10.332 40.584 1.00 73.76  ? 52   SER H O     1 
ATOM   5429  C  CB    . SER H 4 55  ? 8.530   -10.102 43.428 1.00 73.31  ? 52   SER H CB    1 
ATOM   5430  O  OG    . SER H 4 55  ? 7.298   -10.781 43.309 1.00 72.84  ? 52   SER H OG    1 
ATOM   5431  N  N     . SER H 4 56  ? 9.256   -11.303 40.716 1.00 73.30  ? 53   SER H N     1 
ATOM   5432  C  CA    . SER H 4 56  ? 8.966   -12.410 39.810 1.00 72.87  ? 53   SER H CA    1 
ATOM   5433  C  C     . SER H 4 56  ? 7.591   -13.058 40.032 1.00 73.02  ? 53   SER H C     1 
ATOM   5434  O  O     . SER H 4 56  ? 6.836   -13.237 39.073 1.00 73.08  ? 53   SER H O     1 
ATOM   5435  C  CB    . SER H 4 56  ? 10.044  -13.465 39.959 1.00 72.60  ? 53   SER H CB    1 
ATOM   5436  O  OG    . SER H 4 56  ? 10.142  -14.233 38.780 1.00 73.10  ? 53   SER H OG    1 
ATOM   5437  N  N     . LYS H 4 57  ? 7.284   -13.408 41.287 1.00 72.69  ? 54   LYS H N     1 
ATOM   5438  C  CA    . LYS H 4 57  ? 6.019   -14.053 41.651 1.00 72.50  ? 54   LYS H CA    1 
ATOM   5439  C  C     . LYS H 4 57  ? 4.828   -13.119 41.487 1.00 72.13  ? 54   LYS H C     1 
ATOM   5440  O  O     . LYS H 4 57  ? 3.851   -13.453 40.821 1.00 71.89  ? 54   LYS H O     1 
ATOM   5441  C  CB    . LYS H 4 57  ? 6.072   -14.565 43.084 1.00 72.75  ? 54   LYS H CB    1 
ATOM   5442  C  CG    . LYS H 4 57  ? 7.269   -15.499 43.389 1.00 74.01  ? 54   LYS H CG    1 
ATOM   5443  C  CD    . LYS H 4 57  ? 7.175   -16.078 44.804 1.00 73.30  ? 54   LYS H CD    1 
ATOM   5444  C  CE    . LYS H 4 57  ? 7.954   -17.375 44.956 1.00 75.00  ? 54   LYS H CE    1 
ATOM   5445  N  NZ    . LYS H 4 57  ? 7.530   -18.024 46.254 1.00 77.61  ? 54   LYS H NZ    1 
ATOM   5446  N  N     . ALA H 4 58  ? 4.921   -11.939 42.093 1.00 71.67  ? 55   ALA H N     1 
ATOM   5447  C  CA    . ALA H 4 58  ? 3.922   -10.903 41.927 1.00 70.86  ? 55   ALA H CA    1 
ATOM   5448  C  C     . ALA H 4 58  ? 3.612   -10.655 40.454 1.00 70.56  ? 55   ALA H C     1 
ATOM   5449  O  O     . ALA H 4 58  ? 2.448   -10.639 40.044 1.00 70.06  ? 55   ALA H O     1 
ATOM   5450  C  CB    . ALA H 4 58  ? 4.387   -9.662  42.562 1.00 70.95  ? 55   ALA H CB    1 
ATOM   5451  N  N     . MET H 4 59  ? 4.646   -10.474 39.646 1.00 70.18  ? 56   MET H N     1 
ATOM   5452  C  CA    . MET H 4 59  ? 4.402   -10.281 38.230 1.00 70.21  ? 56   MET H CA    1 
ATOM   5453  C  C     . MET H 4 59  ? 3.560   -11.444 37.772 1.00 69.87  ? 56   MET H C     1 
ATOM   5454  O  O     . MET H 4 59  ? 2.464   -11.251 37.235 1.00 69.96  ? 56   MET H O     1 
ATOM   5455  C  CB    . MET H 4 59  ? 5.706   -10.251 37.449 1.00 70.69  ? 56   MET H CB    1 
ATOM   5456  C  CG    . MET H 4 59  ? 5.577   -9.722  36.031 1.00 72.29  ? 56   MET H CG    1 
ATOM   5457  S  SD    . MET H 4 59  ? 4.529   -8.258  35.927 1.00 76.47  ? 56   MET H SD    1 
ATOM   5458  C  CE    . MET H 4 59  ? 3.214   -8.896  34.911 1.00 75.93  ? 56   MET H CE    1 
ATOM   5459  N  N     . SER H 4 60  ? 4.070   -12.654 38.033 1.00 68.72  ? 57   SER H N     1 
ATOM   5460  C  CA    . SER H 4 60  ? 3.415   -13.871 37.622 1.00 67.26  ? 57   SER H CA    1 
ATOM   5461  C  C     . SER H 4 60  ? 1.932   -13.809 37.997 1.00 66.78  ? 57   SER H C     1 
ATOM   5462  O  O     . SER H 4 60  ? 1.076   -13.959 37.136 1.00 66.75  ? 57   SER H O     1 
ATOM   5463  C  CB    . SER H 4 60  ? 4.099   -15.066 38.255 1.00 66.60  ? 57   SER H CB    1 
ATOM   5464  O  OG    . SER H 4 60  ? 3.500   -16.265 37.811 1.00 67.15  ? 57   SER H OG    1 
ATOM   5465  N  N     . ILE H 4 61  ? 1.649   -13.535 39.273 1.00 66.01  ? 58   ILE H N     1 
ATOM   5466  C  CA    . ILE H 4 61  ? 0.287   -13.386 39.772 1.00 64.95  ? 58   ILE H CA    1 
ATOM   5467  C  C     . ILE H 4 61  ? -0.484  -12.419 38.907 1.00 64.69  ? 58   ILE H C     1 
ATOM   5468  O  O     . ILE H 4 61  ? -1.348  -12.863 38.167 1.00 64.69  ? 58   ILE H O     1 
ATOM   5469  C  CB    . ILE H 4 61  ? 0.255   -13.002 41.239 1.00 64.74  ? 58   ILE H CB    1 
ATOM   5470  C  CG1   . ILE H 4 61  ? 0.870   -14.138 42.026 1.00 63.62  ? 58   ILE H CG1   1 
ATOM   5471  C  CG2   . ILE H 4 61  ? -1.197  -12.837 41.725 1.00 65.98  ? 58   ILE H CG2   1 
ATOM   5472  C  CD1   . ILE H 4 61  ? 1.576   -13.710 43.200 1.00 63.72  ? 58   ILE H CD1   1 
ATOM   5473  N  N     . MET H 4 62  ? -0.143  -11.131 38.955 1.00 64.43  ? 59   MET H N     1 
ATOM   5474  C  CA    . MET H 4 62  ? -0.650  -10.161 37.982 1.00 64.55  ? 59   MET H CA    1 
ATOM   5475  C  C     . MET H 4 62  ? -0.946  -10.824 36.635 1.00 64.67  ? 59   MET H C     1 
ATOM   5476  O  O     . MET H 4 62  ? -2.098  -10.842 36.166 1.00 64.61  ? 59   MET H O     1 
ATOM   5477  C  CB    . MET H 4 62  ? 0.354   -9.038  37.740 1.00 64.92  ? 59   MET H CB    1 
ATOM   5478  C  CG    . MET H 4 62  ? 0.351   -7.879  38.745 1.00 65.75  ? 59   MET H CG    1 
ATOM   5479  S  SD    . MET H 4 62  ? -1.243  -7.567  39.521 1.00 71.55  ? 59   MET H SD    1 
ATOM   5480  C  CE    . MET H 4 62  ? -2.230  -6.965  38.144 1.00 66.34  ? 59   MET H CE    1 
ATOM   5481  N  N     . ASN H 4 63  ? 0.091   -11.407 36.030 1.00 64.34  ? 60   ASN H N     1 
ATOM   5482  C  CA    . ASN H 4 63  ? -0.075  -12.044 34.729 1.00 63.33  ? 60   ASN H CA    1 
ATOM   5483  C  C     . ASN H 4 63  ? -1.269  -12.959 34.642 1.00 63.23  ? 60   ASN H C     1 
ATOM   5484  O  O     . ASN H 4 63  ? -1.896  -13.011 33.589 1.00 63.23  ? 60   ASN H O     1 
ATOM   5485  C  CB    . ASN H 4 63  ? 1.182   -12.763 34.248 1.00 62.66  ? 60   ASN H CB    1 
ATOM   5486  C  CG    . ASN H 4 63  ? 1.196   -12.932 32.731 1.00 61.86  ? 60   ASN H CG    1 
ATOM   5487  O  OD1   . ASN H 4 63  ? 1.113   -14.046 32.213 1.00 61.69  ? 60   ASN H OD1   1 
ATOM   5488  N  ND2   . ASN H 4 63  ? 1.266   -11.821 32.014 1.00 60.13  ? 60   ASN H ND2   1 
ATOM   5489  N  N     . SER H 4 64  ? -1.583  -13.673 35.725 1.00 62.92  ? 61   SER H N     1 
ATOM   5490  C  CA    . SER H 4 64  ? -2.733  -14.564 35.726 1.00 63.61  ? 61   SER H CA    1 
ATOM   5491  C  C     . SER H 4 64  ? -4.015  -13.760 35.766 1.00 63.20  ? 61   SER H C     1 
ATOM   5492  O  O     . SER H 4 64  ? -4.961  -14.022 35.038 1.00 62.71  ? 61   SER H O     1 
ATOM   5493  C  CB    . SER H 4 64  ? -2.695  -15.528 36.912 1.00 63.98  ? 61   SER H CB    1 
ATOM   5494  O  OG    . SER H 4 64  ? -1.446  -16.188 36.984 1.00 66.55  ? 61   SER H OG    1 
ATOM   5495  N  N     . PHE H 4 65  ? -4.020  -12.757 36.625 1.00 63.52  ? 62   PHE H N     1 
ATOM   5496  C  CA    . PHE H 4 65  ? -5.198  -11.947 36.847 1.00 63.20  ? 62   PHE H CA    1 
ATOM   5497  C  C     . PHE H 4 65  ? -5.709  -11.408 35.510 1.00 63.15  ? 62   PHE H C     1 
ATOM   5498  O  O     . PHE H 4 65  ? -6.921  -11.518 35.198 1.00 63.24  ? 62   PHE H O     1 
ATOM   5499  C  CB    . PHE H 4 65  ? -4.910  -10.850 37.893 1.00 62.94  ? 62   PHE H CB    1 
ATOM   5500  C  CG    . PHE H 4 65  ? -5.929  -9.764  37.921 1.00 62.44  ? 62   PHE H CG    1 
ATOM   5501  C  CD1   . PHE H 4 65  ? -7.232  -10.021 38.358 1.00 63.76  ? 62   PHE H CD1   1 
ATOM   5502  C  CD2   . PHE H 4 65  ? -5.607  -8.488  37.480 1.00 61.48  ? 62   PHE H CD2   1 
ATOM   5503  C  CE1   . PHE H 4 65  ? -8.200  -9.023  38.346 1.00 62.35  ? 62   PHE H CE1   1 
ATOM   5504  C  CE2   . PHE H 4 65  ? -6.547  -7.486  37.481 1.00 61.60  ? 62   PHE H CE2   1 
ATOM   5505  C  CZ    . PHE H 4 65  ? -7.856  -7.751  37.912 1.00 61.91  ? 62   PHE H CZ    1 
ATOM   5506  N  N     . VAL H 4 66  ? -4.792  -10.890 34.696 1.00 62.61  ? 63   VAL H N     1 
ATOM   5507  C  CA    . VAL H 4 66  ? -5.188  -10.353 33.397 1.00 62.51  ? 63   VAL H CA    1 
ATOM   5508  C  C     . VAL H 4 66  ? -5.847  -11.426 32.537 1.00 63.01  ? 63   VAL H C     1 
ATOM   5509  O  O     . VAL H 4 66  ? -6.974  -11.227 32.006 1.00 62.96  ? 63   VAL H O     1 
ATOM   5510  C  CB    . VAL H 4 66  ? -4.018  -9.767  32.639 1.00 62.67  ? 63   VAL H CB    1 
ATOM   5511  C  CG1   . VAL H 4 66  ? -4.479  -9.301  31.294 1.00 61.96  ? 63   VAL H CG1   1 
ATOM   5512  C  CG2   . VAL H 4 66  ? -3.373  -8.611  33.434 1.00 62.05  ? 63   VAL H CG2   1 
ATOM   5513  N  N     . ASN H 4 67  ? -5.171  -12.577 32.430 1.00 62.53  ? 64   ASN H N     1 
ATOM   5514  C  CA    . ASN H 4 67  ? -5.739  -13.700 31.691 1.00 62.21  ? 64   ASN H CA    1 
ATOM   5515  C  C     . ASN H 4 67  ? -7.140  -14.189 32.206 1.00 62.62  ? 64   ASN H C     1 
ATOM   5516  O  O     . ASN H 4 67  ? -7.992  -14.588 31.396 1.00 62.38  ? 64   ASN H O     1 
ATOM   5517  C  CB    . ASN H 4 67  ? -4.726  -14.809 31.590 1.00 61.13  ? 64   ASN H CB    1 
ATOM   5518  C  CG    . ASN H 4 67  ? -3.513  -14.419 30.760 1.00 62.76  ? 64   ASN H CG    1 
ATOM   5519  O  OD1   . ASN H 4 67  ? -3.627  -14.087 29.576 1.00 64.42  ? 64   ASN H OD1   1 
ATOM   5520  N  ND2   . ASN H 4 67  ? -2.332  -14.476 31.369 1.00 62.61  ? 64   ASN H ND2   1 
ATOM   5521  N  N     . ASP H 4 68  ? -7.377  -14.125 33.523 1.00 62.66  ? 65   ASP H N     1 
ATOM   5522  C  CA    . ASP H 4 68  ? -8.600  -14.642 34.114 1.00 63.55  ? 65   ASP H CA    1 
ATOM   5523  C  C     . ASP H 4 68  ? -9.770  -13.775 33.676 1.00 63.89  ? 65   ASP H C     1 
ATOM   5524  O  O     . ASP H 4 68  ? -10.735 -14.249 33.109 1.00 62.44  ? 65   ASP H O     1 
ATOM   5525  C  CB    . ASP H 4 68  ? -8.500  -14.712 35.651 1.00 64.07  ? 65   ASP H CB    1 
ATOM   5526  C  CG    . ASP H 4 68  ? -9.901  -14.901 36.353 1.00 65.92  ? 65   ASP H CG    1 
ATOM   5527  O  OD1   . ASP H 4 68  ? -10.814 -15.479 35.717 1.00 68.65  ? 65   ASP H OD1   1 
ATOM   5528  O  OD2   . ASP H 4 68  ? -10.096 -14.461 37.530 1.00 63.76  ? 65   ASP H OD2   1 
ATOM   5529  N  N     . VAL H 4 69  ? -9.634  -12.482 33.949 1.00 65.36  ? 66   VAL H N     1 
ATOM   5530  C  CA    . VAL H 4 69  ? -10.597 -11.445 33.581 1.00 65.28  ? 66   VAL H CA    1 
ATOM   5531  C  C     . VAL H 4 69  ? -10.798 -11.392 32.077 1.00 65.33  ? 66   VAL H C     1 
ATOM   5532  O  O     . VAL H 4 69  ? -11.929 -11.252 31.618 1.00 65.04  ? 66   VAL H O     1 
ATOM   5533  C  CB    . VAL H 4 69  ? -10.106 -10.105 34.102 1.00 65.46  ? 66   VAL H CB    1 
ATOM   5534  C  CG1   . VAL H 4 69  ? -10.888 -8.960  33.504 1.00 66.52  ? 66   VAL H CG1   1 
ATOM   5535  C  CG2   . VAL H 4 69  ? -10.176 -10.095 35.610 1.00 65.85  ? 66   VAL H CG2   1 
ATOM   5536  N  N     . PHE H 4 70  ? -9.715  -11.532 31.305 1.00 65.63  ? 67   PHE H N     1 
ATOM   5537  C  CA    . PHE H 4 70  ? -9.870  -11.696 29.851 1.00 65.95  ? 67   PHE H CA    1 
ATOM   5538  C  C     . PHE H 4 70  ? -10.883 -12.796 29.493 1.00 66.30  ? 67   PHE H C     1 
ATOM   5539  O  O     . PHE H 4 70  ? -11.874 -12.503 28.835 1.00 66.36  ? 67   PHE H O     1 
ATOM   5540  C  CB    . PHE H 4 70  ? -8.548  -11.954 29.137 1.00 65.63  ? 67   PHE H CB    1 
ATOM   5541  C  CG    . PHE H 4 70  ? -8.675  -11.996 27.634 1.00 66.09  ? 67   PHE H CG    1 
ATOM   5542  C  CD1   . PHE H 4 70  ? -8.070  -11.013 26.842 1.00 66.03  ? 67   PHE H CD1   1 
ATOM   5543  C  CD2   . PHE H 4 70  ? -9.390  -13.020 27.000 1.00 65.66  ? 67   PHE H CD2   1 
ATOM   5544  C  CE1   . PHE H 4 70  ? -8.177  -11.050 25.446 1.00 64.86  ? 67   PHE H CE1   1 
ATOM   5545  C  CE2   . PHE H 4 70  ? -9.506  -13.067 25.603 1.00 65.60  ? 67   PHE H CE2   1 
ATOM   5546  C  CZ    . PHE H 4 70  ? -8.896  -12.079 24.824 1.00 65.10  ? 67   PHE H CZ    1 
ATOM   5547  N  N     . GLU H 4 71  ? -10.640 -14.044 29.918 1.00 66.59  ? 68   GLU H N     1 
ATOM   5548  C  CA    . GLU H 4 71  ? -11.549 -15.126 29.579 1.00 67.07  ? 68   GLU H CA    1 
ATOM   5549  C  C     . GLU H 4 71  ? -12.922 -14.829 30.112 1.00 66.47  ? 68   GLU H C     1 
ATOM   5550  O  O     . GLU H 4 71  ? -13.900 -15.118 29.459 1.00 66.15  ? 68   GLU H O     1 
ATOM   5551  C  CB    . GLU H 4 71  ? -11.123 -16.485 30.137 1.00 68.08  ? 68   GLU H CB    1 
ATOM   5552  C  CG    . GLU H 4 71  ? -10.243 -17.366 29.237 1.00 72.28  ? 68   GLU H CG    1 
ATOM   5553  C  CD    . GLU H 4 71  ? -8.877  -17.645 29.904 1.00 79.07  ? 68   GLU H CD    1 
ATOM   5554  O  OE1   . GLU H 4 71  ? -8.872  -17.887 31.158 1.00 79.59  ? 68   GLU H OE1   1 
ATOM   5555  O  OE2   . GLU H 4 71  ? -7.828  -17.605 29.190 1.00 79.33  ? 68   GLU H OE2   1 
ATOM   5556  N  N     . ARG H 4 72  ? -12.990 -14.270 31.310 1.00 66.31  ? 69   ARG H N     1 
ATOM   5557  C  CA    . ARG H 4 72  ? -14.253 -14.131 31.990 1.00 66.94  ? 69   ARG H CA    1 
ATOM   5558  C  C     . ARG H 4 72  ? -15.158 -13.206 31.184 1.00 68.28  ? 69   ARG H C     1 
ATOM   5559  O  O     . ARG H 4 72  ? -16.296 -13.571 30.828 1.00 68.06  ? 69   ARG H O     1 
ATOM   5560  C  CB    . ARG H 4 72  ? -14.043 -13.597 33.387 1.00 66.49  ? 69   ARG H CB    1 
ATOM   5561  C  CG    . ARG H 4 72  ? -13.287 -14.525 34.308 1.00 65.70  ? 69   ARG H CG    1 
ATOM   5562  C  CD    . ARG H 4 72  ? -14.002 -14.549 35.619 1.00 64.52  ? 69   ARG H CD    1 
ATOM   5563  N  NE    . ARG H 4 72  ? -13.130 -14.436 36.771 1.00 61.92  ? 69   ARG H NE    1 
ATOM   5564  C  CZ    . ARG H 4 72  ? -13.475 -13.787 37.874 1.00 61.46  ? 69   ARG H CZ    1 
ATOM   5565  N  NH1   . ARG H 4 72  ? -14.655 -13.178 37.935 1.00 60.85  ? 69   ARG H NH1   1 
ATOM   5566  N  NH2   . ARG H 4 72  ? -12.644 -13.725 38.904 1.00 60.05  ? 69   ARG H NH2   1 
ATOM   5567  N  N     . ILE H 4 73  ? -14.622 -12.023 30.877 1.00 69.10  ? 70   ILE H N     1 
ATOM   5568  C  CA    . ILE H 4 73  ? -15.253 -11.095 29.963 1.00 69.86  ? 70   ILE H CA    1 
ATOM   5569  C  C     . ILE H 4 73  ? -15.500 -11.751 28.614 1.00 70.37  ? 70   ILE H C     1 
ATOM   5570  O  O     . ILE H 4 73  ? -16.652 -11.887 28.192 1.00 70.86  ? 70   ILE H O     1 
ATOM   5571  C  CB    . ILE H 4 73  ? -14.404 -9.819  29.774 1.00 70.55  ? 70   ILE H CB    1 
ATOM   5572  C  CG1   . ILE H 4 73  ? -14.155 -9.133  31.134 1.00 70.32  ? 70   ILE H CG1   1 
ATOM   5573  C  CG2   . ILE H 4 73  ? -15.079 -8.872  28.751 1.00 70.06  ? 70   ILE H CG2   1 
ATOM   5574  C  CD1   . ILE H 4 73  ? -13.317 -7.882  31.054 1.00 69.34  ? 70   ILE H CD1   1 
ATOM   5575  N  N     . ALA H 4 74  ? -14.422 -12.177 27.959 1.00 70.53  ? 71   ALA H N     1 
ATOM   5576  C  CA    . ALA H 4 74  ? -14.504 -12.733 26.610 1.00 70.88  ? 71   ALA H CA    1 
ATOM   5577  C  C     . ALA H 4 74  ? -15.603 -13.775 26.508 1.00 71.34  ? 71   ALA H C     1 
ATOM   5578  O  O     . ALA H 4 74  ? -16.476 -13.665 25.650 1.00 72.01  ? 71   ALA H O     1 
ATOM   5579  C  CB    . ALA H 4 74  ? -13.166 -13.313 26.181 1.00 70.67  ? 71   ALA H CB    1 
ATOM   5580  N  N     . GLY H 4 75  ? -15.569 -14.766 27.396 1.00 71.73  ? 72   GLY H N     1 
ATOM   5581  C  CA    . GLY H 4 75  ? -16.574 -15.821 27.437 1.00 72.34  ? 72   GLY H CA    1 
ATOM   5582  C  C     . GLY H 4 75  ? -17.986 -15.291 27.564 1.00 73.12  ? 72   GLY H C     1 
ATOM   5583  O  O     . GLY H 4 75  ? -18.877 -15.701 26.839 1.00 73.04  ? 72   GLY H O     1 
ATOM   5584  N  N     . GLU H 4 76  ? -18.190 -14.354 28.480 1.00 74.37  ? 73   GLU H N     1 
ATOM   5585  C  CA    . GLU H 4 76  ? -19.544 -13.890 28.788 1.00 75.27  ? 73   GLU H CA    1 
ATOM   5586  C  C     . GLU H 4 76  ? -20.084 -13.040 27.634 1.00 75.44  ? 73   GLU H C     1 
ATOM   5587  O  O     . GLU H 4 76  ? -21.302 -12.974 27.409 1.00 75.99  ? 73   GLU H O     1 
ATOM   5588  C  CB    . GLU H 4 76  ? -19.582 -13.177 30.148 1.00 75.00  ? 73   GLU H CB    1 
ATOM   5589  C  CG    . GLU H 4 76  ? -20.914 -12.503 30.487 1.00 78.10  ? 73   GLU H CG    1 
ATOM   5590  C  CD    . GLU H 4 76  ? -22.062 -13.485 30.781 1.00 80.77  ? 73   GLU H CD    1 
ATOM   5591  O  OE1   . GLU H 4 76  ? -23.051 -13.523 29.987 1.00 77.60  ? 73   GLU H OE1   1 
ATOM   5592  O  OE2   . GLU H 4 76  ? -21.959 -14.203 31.818 1.00 82.62  ? 73   GLU H OE2   1 
ATOM   5593  N  N     . ALA H 4 77  ? -19.176 -12.433 26.875 1.00 75.40  ? 74   ALA H N     1 
ATOM   5594  C  CA    . ALA H 4 77  ? -19.553 -11.711 25.663 1.00 75.73  ? 74   ALA H CA    1 
ATOM   5595  C  C     . ALA H 4 77  ? -19.973 -12.709 24.585 1.00 76.15  ? 74   ALA H C     1 
ATOM   5596  O  O     . ALA H 4 77  ? -20.976 -12.521 23.874 1.00 75.74  ? 74   ALA H O     1 
ATOM   5597  C  CB    . ALA H 4 77  ? -18.396 -10.871 25.177 1.00 75.48  ? 74   ALA H CB    1 
ATOM   5598  N  N     . SER H 4 78  ? -19.181 -13.774 24.491 1.00 76.55  ? 75   SER H N     1 
ATOM   5599  C  CA    . SER H 4 78  ? -19.437 -14.899 23.600 1.00 76.86  ? 75   SER H CA    1 
ATOM   5600  C  C     . SER H 4 78  ? -20.820 -15.533 23.805 1.00 76.86  ? 75   SER H C     1 
ATOM   5601  O  O     . SER H 4 78  ? -21.526 -15.809 22.830 1.00 76.84  ? 75   SER H O     1 
ATOM   5602  C  CB    . SER H 4 78  ? -18.349 -15.942 23.777 1.00 76.40  ? 75   SER H CB    1 
ATOM   5603  O  OG    . SER H 4 78  ? -18.471 -16.911 22.774 1.00 77.55  ? 75   SER H OG    1 
ATOM   5604  N  N     . ARG H 4 79  ? -21.199 -15.757 25.061 1.00 77.09  ? 76   ARG H N     1 
ATOM   5605  C  CA    . ARG H 4 79  ? -22.566 -16.166 25.380 1.00 77.56  ? 76   ARG H CA    1 
ATOM   5606  C  C     . ARG H 4 79  ? -23.579 -15.163 24.859 1.00 77.91  ? 76   ARG H C     1 
ATOM   5607  O  O     . ARG H 4 79  ? -24.586 -15.568 24.292 1.00 78.10  ? 76   ARG H O     1 
ATOM   5608  C  CB    . ARG H 4 79  ? -22.762 -16.380 26.881 1.00 77.41  ? 76   ARG H CB    1 
ATOM   5609  C  CG    . ARG H 4 79  ? -22.759 -17.842 27.321 1.00 77.36  ? 76   ARG H CG    1 
ATOM   5610  C  CD    . ARG H 4 79  ? -22.343 -17.981 28.771 1.00 77.64  ? 76   ARG H CD    1 
ATOM   5611  N  NE    . ARG H 4 79  ? -20.883 -18.005 28.909 1.00 78.20  ? 76   ARG H NE    1 
ATOM   5612  C  CZ    . ARG H 4 79  ? -20.214 -17.471 29.927 1.00 78.02  ? 76   ARG H CZ    1 
ATOM   5613  N  NH1   . ARG H 4 79  ? -20.858 -16.849 30.907 1.00 79.04  ? 76   ARG H NH1   1 
ATOM   5614  N  NH2   . ARG H 4 79  ? -18.894 -17.551 29.966 1.00 78.50  ? 76   ARG H NH2   1 
ATOM   5615  N  N     . LEU H 4 80  ? -23.293 -13.866 25.017 1.00 78.36  ? 77   LEU H N     1 
ATOM   5616  C  CA    . LEU H 4 80  ? -24.229 -12.796 24.619 1.00 78.76  ? 77   LEU H CA    1 
ATOM   5617  C  C     . LEU H 4 80  ? -24.496 -12.713 23.117 1.00 79.02  ? 77   LEU H C     1 
ATOM   5618  O  O     . LEU H 4 80  ? -25.650 -12.561 22.683 1.00 78.91  ? 77   LEU H O     1 
ATOM   5619  C  CB    . LEU H 4 80  ? -23.754 -11.434 25.131 1.00 79.06  ? 77   LEU H CB    1 
ATOM   5620  C  CG    . LEU H 4 80  ? -24.268 -10.987 26.505 1.00 79.02  ? 77   LEU H CG    1 
ATOM   5621  C  CD1   . LEU H 4 80  ? -23.339 -9.955  27.098 1.00 78.96  ? 77   LEU H CD1   1 
ATOM   5622  C  CD2   . LEU H 4 80  ? -25.661 -10.445 26.419 1.00 77.02  ? 77   LEU H CD2   1 
ATOM   5623  N  N     . ALA H 4 81  ? -23.432 -12.791 22.323 1.00 79.18  ? 78   ALA H N     1 
ATOM   5624  C  CA    . ALA H 4 81  ? -23.598 -12.945 20.885 1.00 79.29  ? 78   ALA H CA    1 
ATOM   5625  C  C     . ALA H 4 81  ? -24.531 -14.124 20.627 1.00 79.70  ? 78   ALA H C     1 
ATOM   5626  O  O     . ALA H 4 81  ? -25.594 -13.949 20.015 1.00 79.63  ? 78   ALA H O     1 
ATOM   5627  C  CB    . ALA H 4 81  ? -22.266 -13.156 20.213 1.00 79.22  ? 78   ALA H CB    1 
ATOM   5628  N  N     . HIS H 4 82  ? -24.149 -15.301 21.141 1.00 79.91  ? 79   HIS H N     1 
ATOM   5629  C  CA    . HIS H 4 82  ? -24.903 -16.539 20.934 1.00 80.48  ? 79   HIS H CA    1 
ATOM   5630  C  C     . HIS H 4 82  ? -26.367 -16.417 21.287 1.00 80.43  ? 79   HIS H C     1 
ATOM   5631  O  O     . HIS H 4 82  ? -27.220 -16.783 20.495 1.00 80.52  ? 79   HIS H O     1 
ATOM   5632  C  CB    . HIS H 4 82  ? -24.289 -17.708 21.696 1.00 80.56  ? 79   HIS H CB    1 
ATOM   5633  C  CG    . HIS H 4 82  ? -23.161 -18.366 20.967 1.00 82.73  ? 79   HIS H CG    1 
ATOM   5634  N  ND1   . HIS H 4 82  ? -21.858 -17.919 21.054 1.00 83.84  ? 79   HIS H ND1   1 
ATOM   5635  C  CD2   . HIS H 4 82  ? -23.142 -19.421 20.116 1.00 84.12  ? 79   HIS H CD2   1 
ATOM   5636  C  CE1   . HIS H 4 82  ? -21.084 -18.675 20.297 1.00 84.00  ? 79   HIS H CE1   1 
ATOM   5637  N  NE2   . HIS H 4 82  ? -21.837 -19.593 19.717 1.00 84.48  ? 79   HIS H NE2   1 
ATOM   5638  N  N     . TYR H 4 83  ? -26.648 -15.880 22.467 1.00 80.51  ? 80   TYR H N     1 
ATOM   5639  C  CA    . TYR H 4 83  ? -28.001 -15.834 22.997 1.00 80.33  ? 80   TYR H CA    1 
ATOM   5640  C  C     . TYR H 4 83  ? -28.903 -15.048 22.086 1.00 80.81  ? 80   TYR H C     1 
ATOM   5641  O  O     . TYR H 4 83  ? -30.102 -15.311 22.013 1.00 80.64  ? 80   TYR H O     1 
ATOM   5642  C  CB    . TYR H 4 83  ? -28.006 -15.184 24.374 1.00 79.76  ? 80   TYR H CB    1 
ATOM   5643  C  CG    . TYR H 4 83  ? -27.366 -16.001 25.479 1.00 79.40  ? 80   TYR H CG    1 
ATOM   5644  C  CD1   . TYR H 4 83  ? -27.258 -17.393 25.392 1.00 78.37  ? 80   TYR H CD1   1 
ATOM   5645  C  CD2   . TYR H 4 83  ? -26.893 -15.379 26.637 1.00 78.56  ? 80   TYR H CD2   1 
ATOM   5646  C  CE1   . TYR H 4 83  ? -26.682 -18.133 26.424 1.00 77.74  ? 80   TYR H CE1   1 
ATOM   5647  C  CE2   . TYR H 4 83  ? -26.328 -16.116 27.670 1.00 77.26  ? 80   TYR H CE2   1 
ATOM   5648  C  CZ    . TYR H 4 83  ? -26.227 -17.483 27.557 1.00 77.43  ? 80   TYR H CZ    1 
ATOM   5649  O  OH    . TYR H 4 83  ? -25.663 -18.198 28.579 1.00 77.99  ? 80   TYR H OH    1 
ATOM   5650  N  N     . ASN H 4 84  ? -28.308 -14.083 21.397 1.00 81.56  ? 81   ASN H N     1 
ATOM   5651  C  CA    . ASN H 4 84  ? -29.035 -13.151 20.550 1.00 82.63  ? 81   ASN H CA    1 
ATOM   5652  C  C     . ASN H 4 84  ? -28.839 -13.448 19.070 1.00 83.15  ? 81   ASN H C     1 
ATOM   5653  O  O     . ASN H 4 84  ? -28.669 -12.537 18.259 1.00 83.32  ? 81   ASN H O     1 
ATOM   5654  C  CB    . ASN H 4 84  ? -28.593 -11.721 20.863 1.00 82.74  ? 81   ASN H CB    1 
ATOM   5655  C  CG    . ASN H 4 84  ? -29.161 -11.208 22.169 1.00 83.14  ? 81   ASN H CG    1 
ATOM   5656  O  OD1   . ASN H 4 84  ? -30.141 -10.468 22.176 1.00 83.58  ? 81   ASN H OD1   1 
ATOM   5657  N  ND2   . ASN H 4 84  ? -28.550 -11.601 23.282 1.00 84.26  ? 81   ASN H ND2   1 
ATOM   5658  N  N     . LYS H 4 85  ? -28.872 -14.733 18.734 1.00 83.92  ? 82   LYS H N     1 
ATOM   5659  C  CA    . LYS H 4 85  ? -28.470 -15.229 17.416 1.00 84.65  ? 82   LYS H CA    1 
ATOM   5660  C  C     . LYS H 4 85  ? -27.555 -14.259 16.632 1.00 85.12  ? 82   LYS H C     1 
ATOM   5661  O  O     . LYS H 4 85  ? -27.963 -13.670 15.628 1.00 85.36  ? 82   LYS H O     1 
ATOM   5662  C  CB    . LYS H 4 85  ? -29.697 -15.650 16.604 1.00 84.44  ? 82   LYS H CB    1 
ATOM   5663  C  CG    . LYS H 4 85  ? -30.248 -17.017 16.977 1.00 84.48  ? 82   LYS H CG    1 
ATOM   5664  C  CD    . LYS H 4 85  ? -31.470 -16.921 17.873 1.00 85.61  ? 82   LYS H CD    1 
ATOM   5665  C  CE    . LYS H 4 85  ? -32.726 -16.586 17.053 1.00 87.25  ? 82   LYS H CE    1 
ATOM   5666  N  NZ    . LYS H 4 85  ? -33.990 -17.038 17.698 1.00 87.69  ? 82   LYS H NZ    1 
ATOM   5667  N  N     . ARG H 4 86  ? -26.321 -14.096 17.099 1.00 85.43  ? 83   ARG H N     1 
ATOM   5668  C  CA    . ARG H 4 86  ? -25.433 -13.092 16.524 1.00 86.14  ? 83   ARG H CA    1 
ATOM   5669  C  C     . ARG H 4 86  ? -23.983 -13.595 16.344 1.00 86.01  ? 83   ARG H C     1 
ATOM   5670  O  O     . ARG H 4 86  ? -23.460 -14.323 17.189 1.00 86.29  ? 83   ARG H O     1 
ATOM   5671  C  CB    . ARG H 4 86  ? -25.502 -11.838 17.389 1.00 86.47  ? 83   ARG H CB    1 
ATOM   5672  C  CG    . ARG H 4 86  ? -25.183 -10.554 16.674 1.00 88.66  ? 83   ARG H CG    1 
ATOM   5673  C  CD    . ARG H 4 86  ? -26.283 -10.150 15.715 1.00 92.37  ? 83   ARG H CD    1 
ATOM   5674  N  NE    . ARG H 4 86  ? -26.373 -8.692  15.639 1.00 95.55  ? 83   ARG H NE    1 
ATOM   5675  C  CZ    . ARG H 4 86  ? -27.342 -7.970  16.202 1.00 96.09  ? 83   ARG H CZ    1 
ATOM   5676  N  NH1   . ARG H 4 86  ? -28.323 -8.574  16.869 1.00 96.41  ? 83   ARG H NH1   1 
ATOM   5677  N  NH2   . ARG H 4 86  ? -27.337 -6.646  16.088 1.00 95.78  ? 83   ARG H NH2   1 
ATOM   5678  N  N     . SER H 4 87  ? -23.344 -13.205 15.245 1.00 85.76  ? 84   SER H N     1 
ATOM   5679  C  CA    . SER H 4 87  ? -22.105 -13.849 14.793 1.00 85.80  ? 84   SER H CA    1 
ATOM   5680  C  C     . SER H 4 87  ? -20.825 -13.146 15.217 1.00 85.84  ? 84   SER H C     1 
ATOM   5681  O  O     . SER H 4 87  ? -19.708 -13.591 14.887 1.00 85.89  ? 84   SER H O     1 
ATOM   5682  C  CB    . SER H 4 87  ? -22.096 -13.942 13.269 1.00 85.82  ? 84   SER H CB    1 
ATOM   5683  O  OG    . SER H 4 87  ? -23.127 -14.780 12.791 1.00 87.15  ? 84   SER H OG    1 
ATOM   5684  N  N     . THR H 4 88  ? -20.974 -12.032 15.922 1.00 85.76  ? 85   THR H N     1 
ATOM   5685  C  CA    . THR H 4 88  ? -19.835 -11.147 16.128 1.00 85.31  ? 85   THR H CA    1 
ATOM   5686  C  C     . THR H 4 88  ? -19.848 -10.456 17.492 1.00 85.00  ? 85   THR H C     1 
ATOM   5687  O  O     . THR H 4 88  ? -20.910 -10.040 17.988 1.00 85.04  ? 85   THR H O     1 
ATOM   5688  C  CB    . THR H 4 88  ? -19.669 -10.147 14.931 1.00 85.38  ? 85   THR H CB    1 
ATOM   5689  O  OG1   . THR H 4 88  ? -18.601 -9.224  15.194 1.00 86.49  ? 85   THR H OG1   1 
ATOM   5690  C  CG2   . THR H 4 88  ? -20.969 -9.389  14.620 1.00 84.21  ? 85   THR H CG2   1 
ATOM   5691  N  N     . ILE H 4 89  ? -18.660 -10.384 18.097 1.00 84.47  ? 86   ILE H N     1 
ATOM   5692  C  CA    . ILE H 4 89  ? -18.461 -9.739  19.387 1.00 84.02  ? 86   ILE H CA    1 
ATOM   5693  C  C     . ILE H 4 89  ? -17.954 -8.321  19.169 1.00 83.83  ? 86   ILE H C     1 
ATOM   5694  O  O     . ILE H 4 89  ? -16.783 -8.129  18.817 1.00 84.07  ? 86   ILE H O     1 
ATOM   5695  C  CB    . ILE H 4 89  ? -17.430 -10.506 20.275 1.00 84.29  ? 86   ILE H CB    1 
ATOM   5696  C  CG1   . ILE H 4 89  ? -17.905 -11.935 20.571 1.00 84.30  ? 86   ILE H CG1   1 
ATOM   5697  C  CG2   . ILE H 4 89  ? -17.142 -9.731  21.574 1.00 83.84  ? 86   ILE H CG2   1 
ATOM   5698  C  CD1   . ILE H 4 89  ? -17.118 -12.638 21.652 1.00 83.61  ? 86   ILE H CD1   1 
ATOM   5699  N  N     . THR H 4 90  ? -18.835 -7.340  19.376 1.00 83.27  ? 87   THR H N     1 
ATOM   5700  C  CA    . THR H 4 90  ? -18.465 -5.919  19.328 1.00 82.56  ? 87   THR H CA    1 
ATOM   5701  C  C     . THR H 4 90  ? -18.492 -5.333  20.711 1.00 81.87  ? 87   THR H C     1 
ATOM   5702  O  O     . THR H 4 90  ? -19.200 -5.827  21.578 1.00 81.94  ? 87   THR H O     1 
ATOM   5703  C  CB    . THR H 4 90  ? -19.448 -5.099  18.525 1.00 82.48  ? 87   THR H CB    1 
ATOM   5704  O  OG1   . THR H 4 90  ? -20.778 -5.469  18.911 1.00 83.01  ? 87   THR H OG1   1 
ATOM   5705  C  CG2   . THR H 4 90  ? -19.245 -5.337  17.048 1.00 83.51  ? 87   THR H CG2   1 
ATOM   5706  N  N     . SER H 4 91  ? -17.751 -4.250  20.899 1.00 81.08  ? 88   SER H N     1 
ATOM   5707  C  CA    . SER H 4 91  ? -17.657 -3.583  22.190 1.00 80.31  ? 88   SER H CA    1 
ATOM   5708  C  C     . SER H 4 91  ? -18.978 -3.389  22.941 1.00 79.68  ? 88   SER H C     1 
ATOM   5709  O  O     . SER H 4 91  ? -18.965 -3.226  24.157 1.00 79.75  ? 88   SER H O     1 
ATOM   5710  C  CB    . SER H 4 91  ? -16.911 -2.258  22.060 1.00 80.33  ? 88   SER H CB    1 
ATOM   5711  O  OG    . SER H 4 91  ? -17.162 -1.645  20.812 1.00 80.78  ? 88   SER H OG    1 
ATOM   5712  N  N     . ARG H 4 92  ? -20.107 -3.427  22.243 1.00 78.93  ? 89   ARG H N     1 
ATOM   5713  C  CA    . ARG H 4 92  ? -21.390 -3.434  22.932 1.00 78.36  ? 89   ARG H CA    1 
ATOM   5714  C  C     . ARG H 4 92  ? -21.497 -4.683  23.804 1.00 78.10  ? 89   ARG H C     1 
ATOM   5715  O  O     . ARG H 4 92  ? -21.835 -4.575  24.987 1.00 78.29  ? 89   ARG H O     1 
ATOM   5716  C  CB    . ARG H 4 92  ? -22.557 -3.357  21.955 1.00 78.49  ? 89   ARG H CB    1 
ATOM   5717  C  CG    . ARG H 4 92  ? -23.885 -3.119  22.660 1.00 79.49  ? 89   ARG H CG    1 
ATOM   5718  C  CD    . ARG H 4 92  ? -25.094 -3.421  21.782 1.00 81.23  ? 89   ARG H CD    1 
ATOM   5719  N  NE    . ARG H 4 92  ? -26.254 -2.680  22.272 1.00 83.79  ? 89   ARG H NE    1 
ATOM   5720  C  CZ    . ARG H 4 92  ? -27.357 -3.226  22.775 1.00 85.02  ? 89   ARG H CZ    1 
ATOM   5721  N  NH1   . ARG H 4 92  ? -27.488 -4.543  22.838 1.00 86.27  ? 89   ARG H NH1   1 
ATOM   5722  N  NH2   . ARG H 4 92  ? -28.343 -2.449  23.202 1.00 85.22  ? 89   ARG H NH2   1 
ATOM   5723  N  N     . GLU H 4 93  ? -21.206 -5.847  23.204 1.00 77.38  ? 90   GLU H N     1 
ATOM   5724  C  CA    . GLU H 4 93  ? -21.063 -7.151  23.885 1.00 76.47  ? 90   GLU H CA    1 
ATOM   5725  C  C     . GLU H 4 93  ? -20.086 -7.084  25.051 1.00 75.41  ? 90   GLU H C     1 
ATOM   5726  O  O     . GLU H 4 93  ? -20.459 -7.370  26.187 1.00 75.51  ? 90   GLU H O     1 
ATOM   5727  C  CB    . GLU H 4 93  ? -20.544 -8.210  22.901 1.00 76.64  ? 90   GLU H CB    1 
ATOM   5728  C  CG    . GLU H 4 93  ? -21.594 -8.895  22.050 1.00 78.30  ? 90   GLU H CG    1 
ATOM   5729  C  CD    . GLU H 4 93  ? -22.407 -7.934  21.204 1.00 80.15  ? 90   GLU H CD    1 
ATOM   5730  O  OE1   . GLU H 4 93  ? -21.814 -7.264  20.322 1.00 80.21  ? 90   GLU H OE1   1 
ATOM   5731  O  OE2   . GLU H 4 93  ? -23.639 -7.858  21.428 1.00 79.93  ? 90   GLU H OE2   1 
ATOM   5732  N  N     . ILE H 4 94  ? -18.838 -6.713  24.748 1.00 73.94  ? 91   ILE H N     1 
ATOM   5733  C  CA    . ILE H 4 94  ? -17.773 -6.519  25.737 1.00 72.56  ? 91   ILE H CA    1 
ATOM   5734  C  C     . ILE H 4 94  ? -18.207 -5.580  26.843 1.00 71.83  ? 91   ILE H C     1 
ATOM   5735  O  O     . ILE H 4 94  ? -17.910 -5.798  28.005 1.00 71.25  ? 91   ILE H O     1 
ATOM   5736  C  CB    . ILE H 4 94  ? -16.499 -5.955  25.069 1.00 72.77  ? 91   ILE H CB    1 
ATOM   5737  C  CG1   . ILE H 4 94  ? -15.881 -7.014  24.148 1.00 72.74  ? 91   ILE H CG1   1 
ATOM   5738  C  CG2   . ILE H 4 94  ? -15.511 -5.411  26.107 1.00 70.96  ? 91   ILE H CG2   1 
ATOM   5739  C  CD1   . ILE H 4 94  ? -14.688 -7.756  24.704 1.00 71.84  ? 91   ILE H CD1   1 
ATOM   5740  N  N     . GLN H 4 95  ? -18.924 -4.532  26.486 1.00 71.48  ? 92   GLN H N     1 
ATOM   5741  C  CA    . GLN H 4 95  ? -19.505 -3.697  27.521 1.00 71.59  ? 92   GLN H CA    1 
ATOM   5742  C  C     . GLN H 4 95  ? -20.517 -4.422  28.375 1.00 71.09  ? 92   GLN H C     1 
ATOM   5743  O  O     . GLN H 4 95  ? -20.362 -4.470  29.584 1.00 71.90  ? 92   GLN H O     1 
ATOM   5744  C  CB    . GLN H 4 95  ? -20.177 -2.467  26.960 1.00 72.07  ? 92   GLN H CB    1 
ATOM   5745  C  CG    . GLN H 4 95  ? -20.857 -1.636  28.027 1.00 71.67  ? 92   GLN H CG    1 
ATOM   5746  C  CD    . GLN H 4 95  ? -21.130 -0.266  27.532 1.00 71.91  ? 92   GLN H CD    1 
ATOM   5747  O  OE1   . GLN H 4 95  ? -22.266 0.065   27.200 1.00 73.51  ? 92   GLN H OE1   1 
ATOM   5748  N  NE2   . GLN H 4 95  ? -20.086 0.539   27.426 1.00 71.78  ? 92   GLN H NE2   1 
ATOM   5749  N  N     . THR H 4 96  ? -21.567 -4.964  27.783 1.00 70.07  ? 93   THR H N     1 
ATOM   5750  C  CA    . THR H 4 96  ? -22.591 -5.537  28.647 1.00 69.31  ? 93   THR H CA    1 
ATOM   5751  C  C     . THR H 4 96  ? -22.059 -6.726  29.425 1.00 68.63  ? 93   THR H C     1 
ATOM   5752  O  O     . THR H 4 96  ? -22.486 -6.947  30.557 1.00 68.20  ? 93   THR H O     1 
ATOM   5753  C  CB    . THR H 4 96  ? -23.908 -5.879  27.942 1.00 69.27  ? 93   THR H CB    1 
ATOM   5754  O  OG1   . THR H 4 96  ? -24.653 -6.762  28.794 1.00 69.61  ? 93   THR H OG1   1 
ATOM   5755  C  CG2   . THR H 4 96  ? -23.646 -6.553  26.629 1.00 68.53  ? 93   THR H CG2   1 
ATOM   5756  N  N     . ALA H 4 97  ? -21.112 -7.457  28.823 1.00 68.22  ? 94   ALA H N     1 
ATOM   5757  C  CA    . ALA H 4 97  ? -20.303 -8.470  29.532 1.00 67.88  ? 94   ALA H CA    1 
ATOM   5758  C  C     . ALA H 4 97  ? -19.745 -7.890  30.814 1.00 67.77  ? 94   ALA H C     1 
ATOM   5759  O  O     . ALA H 4 97  ? -19.822 -8.505  31.875 1.00 67.96  ? 94   ALA H O     1 
ATOM   5760  C  CB    . ALA H 4 97  ? -19.162 -8.936  28.676 1.00 67.27  ? 94   ALA H CB    1 
ATOM   5761  N  N     . VAL H 4 98  ? -19.204 -6.687  30.710 1.00 67.93  ? 95   VAL H N     1 
ATOM   5762  C  CA    . VAL H 4 98  ? -18.580 -6.027  31.838 1.00 68.58  ? 95   VAL H CA    1 
ATOM   5763  C  C     . VAL H 4 98  ? -19.594 -5.717  32.920 1.00 69.33  ? 95   VAL H C     1 
ATOM   5764  O  O     . VAL H 4 98  ? -19.290 -5.842  34.127 1.00 69.50  ? 95   VAL H O     1 
ATOM   5765  C  CB    . VAL H 4 98  ? -17.840 -4.771  31.381 1.00 68.38  ? 95   VAL H CB    1 
ATOM   5766  C  CG1   . VAL H 4 98  ? -18.068 -3.620  32.332 1.00 68.32  ? 95   VAL H CG1   1 
ATOM   5767  C  CG2   . VAL H 4 98  ? -16.341 -5.081  31.210 1.00 68.99  ? 95   VAL H CG2   1 
ATOM   5768  N  N     . ARG H 4 99  ? -20.807 -5.353  32.494 1.00 69.76  ? 96   ARG H N     1 
ATOM   5769  C  CA    . ARG H 4 99  ? -21.863 -5.015  33.439 1.00 70.27  ? 96   ARG H CA    1 
ATOM   5770  C  C     . ARG H 4 99  ? -22.377 -6.211  34.220 1.00 69.63  ? 96   ARG H C     1 
ATOM   5771  O  O     . ARG H 4 99  ? -22.890 -6.047  35.324 1.00 69.73  ? 96   ARG H O     1 
ATOM   5772  C  CB    . ARG H 4 99  ? -23.016 -4.252  32.769 1.00 71.32  ? 96   ARG H CB    1 
ATOM   5773  C  CG    . ARG H 4 99  ? -22.642 -2.812  32.363 1.00 74.01  ? 96   ARG H CG    1 
ATOM   5774  C  CD    . ARG H 4 99  ? -23.824 -1.860  32.532 1.00 78.14  ? 96   ARG H CD    1 
ATOM   5775  N  NE    . ARG H 4 99  ? -23.400 -0.473  32.780 1.00 81.81  ? 96   ARG H NE    1 
ATOM   5776  C  CZ    . ARG H 4 99  ? -23.143 0.431   31.826 1.00 84.54  ? 96   ARG H CZ    1 
ATOM   5777  N  NH1   . ARG H 4 99  ? -23.259 0.114   30.535 1.00 85.18  ? 96   ARG H NH1   1 
ATOM   5778  N  NH2   . ARG H 4 99  ? -22.774 1.669   32.160 1.00 84.87  ? 96   ARG H NH2   1 
ATOM   5779  N  N     . LEU H 4 100 ? -22.228 -7.410  33.660 1.00 68.91  ? 97   LEU H N     1 
ATOM   5780  C  CA    . LEU H 4 100 ? -22.643 -8.631  34.353 1.00 67.83  ? 97   LEU H CA    1 
ATOM   5781  C  C     . LEU H 4 100 ? -21.577 -9.108  35.330 1.00 67.94  ? 97   LEU H C     1 
ATOM   5782  O  O     . LEU H 4 100 ? -21.870 -9.430  36.490 1.00 67.64  ? 97   LEU H O     1 
ATOM   5783  C  CB    . LEU H 4 100 ? -22.928 -9.722  33.348 1.00 67.07  ? 97   LEU H CB    1 
ATOM   5784  C  CG    . LEU H 4 100 ? -24.123 -9.501  32.438 1.00 66.97  ? 97   LEU H CG    1 
ATOM   5785  C  CD1   . LEU H 4 100 ? -23.903 -10.360 31.224 1.00 67.15  ? 97   LEU H CD1   1 
ATOM   5786  C  CD2   . LEU H 4 100 ? -25.492 -9.808  33.116 1.00 64.16  ? 97   LEU H CD2   1 
ATOM   5787  N  N     . LEU H 4 101 ? -20.341 -9.122  34.838 1.00 68.03  ? 98   LEU H N     1 
ATOM   5788  C  CA    . LEU H 4 101 ? -19.161 -9.598  35.551 1.00 68.51  ? 98   LEU H CA    1 
ATOM   5789  C  C     . LEU H 4 101 ? -18.668 -8.821  36.755 1.00 68.97  ? 98   LEU H C     1 
ATOM   5790  O  O     . LEU H 4 101 ? -18.311 -9.417  37.759 1.00 69.33  ? 98   LEU H O     1 
ATOM   5791  C  CB    . LEU H 4 101 ? -18.008 -9.640  34.571 1.00 68.63  ? 98   LEU H CB    1 
ATOM   5792  C  CG    . LEU H 4 101 ? -17.580 -11.050 34.270 1.00 69.23  ? 98   LEU H CG    1 
ATOM   5793  C  CD1   . LEU H 4 101 ? -17.580 -11.249 32.754 1.00 68.13  ? 98   LEU H CD1   1 
ATOM   5794  C  CD2   . LEU H 4 101 ? -16.216 -11.288 34.969 1.00 67.81  ? 98   LEU H CD2   1 
ATOM   5795  N  N     . LEU H 4 102 ? -18.581 -7.499  36.630 1.00 70.09  ? 99   LEU H N     1 
ATOM   5796  C  CA    . LEU H 4 102 ? -17.924 -6.666  37.640 1.00 70.93  ? 99   LEU H CA    1 
ATOM   5797  C  C     . LEU H 4 102 ? -18.886 -6.102  38.694 1.00 71.69  ? 99   LEU H C     1 
ATOM   5798  O  O     . LEU H 4 102 ? -20.068 -5.862  38.403 1.00 72.37  ? 99   LEU H O     1 
ATOM   5799  C  CB    . LEU H 4 102 ? -17.117 -5.544  36.969 1.00 70.92  ? 99   LEU H CB    1 
ATOM   5800  C  CG    . LEU H 4 102 ? -16.090 -5.865  35.861 1.00 71.49  ? 99   LEU H CG    1 
ATOM   5801  C  CD1   . LEU H 4 102 ? -14.970 -4.837  35.807 1.00 71.22  ? 99   LEU H CD1   1 
ATOM   5802  C  CD2   . LEU H 4 102 ? -15.467 -7.235  36.050 1.00 72.75  ? 99   LEU H CD2   1 
ATOM   5803  N  N     . PRO H 4 103 ? -18.402 -5.934  39.939 1.00 72.15  ? 100  PRO H N     1 
ATOM   5804  C  CA    . PRO H 4 103 ? -19.169 -5.179  40.937 1.00 72.33  ? 100  PRO H CA    1 
ATOM   5805  C  C     . PRO H 4 103 ? -19.201 -3.673  40.627 1.00 72.80  ? 100  PRO H C     1 
ATOM   5806  O  O     . PRO H 4 103 ? -18.278 -3.141  39.987 1.00 73.04  ? 100  PRO H O     1 
ATOM   5807  C  CB    . PRO H 4 103 ? -18.423 -5.455  42.235 1.00 72.18  ? 100  PRO H CB    1 
ATOM   5808  C  CG    . PRO H 4 103 ? -17.011 -5.805  41.813 1.00 72.67  ? 100  PRO H CG    1 
ATOM   5809  C  CD    . PRO H 4 103 ? -17.138 -6.469  40.480 1.00 72.45  ? 100  PRO H CD    1 
ATOM   5810  N  N     . GLY H 4 104 ? -20.266 -3.006  41.076 1.00 72.93  ? 101  GLY H N     1 
ATOM   5811  C  CA    . GLY H 4 104 ? -20.535 -1.576  40.786 1.00 72.73  ? 101  GLY H CA    1 
ATOM   5812  C  C     . GLY H 4 104 ? -19.401 -0.601  40.488 1.00 72.26  ? 101  GLY H C     1 
ATOM   5813  O  O     . GLY H 4 104 ? -19.034 -0.388  39.334 1.00 72.25  ? 101  GLY H O     1 
ATOM   5814  N  N     . GLU H 4 105 ? -18.847 0.020   41.514 1.00 72.06  ? 102  GLU H N     1 
ATOM   5815  C  CA    . GLU H 4 105 ? -17.877 1.075   41.270 1.00 72.57  ? 102  GLU H CA    1 
ATOM   5816  C  C     . GLU H 4 105 ? -16.799 0.645   40.272 1.00 71.98  ? 102  GLU H C     1 
ATOM   5817  O  O     . GLU H 4 105 ? -16.418 1.408   39.389 1.00 71.44  ? 102  GLU H O     1 
ATOM   5818  C  CB    . GLU H 4 105 ? -17.283 1.605   42.579 1.00 72.93  ? 102  GLU H CB    1 
ATOM   5819  C  CG    . GLU H 4 105 ? -17.455 3.144   42.731 1.00 75.67  ? 102  GLU H CG    1 
ATOM   5820  C  CD    . GLU H 4 105 ? -18.921 3.588   42.962 1.00 78.85  ? 102  GLU H CD    1 
ATOM   5821  O  OE1   . GLU H 4 105 ? -19.889 2.890   42.551 1.00 78.63  ? 102  GLU H OE1   1 
ATOM   5822  O  OE2   . GLU H 4 105 ? -19.105 4.663   43.574 1.00 82.19  ? 102  GLU H OE2   1 
ATOM   5823  N  N     . LEU H 4 106 ? -16.363 -0.604  40.387 1.00 71.95  ? 103  LEU H N     1 
ATOM   5824  C  CA    . LEU H 4 106 ? -15.441 -1.192  39.429 1.00 71.73  ? 103  LEU H CA    1 
ATOM   5825  C  C     . LEU H 4 106 ? -16.053 -1.169  38.017 1.00 72.08  ? 103  LEU H C     1 
ATOM   5826  O  O     . LEU H 4 106 ? -15.489 -0.539  37.108 1.00 72.28  ? 103  LEU H O     1 
ATOM   5827  C  CB    . LEU H 4 106 ? -15.047 -2.605  39.880 1.00 71.75  ? 103  LEU H CB    1 
ATOM   5828  C  CG    . LEU H 4 106 ? -13.549 -2.967  39.915 1.00 71.74  ? 103  LEU H CG    1 
ATOM   5829  C  CD1   . LEU H 4 106 ? -12.651 -1.851  40.456 1.00 69.75  ? 103  LEU H CD1   1 
ATOM   5830  C  CD2   . LEU H 4 106 ? -13.310 -4.246  40.706 1.00 71.55  ? 103  LEU H CD2   1 
ATOM   5831  N  N     . ALA H 4 107 ? -17.218 -1.805  37.847 1.00 71.95  ? 104  ALA H N     1 
ATOM   5832  C  CA    . ALA H 4 107 ? -17.920 -1.846  36.561 1.00 71.71  ? 104  ALA H CA    1 
ATOM   5833  C  C     . ALA H 4 107 ? -18.120 -0.458  35.954 1.00 72.13  ? 104  ALA H C     1 
ATOM   5834  O  O     . ALA H 4 107 ? -17.725 -0.210  34.808 1.00 72.02  ? 104  ALA H O     1 
ATOM   5835  C  CB    . ALA H 4 107 ? -19.257 -2.548  36.709 1.00 71.79  ? 104  ALA H CB    1 
ATOM   5836  N  N     . LYS H 4 108 ? -18.717 0.451   36.724 1.00 72.41  ? 105  LYS H N     1 
ATOM   5837  C  CA    . LYS H 4 108 ? -19.012 1.801   36.235 1.00 72.88  ? 105  LYS H CA    1 
ATOM   5838  C  C     . LYS H 4 108 ? -17.759 2.475   35.662 1.00 72.68  ? 105  LYS H C     1 
ATOM   5839  O  O     . LYS H 4 108 ? -17.698 2.797   34.478 1.00 72.41  ? 105  LYS H O     1 
ATOM   5840  C  CB    . LYS H 4 108 ? -19.637 2.628   37.353 1.00 72.65  ? 105  LYS H CB    1 
ATOM   5841  C  CG    . LYS H 4 108 ? -20.100 4.024   36.963 1.00 73.58  ? 105  LYS H CG    1 
ATOM   5842  C  CD    . LYS H 4 108 ? -20.399 4.873   38.210 1.00 73.85  ? 105  LYS H CD    1 
ATOM   5843  C  CE    . LYS H 4 108 ? -21.265 4.104   39.239 1.00 76.48  ? 105  LYS H CE    1 
ATOM   5844  N  NZ    . LYS H 4 108 ? -20.912 4.400   40.677 1.00 77.16  ? 105  LYS H NZ    1 
ATOM   5845  N  N     . HIS H 4 109 ? -16.752 2.653   36.501 1.00 73.14  ? 106  HIS H N     1 
ATOM   5846  C  CA    . HIS H 4 109 ? -15.485 3.206   36.048 1.00 74.31  ? 106  HIS H CA    1 
ATOM   5847  C  C     . HIS H 4 109 ? -14.924 2.503   34.815 1.00 74.13  ? 106  HIS H C     1 
ATOM   5848  O  O     . HIS H 4 109 ? -14.674 3.148   33.798 1.00 73.86  ? 106  HIS H O     1 
ATOM   5849  C  CB    . HIS H 4 109 ? -14.485 3.207   37.191 1.00 74.87  ? 106  HIS H CB    1 
ATOM   5850  C  CG    . HIS H 4 109 ? -14.844 4.164   38.282 1.00 77.80  ? 106  HIS H CG    1 
ATOM   5851  N  ND1   . HIS H 4 109 ? -13.920 4.996   38.877 1.00 80.40  ? 106  HIS H ND1   1 
ATOM   5852  C  CD2   . HIS H 4 109 ? -16.039 4.456   38.850 1.00 79.46  ? 106  HIS H CD2   1 
ATOM   5853  C  CE1   . HIS H 4 109 ? -14.524 5.733   39.792 1.00 82.21  ? 106  HIS H CE1   1 
ATOM   5854  N  NE2   . HIS H 4 109 ? -15.810 5.424   39.795 1.00 82.35  ? 106  HIS H NE2   1 
ATOM   5855  N  N     . ALA H 4 110 ? -14.766 1.181   34.906 1.00 74.23  ? 107  ALA H N     1 
ATOM   5856  C  CA    . ALA H 4 110 ? -14.326 0.350   33.776 1.00 74.04  ? 107  ALA H CA    1 
ATOM   5857  C  C     . ALA H 4 110 ? -15.082 0.647   32.477 1.00 74.27  ? 107  ALA H C     1 
ATOM   5858  O  O     . ALA H 4 110 ? -14.452 0.796   31.425 1.00 73.91  ? 107  ALA H O     1 
ATOM   5859  C  CB    . ALA H 4 110 ? -14.449 -1.105  34.126 1.00 73.84  ? 107  ALA H CB    1 
ATOM   5860  N  N     . VAL H 4 111 ? -16.419 0.728   32.557 1.00 74.31  ? 108  VAL H N     1 
ATOM   5861  C  CA    . VAL H 4 111 ? -17.254 1.085   31.407 1.00 74.52  ? 108  VAL H CA    1 
ATOM   5862  C  C     . VAL H 4 111 ? -16.854 2.444   30.848 1.00 75.33  ? 108  VAL H C     1 
ATOM   5863  O  O     . VAL H 4 111 ? -16.533 2.554   29.664 1.00 74.99  ? 108  VAL H O     1 
ATOM   5864  C  CB    . VAL H 4 111 ? -18.772 1.078   31.747 1.00 74.41  ? 108  VAL H CB    1 
ATOM   5865  C  CG1   . VAL H 4 111 ? -19.595 1.746   30.660 1.00 72.53  ? 108  VAL H CG1   1 
ATOM   5866  C  CG2   . VAL H 4 111 ? -19.254 -0.334  31.961 1.00 74.38  ? 108  VAL H CG2   1 
ATOM   5867  N  N     . SER H 4 112 ? -16.854 3.474   31.696 1.00 76.47  ? 109  SER H N     1 
ATOM   5868  C  CA    . SER H 4 112 ? -16.537 4.820   31.218 1.00 77.89  ? 109  SER H CA    1 
ATOM   5869  C  C     . SER H 4 112 ? -15.163 4.753   30.562 1.00 78.18  ? 109  SER H C     1 
ATOM   5870  O  O     . SER H 4 112 ? -15.008 5.044   29.383 1.00 78.17  ? 109  SER H O     1 
ATOM   5871  C  CB    . SER H 4 112 ? -16.603 5.865   32.353 1.00 78.07  ? 109  SER H CB    1 
ATOM   5872  O  OG    . SER H 4 112 ? -15.306 6.324   32.757 1.00 80.32  ? 109  SER H OG    1 
ATOM   5873  N  N     . GLU H 4 113 ? -14.191 4.313   31.351 1.00 79.08  ? 110  GLU H N     1 
ATOM   5874  C  CA    . GLU H 4 113 ? -12.850 3.990   30.909 1.00 80.11  ? 110  GLU H CA    1 
ATOM   5875  C  C     . GLU H 4 113 ? -12.740 3.342   29.532 1.00 80.60  ? 110  GLU H C     1 
ATOM   5876  O  O     . GLU H 4 113 ? -11.894 3.737   28.709 1.00 81.11  ? 110  GLU H O     1 
ATOM   5877  C  CB    . GLU H 4 113 ? -12.240 3.030   31.916 1.00 80.41  ? 110  GLU H CB    1 
ATOM   5878  C  CG    . GLU H 4 113 ? -11.638 3.704   33.108 1.00 82.11  ? 110  GLU H CG    1 
ATOM   5879  C  CD    . GLU H 4 113 ? -10.444 4.537   32.720 1.00 84.59  ? 110  GLU H CD    1 
ATOM   5880  O  OE1   . GLU H 4 113 ? -9.868  4.296   31.624 1.00 84.91  ? 110  GLU H OE1   1 
ATOM   5881  O  OE2   . GLU H 4 113 ? -10.098 5.436   33.513 1.00 86.49  ? 110  GLU H OE2   1 
ATOM   5882  N  N     . GLY H 4 114 ? -13.567 2.326   29.301 1.00 80.42  ? 111  GLY H N     1 
ATOM   5883  C  CA    . GLY H 4 114 ? -13.542 1.586   28.057 1.00 80.42  ? 111  GLY H CA    1 
ATOM   5884  C  C     . GLY H 4 114 ? -14.149 2.330   26.889 1.00 80.78  ? 111  GLY H C     1 
ATOM   5885  O  O     . GLY H 4 114 ? -13.525 2.409   25.823 1.00 80.72  ? 111  GLY H O     1 
ATOM   5886  N  N     . THR H 4 115 ? -15.358 2.878   27.079 1.00 80.86  ? 112  THR H N     1 
ATOM   5887  C  CA    . THR H 4 115 ? -16.089 3.521   25.977 1.00 80.67  ? 112  THR H CA    1 
ATOM   5888  C  C     . THR H 4 115 ? -15.402 4.827   25.604 1.00 81.25  ? 112  THR H C     1 
ATOM   5889  O  O     . THR H 4 115 ? -15.603 5.365   24.511 1.00 81.35  ? 112  THR H O     1 
ATOM   5890  C  CB    . THR H 4 115 ? -17.607 3.758   26.263 1.00 80.43  ? 112  THR H CB    1 
ATOM   5891  O  OG1   . THR H 4 115 ? -17.878 5.154   26.359 1.00 79.71  ? 112  THR H OG1   1 
ATOM   5892  C  CG2   . THR H 4 115 ? -18.077 3.069   27.517 1.00 79.94  ? 112  THR H CG2   1 
ATOM   5893  N  N     . LYS H 4 116 ? -14.583 5.322   26.523 1.00 81.73  ? 113  LYS H N     1 
ATOM   5894  C  CA    . LYS H 4 116 ? -13.707 6.439   26.248 1.00 82.59  ? 113  LYS H CA    1 
ATOM   5895  C  C     . LYS H 4 116 ? -12.682 6.048   25.175 1.00 82.90  ? 113  LYS H C     1 
ATOM   5896  O  O     . LYS H 4 116 ? -12.513 6.762   24.189 1.00 82.97  ? 113  LYS H O     1 
ATOM   5897  C  CB    . LYS H 4 116 ? -13.039 6.899   27.546 1.00 82.57  ? 113  LYS H CB    1 
ATOM   5898  C  CG    . LYS H 4 116 ? -11.973 7.980   27.399 1.00 83.31  ? 113  LYS H CG    1 
ATOM   5899  C  CD    . LYS H 4 116 ? -11.305 8.259   28.758 1.00 83.38  ? 113  LYS H CD    1 
ATOM   5900  C  CE    . LYS H 4 116 ? -9.820  8.665   28.546 1.00 84.47  ? 113  LYS H CE    1 
ATOM   5901  N  NZ    . LYS H 4 116 ? -9.175  8.954   29.882 1.00 85.76  ? 113  LYS H NZ    1 
ATOM   5902  N  N     . ALA H 4 117 ? -12.038 4.897   25.339 1.00 83.62  ? 114  ALA H N     1 
ATOM   5903  C  CA    . ALA H 4 117 ? -10.953 4.492   24.433 1.00 84.57  ? 114  ALA H CA    1 
ATOM   5904  C  C     . ALA H 4 117 ? -11.439 4.151   23.024 1.00 85.18  ? 114  ALA H C     1 
ATOM   5905  O  O     . ALA H 4 117 ? -10.667 4.255   22.059 1.00 85.47  ? 114  ALA H O     1 
ATOM   5906  C  CB    . ALA H 4 117 ? -10.159 3.336   25.016 1.00 84.50  ? 114  ALA H CB    1 
ATOM   5907  N  N     . VAL H 4 118 ? -12.706 3.728   22.930 1.00 85.55  ? 115  VAL H N     1 
ATOM   5908  C  CA    . VAL H 4 118 ? -13.411 3.484   21.662 1.00 85.71  ? 115  VAL H CA    1 
ATOM   5909  C  C     . VAL H 4 118 ? -13.485 4.789   20.912 1.00 85.61  ? 115  VAL H C     1 
ATOM   5910  O  O     . VAL H 4 118 ? -12.860 4.967   19.867 1.00 85.75  ? 115  VAL H O     1 
ATOM   5911  C  CB    . VAL H 4 118 ? -14.883 3.071   21.906 1.00 85.82  ? 115  VAL H CB    1 
ATOM   5912  C  CG1   . VAL H 4 118 ? -15.631 2.910   20.588 1.00 86.00  ? 115  VAL H CG1   1 
ATOM   5913  C  CG2   . VAL H 4 118 ? -14.970 1.806   22.730 1.00 86.39  ? 115  VAL H CG2   1 
ATOM   5914  N  N     . THR H 4 119 ? -14.294 5.684   21.461 1.00 85.56  ? 116  THR H N     1 
ATOM   5915  C  CA    . THR H 4 119 ? -14.383 7.055   21.020 1.00 85.51  ? 116  THR H CA    1 
ATOM   5916  C  C     . THR H 4 119 ? -13.019 7.568   20.548 1.00 85.37  ? 116  THR H C     1 
ATOM   5917  O  O     . THR H 4 119 ? -12.875 7.902   19.378 1.00 85.21  ? 116  THR H O     1 
ATOM   5918  C  CB    . THR H 4 119 ? -14.966 7.890   22.155 1.00 85.49  ? 116  THR H CB    1 
ATOM   5919  O  OG1   . THR H 4 119 ? -16.395 7.735   22.164 1.00 85.80  ? 116  THR H OG1   1 
ATOM   5920  C  CG2   . THR H 4 119 ? -14.607 9.332   22.010 1.00 86.00  ? 116  THR H CG2   1 
ATOM   5921  N  N     . LYS H 4 120 ? -12.022 7.576   21.441 1.00 85.64  ? 117  LYS H N     1 
ATOM   5922  C  CA    . LYS H 4 120 ? -10.660 8.060   21.129 1.00 85.63  ? 117  LYS H CA    1 
ATOM   5923  C  C     . LYS H 4 120 ? -10.077 7.363   19.907 1.00 85.94  ? 117  LYS H C     1 
ATOM   5924  O  O     . LYS H 4 120 ? -9.552  8.007   19.008 1.00 85.78  ? 117  LYS H O     1 
ATOM   5925  C  CB    . LYS H 4 120 ? -9.736  7.871   22.331 1.00 85.46  ? 117  LYS H CB    1 
ATOM   5926  C  CG    . LYS H 4 120 ? -8.270  8.131   22.057 1.00 85.35  ? 117  LYS H CG    1 
ATOM   5927  C  CD    . LYS H 4 120 ? -7.741  9.282   22.868 1.00 87.58  ? 117  LYS H CD    1 
ATOM   5928  C  CE    . LYS H 4 120 ? -6.281  9.609   22.513 1.00 89.83  ? 117  LYS H CE    1 
ATOM   5929  N  NZ    . LYS H 4 120 ? -6.141  10.483  21.288 1.00 90.90  ? 117  LYS H NZ    1 
ATOM   5930  N  N     . TYR H 4 121 ? -10.198 6.043   19.889 1.00 86.79  ? 118  TYR H N     1 
ATOM   5931  C  CA    . TYR H 4 121 ? -9.729  5.193   18.794 1.00 87.86  ? 118  TYR H CA    1 
ATOM   5932  C  C     . TYR H 4 121 ? -10.405 5.444   17.431 1.00 88.71  ? 118  TYR H C     1 
ATOM   5933  O  O     . TYR H 4 121 ? -9.741  5.396   16.390 1.00 88.88  ? 118  TYR H O     1 
ATOM   5934  C  CB    . TYR H 4 121 ? -9.918  3.740   19.202 1.00 87.67  ? 118  TYR H CB    1 
ATOM   5935  C  CG    . TYR H 4 121 ? -9.485  2.734   18.178 1.00 87.47  ? 118  TYR H CG    1 
ATOM   5936  C  CD1   . TYR H 4 121 ? -8.156  2.319   18.109 1.00 86.87  ? 118  TYR H CD1   1 
ATOM   5937  C  CD2   . TYR H 4 121 ? -10.408 2.170   17.296 1.00 86.60  ? 118  TYR H CD2   1 
ATOM   5938  C  CE1   . TYR H 4 121 ? -7.754  1.388   17.176 1.00 86.49  ? 118  TYR H CE1   1 
ATOM   5939  C  CE2   . TYR H 4 121 ? -10.014 1.242   16.356 1.00 86.09  ? 118  TYR H CE2   1 
ATOM   5940  C  CZ    . TYR H 4 121 ? -8.686  0.860   16.305 1.00 86.64  ? 118  TYR H CZ    1 
ATOM   5941  O  OH    . TYR H 4 121 ? -8.285  -0.062  15.383 1.00 87.87  ? 118  TYR H OH    1 
ATOM   5942  N  N     . THR H 4 122 ? -11.717 5.671   17.437 1.00 89.65  ? 119  THR H N     1 
ATOM   5943  C  CA    . THR H 4 122 ? -12.442 6.069   16.229 1.00 90.74  ? 119  THR H CA    1 
ATOM   5944  C  C     . THR H 4 122 ? -11.813 7.330   15.599 1.00 91.87  ? 119  THR H C     1 
ATOM   5945  O  O     . THR H 4 122 ? -11.439 7.332   14.419 1.00 91.81  ? 119  THR H O     1 
ATOM   5946  C  CB    . THR H 4 122 ? -13.955 6.319   16.538 1.00 90.60  ? 119  THR H CB    1 
ATOM   5947  O  OG1   . THR H 4 122 ? -14.660 5.076   16.535 1.00 89.41  ? 119  THR H OG1   1 
ATOM   5948  C  CG2   . THR H 4 122 ? -14.600 7.268   15.517 1.00 90.61  ? 119  THR H CG2   1 
ATOM   5949  N  N     . SER H 4 123 ? -11.683 8.382   16.410 1.00 93.00  ? 120  SER H N     1 
ATOM   5950  C  CA    . SER H 4 123 ? -11.279 9.708   15.943 1.00 94.12  ? 120  SER H CA    1 
ATOM   5951  C  C     . SER H 4 123 ? -9.865  9.767   15.336 1.00 94.83  ? 120  SER H C     1 
ATOM   5952  O  O     . SER H 4 123 ? -9.626  10.517  14.375 1.00 94.99  ? 120  SER H O     1 
ATOM   5953  C  CB    . SER H 4 123 ? -11.400 10.714  17.087 1.00 94.09  ? 120  SER H CB    1 
ATOM   5954  O  OG    . SER H 4 123 ? -10.483 10.404  18.121 1.00 94.38  ? 120  SER H OG    1 
ATOM   5955  N  N     . ALA H 4 124 ? -8.941  8.985   15.900 1.00 95.33  ? 121  ALA H N     1 
ATOM   5956  C  CA    . ALA H 4 124 ? -7.551  8.961   15.433 1.00 95.67  ? 121  ALA H CA    1 
ATOM   5957  C  C     . ALA H 4 124 ? -7.321  7.887   14.367 1.00 95.74  ? 121  ALA H C     1 
ATOM   5958  O  O     . ALA H 4 124 ? -8.258  7.460   13.684 1.00 95.89  ? 121  ALA H O     1 
ATOM   5959  C  CB    . ALA H 4 124 ? -6.592  8.769   16.613 1.00 95.73  ? 121  ALA H CB    1 
ATOM   5960  O  "O5'" . DA  I 5 1   ? -47.035 -51.765 76.572 1.00 153.28 ? -72  DA  I "O5'" 1 
ATOM   5961  C  "C5'" . DA  I 5 1   ? -48.209 -52.017 75.817 1.00 154.51 ? -72  DA  I "C5'" 1 
ATOM   5962  C  "C4'" . DA  I 5 1   ? -49.455 -51.851 76.676 1.00 155.34 ? -72  DA  I "C4'" 1 
ATOM   5963  O  "O4'" . DA  I 5 1   ? -49.476 -50.528 77.281 1.00 155.08 ? -72  DA  I "O4'" 1 
ATOM   5964  C  "C3'" . DA  I 5 1   ? -50.787 -51.982 75.935 1.00 156.17 ? -72  DA  I "C3'" 1 
ATOM   5965  O  "O3'" . DA  I 5 1   ? -51.737 -52.672 76.759 1.00 157.99 ? -72  DA  I "O3'" 1 
ATOM   5966  C  "C2'" . DA  I 5 1   ? -51.177 -50.523 75.721 1.00 155.42 ? -72  DA  I "C2'" 1 
ATOM   5967  C  "C1'" . DA  I 5 1   ? -50.761 -49.976 77.075 1.00 154.39 ? -72  DA  I "C1'" 1 
ATOM   5968  N  N9    . DA  I 5 1   ? -50.710 -48.521 77.143 1.00 154.04 ? -72  DA  I N9    1 
ATOM   5969  C  C8    . DA  I 5 1   ? -49.795 -47.696 76.559 1.00 153.75 ? -72  DA  I C8    1 
ATOM   5970  N  N7    . DA  I 5 1   ? -49.999 -46.423 76.795 1.00 153.60 ? -72  DA  I N7    1 
ATOM   5971  C  C5    . DA  I 5 1   ? -51.135 -46.412 77.589 1.00 153.82 ? -72  DA  I C5    1 
ATOM   5972  C  C6    . DA  I 5 1   ? -51.884 -45.370 78.186 1.00 153.91 ? -72  DA  I C6    1 
ATOM   5973  N  N6    . DA  I 5 1   ? -51.570 -44.081 78.061 1.00 153.93 ? -72  DA  I N6    1 
ATOM   5974  N  N1    . DA  I 5 1   ? -52.973 -45.697 78.921 1.00 153.95 ? -72  DA  I N1    1 
ATOM   5975  C  C2    . DA  I 5 1   ? -53.294 -46.992 79.045 1.00 153.95 ? -72  DA  I C2    1 
ATOM   5976  N  N3    . DA  I 5 1   ? -52.670 -48.058 78.536 1.00 153.99 ? -72  DA  I N3    1 
ATOM   5977  C  C4    . DA  I 5 1   ? -51.589 -47.700 77.812 1.00 153.98 ? -72  DA  I C4    1 
ATOM   5978  P  P     . DT  I 5 2   ? -53.310 -52.753 76.427 1.00 159.74 ? -71  DT  I P     1 
ATOM   5979  O  OP1   . DT  I 5 2   ? -53.790 -54.043 76.968 1.00 159.58 ? -71  DT  I OP1   1 
ATOM   5980  O  OP2   . DT  I 5 2   ? -53.537 -52.437 74.996 1.00 159.84 ? -71  DT  I OP2   1 
ATOM   5981  O  "O5'" . DT  I 5 2   ? -53.949 -51.569 77.297 1.00 160.62 ? -71  DT  I "O5'" 1 
ATOM   5982  C  "C5'" . DT  I 5 2   ? -55.264 -51.711 77.843 1.00 161.80 ? -71  DT  I "C5'" 1 
ATOM   5983  C  "C4'" . DT  I 5 2   ? -56.177 -50.562 77.439 1.00 162.82 ? -71  DT  I "C4'" 1 
ATOM   5984  O  "O4'" . DT  I 5 2   ? -55.395 -49.365 77.175 1.00 163.01 ? -71  DT  I "O4'" 1 
ATOM   5985  C  "C3'" . DT  I 5 2   ? -57.043 -50.800 76.197 1.00 163.28 ? -71  DT  I "C3'" 1 
ATOM   5986  O  "O3'" . DT  I 5 2   ? -58.428 -50.508 76.501 1.00 164.01 ? -71  DT  I "O3'" 1 
ATOM   5987  C  "C2'" . DT  I 5 2   ? -56.442 -49.835 75.176 1.00 163.16 ? -71  DT  I "C2'" 1 
ATOM   5988  C  "C1'" . DT  I 5 2   ? -55.998 -48.700 76.089 1.00 163.15 ? -71  DT  I "C1'" 1 
ATOM   5989  N  N1    . DT  I 5 2   ? -55.023 -47.728 75.496 1.00 163.22 ? -71  DT  I N1    1 
ATOM   5990  C  C2    . DT  I 5 2   ? -55.169 -46.372 75.753 1.00 163.16 ? -71  DT  I C2    1 
ATOM   5991  O  O2    . DT  I 5 2   ? -56.054 -45.890 76.442 1.00 163.13 ? -71  DT  I O2    1 
ATOM   5992  N  N3    . DT  I 5 2   ? -54.219 -45.579 75.158 1.00 163.24 ? -71  DT  I N3    1 
ATOM   5993  C  C4    . DT  I 5 2   ? -53.164 -45.991 74.355 1.00 163.31 ? -71  DT  I C4    1 
ATOM   5994  O  O4    . DT  I 5 2   ? -52.368 -45.190 73.876 1.00 163.33 ? -71  DT  I O4    1 
ATOM   5995  C  C5    . DT  I 5 2   ? -53.067 -47.416 74.126 1.00 163.27 ? -71  DT  I C5    1 
ATOM   5996  C  C7    . DT  I 5 2   ? -51.970 -47.983 73.272 1.00 163.12 ? -71  DT  I C7    1 
ATOM   5997  C  C6    . DT  I 5 2   ? -53.989 -48.203 74.702 1.00 163.30 ? -71  DT  I C6    1 
ATOM   5998  P  P     . DC  I 5 3   ? -59.631 -50.546 75.429 1.00 164.22 ? -70  DC  I P     1 
ATOM   5999  O  OP1   . DC  I 5 3   ? -60.740 -51.320 76.025 1.00 164.02 ? -70  DC  I OP1   1 
ATOM   6000  O  OP2   . DC  I 5 3   ? -59.103 -50.945 74.104 1.00 164.17 ? -70  DC  I OP2   1 
ATOM   6001  O  "O5'" . DC  I 5 3   ? -60.072 -49.006 75.337 1.00 164.85 ? -70  DC  I "O5'" 1 
ATOM   6002  C  "C5'" . DC  I 5 3   ? -60.852 -48.367 76.358 1.00 165.14 ? -70  DC  I "C5'" 1 
ATOM   6003  C  "C4'" . DC  I 5 3   ? -60.854 -46.856 76.182 1.00 165.33 ? -70  DC  I "C4'" 1 
ATOM   6004  O  "O4'" . DC  I 5 3   ? -59.482 -46.376 76.196 1.00 165.22 ? -70  DC  I "O4'" 1 
ATOM   6005  C  "C3'" . DC  I 5 3   ? -61.410 -46.336 74.858 1.00 165.67 ? -70  DC  I "C3'" 1 
ATOM   6006  O  "O3'" . DC  I 5 3   ? -62.839 -46.243 74.857 1.00 166.35 ? -70  DC  I "O3'" 1 
ATOM   6007  C  "C2'" . DC  I 5 3   ? -60.744 -44.967 74.795 1.00 165.33 ? -70  DC  I "C2'" 1 
ATOM   6008  C  "C1'" . DC  I 5 3   ? -59.339 -45.311 75.266 1.00 164.97 ? -70  DC  I "C1'" 1 
ATOM   6009  N  N1    . DC  I 5 3   ? -58.392 -45.672 74.142 1.00 164.68 ? -70  DC  I N1    1 
ATOM   6010  C  C2    . DC  I 5 3   ? -57.705 -44.654 73.465 1.00 164.42 ? -70  DC  I C2    1 
