data_3LZI
# 
_entry.id   3LZI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LZI         
NDB   NA0471       
RCSB  RCSB057919   
WWPDB D_1000057919 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1IG9 . unspecified 
PDB 1IH7 . unspecified 
PDB 3LZJ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3LZI 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, M.'         1 
'Beckman, J.'      2 
'Blaha, G.'        3 
'Wang, J.'         4 
'Konigsberg, W.H.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Substitution of Ala for Tyr567 in RB69 DNA polymerase allows dAMP to be inserted opposite 7,8-dihydro-8-oxoguanine .' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            49 
_citation.page_first                4116 
_citation.page_last                 4125 
_citation.year                      2010 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20411947 
_citation.pdbx_database_id_DOI      10.1021/bi100102s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Beckman, J.'      1 
primary 'Wang, M.'         2 
primary 'Blaha, G.'        3 
primary 'Wang, J.'         4 
primary 'Konigsberg, W.H.' 5 
# 
_cell.entry_id           3LZI 
_cell.length_a           78.148 
_cell.length_b           117.603 
_cell.length_c           130.681 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LZI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                            104563.047 1   2.7.7.7 
'D222A, D327A, Y567A' ? ?                     
2 polymer     syn 
;DNA (5'-D(P*TP*CP*AP*(8OG)P*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3')
;
5557.591   1   ?       ?                     ? 'Template DNA strand' 
3 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*(DOC))-3')
;
3951.586   1   ?       ?                     ? 'Primer DNA strand'   
4 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182    1   ?       ?                     ? ?                     
5 non-polymer syn 'CALCIUM ION'                                                               40.078     5   ?       ? ? ? 
6 water       nat water                                                                       18.015     176 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no yes '(DT)(DC)(DA)(8OG)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' TCAGGTAAGCAGTCCGCG T 
? 
3 polydeoxyribonucleotide no yes '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DOC)' GCGGACTGCTTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 LEU n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 SER n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DT  n 
2 2   DC  n 
2 3   DA  n 
2 4   8OG n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DOC n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Bacteriophage RB69' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 '43, gp43' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 21b' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 3LZI       3LZI   2 TCAGGTAAGCAGTCCGCG ? ? 
3 PDB 3LZI       3LZI   3 GCGGACTGCTTAC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LZI A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 3LZI T 1 ? 18  ? 3LZI   1   ? 18  ? 1   18  
3 3 3LZI P 1 ? 13  ? 3LZI   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LZI ALA A 222 ? UNP Q38087 ASP 222 ENGINEERED 222 1 
1 3LZI ALA A 327 ? UNP Q38087 ASP 327 ENGINEERED 327 2 
1 3LZI ALA A 567 ? UNP Q38087 TYR 567 ENGINEERED 567 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                                                       
'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                                                       'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                                                       
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3LZI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   53.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'micro-batch vapor-diffusion' 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;150 mM CaCl2, 11%(w/v) PEG 350 monomethyl ether MME, and 100 mM Na Cacodylate pH 6.5  , micro-batch vapor-diffusion, temperature 293.15K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   Q315 
_diffrn_detector.pdbx_collection_date   2009-10-01 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.entry_id                     3LZI 
_reflns.observed_criterion_sigma_I   0.95 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   51799 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.32 
_reflns.B_iso_Wilson_estimate        48.8 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   78.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.945 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4177 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3LZI 
_refine.pdbx_starting_model                      'PDB entry 1IG9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_number_reflns_obs                     49070 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.15 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    95.28 
_refine.ls_R_factor_obs                          0.20817 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20557 
_refine.ls_R_factor_R_free                       0.25773 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2642 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.920 
_refine.B_iso_mean                               40.606 
_refine.aniso_B[1][1]                            -0.46 
_refine.aniso_B[2][2]                            -0.70 
_refine.aniso_B[3][3]                            1.16 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.348 
_refine.pdbx_overall_ESU_R_Free                  0.251 
_refine.overall_SU_ML                            0.188 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             17.337 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7367 
_refine_hist.pdbx_number_atoms_nucleic_acid   634 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             176 
_refine_hist.number_atoms_total               8212 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        38.15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 8289  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.220  2.062  ? 11328 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.445  5.000  ? 902   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.883 24.171 ? 374   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.750 15.000 ? 1347  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.206 15.000 ? 46    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.087  0.200  ? 1198  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 6113  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.557  4.000  ? 4506  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.775  6.000  ? 7304  'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.132  6.000  ? 3783  'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.591  9.000  ? 4024  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.3 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             2870 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               76.32 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3LZI 
_struct.title                     'RB69 DNA Polymerase (Y567A) ternary complex with dATP Opposite 7,8-dihydro-8-oxoguanine' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LZI 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'DNA polymerase, replication fidelity, 7, 8-dihydro-8-oxoguanine, Polymerase-DNA-dNTP ternary complex, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? SER A 310 ? PRO A 308 SER A 310 5 ? 3  
HELX_P HELX_P14 14 LYS A 311 ? GLN A 339 ? LYS A 311 GLN A 339 1 ? 29 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLN A 376 ? SER A 360 GLN A 376 1 ? 17 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P23 23 ASP A 579 ? CYS A 609 ? ASP A 579 CYS A 609 1 ? 31 
HELX_P HELX_P24 24 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P25 25 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P26 26 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P27 27 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P28 28 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P29 29 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P30 30 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P31 31 ASN A 775 ? ALA A 780 ? ASN A 775 ALA A 780 1 ? 6  
HELX_P HELX_P32 32 ASN A 787 ? ASP A 792 ? ASN A 787 ASP A 792 1 ? 6  
HELX_P HELX_P33 33 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P34 34 THR A 855 ? MET A 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P35 35 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P36 36 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
HELX_P HELX_P37 37 SER A 896 ? MET A 900 ? SER A 896 MET A 900 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DA  3   "O3'" ? ? ? 1_555 B 8OG 4  P  ? ? T DA  3   T 8OG 4    1_555 ? ? ? ? ? ? ?            1.474 ? 
covale2  covale ? ? B 8OG 4   "O3'" ? ? ? 1_555 B DG  5  P  ? ? T 8OG 4   T DG  5    1_555 ? ? ? ? ? ? ?            1.482 ? 
covale3  covale ? ? C DA  12  "O3'" ? ? ? 1_555 C DOC 13 P  ? ? P DA  114 P DOC 115  1_555 ? ? ? ? ? ? ?            1.481 ? 
metalc1  metalc ? ? D DTP .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A DTP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc2  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623 A CA  905  1_555 ? ? ? ? ? ? ?            2.159 ? 
metalc3  metalc ? ? D DTP .   O2G   ? ? ? 1_555 E CA  .  CA ? ? A DTP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc4  metalc ? ? A ASN 505 O     ? ? ? 1_555 F CA  .  CA ? ? A ASN 505 A CA  906  1_555 ? ? ? ? ? ? ?            2.274 ? 
metalc5  metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412 A CA  905  1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc6  metalc ? ? A LYS 531 O     ? ? ? 1_555 F CA  .  CA ? ? A LYS 531 A CA  906  1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc7  metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc8  metalc ? ? D DTP .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A DTP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.556 ? 
metalc9  metalc ? ? A GLU 716 OE1   ? ? ? 1_555 H CA  .  CA ? ? A GLU 716 A CA  908  1_555 ? ? ? ? ? ? ?            2.563 ? 
metalc10 metalc ? ? A ASN 507 OD1   ? ? ? 1_555 F CA  .  CA ? ? A ASN 507 A CA  906  1_555 ? ? ? ? ? ? ?            2.586 ? 
metalc11 metalc ? ? D DTP .   O2A   ? ? ? 1_555 G CA  .  CA ? ? A DTP 904 A CA  907  1_555 ? ? ? ? ? ? ?            2.611 ? 
metalc12 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.691 ? 
metalc13 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  909  1_555 ? ? ? ? ? ? ?            2.741 ? 
metalc14 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  909  1_555 ? ? ? ? ? ? ?            2.751 ? 
metalc15 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 G CA  .  CA ? ? A ASP 623 A CA  907  1_555 ? ? ? ? ? ? ?            2.836 ? 
metalc16 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASP 411 A CA  907  1_555 ? ? ? ? ? ? ?            2.839 ? 
metalc17 metalc ? ? F CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  906 A HOH 983  1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc18 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  909 A HOH 1070 1_555 ? ? ? ? ? ? ?            2.498 ? 
metalc19 metalc ? ? F CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  906 A HOH 933  1_555 ? ? ? ? ? ? ?            2.666 ? 
metalc20 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  909 A HOH 910  1_555 ? ? ? ? ? ? ?            2.941 ? 
metalc21 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  909 A HOH 1019 1_555 ? ? ? ? ? ? ?            3.010 ? 
metalc22 metalc ? ? G CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  907 A HOH 1069 1_555 ? ? ? ? ? ? ?            3.089 ? 
hydrog1  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DOC 13 N3 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DOC 13 O2 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DOC 13 N4 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  13  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  13  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  17  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  17  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  17  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 43  A . ? GLU 43  A SER 44  A ? SER 44  A 1 15.08  
2 SER 44  A . ? SER 44  A GLN 45  A ? GLN 45  A 1 0.15   
3 ASN 255 A . ? ASN 255 A MET 256 A ? MET 256 A 1 3.06   
4 TYR 257 A . ? TYR 257 A GLY 258 A ? GLY 258 A 1 -0.68  
5 SER 639 A . ? SER 639 A LYS 640 A ? LYS 640 A 1 -7.82  
6 VAL 793 A . ? VAL 793 A GLY 794 A ? GLY 794 A 1 6.07   
7 GLY 794 A . ? GLY 794 A GLY 795 A ? GLY 795 A 1 -5.99  
8 ALA 895 A . ? ALA 895 A SER 896 A ? SER 896 A 1 -18.67 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? GLN A 10  ? PHE A 4   GLN A 10  
A 2 ILE A 15  ? ILE A 20  ? ILE A 15  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ALA A 135 ? ASP A 140 ? ALA A 135 ASP A 140 
D 4 VAL A 110 ? GLU A 116 ? VAL A 110 GLU A 116 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? LYS A 251 ? THR A 248 LYS A 251 
F 2 ILE A 262 ? LEU A 265 ? ILE A 262 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N ILE A 15  ? N ILE A 15  O VAL A 31  ? O VAL A 31  
B 1 2 N ALA A 39  ? N ALA A 39  O THR A 58  ? O THR A 58  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O ILE A 212 ? O ILE A 212 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O ALA A 689 ? O ALA A 689 N VAL A 407 ? N VAL A 407 
G 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
G 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 781 ? N SER A 781 O VAL A 832 ? O VAL A 832 
J 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DTP A 904' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 905'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 906'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 907'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 908'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 909'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 17 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 17 SER A 414 ? SER A 414  . ? 1_555 ? 