ATOM   6011  O  O2    . DC  I 5 3   ? -57.884 -43.477 73.797 1.00 164.40 ? -70  DC  I O2    1 
ATOM   6012  N  N3    . DC  I 5 3   ? -56.852 -44.993 72.461 1.00 164.38 ? -70  DC  I N3    1 
ATOM   6013  C  C4    . DC  I 5 3   ? -56.679 -46.275 72.119 1.00 164.52 ? -70  DC  I C4    1 
ATOM   6014  N  N4    . DC  I 5 3   ? -55.835 -46.561 71.126 1.00 164.58 ? -70  DC  I N4    1 
ATOM   6015  C  C5    . DC  I 5 3   ? -57.368 -47.328 72.786 1.00 164.45 ? -70  DC  I C5    1 
ATOM   6016  C  C6    . DC  I 5 3   ? -58.199 -46.979 73.775 1.00 164.65 ? -70  DC  I C6    1 
ATOM   6017  P  P     . DG  I 5 4   ? -63.707 -46.468 73.516 1.00 166.66 ? -69  DG  I P     1 
ATOM   6018  O  OP1   . DG  I 5 4   ? -64.574 -47.643 73.753 1.00 166.73 ? -69  DG  I OP1   1 
ATOM   6019  O  OP2   . DG  I 5 4   ? -62.808 -46.466 72.337 1.00 166.51 ? -69  DG  I OP2   1 
ATOM   6020  O  "O5'" . DG  I 5 4   ? -64.650 -45.174 73.433 1.00 165.91 ? -69  DG  I "O5'" 1 
ATOM   6021  C  "C5'" . DG  I 5 4   ? -64.422 -44.028 74.253 1.00 164.98 ? -69  DG  I "C5'" 1 
ATOM   6022  C  "C4'" . DG  I 5 4   ? -63.666 -42.960 73.479 1.00 164.52 ? -69  DG  I "C4'" 1 
ATOM   6023  O  "O4'" . DG  I 5 4   ? -62.328 -43.412 73.129 1.00 164.06 ? -69  DG  I "O4'" 1 
ATOM   6024  C  "C3'" . DG  I 5 4   ? -64.304 -42.499 72.170 1.00 164.42 ? -69  DG  I "C3'" 1 
ATOM   6025  O  "O3'" . DG  I 5 4   ? -64.202 -41.071 72.140 1.00 164.75 ? -69  DG  I "O3'" 1 
ATOM   6026  C  "C2'" . DG  I 5 4   ? -63.423 -43.188 71.124 1.00 163.89 ? -69  DG  I "C2'" 1 
ATOM   6027  C  "C1'" . DG  I 5 4   ? -62.073 -43.005 71.803 1.00 163.17 ? -69  DG  I "C1'" 1 
ATOM   6028  N  N9    . DG  I 5 4   ? -60.967 -43.756 71.212 1.00 162.91 ? -69  DG  I N9    1 
ATOM   6029  C  C8    . DG  I 5 4   ? -60.877 -45.111 71.001 1.00 162.82 ? -69  DG  I C8    1 
ATOM   6030  N  N7    . DG  I 5 4   ? -59.760 -45.487 70.446 1.00 162.86 ? -69  DG  I N7    1 
ATOM   6031  C  C5    . DG  I 5 4   ? -59.062 -44.300 70.271 1.00 162.82 ? -69  DG  I C5    1 
ATOM   6032  C  C6    . DG  I 5 4   ? -57.781 -44.068 69.712 1.00 162.75 ? -69  DG  I C6    1 
ATOM   6033  O  O6    . DG  I 5 4   ? -56.994 -44.904 69.253 1.00 162.72 ? -69  DG  I O6    1 
ATOM   6034  N  N1    . DG  I 5 4   ? -57.437 -42.716 69.723 1.00 162.74 ? -69  DG  I N1    1 
ATOM   6035  C  C2    . DG  I 5 4   ? -58.240 -41.710 70.213 1.00 162.76 ? -69  DG  I C2    1 
ATOM   6036  N  N2    . DG  I 5 4   ? -57.755 -40.464 70.143 1.00 162.82 ? -69  DG  I N2    1 
ATOM   6037  N  N3    . DG  I 5 4   ? -59.441 -41.913 70.738 1.00 162.71 ? -69  DG  I N3    1 
ATOM   6038  C  C4    . DG  I 5 4   ? -59.790 -43.226 70.737 1.00 162.81 ? -69  DG  I C4    1 
ATOM   6039  P  P     . DA  I 5 5   ? -64.673 -40.144 70.916 1.00 165.11 ? -68  DA  I P     1 
ATOM   6040  O  OP1   . DA  I 5 5   ? -66.023 -39.648 71.260 1.00 165.34 ? -68  DA  I OP1   1 
ATOM   6041  O  OP2   . DA  I 5 5   ? -64.465 -40.832 69.620 1.00 164.88 ? -68  DA  I OP2   1 
ATOM   6042  O  "O5'" . DA  I 5 5   ? -63.655 -38.906 71.025 1.00 164.83 ? -68  DA  I "O5'" 1 
ATOM   6043  C  "C5'" . DA  I 5 5   ? -62.235 -39.105 71.102 1.00 164.14 ? -68  DA  I "C5'" 1 
ATOM   6044  C  "C4'" . DA  I 5 5   ? -61.479 -38.374 69.998 1.00 163.59 ? -68  DA  I "C4'" 1 
ATOM   6045  O  "O4'" . DA  I 5 5   ? -60.460 -39.239 69.431 1.00 163.76 ? -68  DA  I "O4'" 1 
ATOM   6046  C  "C3'" . DA  I 5 5   ? -62.330 -37.867 68.836 1.00 162.88 ? -68  DA  I "C3'" 1 
ATOM   6047  O  "O3'" . DA  I 5 5   ? -62.014 -36.515 68.526 1.00 161.67 ? -68  DA  I "O3'" 1 
ATOM   6048  C  "C2'" . DA  I 5 5   ? -62.013 -38.799 67.670 1.00 163.26 ? -68  DA  I "C2'" 1 
ATOM   6049  C  "C1'" . DA  I 5 5   ? -60.720 -39.510 68.067 1.00 163.76 ? -68  DA  I "C1'" 1 
ATOM   6050  N  N9    . DA  I 5 5   ? -60.794 -40.962 67.875 1.00 163.89 ? -68  DA  I N9    1 
ATOM   6051  C  C8    . DA  I 5 5   ? -61.785 -41.798 68.312 1.00 163.98 ? -68  DA  I C8    1 
ATOM   6052  N  N7    . DA  I 5 5   ? -61.609 -43.059 67.998 1.00 164.14 ? -68  DA  I N7    1 
ATOM   6053  C  C5    . DA  I 5 5   ? -60.415 -43.057 67.300 1.00 163.91 ? -68  DA  I C5    1 
ATOM   6054  C  C6    . DA  I 5 5   ? -59.672 -44.092 66.692 1.00 163.80 ? -68  DA  I C6    1 
ATOM   6055  N  N6    . DA  I 5 5   ? -60.052 -45.374 66.701 1.00 163.83 ? -68  DA  I N6    1 
ATOM   6056  N  N1    . DA  I 5 5   ? -58.519 -43.752 66.075 1.00 163.83 ? -68  DA  I N1    1 
ATOM   6057  C  C2    . DA  I 5 5   ? -58.150 -42.464 66.072 1.00 163.93 ? -68  DA  I C2    1 
ATOM   6058  N  N3    . DA  I 5 5   ? -58.758 -41.406 66.606 1.00 163.94 ? -68  DA  I N3    1 
ATOM   6059  C  C4    . DA  I 5 5   ? -59.900 -41.772 67.212 1.00 163.88 ? -68  DA  I C4    1 
ATOM   6060  P  P     . DT  I 5 6   ? -63.150 -35.546 67.940 1.00 160.97 ? -67  DT  I P     1 
ATOM   6061  O  OP1   . DT  I 5 6   ? -63.524 -34.606 69.021 1.00 161.01 ? -67  DT  I OP1   1 
ATOM   6062  O  OP2   . DT  I 5 6   ? -64.189 -36.384 67.293 1.00 160.98 ? -67  DT  I OP2   1 
ATOM   6063  O  "O5'" . DT  I 5 6   ? -62.397 -34.729 66.785 1.00 159.69 ? -67  DT  I "O5'" 1 
ATOM   6064  C  "C5'" . DT  I 5 6   ? -61.848 -35.411 65.656 1.00 157.56 ? -67  DT  I "C5'" 1 
ATOM   6065  C  "C4'" . DT  I 5 6   ? -60.336 -35.486 65.771 1.00 155.84 ? -67  DT  I "C4'" 1 
ATOM   6066  O  "O4'" . DT  I 5 6   ? -59.936 -36.854 66.022 1.00 155.34 ? -67  DT  I "O4'" 1 
ATOM   6067  C  "C3'" . DT  I 5 6   ? -59.592 -35.009 64.535 1.00 154.79 ? -67  DT  I "C3'" 1 
ATOM   6068  O  "O3'" . DT  I 5 6   ? -58.894 -33.801 64.829 1.00 153.59 ? -67  DT  I "O3'" 1 
ATOM   6069  C  "C2'" . DT  I 5 6   ? -58.627 -36.133 64.174 1.00 154.53 ? -67  DT  I "C2'" 1 
ATOM   6070  C  "C1'" . DT  I 5 6   ? -58.861 -37.239 65.191 1.00 154.65 ? -67  DT  I "C1'" 1 
ATOM   6071  N  N1    . DT  I 5 6   ? -59.183 -38.555 64.555 1.00 154.40 ? -67  DT  I N1    1 
ATOM   6072  C  C2    . DT  I 5 6   ? -58.170 -39.369 64.071 1.00 154.48 ? -67  DT  I C2    1 
ATOM   6073  O  O2    . DT  I 5 6   ? -56.984 -39.096 64.115 1.00 154.66 ? -67  DT  I O2    1 
ATOM   6074  N  N3    . DT  I 5 6   ? -58.599 -40.547 63.515 1.00 154.28 ? -67  DT  I N3    1 
ATOM   6075  C  C4    . DT  I 5 6   ? -59.903 -40.991 63.399 1.00 154.50 ? -67  DT  I C4    1 
ATOM   6076  O  O4    . DT  I 5 6   ? -60.168 -42.071 62.879 1.00 154.52 ? -67  DT  I O4    1 
ATOM   6077  C  C5    . DT  I 5 6   ? -60.912 -40.095 63.922 1.00 154.62 ? -67  DT  I C5    1 
ATOM   6078  C  C7    . DT  I 5 6   ? -62.372 -40.445 63.860 1.00 154.64 ? -67  DT  I C7    1 
ATOM   6079  C  C6    . DT  I 5 6   ? -60.506 -38.939 64.462 1.00 154.41 ? -67  DT  I C6    1 
ATOM   6080  P  P     . DG  I 5 7   ? -58.961 -32.555 63.819 1.00 152.88 ? -66  DG  I P     1 
ATOM   6081  O  OP1   . DG  I 5 7   ? -58.286 -31.408 64.467 1.00 152.61 ? -66  DG  I OP1   1 
ATOM   6082  O  OP2   . DG  I 5 7   ? -60.357 -32.382 63.354 1.00 153.20 ? -66  DG  I OP2   1 
ATOM   6083  O  "O5'" . DG  I 5 7   ? -58.117 -33.081 62.563 1.00 152.22 ? -66  DG  I "O5'" 1 
ATOM   6084  C  "C5'" . DG  I 5 7   ? -56.707 -33.262 62.659 1.00 151.01 ? -66  DG  I "C5'" 1 
ATOM   6085  C  "C4'" . DG  I 5 7   ? -56.215 -34.430 61.818 1.00 149.81 ? -66  DG  I "C4'" 1 
ATOM   6086  O  "O4'" . DG  I 5 7   ? -57.084 -35.580 61.967 1.00 149.36 ? -66  DG  I "O4'" 1 
ATOM   6087  C  "C3'" . DG  I 5 7   ? -56.116 -34.169 60.318 1.00 149.23 ? -66  DG  I "C3'" 1 
ATOM   6088  O  "O3'" . DG  I 5 7   ? -54.790 -34.501 59.910 1.00 148.53 ? -66  DG  I "O3'" 1 
ATOM   6089  C  "C2'" . DG  I 5 7   ? -57.173 -35.100 59.723 1.00 149.17 ? -66  DG  I "C2'" 1 
ATOM   6090  C  "C1'" . DG  I 5 7   ? -57.129 -36.241 60.727 1.00 149.04 ? -66  DG  I "C1'" 1 
ATOM   6091  N  N9    . DG  I 5 7   ? -58.279 -37.140 60.705 1.00 148.95 ? -66  DG  I N9    1 
ATOM   6092  C  C8    . DG  I 5 7   ? -59.593 -36.821 60.951 1.00 148.93 ? -66  DG  I C8    1 
ATOM   6093  N  N7    . DG  I 5 7   ? -60.400 -37.840 60.860 1.00 148.86 ? -66  DG  I N7    1 
ATOM   6094  C  C5    . DG  I 5 7   ? -59.568 -38.902 60.533 1.00 148.83 ? -66  DG  I C5    1 
ATOM   6095  C  C6    . DG  I 5 7   ? -59.876 -40.265 60.302 1.00 148.89 ? -66  DG  I C6    1 
ATOM   6096  O  O6    . DG  I 5 7   ? -60.982 -40.816 60.349 1.00 148.79 ? -66  DG  I O6    1 
ATOM   6097  N  N1    . DG  I 5 7   ? -58.742 -41.018 60.000 1.00 148.99 ? -66  DG  I N1    1 
ATOM   6098  C  C2    . DG  I 5 7   ? -57.464 -40.513 59.923 1.00 148.87 ? -66  DG  I C2    1 
ATOM   6099  N  N2    . DG  I 5 7   ? -56.499 -41.392 59.613 1.00 148.88 ? -66  DG  I N2    1 
ATOM   6100  N  N3    . DG  I 5 7   ? -57.162 -39.235 60.134 1.00 148.64 ? -66  DG  I N3    1 
ATOM   6101  C  C4    . DG  I 5 7   ? -58.257 -38.489 60.435 1.00 148.72 ? -66  DG  I C4    1 
ATOM   6102  P  P     . DT  I 5 8   ? -54.286 -34.418 58.393 1.00 148.08 ? -65  DT  I P     1 
ATOM   6103  O  OP1   . DT  I 5 8   ? -52.867 -33.988 58.424 1.00 147.83 ? -65  DT  I OP1   1 
ATOM   6104  O  OP2   . DT  I 5 8   ? -55.271 -33.679 57.570 1.00 147.98 ? -65  DT  I OP2   1 
ATOM   6105  O  "O5'" . DT  I 5 8   ? -54.359 -35.947 57.962 1.00 147.49 ? -65  DT  I "O5'" 1 
ATOM   6106  C  "C5'" . DT  I 5 8   ? -53.438 -36.859 58.534 1.00 147.21 ? -65  DT  I "C5'" 1 
ATOM   6107  C  "C4'" . DT  I 5 8   ? -53.387 -38.112 57.689 1.00 146.79 ? -65  DT  I "C4'" 1 
ATOM   6108  O  "O4'" . DT  I 5 8   ? -54.625 -38.841 57.870 1.00 146.13 ? -65  DT  I "O4'" 1 
ATOM   6109  C  "C3'" . DT  I 5 8   ? -53.224 -37.875 56.191 1.00 146.79 ? -65  DT  I "C3'" 1 
ATOM   6110  O  "O3'" . DT  I 5 8   ? -52.130 -38.684 55.753 1.00 147.80 ? -65  DT  I "O3'" 1 
ATOM   6111  C  "C2'" . DT  I 5 8   ? -54.585 -38.256 55.600 1.00 145.99 ? -65  DT  I "C2'" 1 
ATOM   6112  C  "C1'" . DT  I 5 8   ? -55.133 -39.250 56.620 1.00 144.82 ? -65  DT  I "C1'" 1 
ATOM   6113  N  N1    . DT  I 5 8   ? -56.626 -39.296 56.747 1.00 144.42 ? -65  DT  I N1    1 
ATOM   6114  C  C2    . DT  I 5 8   ? -57.283 -40.510 56.632 1.00 144.01 ? -65  DT  I C2    1 
ATOM   6115  O  O2    . DT  I 5 8   ? -56.727 -41.578 56.427 1.00 143.63 ? -65  DT  I O2    1 
ATOM   6116  N  N3    . DT  I 5 8   ? -58.648 -40.425 56.776 1.00 144.01 ? -65  DT  I N3    1 
ATOM   6117  C  C4    . DT  I 5 8   ? -59.409 -39.292 57.013 1.00 143.92 ? -65  DT  I C4    1 
ATOM   6118  O  O4    . DT  I 5 8   ? -60.630 -39.349 57.119 1.00 143.83 ? -65  DT  I O4    1 
ATOM   6119  C  C5    . DT  I 5 8   ? -58.660 -38.060 57.123 1.00 143.73 ? -65  DT  I C5    1 
ATOM   6120  C  C7    . DT  I 5 8   ? -59.350 -36.753 57.376 1.00 143.83 ? -65  DT  I C7    1 
ATOM   6121  C  C6    . DT  I 5 8   ? -57.328 -38.123 56.989 1.00 144.19 ? -65  DT  I C6    1 
ATOM   6122  P  P     . DA  I 5 9   ? -51.839 -39.044 54.220 1.00 148.84 ? -64  DA  I P     1 
ATOM   6123  O  OP1   . DA  I 5 9   ? -50.393 -39.347 54.119 1.00 148.74 ? -64  DA  I OP1   1 
ATOM   6124  O  OP2   . DA  I 5 9   ? -52.429 -38.002 53.347 1.00 148.72 ? -64  DA  I OP2   1 
ATOM   6125  O  "O5'" . DA  I 5 9   ? -52.671 -40.397 54.020 1.00 149.14 ? -64  DA  I "O5'" 1 
ATOM   6126  C  "C5'" . DA  I 5 9   ? -52.198 -41.613 54.598 1.00 149.88 ? -64  DA  I "C5'" 1 
ATOM   6127  C  "C4'" . DA  I 5 9   ? -53.037 -42.792 54.142 1.00 150.24 ? -64  DA  I "C4'" 1 
ATOM   6128  O  "O4'" . DA  I 5 9   ? -54.434 -42.500 54.390 1.00 150.35 ? -64  DA  I "O4'" 1 
ATOM   6129  C  "C3'" . DA  I 5 9   ? -52.918 -43.153 52.665 1.00 150.46 ? -64  DA  I "C3'" 1 
ATOM   6130  O  "O3'" . DA  I 5 9   ? -52.768 -44.573 52.570 1.00 151.41 ? -64  DA  I "O3'" 1 
ATOM   6131  C  "C2'" . DA  I 5 9   ? -54.207 -42.592 52.061 1.00 150.35 ? -64  DA  I "C2'" 1 
ATOM   6132  C  "C1'" . DA  I 5 9   ? -55.187 -42.727 53.219 1.00 150.20 ? -64  DA  I "C1'" 1 
ATOM   6133  N  N9    . DA  I 5 9   ? -56.288 -41.767 53.209 1.00 150.11 ? -64  DA  I N9    1 
ATOM   6134  C  C8    . DA  I 5 9   ? -56.198 -40.401 53.223 1.00 150.00 ? -64  DA  I C8    1 
ATOM   6135  N  N7    . DA  I 5 9   ? -57.359 -39.791 53.217 1.00 149.78 ? -64  DA  I N7    1 
ATOM   6136  C  C5    . DA  I 5 9   ? -58.273 -40.829 53.204 1.00 149.91 ? -64  DA  I C5    1 
ATOM   6137  C  C6    . DA  I 5 9   ? -59.685 -40.854 53.197 1.00 150.10 ? -64  DA  I C6    1 
ATOM   6138  N  N6    . DA  I 5 9   ? -60.428 -39.743 53.198 1.00 150.02 ? -64  DA  I N6    1 
ATOM   6139  N  N1    . DA  I 5 9   ? -60.302 -42.062 53.182 1.00 150.17 ? -64  DA  I N1    1 
ATOM   6140  C  C2    . DA  I 5 9   ? -59.548 -43.175 53.183 1.00 150.09 ? -64  DA  I C2    1 
ATOM   6141  N  N3    . DA  I 5 9   ? -58.215 -43.275 53.189 1.00 150.02 ? -64  DA  I N3    1 
ATOM   6142  C  C4    . DA  I 5 9   ? -57.633 -42.057 53.202 1.00 149.98 ? -64  DA  I C4    1 
ATOM   6143  P  P     . DT  I 5 10  ? -53.325 -45.490 51.375 1.00 152.76 ? -63  DT  I P     1 
ATOM   6144  O  OP1   . DT  I 5 10  ? -52.359 -46.602 51.194 1.00 152.81 ? -63  DT  I OP1   1 
ATOM   6145  O  OP2   . DT  I 5 10  ? -53.683 -44.639 50.218 1.00 152.71 ? -63  DT  I OP2   1 
ATOM   6146  O  "O5'" . DT  I 5 10  ? -54.687 -46.078 51.986 1.00 153.07 ? -63  DT  I "O5'" 1 
ATOM   6147  C  "C5'" . DT  I 5 10  ? -55.160 -47.382 51.632 1.00 153.14 ? -63  DT  I "C5'" 1 
ATOM   6148  C  "C4'" . DT  I 5 10  ? -56.342 -47.291 50.682 1.00 153.32 ? -63  DT  I "C4'" 1 
ATOM   6149  O  "O4'" . DT  I 5 10  ? -57.136 -46.117 51.002 1.00 153.09 ? -63  DT  I "O4'" 1 
ATOM   6150  C  "C3'" . DT  I 5 10  ? -55.967 -47.170 49.199 1.00 153.61 ? -63  DT  I "C3'" 1 
ATOM   6151  O  "O3'" . DT  I 5 10  ? -56.498 -48.283 48.414 1.00 154.16 ? -63  DT  I "O3'" 1 
ATOM   6152  C  "C2'" . DT  I 5 10  ? -56.486 -45.783 48.810 1.00 153.32 ? -63  DT  I "C2'" 1 
ATOM   6153  C  "C1'" . DT  I 5 10  ? -57.659 -45.663 49.776 1.00 152.83 ? -63  DT  I "C1'" 1 
ATOM   6154  N  N1    . DT  I 5 10  ? -58.298 -44.312 49.873 1.00 152.67 ? -63  DT  I N1    1 
ATOM   6155  C  C2    . DT  I 5 10  ? -59.673 -44.244 50.016 1.00 152.41 ? -63  DT  I C2    1 
ATOM   6156  O  O2    . DT  I 5 10  ? -60.399 -45.219 50.088 1.00 152.35 ? -63  DT  I O2    1 
ATOM   6157  N  N3    . DT  I 5 10  ? -60.176 -42.970 50.086 1.00 152.43 ? -63  DT  I N3    1 
ATOM   6158  C  C4    . DT  I 5 10  ? -59.461 -41.784 50.019 1.00 152.58 ? -63  DT  I C4    1 
ATOM   6159  O  O4    . DT  I 5 10  ? -60.019 -40.691 50.093 1.00 152.66 ? -63  DT  I O4    1 
ATOM   6160  C  C5    . DT  I 5 10  ? -58.030 -41.925 49.863 1.00 152.46 ? -63  DT  I C5    1 
ATOM   6161  C  C7    . DT  I 5 10  ? -57.146 -40.716 49.778 1.00 152.53 ? -63  DT  I C7    1 
ATOM   6162  C  C6    . DT  I 5 10  ? -57.524 -43.166 49.796 1.00 152.52 ? -63  DT  I C6    1 
ATOM   6163  P  P     . DA  I 5 11  ? -57.778 -48.246 47.433 1.00 154.56 ? -62  DA  I P     1 
ATOM   6164  O  OP1   . DA  I 5 11  ? -58.027 -49.634 46.986 1.00 154.75 ? -62  DA  I OP1   1 
ATOM   6165  O  OP2   . DA  I 5 11  ? -57.585 -47.204 46.397 1.00 154.34 ? -62  DA  I OP2   1 
ATOM   6166  O  "O5'" . DA  I 5 11  ? -58.957 -47.784 48.424 1.00 154.72 ? -62  DA  I "O5'" 1 
ATOM   6167  C  "C5'" . DA  I 5 11  ? -60.108 -48.584 48.714 1.00 153.96 ? -62  DA  I "C5'" 1 
ATOM   6168  C  "C4'" . DA  I 5 11  ? -61.311 -48.075 47.934 1.00 153.36 ? -62  DA  I "C4'" 1 
ATOM   6169  O  "O4'" . DA  I 5 11  ? -61.432 -46.631 48.052 1.00 152.71 ? -62  DA  I "O4'" 1 
ATOM   6170  C  "C3'" . DA  I 5 11  ? -61.284 -48.375 46.438 1.00 153.15 ? -62  DA  I "C3'" 1 
ATOM   6171  O  "O3'" . DA  I 5 11  ? -62.602 -48.679 46.003 1.00 153.59 ? -62  DA  I "O3'" 1 
ATOM   6172  C  "C2'" . DA  I 5 11  ? -60.814 -47.054 45.842 1.00 152.70 ? -62  DA  I "C2'" 1 
ATOM   6173  C  "C1'" . DA  I 5 11  ? -61.532 -46.070 46.761 1.00 152.53 ? -62  DA  I "C1'" 1 
ATOM   6174  N  N9    . DA  I 5 11  ? -60.988 -44.713 46.785 1.00 152.55 ? -62  DA  I N9    1 
ATOM   6175  C  C8    . DA  I 5 11  ? -59.688 -44.319 46.592 1.00 152.50 ? -62  DA  I C8    1 
ATOM   6176  N  N7    . DA  I 5 11  ? -59.506 -43.021 46.670 1.00 152.31 ? -62  DA  I N7    1 
ATOM   6177  C  C5    . DA  I 5 11  ? -60.774 -42.522 46.930 1.00 152.51 ? -62  DA  I C5    1 
ATOM   6178  C  C6    . DA  I 5 11  ? -61.271 -41.210 47.130 1.00 152.50 ? -62  DA  I C6    1 
ATOM   6179  N  N6    . DA  I 5 11  ? -60.501 -40.118 47.092 1.00 152.54 ? -62  DA  I N6    1 
ATOM   6180  N  N1    . DA  I 5 11  ? -62.597 -41.058 47.371 1.00 152.52 ? -62  DA  I N1    1 
ATOM   6181  C  C2    . DA  I 5 11  ? -63.377 -42.150 47.409 1.00 152.54 ? -62  DA  I C2    1 
ATOM   6182  N  N3    . DA  I 5 11  ? -63.025 -43.431 47.241 1.00 152.64 ? -62  DA  I N3    1 
ATOM   6183  C  C4    . DA  I 5 11  ? -61.701 -43.554 47.004 1.00 152.66 ? -62  DA  I C4    1 
ATOM   6184  P  P     . DT  I 5 12  ? -63.043 -50.124 45.466 1.00 153.42 ? -61  DT  I P     1 
ATOM   6185  O  OP1   . DT  I 5 12  ? -63.424 -50.956 46.632 1.00 153.01 ? -61  DT  I OP1   1 
ATOM   6186  O  OP2   . DT  I 5 12  ? -62.013 -50.605 44.515 1.00 153.35 ? -61  DT  I OP2   1 
ATOM   6187  O  "O5'" . DT  I 5 12  ? -64.358 -49.759 44.621 1.00 153.45 ? -61  DT  I "O5'" 1 
ATOM   6188  C  "C5'" . DT  I 5 12  ? -65.319 -48.806 45.106 1.00 153.18 ? -61  DT  I "C5'" 1 
ATOM   6189  C  "C4'" . DT  I 5 12  ? -65.544 -47.642 44.144 1.00 153.04 ? -61  DT  I "C4'" 1 
ATOM   6190  O  "O4'" . DT  I 5 12  ? -64.495 -46.645 44.300 1.00 152.53 ? -61  DT  I "O4'" 1 
ATOM   6191  C  "C3'" . DT  I 5 12  ? -65.599 -47.983 42.650 1.00 153.26 ? -61  DT  I "C3'" 1 
ATOM   6192  O  "O3'" . DT  I 5 12  ? -66.808 -47.449 42.081 1.00 153.80 ? -61  DT  I "O3'" 1 
ATOM   6193  C  "C2'" . DT  I 5 12  ? -64.339 -47.315 42.092 1.00 152.77 ? -61  DT  I "C2'" 1 
ATOM   6194  C  "C1'" . DT  I 5 12  ? -64.207 -46.114 43.023 1.00 152.03 ? -61  DT  I "C1'" 1 
ATOM   6195  N  N1    . DT  I 5 12  ? -62.871 -45.402 43.040 1.00 151.94 ? -61  DT  I N1    1 
ATOM   6196  C  C2    . DT  I 5 12  ? -62.829 -44.069 43.427 1.00 151.75 ? -61  DT  I C2    1 
ATOM   6197  O  O2    . DT  I 5 12  ? -63.816 -43.431 43.757 1.00 151.52 ? -61  DT  I O2    1 
ATOM   6198  N  N3    . DT  I 5 12  ? -61.570 -43.501 43.413 1.00 151.68 ? -61  DT  I N3    1 
ATOM   6199  C  C4    . DT  I 5 12  ? -60.374 -44.114 43.060 1.00 151.72 ? -61  DT  I C4    1 
ATOM   6200  O  O4    . DT  I 5 12  ? -59.306 -43.511 43.084 1.00 151.53 ? -61  DT  I O4    1 
ATOM   6201  C  C5    . DT  I 5 12  ? -60.481 -45.504 42.664 1.00 151.84 ? -61  DT  I C5    1 
ATOM   6202  C  C7    . DT  I 5 12  ? -59.262 -46.286 42.259 1.00 151.70 ? -61  DT  I C7    1 
ATOM   6203  C  C6    . DT  I 5 12  ? -61.705 -46.068 42.672 1.00 152.09 ? -61  DT  I C6    1 
ATOM   6204  P  P     . DA  I 5 13  ? -67.378 -47.864 40.634 1.00 153.81 ? -60  DA  I P     1 
ATOM   6205  O  OP1   . DA  I 5 13  ? -67.566 -49.334 40.630 1.00 153.50 ? -60  DA  I OP1   1 
ATOM   6206  O  OP2   . DA  I 5 13  ? -66.542 -47.235 39.583 1.00 153.76 ? -60  DA  I OP2   1 
ATOM   6207  O  "O5'" . DA  I 5 13  ? -68.802 -47.120 40.600 1.00 153.81 ? -60  DA  I "O5'" 1 
ATOM   6208  C  "C5'" . DA  I 5 13  ? -69.170 -46.155 41.598 1.00 154.13 ? -60  DA  I "C5'" 1 
ATOM   6209  C  "C4'" . DA  I 5 13  ? -69.044 -44.711 41.127 1.00 154.75 ? -60  DA  I "C4'" 1 
ATOM   6210  O  "O4'" . DA  I 5 13  ? -67.736 -44.179 41.477 1.00 154.77 ? -60  DA  I "O4'" 1 
ATOM   6211  C  "C3'" . DA  I 5 13  ? -69.231 -44.444 39.628 1.00 155.38 ? -60  DA  I "C3'" 1 
ATOM   6212  O  "O3'" . DA  I 5 13  ? -70.349 -43.561 39.412 1.00 156.29 ? -60  DA  I "O3'" 1 
ATOM   6213  C  "C2'" . DA  I 5 13  ? -67.908 -43.803 39.223 1.00 155.25 ? -60  DA  I "C2'" 1 
ATOM   6214  C  "C1'" . DA  I 5 13  ? -67.429 -43.184 40.526 1.00 154.94 ? -60  DA  I "C1'" 1 
ATOM   6215  N  N9    . DA  I 5 13  ? -65.997 -42.889 40.475 1.00 154.99 ? -60  DA  I N9    1 
ATOM   6216  C  C8    . DA  I 5 13  ? -64.982 -43.801 40.380 1.00 155.04 ? -60  DA  I C8    1 
ATOM   6217  N  N7    . DA  I 5 13  ? -63.784 -43.265 40.327 1.00 155.32 ? -60  DA  I N7    1 
ATOM   6218  C  C5    . DA  I 5 13  ? -64.019 -41.901 40.385 1.00 155.09 ? -60  DA  I C5    1 
ATOM   6219  C  C6    . DA  I 5 13  ? -63.151 -40.782 40.372 1.00 154.81 ? -60  DA  I C6    1 
ATOM   6220  N  N6    . DA  I 5 13  ? -61.822 -40.889 40.296 1.00 154.81 ? -60  DA  I N6    1 
ATOM   6221  N  N1    . DA  I 5 13  ? -63.702 -39.547 40.442 1.00 154.80 ? -60  DA  I N1    1 
ATOM   6222  C  C2    . DA  I 5 13  ? -65.039 -39.447 40.521 1.00 155.05 ? -60  DA  I C2    1 
ATOM   6223  N  N3    . DA  I 5 13  ? -65.956 -40.426 40.539 1.00 155.11 ? -60  DA  I N3    1 
ATOM   6224  C  C4    . DA  I 5 13  ? -65.382 -41.647 40.470 1.00 155.15 ? -60  DA  I C4    1 
ATOM   6225  P  P     . DT  I 5 14  ? -70.608 -42.695 38.077 1.00 156.48 ? -59  DT  I P     1 
ATOM   6226  O  OP1   . DT  I 5 14  ? -72.056 -42.779 37.789 1.00 156.55 ? -59  DT  I OP1   1 
ATOM   6227  O  OP2   . DT  I 5 14  ? -69.640 -43.073 37.019 1.00 156.30 ? -59  DT  I OP2   1 
ATOM   6228  O  "O5'" . DT  I 5 14  ? -70.276 -41.205 38.567 1.00 156.94 ? -59  DT  I "O5'" 1 
ATOM   6229  C  "C5'" . DT  I 5 14  ? -70.749 -40.066 37.842 1.00 157.66 ? -59  DT  I "C5'" 1 
ATOM   6230  C  "C4'" . DT  I 5 14  ? -69.607 -39.164 37.394 1.00 158.29 ? -59  DT  I "C4'" 1 
ATOM   6231  O  "O4'" . DT  I 5 14  ? -68.318 -39.731 37.755 1.00 158.56 ? -59  DT  I "O4'" 1 
ATOM   6232  C  "C3'" . DT  I 5 14  ? -69.531 -38.880 35.890 1.00 158.60 ? -59  DT  I "C3'" 1 
ATOM   6233  O  "O3'" . DT  I 5 14  ? -69.155 -37.523 35.576 1.00 159.36 ? -59  DT  I "O3'" 1 
ATOM   6234  C  "C2'" . DT  I 5 14  ? -68.420 -39.826 35.447 1.00 158.59 ? -59  DT  I "C2'" 1 
ATOM   6235  C  "C1'" . DT  I 5 14  ? -67.471 -39.627 36.628 1.00 158.91 ? -59  DT  I "C1'" 1 
ATOM   6236  N  N1    . DT  I 5 14  ? -66.283 -40.570 36.745 1.00 158.92 ? -59  DT  I N1    1 
ATOM   6237  C  C2    . DT  I 5 14  ? -65.039 -40.054 37.083 1.00 158.76 ? -59  DT  I C2    1 
ATOM   6238  O  O2    . DT  I 5 14  ? -64.819 -38.875 37.302 1.00 158.72 ? -59  DT  I O2    1 
ATOM   6239  N  N3    . DT  I 5 14  ? -64.030 -40.985 37.162 1.00 158.92 ? -59  DT  I N3    1 
ATOM   6240  C  C4    . DT  I 5 14  ? -64.123 -42.352 36.942 1.00 159.09 ? -59  DT  I C4    1 
ATOM   6241  O  O4    . DT  I 5 14  ? -63.145 -43.092 37.043 1.00 159.01 ? -59  DT  I O4    1 
ATOM   6242  C  C5    . DT  I 5 14  ? -65.446 -42.832 36.592 1.00 159.12 ? -59  DT  I C5    1 
ATOM   6243  C  C7    . DT  I 5 14  ? -65.686 -44.295 36.326 1.00 159.03 ? -59  DT  I C7    1 
ATOM   6244  C  C6    . DT  I 5 14  ? -66.443 -41.930 36.512 1.00 159.10 ? -59  DT  I C6    1 
ATOM   6245  P  P     . DC  I 5 15  ? -69.464 -36.222 36.476 1.00 160.09 ? -58  DC  I P     1 
ATOM   6246  O  OP1   . DC  I 5 15  ? -68.520 -36.217 37.622 1.00 159.83 ? -58  DC  I OP1   1 
ATOM   6247  O  OP2   . DC  I 5 15  ? -70.925 -36.156 36.725 1.00 159.96 ? -58  DC  I OP2   1 
ATOM   6248  O  "O5'" . DC  I 5 15  ? -69.098 -35.030 35.455 1.00 160.02 ? -58  DC  I "O5'" 1 
ATOM   6249  C  "C5'" . DC  I 5 15  ? -68.162 -33.979 35.763 1.00 159.69 ? -58  DC  I "C5'" 1 
ATOM   6250  C  "C4'" . DC  I 5 15  ? -66.894 -34.021 34.907 1.00 159.32 ? -58  DC  I "C4'" 1 
ATOM   6251  O  "O4'" . DC  I 5 15  ? -66.171 -35.271 35.043 1.00 159.37 ? -58  DC  I "O4'" 1 
ATOM   6252  C  "C3'" . DC  I 5 15  ? -67.052 -33.807 33.397 1.00 158.88 ? -58  DC  I "C3'" 1 
ATOM   6253  O  "O3'" . DC  I 5 15  ? -66.099 -32.842 32.984 1.00 158.30 ? -58  DC  I "O3'" 1 
ATOM   6254  C  "C2'" . DC  I 5 15  ? -66.693 -35.165 32.807 1.00 158.88 ? -58  DC  I "C2'" 1 
ATOM   6255  C  "C1'" . DC  I 5 15  ? -65.574 -35.496 33.785 1.00 159.28 ? -58  DC  I "C1'" 1 
ATOM   6256  N  N1    . DC  I 5 15  ? -64.989 -36.868 33.732 1.00 159.55 ? -58  DC  I N1    1 
ATOM   6257  C  C2    . DC  I 5 15  ? -63.590 -36.996 33.684 1.00 159.72 ? -58  DC  I C2    1 
ATOM   6258  O  O2    . DC  I 5 15  ? -62.882 -35.975 33.683 1.00 159.80 ? -58  DC  I O2    1 
ATOM   6259  N  N3    . DC  I 5 15  ? -63.046 -38.245 33.639 1.00 159.63 ? -58  DC  I N3    1 
ATOM   6260  C  C4    . DC  I 5 15  ? -63.838 -39.323 33.644 1.00 159.47 ? -58  DC  I C4    1 
ATOM   6261  N  N4    . DC  I 5 15  ? -63.257 -40.526 33.601 1.00 159.46 ? -58  DC  I N4    1 
ATOM   6262  C  C5    . DC  I 5 15  ? -65.262 -39.213 33.693 1.00 159.70 ? -58  DC  I C5    1 
ATOM   6263  C  C6    . DC  I 5 15  ? -65.790 -37.979 33.739 1.00 159.78 ? -58  DC  I C6    1 
ATOM   6264  P  P     . DT  I 5 16  ? -66.501 -31.298 32.877 1.00 158.12 ? -57  DT  I P     1 
ATOM   6265  O  OP1   . DT  I 5 16  ? -67.122 -30.868 34.153 1.00 157.95 ? -57  DT  I OP1   1 
ATOM   6266  O  OP2   . DT  I 5 16  ? -67.222 -31.146 31.591 1.00 157.91 ? -57  DT  I OP2   1 
ATOM   6267  O  "O5'" . DT  I 5 16  ? -65.102 -30.536 32.745 1.00 157.20 ? -57  DT  I "O5'" 1 
ATOM   6268  C  "C5'" . DT  I 5 16  ? -63.949 -30.950 33.465 1.00 155.63 ? -57  DT  I "C5'" 1 
ATOM   6269  C  "C4'" . DT  I 5 16  ? -62.807 -31.237 32.507 1.00 154.35 ? -57  DT  I "C4'" 1 
ATOM   6270  O  "O4'" . DT  I 5 16  ? -62.630 -32.665 32.379 1.00 154.00 ? -57  DT  I "O4'" 1 
ATOM   6271  C  "C3'" . DT  I 5 16  ? -62.994 -30.712 31.080 1.00 153.58 ? -57  DT  I "C3'" 1 
ATOM   6272  O  "O3'" . DT  I 5 16  ? -61.828 -30.010 30.672 1.00 152.67 ? -57  DT  I "O3'" 1 
ATOM   6273  C  "C2'" . DT  I 5 16  ? -63.201 -31.971 30.250 1.00 153.63 ? -57  DT  I "C2'" 1 
ATOM   6274  C  "C1'" . DT  I 5 16  ? -62.282 -32.893 31.035 1.00 154.23 ? -57  DT  I "C1'" 1 
ATOM   6275  N  N1    . DT  I 5 16  ? -62.428 -34.333 30.784 1.00 154.31 ? -57  DT  I N1    1 
ATOM   6276  C  C2    . DT  I 5 16  ? -61.338 -35.148 31.028 1.00 154.50 ? -57  DT  I C2    1 
ATOM   6277  O  O2    . DT  I 5 16  ? -60.257 -34.747 31.432 1.00 154.45 ? -57  DT  I O2    1 
ATOM   6278  N  N3    . DT  I 5 16  ? -61.565 -36.478 30.772 1.00 154.62 ? -57  DT  I N3    1 
ATOM   6279  C  C4    . DT  I 5 16  ? -62.743 -37.054 30.315 1.00 154.57 ? -57  DT  I C4    1 
ATOM   6280  O  O4    . DT  I 5 16  ? -62.823 -38.265 30.125 1.00 154.60 ? -57  DT  I O4    1 
ATOM   6281  C  C5    . DT  I 5 16  ? -63.845 -36.137 30.082 1.00 154.56 ? -57  DT  I C5    1 
ATOM   6282  C  C7    . DT  I 5 16  ? -65.180 -36.621 29.584 1.00 154.41 ? -57  DT  I C7    1 
ATOM   6283  C  C6    . DT  I 5 16  ? -63.634 -34.835 30.329 1.00 154.40 ? -57  DT  I C6    1 
ATOM   6284  P  P     . DG  I 5 17  ? -61.765 -28.420 30.832 1.00 152.16 ? -56  DG  I P     1 
ATOM   6285  O  OP1   . DG  I 5 17  ? -61.913 -28.096 32.274 1.00 152.04 ? -56  DG  I OP1   1 
ATOM   6286  O  OP2   . DG  I 5 17  ? -62.705 -27.841 29.846 1.00 152.18 ? -56  DG  I OP2   1 
ATOM   6287  O  "O5'" . DG  I 5 17  ? -60.285 -28.049 30.348 1.00 150.86 ? -56  DG  I "O5'" 1 
ATOM   6288  C  "C5'" . DG  I 5 17  ? -59.203 -28.075 31.272 1.00 148.98 ? -56  DG  I "C5'" 1 
ATOM   6289  C  "C4'" . DG  I 5 17  ? -58.186 -29.123 30.863 1.00 147.50 ? -56  DG  I "C4'" 1 
ATOM   6290  O  "O4'" . DG  I 5 17  ? -58.855 -30.361 30.503 1.00 147.17 ? -56  DG  I "O4'" 1 
ATOM   6291  C  "C3'" . DG  I 5 17  ? -57.343 -28.713 29.663 1.00 146.59 ? -56  DG  I "C3'" 1 
ATOM   6292  O  "O3'" . DG  I 5 17  ? -55.990 -29.022 29.900 1.00 145.07 ? -56  DG  I "O3'" 1 
ATOM   6293  C  "C2'" . DG  I 5 17  ? -57.881 -29.556 28.515 1.00 146.87 ? -56  DG  I "C2'" 1 
ATOM   6294  C  "C1'" . DG  I 5 17  ? -58.398 -30.794 29.239 1.00 146.90 ? -56  DG  I "C1'" 1 
ATOM   6295  N  N9    . DG  I 5 17  ? -59.498 -31.423 28.521 1.00 146.80 ? -56  DG  I N9    1 
ATOM   6296  C  C8    . DG  I 5 17  ? -60.550 -30.784 27.909 1.00 146.86 ? -56  DG  I C8    1 
ATOM   6297  N  N7    . DG  I 5 17  ? -61.388 -31.596 27.333 1.00 147.01 ? -56  DG  I N7    1 
ATOM   6298  C  C5    . DG  I 5 17  ? -60.857 -32.854 27.578 1.00 146.88 ? -56  DG  I C5    1 
ATOM   6299  C  C6    . DG  I 5 17  ? -61.331 -34.130 27.194 1.00 146.88 ? -56  DG  I C6    1 
ATOM   6300  O  O6    . DG  I 5 17  ? -62.350 -34.397 26.545 1.00 146.92 ? -56  DG  I O6    1 
ATOM   6301  N  N1    . DG  I 5 17  ? -60.499 -35.156 27.641 1.00 146.87 ? -56  DG  I N1    1 
ATOM   6302  C  C2    . DG  I 5 17  ? -59.349 -34.966 28.369 1.00 146.78 ? -56  DG  I C2    1 
ATOM   6303  N  N2    . DG  I 5 17  ? -58.676 -36.069 28.715 1.00 146.79 ? -56  DG  I N2    1 
ATOM   6304  N  N3    . DG  I 5 17  ? -58.893 -33.773 28.733 1.00 146.79 ? -56  DG  I N3    1 
ATOM   6305  C  C4    . DG  I 5 17  ? -59.692 -32.765 28.306 1.00 146.71 ? -56  DG  I C4    1 
ATOM   6306  P  P     . DA  I 5 18  ? -54.848 -28.042 29.378 1.00 143.61 ? -55  DA  I P     1 
ATOM   6307  O  OP1   . DA  I 5 18  ? -54.523 -27.142 30.507 1.00 143.68 ? -55  DA  I OP1   1 
ATOM   6308  O  OP2   . DA  I 5 18  ? -55.251 -27.470 28.073 1.00 143.62 ? -55  DA  I OP2   1 
ATOM   6309  O  "O5'" . DA  I 5 18  ? -53.634 -29.048 29.105 1.00 142.82 ? -55  DA  I "O5'" 1 
ATOM   6310  C  "C5'" . DA  I 5 18  ? -53.135 -29.886 30.149 1.00 142.09 ? -55  DA  I "C5'" 1 
ATOM   6311  C  "C4'" . DA  I 5 18  ? -52.747 -31.269 29.637 1.00 141.51 ? -55  DA  I "C4'" 1 
ATOM   6312  O  "O4'" . DA  I 5 18  ? -53.858 -31.867 28.933 1.00 141.55 ? -55  DA  I "O4'" 1 
ATOM   6313  C  "C3'" . DA  I 5 18  ? -51.598 -31.337 28.640 1.00 141.15 ? -55  DA  I "C3'" 1 
ATOM   6314  O  "O3'" . DA  I 5 18  ? -51.008 -32.627 28.728 1.00 140.14 ? -55  DA  I "O3'" 1 
ATOM   6315  C  "C2'" . DA  I 5 18  ? -52.313 -31.173 27.306 1.00 141.49 ? -55  DA  I "C2'" 1 
ATOM   6316  C  "C1'" . DA  I 5 18  ? -53.512 -32.071 27.579 1.00 142.08 ? -55  DA  I "C1'" 1 
ATOM   6317  N  N9    . DA  I 5 18  ? -54.712 -31.791 26.812 1.00 142.28 ? -55  DA  I N9    1 
ATOM   6318  C  C8    . DA  I 5 18  ? -55.165 -30.591 26.333 1.00 142.44 ? -55  DA  I C8    1 
ATOM   6319  N  N7    . DA  I 5 18  ? -56.303 -30.681 25.686 1.00 142.49 ? -55  DA  I N7    1 
ATOM   6320  C  C5    . DA  I 5 18  ? -56.614 -32.032 25.759 1.00 142.67 ? -55  DA  I C5    1 
ATOM   6321  C  C6    . DA  I 5 18  ? -57.696 -32.798 25.270 1.00 142.52 ? -55  DA  I C6    1 
ATOM   6322  N  N6    . DA  I 5 18  ? -58.710 -32.273 24.579 1.00 142.39 ? -55  DA  I N6    1 
ATOM   6323  N  N1    . DA  I 5 18  ? -57.695 -34.130 25.519 1.00 142.52 ? -55  DA  I N1    1 
ATOM   6324  C  C2    . DA  I 5 18  ? -56.675 -34.663 26.212 1.00 142.47 ? -55  DA  I C2    1 
ATOM   6325  N  N3    . DA  I 5 18  ? -55.605 -34.048 26.720 1.00 142.24 ? -55  DA  I N3    1 
ATOM   6326  C  C4    . DA  I 5 18  ? -55.641 -32.728 26.455 1.00 142.40 ? -55  DA  I C4    1 
ATOM   6327  P  P     . DC  I 5 19  ? -49.464 -32.845 28.403 1.00 139.54 ? -54  DC  I P     1 
ATOM   6328  O  OP1   . DC  I 5 19  ? -48.757 -32.845 29.702 1.00 139.85 ? -54  DC  I OP1   1 
ATOM   6329  O  OP2   . DC  I 5 19  ? -49.073 -31.917 27.317 1.00 139.38 ? -54  DC  I OP2   1 
ATOM   6330  O  "O5'" . DC  I 5 19  ? -49.389 -34.312 27.790 1.00 139.77 ? -54  DC  I "O5'" 1 
ATOM   6331  C  "C5'" . DC  I 5 19  ? -49.937 -35.407 28.489 1.00 140.28 ? -54  DC  I "C5'" 1 
ATOM   6332  C  "C4'" . DC  I 5 19  ? -50.618 -36.348 27.519 1.00 140.78 ? -54  DC  I "C4'" 1 
ATOM   6333  O  "O4'" . DC  I 5 19  ? -51.696 -35.660 26.838 1.00 141.08 ? -54  DC  I "O4'" 1 
ATOM   6334  C  "C3'" . DC  I 5 19  ? -49.696 -36.912 26.446 1.00 141.10 ? -54  DC  I "C3'" 1 
ATOM   6335  O  "O3'" . DC  I 5 19  ? -49.781 -38.335 26.486 1.00 141.93 ? -54  DC  I "O3'" 1 
ATOM   6336  C  "C2'" . DC  I 5 19  ? -50.212 -36.309 25.137 1.00 141.09 ? -54  DC  I "C2'" 1 
ATOM   6337  C  "C1'" . DC  I 5 19  ? -51.659 -35.932 25.452 1.00 141.58 ? -54  DC  I "C1'" 1 
ATOM   6338  N  N1    . DC  I 5 19  ? -52.201 -34.714 24.736 1.00 141.91 ? -54  DC  I N1    1 
ATOM   6339  C  C2    . DC  I 5 19  ? -53.525 -34.686 24.224 1.00 142.09 ? -54  DC  I C2    1 
ATOM   6340  O  O2    . DC  I 5 19  ? -54.276 -35.668 24.337 1.00 141.81 ? -54  DC  I O2    1 
ATOM   6341  N  N3    . DC  I 5 19  ? -53.963 -33.559 23.597 1.00 141.93 ? -54  DC  I N3    1 
ATOM   6342  C  C4    . DC  I 5 19  ? -53.155 -32.498 23.477 1.00 141.90 ? -54  DC  I C4    1 
ATOM   6343  N  N4    . DC  I 5 19  ? -53.628 -31.414 22.855 1.00 141.81 ? -54  DC  I N4    1 
ATOM   6344  C  C5    . DC  I 5 19  ? -51.821 -32.499 23.989 1.00 141.97 ? -54  DC  I C5    1 
ATOM   6345  C  C6    . DC  I 5 19  ? -51.395 -33.611 24.604 1.00 141.92 ? -54  DC  I C6    1 
ATOM   6346  P  P     . DA  I 5 20  ? -48.466 -39.243 26.615 1.00 142.27 ? -53  DA  I P     1 
ATOM   6347  O  OP1   . DA  I 5 20  ? -48.639 -40.240 27.697 1.00 141.90 ? -53  DA  I OP1   1 
ATOM   6348  O  OP2   . DA  I 5 20  ? -47.314 -38.319 26.618 1.00 142.01 ? -53  DA  I OP2   1 
ATOM   6349  O  "O5'" . DA  I 5 20  ? -48.481 -40.046 25.236 1.00 143.00 ? -53  DA  I "O5'" 1 
ATOM   6350  C  "C5'" . DA  I 5 20  ? -49.688 -40.694 24.826 1.00 143.48 ? -53  DA  I "C5'" 1 
ATOM   6351  C  "C4'" . DA  I 5 20  ? -50.041 -40.354 23.388 1.00 143.72 ? -53  DA  I "C4'" 1 
ATOM   6352  O  "O4'" . DA  I 5 20  ? -50.530 -38.999 23.267 1.00 143.44 ? -53  DA  I "O4'" 1 
ATOM   6353  C  "C3'" . DA  I 5 20  ? -48.886 -40.452 22.402 1.00 143.94 ? -53  DA  I "C3'" 1 
ATOM   6354  O  "O3'" . DA  I 5 20  ? -48.789 -41.834 22.010 1.00 144.97 ? -53  DA  I "O3'" 1 
ATOM   6355  C  "C2'" . DA  I 5 20  ? -49.320 -39.491 21.295 1.00 143.74 ? -53  DA  I "C2'" 1 
ATOM   6356  C  "C1'" . DA  I 5 20  ? -50.452 -38.661 21.901 1.00 143.70 ? -53  DA  I "C1'" 1 
ATOM   6357  N  N9    . DA  I 5 20  ? -50.214 -37.227 21.756 1.00 143.81 ? -53  DA  I N9    1 
ATOM   6358  C  C8    . DA  I 5 20  ? -49.053 -36.560 22.047 1.00 143.93 ? -53  DA  I C8    1 
ATOM   6359  N  N7    . DA  I 5 20  ? -49.101 -35.271 21.816 1.00 144.11 ? -53  DA  I N7    1 
ATOM   6360  C  C5    . DA  I 5 20  ? -50.382 -35.076 21.329 1.00 144.16 ? -53  DA  I C5    1 
ATOM   6361  C  C6    . DA  I 5 20  ? -51.058 -33.917 20.890 1.00 143.99 ? -53  DA  I C6    1 
ATOM   6362  N  N6    . DA  I 5 20  ? -50.492 -32.703 20.887 1.00 143.67 ? -53  DA  I N6    1 
ATOM   6363  N  N1    . DA  I 5 20  ? -52.336 -34.062 20.461 1.00 143.88 ? -53  DA  I N1    1 
ATOM   6364  C  C2    . DA  I 5 20  ? -52.892 -35.284 20.469 1.00 143.72 ? -53  DA  I C2    1 
ATOM   6365  N  N3    . DA  I 5 20  ? -52.356 -36.444 20.857 1.00 143.56 ? -53  DA  I N3    1 
ATOM   6366  C  C4    . DA  I 5 20  ? -51.087 -36.273 21.280 1.00 143.94 ? -53  DA  I C4    1 
ATOM   6367  P  P     . DC  I 5 21  ? -48.331 -42.406 20.578 1.00 145.93 ? -52  DC  I P     1 
ATOM   6368  O  OP1   . DC  I 5 21  ? -47.522 -43.613 20.853 1.00 145.66 ? -52  DC  I OP1   1 
ATOM   6369  O  OP2   . DC  I 5 21  ? -47.711 -41.326 19.775 1.00 145.98 ? -52  DC  I OP2   1 
ATOM   6370  O  "O5'" . DC  I 5 21  ? -49.708 -42.875 19.882 1.00 146.19 ? -52  DC  I "O5'" 1 
ATOM   6371  C  "C5'" . DC  I 5 21  ? -50.970 -42.176 19.997 1.00 146.69 ? -52  DC  I "C5'" 1 
ATOM   6372  C  "C4'" . DC  I 5 21  ? -51.470 -41.578 18.681 1.00 147.21 ? -52  DC  I "C4'" 1 
ATOM   6373  O  "O4'" . DC  I 5 21  ? -51.485 -40.125 18.753 1.00 147.14 ? -52  DC  I "O4'" 1 
ATOM   6374  C  "C3'" . DC  I 5 21  ? -50.663 -41.915 17.423 1.00 147.71 ? -52  DC  I "C3'" 1 
ATOM   6375  O  "O3'" . DC  I 5 21  ? -51.522 -42.187 16.311 1.00 148.30 ? -52  DC  I "O3'" 1 
ATOM   6376  C  "C2'" . DC  I 5 21  ? -49.855 -40.647 17.180 1.00 147.56 ? -52  DC  I "C2'" 1 
ATOM   6377  C  "C1'" . DC  I 5 21  ? -50.898 -39.610 17.571 1.00 147.22 ? -52  DC  I "C1'" 1 
ATOM   6378  N  N1    . DC  I 5 21  ? -50.362 -38.231 17.803 1.00 147.06 ? -52  DC  I N1    1 
ATOM   6379  C  C2    . DC  I 5 21  ? -51.248 -37.148 17.791 1.00 147.16 ? -52  DC  I C2    1 
ATOM   6380  O  O2    . DC  I 5 21  ? -52.454 -37.344 17.591 1.00 147.26 ? -52  DC  I O2    1 
ATOM   6381  N  N3    . DC  I 5 21  ? -50.758 -35.898 18.002 1.00 147.24 ? -52  DC  I N3    1 
ATOM   6382  C  C4    . DC  I 5 21  ? -49.454 -35.706 18.212 1.00 147.18 ? -52  DC  I C4    1 
ATOM   6383  N  N4    . DC  I 5 21  ? -49.032 -34.453 18.414 1.00 147.23 ? -52  DC  I N4    1 
ATOM   6384  C  C5    . DC  I 5 21  ? -48.532 -36.797 18.230 1.00 147.12 ? -52  DC  I C5    1 
ATOM   6385  C  C6    . DC  I 5 21  ? -49.025 -38.024 18.021 1.00 146.93 ? -52  DC  I C6    1 
ATOM   6386  P  P     . DG  I 5 22  ? -50.966 -42.937 15.005 1.00 148.54 ? -51  DG  I P     1 
ATOM   6387  O  OP1   . DG  I 5 22  ? -51.792 -44.157 14.846 1.00 148.07 ? -51  DG  I OP1   1 
ATOM   6388  O  OP2   . DG  I 5 22  ? -49.488 -43.040 15.082 1.00 148.11 ? -51  DG  I OP2   1 
ATOM   6389  O  "O5'" . DG  I 5 22  ? -51.278 -41.905 13.825 1.00 148.97 ? -51  DG  I "O5'" 1 
ATOM   6390  C  "C5'" . DG  I 5 22  ? -52.615 -41.669 13.408 1.00 149.97 ? -51  DG  I "C5'" 1 
ATOM   6391  C  "C4'" . DG  I 5 22  ? -52.698 -40.426 12.538 1.00 150.58 ? -51  DG  I "C4'" 1 
ATOM   6392  O  "O4'" . DG  I 5 22  ? -52.106 -39.296 13.226 1.00 150.46 ? -51  DG  I "O4'" 1 
ATOM   6393  C  "C3'" . DG  I 5 22  ? -52.008 -40.529 11.178 1.00 150.88 ? -51  DG  I "C3'" 1 
ATOM   6394  O  "O3'" . DG  I 5 22  ? -53.009 -40.253 10.180 1.00 151.29 ? -51  DG  I "O3'" 1 
ATOM   6395  C  "C2'" . DG  I 5 22  ? -50.863 -39.515 11.267 1.00 150.64 ? -51  DG  I "C2'" 1 
ATOM   6396  C  "C1'" . DG  I 5 22  ? -51.371 -38.524 12.306 1.00 150.23 ? -51  DG  I "C1'" 1 
ATOM   6397  N  N9    . DG  I 5 22  ? -50.329 -37.840 13.066 1.00 150.28 ? -51  DG  I N9    1 
ATOM   6398  C  C8    . DG  I 5 22  ? -49.275 -38.419 13.738 1.00 150.26 ? -51  DG  I C8    1 
ATOM   6399  N  N7    . DG  I 5 22  ? -48.500 -37.560 14.341 1.00 150.21 ? -51  DG  I N7    1 
ATOM   6400  C  C5    . DG  I 5 22  ? -49.080 -36.330 14.056 1.00 150.20 ? -51  DG  I C5    1 
ATOM   6401  C  C6    . DG  I 5 22  ? -48.686 -35.027 14.444 1.00 150.09 ? -51  DG  I C6    1 
ATOM   6402  O  O6    . DG  I 5 22  ? -47.714 -34.702 15.135 1.00 150.09 ? -51  DG  I O6    1 
ATOM   6403  N  N1    . DG  I 5 22  ? -49.541 -34.043 13.946 1.00 150.18 ? -51  DG  I N1    1 
ATOM   6404  C  C2    . DG  I 5 22  ? -50.649 -34.294 13.167 1.00 150.17 ? -51  DG  I C2    1 
ATOM   6405  N  N2    . DG  I 5 22  ? -51.361 -33.226 12.782 1.00 150.16 ? -51  DG  I N2    1 
ATOM   6406  N  N3    . DG  I 5 22  ? -51.035 -35.514 12.800 1.00 150.09 ? -51  DG  I N3    1 
ATOM   6407  C  C4    . DG  I 5 22  ? -50.208 -36.482 13.276 1.00 150.26 ? -51  DG  I C4    1 
ATOM   6408  P  P     . DT  I 5 23  ? -52.759 -39.673 8.706  1.00 151.42 ? -50  DT  I P     1 
ATOM   6409  O  OP1   . DT  I 5 23  ? -53.993 -40.006 7.958  1.00 151.47 ? -50  DT  I OP1   1 
ATOM   6410  O  OP2   . DT  I 5 23  ? -51.440 -40.120 8.187  1.00 150.64 ? -50  DT  I OP2   1 
ATOM   6411  O  "O5'" . DT  I 5 23  ? -52.720 -38.088 8.954  1.00 151.58 ? -50  DT  I "O5'" 1 
ATOM   6412  C  "C5'" . DT  I 5 23  ? -53.890 -37.282 8.784  1.00 152.10 ? -50  DT  I "C5'" 1 
ATOM   6413  C  "C4'" . DT  I 5 23  ? -53.561 -35.964 8.096  1.00 152.69 ? -50  DT  I "C4'" 1 
ATOM   6414  O  "O4'" . DT  I 5 23  ? -52.665 -35.197 8.939  1.00 152.76 ? -50  DT  I "O4'" 1 
ATOM   6415  C  "C3'" . DT  I 5 23  ? -52.874 -36.069 6.732  1.00 153.19 ? -50  DT  I "C3'" 1 
ATOM   6416  O  "O3'" . DT  I 5 23  ? -53.409 -35.097 5.824  1.00 153.86 ? -50  DT  I "O3'" 1 
ATOM   6417  C  "C2'" . DT  I 5 23  ? -51.405 -35.792 7.043  1.00 152.97 ? -50  DT  I "C2'" 1 
ATOM   6418  C  "C1'" . DT  I 5 23  ? -51.514 -34.815 8.210  1.00 152.76 ? -50  DT  I "C1'" 1 
ATOM   6419  N  N1    . DT  I 5 23  ? -50.322 -34.788 9.133  1.00 152.79 ? -50  DT  I N1    1 
ATOM   6420  C  C2    . DT  I 5 23  ? -49.903 -33.582 9.669  1.00 152.62 ? -50  DT  I C2    1 
ATOM   6421  O  O2    . DT  I 5 23  ? -50.441 -32.511 9.446  1.00 152.63 ? -50  DT  I O2    1 
ATOM   6422  N  N3    . DT  I 5 23  ? -48.808 -33.671 10.492 1.00 152.51 ? -50  DT  I N3    1 
ATOM   6423  C  C4    . DT  I 5 23  ? -48.104 -34.810 10.835 1.00 152.57 ? -50  DT  I C4    1 
ATOM   6424  O  O4    . DT  I 5 23  ? -47.138 -34.764 11.587 1.00 152.70 ? -50  DT  I O4    1 
ATOM   6425  C  C5    . DT  I 5 23  ? -48.584 -36.038 10.244 1.00 152.71 ? -50  DT  I C5    1 
ATOM   6426  C  C7    . DT  I 5 23  ? -47.907 -37.348 10.531 1.00 152.70 ? -50  DT  I C7    1 
ATOM   6427  C  C6    . DT  I 5 23  ? -49.655 -35.967 9.436  1.00 152.88 ? -50  DT  I C6    1 
ATOM   6428  P  P     . DG  I 5 24  ? -53.078 -35.124 4.252  1.00 154.01 ? -49  DG  I P     1 
ATOM   6429  O  OP1   . DG  I 5 24  ? -54.203 -34.440 3.570  1.00 154.21 ? -49  DG  I OP1   1 
ATOM   6430  O  OP2   . DG  I 5 24  ? -52.707 -36.509 3.870  1.00 153.99 ? -49  DG  I OP2   1 
ATOM   6431  O  "O5'" . DG  I 5 24  ? -51.757 -34.233 4.113  1.00 153.17 ? -49  DG  I "O5'" 1 
ATOM   6432  C  "C5'" . DG  I 5 24  ? -51.756 -32.852 4.460  1.00 152.81 ? -49  DG  I "C5'" 1 
ATOM   6433  C  "C4'" . DG  I 5 24  ? -50.339 -32.295 4.481  1.00 152.68 ? -49  DG  I "C4'" 1 
ATOM   6434  O  "O4'" . DG  I 5 24  ? -49.582 -32.811 5.610  1.00 152.73 ? -49  DG  I "O4'" 1 
ATOM   6435  C  "C3'" . DG  I 5 24  ? -49.483 -32.584 3.246  1.00 152.23 ? -49  DG  I "C3'" 1 
ATOM   6436  O  "O3'" . DG  I 5 24  ? -48.766 -31.416 2.896  1.00 151.34 ? -49  DG  I "O3'" 1 
ATOM   6437  C  "C2'" . DG  I 5 24  ? -48.519 -33.652 3.746  1.00 152.44 ? -49  DG  I "C2'" 1 
ATOM   6438  C  "C1'" . DG  I 5 24  ? -48.280 -33.087 5.141  1.00 152.60 ? -49  DG  I "C1'" 1 
ATOM   6439  N  N9    . DG  I 5 24  ? -47.594 -33.955 6.092  1.00 152.58 ? -49  DG  I N9    1 
ATOM   6440  C  C8    . DG  I 5 24  ? -47.562 -35.329 6.110  1.00 152.65 ? -49  DG  I C8    1 
ATOM   6441  N  N7    . DG  I 5 24  ? -46.864 -35.817 7.095  1.00 152.88 ? -49  DG  I N7    1 
ATOM   6442  C  C5    . DG  I 5 24  ? -46.405 -34.696 7.778  1.00 152.81 ? -49  DG  I C5    1 
ATOM   6443  C  C6    . DG  I 5 24  ? -45.592 -34.595 8.936  1.00 152.66 ? -49  DG  I C6    1 
ATOM   6444  O  O6    . DG  I 5 24  ? -45.111 -35.515 9.612  1.00 152.59 ? -49  DG  I O6    1 
ATOM   6445  N  N1    . DG  I 5 24  ? -45.359 -33.268 9.303  1.00 152.65 ? -49  DG  I N1    1 
ATOM   6446  C  C2    . DG  I 5 24  ? -45.847 -32.171 8.627  1.00 152.67 ? -49  DG  I C2    1 
ATOM   6447  N  N2    . DG  I 5 24  ? -45.523 -30.966 9.117  1.00 152.60 ? -49  DG  I N2    1 
ATOM   6448  N  N3    . DG  I 5 24  ? -46.607 -32.255 7.540  1.00 152.78 ? -49  DG  I N3    1 
ATOM   6449  C  C4    . DG  I 5 24  ? -46.846 -33.541 7.171  1.00 152.76 ? -49  DG  I C4    1 
ATOM   6450  P  P     . DC  I 5 25  ? -49.440 -30.299 1.979  1.00 150.75 ? -48  DC  I P     1 
ATOM   6451  O  OP1   . DC  I 5 25  ? -50.571 -29.697 2.731  1.00 150.42 ? -48  DC  I OP1   1 
ATOM   6452  O  OP2   . DC  I 5 25  ? -49.691 -30.932 0.663  1.00 150.68 ? -48  DC  I OP2   1 
ATOM   6453  O  "O5'" . DC  I 5 25  ? -48.240 -29.237 1.816  1.00 149.83 ? -48  DC  I "O5'" 1 
ATOM   6454  C  "C5'" . DC  I 5 25  ? -48.187 -28.020 2.587  1.00 148.40 ? -48  DC  I "C5'" 1 
ATOM   6455  C  "C4'" . DC  I 5 25  ? -46.925 -27.897 3.438  1.00 146.99 ? -48  DC  I "C4'" 1 
ATOM   6456  O  "O4'" . DC  I 5 25  ? -46.639 -29.161 4.100  1.00 146.88 ? -48  DC  I "O4'" 1 
ATOM   6457  C  "C3'" . DC  I 5 25  ? -45.647 -27.501 2.689  1.00 145.95 ? -48  DC  I "C3'" 1 
ATOM   6458  O  "O3'" . DC  I 5 25  ? -44.927 -26.460 3.398  1.00 144.03 ? -48  DC  I "O3'" 1 
ATOM   6459  C  "C2'" . DC  I 5 25  ? -44.868 -28.817 2.641  1.00 146.41 ? -48  DC  I "C2'" 1 
ATOM   6460  C  "C1'" . DC  I 5 25  ? -45.256 -29.422 3.990  1.00 146.84 ? -48  DC  I "C1'" 1 
ATOM   6461  N  N1    . DC  I 5 25  ? -44.994 -30.898 4.197  1.00 147.02 ? -48  DC  I N1    1 
ATOM   6462  C  C2    . DC  I 5 25  ? -44.351 -31.330 5.372  1.00 147.31 ? -48  DC  I C2    1 
ATOM   6463  O  O2    . DC  I 5 25  ? -43.999 -30.502 6.217  1.00 147.56 ? -48  DC  I O2    1 
ATOM   6464  N  N3    . DC  I 5 25  ? -44.119 -32.656 5.563  1.00 147.36 ? -48  DC  I N3    1 
ATOM   6465  C  C4    . DC  I 5 25  ? -44.500 -33.544 4.644  1.00 147.11 ? -48  DC  I C4    1 
ATOM   6466  N  N4    . DC  I 5 25  ? -44.246 -34.835 4.884  1.00 147.05 ? -48  DC  I N4    1 
ATOM   6467  C  C5    . DC  I 5 25  ? -45.153 -33.134 3.440  1.00 147.26 ? -48  DC  I C5    1 
ATOM   6468  C  C6    . DC  I 5 25  ? -45.382 -31.821 3.262  1.00 147.22 ? -48  DC  I C6    1 
ATOM   6469  P  P     . DC  I 5 26  ? -44.312 -25.153 2.679  1.00 141.89 ? -47  DC  I P     1 
ATOM   6470  O  OP1   . DC  I 5 26  ? -45.320 -24.075 2.787  1.00 142.06 ? -47  DC  I OP1   1 
ATOM   6471  O  OP2   . DC  I 5 26  ? -43.815 -25.535 1.340  1.00 141.72 ? -47  DC  I OP2   1 
ATOM   6472  O  "O5'" . DC  I 5 26  ? -43.020 -24.753 3.549  1.00 140.05 ? -47  DC  I "O5'" 1 
ATOM   6473  C  "C5'" . DC  I 5 26  ? -42.751 -25.232 4.868  1.00 136.77 ? -47  DC  I "C5'" 1 
ATOM   6474  C  "C4'" . DC  I 5 26  ? -41.387 -25.902 4.977  1.00 134.92 ? -47  DC  I "C4'" 1 
ATOM   6475  O  "O4'" . DC  I 5 26  ? -41.566 -27.340 4.930  1.00 134.69 ? -47  DC  I "O4'" 1 
ATOM   6476  C  "C3'" . DC  I 5 26  ? -40.336 -25.572 3.903  1.00 133.95 ? -47  DC  I "C3'" 1 
ATOM   6477  O  "O3'" . DC  I 5 26  ? -39.070 -25.195 4.475  1.00 132.64 ? -47  DC  I "O3'" 1 
ATOM   6478  C  "C2'" . DC  I 5 26  ? -40.172 -26.893 3.152  1.00 134.32 ? -47  DC  I "C2'" 1 
ATOM   6479  C  "C1'" . DC  I 5 26  ? -40.410 -27.854 4.306  1.00 134.71 ? -47  DC  I "C1'" 1 
ATOM   6480  N  N1    . DC  I 5 26  ? -40.549 -29.317 3.958  1.00 134.81 ? -47  DC  I N1    1 
ATOM   6481  C  C2    . DC  I 5 26  ? -39.464 -30.161 4.244  1.00 134.82 ? -47  DC  I C2    1 
ATOM   6482  O  O2    . DC  I 5 26  ? -38.451 -29.679 4.756  1.00 134.47 ? -47  DC  I O2    1 
ATOM   6483  N  N3    . DC  I 5 26  ? -39.550 -31.486 3.958  1.00 134.95 ? -47  DC  I N3    1 
ATOM   6484  C  C4    . DC  I 5 26  ? -40.663 -31.975 3.404  1.00 134.80 ? -47  DC  I C4    1 
ATOM   6485  N  N4    . DC  I 5 26  ? -40.684 -33.288 3.145  1.00 134.51 ? -47  DC  I N4    1 
ATOM   6486  C  C5    . DC  I 5 26  ? -41.786 -31.136 3.101  1.00 134.48 ? -47  DC  I C5    1 
ATOM   6487  C  C6    . DC  I 5 26  ? -41.687 -29.829 3.394  1.00 134.33 ? -47  DC  I C6    1 
ATOM   6488  P  P     . DT  I 5 27  ? -38.715 -23.712 4.991  1.00 131.39 ? -46  DT  I P     1 
ATOM   6489  O  OP1   . DT  I 5 27  ? -39.981 -22.950 5.088  1.00 130.77 ? -46  DT  I OP1   1 
ATOM   6490  O  OP2   . DT  I 5 27  ? -37.583 -23.190 4.187  1.00 130.79 ? -46  DT  I OP2   1 
ATOM   6491  O  "O5'" . DT  I 5 27  ? -38.128 -23.917 6.471  1.00 129.68 ? -46  DT  I "O5'" 1 
ATOM   6492  C  "C5'" . DT  I 5 27  ? -38.223 -25.150 7.187  1.00 127.41 ? -46  DT  I "C5'" 1 
ATOM   6493  C  "C4'" . DT  I 5 27  ? -36.892 -25.889 7.268  1.00 125.83 ? -46  DT  I "C4'" 1 
ATOM   6494  O  "O4'" . DT  I 5 27  ? -36.851 -26.934 6.268  1.00 126.18 ? -46  DT  I "O4'" 1 
ATOM   6495  C  "C3'" . DT  I 5 27  ? -35.598 -25.096 7.068  1.00 124.39 ? -46  DT  I "C3'" 1 
ATOM   6496  O  "O3'" . DT  I 5 27  ? -34.656 -25.605 8.010  1.00 122.12 ? -46  DT  I "O3'" 1 
ATOM   6497  C  "C2'" . DT  I 5 27  ? -35.194 -25.431 5.632  1.00 124.65 ? -46  DT  I "C2'" 1 
ATOM   6498  C  "C1'" . DT  I 5 27  ? -35.610 -26.895 5.589  1.00 125.70 ? -46  DT  I "C1'" 1 
ATOM   6499  N  N1    . DT  I 5 27  ? -35.871 -27.507 4.256  1.00 125.95 ? -46  DT  I N1    1 
ATOM   6500  C  C2    . DT  I 5 27  ? -35.800 -28.883 4.141  1.00 125.95 ? -46  DT  I C2    1 
ATOM   6501  O  O2    . DT  I 5 27  ? -35.511 -29.631 5.058  1.00 125.82 ? -46  DT  I O2    1 
ATOM   6502  N  N3    . DT  I 5 27  ? -36.081 -29.370 2.890  1.00 126.11 ? -46  DT  I N3    1 
ATOM   6503  C  C4    . DT  I 5 27  ? -36.423 -28.642 1.765  1.00 126.04 ? -46  DT  I C4    1 
ATOM   6504  O  O4    . DT  I 5 27  ? -36.647 -29.197 0.692  1.00 125.79 ? -46  DT  I O4    1 
ATOM   6505  C  C5    . DT  I 5 27  ? -36.489 -27.207 1.958  1.00 126.06 ? -46  DT  I C5    1 
ATOM   6506  C  C7    . DT  I 5 27  ? -36.850 -26.288 0.830  1.00 126.08 ? -46  DT  I C7    1 
ATOM   6507  C  C6    . DT  I 5 27  ? -36.221 -26.715 3.176  1.00 126.10 ? -46  DT  I C6    1 
ATOM   6508  P  P     . DG  I 5 28  ? -33.311 -24.832 8.400  1.00 120.26 ? -45  DG  I P     1 
ATOM   6509  O  OP1   . DG  I 5 28  ? -33.718 -23.672 9.230  1.00 119.72 ? -45  DG  I OP1   1 
ATOM   6510  O  OP2   . DG  I 5 28  ? -32.488 -24.668 7.176  1.00 119.68 ? -45  DG  I OP2   1 
ATOM   6511  O  "O5'" . DG  I 5 28  ? -32.523 -25.878 9.321  1.00 118.42 ? -45  DG  I "O5'" 1 
ATOM   6512  C  "C5'" . DG  I 5 28  ? -33.210 -26.863 10.095 1.00 115.39 ? -45  DG  I "C5'" 1 
ATOM   6513  C  "C4'" . DG  I 5 28  ? -32.760 -28.274 9.758  1.00 112.60 ? -45  DG  I "C4'" 1 
ATOM   6514  O  "O4'" . DG  I 5 28  ? -33.224 -28.640 8.430  1.00 112.12 ? -45  DG  I "O4'" 1 
ATOM   6515  C  "C3'" . DG  I 5 28  ? -31.248 -28.460 9.753  1.00 111.02 ? -45  DG  I "C3'" 1 
ATOM   6516  O  "O3'" . DG  I 5 28  ? -30.902 -29.712 10.325 1.00 109.23 ? -45  DG  I "O3'" 1 
ATOM   6517  C  "C2'" . DG  I 5 28  ? -30.903 -28.397 8.271  1.00 111.10 ? -45  DG  I "C2'" 1 
ATOM   6518  C  "C1'" . DG  I 5 28  ? -32.123 -29.077 7.661  1.00 111.21 ? -45  DG  I "C1'" 1 
ATOM   6519  N  N9    . DG  I 5 28  ? -32.305 -28.750 6.249  1.00 111.02 ? -45  DG  I N9    1 
ATOM   6520  C  C8    . DG  I 5 28  ? -32.207 -27.508 5.667  1.00 110.90 ? -45  DG  I C8    1 
ATOM   6521  N  N7    . DG  I 5 28  ? -32.405 -27.519 4.382  1.00 110.85 ? -45  DG  I N7    1 
ATOM   6522  C  C5    . DG  I 5 28  ? -32.642 -28.852 4.093  1.00 110.76 ? -45  DG  I C5    1 
ATOM   6523  C  C6    . DG  I 5 28  ? -32.927 -29.475 2.857  1.00 110.83 ? -45  DG  I C6    1 
ATOM   6524  O  O6    . DG  I 5 28  ? -33.017 -28.928 1.753  1.00 111.07 ? -45  DG  I O6    1 
ATOM   6525  N  N1    . DG  I 5 28  ? -33.107 -30.859 2.978  1.00 110.89 ? -45  DG  I N1    1 
ATOM   6526  C  C2    . DG  I 5 28  ? -33.027 -31.559 4.165  1.00 110.98 ? -45  DG  I C2    1 
ATOM   6527  N  N2    . DG  I 5 28  ? -33.225 -32.887 4.106  1.00 110.62 ? -45  DG  I N2    1 
ATOM   6528  N  N3    . DG  I 5 28  ? -32.761 -30.977 5.336  1.00 111.30 ? -45  DG  I N3    1 
ATOM   6529  C  C4    . DG  I 5 28  ? -32.586 -29.628 5.229  1.00 111.00 ? -45  DG  I C4    1 
ATOM   6530  P  P     . DG  I 5 29  ? -29.362 -30.082 10.566 1.00 107.80 ? -44  DG  I P     1 
ATOM   6531  O  OP1   . DG  I 5 29  ? -29.173 -30.241 12.023 1.00 108.41 ? -44  DG  I OP1   1 
ATOM   6532  O  OP2   . DG  I 5 29  ? -28.506 -29.139 9.812  1.00 107.76 ? -44  DG  I OP2   1 
ATOM   6533  O  "O5'" . DG  I 5 29  ? -29.209 -31.516 9.881  1.00 107.00 ? -44  DG  I "O5'" 1 
ATOM   6534  C  "C5'" . DG  I 5 29  ? -30.154 -32.565 10.101 1.00 105.81 ? -44  DG  I "C5'" 1 
ATOM   6535  C  "C4'" . DG  I 5 29  ? -30.065 -33.600 8.991  1.00 104.62 ? -44  DG  I "C4'" 1 
ATOM   6536  O  "O4'" . DG  I 5 29  ? -30.536 -33.020 7.751  1.00 104.11 ? -44  DG  I "O4'" 1 
ATOM   6537  C  "C3'" . DG  I 5 29  ? -28.663 -34.132 8.702  1.00 104.81 ? -44  DG  I "C3'" 1 
ATOM   6538  O  "O3'" . DG  I 5 29  ? -28.767 -35.522 8.466  1.00 106.07 ? -44  DG  I "O3'" 1 
ATOM   6539  C  "C2'" . DG  I 5 29  ? -28.208 -33.351 7.469  1.00 103.77 ? -44  DG  I "C2'" 1 
ATOM   6540  C  "C1'" . DG  I 5 29  ? -29.532 -33.104 6.757  1.00 103.41 ? -44  DG  I "C1'" 1 
ATOM   6541  N  N9    . DG  I 5 29  ? -29.582 -31.904 5.920  1.00 103.37 ? -44  DG  I N9    1 
ATOM   6542  C  C8    . DG  I 5 29  ? -29.482 -30.585 6.296  1.00 103.07 ? -44  DG  I C8    1 
ATOM   6543  N  N7    . DG  I 5 29  ? -29.573 -29.738 5.304  1.00 103.02 ? -44  DG  I N7    1 
ATOM   6544  C  C5    . DG  I 5 29  ? -29.744 -30.553 4.185  1.00 103.41 ? -44  DG  I C5    1 
ATOM   6545  C  C6    . DG  I 5 29  ? -29.908 -30.231 2.810  1.00 102.92 ? -44  DG  I C6    1 
ATOM   6546  O  O6    . DG  I 5 29  ? -29.932 -29.122 2.266  1.00 103.24 ? -44  DG  I O6    1 
ATOM   6547  N  N1    . DG  I 5 29  ? -30.057 -31.364 2.018  1.00 102.91 ? -44  DG  I N1    1 
ATOM   6548  C  C2    . DG  I 5 29  ? -30.054 -32.657 2.482  1.00 103.04 ? -44  DG  I C2    1 
ATOM   6549  N  N2    . DG  I 5 29  ? -30.204 -33.627 1.567  1.00 103.38 ? -44  DG  I N2    1 
ATOM   6550  N  N3    . DG  I 5 29  ? -29.903 -32.981 3.757  1.00 103.29 ? -44  DG  I N3    1 
ATOM   6551  C  C4    . DG  I 5 29  ? -29.756 -31.886 4.553  1.00 103.70 ? -44  DG  I C4    1 
ATOM   6552  P  P     . DA  I 5 30  ? -27.485 -36.464 8.328  1.00 107.62 ? -43  DA  I P     1 
ATOM   6553  O  OP1   . DA  I 5 30  ? -27.327 -37.224 9.592  1.00 107.19 ? -43  DA  I OP1   1 
ATOM   6554  O  OP2   . DA  I 5 30  ? -26.347 -35.687 7.771  1.00 106.74 ? -43  DA  I OP2   1 
ATOM   6555  O  "O5'" . DA  I 5 30  ? -27.975 -37.520 7.223  1.00 109.94 ? -43  DA  I "O5'" 1 
ATOM   6556  C  "C5'" . DA  I 5 30  ? -28.875 -37.206 6.151  1.00 112.12 ? -43  DA  I "C5'" 1 
ATOM   6557  C  "C4'" . DA  I 5 30  ? -28.327 -37.570 4.770  1.00 113.96 ? -43  DA  I "C4'" 1 
ATOM   6558  O  "O4'" . DA  I 5 30  ? -28.386 -36.388 3.931  1.00 113.63 ? -43  DA  I "O4'" 1 
ATOM   6559  C  "C3'" . DA  I 5 30  ? -26.891 -38.100 4.657  1.00 115.46 ? -43  DA  I "C3'" 1 
ATOM   6560  O  "O3'" . DA  I 5 30  ? -26.844 -39.128 3.645  1.00 118.58 ? -43  DA  I "O3'" 1 
ATOM   6561  C  "C2'" . DA  I 5 30  ? -26.097 -36.854 4.276  1.00 114.38 ? -43  DA  I "C2'" 1 
ATOM   6562  C  "C1'" . DA  I 5 30  ? -27.105 -36.089 3.428  1.00 114.75 ? -43  DA  I "C1'" 1 
ATOM   6563  N  N9    . DA  I 5 30  ? -26.970 -34.638 3.467  1.00 115.24 ? -43  DA  I N9    1 
ATOM   6564  C  C8    . DA  I 5 30  ? -26.717 -33.849 4.558  1.00 115.71 ? -43  DA  I C8    1 
ATOM   6565  N  N7    . DA  I 5 30  ? -26.651 -32.563 4.306  1.00 115.39 ? -43  DA  I N7    1 
ATOM   6566  C  C5    . DA  I 5 30  ? -26.879 -32.508 2.944  1.00 115.43 ? -43  DA  I C5    1 
ATOM   6567  C  C6    . DA  I 5 30  ? -26.940 -31.426 2.046  1.00 115.56 ? -43  DA  I C6    1 
ATOM   6568  N  N6    . DA  I 5 30  ? -26.766 -30.163 2.446  1.00 115.57 ? -43  DA  I N6    1 
ATOM   6569  N  N1    . DA  I 5 30  ? -27.192 -31.693 0.738  1.00 115.60 ? -43  DA  I N1    1 
ATOM   6570  C  C2    . DA  I 5 30  ? -27.367 -32.972 0.356  1.00 115.52 ? -43  DA  I C2    1 
ATOM   6571  N  N3    . DA  I 5 30  ? -27.334 -34.073 1.112  1.00 115.57 ? -43  DA  I N3    1 
ATOM   6572  C  C4    . DA  I 5 30  ? -27.082 -33.771 2.406  1.00 115.46 ? -43  DA  I C4    1 
ATOM   6573  P  P     . DG  I 5 31  ? -25.666 -40.219 3.456  1.00 120.82 ? -42  DG  I P     1 
ATOM   6574  O  OP1   . DG  I 5 31  ? -26.074 -41.457 4.159  1.00 120.72 ? -42  DG  I OP1   1 
ATOM   6575  O  OP2   . DG  I 5 31  ? -24.358 -39.587 3.764  1.00 120.49 ? -42  DG  I OP2   1 
ATOM   6576  O  "O5'" . DG  I 5 31  ? -25.699 -40.515 1.874  1.00 121.88 ? -42  DG  I "O5'" 1 
ATOM   6577  C  "C5'" . DG  I 5 31  ? -26.678 -39.929 1.002  1.00 123.32 ? -42  DG  I "C5'" 1 
ATOM   6578  C  "C4'" . DG  I 5 31  ? -26.096 -39.465 -0.331 1.00 124.93 ? -42  DG  I "C4'" 1 
ATOM   6579  O  "O4'" . DG  I 5 31  ? -25.985 -38.018 -0.369 1.00 125.35 ? -42  DG  I "O4'" 1 
ATOM   6580  C  "C3'" . DG  I 5 31  ? -24.717 -39.983 -0.729 1.00 125.90 ? -42  DG  I "C3'" 1 
ATOM   6581  O  "O3'" . DG  I 5 31  ? -24.691 -40.127 -2.148 1.00 127.47 ? -42  DG  I "O3'" 1 
ATOM   6582  C  "C2'" . DG  I 5 31  ? -23.787 -38.867 -0.271 1.00 125.85 ? -42  DG  I "C2'" 1 
ATOM   6583  C  "C1'" . DG  I 5 31  ? -24.636 -37.638 -0.579 1.00 126.76 ? -42  DG  I "C1'" 1 
ATOM   6584  N  N9    . DG  I 5 31  ? -24.377 -36.488 0.284  1.00 127.33 ? -42  DG  I N9    1 
ATOM   6585  C  C8    . DG  I 5 31  ? -24.146 -36.490 1.645  1.00 127.52 ? -42  DG  I C8    1 
ATOM   6586  N  N7    . DG  I 5 31  ? -23.958 -35.307 2.159  1.00 127.27 ? -42  DG  I N7    1 
ATOM   6587  C  C5    . DG  I 5 31  ? -24.068 -34.464 1.063  1.00 127.20 ? -42  DG  I C5    1 
ATOM   6588  C  C6    . DG  I 5 31  ? -23.960 -33.058 1.001  1.00 127.20 ? -42  DG  I C6    1 
ATOM   6589  O  O6    . DG  I 5 31  ? -23.730 -32.284 1.939  1.00 127.33 ? -42  DG  I O6    1 
ATOM   6590  N  N1    . DG  I 5 31  ? -24.131 -32.576 -0.301 1.00 127.40 ? -42  DG  I N1    1 
ATOM   6591  C  C2    . DG  I 5 31  ? -24.386 -33.370 -1.403 1.00 127.39 ? -42  DG  I C2    1 
ATOM   6592  N  N2    . DG  I 5 31  ? -24.528 -32.739 -2.576 1.00 127.31 ? -42  DG  I N2    1 
ATOM   6593  N  N3    . DG  I 5 31  ? -24.497 -34.695 -1.357 1.00 127.29 ? -42  DG  I N3    1 