4  AC1 17 LEU A 415 ? LEU A 415  . ? 1_555 ? 
5  AC1 17 TYR A 416 ? TYR A 416  . ? 1_555 ? 
6  AC1 17 ARG A 482 ? ARG A 482  . ? 1_555 ? 
7  AC1 17 LYS A 560 ? LYS A 560  . ? 1_555 ? 
8  AC1 17 ASN A 564 ? ASN A 564  . ? 1_555 ? 
9  AC1 17 ASP A 623 ? ASP A 623  . ? 1_555 ? 
10 AC1 17 CA  E .   ? CA  A 905  . ? 1_555 ? 
11 AC1 17 CA  G .   ? CA  A 907  . ? 1_555 ? 
12 AC1 17 HOH J .   ? HOH A 912  . ? 1_555 ? 
13 AC1 17 HOH J .   ? HOH A 1068 . ? 1_555 ? 
14 AC1 17 HOH J .   ? HOH A 1069 . ? 1_555 ? 
15 AC1 17 DOC C 13  ? DOC P 115  . ? 1_555 ? 
16 AC1 17 8OG B 4   ? 8OG T 4    . ? 1_555 ? 
17 AC1 17 DG  B 5   ? DG  T 5    . ? 1_555 ? 
18 AC2 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
19 AC2 4  LEU A 412 ? LEU A 412  . ? 1_555 ? 
20 AC2 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
21 AC2 4  DTP D .   ? DTP A 904  . ? 1_555 ? 
22 AC3 5  ASN A 505 ? ASN A 505  . ? 1_555 ? 
23 AC3 5  ASN A 507 ? ASN A 507  . ? 1_555 ? 
24 AC3 5  LYS A 531 ? LYS A 531  . ? 1_555 ? 
25 AC3 5  HOH J .   ? HOH A 933  . ? 1_555 ? 
26 AC3 5  HOH J .   ? HOH A 983  . ? 1_555 ? 
27 AC4 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
28 AC4 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
29 AC4 5  DTP D .   ? DTP A 904  . ? 1_555 ? 
30 AC4 5  HOH J .   ? HOH A 1069 . ? 1_555 ? 
31 AC4 5  DOC C 13  ? DOC P 115  . ? 1_555 ? 
32 AC5 2  GLU A 686 ? GLU A 686  . ? 1_555 ? 
33 AC5 2  GLU A 716 ? GLU A 716  . ? 1_555 ? 
34 AC6 4  GLU A 116 ? GLU A 116  . ? 1_555 ? 
35 AC6 4  HOH J .   ? HOH A 910  . ? 1_555 ? 
36 AC6 4  HOH J .   ? HOH A 1019 . ? 1_555 ? 
37 AC6 4  HOH J .   ? HOH A 1070 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3LZI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LZI 
_atom_sites.fract_transf_matrix[1][1]   0.012796 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008503 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007652 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -38.108 -20.892 32.523 1.00 55.75  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.826 -20.420 33.115 1.00 57.64  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.686 -18.915 32.958 1.00 57.02  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.362 -18.295 32.128 1.00 57.79  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.619 -21.146 32.498 1.00 60.04  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -35.659 -21.322 30.972 1.00 67.06  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -34.029 -21.465 30.184 1.00 72.41  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -33.534 -19.748 30.199 1.00 73.80  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.817 -18.324 33.767 1.00 55.05  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.579 -16.891 33.680 1.00 52.71  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.618 -16.595 32.527 1.00 49.12  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.645 -17.324 32.317 1.00 46.93  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -35.036 -16.357 35.004 1.00 54.60  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.484 -14.943 35.320 1.00 57.95  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -36.570 -14.912 36.384 1.00 60.04  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -36.704 -13.508 36.951 1.00 60.43  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -36.893 -13.535 38.426 1.00 60.81  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.907 -15.533 31.778 1.00 44.92  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -34.107 -15.164 30.605 1.00 42.31  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.688 -14.692 30.976 1.00 38.28  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.447 -14.221 32.094 1.00 37.80  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -34.838 -14.101 29.770 1.00 42.49  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -36.303 -14.461 29.483 1.00 49.86  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -36.960 -13.622 28.392 1.00 53.88  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -37.938 -14.121 27.785 1.00 56.50  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.520 -12.477 28.137 1.00 52.56  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -31.750 -14.849 30.047 1.00 32.60  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.406 -14.289 30.216 1.00 31.00  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -29.797 -13.967 28.869 1.00 29.26  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -30.084 -14.632 27.873 1.00 27.06  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.479 -15.202 31.042 1.00 29.64  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.277 -16.572 30.454 1.00 31.37  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.147 -17.611 30.768 1.00 27.62  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.197 -16.829 29.599 1.00 31.38  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -29.967 -18.882 30.228 1.00 32.54  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -28.000 -18.098 29.066 1.00 32.91  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -28.888 -19.131 29.381 1.00 32.71  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -28.974 -12.926 28.846 1.00 27.99  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.335 -12.484 27.619 1.00 27.93  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.203 -13.402 27.211 1.00 28.39  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -26.627 -14.114 28.036 1.00 27.26  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -27.790 -11.062 27.770 1.00 28.06  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.624 -10.906 28.739 1.00 27.06  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -26.853 -10.658 30.103 1.00 25.94  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.300 -10.972 28.295 1.00 25.29  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.797 -10.489 31.000 1.00 26.46  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.221 -10.794 29.196 1.00 24.87  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.492 -10.554 30.543 1.00 25.18  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.478 -10.388 31.442 1.00 26.39  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -26.878 -13.346 25.928 1.00 27.08  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -25.725 -14.030 25.389 1.00 27.27  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -24.670 -12.995 25.020 1.00 28.78  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -23.537 -13.061 25.500 1.00 30.38  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.141 -14.848 24.164 1.00 25.52  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.136 -15.968 24.477 1.00 25.90  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -27.739 -16.500 23.197 1.00 22.81  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -26.474 -17.095 25.301 1.00 20.64  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.046 -12.046 24.161 1.00 29.76  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -24.169 -10.939 23.780 1.00 30.48  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -24.943 -9.629  23.711 1.00 32.43  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -26.122 -9.607  23.373 1.00 32.53  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -23.553 -11.139 22.389 1.00 31.91  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -24.606 -11.139 21.404 1.00 32.84  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -22.724 -12.419 22.320 1.00 25.15  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -24.265 -8.529  24.005 1.00 34.08  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -24.861 -7.219  23.832 1.00 33.68  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -23.916 -6.354  23.019 1.00 33.95  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -22.698 -6.488  23.115 1.00 35.75  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -25.230 -6.576  25.185 1.00 34.60  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -23.988 -6.163  25.957 1.00 36.89  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -26.152 -5.398  24.976 1.00 31.23  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -24.480 -5.482  22.196 1.00 34.38  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -23.676 -4.605  21.362 1.00 34.32  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -24.415 -3.278  21.163 1.00 35.52  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -25.641 -3.262  21.054 1.00 34.80  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -23.424 -5.302  20.026 1.00 33.76  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -22.038 -5.131  19.460 1.00 39.13  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -20.939 -5.789  20.284 1.00 39.95  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -20.281 -5.051  21.050 1.00 42.66  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -20.719 -7.023  20.161 1.00 37.75  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -23.684 -2.164  21.164 1.00 38.03  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -24.255 -0.879  20.737 1.00 40.53  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -23.775 -0.550  19.329 1.00 42.35  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -22.574 -0.402  19.085 1.00 42.36  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -23.909 0.277   21.693 1.00 40.29  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -24.061 1.656   21.014 1.00 42.78  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -23.898 2.873   21.923 1.00 45.69  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -24.366 3.957   21.577 1.00 47.81  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -23.233 2.709   23.069 1.00 44.44  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -24.713 -0.436  18.401 1.00 46.47  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -24.356 -0.066  17.037 1.00 50.16  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -24.626 1.426   16.762 1.00 52.62  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -23.683 2.235   16.753 1.00 55.18  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -24.960 -1.041  15.991 1.00 50.51  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -24.301 -2.421  16.164 1.00 50.50  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -24.774 -0.495  14.562 1.00 49.88  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -24.747 -3.489  15.181 1.00 53.56  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -25.882 1.806   16.557 1.00 51.39  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -26.179 3.233   16.366 1.00 53.44  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -26.860 3.800   17.596 1.00 51.55  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -26.256 3.915   18.667 1.00 50.79  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -28.133 4.139   17.427 1.00 51.04  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -29.025 4.416   18.539 1.00 49.21  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -29.716 3.114   18.915 1.00 45.54  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -30.746 3.108   19.590 1.00 44.78  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -30.042 5.490   18.146 1.00 51.24  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -29.407 6.867   17.980 1.00 53.97  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -29.851 7.626   17.086 1.00 54.70  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -28.472 7.188   18.750 1.00 53.33  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -29.120 2.010   18.474 1.00 42.91  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -29.660 0.680   18.712 1.00 40.27  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -28.743 -0.189  19.555 1.00 36.39  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -27.519 -0.170  19.400 1.00 32.17  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -29.962 -0.021  17.385 1.00 40.94  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -31.191 0.443   16.848 1.00 46.71  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -29.367 -0.929  20.465 1.00 35.21  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -28.730 -2.028  21.172 1.00 35.38  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -29.106 -3.323  20.441 1.00 34.90  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -30.282 -3.547  20.135 1.00 33.78  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -29.205 -2.086  22.660 1.00 35.62  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -28.678 -0.878  23.459 1.00 32.18  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -28.841 -3.429  23.327 1.00 32.45  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -27.157 -0.682  23.483 1.00 24.79  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -28.109 -4.146  20.131 1.00 34.50  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -28.352 -5.471  19.558 1.00 35.94  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -28.035 -6.530  20.603 1.00 34.70  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -26.916 -6.587  21.121 1.00 35.14  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -27.519 -5.702  18.295 1.00 35.89  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -28.085 -5.042  17.071 1.00 39.20  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -28.907 -5.755  16.199 1.00 39.13  