ATOM   6594  C  C4    . DG  I 5 31  ? -24.331 -35.169 -0.096 1.00 127.28 ? -42  DG  I C4    1 
ATOM   6595  P  P     . DA  I 5 32  ? -23.534 -40.922 -2.919 1.00 128.44 ? -41  DA  I P     1 
ATOM   6596  O  OP1   . DA  I 5 32  ? -24.208 -42.096 -3.509 1.00 128.75 ? -41  DA  I OP1   1 
ATOM   6597  O  OP2   . DA  I 5 32  ? -22.368 -41.114 -2.021 1.00 128.47 ? -41  DA  I OP2   1 
ATOM   6598  O  "O5'" . DA  I 5 32  ? -23.072 -39.934 -4.095 1.00 129.55 ? -41  DA  I "O5'" 1 
ATOM   6599  C  "C5'" . DA  I 5 32  ? -23.364 -38.538 -4.068 1.00 132.03 ? -41  DA  I "C5'" 1 
ATOM   6600  C  "C4'" . DA  I 5 32  ? -22.536 -37.726 -5.061 1.00 134.16 ? -41  DA  I "C4'" 1 
ATOM   6601  O  "O4'" . DA  I 5 32  ? -22.413 -36.360 -4.578 1.00 135.12 ? -41  DA  I "O4'" 1 
ATOM   6602  C  "C3'" . DA  I 5 32  ? -21.102 -38.185 -5.328 1.00 135.39 ? -41  DA  I "C3'" 1 
ATOM   6603  O  "O3'" . DA  I 5 32  ? -20.729 -37.883 -6.679 1.00 136.49 ? -41  DA  I "O3'" 1 
ATOM   6604  C  "C2'" . DA  I 5 32  ? -20.275 -37.383 -4.326 1.00 135.77 ? -41  DA  I "C2'" 1 
ATOM   6605  C  "C1'" . DA  I 5 32  ? -21.090 -36.102 -4.133 1.00 135.90 ? -41  DA  I "C1'" 1 
ATOM   6606  N  N9    . DA  I 5 32  ? -21.113 -35.662 -2.734 1.00 136.17 ? -41  DA  I N9    1 
ATOM   6607  C  C8    . DA  I 5 32  ? -21.304 -36.451 -1.628 1.00 136.11 ? -41  DA  I C8    1 
ATOM   6608  N  N7    . DA  I 5 32  ? -21.268 -35.801 -0.492 1.00 136.16 ? -41  DA  I N7    1 
ATOM   6609  C  C5    . DA  I 5 32  ? -21.042 -34.489 -0.873 1.00 136.14 ? -41  DA  I C5    1 
ATOM   6610  C  C6    . DA  I 5 32  ? -20.894 -33.301 -0.130 1.00 135.87 ? -41  DA  I C6    1 
ATOM   6611  N  N6    . DA  I 5 32  ? -20.968 -33.269 1.201  1.00 135.91 ? -41  DA  I N6    1 
ATOM   6612  N  N1    . DA  I 5 32  ? -20.671 -32.152 -0.807 1.00 136.03 ? -41  DA  I N1    1 
ATOM   6613  C  C2    . DA  I 5 32  ? -20.598 -32.194 -2.146 1.00 136.06 ? -41  DA  I C2    1 
ATOM   6614  N  N3    . DA  I 5 32  ? -20.714 -33.252 -2.954 1.00 136.12 ? -41  DA  I N3    1 
ATOM   6615  C  C4    . DA  I 5 32  ? -20.937 -34.381 -2.251 1.00 136.24 ? -41  DA  I C4    1 
ATOM   6616  P  P     . DC  I 5 33  ? -19.306 -38.313 -7.294 1.00 137.23 ? -40  DC  I P     1 
ATOM   6617  O  OP1   . DC  I 5 33  ? -19.494 -38.389 -8.760 1.00 137.08 ? -40  DC  I OP1   1 
ATOM   6618  O  OP2   . DC  I 5 33  ? -18.779 -39.478 -6.544 1.00 136.86 ? -40  DC  I OP2   1 
ATOM   6619  O  "O5'" . DC  I 5 33  ? -18.348 -37.076 -6.964 1.00 137.58 ? -40  DC  I "O5'" 1 
ATOM   6620  C  "C5'" . DC  I 5 33  ? -18.712 -35.740 -7.306 1.00 138.48 ? -40  DC  I "C5'" 1 
ATOM   6621  C  "C4'" . DC  I 5 33  ? -17.797 -34.763 -6.595 1.00 139.17 ? -40  DC  I "C4'" 1 
ATOM   6622  O  "O4'" . DC  I 5 33  ? -18.258 -34.559 -5.231 1.00 139.97 ? -40  DC  I "O4'" 1 
ATOM   6623  C  "C3'" . DC  I 5 33  ? -16.349 -35.232 -6.489 1.00 139.51 ? -40  DC  I "C3'" 1 
ATOM   6624  O  "O3'" . DC  I 5 33  ? -15.492 -34.258 -7.049 1.00 139.90 ? -40  DC  I "O3'" 1 
ATOM   6625  C  "C2'" . DC  I 5 33  ? -16.113 -35.363 -4.988 1.00 139.93 ? -40  DC  I "C2'" 1 
ATOM   6626  C  "C1'" . DC  I 5 33  ? -17.111 -34.350 -4.435 1.00 140.35 ? -40  DC  I "C1'" 1 
ATOM   6627  N  N1    . DC  I 5 33  ? -17.383 -34.465 -2.942 1.00 140.57 ? -40  DC  I N1    1 
ATOM   6628  C  C2    . DC  I 5 33  ? -17.330 -33.322 -2.114 1.00 140.62 ? -40  DC  I C2    1 
ATOM   6629  O  O2    . DC  I 5 33  ? -17.080 -32.211 -2.594 1.00 140.71 ? -40  DC  I O2    1 
ATOM   6630  N  N3    . DC  I 5 33  ? -17.562 -33.453 -0.781 1.00 140.61 ? -40  DC  I N3    1 
ATOM   6631  C  C4    . DC  I 5 33  ? -17.825 -34.655 -0.260 1.00 140.66 ? -40  DC  I C4    1 
ATOM   6632  N  N4    . DC  I 5 33  ? -18.049 -34.728 1.056  1.00 140.64 ? -40  DC  I N4    1 
ATOM   6633  C  C5    . DC  I 5 33  ? -17.882 -35.832 -1.071 1.00 140.71 ? -40  DC  I C5    1 
ATOM   6634  C  C6    . DC  I 5 33  ? -17.655 -35.689 -2.386 1.00 140.79 ? -40  DC  I C6    1 
ATOM   6635  P  P     . DT  I 5 34  ? -14.029 -34.641 -7.582 1.00 140.20 ? -39  DT  I P     1 
ATOM   6636  O  OP1   . DT  I 5 34  ? -14.156 -34.858 -9.041 1.00 140.65 ? -39  DT  I OP1   1 
ATOM   6637  O  OP2   . DT  I 5 34  ? -13.455 -35.711 -6.731 1.00 139.91 ? -39  DT  I OP2   1 
ATOM   6638  O  "O5'" . DT  I 5 34  ? -13.199 -33.293 -7.332 1.00 139.75 ? -39  DT  I "O5'" 1 
ATOM   6639  C  "C5'" . DT  I 5 34  ? -13.731 -32.029 -7.756 1.00 139.45 ? -39  DT  I "C5'" 1 
ATOM   6640  C  "C4'" . DT  I 5 34  ? -13.267 -30.903 -6.847 1.00 139.39 ? -39  DT  I "C4'" 1 
ATOM   6641  O  "O4'" . DT  I 5 34  ? -13.908 -31.004 -5.547 1.00 139.69 ? -39  DT  I "O4'" 1 
ATOM   6642  C  "C3'" . DT  I 5 34  ? -11.764 -30.889 -6.591 1.00 139.36 ? -39  DT  I "C3'" 1 
ATOM   6643  O  "O3'" . DT  I 5 34  ? -11.252 -29.576 -6.873 1.00 138.40 ? -39  DT  I "O3'" 1 
ATOM   6644  C  "C2'" . DT  I 5 34  ? -11.625 -31.333 -5.129 1.00 139.69 ? -39  DT  I "C2'" 1 
ATOM   6645  C  "C1'" . DT  I 5 34  ? -12.948 -30.885 -4.510 1.00 140.07 ? -39  DT  I "C1'" 1 
ATOM   6646  N  N1    . DT  I 5 34  ? -13.408 -31.685 -3.292 1.00 140.32 ? -39  DT  I N1    1 
ATOM   6647  C  C2    . DT  I 5 34  ? -13.896 -31.041 -2.157 1.00 140.23 ? -39  DT  I C2    1 
ATOM   6648  O  O2    . DT  I 5 34  ? -13.996 -29.829 -2.032 1.00 140.04 ? -39  DT  I O2    1 
ATOM   6649  N  N3    . DT  I 5 34  ? -14.279 -31.886 -1.141 1.00 140.06 ? -39  DT  I N3    1 
ATOM   6650  C  C4    . DT  I 5 34  ? -14.232 -33.271 -1.129 1.00 140.04 ? -39  DT  I C4    1 
ATOM   6651  O  O4    . DT  I 5 34  ? -14.598 -33.929 -0.159 1.00 139.95 ? -39  DT  I O4    1 
ATOM   6652  C  C5    . DT  I 5 34  ? -13.711 -33.882 -2.329 1.00 140.11 ? -39  DT  I C5    1 
ATOM   6653  C  C7    . DT  I 5 34  ? -13.602 -35.375 -2.440 1.00 140.12 ? -39  DT  I C7    1 
ATOM   6654  C  C6    . DT  I 5 34  ? -13.336 -33.073 -3.333 1.00 140.29 ? -39  DT  I C6    1 
ATOM   6655  P  P     . DA  I 5 35  ? -9.796  -29.120 -6.390 1.00 137.48 ? -38  DA  I P     1 
ATOM   6656  O  OP1   . DA  I 5 35  ? -9.399  -27.917 -7.160 1.00 136.82 ? -38  DA  I OP1   1 
ATOM   6657  O  OP2   . DA  I 5 35  ? -8.890  -30.296 -6.340 1.00 136.94 ? -38  DA  I OP2   1 
ATOM   6658  O  "O5'" . DA  I 5 35  ? -10.156 -28.731 -4.879 1.00 136.90 ? -38  DA  I "O5'" 1 
ATOM   6659  C  "C5'" . DA  I 5 35  ? -10.432 -27.391 -4.474 1.00 135.29 ? -38  DA  I "C5'" 1 
ATOM   6660  C  "C4'" . DA  I 5 35  ? -9.533  -27.026 -3.303 1.00 133.64 ? -38  DA  I "C4'" 1 
ATOM   6661  O  "O4'" . DA  I 5 35  ? -9.950  -27.772 -2.133 1.00 133.38 ? -38  DA  I "O4'" 1 
ATOM   6662  C  "C3'" . DA  I 5 35  ? -8.044  -27.322 -3.506 1.00 132.50 ? -38  DA  I "C3'" 1 
ATOM   6663  O  "O3'" . DA  I 5 35  ? -7.296  -26.168 -3.090 1.00 130.65 ? -38  DA  I "O3'" 1 
ATOM   6664  C  "C2'" . DA  I 5 35  ? -7.791  -28.611 -2.710 1.00 132.87 ? -38  DA  I "C2'" 1 
ATOM   6665  C  "C1'" . DA  I 5 35  ? -8.914  -28.624 -1.672 1.00 133.46 ? -38  DA  I "C1'" 1 
ATOM   6666  N  N9    . DA  I 5 35  ? -9.533  -29.928 -1.425 1.00 133.53 ? -38  DA  I N9    1 
ATOM   6667  C  C8    . DA  I 5 35  ? -9.480  -31.053 -2.203 1.00 133.31 ? -38  DA  I C8    1 
ATOM   6668  N  N7    . DA  I 5 35  ? -10.153 -32.067 -1.717 1.00 133.16 ? -38  DA  I N7    1 
ATOM   6669  C  C5    . DA  I 5 35  ? -10.692 -31.572 -0.545 1.00 133.46 ? -38  DA  I C5    1 
ATOM   6670  C  C6    . DA  I 5 35  ? -11.508 -32.148 0.450  1.00 133.53 ? -38  DA  I C6    1 
ATOM   6671  N  N6    . DA  I 5 35  ? -11.931 -33.412 0.384  1.00 133.44 ? -38  DA  I N6    1 
ATOM   6672  N  N1    . DA  I 5 35  ? -11.872 -31.382 1.511  1.00 133.42 ? -38  DA  I N1    1 
ATOM   6673  C  C2    . DA  I 5 35  ? -11.439 -30.114 1.573  1.00 133.25 ? -38  DA  I C2    1 
ATOM   6674  N  N3    . DA  I 5 35  ? -10.666 -29.466 0.698  1.00 133.62 ? -38  DA  I N3    1 
ATOM   6675  C  C4    . DA  I 5 35  ? -10.321 -30.254 -0.345 1.00 133.66 ? -38  DA  I C4    1 
ATOM   6676  P  P     . DG  I 5 36  ? -5.816  -26.204 -2.474 1.00 129.59 ? -37  DG  I P     1 
ATOM   6677  O  OP1   . DG  I 5 36  ? -5.283  -24.821 -2.520 1.00 129.20 ? -37  DG  I OP1   1 
ATOM   6678  O  OP2   . DG  I 5 36  ? -5.051  -27.328 -3.057 1.00 129.42 ? -37  DG  I OP2   1 
ATOM   6679  O  "O5'" . DG  I 5 36  ? -6.104  -26.599 -0.955 1.00 130.33 ? -37  DG  I "O5'" 1 
ATOM   6680  C  "C5'" . DG  I 5 36  ? -6.572  -25.640 0.000  1.00 129.79 ? -37  DG  I "C5'" 1 
ATOM   6681  C  "C4'" . DG  I 5 36  ? -6.039  -25.991 1.378  1.00 128.62 ? -37  DG  I "C4'" 1 
ATOM   6682  O  "O4'" . DG  I 5 36  ? -6.465  -27.322 1.750  1.00 128.98 ? -37  DG  I "O4'" 1 
ATOM   6683  C  "C3'" . DG  I 5 36  ? -4.520  -25.988 1.505  1.00 127.38 ? -37  DG  I "C3'" 1 
ATOM   6684  O  "O3'" . DG  I 5 36  ? -4.168  -25.503 2.785  1.00 125.08 ? -37  DG  I "O3'" 1 
ATOM   6685  C  "C2'" . DG  I 5 36  ? -4.131  -27.461 1.341  1.00 128.16 ? -37  DG  I "C2'" 1 
ATOM   6686  C  "C1'" . DG  I 5 36  ? -5.357  -28.192 1.882  1.00 129.54 ? -37  DG  I "C1'" 1 
ATOM   6687  N  N9    . DG  I 5 36  ? -5.766  -29.400 1.177  1.00 129.71 ? -37  DG  I N9    1 
ATOM   6688  C  C8    . DG  I 5 36  ? -5.270  -29.935 0.014  1.00 130.13 ? -37  DG  I C8    1 
ATOM   6689  N  N7    . DG  I 5 36  ? -5.880  -31.028 -0.352 1.00 130.35 ? -37  DG  I N7    1 
ATOM   6690  C  C5    . DG  I 5 36  ? -6.844  -31.223 0.628  1.00 130.12 ? -37  DG  I C5    1 
ATOM   6691  C  C6    . DG  I 5 36  ? -7.816  -32.245 0.780  1.00 130.08 ? -37  DG  I C6    1 
ATOM   6692  O  O6    . DG  I 5 36  ? -8.027  -33.218 0.044  1.00 129.98 ? -37  DG  I O6    1 
ATOM   6693  N  N1    . DG  I 5 36  ? -8.597  -32.066 1.924  1.00 130.09 ? -37  DG  I N1    1 
ATOM   6694  C  C2    . DG  I 5 36  ? -8.465  -31.026 2.819  1.00 130.22 ? -37  DG  I C2    1 
ATOM   6695  N  N2    . DG  I 5 36  ? -9.307  -31.010 3.869  1.00 129.95 ? -37  DG  I N2    1 
ATOM   6696  N  N3    . DG  I 5 36  ? -7.554  -30.067 2.684  1.00 130.32 ? -37  DG  I N3    1 
ATOM   6697  C  C4    . DG  I 5 36  ? -6.785  -30.228 1.574  1.00 129.93 ? -37  DG  I C4    1 
ATOM   6698  P  P     . DG  I 5 37  ? -4.296  -23.962 3.195  1.00 123.59 ? -36  DG  I P     1 
ATOM   6699  O  OP1   . DG  I 5 37  ? -5.500  -23.356 2.579  1.00 123.27 ? -36  DG  I OP1   1 
ATOM   6700  O  OP2   . DG  I 5 37  ? -2.964  -23.368 2.965  1.00 123.64 ? -36  DG  I OP2   1 
ATOM   6701  O  "O5'" . DG  I 5 37  ? -4.508  -24.048 4.785  1.00 123.01 ? -36  DG  I "O5'" 1 
ATOM   6702  C  "C5'" . DG  I 5 37  ? -5.574  -24.818 5.372  1.00 121.26 ? -36  DG  I "C5'" 1 
ATOM   6703  C  "C4'" . DG  I 5 37  ? -5.093  -25.915 6.319  1.00 120.07 ? -36  DG  I "C4'" 1 
ATOM   6704  O  "O4'" . DG  I 5 37  ? -4.829  -27.146 5.593  1.00 120.85 ? -36  DG  I "O4'" 1 
ATOM   6705  C  "C3'" . DG  I 5 37  ? -3.815  -25.670 7.121  1.00 118.99 ? -36  DG  I "C3'" 1 
ATOM   6706  O  "O3'" . DG  I 5 37  ? -3.985  -26.263 8.393  1.00 116.44 ? -36  DG  I "O3'" 1 
ATOM   6707  C  "C2'" . DG  I 5 37  ? -2.760  -26.451 6.347  1.00 120.04 ? -36  DG  I "C2'" 1 
ATOM   6708  C  "C1'" . DG  I 5 37  ? -3.612  -27.681 6.088  1.00 121.74 ? -36  DG  I "C1'" 1 
ATOM   6709  N  N9    . DG  I 5 37  ? -3.073  -28.705 5.187  1.00 122.18 ? -36  DG  I N9    1 
ATOM   6710  C  C8    . DG  I 5 37  ? -1.840  -28.775 4.582  1.00 122.49 ? -36  DG  I C8    1 
ATOM   6711  N  N7    . DG  I 5 37  ? -1.679  -29.838 3.836  1.00 122.71 ? -36  DG  I N7    1 
ATOM   6712  C  C5    . DG  I 5 37  ? -2.879  -30.526 3.960  1.00 122.42 ? -36  DG  I C5    1 
ATOM   6713  C  C6    . DG  I 5 37  ? -3.308  -31.751 3.389  1.00 122.27 ? -36  DG  I C6    1 
ATOM   6714  O  O6    . DG  I 5 37  ? -2.700  -32.519 2.628  1.00 122.13 ? -36  DG  I O6    1 
ATOM   6715  N  N1    . DG  I 5 37  ? -4.606  -32.067 3.787  1.00 122.57 ? -36  DG  I N1    1 
ATOM   6716  C  C2    . DG  I 5 37  ? -5.397  -31.308 4.624  1.00 122.53 ? -36  DG  I C2    1 
ATOM   6717  N  N2    . DG  I 5 37  ? -6.623  -31.775 4.899  1.00 122.35 ? -36  DG  I N2    1 
ATOM   6718  N  N3    . DG  I 5 37  ? -5.006  -30.166 5.164  1.00 122.40 ? -36  DG  I N3    1 
ATOM   6719  C  C4    . DG  I 5 37  ? -3.741  -29.839 4.792  1.00 122.49 ? -36  DG  I C4    1 
ATOM   6720  P  P     . DG  I 5 38  ? -3.715  -25.458 9.741  1.00 114.31 ? -35  DG  I P     1 
ATOM   6721  O  OP1   . DG  I 5 38  ? -4.099  -24.042 9.538  1.00 113.16 ? -35  DG  I OP1   1 
ATOM   6722  O  OP2   . DG  I 5 38  ? -2.345  -25.794 10.184 1.00 113.61 ? -35  DG  I OP2   1 
ATOM   6723  O  "O5'" . DG  I 5 38  ? -4.737  -26.142 10.772 1.00 114.45 ? -35  DG  I "O5'" 1 
ATOM   6724  C  "C5'" . DG  I 5 38  ? -5.779  -27.049 10.393 1.00 114.61 ? -35  DG  I "C5'" 1 
ATOM   6725  C  "C4'" . DG  I 5 38  ? -5.626  -28.422 11.043 1.00 114.83 ? -35  DG  I "C4'" 1 
ATOM   6726  O  "O4'" . DG  I 5 38  ? -4.777  -29.244 10.200 1.00 115.52 ? -35  DG  I "O4'" 1 
ATOM   6727  C  "C3'" . DG  I 5 38  ? -5.008  -28.491 12.445 1.00 114.66 ? -35  DG  I "C3'" 1 
ATOM   6728  O  "O3'" . DG  I 5 38  ? -5.591  -29.567 13.214 1.00 113.18 ? -35  DG  I "O3'" 1 
ATOM   6729  C  "C2'" . DG  I 5 38  ? -3.543  -28.759 12.123 1.00 115.74 ? -35  DG  I "C2'" 1 
ATOM   6730  C  "C1'" . DG  I 5 38  ? -3.695  -29.738 10.963 1.00 117.11 ? -35  DG  I "C1'" 1 
ATOM   6731  N  N9    . DG  I 5 38  ? -2.519  -29.806 10.110 1.00 117.61 ? -35  DG  I N9    1 
ATOM   6732  C  C8    . DG  I 5 38  ? -1.353  -29.103 10.292 1.00 117.80 ? -35  DG  I C8    1 
ATOM   6733  N  N7    . DG  I 5 38  ? -0.463  -29.345 9.378  1.00 117.98 ? -35  DG  I N7    1 
ATOM   6734  C  C5    . DG  I 5 38  ? -1.075  -30.267 8.540  1.00 117.85 ? -35  DG  I C5    1 
ATOM   6735  C  C6    . DG  I 5 38  ? -0.585  -30.896 7.371  1.00 117.79 ? -35  DG  I C6    1 
ATOM   6736  O  O6    . DG  I 5 38  ? 0.520   -30.754 6.837  1.00 118.04 ? -35  DG  I O6    1 
ATOM   6737  N  N1    . DG  I 5 38  ? -1.503  -31.766 6.801  1.00 117.71 ? -35  DG  I N1    1 
ATOM   6738  C  C2    . DG  I 5 38  ? -2.756  -32.000 7.301  1.00 117.89 ? -35  DG  I C2    1 
ATOM   6739  N  N2    . DG  I 5 38  ? -3.495  -32.877 6.601  1.00 117.84 ? -35  DG  I N2    1 
ATOM   6740  N  N3    . DG  I 5 38  ? -3.233  -31.417 8.402  1.00 118.18 ? -35  DG  I N3    1 
ATOM   6741  C  C4    . DG  I 5 38  ? -2.343  -30.564 8.973  1.00 117.78 ? -35  DG  I C4    1 
ATOM   6742  P  P     . DA  I 5 39  ? -5.159  -29.948 14.717 1.00 111.61 ? -34  DA  I P     1 
ATOM   6743  O  OP1   . DA  I 5 39  ? -6.297  -29.565 15.557 1.00 111.34 ? -34  DA  I OP1   1 
ATOM   6744  O  OP2   . DA  I 5 39  ? -3.795  -29.444 15.022 1.00 110.27 ? -34  DA  I OP2   1 
ATOM   6745  O  "O5'" . DA  I 5 39  ? -5.134  -31.545 14.730 1.00 113.11 ? -34  DA  I "O5'" 1 
ATOM   6746  C  "C5'" . DA  I 5 39  ? -5.014  -32.319 13.526 1.00 116.54 ? -34  DA  I "C5'" 1 
ATOM   6747  C  "C4'" . DA  I 5 39  ? -3.788  -33.234 13.493 1.00 118.61 ? -34  DA  I "C4'" 1 
ATOM   6748  O  "O4'" . DA  I 5 39  ? -2.833  -32.783 12.491 1.00 119.15 ? -34  DA  I "O4'" 1 
ATOM   6749  C  "C3'" . DA  I 5 39  ? -2.983  -33.385 14.791 1.00 119.83 ? -34  DA  I "C3'" 1 
ATOM   6750  O  "O3'" . DA  I 5 39  ? -2.521  -34.724 14.919 1.00 121.53 ? -34  DA  I "O3'" 1 
ATOM   6751  C  "C2'" . DA  I 5 39  ? -1.789  -32.480 14.536 1.00 119.85 ? -34  DA  I "C2'" 1 
ATOM   6752  C  "C1'" . DA  I 5 39  ? -1.564  -32.914 13.091 1.00 120.62 ? -34  DA  I "C1'" 1 
ATOM   6753  N  N9    . DA  I 5 39  ? -0.538  -32.195 12.346 1.00 121.21 ? -34  DA  I N9    1 
ATOM   6754  C  C8    . DA  I 5 39  ? 0.056   -31.008 12.679 1.00 121.53 ? -34  DA  I C8    1 
ATOM   6755  N  N7    . DA  I 5 39  ? 0.959   -30.606 11.820 1.00 121.76 ? -34  DA  I N7    1 
ATOM   6756  C  C5    . DA  I 5 39  ? 0.959   -31.602 10.858 1.00 121.74 ? -34  DA  I C5    1 
ATOM   6757  C  C6    . DA  I 5 39  ? 1.703   -31.773 9.672  1.00 121.15 ? -34  DA  I C6    1 
ATOM   6758  N  N6    . DA  I 5 39  ? 2.613   -30.891 9.252  1.00 121.01 ? -34  DA  I N6    1 
ATOM   6759  N  N1    . DA  I 5 39  ? 1.462   -32.882 8.936  1.00 121.26 ? -34  DA  I N1    1 
ATOM   6760  C  C2    . DA  I 5 39  ? 0.542   -33.762 9.357  1.00 121.32 ? -34  DA  I C2    1 
ATOM   6761  N  N3    . DA  I 5 39  ? -0.212  -33.712 10.456 1.00 121.64 ? -34  DA  I N3    1 
ATOM   6762  C  C4    . DA  I 5 39  ? 0.042   -32.594 11.166 1.00 121.68 ? -34  DA  I C4    1 
ATOM   6763  P  P     . DG  I 5 40  ? -3.364  -35.884 15.623 1.00 122.53 ? -33  DG  I P     1 
ATOM   6764  O  OP1   . DG  I 5 40  ? -4.726  -35.942 15.036 1.00 122.38 ? -33  DG  I OP1   1 
ATOM   6765  O  OP2   . DG  I 5 40  ? -3.166  -35.696 17.077 1.00 122.03 ? -33  DG  I OP2   1 
ATOM   6766  O  "O5'" . DG  I 5 40  ? -2.584  -37.199 15.148 1.00 124.29 ? -33  DG  I "O5'" 1 
ATOM   6767  C  "C5'" . DG  I 5 40  ? -2.909  -37.804 13.885 1.00 126.78 ? -33  DG  I "C5'" 1 
ATOM   6768  C  "C4'" . DG  I 5 40  ? -1.683  -38.382 13.189 1.00 128.61 ? -33  DG  I "C4'" 1 
ATOM   6769  O  "O4'" . DG  I 5 40  ? -0.916  -37.323 12.555 1.00 129.11 ? -33  DG  I "O4'" 1 
ATOM   6770  C  "C3'" . DG  I 5 40  ? -0.725  -39.155 14.092 1.00 129.65 ? -33  DG  I "C3'" 1 
ATOM   6771  O  "O3'" . DG  I 5 40  ? -0.529  -40.459 13.551 1.00 130.86 ? -33  DG  I "O3'" 1 
ATOM   6772  C  "C2'" . DG  I 5 40  ? 0.561   -38.330 14.086 1.00 129.80 ? -33  DG  I "C2'" 1 
ATOM   6773  C  "C1'" . DG  I 5 40  ? 0.461   -37.495 12.815 1.00 130.28 ? -33  DG  I "C1'" 1 
ATOM   6774  N  N9    . DG  I 5 40  ? 1.081   -36.175 12.950 1.00 130.71 ? -33  DG  I N9    1 
ATOM   6775  C  C8    . DG  I 5 40  ? 0.852   -35.259 13.952 1.00 130.74 ? -33  DG  I C8    1 
ATOM   6776  N  N7    . DG  I 5 40  ? 1.541   -34.159 13.829 1.00 130.88 ? -33  DG  I N7    1 
ATOM   6777  C  C5    . DG  I 5 40  ? 2.285   -34.355 12.672 1.00 130.77 ? -33  DG  I C5    1 
ATOM   6778  C  C6    . DG  I 5 40  ? 3.220   -33.501 12.037 1.00 130.56 ? -33  DG  I C6    1 
ATOM   6779  O  O6    . DG  I 5 40  ? 3.577   -32.369 12.381 1.00 130.62 ? -33  DG  I O6    1 
ATOM   6780  N  N1    . DG  I 5 40  ? 3.753   -34.061 10.881 1.00 130.55 ? -33  DG  I N1    1 
ATOM   6781  C  C2    . DG  I 5 40  ? 3.422   -35.308 10.406 1.00 130.63 ? -33  DG  I C2    1 
ATOM   6782  N  N2    . DG  I 5 40  ? 4.036   -35.688 9.280  1.00 130.73 ? -33  DG  I N2    1 
ATOM   6783  N  N3    . DG  I 5 40  ? 2.548   -36.124 10.989 1.00 130.61 ? -33  DG  I N3    1 
ATOM   6784  C  C4    . DG  I 5 40  ? 2.015   -35.588 12.117 1.00 130.78 ? -33  DG  I C4    1 
ATOM   6785  P  P     . DT  I 5 41  ? 0.161   -41.663 14.358 1.00 131.21 ? -32  DT  I P     1 
ATOM   6786  O  OP1   . DT  I 5 41  ? -0.894  -42.679 14.568 1.00 130.70 ? -32  DT  I OP1   1 
ATOM   6787  O  OP2   . DT  I 5 41  ? 0.928   -41.161 15.524 1.00 131.13 ? -32  DT  I OP2   1 
ATOM   6788  O  "O5'" . DT  I 5 41  ? 1.231   -42.185 13.284 1.00 132.00 ? -32  DT  I "O5'" 1 
ATOM   6789  C  "C5'" . DT  I 5 41  ? 1.673   -41.348 12.204 1.00 133.21 ? -32  DT  I "C5'" 1 
ATOM   6790  C  "C4'" . DT  I 5 41  ? 3.183   -41.135 12.161 1.00 134.02 ? -32  DT  I "C4'" 1 
ATOM   6791  O  "O4'" . DT  I 5 41  ? 3.491   -39.718 12.289 1.00 133.80 ? -32  DT  I "O4'" 1 
ATOM   6792  C  "C3'" . DT  I 5 41  ? 4.028   -41.848 13.218 1.00 134.64 ? -32  DT  I "C3'" 1 
ATOM   6793  O  "O3'" . DT  I 5 41  ? 5.146   -42.467 12.575 1.00 136.07 ? -32  DT  I "O3'" 1 
ATOM   6794  C  "C2'" . DT  I 5 41  ? 4.462   -40.698 14.120 1.00 134.47 ? -32  DT  I "C2'" 1 
ATOM   6795  C  "C1'" . DT  I 5 41  ? 4.654   -39.606 13.074 1.00 134.30 ? -32  DT  I "C1'" 1 
ATOM   6796  N  N1    . DT  I 5 41  ? 4.797   -38.206 13.610 1.00 134.65 ? -32  DT  I N1    1 
ATOM   6797  C  C2    . DT  I 5 41  ? 5.676   -37.316 13.011 1.00 134.74 ? -32  DT  I C2    1 
ATOM   6798  O  O2    . DT  I 5 41  ? 6.367   -37.585 12.045 1.00 134.74 ? -32  DT  I O2    1 
ATOM   6799  N  N3    . DT  I 5 41  ? 5.723   -36.070 13.595 1.00 134.68 ? -32  DT  I N3    1 
ATOM   6800  C  C4    . DT  I 5 41  ? 5.002   -35.620 14.688 1.00 134.48 ? -32  DT  I C4    1 
ATOM   6801  O  O4    . DT  I 5 41  ? 5.132   -34.479 15.120 1.00 134.23 ? -32  DT  I O4    1 
ATOM   6802  C  C5    . DT  I 5 41  ? 4.108   -36.598 15.273 1.00 134.81 ? -32  DT  I C5    1 
ATOM   6803  C  C7    . DT  I 5 41  ? 3.259   -36.269 16.468 1.00 134.87 ? -32  DT  I C7    1 
ATOM   6804  C  C6    . DT  I 5 41  ? 4.053   -37.816 14.712 1.00 135.02 ? -32  DT  I C6    1 
ATOM   6805  P  P     . DA  I 5 42  ? 6.140   -43.457 13.357 1.00 137.03 ? -31  DA  I P     1 
ATOM   6806  O  OP1   . DA  I 5 42  ? 5.430   -44.748 13.460 1.00 136.83 ? -31  DA  I OP1   1 
ATOM   6807  O  OP2   . DA  I 5 42  ? 6.615   -42.802 14.602 1.00 136.79 ? -31  DA  I OP2   1 
ATOM   6808  O  "O5'" . DA  I 5 42  ? 7.397   -43.625 12.368 1.00 136.96 ? -31  DA  I "O5'" 1 
ATOM   6809  C  "C5'" . DA  I 5 42  ? 7.625   -42.788 11.228 1.00 137.14 ? -31  DA  I "C5'" 1 
ATOM   6810  C  "C4'" . DA  I 5 42  ? 8.835   -41.880 11.411 1.00 137.76 ? -31  DA  I "C4'" 1 
ATOM   6811  O  "O4'" . DA  I 5 42  ? 8.393   -40.655 12.052 1.00 137.89 ? -31  DA  I "O4'" 1 
ATOM   6812  C  "C3'" . DA  I 5 42  ? 9.983   -42.408 12.280 1.00 138.44 ? -31  DA  I "C3'" 1 
ATOM   6813  O  "O3'" . DA  I 5 42  ? 11.265  -41.898 11.844 1.00 139.65 ? -31  DA  I "O3'" 1 
ATOM   6814  C  "C2'" . DA  I 5 42  ? 9.606   -41.824 13.634 1.00 138.54 ? -31  DA  I "C2'" 1 
ATOM   6815  C  "C1'" . DA  I 5 42  ? 9.243   -40.423 13.157 1.00 138.55 ? -31  DA  I "C1'" 1 
ATOM   6816  N  N9    . DA  I 5 42  ? 8.628   -39.572 14.180 1.00 138.64 ? -31  DA  I N9    1 
ATOM   6817  C  C8    . DA  I 5 42  ? 7.833   -39.974 15.220 1.00 138.57 ? -31  DA  I C8    1 
ATOM   6818  N  N7    . DA  I 5 42  ? 7.438   -38.993 15.994 1.00 138.74 ? -31  DA  I N7    1 
ATOM   6819  C  C5    . DA  I 5 42  ? 8.015   -37.865 15.430 1.00 138.77 ? -31  DA  I C5    1 
ATOM   6820  C  C6    . DA  I 5 42  ? 7.982   -36.494 15.781 1.00 138.77 ? -31  DA  I C6    1 
ATOM   6821  N  N6    . DA  I 5 42  ? 7.300   -36.027 16.837 1.00 138.57 ? -31  DA  I N6    1 
ATOM   6822  N  N1    . DA  I 5 42  ? 8.671   -35.622 15.002 1.00 138.72 ? -31  DA  I N1    1 
ATOM   6823  C  C2    . DA  I 5 42  ? 9.352   -36.090 13.945 1.00 138.48 ? -31  DA  I C2    1 
ATOM   6824  N  N3    . DA  I 5 42  ? 9.455   -37.353 13.524 1.00 138.56 ? -31  DA  I N3    1 
ATOM   6825  C  C4    . DA  I 5 42  ? 8.759   -38.202 14.310 1.00 138.65 ? -31  DA  I C4    1 
ATOM   6826  P  P     . DA  I 5 43  ? 12.649  -42.266 12.595 1.00 140.48 ? -30  DA  I P     1 
ATOM   6827  O  OP1   . DA  I 5 43  ? 12.799  -43.732 12.504 1.00 140.60 ? -30  DA  I OP1   1 
ATOM   6828  O  OP2   . DA  I 5 43  ? 12.699  -41.617 13.924 1.00 140.49 ? -30  DA  I OP2   1 
ATOM   6829  O  "O5'" . DA  I 5 43  ? 13.783  -41.566 11.707 1.00 140.84 ? -30  DA  I "O5'" 1 
ATOM   6830  C  "C5'" . DA  I 5 43  ? 13.632  -40.223 11.236 1.00 141.76 ? -30  DA  I "C5'" 1 
ATOM   6831  C  "C4'" . DA  I 5 43  ? 14.323  -39.175 12.101 1.00 142.34 ? -30  DA  I "C4'" 1 
ATOM   6832  O  "O4'" . DA  I 5 43  ? 13.325  -38.502 12.911 1.00 142.82 ? -30  DA  I "O4'" 1 
ATOM   6833  C  "C3'" . DA  I 5 43  ? 15.431  -39.622 13.068 1.00 142.27 ? -30  DA  I "C3'" 1 
ATOM   6834  O  "O3'" . DA  I 5 43  ? 16.664  -38.951 12.693 1.00 141.73 ? -30  DA  I "O3'" 1 
ATOM   6835  C  "C2'" . DA  I 5 43  ? 14.870  -39.261 14.450 1.00 142.68 ? -30  DA  I "C2'" 1 
ATOM   6836  C  "C1'" . DA  I 5 43  ? 13.964  -38.087 14.098 1.00 143.05 ? -30  DA  I "C1'" 1 
ATOM   6837  N  N9    . DA  I 5 43  ? 12.947  -37.728 15.084 1.00 143.04 ? -30  DA  I N9    1 
ATOM   6838  C  C8    . DA  I 5 43  ? 11.936  -38.522 15.544 1.00 143.13 ? -30  DA  I C8    1 
ATOM   6839  N  N7    . DA  I 5 43  ? 11.163  -37.932 16.423 1.00 143.38 ? -30  DA  I N7    1 
ATOM   6840  C  C5    . DA  I 5 43  ? 11.691  -36.658 16.543 1.00 143.29 ? -30  DA  I C5    1 
ATOM   6841  C  C6    . DA  I 5 43  ? 11.319  -35.537 17.321 1.00 143.20 ? -30  DA  I C6    1 
ATOM   6842  N  N6    . DA  I 5 43  ? 10.276  -35.537 18.156 1.00 143.08 ? -30  DA  I N6    1 
ATOM   6843  N  N1    . DA  I 5 43  ? 12.061  -34.410 17.209 1.00 143.20 ? -30  DA  I N1    1 
ATOM   6844  C  C2    . DA  I 5 43  ? 13.105  -34.412 16.367 1.00 143.27 ? -30  DA  I C2    1 
ATOM   6845  N  N3    . DA  I 5 43  ? 13.549  -35.406 15.588 1.00 143.36 ? -30  DA  I N3    1 
ATOM   6846  C  C4    . DA  I 5 43  ? 12.793  -36.513 15.719 1.00 143.25 ? -30  DA  I C4    1 
ATOM   6847  P  P     . DT  I 5 44  ? 17.676  -38.147 13.658 1.00 141.83 ? -29  DT  I P     1 
ATOM   6848  O  OP1   . DT  I 5 44  ? 18.948  -37.980 12.919 1.00 141.66 ? -29  DT  I OP1   1 
ATOM   6849  O  OP2   . DT  I 5 44  ? 17.706  -38.790 14.995 1.00 141.68 ? -29  DT  I OP2   1 
ATOM   6850  O  "O5'" . DT  I 5 44  ? 16.988  -36.703 13.785 1.00 140.92 ? -29  DT  I "O5'" 1 
ATOM   6851  C  "C5'" . DT  I 5 44  ? 17.781  -35.512 13.832 1.00 139.33 ? -29  DT  I "C5'" 1 
ATOM   6852  C  "C4'" . DT  I 5 44  ? 17.899  -34.963 15.247 1.00 138.08 ? -29  DT  I "C4'" 1 
ATOM   6853  O  "O4'" . DT  I 5 44  ? 16.649  -35.153 15.961 1.00 137.52 ? -29  DT  I "O4'" 1 
ATOM   6854  C  "C3'" . DT  I 5 44  ? 18.999  -35.586 16.115 1.00 137.39 ? -29  DT  I "C3'" 1 
ATOM   6855  O  "O3'" . DT  I 5 44  ? 19.944  -34.559 16.519 1.00 136.23 ? -29  DT  I "O3'" 1 
ATOM   6856  C  "C2'" . DT  I 5 44  ? 18.219  -36.263 17.246 1.00 137.52 ? -29  DT  I "C2'" 1 
ATOM   6857  C  "C1'" . DT  I 5 44  ? 16.983  -35.376 17.310 1.00 137.32 ? -29  DT  I "C1'" 1 
ATOM   6858  N  N1    . DT  I 5 44  ? 15.809  -35.937 18.045 1.00 137.15 ? -29  DT  I N1    1 
ATOM   6859  C  C2    . DT  I 5 44  ? 15.157  -35.126 18.957 1.00 137.28 ? -29  DT  I C2    1 
ATOM   6860  O  O2    . DT  I 5 44  ? 15.479  -33.974 19.199 1.00 137.27 ? -29  DT  I O2    1 
ATOM   6861  N  N3    . DT  I 5 44  ? 14.090  -35.715 19.587 1.00 137.32 ? -29  DT  I N3    1 
ATOM   6862  C  C4    . DT  I 5 44  ? 13.621  -37.004 19.405 1.00 137.25 ? -29  DT  I C4    1 
ATOM   6863  O  O4    . DT  I 5 44  ? 12.651  -37.420 20.032 1.00 137.09 ? -29  DT  I O4    1 
ATOM   6864  C  C5    . DT  I 5 44  ? 14.350  -37.801 18.438 1.00 137.26 ? -29  DT  I C5    1 
ATOM   6865  C  C7    . DT  I 5 44  ? 13.945  -39.218 18.149 1.00 137.37 ? -29  DT  I C7    1 
ATOM   6866  C  C6    . DT  I 5 44  ? 15.395  -37.237 17.813 1.00 137.09 ? -29  DT  I C6    1 
ATOM   6867  P  P     . DC  I 5 45  ? 20.418  -34.179 18.009 1.00 135.46 ? -28  DC  I P     1 
ATOM   6868  O  OP1   . DC  I 5 45  ? 21.755  -33.564 17.878 1.00 135.76 ? -28  DC  I OP1   1 
ATOM   6869  O  OP2   . DC  I 5 45  ? 20.251  -35.327 18.926 1.00 134.74 ? -28  DC  I OP2   1 
ATOM   6870  O  "O5'" . DC  I 5 45  ? 19.371  -33.038 18.420 1.00 136.41 ? -28  DC  I "O5'" 1 
ATOM   6871  C  "C5'" . DC  I 5 45  ? 19.745  -31.652 18.550 1.00 136.69 ? -28  DC  I "C5'" 1 
ATOM   6872  C  "C4'" . DC  I 5 45  ? 19.332  -31.067 19.898 1.00 136.94 ? -28  DC  I "C4'" 1 
ATOM   6873  O  "O4'" . DC  I 5 45  ? 18.218  -31.810 20.474 1.00 136.71 ? -28  DC  I "O4'" 1 
ATOM   6874  C  "C3'" . DC  I 5 45  ? 20.413  -31.070 20.978 1.00 137.29 ? -28  DC  I "C3'" 1 
ATOM   6875  O  "O3'" . DC  I 5 45  ? 20.174  -30.057 21.952 1.00 138.25 ? -28  DC  I "O3'" 1 
ATOM   6876  C  "C2'" . DC  I 5 45  ? 20.165  -32.424 21.633 1.00 137.02 ? -28  DC  I "C2'" 1 
ATOM   6877  C  "C1'" . DC  I 5 45  ? 18.634  -32.410 21.691 1.00 136.35 ? -28  DC  I "C1'" 1 
ATOM   6878  N  N1    . DC  I 5 45  ? 17.954  -33.745 21.830 1.00 136.16 ? -28  DC  I N1    1 
ATOM   6879  C  C2    . DC  I 5 45  ? 16.597  -33.803 22.196 1.00 136.09 ? -28  DC  I C2    1 
ATOM   6880  O  O2    . DC  I 5 45  ? 15.970  -32.752 22.403 1.00 135.74 ? -28  DC  I O2    1 
ATOM   6881  N  N3    . DC  I 5 45  ? 16.005  -35.027 22.312 1.00 135.90 ? -28  DC  I N3    1 
ATOM   6882  C  C4    . DC  I 5 45  ? 16.705  -36.145 22.080 1.00 135.86 ? -28  DC  I C4    1 
ATOM   6883  N  N4    . DC  I 5 45  ? 16.086  -37.321 22.205 1.00 135.69 ? -28  DC  I N4    1 
ATOM   6884  C  C5    . DC  I 5 45  ? 18.081  -36.107 21.706 1.00 135.76 ? -28  DC  I C5    1 
ATOM   6885  C  C6    . DC  I 5 45  ? 18.652  -34.902 21.595 1.00 136.04 ? -28  DC  I C6    1 
ATOM   6886  P  P     . DC  I 5 46  ? 20.548  -28.503 21.796 1.00 139.13 ? -27  DC  I P     1 
ATOM   6887  O  OP1   . DC  I 5 46  ? 20.240  -28.055 20.411 1.00 138.60 ? -27  DC  I OP1   1 
ATOM   6888  O  OP2   . DC  I 5 46  ? 21.902  -28.319 22.372 1.00 139.16 ? -27  DC  I OP2   1 
ATOM   6889  O  "O5'" . DC  I 5 46  ? 19.537  -27.792 22.822 1.00 138.73 ? -27  DC  I "O5'" 1 
ATOM   6890  C  "C5'" . DC  I 5 46  ? 18.250  -28.351 23.121 1.00 138.04 ? -27  DC  I "C5'" 1 
ATOM   6891  C  "C4'" . DC  I 5 46  ? 18.144  -28.968 24.512 1.00 137.42 ? -27  DC  I "C4'" 1 
ATOM   6892  O  "O4'" . DC  I 5 46  ? 18.083  -30.414 24.409 1.00 137.81 ? -27  DC  I "O4'" 1 
ATOM   6893  C  "C3'" . DC  I 5 46  ? 19.255  -28.685 25.525 1.00 136.69 ? -27  DC  I "C3'" 1 
ATOM   6894  O  "O3'" . DC  I 5 46  ? 18.651  -28.104 26.659 1.00 135.13 ? -27  DC  I "O3'" 1 
ATOM   6895  C  "C2'" . DC  I 5 46  ? 19.833  -30.061 25.868 1.00 137.18 ? -27  DC  I "C2'" 1 
ATOM   6896  C  "C1'" . DC  I 5 46  ? 18.615  -30.939 25.606 1.00 138.11 ? -27  DC  I "C1'" 1 
ATOM   6897  N  N1    . DC  I 5 46  ? 18.827  -32.417 25.418 1.00 138.57 ? -27  DC  I N1    1 
ATOM   6898  C  C2    . DC  I 5 46  ? 17.700  -33.260 25.421 1.00 138.65 ? -27  DC  I C2    1 
ATOM   6899  O  O2    . DC  I 5 46  ? 16.571  -32.784 25.581 1.00 138.79 ? -27  DC  I O2    1 
ATOM   6900  N  N3    . DC  I 5 46  ? 17.869  -34.594 25.249 1.00 138.69 ? -27  DC  I N3    1 
ATOM   6901  C  C4    . DC  I 5 46  ? 19.093  -35.095 25.081 1.00 138.65 ? -27  DC  I C4    1 
ATOM   6902  N  N4    . DC  I 5 46  ? 19.188  -36.418 24.918 1.00 138.72 ? -27  DC  I N4    1 
ATOM   6903  C  C5    . DC  I 5 46  ? 20.259  -34.263 25.074 1.00 138.64 ? -27  DC  I C5    1 
ATOM   6904  C  C6    . DC  I 5 46  ? 20.082  -32.944 25.242 1.00 138.60 ? -27  DC  I C6    1 
ATOM   6905  P  P     . DC  I 5 47  ? 19.451  -27.086 27.594 1.00 133.85 ? -26  DC  I P     1 
ATOM   6906  O  OP1   . DC  I 5 47  ? 19.544  -25.802 26.859 1.00 133.68 ? -26  DC  I OP1   1 
ATOM   6907  O  OP2   . DC  I 5 47  ? 20.673  -27.768 28.074 1.00 133.25 ? -26  DC  I OP2   1 
ATOM   6908  O  "O5'" . DC  I 5 47  ? 18.465  -26.921 28.852 1.00 132.57 ? -26  DC  I "O5'" 1 
ATOM   6909  C  "C5'" . DC  I 5 47  ? 17.118  -26.455 28.680 1.00 129.91 ? -26  DC  I "C5'" 1 
ATOM   6910  C  "C4'" . DC  I 5 47  ? 16.074  -27.426 29.221 1.00 127.88 ? -26  DC  I "C4'" 1 
ATOM   6911  O  "O4'" . DC  I 5 47  ? 16.428  -28.798 28.905 1.00 127.78 ? -26  DC  I "O4'" 1 
ATOM   6912  C  "C3'" . DC  I 5 47  ? 15.827  -27.395 30.728 1.00 126.04 ? -26  DC  I "C3'" 1 
ATOM   6913  O  "O3'" . DC  I 5 47  ? 14.424  -27.219 30.958 1.00 122.87 ? -26  DC  I "O3'" 1 
ATOM   6914  C  "C2'" . DC  I 5 47  ? 16.329  -28.753 31.219 1.00 126.55 ? -26  DC  I "C2'" 1 
ATOM   6915  C  "C1'" . DC  I 5 47  ? 16.091  -29.627 29.995 1.00 127.59 ? -26  DC  I "C1'" 1 
ATOM   6916  N  N1    . DC  I 5 47  ? 16.907  -30.899 29.927 1.00 128.18 ? -26  DC  I N1    1 
ATOM   6917  C  C2    . DC  I 5 47  ? 16.431  -32.093 30.515 1.00 128.27 ? -26  DC  I C2    1 
ATOM   6918  O  O2    . DC  I 5 47  ? 15.337  -32.107 31.101 1.00 128.25 ? -26  DC  I O2    1 
ATOM   6919  N  N3    . DC  I 5 47  ? 17.195  -33.217 30.426 1.00 128.00 ? -26  DC  I N3    1 
ATOM   6920  C  C4    . DC  I 5 47  ? 18.371  -33.192 29.791 1.00 127.93 ? -26  DC  I C4    1 
ATOM   6921  N  N4    . DC  I 5 47  ? 19.077  -34.323 29.735 1.00 127.92 ? -26  DC  I N4    1 
ATOM   6922  C  C5    . DC  I 5 47  ? 18.874  -32.000 29.187 1.00 128.26 ? -26  DC  I C5    1 
ATOM   6923  C  C6    . DC  I 5 47  ? 18.118  -30.895 29.278 1.00 128.37 ? -26  DC  I C6    1 
ATOM   6924  P  P     . DC  I 5 48  ? 13.883  -26.591 32.328 1.00 120.33 ? -25  DC  I P     1 
ATOM   6925  O  OP1   . DC  I 5 48  ? 12.513  -26.072 32.122 1.00 120.00 ? -25  DC  I OP1   1 
ATOM   6926  O  OP2   . DC  I 5 48  ? 14.938  -25.739 32.907 1.00 119.76 ? -25  DC  I OP2   1 
ATOM   6927  O  "O5'" . DC  I 5 48  ? 13.775  -27.884 33.247 1.00 119.70 ? -25  DC  I "O5'" 1 
ATOM   6928  C  "C5'" . DC  I 5 48  ? 12.709  -28.805 33.066 1.00 117.59 ? -25  DC  I "C5'" 1 
ATOM   6929  C  "C4'" . DC  I 5 48  ? 12.994  -30.031 33.903 1.00 116.14 ? -25  DC  I "C4'" 1 
ATOM   6930  O  "O4'" . DC  I 5 48  ? 14.228  -30.627 33.426 1.00 116.45 ? -25  DC  I "O4'" 1 
ATOM   6931  C  "C3'" . DC  I 5 48  ? 13.183  -29.745 35.397 1.00 114.87 ? -25  DC  I "C3'" 1 
ATOM   6932  O  "O3'" . DC  I 5 48  ? 12.398  -30.618 36.232 1.00 113.30 ? -25  DC  I "O3'" 1 
ATOM   6933  C  "C2'" . DC  I 5 48  ? 14.681  -29.988 35.584 1.00 115.44 ? -25  DC  I "C2'" 1 
ATOM   6934  C  "C1'" . DC  I 5 48  ? 14.902  -31.106 34.565 1.00 116.28 ? -25  DC  I "C1'" 1 
ATOM   6935  N  N1    . DC  I 5 48  ? 16.322  -31.527 34.224 1.00 116.30 ? -25  DC  I N1    1 
ATOM   6936  C  C2    . DC  I 5 48  ? 16.603  -32.887 33.961 1.00 116.56 ? -25  DC  I C2    1 
ATOM   6937  O  O2    . DC  I 5 48  ? 15.712  -33.738 34.009 1.00 116.85 ? -25  DC  I O2    1 
ATOM   6938  N  N3    . DC  I 5 48  ? 17.868  -33.267 33.656 1.00 116.73 ? -25  DC  I N3    1 
ATOM   6939  C  C4    . DC  I 5 48  ? 18.842  -32.359 33.604 1.00 116.85 ? -25  DC  I C4    1 
ATOM   6940  N  N4    . DC  I 5 48  ? 20.065  -32.798 33.298 1.00 116.45 ? -25  DC  I N4    1 
ATOM   6941  C  C5    . DC  I 5 48  ? 18.592  -30.973 33.866 1.00 116.98 ? -25  DC  I C5    1 
ATOM   6942  C  C6    . DC  I 5 48  ? 17.333  -30.605 34.166 1.00 116.43 ? -25  DC  I C6    1 
ATOM   6943  P  P     . DT  I 5 49  ? 10.793  -30.567 36.350 1.00 112.23 ? -24  DT  I P     1 
ATOM   6944  O  OP1   . DT  I 5 49  ? 10.192  -30.279 35.025 1.00 111.60 ? -24  DT  I OP1   1 
ATOM   6945  O  OP2   . DT  I 5 49  ? 10.474  -29.744 37.531 1.00 112.65 ? -24  DT  I OP2   1 
ATOM   6946  O  "O5'" . DT  I 5 49  ? 10.401  -32.061 36.764 1.00 112.37 ? -24  DT  I "O5'" 1 
ATOM   6947  C  "C5'" . DT  I 5 49  ? 10.455  -33.135 35.803 1.00 111.93 ? -24  DT  I "C5'" 1 
ATOM   6948  C  "C4'" . DT  I 5 49  ? 11.329  -34.293 36.268 1.00 111.08 ? -24  DT  I "C4'" 1 
ATOM   6949  O  "O4'" . DT  I 5 49  ? 12.740  -34.050 36.002 1.00 110.67 ? -24  DT  I "O4'" 1 
ATOM   6950  C  "C3'" . DT  I 5 49  ? 11.227  -34.609 37.761 1.00 110.70 ? -24  DT  I "C3'" 1 
ATOM   6951  O  "O3'" . DT  I 5 49  ? 10.578  -35.877 37.941 1.00 109.38 ? -24  DT  I "O3'" 1 
ATOM   6952  C  "C2'" . DT  I 5 49  ? 12.681  -34.573 38.256 1.00 111.15 ? -24  DT  I "C2'" 1 
ATOM   6953  C  "C1'" . DT  I 5 49  ? 13.458  -34.799 36.960 1.00 111.52 ? -24  DT  I "C1'" 1 
ATOM   6954  N  N1    . DT  I 5 49  ? 14.928  -34.431 36.966 1.00 111.54 ? -24  DT  I N1    1 
ATOM   6955  C  C2    . DT  I 5 49  ? 15.877  -35.389 36.614 1.00 112.10 ? -24  DT  I C2    1 
ATOM   6956  O  O2    . DT  I 5 49  ? 15.645  -36.545 36.291 1.00 112.36 ? -24  DT  I O2    1 
ATOM   6957  N  N3    . DT  I 5 49  ? 17.170  -34.951 36.647 1.00 111.87 ? -24  DT  I N3    1 
ATOM   6958  C  C4    . DT  I 5 49  ? 17.616  -33.695 36.990 1.00 111.88 ? -24  DT  I C4    1 
ATOM   6959  O  O4    . DT  I 5 49  ? 18.809  -33.417 36.986 1.00 112.30 ? -24  DT  I O4    1 
ATOM   6960  C  C5    . DT  I 5 49  ? 16.597  -32.743 37.348 1.00 111.85 ? -24  DT  I C5    1 
ATOM   6961  C  C7    . DT  I 5 49  ? 16.998  -31.345 37.737 1.00 111.97 ? -24  DT  I C7    1 
ATOM   6962  C  C6    . DT  I 5 49  ? 15.317  -33.153 37.319 1.00 111.35 ? -24  DT  I C6    1 
ATOM   6963  P  P     . DT  I 5 50  ? 9.959   -36.301 39.352 1.00 108.08 ? -23  DT  I P     1 
ATOM   6964  O  OP1   . DT  I 5 50  ? 8.611   -36.842 39.124 1.00 108.15 ? -23  DT  I OP1   1 
ATOM   6965  O  OP2   . DT  I 5 50  ? 10.158  -35.206 40.319 1.00 108.59 ? -23  DT  I OP2   1 
ATOM   6966  O  "O5'" . DT  I 5 50  ? 10.905  -37.493 39.799 1.00 110.82 ? -23  DT  I "O5'" 1 
ATOM   6967  C  "C5'" . DT  I 5 50  ? 11.116  -38.594 38.924 1.00 114.26 ? -23  DT  I "C5'" 1 
ATOM   6968  C  "C4'" . DT  I 5 50  ? 12.501  -39.167 39.141 1.00 116.69 ? -23  DT  I "C4'" 1 
ATOM   6969  O  "O4'" . DT  I 5 50  ? 13.510  -38.158 38.919 1.00 117.12 ? -23  DT  I "O4'" 1 
ATOM   6970  C  "C3'" . DT  I 5 50  ? 12.736  -39.666 40.561 1.00 118.51 ? -23  DT  I "C3'" 1 
ATOM   6971  O  "O3'" . DT  I 5 50  ? 12.838  -41.085 40.511 1.00 120.57 ? -23  DT  I "O3'" 1 
ATOM   6972  C  "C2'" . DT  I 5 50  ? 14.021  -38.972 41.022 1.00 117.98 ? -23  DT  I "C2'" 1 
ATOM   6973  C  "C1'" . DT  I 5 50  ? 14.617  -38.519 39.701 1.00 117.83 ? -23  DT  I "C1'" 1 
ATOM   6974  N  N1    . DT  I 5 50  ? 15.552  -37.373 39.802 1.00 117.86 ? -23  DT  I N1    1 
ATOM   6975  C  C2    . DT  I 5 50  ? 16.864  -37.582 39.452 1.00 118.12 ? -23  DT  I C2    1 
ATOM   6976  O  O2    . DT  I 5 50  ? 17.290  -38.653 39.066 1.00 118.79 ? -23  DT  I O2    1 
ATOM   6977  N  N3    . DT  I 5 50  ? 17.672  -36.485 39.574 1.00 118.22 ? -23  DT  I N3    1 
ATOM   6978  C  C4    . DT  I 5 50  ? 17.305  -35.220 39.998 1.00 118.27 ? -23  DT  I C4    1 
ATOM   6979  O  O4    . DT  I 5 50  ? 18.113  -34.299 40.069 1.00 118.25 ? -23  DT  I O4    1 
ATOM   6980  C  C5    . DT  I 5 50  ? 15.912  -35.061 40.347 1.00 118.46 ? -23  DT  I C5    1 
ATOM   6981  C  C7    . DT  I 5 50  ? 15.398  -33.730 40.823 1.00 118.47 ? -23  DT  I C7    1 
ATOM   6982  C  C6    . DT  I 5 50  ? 15.113  -36.136 40.236 1.00 118.20 ? -23  DT  I C6    1 
ATOM   6983  P  P     . DG  I 5 51  ? 12.821  -41.963 41.838 1.00 121.86 ? -22  DG  I P     1 
ATOM   6984  O  OP1   . DG  I 5 51  ? 12.334  -43.313 41.477 1.00 121.65 ? -22  DG  I OP1   1 
ATOM   6985  O  OP2   . DG  I 5 51  ? 12.170  -41.200 42.928 1.00 121.41 ? -22  DG  I OP2   1 
ATOM   6986  O  "O5'" . DG  I 5 51  ? 14.384  -42.024 42.140 1.00 124.13 ? -22  DG  I "O5'" 1 
ATOM   6987  C  "C5'" . DG  I 5 51  ? 15.268  -42.492 41.137 1.00 128.29 ? -22  DG  I "C5'" 1 
ATOM   6988  C  "C4'" . DG  I 5 51  ? 16.672  -42.409 41.675 1.00 131.62 ? -22  DG  I "C4'" 1 
ATOM   6989  O  "O4'" . DG  I 5 51  ? 17.149  -41.064 41.447 1.00 132.87 ? -22  DG  I "O4'" 1 
ATOM   6990  C  "C3'" . DG  I 5 51  ? 16.769  -42.664 43.178 1.00 133.63 ? -22  DG  I "C3'" 1 
ATOM   6991  O  "O3'" . DG  I 5 51  ? 17.855  -43.533 43.447 1.00 136.07 ? -22  DG  I "O3'" 1 
ATOM   6992  C  "C2'" . DG  I 5 51  ? 17.020  -41.277 43.758 1.00 134.17 ? -22  DG  I "C2'" 1 
ATOM   6993  C  "C1'" . DG  I 5 51  ? 17.816  -40.654 42.620 1.00 134.70 ? -22  DG  I "C1'" 1 
ATOM   6994  N  N9    . DG  I 5 51  ? 17.902  -39.197 42.692 1.00 135.00 ? -22  DG  I N9    1 
ATOM   6995  C  C8    . DG  I 5 51  ? 16.874  -38.305 42.880 1.00 134.95 ? -22  DG  I C8    1 
ATOM   6996  N  N7    . DG  I 5 51  ? 17.273  -37.066 42.909 1.00 135.26 ? -22  DG  I N7    1 
ATOM   6997  C  C5    . DG  I 5 51  ? 18.653  -37.138 42.731 1.00 135.28 ? -22  DG  I C5    1 
ATOM   6998  C  C6    . DG  I 5 51  ? 19.639  -36.116 42.676 1.00 135.08 ? -22  DG  I C6    1 
ATOM   6999  O  O6    . DG  I 5 51  ? 19.485  -34.894 42.772 1.00 135.30 ? -22  DG  I O6    1 
ATOM   7000  N  N1    . DG  I 5 51  ? 20.925  -36.615 42.489 1.00 134.94 ? -22  DG  I N1    1 
ATOM   7001  C  C2    . DG  I 5 51  ? 21.226  -37.949 42.367 1.00 135.20 ? -22  DG  I C2    1 
ATOM   7002  N  N2    . DG  I 5 51  ? 22.520  -38.247 42.186 1.00 135.25 ? -22  DG  I N2    1 
ATOM   7003  N  N3    . DG  I 5 51  ? 20.317  -38.920 42.413 1.00 135.51 ? -22  DG  I N3    1 
ATOM   7004  C  C4    . DG  I 5 51  ? 19.054  -38.447 42.597 1.00 135.24 ? -22  DG  I C4    1 
ATOM   7005  P  P     . DG  I 5 52  ? 17.924  -44.433 44.775 1.00 137.75 ? -21  DG  I P     1 
ATOM   7006  O  OP1   . DG  I 5 52  ? 17.253  -45.711 44.461 1.00 137.80 ? -21  DG  I OP1   1 
ATOM   7007  O  OP2   . DG  I 5 52  ? 17.493  -43.658 45.963 1.00 137.30 ? -21  DG  I OP2   1 
ATOM   7008  O  "O5'" . DG  I 5 52  ? 19.497  -44.700 44.895 1.00 139.22 ? -21  DG  I "O5'" 1 
ATOM   7009  C  "C5'" . DG  I 5 52  ? 20.447  -43.909 44.175 1.00 141.86 ? -21  DG  I "C5'" 1 
ATOM   7010  C  "C4'" . DG  I 5 52  ? 21.303  -43.095 45.128 1.00 144.00 ? -21  DG  I "C4'" 1 
ATOM   7011  O  "O4'" . DG  I 5 52  ? 21.147  -41.680 44.828 1.00 145.02 ? -21  DG  I "O4'" 1 
ATOM   7012  C  "C3'" . DG  I 5 52  ? 20.966  -43.245 46.616 1.00 145.10 ? -21  DG  I "C3'" 1 
ATOM   7013  O  "O3'" . DG  I 5 52  ? 22.178  -43.378 47.358 1.00 146.14 ? -21  DG  I "O3'" 1 
ATOM   7014  C  "C2'" . DG  I 5 52  ? 20.237  -41.939 46.925 1.00 145.42 ? -21  DG  I "C2'" 1 
ATOM   7015  C  "C1'" . DG  I 5 52  ? 21.099  -41.016 46.075 1.00 145.87 ? -21  DG  I "C1'" 1 
ATOM   7016  N  N9    . DG  I 5 52  ? 20.633  -39.633 45.968 1.00 145.92 ? -21  DG  I N9    1 
ATOM   7017  C  C8    . DG  I 5 52  ? 19.348  -39.186 45.782 1.00 145.99 ? -21  DG  I C8    1 
ATOM   7018  N  N7    . DG  I 5 52  ? 19.255  -37.885 45.741 1.00 146.11 ? -21  DG  I N7    1 
ATOM   7019  C  C5    . DG  I 5 52  ? 20.557  -37.434 45.912 1.00 146.09 ? -21  DG  I C5    1 
ATOM   7020  C  C6    . DG  I 5 52  ? 21.081  -36.112 45.954 1.00 146.17 ? -21  DG  I C6    1 
ATOM   7021  O  O6    . DG  I 5 52  ? 20.471  -35.040 45.845 1.00 146.05 ? -21  DG  I O6    1 
ATOM   7022  N  N1    . DG  I 5 52  ? 22.465  -36.094 46.153 1.00 146.25 ? -21  DG  I N1    1 
ATOM   7023  C  C2    . DG  I 5 52  ? 23.248  -37.221 46.288 1.00 146.21 ? -21  DG  I C2    1 
ATOM   7024  N  N2    . DG  I 5 52  ? 24.560  -37.009 46.470 1.00 146.04 ? -21  DG  I N2    1 
ATOM   7025  N  N3    . DG  I 5 52  ? 22.771  -38.466 46.249 1.00 146.20 ? -21  DG  I N3    1 
ATOM   7026  C  C4    . DG  I 5 52  ? 21.421  -38.501 46.057 1.00 146.12 ? -21  DG  I C4    1 
ATOM   7027  P  P     . DC  I 5 53  ? 22.202  -43.604 48.948 1.00 146.85 ? -20  DC  I P     1 
ATOM   7028  O  OP1   . DC  I 5 53  ? 21.666  -44.955 49.222 1.00 146.38 ? -20  DC  I OP1   1 
ATOM   7029  O  OP2   . DC  I 5 53  ? 21.608  -42.430 49.630 1.00 146.73 ? -20  DC  I OP2   1 
ATOM   7030  O  "O5'" . DC  I 5 53  ? 23.777  -43.590 49.249 1.00 147.31 ? -20  DC  I "O5'" 1 
ATOM   7031  C  "C5'" . DC  I 5 53  ? 24.671  -42.742 48.519 1.00 147.85 ? -20  DC  I "C5'" 1 
ATOM   7032  C  "C4'" . DC  I 5 53  ? 25.212  -41.609 49.376 1.00 148.50 ? -20  DC  I "C4'" 1 
ATOM   7033  O  "O4'" . DC  I 5 53  ? 24.584  -40.370 48.961 1.00 148.43 ? -20  DC  I "O4'" 1 
ATOM   7034  C  "C3'" . DC  I 5 53  ? 24.974  -41.724 50.885 1.00 149.00 ? -20  DC  I "C3'" 1 
ATOM   7035  O  "O3'" . DC  I 5 53  ? 26.204  -41.590 51.610 1.00 149.89 ? -20  DC  I "O3'" 1 
ATOM   7036  C  "C2'" . DC  I 5 53  ? 24.013  -40.579 51.198 1.00 148.70 ? -20  DC  I "C2'" 1 
ATOM   7037  C  "C1'" . DC  I 5 53  ? 24.375  -39.579 50.110 1.00 148.53 ? -20  DC  I "C1'" 1 
ATOM   7038  N  N1    . DC  I 5 53  ? 23.304  -38.583 49.820 1.00 148.55 ? -20  DC  I N1    1 
ATOM   7039  C  C2    . DC  I 5 53  ? 23.615  -37.220 49.632 1.00 148.43 ? -20  DC  I C2    1 
ATOM   7040  O  O2    . DC  I 5 53  ? 24.787  -36.822 49.702 1.00 148.34 ? -20  DC  I O2    1 
ATOM   7041  N  N3    . DC  I 5 53  ? 22.599  -36.357 49.369 1.00 148.38 ? -20  DC  I N3    1 
ATOM   7042  C  C4    . DC  I 5 53  ? 21.338  -36.806 49.295 1.00 148.48 ? -20  DC  I C4    1 
ATOM   7043  N  N4    . DC  I 5 53  ? 20.368  -35.927 49.036 1.00 148.55 ? -20  DC  I N4    1 
ATOM   7044  C  C5    . DC  I 5 53  ? 21.002  -38.179 49.486 1.00 148.46 ? -20  DC  I C5    1 
ATOM   7045  C  C6    . DC  I 5 53  ? 22.009  -39.021 49.741 1.00 148.57 ? -20  DC  I C6    1 
ATOM   7046  P  P     . DG  I 5 54  ? 26.337  -42.043 53.149 1.00 150.59 ? -19  DG  I P     1 
ATOM   7047  O  OP1   . DG  I 5 54  ? 27.556  -42.876 53.247 1.00 150.77 ? -19  DG  I OP1   1 
ATOM   7048  O  OP2   . DG  I 5 54  ? 25.047  -42.595 53.629 1.00 150.31 ? -19  DG  I OP2   1 
ATOM   7049  O  "O5'" . DG  I 5 54  ? 26.579  -40.655 53.916 1.00 150.73 ? -19  DG  I "O5'" 1 
ATOM   7050  C  "C5'" . DG  I 5 54  ? 27.879  -40.061 53.989 1.00 150.79 ? -19  DG  I "C5'" 1 
ATOM   7051  C  "C4'" . DG  I 5 54  ? 27.796  -38.580 54.330 1.00 150.55 ? -19  DG  I "C4'" 1 
ATOM   7052  O  "O4'" . DG  I 5 54  ? 26.736  -37.962 53.554 1.00 150.39 ? -19  DG  I "O4'" 1 
ATOM   7053  C  "C3'" . DG  I 5 54  ? 27.473  -38.242 55.785 1.00 150.59 ? -19  DG  I "C3'" 1 
ATOM   7054  O  "O3'" . DG  I 5 54  ? 28.061  -36.983 56.149 1.00 150.99 ? -19  DG  I "O3'" 1 
ATOM   7055  C  "C2'" . DG  I 5 54  ? 25.958  -38.100 55.726 1.00 150.17 ? -19  DG  I "C2'" 1 
ATOM   7056  C  "C1'" . DG  I 5 54  ? 25.910  -37.261 54.456 1.00 150.02 ? -19  DG  I "C1'" 1 
ATOM   7057  N  N9    . DG  I 5 54  ? 24.598  -37.038 53.863 1.00 150.05 ? -19  DG  I N9    1 
ATOM   7058  C  C8    . DG  I 5 54  ? 23.578  -37.944 53.681 1.00 150.11 ? -19  DG  I C8    1 
ATOM   7059  N  N7    . DG  I 5 54  ? 22.521  -37.427 53.116 1.00 150.09 ? -19  DG  I N7    1 
ATOM   7060  C  C5    . DG  I 5 54  ? 22.868  -36.097 52.912 1.00 149.94 ? -19  DG  I C5    1 
ATOM   7061  C  C6    . DG  I 5 54  ? 22.129  -35.041 52.337 1.00 149.72 ? -19  DG  I C6    1 
ATOM   7062  O  O6    . DG  I 5 54  ? 20.986  -35.087 51.882 1.00 149.90 ? -19  DG  I O6    1 
ATOM   7063  N  N1    . DG  I 5 54  ? 22.837  -33.840 52.317 1.00 149.98 ? -19  DG  I N1    1 
ATOM   7064  C  C2    . DG  I 5 54  ? 24.120  -33.683 52.798 1.00 150.12 ? -19  DG  I C2    1 
ATOM   7065  N  N2    . DG  I 5 54  ? 24.651  -32.454 52.695 1.00 150.05 ? -19  DG  I N2    1 
ATOM   7066  N  N3    . DG  I 5 54  ? 24.830  -34.668 53.341 1.00 149.92 ? -19  DG  I N3    1 
ATOM   7067  C  C4    . DG  I 5 54  ? 24.143  -35.841 53.366 1.00 150.00 ? -19  DG  I C4    1 
ATOM   7068  P  P     . DG  I 5 55  ? 29.519  -36.822 56.801 1.00 151.06 ? -18  DG  I P     1 
ATOM   7069  O  OP1   . DG  I 5 55  ? 30.500  -36.922 55.694 1.00 150.78 ? -18  DG  I OP1   1 
ATOM   7070  O  OP2   . DG  I 5 55  ? 29.615  -37.741 57.964 1.00 150.51 ? -18  DG  I OP2   1 
ATOM   7071  O  "O5'" . DG  I 5 55  ? 29.487  -35.308 57.358 1.00 151.17 ? -18  DG  I "O5'" 1 
ATOM   7072  C  "C5'" . DG  I 5 55  ? 29.669  -34.167 56.487 1.00 151.19 ? -18  DG  I "C5'" 1 
ATOM   7073  C  "C4'" . DG  I 5 55  ? 28.767  -32.976 56.812 1.00 151.07 ? -18  DG  I "C4'" 1 
ATOM   7074  O  "O4'" . DG  I 5 55  ? 27.442  -33.156 56.237 1.00 151.40 ? -18  DG  I "O4'" 1 
ATOM   7075  C  "C3'" . DG  I 5 55  ? 28.558  -32.658 58.294 1.00 150.84 ? -18  DG  I "C3'" 1 
ATOM   7076  O  "O3'" . DG  I 5 55  ? 28.764  -31.256 58.545 1.00 149.56 ? -18  DG  I "O3'" 1 
ATOM   7077  C  "C2'" . DG  I 5 55  ? 27.113  -33.083 58.548 1.00 151.47 ? -18  DG  I "C2'" 1 
ATOM   7078  C  "C1'" . DG  I 5 55  ? 26.455  -32.829 57.196 1.00 152.30 ? -18  DG  I "C1'" 1 
ATOM   7079  N  N9    . DG  I 5 55  ? 25.275  -33.670 57.007 1.00 152.60 ? -18  DG  I N9    1 
ATOM   7080  C  C8    . DG  I 5 55  ? 25.231  -35.030 57.187 1.00 152.82 ? -18  DG  I C8    1 
ATOM   7081  N  N7    . DG  I 5 55  ? 24.062  -35.557 56.967 1.00 152.90 ? -18  DG  I N7    1 
ATOM   7082  C  C5    . DG  I 5 55  ? 23.267  -34.479 56.618 1.00 152.76 ? -18  DG  I C5    1 
ATOM   7083  C  C6    . DG  I 5 55  ? 21.894  -34.451 56.270 1.00 152.69 ? -18  DG  I C6    1 
ATOM   7084  O  O6    . DG  I 5 55  ? 21.108  -35.405 56.205 1.00 152.60 ? -18  DG  I O6    1 
ATOM   7085  N  N1    . DG  I 5 55  ? 21.450  -33.159 55.978 1.00 152.90 ? -18  DG  I N1    1 
ATOM   7086  C  C2    . DG  I 5 55  ? 22.246  -32.033 56.021 1.00 152.94 ? -18  DG  I C2    1 
ATOM   7087  N  N2    . DG  I 5 55  ? 21.642  -30.876 55.708 1.00 152.71 ? -18  DG  I N2    1 
ATOM   7088  N  N3    . DG  I 5 55  ? 23.542  -32.049 56.349 1.00 153.05 ? -18  DG  I N3    1 
ATOM   7089  C  C4    . DG  I 5 55  ? 23.992  -33.303 56.638 1.00 152.85 ? -18  DG  I C4    1 
ATOM   7090  P  P     . DT  I 5 56  ? 28.601  -30.614 60.011 1.00 148.35 ? -17  DT  I P     1 
ATOM   7091  O  OP1   . DT  I 5 56  ? 29.396  -29.366 60.025 1.00 148.27 ? -17  DT  I OP1   1 
ATOM   7092  O  OP2   . DT  I 5 56  ? 28.824  -31.663 61.037 1.00 148.01 ? -17  DT  I OP2   1 
ATOM   7093  O  "O5'" . DT  I 5 56  ? 27.055  -30.217 60.069 1.00 147.19 ? -17  DT  I "O5'" 1 
ATOM   7094  C  "C5'" . DT  I 5 56  ? 26.488  -29.353 59.086 1.00 145.43 ? -17  DT  I "C5'" 1 
ATOM   7095  C  "C4'" . DT  I 5 56  ? 25.056  -29.015 59.452 1.00 143.97 ? -17  DT  I "C4'" 1 
ATOM   7096  O  "O4'" . DT  I 5 56  ? 24.195  -30.126 59.097 1.00 143.93 ? -17  DT  I "O4'" 1 
ATOM   7097  C  "C3'" . DT  I 5 56  ? 24.826  -28.752 60.939 1.00 143.18 ? -17  DT  I "C3'" 1 
ATOM   7098  O  "O3'" . DT  I 5 56  ? 24.103  -27.533 61.101 1.00 141.82 ? -17  DT  I "O3'" 1 
ATOM   7099  C  "C2'" . DT  I 5 56  ? 24.018  -29.959 61.410 1.00 143.43 ? -17  DT  I "C2'" 1 
ATOM   7100  C  "C1'" . DT  I 5 56  ? 23.259  -30.313 60.136 1.00 143.96 ? -17  DT  I "C1'" 1 
ATOM   7101  N  N1    . DT  I 5 56  ? 22.720  -31.711 60.122 1.00 143.93 ? -17  DT  I N1    1 
ATOM   7102  C  C2    . DT  I 5 56  ? 21.357  -31.918 59.996 1.00 143.97 ? -17  DT  I C2    1 
ATOM   7103  O  O2    . DT  I 5 56  ? 20.536  -31.026 59.882 1.00 143.97 ? -17  DT  I O2    1 
ATOM   7104  N  N3    . DT  I 5 56  ? 20.977  -33.238 60.005 1.00 144.16 ? -17  DT  I N3    1 
ATOM   7105  C  C4    . DT  I 5 56  ? 21.799  -34.347 60.127 1.00 144.16 ? -17  DT  I C4    1 
ATOM   7106  O  O4    . DT  I 5 56  ? 21.348  -35.489 60.124 1.00 144.07 ? -17  DT  I O4    1 
ATOM   7107  C  C5    . DT  I 5 56  ? 23.213  -34.061 60.258 1.00 144.23 ? -17  DT  I C5    1 
ATOM   7108  C  C7    . DT  I 5 56  ? 24.219  -35.168 60.404 1.00 144.18 ? -17  DT  I C7    1 
ATOM   7109  C  C6    . DT  I 5 56  ? 23.596  -32.775 60.250 1.00 144.09 ? -17  DT  I C6    1 
ATOM   7110  P  P     . DT  I 5 57  ? 24.047  -26.751 62.501 1.00 140.21 ? -16  DT  I P     1 
ATOM   7111  O  OP1   . DT  I 5 57  ? 24.425  -25.344 62.218 1.00 140.23 ? -16  DT  I OP1   1 
ATOM   7112  O  OP2   . DT  I 5 57  ? 24.777  -27.533 63.527 1.00 140.32 ? -16  DT  I OP2   1 
ATOM   7113  O  "O5'" . DT  I 5 57  ? 22.499  -26.818 62.908 1.00 138.51 ? -16  DT  I "O5'" 1 
ATOM   7114  C  "C5'" . DT  I 5 57  ? 21.466  -26.500 61.976 1.00 135.93 ? -16  DT  I "C5'" 1 
ATOM   7115  C  "C4'" . DT  I 5 57  ? 20.154  -27.151 62.378 1.00 133.65 ? -16  DT  I "C4'" 1 
ATOM   7116  O  "O4'" . DT  I 5 57  ? 20.214  -28.581 62.142 1.00 133.67 ? -16  DT  I "O4'" 1 
ATOM   7117  C  "C3'" . DT  I 5 57  ? 19.767  -26.983 63.846 1.00 131.87 ? -16  DT  I "C3'" 1 
ATOM   7118  O  "O3'" . DT  I 5 57  ? 18.473  -26.422 63.908 1.00 128.40 ? -16  DT  I "O3'" 1 
ATOM   7119  C  "C2'" . DT  I 5 57  ? 19.772  -28.400 64.417 1.00 132.73 ? -16  DT  I "C2'" 1 
ATOM   7120  C  "C1'" . DT  I 5 57  ? 19.468  -29.208 63.162 1.00 134.06 ? -16  DT  I "C1'" 1 
ATOM   7121  N  N1    . DT  I 5 57  ? 19.830  -30.654 63.233 1.00 134.46 ? -16  DT  I N1    1 
ATOM   7122  C  C2    . DT  I 5 57  ? 18.879  -31.599 62.893 1.00 134.67 ? -16  DT  I C2    1 
ATOM   7123  O  O2    . DT  I 5 57  ? 17.749  -31.327 62.532 1.00 134.74 ? -16  DT  I O2    1 
ATOM   7124  N  N3    . DT  I 5 57  ? 19.302  -32.901 62.990 1.00 134.77 ? -16  DT  I N3    1 
ATOM   7125  C  C4    . DT  I 5 57  ? 20.554  -33.346 63.383 1.00 134.83 ? -16  DT  I C4    1 
ATOM   7126  O  O4    . DT  I 5 57  ? 20.811  -34.547 63.428 1.00 134.66 ? -16  DT  I O4    1 
ATOM   7127  C  C5    . DT  I 5 57  ? 21.509  -32.304 63.727 1.00 134.92 ? -16  DT  I C5    1 
ATOM   7128  C  C7    . DT  I 5 57  ? 22.907  -32.632 64.176 1.00 134.57 ? -16  DT  I C7    1 
ATOM   7129  C  C6    . DT  I 5 57  ? 21.102  -31.028 63.635 1.00 134.75 ? -16  DT  I C6    1 
ATOM   7130  P  P     . DA  I 5 58  ? 18.266  -24.889 64.291 1.00 125.30 ? -15  DA  I P     1 
ATOM   7131  O  OP1   . DA  I 5 58  ? 19.494  -24.147 63.924 1.00 125.18 ? -15  DA  I OP1   1 
ATOM   7132  O  OP2   . DA  I 5 58  ? 17.732  -24.873 65.677 1.00 124.43 ? -15  DA  I OP2   1 
ATOM   7133  O  "O5'" . DA  I 5 58  ? 17.119  -24.401 63.284 1.00 123.41 ? -15  DA  I "O5'" 1 
ATOM   7134  C  "C5'" . DA  I 5 58  ? 16.985  -24.946 61.963 1.00 119.53 ? -15  DA  I "C5'" 1 
ATOM   7135  C  "C4'" . DA  I 5 58  ? 15.671  -25.705 61.845 1.00 116.14 ? -15  DA  I "C4'" 1 
ATOM   7136  O  "O4'" . DA  I 5 58  ? 15.860  -27.109 62.187 1.00 115.38 ? -15  DA  I "O4'" 1 
ATOM   7137  C  "C3'" . DA  I 5 58  ? 14.560  -25.200 62.761 1.00 113.91 ? -15  DA  I "C3'" 1 
ATOM   7138  O  "O3'" . DA  I 5 58  ? 13.319  -25.335 62.078 1.00 110.68 ? -15  DA  I "O3'" 1 
ATOM   7139  C  "C2'" . DA  I 5 58  ? 14.670  -26.142 63.958 1.00 114.32 ? -15  DA  I "C2'" 1 
ATOM   7140  C  "C1'" . DA  I 5 58  ? 14.950  -27.447 63.219 1.00 114.74 ? -15  DA  I "C1'" 1 
ATOM   7141  N  N9    . DA  I 5 58  ? 15.465  -28.525 64.063 1.00 114.64 ? -15  DA  I N9    1 
ATOM   7142  C  C8    . DA  I 5 58  ? 16.227  -28.411 65.196 1.00 114.73 ? -15  DA  I C8    1 
ATOM   7143  N  N7    . DA  I 5 58  ? 16.538  -29.560 65.752 1.00 114.82 ? -15  DA  I N7    1 
ATOM   7144  C  C5    . DA  I 5 58  ? 15.929  -30.490 64.931 1.00 114.58 ? -15  DA  I C5    1 
ATOM   7145  C  C6    . DA  I 5 58  ? 15.875  -31.894 64.972 1.00 114.36 ? -15  DA  I C6    1 
ATOM   7146  N  N6    . DA  I 5 58  ? 16.469  -32.616 65.924 1.00 114.47 ? -15  DA  I N6    1 
ATOM   7147  N  N1    . DA  I 5 58  ? 15.183  -32.525 63.999 1.00 114.41 ? -15  DA  I N1    1 
ATOM   7148  C  C2    . DA  I 5 58  ? 14.584  -31.800 63.045 1.00 114.42 ? -15  DA  I C2    1 
ATOM   7149  N  N3    . DA  I 5 58  ? 14.564  -30.475 62.904 1.00 114.45 ? -15  DA  I N3    1 
ATOM   7150  C  C4    . DA  I 5 58  ? 15.261  -29.873 63.886 1.00 114.64 ? -15  DA  I C4    1 
ATOM   7151  P  P     . DA  I 5 59  ? 11.903  -25.000 62.751 1.00 108.18 ? -14  DA  I P     1 
ATOM   7152  O  OP1   . DA  I 5 59  ? 11.210  -24.093 61.805 1.00 107.30 ? -14  DA  I OP1   1 
ATOM   7153  O  OP2   . DA  I 5 59  ? 12.052  -24.657 64.190 1.00 107.09 ? -14  DA  I OP2   1 
ATOM   7154  O  "O5'" . DA  I 5 59  ? 11.192  -26.421 62.707 1.00 105.00 ? -14  DA  I "O5'" 1 
ATOM   7155  C  "C5'" . DA  I 5 59  ? 11.114  -27.157 61.504 1.00 100.45 ? -14  DA  I "C5'" 1 
ATOM   7156  C  "C4'" . DA  I 5 59  ? 10.593  -28.541 61.837 1.00 97.34  ? -14  DA  I "C4'" 1 
ATOM   7157  O  "O4'" . DA  I 5 59  ? 11.572  -29.226 62.650 1.00 97.24  ? -14  DA  I "O4'" 1 
ATOM   7158  C  "C3'" . DA  I 5 59  ? 9.288   -28.569 62.635 1.00 94.54  ? -14  DA  I "C3'" 1 
ATOM   7159  O  "O3'" . DA  I 5 59  ? 8.466   -29.595 62.126 1.00 90.28  ? -14  DA  I "O3'" 1 
ATOM   7160  C  "C2'" . DA  I 5 59  ? 9.736   -28.884 64.049 1.00 95.27  ? -14  DA  I "C2'" 1 
ATOM   7161  C  "C1'" . DA  I 5 59  ? 10.880  -29.823 63.713 1.00 98.57  ? -14  DA  I "C1'" 1 
ATOM   7162  N  N9    . DA  I 5 59  ? 11.774  -29.998 64.834 1.00 99.62  ? -14  DA  I N9    1 
ATOM   7163  C  C8    . DA  I 5 59  ? 12.309  -29.012 65.614 1.00 100.26 ? -14  DA  I C8    1 
ATOM   7164  N  N7    . DA  I 5 59  ? 13.078  -29.464 66.575 1.00 100.73 ? -14  DA  I N7    1 
ATOM   7165  C  C5    . DA  I 5 59  ? 13.029  -30.838 66.412 1.00 100.43 ? -14  DA  I C5    1 
ATOM   7166  C  C6    . DA  I 5 59  ? 13.636  -31.887 67.120 1.00 99.93  ? -14  DA  I C6    1 
ATOM   7167  N  N6    . DA  I 5 59  ? 14.430  -31.663 68.166 1.00 99.90  ? -14  DA  I N6    1 
ATOM   7168  N  N1    . DA  I 5 59  ? 13.394  -33.156 66.708 1.00 100.17 ? -14  DA  I N1    1 
ATOM   7169  C  C2    . DA  I 5 59  ? 12.592  -33.359 65.645 1.00 100.15 ? -14  DA  I C2    1 
ATOM   7170  N  N3    . DA  I 5 59  ? 11.961  -32.448 64.897 1.00 100.18 ? -14  DA  I N3    1 
ATOM   7171  C  C4    . DA  I 5 59  ? 12.231  -31.195 65.336 1.00 100.54 ? -14  DA  I C4    1 
ATOM   7172  P  P     . DA  I 5 60  ? 6.953   -29.761 62.588 1.00 87.25  ? -13  DA  I P     1 
ATOM   7173  O  OP1   . DA  I 5 60  ? 6.160   -29.675 61.364 1.00 88.75  ? -13  DA  I OP1   1 
ATOM   7174  O  OP2   . DA  I 5 60  ? 6.647   -28.947 63.776 1.00 85.78  ? -13  DA  I OP2   1 
ATOM   7175  O  "O5'" . DA  I 5 60  ? 6.854   -31.266 63.065 1.00 88.87  ? -13  DA  I "O5'" 1 
ATOM   7176  C  "C5'" . DA  I 5 60  ? 7.471   -32.314 62.337 1.00 89.55  ? -13  DA  I "C5'" 1 
ATOM   7177  C  "C4'" . DA  I 5 60  ? 7.688   -33.507 63.248 1.00 89.67  ? -13  DA  I "C4'" 1 
ATOM   7178  O  "O4'" . DA  I 5 60  ? 8.820   -33.245 64.121 1.00 88.76  ? -13  DA  I "O4'" 1 
ATOM   7179  C  "C3'" . DA  I 5 60  ? 6.487   -33.873 64.130 1.00 90.61  ? -13  DA  I "C3'" 1 
ATOM   7180  O  "O3'" . DA  I 5 60  ? 6.164   -35.284 63.924 1.00 93.14  ? -13  DA  I "O3'" 1 
ATOM   7181  C  "C2'" . DA  I 5 60  ? 6.965   -33.513 65.539 1.00 89.20  ? -13  DA  I "C2'" 1 
ATOM   7182  C  "C1'" . DA  I 5 60  ? 8.484   -33.685 65.415 1.00 89.45  ? -13  DA  I "C1'" 1 
ATOM   7183  N  N9    . DA  I 5 60  ? 9.252   -32.958 66.424 1.00 89.40  ? -13  DA  I N9    1 
ATOM   7184  C  C8    . DA  I 5 60  ? 9.316   -31.600 66.596 1.00 89.94  ? -13  DA  I C8    1 
ATOM   7185  N  N7    . DA  I 5 60  ? 10.080  -31.213 67.593 1.00 90.18  ? -13  DA  I N7    1 
ATOM   7186  C  C5    . DA  I 5 60  ? 10.544  -32.411 68.125 1.00 90.46  ? -13  DA  I C5    1 
ATOM   7187  C  C6    . DA  I 5 60  ? 11.390  -32.710 69.218 1.00 89.47  ? -13  DA  I C6    1 
ATOM   7188  N  N6    . DA  I 5 60  ? 11.933  -31.765 69.979 1.00 89.65  ? -13  DA  I N6    1 
ATOM   7189  N  N1    . DA  I 5 60  ? 11.659  -34.004 69.500 1.00 89.39  ? -13  DA  I N1    1 
ATOM   7190  C  C2    . DA  I 5 60  ? 11.112  -34.956 68.733 1.00 89.89  ? -13  DA  I C2    1 
ATOM   7191  N  N3    . DA  I 5 60  ? 10.300  -34.806 67.681 1.00 90.52  ? -13  DA  I N3    1 
ATOM   7192  C  C4    . DA  I 5 60  ? 10.047  -33.498 67.417 1.00 90.37  ? -13  DA  I C4    1 
ATOM   7193  P  P     . DA  I 5 61  ? 4.800   -36.027 64.366 1.00 93.71  ? -12  DA  I P     1 
ATOM   7194  O  OP1   . DA  I 5 61  ? 4.477   -37.004 63.301 1.00 92.54  ? -12  DA  I OP1   1 
ATOM   7195  O  OP2   . DA  I 5 61  ? 3.763   -35.073 64.812 1.00 93.35  ? -12  DA  I OP2   1 
ATOM   7196  O  "O5'" . DA  I 5 61  ? 5.335   -36.770 65.669 1.00 95.10  ? -12  DA  I "O5'" 1 
ATOM   7197  C  "C5'" . DA  I 5 61  ? 6.679   -37.228 65.692 1.00 98.45  ? -12  DA  I "C5'" 1 
ATOM   7198  C  "C4'" . DA  I 5 61  ? 6.971   -38.007 66.961 1.00 101.78 ? -12  DA  I "C4'" 1 
ATOM   7199  O  "O4'" . DA  I 5 61  ? 7.920   -37.273 67.783 1.00 102.46 ? -12  DA  I "O4'" 1 
ATOM   7200  C  "C3'" . DA  I 5 61  ? 5.766   -38.344 67.842 1.00 103.80 ? -12  DA  I "C3'" 1 
ATOM   7201  O  "O3'" . DA  I 5 61  ? 5.892   -39.744 68.191 1.00 107.42 ? -12  DA  I "O3'" 1 
ATOM   7202  C  "C2'" . DA  I 5 61  ? 5.879   -37.337 68.992 1.00 103.08 ? -12  DA  I "C2'" 1 
ATOM   7203  C  "C1'" . DA  I 5 61  ? 7.389   -37.071 69.078 1.00 103.12 ? -12  DA  I "C1'" 1 
ATOM   7204  N  N9    . DA  I 5 61  ? 7.750   -35.723 69.535 1.00 102.94 ? -12  DA  I N9    1 
ATOM   7205  C  C8    . DA  I 5 61  ? 7.544   -34.548 68.869 1.00 102.85 ? -12  DA  I C8    1 
ATOM   7206  N  N7    . DA  I 5 61  ? 7.954   -33.482 69.504 1.00 102.18 ? -12  DA  I N7    1 
ATOM   7207  C  C5    . DA  I 5 61  ? 8.466   -33.987 70.680 1.00 102.79 ? -12  DA  I C5    1 
ATOM   7208  C  C6    . DA  I 5 61  ? 9.056   -33.364 71.800 1.00 103.31 ? -12  DA  I C6    1 
ATOM   7209  N  N6    . DA  I 5 61  ? 9.222   -32.041 71.876 1.00 103.08 ? -12  DA  I N6    1 
ATOM   7210  N  N1    . DA  I 5 61  ? 9.460   -34.150 72.836 1.00 103.56 ? -12  DA  I N1    1 
ATOM   7211  C  C2    . DA  I 5 61  ? 9.289   -35.480 72.745 1.00 103.21 ? -12  DA  I C2    1 
ATOM   7212  N  N3    . DA  I 5 61  ? 8.745   -36.175 71.735 1.00 103.28 ? -12  DA  I N3    1 
ATOM   7213  C  C4    . DA  I 5 61  ? 8.352   -35.368 70.723 1.00 102.98 ? -12  DA  I C4    1 
ATOM   7214  P  P     . DC  I 5 62  ? 5.144   -40.506 69.392 1.00 109.43 ? -11  DC  I P     1 
ATOM   7215  O  OP1   . DC  I 5 62  ? 5.439   -41.948 69.214 1.00 109.11 ? -11  DC  I OP1   1 
ATOM   7216  O  OP2   . DC  I 5 62  ? 3.742   -40.017 69.467 1.00 108.86 ? -11  DC  I OP2   1 
ATOM   7217  O  "O5'" . DC  I 5 62  ? 5.922   -39.966 70.683 1.00 110.09 ? -11  DC  I "O5'" 1 
ATOM   7218  C  "C5'" . DC  I 5 62  ? 6.819   -40.760 71.437 1.00 111.91 ? -11  DC  I "C5'" 1 
ATOM   7219  C  "C4'" . DC  I 5 62  ? 6.723   -40.322 72.884 1.00 113.90 ? -11  DC  I "C4'" 1 
ATOM   7220  O  "O4'" . DC  I 5 62  ? 7.095   -38.923 73.010 1.00 113.92 ? -11  DC  I "O4'" 1 
ATOM   7221  C  "C3'" . DC  I 5 62  ? 5.321   -40.452 73.470 1.00 115.71 ? -11  DC  I "C3'" 1 
ATOM   7222  O  "O3'" . DC  I 5 62  ? 5.444   -41.105 74.721 1.00 118.97 ? -11  DC  I "O3'" 1 
ATOM   7223  C  "C2'" . DC  I 5 62  ? 4.831   -39.007 73.580 1.00 114.63 ? -11  DC  I "C2'" 1 
ATOM   7224  C  "C1'" . DC  I 5 62  ? 6.130   -38.235 73.784 1.00 113.82 ? -11  DC  I "C1'" 1 
ATOM   7225  N  N1    . DC  I 5 62  ? 6.047   -36.758 73.412 1.00 113.56 ? -11  DC  I N1    1 
ATOM   7226  C  C2    . DC  I 5 62  ? 6.575   -35.759 74.263 1.00 113.56 ? -11  DC  I C2    1 
ATOM   7227  O  O2    . DC  I 5 62  ? 7.125   -36.060 75.331 1.00 113.38 ? -11  DC  I O2    1 
ATOM   7228  N  N3    . DC  I 5 62  ? 6.468   -34.454 73.893 1.00 113.50 ? -11  DC  I N3    1 
ATOM   7229  C  C4    . DC  I 5 62  ? 5.873   -34.117 72.741 1.00 113.54 ? -11  DC  I C4    1 
ATOM   7230  N  N4    . DC  I 5 62  ? 5.802   -32.818 72.426 1.00 113.20 ? -11  DC  I N4    1 
ATOM   7231  C  C5    . DC  I 5 62  ? 5.330   -35.106 71.864 1.00 113.12 ? -11  DC  I C5    1 
ATOM   7232  C  C6    . DC  I 5 62  ? 5.439   -36.389 72.239 1.00 113.15 ? -11  DC  I C6    1 
ATOM   7233  P  P     . DG  I 5 63  ? 4.204   -41.455 75.676 1.00 121.59 ? -10  DG  I P     1 
ATOM   7234  O  OP1   . DG  I 5 63  ? 3.647   -42.751 75.231 1.00 121.06 ? -10  DG  I OP1   1 
ATOM   7235  O  OP2   . DG  I 5 63  ? 3.301   -40.291 75.815 1.00 121.62 ? -10  DG  I OP2   1 
ATOM   7236  O  "O5'" . DG  I 5 63  ? 4.964   -41.600 77.081 1.00 122.49 ? -10  DG  I "O5'" 1 
ATOM   7237  C  "C5'" . DG  I 5 63  ? 6.206   -40.922 77.288 1.00 124.20 ? -10  DG  I "C5'" 1 
ATOM   7238  C  "C4'" . DG  I 5 63  ? 6.158   -39.865 78.387 1.00 126.03 ? -10  DG  I "C4'" 1 
ATOM   7239  O  "O4'" . DG  I 5 63  ? 6.156   -38.538 77.789 1.00 126.89 ? -10  DG  I "O4'" 1 
ATOM   7240  C  "C3'" . DG  I 5 63  ? 4.989   -39.888 79.376 1.00 126.59 ? -10  DG  I "C3'" 1 
ATOM   7241  O  "O3'" . DG  I 5 63  ? 5.503   -39.658 80.701 1.00 126.89 ? -10  DG  I "O3'" 1 
ATOM   7242  C  "C2'" . DG  I 5 63  ? 4.120   -38.736 78.881 1.00 126.98 ? -10  DG  I "C2'" 1 
ATOM   7243  C  "C1'" . DG  I 5 63  ? 5.171   -37.736 78.410 1.00 127.58 ? -10  DG  I "C1'" 1 
ATOM   7244  N  N9    . DG  I 5 63  ? 4.679   -36.792 77.413 1.00 127.87 ? -10  DG  I N9    1 
ATOM   7245  C  C8    . DG  I 5 63  ? 4.147   -37.132 76.194 1.00 128.13 ? -10  DG  I C8    1 
ATOM   7246  N  N7    . DG  I 5 63  ? 3.776   -36.120 75.467 1.00 128.12 ? -10  DG  I N7    1 
ATOM   7247  C  C5    . DG  I 5 63  ? 4.078   -35.027 76.259 1.00 128.00 ? -10  DG  I C5    1 
ATOM   7248  C  C6    . DG  I 5 63  ? 3.889   -33.654 75.985 1.00 128.00 ? -10  DG  I C6    1 
ATOM   7249  O  O6    . DG  I 5 63  ? 3.410   -33.145 74.965 1.00 127.97 ? -10  DG  I O6    1 
ATOM   7250  N  N1    . DG  I 5 63  ? 4.318   -32.847 77.038 1.00 128.17 ? -10  DG  I N1    1 
ATOM   7251  C  C2    . DG  I 5 63  ? 4.865   -33.319 78.211 1.00 128.13 ? -10  DG  I C2    1 
ATOM   7252  N  N2    . DG  I 5 63  ? 5.214   -32.383 79.103 1.00 127.88 ? -10  DG  I N2    1 
ATOM   7253  N  N3    . DG  I 5 63  ? 5.049   -34.615 78.483 1.00 128.15 ? -10  DG  I N3    1 
ATOM   7254  C  C4    . DG  I 5 63  ? 4.638   -35.415 77.462 1.00 128.02 ? -10  DG  I C4    1 
ATOM   7255  P  P     . DC  I 5 64  ? 4.652   -39.753 82.064 1.00 127.00 ? -9   DC  I P     1 
ATOM   7256  O  OP1   . DC  I 5 64  ? 5.081   -40.988 82.745 1.00 127.39 ? -9   DC  I OP1   1 
ATOM   7257  O  OP2   . DC  I 5 64  ? 3.208   -39.539 81.818 1.00 127.13 ? -9   DC  I OP2   1 
ATOM   7258  O  "O5'" . DC  I 5 64  ? 5.209   -38.510 82.900 1.00 127.25 ? -9   DC  I "O5'" 1 
ATOM   7259  C  "C5'" . DC  I 5 64  ? 5.743   -37.354 82.251 1.00 128.09 ? -9   DC  I "C5'" 1 
ATOM   7260  C  "C4'" . DC  I 5 64  ? 5.395   -36.079 83.007 1.00 128.80 ? -9   DC  I "C4'" 1 
ATOM   7261  O  "O4'" . DC  I 5 64  ? 4.846   -35.079 82.106 1.00 129.15 ? -9   DC  I "O4'" 1 
ATOM   7262  C  "C3'" . DC  I 5 64  ? 4.378   -36.210 84.134 1.00 129.24 ? -9   DC  I "C3'" 1 
ATOM   7263  O  "O3'" . DC  I 5 64  ? 4.749   -35.281 85.150 1.00 129.81 ? -9   DC  I "O3'" 1 
ATOM   7264  C  "C2'" . DC  I 5 64  ? 3.054   -35.860 83.448 1.00 129.47 ? -9   DC  I "C2'" 1 
ATOM   7265  C  "C1'" . DC  I 5 64  ? 3.477   -34.830 82.394 1.00 129.74 ? -9   DC  I "C1'" 1 
ATOM   7266  N  N1    . DC  I 5 64  ? 2.744   -34.829 81.060 1.00 129.85 ? -9   DC  I N1    1 
ATOM   7267  C  C2    . DC  I 5 64  ? 2.482   -33.608 80.403 1.00 129.96 ? -9   DC  I C2    1 
ATOM   7268  O  O2    . DC  I 5 64  ? 2.830   -32.539 80.925 1.00 129.80 ? -9   DC  I O2    1 
ATOM   7269  N  N3    . DC  I 5 64  ? 1.847   -33.630 79.196 1.00 129.93 ? -9   DC  I N3    1 
ATOM   7270  C  C4    . DC  I 5 64  ? 1.482   -34.793 78.636 1.00 130.02 ? -9   DC  I C4    1 
ATOM   7271  N  N4    . DC  I 5 64  ? 0.861   -34.764 77.448 1.00 129.75 ? -9   DC  I N4    1 
ATOM   7272  C  C5    . DC  I 5 64  ? 1.741   -36.042 79.284 1.00 129.84 ? -9   DC  I C5    1 
ATOM   7273  C  C6    . DC  I 5 64  ? 2.367   -36.008 80.471 1.00 129.82 ? -9   DC  I C6    1 
ATOM   7274  P  P     . DG  I 5 65  ? 4.448   -35.474 86.716 1.00 130.07 ? -8   DG  I P     1 
ATOM   7275  O  OP1   . DG  I 5 65  ? 5.698   -35.139 87.447 1.00 129.54 ? -8   DG  I OP1   1 
ATOM   7276  O  OP2   . DG  I 5 65  ? 3.790   -36.785 86.944 1.00 130.16 ? -8   DG  I OP2   1 
ATOM   7277  O  "O5'" . DG  I 5 65  ? 3.359   -34.319 86.968 1.00 129.53 ? -8   DG  I "O5'" 1 
ATOM   7278  C  "C5'" . DG  I 5 65  ? 3.775   -32.948 87.040 1.00 128.12 ? -8   DG  I "C5'" 1 
ATOM   7279  C  "C4'" . DG  I 5 65  ? 2.695   -31.981 86.589 1.00 126.88 ? -8   DG  I "C4'" 1 
ATOM   7280  O  "O4'" . DG  I 5 65  ? 2.293   -32.285 85.231 1.00 126.86 ? -8   DG  I "O4'" 1 
ATOM   7281  C  "C3'" . DG  I 5 65  ? 1.417   -31.990 87.424 1.00 126.30 ? -8   DG  I "C3'" 1 
ATOM   7282  O  "O3'" . DG  I 5 65  ? 1.149   -30.653 87.843 1.00 125.02 ? -8   DG  I "O3'" 1 
ATOM   7283  C  "C2'" . DG  I 5 65  ? 0.355   -32.526 86.460 1.00 126.53 ? -8   DG  I "C2'" 1 
ATOM   7284  C  "C1'" . DG  I 5 65  ? 0.908   -32.018 85.136 1.00 127.32 ? -8   DG  I "C1'" 1 
ATOM   7285  N  N9    . DG  I 5 65  ? 0.380   -32.642 83.920 1.00 127.57 ? -8   DG  I N9    1 
ATOM   7286  C  C8    . DG  I 5 65  ? 0.443   -33.974 83.586 1.00 127.76 ? -8   DG  I C8    1 
ATOM   7287  N  N7    . DG  I 5 65  ? -0.090  -34.262 82.432 1.00 127.77 ? -8   DG  I N7    1 
ATOM   7288  C  C5    . DG  I 5 65  ? -0.548  -33.037 81.968 1.00 127.60 ? -8   DG  I C5    1 
ATOM   7289  C  C6    . DG  I 5 65  ? -1.224  -32.722 80.764 1.00 127.60 ? -8   DG  I C6    1 
ATOM   7290  O  O6    . DG  I 5 65  ? -1.558  -33.490 79.852 1.00 127.45 ? -8   DG  I O6    1 
ATOM   7291  N  N1    . DG  I 5 65  ? -1.512  -31.358 80.667 1.00 127.79 ? -8   DG  I N1    1 
ATOM   7292  C  C2    . DG  I 5 65  ? -1.192  -30.413 81.617 1.00 127.43 ? -8   DG  I C2    1 
ATOM   7293  N  N2    . DG  I 5 65  ? -1.555  -29.152 81.337 1.00 127.26 ? -8   DG  I N2    1 
ATOM   7294  N  N3    . DG  I 5 65  ? -0.559  -30.700 82.752 1.00 127.30 ? -8   DG  I N3    1 
ATOM   7295  C  C4    . DG  I 5 65  ? -0.266  -32.025 82.865 1.00 127.43 ? -8   DG  I C4    1 
ATOM   7296  P  P     . DG  I 5 66  ? 0.183   -30.309 89.076 1.00 123.58 ? -7   DG  I P     1 
ATOM   7297  O  OP1   . DG  I 5 66  ? 1.065   -30.155 90.247 1.00 123.66 ? -7   DG  I OP1   1 
ATOM   7298  O  OP2   . DG  I 5 66  ? -0.949  -31.264 89.113 1.00 122.76 ? -7   DG  I OP2   1 
ATOM   7299  O  "O5'" . DG  I 5 66  ? -0.411  -28.867 88.705 1.00 123.87 ? -7   DG  I "O5'" 1 
ATOM   7300  C  "C5'" . DG  I 5 66  ? -0.282  -28.306 87.382 1.00 124.04 ? -7   DG  I "C5'" 1 
ATOM   7301  C  "C4'" . DG  I 5 66  ? -1.563  -27.676 86.825 1.00 124.08 ? -7   DG  I "C4'" 1 
ATOM   7302  O  "O4'" . DG  I 5 66  ? -2.072  -28.461 85.714 1.00 124.86 ? -7   DG  I "O4'" 1 
ATOM   7303  C  "C3'" . DG  I 5 66  ? -2.775  -27.510 87.742 1.00 123.54 ? -7   DG  I "C3'" 1 
ATOM   7304  O  "O3'" . DG  I 5 66  ? -3.516  -26.387 87.289 1.00 121.75 ? -7   DG  I "O3'" 1 
ATOM   7305  C  "C2'" . DG  I 5 66  ? -3.564  -28.796 87.503 1.00 124.20 ? -7   DG  I "C2'" 1 
ATOM   7306  C  "C1'" . DG  I 5 66  ? -3.380  -28.939 85.995 1.00 125.48 ? -7   DG  I "C1'" 1 
ATOM   7307  N  N9    . DG  I 5 66  ? -3.415  -30.292 85.457 1.00 125.80 ? -7   DG  I N9    1 
ATOM   7308  C  C8    . DG  I 5 66  ? -3.118  -31.459 86.120 1.00 126.07 ? -7   DG  I C8    1 
ATOM   7309  N  N7    . DG  I 5 66  ? -3.214  -32.519 85.365 1.00 126.61 ? -7   DG  I N7    1 
ATOM   7310  C  C5    . DG  I 5 66  ? -3.589  -32.027 84.117 1.00 126.49 ? -7   DG  I C5    1 
ATOM   7311  C  C6    . DG  I 5 66  ? -3.836  -32.711 82.892 1.00 126.14 ? -7   DG  I C6    1 
ATOM   7312  O  O6    . DG  I 5 66  ? -3.779  -33.928 82.661 1.00 125.95 ? -7   DG  I O6    1 
ATOM   7313  N  N1    . DG  I 5 66  ? -4.196  -31.839 81.865 1.00 125.92 ? -7   DG  I N1    1 
ATOM   7314  C  C2    . DG  I 5 66  ? -4.299  -30.471 82.002 1.00 126.09 ? -7   DG  I C2    1 
ATOM   7315  N  N2    . DG  I 5 66  ? -4.644  -29.800 80.897 1.00 125.97 ? -7   DG  I N2    1 
ATOM   7316  N  N3    . DG  I 5 66  ? -4.061  -29.813 83.137 1.00 126.06 ? -7   DG  I N3    1 
ATOM   7317  C  C4    . DG  I 5 66  ? -3.714  -30.650 84.157 1.00 126.27 ? -7   DG  I C4    1 
ATOM   7318  P  P     . DG  I 5 67  ? -3.361  -24.926 87.919 1.00 120.25 ? -6   DG  I P     1 
ATOM   7319  O  OP1   . DG  I 5 67  ? -2.014  -24.826 88.528 1.00 119.67 ? -6   DG  I OP1   1 
ATOM   7320  O  OP2   . DG  I 5 67  ? -4.600  -24.713 88.704 1.00 119.57 ? -6   DG  I OP2   1 
ATOM   7321  O  "O5'" . DG  I 5 67  ? -3.404  -23.900 86.683 1.00 120.15 ? -6   DG  I "O5'" 1 
ATOM   7322  C  "C5'" . DG  I 5 67  ? -3.089  -24.298 85.342 1.00 119.43 ? -6   DG  I "C5'" 1 
ATOM   7323  C  "C4'" . DG  I 5 67  ? -4.132  -23.840 84.325 1.00 118.90 ? -6   DG  I "C4'" 1 
ATOM   7324  O  "O4'" . DG  I 5 67  ? -4.893  -24.954 83.782 1.00 119.21 ? -6   DG  I "O4'" 1 
ATOM   7325  C  "C3'" . DG  I 5 67  ? -5.186  -22.836 84.774 1.00 118.16 ? -6   DG  I "C3'" 1 
ATOM   7326  O  "O3'" . DG  I 5 67  ? -5.397  -22.008 83.655 1.00 116.42 ? -6   DG  I "O3'" 1 
ATOM   7327  C  "C2'" . DG  I 5 67  ? -6.411  -23.692 85.094 1.00 118.78 ? -6   DG  I "C2'" 1 
ATOM   7328  C  "C1'" . DG  I 5 67  ? -6.252  -24.885 84.161 1.00 120.54 ? -6   DG  I "C1'" 1 
ATOM   7329  N  N9    . DG  I 5 67  ? -6.461  -26.155 84.818 1.00 121.11 ? -6   DG  I N9    1 
ATOM   7330  C  C8    . DG  I 5 67  ? -6.391  -26.406 86.166 1.00 121.69 ? -6   DG  I C8    1 
ATOM   7331  N  N7    . DG  I 5 67  ? -6.596  -27.655 86.471 1.00 121.95 ? -6   DG  I N7    1 
ATOM   7332  C  C5    . DG  I 5 67  ? -6.806  -28.270 85.245 1.00 121.58 ? -6   DG  I C5    1 
ATOM   7333  C  C6    . DG  I 5 67  ? -7.083  -29.625 84.951 1.00 121.47 ? -6   DG  I C6    1 
ATOM   7334  O  O6    . DG  I 5 67  ? -7.198  -30.574 85.741 1.00 121.64 ? -6   DG  I O6    1 
ATOM   7335  N  N1    . DG  I 5 67  ? -7.235  -29.832 83.583 1.00 121.57 ? -6   DG  I N1    1 
ATOM   7336  C  C2    . DG  I 5 67  ? -7.130  -28.847 82.623 1.00 121.72 ? -6   DG  I C2    1 
ATOM   7337  N  N2    . DG  I 5 67  ? -7.309  -29.248 81.355 1.00 121.67 ? -6   DG  I N2    1 
ATOM   7338  N  N3    . DG  I 5 67  ? -6.871  -27.569 82.886 1.00 121.60 ? -6   DG  I N3    1 
ATOM   7339  C  C4    . DG  I 5 67  ? -6.720  -27.357 84.215 1.00 121.42 ? -6   DG  I C4    1 
ATOM   7340  P  P     . DG  I 5 68  ? -6.523  -20.882 83.568 1.00 115.08 ? -5   DG  I P     1 
ATOM   7341  O  OP1   . DG  I 5 68  ? -5.748  -19.628 83.528 1.00 114.13 ? -5   DG  I OP1   1 
ATOM   7342  O  OP2   . DG  I 5 68  ? -7.595  -21.116 84.575 1.00 114.38 ? -5   DG  I OP2   1 
ATOM   7343  O  "O5'" . DG  I 5 68  ? -7.160  -21.113 82.109 1.00 113.67 ? -5   DG  I "O5'" 1 
ATOM   7344  C  "C5'" . DG  I 5 68  ? -7.279  -22.404 81.499 1.00 110.06 ? -5   DG  I "C5'" 1 
ATOM   7345  C  "C4'" . DG  I 5 68  ? -8.663  -22.669 80.927 1.00 107.81 ? -5   DG  I "C4'" 1 
ATOM   7346  O  "O4'" . DG  I 5 68  ? -9.158  -23.926 81.442 1.00 107.80 ? -5   DG  I "O4'" 1 
ATOM   7347  C  "C3'" . DG  I 5 68  ? -9.772  -21.697 81.291 1.00 107.07 ? -5   DG  I "C3'" 1 
ATOM   7348  O  "O3'" . DG  I 5 68  ? -10.862 -21.891 80.384 1.00 106.03 ? -5   DG  I "O3'" 1 
ATOM   7349  C  "C2'" . DG  I 5 68  ? -10.151 -22.196 82.683 1.00 107.22 ? -5   DG  I "C2'" 1 
ATOM   7350  C  "C1'" . DG  I 5 68  ? -10.223 -23.682 82.350 1.00 107.66 ? -5   DG  I "C1'" 1 
ATOM   7351  N  N9    . DG  I 5 68  ? -10.136 -24.639 83.462 1.00 108.06 ? -5   DG  I N9    1 
ATOM   7352  C  C8    . DG  I 5 68  ? -10.029 -24.401 84.820 1.00 107.68 ? -5   DG  I C8    1 
ATOM   7353  N  N7    . DG  I 5 68  ? -9.971  -25.491 85.539 1.00 107.26 ? -5   DG  I N7    1 
ATOM   7354  C  C5    . DG  I 5 68  ? -10.040 -26.519 84.601 1.00 107.81 ? -5   DG  I C5    1 
ATOM   7355  C  C6    . DG  I 5 68  ? -10.027 -27.931 84.761 1.00 107.74 ? -5   DG  I C6    1 
ATOM   7356  O  O6    . DG  I 5 68  ? -9.942  -28.578 85.809 1.00 107.84 ? -5   DG  I O6    1 
ATOM   7357  N  N1    . DG  I 5 68  ? -10.118 -28.616 83.548 1.00 107.56 ? -5   DG  I N1    1 
ATOM   7358  C  C2    . DG  I 5 68  ? -10.221 -28.013 82.318 1.00 107.31 ? -5   DG  I C2    1 
ATOM   7359  N  N2    . DG  I 5 68  ? -10.305 -28.829 81.263 1.00 107.49 ? -5   DG  I N2    1 
ATOM   7360  N  N3    . DG  I 5 68  ? -10.234 -26.699 82.142 1.00 107.81 ? -5   DG  I N3    1 
ATOM   7361  C  C4    . DG  I 5 68  ? -10.140 -26.012 83.319 1.00 108.16 ? -5   DG  I C4    1 
ATOM   7362  P  P     . DG  I 5 69  ? -11.062 -21.065 79.020 1.00 104.54 ? -4   DG  I P     1 
ATOM   7363  O  OP1   . DG  I 5 69  ? -9.722  -20.857 78.405 1.00 103.79 ? -4   DG  I OP1   1 
ATOM   7364  O  OP2   . DG  I 5 69  ? -11.959 -19.916 79.312 1.00 102.97 ? -4   DG  I OP2   1 
ATOM   7365  O  "O5'" . DG  I 5 69  ? -11.888 -22.117 78.137 1.00 102.85 ? -4   DG  I "O5'" 1 
ATOM   7366  C  "C5'" . DG  I 5 69  ? -11.319 -23.395 77.973 1.00 101.90 ? -4   DG  I "C5'" 1 
ATOM   7367  C  "C4'" . DG  I 5 69  ? -12.240 -24.423 77.338 1.00 101.30 ? -4   DG  I "C4'" 1 
ATOM   7368  O  "O4'" . DG  I 5 69  ? -12.442 -25.551 78.230 1.00 101.80 ? -4   DG  I "O4'" 1 
ATOM   7369  C  "C3'" . DG  I 5 69  ? -13.632 -24.003 76.894 1.00 99.89  ? -4   DG  I "C3'" 1 
ATOM   7370  O  "O3'" . DG  I 5 69  ? -13.935 -24.802 75.726 1.00 96.88  ? -4   DG  I "O3'" 1 
ATOM   7371  C  "C2'" . DG  I 5 69  ? -14.464 -24.327 78.133 1.00 101.35 ? -4   DG  I "C2'" 1 
ATOM   7372  C  "C1'" . DG  I 5 69  ? -13.739 -25.514 78.771 1.00 102.64 ? -4   DG  I "C1'" 1 
ATOM   7373  N  N9    . DG  I 5 69  ? -13.556 -25.376 80.210 1.00 103.15 ? -4   DG  I N9    1 
ATOM   7374  C  C8    . DG  I 5 69  ? -13.347 -24.200 80.897 1.00 103.39 ? -4   DG  I C8    1 
ATOM   7375  N  N7    . DG  I 5 69  ? -13.210 -24.360 82.181 1.00 103.25 ? -4   DG  I N7    1 
ATOM   7376  C  C5    . DG  I 5 69  ? -13.328 -25.727 82.349 1.00 102.97 ? -4   DG  I C5    1 
ATOM   7377  C  C6    . DG  I 5 69  ? -13.260 -26.477 83.538 1.00 103.40 ? -4   DG  I C6    1 
ATOM   7378  O  O6    . DG  I 5 69  ? -13.071 -26.039 84.685 1.00 103.05 ? -4   DG  I O6    1 
ATOM   7379  N  N1    . DG  I 5 69  ? -13.423 -27.848 83.289 1.00 103.55 ? -4   DG  I N1    1 
ATOM   7380  C  C2    . DG  I 5 69  ? -13.634 -28.410 82.046 1.00 103.04 ? -4   DG  I C2    1 
ATOM   7381  N  N2    . DG  I 5 69  ? -13.770 -29.745 82.017 1.00 103.03 ? -4   DG  I N2    1 
ATOM   7382  N  N3    . DG  I 5 69  ? -13.699 -27.704 80.921 1.00 102.56 ? -4   DG  I N3    1 
ATOM   7383  C  C4    . DG  I 5 69  ? -13.538 -26.376 81.151 1.00 102.74 ? -4   DG  I C4    1 
ATOM   7384  P  P     . DA  I 5 70  ? -15.399 -25.065 75.132 1.00 94.11  ? -3   DA  I P     1 
ATOM   7385  O  OP1   . DA  I 5 70  ? -15.302 -24.952 73.662 1.00 95.08  ? -3   DA  I OP1   1 
ATOM   7386  O  OP2   . DA  I 5 70  ? -16.421 -24.236 75.806 1.00 93.77  ? -3   DA  I OP2   1 
ATOM   7387  O  "O5'" . DA  I 5 70  ? -15.602 -26.588 75.582 1.00 93.48  ? -3   DA  I "O5'" 1 
ATOM   7388  C  "C5'" . DA  I 5 70  ? -14.854 -27.686 75.019 1.00 93.41  ? -3   DA  I "C5'" 1 
ATOM   7389  C  "C4'" . DA  I 5 70  ? -15.546 -29.028 75.255 1.00 92.96  ? -3   DA  I "C4'" 1 
ATOM   7390  O  "O4'" . DA  I 5 70  ? -15.619 -29.264 76.681 1.00 92.89  ? -3   DA  I "O4'" 1 
ATOM   7391  C  "C3'" . DA  I 5 70  ? -16.997 -29.145 74.782 1.00 93.90  ? -3   DA  I "C3'" 1 
ATOM   7392  O  "O3'" . DA  I 5 70  ? -17.342 -30.505 74.421 1.00 95.43  ? -3   DA  I "O3'" 1 
ATOM   7393  C  "C2'" . DA  I 5 70  ? -17.793 -28.626 75.987 1.00 92.95  ? -3   DA  I "C2'" 1 
ATOM   7394  C  "C1'" . DA  I 5 70  ? -16.957 -29.160 77.146 1.00 91.97  ? -3   DA  I "C1'" 1 
ATOM   7395  N  N9    . DA  I 5 70  ? -16.963 -28.330 78.351 1.00 91.39  ? -3   DA  I N9    1 
ATOM   7396  C  C8    . DA  I 5 70  ? -16.949 -26.965 78.447 1.00 91.22  ? -3   DA  I C8    1 
ATOM   7397  N  N7    . DA  I 5 70  ? -16.951 -26.507 79.674 1.00 90.46  ? -3   DA  I N7    1 
ATOM   7398  C  C5    . DA  I 5 70  ? -16.963 -27.658 80.438 1.00 90.90  ? -3   DA  I C5    1 
ATOM   7399  C  C6    . DA  I 5 70  ? -16.972 -27.871 81.830 1.00 91.17  ? -3   DA  I C6    1 
ATOM   7400  N  N6    . DA  I 5 70  ? -16.969 -26.879 82.723 1.00 91.42  ? -3   DA  I N6    1 
ATOM   7401  N  N1    . DA  I 5 70  ? -16.984 -29.153 82.266 1.00 91.67  ? -3   DA  I N1    1 
ATOM   7402  C  C2    . DA  I 5 70  ? -16.991 -30.162 81.376 1.00 91.56  ? -3   DA  I C2    1 
ATOM   7403  N  N3    . DA  I 5 70  ? -16.984 -30.085 80.043 1.00 91.82  ? -3   DA  I N3    1 
ATOM   7404  C  C4    . DA  I 5 70  ? -16.975 -28.793 79.640 1.00 91.46  ? -3   DA  I C4    1 
ATOM   7405  P  P     . DC  I 5 71  ? -18.867 -31.040 74.445 1.00 96.45  ? -2   DC  I P     1 
ATOM   7406  O  OP1   . DC  I 5 71  ? -18.911 -32.186 73.511 1.00 95.83  ? -2   DC  I OP1   1 
ATOM   7407  O  OP2   . DC  I 5 71  ? -19.816 -29.903 74.320 1.00 94.54  ? -2   DC  I OP2   1 
ATOM   7408  O  "O5'" . DC  I 5 71  ? -19.002 -31.594 75.948 1.00 99.22  ? -2   DC  I "O5'" 1 
ATOM   7409  C  "C5'" . DC  I 5 71  ? -19.832 -32.700 76.316 1.00 102.12 ? -2   DC  I "C5'" 1 
ATOM   7410  C  "C4'" . DC  I 5 71  ? -20.754 -32.331 77.467 1.00 104.29 ? -2   DC  I "C4'" 1 
ATOM   7411  O  "O4'" . DC  I 5 71  ? -20.132 -31.304 78.290 1.00 103.48 ? -2   DC  I "O4'" 1 
ATOM   7412  C  "C3'" . DC  I 5 71  ? -22.131 -31.788 77.040 1.00 106.27 ? -2   DC  I "C3'" 1 
ATOM   7413  O  "O3'" . DC  I 5 71  ? -23.241 -32.408 77.706 1.00 109.48 ? -2   DC  I "O3'" 1 
ATOM   7414  C  "C2'" . DC  I 5 71  ? -22.062 -30.333 77.477 1.00 105.11 ? -2   DC  I "C2'" 1 
ATOM   7415  C  "C1'" . DC  I 5 71  ? -21.193 -30.491 78.719 1.00 103.83 ? -2   DC  I "C1'" 1 
ATOM   7416  N  N1    . DC  I 5 71  ? -20.714 -29.217 79.306 1.00 103.77 ? -2   DC  I N1    1 
ATOM   7417  C  C2    . DC  I 5 71  ? -20.281 -29.157 80.647 1.00 103.92 ? -2   DC  I C2    1 
ATOM   7418  O  O2    . DC  I 5 71  ? -20.275 -30.175 81.358 1.00 103.57 ? -2   DC  I O2    1 
ATOM   7419  N  N3    . DC  I 5 71  ? -19.872 -27.955 81.134 1.00 103.55 ? -2   DC  I N3    1 
ATOM   7420  C  C4    . DC  I 5 71  ? -19.892 -26.872 80.348 1.00 103.66 ? -2   DC  I C4    1 
ATOM   7421  N  N4    . DC  I 5 71  ? -19.478 -25.709 80.854 1.00 104.16 ? -2   DC  I N4    1 
ATOM   7422  C  C5    . DC  I 5 71  ? -20.334 -26.915 78.997 1.00 103.37 ? -2   DC  I C5    1 
ATOM   7423  C  C6    . DC  I 5 71  ? -20.735 -28.095 78.529 1.00 103.49 ? -2   DC  I C6    1 
ATOM   7424  P  P     . DA  I 5 72  ? -23.624 -33.960 77.596 1.00 112.26 ? -1   DA  I P     1 
ATOM   7425  O  OP1   . DA  I 5 72  ? -22.927 -34.576 76.454 1.00 111.89 ? -1   DA  I OP1   1 
ATOM   7426  O  OP2   . DA  I 5 72  ? -25.096 -34.030 77.657 1.00 112.33 ? -1   DA  I OP2   1 
ATOM   7427  O  "O5'" . DA  I 5 72  ? -23.033 -34.615 78.938 1.00 115.97 ? -1   DA  I "O5'" 1 
ATOM   7428  C  "C5'" . DA  I 5 72  ? -22.718 -33.871 80.128 1.00 120.97 ? -1   DA  I "C5'" 1 
ATOM   7429  C  "C4'" . DA  I 5 72  ? -23.736 -33.992 81.267 1.00 124.94 ? -1   DA  I "C4'" 1 
ATOM   7430  O  "O4'" . DA  I 5 72  ? -23.590 -32.831 82.129 1.00 125.93 ? -1   DA  I "O4'" 1 
ATOM   7431  C  "C3'" . DA  I 5 72  ? -25.233 -34.027 80.931 1.00 127.13 ? -1   DA  I "C3'" 1 
ATOM   7432  O  "O3'" . DA  I 5 72  ? -25.984 -34.694 81.975 1.00 130.76 ? -1   DA  I "O3'" 1 
ATOM   7433  C  "C2'" . DA  I 5 72  ? -25.560 -32.545 80.832 1.00 127.03 ? -1   DA  I "C2'" 1 
ATOM   7434  C  "C1'" . DA  I 5 72  ? -24.686 -31.951 81.935 1.00 127.21 ? -1   DA  I "C1'" 1 
ATOM   7435  N  N9    . DA  I 5 72  ? -24.214 -30.626 81.556 1.00 127.49 ? -1   DA  I N9    1 
ATOM   7436  C  C8    . DA  I 5 72  ? -24.018 -30.192 80.276 1.00 127.77 ? -1   DA  I C8    1 
ATOM   7437  N  N7    . DA  I 5 72  ? -23.597 -28.956 80.187 1.00 128.21 ? -1   DA  I N7    1 
ATOM   7438  C  C5    . DA  I 5 72  ? -23.521 -28.547 81.502 1.00 127.80 ? -1   DA  I C5    1 
ATOM   7439  C  C6    . DA  I 5 72  ? -23.138 -27.321 82.069 1.00 127.53 ? -1   DA  I C6    1 
ATOM   7440  N  N6    . DA  I 5 72  ? -22.757 -26.281 81.324 1.00 127.22 ? -1   DA  I N6    1 
ATOM   7441  N  N1    . DA  I 5 72  ? -23.171 -27.221 83.419 1.00 127.87 ? -1   DA  I N1    1 
ATOM   7442  C  C2    . DA  I 5 72  ? -23.569 -28.285 84.142 1.00 127.83 ? -1   DA  I C2    1 
ATOM   7443  N  N3    . DA  I 5 72  ? -23.945 -29.495 83.715 1.00 127.58 ? -1   DA  I N3    1 
ATOM   7444  C  C4    . DA  I 5 72  ? -23.900 -29.561 82.370 1.00 127.68 ? -1   DA  I C4    1 
ATOM   7445  P  P     . DG  I 5 73  ? -27.497 -34.343 82.426 1.00 133.29 ? 0    DG  I P     1 
ATOM   7446  O  OP1   . DG  I 5 73  ? -28.028 -35.542 83.105 1.00 132.94 ? 0    DG  I OP1   1 
ATOM   7447  O  OP2   . DG  I 5 73  ? -28.259 -33.748 81.302 1.00 132.76 ? 0    DG  I OP2   1 
ATOM   7448  O  "O5'" . DG  I 5 73  ? -27.277 -33.210 83.527 1.00 135.08 ? 0    DG  I "O5'" 1 
ATOM   7449  C  "C5'" . DG  I 5 73  ? -26.933 -33.564 84.860 1.00 138.24 ? 0    DG  I "C5'" 1 
ATOM   7450  C  "C4'" . DG  I 5 73  ? -27.550 -32.576 85.833 1.00 140.58 ? 0    DG  I "C4'" 1 
ATOM   7451  O  "O4'" . DG  I 5 73  ? -27.040 -31.247 85.562 1.00 141.43 ? 0    DG  I "O4'" 1 
ATOM   7452  C  "C3'" . DG  I 5 73  ? -29.070 -32.459 85.778 1.00 141.92 ? 0    DG  I "C3'" 1 
ATOM   7453  O  "O3'" . DG  I 5 73  ? -29.549 -32.312 87.112 1.00 143.38 ? 0    DG  I "O3'" 1 
ATOM   7454  C  "C2'" . DG  I 5 73  ? -29.321 -31.215 84.921 1.00 141.96 ? 0    DG  I "C2'" 1 
ATOM   7455  C  "C1'" . DG  I 5 73  ? -28.095 -30.361 85.230 1.00 142.54 ? 0    DG  I "C1'" 1 
ATOM   7456  N  N9    . DG  I 5 73  ? -27.642 -29.528 84.116 1.00 142.96 ? 0    DG  I N9    1 
ATOM   7457  C  C8    . DG  I 5 73  ? -27.385 -29.935 82.826 1.00 143.13 ? 0    DG  I C8    1 
ATOM   7458  N  N7    . DG  I 5 73  ? -26.981 -28.974 82.039 1.00 143.19 ? 0    DG  I N7    1 
ATOM   7459  C  C5    . DG  I 5 73  ? -26.966 -27.853 82.859 1.00 143.02 ? 0    DG  I C5    1 
ATOM   7460  C  C6    . DG  I 5 73  ? -26.618 -26.515 82.558 1.00 142.88 ? 0    DG  I C6    1 
ATOM   7461  O  O6    . DG  I 5 73  ? -26.239 -26.057 81.472 1.00 142.79 ? 0    DG  I O6    1 
ATOM   7462  N  N1    . DG  I 5 73  ? -26.742 -25.680 83.671 1.00 143.01 ? 0    DG  I N1    1 
ATOM   7463  C  C2    . DG  I 5 73  ? -27.151 -26.100 84.918 1.00 142.95 ? 0    DG  I C2    1 
ATOM   7464  N  N2    . DG  I 5 73  ? -27.210 -25.166 85.872 1.00 142.98 ? 0    DG  I N2    1 
ATOM   7465  N  N3    . DG  I 5 73  ? -27.482 -27.352 85.214 1.00 142.84 ? 0    DG  I N3    1 
ATOM   7466  C  C4    . DG  I 5 73  ? -27.366 -28.176 84.141 1.00 143.01 ? 0    DG  I C4    1 
ATOM   7467  P  P     . DC  I 5 74  ? -31.111 -32.280 87.461 1.00 144.27 ? 1    DC  I P     1 
ATOM   7468  O  OP1   . DC  I 5 74  ? -31.233 -32.814 88.833 1.00 144.58 ? 1    DC  I OP1   1 
ATOM   7469  O  OP2   . DC  I 5 74  ? -31.867 -32.932 86.367 1.00 144.15 ? 1    DC  I OP2   1 
ATOM   7470  O  "O5'" . DC  I 5 74  ? -31.466 -30.714 87.459 1.00 144.74 ? 1    DC  I "O5'" 1 
ATOM   7471  C  "C5'" . DC  I 5 74  ? -30.821 -29.824 88.371 1.00 146.09 ? 1    DC  I "C5'" 1 
ATOM   7472  C  "C4'" . DC  I 5 74  ? -31.024 -28.350 88.027 1.00 147.31 ? 1    DC  I "C4'" 1 
ATOM   7473  O  "O4'" . DC  I 5 74  ? -30.382 -27.992 86.768 1.00 147.83 ? 1    DC  I "O4'" 1 
ATOM   7474  C  "C3'" . DC  I 5 74  ? -32.472 -27.870 87.916 1.00 147.77 ? 1    DC  I "C3'" 1 
ATOM   7475  O  "O3'" . DC  I 5 74  ? -32.605 -26.694 88.697 1.00 148.69 ? 1    DC  I "O3'" 1 
ATOM   7476  C  "C2'" . DC  I 5 74  ? -32.620 -27.517 86.439 1.00 147.73 ? 1    DC  I "C2'" 1 
ATOM   7477  C  "C1'" . DC  I 5 74  ? -31.207 -27.024 86.148 1.00 147.60 ? 1    DC  I "C1'" 1 
ATOM   7478  N  N1    . DC  I 5 74  ? -30.879 -26.824 84.692 1.00 147.40 ? 1    DC  I N1    1 
ATOM   7479  C  C2    . DC  I 5 74  ? -30.769 -25.515 84.193 1.00 147.36 ? 1    DC  I C2    1 
ATOM   7480  O  O2    . DC  I 5 74  ? -30.937 -24.552 84.948 1.00 147.44 ? 1    DC  I O2    1 
ATOM   7481  N  N3    . DC  I 5 74  ? -30.476 -25.330 82.883 1.00 147.39 ? 1    DC  I N3    1 
ATOM   7482  C  C4    . DC  I 5 74  ? -30.299 -26.384 82.085 1.00 147.45 ? 1    DC  I C4    1 
ATOM   7483  N  N4    . DC  I 5 74  ? -30.015 -26.138 80.805 1.00 147.52 ? 1    DC  I N4    1 
ATOM   7484  C  C5    . DC  I 5 74  ? -30.409 -27.727 82.562 1.00 147.34 ? 1    DC  I C5    1 
ATOM   7485  C  C6    . DC  I 5 74  ? -30.698 -27.898 83.859 1.00 147.39 ? 1    DC  I C6    1 
ATOM   7486  P  P     . DG  I 5 75  ? -33.746 -26.512 89.803 1.00 149.24 ? 2    DG  I P     1 
ATOM   7487  O  OP1   . DG  I 5 75  ? -33.536 -27.537 90.854 1.00 149.18 ? 2    DG  I OP1   1 
ATOM   7488  O  OP2   . DG  I 5 75  ? -35.053 -26.428 89.108 1.00 149.00 ? 2    DG  I OP2   1 
ATOM   7489  O  "O5'" . DG  I 5 75  ? -33.402 -25.070 90.413 1.00 149.22 ? 2    DG  I "O5'" 1 
ATOM   7490  C  "C5'" . DG  I 5 75  ? -32.569 -24.149 89.708 1.00 149.83 ? 2    DG  I "C5'" 1 
ATOM   7491  C  "C4'" . DG  I 5 75  ? -33.368 -23.194 88.833 1.00 150.51 ? 2    DG  I "C4'" 1 
ATOM   7492  O  "O4'" . DG  I 5 75  ? -33.207 -23.529 87.429 1.00 150.72 ? 2    DG  I "O4'" 1 
ATOM   7493  C  "C3'" . DG  I 5 75  ? -34.876 -23.139 89.076 1.00 150.80 ? 2    DG  I "C3'" 1 
ATOM   7494  O  "O3'" . DG  I 5 75  ? -35.212 -21.789 89.324 1.00 151.28 ? 2    DG  I "O3'" 1 
ATOM   7495  C  "C2'" . DG  I 5 75  ? -35.494 -23.652 87.772 1.00 150.69 ? 2    DG  I "C2'" 1 
ATOM   7496  C  "C1'" . DG  I 5 75  ? -34.425 -23.249 86.765 1.00 150.31 ? 2    DG  I "C1'" 1 
ATOM   7497  N  N9    . DG  I 5 75  ? -34.429 -23.963 85.486 1.00 150.09 ? 2    DG  I N9    1 
ATOM   7498  C  C8    . DG  I 5 75  ? -34.966 -25.197 85.197 1.00 149.92 ? 2    DG  I C8    1 
ATOM   7499  N  N7    . DG  I 5 75  ? -34.794 -25.565 83.960 1.00 149.84 ? 2    DG  I N7    1 
ATOM   7500  C  C5    . DG  I 5 75  ? -34.098 -24.509 83.390 1.00 149.89 ? 2    DG  I C5    1 
ATOM   7501  C  C6    . DG  I 5 75  ? -33.625 -24.332 82.067 1.00 150.04 ? 2    DG  I C6    1 
ATOM   7502  O  O6    . DG  I 5 75  ? -33.735 -25.107 81.108 1.00 149.92 ? 2    DG  I O6    1 
ATOM   7503  N  N1    . DG  I 5 75  ? -32.964 -23.114 81.907 1.00 150.19 ? 2    DG  I N1    1 
ATOM   7504  C  C2    . DG  I 5 75  ? -32.779 -22.180 82.903 1.00 149.99 ? 2    DG  I C2    1 
ATOM   7505  N  N2    . DG  I 5 75  ? -32.117 -21.063 82.572 1.00 149.93 ? 2    DG  I N2    1 
ATOM   7506  N  N3    . DG  I 5 75  ? -33.219 -22.335 84.145 1.00 149.88 ? 2    DG  I N3    1 
ATOM   7507  C  C4    . DG  I 5 75  ? -33.866 -23.516 84.316 1.00 149.88 ? 2    DG  I C4    1 
ATOM   7508  P  P     . DC  I 5 76  ? -36.649 -21.356 89.873 1.00 151.76 ? 3    DC  I P     1 
ATOM   7509  O  OP1   . DC  I 5 76  ? -36.419 -20.767 91.216 1.00 151.88 ? 3    DC  I OP1   1 
ATOM   7510  O  OP2   . DC  I 5 76  ? -37.619 -22.468 89.712 1.00 151.59 ? 3    DC  I OP2   1 
ATOM   7511  O  "O5'" . DC  I 5 76  ? -37.051 -20.204 88.830 1.00 151.25 ? 3    DC  I "O5'" 1 
ATOM   7512  C  "C5'" . DC  I 5 76  ? -36.226 -19.043 88.689 1.00 150.35 ? 3    DC  I "C5'" 1 
ATOM   7513  C  "C4'" . DC  I 5 76  ? -36.375 -18.413 87.316 1.00 149.55 ? 3    DC  I "C4'" 1 
ATOM   7514  O  "O4'" . DC  I 5 76  ? -36.068 -19.389 86.286 1.00 149.37 ? 3    DC  I "O4'" 1 
ATOM   7515  C  "C3'" . DC  I 5 76  ? -37.762 -17.854 87.003 1.00 149.13 ? 3    DC  I "C3'" 1 
ATOM   7516  O  "O3'" . DC  I 5 76  ? -37.611 -16.529 86.491 1.00 148.55 ? 3    DC  I "O3'" 1 
ATOM   7517  C  "C2'" . DC  I 5 76  ? -38.308 -18.824 85.955 1.00 149.23 ? 3    DC  I "C2'" 1 
ATOM   7518  C  "C1'" . DC  I 5 76  ? -37.032 -19.290 85.257 1.00 149.28 ? 3    DC  I "C1'" 1 
ATOM   7519  N  N1    . DC  I 5 76  ? -37.139 -20.619 84.550 1.00 149.28 ? 3    DC  I N1    1 
ATOM   7520  C  C2    . DC  I 5 76  ? -36.920 -20.724 83.159 1.00 148.92 ? 3    DC  I C2    1 
ATOM   7521  O  O2    . DC  I 5 76  ? -36.639 -19.717 82.495 1.00 148.39 ? 3    DC  I O2    1 
ATOM   7522  N  N3    . DC  I 5 76  ? -37.026 -21.952 82.574 1.00 148.89 ? 3    DC  I N3    1 
ATOM   7523  C  C4    . DC  I 5 76  ? -37.333 -23.032 83.312 1.00 149.05 ? 3    DC  I C4    1 
ATOM   7524  N  N4    . DC  I 5 76  ? -37.429 -24.221 82.709 1.00 148.85 ? 3    DC  I N4    1 
ATOM   7525  C  C5    . DC  I 5 76  ? -37.557 -22.945 84.718 1.00 148.93 ? 3    DC  I C5    1 
ATOM   7526  C  C6    . DC  I 5 76  ? -37.449 -21.736 85.284 1.00 149.29 ? 3    DC  I C6    1 
ATOM   7527  P  P     . DG  I 5 77  ? -38.773 -15.420 86.514 1.00 148.07 ? 4    DG  I P     1 
ATOM   7528  O  OP1   . DG  I 5 77  ? -38.701 -14.728 87.818 1.00 148.08 ? 4    DG  I OP1   1 
ATOM   7529  O  OP2   . DG  I 5 77  ? -40.054 -16.030 86.077 1.00 148.11 ? 4    DG  I OP2   1 
ATOM   7530  O  "O5'" . DG  I 5 77  ? -38.289 -14.387 85.386 1.00 147.81 ? 4    DG  I "O5'" 1 
ATOM   7531  C  "C5'" . DG  I 5 77  ? -37.416 -14.781 84.311 1.00 147.11 ? 4    DG  I "C5'" 1 
ATOM   7532  C  "C4'" . DG  I 5 77  ? -38.133 -14.850 82.970 1.00 146.21 ? 4    DG  I "C4'" 1 
ATOM   7533  O  "O4'" . DG  I 5 77  ? -38.371 -16.230 82.594 1.00 146.08 ? 4    DG  I "O4'" 1 
ATOM   7534  C  "C3'" . DG  I 5 77  ? -39.489 -14.156 82.929 1.00 145.69 ? 4    DG  I "C3'" 1 
ATOM   7535  O  "O3'" . DG  I 5 77  ? -39.402 -13.139 81.933 1.00 145.03 ? 4    DG  I "O3'" 1 
ATOM   7536  C  "C2'" . DG  I 5 77  ? -40.496 -15.283 82.667 1.00 145.58 ? 4    DG  I "C2'" 1 
ATOM   7537  C  "C1'" . DG  I 5 77  ? -39.639 -16.340 81.989 1.00 146.01 ? 4    DG  I "C1'" 1 
ATOM   7538  N  N9    . DG  I 5 77  ? -40.087 -17.716 82.176 1.00 146.05 ? 4    DG  I N9    1 
ATOM   7539  C  C8    . DG  I 5 77  ? -40.605 -18.271 83.321 1.00 146.24 ? 4    DG  I C8    1 
ATOM   7540  N  N7    . DG  I 5 77  ? -40.912 -19.533 83.205 1.00 146.23 ? 4    DG  I N7    1 
ATOM   7541  C  C5    . DG  I 5 77  ? -40.574 -19.842 81.896 1.00 146.27 ? 4    DG  I C5    1 
ATOM   7542  C  C6    . DG  I 5 77  ? -40.680 -21.070 81.192 1.00 146.34 ? 4    DG  I C6    1 
ATOM   7543  O  O6    . DG  I 5 77  ? -41.114 -22.154 81.610 1.00 146.13 ? 4    DG  I O6    1 
ATOM   7544  N  N1    . DG  I 5 77  ? -40.225 -20.963 79.872 1.00 146.40 ? 4    DG  I N1    1 
ATOM   7545  C  C2    . DG  I 5 77  ? -39.724 -19.807 79.306 1.00 146.36 ? 4    DG  I C2    1 
ATOM   7546  N  N2    . DG  I 5 77  ? -39.331 -19.892 78.025 1.00 146.14 ? 4    DG  I N2    1 
ATOM   7547  N  N3    . DG  I 5 77  ? -39.621 -18.648 79.961 1.00 146.31 ? 4    DG  I N3    1 
ATOM   7548  C  C4    . DG  I 5 77  ? -40.061 -18.734 81.247 1.00 146.21 ? 4    DG  I C4    1 
ATOM   7549  P  P     . DT  I 5 78  ? -40.571 -12.810 80.895 1.00 145.00 ? 5    DT  I P     1 
ATOM   7550  O  OP1   . DT  I 5 78  ? -40.219 -11.529 80.237 1.00 144.71 ? 5    DT  I OP1   1 
ATOM   7551  O  OP2   . DT  I 5 78  ? -41.886 -12.946 81.569 1.00 144.64 ? 5    DT  I OP2   1 
ATOM   7552  O  "O5'" . DT  I 5 78  ? -40.418 -14.016 79.854 1.00 144.54 ? 5    DT  I "O5'" 1 
ATOM   7553  C  "C5'" . DT  I 5 78  ? -39.290 -14.124 78.988 1.00 143.88 ? 5    DT  I "C5'" 1 
ATOM   7554  C  "C4'" . DT  I 5 78  ? -39.757 -14.590 77.620 1.00 143.44 ? 5    DT  I "C4'" 1 
ATOM   7555  O  "O4'" . DT  I 5 78  ? -40.342 -15.910 77.745 1.00 143.42 ? 5    DT  I "O4'" 1 
ATOM   7556  C  "C3'" . DT  I 5 78  ? -40.821 -13.706 76.963 1.00 143.03 ? 5    DT  I "C3'" 1 
ATOM   7557  O  "O3'" . DT  I 5 78  ? -40.651 -13.628 75.534 1.00 141.60 ? 5    DT  I "O3'" 1 
ATOM   7558  C  "C2'" . DT  I 5 78  ? -42.128 -14.405 77.337 1.00 143.56 ? 5    DT  I "C2'" 1 
ATOM   7559  C  "C1'" . DT  I 5 78  ? -41.708 -15.874 77.372 1.00 144.14 ? 5    DT  I "C1'" 1 
ATOM   7560  N  N1    . DT  I 5 78  ? -42.454 -16.741 78.339 1.00 144.47 ? 5    DT  I N1    1 
ATOM   7561  C  C2    . DT  I 5 78  ? -42.642 -18.073 78.021 1.00 144.56 ? 5    DT  I C2    1 
ATOM   7562  O  O2    . DT  I 5 78  ? -42.241 -18.582 76.989 1.00 144.58 ? 5    DT  I O2    1 
ATOM   7563  N  N3    . DT  I 5 78  ? -43.325 -18.798 78.967 1.00 144.40 ? 5    DT  I N3    1 
ATOM   7564  C  C4    . DT  I 5 78  ? -43.824 -18.343 80.176 1.00 144.48 ? 5    DT  I C4    1 
ATOM   7565  O  O4    . DT  I 5 78  ? -44.423 -19.096 80.940 1.00 144.48 ? 5    DT  I O4    1 
ATOM   7566  C  C5    . DT  I 5 78  ? -43.594 -16.938 80.456 1.00 144.78 ? 5    DT  I C5    1 
ATOM   7567  C  C7    . DT  I 5 78  ? -44.081 -16.303 81.732 1.00 144.59 ? 5    DT  I C7    1 
ATOM   7568  C  C6    . DT  I 5 78  ? -42.925 -16.219 79.535 1.00 144.77 ? 5    DT  I C6    1 
ATOM   7569  P  P     . DA  I 5 79  ? -39.663 -12.575 74.826 1.00 140.20 ? 6    DA  I P     1 
ATOM   7570  O  OP1   . DA  I 5 79  ? -38.506 -12.302 75.706 1.00 140.29 ? 6    DA  I OP1   1 
ATOM   7571  O  OP2   . DA  I 5 79  ? -40.501 -11.458 74.336 1.00 139.93 ? 6    DA  I OP2   1 
ATOM   7572  O  "O5'" . DA  I 5 79  ? -39.108 -13.397 73.570 1.00 138.80 ? 6    DA  I "O5'" 1 
ATOM   7573  C  "C5'" . DA  I 5 79  ? -38.613 -14.728 73.747 1.00 136.74 ? 6    DA  I "C5'" 1 
ATOM   7574  C  "C4'" . DA  I 5 79  ? -39.399 -15.733 72.917 1.00 135.33 ? 6    DA  I "C4'" 1 
ATOM   7575  O  "O4'" . DA  I 5 79  ? -40.483 -16.324 73.681 1.00 135.07 ? 6    DA  I "O4'" 1 
ATOM   7576  C  "C3'" . DA  I 5 79  ? -40.051 -15.196 71.646 1.00 134.35 ? 6    DA  I "C3'" 1 
ATOM   7577  O  "O3'" . DA  I 5 79  ? -39.857 -16.167 70.636 1.00 132.66 ? 6    DA  I "O3'" 1 
ATOM   7578  C  "C2'" . DA  I 5 79  ? -41.525 -15.076 72.020 1.00 134.23 ? 6    DA  I "C2'" 1 
ATOM   7579  C  "C1'" . DA  I 5 79  ? -41.649 -16.317 72.884 1.00 134.85 ? 6    DA  I "C1'" 1 
ATOM   7580  N  N9    . DA  I 5 79  ? -42.789 -16.316 73.781 1.00 135.03 ? 6    DA  I N9    1 
ATOM   7581  C  C8    . DA  I 5 79  ? -43.449 -15.232 74.291 1.00 135.13 ? 6    DA  I C8    1 
ATOM   7582  N  N7    . DA  I 5 79  ? -44.440 -15.553 75.087 1.00 135.21 ? 6    DA  I N7    1 
ATOM   7583  C  C5    . DA  I 5 79  ? -44.424 -16.940 75.100 1.00 135.19 ? 6    DA  I C5    1 
ATOM   7584  C  C6    . DA  I 5 79  ? -45.229 -17.902 75.748 1.00 135.05 ? 6    DA  I C6    1 
ATOM   7585  N  N6    . DA  I 5 79  ? -46.244 -17.589 76.554 1.00 134.89 ? 6    DA  I N6    1 
ATOM   7586  N  N1    . DA  I 5 79  ? -44.941 -19.207 75.540 1.00 135.34 ? 6    DA  I N1    1 
ATOM   7587  C  C2    . DA  I 5 79  ? -43.919 -19.533 74.731 1.00 135.27 ? 6    DA  I C2    1 
ATOM   7588  N  N3    . DA  I 5 79  ? -43.097 -18.718 74.068 1.00 135.19 ? 6    DA  I N3    1 
ATOM   7589  C  C4    . DA  I 5 79  ? -43.407 -17.427 74.296 1.00 135.13 ? 6    DA  I C4    1 
ATOM   7590  P  P     . DC  I 5 80  ? -39.969 -15.814 69.086 1.00 130.64 ? 7    DC  I P     1 
ATOM   7591  O  OP1   . DC  I 5 80  ? -38.612 -15.472 68.606 1.00 130.53 ? 7    DC  I OP1   1 
ATOM   7592  O  OP2   . DC  I 5 80  ? -41.102 -14.885 68.830 1.00 130.41 ? 7    DC  I OP2   1 
ATOM   7593  O  "O5'" . DC  I 5 80  ? -40.395 -17.260 68.575 1.00 129.21 ? 7    DC  I "O5'" 1 
ATOM   7594  C  "C5'" . DC  I 5 80  ? -41.771 -17.533 68.442 1.00 127.06 ? 7    DC  I "C5'" 1 
ATOM   7595  C  "C4'" . DC  I 5 80  ? -42.022 -19.019 68.567 1.00 125.64 ? 7    DC  I "C4'" 1 
ATOM   7596  O  "O4'" . DC  I 5 80  ? -42.490 -19.280 69.905 1.00 125.29 ? 7    DC  I "O4'" 1 
ATOM   7597  C  "C3'" . DC  I 5 80  ? -43.091 -19.538 67.613 1.00 125.07 ? 7    DC  I "C3'" 1 
ATOM   7598  O  "O3'" . DC  I 5 80  ? -42.769 -20.842 67.130 1.00 123.91 ? 7    DC  I "O3'" 1 
ATOM   7599  C  "C2'" . DC  I 5 80  ? -44.367 -19.564 68.445 1.00 125.28 ? 7    DC  I "C2'" 1 
ATOM   7600  C  "C1'" . DC  I 5 80  ? -43.876 -19.573 69.889 1.00 125.38 ? 7    DC  I "C1'" 1 
ATOM   7601  N  N1    . DC  I 5 80  ? -44.639 -18.604 70.742 1.00 125.30 ? 7    DC  I N1    1 
ATOM   7602  C  C2    . DC  I 5 80  ? -45.434 -19.113 71.772 1.00 124.99 ? 7    DC  I C2    1 
ATOM   7603  O  O2    . DC  I 5 80  ? -45.475 -20.335 71.963 1.00 124.93 ? 7    DC  I O2    1 
ATOM   7604  N  N3    . DC  I 5 80  ? -46.130 -18.240 72.540 1.00 125.08 ? 7    DC  I N3    1 
ATOM   7605  C  C4    . DC  I 5 80  ? -46.064 -16.927 72.304 1.00 125.16 ? 7    DC  I C4    1 
ATOM   7606  N  N4    . DC  I 5 80  ? -46.775 -16.125 73.102 1.00 125.36 ? 7    DC  I N4    1 
ATOM   7607  C  C5    . DC  I 5 80  ? -45.265 -16.381 71.257 1.00 124.91 ? 7    DC  I C5    1 
ATOM   7608  C  C6    . DC  I 5 80  ? -44.580 -17.253 70.508 1.00 125.29 ? 7    DC  I C6    1 
ATOM   7609  P  P     . DG  I 5 81  ? -43.604 -21.495 65.931 1.00 122.58 ? 8    DG  I P     1 
ATOM   7610  O  OP1   . DG  I 5 81  ? -42.699 -22.423 65.224 1.00 122.74 ? 8    DG  I OP1   1 
ATOM   7611  O  OP2   . DG  I 5 81  ? -44.272 -20.421 65.164 1.00 122.12 ? 8    DG  I OP2   1 
ATOM   7612  O  "O5'" . DG  I 5 81  ? -44.730 -22.324 66.704 1.00 122.68 ? 8    DG  I "O5'" 1 
ATOM   7613  C  "C5'" . DG  I 5 81  ? -44.439 -23.591 67.281 1.00 123.46 ? 8    DG  I "C5'" 1 
ATOM   7614  C  "C4'" . DG  I 5 81  ? -45.704 -24.299 67.748 1.00 124.29 ? 8    DG  I "C4'" 1 
ATOM   7615  O  "O4'" . DG  I 5 81  ? -46.385 -23.538 68.778 1.00 124.95 ? 8    DG  I "O4'" 1 
ATOM   7616  C  "C3'" . DG  I 5 81  ? -46.767 -24.586 66.696 1.00 124.43 ? 8    DG  I "C3'" 1 
ATOM   7617  O  "O3'" . DG  I 5 81  ? -47.313 -25.854 67.012 1.00 124.99 ? 8    DG  I "O3'" 1 
ATOM   7618  C  "C2'" . DG  I 5 81  ? -47.778 -23.455 66.876 1.00 124.39 ? 8    DG  I "C2'" 1 
ATOM   7619  C  "C1'" . DG  I 5 81  ? -47.703 -23.210 68.381 1.00 125.17 ? 8    DG  I "C1'" 1 
ATOM   7620  N  N9    . DG  I 5 81  ? -47.908 -21.840 68.847 1.00 125.25 ? 8    DG  I N9    1 
ATOM   7621  C  C8    . DG  I 5 81  ? -47.453 -20.678 68.274 1.00 125.28 ? 8    DG  I C8    1 
ATOM   7622  N  N7    . DG  I 5 81  ? -47.777 -19.604 68.939 1.00 125.34 ? 8    DG  I N7    1 
ATOM   7623  C  C5    . DG  I 5 81  ? -48.491 -20.081 70.031 1.00 125.48 ? 8    DG  I C5    1 
ATOM   7624  C  C6    . DG  I 5 81  ? -49.101 -19.384 71.114 1.00 125.54 ? 8    DG  I C6    1 
ATOM   7625  O  O6    . DG  I 5 81  ? -49.133 -18.162 71.328 1.00 125.36 ? 8    DG  I O6    1 
ATOM   7626  N  N1    . DG  I 5 81  ? -49.727 -20.251 72.018 1.00 125.54 ? 8    DG  I N1    1 
ATOM   7627  C  C2    . DG  I 5 81  ? -49.757 -21.627 71.891 1.00 125.53 ? 8    DG  I C2    1 
ATOM   7628  N  N2    . DG  I 5 81  ? -50.405 -22.298 72.860 1.00 125.34 ? 8    DG  I N2    1 
ATOM   7629  N  N3    . DG  I 5 81  ? -49.190 -22.290 70.881 1.00 125.50 ? 8    DG  I N3    1 
ATOM   7630  C  C4    . DG  I 5 81  ? -48.576 -21.460 69.991 1.00 125.46 ? 8    DG  I C4    1 
ATOM   7631  P  P     . DT  I 5 82  ? -48.187 -26.700 65.975 1.00 125.68 ? 9    DT  I P     1 
ATOM   7632  O  OP1   . DT  I 5 82  ? -47.783 -28.120 66.103 1.00 125.11 ? 9    DT  I OP1   1 
ATOM   7633  O  OP2   . DT  I 5 82  ? -48.135 -26.049 64.649 1.00 125.89 ? 9    DT  I OP2   1 
ATOM   7634  O  "O5'" . DT  I 5 82  ? -49.669 -26.484 66.547 1.00 126.72 ? 9    DT  I "O5'" 1 
ATOM   7635  C  "C5'" . DT  I 5 82  ? -50.085 -27.092 67.783 1.00 128.24 ? 9    DT  I "C5'" 1 
ATOM   7636  C  "C4'" . DT  I 5 82  ? -51.251 -26.358 68.428 1.00 129.03 ? 9    DT  I "C4'" 1 
ATOM   7637  O  "O4'" . DT  I 5 82  ? -50.919 -24.962 68.605 1.00 129.13 ? 9    DT  I "O4'" 1 
ATOM   7638  C  "C3'" . DT  I 5 82  ? -52.542 -26.376 67.619 1.00 130.06 ? 9    DT  I "C3'" 1 
ATOM   7639  O  "O3'" . DT  I 5 82  ? -53.502 -27.217 68.265 1.00 131.75 ? 9    DT  I "O3'" 1 
ATOM   7640  C  "C2'" . DT  I 5 82  ? -52.986 -24.913 67.548 1.00 129.65 ? 9    DT  I "C2'" 1 
ATOM   7641  C  "C1'" . DT  I 5 82  ? -52.111 -24.221 68.580 1.00 129.45 ? 9    DT  I "C1'" 1 
ATOM   7642  N  N1    . DT  I 5 82  ? -51.775 -22.808 68.258 1.00 129.52 ? 9    DT  I N1    1 
ATOM   7643  C  C2    . DT  I 5 82  ? -51.952 -21.834 69.222 1.00 129.92 ? 9    DT  I C2    1 
ATOM   7644  O  O2    . DT  I 5 82  ? -52.376 -22.051 70.339 1.00 130.28 ? 9    DT  I O2    1 
ATOM   7645  N  N3    . DT  I 5 82  ? -51.613 -20.564 68.838 1.00 129.85 ? 9    DT  I N3    1 
ATOM   7646  C  C4    . DT  I 5 82  ? -51.126 -20.172 67.608 1.00 130.07 ? 9    DT  I C4    1 
ATOM   7647  O  O4    . DT  I 5 82  ? -50.864 -18.993 67.388 1.00 130.00 ? 9    DT  I O4    1 
ATOM   7648  C  C5    . DT  I 5 82  ? -50.954 -21.237 66.633 1.00 130.27 ? 9    DT  I C5    1 
ATOM   7649  C  C7    . DT  I 5 82  ? -50.429 -20.961 65.247 1.00 129.87 ? 9    DT  I C7    1 
ATOM   7650  C  C6    . DT  I 5 82  ? -51.284 -22.486 67.007 1.00 129.88 ? 9    DT  I C6    1 
ATOM   7651  P  P     . DG  I 5 83  ? -54.759 -27.836 67.477 1.00 133.12 ? 10   DG  I P     1 
ATOM   7652  O  OP1   . DG  I 5 83  ? -55.283 -28.940 68.310 1.00 133.28 ? 10   DG  I OP1   1 
ATOM   7653  O  OP2   . DG  I 5 83  ? -54.389 -28.121 66.073 1.00 132.38 ? 10   DG  I OP2   1 
ATOM   7654  O  "O5'" . DG  I 5 83  ? -55.808 -26.624 67.474 1.00 134.18 ? 10   DG  I "O5'" 1 
ATOM   7655  C  "C5'" . DG  I 5 83  ? -56.234 -26.044 68.707 1.00 136.17 ? 10   DG  I "C5'" 1 
ATOM   7656  C  "C4'" . DG  I 5 83  ? -57.071 -24.791 68.510 1.00 137.68 ? 10   DG  I "C4'" 1 
ATOM   7657  O  "O4'" . DG  I 5 83  ? -56.217 -23.629 68.360 1.00 137.83 ? 10   DG  I "O4'" 1 
ATOM   7658  C  "C3'" . DG  I 5 83  ? -57.999 -24.802 67.298 1.00 138.75 ? 10   DG  I "C3'" 1 
ATOM   7659  O  "O3'" . DG  I 5 83  ? -59.316 -24.465 67.722 1.00 140.65 ? 10   DG  I "O3'" 1 
ATOM   7660  C  "C2'" . DG  I 5 83  ? -57.411 -23.731 66.382 1.00 138.39 ? 10   DG  I "C2'" 1 
ATOM   7661  C  "C1'" . DG  I 5 83  ? -56.821 -22.777 67.412 1.00 138.29 ? 10   DG  I "C1'" 1 
ATOM   7662  N  N9    . DG  I 5 83  ? -55.814 -21.859 66.893 1.00 138.38 ? 10   DG  I N9    1 
ATOM   7663  C  C8    . DG  I 5 83  ? -54.647 -22.194 66.252 1.00 138.37 ? 10   DG  I C8    1 
ATOM   7664  N  N7    . DG  I 5 83  ? -53.932 -21.168 65.897 1.00 138.20 ? 10   DG  I N7    1 
ATOM   7665  C  C5    . DG  I 5 83  ? -54.666 -20.077 66.330 1.00 138.36 ? 10   DG  I C5    1 
ATOM   7666  C  C6    . DG  I 5 83  ? -54.385 -18.693 66.222 1.00 138.38 ? 10   DG  I C6    1 
ATOM   7667  O  O6    . DG  I 5 83  ? -53.399 -18.152 65.710 1.00 138.35 ? 10   DG  I O6    1 
ATOM   7668  N  N1    . DG  I 5 83  ? -55.388 -17.908 66.788 1.00 138.54 ? 10   DG  I N1    1 
ATOM   7669  C  C2    . DG  I 5 83  ? -56.524 -18.402 67.393 1.00 138.49 ? 10   DG  I C2    1 
ATOM   7670  N  N2    . DG  I 5 83  ? -57.377 -17.490 67.883 1.00 138.26 ? 10   DG  I N2    1 
ATOM   7671  N  N3    . DG  I 5 83  ? -56.801 -19.702 67.498 1.00 138.53 ? 10   DG  I N3    1 
ATOM   7672  C  C4    . DG  I 5 83  ? -55.831 -20.482 66.947 1.00 138.50 ? 10   DG  I C4    1 
ATOM   7673  P  P     . DC  I 5 84  ? -60.545 -25.484 67.589 1.00 141.84 ? 11   DC  I P     1 
ATOM   7674  O  OP1   . DC  I 5 84  ? -61.019 -25.764 68.962 1.00 141.78 ? 11   DC  I OP1   1 
ATOM   7675  O  OP2   . DC  I 5 84  ? -60.168 -26.617 66.712 1.00 142.19 ? 11   DC  I OP2   1 
ATOM   7676  O  "O5'" . DC  I 5 84  ? -61.609 -24.593 66.780 1.00 143.01 ? 11   DC  I "O5'" 1 
ATOM   7677  C  "C5'" . DC  I 5 84  ? -62.749 -24.020 67.417 1.00 144.61 ? 11   DC  I "C5'" 1 
ATOM   7678  C  "C4'" . DC  I 5 84  ? -62.532 -22.560 67.786 1.00 146.03 ? 11   DC  I "C4'" 1 
ATOM   7679  O  "O4'" . DC  I 5 84  ? -61.161 -22.145 67.573 1.00 145.88 ? 11   DC  I "O4'" 1 
ATOM   7680  C  "C3'" . DC  I 5 84  ? -63.325 -21.548 66.972 1.00 147.24 ? 11   DC  I "C3'" 1 
ATOM   7681  O  "O3'" . DC  I 5 84  ? -64.679 -21.483 67.431 1.00 149.27 ? 11   DC  I "O3'" 1 
ATOM   7682  C  "C2'" . DC  I 5 84  ? -62.573 -20.261 67.298 1.00 146.78 ? 11   DC  I "C2'" 1 
ATOM   7683  C  "C1'" . DC  I 5 84  ? -61.139 -20.729 67.562 1.00 146.15 ? 11   DC  I "C1'" 1 
ATOM   7684  N  N1    . DC  I 5 84  ? -60.167 -20.230 66.534 1.00 146.13 ? 11   DC  I N1    1 
ATOM   7685  C  C2    . DC  I 5 84  ? -59.796 -18.866 66.481 1.00 145.96 ? 11   DC  I C2    1 
ATOM   7686  O  O2    . DC  I 5 84  ? -60.258 -18.049 67.294 1.00 145.72 ? 11   DC  I O2    1 
ATOM   7687  N  N3    . DC  I 5 84  ? -58.916 -18.467 65.523 1.00 145.83 ? 11   DC  I N3    1 
ATOM   7688  C  C4    . DC  I 5 84  ? -58.417 -19.351 64.653 1.00 145.98 ? 11   DC  I C4    1 
ATOM   7689  N  N4    . DC  I 5 84  ? -57.555 -18.913 63.731 1.00 145.89 ? 11   DC  I N4    1 
ATOM   7690  C  C5    . DC  I 5 84  ? -58.782 -20.732 64.686 1.00 146.09 ? 11   DC  I C5    1 
ATOM   7691  C  C6    . DC  I 5 84  ? -59.651 -21.119 65.629 1.00 146.17 ? 11   DC  I C6    1 
ATOM   7692  P  P     . DG  I 5 85  ? -65.888 -21.068 66.457 1.00 150.78 ? 12   DG  I P     1 
ATOM   7693  O  OP1   . DG  I 5 85  ? -67.145 -21.191 67.231 1.00 150.64 ? 12   DG  I OP1   1 
ATOM   7694  O  OP2   . DG  I 5 85  ? -65.753 -21.834 65.195 1.00 150.54 ? 12   DG  I OP2   1 
ATOM   7695  O  "O5'" . DG  I 5 85  ? -65.606 -19.516 66.153 1.00 151.74 ? 12   DG  I "O5'" 1 
ATOM   7696  C  "C5'" . DG  I 5 85  ? -65.839 -18.512 67.150 1.00 153.36 ? 12   DG  I "C5'" 1 
ATOM   7697  C  "C4'" . DG  I 5 85  ? -65.112 -17.211 66.836 1.00 154.57 ? 12   DG  I "C4'" 1 
ATOM   7698  O  "O4'" . DG  I 5 85  ? -63.836 -17.496 66.201 1.00 154.84 ? 12   DG  I "O4'" 1 
ATOM   7699  C  "C3'" . DG  I 5 85  ? -65.849 -16.242 65.905 1.00 155.29 ? 12   DG  I "C3'" 1 
ATOM   7700  O  "O3'" . DG  I 5 85  ? -65.674 -14.881 66.369 1.00 156.45 ? 12   DG  I "O3'" 1 
ATOM   7701  C  "C2'" . DG  I 5 85  ? -65.194 -16.524 64.556 1.00 155.17 ? 12   DG  I "C2'" 1 
ATOM   7702  C  "C1'" . DG  I 5 85  ? -63.752 -16.769 64.989 1.00 155.05 ? 12   DG  I "C1'" 1 
ATOM   7703  N  N9    . DG  I 5 85  ? -62.988 -17.508 63.985 1.00 155.02 ? 12   DG  I N9    1 
ATOM   7704  C  C8    . DG  I 5 85  ? -63.210 -18.799 63.570 1.00 154.95 ? 12   DG  I C8    1 
ATOM   7705  N  N7    . DG  I 5 85  ? -62.378 -19.199 62.649 1.00 155.10 ? 12   DG  I N7    1 
ATOM   7706  C  C5    . DG  I 5 85  ? -61.551 -18.103 62.434 1.00 155.10 ? 12   DG  I C5    1 
ATOM   7707  C  C6    . DG  I 5 85  ? -60.460 -17.949 61.541 1.00 154.95 ? 12   DG  I C6    1 
ATOM   7708  O  O6    . DG  I 5 85  ? -60.003 -18.782 60.746 1.00 154.78 ? 12   DG  I O6    1 
ATOM   7709  N  N1    . DG  I 5 85  ? -59.889 -16.678 61.632 1.00 154.93 ? 12   DG  I N1    1 
ATOM   7710  C  C2    . DG  I 5 85  ? -60.324 -15.686 62.482 1.00 154.93 ? 12   DG  I C2    1 
ATOM   7711  N  N2    . DG  I 5 85  ? -59.654 -14.529 62.433 1.00 154.97 ? 12   DG  I N2    1 
ATOM   7712  N  N3    . DG  I 5 85  ? -61.345 -15.814 63.323 1.00 154.87 ? 12   DG  I N3    1 
ATOM   7713  C  C4    . DG  I 5 85  ? -61.914 -17.048 63.249 1.00 155.09 ? 12   DG  I C4    1 
ATOM   7714  P  P     . DT  I 5 86  ? -65.724 -13.553 65.449 1.00 157.41 ? 13   DT  I P     1 
ATOM   7715  O  OP1   . DT  I 5 86  ? -66.168 -12.431 66.311 1.00 157.27 ? 13   DT  I OP1   1 
ATOM   7716  O  OP2   . DT  I 5 86  ? -66.470 -13.831 64.194 1.00 157.27 ? 13   DT  I OP2   1 
ATOM   7717  O  "O5'" . DT  I 5 86  ? -64.172 -13.339 65.107 1.00 157.14 ? 13   DT  I "O5'" 1 
ATOM   7718  C  "C5'" . DT  I 5 86  ? -63.479 -12.163 65.532 1.00 156.61 ? 13   DT  I "C5'" 1 
ATOM   7719  C  "C4'" . DT  I 5 86  ? -63.027 -11.376 64.319 1.00 156.44 ? 13   DT  I "C4'" 1 
ATOM   7720  O  "O4'" . DT  I 5 86  ? -62.395 -12.294 63.392 1.00 156.78 ? 13   DT  I "O4'" 1 
ATOM   7721  C  "C3'" . DT  I 5 86  ? -64.141 -10.663 63.542 1.00 156.05 ? 13   DT  I "C3'" 1 
ATOM   7722  O  "O3'" . DT  I 5 86  ? -63.795 -9.265  63.406 1.00 155.13 ? 13   DT  I "O3'" 1 
ATOM   7723  C  "C2'" . DT  I 5 86  ? -64.258 -11.463 62.236 1.00 156.11 ? 13   DT  I "C2'" 1 
ATOM   7724  C  "C1'" . DT  I 5 86  ? -62.841 -12.009 62.081 1.00 156.50 ? 13   DT  I "C1'" 1 
ATOM   7725  N  N1    . DT  I 5 86  ? -62.670 -13.246 61.245 1.00 156.39 ? 13   DT  I N1    1 
ATOM   7726  C  C2    . DT  I 5 86  ? -61.587 -13.316 60.385 1.00 156.35 ? 13   DT  I C2    1 
ATOM   7727  O  O2    . DT  I 5 86  ? -60.762 -12.425 60.256 1.00 156.25 ? 13   DT  I O2    1 
ATOM   7728  N  N3    . DT  I 5 86  ? -61.500 -14.482 59.666 1.00 156.29 ? 13   DT  I N3    1 
ATOM   7729  C  C4    . DT  I 5 86  ? -62.365 -15.561 59.719 1.00 156.38 ? 13   DT  I C4    1 
ATOM   7730  O  O4    . DT  I 5 86  ? -62.185 -16.556 59.025 1.00 156.47 ? 13   DT  I O4    1 
ATOM   7731  C  C5    . DT  I 5 86  ? -63.475 -15.427 60.640 1.00 156.33 ? 13   DT  I C5    1 
ATOM   7732  C  C7    . DT  I 5 86  ? -64.488 -16.526 60.796 1.00 156.28 ? 13   DT  I C7    1 
ATOM   7733  C  C6    . DT  I 5 86  ? -63.569 -14.294 61.352 1.00 156.27 ? 13   DT  I C6    1 
ATOM   7734  P  P     . DT  I 5 87  ? -63.861 -8.394  62.058 1.00 154.87 ? 14   DT  I P     1 
ATOM   7735  O  OP1   . DT  I 5 87  ? -63.861 -6.972  62.477 1.00 154.67 ? 14   DT  I OP1   1 
ATOM   7736  O  OP2   . DT  I 5 87  ? -64.959 -8.896  61.196 1.00 154.36 ? 14   DT  I OP2   1 
ATOM   7737  O  "O5'" . DT  I 5 87  ? -62.459 -8.737  61.344 1.00 154.73 ? 14   DT  I "O5'" 1 
ATOM   7738  C  "C5'" . DT  I 5 87  ? -61.493 -7.725  60.994 1.00 153.51 ? 14   DT  I "C5'" 1 
ATOM   7739  C  "C4'" . DT  I 5 87  ? -60.782 -8.014  59.676 1.00 152.66 ? 14   DT  I "C4'" 1 
ATOM   7740  O  "O4'" . DT  I 5 87  ? -60.842 -9.425  59.328 1.00 152.52 ? 14   DT  I "O4'" 1 
ATOM   7741  C  "C3'" . DT  I 5 87  ? -61.329 -7.255  58.466 1.00 152.37 ? 14   DT  I "C3'" 1 
ATOM   7742  O  "O3'" . DT  I 5 87  ? -60.287 -6.458  57.891 1.00 152.11 ? 14   DT  I "O3'" 1 
ATOM   7743  C  "C2'" . DT  I 5 87  ? -61.814 -8.354  57.519 1.00 152.37 ? 14   DT  I "C2'" 1 
ATOM   7744  C  "C1'" . DT  I 5 87  ? -60.916 -9.515  57.919 1.00 152.75 ? 14   DT  I "C1'" 1 
ATOM   7745  N  N1    . DT  I 5 87  ? -61.413 -10.872 57.489 1.00 152.97 ? 14   DT  I N1    1 
ATOM   7746  C  C2    . DT  I 5 87  ? -60.633 -11.672 56.658 1.00 152.98 ? 14   DT  I C2    1 
ATOM   7747  O  O2    . DT  I 5 87  ? -59.532 -11.365 56.228 1.00 152.89 ? 14   DT  I O2    1 
ATOM   7748  N  N3    . DT  I 5 87  ? -61.197 -12.886 56.338 1.00 153.06 ? 14   DT  I N3    1 
ATOM   7749  C  C4    . DT  I 5 87  ? -62.430 -13.373 56.744 1.00 153.03 ? 14   DT  I C4    1 
ATOM   7750  O  O4    . DT  I 5 87  ? -62.839 -14.476 56.397 1.00 152.96 ? 14   DT  I O4    1 
ATOM   7751  C  C5    . DT  I 5 87  ? -63.194 -12.494 57.600 1.00 153.05 ? 14   DT  I C5    1 
ATOM   7752  C  C7    . DT  I 5 87  ? -64.542 -12.911 58.107 1.00 152.93 ? 14   DT  I C7    1 
ATOM   7753  C  C6    . DT  I 5 87  ? -62.659 -11.305 57.925 1.00 153.18 ? 14   DT  I C6    1 
ATOM   7754  P  P     . DT  I 5 88  ? -60.444 -5.658  56.505 1.00 151.82 ? 15   DT  I P     1 
ATOM   7755  O  OP1   . DT  I 5 88  ? -59.665 -4.405  56.631 1.00 151.70 ? 15   DT  I OP1   1 
ATOM   7756  O  OP2   . DT  I 5 88  ? -61.874 -5.604  56.133 1.00 151.63 ? 15   DT  I OP2   1 
ATOM   7757  O  "O5'" . DT  I 5 88  ? -59.716 -6.606  55.446 1.00 152.17 ? 15   DT  I "O5'" 1 
ATOM   7758  C  "C5'" . DT  I 5 88  ? -58.294 -6.724  55.453 1.00 152.89 ? 15   DT  I "C5'" 1 
ATOM   7759  C  "C4'" . DT  I 5 88  ? -57.815 -7.729  54.419 1.00 153.55 ? 15   DT  I "C4'" 1 