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -27.796 -3.709  16.786 1.00 39.21  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -29.439 -5.153  15.060 1.00 41.71  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -28.320 -3.089  15.641 1.00 44.22  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -29.146 -3.814  14.777 1.00 43.47  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -29.035 -7.346  20.919 1.00 32.64  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -28.896 -8.364  21.948 1.00 30.96  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -29.290 -9.753  21.465 1.00 30.98  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -30.389 -9.961  20.918 1.00 28.95  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -29.706 -8.009  23.189 1.00 27.97  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -29.422 -8.940  24.361 1.00 27.05  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -30.501 -8.920  25.418 1.00 29.50  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.342 -9.629  26.427 1.00 31.51  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -31.521 -8.214  25.249 1.00 36.31  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -28.372 -10.696 21.665 1.00 25.99  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -28.696 -12.096 21.551 1.00 24.58  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -28.977 -12.564 22.982 1.00 26.15  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -28.267 -12.173 23.916 1.00 23.95  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -27.544 -12.863 20.898 1.00 24.41  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -27.170 -12.322 19.508 1.00 27.46  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -25.878 -12.925 18.961 1.00 27.99  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -26.010 -14.358 18.725 1.00 29.96  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -24.993 -15.198 18.552 1.00 30.28  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -23.744 -14.750 18.572 1.00 30.44  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -25.229 -16.496 18.363 1.00 24.99  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -30.030 -13.365 23.158 1.00 26.71  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -30.420 -13.826 24.487 1.00 27.15  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -31.082 -15.195 24.451 1.00 29.97  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -31.362 -15.755 23.377 1.00 31.11  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.324 -12.790 25.186 1.00 29.47  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -32.686 -12.587 24.539 1.00 30.36  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -32.810 -11.898 23.327 1.00 32.54  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -33.846 -13.076 25.137 1.00 33.06  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -34.045 -11.718 22.722 1.00 33.49  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -35.105 -12.890 24.542 1.00 33.42  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.190 -12.207 23.335 1.00 36.10  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -36.409 -12.025 22.719 1.00 36.93  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.299 -15.748 25.640 1.00 31.31  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -32.033 -16.989 25.793 1.00 30.88  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.356 -16.627 26.448 1.00 33.81  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.369 -16.033 27.533 1.00 33.43  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.249 -18.000 26.657 1.00 32.03  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -29.915 -18.387 25.987 1.00 26.64  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.107 -19.221 26.969 1.00 30.27  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.049 -19.196 24.674 1.00 30.01  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -34.465 -16.968 25.791 1.00 34.07  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -35.789 -16.605 26.315 1.00 34.22  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.295 -17.594 27.355 1.00 36.32  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -35.580 -18.543 27.718 1.00 36.27  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -36.819 -16.349 25.195 1.00 32.74  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.255 -17.618 24.450 1.00 33.60  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -37.092 -18.762 24.948 1.00 26.83  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -37.802 -17.451 23.337 1.00 37.01  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.528 -17.366 27.820 1.00 37.82  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -38.108 -18.109 28.939 1.00 37.06  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.357 -19.573 28.614 1.00 37.28  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -38.539 -20.394 29.516 1.00 36.36  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.391 -17.435 29.438 1.00 38.68  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.349 -17.295 28.398 1.00 39.84  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.352 -19.903 27.327 1.00 38.27  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -38.461 -21.297 26.899 1.00 39.93  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.129 -21.939 26.554 1.00 38.70  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -37.095 -23.038 26.007 1.00 37.97  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -39.431 -21.419 25.727 1.00 40.99  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -40.853 -21.150 26.141 1.00 43.59  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.326 -21.692 27.146 1.00 45.46  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -41.542 -20.296 25.390 1.00 39.69  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -36.033 -21.252 26.874 1.00 36.47  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -34.703 -21.756 26.555 1.00 36.11  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -34.328 -21.637 25.087 1.00 37.24  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -33.374 -22.278 24.645 1.00 38.10  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -35.070 -20.817 24.337 1.00 35.49  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -34.768 -20.557 22.925 1.00 36.52  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -33.820 -19.381 22.729 1.00 35.19  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -33.944 -18.355 23.409 1.00 33.33  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -36.055 -20.348 22.109 1.00 38.90  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -36.371 -21.516 21.166 1.00 48.69  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -37.861 -21.813 21.045 1.00 57.13  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -38.095 -23.034 20.262 1.00 66.22  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -39.203 -23.781 20.309 1.00 67.61  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -40.210 -23.450 21.114 1.00 67.96  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -39.302 -24.870 19.548 1.00 63.58  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -32.879 -19.538 21.795 1.00 34.41  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -32.009 -18.444 21.388 1.00 32.91  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -32.731 -17.468 20.466 1.00 32.81  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -33.331 -17.859 19.471 1.00 30.62  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -30.722 -18.930 20.713 1.00 33.78  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -29.778 -17.748 20.435 1.00 37.99  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -28.441 -18.110 19.821 1.00 41.05  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -27.938 -19.231 20.039 1.00 43.43  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -27.880 -17.238 19.129 1.00 40.74  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -32.652 -16.188 20.810 1.00 34.28  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -33.309 -15.140 20.057 1.00 35.34  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -32.375 -13.950 19.940 1.00 35.42  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -31.376 -13.869 20.665 1.00 33.29  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -34.601 -14.712 20.767 1.00 37.81  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -35.628 -15.831 21.000 1.00 42.11  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -36.663 -15.892 19.898 1.00 48.23  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -37.890 -16.539 20.366 1.00 56.10  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -38.353 -17.712 19.933 1.00 57.34  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -37.708 -18.397 18.992 1.00 58.22  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -39.478 -18.198 20.440 1.00 57.60  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -32.711 -13.036 19.026 1.00 35.42  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -32.012 -11.760 18.883 1.00 36.84  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -33.003 -10.607 18.732 1.00 36.56  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -34.079 -10.773 18.156 1.00 36.32  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -30.970 -11.768 17.716 1.00 38.48  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -30.452 -10.442 17.509 1.00 44.47  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -31.584 -12.271 16.419 1.00 40.71  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -32.635 -9.440  19.252 1.00 36.21  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -33.490 -8.259  19.159 1.00 37.60  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -32.719 -6.945  19.045 1.00 40.43  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -31.626 -6.793  19.609 1.00 41.06  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -34.486 -8.197  20.331 1.00 36.71  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -33.854 -8.065  21.713 1.00 34.42  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -34.898 -8.237  22.796 1.00 32.54  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -34.271 -8.476  24.092 1.00 31.78  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -34.908 -8.922  25.168 1.00 29.20  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.199 -9.194  25.117 1.00 29.62  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.239 -9.116  26.297 1.00 30.83  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -33.306 -6.013  18.296 1.00 42.58  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -32.834 -4.638  18.199 1.00 44.08  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -33.735 -3.746  19.052 1.00 43.29  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -34.955 -3.736  18.873 1.00 42.28  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -32.848 -4.178  16.738 1.00 45.28  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -32.416 -2.728  16.524 1.00 51.19  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -32.282 -2.343  15.050 1.00 53.91  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -32.705 -3.133  14.170 1.00 53.29  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -31.748 -1.239  14.777 1.00 51.41  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -33.133 -3.015  19.988 1.00 42.38  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -33.885 -2.149  20.894 1.00 42.58  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -33.372 -0.716  20.804 1.00 44.22  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -32.164 -0.481  20.888 1.00 44.49  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -33.813 -2.653  22.358 1.00 42.13  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -34.508 -1.681  23.315 1.00 41.71  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -34.430 -4.044  22.481 1.00 44.19  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -34.288 0.237   20.619 1.00 44.87  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -33.916 1.650   20.573 1.00 46.07  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -33.831 2.147   22.005 1.00 44.69  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -34.760 2.774   22.512 1.00 45.14  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -34.913 2.470   19.744 1.00 49.34  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -34.791 2.262   18.224 1.00 57.39  ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -36.050 2.667   17.445 1.00 63.93  ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -35.935 3.515   16.530 1.00 66.55  ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -37.150 2.137   17.738 1.00 64.48  ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -32.704 1.847   22.651 1.00 42.38  ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -32.539 2.064   24.085 1.00 38.46  ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -32.555 3.539   24.428 1.00 37.47  ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -31.813 4.329   23.851 1.00 36.60  ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -31.251 1.403   24.600 1.00 35.61  ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -31.051 1.515   26.102 1.00 31.22  ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -31.963 0.952   26.994 1.00 30.23  ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -29.949 2.182   26.625 1.00 28.83  ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -31.782 1.051   28.374 1.00 29.69  ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -29.749 2.275   27.995 1.00 29.17  ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.668 1.718   28.862 1.00 32.29  ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.468 1.832   30.217 1.00 35.50  ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.426 3.894   25.363 1.00 37.53  ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.542 5.259   25.852 1.00 37.33  ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.825 5.367   27.202 1.00 37.26  ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.378 4.979   28.241 1.00 37.27  ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -35.021 5.664   25.934 1.00 38.02  ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -35.617 6.055   24.574 1.00 42.29  ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -37.122 5.832   24.514 1.00 48.24  ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.457 4.448   23.940 1.00 52.84  ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -38.787 3.923   24.385 1.00 53.75  ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.571 5.865   27.184 1.00 35.88  ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.734 5.890   28.380 1.00 33.77  ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -31.002 7.094   29.262 1.00 33.10  ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.467 8.123   28.785 1.00 33.71  ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.321 5.999   27.801 1.00 34.61  ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.500 6.813   26.559 1.00 34.46  ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -30.865 6.420   26.011 1.00 35.36  ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.681 6.971   30.543 1.00 34.04  ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.724 8.115   31.440 1.00 32.75  ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -29.333 8.489   31.950 1.00 33.84  ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.502 7.615   32.208 1.00 35.38  ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.659 7.841   32.612 1.00 30.27  ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.994 7.712   32.154 1.00 33.83  ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -29.085 9.790   32.072 1.00 32.20  ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.937 10.284  32.815 1.00 32.43  ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -28.458 11.294  33.822 1.00 33.02  ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -29.668 11.526  33.884 1.00 33.48  ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.885 10.884  31.879 1.00 32.73  ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -26.233 9.898   30.900 1.00 31.07  ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.743 10.611  29.663 1.00 33.07  ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -25.102 9.113   31.548 1.00 32.96  ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -27.570 11.866  34.631 1.00 31.82  ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -28.000 12.712  35.738 1.00 33.68  ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -27.168 13.979  35.891 1.00 34.73  ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -26.010 14.040  35.464 1.00 34.42  ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -27.977 11.923  37.055 1.00 35.27  ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -28.855 10.705  37.053 1.00 33.42  ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -28.430 9.520   36.451 1.00 34.88  ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -30.092 10.734  37.673 1.00 27.79  ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -29.248 8.385   36.441 1.00 32.55  ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -30.911 9.607   37.686 1.00 32.56  ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -30.491 8.432   37.064 1.00 33.13  ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -27.771 14.981  36.522 1.00 35.70  ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -27.125 16.264  36.776 1.00 37.41  ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -27.489 16.736  38.173 1.00 36.74  ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -28.625 16.562  38.601 1.00 36.64  ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -27.562 17.299  35.730 1.00 35.74  ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -26.530 17.328  38.881 1.00 39.35  ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -26.807 17.954  40.172 1.00 43.57  ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -27.882 19.027  40.008 1.00 46.97  ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -27.871 19.782  39.030 1.00 46.39  ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -25.544 18.583  40.765 1.00 43.37  ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -24.482 17.593  41.133 1.00 45.37  ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -24.721 16.509  41.950 1.00 44.97  ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -23.166 17.539  40.813 1.00 45.35  ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -23.603 15.823  42.105 1.00 44.05  ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -22.644 16.427  41.426 1.00 44.44  ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -28.800 19.083  40.968 1.00 51.10  ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -29.931 20.011  40.940 1.00 56.84  ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -30.081 20.722  42.290 1.00 60.41  ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -29.441 20.316  43.260 1.00 59.66  ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -31.216 19.261  40.580 1.00 57.58  ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -31.650 17.941  41.751 1.00 66.19  ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -30.925 21.783  42.352 1.00 65.41  ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -31.160 22.630  43.526 1.00 69.15  ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -30.965 21.967  44.897 1.00 73.48  ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -29.911 22.173  45.507 1.00 74.58  ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -32.603 23.096  43.323 1.00 69.26  ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -32.764 23.159  41.827 1.00 68.36  ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -31.677 22.304  41.194 1.00 66.42  ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -31.956 21.204  45.379 1.00 76.76  ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -31.814 20.417  46.628 1.00 81.74  ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -33.057 19.755  47.278 1.00 84.02  ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -32.989 18.553  47.538 1.00 85.98  ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -30.963 21.140  47.700 1.00 82.87  ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -30.254 20.199  48.688 1.00 86.01  ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -28.869 20.694  49.102 1.00 88.78  ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -28.760 21.848  49.574 1.00 89.80  ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -27.888 19.924  48.960 1.00 88.63  ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -34.181 20.433  47.562 1.00 85.43  ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -34.668 21.768  47.118 1.00 86.90  ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -35.416 21.786  45.761 1.00 87.76  ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -35.283 22.748  45.002 1.00 88.62  ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -33.627 22.897  47.232 1.00 86.86  ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -33.380 23.227  48.586 1.00 87.94  ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -36.232 20.766  45.461 1.00 88.04  ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -36.497 19.599  46.320 1.00 87.91  ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -37.038 18.431  45.490 1.00 86.52  ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -37.057 18.497  44.258 1.00 86.52  ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -37.487 19.943  47.450 1.00 88.75  ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -37.270 19.127  48.735 1.00 89.87  ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -38.511 19.038  49.604 1.00 91.02  ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -39.078 17.958  49.786 1.00 90.46  ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -38.944 20.174  50.142 1.00 91.62  ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -37.463 17.372  46.186 1.00 84.23  ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -38.152 16.213  45.605 1.00 81.76  ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -37.477 15.637  44.356 1.00 79.68  ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -37.801 16.015  43.224 1.00 79.73  ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -39.634 16.537  45.340 1.00 81.84  ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -36.539 14.719  44.570 1.00 76.23  ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -35.829 14.097  43.457 1.00 72.78  ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -35.892 12.565  43.427 1.00 70.39  ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -36.274 11.996  42.401 1.00 71.14  ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -34.363 14.607  43.328 1.00 73.26  ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -33.647 13.786  42.394 1.00 72.12  ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -33.643 14.604  44.679 1.00 72.69  ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -35.530 11.912  44.535 1.00 65.31  ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -35.366 10.446  44.596 1.00 61.45  ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -33.921 9.991   44.307 1.00 58.24  ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -33.426 9.060   44.951 1.00 59.50  ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -36.364 9.715   43.674 1.00 62.38  ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -36.295 8.183   43.709 1.00 63.48  ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -36.853 7.556   42.435 1.00 62.92  ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -36.662 6.043   42.438 1.00 63.89  ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -36.910 5.410   41.110 1.00 58.82  ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -33.249 10.635  43.350 1.00 51.68  ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -31.874 10.254  42.991 1.00 45.39  ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -30.812 11.118  43.658 1.00 42.59  ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -30.906 12.343  43.651 1.00 39.75  ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -31.663 10.314  41.486 1.00 43.98  ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -32.645 9.513   40.683 1.00 44.65  ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -33.699 10.140  40.026 1.00 44.44  ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -32.514 8.129   40.559 1.00 44.77  ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -34.605 9.417   39.270 1.00 45.24  ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -33.423 7.393   39.810 1.00 46.46  ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -34.465 8.049   39.164 1.00 47.90  ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -35.376 7.343   38.413 1.00 53.74  ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -29.790 10.466  44.208 1.00 39.70  ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -28.681 11.146  44.863 1.00 38.92  ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -27.361 10.553  44.389 1.00 39.08  ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -27.271 9.346   44.174 1.00 39.05  ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -28.779 10.996  46.385 1.00 39.80  ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -29.997 11.644  46.988 1.00 43.60  ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -31.172 10.918  47.166 1.00 45.55  ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -29.963 12.978  47.390 1.00 46.91  ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -32.299 11.514  47.727 1.00 48.83  ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -31.085 13.590  47.953 1.00 47.90  ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -32.255 12.860  48.121 1.00 50.31  ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -26.334 11.389  44.228 1.00 36.58  ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -24.998 10.864  43.960 1.00 35.06  ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -24.461 10.180  45.222 1.00 35.55  ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -25.141 10.174  46.254 1.00 33.31  ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -24.059 11.951  43.432 1.00 33.94  ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -23.550 12.906  44.518 1.00 36.66  ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -23.722 12.660  45.737 1.00 37.33  ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -22.945 13.921  44.131 1.00 39.19  ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -23.255 9.621   45.151 1.00 34.49  ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -22.758 8.787   46.255 1.00 36.66  ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -22.470 9.582   47.519 1.00 38.13  ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -22.456 9.025   48.605 1.00 40.34  ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -21.516 7.927   45.869 1.00 36.43  ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -20.375 8.811   45.344 1.00 36.21  ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -21.909 6.852   44.872 1.00 34.69  ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -19.010 8.123   45.286 1.00 38.15  ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -22.260 10.886  47.359 1.00 40.37  ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -21.972 11.789  48.468 1.00 41.13  ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -23.235 12.367  49.105 1.00 42.95  ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -23.151 13.137  50.068 1.00 44.41  ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -21.048 12.911  47.992 1.00 42.75  ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -19.827 12.389  47.278 1.00 42.16  ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -19.688 12.529  45.895 1.00 40.39  ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -18.819 11.720  47.986 1.00 42.69  ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -18.556 12.024  45.232 1.00 40.52  ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -17.693 11.215  47.339 1.00 41.83  ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -17.568 11.371  45.969 1.00 41.06  ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -16.456 10.864  45.352 1.00 44.15  ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -24.399 11.980  48.577 1.00 43.66  ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -25.694 12.366  49.148 1.00 42.06  ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -26.291 13.611  48.522 1.00 41.99  ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -27.306 14.131  48.991 1.00 43.62  ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -25.664 14.083  47.453 1.00 40.85  ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -26.089 15.307  46.804 1.00 40.84  ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -27.171 15.018  45.765 1.00 41.03  ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -27.069 14.039  45.012 1.00 40.38  ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -24.895 16.064  46.202 1.00 41.75  ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -23.891 16.550  47.257 1.00 44.92  ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -23.449 17.990  47.024 1.00 52.86  ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -24.379 18.999  47.727 1.00 56.00  ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -24.159 20.415  47.270 1.00 54.45  ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -28.225 15.856  45.743 1.00 38.22  ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -29.382 15.610  44.884 1.00 38.79  ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -29.064 15.748  43.407 1.00 37.57  ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -28.289 16.619  43.019 1.00 38.52  ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -30.390 16.683  45.321 1.00 37.14  ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -29.577 17.736  45.953 1.00 38.33  ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -28.427 17.032  46.607 1.00 38.40  ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -29.672 14.884  42.603 1.00 38.17  ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -29.482 14.888  41.166 1.00 40.58  ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -30.816 14.785  40.465 1.00 41.46  ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -31.754 14.183  40.986 1.00 41.88  ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -28.605 13.714  40.744 1.00 41.61  ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -26.955 13.762  41.438 1.00 46.60  ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -30.896 15.381  39.284 1.00 41.10  ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? -32.067 15.244  38.445 1.00 39.67  ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? -31.756 14.265  37.316 1.00 38.57  ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? -30.618 14.165  36.856 1.00 36.50  ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? -32.566 16.618  37.913 1.00 42.02  ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? -33.876 16.473  37.353 1.00 44.79  ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? -31.612 17.211  36.853 1.00 43.11  ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? -32.779 13.543  36.885 1.00 37.36  ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? -32.645 12.529  35.851 1.00 37.45  ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? -32.942 13.112  34.472 1.00 36.92  ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? -33.936 13.812  34.283 1.00 37.62  ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? -33.597 11.366  36.158 1.00 37.52  ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? -33.630 10.254  35.125 1.00 38.62  ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? -34.420 9.051   35.632 1.00 36.96  ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? -34.752 8.144   34.538 1.00 38.24  ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? -35.982 7.917   34.086 1.00 39.65  ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? -37.035 8.501   34.644 1.00 40.22  ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? -36.162 7.077   33.080 1.00 45.57  ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? -32.073 12.813  33.518 1.00 35.66  ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? -32.284 13.207  32.135 1.00 36.88  ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? -32.495 11.959  31.282 1.00 37.87  ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? -31.567 11.149  31.095 1.00 33.26  ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? -31.098 14.025  31.610 1.00 38.97  ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? -30.771 15.275  32.441 1.00 42.27  ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? -30.262 16.418  31.573 1.00 46.14  ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? -31.410 17.282  30.998 1.00 52.87  ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? -32.052 16.718  29.763 1.00 53.80  ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? -33.725 11.806  30.791 1.00 36.77  ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? -34.085 10.707  29.911 1.00 39.26  ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? -33.945 11.156  28.463 1.00 39.03  ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? -34.574 12.128  28.043 1.00 39.45  ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? -35.520 10.227  30.192 1.00 41.16  ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? -36.073 9.063   29.347 1.00 42.54  ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? -35.406 7.735   29.689 1.00 39.56  ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? -37.585 8.950   29.480 1.00 45.76  ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? -33.127 10.436  27.703 1.00 37.45  ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? -32.830 10.826  26.331 1.00 36.89  ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? -33.607 9.990   25.340 1.00 38.65  ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? -33.915 8.824   25.604 1.00 36.32  ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? -31.325 10.751  26.054 1.00 35.23  ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? -30.520 11.691  26.903 1.00 36.65  ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? -30.071 11.301  28.161 1.00 32.90  ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? -30.229 12.977  26.453 1.00 36.39  ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? -29.335 12.170  28.947 1.00 36.53  ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? -29.502 13.857  27.237 1.00 36.69  ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? -29.054 13.455  28.490 1.00 35.53  ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? -33.933 10.605  24.206 1.00 39.93  ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? -34.715 9.950   23.163 1.00 40.76  ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? -33.886 8.883   22.447 1.00 40.83  ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? -34.439 7.902   21.938 1.00 42.77  ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? -35.258 10.981  22.173 1.00 42.13  ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? -32.566 9.083   22.419 1.00 37.62  ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? -31.628 8.086   21.905 1.00 36.49  ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? -30.240 8.228   22.529 1.00 37.24  ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? -29.977 9.202   23.237 1.00 38.36  ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? -31.564 8.109   20.371 1.00 35.11  ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? -31.394 9.505   19.803 1.00 37.38  ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? -30.339 10.135  19.952 1.00 37.25  ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? -32.437 9.996   19.128 1.00 35.99  ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? -29.360 7.258   22.269 1.00 38.06  ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? -28.026 7.230   22.877 1.00 39.04  ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? -27.094 8.291   22.312 1.00 41.60  ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? -26.219 8.786   23.030 1.00 40.75  ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? -27.383 5.849   22.746 1.00 39.84  ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? -28.069 4.786   23.597 1.00 40.09  ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? -27.373 3.127   23.464 1.00 38.33  ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? -27.830 2.646   21.798 1.00 35.07  ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? -27.283 8.645   21.039 1.00 43.54  ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? -26.480 9.702   20.422 1.00 46.65  ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? -26.658 10.991  21.217 1.00 44.74  ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? -25.676 11.569  21.686 1.00 45.14  ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? -26.842 9.909   18.939 1.00 49.83  ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? -25.845 10.779  18.168 1.00 55.64  ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? -26.354 11.147  16.774 1.00 65.39  ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? -25.400 11.992  16.048 1.00 70.82  ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? -25.552 13.299  15.819 1.00 74.59  ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? -26.636 13.946  16.242 1.00 74.50  ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? -24.613 13.964  15.153 1.00 74.10  ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? -27.915 11.405  21.393 1.00 43.60  ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? -28.264 12.598  22.172 1.00 42.93  ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? -27.645 12.620  23.566 1.00 40.91  ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? -27.254 13.675  24.053 1.00 43.99  ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? -29.782 12.736  22.306 1.00 44.85  ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? -30.476 12.987  20.982 1.00 48.17  ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? -29.790 13.194  19.952 1.00 49.37  ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? -31.728 12.973  20.981 1.00 51.34  ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? -27.562 11.460  24.205 1.00 39.01  ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? -27.017 11.370  25.558 1.00 37.22  ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? -25.504 11.553  25.548 1.00 36.81  ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? -24.933 12.064  26.508 1.00 36.74  ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? -27.395 10.045  26.202 1.00 33.40  ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? -24.870 11.127  24.457 1.00 37.75  ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? -23.431 11.313  24.252 1.00 38.85  ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? -23.120 12.787  23.993 1.00 39.16  ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? -22.183 13.336  24.563 1.00 37.31  ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? -22.932 10.458  23.078 1.00 37.29  ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? -22.803 9.098   23.445 1.00 38.70  ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? -23.920 13.417  23.131 1.00 40.71  ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? -23.781 14.839  22.838 1.00 42.78  ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? -23.958 15.667  24.098 1.00 41.51  ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? -23.167 16.569  24.360 1.00 43.79  ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? -24.794 15.290  21.791 1.00 45.11  ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? -24.520 14.807  20.386 1.00 50.27  ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? -25.544 