ATOM   7760  O  "O4'" . DT  I 5 88  ? -58.638 -8.926  54.444 1.00 154.03 ? 15   DT  I "O4'" 1 
ATOM   7761  C  "C3'" . DT  I 5 88  ? -57.834 -7.212  52.985 1.00 153.77 ? 15   DT  I "C3'" 1 
ATOM   7762  O  "O3'" . DT  I 5 88  ? -56.535 -7.341  52.450 1.00 153.80 ? 15   DT  I "O3'" 1 
ATOM   7763  C  "C2'" . DT  I 5 88  ? -58.825 -8.114  52.251 1.00 153.99 ? 15   DT  I "C2'" 1 
ATOM   7764  C  "C1'" . DT  I 5 88  ? -58.838 -9.371  53.119 1.00 154.63 ? 15   DT  I "C1'" 1 
ATOM   7765  N  N1    . DT  I 5 88  ? -60.112 -10.171 53.041 1.00 154.94 ? 15   DT  I N1    1 
ATOM   7766  C  C2    . DT  I 5 88  ? -60.062 -11.524 52.734 1.00 155.14 ? 15   DT  I C2    1 
ATOM   7767  O  O2    . DT  I 5 88  ? -59.031 -12.137 52.516 1.00 155.32 ? 15   DT  I O2    1 
ATOM   7768  N  N3    . DT  I 5 88  ? -61.282 -12.154 52.684 1.00 155.05 ? 15   DT  I N3    1 
ATOM   7769  C  C4    . DT  I 5 88  ? -62.523 -11.581 52.907 1.00 155.03 ? 15   DT  I C4    1 
ATOM   7770  O  O4    . DT  I 5 88  ? -63.556 -12.241 52.839 1.00 155.11 ? 15   DT  I O4    1 
ATOM   7771  C  C5    . DT  I 5 88  ? -62.508 -10.167 53.224 1.00 155.05 ? 15   DT  I C5    1 
ATOM   7772  C  C7    . DT  I 5 88  ? -63.783 -9.420  53.489 1.00 155.07 ? 15   DT  I C7    1 
ATOM   7773  C  C6    . DT  I 5 88  ? -61.324 -9.542  53.274 1.00 154.98 ? 15   DT  I C6    1 
ATOM   7774  P  P     . DA  I 5 89  ? -55.872 -6.214  51.527 1.00 154.05 ? 16   DA  I P     1 
ATOM   7775  O  OP1   . DA  I 5 89  ? -54.790 -5.574  52.317 1.00 153.83 ? 16   DA  I OP1   1 
ATOM   7776  O  OP2   . DA  I 5 89  ? -56.936 -5.382  50.922 1.00 153.99 ? 16   DA  I OP2   1 
ATOM   7777  O  "O5'" . DA  I 5 89  ? -55.243 -7.087  50.337 1.00 153.72 ? 16   DA  I "O5'" 1 
ATOM   7778  C  "C5'" . DA  I 5 89  ? -54.812 -8.437  50.560 1.00 153.14 ? 16   DA  I "C5'" 1 
ATOM   7779  C  "C4'" . DA  I 5 89  ? -55.471 -9.433  49.614 1.00 152.72 ? 16   DA  I "C4'" 1 
ATOM   7780  O  "O4'" . DA  I 5 89  ? -56.876 -9.617  49.944 1.00 152.76 ? 16   DA  I "O4'" 1 
ATOM   7781  C  "C3'" . DA  I 5 89  ? -55.430 -9.087  48.120 1.00 152.26 ? 16   DA  I "C3'" 1 
ATOM   7782  O  "O3'" . DA  I 5 89  ? -54.884 -10.179 47.380 1.00 150.94 ? 16   DA  I "O3'" 1 
ATOM   7783  C  "C2'" . DA  I 5 89  ? -56.899 -8.889  47.765 1.00 152.67 ? 16   DA  I "C2'" 1 
ATOM   7784  C  "C1'" . DA  I 5 89  ? -57.500 -9.916  48.715 1.00 153.10 ? 16   DA  I "C1'" 1 
ATOM   7785  N  N9    . DA  I 5 89  ? -58.960 -9.914  48.813 1.00 153.24 ? 16   DA  I N9    1 
ATOM   7786  C  C8    . DA  I 5 89  ? -59.804 -8.838  48.884 1.00 153.20 ? 16   DA  I C8    1 
ATOM   7787  N  N7    . DA  I 5 89  ? -61.072 -9.169  48.954 1.00 153.10 ? 16   DA  I N7    1 
ATOM   7788  C  C5    . DA  I 5 89  ? -61.061 -10.555 48.922 1.00 153.19 ? 16   DA  I C5    1 
ATOM   7789  C  C6    . DA  I 5 89  ? -62.089 -11.526 48.963 1.00 153.32 ? 16   DA  I C6    1 
ATOM   7790  N  N6    . DA  I 5 89  ? -63.392 -11.226 49.049 1.00 153.16 ? 16   DA  I N6    1 
ATOM   7791  N  N1    . DA  I 5 89  ? -61.725 -12.831 48.912 1.00 153.42 ? 16   DA  I N1    1 
ATOM   7792  C  C2    . DA  I 5 89  ? -60.423 -13.143 48.824 1.00 153.23 ? 16   DA  I C2    1 
ATOM   7793  N  N3    . DA  I 5 89  ? -59.373 -12.321 48.778 1.00 153.19 ? 16   DA  I N3    1 
ATOM   7794  C  C4    . DA  I 5 89  ? -59.764 -11.031 48.830 1.00 153.24 ? 16   DA  I C4    1 
ATOM   7795  P  P     . DA  I 5 90  ? -53.391 -10.113 46.815 1.00 149.95 ? 17   DA  I P     1 
ATOM   7796  O  OP1   . DA  I 5 90  ? -52.476 -9.731  47.915 1.00 149.59 ? 17   DA  I OP1   1 
ATOM   7797  O  OP2   . DA  I 5 90  ? -53.417 -9.322  45.570 1.00 149.71 ? 17   DA  I OP2   1 
ATOM   7798  O  "O5'" . DA  I 5 90  ? -53.113 -11.631 46.418 1.00 149.88 ? 17   DA  I "O5'" 1 
ATOM   7799  C  "C5'" . DA  I 5 90  ? -53.094 -12.637 47.421 1.00 149.99 ? 17   DA  I "C5'" 1 
ATOM   7800  C  "C4'" . DA  I 5 90  ? -53.881 -13.842 46.954 1.00 150.01 ? 17   DA  I "C4'" 1 
ATOM   7801  O  "O4'" . DA  I 5 90  ? -55.294 -13.600 47.164 1.00 150.44 ? 17   DA  I "O4'" 1 
ATOM   7802  C  "C3'" . DA  I 5 90  ? -53.705 -14.157 45.471 1.00 149.72 ? 17   DA  I "C3'" 1 
ATOM   7803  O  "O3'" . DA  I 5 90  ? -53.180 -15.463 45.297 1.00 148.98 ? 17   DA  I "O3'" 1 
ATOM   7804  C  "C2'" . DA  I 5 90  ? -55.108 -14.023 44.887 1.00 150.34 ? 17   DA  I "C2'" 1 
ATOM   7805  C  "C1'" . DA  I 5 90  ? -55.993 -14.218 46.108 1.00 150.97 ? 17   DA  I "C1'" 1 
ATOM   7806  N  N9    . DA  I 5 90  ? -57.303 -13.597 45.941 1.00 151.20 ? 17   DA  I N9    1 
ATOM   7807  C  C8    . DA  I 5 90  ? -57.599 -12.261 45.963 1.00 151.24 ? 17   DA  I C8    1 
ATOM   7808  N  N7    . DA  I 5 90  ? -58.869 -11.994 45.774 1.00 151.09 ? 17   DA  I N7    1 
ATOM   7809  C  C5    . DA  I 5 90  ? -59.443 -13.242 45.611 1.00 151.22 ? 17   DA  I C5    1 
ATOM   7810  C  C6    . DA  I 5 90  ? -60.772 -13.655 45.377 1.00 151.29 ? 17   DA  I C6    1 
ATOM   7811  N  N6    . DA  I 5 90  ? -61.789 -12.795 45.266 1.00 151.21 ? 17   DA  I N6    1 
ATOM   7812  N  N1    . DA  I 5 90  ? -61.016 -14.986 45.263 1.00 151.39 ? 17   DA  I N1    1 
ATOM   7813  C  C2    . DA  I 5 90  ? -59.990 -15.847 45.379 1.00 151.27 ? 17   DA  I C2    1 
ATOM   7814  N  N3    . DA  I 5 90  ? -58.700 -15.574 45.601 1.00 151.27 ? 17   DA  I N3    1 
ATOM   7815  C  C4    . DA  I 5 90  ? -58.492 -14.245 45.709 1.00 151.27 ? 17   DA  I C4    1 
ATOM   7816  P  P     . DG  I 5 91  ? -52.702 -15.952 43.853 1.00 148.38 ? 18   DG  I P     1 
ATOM   7817  O  OP1   . DG  I 5 91  ? -51.790 -17.101 44.032 1.00 148.43 ? 18   DG  I OP1   1 
ATOM   7818  O  OP2   . DG  I 5 91  ? -52.267 -14.773 43.073 1.00 147.90 ? 18   DG  I OP2   1 
ATOM   7819  O  "O5'" . DG  I 5 91  ? -54.060 -16.484 43.210 1.00 149.34 ? 18   DG  I "O5'" 1 
ATOM   7820  C  "C5'" . DG  I 5 91  ? -54.776 -17.570 43.790 1.00 150.62 ? 18   DG  I "C5'" 1 
ATOM   7821  C  "C4'" . DG  I 5 91  ? -56.157 -17.680 43.167 1.00 151.62 ? 18   DG  I "C4'" 1 
ATOM   7822  O  "O4'" . DG  I 5 91  ? -56.888 -16.448 43.373 1.00 151.91 ? 18   DG  I "O4'" 1 
ATOM   7823  C  "C3'" . DG  I 5 91  ? -56.170 -17.918 41.655 1.00 152.20 ? 18   DG  I "C3'" 1 
ATOM   7824  O  "O3'" . DG  I 5 91  ? -56.659 -19.235 41.381 1.00 152.76 ? 18   DG  I "O3'" 1 
ATOM   7825  C  "C2'" . DG  I 5 91  ? -57.072 -16.815 41.090 1.00 152.13 ? 18   DG  I "C2'" 1 
ATOM   7826  C  "C1'" . DG  I 5 91  ? -57.836 -16.376 42.333 1.00 152.34 ? 18   DG  I "C1'" 1 
ATOM   7827  N  N9    . DG  I 5 91  ? -58.401 -15.028 42.269 1.00 152.43 ? 18   DG  I N9    1 
ATOM   7828  C  C8    . DG  I 5 91  ? -57.738 -13.830 42.402 1.00 152.36 ? 18   DG  I C8    1 
ATOM   7829  N  N7    . DG  I 5 91  ? -58.519 -12.791 42.300 1.00 152.31 ? 18   DG  I N7    1 
ATOM   7830  C  C5    . DG  I 5 91  ? -59.782 -13.331 42.085 1.00 152.42 ? 18   DG  I C5    1 
ATOM   7831  C  C6    . DG  I 5 91  ? -61.040 -12.697 41.896 1.00 152.36 ? 18   DG  I C6    1 
ATOM   7832  O  O6    . DG  I 5 91  ? -61.292 -11.486 41.881 1.00 152.42 ? 18   DG  I O6    1 
ATOM   7833  N  N1    . DG  I 5 91  ? -62.078 -13.612 41.709 1.00 152.35 ? 18   DG  I N1    1 
ATOM   7834  C  C2    . DG  I 5 91  ? -61.923 -14.980 41.707 1.00 152.46 ? 18   DG  I C2    1 
ATOM   7835  N  N2    . DG  I 5 91  ? -63.035 -15.706 41.511 1.00 152.41 ? 18   DG  I N2    1 
ATOM   7836  N  N3    . DG  I 5 91  ? -60.751 -15.588 41.881 1.00 152.54 ? 18   DG  I N3    1 
ATOM   7837  C  C4    . DG  I 5 91  ? -59.727 -14.709 42.065 1.00 152.49 ? 18   DG  I C4    1 
ATOM   7838  P  P     . DC  I 5 92  ? -56.557 -19.886 39.920 1.00 153.00 ? 19   DC  I P     1 
ATOM   7839  O  OP1   . DC  I 5 92  ? -56.383 -21.351 40.080 1.00 152.33 ? 19   DC  I OP1   1 
ATOM   7840  O  OP2   . DC  I 5 92  ? -55.607 -19.098 39.103 1.00 152.48 ? 19   DC  I OP2   1 
ATOM   7841  O  "O5'" . DC  I 5 92  ? -58.012 -19.575 39.342 1.00 154.58 ? 19   DC  I "O5'" 1 
ATOM   7842  C  "C5'" . DC  I 5 92  ? -59.185 -20.163 39.903 1.00 156.39 ? 19   DC  I "C5'" 1 
ATOM   7843  C  "C4'" . DC  I 5 92  ? -60.404 -19.697 39.130 1.00 157.67 ? 19   DC  I "C4'" 1 
ATOM   7844  O  "O4'" . DC  I 5 92  ? -60.631 -18.301 39.447 1.00 157.41 ? 19   DC  I "O4'" 1 
ATOM   7845  C  "C3'" . DC  I 5 92  ? -60.263 -19.788 37.609 1.00 159.03 ? 19   DC  I "C3'" 1 
ATOM   7846  O  "O3'" . DC  I 5 92  ? -61.412 -20.401 37.023 1.00 161.77 ? 19   DC  I "O3'" 1 
ATOM   7847  C  "C2'" . DC  I 5 92  ? -60.119 -18.332 37.178 1.00 158.30 ? 19   DC  I "C2'" 1 
ATOM   7848  C  "C1'" . DC  I 5 92  ? -60.934 -17.622 38.250 1.00 157.47 ? 19   DC  I "C1'" 1 
ATOM   7849  N  N1    . DC  I 5 92  ? -60.610 -16.172 38.392 1.00 157.21 ? 19   DC  I N1    1 
ATOM   7850  C  C2    . DC  I 5 92  ? -61.642 -15.217 38.367 1.00 157.03 ? 19   DC  I C2    1 
ATOM   7851  O  O2    . DC  I 5 92  ? -62.820 -15.573 38.233 1.00 156.89 ? 19   DC  I O2    1 
ATOM   7852  N  N3    . DC  I 5 92  ? -61.314 -13.906 38.494 1.00 156.89 ? 19   DC  I N3    1 
ATOM   7853  C  C4    . DC  I 5 92  ? -60.037 -13.540 38.634 1.00 156.97 ? 19   DC  I C4    1 
ATOM   7854  N  N4    . DC  I 5 92  ? -59.773 -12.237 38.753 1.00 157.08 ? 19   DC  I N4    1 
ATOM   7855  C  C5    . DC  I 5 92  ? -58.974 -14.492 38.658 1.00 156.95 ? 19   DC  I C5    1 
ATOM   7856  C  C6    . DC  I 5 92  ? -59.305 -15.783 38.535 1.00 157.07 ? 19   DC  I C6    1 
ATOM   7857  P  P     . DG  I 5 93  ? -61.390 -20.995 35.529 1.00 163.92 ? 20   DG  I P     1 
ATOM   7858  O  OP1   . DG  I 5 93  ? -61.061 -22.436 35.628 1.00 163.78 ? 20   DG  I OP1   1 
ATOM   7859  O  OP2   . DG  I 5 93  ? -60.560 -20.118 34.665 1.00 163.36 ? 20   DG  I OP2   1 
ATOM   7860  O  "O5'" . DG  I 5 93  ? -62.923 -20.862 35.067 1.00 165.69 ? 20   DG  I "O5'" 1 
ATOM   7861  C  "C5'" . DG  I 5 93  ? -63.897 -20.126 35.825 1.00 168.42 ? 20   DG  I "C5'" 1 
ATOM   7862  C  "C4'" . DG  I 5 93  ? -64.409 -18.890 35.092 1.00 170.73 ? 20   DG  I "C4'" 1 
ATOM   7863  O  "O4'" . DG  I 5 93  ? -63.753 -17.697 35.604 1.00 171.39 ? 20   DG  I "O4'" 1 
ATOM   7864  C  "C3'" . DG  I 5 93  ? -64.218 -18.863 33.569 1.00 172.11 ? 20   DG  I "C3'" 1 
ATOM   7865  O  "O3'" . DG  I 5 93  ? -65.482 -18.594 32.931 1.00 173.66 ? 20   DG  I "O3'" 1 
ATOM   7866  C  "C2'" . DG  I 5 93  ? -63.177 -17.762 33.360 1.00 172.20 ? 20   DG  I "C2'" 1 
ATOM   7867  C  "C1'" . DG  I 5 93  ? -63.522 -16.830 34.512 1.00 172.45 ? 20   DG  I "C1'" 1 
ATOM   7868  N  N9    . DG  I 5 93  ? -62.477 -15.860 34.838 1.00 172.67 ? 20   DG  I N9    1 
ATOM   7869  C  C8    . DG  I 5 93  ? -61.139 -16.101 35.038 1.00 172.76 ? 20   DG  I C8    1 
ATOM   7870  N  N7    . DG  I 5 93  ? -60.447 -15.032 35.316 1.00 172.81 ? 20   DG  I N7    1 
ATOM   7871  C  C5    . DG  I 5 93  ? -61.385 -14.008 35.289 1.00 172.84 ? 20   DG  I C5    1 
ATOM   7872  C  C6    . DG  I 5 93  ? -61.230 -12.616 35.517 1.00 172.81 ? 20   DG  I C6    1 
ATOM   7873  O  O6    . DG  I 5 93  ? -60.191 -11.999 35.789 1.00 172.78 ? 20   DG  I O6    1 
ATOM   7874  N  N1    . DG  I 5 93  ? -62.436 -11.923 35.394 1.00 172.81 ? 20   DG  I N1    1 
ATOM   7875  C  C2    . DG  I 5 93  ? -63.648 -12.510 35.096 1.00 172.82 ? 20   DG  I C2    1 
ATOM   7876  N  N2    . DG  I 5 93  ? -64.707 -11.693 35.020 1.00 172.80 ? 20   DG  I N2    1 
ATOM   7877  N  N3    . DG  I 5 93  ? -63.808 -13.814 34.885 1.00 172.85 ? 20   DG  I N3    1 
ATOM   7878  C  C4    . DG  I 5 93  ? -62.640 -14.502 34.998 1.00 172.80 ? 20   DG  I C4    1 
ATOM   7879  P  P     . DG  I 5 94  ? -65.651 -18.059 31.423 1.00 174.75 ? 21   DG  I P     1 
ATOM   7880  O  OP1   . DG  I 5 94  ? -66.981 -18.515 30.959 1.00 174.80 ? 21   DG  I OP1   1 
ATOM   7881  O  OP2   . DG  I 5 94  ? -64.449 -18.410 30.624 1.00 174.78 ? 21   DG  I OP2   1 
ATOM   7882  O  "O5'" . DG  I 5 94  ? -65.672 -16.467 31.627 1.00 175.42 ? 21   DG  I "O5'" 1 
ATOM   7883  C  "C5'" . DG  I 5 94  ? -66.852 -15.685 31.402 1.00 176.42 ? 21   DG  I "C5'" 1 
ATOM   7884  C  "C4'" . DG  I 5 94  ? -66.506 -14.334 30.797 1.00 177.06 ? 21   DG  I "C4'" 1 
ATOM   7885  O  "O4'" . DG  I 5 94  ? -65.469 -13.719 31.599 1.00 177.32 ? 21   DG  I "O4'" 1 
ATOM   7886  C  "C3'" . DG  I 5 94  ? -65.982 -14.393 29.362 1.00 177.39 ? 21   DG  I "C3'" 1 
ATOM   7887  O  "O3'" . DG  I 5 94  ? -66.996 -13.940 28.451 1.00 177.60 ? 21   DG  I "O3'" 1 
ATOM   7888  C  "C2'" . DG  I 5 94  ? -64.744 -13.495 29.340 1.00 177.49 ? 21   DG  I "C2'" 1 
ATOM   7889  C  "C1'" . DG  I 5 94  ? -64.574 -13.004 30.773 1.00 177.71 ? 21   DG  I "C1'" 1 
ATOM   7890  N  N9    . DG  I 5 94  ? -63.204 -13.180 31.261 1.00 177.83 ? 21   DG  I N9    1 
ATOM   7891  C  C8    . DG  I 5 94  ? -62.487 -14.354 31.352 1.00 177.80 ? 21   DG  I C8    1 
ATOM   7892  N  N7    . DG  I 5 94  ? -61.280 -14.194 31.823 1.00 177.68 ? 21   DG  I N7    1 
ATOM   7893  C  C5    . DG  I 5 94  ? -61.188 -12.828 32.058 1.00 177.75 ? 21   DG  I C5    1 
ATOM   7894  C  C6    . DG  I 5 94  ? -60.113 -12.054 32.566 1.00 177.79 ? 21   DG  I C6    1 
ATOM   7895  O  O6    . DG  I 5 94  ? -58.996 -12.451 32.923 1.00 177.83 ? 21   DG  I O6    1 
ATOM   7896  N  N1    . DG  I 5 94  ? -60.430 -10.695 32.653 1.00 177.84 ? 21   DG  I N1    1 
ATOM   7897  C  C2    . DG  I 5 94  ? -61.642 -10.149 32.284 1.00 177.82 ? 21   DG  I C2    1 
ATOM   7898  N  N2    . DG  I 5 94  ? -61.778 -8.822  32.427 1.00 177.79 ? 21   DG  I N2    1 
ATOM   7899  N  N3    . DG  I 5 94  ? -62.656 -10.863 31.804 1.00 177.80 ? 21   DG  I N3    1 
ATOM   7900  C  C4    . DG  I 5 94  ? -62.363 -12.189 31.717 1.00 177.82 ? 21   DG  I C4    1 
ATOM   7901  P  P     . DT  I 5 95  ? -66.764 -13.869 26.861 1.00 177.59 ? 22   DT  I P     1 
ATOM   7902  O  OP1   . DT  I 5 95  ? -68.094 -13.987 26.223 1.00 177.62 ? 22   DT  I OP1   1 
ATOM   7903  O  OP2   . DT  I 5 95  ? -65.705 -14.836 26.486 1.00 177.35 ? 22   DT  I OP2   1 
ATOM   7904  O  "O5'" . DT  I 5 95  ? -66.200 -12.377 26.640 1.00 177.24 ? 22   DT  I "O5'" 1 
ATOM   7905  C  "C5'" . DT  I 5 95  ? -66.874 -11.223 27.183 1.00 176.57 ? 22   DT  I "C5'" 1 
ATOM   7906  C  "C4'" . DT  I 5 95  ? -65.973 -9.995  27.284 1.00 175.95 ? 22   DT  I "C4'" 1 
ATOM   7907  O  "O4'" . DT  I 5 95  ? -64.817 -10.285 28.122 1.00 175.91 ? 22   DT  I "O4'" 1 
ATOM   7908  C  "C3'" . DT  I 5 95  ? -65.410 -9.481  25.954 1.00 175.64 ? 22   DT  I "C3'" 1 
ATOM   7909  O  "O3'" . DT  I 5 95  ? -65.475 -8.044  25.842 1.00 175.09 ? 22   DT  I "O3'" 1 
ATOM   7910  C  "C2'" . DT  I 5 95  ? -63.964 -9.963  26.007 1.00 175.65 ? 22   DT  I "C2'" 1 
ATOM   7911  C  "C1'" . DT  I 5 95  ? -63.691 -9.714  27.484 1.00 175.48 ? 22   DT  I "C1'" 1 
ATOM   7912  N  N1    . DT  I 5 95  ? -62.377 -10.256 27.986 1.00 175.34 ? 22   DT  I N1    1 
ATOM   7913  C  C2    . DT  I 5 95  ? -61.598 -9.457  28.808 1.00 175.27 ? 22   DT  I C2    1 
ATOM   7914  O  O2    . DT  I 5 95  ? -61.917 -8.335  29.171 1.00 175.19 ? 22   DT  I O2    1 
ATOM   7915  N  N3    . DT  I 5 95  ? -60.412 -10.027 29.205 1.00 175.20 ? 22   DT  I N3    1 
ATOM   7916  C  C4    . DT  I 5 95  ? -59.927 -11.281 28.872 1.00 175.18 ? 22   DT  I C4    1 
ATOM   7917  O  O4    . DT  I 5 95  ? -58.846 -11.685 29.291 1.00 175.06 ? 22   DT  I O4    1 
ATOM   7918  C  C5    . DT  I 5 95  ? -60.783 -12.064 28.005 1.00 175.23 ? 22   DT  I C5    1 
ATOM   7919  C  C7    . DT  I 5 95  ? -60.377 -13.442 27.567 1.00 175.28 ? 22   DT  I C7    1 
ATOM   7920  C  C6    . DT  I 5 95  ? -61.948 -11.521 27.609 1.00 175.26 ? 22   DT  I C6    1 
ATOM   7921  P  P     . DG  I 5 96  ? -65.226 -7.346  24.412 1.00 174.73 ? 23   DG  I P     1 
ATOM   7922  O  OP1   . DG  I 5 96  ? -66.340 -7.772  23.535 1.00 174.78 ? 23   DG  I OP1   1 
ATOM   7923  O  OP2   . DG  I 5 96  ? -63.839 -7.635  23.982 1.00 174.76 ? 23   DG  I OP2   1 
ATOM   7924  O  "O5'" . DG  I 5 96  ? -65.341 -5.760  24.653 1.00 173.76 ? 23   DG  I "O5'" 1 
ATOM   7925  C  "C5'" . DG  I 5 96  ? -64.791 -5.070  25.787 1.00 172.46 ? 23   DG  I "C5'" 1 
ATOM   7926  C  "C4'" . DG  I 5 96  ? -63.311 -4.705  25.662 1.00 171.58 ? 23   DG  I "C4'" 1 
ATOM   7927  O  "O4'" . DG  I 5 96  ? -62.487 -5.769  26.206 1.00 171.77 ? 23   DG  I "O4'" 1 
ATOM   7928  C  "C3'" . DG  I 5 96  ? -62.741 -4.381  24.270 1.00 170.46 ? 23   DG  I "C3'" 1 
ATOM   7929  O  "O3'" . DG  I 5 96  ? -62.440 -2.960  24.206 1.00 168.21 ? 23   DG  I "O3'" 1 
ATOM   7930  C  "C2'" . DG  I 5 96  ? -61.521 -5.306  24.138 1.00 170.87 ? 23   DG  I "C2'" 1 
ATOM   7931  C  "C1'" . DG  I 5 96  ? -61.222 -5.677  25.588 1.00 171.45 ? 23   DG  I "C1'" 1 
ATOM   7932  N  N9    . DG  I 5 96  ? -60.517 -6.943  25.802 1.00 171.47 ? 23   DG  I N9    1 
ATOM   7933  C  C8    . DG  I 5 96  ? -60.903 -8.202  25.401 1.00 171.43 ? 23   DG  I C8    1 
ATOM   7934  N  N7    . DG  I 5 96  ? -60.067 -9.141  25.750 1.00 171.43 ? 23   DG  I N7    1 
ATOM   7935  C  C5    . DG  I 5 96  ? -59.061 -8.466  26.432 1.00 171.46 ? 23   DG  I C5    1 
ATOM   7936  C  C6    . DG  I 5 96  ? -57.877 -8.954  27.048 1.00 171.44 ? 23   DG  I C6    1 
ATOM   7937  O  O6    . DG  I 5 96  ? -57.474 -10.122 27.112 1.00 171.46 ? 23   DG  I O6    1 
ATOM   7938  N  N1    . DG  I 5 96  ? -57.125 -7.933  27.631 1.00 171.43 ? 23   DG  I N1    1 
ATOM   7939  C  C2    . DG  I 5 96  ? -57.479 -6.600  27.615 1.00 171.47 ? 23   DG  I C2    1 
ATOM   7940  N  N2    . DG  I 5 96  ? -56.646 -5.747  28.228 1.00 171.47 ? 23   DG  I N2    1 
ATOM   7941  N  N3    . DG  I 5 96  ? -58.584 -6.130  27.046 1.00 171.43 ? 23   DG  I N3    1 
ATOM   7942  C  C4    . DG  I 5 96  ? -59.326 -7.113  26.473 1.00 171.46 ? 23   DG  I C4    1 
ATOM   7943  P  P     . DC  I 5 97  ? -61.326 -2.245  23.286 1.00 166.18 ? 24   DC  I P     1 
ATOM   7944  O  OP1   . DC  I 5 97  ? -61.837 -0.898  22.939 1.00 166.20 ? 24   DC  I OP1   1 
ATOM   7945  O  OP2   . DC  I 5 97  ? -60.895 -3.149  22.193 1.00 165.83 ? 24   DC  I OP2   1 
ATOM   7946  O  "O5'" . DC  I 5 97  ? -60.132 -2.078  24.336 1.00 164.34 ? 24   DC  I "O5'" 1 
ATOM   7947  C  "C5'" . DC  I 5 97  ? -59.401 -0.863  24.436 1.00 161.36 ? 24   DC  I "C5'" 1 
ATOM   7948  C  "C4'" . DC  I 5 97  ? -57.969 -1.111  24.008 1.00 159.30 ? 24   DC  I "C4'" 1 
ATOM   7949  O  "O4'" . DC  I 5 97  ? -57.564 -2.451  24.390 1.00 158.89 ? 24   DC  I "O4'" 1 
ATOM   7950  C  "C3'" . DC  I 5 97  ? -57.713 -1.026  22.509 1.00 158.04 ? 24   DC  I "C3'" 1 
ATOM   7951  O  "O3'" . DC  I 5 97  ? -56.424 -0.486  22.334 1.00 156.42 ? 24   DC  I "O3'" 1 
ATOM   7952  C  "C2'" . DC  I 5 97  ? -57.712 -2.482  22.066 1.00 158.18 ? 24   DC  I "C2'" 1 
ATOM   7953  C  "C1'" . DC  I 5 97  ? -56.977 -3.071  23.265 1.00 158.49 ? 24   DC  I "C1'" 1 
ATOM   7954  N  N1    . DC  I 5 97  ? -57.036 -4.552  23.428 1.00 158.47 ? 24   DC  I N1    1 
ATOM   7955  C  C2    . DC  I 5 97  ? -55.946 -5.199  24.032 1.00 158.55 ? 24   DC  I C2    1 
ATOM   7956  O  O2    . DC  I 5 97  ? -54.974 -4.533  24.411 1.00 158.62 ? 24   DC  I O2    1 
ATOM   7957  N  N3    . DC  I 5 97  ? -55.984 -6.548  24.187 1.00 158.53 ? 24   DC  I N3    1 
ATOM   7958  C  C4    . DC  I 5 97  ? -57.048 -7.238  23.767 1.00 158.54 ? 24   DC  I C4    1 
ATOM   7959  N  N4    . DC  I 5 97  ? -57.027 -8.561  23.944 1.00 158.50 ? 24   DC  I N4    1 
ATOM   7960  C  C5    . DC  I 5 97  ? -58.172 -6.601  23.150 1.00 158.48 ? 24   DC  I C5    1 
ATOM   7961  C  C6    . DC  I 5 97  ? -58.122 -5.270  23.003 1.00 158.41 ? 24   DC  I C6    1 
ATOM   7962  P  P     . DT  I 5 98  ? -56.215 0.858   21.499 1.00 155.04 ? 25   DT  I P     1 
ATOM   7963  O  OP1   . DT  I 5 98  ? -56.952 1.945   22.192 1.00 154.95 ? 25   DT  I OP1   1 
ATOM   7964  O  OP2   . DT  I 5 98  ? -56.505 0.525   20.083 1.00 155.12 ? 25   DT  I OP2   1 
ATOM   7965  O  "O5'" . DT  I 5 98  ? -54.638 1.131   21.612 1.00 153.12 ? 25   DT  I "O5'" 1 
ATOM   7966  C  "C5'" . DT  I 5 98  ? -53.915 0.865   22.818 1.00 149.59 ? 25   DT  I "C5'" 1 
ATOM   7967  C  "C4'" . DT  I 5 98  ? -52.924 -0.278  22.652 1.00 146.90 ? 25   DT  I "C4'" 1 
ATOM   7968  O  "O4'" . DT  I 5 98  ? -53.619 -1.540  22.514 1.00 146.00 ? 25   DT  I "O4'" 1 
ATOM   7969  C  "C3'" . DT  I 5 98  ? -51.990 -0.202  21.443 1.00 145.21 ? 25   DT  I "C3'" 1 
ATOM   7970  O  "O3'" . DT  I 5 98  ? -50.687 0.099   21.881 1.00 143.42 ? 25   DT  I "O3'" 1 
ATOM   7971  C  "C2'" . DT  I 5 98  ? -52.019 -1.600  20.832 1.00 145.11 ? 25   DT  I "C2'" 1 
ATOM   7972  C  "C1'" . DT  I 5 98  ? -52.671 -2.411  21.944 1.00 145.55 ? 25   DT  I "C1'" 1 
ATOM   7973  N  N1    . DT  I 5 98  ? -53.357 -3.638  21.476 1.00 145.44 ? 25   DT  I N1    1 
ATOM   7974  C  C2    . DT  I 5 98  ? -52.959 -4.878  21.953 1.00 145.44 ? 25   DT  I C2    1 
ATOM   7975  O  O2    . DT  I 5 98  ? -52.060 -5.060  22.760 1.00 145.19 ? 25   DT  I O2    1 
ATOM   7976  N  N3    . DT  I 5 98  ? -53.676 -5.929  21.438 1.00 145.46 ? 25   DT  I N3    1 
ATOM   7977  C  C4    . DT  I 5 98  ? -54.717 -5.863  20.524 1.00 145.51 ? 25   DT  I C4    1 
ATOM   7978  O  O4    . DT  I 5 98  ? -55.290 -6.873  20.132 1.00 145.45 ? 25   DT  I O4    1 
ATOM   7979  C  C5    . DT  I 5 98  ? -55.076 -4.536  20.071 1.00 145.49 ? 25   DT  I C5    1 
ATOM   7980  C  C7    . DT  I 5 98  ? -56.185 -4.321  19.080 1.00 145.58 ? 25   DT  I C7    1 
ATOM   7981  C  C6    . DT  I 5 98  ? -54.386 -3.503  20.564 1.00 145.40 ? 25   DT  I C6    1 
ATOM   7982  P  P     . DA  I 5 99  ? -50.115 1.584   21.759 1.00 142.49 ? 26   DA  I P     1 
ATOM   7983  O  OP1   . DA  I 5 99  ? -51.012 2.498   22.498 1.00 142.46 ? 26   DA  I OP1   1 
ATOM   7984  O  OP2   . DA  I 5 99  ? -49.807 1.824   20.334 1.00 142.48 ? 26   DA  I OP2   1 
ATOM   7985  O  "O5'" . DA  I 5 99  ? -48.719 1.499   22.535 1.00 142.45 ? 26   DA  I "O5'" 1 
ATOM   7986  C  "C5'" . DA  I 5 99  ? -48.658 0.991   23.870 1.00 141.32 ? 26   DA  I "C5'" 1 
ATOM   7987  C  "C4'" . DA  I 5 99  ? -47.790 -0.259  23.964 1.00 140.31 ? 26   DA  I "C4'" 1 
ATOM   7988  O  "O4'" . DA  I 5 99  ? -48.417 -1.410  23.328 1.00 140.46 ? 26   DA  I "O4'" 1 
ATOM   7989  C  "C3'" . DA  I 5 99  ? -46.375 -0.159  23.392 1.00 139.11 ? 26   DA  I "C3'" 1 
ATOM   7990  O  "O3'" . DA  I 5 99  ? -45.526 -0.706  24.401 1.00 137.22 ? 26   DA  I "O3'" 1 
ATOM   7991  C  "C2'" . DA  I 5 99  ? -46.440 -1.008  22.120 1.00 139.39 ? 26   DA  I "C2'" 1 
ATOM   7992  C  "C1'" . DA  I 5 99  ? -47.472 -2.071  22.506 1.00 140.43 ? 26   DA  I "C1'" 1 
ATOM   7993  N  N9    . DA  I 5 99  ? -48.186 -2.726  21.400 1.00 140.68 ? 26   DA  I N9    1 
ATOM   7994  C  C8    . DA  I 5 99  ? -48.525 -2.193  20.185 1.00 140.70 ? 26   DA  I C8    1 
ATOM   7995  N  N7    . DA  I 5 99  ? -49.171 -3.018  19.393 1.00 140.68 ? 26   DA  I N7    1 
ATOM   7996  C  C5    . DA  I 5 99  ? -49.271 -4.183  20.132 1.00 140.61 ? 26   DA  I C5    1 
ATOM   7997  C  C6    . DA  I 5 99  ? -49.852 -5.447  19.859 1.00 140.51 ? 26   DA  I C6    1 
ATOM   7998  N  N6    . DA  I 5 99  ? -50.466 -5.759  18.714 1.00 140.45 ? 26   DA  I N6    1 
ATOM   7999  N  N1    . DA  I 5 99  ? -49.778 -6.394  20.818 1.00 140.62 ? 26   DA  I N1    1 
ATOM   8000  C  C2    . DA  I 5 99  ? -49.161 -6.088  21.970 1.00 140.76 ? 26   DA  I C2    1 
ATOM   8001  N  N3    . DA  I 5 99  ? -48.585 -4.942  22.344 1.00 140.62 ? 26   DA  I N3    1 
ATOM   8002  C  C4    . DA  I 5 99  ? -48.671 -4.018  21.372 1.00 140.69 ? 26   DA  I C4    1 
ATOM   8003  P  P     . DG  I 5 100 ? -43.926 -0.673  24.410 1.00 134.92 ? 27   DG  I P     1 
ATOM   8004  O  OP1   . DG  I 5 100 ? -43.535 -0.769  25.835 1.00 134.87 ? 27   DG  I OP1   1 
ATOM   8005  O  OP2   . DG  I 5 100 ? -43.418 0.452   23.594 1.00 134.34 ? 27   DG  I OP2   1 
ATOM   8006  O  "O5'" . DG  I 5 100 ? -43.589 -2.045  23.652 1.00 133.67 ? 27   DG  I "O5'" 1 
ATOM   8007  C  "C5'" . DG  I 5 100 ? -43.815 -3.305  24.289 1.00 131.60 ? 27   DG  I "C5'" 1 
ATOM   8008  C  "C4'" . DG  I 5 100 ? -43.617 -4.485  23.349 1.00 130.44 ? 27   DG  I "C4'" 1 
ATOM   8009  O  "O4'" . DG  I 5 100 ? -44.638 -4.457  22.321 1.00 130.68 ? 27   DG  I "O4'" 1 
ATOM   8010  C  "C3'" . DG  I 5 100 ? -42.273 -4.549  22.620 1.00 129.61 ? 27   DG  I "C3'" 1 
ATOM   8011  O  "O3'" . DG  I 5 100 ? -41.748 -5.872  22.642 1.00 127.60 ? 27   DG  I "O3'" 1 
ATOM   8012  C  "C2'" . DG  I 5 100 ? -42.635 -4.148  21.195 1.00 130.45 ? 27   DG  I "C2'" 1 
ATOM   8013  C  "C1'" . DG  I 5 100 ? -44.026 -4.759  21.084 1.00 131.52 ? 27   DG  I "C1'" 1 
ATOM   8014  N  N9    . DG  I 5 100 ? -44.842 -4.267  19.970 1.00 131.90 ? 27   DG  I N9    1 
ATOM   8015  C  C8    . DG  I 5 100 ? -44.911 -2.987  19.474 1.00 132.02 ? 27   DG  I C8    1 
ATOM   8016  N  N7    . DG  I 5 100 ? -45.733 -2.861  18.470 1.00 132.14 ? 27   DG  I N7    1 
ATOM   8017  C  C5    . DG  I 5 100 ? -46.246 -4.138  18.278 1.00 132.09 ? 27   DG  I C5    1 
ATOM   8018  C  C6    . DG  I 5 100 ? -47.185 -4.627  17.329 1.00 132.09 ? 27   DG  I C6    1 
ATOM   8019  O  O6    . DG  I 5 100 ? -47.784 -4.011  16.431 1.00 132.10 ? 27   DG  I O6    1 
ATOM   8020  N  N1    . DG  I 5 100 ? -47.422 -5.990  17.487 1.00 131.83 ? 27   DG  I N1    1 
ATOM   8021  C  C2    . DG  I 5 100 ? -46.832 -6.779  18.441 1.00 131.87 ? 27   DG  I C2    1 
ATOM   8022  N  N2    . DG  I 5 100 ? -47.179 -8.071  18.443 1.00 132.05 ? 27   DG  I N2    1 
ATOM   8023  N  N3    . DG  I 5 100 ? -45.954 -6.338  19.328 1.00 132.16 ? 27   DG  I N3    1 
ATOM   8024  C  C4    . DG  I 5 100 ? -45.706 -5.011  19.194 1.00 132.03 ? 27   DG  I C4    1 
ATOM   8025  P  P     . DA  I 5 101 ? -40.221 -6.159  23.026 1.00 125.87 ? 28   DA  I P     1 
ATOM   8026  O  OP1   . DA  I 5 101 ? -40.087 -5.879  24.463 1.00 125.71 ? 28   DA  I OP1   1 
ATOM   8027  O  OP2   . DA  I 5 101 ? -39.319 -5.495  22.066 1.00 125.29 ? 28   DA  I OP2   1 
ATOM   8028  O  "O5'" . DA  I 5 101 ? -40.098 -7.727  22.792 1.00 127.07 ? 28   DA  I "O5'" 1 
ATOM   8029  C  "C5'" . DA  I 5 101 ? -41.251 -8.560  22.885 1.00 129.64 ? 28   DA  I "C5'" 1 
ATOM   8030  C  "C4'" . DA  I 5 101 ? -41.674 -9.110  21.531 1.00 131.61 ? 28   DA  I "C4'" 1 
ATOM   8031  O  "O4'" . DA  I 5 101 ? -42.256 -8.056  20.722 1.00 132.70 ? 28   DA  I "O4'" 1 
ATOM   8032  C  "C3'" . DA  I 5 101 ? -40.566 -9.723  20.671 1.00 132.46 ? 28   DA  I "C3'" 1 
ATOM   8033  O  "O3'" . DA  I 5 101 ? -40.930 -11.049 20.288 1.00 133.13 ? 28   DA  I "O3'" 1 
ATOM   8034  C  "C2'" . DA  I 5 101 ? -40.468 -8.783  19.467 1.00 132.87 ? 28   DA  I "C2'" 1 
ATOM   8035  C  "C1'" . DA  I 5 101 ? -41.923 -8.347  19.380 1.00 133.92 ? 28   DA  I "C1'" 1 
ATOM   8036  N  N9    . DA  I 5 101 ? -42.256 -7.208  18.519 1.00 134.31 ? 28   DA  I N9    1 
ATOM   8037  C  C8    . DA  I 5 101 ? -41.714 -5.949  18.508 1.00 134.50 ? 28   DA  I C8    1 
ATOM   8038  N  N7    . DA  I 5 101 ? -42.251 -5.142  17.619 1.00 134.62 ? 28   DA  I N7    1 
ATOM   8039  C  C5    . DA  I 5 101 ? -43.215 -5.927  16.998 1.00 134.91 ? 28   DA  I C5    1 
ATOM   8040  C  C6    . DA  I 5 101 ? -44.148 -5.681  15.954 1.00 134.78 ? 28   DA  I C6    1 
ATOM   8041  N  N6    . DA  I 5 101 ? -44.260 -4.510  15.316 1.00 134.55 ? 28   DA  I N6    1 
ATOM   8042  N  N1    . DA  I 5 101 ? -44.971 -6.693  15.578 1.00 134.67 ? 28   DA  I N1    1 
ATOM   8043  C  C2    . DA  I 5 101 ? -44.871 -7.883  16.195 1.00 134.62 ? 28   DA  I C2    1 
ATOM   8044  N  N3    . DA  I 5 101 ? -44.043 -8.230  17.187 1.00 134.84 ? 28   DA  I N3    1 
ATOM   8045  C  C4    . DA  I 5 101 ? -43.235 -7.204  17.546 1.00 134.81 ? 28   DA  I C4    1 
ATOM   8046  P  P     . DG  I 5 102 ? -39.808 -12.141 19.950 1.00 134.02 ? 29   DG  I P     1 
ATOM   8047  O  OP1   . DG  I 5 102 ? -39.893 -13.209 20.968 1.00 133.21 ? 29   DG  I OP1   1 
ATOM   8048  O  OP2   . DG  I 5 102 ? -38.542 -11.421 19.709 1.00 133.61 ? 29   DG  I OP2   1 
ATOM   8049  O  "O5'" . DG  I 5 102 ? -40.237 -12.741 18.533 1.00 136.01 ? 29   DG  I "O5'" 1 
ATOM   8050  C  "C5'" . DG  I 5 102 ? -41.563 -13.197 18.268 1.00 138.97 ? 29   DG  I "C5'" 1 
ATOM   8051  C  "C4'" . DG  I 5 102 ? -41.875 -13.092 16.782 1.00 141.01 ? 29   DG  I "C4'" 1 
ATOM   8052  O  "O4'" . DG  I 5 102 ? -42.197 -11.713 16.444 1.00 142.00 ? 29   DG  I "O4'" 1 
ATOM   8053  C  "C3'" . DG  I 5 102 ? -40.732 -13.507 15.858 1.00 142.09 ? 29   DG  I "C3'" 1 
ATOM   8054  O  "O3'" . DG  I 5 102 ? -41.205 -14.384 14.827 1.00 143.39 ? 29   DG  I "O3'" 1 
ATOM   8055  C  "C2'" . DG  I 5 102 ? -40.225 -12.166 15.320 1.00 142.38 ? 29   DG  I "C2'" 1 
ATOM   8056  C  "C1'" . DG  I 5 102 ? -41.509 -11.349 15.263 1.00 142.83 ? 29   DG  I "C1'" 1 
ATOM   8057  N  N9    . DG  I 5 102 ? -41.295 -9.898  15.217 1.00 143.10 ? 29   DG  I N9    1 
ATOM   8058  C  C8    . DG  I 5 102 ? -40.667 -9.127  16.165 1.00 143.25 ? 29   DG  I C8    1 
ATOM   8059  N  N7    . DG  I 5 102 ? -40.611 -7.858  15.873 1.00 143.33 ? 29   DG  I N7    1 
ATOM   8060  C  C5    . DG  I 5 102 ? -41.243 -7.772  14.640 1.00 143.19 ? 29   DG  I C5    1 
ATOM   8061  C  C6    . DG  I 5 102 ? -41.487 -6.643  13.819 1.00 142.99 ? 29   DG  I C6    1 
ATOM   8062  O  O6    . DG  I 5 102 ? -41.181 -5.465  14.030 1.00 143.18 ? 29   DG  I O6    1 
ATOM   8063  N  N1    . DG  I 5 102 ? -42.154 -6.979  12.644 1.00 143.03 ? 29   DG  I N1    1 
ATOM   8064  C  C2    . DG  I 5 102 ? -42.542 -8.256  12.311 1.00 143.15 ? 29   DG  I C2    1 
ATOM   8065  N  N2    . DG  I 5 102 ? -43.176 -8.395  11.140 1.00 143.21 ? 29   DG  I N2    1 
ATOM   8066  N  N3    . DG  I 5 102 ? -42.322 -9.325  13.070 1.00 143.23 ? 29   DG  I N3    1 
ATOM   8067  C  C4    . DG  I 5 102 ? -41.672 -9.016  14.222 1.00 143.18 ? 29   DG  I C4    1 
ATOM   8068  P  P     . DC  I 5 103 ? -40.185 -15.089 13.801 1.00 144.79 ? 30   DC  I P     1 
ATOM   8069  O  OP1   . DC  I 5 103 ? -39.596 -16.254 14.494 1.00 144.26 ? 30   DC  I OP1   1 
ATOM   8070  O  OP2   . DC  I 5 103 ? -39.277 -14.068 13.231 1.00 144.85 ? 30   DC  I OP2   1 
ATOM   8071  O  "O5'" . DC  I 5 103 ? -41.125 -15.575 12.595 1.00 146.14 ? 30   DC  I "O5'" 1 
ATOM   8072  C  "C5'" . DC  I 5 103 ? -42.166 -14.731 12.054 1.00 147.64 ? 30   DC  I "C5'" 1 
ATOM   8073  C  "C4'" . DC  I 5 103 ? -41.794 -13.941 10.797 1.00 148.44 ? 30   DC  I "C4'" 1 
ATOM   8074  O  "O4'" . DC  I 5 103 ? -41.665 -12.534 11.135 1.00 148.57 ? 30   DC  I "O4'" 1 
ATOM   8075  C  "C3'" . DC  I 5 103 ? -40.510 -14.332 10.052 1.00 149.10 ? 30   DC  I "C3'" 1 
ATOM   8076  O  "O3'" . DC  I 5 103 ? -40.839 -14.869 8.740  1.00 150.09 ? 30   DC  I "O3'" 1 
ATOM   8077  C  "C2'" . DC  I 5 103 ? -39.666 -13.051 10.056 1.00 149.21 ? 30   DC  I "C2'" 1 
ATOM   8078  C  "C1'" . DC  I 5 103 ? -40.715 -11.962 10.264 1.00 149.21 ? 30   DC  I "C1'" 1 
ATOM   8079  N  N1    . DC  I 5 103 ? -40.181 -10.676 10.837 1.00 149.49 ? 30   DC  I N1    1 
ATOM   8080  C  C2    . DC  I 5 103 ? -40.316 -9.472  10.118 1.00 149.63 ? 30   DC  I C2    1 
ATOM   8081  O  O2    . DC  I 5 103 ? -40.878 -9.466  9.013  1.00 149.58 ? 30   DC  I O2    1 
ATOM   8082  N  N3    . DC  I 5 103 ? -39.820 -8.327  10.661 1.00 149.74 ? 30   DC  I N3    1 
ATOM   8083  C  C4    . DC  I 5 103 ? -39.214 -8.347  11.854 1.00 149.50 ? 30   DC  I C4    1 
ATOM   8084  N  N4    . DC  I 5 103 ? -38.747 -7.194  12.341 1.00 149.42 ? 30   DC  I N4    1 
ATOM   8085  C  C5    . DC  I 5 103 ? -39.061 -9.556  12.597 1.00 149.55 ? 30   DC  I C5    1 
ATOM   8086  C  C6    . DC  I 5 103 ? -39.556 -10.680 12.057 1.00 149.56 ? 30   DC  I C6    1 
ATOM   8087  P  P     . DT  I 5 104 ? -40.344 -14.323 7.304  1.00 151.07 ? 31   DT  I P     1 
ATOM   8088  O  OP1   . DT  I 5 104 ? -40.894 -15.253 6.289  1.00 150.87 ? 31   DT  I OP1   1 
ATOM   8089  O  OP2   . DT  I 5 104 ? -38.881 -14.066 7.339  1.00 150.32 ? 31   DT  I OP2   1 
ATOM   8090  O  "O5'" . DT  I 5 104 ? -41.115 -12.921 7.174  1.00 151.54 ? 31   DT  I "O5'" 1 
ATOM   8091  C  "C5'" . DT  I 5 104 ? -41.832 -12.553 6.000  1.00 151.94 ? 31   DT  I "C5'" 1 
ATOM   8092  C  "C4'" . DT  I 5 104 ? -41.068 -11.495 5.218  1.00 152.45 ? 31   DT  I "C4'" 1 
ATOM   8093  O  "O4'" . DT  I 5 104 ? -40.472 -10.517 6.114  1.00 152.40 ? 31   DT  I "O4'" 1 
ATOM   8094  C  "C3'" . DT  I 5 104 ? -39.919 -12.013 4.352  1.00 152.74 ? 31   DT  I "C3'" 1 
ATOM   8095  O  "O3'" . DT  I 5 104 ? -39.983 -11.368 3.087  1.00 153.43 ? 31   DT  I "O3'" 1 
ATOM   8096  C  "C2'" . DT  I 5 104 ? -38.677 -11.566 5.115  1.00 152.45 ? 31   DT  I "C2'" 1 
ATOM   8097  C  "C1'" . DT  I 5 104 ? -39.197 -10.218 5.590  1.00 152.49 ? 31   DT  I "C1'" 1 
ATOM   8098  N  N1    . DT  I 5 104 ? -38.363 -9.516  6.605  1.00 152.62 ? 31   DT  I N1    1 
ATOM   8099  C  C2    . DT  I 5 104 ? -38.024 -8.191  6.386  1.00 152.68 ? 31   DT  I C2    1 
ATOM   8100  O  O2    . DT  I 5 104 ? -38.355 -7.552  5.401  1.00 152.64 ? 31   DT  I O2    1 
ATOM   8101  N  N3    . DT  I 5 104 ? -37.253 -7.630  7.372  1.00 152.67 ? 31   DT  I N3    1 
ATOM   8102  C  C4    . DT  I 5 104 ? -36.808 -8.243  8.528  1.00 152.54 ? 31   DT  I C4    1 
ATOM   8103  O  O4    . DT  I 5 104 ? -36.124 -7.634  9.340  1.00 152.65 ? 31   DT  I O4    1 
ATOM   8104  C  C5    . DT  I 5 104 ? -37.200 -9.625  8.698  1.00 152.56 ? 31   DT  I C5    1 
ATOM   8105  C  C7    . DT  I 5 104 ? -36.780 -10.407 9.906  1.00 152.50 ? 31   DT  I C7    1 
ATOM   8106  C  C6    . DT  I 5 104 ? -37.949 -10.189 7.741  1.00 152.61 ? 31   DT  I C6    1 
ATOM   8107  P  P     . DG  I 5 105 ? -39.436 -12.059 1.752  1.00 153.85 ? 32   DG  I P     1 
ATOM   8108  O  OP1   . DG  I 5 105 ? -40.557 -12.866 1.220  1.00 153.76 ? 32   DG  I OP1   1 
ATOM   8109  O  OP2   . DG  I 5 105 ? -38.126 -12.693 2.038  1.00 153.45 ? 32   DG  I OP2   1 
ATOM   8110  O  "O5'" . DG  I 5 105 ? -39.163 -10.827 0.763  1.00 154.23 ? 32   DG  I "O5'" 1 
ATOM   8111  C  "C5'" . DG  I 5 105 ? -39.594 -9.502  1.074  1.00 155.17 ? 32   DG  I "C5'" 1 
ATOM   8112  C  "C4'" . DG  I 5 105 ? -38.491 -8.481  0.838  1.00 155.95 ? 32   DG  I "C4'" 1 
ATOM   8113  O  "O4'" . DG  I 5 105 ? -37.924 -8.059  2.108  1.00 156.32 ? 32   DG  I "O4'" 1 
ATOM   8114  C  "C3'" . DG  I 5 105 ? -37.324 -8.951  -0.032 1.00 156.17 ? 32   DG  I "C3'" 1 
ATOM   8115  O  "O3'" . DG  I 5 105 ? -37.167 -8.018  -1.118 1.00 156.39 ? 32   DG  I "O3'" 1 
ATOM   8116  C  "C2'" . DG  I 5 105 ? -36.146 -9.019  0.943  1.00 156.48 ? 32   DG  I "C2'" 1 
ATOM   8117  C  "C1'" . DG  I 5 105 ? -36.519 -7.972  1.985  1.00 157.06 ? 32   DG  I "C1'" 1 
ATOM   8118  N  N9    . DG  I 5 105 ? -35.910 -8.184  3.302  1.00 157.26 ? 32   DG  I N9    1 
ATOM   8119  C  C8    . DG  I 5 105 ? -36.011 -9.309  4.088  1.00 157.28 ? 32   DG  I C8    1 
ATOM   8120  N  N7    . DG  I 5 105 ? -35.369 -9.223  5.219  1.00 157.22 ? 32   DG  I N7    1 
ATOM   8121  C  C5    . DG  I 5 105 ? -34.801 -7.957  5.188  1.00 157.29 ? 32   DG  I C5    1 
ATOM   8122  C  C6    . DG  I 5 105 ? -33.986 -7.297  6.146  1.00 157.38 ? 32   DG  I C6    1 
ATOM   8123  O  O6    . DG  I 5 105 ? -33.597 -7.720  7.245  1.00 157.32 ? 32   DG  I O6    1 
ATOM   8124  N  N1    . DG  I 5 105 ? -33.615 -6.016  5.731  1.00 157.40 ? 32   DG  I N1    1 
ATOM   8125  C  C2    . DG  I 5 105 ? -33.986 -5.444  4.534  1.00 157.27 ? 32   DG  I C2    1 
ATOM   8126  N  N2    . DG  I 5 105 ? -33.532 -4.204  4.308  1.00 157.24 ? 32   DG  I N2    1 
ATOM   8127  N  N3    . DG  I 5 105 ? -34.748 -6.052  3.627  1.00 157.32 ? 32   DG  I N3    1 
ATOM   8128  C  C4    . DG  I 5 105 ? -35.122 -7.302  4.015  1.00 157.29 ? 32   DG  I C4    1 
ATOM   8129  P  P     . DT  I 5 106 ? -35.782 -7.684  -1.865 1.00 156.42 ? 33   DT  I P     1 
ATOM   8130  O  OP1   . DT  I 5 106 ? -36.133 -7.019  -3.140 1.00 156.37 ? 33   DT  I OP1   1 
ATOM   8131  O  OP2   . DT  I 5 106 ? -34.930 -8.894  -1.899 1.00 156.37 ? 33   DT  I OP2   1 
ATOM   8132  O  "O5'" . DT  I 5 106 ? -35.096 -6.616  -0.888 1.00 155.70 ? 33   DT  I "O5'" 1 
ATOM   8133  C  "C5'" . DT  I 5 106 ? -35.689 -5.338  -0.676 1.00 154.74 ? 33   DT  I "C5'" 1 
ATOM   8134  C  "C4'" . DT  I 5 106 ? -34.619 -4.329  -0.311 1.00 154.15 ? 33   DT  I "C4'" 1 
ATOM   8135  O  "O4'" . DT  I 5 106 ? -33.957 -4.760  0.908  1.00 154.38 ? 33   DT  I "O4'" 1 
ATOM   8136  C  "C3'" . DT  I 5 106 ? -33.526 -4.150  -1.362 1.00 153.52 ? 33   DT  I "C3'" 1 
ATOM   8137  O  "O3'" . DT  I 5 106 ? -33.317 -2.752  -1.597 1.00 152.43 ? 33   DT  I "O3'" 1 
ATOM   8138  C  "C2'" . DT  I 5 106 ? -32.313 -4.847  -0.740 1.00 153.91 ? 33   DT  I "C2'" 1 
ATOM   8139  C  "C1'" . DT  I 5 106 ? -32.557 -4.637  0.749  1.00 154.29 ? 33   DT  I "C1'" 1 
ATOM   8140  N  N1    . DT  I 5 106 ? -31.852 -5.630  1.634  1.00 154.39 ? 33   DT  I N1    1 
ATOM   8141  C  C2    . DT  I 5 106 ? -30.870 -5.209  2.521  1.00 154.30 ? 33   DT  I C2    1 
ATOM   8142  O  O2    . DT  I 5 106 ? -30.511 -4.052  2.653  1.00 154.24 ? 33   DT  I O2    1 
ATOM   8143  N  N3    . DT  I 5 106 ? -30.303 -6.216  3.268  1.00 154.27 ? 33   DT  I N3    1 
ATOM   8144  C  C4    . DT  I 5 106 ? -30.611 -7.568  3.223  1.00 154.33 ? 33   DT  I C4    1 
ATOM   8145  O  O4    . DT  I 5 106 ? -30.049 -8.390  3.937  1.00 154.29 ? 33   DT  I O4    1 
ATOM   8146  C  C5    . DT  I 5 106 ? -31.641 -7.939  2.281  1.00 154.45 ? 33   DT  I C5    1 
ATOM   8147  C  C7    . DT  I 5 106 ? -32.066 -9.372  2.134  1.00 154.41 ? 33   DT  I C7    1 
ATOM   8148  C  C6    . DT  I 5 106 ? -32.202 -6.968  1.545  1.00 154.58 ? 33   DT  I C6    1 
ATOM   8149  P  P     . DC  I 5 107 ? -32.064 -2.193  -2.435 1.00 151.88 ? 34   DC  I P     1 
ATOM   8150  O  OP1   . DC  I 5 107 ? -32.429 -0.864  -2.979 1.00 151.94 ? 34   DC  I OP1   1 
ATOM   8151  O  OP2   . DC  I 5 107 ? -31.602 -3.254  -3.363 1.00 151.34 ? 34   DC  I OP2   1 
ATOM   8152  O  "O5'" . DC  I 5 107 ? -30.951 -1.973  -1.301 1.00 150.70 ? 34   DC  I "O5'" 1 
ATOM   8153  C  "C5'" . DC  I 5 107 ? -30.861 -0.743  -0.586 1.00 148.68 ? 34   DC  I "C5'" 1 
ATOM   8154  C  "C4'" . DC  I 5 107 ? -29.565 -0.668  0.202  1.00 147.51 ? 34   DC  I "C4'" 1 
ATOM   8155  O  "O4'" . DC  I 5 107 ? -29.324 -1.913  0.909  1.00 147.68 ? 34   DC  I "O4'" 1 
ATOM   8156  C  "C3'" . DC  I 5 107 ? -28.296 -0.401  -0.602 1.00 146.57 ? 34   DC  I "C3'" 1 
ATOM   8157  O  "O3'" . DC  I 5 107 ? -27.554 0.530   0.148  1.00 145.37 ? 34   DC  I "O3'" 1 
ATOM   8158  C  "C2'" . DC  I 5 107 ? -27.591 -1.756  -0.624 1.00 146.93 ? 34   DC  I "C2'" 1 
ATOM   8159  C  "C1'" . DC  I 5 107 ? -27.949 -2.243  0.779  1.00 147.47 ? 34   DC  I "C1'" 1 
ATOM   8160  N  N1    . DC  I 5 107 ? -27.747 -3.714  1.094  1.00 147.48 ? 34   DC  I N1    1 
ATOM   8161  C  C2    . DC  I 5 107 ? -27.014 -4.102  2.233  1.00 147.12 ? 34   DC  I C2    1 
ATOM   8162  O  O2    . DC  I 5 107 ? -26.522 -3.238  2.972  1.00 146.71 ? 34   DC  I O2    1 
ATOM   8163  N  N3    . DC  I 5 107 ? -26.864 -5.432  2.492  1.00 147.10 ? 34   DC  I N3    1 
ATOM   8164  C  C4    . DC  I 5 107 ? -27.410 -6.345  1.676  1.00 147.10 ? 34   DC  I C4    1 
ATOM   8165  N  N4    . DC  I 5 107 ? -27.244 -7.639  1.961  1.00 147.07 ? 34   DC  I N4    1 
ATOM   8166  C  C5    . DC  I 5 107 ? -28.157 -5.976  0.519  1.00 147.04 ? 34   DC  I C5    1 
ATOM   8167  C  C6    . DC  I 5 107 ? -28.300 -4.668  0.275  1.00 147.51 ? 34   DC  I C6    1 
ATOM   8168  P  P     . DT  I 5 108 ? -26.401 1.437   -0.483 1.00 144.84 ? 35   DT  I P     1 
ATOM   8169  O  OP1   . DT  I 5 108 ? -27.092 2.520   -1.216 1.00 145.03 ? 35   DT  I OP1   1 
ATOM   8170  O  OP2   . DT  I 5 108 ? -25.403 0.581   -1.173 1.00 144.33 ? 35   DT  I OP2   1 
ATOM   8171  O  "O5'" . DT  I 5 108 ? -25.690 2.066   0.817  1.00 143.61 ? 35   DT  I "O5'" 1 
ATOM   8172  C  "C5'" . DT  I 5 108 ? -25.952 1.568   2.144  1.00 140.86 ? 35   DT  I "C5'" 1 
ATOM   8173  C  "C4'" . DT  I 5 108 ? -24.797 0.757   2.724  1.00 138.83 ? 35   DT  I "C4'" 1 
ATOM   8174  O  "O4'" . DT  I 5 108 ? -24.943 -0.661  2.449  1.00 138.78 ? 35   DT  I "O4'" 1 
ATOM   8175  C  "C3'" . DT  I 5 108 ? -23.386 1.115   2.247  1.00 137.24 ? 35   DT  I "C3'" 1 
ATOM   8176  O  "O3'" . DT  I 5 108 ? -22.612 1.391   3.386  1.00 135.23 ? 35   DT  I "O3'" 1 
ATOM   8177  C  "C2'" . DT  I 5 108 ? -22.882 -0.155  1.563  1.00 137.57 ? 35   DT  I "C2'" 1 
ATOM   8178  C  "C1'" . DT  I 5 108 ? -23.628 -1.183  2.403  1.00 138.01 ? 35   DT  I "C1'" 1 
ATOM   8179  N  N1    . DT  I 5 108 ? -23.670 -2.608  1.927  1.00 137.90 ? 35   DT  I N1    1 
ATOM   8180  C  C2    . DT  I 5 108 ? -23.440 -3.612  2.847  1.00 138.05 ? 35   DT  I C2    1 
ATOM   8181  O  O2    . DT  I 5 108 ? -23.190 -3.406  4.023  1.00 138.14 ? 35   DT  I O2    1 
ATOM   8182  N  N3    . DT  I 5 108 ? -23.509 -4.887  2.344  1.00 137.78 ? 35   DT  I N3    1 
ATOM   8183  C  C4    . DT  I 5 108 ? -23.782 -5.259  1.043  1.00 137.86 ? 35   DT  I C4    1 
ATOM   8184  O  O4    . DT  I 5 108 ? -23.817 -6.444  0.719  1.00 137.58 ? 35   DT  I O4    1 
ATOM   8185  C  C5    . DT  I 5 108 ? -24.019 -4.159  0.126  1.00 138.21 ? 35   DT  I C5    1 
ATOM   8186  C  C7    . DT  I 5 108 ? -24.328 -4.402  -1.326 1.00 138.22 ? 35   DT  I C7    1 
ATOM   8187  C  C6    . DT  I 5 108 ? -23.957 -2.907  0.609  1.00 138.10 ? 35   DT  I C6    1 
ATOM   8188  P  P     . DA  I 5 109 ? -22.432 2.888   3.913  1.00 134.44 ? 36   DA  I P     1 
ATOM   8189  O  OP1   . DA  I 5 109 ? -23.738 3.594   3.939  1.00 134.23 ? 36   DA  I OP1   1 
ATOM   8190  O  OP2   . DA  I 5 109 ? -21.299 3.451   3.143  1.00 134.48 ? 36   DA  I OP2   1 
ATOM   8191  O  "O5'" . DA  I 5 109 ? -21.958 2.667   5.429  1.00 133.03 ? 36   DA  I "O5'" 1 
ATOM   8192  C  "C5'" . DA  I 5 109 ? -22.770 1.936   6.352  1.00 130.51 ? 36   DA  I "C5'" 1 
ATOM   8193  C  "C4'" . DA  I 5 109 ? -21.964 0.875   7.085  1.00 128.80 ? 36   DA  I "C4'" 1 
ATOM   8194  O  "O4'" . DA  I 5 109 ? -21.873 -0.339  6.294  1.00 128.90 ? 36   DA  I "O4'" 1 
ATOM   8195  C  "C3'" . DA  I 5 109 ? -20.529 1.249   7.451  1.00 127.25 ? 36   DA  I "C3'" 1 
ATOM   8196  O  "O3'" . DA  I 5 109 ? -20.335 0.887   8.820  1.00 124.21 ? 36   DA  I "O3'" 1 
ATOM   8197  C  "C2'" . DA  I 5 109 ? -19.677 0.435   6.477  1.00 127.61 ? 36   DA  I "C2'" 1 
ATOM   8198  C  "C1'" . DA  I 5 109 ? -20.538 -0.803  6.277  1.00 129.35 ? 36   DA  I "C1'" 1 
ATOM   8199  N  N9    . DA  I 5 109 ? -20.359 -1.456  4.990  1.00 129.89 ? 36   DA  I N9    1 
ATOM   8200  C  C8    . DA  I 5 109 ? -20.179 -0.840  3.782  1.00 130.46 ? 36   DA  I C8    1 
ATOM   8201  N  N7    . DA  I 5 109 ? -20.060 -1.663  2.768  1.00 130.61 ? 36   DA  I N7    1 
ATOM   8202  C  C5    . DA  I 5 109 ? -20.177 -2.910  3.352  1.00 130.36 ? 36   DA  I C5    1 
ATOM   8203  C  C6    . DA  I 5 109 ? -20.137 -4.210  2.809  1.00 130.14 ? 36   DA  I C6    1 
ATOM   8204  N  N6    . DA  I 5 109 ? -19.967 -4.438  1.506  1.00 130.00 ? 36   DA  I N6    1 
ATOM   8205  N  N1    . DA  I 5 109 ? -20.287 -5.257  3.655  1.00 130.25 ? 36   DA  I N1    1 
ATOM   8206  C  C2    . DA  I 5 109 ? -20.461 -5.007  4.964  1.00 130.28 ? 36   DA  I C2    1 
ATOM   8207  N  N3    . DA  I 5 109 ? -20.516 -3.825  5.592  1.00 130.39 ? 36   DA  I N3    1 
ATOM   8208  C  C4    . DA  I 5 109 ? -20.366 -2.805  4.723  1.00 130.24 ? 36   DA  I C4    1 
ATOM   8209  P  P     . DC  I 5 110 ? -18.919 0.942   9.569  1.00 121.84 ? 37   DC  I P     1 
ATOM   8210  O  OP1   . DC  I 5 110 ? -19.052 1.922   10.667 1.00 121.35 ? 37   DC  I OP1   1 
ATOM   8211  O  OP2   . DC  I 5 110 ? -17.809 1.051   8.592  1.00 121.43 ? 37   DC  I OP2   1 
ATOM   8212  O  "O5'" . DC  I 5 110 ? -18.811 -0.507  10.226 1.00 120.50 ? 37   DC  I "O5'" 1 
ATOM   8213  C  "C5'" . DC  I 5 110 ? -19.707 -1.558  9.893  1.00 117.76 ? 37   DC  I "C5'" 1 
ATOM   8214  C  "C4'" . DC  I 5 110 ? -18.980 -2.888  9.887  1.00 115.80 ? 37   DC  I "C4'" 1 
ATOM   8215  O  "O4'" . DC  I 5 110 ? -18.896 -3.383  8.529  1.00 115.04 ? 37   DC  I "O4'" 1 
ATOM   8216  C  "C3'" . DC  I 5 110 ? -17.547 -2.889  10.422 1.00 115.26 ? 37   DC  I "C3'" 1 
ATOM   8217  O  "O3'" . DC  I 5 110 ? -17.359 -4.151  11.047 1.00 115.07 ? 37   DC  I "O3'" 1 
ATOM   8218  C  "C2'" . DC  I 5 110 ? -16.704 -2.793  9.157  1.00 114.91 ? 37   DC  I "C2'" 1 
ATOM   8219  C  "C1'" . DC  I 5 110 ? -17.540 -3.690  8.248  1.00 115.34 ? 37   DC  I "C1'" 1 
ATOM   8220  N  N1    . DC  I 5 110 ? -17.341 -3.556  6.774  1.00 115.42 ? 37   DC  I N1    1 
ATOM   8221  C  C2    . DC  I 5 110 ? -17.321 -4.717  5.991  1.00 115.22 ? 37   DC  I C2    1 
ATOM   8222  O  O2    . DC  I 5 110 ? -17.445 -5.831  6.521  1.00 115.16 ? 37   DC  I O2    1 
ATOM   8223  N  N3    . DC  I 5 110 ? -17.159 -4.582  4.650  1.00 115.59 ? 37   DC  I N3    1 
ATOM   8224  C  C4    . DC  I 5 110 ? -17.023 -3.370  4.099  1.00 115.54 ? 37   DC  I C4    1 
ATOM   8225  N  N4    . DC  I 5 110 ? -16.864 -3.313  2.775  1.00 115.56 ? 37   DC  I N4    1 
ATOM   8226  C  C5    . DC  I 5 110 ? -17.046 -2.171  4.875  1.00 115.28 ? 37   DC  I C5    1 
ATOM   8227  C  C6    . DC  I 5 110 ? -17.210 -2.317  6.195  1.00 115.72 ? 37   DC  I C6    1 
ATOM   8228  P  P     . DG  I 5 111 ? -16.357 -4.434  12.255 1.00 113.49 ? 38   DG  I P     1 
ATOM   8229  O  OP1   . DG  I 5 111 ? -17.192 -4.417  13.479 1.00 113.01 ? 38   DG  I OP1   1 
ATOM   8230  O  OP2   . DG  I 5 111 ? -15.153 -3.587  12.107 1.00 113.13 ? 38   DG  I OP2   1 
ATOM   8231  O  "O5'" . DG  I 5 111 ? -15.863 -5.920  11.957 1.00 112.86 ? 38   DG  I "O5'" 1 
ATOM   8232  C  "C5'" . DG  I 5 111 ? -16.762 -6.992  11.685 1.00 112.31 ? 38   DG  I "C5'" 1 
ATOM   8233  C  "C4'" . DG  I 5 111 ? -16.030 -8.059  10.891 1.00 112.00 ? 38   DG  I "C4'" 1 
ATOM   8234  O  "O4'" . DG  I 5 111 ? -15.933 -7.615  9.513  1.00 113.07 ? 38   DG  I "O4'" 1 
ATOM   8235  C  "C3'" . DG  I 5 111 ? -14.603 -8.347  11.361 1.00 111.11 ? 38   DG  I "C3'" 1 
ATOM   8236  O  "O3'" . DG  I 5 111 ? -14.366 -9.751  11.439 1.00 108.75 ? 38   DG  I "O3'" 1 
ATOM   8237  C  "C2'" . DG  I 5 111 ? -13.720 -7.645  10.332 1.00 112.27 ? 38   DG  I "C2'" 1 
ATOM   8238  C  "C1'" . DG  I 5 111 ? -14.586 -7.624  9.081  1.00 114.32 ? 38   DG  I "C1'" 1 
ATOM   8239  N  N9    . DG  I 5 111 ? -14.350 -6.440  8.258  1.00 115.03 ? 38   DG  I N9    1 
ATOM   8240  C  C8    . DG  I 5 111 ? -14.039 -5.175  8.719  1.00 115.47 ? 38   DG  I C8    1 
ATOM   8241  N  N7    . DG  I 5 111 ? -13.879 -4.289  7.776  1.00 115.31 ? 38   DG  I N7    1 
ATOM   8242  C  C5    . DG  I 5 111 ? -14.096 -5.013  6.614  1.00 115.14 ? 38   DG  I C5    1 
ATOM   8243  C  C6    . DG  I 5 111 ? -14.057 -4.565  5.277  1.00 115.08 ? 38   DG  I C6    1 
ATOM   8244  O  O6    . DG  I 5 111 ? -13.818 -3.412  4.886  1.00 115.18 ? 38   DG  I O6    1 
ATOM   8245  N  N1    . DG  I 5 111 ? -14.339 -5.596  4.371  1.00 115.30 ? 38   DG  I N1    1 
ATOM   8246  C  C2    . DG  I 5 111 ? -14.624 -6.903  4.732  1.00 115.51 ? 38   DG  I C2    1 
ATOM   8247  N  N2    . DG  I 5 111 ? -14.863 -7.758  3.720  1.00 115.29 ? 38   DG  I N2    1 
ATOM   8248  N  N3    . DG  I 5 111 ? -14.664 -7.336  5.996  1.00 115.20 ? 38   DG  I N3    1 
ATOM   8249  C  C4    . DG  I 5 111 ? -14.388 -6.339  6.882  1.00 115.11 ? 38   DG  I C4    1 
ATOM   8250  P  P     . DA  I 5 112 ? -12.928 -10.396 11.742 1.00 106.51 ? 39   DA  I P     1 
ATOM   8251  O  OP1   . DA  I 5 112 ? -13.080 -11.379 12.836 1.00 107.21 ? 39   DA  I OP1   1 
ATOM   8252  O  OP2   . DA  I 5 112 ? -11.880 -9.364  11.814 1.00 105.88 ? 39   DA  I OP2   1 
ATOM   8253  O  "O5'" . DA  I 5 112 ? -12.706 -11.224 10.408 1.00 107.78 ? 39   DA  I "O5'" 1 
ATOM   8254  C  "C5'" . DA  I 5 112 ? -13.816 -11.933 9.842  1.00 108.79 ? 39   DA  I "C5'" 1 
ATOM   8255  C  "C4'" . DA  I 5 112 ? -13.359 -12.950 8.811  1.00 109.22 ? 39   DA  I "C4'" 1 
ATOM   8256  O  "O4'" . DA  I 5 112 ? -13.288 -12.317 7.510  1.00 109.38 ? 39   DA  I "O4'" 1 
ATOM   8257  C  "C3'" . DA  I 5 112 ? -11.979 -13.558 9.041  1.00 109.48 ? 39   DA  I "C3'" 1 
ATOM   8258  O  "O3'" . DA  I 5 112 ? -12.016 -14.895 8.543  1.00 110.78 ? 39   DA  I "O3'" 1 
ATOM   8259  C  "C2'" . DA  I 5 112 ? -11.050 -12.602 8.285  1.00 109.08 ? 39   DA  I "C2'" 1 
ATOM   8260  C  "C1'" . DA  I 5 112 ? -11.940 -12.055 7.162  1.00 108.81 ? 39   DA  I "C1'" 1 
ATOM   8261  N  N9    . DA  I 5 112 ? -11.835 -10.617 6.935  1.00 108.51 ? 39   DA  I N9    1 
ATOM   8262  C  C8    . DA  I 5 112 ? -11.834 -9.648  7.894  1.00 108.48 ? 39   DA  I C8    1 
ATOM   8263  N  N7    . DA  I 5 112 ? -11.736 -8.429  7.432  1.00 108.63 ? 39   DA  I N7    1 
ATOM   8264  C  C5    . DA  I 5 112 ? -11.672 -8.608  6.068  1.00 108.61 ? 39   DA  I C5    1 
ATOM   8265  C  C6    . DA  I 5 112 ? -11.557 -7.685  5.016  1.00 108.41 ? 39   DA  I C6    1 
ATOM   8266  N  N6    . DA  I 5 112 ? -11.497 -6.372  5.244  1.00 108.30 ? 39   DA  I N6    1 
ATOM   8267  N  N1    . DA  I 5 112 ? -11.517 -8.166  3.749  1.00 108.48 ? 39   DA  I N1    1 
ATOM   8268  C  C2    . DA  I 5 112 ? -11.582 -9.494  3.560  1.00 108.57 ? 39   DA  I C2    1 
ATOM   8269  N  N3    . DA  I 5 112 ? -11.685 -10.464 4.480  1.00 108.94 ? 39   DA  I N3    1 
ATOM   8270  C  C4    . DA  I 5 112 ? -11.734 -9.950  5.731  1.00 108.91 ? 39   DA  I C4    1 
ATOM   8271  P  P     . DC  I 5 113 ? -10.731 -15.708 8.041  1.00 112.15 ? 40   DC  I P     1 
ATOM   8272  O  OP1   . DC  I 5 113 ? -11.201 -17.075 7.746  1.00 112.73 ? 40   DC  I OP1   1 
ATOM   8273  O  OP2   . DC  I 5 113 ? -9.586  -15.475 8.946  1.00 112.00 ? 40   DC  I OP2   1 
ATOM   8274  O  "O5'" . DC  I 5 113 ? -10.354 -14.997 6.666  1.00 113.90 ? 40   DC  I "O5'" 1 
ATOM   8275  C  "C5'" . DC  I 5 113 ? -11.043 -15.239 5.435  1.00 114.89 ? 40   DC  I "C5'" 1 
ATOM   8276  C  "C4'" . DC  I 5 113 ? -10.069 -14.895 4.325  1.00 115.64 ? 40   DC  I "C4'" 1 
ATOM   8277  O  "O4'" . DC  I 5 113 ? -9.971  -13.458 4.164  1.00 115.64 ? 40   DC  I "O4'" 1 
ATOM   8278  C  "C3'" . DC  I 5 113 ? -8.647  -15.378 4.593  1.00 116.56 ? 40   DC  I "C3'" 1 
ATOM   8279  O  "O3'" . DC  I 5 113 ? -8.216  -16.010 3.408  1.00 119.22 ? 40   DC  I "O3'" 1 
ATOM   8280  C  "C2'" . DC  I 5 113 ? -7.844  -14.118 4.926  1.00 115.67 ? 40   DC  I "C2'" 1 
ATOM   8281  C  "C1'" . DC  I 5 113 ? -8.604  -13.077 4.114  1.00 114.99 ? 40   DC  I "C1'" 1 
ATOM   8282  N  N1    . DC  I 5 113 ? -8.499  -11.646 4.559  1.00 114.50 ? 40   DC  I N1    1 
ATOM   8283  C  C2    . DC  I 5 113 ? -8.297  -10.644 3.593  1.00 114.61 ? 40   DC  I C2    1 
ATOM   8284  O  O2    . DC  I 5 113 ? -8.189  -10.955 2.398  1.00 114.78 ? 40   DC  I O2    1 
ATOM   8285  N  N3    . DC  I 5 113 ? -8.220  -9.346  3.988  1.00 114.09 ? 40   DC  I N3    1 
ATOM   8286  C  C4    . DC  I 5 113 ? -8.345  -9.041  5.278  1.00 114.18 ? 40   DC  I C4    1 
ATOM   8287  N  N4    . DC  I 5 113 ? -8.254  -7.755  5.611  1.00 114.20 ? 40   DC  I N4    1 
ATOM   8288  C  C5    . DC  I 5 113 ? -8.553  -10.038 6.281  1.00 114.12 ? 40   DC  I C5    1 
ATOM   8289  C  C6    . DC  I 5 113 ? -8.629  -11.313 5.878  1.00 114.32 ? 40   DC  I C6    1 
ATOM   8290  P  P     . DC  I 5 114 ? -6.927  -16.952 3.324  1.00 120.94 ? 41   DC  I P     1 
ATOM   8291  O  OP1   . DC  I 5 114 ? -7.329  -18.113 2.491  1.00 120.00 ? 41   DC  I OP1   1 
ATOM   8292  O  OP2   . DC  I 5 114 ? -6.361  -17.174 4.678  1.00 120.68 ? 41   DC  I OP2   1 
ATOM   8293  O  "O5'" . DC  I 5 114 ? -5.914  -15.998 2.518  1.00 122.35 ? 41   DC  I "O5'" 1 
ATOM   8294  C  "C5'" . DC  I 5 114 ? -6.373  -15.264 1.369  1.00 124.38 ? 41   DC  I "C5'" 1 
ATOM   8295  C  "C4'" . DC  I 5 114 ? -5.456  -14.112 0.977  1.00 126.17 ? 41   DC  I "C4'" 1 
ATOM   8296  O  "O4'" . DC  I 5 114 ? -5.799  -12.909 1.722  1.00 126.12 ? 41   DC  I "O4'" 1 
ATOM   8297  C  "C3'" . DC  I 5 114 ? -3.958  -14.344 1.187  1.00 127.65 ? 41   DC  I "C3'" 1 
ATOM   8298  O  "O3'" . DC  I 5 114 ? -3.265  -14.102 -0.039 1.00 130.54 ? 41   DC  I "O3'" 1 
ATOM   8299  C  "C2'" . DC  I 5 114 ? -3.573  -13.326 2.259  1.00 126.77 ? 41   DC  I "C2'" 1 
ATOM   8300  C  "C1'" . DC  I 5 114 ? -4.601  -12.223 2.027  1.00 125.38 ? 41   DC  I "C1'" 1 
ATOM   8301  N  N1    . DC  I 5 114 ? -4.789  -11.286 3.194  1.00 124.75 ? 41   DC  I N1    1 
ATOM   8302  C  C2    . DC  I 5 114 ? -4.622  -9.909  3.000  1.00 124.05 ? 41   DC  I C2    1 
ATOM   8303  O  O2    . DC  I 5 114 ? -4.334  -9.479  1.886  1.00 124.31 ? 41   DC  I O2    1 
ATOM   8304  N  N3    . DC  I 5 114 ? -4.785  -9.068  4.043  1.00 123.88 ? 41   DC  I N3    1 
ATOM   8305  C  C4    . DC  I 5 114 ? -5.098  -9.554  5.240  1.00 124.31 ? 41   DC  I C4    1 
ATOM   8306  N  N4    . DC  I 5 114 ? -5.243  -8.672  6.225  1.00 124.51 ? 41   DC  I N4    1 
ATOM   8307  C  C5    . DC  I 5 114 ? -5.271  -10.951 5.480  1.00 124.24 ? 41   DC  I C5    1 
ATOM   8308  C  C6    . DC  I 5 114 ? -5.111  -11.771 4.436  1.00 124.62 ? 41   DC  I C6    1 
ATOM   8309  P  P     . DA  I 5 115 ? -1.709  -14.442 -0.235 1.00 132.57 ? 42   DA  I P     1 
ATOM   8310  O  OP1   . DA  I 5 115 ? -1.569  -14.896 -1.637 1.00 132.97 ? 42   DA  I OP1   1 
ATOM   8311  O  OP2   . DA  I 5 115 ? -1.242  -15.334 0.856  1.00 132.31 ? 42   DA  I OP2   1 
ATOM   8312  O  "O5'" . DA  I 5 115 ? -1.010  -13.005 -0.058 1.00 133.48 ? 42   DA  I "O5'" 1 
ATOM   8313  C  "C5'" . DA  I 5 115 ? -0.877  -12.088 -1.160 1.00 134.93 ? 42   DA  I "C5'" 1 
ATOM   8314  C  "C4'" . DA  I 5 115 ? 0.380   -11.221 -1.072 1.00 136.08 ? 42   DA  I "C4'" 1 
ATOM   8315  O  "O4'" . DA  I 5 115 ? 0.106   -10.091 -0.204 1.00 136.41 ? 42   DA  I "O4'" 1 
ATOM   8316  C  "C3'" . DA  I 5 115 ? 1.664   -11.882 -0.543 1.00 136.66 ? 42   DA  I "C3'" 1 
ATOM   8317  O  "O3'" . DA  I 5 115 ? 2.836   -11.573 -1.381 1.00 137.65 ? 42   DA  I "O3'" 1 
ATOM   8318  C  "C2'" . DA  I 5 115 ? 1.740   -11.445 0.921  1.00 136.45 ? 42   DA  I "C2'" 1 
ATOM   8319  C  "C1'" . DA  I 5 115 ? 0.883   -10.178 0.979  1.00 136.88 ? 42   DA  I "C1'" 1 
ATOM   8320  N  N9    . DA  I 5 115 ? 0.018   -10.110 2.163  1.00 137.01 ? 42   DA  I N9    1 
ATOM   8321  C  C8    . DA  I 5 115 ? -0.784  -11.094 2.678  1.00 136.97 ? 42   DA  I C8    1 
ATOM   8322  N  N7    . DA  I 5 115 ? -1.442  -10.745 3.756  1.00 136.80 ? 42   DA  I N7    1 
ATOM   8323  C  C5    . DA  I 5 115 ? -1.044  -9.439  3.967  1.00 136.94 ? 42   DA  I C5    1 
ATOM   8324  C  C6    . DA  I 5 115 ? -1.379  -8.492  4.954  1.00 137.14 ? 42   DA  I C6    1 
ATOM   8325  N  N6    . DA  I 5 115 ? -2.228  -8.745  5.950  1.00 136.94 ? 42   DA  I N6    1 
ATOM   8326  N  N1    . DA  I 5 115 ? -0.804  -7.270  4.877  1.00 137.22 ? 42   DA  I N1    1 
ATOM   8327  C  C2    . DA  I 5 115 ? 0.053   -7.014  3.879  1.00 136.94 ? 42   DA  I C2    1 
ATOM   8328  N  N3    . DA  I 5 115 ? 0.444   -7.825  2.898  1.00 136.84 ? 42   DA  I N3    1 
ATOM   8329  C  C4    . DA  I 5 115 ? -0.144  -9.030  2.998  1.00 136.91 ? 42   DA  I C4    1 
ATOM   8330  P  P     . DA  I 5 116 ? 4.098   -10.629 -1.016 1.00 138.13 ? 43   DA  I P     1 
ATOM   8331  O  OP1   . DA  I 5 116 ? 4.985   -10.597 -2.202 1.00 137.74 ? 43   DA  I OP1   1 
ATOM   8332  O  OP2   . DA  I 5 116 ? 4.677   -11.055 0.281  1.00 137.77 ? 43   DA  I OP2   1 
ATOM   8333  O  "O5'" . DA  I 5 116 ? 3.400   -9.193  -0.842 1.00 138.37 ? 43   DA  I "O5'" 1 
ATOM   8334  C  "C5'" . DA  I 5 116 ? 3.897   -8.012  -1.467 1.00 138.42 ? 43   DA  I "C5'" 1 
ATOM   8335  C  "C4'" . DA  I 5 116 ? 4.596   -7.148  -0.432 1.00 138.63 ? 43   DA  I "C4'" 1 
ATOM   8336  O  "O4'" . DA  I 5 116 ? 3.854   -7.204  0.813  1.00 138.93 ? 43   DA  I "O4'" 1 
ATOM   8337  C  "C3'" . DA  I 5 116 ? 6.033   -7.573  -0.125 1.00 138.30 ? 43   DA  I "C3'" 1 
ATOM   8338  O  "O3'" . DA  I 5 116 ? 6.936   -6.471  -0.396 1.00 137.71 ? 43   DA  I "O3'" 1 
ATOM   8339  C  "C2'" . DA  I 5 116 ? 6.000   -8.098  1.314  1.00 138.62 ? 43   DA  I "C2'" 1 
ATOM   8340  C  "C1'" . DA  I 5 116 ? 4.734   -7.464  1.894  1.00 139.18 ? 43   DA  I "C1'" 1 
ATOM   8341  N  N9    . DA  I 5 116 ? 4.033   -8.257  2.911  1.00 139.20 ? 43   DA  I N9    1 
ATOM   8342  C  C8    . DA  I 5 116 ? 3.755   -9.597  2.891  1.00 139.16 ? 43   DA  I C8    1 
ATOM   8343  N  N7    . DA  I 5 116 ? 3.107   -10.030 3.943  1.00 138.90 ? 43   DA  I N7    1 
ATOM   8344  C  C5    . DA  I 5 116 ? 2.950   -8.892  4.710  1.00 138.90 ? 43   DA  I C5    1 
ATOM   8345  C  C6    . DA  I 5 116 ? 2.340   -8.670  5.958  1.00 139.18 ? 43   DA  I C6    1 
ATOM   8346  N  N6    . DA  I 5 116 ? 1.754   -9.640  6.667  1.00 139.13 ? 43   DA  I N6    1 
ATOM   8347  N  N1    . DA  I 5 116 ? 2.355   -7.408  6.450  1.00 139.36 ? 43   DA  I N1    1 
ATOM   8348  C  C2    . DA  I 5 116 ? 2.939   -6.432  5.739  1.00 139.14 ? 43   DA  I C2    1 
ATOM   8349  N  N3    . DA  I 5 116 ? 3.542   -6.525  4.555  1.00 138.96 ? 43   DA  I N3    1 
ATOM   8350  C  C4    . DA  I 5 116 ? 3.511   -7.790  4.092  1.00 138.89 ? 43   DA  I C4    1 
ATOM   8351  P  P     . DT  I 5 117 ? 7.684   -5.525  0.667  1.00 137.12 ? 44   DT  I P     1 
ATOM   8352  O  OP1   . DT  I 5 117 ? 8.219   -4.372  -0.097 1.00 136.89 ? 44   DT  I OP1   1 
ATOM   8353  O  OP2   . DT  I 5 117 ? 8.623   -6.371  1.448  1.00 136.79 ? 44   DT  I OP2   1 
ATOM   8354  O  "O5'" . DT  I 5 117 ? 6.507   -4.987  1.618  1.00 136.10 ? 44   DT  I "O5'" 1 
ATOM   8355  C  "C5'" . DT  I 5 117 ? 6.456   -3.622  2.056  1.00 134.44 ? 44   DT  I "C5'" 1 
ATOM   8356  C  "C4'" . DT  I 5 117 ? 6.641   -3.481  3.561  1.00 132.78 ? 44   DT  I "C4'" 1 
ATOM   8357  O  "O4'" . DT  I 5 117 ? 6.065   -4.623  4.241  1.00 132.05 ? 44   DT  I "O4'" 1 
ATOM   8358  C  "C3'" . DT  I 5 117 ? 8.091   -3.378  4.045  1.00 132.01 ? 44   DT  I "C3'" 1 
ATOM   8359  O  "O3'" . DT  I 5 117 ? 8.240   -2.160  4.793  1.00 131.09 ? 44   DT  I "O3'" 1 
ATOM   8360  C  "C2'" . DT  I 5 117 ? 8.302   -4.644  4.881  1.00 131.78 ? 44   DT  I "C2'" 1 
ATOM   8361  C  "C1'" . DT  I 5 117 ? 6.878   -4.904  5.359  1.00 132.06 ? 44   DT  I "C1'" 1 
ATOM   8362  N  N1    . DT  I 5 117 ? 6.555   -6.290  5.843  1.00 132.11 ? 44   DT  I N1    1 
ATOM   8363  C  C2    . DT  I 5 117 ? 5.935   -6.442  7.073  1.00 131.96 ? 44   DT  I C2    1 
ATOM   8364  O  O2    . DT  I 5 117 ? 5.632   -5.523  7.813  1.00 131.98 ? 44   DT  I O2    1 
ATOM   8365  N  N3    . DT  I 5 117 ? 5.670   -7.741  7.420  1.00 131.95 ? 44   DT  I N3    1 
ATOM   8366  C  C4    . DT  I 5 117 ? 5.947   -8.878  6.685  1.00 132.07 ? 44   DT  I C4    1 
ATOM   8367  O  O4    . DT  I 5 117 ? 5.661   -9.993  7.106  1.00 132.16 ? 44   DT  I O4    1 
ATOM   8368  C  C5    . DT  I 5 117 ? 6.594   -8.657  5.411  1.00 132.08 ? 44   DT  I C5    1 
ATOM   8369  C  C7    . DT  I 5 117 ? 6.951   -9.814  4.522  1.00 131.98 ? 44   DT  I C7    1 
ATOM   8370  C  C6    . DT  I 5 117 ? 6.858   -7.389  5.054  1.00 132.07 ? 44   DT  I C6    1 
ATOM   8371  P  P     . DT  I 5 118 ? 9.585   -1.763  5.581  1.00 130.63 ? 45   DT  I P     1 
ATOM   8372  O  OP1   . DT  I 5 118 ? 9.784   -0.299  5.446  1.00 129.75 ? 45   DT  I OP1   1 
ATOM   8373  O  OP2   . DT  I 5 118 ? 10.673  -2.698  5.204  1.00 129.99 ? 45   DT  I OP2   1 
ATOM   8374  O  "O5'" . DT  I 5 118 ? 9.172   -2.121  7.092  1.00 130.41 ? 45   DT  I "O5'" 1 
ATOM   8375  C  "C5'" . DT  I 5 118 ? 8.898   -1.131  8.089  1.00 128.63 ? 45   DT  I "C5'" 1 
ATOM   8376  C  "C4'" . DT  I 5 118 ? 9.054   -1.742  9.467  1.00 127.33 ? 45   DT  I "C4'" 1 
ATOM   8377  O  "O4'" . DT  I 5 118 ? 8.525   -3.085  9.447  1.00 127.61 ? 45   DT  I "O4'" 1 
ATOM   8378  C  "C3'" . DT  I 5 118 ? 10.488  -1.866  9.987  1.00 126.68 ? 45   DT  I "C3'" 1 
ATOM   8379  O  "O3'" . DT  I 5 118 ? 10.550  -1.375  11.321 1.00 125.39 ? 45   DT  I "O3'" 1 
ATOM   8380  C  "C2'" . DT  I 5 118 ? 10.795  -3.360  9.940  1.00 127.08 ? 45   DT  I "C2'" 1 
ATOM   8381  C  "C1'" . DT  I 5 118 ? 9.401   -3.936  10.156 1.00 128.24 ? 45   DT  I "C1'" 1 
ATOM   8382  N  N1    . DT  I 5 118 ? 9.155   -5.297  9.619  1.00 128.59 ? 45   DT  I N1    1 
ATOM   8383  C  C2    . DT  I 5 118 ? 7.986   -5.955  9.973  1.00 128.70 ? 45   DT  I C2    1 
ATOM   8384  O  O2    . DT  I 5 118 ? 7.136   -5.497  10.722 1.00 128.63 ? 45   DT  I O2    1 
ATOM   8385  N  N3    . DT  I 5 118 ? 7.845   -7.201  9.416  1.00 128.67 ? 45   DT  I N3    1 
ATOM   8386  C  C4    . DT  I 5 118 ? 8.725   -7.834  8.555  1.00 128.78 ? 45   DT  I C4    1 
ATOM   8387  O  O4    . DT  I 5 118 ? 8.497   -8.958  8.119  1.00 128.73 ? 45   DT  I O4    1 
ATOM   8388  C  C5    . DT  I 5 118 ? 9.925   -7.091  8.223  1.00 128.98 ? 45   DT  I C5    1 
ATOM   8389  C  C7    . DT  I 5 118 ? 10.962  -7.668  7.301  1.00 128.65 ? 45   DT  I C7    1 
ATOM   8390  C  C6    . DT  I 5 118 ? 10.077  -5.871  8.761  1.00 128.86 ? 45   DT  I C6    1 
ATOM   8391  P  P     . DG  I 5 119 ? 10.580  0.204   11.562 1.00 124.55 ? 46   DG  I P     1 
ATOM   8392  O  OP1   . DG  I 5 119 ? 9.323   0.780   11.014 1.00 124.21 ? 46   DG  I OP1   1 
ATOM   8393  O  OP2   . DG  I 5 119 ? 11.904  0.671   11.098 1.00 124.97 ? 46   DG  I OP2   1 
ATOM   8394  O  "O5'" . DG  I 5 119 ? 10.602  0.383   13.151 1.00 123.82 ? 46   DG  I "O5'" 1 
ATOM   8395  C  "C5'" . DG  I 5 119 ? 9.436   0.780   13.863 1.00 121.59 ? 46   DG  I "C5'" 1 
ATOM   8396  C  "C4'" . DG  I 5 119 ? 9.155   -0.233  14.950 1.00 119.94 ? 46   DG  I "C4'" 1 
ATOM   8397  O  "O4'" . DG  I 5 119 ? 9.193   -1.564  14.380 1.00 119.33 ? 46   DG  I "O4'" 1 
ATOM   8398  C  "C3'" . DG  I 5 119 ? 10.158  -0.210  16.113 1.00 119.51 ? 46   DG  I "C3'" 1 
ATOM   8399  O  "O3'" . DG  I 5 119 ? 9.540   -0.378  17.420 1.00 117.48 ? 46   DG  I "O3'" 1 
ATOM   8400  C  "C2'" . DG  I 5 119 ? 11.089  -1.376  15.776 1.00 119.93 ? 46   DG  I "C2'" 1 
ATOM   8401  C  "C1'" . DG  I 5 119 ? 10.071  -2.338  15.171 1.00 120.62 ? 46   DG  I "C1'" 1 
ATOM   8402  N  N9    . DG  I 5 119 ? 10.604  -3.399  14.329 1.00 120.95 ? 46   DG  I N9    1 
ATOM   8403  C  C8    . DG  I 5 119 ? 11.825  -3.483  13.701 1.00 120.94 ? 46   DG  I C8    1 
ATOM   8404  N  N7    . DG  I 5 119 ? 11.967  -4.585  13.017 1.00 121.05 ? 46   DG  I N7    1 
ATOM   8405  C  C5    . DG  I 5 119 ? 10.772  -5.274  13.210 1.00 121.22 ? 46   DG  I C5    1 
ATOM   8406  C  C6    . DG  I 5 119 ? 10.319  -6.529  12.723 1.00 120.97 ? 46   DG  I C6    1 
ATOM   8407  O  O6    . DG  I 5 119 ? 10.910  -7.331  11.995 1.00 121.00 ? 46   DG  I O6    1 
ATOM   8408  N  N1    . DG  I 5 119 ? 9.036   -6.847  13.165 1.00 120.89 ? 46   DG  I N1    1 
ATOM   8409  C  C2    . DG  I 5 119 ? 8.274   -6.045  13.976 1.00 120.85 ? 46   DG  I C2    1 
ATOM   8410  N  N2    . DG  I 5 119 ? 7.060   -6.502  14.303 1.00 121.05 ? 46   DG  I N2    1 
ATOM   8411  N  N3    . DG  I 5 119 ? 8.676   -4.870  14.435 1.00 121.12 ? 46   DG  I N3    1 
ATOM   8412  C  C4    . DG  I 5 119 ? 9.925   -4.549  14.014 1.00 121.27 ? 46   DG  I C4    1 
ATOM   8413  P  P     . DA  I 5 120 ? 8.081   0.179   17.818 1.00 116.08 ? 47   DA  I P     1 
ATOM   8414  O  OP1   . DA  I 5 120 ? 7.252   0.502   16.634 1.00 115.52 ? 47   DA  I OP1   1 
ATOM   8415  O  OP2   . DA  I 5 120 ? 8.280   1.202   18.860 1.00 116.21 ? 47   DA  I OP2   1 
ATOM   8416  O  "O5'" . DA  I 5 120 ? 7.441   -1.096  18.522 1.00 115.85 ? 47   DA  I "O5'" 1 
ATOM   8417  C  "C5'" . DA  I 5 120 ? 6.036   -1.316  18.486 1.00 114.73 ? 47   DA  I "C5'" 1 
ATOM   8418  C  "C4'" . DA  I 5 120 ? 5.718   -2.716  18.978 1.00 113.80 ? 47   DA  I "C4'" 1 
ATOM   8419  O  "O4'" . DA  I 5 120 ? 6.660   -3.684  18.443 1.00 114.42 ? 47   DA  I "O4'" 1 
ATOM   8420  C  "C3'" . DA  I 5 120 ? 5.780   -2.906  20.480 1.00 113.01 ? 47   DA  I "C3'" 1 
ATOM   8421  O  "O3'" . DA  I 5 120 ? 4.819   -3.907  20.790 1.00 111.49 ? 47   DA  I "O3'" 1 
ATOM   8422  C  "C2'" . DA  I 5 120 ? 7.217   -3.371  20.725 1.00 113.68 ? 47   DA  I "C2'" 1 
ATOM   8423  C  "C1'" . DA  I 5 120 ? 7.479   -4.210  19.476 1.00 115.21 ? 47   DA  I "C1'" 1 
ATOM   8424  N  N9    . DA  I 5 120 ? 8.853   -4.215  18.980 1.00 115.43 ? 47   DA  I N9    1 
ATOM   8425  C  C8    . DA  I 5 120 ? 9.804   -3.243  19.118 1.00 115.75 ? 47   DA  I C8    1 
ATOM   8426  N  N7    . DA  I 5 120 ? 10.946  -3.542  18.547 1.00 116.07 ? 47   DA  I N7    1 
ATOM   8427  C  C5    . DA  I 5 120 ? 10.724  -4.790  17.988 1.00 115.77 ? 47   DA  I C5    1 
ATOM   8428  C  C6    . DA  I 5 120 ? 11.540  -5.668  17.242 1.00 115.91 ? 47   DA  I C6    1 
ATOM   8429  N  N6    . DA  I 5 120 ? 12.806  -5.389  16.922 1.00 115.97 ? 47   DA  I N6    1 
ATOM   8430  N  N1    . DA  I 5 120 ? 11.015  -6.845  16.834 1.00 115.87 ? 47   DA  I N1    1 
ATOM   8431  C  C2    . DA  I 5 120 ? 9.748   -7.126  17.155 1.00 115.90 ? 47   DA  I C2    1 
ATOM   8432  N  N3    . DA  I 5 120 ? 8.888   -6.380  17.852 1.00 116.11 ? 47   DA  I N3    1 
ATOM   8433  C  C4    . DA  I 5 120 ? 9.441   -5.218  18.246 1.00 115.61 ? 47   DA  I C4    1 
ATOM   8434  P  P     . DG  I 5 121 ? 4.485   -4.322  22.290 1.00 109.47 ? 48   DG  I P     1 
ATOM   8435  O  OP1   . DG  I 5 121 ? 3.043   -4.627  22.331 1.00 108.87 ? 48   DG  I OP1   1 
ATOM   8436  O  OP2   . DG  I 5 121 ? 5.090   -3.336  23.216 1.00 109.46 ? 48   DG  I OP2   1 
ATOM   8437  O  "O5'" . DG  I 5 121 ? 5.353   -5.634  22.508 1.00 109.19 ? 48   DG  I "O5'" 1 
ATOM   8438  C  "C5'" . DG  I 5 121 ? 5.057   -6.864  21.913 1.00 109.70 ? 48   DG  I "C5'" 1 
ATOM   8439  C  "C4'" . DG  I 5 121 ? 6.300   -7.710  22.082 1.00 110.61 ? 48   DG  I "C4'" 1 
ATOM   8440  O  "O4'" . DG  I 5 121 ? 7.412   -7.073  21.409 1.00 111.30 ? 48   DG  I "O4'" 1 
ATOM   8441  C  "C3'" . DG  I 5 121 ? 6.768   -7.900  23.525 1.00 110.26 ? 48   DG  I "C3'" 1 
ATOM   8442  O  "O3'" . DG  I 5 121 ? 7.042   -9.276  23.725 1.00 108.86 ? 48   DG  I "O3'" 1 
ATOM   8443  C  "C2'" . DG  I 5 121 ? 8.057   -7.094  23.592 1.00 110.91 ? 48   DG  I "C2'" 1 
ATOM   8444  C  "C1'" . DG  I 5 121 ? 8.541   -7.376  22.183 1.00 113.81 ? 48   DG  I "C1'" 1 
ATOM   8445  N  N9    . DG  I 5 121 ? 9.704   -6.612  21.749 1.00 114.98 ? 48   DG  I N9    1 
ATOM   8446  C  C8    . DG  I 5 121 ? 9.978   -5.287  22.001 1.00 115.60 ? 48   DG  I C8    1 
ATOM   8447  N  N7    . DG  I 5 121 ? 11.105  -4.876  21.492 1.00 115.75 ? 48   DG  I N7    1 
ATOM   8448  C  C5    . DG  I 5 121 ? 11.618  -6.004  20.859 1.00 115.87 ? 48   DG  I C5    1 
ATOM   8449  C  C6    . DG  I 5 121 ? 12.824  -6.172  20.129 1.00 115.56 ? 48   DG  I C6    1 
ATOM   8450  O  O6    . DG  I 5 121 ? 13.690  -5.322  19.886 1.00 115.55 ? 48   DG  I O6    1 
ATOM   8451  N  N1    . DG  I 5 121 ? 12.976  -7.472  19.642 1.00 115.41 ? 48   DG  I N1    1 
ATOM   8452  C  C2    . DG  I 5 121 ? 12.074  -8.493  19.840 1.00 115.50 ? 48   DG  I C2    1 
ATOM   8453  N  N2    . DG  I 5 121 ? 12.394  -9.677  19.299 1.00 115.28 ? 48   DG  I N2    1 
ATOM   8454  N  N3    . DG  I 5 121 ? 10.937  -8.350  20.522 1.00 116.14 ? 48   DG  I N3    1 
ATOM   8455  C  C4    . DG  I 5 121 ? 10.768  -7.082  21.001 1.00 115.86 ? 48   DG  I C4    1 
ATOM   8456  P  P     . DC  I 5 122 ? 6.639   -10.040 25.066 1.00 106.87 ? 49   DC  I P     1 
ATOM   8457  O  OP1   . DC  I 5 122 ? 5.245   -10.503 24.923 1.00 105.73 ? 49   DC  I OP1   1 
ATOM   8458  O  OP2   . DC  I 5 122 ? 7.040   -9.200  26.216 1.00 106.94 ? 49   DC  I OP2   1 
ATOM   8459  O  "O5'" . DC  I 5 122 ? 7.619   -11.297 25.040 1.00 107.70 ? 49   DC  I "O5'" 1 
ATOM   8460  C  "C5'" . DC  I 5 122 ? 7.819   -12.033 23.840 1.00 110.37 ? 49   DC  I "C5'" 1 
ATOM   8461  C  "C4'" . DC  I 5 122 ? 9.286   -12.390 23.653 1.00 112.51 ? 49   DC  I "C4'" 1 
ATOM   8462  O  "O4'" . DC  I 5 122 ? 10.022  -11.265 23.118 1.00 113.22 ? 49   DC  I "O4'" 1 
ATOM   8463  C  "C3'" . DC  I 5 122 ? 10.030  -12.803 24.914 1.00 113.50 ? 49   DC  I "C3'" 1 
ATOM   8464  O  "O3'" . DC  I 5 122 ? 10.079  -14.226 24.945 1.00 114.48 ? 49   DC  I "O3'" 1 
ATOM   8465  C  "C2'" . DC  I 5 122 ? 11.413  -12.164 24.784 1.00 113.55 ? 49   DC  I "C2'" 1 
ATOM   8466  C  "C1'" . DC  I 5 122 ? 11.379  -11.389 23.474 1.00 114.10 ? 49   DC  I "C1'" 1 
ATOM   8467  N  N1    . DC  I 5 122 ? 11.939  -10.011 23.560 1.00 114.68 ? 49   DC  I N1    1 
ATOM   8468  C  C2    . DC  I 5 122 ? 13.294  -9.733  23.277 1.00 115.64 ? 49   DC  I C2    1 
ATOM   8469  O  O2    . DC  I 5 122 ? 14.074  -10.642 22.955 1.00 116.03 ? 49   DC  I O2    1 
ATOM   8470  N  N3    . DC  I 5 122 ? 13.732  -8.447  23.369 1.00 115.68 ? 49   DC  I N3    1 
ATOM   8471  C  C4    . DC  I 5 122 ? 12.889  -7.472  23.716 1.00 115.09 ? 49   DC  I C4    1 
ATOM   8472  N  N4    . DC  I 5 122 ? 13.347  -6.224  23.795 1.00 115.38 ? 49   DC  I N4    1 
ATOM   8473  C  C5    . DC  I 5 122 ? 11.525  -7.735  24.008 1.00 115.39 ? 49   DC  I C5    1 
ATOM   8474  C  C6    . DC  I 5 122 ? 11.099  -8.998  23.912 1.00 114.72 ? 49   DC  I C6    1 
ATOM   8475  P  P     . DG  I 5 123 ? 10.661  -15.017 26.199 1.00 114.75 ? 50   DG  I P     1 
ATOM   8476  O  OP1   . DG  I 5 123 ? 10.131  -16.394 26.126 1.00 114.50 ? 50   DG  I OP1   1 
ATOM   8477  O  OP2   . DG  I 5 123 ? 10.443  -14.221 27.428 1.00 114.48 ? 50   DG  I OP2   1 
ATOM   8478  O  "O5'" . DG  I 5 123 ? 12.220  -15.042 25.853 1.00 117.08 ? 50   DG  I "O5'" 1 
ATOM   8479  C  "C5'" . DG  I 5 123 ? 12.622  -15.756 24.683 1.00 121.53 ? 50   DG  I "C5'" 1 
ATOM   8480  C  "C4'" . DG  I 5 123 ? 14.120  -15.704 24.444 1.00 124.41 ? 50   DG  I "C4'" 1 
ATOM   8481  O  "O4'" . DG  I 5 123 ? 14.533  -14.331 24.240 1.00 125.83 ? 50   DG  I "O4'" 1 
ATOM   8482  C  "C3'" . DG  I 5 123 ? 14.996  -16.239 25.565 1.00 126.22 ? 50   DG  I "C3'" 1 
ATOM   8483  O  "O3'" . DG  I 5 123 ? 16.116  -16.863 24.966 1.00 128.12 ? 50   DG  I "O3'" 1 
ATOM   8484  C  "C2'" . DG  I 5 123 ? 15.383  -14.972 26.325 1.00 126.79 ? 50   DG  I "C2'" 1 
ATOM   8485  C  "C1'" . DG  I 5 123 ? 15.492  -13.948 25.204 1.00 127.52 ? 50   DG  I "C1'" 1 
ATOM   8486  N  N9    . DG  I 5 123 ? 15.183  -12.573 25.588 1.00 128.09 ? 50   DG  I N9    1 
ATOM   8487  C  C8    . DG  I 5 123 ? 14.131  -12.144 26.363 1.00 128.45 ? 50   DG  I C8    1 
ATOM   8488  N  N7    . DG  I 5 123 ? 14.093  -10.851 26.536 1.00 128.59 ? 50   DG  I N7    1 
ATOM   8489  C  C5    . DG  I 5 123 ? 15.191  -10.388 25.828 1.00 128.32 ? 50   DG  I C5    1 
ATOM   8490  C  C6    . DG  I 5 123 ? 15.664  -9.069  25.648 1.00 128.09 ? 50   DG  I C6    1 
ATOM   8491  O  O6    . DG  I 5 123 ? 15.190  -8.023  26.097 1.00 128.17 ? 50   DG  I O6    1 
ATOM   8492  N  N1    . DG  I 5 123 ? 16.814  -9.026  24.862 1.00 128.46 ? 50   DG  I N1    1 
ATOM   8493  C  C2    . DG  I 5 123 ? 17.433  -10.128 24.313 1.00 128.49 ? 50   DG  I C2    1 
ATOM   8494  N  N2    . DG  I 5 123 ? 18.537  -9.897  23.581 1.00 128.36 ? 50   DG  I N2    1 
ATOM   8495  N  N3    . DG  I 5 123 ? 16.992  -11.373 24.471 1.00 128.47 ? 50   DG  I N3    1 
ATOM   8496  C  C4    . DG  I 5 123 ? 15.872  -11.433 25.236 1.00 128.33 ? 50   DG  I C4    1 
ATOM   8497  P  P     . DG  I 5 124 ? 17.205  -17.712 25.775 1.00 129.34 ? 51   DG  I P     1 
ATOM   8498  O  OP1   . DG  I 5 124 ? 16.753  -19.121 25.743 1.00 129.20 ? 51   DG  I OP1   1 
ATOM   8499  O  OP2   . DG  I 5 124 ? 17.518  -17.061 27.069 1.00 129.02 ? 51   DG  I OP2   1 
ATOM   8500  O  "O5'" . DG  I 5 124 ? 18.497  -17.543 24.836 1.00 132.14 ? 51   DG  I "O5'" 1 
ATOM   8501  C  "C5'" . DG  I 5 124 ? 18.762  -16.323 24.113 1.00 134.94 ? 51   DG  I "C5'" 1 
ATOM   8502  C  "C4'" . DG  I 5 124 ? 19.992  -15.571 24.613 1.00 137.12 ? 51   DG  I "C4'" 1 
ATOM   8503  O  "O4'" . DG  I 5 124 ? 19.622  -14.198 24.936 1.00 137.78 ? 51   DG  I "O4'" 1 
ATOM   8504  C  "C3'" . DG  I 5 124 ? 20.688  -16.131 25.854 1.00 138.47 ? 51   DG  I "C3'" 1 
ATOM   8505  O  "O3'" . DG  I 5 124 ? 22.110  -16.179 25.647 1.00 140.07 ? 51   DG  I "O3'" 1 
ATOM   8506  C  "C2'" . DG  I 5 124 ? 20.270  -15.165 26.967 1.00 138.53 ? 51   DG  I "C2'" 1 
ATOM   8507  C  "C1'" . DG  I 5 124 ? 20.080  -13.843 26.231 1.00 138.35 ? 51   DG  I "C1'" 1 
ATOM   8508  N  N9    . DG  I 5 124 ? 19.111  -12.955 26.883 1.00 138.37 ? 51   DG  I N9    1 
ATOM   8509  C  C8    . DG  I 5 124 ? 17.985  -13.360 27.558 1.00 138.46 ? 51   DG  I C8    1 
ATOM   8510  N  N7    . DG  I 5 124 ? 17.279  -12.387 28.051 1.00 138.45 ? 51   DG  I N7    1 
ATOM   8511  C  C5    . DG  I 5 124 ? 17.985  -11.251 27.689 1.00 138.44 ? 51   DG  I C5    1 
ATOM   8512  C  C6    . DG  I 5 124 ? 17.693  -9.892  27.955 1.00 138.56 ? 51   DG  I C6    1 
ATOM   8513  O  O6    . DG  I 5 124 ? 16.723  -9.435  28.576 1.00 138.59 ? 51   DG  I O6    1 
ATOM   8514  N  N1    . DG  I 5 124 ? 18.648  -9.029  27.418 1.00 138.55 ? 51   DG  I N1    1 
ATOM   8515  C  C2    . DG  I 5 124 ? 19.753  -9.438  26.712 1.00 138.35 ? 51   DG  I C2    1 
ATOM   8516  N  N2    . DG  I 5 124 ? 20.558  -8.459  26.279 1.00 138.40 ? 51   DG  I N2    1 
ATOM   8517  N  N3    . DG  I 5 124 ? 20.037  -10.713 26.454 1.00 138.38 ? 51   DG  I N3    1 
ATOM   8518  C  C4    . DG  I 5 124 ? 19.117  -11.573 26.969 1.00 138.32 ? 51   DG  I C4    1 
ATOM   8519  P  P     . DC  I 5 125 ? 23.153  -16.432 26.846 1.00 141.51 ? 52   DC  I P     1 
ATOM   8520  O  OP1   . DC  I 5 125 ? 24.395  -16.956 26.239 1.00 141.87 ? 52   DC  I OP1   1 
ATOM   8521  O  OP2   . DC  I 5 125 ? 22.487  -17.202 27.923 1.00 141.31 ? 52   DC  I OP2   1 
ATOM   8522  O  "O5'" . DC  I 5 125 ? 23.448  -14.964 27.406 1.00 142.23 ? 52   DC  I "O5'" 1 
ATOM   8523  C  "C5'" . DC  I 5 125 ? 23.865  -13.928 26.517 1.00 143.40 ? 52   DC  I "C5'" 1 
ATOM   8524  C  "C4'" . DC  I 5 125 ? 24.483  -12.757 27.264 1.00 144.28 ? 52   DC  I "C4'" 1 
ATOM   8525  O  "O4'" . DC  I 5 125 ? 23.455  -11.808 27.657 1.00 144.55 ? 52   DC  I "O4'" 1 
ATOM   8526  C  "C3'" . DC  I 5 125 ? 25.267  -13.083 28.531 1.00 144.53 ? 52   DC  I "C3'" 1 
ATOM   8527  O  "O3'" . DC  I 5 125 ? 26.441  -12.272 28.497 1.00 145.02 ? 52   DC  I "O3'" 1 
ATOM   8528  C  "C2'" . DC  I 5 125 ? 24.290  -12.722 29.651 1.00 144.42 ? 52   DC  I "C2'" 1 
ATOM   8529  C  "C1'" . DC  I 5 125 ? 23.561  -11.529 29.038 1.00 144.85 ? 52   DC  I "C1'" 1 
ATOM   8530  N  N1    . DC  I 5 125 ? 22.182  -11.287 29.573 1.00 145.14 ? 52   DC  I N1    1 
ATOM   8531  C  C2    . DC  I 5 125 ? 21.696  -9.973  29.725 1.00 145.20 ? 52   DC  I C2    1 
ATOM   8532  O  O2    . DC  I 5 125 ? 22.413  -9.007  29.419 1.00 145.14 ? 52   DC  I O2    1 
ATOM   8533  N  N3    . DC  I 5 125 ? 20.436  -9.799  30.213 1.00 145.07 ? 52   DC  I N3    1 
ATOM   8534  C  C4    . DC  I 5 125 ? 19.685  -10.857 30.539 1.00 144.97 ? 52   DC  I C4    1 
ATOM   8535  N  N4    . DC  I 5 125 ? 18.460  -10.643 31.014 1.00 145.00 ? 52   DC  I N4    1 
ATOM   8536  C  C5    . DC  I 5 125 ? 20.154  -12.195 30.389 1.00 145.25 ? 52   DC  I C5    1 
ATOM   8537  C  C6    . DC  I 5 125 ? 21.393  -12.358 29.907 1.00 145.42 ? 52   DC  I C6    1 
ATOM   8538  P  P     . DC  I 5 126 ? 27.343  -11.964 29.782 1.00 145.42 ? 53   DC  I P     1 
ATOM   8539  O  OP1   . DC  I 5 126 ? 28.685  -11.570 29.293 1.00 145.79 ? 53   DC  I OP1   1 
ATOM   8540  O  OP2   . DC  I 5 126 ? 27.213  -13.080 30.748 1.00 145.57 ? 53   DC  I OP2   1 
ATOM   8541  O  "O5'" . DC  I 5 126 ? 26.616  -10.679 30.391 1.00 145.04 ? 53   DC  I "O5'" 1 
ATOM   8542  C  "C5'" . DC  I 5 126 ? 26.851  -9.381  29.854 1.00 144.09 ? 53   DC  I "C5'" 1 
ATOM   8543  C  "C4'" . DC  I 5 126 ? 26.672  -8.361  30.958 1.00 143.37 ? 53   DC  I "C4'" 1 
ATOM   8544  O  "O4'" . DC  I 5 126 ? 25.268  -8.320  31.317 1.00 143.02 ? 53   DC  I "O4'" 1 
ATOM   8545  C  "C3'" . DC  I 5 126 ? 27.453  -8.674  32.230 1.00 143.27 ? 53   DC  I "C3'" 1 
ATOM   8546  O  "O3'" . DC  I 5 126 ? 28.182  -7.504  32.619 1.00 143.94 ? 53   DC  I "O3'" 1 
ATOM   8547  C  "C2'" . DC  I 5 126 ? 26.376  -9.110  33.228 1.00 143.11 ? 53   DC  I "C2'" 1 
ATOM   8548  C  "C1'" . DC  I 5 126 ? 25.109  -8.427  32.719 1.00 142.62 ? 53   DC  I "C1'" 1 
ATOM   8549  N  N1    . DC  I 5 126 ? 23.795  -9.143  33.036 1.00 142.35 ? 53   DC  I N1    1 
ATOM   8550  C  C2    . DC  I 5 126 ? 22.615  -8.410  33.310 1.00 142.17 ? 53   DC  I C2    1 
ATOM   8551  O  O2    . DC  I 5 126 ? 22.619  -7.172  33.300 1.00 142.00 ? 53   DC  I O2    1 
ATOM   8552  N  N3    . DC  I 5 126 ? 21.466  -9.082  33.586 1.00 141.94 ? 53   DC  I N3    1 
ATOM   8553  C  C4    . DC  I 5 126 ? 21.455  -10.415 33.598 1.00 141.88 ? 53   DC  I C4    1 
ATOM   8554  N  N4    . DC  I 5 126 ? 20.299  -11.020 33.873 1.00 142.00 ? 53   DC  I N4    1 
ATOM   8555  C  C5    . DC  I 5 126 ? 22.628  -11.182 33.326 1.00 141.81 ? 53   DC  I C5    1 
ATOM   8556  C  C6    . DC  I 5 126 ? 23.757  -10.514 33.053 1.00 141.88 ? 53   DC  I C6    1 
ATOM   8557  P  P     . DT  I 5 127 ? 28.890  -7.309  34.053 1.00 144.35 ? 54   DT  I P     1 
ATOM   8558  O  OP1   . DT  I 5 127 ? 29.929  -6.266  33.899 1.00 144.43 ? 54   DT  I OP1   1 
ATOM   8559  O  OP2   . DT  I 5 127 ? 29.258  -8.631  34.615 1.00 144.18 ? 54   DT  I OP2   1 
ATOM   8560  O  "O5'" . DT  I 5 127 ? 27.705  -6.693  34.931 1.00 143.67 ? 54   DT  I "O5'" 1 
ATOM   8561  C  "C5'" . DT  I 5 127 ? 27.108  -5.443  34.572 1.00 142.79 ? 54   DT  I "C5'" 1 
ATOM   8562  C  "C4'" . DT  I 5 127 ? 26.575  -4.745  35.811 1.00 142.14 ? 54   DT  I "C4'" 1 
ATOM   8563  O  "O4'" . DT  I 5 127 ? 25.282  -5.313  36.148 1.00 141.91 ? 54   DT  I "O4'" 1 
ATOM   8564  C  "C3'" . DT  I 5 127 ? 27.463  -4.870  37.056 1.00 141.58 ? 54   DT  I "C3'" 1 
ATOM   8565  O  "O3'" . DT  I 5 127 ? 27.711  -3.550  37.614 1.00 140.63 ? 54   DT  I "O3'" 1 
ATOM   8566  C  "C2'" . DT  I 5 127 ? 26.722  -5.869  37.959 1.00 141.40 ? 54   DT  I "C2'" 1 
ATOM   8567  C  "C1'" . DT  I 5 127 ? 25.270  -5.776  37.489 1.00 141.13 ? 54   DT  I "C1'" 1 
ATOM   8568  N  N1    . DT  I 5 127 ? 24.508  -7.068  37.505 1.00 140.86 ? 54   DT  I N1    1 
ATOM   8569  C  C2    . DT  I 5 127 ? 23.186  -7.078  37.923 1.00 140.52 ? 54   DT  I C2    1 
ATOM   8570  O  O2    . DT  I 5 127 ? 22.578  -6.090  38.304 1.00 140.19 ? 54   DT  I O2    1 
ATOM   8571  N  N3    . DT  I 5 127 ? 22.592  -8.319  37.881 1.00 140.64 ? 54   DT  I N3    1 
ATOM   8572  C  C4    . DT  I 5 127 ? 23.166  -9.519  37.470 1.00 140.77 ? 54   DT  I C4    1 
ATOM   8573  O  O4    . DT  I 5 127 ? 22.536  -10.574 37.474 1.00 140.58 ? 54   DT  I O4    1 
ATOM   8574  C  C5    . DT  I 5 127 ? 24.548  -9.435  37.045 1.00 140.47 ? 54   DT  I C5    1 
ATOM   8575  C  C7    . DT  I 5 127 ? 25.293  -10.652 36.577 1.00 140.20 ? 54   DT  I C7    1 
ATOM   8576  C  C6    . DT  I 5 127 ? 25.138  -8.230  37.080 1.00 140.71 ? 54   DT  I C6    1 
ATOM   8577  P  P     . DC  I 5 128 ? 27.534  -3.140  39.159 1.00 139.93 ? 55   DC  I P     1 
ATOM   8578  O  OP1   . DC  I 5 128 ? 28.136  -1.798  39.350 1.00 140.17 ? 55   DC  I OP1   1 
ATOM   8579  O  OP2   . DC  I 5 128 ? 28.041  -4.251  39.999 1.00 139.85 ? 55   DC  I OP2   1 
ATOM   8580  O  "O5'" . DC  I 5 128 ? 25.937  -3.030  39.295 1.00 138.46 ? 55   DC  I "O5'" 1 
ATOM   8581  C  "C5'" . DC  I 5 128 ? 25.286  -1.807  39.642 1.00 136.40 ? 55   DC  I "C5'" 1 
ATOM   8582  C  "C4'" . DC  I 5 128 ? 24.418  -2.003  40.875 1.00 135.27 ? 55   DC  I "C4'" 1 
ATOM   8583  O  "O4'" . DC  I 5 128 ? 23.951  -3.375  40.944 1.00 135.25 ? 55   DC  I "O4'" 1 
ATOM   8584  C  "C3'" . DC  I 5 128 ? 25.081  -1.752  42.224 1.00 134.65 ? 55   DC  I "C3'" 1 
ATOM   8585  O  "O3'" . DC  I 5 128 ? 24.086  -1.343  43.154 1.00 134.15 ? 55   DC  I "O3'" 1 
ATOM   8586  C  "C2'" . DC  I 5 128 ? 25.591  -3.138  42.608 1.00 134.57 ? 55   DC  I "C2'" 1 
ATOM   8587  C  "C1'" . DC  I 5 128 ? 24.425  -4.001  42.125 1.00 134.72 ? 55   DC  I "C1'" 1 
ATOM   8588  N  N1    . DC  I 5 128 ? 24.733  -5.432  41.783 1.00 134.60 ? 55   DC  I N1    1 
ATOM   8589  C  C2    . DC  I 5 128 ? 23.677  -6.322  41.519 1.00 134.50 ? 55   DC  I C2    1 
ATOM   8590  O  O2    . DC  I 5 128 ? 22.506  -5.932  41.573 1.00 134.65 ? 55   DC  I O2    1 
ATOM   8591  N  N3    . DC  I 5 128 ? 23.963  -7.608  41.205 1.00 134.41 ? 55   DC  I N3    1 
ATOM   8592  C  C4    . DC  I 5 128 ? 25.232  -8.016  41.147 1.00 134.62 ? 55   DC  I C4    1 
ATOM   8593  N  N4    . DC  I 5 128 ? 25.456  -9.295  40.834 1.00 134.72 ? 55   DC  I N4    1 
ATOM   8594  C  C5    . DC  I 5 128 ? 26.325  -7.135  41.407 1.00 134.31 ? 55   DC  I C5    1 
ATOM   8595  C  C6    . DC  I 5 128 ? 26.029  -5.868  41.717 1.00 134.33 ? 55   DC  I C6    1 
ATOM   8596  P  P     . DG  I 5 129 ? 23.695  0.185   43.429 1.00 133.45 ? 56   DG  I P     1 
ATOM   8597  O  OP1   . DG  I 5 129 ? 24.375  1.020   42.412 1.00 133.95 ? 56   DG  I OP1   1 
ATOM   8598  O  OP2   . DG  I 5 129 ? 23.923  0.418   44.873 1.00 132.59 ? 56   DG  I OP2   1 
ATOM   8599  O  "O5'" . DG  I 5 129 ? 22.111  0.280   43.158 1.00 132.74 ? 56   DG  I "O5'" 1 
ATOM   8600  C  "C5'" . DG  I 5 129 ? 21.315  -0.815  42.666 1.00 131.21 ? 56   DG  I "C5'" 1 
ATOM   8601  C  "C4'" . DG  I 5 129 ? 20.285  -1.323  43.678 1.00 130.07 ? 56   DG  I "C4'" 1 
ATOM   8602  O  "O4'" . DG  I 5 129 ? 20.676  -2.640  44.142 1.00 130.41 ? 56   DG  I "O4'" 1 
ATOM   8603  C  "C3'" . DG  I 5 129 ? 20.064  -0.553  44.978 1.00 128.86 ? 56   DG  I "C3'" 1 
ATOM   8604  O  "O3'" . DG  I 5 129 ? 18.799  -0.920  45.494 1.00 126.32 ? 56   DG  I "O3'" 1 
ATOM   8605  C  "C2'" . DG  I 5 129 ? 21.162  -1.103  45.882 1.00 129.21 ? 56   DG  I "C2'" 1 
ATOM   8606  C  "C1'" . DG  I 5 129 ? 21.074  -2.579  45.505 1.00 130.38 ? 56   DG  I "C1'" 1 
ATOM   8607  N  N9    . DG  I 5 129 ? 22.310  -3.346  45.615 1.00 130.41 ? 56   DG  I N9    1 
ATOM   8608  C  C8    . DG  I 5 129 ? 23.588  -2.906  45.866 1.00 130.55 ? 56   DG  I C8    1 
ATOM   8609  N  N7    . DG  I 5 129 ? 24.474  -3.862  45.885 1.00 130.37 ? 56   DG  I N7    1 
ATOM   8610  C  C5    . DG  I 5 129 ? 23.734  -5.005  45.630 1.00 130.53 ? 56   DG  I C5    1 
ATOM   8611  C  C6    . DG  I 5 129 ? 24.144  -6.359  45.530 1.00 130.84 ? 56   DG  I C6    1 
ATOM   8612  O  O6    . DG  I 5 129 ? 25.290  -6.820  45.656 1.00 130.67 ? 56   DG  I O6    1 
ATOM   8613  N  N1    . DG  I 5 129 ? 23.065  -7.212  45.260 1.00 130.80 ? 56   DG  I N1    1 
ATOM   8614  C  C2    . DG  I 5 129 ? 21.755  -6.799  45.106 1.00 130.62 ? 56   DG  I C2    1 
ATOM   8615  N  N2    . DG  I 5 129 ? 20.848  -7.749  44.856 1.00 130.45 ? 56   DG  I N2    1 
ATOM   8616  N  N3    . DG  I 5 129 ? 21.361  -5.535  45.196 1.00 130.44 ? 56   DG  I N3    1 
ATOM   8617  C  C4    . DG  I 5 129 ? 22.400  -4.702  45.459 1.00 130.40 ? 56   DG  I C4    1 
ATOM   8618  P  P     . DG  I 5 130 ? 18.036  0.006   46.549 1.00 124.95 ? 57   DG  I P     1 
ATOM   8619  O  OP1   . DG  I 5 130 ? 17.698  1.240   45.805 1.00 125.11 ? 57   DG  I OP1   1 
ATOM   8620  O  OP2   . DG  I 5 130 ? 18.796  0.053   47.823 1.00 123.83 ? 57   DG  I OP2   1 
ATOM   8621  O  "O5'" . DG  I 5 130 ? 16.684  -0.792  46.858 1.00 123.52 ? 57   DG  I "O5'" 1 
ATOM   8622  C  "C5'" . DG  I 5 130 ? 15.960  -1.484  45.832 1.00 121.34 ? 57   DG  I "C5'" 1 
ATOM   8623  C  "C4'" . DG  I 5 130 ? 15.559  -2.897  46.251 1.00 119.36 ? 57   DG  I "C4'" 1 
ATOM   8624  O  "O4'" . DG  I 5 130 ? 16.724  -3.760  46.304 1.00 119.18 ? 57   DG  I "O4'" 1 
ATOM   8625  C  "C3'" . DG  I 5 130 ? 14.864  -3.041  47.606 1.00 117.73 ? 57   DG  I "C3'" 1 
ATOM   8626  O  "O3'" . DG  I 5 130 ? 13.830  -4.011  47.500 1.00 115.00 ? 57   DG  I "O3'" 1 
ATOM   8627  C  "C2'" . DG  I 5 130 ? 15.978  -3.493  48.539 1.00 118.34 ? 57   DG  I "C2'" 1 
ATOM   8628  C  "C1'" . DG  I 5 130 ? 16.852  -4.314  47.597 1.00 119.92 ? 57   DG  I "C1'" 1 
ATOM   8629  N  N9    . DG  I 5 130 ? 18.262  -4.304  47.972 1.00 120.33 ? 57   DG  I N9    1 
ATOM   8630  C  C8    . DG  I 5 130 ? 19.027  -3.212  48.311 1.00 120.25 ? 57   DG  I C8    1 
ATOM   8631  N  N7    . DG  I 5 130 ? 20.257  -3.518  48.604 1.00 120.21 ? 57   DG  I N7    1 
ATOM   8632  C  C5    . DG  I 5 130 ? 20.313  -4.896  48.449 1.00 120.26 ? 57   DG  I C5    1 
ATOM   8633  C  C6    . DG  I 5 130 ? 21.394  -5.793  48.632 1.00 120.41 ? 57   DG  I C6    1 
ATOM   8634  O  O6    . DG  I 5 130 ? 22.553  -5.522  48.974 1.00 120.68 ? 57   DG  I O6    1 
ATOM   8635  N  N1    . DG  I 5 130 ? 21.035  -7.119  48.375 1.00 120.27 ? 57   DG  I N1    1 
ATOM   8636  C  C2    . DG  I 5 130 ? 19.777  -7.526  47.988 1.00 120.31 ? 57   DG  I C2    1 
ATOM   8637  N  N2    . DG  I 5 130 ? 19.612  -8.843  47.786 1.00 120.31 ? 57   DG  I N2    1 
ATOM   8638  N  N3    . DG  I 5 130 ? 18.752  -6.695  47.813 1.00 120.46 ? 57   DG  I N3    1 
ATOM   8639  C  C4    . DG  I 5 130 ? 19.091  -5.400  48.062 1.00 120.42 ? 57   DG  I C4    1 
ATOM   8640  P  P     . DC  I 5 131 ? 12.764  -4.269  48.663 1.00 112.73 ? 58   DC  I P     1 
ATOM   8641  O  OP1   . DC  I 5 131 ? 11.512  -4.675  47.993 1.00 112.76 ? 58   DC  I OP1   1 
ATOM   8642  O  OP2   . DC  I 5 131 ? 12.754  -3.185  49.661 1.00 112.62 ? 58   DC  I OP2   1 
ATOM   8643  O  "O5'" . DC  I 5 131 ? 13.404  -5.515  49.407 1.00 113.17 ? 58   DC  I "O5'" 1 
ATOM   8644  C  "C5'" . DC  I 5 131 ? 13.651  -6.727  48.704 1.00 113.56 ? 58   DC  I "C5'" 1 
ATOM   8645  C  "C4'" . DC  I 5 131 ? 14.552  -7.607  49.539 1.00 113.66 ? 58   DC  I "C4'" 1 
ATOM   8646  O  "O4'" . DC  I 5 131 ? 15.865  -7.002  49.657 1.00 113.60 ? 58   DC  I "O4'" 1 
ATOM   8647  C  "C3'" . DC  I 5 131 ? 14.077  -7.845  50.970 1.00 114.33 ? 58   DC  I "C3'" 1 
ATOM   8648  O  "O3'" . DC  I 5 131 ? 14.163  -9.239  51.212 1.00 115.98 ? 58   DC  I "O3'" 1 
ATOM   8649  C  "C2'" . DC  I 5 131 ? 15.079  -7.043  51.812 1.00 113.69 ? 58   DC  I "C2'" 1 
ATOM   8650  C  "C1'" . DC  I 5 131 ? 16.322  -7.268  50.963 1.00 113.65 ? 58   DC  I "C1'" 1 
ATOM   8651  N  N1    . DC  I 5 131 ? 17.546  -6.450  51.244 1.00 113.81 ? 58   DC  I N1    1 
ATOM   8652  C  C2    . DC  I 5 131 ? 18.787  -7.117  51.356 1.00 114.30 ? 58   DC  I C2    1 
ATOM   8653  O  O2    . DC  I 5 131 ? 18.850  -8.353  51.237 1.00 114.16 ? 58   DC  I O2    1 
ATOM   8654  N  N3    . DC  I 5 131 ? 19.907  -6.384  51.604 1.00 114.21 ? 58   DC  I N3    1 
ATOM   8655  C  C4    . DC  I 5 131 ? 19.819  -5.056  51.734 1.00 114.24 ? 58   DC  I C4    1 
ATOM   8656  N  N4    . DC  I 5 131 ? 20.958  -4.400  51.976 1.00 114.12 ? 58   DC  I N4    1 
ATOM   8657  C  C5    . DC  I 5 131 ? 18.570  -4.355  51.620 1.00 113.82 ? 58   DC  I C5    1 
ATOM   8658  C  C6    . DC  I 5 131 ? 17.472  -5.086  51.376 1.00 113.38 ? 58   DC  I C6    1 
ATOM   8659  P  P     . DA  I 5 132 ? 12.882  -10.130 51.593 1.00 115.79 ? 59   DA  I P     1 
ATOM   8660  O  OP1   . DA  I 5 132 ? 12.063  -10.307 50.366 1.00 116.03 ? 59   DA  I OP1   1 
ATOM   8661  O  OP2   . DA  I 5 132 ? 12.295  -9.577  52.838 1.00 115.86 ? 59   DA  I OP2   1 
ATOM   8662  O  "O5'" . DA  I 5 132 ? 13.548  -11.539 51.935 1.00 118.25 ? 59   DA  I "O5'" 1 
ATOM   8663  C  "C5'" . DA  I 5 132 ? 14.431  -12.160 51.000 1.00 121.53 ? 59   DA  I "C5'" 1 
ATOM   8664  C  "C4'" . DA  I 5 132 ? 15.644  -12.754 51.704 1.00 124.49 ? 59   DA  I "C4'" 1 
ATOM   8665  O  "O4'" . DA  I 5 132 ? 16.627  -11.722 51.983 1.00 125.05 ? 59   DA  I "O4'" 1 
ATOM   8666  C  "C3'" . DA  I 5 132 ? 15.387  -13.454 53.043 1.00 126.37 ? 59   DA  I "C3'" 1 
ATOM   8667  O  "O3'" . DA  I 5 132 ? 16.201  -14.637 53.087 1.00 128.90 ? 59   DA  I "O3'" 1 
ATOM   8668  C  "C2'" . DA  I 5 132 ? 15.804  -12.397 54.070 1.00 125.98 ? 59   DA  I "C2'" 1 
ATOM   8669  C  "C1'" . DA  I 5 132 ? 17.002  -11.787 53.349 1.00 126.14 ? 59   DA  I "C1'" 1 
ATOM   8670  N  N9    . DA  I 5 132 ? 17.397  -10.442 53.768 1.00 126.46 ? 59   DA  I N9    1 
ATOM   8671  C  C8    . DA  I 5 132 ? 16.603  -9.332  53.867 1.00 126.48 ? 59   DA  I C8    1 
ATOM   8672  N  N7    . DA  I 5 132 ? 17.237  -8.250  54.253 1.00 126.21 ? 59   DA  I N7    1 
ATOM   8673  C  C5    . DA  I 5 132 ? 18.537  -8.683  54.413 1.00 126.16 ? 59   DA  I C5    1 
ATOM   8674  C  C6    . DA  I 5 132 ? 19.708  -8.017  54.811 1.00 126.17 ? 59   DA  I C6    1 
ATOM   8675  N  N6    . DA  I 5 132 ? 19.728  -6.722  55.124 1.00 126.38 ? 59   DA  I N6    1 
ATOM   8676  N  N1    . DA  I 5 132 ? 20.852  -8.732  54.871 1.00 126.39 ? 59   DA  I N1    1 
ATOM   8677  C  C2    . DA  I 5 132 ? 20.823  -10.035 54.559 1.00 126.43 ? 59   DA  I C2    1 
ATOM   8678  N  N3    . DA  I 5 132 ? 19.780  -10.773 54.170 1.00 126.51 ? 59   DA  I N3    1 
ATOM   8679  C  C4    . DA  I 5 132 ? 18.660  -10.028 54.113 1.00 126.39 ? 59   DA  I C4    1 
ATOM   8680  P  P     . DC  I 5 133 ? 16.051  -15.806 54.175 1.00 130.30 ? 60   DC  I P     1 
ATOM   8681  O  OP1   . DC  I 5 133 ? 16.213  -17.070 53.427 1.00 130.40 ? 60   DC  I OP1   1 
ATOM   8682  O  OP2   . DC  I 5 133 ? 14.828  -15.579 54.986 1.00 129.79 ? 60   DC  I OP2   1 
ATOM   8683  O  "O5'" . DC  I 5 133 ? 17.334  -15.604 55.115 1.00 132.17 ? 60   DC  I "O5'" 1 
ATOM   8684  C  "C5'" . DC  I 5 133 ? 18.663  -15.563 54.568 1.00 136.10 ? 60   DC  I "C5'" 1 
ATOM   8685  C  "C4'" . DC  I 5 133 ? 19.716  -15.257 55.633 1.00 139.33 ? 60   DC  I "C4'" 1 
ATOM   8686  O  "O4'" . DC  I 5 133 ? 19.887  -13.814 55.756 1.00 139.82 ? 60   DC  I "O4'" 1 
ATOM   8687  C  "C3'" . DC  I 5 133 ? 19.429  -15.786 57.048 1.00 141.22 ? 60   DC  I "C3'" 1 
ATOM   8688  O  "O3'" . DC  I 5 133 ? 20.574  -16.499 57.602 1.00 143.56 ? 60   DC  I "O3'" 1 
ATOM   8689  C  "C2'" . DC  I 5 133 ? 19.048  -14.519 57.818 1.00 140.82 ? 60   DC  I "C2'" 1 
ATOM   8690  C  "C1'" . DC  I 5 133 ? 19.923  -13.478 57.130 1.00 140.08 ? 60   DC  I "C1'" 1 
ATOM   8691  N  N1    . DC  I 5 133 ? 19.468  -12.064 57.346 1.00 139.96 ? 60   DC  I N1    1 
ATOM   8692  C  C2    . DC  I 5 133 ? 20.363  -11.112 57.866 1.00 139.86 ? 60   DC  I C2    1 
ATOM   8693  O  O2    . DC  I 5 133 ? 21.528  -11.431 58.139 1.00 139.60 ? 60   DC  I O2    1 
ATOM   8694  N  N3    . DC  I 5 133 ? 19.924  -9.840  58.055 1.00 139.91 ? 60   DC  I N3    1 
ATOM   8695  C  C4    . DC  I 5 133 ? 18.664  -9.510  57.755 1.00 139.80 ? 60   DC  I C4    1 
ATOM   8696  N  N4    . DC  I 5 133 ? 18.290  -8.246  57.960 1.00 139.68 ? 60   DC  I N4    1 
ATOM   8697  C  C5    . DC  I 5 133 ? 17.734  -10.460 57.233 1.00 139.71 ? 60   DC  I C5    1 
ATOM   8698  C  C6    . DC  I 5 133 ? 18.177  -11.711 57.045 1.00 139.89 ? 60   DC  I C6    1 
ATOM   8699  P  P     . DC  I 5 134 ? 20.749  -16.855 59.167 1.00 145.26 ? 61   DC  I P     1 
ATOM   8700  O  OP1   . DC  I 5 134 ? 21.736  -17.949 59.286 1.00 145.03 ? 61   DC  I OP1   1 
ATOM   8701  O  OP2   . DC  I 5 134 ? 19.416  -17.000 59.807 1.00 145.00 ? 61   DC  I OP2   1 
ATOM   8702  O  "O5'" . DC  I 5 134 ? 21.440  -15.525 59.712 1.00 146.88 ? 61   DC  I "O5'" 1 
ATOM   8703  C  "C5'" . DC  I 5 134 ? 22.706  -15.139 59.189 1.00 149.46 ? 61   DC  I "C5'" 1 
ATOM   8704  C  "C4'" . DC  I 5 134 ? 23.609  -14.644 60.301 1.00 151.56 ? 61   DC  I "C4'" 1 
ATOM   8705  O  "O4'" . DC  I 5 134 ? 23.347  -13.239 60.539 1.00 151.94 ? 61   DC  I "O4'" 1 
ATOM   8706  C  "C3'" . DC  I 5 134 ? 23.452  -15.332 61.651 1.00 153.08 ? 61   DC  I "C3'" 1 
ATOM   8707  O  "O3'" . DC  I 5 134 ? 24.751  -15.439 62.241 1.00 155.25 ? 61   DC  I "O3'" 1 
ATOM   8708  C  "C2'" . DC  I 5 134 ? 22.492  -14.413 62.413 1.00 152.96 ? 61   DC  I "C2'" 1 
ATOM   8709  C  "C1'" . DC  I 5 134 ? 22.804  -13.037 61.829 1.00 152.65 ? 61   DC  I "C1'" 1 
ATOM   8710  N  N1    . DC  I 5 134 ? 21.633  -12.112 61.667 1.00 152.92 ? 61   DC  I N1    1 
ATOM   8711  C  C2    . DC  I 5 134 ? 21.849  -10.722 61.687 1.00 152.99 ? 61   DC  I C2    1 
ATOM   8712  O  O2    . DC  I 5 134 ? 22.997  -10.279 61.846 1.00 153.03 ? 61   DC  I O2    1 
ATOM   8713  N  N3    . DC  I 5 134 ? 20.781  -9.893  61.533 1.00 152.84 ? 61   DC  I N3    1 
ATOM   8714  C  C4    . DC  I 5 134 ? 19.555  -10.396 61.362 1.00 152.77 ? 61   DC  I C4    1 
ATOM   8715  N  N4    . DC  I 5 134 ? 18.543  -9.536  61.215 1.00 152.72 ? 61   DC  I N4    1 
ATOM   8716  C  C5    . DC  I 5 134 ? 19.313  -11.804 61.335 1.00 152.88 ? 61   DC  I C5    1 
ATOM   8717  C  C6    . DC  I 5 134 ? 20.369  -12.614 61.485 1.00 153.02 ? 61   DC  I C6    1 
ATOM   8718  P  P     . DG  I 5 135 ? 24.993  -15.835 63.774 1.00 157.11 ? 62   DG  I P     1 
ATOM   8719  O  OP1   . DG  I 5 135 ? 26.415  -16.228 63.902 1.00 157.51 ? 62   DG  I OP1   1 
ATOM   8720  O  OP2   . DG  I 5 135 ? 23.941  -16.796 64.188 1.00 157.27 ? 62   DG  I OP2   1 
ATOM   8721  O  "O5'" . DG  I 5 135 ? 24.772  -14.442 64.538 1.00 157.86 ? 62   DG  I "O5'" 1 
ATOM   8722  C  "C5'" . DG  I 5 135 ? 25.657  -13.343 64.298 1.00 159.37 ? 62   DG  I "C5'" 1 
ATOM   8723  C  "C4'" . DG  I 5 135 ? 25.271  -12.128 65.123 1.00 160.65 ? 62   DG  I "C4'" 1 
ATOM   8724  O  "O4'" . DG  I 5 135 ? 24.015  -11.598 64.632 1.00 161.15 ? 62   DG  I "O4'" 1 
ATOM   8725  C  "C3'" . DG  I 5 135 ? 25.074  -12.387 66.617 1.00 161.13 ? 62   DG  I "C3'" 1 
ATOM   8726  O  "O3'" . DG  I 5 135 ? 25.731  -11.386 67.386 1.00 161.34 ? 62   DG  I "O3'" 1 
ATOM   8727  C  "C2'" . DG  I 5 135 ? 23.563  -12.315 66.809 1.00 161.39 ? 62   DG  I "C2'" 1 
ATOM   8728  C  "C1'" . DG  I 5 135 ? 23.204  -11.291 65.743 1.00 161.83 ? 62   DG  I "C1'" 1 
ATOM   8729  N  N9    . DG  I 5 135 ? 21.803  -11.320 65.340 1.00 162.08 ? 62   DG  I N9    1 
ATOM   8730  C  C8    . DG  I 5 135 ? 21.035  -12.409 64.996 1.00 162.15 ? 62   DG  I C8    1 
ATOM   8731  N  N7    . DG  I 5 135 ? 19.806  -12.097 64.686 1.00 162.13 ? 62   DG  I N7    1 
ATOM   8732  C  C5    . DG  I 5 135 ? 19.759  -10.715 64.835 1.00 162.13 ? 62   DG  I C5    1 
ATOM   8733  C  C6    . DG  I 5 135 ? 18.693  -9.800  64.643 1.00 162.12 ? 62   DG  I C6    1 
ATOM   8734  O  O6    . DG  I 5 135 ? 17.536  -10.047 64.287 1.00 162.33 ? 62   DG  I O6    1 
ATOM   8735  N  N1    . DG  I 5 135 ? 19.065  -8.480  64.900 1.00 161.97 ? 62   DG  I N1    1 
ATOM   8736  C  C2    . DG  I 5 135 ? 20.325  -8.101  65.297 1.00 162.12 ? 62   DG  I C2    1 
ATOM   8737  N  N2    . DG  I 5 135 ? 20.520  -6.798  65.508 1.00 162.11 ? 62   DG  I N2    1 
ATOM   8738  N  N3    . DG  I 5 135 ? 21.333  -8.943  65.489 1.00 162.23 ? 62   DG  I N3    1 
ATOM   8739  C  C4    . DG  I 5 135 ? 20.981  -10.228 65.237 1.00 162.13 ? 62   DG  I C4    1 
ATOM   8740  P  P     . DG  I 5 136 ? 26.312  -11.718 68.843 1.00 161.60 ? 63   DG  I P     1 
ATOM   8741  O  OP1   . DG  I 5 136 ? 27.785  -11.751 68.719 1.00 161.58 ? 63   DG  I OP1   1 
ATOM   8742  O  OP2   . DG  I 5 136 ? 25.595  -12.889 69.401 1.00 161.57 ? 63   DG  I OP2   1 
ATOM   8743  O  "O5'" . DG  I 5 136 ? 25.891  -10.437 69.709 1.00 161.76 ? 63   DG  I "O5'" 1 
ATOM   8744  C  "C5'" . DG  I 5 136 ? 26.293  -9.126  69.312 1.00 161.61 ? 63   DG  I "C5'" 1 
ATOM   8745  C  "C4'" . DG  I 5 136 ? 25.151  -8.130  69.426 1.00 161.44 ? 63   DG  I "C4'" 1 
ATOM   8746  O  "O4'" . DG  I 5 136 ? 23.984  -8.574  68.682 1.00 161.16 ? 63   DG  I "O4'" 1 
ATOM   8747  C  "C3'" . DG  I 5 136 ? 24.665  -7.867  70.850 1.00 161.47 ? 63   DG  I "C3'" 1 
ATOM   8748  O  "O3'" . DG  I 5 136 ? 25.062  -6.553  71.237 1.00 161.97 ? 63   DG  I "O3'" 1 
ATOM   8749  C  "C2'" . DG  I 5 136 ? 23.143  -7.997  70.759 1.00 161.23 ? 63   DG  I "C2'" 1 
ATOM   8750  C  "C1'" . DG  I 5 136 ? 22.881  -7.912  69.260 1.00 160.59 ? 63   DG  I "C1'" 1 
ATOM   8751  N  N9    . DG  I 5 136 ? 21.628  -8.553  68.864 1.00 160.46 ? 63   DG  I N9    1 
ATOM   8752  C  C8    . DG  I 5 136 ? 21.403  -9.902  68.719 1.00 160.35 ? 63   DG  I C8    1 
ATOM   8753  N  N7    . DG  I 5 136 ? 20.181  -10.191 68.367 1.00 160.37 ? 63   DG  I N7    1 
ATOM   8754  C  C5    . DG  I 5 136 ? 19.550  -8.959  68.276 1.00 160.34 ? 63   DG  I C5    1 
ATOM   8755  C  C6    . DG  I 5 136 ? 18.214  -8.644  67.928 1.00 160.27 ? 63   DG  I C6    1 
ATOM   8756  O  O6    . DG  I 5 136 ? 17.305  -9.425  67.628 1.00 160.30 ? 63   DG  I O6    1 
ATOM   8757  N  N1    . DG  I 5 136 ? 17.967  -7.272  67.948 1.00 160.20 ? 63   DG  I N1    1 
ATOM   8758  C  C2    . DG  I 5 136 ? 18.906  -6.320  68.267 1.00 160.23 ? 63   DG  I C2    1 
ATOM   8759  N  N2    . DG  I 5 136 ? 18.488  -5.047  68.234 1.00 160.28 ? 63   DG  I N2    1 
ATOM   8760  N  N3    . DG  I 5 136 ? 20.165  -6.599  68.596 1.00 160.19 ? 63   DG  I N3    1 
ATOM   8761  C  C4    . DG  I 5 136 ? 20.424  -7.936  68.582 1.00 160.39 ? 63   DG  I C4    1 
ATOM   8762  P  P     . DG  I 5 137 ? 24.899  -6.000  72.736 1.00 162.30 ? 64   DG  I P     1 
ATOM   8763  O  OP1   . DG  I 5 137 ? 25.986  -5.018  72.949 1.00 162.24 ? 64   DG  I OP1   1 
ATOM   8764  O  OP2   . DG  I 5 137 ? 24.760  -7.152  73.662 1.00 161.93 ? 64   DG  I OP2   1 
ATOM   8765  O  "O5'" . DG  I 5 137 ? 23.496  -5.221  72.694 1.00 161.65 ? 64   DG  I "O5'" 1 
ATOM   8766  C  "C5'" . DG  I 5 137 ? 23.303  -4.025  71.924 1.00 160.80 ? 64   DG  I "C5'" 1 
ATOM   8767  C  "C4'" . DG  I 5 137 ? 21.852  -3.570  71.998 1.00 160.32 ? 64   DG  I "C4'" 1 
ATOM   8768  O  "O4'" . DG  I 5 137 ? 21.004  -4.562  71.358 1.00 160.63 ? 64   DG  I "O4'" 1 
ATOM   8769  C  "C3'" . DG  I 5 137 ? 21.296  -3.407  73.413 1.00 159.99 ? 64   DG  I "C3'" 1 
ATOM   8770  O  "O3'" . DG  I 5 137 ? 20.483  -2.225  73.538 1.00 159.21 ? 64   DG  I "O3'" 1 
ATOM   8771  C  "C2'" . DG  I 5 137 ? 20.481  -4.685  73.618 1.00 160.25 ? 64   DG  I "C2'" 1 
ATOM   8772  C  "C1'" . DG  I 5 137 ? 19.908  -4.839  72.215 1.00 160.48 ? 64   DG  I "C1'" 1 
ATOM   8773  N  N9    . DG  I 5 137 ? 19.309  -6.146  71.926 1.00 160.30 ? 64   DG  I N9    1 
ATOM   8774  C  C8    . DG  I 5 137 ? 19.863  -7.390  72.117 1.00 160.26 ? 64   DG  I C8    1 
ATOM   8775  N  N7    . DG  I 5 137 ? 19.079  -8.372  71.765 1.00 160.27 ? 64   DG  I N7    1 
ATOM   8776  C  C5    . DG  I 5 137 ? 17.926  -7.744  71.312 1.00 160.36 ? 64   DG  I C5    1 
ATOM   8777  C  C6    . DG  I 5 137 ? 16.714  -8.291  70.802 1.00 160.50 ? 64   DG  I C6    1 
ATOM   8778  O  O6    . DG  I 5 137 ? 16.413  -9.482  70.640 1.00 160.41 ? 64   DG  I O6    1 
ATOM   8779  N  N1    . DG  I 5 137 ? 15.792  -7.304  70.451 1.00 160.32 ? 64   DG  I N1    1 
ATOM   8780  C  C2    . DG  I 5 137 ? 16.014  -5.952  70.581 1.00 160.36 ? 64   DG  I C2    1 
ATOM   8781  N  N2    . DG  I 5 137 ? 15.012  -5.151  70.197 1.00 160.27 ? 64   DG  I N2    1 
ATOM   8782  N  N3    . DG  I 5 137 ? 17.140  -5.427  71.062 1.00 160.35 ? 64   DG  I N3    1 
ATOM   8783  C  C4    . DG  I 5 137 ? 18.052  -6.374  71.408 1.00 160.23 ? 64   DG  I C4    1 
ATOM   8784  P  P     . DA  I 5 138 ? 20.019  -1.770  75.008 1.00 158.75 ? 65   DA  I P     1 
ATOM   8785  O  OP1   . DA  I 5 138 ? 21.254  -1.668  75.820 1.00 158.83 ? 65   DA  I OP1   1 
ATOM   8786  O  OP2   . DA  I 5 138 ? 18.948  -2.688  75.447 1.00 158.58 ? 65   DA  I OP2   1 
ATOM   8787  O  "O5'" . DA  I 5 138 ? 19.383  -0.302  74.875 1.00 157.64 ? 65   DA  I "O5'" 1 
ATOM   8788  C  "C5'" . DA  I 5 138 ? 18.617  0.129   73.752 1.00 155.97 ? 65   DA  I "C5'" 1 
ATOM   8789  C  "C4'" . DA  I 5 138 ? 17.137  -0.218  73.848 1.00 154.60 ? 65   DA  I "C4'" 1 
ATOM   8790  O  "O4'" . DA  I 5 138 ? 16.977  -1.601  73.435 1.00 154.27 ? 65   DA  I "O4'" 1 
ATOM   8791  C  "C3'" . DA  I 5 138 ? 16.443  -0.100  75.215 1.00 153.91 ? 65   DA  I "C3'" 1 
ATOM   8792  O  "O3'" . DA  I 5 138 ? 15.316  0.817   75.151 1.00 153.44 ? 65   DA  I "O3'" 1 
ATOM   8793  C  "C2'" . DA  I 5 138 ? 16.050  -1.544  75.524 1.00 153.74 ? 65   DA  I "C2'" 1 
ATOM   8794  C  "C1'" . DA  I 5 138 ? 15.845  -2.078  74.115 1.00 153.22 ? 65   DA  I "C1'" 1 
ATOM   8795  N  N9    . DA  I 5 138 ? 15.739  -3.529  74.017 1.00 152.78 ? 65   DA  I N9    1 
ATOM   8796  C  C8    . DA  I 5 138 ? 16.705  -4.455  74.281 1.00 152.63 ? 65   DA  I C8    1 
ATOM   8797  N  N7    . DA  I 5 138 ? 16.308  -5.691  74.108 1.00 152.68 ? 65   DA  I N7    1 
ATOM   8798  C  C5    . DA  I 5 138 ? 14.990  -5.566  73.705 1.00 152.70 ? 65   DA  I C5    1 
ATOM   8799  C  C6    . DA  I 5 138 ? 14.005  -6.515  73.354 1.00 152.86 ? 65   DA  I C6    1 
ATOM   8800  N  N6    . DA  I 5 138 ? 14.219  -7.835  73.365 1.00 152.79 ? 65   DA  I N6    1 
ATOM   8801  N  N1    . DA  I 5 138 ? 12.786  -6.053  72.992 1.00 152.74 ? 65   DA  I N1    1 
ATOM   8802  C  C2    . DA  I 5 138 ? 12.576  -4.729  72.975 1.00 152.61 ? 65   DA  I C2    1 
ATOM   8803  N  N3    . DA  I 5 138 ? 13.422  -3.745  73.283 1.00 152.41 ? 65   DA  I N3    1 
ATOM   8804  C  C4    . DA  I 5 138 ? 14.622  -4.235  73.642 1.00 152.56 ? 65   DA  I C4    1 
ATOM   8805  P  P     . DT  I 5 139 ? 13.784  0.501   75.555 1.00 153.14 ? 66   DT  I P     1 
ATOM   8806  O  OP1   . DT  I 5 139 ? 13.066  1.787   75.700 1.00 153.04 ? 66   DT  I OP1   1 
ATOM   8807  O  OP2   . DT  I 5 139 ? 13.747  -0.441  76.695 1.00 153.08 ? 66   DT  I OP2   1 
ATOM   8808  O  "O5'" . DT  I 5 139 ? 13.247  -0.263  74.249 1.00 152.93 ? 66   DT  I "O5'" 1 
ATOM   8809  C  "C5'" . DT  I 5 139 ? 12.215  0.273   73.411 1.00 152.24 ? 66   DT  I "C5'" 1 
ATOM   8810  C  "C4'" . DT  I 5 139 ? 10.888  -0.435  73.652 1.00 151.56 ? 66   DT  I "C4'" 1 
ATOM   8811  O  "O4'" . DT  I 5 139 ? 11.093  -1.863  73.848 1.00 151.93 ? 66   DT  I "O4'" 1 
ATOM   8812  C  "C3'" . DT  I 5 139 ? 10.102  0.036   74.873 1.00 150.73 ? 66   DT  I "C3'" 1 
ATOM   8813  O  "O3'" . DT  I 5 139 ? 8.716   0.044   74.512 1.00 148.92 ? 66   DT  I "O3'" 1 
ATOM   8814  C  "C2'" . DT  I 5 139 ? 10.460  -1.015  75.927 1.00 151.22 ? 66   DT  I "C2'" 1 
ATOM   8815  C  "C1'" . DT  I 5 139 ? 10.470  -2.265  75.056 1.00 152.23 ? 66   DT  I "C1'" 1 
ATOM   8816  N  N1    . DT  I 5 139 ? 11.168  -3.469  75.636 1.00 152.70 ? 66   DT  I N1    1 
ATOM   8817  C  C2    . DT  I 5 139 ? 10.577  -4.723  75.522 1.00 152.95 ? 66   DT  I C2    1 
ATOM   8818  O  O2    . DT  I 5 139 ? 9.504   -4.929  74.975 1.00 152.81 ? 66   DT  I O2    1 
ATOM   8819  N  N3    . DT  I 5 139 ? 11.300  -5.754  76.080 1.00 153.02 ? 66   DT  I N3    1 
ATOM   8820  C  C4    . DT  I 5 139 ? 12.526  -5.662  76.723 1.00 152.70 ? 66   DT  I C4    1 
ATOM   8821  O  O4    . DT  I 5 139 ? 13.092  -6.644  77.187 1.00 152.60 ? 66   DT  I O4    1 
ATOM   8822  C  C5    . DT  I 5 139 ? 13.090  -4.336  76.807 1.00 152.79 ? 66   DT  I C5    1 
ATOM   8823  C  C7    . DT  I 5 139 ? 14.413  -4.118  77.483 1.00 152.70 ? 66   DT  I C7    1 
ATOM   8824  C  C6    . DT  I 5 139 ? 12.395  -3.319  76.269 1.00 152.91 ? 66   DT  I C6    1 
ATOM   8825  P  P     . DT  I 5 140 ? 7.488   0.018   75.551 1.00 147.30 ? 67   DT  I P     1 
ATOM   8826  O  OP1   . DT  I 5 140 ? 6.834   1.341   75.485 1.00 147.06 ? 67   DT  I OP1   1 
ATOM   8827  O  OP2   . DT  I 5 140 ? 7.926   -0.505  76.867 1.00 147.53 ? 67   DT  I OP2   1 
ATOM   8828  O  "O5'" . DT  I 5 140 ? 6.517   -1.069  74.880 1.00 145.30 ? 67   DT  I "O5'" 1 
ATOM   8829  C  "C5'" . DT  I 5 140 ? 6.976   -2.400  74.596 1.00 142.13 ? 67   DT  I "C5'" 1 
ATOM   8830  C  "C4'" . DT  I 5 140 ? 5.992   -3.481  75.025 1.00 139.57 ? 67   DT  I "C4'" 1 
ATOM   8831  O  "O4'" . DT  I 5 140 ? 6.731   -4.642  75.488 1.00 139.13 ? 67   DT  I "O4'" 1 
ATOM   8832  C  "C3'" . DT  I 5 140 ? 5.004   -3.122  76.136 1.00 137.79 ? 67   DT  I "C3'" 1 
ATOM   8833  O  "O3'" . DT  I 5 140 ? 3.662   -3.412  75.672 1.00 135.25 ? 67   DT  I "O3'" 1 
ATOM   8834  C  "C2'" . DT  I 5 140 ? 5.509   -3.899  77.360 1.00 137.99 ? 67   DT  I "C2'" 1 
ATOM   8835  C  "C1'" . DT  I 5 140 ? 6.261   -5.079  76.751 1.00 138.27 ? 67   DT  I "C1'" 1 
ATOM   8836  N  N1    . DT  I 5 140 ? 7.438   -5.576  77.543 1.00 138.11 ? 67   DT  I N1    1 
ATOM   8837  C  C2    . DT  I 5 140 ? 7.599   -6.930  77.789 1.00 137.95 ? 67   DT  I C2    1 
ATOM   8838  O  O2    . DT  I 5 140 ? 6.830   -7.795  77.415 1.00 137.92 ? 67   DT  I O2    1 
ATOM   8839  N  N3    . DT  I 5 140 ? 8.721   -7.248  78.511 1.00 137.91 ? 67   DT  I N3    1 
ATOM   8840  C  C4    . DT  I 5 140 ? 9.680   -6.378  79.002 1.00 137.92 ? 67   DT  I C4    1 
ATOM   8841  O  O4    . DT  I 5 140 ? 10.651  -6.759  79.643 1.00 137.86 ? 67   DT  I O4    1 
ATOM   8842  C  C5    . DT  I 5 140 ? 9.458   -4.985  78.711 1.00 138.13 ? 67   DT  I C5    1 
ATOM   8843  C  C7    . DT  I 5 140 ? 10.431  -3.950  79.193 1.00 138.27 ? 67   DT  I C7    1 
ATOM   8844  C  C6    . DT  I 5 140 ? 8.365   -4.656  78.007 1.00 138.25 ? 67   DT  I C6    1 
ATOM   8845  P  P     . DC  I 5 141 ? 2.552   -4.278  76.445 1.00 134.05 ? 68   DC  I P     1 
ATOM   8846  O  OP1   . DC  I 5 141 ? 1.343   -4.284  75.589 1.00 133.53 ? 68   DC  I OP1   1 
ATOM   8847  O  OP2   . DC  I 5 141 ? 2.441   -3.773  77.836 1.00 133.65 ? 68   DC  I OP2   1 
ATOM   8848  O  "O5'" . DC  I 5 141 ? 3.213   -5.748  76.476 1.00 132.77 ? 68   DC  I "O5'" 1 
ATOM   8849  C  "C5'" . DC  I 5 141 ? 2.478   -6.961  76.344 1.00 130.17 ? 68   DC  I "C5'" 1 
ATOM   8850  C  "C4'" . DC  I 5 141 ? 2.526   -7.772  77.626 1.00 128.66 ? 68   DC  I "C4'" 1 
ATOM   8851  O  "O4'" . DC  I 5 141 ? 3.826   -7.694  78.262 1.00 128.09 ? 68   DC  I "O4'" 1 
ATOM   8852  C  "C3'" . DC  I 5 141 ? 1.524   -7.346  78.699 1.00 127.92 ? 68   DC  I "C3'" 1 
ATOM   8853  O  "O3'" . DC  I 5 141 ? 0.877   -8.489  79.235 1.00 126.91 ? 68   DC  I "O3'" 1 
ATOM   8854  C  "C2'" . DC  I 5 141 ? 2.413   -6.730  79.773 1.00 128.09 ? 68   DC  I "C2'" 1 
ATOM   8855  C  "C1'" . DC  I 5 141 ? 3.582   -7.694  79.651 1.00 128.13 ? 68   DC  I "C1'" 1 
ATOM   8856  N  N1    . DC  I 5 141 ? 4.836   -7.312  80.329 1.00 128.38 ? 68   DC  I N1    1 
ATOM   8857  C  C2    . DC  I 5 141 ? 5.801   -8.301  80.583 1.00 128.29 ? 68   DC  I C2    1 
ATOM   8858  O  O2    . DC  I 5 141 ? 5.588   -9.475  80.257 1.00 128.08 ? 68   DC  I O2    1 
ATOM   8859  N  N3    . DC  I 5 141 ? 6.957   -7.936  81.193 1.00 128.26 ? 68   DC  I N3    1 
ATOM   8860  C  C4    . DC  I 5 141 ? 7.157   -6.658  81.535 1.00 128.28 ? 68   DC  I C4    1 
ATOM   8861  N  N4    . DC  I 5 141 ? 8.308   -6.345  82.132 1.00 128.31 ? 68   DC  I N4    1 
ATOM   8862  C  C5    . DC  I 5 141 ? 6.190   -5.636  81.283 1.00 128.33 ? 68   DC  I C5    1 
ATOM   8863  C  C6    . DC  I 5 141 ? 5.055   -6.007  80.682 1.00 128.64 ? 68   DC  I C6    1 
ATOM   8864  P  P     . DT  I 5 142 ? -0.312  -9.235  78.478 1.00 125.96 ? 69   DT  I P     1 
ATOM   8865  O  OP1   . DT  I 5 142 ? -0.232  -8.909  77.038 1.00 125.70 ? 69   DT  I OP1   1 
ATOM   8866  O  OP2   . DT  I 5 142 ? -1.544  -8.978  79.256 1.00 125.60 ? 69   DT  I OP2   1 
ATOM   8867  O  "O5'" . DT  I 5 142 ? 0.034   -10.783 78.666 1.00 126.15 ? 69   DT  I "O5'" 1 
ATOM   8868  C  "C5'" . DT  I 5 142 ? 1.322   -11.309 78.346 1.00 126.22 ? 69   DT  I "C5'" 1 
ATOM   8869  C  "C4'" . DT  I 5 142 ? 1.897   -12.116 79.498 1.00 126.28 ? 69   DT  I "C4'" 1 
ATOM   8870  O  "O4'" . DT  I 5 142 ? 2.647   -11.224 80.358 1.00 127.32 ? 69   DT  I "O4'" 1 
ATOM   8871  C  "C3'" . DT  I 5 142 ? 0.881   -12.829 80.392 1.00 125.87 ? 69   DT  I "C3'" 1 
ATOM   8872  O  "O3'" . DT  I 5 142 ? 1.077   -14.241 80.293 1.00 123.95 ? 69   DT  I "O3'" 1 
ATOM   8873  C  "C2'" . DT  I 5 142 ? 1.139   -12.296 81.806 1.00 126.99 ? 69   DT  I "C2'" 1 
ATOM   8874  C  "C1'" . DT  I 5 142 ? 2.513   -11.642 81.700 1.00 128.27 ? 69   DT  I "C1'" 1 
ATOM   8875  N  N1    . DT  I 5 142 ? 2.717   -10.436 82.562 1.00 128.68 ? 69   DT  I N1    1 
ATOM   8876  C  C2    . DT  I 5 142 ? 3.961   -10.195 83.131 1.00 129.30 ? 69   DT  I C2    1 
ATOM   8877  O  O2    . DT  I 5 142 ? 4.937   -10.916 82.993 1.00 129.54 ? 69   DT  I O2    1 
ATOM   8878  N  N3    . DT  I 5 142 ? 4.030   -9.055  83.892 1.00 129.32 ? 69   DT  I N3    1 
ATOM   8879  C  C4    . DT  I 5 142 ? 3.009   -8.151  84.129 1.00 129.18 ? 69   DT  I C4    1 
ATOM   8880  O  O4    . DT  I 5 142 ? 3.204   -7.166  84.835 1.00 128.98 ? 69   DT  I O4    1 
ATOM   8881  C  C5    . DT  I 5 142 ? 1.732   -8.458  83.501 1.00 129.40 ? 69   DT  I C5    1 
ATOM   8882  C  C7    . DT  I 5 142 ? 0.522   -7.574  83.664 1.00 129.13 ? 69   DT  I C7    1 
ATOM   8883  C  C6    . DT  I 5 142 ? 1.658   -9.569  82.756 1.00 128.92 ? 69   DT  I C6    1 
ATOM   8884  P  P     . DG  I 5 143 ? 0.094   -15.312 80.968 1.00 122.73 ? 70   DG  I P     1 
ATOM   8885  O  OP1   . DG  I 5 143 ? 0.201   -16.533 80.143 1.00 122.86 ? 70   DG  I OP1   1 
ATOM   8886  O  OP2   . DG  I 5 143 ? -1.235  -14.711 81.219 1.00 122.48 ? 70   DG  I OP2   1 
ATOM   8887  O  "O5'" . DG  I 5 143 ? 0.755   -15.564 82.409 1.00 122.39 ? 70   DG  I "O5'" 1 
ATOM   8888  C  "C5'" . DG  I 5 143 ? 2.041   -16.170 82.558 1.00 120.50 ? 70   DG  I "C5'" 1 
ATOM   8889  C  "C4'" . DG  I 5 143 ? 2.600   -15.980 83.960 1.00 119.34 ? 70   DG  I "C4'" 1 
ATOM   8890  O  "O4'" . DG  I 5 143 ? 2.815   -14.570 84.218 1.00 118.75 ? 70   DG  I "O4'" 1 
ATOM   8891  C  "C3'" . DG  I 5 143 ? 1.763   -16.484 85.139 1.00 119.11 ? 70   DG  I "C3'" 1 
ATOM   8892  O  "O3'" . DG  I 5 143 ? 2.668   -17.034 86.090 1.00 119.17 ? 70   DG  I "O3'" 1 
ATOM   8893  C  "C2'" . DG  I 5 143 ? 1.163   -15.198 85.687 1.00 118.79 ? 70   DG  I "C2'" 1 
ATOM   8894  C  "C1'" . DG  I 5 143 ? 2.417   -14.348 85.551 1.00 118.97 ? 70   DG  I "C1'" 1 
ATOM   8895  N  N9    . DG  I 5 143 ? 2.294   -12.916 85.793 1.00 119.11 ? 70   DG  I N9    1 
ATOM   8896  C  C8    . DG  I 5 143 ? 1.269   -12.065 85.457 1.00 119.41 ? 70   DG  I C8    1 
ATOM   8897  N  N7    . DG  I 5 143 ? 1.482   -10.829 85.821 1.00 119.59 ? 70   DG  I N7    1 
ATOM   8898  C  C5    . DG  I 5 143 ? 2.730   -10.861 86.431 1.00 119.34 ? 70   DG  I C5    1 
ATOM   8899  C  C6    . DG  I 5 143 ? 3.500   -9.828  87.026 1.00 119.10 ? 70   DG  I C6    1 
ATOM   8900  O  O6    . DG  I 5 143 ? 3.226   -8.628  87.144 1.00 119.10 ? 70   DG  I O6    1 
ATOM   8901  N  N1    . DG  I 5 143 ? 4.710   -10.301 87.526 1.00 119.20 ? 70   DG  I N1    1 
ATOM   8902  C  C2    . DG  I 5 143 ? 5.129   -11.608 87.459 1.00 119.43 ? 70   DG  I C2    1 
ATOM   8903  N  N2    . DG  I 5 143 ? 6.325   -11.887 87.995 1.00 119.45 ? 70   DG  I N2    1 
ATOM   8904  N  N3    . DG  I 5 143 ? 4.418   -12.585 86.911 1.00 119.45 ? 70   DG  I N3    1 
ATOM   8905  C  C4    . DG  I 5 143 ? 3.237   -12.141 86.418 1.00 119.24 ? 70   DG  I C4    1 
ATOM   8906  P  P     . DA  I 5 144 ? 2.313   -18.252 87.068 1.00 118.93 ? 71   DA  I P     1 
ATOM   8907  O  OP1   . DA  I 5 144 ? 1.796   -19.357 86.230 1.00 119.22 ? 71   DA  I OP1   1 
ATOM   8908  O  OP2   . DA  I 5 144 ? 1.490   -17.752 88.195 1.00 118.23 ? 71   DA  I OP2   1 
ATOM   8909  O  "O5'" . DA  I 5 144 ? 3.757   -18.667 87.636 1.00 118.43 ? 71   DA  I "O5'" 1 
ATOM   8910  C  "C5'" . DA  I 5 144 ? 4.933   -17.868 87.415 1.00 118.24 ? 71   DA  I "C5'" 1 
ATOM   8911  C  "C4'" . DA  I 5 144 ? 5.549   -17.313 88.699 1.00 117.68 ? 71   DA  I "C4'" 1 
ATOM   8912  O  "O4'" . DA  I 5 144 ? 5.392   -15.866 88.732 1.00 117.05 ? 71   DA  I "O4'" 1 
ATOM   8913  C  "C3'" . DA  I 5 144 ? 4.972   -17.815 90.021 1.00 118.20 ? 71   DA  I "C3'" 1 
ATOM   8914  O  "O3'" . DA  I 5 144 ? 6.015   -17.936 91.007 1.00 120.09 ? 71   DA  I "O3'" 1 
ATOM   8915  C  "C2'" . DA  I 5 144 ? 3.992   -16.707 90.366 1.00 117.66 ? 71   DA  I "C2'" 1 
ATOM   8916  C  "C1'" . DA  I 5 144 ? 4.816   -15.497 89.963 1.00 117.10 ? 71   DA  I "C1'" 1 
ATOM   8917  N  N9    . DA  I 5 144 ? 3.985   -14.309 89.838 1.00 117.17 ? 71   DA  I N9    1 
ATOM   8918  C  C8    . DA  I 5 144 ? 2.707   -14.259 89.355 1.00 117.39 ? 71   DA  I C8    1 
ATOM   8919  N  N7    . DA  I 5 144 ? 2.172   -13.063 89.374 1.00 117.80 ? 71   DA  I N7    1 
ATOM   8920  C  C5    . DA  I 5 144 ? 3.168   -12.269 89.915 1.00 117.59 ? 71   DA  I C5    1 
ATOM   8921  C  C6    . DA  I 5 144 ? 3.226   -10.888 90.202 1.00 117.28 ? 71   DA  I C6    1 
ATOM   8922  N  N6    . DA  I 5 144 ? 2.214   -10.052 89.961 1.00 117.25 ? 71   DA  I N6    1 
ATOM   8923  N  N1    . DA  I 5 144 ? 4.368   -10.401 90.738 1.00 117.24 ? 71   DA  I N1    1 
ATOM   8924  C  C2    . DA  I 5 144 ? 5.380   -11.250 90.980 1.00 117.36 ? 71   DA  I C2    1 