15.341  19.402 1.00 59.34  ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? -26.760 15.218  19.612 1.00 60.40  ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? -25.059 15.948  18.318 1.00 61.25  ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? -24.984 15.350  24.883 1.00 38.81  ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? -25.222 16.052  26.133 1.00 36.81  ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? -24.023 15.937  27.065 1.00 39.06  ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? -23.676 16.907  27.738 1.00 39.79  ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? -26.480 15.536  26.819 1.00 36.74  ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? -26.760 16.241  28.099 1.00 35.16  ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? -27.315 17.485  28.249 1.00 33.69  ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? -26.493 15.757  29.417 1.00 32.22  ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? -27.401 17.804  29.583 1.00 35.70  ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? -26.909 16.758  30.322 1.00 32.22  ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? -25.936 14.576  29.923 1.00 34.17  ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? -26.788 16.614  31.703 1.00 29.17  ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? -25.817 14.433  31.301 1.00 34.16  ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? -26.241 15.448  32.174 1.00 31.82  ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? -23.389 14.760  27.090 1.00 40.32  ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? -22.145 14.549  27.852 1.00 42.00  ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? -21.056 15.561  27.454 1.00 41.57  ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? -20.410 16.163  28.317 1.00 41.33  ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? -21.610 13.086  27.712 1.00 41.95  ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? -22.483 12.110  28.508 1.00 44.55  ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? -20.177 12.975  28.221 1.00 43.23  ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? -22.215 10.642  28.221 1.00 44.75  ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? -20.873 15.744  26.148 1.00 42.92  ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? -19.883 16.681  25.621 1.00 45.46  ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? -20.181 18.117  26.061 1.00 43.32  ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? -19.298 18.806  26.571 1.00 43.25  ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? -19.803 16.596  24.090 1.00 48.31  ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? -18.616 17.349  23.499 1.00 54.38  ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? -18.866 17.764  22.058 1.00 61.13  ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? -17.703 18.599  21.517 1.00 63.59  ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? -18.000 19.173  20.172 1.00 63.81  ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? -21.426 18.549  25.876 1.00 42.23  ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? -21.847 19.892  26.278 1.00 40.80  ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? -21.571 20.175  27.756 1.00 41.07  ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? -21.070 21.250  28.090 1.00 41.25  ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? -23.317 20.145  25.931 1.00 40.32  ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? -23.607 20.029  24.441 1.00 41.52  ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? -24.884 20.749  24.030 1.00 41.86  ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? -26.098 20.118  24.554 1.00 42.08  ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? -26.700 19.060  24.012 1.00 43.79  ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? -26.206 18.476  22.922 1.00 42.15  ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? -27.801 18.578  24.569 1.00 44.28  ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? -21.869 19.206  28.627 1.00 40.31  ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? -21.623 19.348  30.067 1.00 40.06  ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? -20.148 19.533  30.380 1.00 41.32  ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? -19.798 20.248  31.322 1.00 41.58  ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? -22.159 18.150  30.855 1.00 38.58  ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? -23.666 18.036  30.879 1.00 39.13  ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? -24.452 19.351  31.831 1.00 39.67  ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? -24.272 18.724  33.497 1.00 34.73  ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? -19.292 18.869  29.603 1.00 44.54  ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? -17.841 19.013  29.735 1.00 47.71  ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? -17.411 20.429  29.311 1.00 46.28  ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? -16.634 21.078  30.012 1.00 41.95  ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? -17.108 17.948  28.900 1.00 50.51  ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? -15.583 17.916  29.107 1.00 58.82  ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? -14.839 17.196  27.985 1.00 64.19  ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? -14.166 17.879  27.175 1.00 63.67  ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? -14.933 15.949  27.911 1.00 68.04  ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? -17.938 20.883  28.171 1.00 46.52  ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? -17.663 22.210  27.627 1.00 49.96  ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? -18.178 23.324  28.538 1.00 49.83  ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? -17.604 24.407  28.580 1.00 51.88  ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? -18.285 22.358  26.232 1.00 52.03  ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? -17.628 21.460  25.187 1.00 56.03  ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? -16.423 21.134  25.316 1.00 56.34  ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? -18.330 21.088  24.219 1.00 60.35  ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? -19.269 23.048  29.250 1.00 47.89  ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? -19.830 23.968  30.235 1.00 44.41  ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? -18.996 23.945  31.523 1.00 43.60  ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? -18.862 24.961  32.200 1.00 43.82  ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? -21.316 23.621  30.526 1.00 43.85  ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? -22.206 24.046  29.349 1.00 42.84  ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? -21.797 24.257  31.824 1.00 41.11  ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? -23.638 23.483  29.393 1.00 40.87  ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? -18.432 22.784  31.847 1.00 42.08  ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? -17.672 22.606  33.079 1.00 40.39  ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? -18.448 21.964  34.222 1.00 40.90  ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? -18.115 22.191  35.387 1.00 40.84  ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? -19.470 21.159  33.903 1.00 39.73  ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? -20.325 20.530  34.932 1.00 39.61  ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? -20.413 19.018  34.808 1.00 39.10  ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? -20.415 18.478  33.698 1.00 40.93  ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? -21.743 21.111  34.918 1.00 39.54  ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? -21.955 22.512  35.492 1.00 37.92  ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? -23.301 23.052  35.040 1.00 34.67  ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? -21.841 22.511  37.010 1.00 38.66  ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? -20.513 18.348  35.955 1.00 37.53  ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? -20.499 16.888  36.008 1.00 36.23  ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? -21.724 16.272  35.348 1.00 37.73  ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? -22.867 16.675  35.608 1.00 37.32  ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? -20.357 16.368  37.443 1.00 33.70  ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? -20.031 14.880  37.485 1.00 36.95  ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? -19.738 14.331  38.875 1.00 38.77  ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? -19.817 15.085  39.875 1.00 41.50  ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? -19.423 13.122  38.959 1.00 36.99  ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? -21.458 15.302  34.477 1.00 37.00  ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? -22.491 14.513  33.842 1.00 34.93  ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? -22.454 13.124  34.479 1.00 33.67  ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? -21.584 12.311  34.174 1.00 30.85  ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? -22.247 14.447  32.330 1.00 34.91  ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? -23.402 12.864  35.375 1.00 33.50  ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? -23.395 11.631  36.170 1.00 34.80  ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? -24.182 10.483  35.523 1.00 33.93  ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? -24.997 10.709  34.633 1.00 35.45  ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? -23.941 11.909  37.570 1.00 34.06  ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? -23.137 12.841  38.469 1.00 34.20  ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? -23.663 14.267  38.360 1.00 40.18  ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? -23.250 12.351  39.893 1.00 33.29  ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? -23.930 9.257   35.978 1.00 33.00  ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? -24.636 8.085   35.476 1.00 32.03  ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? -23.758 7.184   34.625 1.00 34.05  ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? -22.616 7.541   34.290 1.00 33.24  ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? -24.294 6.018   34.265 1.00 31.95  ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? -23.533 5.020   33.521 1.00 31.72  ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? -23.411 5.403   32.043 1.00 32.00  ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? -24.379 5.350   31.300 1.00 32.28  ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? -24.134 3.617   33.719 1.00 29.87  ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? -23.494 2.508   32.890 1.00 30.73  ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? -21.688 2.460   32.913 1.00 33.13  ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? -21.345 1.590   34.440 1.00 33.63  ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? -22.206 5.786   31.636 1.00 32.42  ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? -21.957 6.270   30.279 1.00 35.87  ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? -21.731 5.159   29.254 1.00 35.38  ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? -21.827 5.406   28.053 1.00 35.86  ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? -20.780 7.259   30.262 1.00 36.34  ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? -19.521 6.677   30.884 1.00 38.64  ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? -18.429 6.959   30.363 1.00 39.21  ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? -19.623 5.931   31.886 1.00 39.46  ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? -21.421 3.950   29.723 1.00 36.69  ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? -21.384 2.767   28.846 1.00 35.43  ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? -22.797 2.206   28.793 1.00 34.82  ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? -23.236 1.469   29.691 1.00 34.41  ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? -20.397 1.716   29.363 1.00 37.36  ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? -20.214 0.544   28.399 1.00 40.45  ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? -20.988 0.410   27.428 1.00 42.51  ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? -19.281 -0.258  28.613 1.00 43.80  ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? -23.506 2.573   27.734 1.00 33.43  ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? -24.943 2.363   27.664 1.00 32.05  ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? -25.368 0.894   27.636 1.00 33.48  ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? -26.421 0.553   28.186 1.00 34.27  ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? -25.565 3.177   26.518 1.00 31.25  ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? -25.315 4.662   26.620 1.00 30.01  ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? -25.647 5.364   27.786 1.00 32.86  ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? -24.759 5.362   