ATOM   8925  N  N3    . DA  I 5 144 ? 5.443   -12.566 90.754 1.00 117.30 ? 71   DA  I N3    1 
ATOM   8926  C  C4    . DA  I 5 144 ? 4.294   -13.022 90.217 1.00 117.46 ? 71   DA  I C4    1 
ATOM   8927  P  P     . DT  I 5 145 ? 5.769   -18.079 92.597 1.00 120.48 ? 72   DT  I P     1 
ATOM   8928  O  OP1   . DT  I 5 145 ? 6.871   -18.914 93.118 1.00 120.18 ? 72   DT  I OP1   1 
ATOM   8929  O  OP2   . DT  I 5 145 ? 4.355   -18.439 92.882 1.00 120.21 ? 72   DT  I OP2   1 
ATOM   8930  O  "O5'" . DT  I 5 145 ? 5.983   -16.584 93.102 1.00 120.53 ? 72   DT  I "O5'" 1 
ATOM   8931  C  "C5'" . DT  I 5 145 ? 7.282   -16.037 93.247 1.00 120.98 ? 72   DT  I "C5'" 1 
ATOM   8932  C  "C4'" . DT  I 5 145 ? 7.176   -14.952 94.295 1.00 121.33 ? 72   DT  I "C4'" 1 
ATOM   8933  O  "O4'" . DT  I 5 145 ? 6.315   -13.904 93.780 1.00 120.97 ? 72   DT  I "O4'" 1 
ATOM   8934  C  "C3'" . DT  I 5 145 ? 6.560   -15.451 95.604 1.00 121.28 ? 72   DT  I "C3'" 1 
ATOM   8935  O  "O3'" . DT  I 5 145 ? 7.468   -15.248 96.678 1.00 121.44 ? 72   DT  I "O3'" 1 
ATOM   8936  C  "C2'" . DT  I 5 145 ? 5.269   -14.653 95.791 1.00 121.17 ? 72   DT  I "C2'" 1 
ATOM   8937  C  "C1'" . DT  I 5 145 ? 5.407   -13.511 94.786 1.00 121.31 ? 72   DT  I "C1'" 1 
ATOM   8938  N  N1    . DT  I 5 145 ? 4.131   -13.119 94.127 1.00 121.20 ? 72   DT  I N1    1 
ATOM   8939  C  C2    . DT  I 5 145 ? 3.821   -11.777 94.044 1.00 121.43 ? 72   DT  I C2    1 
ATOM   8940  O  O2    . DT  I 5 145 ? 4.528   -10.882 94.479 1.00 121.55 ? 72   DT  I O2    1 
ATOM   8941  N  N3    . DT  I 5 145 ? 2.629   -11.509 93.420 1.00 121.57 ? 72   DT  I N3    1 
ATOM   8942  C  C4    . DT  I 5 145 ? 1.736   -12.416 92.881 1.00 121.43 ? 72   DT  I C4    1 
ATOM   8943  O  O4    . DT  I 5 145 ? 0.696   -12.043 92.345 1.00 121.46 ? 72   DT  I O4    1 
ATOM   8944  C  C5    . DT  I 5 145 ? 2.122   -13.806 92.999 1.00 121.33 ? 72   DT  I C5    1 
ATOM   8945  C  C7    . DT  I 5 145 ? 1.242   -14.895 92.456 1.00 121.39 ? 72   DT  I C7    1 
ATOM   8946  C  C6    . DT  I 5 145 ? 3.287   -14.087 93.607 1.00 121.14 ? 72   DT  I C6    1 
ATOM   8947  O  "O5'" . DA  J 6 1   ? -1.837  -1.101  91.869 1.00 149.34 ? -72  DA  J "O5'" 1 
ATOM   8948  C  "C5'" . DA  J 6 1   ? -0.420  -0.991  91.951 1.00 149.64 ? -72  DA  J "C5'" 1 
ATOM   8949  C  "C4'" . DA  J 6 1   ? 0.091   -1.462  93.304 1.00 149.93 ? -72  DA  J "C4'" 1 
ATOM   8950  O  "O4'" . DA  J 6 1   ? -0.613  -2.663  93.701 1.00 149.98 ? -72  DA  J "O4'" 1 
ATOM   8951  C  "C3'" . DA  J 6 1   ? 1.562   -1.854  93.344 1.00 149.99 ? -72  DA  J "C3'" 1 
ATOM   8952  O  "O3'" . DA  J 6 1   ? 2.367   -0.725  93.629 1.00 150.21 ? -72  DA  J "O3'" 1 
ATOM   8953  C  "C2'" . DA  J 6 1   ? 1.631   -2.849  94.494 1.00 149.95 ? -72  DA  J "C2'" 1 
ATOM   8954  C  "C1'" . DA  J 6 1   ? 0.240   -3.489  94.483 1.00 150.09 ? -72  DA  J "C1'" 1 
ATOM   8955  N  N9    . DA  J 6 1   ? 0.176   -4.866  93.970 1.00 150.11 ? -72  DA  J N9    1 
ATOM   8956  C  C8    . DA  J 6 1   ? -0.899  -5.422  93.333 1.00 150.03 ? -72  DA  J C8    1 
ATOM   8957  N  N7    . DA  J 6 1   ? -0.733  -6.669  92.967 1.00 149.84 ? -72  DA  J N7    1 
ATOM   8958  C  C5    . DA  J 6 1   ? 0.547   -6.962  93.399 1.00 149.88 ? -72  DA  J C5    1 
ATOM   8959  C  C6    . DA  J 6 1   ? 1.320   -8.137  93.315 1.00 149.91 ? -72  DA  J C6    1 
ATOM   8960  N  N6    . DA  J 6 1   ? 0.867   -9.252  92.738 1.00 149.94 ? -72  DA  J N6    1 
ATOM   8961  N  N1    . DA  J 6 1   ? 2.567   -8.121  93.844 1.00 150.02 ? -72  DA  J N1    1 
ATOM   8962  C  C2    . DA  J 6 1   ? 3.010   -6.994  94.421 1.00 149.93 ? -72  DA  J C2    1 
ATOM   8963  N  N3    . DA  J 6 1   ? 2.371   -5.828  94.558 1.00 149.98 ? -72  DA  J N3    1 
ATOM   8964  C  C4    . DA  J 6 1   ? 1.130   -5.870  94.023 1.00 150.00 ? -72  DA  J C4    1 
ATOM   8965  P  P     . DT  J 6 2   ? 3.839   -0.597  93.011 1.00 150.71 ? -71  DT  J P     1 
ATOM   8966  O  OP1   . DT  J 6 2   ? 4.107   0.842   92.797 1.00 151.04 ? -71  DT  J OP1   1 
ATOM   8967  O  OP2   . DT  J 6 2   ? 3.947   -1.514  91.857 1.00 150.97 ? -71  DT  J OP2   1 
ATOM   8968  O  "O5'" . DT  J 6 2   ? 4.789   -1.134  94.185 1.00 150.35 ? -71  DT  J "O5'" 1 
ATOM   8969  C  "C5'" . DT  J 6 2   ? 6.192   -1.259  93.972 1.00 149.56 ? -71  DT  J "C5'" 1 
ATOM   8970  C  "C4'" . DT  J 6 2   ? 6.587   -2.718  93.804 1.00 149.46 ? -71  DT  J "C4'" 1 
ATOM   8971  O  "O4'" . DT  J 6 2   ? 5.437   -3.528  93.432 1.00 149.60 ? -71  DT  J "O4'" 1 
ATOM   8972  C  "C3'" . DT  J 6 2   ? 7.647   -2.972  92.736 1.00 149.09 ? -71  DT  J "C3'" 1 
ATOM   8973  O  "O3'" . DT  J 6 2   ? 8.876   -3.387  93.343 1.00 149.12 ? -71  DT  J "O3'" 1 
ATOM   8974  C  "C2'" . DT  J 6 2   ? 7.054   -4.063  91.842 1.00 149.07 ? -71  DT  J "C2'" 1 
ATOM   8975  C  "C1'" . DT  J 6 2   ? 5.901   -4.624  92.667 1.00 149.13 ? -71  DT  J "C1'" 1 
ATOM   8976  N  N1    . DT  J 6 2   ? 4.791   -5.262  91.841 1.00 149.06 ? -71  DT  J N1    1 
ATOM   8977  C  C2    . DT  J 6 2   ? 4.851   -6.619  91.545 1.00 149.00 ? -71  DT  J C2    1 
ATOM   8978  O  O2    . DT  J 6 2   ? 5.746   -7.363  91.908 1.00 148.90 ? -71  DT  J O2    1 
ATOM   8979  N  N3    . DT  J 6 2   ? 3.803   -7.097  90.794 1.00 148.89 ? -71  DT  J N3    1 
ATOM   8980  C  C4    . DT  J 6 2   ? 2.724   -6.379  90.313 1.00 148.83 ? -71  DT  J C4    1 
ATOM   8981  O  O4    . DT  J 6 2   ? 1.845   -6.916  89.650 1.00 148.87 ? -71  DT  J O4    1 
ATOM   8982  C  C5    . DT  J 6 2   ? 2.714   -4.973  90.648 1.00 148.83 ? -71  DT  J C5    1 
ATOM   8983  C  C7    . DT  J 6 2   ? 1.595   -4.082  90.187 1.00 148.87 ? -71  DT  J C7    1 
ATOM   8984  C  C6    . DT  J 6 2   ? 3.732   -4.494  91.382 1.00 148.83 ? -71  DT  J C6    1 
ATOM   8985  P  P     . DC  J 6 3   ? 10.234  -3.496  92.489 1.00 149.19 ? -70  DC  J P     1 
ATOM   8986  O  OP1   . DC  J 6 3   ? 11.410  -3.398  93.388 1.00 149.07 ? -70  DC  J OP1   1 
ATOM   8987  O  OP2   . DC  J 6 3   ? 10.128  -2.567  91.340 1.00 149.10 ? -70  DC  J OP2   1 
ATOM   8988  O  "O5'" . DC  J 6 3   ? 10.134  -4.990  91.927 1.00 148.82 ? -70  DC  J "O5'" 1 
ATOM   8989  C  "C5'" . DC  J 6 3   ? 10.323  -6.119  92.784 1.00 148.13 ? -70  DC  J "C5'" 1 
ATOM   8990  C  "C4'" . DC  J 6 3   ? 10.678  -7.345  91.957 1.00 147.36 ? -70  DC  J "C4'" 1 
ATOM   8991  O  "O4'" . DC  J 6 3   ? 9.482   -7.907  91.353 1.00 147.32 ? -70  DC  J "O4'" 1 
ATOM   8992  C  "C3'" . DC  J 6 3   ? 11.658  -7.081  90.821 1.00 146.68 ? -70  DC  J "C3'" 1 
ATOM   8993  O  "O3'" . DC  J 6 3   ? 12.694  -8.050  90.857 1.00 145.74 ? -70  DC  J "O3'" 1 
ATOM   8994  C  "C2'" . DC  J 6 3   ? 10.811  -7.152  89.549 1.00 146.95 ? -70  DC  J "C2'" 1 
ATOM   8995  C  "C1'" . DC  J 6 3   ? 9.618   -8.013  89.947 1.00 147.15 ? -70  DC  J "C1'" 1 
ATOM   8996  N  N1    . DC  J 6 3   ? 8.323   -7.595  89.291 1.00 147.15 ? -70  DC  J N1    1 
ATOM   8997  C  C2    . DC  J 6 3   ? 7.431   -8.561  88.789 1.00 147.07 ? -70  DC  J C2    1 
ATOM   8998  O  O2    . DC  J 6 3   ? 7.706   -9.765  88.881 1.00 147.01 ? -70  DC  J O2    1 
ATOM   8999  N  N3    . DC  J 6 3   ? 6.274   -8.141  88.208 1.00 147.07 ? -70  DC  J N3    1 
ATOM   9000  C  C4    . DC  J 6 3   ? 5.991   -6.838  88.114 1.00 146.98 ? -70  DC  J C4    1 
ATOM   9001  N  N4    . DC  J 6 3   ? 4.842   -6.478  87.535 1.00 147.07 ? -70  DC  J N4    1 
ATOM   9002  C  C5    . DC  J 6 3   ? 6.881   -5.845  88.613 1.00 146.96 ? -70  DC  J C5    1 
ATOM   9003  C  C6    . DC  J 6 3   ? 8.016   -6.265  89.185 1.00 146.96 ? -70  DC  J C6    1 
ATOM   9004  P  P     . DA  J 6 4   ? 13.731  -8.227  89.646 1.00 145.05 ? -69  DA  J P     1 
ATOM   9005  O  OP1   . DA  J 6 4   ? 15.026  -8.635  90.244 1.00 145.30 ? -69  DA  J OP1   1 
ATOM   9006  O  OP2   . DA  J 6 4   ? 13.667  -7.038  88.754 1.00 144.75 ? -69  DA  J OP2   1 
ATOM   9007  O  "O5'" . DA  J 6 4   ? 13.119  -9.473  88.855 1.00 143.39 ? -69  DA  J "O5'" 1 
ATOM   9008  C  "C5'" . DA  J 6 4   ? 13.097  -10.772 89.435 1.00 141.19 ? -69  DA  J "C5'" 1 
ATOM   9009  C  "C4'" . DA  J 6 4   ? 12.697  -11.794 88.386 1.00 139.84 ? -69  DA  J "C4'" 1 
ATOM   9010  O  "O4'" . DA  J 6 4   ? 11.438  -11.433 87.761 1.00 139.76 ? -69  DA  J "O4'" 1 
ATOM   9011  C  "C3'" . DA  J 6 4   ? 13.673  -11.973 87.235 1.00 138.98 ? -69  DA  J "C3'" 1 
ATOM   9012  O  "O3'" . DA  J 6 4   ? 13.647  -13.344 86.884 1.00 137.84 ? -69  DA  J "O3'" 1 
ATOM   9013  C  "C2'" . DA  J 6 4   ? 13.111  -11.090 86.119 1.00 138.96 ? -69  DA  J "C2'" 1 
ATOM   9014  C  "C1'" . DA  J 6 4   ? 11.608  -11.136 86.385 1.00 139.05 ? -69  DA  J "C1'" 1 
ATOM   9015  N  N9    . DA  J 6 4   ? 10.883  -9.887  86.159 1.00 138.95 ? -69  DA  J N9    1 
ATOM   9016  C  C8    . DA  J 6 4   ? 11.380  -8.612  86.207 1.00 138.75 ? -69  DA  J C8    1 
ATOM   9017  N  N7    . DA  J 6 4   ? 10.478  -7.689  85.976 1.00 138.89 ? -69  DA  J N7    1 
ATOM   9018  C  C5    . DA  J 6 4   ? 9.306   -8.404  85.772 1.00 138.95 ? -69  DA  J C5    1 
ATOM   9019  C  C6    . DA  J 6 4   ? 7.980   -8.011  85.475 1.00 138.81 ? -69  DA  J C6    1 
ATOM   9020  N  N6    . DA  J 6 4   ? 7.611   -6.736  85.340 1.00 138.79 ? -69  DA  J N6    1 
ATOM   9021  N  N1    . DA  J 6 4   ? 7.042   -8.977  85.328 1.00 138.78 ? -69  DA  J N1    1 
ATOM   9022  C  C2    . DA  J 6 4   ? 7.411   -10.259 85.466 1.00 138.82 ? -69  DA  J C2    1 
ATOM   9023  N  N3    . DA  J 6 4   ? 8.623   -10.750 85.743 1.00 139.04 ? -69  DA  J N3    1 
ATOM   9024  C  C4    . DA  J 6 4   ? 9.537   -9.765  85.883 1.00 139.02 ? -69  DA  J C4    1 
ATOM   9025  P  P     . DG  J 6 5   ? 14.899  -14.051 86.187 1.00 136.74 ? -68  DG  J P     1 
ATOM   9026  O  OP1   . DG  J 6 5   ? 15.242  -15.245 86.993 1.00 136.49 ? -68  DG  J OP1   1 
ATOM   9027  O  OP2   . DG  J 6 5   ? 15.923  -13.012 85.927 1.00 136.70 ? -68  DG  J OP2   1 
ATOM   9028  O  "O5'" . DG  J 6 5   ? 14.306  -14.510 84.762 1.00 136.04 ? -68  DG  J "O5'" 1 
ATOM   9029  C  "C5'" . DG  J 6 5   ? 13.164  -15.390 84.613 1.00 133.76 ? -68  DG  J "C5'" 1 
ATOM   9030  C  "C4'" . DG  J 6 5   ? 12.432  -15.187 83.284 1.00 131.81 ? -68  DG  J "C4'" 1 
ATOM   9031  O  "O4'" . DG  J 6 5   ? 11.743  -13.906 83.267 1.00 130.99 ? -68  DG  J "O4'" 1 
ATOM   9032  C  "C3'" . DG  J 6 5   ? 13.297  -15.231 82.017 1.00 130.94 ? -68  DG  J "C3'" 1 
ATOM   9033  O  "O3'" . DG  J 6 5   ? 12.620  -15.893 80.960 1.00 130.30 ? -68  DG  J "O3'" 1 
ATOM   9034  C  "C2'" . DG  J 6 5   ? 13.457  -13.761 81.654 1.00 130.48 ? -68  DG  J "C2'" 1 
ATOM   9035  C  "C1'" . DG  J 6 5   ? 12.097  -13.217 82.085 1.00 129.95 ? -68  DG  J "C1'" 1 
ATOM   9036  N  N9    . DG  J 6 5   ? 12.080  -11.780 82.336 1.00 129.74 ? -68  DG  J N9    1 
ATOM   9037  C  C8    . DG  J 6 5   ? 13.159  -10.956 82.550 1.00 129.58 ? -68  DG  J C8    1 
ATOM   9038  N  N7    . DG  J 6 5   ? 12.831  -9.710  82.735 1.00 129.61 ? -68  DG  J N7    1 
ATOM   9039  C  C5    . DG  J 6 5   ? 11.447  -9.709  82.634 1.00 129.49 ? -68  DG  J C5    1 
ATOM   9040  C  C6    . DG  J 6 5   ? 10.531  -8.640  82.743 1.00 129.54 ? -68  DG  J C6    1 
ATOM   9041  O  O6    . DG  J 6 5   ? 10.772  -7.443  82.964 1.00 129.59 ? -68  DG  J O6    1 
ATOM   9042  N  N1    . DG  J 6 5   ? 9.216   -9.070  82.571 1.00 129.48 ? -68  DG  J N1    1 
ATOM   9043  C  C2    . DG  J 6 5   ? 8.834   -10.364 82.324 1.00 129.39 ? -68  DG  J C2    1 
ATOM   9044  N  N2    . DG  J 6 5   ? 7.518   -10.577 82.190 1.00 129.51 ? -68  DG  J N2    1 
ATOM   9045  N  N3    . DG  J 6 5   ? 9.683   -11.375 82.221 1.00 129.27 ? -68  DG  J N3    1 
ATOM   9046  C  C4    . DG  J 6 5   ? 10.968  -10.975 82.386 1.00 129.47 ? -68  DG  J C4    1 
ATOM   9047  P  P     . DA  J 6 6   ? 12.694  -17.478 80.730 1.00 129.69 ? -67  DA  J P     1 
ATOM   9048  O  OP1   . DA  J 6 6   ? 12.702  -18.172 82.042 1.00 129.04 ? -67  DA  J OP1   1 
ATOM   9049  O  OP2   . DA  J 6 6   ? 13.785  -17.687 79.756 1.00 129.38 ? -67  DA  J OP2   1 
ATOM   9050  O  "O5'" . DA  J 6 6   ? 11.312  -17.830 79.978 1.00 129.13 ? -67  DA  J "O5'" 1 
ATOM   9051  C  "C5'" . DA  J 6 6   ? 10.145  -16.969 80.005 1.00 126.89 ? -67  DA  J "C5'" 1 
ATOM   9052  C  "C4'" . DA  J 6 6   ? 9.796   -16.371 78.638 1.00 125.04 ? -67  DA  J "C4'" 1 
ATOM   9053  O  "O4'" . DA  J 6 6   ? 9.762   -14.919 78.698 1.00 124.04 ? -67  DA  J "O4'" 1 
ATOM   9054  C  "C3'" . DA  J 6 6   ? 10.722  -16.743 77.479 1.00 123.80 ? -67  DA  J "C3'" 1 
ATOM   9055  O  "O3'" . DA  J 6 6   ? 9.974   -17.566 76.577 1.00 122.80 ? -67  DA  J "O3'" 1 
ATOM   9056  C  "C2'" . DA  J 6 6   ? 11.202  -15.415 76.888 1.00 123.38 ? -67  DA  J "C2'" 1 
ATOM   9057  C  "C1'" . DA  J 6 6   ? 10.304  -14.364 77.522 1.00 123.13 ? -67  DA  J "C1'" 1 
ATOM   9058  N  N9    . DA  J 6 6   ? 11.023  -13.182 77.964 1.00 123.08 ? -67  DA  J N9    1 
ATOM   9059  C  C8    . DA  J 6 6   ? 12.375  -13.021 78.112 1.00 123.30 ? -67  DA  J C8    1 
ATOM   9060  N  N7    . DA  J 6 6   ? 12.735  -11.836 78.546 1.00 122.85 ? -67  DA  J N7    1 
ATOM   9061  C  C5    . DA  J 6 6   ? 11.531  -11.186 78.696 1.00 122.54 ? -67  DA  J C5    1 
ATOM   9062  C  C6    . DA  J 6 6   ? 11.223  -9.894  79.125 1.00 122.72 ? -67  DA  J C6    1 
ATOM   9063  N  N6    . DA  J 6 6   ? 12.165  -9.026  79.488 1.00 123.03 ? -67  DA  J N6    1 
ATOM   9064  N  N1    . DA  J 6 6   ? 9.921   -9.542  79.166 1.00 123.04 ? -67  DA  J N1    1 
ATOM   9065  C  C2    . DA  J 6 6   ? 8.991   -10.432 78.796 1.00 122.99 ? -67  DA  J C2    1 
ATOM   9066  N  N3    . DA  J 6 6   ? 9.163   -11.684 78.374 1.00 122.69 ? -67  DA  J N3    1 
ATOM   9067  C  C4    . DA  J 6 6   ? 10.466  -11.995 78.348 1.00 122.72 ? -67  DA  J C4    1 
ATOM   9068  P  P     . DA  J 6 7   ? 10.217  -17.644 74.998 1.00 122.15 ? -66  DA  J P     1 
ATOM   9069  O  OP1   . DA  J 6 7   ? 9.421   -18.786 74.495 1.00 122.17 ? -66  DA  J OP1   1 
ATOM   9070  O  OP2   . DA  J 6 7   ? 11.661  -17.567 74.680 1.00 122.28 ? -66  DA  J OP2   1 
ATOM   9071  O  "O5'" . DA  J 6 7   ? 9.548   -16.287 74.521 1.00 121.72 ? -66  DA  J "O5'" 1 
ATOM   9072  C  "C5'" . DA  J 6 7   ? 8.167   -16.081 74.739 1.00 121.65 ? -66  DA  J "C5'" 1 
ATOM   9073  C  "C4'" . DA  J 6 7   ? 7.684   -14.980 73.823 1.00 121.44 ? -66  DA  J "C4'" 1 
ATOM   9074  O  "O4'" . DA  J 6 7   ? 8.100   -13.694 74.349 1.00 121.17 ? -66  DA  J "O4'" 1 
ATOM   9075  C  "C3'" . DA  J 6 7   ? 8.254   -15.096 72.419 1.00 121.51 ? -66  DA  J "C3'" 1 
ATOM   9076  O  "O3'" . DA  J 6 7   ? 7.217   -14.849 71.491 1.00 122.05 ? -66  DA  J "O3'" 1 
ATOM   9077  C  "C2'" . DA  J 6 7   ? 9.368   -14.051 72.396 1.00 121.47 ? -66  DA  J "C2'" 1 
ATOM   9078  C  "C1'" . DA  J 6 7   ? 8.860   -13.006 73.380 1.00 121.58 ? -66  DA  J "C1'" 1 
ATOM   9079  N  N9    . DA  J 6 7   ? 9.920   -12.242 74.039 1.00 121.85 ? -66  DA  J N9    1 
ATOM   9080  C  C8    . DA  J 6 7   ? 11.175  -12.665 74.403 1.00 121.61 ? -66  DA  J C8    1 
ATOM   9081  N  N7    . DA  J 6 7   ? 11.898  -11.734 74.977 1.00 121.39 ? -66  DA  J N7    1 
ATOM   9082  C  C5    . DA  J 6 7   ? 11.063  -10.627 74.986 1.00 121.39 ? -66  DA  J C5    1 
ATOM   9083  C  C6    . DA  J 6 7   ? 11.228  -9.306  75.451 1.00 121.46 ? -66  DA  J C6    1 
ATOM   9084  N  N6    . DA  J 6 7   ? 12.352  -8.884  76.024 1.00 121.69 ? -66  DA  J N6    1 
ATOM   9085  N  N1    . DA  J 6 7   ? 10.198  -8.434  75.314 1.00 121.68 ? -66  DA  J N1    1 
ATOM   9086  C  C2    . DA  J 6 7   ? 9.063   -8.863  74.737 1.00 121.75 ? -66  DA  J C2    1 
ATOM   9087  N  N3    . DA  J 6 7   ? 8.789   -10.081 74.254 1.00 121.78 ? -66  DA  J N3    1 
ATOM   9088  C  C4    . DA  J 6 7   ? 9.839   -10.920 74.411 1.00 121.82 ? -66  DA  J C4    1 
ATOM   9089  P  P     . DT  J 6 8   ? 7.495   -14.695 69.925 1.00 122.50 ? -65  DT  J P     1 
ATOM   9090  O  OP1   . DT  J 6 8   ? 6.342   -15.282 69.213 1.00 122.78 ? -65  DT  J OP1   1 
ATOM   9091  O  OP2   . DT  J 6 8   ? 8.858   -15.183 69.615 1.00 122.10 ? -65  DT  J OP2   1 
ATOM   9092  O  "O5'" . DT  J 6 8   ? 7.456   -13.102 69.743 1.00 123.84 ? -65  DT  J "O5'" 1 
ATOM   9093  C  "C5'" . DT  J 6 8   ? 6.380   -12.326 70.304 1.00 125.85 ? -65  DT  J "C5'" 1 
ATOM   9094  C  "C4'" . DT  J 6 8   ? 6.556   -10.818 70.121 1.00 127.49 ? -65  DT  J "C4'" 1 
ATOM   9095  O  "O4'" . DT  J 6 8   ? 7.607   -10.289 70.983 1.00 128.02 ? -65  DT  J "O4'" 1 
ATOM   9096  C  "C3'" . DT  J 6 8   ? 6.905   -10.336 68.715 1.00 128.23 ? -65  DT  J "C3'" 1 
ATOM   9097  O  "O3'" . DT  J 6 8   ? 6.317   -9.054  68.517 1.00 129.29 ? -65  DT  J "O3'" 1 
ATOM   9098  C  "C2'" . DT  J 6 8   ? 8.426   -10.247 68.772 1.00 128.20 ? -65  DT  J "C2'" 1 
ATOM   9099  C  "C1'" . DT  J 6 8   ? 8.623   -9.702  70.188 1.00 128.14 ? -65  DT  J "C1'" 1 
ATOM   9100  N  N1    . DT  J 6 8   ? 9.962   -9.982  70.805 1.00 128.02 ? -65  DT  J N1    1 
ATOM   9101  C  C2    . DT  J 6 8   ? 10.571  -8.984  71.537 1.00 127.91 ? -65  DT  J C2    1 
ATOM   9102  O  O2    . DT  J 6 8   ? 10.079  -7.883  71.710 1.00 127.81 ? -65  DT  J O2    1 
ATOM   9103  N  N3    . DT  J 6 8   ? 11.793  -9.332  72.064 1.00 128.14 ? -65  DT  J N3    1 
ATOM   9104  C  C4    . DT  J 6 8   ? 12.452  -10.549 71.936 1.00 128.20 ? -65  DT  J C4    1 
ATOM   9105  O  O4    . DT  J 6 8   ? 13.551  -10.759 72.451 1.00 128.32 ? -65  DT  J O4    1 
ATOM   9106  C  C5    . DT  J 6 8   ? 11.757  -11.548 71.159 1.00 127.82 ? -65  DT  J C5    1 
ATOM   9107  C  C7    . DT  J 6 8   ? 12.365  -12.903 70.945 1.00 127.85 ? -65  DT  J C7    1 
ATOM   9108  C  C6    . DT  J 6 8   ? 10.567  -11.218 70.638 1.00 127.89 ? -65  DT  J C6    1 
ATOM   9109  P  P     . DC  J 6 9   ? 6.022   -8.460  67.059 1.00 129.88 ? -64  DC  J P     1 
ATOM   9110  O  OP1   . DC  J 6 9   ? 4.594   -8.711  66.760 1.00 128.89 ? -64  DC  J OP1   1 
ATOM   9111  O  OP2   . DC  J 6 9   ? 7.077   -8.953  66.140 1.00 129.21 ? -64  DC  J OP2   1 
ATOM   9112  O  "O5'" . DC  J 6 9   ? 6.226   -6.874  67.239 1.00 131.15 ? -64  DC  J "O5'" 1 
ATOM   9113  C  "C5'" . DC  J 6 9   ? 6.356   -6.219  68.512 1.00 133.06 ? -64  DC  J "C5'" 1 
ATOM   9114  C  "C4'" . DC  J 6 9   ? 7.638   -5.400  68.610 1.00 134.88 ? -64  DC  J "C4'" 1 
ATOM   9115  O  "O4'" . DC  J 6 9   ? 8.728   -6.229  69.093 1.00 135.08 ? -64  DC  J "O4'" 1 
ATOM   9116  C  "C3'" . DC  J 6 9   ? 8.141   -4.756  67.313 1.00 136.14 ? -64  DC  J "C3'" 1 
ATOM   9117  O  "O3'" . DC  J 6 9   ? 8.309   -3.342  67.486 1.00 138.34 ? -64  DC  J "O3'" 1 
ATOM   9118  C  "C2'" . DC  J 6 9   ? 9.478   -5.447  67.051 1.00 135.73 ? -64  DC  J "C2'" 1 
ATOM   9119  C  "C1'" . DC  J 6 9   ? 9.909   -5.769  68.475 1.00 135.45 ? -64  DC  J "C1'" 1 
ATOM   9120  N  N1    . DC  J 6 9   ? 11.000  -6.790  68.620 1.00 135.58 ? -64  DC  J N1    1 
ATOM   9121  C  C2    . DC  J 6 9   ? 12.173  -6.447  69.314 1.00 135.70 ? -64  DC  J C2    1 
ATOM   9122  O  O2    . DC  J 6 9   ? 12.300  -5.313  69.789 1.00 135.88 ? -64  DC  J O2    1 
ATOM   9123  N  N3    . DC  J 6 9   ? 13.156  -7.373  69.449 1.00 135.78 ? -64  DC  J N3    1 
ATOM   9124  C  C4    . DC  J 6 9   ? 13.003  -8.593  68.928 1.00 135.78 ? -64  DC  J C4    1 
ATOM   9125  N  N4    . DC  J 6 9   ? 14.006  -9.463  69.091 1.00 135.82 ? -64  DC  J N4    1 
ATOM   9126  C  C5    . DC  J 6 9   ? 11.819  -8.969  68.220 1.00 135.70 ? -64  DC  J C5    1 
ATOM   9127  C  C6    . DC  J 6 9   ? 10.859  -8.043  68.091 1.00 135.58 ? -64  DC  J C6    1 
ATOM   9128  P  P     . DC  J 6 10  ? 8.279   -2.294  66.265 1.00 139.56 ? -63  DC  J P     1 
ATOM   9129  O  OP1   . DC  J 6 10  ? 7.702   -1.040  66.806 1.00 139.06 ? -63  DC  J OP1   1 
ATOM   9130  O  OP2   . DC  J 6 10  ? 7.634   -2.923  65.091 1.00 139.23 ? -63  DC  J OP2   1 
ATOM   9131  O  "O5'" . DC  J 6 10  ? 9.839   -2.093  65.931 1.00 140.25 ? -63  DC  J "O5'" 1 
ATOM   9132  C  "C5'" . DC  J 6 10  ? 10.636  -1.266  66.770 1.00 142.29 ? -63  DC  J "C5'" 1 
ATOM   9133  C  "C4'" . DC  J 6 10  ? 12.106  -1.642  66.730 1.00 144.12 ? -63  DC  J "C4'" 1 
ATOM   9134  O  "O4'" . DC  J 6 10  ? 12.304  -3.065  66.944 1.00 144.16 ? -63  DC  J "O4'" 1 
ATOM   9135  C  "C3'" . DC  J 6 10  ? 12.828  -1.304  65.423 1.00 145.92 ? -63  DC  J "C3'" 1 
ATOM   9136  O  "O3'" . DC  J 6 10  ? 13.962  -0.481  65.717 1.00 148.73 ? -63  DC  J "O3'" 1 
ATOM   9137  C  "C2'" . DC  J 6 10  ? 13.263  -2.673  64.907 1.00 145.21 ? -63  DC  J "C2'" 1 
ATOM   9138  C  "C1'" . DC  J 6 10  ? 13.494  -3.365  66.245 1.00 144.58 ? -63  DC  J "C1'" 1 
ATOM   9139  N  N1    . DC  J 6 10  ? 13.797  -4.839  66.156 1.00 144.68 ? -63  DC  J N1    1 
ATOM   9140  C  C2    . DC  J 6 10  ? 15.092  -5.309  66.477 1.00 144.74 ? -63  DC  J C2    1 
ATOM   9141  O  O2    . DC  J 6 10  ? 15.979  -4.520  66.840 1.00 144.41 ? -63  DC  J O2    1 
ATOM   9142  N  N3    . DC  J 6 10  ? 15.347  -6.642  66.380 1.00 144.60 ? -63  DC  J N3    1 
ATOM   9143  C  C4    . DC  J 6 10  ? 14.386  -7.484  65.987 1.00 144.28 ? -63  DC  J C4    1 
ATOM   9144  N  N4    . DC  J 6 10  ? 14.694  -8.781  65.913 1.00 144.38 ? -63  DC  J N4    1 
ATOM   9145  C  C5    . DC  J 6 10  ? 13.073  -7.034  65.655 1.00 144.16 ? -63  DC  J C5    1 
ATOM   9146  C  C6    . DC  J 6 10  ? 12.827  -5.720  65.753 1.00 144.49 ? -63  DC  J C6    1 
ATOM   9147  P  P     . DC  J 6 11  ? 14.686  0.443   64.620 1.00 150.57 ? -62  DC  J P     1 
ATOM   9148  O  OP1   . DC  J 6 11  ? 13.738  1.527   64.274 1.00 150.39 ? -62  DC  J OP1   1 
ATOM   9149  O  OP2   . DC  J 6 11  ? 15.244  -0.402  63.541 1.00 150.51 ? -62  DC  J OP2   1 
ATOM   9150  O  "O5'" . DC  J 6 11  ? 15.933  1.039   65.436 1.00 151.71 ? -62  DC  J "O5'" 1 
ATOM   9151  C  "C5'" . DC  J 6 11  ? 16.655  0.245   66.387 1.00 154.01 ? -62  DC  J "C5'" 1 
ATOM   9152  C  "C4'" . DC  J 6 11  ? 18.063  -0.122  65.931 1.00 156.02 ? -62  DC  J "C4'" 1 
ATOM   9153  O  "O4'" . DC  J 6 11  ? 18.270  -1.545  66.141 1.00 156.50 ? -62  DC  J "O4'" 1 
ATOM   9154  C  "C3'" . DC  J 6 11  ? 18.398  0.168   64.469 1.00 157.16 ? -62  DC  J "C3'" 1 
ATOM   9155  O  "O3'" . DC  J 6 11  ? 19.196  1.356   64.369 1.00 158.70 ? -62  DC  J "O3'" 1 
ATOM   9156  C  "C2'" . DC  J 6 11  ? 19.161  -1.064  63.980 1.00 156.90 ? -62  DC  J "C2'" 1 
ATOM   9157  C  "C1'" . DC  J 6 11  ? 18.958  -2.129  65.051 1.00 156.45 ? -62  DC  J "C1'" 1 
ATOM   9158  N  N1    . DC  J 6 11  ? 18.211  -3.322  64.516 1.00 156.30 ? -62  DC  J N1    1 
ATOM   9159  C  C2    . DC  J 6 11  ? 18.835  -4.578  64.510 1.00 156.23 ? -62  DC  J C2    1 
ATOM   9160  O  O2    . DC  J 6 11  ? 19.983  -4.685  64.952 1.00 156.25 ? -62  DC  J O2    1 
ATOM   9161  N  N3    . DC  J 6 11  ? 18.163  -5.654  64.021 1.00 156.34 ? -62  DC  J N3    1 
ATOM   9162  C  C4    . DC  J 6 11  ? 16.919  -5.504  63.545 1.00 156.39 ? -62  DC  J C4    1 
ATOM   9163  N  N4    . DC  J 6 11  ? 16.292  -6.586  63.071 1.00 156.39 ? -62  DC  J N4    1 
ATOM   9164  C  C5    . DC  J 6 11  ? 16.262  -4.234  63.533 1.00 156.17 ? -62  DC  J C5    1 
ATOM   9165  C  C6    . DC  J 6 11  ? 16.938  -3.186  64.023 1.00 156.21 ? -62  DC  J C6    1 
ATOM   9166  P  P     . DG  J 6 12  ? 19.744  1.925   62.963 1.00 159.71 ? -61  DG  J P     1 
ATOM   9167  O  OP1   . DG  J 6 12  ? 20.043  3.358   63.182 1.00 159.95 ? -61  DG  J OP1   1 
ATOM   9168  O  OP2   . DG  J 6 12  ? 18.817  1.536   61.870 1.00 159.45 ? -61  DG  J OP2   1 
ATOM   9169  O  "O5'" . DG  J 6 12  ? 21.134  1.147   62.770 1.00 160.01 ? -61  DG  J "O5'" 1 
ATOM   9170  C  "C5'" . DG  J 6 12  ? 22.049  0.979   63.874 1.00 160.40 ? -61  DG  J "C5'" 1 
ATOM   9171  C  "C4'" . DG  J 6 12  ? 23.046  -0.140  63.613 1.00 160.47 ? -61  DG  J "C4'" 1 
ATOM   9172  O  "O4'" . DG  J 6 12  ? 22.404  -1.447  63.637 1.00 160.63 ? -61  DG  J "O4'" 1 
ATOM   9173  C  "C3'" . DG  J 6 12  ? 23.737  -0.038  62.260 1.00 160.49 ? -61  DG  J "C3'" 1 
ATOM   9174  O  "O3'" . DG  J 6 12  ? 25.124  -0.293  62.424 1.00 160.22 ? -61  DG  J "O3'" 1 
ATOM   9175  C  "C2'" . DG  J 6 12  ? 23.038  -1.106  61.419 1.00 160.60 ? -61  DG  J "C2'" 1 
ATOM   9176  C  "C1'" . DG  J 6 12  ? 22.781  -2.171  62.478 1.00 160.65 ? -61  DG  J "C1'" 1 
ATOM   9177  N  N9    . DG  J 6 12  ? 21.761  -3.163  62.116 1.00 160.67 ? -61  DG  J N9    1 
ATOM   9178  C  C8    . DG  J 6 12  ? 20.527  -2.946  61.544 1.00 160.53 ? -61  DG  J C8    1 
ATOM   9179  N  N7    . DG  J 6 12  ? 19.841  -4.035  61.340 1.00 160.32 ? -61  DG  J N7    1 
ATOM   9180  C  C5    . DG  J 6 12  ? 20.674  -5.045  61.798 1.00 160.42 ? -61  DG  J C5    1 
ATOM   9181  C  C6    . DG  J 6 12  ? 20.476  -6.447  61.837 1.00 160.60 ? -61  DG  J C6    1 
ATOM   9182  O  O6    . DG  J 6 12  ? 19.489  -7.088  61.457 1.00 160.67 ? -61  DG  J O6    1 
ATOM   9183  N  N1    . DG  J 6 12  ? 21.571  -7.121  62.383 1.00 160.75 ? -61  DG  J N1    1 
ATOM   9184  C  C2    . DG  J 6 12  ? 22.723  -6.514  62.838 1.00 160.60 ? -61  DG  J C2    1 
ATOM   9185  N  N2    . DG  J 6 12  ? 23.675  -7.322  63.331 1.00 160.53 ? -61  DG  J N2    1 
ATOM   9186  N  N3    . DG  J 6 12  ? 22.920  -5.200  62.808 1.00 160.66 ? -61  DG  J N3    1 
ATOM   9187  C  C4    . DG  J 6 12  ? 21.859  -4.528  62.278 1.00 160.62 ? -61  DG  J C4    1 
ATOM   9188  P  P     . DG  J 6 13  ? 26.150  0.047   61.241 1.00 160.25 ? -60  DG  J P     1 
ATOM   9189  O  OP1   . DG  J 6 13  ? 27.316  0.725   61.860 1.00 160.71 ? -60  DG  J OP1   1 
ATOM   9190  O  OP2   . DG  J 6 13  ? 25.416  0.711   60.134 1.00 159.98 ? -60  DG  J OP2   1 
ATOM   9191  O  "O5'" . DG  J 6 13  ? 26.589  -1.409  60.734 1.00 159.17 ? -60  DG  J "O5'" 1 
ATOM   9192  C  "C5'" . DG  J 6 13  ? 27.272  -2.325  61.603 1.00 157.40 ? -60  DG  J "C5'" 1 
ATOM   9193  C  "C4'" . DG  J 6 13  ? 27.364  -3.712  60.982 1.00 155.87 ? -60  DG  J "C4'" 1 
ATOM   9194  O  "O4'" . DG  J 6 13  ? 26.032  -4.276  60.829 1.00 155.20 ? -60  DG  J "O4'" 1 
ATOM   9195  C  "C3'" . DG  J 6 13  ? 28.040  -3.781  59.609 1.00 155.04 ? -60  DG  J "C3'" 1 
ATOM   9196  O  "O3'" . DG  J 6 13  ? 28.994  -4.853  59.624 1.00 153.94 ? -60  DG  J "O3'" 1 
ATOM   9197  C  "C2'" . DG  J 6 13  ? 26.870  -4.001  58.647 1.00 154.96 ? -60  DG  J "C2'" 1 
ATOM   9198  C  "C1'" . DG  J 6 13  ? 25.857  -4.747  59.508 1.00 154.82 ? -60  DG  J "C1'" 1 
ATOM   9199  N  N9    . DG  J 6 13  ? 24.467  -4.524  59.111 1.00 154.73 ? -60  DG  J N9    1 
ATOM   9200  C  C8    . DG  J 6 13  ? 23.860  -3.309  58.897 1.00 154.68 ? -60  DG  J C8    1 
ATOM   9201  N  N7    . DG  J 6 13  ? 22.606  -3.400  58.554 1.00 154.68 ? -60  DG  J N7    1 
ATOM   9202  C  C5    . DG  J 6 13  ? 22.360  -4.765  58.537 1.00 154.70 ? -60  DG  J C5    1 
ATOM   9203  C  C6    . DG  J 6 13  ? 21.171  -5.470  58.235 1.00 154.63 ? -60  DG  J C6    1 
ATOM   9204  O  O6    . DG  J 6 13  ? 20.075  -4.997  57.914 1.00 154.73 ? -60  DG  J O6    1 
ATOM   9205  N  N1    . DG  J 6 13  ? 21.333  -6.853  58.330 1.00 154.62 ? -60  DG  J N1    1 
ATOM   9206  C  C2    . DG  J 6 13  ? 22.506  -7.477  58.682 1.00 154.62 ? -60  DG  J C2    1 
ATOM   9207  N  N2    . DG  J 6 13  ? 22.483  -8.817  58.725 1.00 154.64 ? -60  DG  J N2    1 
ATOM   9208  N  N3    . DG  J 6 13  ? 23.631  -6.826  58.965 1.00 154.89 ? -60  DG  J N3    1 
ATOM   9209  C  C4    . DG  J 6 13  ? 23.493  -5.475  58.876 1.00 154.84 ? -60  DG  J C4    1 
ATOM   9210  P  P     . DT  J 6 14  ? 29.808  -5.397  58.348 1.00 153.14 ? -59  DT  J P     1 
ATOM   9211  O  OP1   . DT  J 6 14  ? 31.239  -5.082  58.560 1.00 153.17 ? -59  DT  J OP1   1 
ATOM   9212  O  OP2   . DT  J 6 14  ? 29.146  -4.969  57.094 1.00 152.86 ? -59  DT  J OP2   1 
ATOM   9213  O  "O5'" . DT  J 6 14  ? 29.638  -6.983  58.503 1.00 152.37 ? -59  DT  J "O5'" 1 
ATOM   9214  C  "C5'" . DT  J 6 14  ? 28.402  -7.572  58.932 1.00 151.31 ? -59  DT  J "C5'" 1 
ATOM   9215  C  "C4'" . DT  J 6 14  ? 27.788  -8.432  57.840 1.00 150.34 ? -59  DT  J "C4'" 1 
ATOM   9216  O  "O4'" . DT  J 6 14  ? 26.420  -8.022  57.582 1.00 150.07 ? -59  DT  J "O4'" 1 
ATOM   9217  C  "C3'" . DT  J 6 14  ? 28.500  -8.363  56.492 1.00 149.68 ? -59  DT  J "C3'" 1 
ATOM   9218  O  "O3'" . DT  J 6 14  ? 28.651  -9.662  55.969 1.00 148.82 ? -59  DT  J "O3'" 1 
ATOM   9219  C  "C2'" . DT  J 6 14  ? 27.569  -7.532  55.618 1.00 149.88 ? -59  DT  J "C2'" 1 
ATOM   9220  C  "C1'" . DT  J 6 14  ? 26.231  -7.982  56.183 1.00 150.13 ? -59  DT  J "C1'" 1 
ATOM   9221  N  N1    . DT  J 6 14  ? 25.075  -7.098  55.874 1.00 150.20 ? -59  DT  J N1    1 
ATOM   9222  C  C2    . DT  J 6 14  ? 23.826  -7.677  55.743 1.00 150.47 ? -59  DT  J C2    1 
ATOM   9223  O  O2    . DT  J 6 14  ? 23.614  -8.874  55.867 1.00 150.63 ? -59  DT  J O2    1 
ATOM   9224  N  N3    . DT  J 6 14  ? 22.813  -6.792  55.463 1.00 150.33 ? -59  DT  J N3    1 
ATOM   9225  C  C4    . DT  J 6 14  ? 22.921  -5.421  55.299 1.00 150.36 ? -59  DT  J C4    1 
ATOM   9226  O  O4    . DT  J 6 14  ? 21.937  -4.729  55.048 1.00 150.36 ? -59  DT  J O4    1 
ATOM   9227  C  C5    . DT  J 6 14  ? 24.259  -4.880  55.449 1.00 150.45 ? -59  DT  J C5    1 
ATOM   9228  C  C7    . DT  J 6 14  ? 24.520  -3.406  55.298 1.00 150.40 ? -59  DT  J C7    1 
ATOM   9229  C  C6    . DT  J 6 14  ? 25.258  -5.734  55.727 1.00 150.12 ? -59  DT  J C6    1 
ATOM   9230  P  P     . DG  J 6 15  ? 30.055  -10.064 55.329 1.00 148.18 ? -58  DG  J P     1 
ATOM   9231  O  OP1   . DG  J 6 15  ? 30.814  -10.745 56.402 1.00 147.78 ? -58  DG  J OP1   1 
ATOM   9232  O  OP2   . DG  J 6 15  ? 30.587  -8.866  54.632 1.00 148.07 ? -58  DG  J OP2   1 
ATOM   9233  O  "O5'" . DG  J 6 15  ? 29.707  -11.142 54.195 1.00 146.87 ? -58  DG  J "O5'" 1 
ATOM   9234  C  "C5'" . DG  J 6 15  ? 28.829  -12.240 54.458 1.00 144.37 ? -58  DG  J "C5'" 1 
ATOM   9235  C  "C4'" . DG  J 6 15  ? 27.914  -12.470 53.274 1.00 142.32 ? -58  DG  J "C4'" 1 
ATOM   9236  O  "O4'" . DG  J 6 15  ? 26.839  -11.503 53.357 1.00 141.77 ? -58  DG  J "O4'" 1 
ATOM   9237  C  "C3'" . DG  J 6 15  ? 28.599  -12.287 51.917 1.00 141.36 ? -58  DG  J "C3'" 1 
ATOM   9238  O  "O3'" . DG  J 6 15  ? 28.747  -13.549 51.207 1.00 139.72 ? -58  DG  J "O3'" 1 
ATOM   9239  C  "C2'" . DG  J 6 15  ? 27.775  -11.213 51.202 1.00 141.51 ? -58  DG  J "C2'" 1 
ATOM   9240  C  "C1'" . DG  J 6 15  ? 26.527  -11.032 52.064 1.00 141.36 ? -58  DG  J "C1'" 1 
ATOM   9241  N  N9    . DG  J 6 15  ? 26.119  -9.631  52.143 1.00 141.36 ? -58  DG  J N9    1 
ATOM   9242  C  C8    . DG  J 6 15  ? 26.954  -8.554  52.338 1.00 141.30 ? -58  DG  J C8    1 
ATOM   9243  N  N7    . DG  J 6 15  ? 26.334  -7.407  52.359 1.00 141.45 ? -58  DG  J N7    1 
ATOM   9244  C  C5    . DG  J 6 15  ? 24.999  -7.737  52.160 1.00 141.37 ? -58  DG  J C5    1 
ATOM   9245  C  C6    . DG  J 6 15  ? 23.857  -6.899  52.088 1.00 141.14 ? -58  DG  J C6    1 
ATOM   9246  O  O6    . DG  J 6 15  ? 23.807  -5.668  52.187 1.00 141.01 ? -58  DG  J O6    1 
ATOM   9247  N  N1    . DG  J 6 15  ? 22.685  -7.624  51.878 1.00 141.22 ? -58  DG  J N1    1 
ATOM   9248  C  C2    . DG  J 6 15  ? 22.629  -8.993  51.754 1.00 141.18 ? -58  DG  J C2    1 
ATOM   9249  N  N2    . DG  J 6 15  ? 21.411  -9.509  51.554 1.00 141.27 ? -58  DG  J N2    1 
ATOM   9250  N  N3    . DG  J 6 15  ? 23.690  -9.794  51.819 1.00 141.10 ? -58  DG  J N3    1 
ATOM   9251  C  C4    . DG  J 6 15  ? 24.845  -9.105  52.023 1.00 141.39 ? -58  DG  J C4    1 
ATOM   9252  P  P     . DC  J 6 16  ? 27.893  -14.039 49.937 1.00 138.09 ? -57  DC  J P     1 
ATOM   9253  O  OP1   . DC  J 6 16  ? 28.398  -15.375 49.546 1.00 138.22 ? -57  DC  J OP1   1 
ATOM   9254  O  OP2   . DC  J 6 16  ? 27.902  -12.966 48.915 1.00 137.69 ? -57  DC  J OP2   1 
ATOM   9255  O  "O5'" . DC  J 6 16  ? 26.428  -14.214 50.565 1.00 137.16 ? -57  DC  J "O5'" 1 
ATOM   9256  C  "C5'" . DC  J 6 16  ? 25.544  -15.239 50.116 1.00 136.05 ? -57  DC  J "C5'" 1 
ATOM   9257  C  "C4'" . DC  J 6 16  ? 24.421  -14.663 49.265 1.00 135.45 ? -57  DC  J "C4'" 1 
ATOM   9258  O  "O4'" . DC  J 6 16  ? 24.296  -13.230 49.472 1.00 135.82 ? -57  DC  J "O4'" 1 
ATOM   9259  C  "C3'" . DC  J 6 16  ? 24.565  -14.846 47.755 1.00 134.68 ? -57  DC  J "C3'" 1 
ATOM   9260  O  "O3'" . DC  J 6 16  ? 23.309  -15.242 47.215 1.00 132.97 ? -57  DC  J "O3'" 1 
ATOM   9261  C  "C2'" . DC  J 6 16  ? 24.935  -13.449 47.268 1.00 135.18 ? -57  DC  J "C2'" 1 
ATOM   9262  C  "C1'" . DC  J 6 16  ? 24.073  -12.624 48.215 1.00 136.30 ? -57  DC  J "C1'" 1 
ATOM   9263  N  N1    . DC  J 6 16  ? 24.359  -11.146 48.311 1.00 137.06 ? -57  DC  J N1    1 
ATOM   9264  C  C2    . DC  J 6 16  ? 23.287  -10.227 48.294 1.00 137.66 ? -57  DC  J C2    1 
ATOM   9265  O  O2    . DC  J 6 16  ? 22.116  -10.640 48.195 1.00 137.72 ? -57  DC  J O2    1 
ATOM   9266  N  N3    . DC  J 6 16  ? 23.564  -8.892  48.388 1.00 137.48 ? -57  DC  J N3    1 
ATOM   9267  C  C4    . DC  J 6 16  ? 24.830  -8.468  48.495 1.00 137.14 ? -57  DC  J C4    1 
ATOM   9268  N  N4    . DC  J 6 16  ? 25.043  -7.153  48.584 1.00 137.09 ? -57  DC  J N4    1 
ATOM   9269  C  C5    . DC  J 6 16  ? 25.931  -9.379  48.520 1.00 137.41 ? -57  DC  J C5    1 
ATOM   9270  C  C6    . DC  J 6 16  ? 25.648  -10.689 48.426 1.00 137.44 ? -57  DC  J C6    1 
ATOM   9271  P  P     . DC  J 6 17  ? 23.200  -16.417 46.133 1.00 131.36 ? -56  DC  J P     1 
ATOM   9272  O  OP1   . DC  J 6 17  ? 23.589  -17.669 46.818 1.00 131.16 ? -56  DC  J OP1   1 
ATOM   9273  O  OP2   . DC  J 6 17  ? 23.914  -15.985 44.906 1.00 131.27 ? -56  DC  J OP2   1 
ATOM   9274  O  "O5'" . DC  J 6 17  ? 21.633  -16.493 45.780 1.00 130.42 ? -56  DC  J "O5'" 1 
ATOM   9275  C  "C5'" . DC  J 6 17  ? 20.675  -15.515 46.230 1.00 127.76 ? -56  DC  J "C5'" 1 
ATOM   9276  C  "C4'" . DC  J 6 17  ? 20.038  -14.698 45.105 1.00 125.54 ? -56  DC  J "C4'" 1 
ATOM   9277  O  "O4'" . DC  J 6 17  ? 20.536  -13.334 45.118 1.00 125.11 ? -56  DC  J "O4'" 1 
ATOM   9278  C  "C3'" . DC  J 6 17  ? 20.259  -15.160 43.670 1.00 124.58 ? -56  DC  J "C3'" 1 
ATOM   9279  O  "O3'" . DC  J 6 17  ? 19.129  -14.771 42.916 1.00 123.70 ? -56  DC  J "O3'" 1 
ATOM   9280  C  "C2'" . DC  J 6 17  ? 21.472  -14.342 43.232 1.00 124.45 ? -56  DC  J "C2'" 1 
ATOM   9281  C  "C1'" . DC  J 6 17  ? 21.125  -13.000 43.871 1.00 124.20 ? -56  DC  J "C1'" 1 
ATOM   9282  N  N1    . DC  J 6 17  ? 22.253  -12.069 44.173 1.00 123.89 ? -56  DC  J N1    1 
ATOM   9283  C  C2    . DC  J 6 17  ? 21.968  -10.731 44.500 1.00 123.73 ? -56  DC  J C2    1 
ATOM   9284  O  O2    . DC  J 6 17  ? 20.798  -10.329 44.515 1.00 123.46 ? -56  DC  J O2    1 
ATOM   9285  N  N3    . DC  J 6 17  ? 22.992  -9.890  44.793 1.00 123.55 ? -56  DC  J N3    1 
ATOM   9286  C  C4    . DC  J 6 17  ? 24.249  -10.336 44.775 1.00 123.76 ? -56  DC  J C4    1 
ATOM   9287  N  N4    . DC  J 6 17  ? 25.219  -9.469  45.071 1.00 123.68 ? -56  DC  J N4    1 
ATOM   9288  C  C5    . DC  J 6 17  ? 24.564  -11.691 44.451 1.00 123.84 ? -56  DC  J C5    1 
ATOM   9289  C  C6    . DC  J 6 17  ? 23.546  -12.514 44.167 1.00 124.03 ? -56  DC  J C6    1 
ATOM   9290  P  P     . DG  J 6 18  ? 17.925  -15.761 42.584 1.00 122.84 ? -55  DG  J P     1 
ATOM   9291  O  OP1   . DG  J 6 18  ? 17.764  -16.708 43.714 1.00 123.21 ? -55  DG  J OP1   1 
ATOM   9292  O  OP2   . DG  J 6 18  ? 18.139  -16.227 41.197 1.00 121.75 ? -55  DG  J OP2   1 
ATOM   9293  O  "O5'" . DG  J 6 18  ? 16.645  -14.803 42.587 1.00 122.91 ? -55  DG  J "O5'" 1 
ATOM   9294  C  "C5'" . DG  J 6 18  ? 16.377  -13.916 43.688 1.00 122.43 ? -55  DG  J "C5'" 1 
ATOM   9295  C  "C4'" . DG  J 6 18  ? 15.936  -12.526 43.222 1.00 121.91 ? -55  DG  J "C4'" 1 
ATOM   9296  O  "O4'" . DG  J 6 18  ? 17.078  -11.670 42.952 1.00 121.90 ? -55  DG  J "O4'" 1 
ATOM   9297  C  "C3'" . DG  J 6 18  ? 15.093  -12.452 41.949 1.00 121.16 ? -55  DG  J "C3'" 1 
ATOM   9298  O  "O3'" . DG  J 6 18  ? 14.203  -11.337 42.079 1.00 119.02 ? -55  DG  J "O3'" 1 
ATOM   9299  C  "C2'" . DG  J 6 18  ? 16.145  -12.263 40.853 1.00 121.24 ? -55  DG  J "C2'" 1 
ATOM   9300  C  "C1'" . DG  J 6 18  ? 17.118  -11.338 41.576 1.00 122.80 ? -55  DG  J "C1'" 1 
ATOM   9301  N  N9    . DG  J 6 18  ? 18.519  -11.432 41.189 1.00 123.15 ? -55  DG  J N9    1 
ATOM   9302  C  C8    . DG  J 6 18  ? 19.207  -12.496 40.653 1.00 123.31 ? -55  DG  J C8    1 
ATOM   9303  N  N7    . DG  J 6 18  ? 20.467  -12.240 40.440 1.00 123.25 ? -55  DG  J N7    1 
ATOM   9304  C  C5    . DG  J 6 18  ? 20.621  -10.927 40.864 1.00 123.32 ? -55  DG  J C5    1 
ATOM   9305  C  C6    . DG  J 6 18  ? 21.767  -10.092 40.882 1.00 123.48 ? -55  DG  J C6    1 
ATOM   9306  O  O6    . DG  J 6 18  ? 22.915  -10.364 40.511 1.00 123.28 ? -55  DG  J O6    1 
ATOM   9307  N  N1    . DG  J 6 18  ? 21.484  -8.822  41.397 1.00 123.52 ? -55  DG  J N1    1 
ATOM   9308  C  C2    . DG  J 6 18  ? 20.240  -8.418  41.842 1.00 123.36 ? -55  DG  J C2    1 
ATOM   9309  N  N2    . DG  J 6 18  ? 20.143  -7.163  42.303 1.00 123.38 ? -55  DG  J N2    1 
ATOM   9310  N  N3    . DG  J 6 18  ? 19.160  -9.189  41.829 1.00 122.93 ? -55  DG  J N3    1 
ATOM   9311  C  C4    . DG  J 6 18  ? 19.429  -10.420 41.331 1.00 123.06 ? -55  DG  J C4    1 
ATOM   9312  P  P     . DA  J 6 19  ? 12.914  -11.145 41.148 1.00 117.40 ? -54  DA  J P     1 
ATOM   9313  O  OP1   . DA  J 6 19  ? 11.713  -11.243 42.014 1.00 116.86 ? -54  DA  J OP1   1 
ATOM   9314  O  OP2   . DA  J 6 19  ? 13.036  -12.001 39.944 1.00 116.26 ? -54  DA  J OP2   1 
ATOM   9315  O  "O5'" . DA  J 6 19  ? 13.124  -9.630  40.663 1.00 117.67 ? -54  DA  J "O5'" 1 
ATOM   9316  C  "C5'" . DA  J 6 19  ? 13.104  -8.482  41.541 1.00 116.40 ? -54  DA  J "C5'" 1 
ATOM   9317  C  "C4'" . DA  J 6 19  ? 13.491  -7.198  40.804 1.00 115.29 ? -54  DA  J "C4'" 1 
ATOM   9318  O  "O4'" . DA  J 6 19  ? 14.843  -7.320  40.292 1.00 114.95 ? -54  DA  J "O4'" 1 
ATOM   9319  C  "C3'" . DA  J 6 19  ? 12.684  -6.829  39.563 1.00 114.49 ? -54  DA  J "C3'" 1 
ATOM   9320  O  "O3'" . DA  J 6 19  ? 12.976  -5.493  39.197 1.00 113.34 ? -54  DA  J "O3'" 1 
ATOM   9321  C  "C2'" . DA  J 6 19  ? 13.362  -7.702  38.518 1.00 114.39 ? -54  DA  J "C2'" 1 
ATOM   9322  C  "C1'" . DA  J 6 19  ? 14.802  -7.344  38.876 1.00 114.88 ? -54  DA  J "C1'" 1 
ATOM   9323  N  N9    . DA  J 6 19  ? 15.822  -8.275  38.423 1.00 115.08 ? -54  DA  J N9    1 
ATOM   9324  C  C8    . DA  J 6 19  ? 15.641  -9.485  37.814 1.00 115.33 ? -54  DA  J C8    1 
ATOM   9325  N  N7    . DA  J 6 19  ? 16.758  -10.106 37.521 1.00 115.24 ? -54  DA  J N7    1 
ATOM   9326  C  C5    . DA  J 6 19  ? 17.735  -9.242  37.970 1.00 114.95 ? -54  DA  J C5    1 
ATOM   9327  C  C6    . DA  J 6 19  ? 19.133  -9.327  37.955 1.00 115.13 ? -54  DA  J C6    1 
ATOM   9328  N  N6    . DA  J 6 19  ? 19.779  -10.375 37.437 1.00 115.26 ? -54  DA  J N6    1 
ATOM   9329  N  N1    . DA  J 6 19  ? 19.828  -8.294  38.484 1.00 115.41 ? -54  DA  J N1    1 
ATOM   9330  C  C2    . DA  J 6 19  ? 19.160  -7.249  38.996 1.00 115.33 ? -54  DA  J C2    1 
ATOM   9331  N  N3    . DA  J 6 19  ? 17.842  -7.062  39.068 1.00 115.19 ? -54  DA  J N3    1 
ATOM   9332  C  C4    . DA  J 6 19  ? 17.182  -8.107  38.532 1.00 115.13 ? -54  DA  J C4    1 
ATOM   9333  P  P     . DG  J 6 20  ? 12.188  -4.178  39.641 1.00 112.10 ? -53  DG  J P     1 
ATOM   9334  O  OP1   . DG  J 6 20  ? 12.324  -3.968  41.103 1.00 111.10 ? -53  DG  J OP1   1 
ATOM   9335  O  OP2   . DG  J 6 20  ? 10.856  -4.192  39.006 1.00 111.24 ? -53  DG  J OP2   1 
ATOM   9336  O  "O5'" . DG  J 6 20  ? 13.089  -3.117  38.852 1.00 113.45 ? -53  DG  J "O5'" 1 
ATOM   9337  C  "C5'" . DG  J 6 20  ? 14.515  -3.106  39.020 1.00 114.67 ? -53  DG  J "C5'" 1 
ATOM   9338  C  "C4'" . DG  J 6 20  ? 15.260  -3.027  37.698 1.00 115.78 ? -53  DG  J "C4'" 1 
ATOM   9339  O  "O4'" . DG  J 6 20  ? 15.791  -4.323  37.301 1.00 115.61 ? -53  DG  J "O4'" 1 
ATOM   9340  C  "C3'" . DG  J 6 20  ? 14.446  -2.505  36.512 1.00 117.07 ? -53  DG  J "C3'" 1 
ATOM   9341  O  "O3'" . DG  J 6 20  ? 15.123  -1.335  36.028 1.00 119.90 ? -53  DG  J "O3'" 1 
ATOM   9342  C  "C2'" . DG  J 6 20  ? 14.449  -3.691  35.546 1.00 116.52 ? -53  DG  J "C2'" 1 
ATOM   9343  C  "C1'" . DG  J 6 20  ? 15.787  -4.333  35.889 1.00 115.72 ? -53  DG  J "C1'" 1 
ATOM   9344  N  N9    . DG  J 6 20  ? 15.995  -5.687  35.366 1.00 115.58 ? -53  DG  J N9    1 
ATOM   9345  C  C8    . DG  J 6 20  ? 15.057  -6.524  34.808 1.00 115.45 ? -53  DG  J C8    1 
ATOM   9346  N  N7    . DG  J 6 20  ? 15.534  -7.674  34.423 1.00 115.26 ? -53  DG  J N7    1 
ATOM   9347  C  C5    . DG  J 6 20  ? 16.882  -7.603  34.740 1.00 115.62 ? -53  DG  J C5    1 
ATOM   9348  C  C6    . DG  J 6 20  ? 17.918  -8.557  34.559 1.00 115.67 ? -53  DG  J C6    1 
ATOM   9349  O  O6    . DG  J 6 20  ? 17.849  -9.690  34.065 1.00 115.65 ? -53  DG  J O6    1 
ATOM   9350  N  N1    . DG  J 6 20  ? 19.148  -8.090  35.012 1.00 115.52 ? -53  DG  J N1    1 
ATOM   9351  C  C2    . DG  J 6 20  ? 19.353  -6.857  35.576 1.00 115.37 ? -53  DG  J C2    1 
ATOM   9352  N  N2    . DG  J 6 20  ? 20.609  -6.600  35.959 1.00 115.56 ? -53  DG  J N2    1 
ATOM   9353  N  N3    . DG  J 6 20  ? 18.398  -5.951  35.759 1.00 115.53 ? -53  DG  J N3    1 
ATOM   9354  C  C4    . DG  J 6 20  ? 17.185  -6.385  35.319 1.00 115.77 ? -53  DG  J C4    1 
ATOM   9355  P  P     . DG  J 6 21  ? 14.917  -0.625  34.597 1.00 121.76 ? -52  DG  J P     1 
ATOM   9356  O  OP1   . DG  J 6 21  ? 13.851  0.385   34.796 1.00 121.31 ? -52  DG  J OP1   1 
ATOM   9357  O  OP2   . DG  J 6 21  ? 14.785  -1.643  33.526 1.00 120.97 ? -52  DG  J OP2   1 
ATOM   9358  O  "O5'" . DG  J 6 21  ? 16.325  0.123   34.355 1.00 123.31 ? -52  DG  J "O5'" 1 
ATOM   9359  C  "C5'" . DG  J 6 21  ? 17.600  -0.446  34.746 1.00 126.18 ? -52  DG  J "C5'" 1 
ATOM   9360  C  "C4'" . DG  J 6 21  ? 18.556  -0.777  33.595 1.00 128.02 ? -52  DG  J "C4'" 1 
ATOM   9361  O  "O4'" . DG  J 6 21  ? 18.709  -2.219  33.482 1.00 128.78 ? -52  DG  J "O4'" 1 
ATOM   9362  C  "C3'" . DG  J 6 21  ? 18.185  -0.282  32.189 1.00 129.23 ? -52  DG  J "C3'" 1 
ATOM   9363  O  "O3'" . DG  J 6 21  ? 19.349  0.157   31.463 1.00 129.92 ? -52  DG  J "O3'" 1 
ATOM   9364  C  "C2'" . DG  J 6 21  ? 17.575  -1.527  31.558 1.00 129.61 ? -52  DG  J "C2'" 1 
ATOM   9365  C  "C1'" . DG  J 6 21  ? 18.503  -2.591  32.130 1.00 130.32 ? -52  DG  J "C1'" 1 
ATOM   9366  N  N9    . DG  J 6 21  ? 17.959  -3.945  32.040 1.00 130.72 ? -52  DG  J N9    1 
ATOM   9367  C  C8    . DG  J 6 21  ? 16.675  -4.351  32.333 1.00 130.90 ? -52  DG  J C8    1 
ATOM   9368  N  N7    . DG  J 6 21  ? 16.474  -5.625  32.152 1.00 130.82 ? -52  DG  J N7    1 
ATOM   9369  C  C5    . DG  J 6 21  ? 17.700  -6.094  31.710 1.00 130.77 ? -52  DG  J C5    1 
ATOM   9370  C  C6    . DG  J 6 21  ? 18.089  -7.404  31.355 1.00 130.86 ? -52  DG  J C6    1 
ATOM   9371  O  O6    . DG  J 6 21  ? 17.385  -8.423  31.369 1.00 130.77 ? -52  DG  J O6    1 
ATOM   9372  N  N1    . DG  J 6 21  ? 19.428  -7.467  30.958 1.00 130.80 ? -52  DG  J N1    1 
ATOM   9373  C  C2    . DG  J 6 21  ? 20.280  -6.383  30.912 1.00 130.85 ? -52  DG  J C2    1 
ATOM   9374  N  N2    . DG  J 6 21  ? 21.540  -6.613  30.507 1.00 130.88 ? -52  DG  J N2    1 
ATOM   9375  N  N3    . DG  J 6 21  ? 19.920  -5.149  31.243 1.00 130.76 ? -52  DG  J N3    1 
ATOM   9376  C  C4    . DG  J 6 21  ? 18.625  -5.078  31.633 1.00 130.64 ? -52  DG  J C4    1 
ATOM   9377  P  P     . DC  J 6 22  ? 19.255  1.000   30.095 1.00 130.42 ? -51  DC  J P     1 
ATOM   9378  O  OP1   . DC  J 6 22  ? 18.729  2.336   30.446 1.00 130.13 ? -51  DC  J OP1   1 
ATOM   9379  O  OP2   . DC  J 6 22  ? 18.560  0.201   29.056 1.00 129.72 ? -51  DC  J OP2   1 
ATOM   9380  O  "O5'" . DC  J 6 22  ? 20.795  1.155   29.656 1.00 131.58 ? -51  DC  J "O5'" 1 
ATOM   9381  C  "C5'" . DC  J 6 22  ? 21.781  0.126   29.858 1.00 132.59 ? -51  DC  J "C5'" 1 
ATOM   9382  C  "C4'" . DC  J 6 22  ? 21.959  -0.837  28.683 1.00 133.74 ? -51  DC  J "C4'" 1 
ATOM   9383  O  "O4'" . DC  J 6 22  ? 21.276  -2.087  28.967 1.00 133.28 ? -51  DC  J "O4'" 1 
ATOM   9384  C  "C3'" . DC  J 6 22  ? 21.465  -0.384  27.301 1.00 134.98 ? -51  DC  J "C3'" 1 
ATOM   9385  O  "O3'" . DC  J 6 22  ? 22.603  -0.147  26.421 1.00 137.90 ? -51  DC  J "O3'" 1 
ATOM   9386  C  "C2'" . DC  J 6 22  ? 20.496  -1.489  26.862 1.00 133.95 ? -51  DC  J "C2'" 1 
ATOM   9387  C  "C1'" . DC  J 6 22  ? 20.908  -2.668  27.738 1.00 132.93 ? -51  DC  J "C1'" 1 
ATOM   9388  N  N1    . DC  J 6 22  ? 19.823  -3.694  27.935 1.00 132.75 ? -51  DC  J N1    1 
ATOM   9389  C  C2    . DC  J 6 22  ? 20.050  -5.048  27.605 1.00 132.52 ? -51  DC  J C2    1 
ATOM   9390  O  O2    . DC  J 6 22  ? 21.147  -5.412  27.159 1.00 132.15 ? -51  DC  J O2    1 
ATOM   9391  N  N3    . DC  J 6 22  ? 19.042  -5.942  27.789 1.00 132.49 ? -51  DC  J N3    1 
ATOM   9392  C  C4    . DC  J 6 22  ? 17.861  -5.540  28.273 1.00 132.37 ? -51  DC  J C4    1 
ATOM   9393  N  N4    . DC  J 6 22  ? 16.905  -6.458  28.431 1.00 132.18 ? -51  DC  J N4    1 
ATOM   9394  C  C5    . DC  J 6 22  ? 17.606  -4.177  28.609 1.00 132.25 ? -51  DC  J C5    1 
ATOM   9395  C  C6    . DC  J 6 22  ? 18.604  -3.302  28.429 1.00 132.45 ? -51  DC  J C6    1 
ATOM   9396  P  P     . DC  J 6 23  ? 22.861  -0.784  24.958 1.00 140.17 ? -50  DC  J P     1 
ATOM   9397  O  OP1   . DC  J 6 23  ? 24.148  -0.231  24.480 1.00 139.90 ? -50  DC  J OP1   1 
ATOM   9398  O  OP2   . DC  J 6 23  ? 21.640  -0.610  24.128 1.00 139.93 ? -50  DC  J OP2   1 
ATOM   9399  O  "O5'" . DC  J 6 23  ? 23.058  -2.351  25.265 1.00 141.59 ? -50  DC  J "O5'" 1 
ATOM   9400  C  "C5'" . DC  J 6 23  ? 24.129  -3.122  24.707 1.00 143.33 ? -50  DC  J "C5'" 1 
ATOM   9401  C  "C4'" . DC  J 6 23  ? 23.623  -4.167  23.719 1.00 144.52 ? -50  DC  J "C4'" 1 
ATOM   9402  O  "O4'" . DC  J 6 23  ? 22.418  -4.820  24.218 1.00 144.62 ? -50  DC  J "O4'" 1 
ATOM   9403  C  "C3'" . DC  J 6 23  ? 23.269  -3.632  22.329 1.00 145.45 ? -50  DC  J "C3'" 1 
ATOM   9404  O  "O3'" . DC  J 6 23  ? 23.732  -4.549  21.328 1.00 146.71 ? -50  DC  J "O3'" 1 
ATOM   9405  C  "C2'" . DC  J 6 23  ? 21.746  -3.576  22.383 1.00 145.06 ? -50  DC  J "C2'" 1 
ATOM   9406  C  "C1'" . DC  J 6 23  ? 21.492  -4.873  23.146 1.00 144.71 ? -50  DC  J "C1'" 1 
ATOM   9407  N  N1    . DC  J 6 23  ? 20.072  -5.084  23.617 1.00 144.66 ? -50  DC  J N1    1 
ATOM   9408  C  C2    . DC  J 6 23  ? 19.521  -6.380  23.607 1.00 144.44 ? -50  DC  J C2    1 
ATOM   9409  O  O2    . DC  J 6 23  ? 20.198  -7.345  23.225 1.00 144.30 ? -50  DC  J O2    1 
ATOM   9410  N  N3    . DC  J 6 23  ? 18.240  -6.546  24.027 1.00 144.34 ? -50  DC  J N3    1 
ATOM   9411  C  C4    . DC  J 6 23  ? 17.521  -5.496  24.435 1.00 144.42 ? -50  DC  J C4    1 
ATOM   9412  N  N4    . DC  J 6 23  ? 16.269  -5.724  24.834 1.00 144.39 ? -50  DC  J N4    1 
ATOM   9413  C  C5    . DC  J 6 23  ? 18.053  -4.171  24.450 1.00 144.35 ? -50  DC  J C5    1 
ATOM   9414  C  C6    . DC  J 6 23  ? 19.317  -4.016  24.036 1.00 144.60 ? -50  DC  J C6    1 
ATOM   9415  P  P     . DG  J 6 24  ? 23.638  -4.234  19.755 1.00 147.53 ? -49  DG  J P     1 
ATOM   9416  O  OP1   . DG  J 6 24  ? 24.576  -3.120  19.483 1.00 147.80 ? -49  DG  J OP1   1 
ATOM   9417  O  OP2   . DG  J 6 24  ? 22.223  -4.087  19.349 1.00 146.97 ? -49  DG  J OP2   1 
ATOM   9418  O  "O5'" . DG  J 6 24  ? 24.191  -5.589  19.096 1.00 147.54 ? -49  DG  J "O5'" 1 
ATOM   9419  C  "C5'" . DG  J 6 24  ? 24.055  -6.857  19.748 1.00 147.97 ? -49  DG  J "C5'" 1 
ATOM   9420  C  "C4'" . DG  J 6 24  ? 22.715  -7.527  19.462 1.00 148.50 ? -49  DG  J "C4'" 1 
ATOM   9421  O  "O4'" . DG  J 6 24  ? 21.628  -6.929  20.223 1.00 149.02 ? -49  DG  J "O4'" 1 
ATOM   9422  C  "C3'" . DG  J 6 24  ? 22.238  -7.528  18.010 1.00 148.38 ? -49  DG  J "C3'" 1 
ATOM   9423  O  "O3'" . DG  J 6 24  ? 21.960  -8.871  17.644 1.00 147.97 ? -49  DG  J "O3'" 1 
ATOM   9424  C  "C2'" . DG  J 6 24  ? 20.956  -6.696  18.043 1.00 148.58 ? -49  DG  J "C2'" 1 
ATOM   9425  C  "C1'" . DG  J 6 24  ? 20.461  -7.078  19.435 1.00 148.88 ? -49  DG  J "C1'" 1 
ATOM   9426  N  N9    . DG  J 6 24  ? 19.357  -6.305  20.016 1.00 148.90 ? -49  DG  J N9    1 
ATOM   9427  C  C8    . DG  J 6 24  ? 19.347  -4.963  20.315 1.00 148.82 ? -49  DG  J C8    1 
ATOM   9428  N  N7    . DG  J 6 24  ? 18.231  -4.546  20.842 1.00 148.81 ? -49  DG  J N7    1 
ATOM   9429  C  C5    . DG  J 6 24  ? 17.443  -5.687  20.901 1.00 148.89 ? -49  DG  J C5    1 
ATOM   9430  C  C6    . DG  J 6 24  ? 16.122  -5.854  21.382 1.00 148.77 ? -49  DG  J C6    1 
ATOM   9431  O  O6    . DG  J 6 24  ? 15.377  -4.993  21.863 1.00 148.75 ? -49  DG  J O6    1 
ATOM   9432  N  N1    . DG  J 6 24  ? 15.676  -7.171  21.269 1.00 148.78 ? -49  DG  J N1    1 
ATOM   9433  C  C2    . DG  J 6 24  ? 16.425  -8.204  20.752 1.00 148.81 ? -49  DG  J C2    1 
ATOM   9434  N  N2    . DG  J 6 24  ? 15.834  -9.407  20.721 1.00 148.76 ? -49  DG  J N2    1 
ATOM   9435  N  N3    . DG  J 6 24  ? 17.669  -8.063  20.301 1.00 148.85 ? -49  DG  J N3    1 
ATOM   9436  C  C4    . DG  J 6 24  ? 18.119  -6.782  20.403 1.00 148.94 ? -49  DG  J C4    1 
ATOM   9437  P  P     . DC  J 6 25  ? 22.262  -9.381  16.161 1.00 147.69 ? -48  DC  J P     1 
ATOM   9438  O  OP1   . DC  J 6 25  ? 23.554  -10.106 16.210 1.00 147.27 ? -48  DC  J OP1   1 
ATOM   9439  O  OP2   . DC  J 6 25  ? 22.075  -8.236  15.237 1.00 147.33 ? -48  DC  J OP2   1 
ATOM   9440  O  "O5'" . DC  J 6 25  ? 21.071  -10.412 15.864 1.00 147.09 ? -48  DC  J "O5'" 1 
ATOM   9441  C  "C5'" . DC  J 6 25  ? 20.824  -11.556 16.684 1.00 146.36 ? -48  DC  J "C5'" 1 
ATOM   9442  C  "C4'" . DC  J 6 25  ? 19.328  -11.796 16.837 1.00 145.87 ? -48  DC  J "C4'" 1 
ATOM   9443  O  "O4'" . DC  J 6 25  ? 18.713  -10.640 17.470 1.00 146.02 ? -48  DC  J "O4'" 1 
ATOM   9444  C  "C3'" . DC  J 6 25  ? 18.555  -12.033 15.537 1.00 145.19 ? -48  DC  J "C3'" 1 
ATOM   9445  O  "O3'" . DC  J 6 25  ? 17.727  -13.199 15.616 1.00 143.90 ? -48  DC  J "O3'" 1 
ATOM   9446  C  "C2'" . DC  J 6 25  ? 17.703  -10.776 15.396 1.00 145.50 ? -48  DC  J "C2'" 1 
ATOM   9447  C  "C1'" . DC  J 6 25  ? 17.461  -10.420 16.858 1.00 145.98 ? -48  DC  J "C1'" 1 
ATOM   9448  N  N1    . DC  J 6 25  ? 16.988  -9.013  17.102 1.00 146.28 ? -48  DC  J N1    1 
ATOM   9449  C  C2    . DC  J 6 25  ? 15.633  -8.776  17.406 1.00 146.41 ? -48  DC  J C2    1 
ATOM   9450  O  O2    . DC  J 6 25  ? 14.843  -9.727  17.469 1.00 146.48 ? -48  DC  J O2    1 
ATOM   9451  N  N3    . DC  J 6 25  ? 15.216  -7.499  17.617 1.00 146.17 ? -48  DC  J N3    1 
ATOM   9452  C  C4    . DC  J 6 25  ? 16.087  -6.491  17.544 1.00 146.07 ? -48  DC  J C4    1 
ATOM   9453  N  N4    . DC  J 6 25  ? 15.630  -5.259  17.766 1.00 146.10 ? -48  DC  J N4    1 
ATOM   9454  C  C5    . DC  J 6 25  ? 17.466  -6.703  17.235 1.00 146.19 ? -48  DC  J C5    1 
ATOM   9455  C  C6    . DC  J 6 25  ? 17.869  -7.964  17.025 1.00 146.20 ? -48  DC  J C6    1 
ATOM   9456  P  P     . DT  J 6 26  ? 17.391  -14.063 14.303 1.00 143.01 ? -47  DT  J P     1 
ATOM   9457  O  OP1   . DT  J 6 26  ? 17.986  -15.400 14.518 1.00 143.11 ? -47  DT  J OP1   1 
ATOM   9458  O  OP2   . DT  J 6 26  ? 17.744  -13.272 13.103 1.00 142.67 ? -47  DT  J OP2   1 
ATOM   9459  O  "O5'" . DT  J 6 26  ? 15.796  -14.212 14.281 1.00 141.65 ? -47  DT  J "O5'" 1 
ATOM   9460  C  "C5'" . DT  J 6 26  ? 15.045  -14.659 15.412 1.00 138.83 ? -47  DT  J "C5'" 1 
ATOM   9461  C  "C4'" . DT  J 6 26  ? 13.679  -14.002 15.393 1.00 136.63 ? -47  DT  J "C4'" 1 
ATOM   9462  O  "O4'" . DT  J 6 26  ? 13.822  -12.563 15.531 1.00 136.63 ? -47  DT  J "O4'" 1 
ATOM   9463  C  "C3'" . DT  J 6 26  ? 12.881  -14.209 14.106 1.00 135.18 ? -47  DT  J "C3'" 1 
ATOM   9464  O  "O3'" . DT  J 6 26  ? 11.550  -14.554 14.456 1.00 132.51 ? -47  DT  J "O3'" 1 
ATOM   9465  C  "C2'" . DT  J 6 26  ? 12.939  -12.846 13.414 1.00 135.81 ? -47  DT  J "C2'" 1 
ATOM   9466  C  "C1'" . DT  J 6 26  ? 12.881  -11.970 14.656 1.00 136.70 ? -47  DT  J "C1'" 1 
ATOM   9467  N  N1    . DT  J 6 26  ? 13.124  -10.493 14.480 1.00 136.91 ? -47  DT  J N1    1 
ATOM   9468  C  C2    . DT  J 6 26  ? 12.019  -9.661  14.473 1.00 137.14 ? -47  DT  J C2    1 
ATOM   9469  O  O2    . DT  J 6 26  ? 10.876  -10.062 14.586 1.00 137.15 ? -47  DT  J O2    1 
ATOM   9470  N  N3    . DT  J 6 26  ? 12.295  -8.324  14.328 1.00 137.37 ? -47  DT  J N3    1 
ATOM   9471  C  C4    . DT  J 6 26  ? 13.545  -7.742  14.192 1.00 137.28 ? -47  DT  J C4    1 
ATOM   9472  O  O4    . DT  J 6 26  ? 13.699  -6.530  14.064 1.00 137.16 ? -47  DT  J O4    1 
ATOM   9473  C  C5    . DT  J 6 26  ? 14.659  -8.659  14.210 1.00 137.11 ? -47  DT  J C5    1 
ATOM   9474  C  C7    . DT  J 6 26  ? 16.044  -8.107  14.058 1.00 137.09 ? -47  DT  J C7    1 
ATOM   9475  C  C6    . DT  J 6 26  ? 14.406  -9.975  14.351 1.00 136.87 ? -47  DT  J C6    1 
ATOM   9476  P  P     . DC  J 6 27  ? 10.950  -15.986 14.082 1.00 130.12 ? -46  DC  J P     1 
ATOM   9477  O  OP1   . DC  J 6 27  ? 11.976  -17.008 14.390 1.00 129.98 ? -46  DC  J OP1   1 
ATOM   9478  O  OP2   . DC  J 6 27  ? 10.356  -15.840 12.731 1.00 129.11 ? -46  DC  J OP2   1 
ATOM   9479  O  "O5'" . DC  J 6 27  ? 9.754   -16.224 15.115 1.00 129.13 ? -46  DC  J "O5'" 1 
ATOM   9480  C  "C5'" . DC  J 6 27  ? 9.619   -15.438 16.295 1.00 127.09 ? -46  DC  J "C5'" 1 
ATOM   9481  C  "C4'" . DC  J 6 27  ? 8.548   -14.374 16.121 1.00 125.31 ? -46  DC  J "C4'" 1 
ATOM   9482  O  "O4'" . DC  J 6 27  ? 9.054   -13.226 15.390 1.00 125.46 ? -46  DC  J "O4'" 1 
ATOM   9483  C  "C3'" . DC  J 6 27  ? 7.293   -14.820 15.374 1.00 123.72 ? -46  DC  J "C3'" 1 
ATOM   9484  O  "O3'" . DC  J 6 27  ? 6.212   -14.326 16.107 1.00 121.18 ? -46  DC  J "O3'" 1 
ATOM   9485  C  "C2'" . DC  J 6 27  ? 7.372   -14.089 14.039 1.00 124.31 ? -46  DC  J "C2'" 1 
ATOM   9486  C  "C1'" . DC  J 6 27  ? 8.018   -12.800 14.524 1.00 125.72 ? -46  DC  J "C1'" 1 
ATOM   9487  N  N1    . DC  J 6 27  ? 8.563   -11.909 13.451 1.00 126.48 ? -46  DC  J N1    1 
ATOM   9488  C  C2    . DC  J 6 27  ? 8.115   -10.578 13.371 1.00 126.30 ? -46  DC  J C2    1 
ATOM   9489  O  O2    . DC  J 6 27  ? 7.288   -10.159 14.183 1.00 126.31 ? -46  DC  J O2    1 
ATOM   9490  N  N3    . DC  J 6 27  ? 8.618   -9.773  12.402 1.00 126.27 ? -46  DC  J N3    1 
ATOM   9491  C  C4    . DC  J 6 27  ? 9.519   -10.253 11.539 1.00 126.42 ? -46  DC  J C4    1 
ATOM   9492  N  N4    . DC  J 6 27  ? 9.978   -9.422  10.602 1.00 126.24 ? -46  DC  J N4    1 
ATOM   9493  C  C5    . DC  J 6 27  ? 9.994   -11.602 11.597 1.00 126.64 ? -46  DC  J C5    1 
ATOM   9494  C  C6    . DC  J 6 27  ? 9.494   -12.388 12.561 1.00 126.98 ? -46  DC  J C6    1 
ATOM   9495  P  P     . DA  J 6 28  ? 4.828   -15.100 16.215 1.00 118.80 ? -45  DA  J P     1 
ATOM   9496  O  OP1   . DA  J 6 28  ? 5.016   -16.131 17.256 1.00 118.73 ? -45  DA  J OP1   1 
ATOM   9497  O  OP2   . DA  J 6 28  ? 4.335   -15.449 14.862 1.00 117.75 ? -45  DA  J OP2   1 
ATOM   9498  O  "O5'" . DA  J 6 28  ? 3.874   -13.952 16.792 1.00 118.73 ? -45  DA  J "O5'" 1 
ATOM   9499  C  "C5'" . DA  J 6 28  ? 4.407   -12.839 17.523 1.00 118.13 ? -45  DA  J "C5'" 1 
ATOM   9500  C  "C4'" . DA  J 6 28  ? 3.702   -11.536 17.175 1.00 117.54 ? -45  DA  J "C4'" 1 
ATOM   9501  O  "O4'" . DA  J 6 28  ? 4.231   -10.990 15.945 1.00 117.86 ? -45  DA  J "O4'" 1 
ATOM   9502  C  "C3'" . DA  J 6 28  ? 2.207   -11.629 16.917 1.00 117.40 ? -45  DA  J "C3'" 1 
ATOM   9503  O  "O3'" . DA  J 6 28  ? 1.689   -10.345 17.174 1.00 116.34 ? -45  DA  J "O3'" 1 
ATOM   9504  C  "C2'" . DA  J 6 28  ? 2.163   -11.933 15.426 1.00 118.15 ? -45  DA  J "C2'" 1 
ATOM   9505  C  "C1'" . DA  J 6 28  ? 3.198   -10.911 14.979 1.00 119.23 ? -45  DA  J "C1'" 1 
ATOM   9506  N  N9    . DA  J 6 28  ? 3.830   -11.165 13.698 1.00 119.61 ? -45  DA  J N9    1 
ATOM   9507  C  C8    . DA  J 6 28  ? 3.872   -12.336 12.996 1.00 120.15 ? -45  DA  J C8    1 
ATOM   9508  N  N7    . DA  J 6 28  ? 4.544   -12.257 11.872 1.00 120.61 ? -45  DA  J N7    1 
ATOM   9509  C  C5    . DA  J 6 28  ? 4.977   -10.942 11.845 1.00 120.46 ? -45  DA  J C5    1 
ATOM   9510  C  C6    . DA  J 6 28  ? 5.745   -10.213 10.914 1.00 120.08 ? -45  DA  J C6    1 
ATOM   9511  N  N6    . DA  J 6 28  ? 6.220   -10.751 9.788  1.00 119.94 ? -45  DA  J N6    1 
ATOM   9512  N  N1    . DA  J 6 28  ? 5.996   -8.912  11.183 1.00 119.96 ? -45  DA  J N1    1 
ATOM   9513  C  C2    . DA  J 6 28  ? 5.515   -8.378  12.315 1.00 120.14 ? -45  DA  J C2    1 
ATOM   9514  N  N3    . DA  J 6 28  ? 4.779   -8.959  13.264 1.00 120.29 ? -45  DA  J N3    1 
ATOM   9515  C  C4    . DA  J 6 28  ? 4.545   -10.253 12.965 1.00 120.24 ? -45  DA  J C4    1 
ATOM   9516  P  P     . DA  J 6 29  ? 0.121   -10.056 17.238 1.00 115.66 ? -44  DA  J P     1 
ATOM   9517  O  OP1   . DA  J 6 29  ? -0.210  -10.000 18.677 1.00 115.90 ? -44  DA  J OP1   1 
ATOM   9518  O  OP2   . DA  J 6 29  ? -0.611  -10.936 16.299 1.00 114.79 ? -44  DA  J OP2   1 
ATOM   9519  O  "O5'" . DA  J 6 29  ? 0.035   -8.572  16.663 1.00 116.09 ? -44  DA  J "O5'" 1 
ATOM   9520  C  "C5'" . DA  J 6 29  ? 0.876   -7.559  17.213 1.00 116.31 ? -44  DA  J "C5'" 1 
ATOM   9521  C  "C4'" . DA  J 6 29  ? 1.100   -6.448  16.206 1.00 116.25 ? -44  DA  J "C4'" 1 
ATOM   9522  O  "O4'" . DA  J 6 29  ? 1.832   -6.988  15.079 1.00 116.78 ? -44  DA  J "O4'" 1 
ATOM   9523  C  "C3'" . DA  J 6 29  ? -0.177  -5.808  15.656 1.00 115.84 ? -44  DA  J "C3'" 1 
ATOM   9524  O  "O3'" . DA  J 6 29  ? -0.113  -4.377  15.818 1.00 114.76 ? -44  DA  J "O3'" 1 
ATOM   9525  C  "C2'" . DA  J 6 29  ? -0.247  -6.296  14.205 1.00 116.13 ? -44  DA  J "C2'" 1 
ATOM   9526  C  "C1'" . DA  J 6 29  ? 1.218   -6.569  13.877 1.00 117.12 ? -44  DA  J "C1'" 1 
ATOM   9527  N  N9    . DA  J 6 29  ? 1.462   -7.614  12.883 1.00 117.44 ? -44  DA  J N9    1 
ATOM   9528  C  C8    . DA  J 6 29  ? 0.943   -8.882  12.856 1.00 117.64 ? -44  DA  J C8    1 
ATOM   9529  N  N7    . DA  J 6 29  ? 1.360   -9.606  11.843 1.00 117.73 ? -44  DA  J N7    1 
ATOM   9530  C  C5    . DA  J 6 29  ? 2.212   -8.754  11.159 1.00 117.74 ? -44  DA  J C5    1 
ATOM   9531  C  C6    . DA  J 6 29  ? 2.976   -8.909  9.985  1.00 117.44 ? -44  DA  J C6    1 
ATOM   9532  N  N6    . DA  J 6 29  ? 3.005   -10.038 9.272  1.00 117.48 ? -44  DA  J N6    1 
ATOM   9533  N  N1    . DA  J 6 29  ? 3.722   -7.863  9.573  1.00 117.55 ? -44  DA  J N1    1 
ATOM   9534  C  C2    . DA  J 6 29  ? 3.708   -6.727  10.284 1.00 117.49 ? -44  DA  J C2    1 
ATOM   9535  N  N3    . DA  J 6 29  ? 3.027   -6.460  11.396 1.00 117.50 ? -44  DA  J N3    1 
ATOM   9536  C  C4    . DA  J 6 29  ? 2.291   -7.521  11.786 1.00 117.70 ? -44  DA  J C4    1 
ATOM   9537  P  P     . DT  J 6 30  ? -1.320  -3.387  15.429 1.00 114.59 ? -43  DT  J P     1 
ATOM   9538  O  OP1   . DT  J 6 30  ? -1.501  -2.342  16.462 1.00 113.49 ? -43  DT  J OP1   1 
ATOM   9539  O  OP2   . DT  J 6 30  ? -2.498  -4.168  14.989 1.00 114.04 ? -43  DT  J OP2   1 
ATOM   9540  O  "O5'" . DT  J 6 30  ? -0.659  -2.724  14.134 1.00 117.50 ? -43  DT  J "O5'" 1 
ATOM   9541  C  "C5'" . DT  J 6 30  ? 0.762   -2.463  14.037 1.00 119.36 ? -43  DT  J "C5'" 1 
ATOM   9542  C  "C4'" . DT  J 6 30  ? 1.127   -1.951  12.653 1.00 120.35 ? -43  DT  J "C4'" 1 
ATOM   9543  O  "O4'" . DT  J 6 30  ? 1.514   -3.073  11.826 1.00 120.06 ? -43  DT  J "O4'" 1 
ATOM   9544  C  "C3'" . DT  J 6 30  ? -0.016  -1.238  11.933 1.00 121.69 ? -43  DT  J "C3'" 1 
ATOM   9545  O  "O3'" . DT  J 6 30  ? 0.408   0.047   11.463 1.00 124.31 ? -43  DT  J "O3'" 1 
ATOM   9546  C  "C2'" . DT  J 6 30  ? -0.415  -2.202  10.817 1.00 121.44 ? -43  DT  J "C2'" 1 
ATOM   9547  C  "C1'" . DT  J 6 30  ? 0.867   -2.992  10.576 1.00 121.24 ? -43  DT  J "C1'" 1 
ATOM   9548  N  N1    . DT  J 6 30  ? 0.673   -4.383  10.023 1.00 121.48 ? -43  DT  J N1    1 
ATOM   9549  C  C2    . DT  J 6 30  ? 1.478   -4.855  8.991  1.00 121.68 ? -43  DT  J C2    1 
ATOM   9550  O  O2    . DT  J 6 30  ? 2.382   -4.233  8.451  1.00 121.62 ? -43  DT  J O2    1 
ATOM   9551  N  N3    . DT  J 6 30  ? 1.191   -6.138  8.593  1.00 121.67 ? -43  DT  J N3    1 
ATOM   9552  C  C4    . DT  J 6 30  ? 0.219   -6.987  9.090  1.00 121.45 ? -43  DT  J C4    1 
ATOM   9553  O  O4    . DT  J 6 30  ? 0.063   -8.119  8.640  1.00 121.50 ? -43  DT  J O4    1 
ATOM   9554  C  C5    . DT  J 6 30  ? -0.588  -6.440  10.159 1.00 121.65 ? -43  DT  J C5    1 
ATOM   9555  C  C7    . DT  J 6 30  ? -1.684  -7.254  10.794 1.00 121.61 ? -43  DT  J C7    1 
ATOM   9556  C  C6    . DT  J 6 30  ? -0.318  -5.187  10.564 1.00 121.65 ? -43  DT  J C6    1 
ATOM   9557  P  P     . DT  J 6 31  ? -0.627  1.163   10.935 1.00 126.16 ? -42  DT  J P     1 
ATOM   9558  O  OP1   . DT  J 6 31  ? -0.065  2.493   11.251 1.00 126.15 ? -42  DT  J OP1   1 
ATOM   9559  O  OP2   . DT  J 6 31  ? -2.010  0.834   11.349 1.00 125.99 ? -42  DT  J OP2   1 
ATOM   9560  O  "O5'" . DT  J 6 31  ? -0.525  0.946   9.360  1.00 127.42 ? -42  DT  J "O5'" 1 
ATOM   9561  C  "C5'" . DT  J 6 31  ? 0.763   0.902   8.743  1.00 129.15 ? -42  DT  J "C5'" 1 
ATOM   9562  C  "C4'" . DT  J 6 31  ? 0.648   0.398   7.320  1.00 130.19 ? -42  DT  J "C4'" 1 
ATOM   9563  O  "O4'" . DT  J 6 31  ? 0.583   -1.052  7.331  1.00 129.81 ? -42  DT  J "O4'" 1 
ATOM   9564  C  "C3'" . DT  J 6 31  ? -0.590  0.907   6.578  1.00 131.11 ? -42  DT  J "C3'" 1 
ATOM   9565  O  "O3'" . DT  J 6 31  ? -0.207  1.523   5.352  1.00 133.12 ? -42  DT  J "O3'" 1 
ATOM   9566  C  "C2'" . DT  J 6 31  ? -1.409  -0.357  6.345  1.00 130.60 ? -42  DT  J "C2'" 1 
ATOM   9567  C  "C1'" . DT  J 6 31  ? -0.340  -1.445  6.343  1.00 129.98 ? -42  DT  J "C1'" 1 
ATOM   9568  N  N1    . DT  J 6 31  ? -0.872  -2.803  6.654  1.00 129.85 ? -42  DT  J N1    1 
ATOM   9569  C  C2    . DT  J 6 31  ? -0.477  -3.888  5.888  1.00 129.77 ? -42  DT  J C2    1 
ATOM   9570  O  O2    . DT  J 6 31  ? 0.304   -3.837  4.957  1.00 129.66 ? -42  DT  J O2    1 
ATOM   9571  N  N3    . DT  J 6 31  ? -1.041  -5.078  6.261  1.00 130.02 ? -42  DT  J N3    1 
ATOM   9572  C  C4    . DT  J 6 31  ? -1.938  -5.298  7.291  1.00 130.13 ? -42  DT  J C4    1 
ATOM   9573  O  O4    . DT  J 6 31  ? -2.361  -6.430  7.516  1.00 129.85 ? -42  DT  J O4    1 
ATOM   9574  C  C5    . DT  J 6 31  ? -2.317  -4.120  8.056  1.00 130.07 ? -42  DT  J C5    1 
ATOM   9575  C  C7    . DT  J 6 31  ? -3.286  -4.196  9.203  1.00 129.78 ? -42  DT  J C7    1 
ATOM   9576  C  C6    . DT  J 6 31  ? -1.769  -2.948  7.701  1.00 129.83 ? -42  DT  J C6    1 
ATOM   9577  P  P     . DG  J 6 32  ? -1.134  2.569   4.562  1.00 134.49 ? -41  DG  J P     1 
ATOM   9578  O  OP1   . DG  J 6 32  ? -0.427  3.868   4.640  1.00 134.77 ? -41  DG  J OP1   1 
ATOM   9579  O  OP2   . DG  J 6 32  ? -2.549  2.461   4.997  1.00 134.01 ? -41  DG  J OP2   1 
ATOM   9580  O  "O5'" . DG  J 6 32  ? -1.056  2.026   3.057  1.00 135.91 ? -41  DG  J "O5'" 1 
ATOM   9581  C  "C5'" . DG  J 6 32  ? -0.804  0.642   2.779  1.00 138.27 ? -41  DG  J "C5'" 1 
ATOM   9582  C  "C4'" . DG  J 6 32  ? -1.716  0.048   1.709  1.00 140.18 ? -41  DG  J "C4'" 1 
ATOM   9583  O  "O4'" . DG  J 6 32  ? -2.050  -1.312  2.085  1.00 140.43 ? -41  DG  J "O4'" 1 
ATOM   9584  C  "C3'" . DG  J 6 32  ? -3.038  0.766   1.414  1.00 141.58 ? -41  DG  J "C3'" 1 
ATOM   9585  O  "O3'" . DG  J 6 32  ? -3.157  0.949   -0.027 1.00 143.56 ? -41  DG  J "O3'" 1 
ATOM   9586  C  "C2'" . DG  J 6 32  ? -4.099  -0.106  2.092  1.00 141.48 ? -41  DG  J "C2'" 1 
ATOM   9587  C  "C1'" . DG  J 6 32  ? -3.454  -1.489  2.132  1.00 141.65 ? -41  DG  J "C1'" 1 
ATOM   9588  N  N9    . DG  J 6 32  ? -3.759  -2.278  3.327  1.00 141.85 ? -41  DG  J N9    1 
ATOM   9589  C  C8    . DG  J 6 32  ? -3.730  -1.848  4.631  1.00 141.91 ? -41  DG  J C8    1 
ATOM   9590  N  N7    . DG  J 6 32  ? -4.041  -2.770  5.495  1.00 141.98 ? -41  DG  J N7    1 
ATOM   9591  C  C5    . DG  J 6 32  ? -4.290  -3.893  4.719  1.00 141.91 ? -41  DG  J C5    1 
ATOM   9592  C  C6    . DG  J 6 32  ? -4.674  -5.204  5.101  1.00 141.92 ? -41  DG  J C6    1 
ATOM   9593  O  O6    . DG  J 6 32  ? -4.874  -5.640  6.243  1.00 141.89 ? -41  DG  J O6    1 
ATOM   9594  N  N1    . DG  J 6 32  ? -4.831  -6.053  4.003  1.00 142.03 ? -41  DG  J N1    1 
ATOM   9595  C  C2    . DG  J 6 32  ? -4.641  -5.677  2.692  1.00 141.95 ? -41  DG  J C2    1 
ATOM   9596  N  N2    . DG  J 6 32  ? -4.839  -6.621  1.759  1.00 141.82 ? -41  DG  J N2    1 
ATOM   9597  N  N3    . DG  J 6 32  ? -4.283  -4.450  2.324  1.00 142.13 ? -41  DG  J N3    1 
ATOM   9598  C  C4    . DG  J 6 32  ? -4.122  -3.608  3.382  1.00 141.95 ? -41  DG  J C4    1 
ATOM   9599  P  P     . DG  J 6 33  ? -4.434  0.658   -0.967 1.00 145.22 ? -40  DG  J P     1 
ATOM   9600  O  OP1   . DG  J 6 33  ? -4.127  1.240   -2.293 1.00 145.34 ? -40  DG  J OP1   1 
ATOM   9601  O  OP2   . DG  J 6 33  ? -5.678  1.076   -0.270 1.00 145.51 ? -40  DG  J OP2   1 
ATOM   9602  O  "O5'" . DG  J 6 33  ? -4.420  -0.936  -1.109 1.00 145.68 ? -40  DG  J "O5'" 1 
ATOM   9603  C  "C5'" . DG  J 6 33  ? -4.321  -1.567  -2.383 1.00 146.60 ? -40  DG  J "C5'" 1 
ATOM   9604  C  "C4'" . DG  J 6 33  ? -5.508  -2.486  -2.583 1.00 147.50 ? -40  DG  J "C4'" 1 
ATOM   9605  O  "O4'" . DG  J 6 33  ? -5.720  -3.233  -1.357 1.00 148.00 ? -40  DG  J "O4'" 1 
ATOM   9606  C  "C3'" . DG  J 6 33  ? -6.821  -1.761  -2.886 1.00 147.96 ? -40  DG  J "C3'" 1 
ATOM   9607  O  "O3'" . DG  J 6 33  ? -7.460  -2.386  -4.021 1.00 147.86 ? -40  DG  J "O3'" 1 
ATOM   9608  C  "C2'" . DG  J 6 33  ? -7.589  -1.854  -1.565 1.00 148.24 ? -40  DG  J "C2'" 1 
ATOM   9609  C  "C1'" . DG  J 6 33  ? -7.101  -3.204  -1.060 1.00 148.86 ? -40  DG  J "C1'" 1 
ATOM   9610  N  N9    . DG  J 6 33  ? -7.351  -3.486  0.358  1.00 149.16 ? -40  DG  J N9    1 
ATOM   9611  C  C8    . DG  J 6 33  ? -7.354  -2.606  1.423  1.00 149.29 ? -40  DG  J C8    1 
ATOM   9612  N  N7    . DG  J 6 33  ? -7.624  -3.168  2.571  1.00 149.26 ? -40  DG  J N7    1 
ATOM   9613  C  C5    . DG  J 6 33  ? -7.811  -4.508  2.246  1.00 149.31 ? -40  DG  J C5    1 
ATOM   9614  C  C6    . DG  J 6 33  ? -8.121  -5.613  3.074  1.00 149.20 ? -40  DG  J C6    1 
ATOM   9615  O  O6    . DG  J 6 33  ? -8.296  -5.600  4.298  1.00 149.18 ? -40  DG  J O6    1 
ATOM   9616  N  N1    . DG  J 6 33  ? -8.223  -6.811  2.355  1.00 149.12 ? -40  DG  J N1    1 
ATOM   9617  C  C2    . DG  J 6 33  ? -8.045  -6.920  0.992  1.00 149.03 ? -40  DG  J C2    1 
ATOM   9618  N  N2    . DG  J 6 33  ? -8.179  -8.139  0.454  1.00 149.15 ? -40  DG  J N2    1 
ATOM   9619  N  N3    . DG  J 6 33  ? -7.753  -5.893  0.206  1.00 148.96 ? -40  DG  J N3    1 
ATOM   9620  C  C4    . DG  J 6 33  ? -7.647  -4.723  0.893  1.00 149.23 ? -40  DG  J C4    1 
ATOM   9621  P  P     . DT  J 6 34  ? -9.023  -2.752  -4.133 1.00 147.51 ? -39  DT  J P     1 
ATOM   9622  O  OP1   . DT  J 6 34  ? -9.356  -2.876  -5.574 1.00 147.82 ? -39  DT  J OP1   1 
ATOM   9623  O  OP2   . DT  J 6 34  ? -9.824  -1.842  -3.279 1.00 147.02 ? -39  DT  J OP2   1 
ATOM   9624  O  "O5'" . DT  J 6 34  ? -9.042  -4.209  -3.477 1.00 146.98 ? -39  DT  J "O5'" 1 
ATOM   9625  C  "C5'" . DT  J 6 34  ? -8.406  -5.323  -4.111 1.00 146.03 ? -39  DT  J "C5'" 1 
ATOM   9626  C  "C4'" . DT  J 6 34  ? -9.245  -6.581  -3.933 1.00 145.28 ? -39  DT  J "C4'" 1 
ATOM   9627  O  "O4'" . DT  J 6 34  ? -9.449  -6.848  -2.518 1.00 144.95 ? -39  DT  J "O4'" 1 
ATOM   9628  C  "C3'" . DT  J 6 34  ? -10.646 -6.536  -4.537 1.00 144.78 ? -39  DT  J "C3'" 1 
ATOM   9629  O  "O3'" . DT  J 6 34  ? -11.018 -7.860  -4.917 1.00 144.24 ? -39  DT  J "O3'" 1 
ATOM   9630  C  "C2'" . DT  J 6 34  ? -11.479 -6.017  -3.364 1.00 144.66 ? -39  DT  J "C2'" 1 
ATOM   9631  C  "C1'" . DT  J 6 34  ? -10.835 -6.803  -2.224 1.00 144.58 ? -39  DT  J "C1'" 1 
ATOM   9632  N  N1    . DT  J 6 34  ? -11.008 -6.247  -0.848 1.00 144.40 ? -39  DT  J N1    1 
ATOM   9633  C  C2    . DT  J 6 34  ? -11.321 -7.116  0.180  1.00 144.48 ? -39  DT  J C2    1 
ATOM   9634  O  O2    . DT  J 6 34  ? -11.477 -8.320  0.028  1.00 144.44 ? -39  DT  J O2    1 
ATOM   9635  N  N3    . DT  J 6 34  ? -11.453 -6.516  1.411  1.00 144.38 ? -39  DT  J N3    1 
ATOM   9636  C  C4    . DT  J 6 34  ? -11.298 -5.171  1.707  1.00 144.24 ? -39  DT  J C4    1 
ATOM   9637  O  O4    . DT  J 6 34  ? -11.437 -4.736  2.842  1.00 144.25 ? -39  DT  J O4    1 
ATOM   9638  C  C5    . DT  J 6 34  ? -10.971 -4.319  0.590  1.00 144.33 ? -39  DT  J C5    1 
ATOM   9639  C  C7    . DT  J 6 34  ? -10.783 -2.844  0.791  1.00 144.37 ? -39  DT  J C7    1 
ATOM   9640  C  C6    . DT  J 6 34  ? -10.841 -4.891  -0.617 1.00 144.49 ? -39  DT  J C6    1 
ATOM   9641  P  P     . DC  J 6 35  ? -12.435 -8.187  -5.596 1.00 144.18 ? -38  DC  J P     1 
ATOM   9642  O  OP1   . DC  J 6 35  ? -12.245 -7.952  -7.046 1.00 144.19 ? -38  DC  J OP1   1 
ATOM   9643  O  OP2   . DC  J 6 35  ? -13.528 -7.471  -4.881 1.00 144.10 ? -38  DC  J OP2   1 
ATOM   9644  O  "O5'" . DC  J 6 35  ? -12.619 -9.762  -5.335 1.00 142.34 ? -38  DC  J "O5'" 1 
ATOM   9645  C  "C5'" . DC  J 6 35  ? -12.398 -10.350 -4.040 1.00 139.98 ? -38  DC  J "C5'" 1 
ATOM   9646  C  "C4'" . DC  J 6 35  ? -13.640 -10.426 -3.157 1.00 137.97 ? -38  DC  J "C4'" 1 
ATOM   9647  O  "O4'" . DC  J 6 35  ? -13.496 -9.481  -2.070 1.00 137.72 ? -38  DC  J "O4'" 1 
ATOM   9648  C  "C3'" . DC  J 6 35  ? -14.979 -10.106 -3.828 1.00 136.52 ? -38  DC  J "C3'" 1 
ATOM   9649  O  "O3'" . DC  J 6 35  ? -15.691 -11.339 -4.111 1.00 134.13 ? -38  DC  J "O3'" 1 
ATOM   9650  C  "C2'" . DC  J 6 35  ? -15.666 -9.090  -2.907 1.00 136.97 ? -38  DC  J "C2'" 1 
ATOM   9651  C  "C1'" . DC  J 6 35  ? -14.779 -9.053  -1.660 1.00 137.72 ? -38  DC  J "C1'" 1 
ATOM   9652  N  N1    . DC  J 6 35  ? -14.624 -7.716  -0.965 1.00 137.83 ? -38  DC  J N1    1 
ATOM   9653  C  C2    . DC  J 6 35  ? -14.568 -7.649  0.447  1.00 138.01 ? -38  DC  J C2    1 
ATOM   9654  O  O2    . DC  J 6 35  ? -14.655 -8.677  1.131  1.00 138.03 ? -38  DC  J O2    1 
ATOM   9655  N  N3    . DC  J 6 35  ? -14.418 -6.440  1.051  1.00 137.89 ? -38  DC  J N3    1 
ATOM   9656  C  C4    . DC  J 6 35  ? -14.323 -5.331  0.310  1.00 137.94 ? -38  DC  J C4    1 
ATOM   9657  N  N4    . DC  J 6 35  ? -14.182 -4.171  0.958  1.00 137.81 ? -38  DC  J N4    1 
ATOM   9658  C  C5    . DC  J 6 35  ? -14.375 -5.369  -1.121 1.00 137.97 ? -38  DC  J C5    1 
ATOM   9659  C  C6    . DC  J 6 35  ? -14.521 -6.567  -1.707 1.00 137.91 ? -38  DC  J C6    1 
ATOM   9660  P  P     . DG  J 6 36  ? -16.930 -11.983 -3.316 1.00 132.42 ? -37  DG  J P     1 
ATOM   9661  O  OP1   . DG  J 6 36  ? -17.040 -13.379 -3.791 1.00 132.19 ? -37  DG  J OP1   1 
ATOM   9662  O  OP2   . DG  J 6 36  ? -18.100 -11.081 -3.454 1.00 132.08 ? -37  DG  J OP2   1 
ATOM   9663  O  "O5'" . DG  J 6 36  ? -16.472 -12.042 -1.781 1.00 131.67 ? -37  DG  J "O5'" 1 
ATOM   9664  C  "C5'" . DG  J 6 36  ? -16.764 -13.204 -0.973 1.00 129.75 ? -37  DG  J "C5'" 1 
ATOM   9665  C  "C4'" . DG  J 6 36  ? -17.761 -12.905 0.144  1.00 127.97 ? -37  DG  J "C4'" 1 
ATOM   9666  O  "O4'" . DG  J 6 36  ? -17.581 -11.546 0.620  1.00 127.60 ? -37  DG  J "O4'" 1 
ATOM   9667  C  "C3'" . DG  J 6 36  ? -19.245 -13.002 -0.209 1.00 126.76 ? -37  DG  J "C3'" 1 
ATOM   9668  O  "O3'" . DG  J 6 36  ? -19.980 -13.353 0.945  1.00 125.10 ? -37  DG  J "O3'" 1 
ATOM   9669  C  "C2'" . DG  J 6 36  ? -19.596 -11.572 -0.589 1.00 126.98 ? -37  DG  J "C2'" 1 
ATOM   9670  C  "C1'" . DG  J 6 36  ? -18.795 -10.832 0.477  1.00 127.04 ? -37  DG  J "C1'" 1 
ATOM   9671  N  N9    . DG  J 6 36  ? -18.457 -9.445  0.178  1.00 127.00 ? -37  DG  J N9    1 
ATOM   9672  C  C8    . DG  J 6 36  ? -18.341 -8.834  -1.048 1.00 127.03 ? -37  DG  J C8    1 
ATOM   9673  N  N7    . DG  J 6 36  ? -18.013 -7.574  -0.977 1.00 126.94 ? -37  DG  J N7    1 
ATOM   9674  C  C5    . DG  J 6 36  ? -17.905 -7.340  0.386  1.00 127.05 ? -37  DG  J C5    1 
ATOM   9675  C  C6    . DG  J 6 36  ? -17.578 -6.158  1.090  1.00 127.06 ? -37  DG  J C6    1 
ATOM   9676  O  O6    . DG  J 6 36  ? -17.313 -5.049  0.612  1.00 127.20 ? -37  DG  J O6    1 
ATOM   9677  N  N1    . DG  J 6 36  ? -17.577 -6.341  2.474  1.00 126.86 ? -37  DG  J N1    1 
ATOM   9678  C  C2    . DG  J 6 36  ? -17.863 -7.530  3.103  1.00 126.85 ? -37  DG  J C2    1 
ATOM   9679  N  N2    . DG  J 6 36  ? -17.819 -7.542  4.441  1.00 126.88 ? -37  DG  J N2    1 
ATOM   9680  N  N3    . DG  J 6 36  ? -18.170 -8.644  2.457  1.00 127.05 ? -37  DG  J N3    1 
ATOM   9681  C  C4    . DG  J 6 36  ? -18.170 -8.479  1.108  1.00 127.12 ? -37  DG  J C4    1 
ATOM   9682  P  P     . DT  J 6 37  ? -20.484 -14.850 1.162  1.00 123.98 ? -36  DT  J P     1 
ATOM   9683  O  OP1   . DT  J 6 37  ? -19.287 -15.716 1.274  1.00 123.62 ? -36  DT  J OP1   1 
ATOM   9684  O  OP2   . DT  J 6 37  ? -21.496 -15.087 0.112  1.00 124.26 ? -36  DT  J OP2   1 
ATOM   9685  O  "O5'" . DT  J 6 37  ? -21.267 -14.822 2.569  1.00 122.18 ? -36  DT  J "O5'" 1 
ATOM   9686  C  "C5'" . DT  J 6 37  ? -20.643 -14.400 3.792  1.00 118.72 ? -36  DT  J "C5'" 1 
ATOM   9687  C  "C4'" . DT  J 6 37  ? -21.438 -13.347 4.567  1.00 116.46 ? -36  DT  J "C4'" 1 
ATOM   9688  O  "O4'" . DT  J 6 37  ? -21.074 -12.009 4.129  1.00 116.01 ? -36  DT  J "O4'" 1 
ATOM   9689  C  "C3'" . DT  J 6 37  ? -22.969 -13.414 4.515  1.00 114.79 ? -36  DT  J "C3'" 1 
ATOM   9690  O  "O3'" . DT  J 6 37  ? -23.544 -13.278 5.825  1.00 113.08 ? -36  DT  J "O3'" 1 
ATOM   9691  C  "C2'" . DT  J 6 37  ? -23.333 -12.185 3.674  1.00 115.29 ? -36  DT  J "C2'" 1 
ATOM   9692  C  "C1'" . DT  J 6 37  ? -22.236 -11.209 4.093  1.00 116.04 ? -36  DT  J "C1'" 1 
ATOM   9693  N  N1    . DT  J 6 37  ? -21.929 -10.032 3.199  1.00 116.44 ? -36  DT  J N1    1 
ATOM   9694  C  C2    . DT  J 6 37  ? -21.401 -8.879  3.766  1.00 116.67 ? -36  DT  J C2    1 
ATOM   9695  O  O2    . DT  J 6 37  ? -21.188 -8.737  4.956  1.00 116.94 ? -36  DT  J O2    1 
ATOM   9696  N  N3    . DT  J 6 37  ? -21.134 -7.858  2.889  1.00 116.55 ? -36  DT  J N3    1 
ATOM   9697  C  C4    . DT  J 6 37  ? -21.323 -7.869  1.519  1.00 116.75 ? -36  DT  J C4    1 
ATOM   9698  O  O4    . DT  J 6 37  ? -21.041 -6.890  0.830  1.00 116.66 ? -36  DT  J O4    1 
ATOM   9699  C  C5    . DT  J 6 37  ? -21.867 -9.100  0.976  1.00 116.86 ? -36  DT  J C5    1 
ATOM   9700  C  C7    . DT  J 6 37  ? -22.123 -9.238  -0.497 1.00 116.68 ? -36  DT  J C7    1 
ATOM   9701  C  C6    . DT  J 6 37  ? -22.136 -10.106 1.829  1.00 116.77 ? -36  DT  J C6    1 
ATOM   9702  P  P     . DA  J 6 38  ? -23.459 -14.321 7.050  1.00 111.18 ? -35  DA  J P     1 
ATOM   9703  O  OP1   . DA  J 6 38  ? -22.231 -15.137 6.946  1.00 110.91 ? -35  DA  J OP1   1 
ATOM   9704  O  OP2   . DA  J 6 38  ? -24.800 -14.940 7.176  1.00 110.21 ? -35  DA  J OP2   1 
ATOM   9705  O  "O5'" . DA  J 6 38  ? -23.284 -13.378 8.334  1.00 111.11 ? -35  DA  J "O5'" 1 
ATOM   9706  C  "C5'" . DA  J 6 38  ? -22.117 -12.588 8.560  1.00 110.22 ? -35  DA  J "C5'" 1 
ATOM   9707  C  "C4'" . DA  J 6 38  ? -22.389 -11.368 9.438  1.00 109.77 ? -35  DA  J "C4'" 1 
ATOM   9708  O  "O4'" . DA  J 6 38  ? -22.555 -10.186 8.613  1.00 110.24 ? -35  DA  J "O4'" 1 
ATOM   9709  C  "C3'" . DA  J 6 38  ? -23.606 -11.360 10.360 1.00 109.30 ? -35  DA  J "C3'" 1 
ATOM   9710  O  "O3'" . DA  J 6 38  ? -23.270 -10.565 11.503 1.00 107.84 ? -35  DA  J "O3'" 1 
ATOM   9711  C  "C2'" . DA  J 6 38  ? -24.674 -10.713 9.473  1.00 109.81 ? -35  DA  J "C2'" 1 
ATOM   9712  C  "C1'" . DA  J 6 38  ? -23.863 -9.663  8.718  1.00 110.99 ? -35  DA  J "C1'" 1 
ATOM   9713  N  N9    . DA  J 6 38  ? -24.240 -9.400  7.339  1.00 111.30 ? -35  DA  J N9    1 
ATOM   9714  C  C8    . DA  J 6 38  ? -24.932 -10.213 6.488  1.00 111.97 ? -35  DA  J C8    1 
ATOM   9715  N  N7    . DA  J 6 38  ? -25.101 -9.710  5.285  1.00 112.49 ? -35  DA  J N7    1 
ATOM   9716  C  C5    . DA  J 6 38  ? -24.462 -8.483  5.344  1.00 112.22 ? -35  DA  J C5    1 
ATOM   9717  C  C6    . DA  J 6 38  ? -24.283 -7.449  4.394  1.00 111.91 ? -35  DA  J C6    1 
ATOM   9718  N  N6    . DA  J 6 38  ? -24.746 -7.520  3.144  1.00 111.79 ? -35  DA  J N6    1 
ATOM   9719  N  N1    . DA  J 6 38  ? -23.600 -6.343  4.776  1.00 111.69 ? -35  DA  J N1    1 
ATOM   9720  C  C2    . DA  J 6 38  ? -23.137 -6.281  6.032  1.00 111.95 ? -35  DA  J C2    1 
ATOM   9721  N  N3    . DA  J 6 38  ? -23.240 -7.188  7.012  1.00 112.33 ? -35  DA  J N3    1 
ATOM   9722  C  C4    . DA  J 6 38  ? -23.924 -8.278  6.606  1.00 112.00 ? -35  DA  J C4    1 
ATOM   9723  P  P     . DG  J 6 39  ? -24.186 -10.417 12.810 1.00 107.02 ? -34  DG  J P     1 
ATOM   9724  O  OP1   . DG  J 6 39  ? -23.359 -10.881 13.930 1.00 107.29 ? -34  DG  J OP1   1 
ATOM   9725  O  OP2   . DG  J 6 39  ? -25.532 -10.986 12.590 1.00 107.31 ? -34  DG  J OP2   1 
ATOM   9726  O  "O5'" . DG  J 6 39  ? -24.399 -8.846  12.985 1.00 107.92 ? -34  DG  J "O5'" 1 
ATOM   9727  C  "C5'" . DG  J 6 39  ? -23.661 -7.894  12.218 1.00 108.90 ? -34  DG  J "C5'" 1 
ATOM   9728  C  "C4'" . DG  J 6 39  ? -24.451 -6.620  11.965 1.00 109.50 ? -34  DG  J "C4'" 1 
ATOM   9729  O  "O4'" . DG  J 6 39  ? -24.932 -6.614  10.607 1.00 109.73 ? -34  DG  J "O4'" 1 
ATOM   9730  C  "C3'" . DG  J 6 39  ? -25.718 -6.388  12.782 1.00 110.97 ? -34  DG  J "C3'" 1 
ATOM   9731  O  "O3'" . DG  J 6 39  ? -25.923 -4.976  12.814 1.00 112.88 ? -34  DG  J "O3'" 1 
ATOM   9732  C  "C2'" . DG  J 6 39  ? -26.798 -7.096  11.967 1.00 110.04 ? -34  DG  J "C2'" 1 
ATOM   9733  C  "C1'" . DG  J 6 39  ? -26.353 -6.563  10.615 1.00 110.31 ? -34  DG  J "C1'" 1 
ATOM   9734  N  N9    . DG  J 6 39  ? -26.767 -7.260  9.411  1.00 110.33 ? -34  DG  J N9    1 
ATOM   9735  C  C8    . DG  J 6 39  ? -27.205 -8.550  9.222  1.00 110.49 ? -34  DG  J C8    1 
ATOM   9736  N  N7    . DG  J 6 39  ? -27.451 -8.825  7.969  1.00 110.44 ? -34  DG  J N7    1 
ATOM   9737  C  C5    . DG  J 6 39  ? -27.156 -7.640  7.304  1.00 110.41 ? -34  DG  J C5    1 
ATOM   9738  C  C6    . DG  J 6 39  ? -27.229 -7.299  5.936  1.00 110.29 ? -34  DG  J C6    1 
ATOM   9739  O  O6    . DG  J 6 39  ? -27.578 -8.021  5.001  1.00 110.54 ? -34  DG  J O6    1 
ATOM   9740  N  N1    . DG  J 6 39  ? -26.829 -5.984  5.688  1.00 110.35 ? -34  DG  J N1    1 
ATOM   9741  C  C2    . DG  J 6 39  ? -26.414 -5.095  6.656  1.00 110.38 ? -34  DG  J C2    1 
ATOM   9742  N  N2    . DG  J 6 39  ? -26.067 -3.862  6.256  1.00 110.63 ? -34  DG  J N2    1 
ATOM   9743  N  N3    . DG  J 6 39  ? -26.348 -5.398  7.940  1.00 110.00 ? -34  DG  J N3    1 
ATOM   9744  C  C4    . DG  J 6 39  ? -26.729 -6.675  8.180  1.00 110.15 ? -34  DG  J C4    1 
ATOM   9745  P  P     . DA  J 6 40  ? -26.507 -4.238  14.105 1.00 114.06 ? -33  DA  J P     1 
ATOM   9746  O  OP1   . DA  J 6 40  ? -25.644 -4.571  15.263 1.00 113.47 ? -33  DA  J OP1   1 
ATOM   9747  O  OP2   . DA  J 6 40  ? -27.963 -4.525  14.155 1.00 113.16 ? -33  DA  J OP2   1 
ATOM   9748  O  "O5'" . DA  J 6 40  ? -26.289 -2.690  13.756 1.00 116.17 ? -33  DA  J "O5'" 1 
ATOM   9749  C  "C5'" . DA  J 6 40  ? -26.082 -2.229  12.415 1.00 119.09 ? -33  DA  J "C5'" 1 
ATOM   9750  C  "C4'" . DA  J 6 40  ? -27.322 -1.599  11.782 1.00 121.06 ? -33  DA  J "C4'" 1 
ATOM   9751  O  "O4'" . DA  J 6 40  ? -27.688 -2.406  10.635 1.00 121.30 ? -33  DA  J "O4'" 1 
ATOM   9752  C  "C3'" . DA  J 6 40  ? -28.582 -1.468  12.654 1.00 122.24 ? -33  DA  J "C3'" 1 
ATOM   9753  O  "O3'" . DA  J 6 40  ? -28.815 -0.082  13.049 1.00 124.11 ? -33  DA  J "O3'" 1 
ATOM   9754  C  "C2'" . DA  J 6 40  ? -29.700 -2.136  11.845 1.00 121.81 ? -33  DA  J "C2'" 1 
ATOM   9755  C  "C1'" . DA  J 6 40  ? -29.085 -2.412  10.473 1.00 121.17 ? -33  DA  J "C1'" 1 
ATOM   9756  N  N9    . DA  J 6 40  ? -29.415 -3.713  9.910  1.00 120.78 ? -33  DA  J N9    1 
ATOM   9757  C  C8    . DA  J 6 40  ? -29.322 -4.915  10.541 1.00 120.96 ? -33  DA  J C8    1 
ATOM   9758  N  N7    . DA  J 6 40  ? -29.672 -5.937  9.801  1.00 121.26 ? -33  DA  J N7    1 
ATOM   9759  C  C5    . DA  J 6 40  ? -30.013 -5.363  8.595  1.00 121.09 ? -33  DA  J C5    1 
ATOM   9760  C  C6    . DA  J 6 40  ? -30.473 -5.917  7.384  1.00 121.11 ? -33  DA  J C6    1 
ATOM   9761  N  N6    . DA  J 6 40  ? -30.667 -7.227  7.206  1.00 120.88 ? -33  DA  J N6    1 
ATOM   9762  N  N1    . DA  J 6 40  ? -30.726 -5.063  6.363  1.00 121.35 ? -33  DA  J N1    1 
ATOM   9763  C  C2    . DA  J 6 40  ? -30.533 -3.745  6.544  1.00 121.33 ? -33  DA  J C2    1 
ATOM   9764  N  N3    . DA  J 6 40  ? -30.103 -3.117  7.643  1.00 121.47 ? -33  DA  J N3    1 
ATOM   9765  C  C4    . DA  J 6 40  ? -29.857 -3.989  8.641  1.00 121.06 ? -33  DA  J C4    1 
ATOM   9766  P  P     . DC  J 6 41  ? -29.974 0.906   12.528 1.00 125.02 ? -32  DC  J P     1 
ATOM   9767  O  OP1   . DC  J 6 41  ? -29.558 2.266   12.929 1.00 124.55 ? -32  DC  J OP1   1 
ATOM   9768  O  OP2   . DC  J 6 41  ? -31.290 0.381   12.959 1.00 124.80 ? -32  DC  J OP2   1 
ATOM   9769  O  "O5'" . DC  J 6 41  ? -29.886 0.808   10.933 1.00 126.78 ? -32  DC  J "O5'" 1 
ATOM   9770  C  "C5'" . DC  J 6 41  ? -30.334 1.862   10.086 1.00 128.83 ? -32  DC  J "C5'" 1 
ATOM   9771  C  "C4'" . DC  J 6 41  ? -31.571 1.458   9.302  1.00 130.34 ? -32  DC  J "C4'" 1 
ATOM   9772  O  "O4'" . DC  J 6 41  ? -31.582 0.027   9.026  1.00 130.42 ? -32  DC  J "O4'" 1 
ATOM   9773  C  "C3'" . DC  J 6 41  ? -32.886 1.764   10.014 1.00 131.70 ? -32  DC  J "C3'" 1 
ATOM   9774  O  "O3'" . DC  J 6 41  ? -33.749 2.482   9.128  1.00 133.85 ? -32  DC  J "O3'" 1 
ATOM   9775  C  "C2'" . DC  J 6 41  ? -33.428 0.375   10.352 1.00 131.47 ? -32  DC  J "C2'" 1 
ATOM   9776  C  "C1'" . DC  J 6 41  ? -32.921 -0.413  9.150  1.00 130.87 ? -32  DC  J "C1'" 1 
ATOM   9777  N  N1    . DC  J 6 41  ? -33.008 -1.925  9.242  1.00 130.83 ? -32  DC  J N1    1 
ATOM   9778  C  C2    . DC  J 6 41  ? -33.510 -2.668  8.156  1.00 130.90 ? -32  DC  J C2    1 
ATOM   9779  O  O2    . DC  J 6 41  ? -33.881 -2.095  7.126  1.00 131.15 ? -32  DC  J O2    1 
ATOM   9780  N  N3    . DC  J 6 41  ? -33.580 -4.019  8.253  1.00 130.71 ? -32  DC  J N3    1 
ATOM   9781  C  C4    . DC  J 6 41  ? -33.182 -4.631  9.369  1.00 130.60 ? -32  DC  J C4    1 
ATOM   9782  N  N4    . DC  J 6 41  ? -33.276 -5.960  9.402  1.00 130.83 ? -32  DC  J N4    1 
ATOM   9783  C  C5    . DC  J 6 41  ? -32.671 -3.910  10.488 1.00 130.42 ? -32  DC  J C5    1 
ATOM   9784  C  C6    . DC  J 6 41  ? -32.608 -2.577  10.378 1.00 130.62 ? -32  DC  J C6    1 
ATOM   9785  P  P     . DA  J 6 42  ? -35.070 3.220   9.665  1.00 135.56 ? -31  DA  J P     1 
ATOM   9786  O  OP1   . DA  J 6 42  ? -34.629 4.414   10.419 1.00 135.33 ? -31  DA  J OP1   1 
ATOM   9787  O  OP2   . DA  J 6 42  ? -35.937 2.218   10.323 1.00 135.76 ? -31  DA  J OP2   1 
ATOM   9788  O  "O5'" . DA  J 6 42  ? -35.834 3.691   8.337  1.00 136.70 ? -31  DA  J "O5'" 1 
ATOM   9789  C  "C5'" . DA  J 6 42  ? -35.533 3.159   7.040  1.00 138.30 ? -31  DA  J "C5'" 1 
ATOM   9790  C  "C4'" . DA  J 6 42  ? -36.559 2.136   6.577  1.00 139.40 ? -31  DA  J "C4'" 1 
ATOM   9791  O  "O4'" . DA  J 6 42  ? -36.177 0.842   7.106  1.00 139.65 ? -31  DA  J "O4'" 1 
ATOM   9792  C  "C3'" . DA  J 6 42  ? -38.011 2.361   7.018  1.00 140.51 ? -31  DA  J "C3'" 1 
ATOM   9793  O  "O3'" . DA  J 6 42  ? -38.933 2.140   5.925  1.00 142.22 ? -31  DA  J "O3'" 1 
ATOM   9794  C  "C2'" . DA  J 6 42  ? -38.187 1.327   8.130  1.00 140.27 ? -31  DA  J "C2'" 1 
ATOM   9795  C  "C1'" . DA  J 6 42  ? -37.359 0.200   7.534  1.00 139.94 ? -31  DA  J "C1'" 1 
ATOM   9796  N  N9    . DA  J 6 42  ? -37.025 -0.888  8.444  1.00 139.84 ? -31  DA  J N9    1 
ATOM   9797  C  C8    . DA  J 6 42  ? -36.473 -0.799  9.690  1.00 139.73 ? -31  DA  J C8    1 
ATOM   9798  N  N7    . DA  J 6 42  ? -36.282 -1.958  10.268 1.00 139.66 ? -31  DA  J N7    1 
ATOM   9799  C  C5    . DA  J 6 42  ? -36.742 -2.872  9.336  1.00 139.69 ? -31  DA  J C5    1 
ATOM   9800  C  C6    . DA  J 6 42  ? -36.819 -4.282  9.335  1.00 139.81 ? -31  DA  J C6    1 
ATOM   9801  N  N6    . DA  J 6 42  ? -36.414 -5.037  10.359 1.00 139.71 ? -31  DA  J N6    1 
ATOM   9802  N  N1    . DA  J 6 42  ? -37.335 -4.890  8.241  1.00 139.91 ? -31  DA  J N1    1 
ATOM   9803  C  C2    . DA  J 6 42  ? -37.742 -4.131  7.211  1.00 139.84 ? -31  DA  J C2    1 
ATOM   9804  N  N3    . DA  J 6 42  ? -37.720 -2.800  7.097  1.00 139.74 ? -31  DA  J N3    1 
ATOM   9805  C  C4    . DA  J 6 42  ? -37.204 -2.227  8.203  1.00 139.74 ? -31  DA  J C4    1 
ATOM   9806  P  P     . DG  J 6 43  ? -40.506 2.459   6.079  1.00 143.35 ? -30  DG  J P     1 
ATOM   9807  O  OP1   . DG  J 6 43  ? -40.627 3.926   6.205  1.00 143.18 ? -30  DG  J OP1   1 
ATOM   9808  O  OP2   . DG  J 6 43  ? -41.048 1.593   7.149  1.00 143.24 ? -30  DG  J OP2   1 
ATOM   9809  O  "O5'" . DG  J 6 43  ? -41.188 2.003   4.697  1.00 144.20 ? -30  DG  J "O5'" 1 
ATOM   9810  C  "C5'" . DG  J 6 43  ? -40.913 0.745   4.056  1.00 145.79 ? -30  DG  J "C5'" 1 
ATOM   9811  C  "C4'" . DG  J 6 43  ? -41.710 -0.437  4.599  1.00 146.78 ? -30  DG  J "C4'" 1 
ATOM   9812  O  "O4'" . DG  J 6 43  ? -40.935 -1.071  5.648  1.00 147.17 ? -30  DG  J "O4'" 1 
ATOM   9813  C  "C3'" . DG  J 6 43  ? -43.091 -0.150  5.207  1.00 147.54 ? -30  DG  J "C3'" 1 
ATOM   9814  O  "O3'" . DG  J 6 43  ? -44.120 -0.782  4.436  1.00 148.58 ? -30  DG  J "O3'" 1 
ATOM   9815  C  "C2'" . DG  J 6 43  ? -43.019 -0.726  6.623  1.00 147.35 ? -30  DG  J "C2'" 1 
ATOM   9816  C  "C1'" . DG  J 6 43  ? -41.850 -1.698  6.519  1.00 147.19 ? -30  DG  J "C1'" 1 
ATOM   9817  N  N9    . DG  J 6 43  ? -41.220 -2.021  7.803  1.00 147.12 ? -30  DG  J N9    1 
ATOM   9818  C  C8    . DG  J 6 43  ? -40.763 -1.139  8.753  1.00 146.98 ? -30  DG  J C8    1 
ATOM   9819  N  N7    . DG  J 6 43  ? -40.256 -1.723  9.801  1.00 147.11 ? -30  DG  J N7    1 
ATOM   9820  C  C5    . DG  J 6 43  ? -40.381 -3.082  9.538  1.00 147.07 ? -30  DG  J C5    1 
ATOM   9821  C  C6    . DG  J 6 43  ? -40.004 -4.213  10.310 1.00 147.05 ? -30  DG  J C6    1 
ATOM   9822  O  O6    . DG  J 6 43  ? -39.468 -4.239  11.425 1.00 147.15 ? -30  DG  J O6    1 
ATOM   9823  N  N1    . DG  J 6 43  ? -40.306 -5.417  9.678  1.00 147.02 ? -30  DG  J N1    1 
ATOM   9824  C  C2    . DG  J 6 43  ? -40.900 -5.519  8.444  1.00 147.02 ? -30  DG  J C2    1 
ATOM   9825  N  N2    . DG  J 6 43  ? -41.116 -6.763  7.989  1.00 147.06 ? -30  DG  J N2    1 
ATOM   9826  N  N3    . DG  J 6 43  ? -41.260 -4.470  7.710  1.00 147.06 ? -30  DG  J N3    1 
ATOM   9827  C  C4    . DG  J 6 43  ? -40.974 -3.283  8.311  1.00 147.09 ? -30  DG  J C4    1 
ATOM   9828  P  P     . DC  J 6 44  ? -45.684 -0.649  4.795  1.00 149.22 ? -29  DC  J P     1 
ATOM   9829  O  OP1   . DC  J 6 44  ? -46.425 -0.637  3.513  1.00 149.00 ? -29  DC  J OP1   1 
ATOM   9830  O  OP2   . DC  J 6 44  ? -45.887 0.456   5.761  1.00 148.92 ? -29  DC  J OP2   1 
ATOM   9831  O  "O5'" . DC  J 6 44  ? -45.976 -2.024  5.567  1.00 149.71 ? -29  DC  J "O5'" 1 
ATOM   9832  C  "C5'" . DC  J 6 44  ? -46.283 -3.228  4.850  1.00 150.09 ? -29  DC  J "C5'" 1 
ATOM   9833  C  "C4'" . DC  J 6 44  ? -46.514 -4.409  5.782  1.00 150.05 ? -29  DC  J "C4'" 1 
ATOM   9834  O  "O4'" . DC  J 6 44  ? -45.412 -4.506  6.720  1.00 149.98 ? -29  DC  J "O4'" 1 
ATOM   9835  C  "C3'" . DC  J 6 44  ? -47.805 -4.364  6.607  1.00 150.04 ? -29  DC  J "C3'" 1 
ATOM   9836  O  "O3'" . DC  J 6 44  ? -48.640 -5.491  6.248  1.00 150.12 ? -29  DC  J "O3'" 1 
ATOM   9837  C  "C2'" . DC  J 6 44  ? -47.319 -4.332  8.060  1.00 150.19 ? -29  DC  J "C2'" 1 
ATOM   9838  C  "C1'" . DC  J 6 44  ? -45.919 -4.937  7.965  1.00 150.14 ? -29  DC  J "C1'" 1 
ATOM   9839  N  N1    . DC  J 6 44  ? -44.975 -4.560  9.094  1.00 150.06 ? -29  DC  J N1    1 
ATOM   9840  C  C2    . DC  J 6 44  ? -44.518 -5.548  9.988  1.00 149.87 ? -29  DC  J C2    1 
ATOM   9841  O  O2    . DC  J 6 44  ? -44.884 -6.722  9.851  1.00 149.70 ? -29  DC  J O2    1 
ATOM   9842  N  N3    . DC  J 6 44  ? -43.673 -5.189  10.992 1.00 150.02 ? -29  DC  J N3    1 
ATOM   9843  C  C4    . DC  J 6 44  ? -43.287 -3.915  11.128 1.00 150.08 ? -29  DC  J C4    1 
ATOM   9844  N  N4    . DC  J 6 44  ? -42.458 -3.618  12.133 1.00 150.01 ? -29  DC  J N4    1 
ATOM   9845  C  C5    . DC  J 6 44  ? -43.739 -2.892  10.239 1.00 149.96 ? -29  DC  J C5    1 
ATOM   9846  C  C6    . DC  J 6 44  ? -44.568 -3.257  9.250  1.00 150.09 ? -29  DC  J C6    1 
ATOM   9847  P  P     . DT  J 6 45  ? -49.325 -6.544  7.254  1.00 150.17 ? -28  DT  J P     1 
ATOM   9848  O  OP1   . DT  J 6 45  ? -50.102 -7.487  6.418  1.00 150.04 ? -28  DT  J OP1   1 
ATOM   9849  O  OP2   . DT  J 6 45  ? -50.022 -5.822  8.344  1.00 150.05 ? -28  DT  J OP2   1 
ATOM   9850  O  "O5'" . DT  J 6 45  ? -48.058 -7.299  7.877  1.00 150.06 ? -28  DT  J "O5'" 1 
ATOM   9851  C  "C5'" . DT  J 6 45  ? -47.882 -8.706  7.750  1.00 150.31 ? -28  DT  J "C5'" 1 
ATOM   9852  C  "C4'" . DT  J 6 45  ? -47.911 -9.355  9.124  1.00 150.36 ? -28  DT  J "C4'" 1 
ATOM   9853  O  "O4'" . DT  J 6 45  ? -47.249 -8.486  10.082 1.00 150.63 ? -28  DT  J "O4'" 1 
ATOM   9854  C  "C3'" . DT  J 6 45  ? -49.305 -9.630  9.689  1.00 150.11 ? -28  DT  J "C3'" 1 
ATOM   9855  O  "O3'" . DT  J 6 45  ? -49.331 -10.934 10.271 1.00 149.30 ? -28  DT  J "O3'" 1 
ATOM   9856  C  "C2'" . DT  J 6 45  ? -49.500 -8.539  10.740 1.00 150.42 ? -28  DT  J "C2'" 1 
ATOM   9857  C  "C1'" . DT  J 6 45  ? -48.064 -8.335  11.226 1.00 150.78 ? -28  DT  J "C1'" 1 
ATOM   9858  N  N1    . DT  J 6 45  ? -47.746 -7.010  11.879 1.00 150.93 ? -28  DT  J N1    1 
ATOM   9859  C  C2    . DT  J 6 45  ? -46.627 -6.912  12.695 1.00 150.80 ? -28  DT  J C2    1 
ATOM   9860  O  O2    . DT  J 6 45  ? -45.871 -7.840  12.931 1.00 150.72 ? -28  DT  J O2    1 
ATOM   9861  N  N3    . DT  J 6 45  ? -46.422 -5.667  13.244 1.00 150.79 ? -28  DT  J N3    1 
ATOM   9862  C  C4    . DT  J 6 45  ? -47.202 -4.535  13.062 1.00 150.88 ? -28  DT  J C4    1 
ATOM   9863  O  O4    . DT  J 6 45  ? -46.921 -3.471  13.604 1.00 150.89 ? -28  DT  J O4    1 
ATOM   9864  C  C5    . DT  J 6 45  ? -48.354 -4.699  12.197 1.00 150.86 ? -28  DT  J C5    1 
ATOM   9865  C  C7    . DT  J 6 45  ? -49.282 -3.552  11.912 1.00 150.67 ? -28  DT  J C7    1 
ATOM   9866  C  C6    . DT  J 6 45  ? -48.564 -5.910  11.657 1.00 150.99 ? -28  DT  J C6    1 
ATOM   9867  P  P     . DC  J 6 46  ? -50.524 -11.969 9.990  1.00 148.64 ? -27  DC  J P     1 
ATOM   9868  O  OP1   . DC  J 6 46  ? -49.949 -13.152 9.303  1.00 148.44 ? -27  DC  J OP1   1 
ATOM   9869  O  OP2   . DC  J 6 46  ? -51.646 -11.229 9.363  1.00 148.67 ? -27  DC  J OP2   1 
ATOM   9870  O  "O5'" . DC  J 6 46  ? -50.988 -12.391 11.471 1.00 147.80 ? -27  DC  J "O5'" 1 
ATOM   9871  C  "C5'" . DC  J 6 46  ? -50.104 -13.090 12.359 1.00 145.75 ? -27  DC  J "C5'" 1 
ATOM   9872  C  "C4'" . DC  J 6 46  ? -50.088 -12.509 13.768 1.00 144.15 ? -27  DC  J "C4'" 1 
ATOM   9873  O  "O4'" . DC  J 6 46  ? -49.739 -11.097 13.762 1.00 143.60 ? -27  DC  J "O4'" 1 
ATOM   9874  C  "C3'" . DC  J 6 46  ? -51.403 -12.605 14.545 1.00 143.38 ? -27  DC  J "C3'" 1 
ATOM   9875  O  "O3'" . DC  J 6 46  ? -51.169 -13.257 15.786 1.00 142.84 ? -27  DC  J "O3'" 1 
ATOM   9876  C  "C2'" . DC  J 6 46  ? -51.794 -11.149 14.784 1.00 143.17 ? -27  DC  J "C2'" 1 
ATOM   9877  C  "C1'" . DC  J 6 46  ? -50.403 -10.529 14.874 1.00 142.99 ? -27  DC  J "C1'" 1 
ATOM   9878  N  N1    . DC  J 6 46  ? -50.317 -9.014  14.889 1.00 142.68 ? -27  DC  J N1    1 
ATOM   9879  C  C2    . DC  J 6 46  ? -49.079 -8.374  14.700 1.00 142.44 ? -27  DC  J C2    1 
ATOM   9880  O  O2    . DC  J 6 46  ? -48.055 -9.044  14.507 1.00 142.39 ? -27  DC  J O2    1 
ATOM   9881  N  N3    . DC  J 6 46  ? -49.031 -7.017  14.730 1.00 142.26 ? -27  DC  J N3    1 
ATOM   9882  C  C4    . DC  J 6 46  ? -50.136 -6.302  14.941 1.00 142.38 ? -27  DC  J C4    1 
ATOM   9883  N  N4    . DC  J 6 46  ? -50.017 -4.974  14.963 1.00 142.47 ? -27  DC  J N4    1 
ATOM   9884  C  C5    . DC  J 6 46  ? -51.405 -6.923  15.144 1.00 142.37 ? -27  DC  J C5    1 
ATOM   9885  C  C6    . DC  J 6 46  ? -51.443 -8.262  15.114 1.00 142.56 ? -27  DC  J C6    1 
ATOM   9886  P  P     . DT  J 6 47  ? -51.398 -14.829 15.980 1.00 142.21 ? -26  DT  J P     1 
ATOM   9887  O  OP1   . DT  J 6 47  ? -51.464 -15.464 14.644 1.00 142.57 ? -26  DT  J OP1   1 
ATOM   9888  O  OP2   . DT  J 6 47  ? -52.517 -14.986 16.937 1.00 141.82 ? -26  DT  J OP2   1 
ATOM   9889  O  "O5'" . DT  J 6 47  ? -50.059 -15.327 16.701 1.00 141.86 ? -26  DT  J "O5'" 1 
ATOM   9890  C  "C5'" . DT  J 6 47  ? -48.830 -14.596 16.622 1.00 141.23 ? -26  DT  J "C5'" 1 
ATOM   9891  C  "C4'" . DT  J 6 47  ? -48.404 -14.038 17.974 1.00 140.75 ? -26  DT  J "C4'" 1 
ATOM   9892  O  "O4'" . DT  J 6 47  ? -48.807 -12.647 18.047 1.00 140.60 ? -26  DT  J "O4'" 1 
ATOM   9893  C  "C3'" . DT  J 6 47  ? -48.979 -14.727 19.220 1.00 140.65 ? -26  DT  J "C3'" 1 
ATOM   9894  O  "O3'" . DT  J 6 47  ? -47.962 -14.926 20.219 1.00 140.14 ? -26  DT  J "O3'" 1 
ATOM   9895  C  "C2'" . DT  J 6 47  ? -50.045 -13.743 19.690 1.00 140.82 ? -26  DT  J "C2'" 1 
ATOM   9896  C  "C1'" . DT  J 6 47  ? -49.369 -12.425 19.322 1.00 141.26 ? -26  DT  J "C1'" 1 
ATOM   9897  N  N1    . DT  J 6 47  ? -50.254 -11.209 19.299 1.00 141.43 ? -26  DT  J N1    1 
ATOM   9898  C  C2    . DT  J 6 47  ? -49.682 -9.967  19.504 1.00 141.54 ? -26  DT  J C2    1 
ATOM   9899  O  O2    . DT  J 6 47  ? -48.494 -9.801  19.697 1.00 141.72 ? -26  DT  J O2    1 
ATOM   9900  N  N3    . DT  J 6 47  ? -50.557 -8.909  19.476 1.00 141.71 ? -26  DT  J N3    1 
ATOM   9901  C  C4    . DT  J 6 47  ? -51.926 -8.971  19.270 1.00 141.69 ? -26  DT  J C4    1 
ATOM   9902  O  O4    . DT  J 6 47  ? -52.605 -7.946  19.268 1.00 141.69 ? -26  DT  J O4    1 
ATOM   9903  C  C5    . DT  J 6 47  ? -52.467 -10.306 19.063 1.00 141.46 ? -26  DT  J C5    1 
ATOM   9904  C  C7    . DT  J 6 47  ? -53.928 -10.548 18.823 1.00 141.38 ? -26  DT  J C7    1 
ATOM   9905  C  C6    . DT  J 6 47  ? -51.615 -11.339 19.088 1.00 141.34 ? -26  DT  J C6    1 
ATOM   9906  P  P     . DA  J 6 48  ? -48.035 -16.067 21.353 1.00 139.44 ? -25  DA  J P     1 
ATOM   9907  O  OP1   . DA  J 6 48  ? -46.934 -17.015 21.088 1.00 139.25 ? -25  DA  J OP1   1 
ATOM   9908  O  OP2   . DA  J 6 48  ? -49.412 -16.590 21.486 1.00 139.45 ? -25  DA  J OP2   1 
ATOM   9909  O  "O5'" . DA  J 6 48  ? -47.713 -15.253 22.688 1.00 139.18 ? -25  DA  J "O5'" 1 
ATOM   9910  C  "C5'" . DA  J 6 48  ? -46.498 -14.515 22.819 1.00 139.12 ? -25  DA  J "C5'" 1 
ATOM   9911  C  "C4'" . DA  J 6 48  ? -46.722 -13.246 23.622 1.00 138.77 ? -25  DA  J "C4'" 1 
ATOM   9912  O  "O4'" . DA  J 6 48  ? -47.763 -12.462 22.978 1.00 139.17 ? -25  DA  J "O4'" 1 
ATOM   9913  C  "C3'" . DA  J 6 48  ? -47.173 -13.471 25.067 1.00 138.50 ? -25  DA  J "C3'" 1 
ATOM   9914  O  "O3'" . DA  J 6 48  ? -46.509 -12.565 25.954 1.00 137.62 ? -25  DA  J "O3'" 1 
ATOM   9915  C  "C2'" . DA  J 6 48  ? -48.672 -13.198 24.981 1.00 138.92 ? -25  DA  J "C2'" 1 
ATOM   9916  C  "C1'" . DA  J 6 48  ? -48.653 -12.041 23.990 1.00 139.79 ? -25  DA  J "C1'" 1 
ATOM   9917  N  N9    . DA  J 6 48  ? -49.962 -11.687 23.442 1.00 140.02 ? -25  DA  J N9    1 
ATOM   9918  C  C8    . DA  J 6 48  ? -50.862 -12.517 22.833 1.00 140.07 ? -25  DA  J C8    1 
ATOM   9919  N  N7    . DA  J 6 48  ? -51.959 -11.909 22.447 1.00 140.22 ? -25  DA  J N7    1 
ATOM   9920  C  C5    . DA  J 6 48  ? -51.770 -10.590 22.834 1.00 140.17 ? -25  DA  J C5    1 
ATOM   9921  C  C6    . DA  J 6 48  ? -52.569 -9.428  22.714 1.00 140.09 ? -25  DA  J C6    1 
ATOM   9922  N  N6    . DA  J 6 48  ? -53.778 -9.418  22.141 1.00 139.91 ? -25  DA  J N6    1 
ATOM   9923  N  N1    . DA  J 6 48  ? -52.077 -8.268  23.205 1.00 140.11 ? -25  DA  J N1    1 
ATOM   9924  C  C2    . DA  J 6 48  ? -50.867 -8.273  23.779 1.00 139.98 ? -25  DA  J C2    1 
ATOM   9925  N  N3    . DA  J 6 48  ? -50.028 -9.296  23.948 1.00 139.82 ? -25  DA  J N3    1 
ATOM   9926  C  C4    . DA  J 6 48  ? -50.540 -10.436 23.450 1.00 139.97 ? -25  DA  J C4    1 
ATOM   9927  P  P     . DG  J 6 49  ? -46.552 -12.727 27.554 1.00 137.32 ? -24  DG  J P     1 
ATOM   9928  O  OP1   . DG  J 6 49  ? -45.559 -13.760 27.909 1.00 137.67 ? -24  DG  J OP1   1 
ATOM   9929  O  OP2   . DG  J 6 49  ? -47.945 -12.879 28.023 1.00 137.28 ? -24  DG  J OP2   1 
ATOM   9930  O  "O5'" . DG  J 6 49  ? -46.040 -11.308 28.080 1.00 137.14 ? -24  DG  J "O5'" 1 
ATOM   9931  C  "C5'" . DG  J 6 49  ? -46.007 -10.163 27.221 1.00 136.81 ? -24  DG  J "C5'" 1 
ATOM   9932  C  "C4'" . DG  J 6 49  ? -46.985 -9.086  27.662 1.00 136.18 ? -24  DG  J "C4'" 1 
ATOM   9933  O  "O4'" . DG  J 6 49  ? -48.205 -9.156  26.876 1.00 136.39 ? -24  DG  J "O4'" 1 
ATOM   9934  C  "C3'" . DG  J 6 49  ? -47.402 -9.145  29.125 1.00 135.52 ? -24  DG  J "C3'" 1 
ATOM   9935  O  "O3'" . DG  J 6 49  ? -47.301 -7.849  29.678 1.00 134.52 ? -24  DG  J "O3'" 1 
ATOM   9936  C  "C2'" . DG  J 6 49  ? -48.847 -9.627  29.064 1.00 136.20 ? -24  DG  J "C2'" 1 
ATOM   9937  C  "C1'" . DG  J 6 49  ? -49.328 -9.079  27.727 1.00 136.99 ? -24  DG  J "C1'" 1 
ATOM   9938  N  N9    . DG  J 6 49  ? -50.415 -9.866  27.146 1.00 137.17 ? -24  DG  J N9    1 
ATOM   9939  C  C8    . DG  J 6 49  ? -50.372 -11.200 26.838 1.00 137.29 ? -24  DG  J C8    1 
ATOM   9940  N  N7    . DG  J 6 49  ? -51.473 -11.665 26.329 1.00 137.28 ? -24  DG  J N7    1 
ATOM   9941  C  C5    . DG  J 6 49  ? -52.318 -10.569 26.302 1.00 137.26 ? -24  DG  J C5    1 
ATOM   9942  C  C6    . DG  J 6 49  ? -53.660 -10.469 25.852 1.00 137.32 ? -24  DG  J C6    1 
ATOM   9943  O  O6    . DG  J 6 49  ? -54.382 -11.358 25.380 1.00 137.23 ? -24  DG  J O6    1 
ATOM   9944  N  N1    . DG  J 6 49  ? -54.165 -9.177  25.991 1.00 137.51 ? -24  DG  J N1    1 
ATOM   9945  C  C2    . DG  J 6 49  ? -53.451 -8.113  26.502 1.00 137.63 ? -24  DG  J C2    1 
ATOM   9946  N  N2    . DG  J 6 49  ? -54.106 -6.943  26.555 1.00 137.47 ? -24  DG  J N2    1 
ATOM   9947  N  N3    . DG  J 6 49  ? -52.190 -8.194  26.933 1.00 137.57 ? -24  DG  J N3    1 
ATOM   9948  C  C4    . DG  J 6 49  ? -51.684 -9.450  26.804 1.00 137.24 ? -24  DG  J C4    1 
ATOM   9949  P  P     . DC  J 6 50  ? -47.185 -7.631  31.256 1.00 133.74 ? -23  DC  J P     1 
ATOM   9950  O  OP1   . DC  J 6 50  ? -45.787 -7.925  31.622 1.00 133.41 ? -23  DC  J OP1   1 
ATOM   9951  O  OP2   . DC  J 6 50  ? -48.297 -8.361  31.910 1.00 133.46 ? -23  DC  J OP2   1 
ATOM   9952  O  "O5'" . DC  J 6 50  ? -47.465 -6.065  31.464 1.00 134.28 ? -23  DC  J "O5'" 1 
ATOM   9953  C  "C5'" . DC  J 6 50  ? -47.923 -5.223  30.391 1.00 135.23 ? -23  DC  J "C5'" 1 
ATOM   9954  C  "C4'" . DC  J 6 50  ? -49.419 -4.906  30.404 1.00 135.63 ? -23  DC  J "C4'" 1 
ATOM   9955  O  "O4'" . DC  J 6 50  ? -50.210 -5.970  29.793 1.00 135.63 ? -23  DC  J "O4'" 1 
ATOM   9956  C  "C3'" . DC  J 6 50  ? -50.042 -4.628  31.773 1.00 135.71 ? -23  DC  J "C3'" 1 
ATOM   9957  O  "O3'" . DC  J 6 50  ? -50.427 -3.253  31.831 1.00 136.30 ? -23  DC  J "O3'" 1 
ATOM   9958  C  "C2'" . DC  J 6 50  ? -51.242 -5.574  31.823 1.00 135.65 ? -23  DC  J "C2'" 1 
ATOM   9959  C  "C1'" . DC  J 6 50  ? -51.502 -5.871  30.348 1.00 135.90 ? -23  DC  J "C1'" 1 
ATOM   9960  N  N1    . DC  J 6 50  ? -52.350 -7.109  30.113 1.00 136.16 ? -23  DC  J N1    1 
ATOM   9961  C  C2    . DC  J 6 50  ? -53.680 -6.986  29.660 1.00 136.04 ? -23  DC  J C2    1 
ATOM   9962  O  O2    . DC  J 6 50  ? -54.155 -5.866  29.431 1.00 136.27 ? -23  DC  J O2    1 
ATOM   9963  N  N3    . DC  J 6 50  ? -54.431 -8.106  29.469 1.00 135.73 ? -23  DC  J N3    1 
ATOM   9964  C  C4    . DC  J 6 50  ? -53.914 -9.309  29.718 1.00 135.90 ? -23  DC  J C4    1 
ATOM   9965  N  N4    . DC  J 6 50  ? -54.687 -10.376 29.517 1.00 136.06 ? -23  DC  J N4    1 
ATOM   9966  C  C5    . DC  J 6 50  ? -52.575 -9.466  30.185 1.00 136.32 ? -23  DC  J C5    1 
ATOM   9967  C  C6    . DC  J 6 50  ? -51.842 -8.356  30.370 1.00 136.46 ? -23  DC  J C6    1 
ATOM   9968  P  P     . DA  J 6 51  ? -50.926 -2.533  33.174 1.00 136.90 ? -22  DA  J P     1 
ATOM   9969  O  OP1   . DA  J 6 51  ? -49.940 -1.481  33.496 1.00 136.52 ? -22  DA  J OP1   1 
ATOM   9970  O  OP2   . DA  J 6 51  ? -51.278 -3.555  34.184 1.00 136.58 ? -22  DA  J OP2   1 
ATOM   9971  O  "O5'" . DA  J 6 51  ? -52.291 -1.823  32.728 1.00 138.96 ? -22  DA  J "O5'" 1 
ATOM   9972  C  "C5'" . DA  J 6 51  ? -53.104 -2.385  31.693 1.00 141.79 ? -22  DA  J "C5'" 1 
ATOM   9973  C  "C4'" . DA  J 6 51  ? -54.592 -2.318  31.997 1.00 143.78 ? -22  DA  J "C4'" 1 
ATOM   9974  O  "O4'" . DA  J 6 51  ? -55.260 -3.486  31.450 1.00 144.33 ? -22  DA  J "O4'" 1 
ATOM   9975  C  "C3'" . DA  J 6 51  ? -54.997 -2.291  33.463 1.00 145.12 ? -22  DA  J "C3'" 1 
ATOM   9976  O  "O3'" . DA  J 6 51  ? -56.152 -1.498  33.569 1.00 147.23 ? -22  DA  J "O3'" 1 
ATOM   9977  C  "C2'" . DA  J 6 51  ? -55.354 -3.743  33.742 1.00 145.24 ? -22  DA  J "C2'" 1 
ATOM   9978  C  "C1'" . DA  J 6 51  ? -56.087 -4.055  32.446 1.00 145.17 ? -22  DA  J "C1'" 1 
ATOM   9979  N  N9    . DA  J 6 51  ? -56.259 -5.474  32.151 1.00 145.37 ? -22  DA  J N9    1 
ATOM   9980  C  C8    . DA  J 6 51  ? -55.403 -6.486  32.483 1.00 145.45 ? -22  DA  J C8    1 
ATOM   9981  N  N7    . DA  J 6 51  ? -55.801 -7.670  32.085 1.00 145.85 ? -22  DA  J N7    1 
ATOM   9982  C  C5    . DA  J 6 51  ? -57.000 -7.423  31.435 1.00 145.71 ? -22  DA  J C5    1 
ATOM   9983  C  C6    . DA  J 6 51  ? -57.926 -8.276  30.788 1.00 145.44 ? -22  DA  J C6    1 
ATOM   9984  N  N6    . DA  J 6 51  ? -57.760 -9.601  30.686 1.00 145.19 ? -22  DA  J N6    1 
ATOM   9985  N  N1    . DA  J 6 51  ? -59.031 -7.709  30.249 1.00 145.42 ? -22  DA  J N1    1 
ATOM   9986  C  C2    . DA  J 6 51  ? -59.193 -6.379  30.355 1.00 145.53 ? -22  DA  J C2    1 
ATOM   9987  N  N3    . DA  J 6 51  ? -58.392 -5.480  30.938 1.00 145.50 ? -22  DA  J N3    1 
ATOM   9988  C  C4    . DA  J 6 51  ? -57.302 -6.069  31.469 1.00 145.58 ? -22  DA  J C4    1 
ATOM   9989  P  P     . DC  J 6 52  ? -56.208 -0.282  34.592 1.00 149.21 ? -21  DC  J P     1 
ATOM   9990  O  OP1   . DC  J 6 52  ? -55.948 0.965   33.835 1.00 149.18 ? -21  DC  J OP1   1 
ATOM   9991  O  OP2   . DC  J 6 52  ? -55.372 -0.634  35.764 1.00 149.35 ? -21  DC  J OP2   1 
ATOM   9992  O  "O5'" . DC  J 6 52  ? -57.738 -0.304  35.055 1.00 150.78 ? -21  DC  J "O5'" 1 
ATOM   9993  C  "C5'" . DC  J 6 52  ? -58.765 -0.334  34.079 1.00 153.34 ? -21  DC  J "C5'" 1 
ATOM   9994  C  "C4'" . DC  J 6 52  ? -59.752 -1.452  34.348 1.00 155.42 ? -21  DC  J "C4'" 1 
ATOM   9995  O  "O4'" . DC  J 6 52  ? -59.213 -2.722  33.905 1.00 155.74 ? -21  DC  J "O4'" 1 
ATOM   9996  C  "C3'" . DC  J 6 52  ? -60.131 -1.684  35.814 1.00 156.72 ? -21  DC  J "C3'" 1 
ATOM   9997  O  "O3'" . DC  J 6 52  ? -61.303 -0.894  36.159 1.00 158.50 ? -21  DC  J "O3'" 1 
ATOM   9998  C  "C2'" . DC  J 6 52  ? -60.301 -3.206  35.902 1.00 156.66 ? -21  DC  J "C2'" 1 
ATOM   9999  C  "C1'" . DC  J 6 52  ? -60.095 -3.670  34.462 1.00 156.27 ? -21  DC  J "C1'" 1 
ATOM   10000 N  N1    . DC  J 6 52  ? -59.563 -5.066  34.349 1.00 156.36 ? -21  DC  J N1    1 
ATOM   10001 C  C2    . DC  J 6 52  ? -60.306 -6.033  33.649 1.00 156.44 ? -21  DC  J C2    1 
ATOM   10002 O  O2    . DC  J 6 52  ? -61.383 -5.725  33.121 1.00 156.39 ? -21  DC  J O2    1 
ATOM   10003 N  N3    . DC  J 6 52  ? -59.813 -7.298  33.563 1.00 156.44 ? -21  DC  J N3    1 
ATOM   10004 C  C4    . DC  J 6 52  ? -58.649 -7.614  34.140 1.00 156.33 ? -21  DC  J C4    1 
ATOM   10005 N  N4    . DC  J 6 52  ? -58.222 -8.875  34.020 1.00 156.20 ? -21  DC  J N4    1 
ATOM   10006 C  C5    . DC  J 6 52  ? -57.880 -6.648  34.861 1.00 156.43 ? -21  DC  J C5    1 
ATOM   10007 C  C6    . DC  J 6 52  ? -58.372 -5.403  34.940 1.00 156.48 ? -21  DC  J C6    1 
ATOM   10008 P  P     . DC  J 6 53  ? -62.711 -1.446  36.723 1.00 159.91 ? -20  DC  J P     1 
ATOM   10009 O  OP1   . DC  J 6 53  ? -63.611 -0.274  36.846 1.00 159.67 ? -20  DC  J OP1   1 
ATOM   10010 O  OP2   . DC  J 6 53  ? -62.457 -2.280  37.923 1.00 159.92 ? -20  DC  J OP2   1 
ATOM   10011 O  "O5'" . DC  J 6 53  ? -63.250 -2.406  35.553 1.00 160.59 ? -20  DC  J "O5'" 1 
ATOM   10012 C  "C5'" . DC  J 6 53  ? -64.646 -2.578  35.308 1.00 161.79 ? -20  DC  J "C5'" 1 
ATOM   10013 C  "C4'" . DC  J 6 53  ? -65.097 -3.989  35.638 1.00 163.01 ? -20  DC  J "C4'" 1 
ATOM   10014 O  "O4'" . DC  J 6 53  ? -64.035 -4.941  35.348 1.00 162.97 ? -20  DC  J "O4'" 1 
ATOM   10015 C  "C3'" . DC  J 6 53  ? -65.480 -4.219  37.103 1.00 164.13 ? -20  DC  J "C3'" 1 
ATOM   10016 O  "O3'" . DC  J 6 53  ? -66.759 -4.863  37.197 1.00 166.06 ? -20  DC  J "O3'" 1 
ATOM   10017 C  "C2'" . DC  J 6 53  ? -64.372 -5.138  37.610 1.00 163.57 ? -20  DC  J "C2'" 1 
ATOM   10018 C  "C1'" . DC  J 6 53  ? -64.149 -5.940  36.335 1.00 162.90 ? -20  DC  J "C1'" 1 
ATOM   10019 N  N1    . DC  J 6 53  ? -62.979 -6.874  36.359 1.00 162.60 ? -20  DC  J N1    1 
ATOM   10020 C  C2    . DC  J 6 53  ? -63.159 -8.190  35.898 1.00 162.44 ? -20  DC  J C2    1 
ATOM   10021 O  O2    . DC  J 6 53  ? -64.267 -8.539  35.470 1.00 162.44 ? -20  DC  J O2    1 
ATOM   10022 N  N3    . DC  J 6 53  ? -62.109 -9.051  35.927 1.00 162.32 ? -20  DC  J N3    1 
ATOM   10023 C  C4    . DC  J 6 53  ? -60.928 -8.641  36.395 1.00 162.54 ? -20  DC  J C4    1 
ATOM   10024 N  N4    . DC  J 6 53  ? -59.926 -9.524  36.403 1.00 162.48 ? -20  DC  J N4    1 
ATOM   10025 C  C5    . DC  J 6 53  ? -60.724 -7.308  36.876 1.00 162.53 ? -20  DC  J C5    1 
ATOM   10026 C  C6    . DC  J 6 53  ? -61.765 -6.466  36.840 1.00 162.47 ? -20  DC  J C6    1 
ATOM   10027 P  P     . DG  J 6 54  ? -67.611 -4.801  38.556 1.00 167.41 ? -19  DG  J P     1 
ATOM   10028 O  OP1   . DG  J 6 54  ? -68.254 -3.468  38.579 1.00 167.51 ? -19  DG  J OP1   1 
ATOM   10029 O  OP2   . DG  J 6 54  ? -66.744 -5.210  39.684 1.00 167.46 ? -19  DG  J OP2   1 
ATOM   10030 O  "O5'" . DG  J 6 54  ? -68.746 -5.927  38.400 1.00 168.23 ? -19  DG  J "O5'" 1 
ATOM   10031 C  "C5'" . DG  J 6 54  ? -68.553 -7.149  37.667 1.00 169.37 ? -19  DG  J "C5'" 1 
ATOM   10032 C  "C4'" . DG  J 6 54  ? -68.288 -8.378  38.537 1.00 170.10 ? -19  DG  J "C4'" 1 
ATOM   10033 O  "O4'" . DG  J 6 54  ? -66.872 -8.478  38.840 1.00 170.24 ? -19  DG  J "O4'" 1 
ATOM   10034 C  "C3'" . DG  J 6 54  ? -69.000 -8.536  39.886 1.00 170.56 ? -19  DG  J "C3'" 1 
ATOM   10035 O  "O3'" . DG  J 6 54  ? -69.394 -9.925  40.020 1.00 171.27 ? -19  DG  J "O3'" 1 
ATOM   10036 C  "C2'" . DG  J 6 54  ? -67.912 -8.122  40.886 1.00 170.35 ? -19  DG  J "C2'" 1 
ATOM   10037 C  "C1'" . DG  J 6 54  ? -66.711 -8.781  40.213 1.00 170.13 ? -19  DG  J "C1'" 1 
ATOM   10038 N  N9    . DG  J 6 54  ? -65.356 -8.357  40.568 1.00 170.11 ? -19  DG  J N9    1 
ATOM   10039 C  C8    . DG  J 6 54  ? -64.927 -7.280  41.311 1.00 170.08 ? -19  DG  J C8    1 
ATOM   10040 N  N7    . DG  J 6 54  ? -63.625 -7.204  41.408 1.00 170.02 ? -19  DG  J N7    1 
ATOM   10041 C  C5    . DG  J 6 54  ? -63.160 -8.295  40.681 1.00 170.01 ? -19  DG  J C5    1 
ATOM   10042 C  C6    . DG  J 6 54  ? -61.839 -8.749  40.418 1.00 169.99 ? -19  DG  J C6    1 
ATOM   10043 O  O6    . DG  J 6 54  ? -60.768 -8.255  40.794 1.00 170.04 ? -19  DG  J O6    1 
ATOM   10044 N  N1    . DG  J 6 54  ? -61.820 -9.904  39.632 1.00 170.03 ? -19  DG  J N1    1 
ATOM   10045 C  C2    . DG  J 6 54  ? -62.943 -10.545 39.156 1.00 170.07 ? -19  DG  J C2    1 
ATOM   10046 N  N2    . DG  J 6 54  ? -62.755 -11.643 38.414 1.00 170.05 ? -19  DG  J N2    1 
ATOM   10047 N  N3    . DG  J 6 54  ? -64.180 -10.132 39.394 1.00 170.10 ? -19  DG  J N3    1 
ATOM   10048 C  C4    . DG  J 6 54  ? -64.215 -9.008  40.158 1.00 170.09 ? -19  DG  J C4    1 
ATOM   10049 P  P     . DC  J 6 55  ? -70.443 -10.460 41.119 1.00 171.60 ? -18  DC  J P     1 
ATOM   10050 O  OP1   . DC  J 6 55  ? -71.665 -9.637  40.976 1.00 171.69 ? -18  DC  J OP1   1 
ATOM   10051 O  OP2   . DC  J 6 55  ? -69.747 -10.526 42.427 1.00 171.54 ? -18  DC  J OP2   1 
ATOM   10052 O  "O5'" . DC  J 6 55  ? -70.799 -11.965 40.674 1.00 170.93 ? -18  DC  J "O5'" 1 
ATOM   10053 C  "C5'" . DC  J 6 55  ? -69.796 -12.921 40.326 1.00 170.07 ? -18  DC  J "C5'" 1 
ATOM   10054 C  "C4'" . DC  J 6 55  ? -69.684 -14.080 41.311 1.00 169.71 ? -18  DC  J "C4'" 1 
ATOM   10055 O  "O4'" . DC  J 6 55  ? -68.282 -14.276 41.629 1.00 169.76 ? -18  DC  J "O4'" 1 
ATOM   10056 C  "C3'" . DC  J 6 55  ? -70.393 -13.976 42.663 1.00 169.71 ? -18  DC  J "C3'" 1 
ATOM   10057 O  "O3'" . DC  J 6 55  ? -70.815 -15.285 43.082 1.00 169.60 ? -18  DC  J "O3'" 1 
ATOM   10058 C  "C2'" . DC  J 6 55  ? -69.308 -13.400 43.569 1.00 169.55 ? -18  DC  J "C2'" 1 
ATOM   10059 C  "C1'" . DC  J 6 55  ? -68.033 -14.023 43.002 1.00 169.49 ? -18  DC  J "C1'" 1 
ATOM   10060 N  N1    . DC  J 6 55  ? -66.802 -13.160 43.133 1.00 169.29 ? -18  DC  J N1    1 
ATOM   10061 C  C2    . DC  J 6 55  ? -65.563 -13.588 42.617 1.00 169.09 ? -18  DC  J C2    1 
ATOM   10062 O  O2    . DC  J 6 55  ? -65.460 -14.680 42.044 1.00 168.98 ? -18  DC  J O2    1 
ATOM   10063 N  N3    . DC  J 6 55  ? -64.485 -12.777 42.760 1.00 169.11 ? -18  DC  J N3    1 
ATOM   10064 C  C4    . DC  J 6 55  ? -64.601 -11.598 43.379 1.00 169.20 ? -18  DC  J C4    1 
ATOM   10065 N  N4    . DC  J 6 55  ? -63.509 -10.839 43.490 1.00 169.24 ? -18  DC  J N4    1 
ATOM   10066 C  C5    . DC  J 6 55  ? -65.844 -11.143 43.910 1.00 169.07 ? -18  DC  J C5    1 
ATOM   10067 C  C6    . DC  J 6 55  ? -66.900 -11.948 43.765 1.00 169.14 ? -18  DC  J C6    1 
ATOM   10068 P  P     . DT  J 6 56  ? -71.553 -15.599 44.480 1.00 169.41 ? -17  DT  J P     1 
ATOM   10069 O  OP1   . DT  J 6 56  ? -72.991 -15.304 44.314 1.00 169.54 ? -17  DT  J OP1   1 
ATOM   10070 O  OP2   . DT  J 6 56  ? -70.820 -14.960 45.598 1.00 169.24 ? -17  DT  J OP2   1 
ATOM   10071 O  "O5'" . DT  J 6 56  ? -71.364 -17.187 44.607 1.00 168.97 ? -17  DT  J "O5'" 1 
ATOM   10072 C  "C5'" . DT  J 6 56  ? -70.375 -17.887 43.835 1.00 168.53 ? -17  DT  J "C5'" 1 
ATOM   10073 C  "C4'" . DT  J 6 56  ? -69.075 -18.154 44.593 1.00 168.05 ? -17  DT  J "C4'" 1 
ATOM   10074 O  "O4'" . DT  J 6 56  ? -68.258 -16.961 44.672 1.00 167.85 ? -17  DT  J "O4'" 1 
ATOM   10075 C  "C3'" . DT  J 6 56  ? -69.199 -18.641 46.040 1.00 167.75 ? -17  DT  J "C3'" 1 
ATOM   10076 O  "O3'" . DT  J 6 56  ? -69.071 -20.081 46.128 1.00 167.38 ? -17  DT  J "O3'" 1 
ATOM   10077 C  "C2'" . DT  J 6 56  ? -68.127 -17.878 46.830 1.00 167.49 ? -17  DT  J "C2'" 1 
ATOM   10078 C  "C1'" . DT  J 6 56  ? -67.356 -17.125 45.747 1.00 167.70 ? -17  DT  J "C1'" 1 
ATOM   10079 N  N1    . DT  J 6 56  ? -66.819 -15.768 46.138 1.00 167.77 ? -17  DT  J N1    1 
ATOM   10080 C  C2    . DT  J 6 56  ? -65.559 -15.369 45.707 1.00 167.87 ? -17  DT  J C2    1 
ATOM   10081 O  O2    . DT  J 6 56  ? -64.814 -16.049 45.016 1.00 167.80 ? -17  DT  J O2    1 
ATOM   10082 N  N3    . DT  J 6 56  ? -65.183 -14.112 46.122 1.00 167.80 ? -17  DT  J N3    1 
ATOM   10083 C  C4    . DT  J 6 56  ? -65.910 -13.228 46.901 1.00 167.68 ? -17  DT  J C4    1 
ATOM   10084 O  O4    . DT  J 6 56  ? -65.461 -12.126 47.209 1.00 167.62 ? -17  DT  J O4    1 
ATOM   10085 C  C5    . DT  J 6 56  ? -67.214 -13.702 47.315 1.00 167.76 ? -17  DT  J C5    1 
ATOM   10086 C  C7    . DT  J 6 56  ? -68.118 -12.853 48.163 1.00 167.75 ? -17  DT  J C7    1 
ATOM   10087 C  C6    . DT  J 6 56  ? -67.597 -14.926 46.917 1.00 167.77 ? -17  DT  J C6    1 
ATOM   10088 P  P     . DT  J 6 57  ? -67.860 -20.952 45.526 1.00 167.26 ? -16  DT  J P     1 
ATOM   10089 O  OP1   . DT  J 6 57  ? -67.486 -20.444 44.185 1.00 167.09 ? -16  DT  J OP1   1 
ATOM   10090 O  OP2   . DT  J 6 57  ? -68.243 -22.375 45.669 1.00 167.38 ? -16  DT  J OP2   1 
ATOM   10091 O