25.551 1.00 31.75  ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? -25.422 6.739   27.884 1.00 33.53  ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? -24.528 6.738   25.632 1.00 32.16  ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? -24.862 7.429   26.804 1.00 33.69  ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? -24.554 0.014   27.048 1.00 34.70  ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? -24.902 -1.417  27.083 1.00 35.16  ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? -24.869 -2.037  28.492 1.00 34.68  ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? -25.685 -2.920  28.798 1.00 31.04  ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? -24.142 -2.250  26.044 1.00 37.30  ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? -22.650 -2.254  26.132 1.00 39.60  ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? -22.094 -2.525  24.733 1.00 43.34  ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? -20.586 -2.410  24.706 1.00 45.04  ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? -20.150 -1.040  25.057 1.00 46.29  ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? -23.974 -1.548  29.356 1.00 32.71  ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? -24.031 -1.916  30.779 1.00 32.24  ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? -25.338 -1.439  31.411 1.00 31.06  ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? -25.960 -2.167  32.180 1.00 33.35  ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? -22.829 -1.382  31.580 1.00 31.09  ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? -21.401 -1.756  31.166 1.00 33.23  ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? -20.403 -1.378  32.260 1.00 28.46  ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? -21.256 -3.231  30.796 1.00 28.88  ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? -25.756 -0.220  31.079 1.00 32.50  ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? -27.034 0.305   31.565 1.00 31.49  ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? -28.198 -0.543  31.032 1.00 30.66  ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? -29.117 -0.892  31.784 1.00 30.65  ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? -27.196 1.769   31.182 1.00 29.59  ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? -28.143 -0.880  29.743 1.00 28.74  ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? -29.142 -1.745  29.132 1.00 27.89  ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? -29.224 -3.093  29.869 1.00 29.53  ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? -30.301 -3.493  30.318 1.00 29.84  ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? -28.877 -1.933  27.632 1.00 28.76  ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? -29.794 -2.948  26.982 1.00 29.81  ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? -29.421 -4.292  26.883 1.00 27.69  ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? -31.052 -2.572  26.506 1.00 26.86  ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? -30.266 -5.228  26.313 1.00 29.05  ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? -31.906 -3.494  25.936 1.00 26.21  ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? -31.517 -4.822  25.838 1.00 33.26  ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? -32.376 -5.742  25.254 1.00 33.25  ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? -28.085 -3.773  30.010 1.00 30.21  ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? -28.040 -5.055  30.724 1.00 29.53  ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? -28.608 -4.946  32.142 1.00 29.39  ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? -29.359 -5.811  32.584 1.00 28.81  ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? -26.620 -5.636  30.753 1.00 27.34  ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? -25.981 -6.159  29.458 1.00 28.97  ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? -24.598 -6.753  29.746 1.00 23.43  ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? -26.868 -7.166  28.733 1.00 28.38  ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? -28.262 -3.867  32.835 1.00 30.21  ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? -28.724 -3.635  34.206 1.00 31.79  ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? -30.247 -3.486  34.300 1.00 32.75  ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? -30.865 -3.978  35.244 1.00 31.46  ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? -28.041 -2.393  34.776 1.00 32.57  ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? -28.382 -2.207  36.134 1.00 35.66  ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? -30.831 -2.801  33.314 1.00 33.33  ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? -32.272 -2.564  33.249 1.00 34.05  ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? -33.011 -3.823  32.844 1.00 35.38  ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? -34.087 -4.108  33.364 1.00 34.59  ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? -32.605 -1.473  32.215 1.00 35.60  ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? -32.311 -0.061  32.712 1.00 38.08  ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? -32.221 0.846   31.853 1.00 37.31  ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? -32.180 0.147   33.942 1.00 37.26  ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? -32.441 -4.560  31.893 1.00 33.97  ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? -33.117 -5.713  31.308 1.00 33.73  ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? -33.037 -6.955  32.198 1.00 33.74  ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? -33.913 -7.808  32.147 1.00 34.80  ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? -32.540 -6.023  29.918 1.00 33.85  ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? -32.524 -4.819  29.150 1.00 34.63  ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? -33.377 -7.089  29.192 1.00 32.02  ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? -31.980 -7.048  33.002 1.00 33.61  ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? -31.762 -8.190  33.891 1.00 31.67  ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? -31.616 -7.689  35.321 1.00 32.61  ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? -30.544 -7.754  35.896 1.00 29.88  ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? -30.543 -9.003  33.417 1.00 28.61  ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? -30.781 -9.503  32.023 1.00 27.91  ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? -30.275 -8.820  30.923 1.00 26.60  ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? -31.605 -10.610 31.795 1.00 24.25  ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? -30.544 -9.247  29.626 1.00 29.40  ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? -31.884 -11.039 30.509 1.00 27.99  ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? -31.355 -10.357 29.426 1.00 29.43  ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? -31.634 -10.792 28.145 1.00 30.63  ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? -32.708 -7.166  35.876 1.00 34.12  ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? -32.693 -6.609  37.226 1.00 37.86  ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? -32.907 -7.647  38.323 1.00 36.53  ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? -33.797 -7.518  39.159 1.00 40.73  ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? -33.700 -5.461  37.370 1.00 39.93  ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? -33.368 -4.545  38.549 1.00 45.99  ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? -32.219 -4.108  38.710 1.00 46.79  ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? -34.372 -4.257  39.381 1.00 46.64  ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? -32.073 -8.673  38.303 1.00 35.07  ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? -32.151 -9.798  39.219 1.00 35.40  ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? -30.879 -10.598 39.039 1.00 36.71  ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? -30.167 -10.406 38.046 1.00 37.86  ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? -33.360 -10.682 38.902 1.00 34.32  ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? -33.494 -11.107 37.448 1.00 32.83  ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? -34.384 -10.457 36.590 1.00 31.75  ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? -32.762 -12.182 36.943 1.00 32.28  ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? -34.528 -10.859 35.256 1.00 32.14  ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? -32.893 -12.589 35.610 1.00 34.19  ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? -33.779 -11.925 34.777 1.00 34.08  ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? -33.919 -12.337 33.471 1.00 36.73  ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? -30.593 -11.495 39.979 1.00 36.96  ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? -29.395 -12.321 39.881 1.00 39.45  ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? -29.542 -13.317 38.739 1.00 40.19  ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? -30.471 -14.134 38.743 1.00 38.67  ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? -29.131 -13.051 41.193 1.00 40.80  ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? -27.706 -13.564 41.341 1.00 46.08  ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? -27.473 -14.276 42.666 1.00 51.61  ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? -26.576 -15.145 42.716 1.00 54.64  ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? -28.182 -13.969 43.654 1.00 49.61  ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? -28.632 -13.239 37.763 1.00 39.07  ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? -28.698 -14.111 36.582 1.00 37.43  ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? -28.321 -15.558 36.902 1.00 38.04  ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? -27.178 -15.854 37.264 1.00 37.45  ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? -27.789 -13.613 35.431 1.00 37.33  ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? -28.297 -12.298 34.849 1.00 35.09  ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? -27.679 -14.673 34.320 1.00 34.58  ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? -27.261 -11.593 33.986 1.00 32.41  ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? -29.293 -16.452 36.773 1.00 40.87  ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? -29.023 -17.884 36.757 1.00 43.25  ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? -28.987 -18.317 35.298 1.00 42.67  ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? -30.000 -18.264 34.598 1.00 45.11  ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? -30.097 -18.649 37.536 1.00 44.71  ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? -29.670 -19.121 38.942 1.00 53.42  ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? -29.752 -18.038 40.043 1.00 53.39  ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? -28.473 -17.191 40.149 1.00 54.40  ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? -27.214 -17.993 40.268 1.00 52.76  ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? -27.810 -18.702 34.829 1.00 40.71  ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? -27.641 -19.074 33.431 1.00 39.28  ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? -27.520 -20.589 33.268 1.00 39.27  ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? -27.146 -21.301 34.204 1.00 38.72  ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? -26.444 -18.341 32.812 1.00 38.61  ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? -25.077 -18.817 33.267 1.00 36.47  ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? -24.543 -18.436 34.509 1.00 38.24  ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? -24.301 -19.622 32.438 1.00 37.07  ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? -23.263 -18.876 34.917 1.00 38.11  ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? -23.041 -20.065 32.826 1.00 37.97  ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? -22.523 -19.690 34.058 1.00 40.72  ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? -21.271 -20.149 34.407 1.00 40.45  ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? -27.863 -21.071 32.077 1.00 38.47  ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? -27.753 -22.483 31.752 1.00 37.35  ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? -26.747 -22.621 30.621 1.00 36.18  ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? -27.042 -22.308 29.467 1.00 36.22  ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? -29.127 -23.048 31.370 1.00 38.34  ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? -29.085 -24.531 31.002 1.00 41.37  ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? -28.054 -25.201 31.246 1.00 41.26  ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? -30.097 -25.029 30.459 1.00 40.82  ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? -25.550 -23.085 30.966 1.00 36.73  ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? -24.437 -23.181 30.013 1.00 34.06  ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? -24.708 -24.094 28.820 1.00 32.42  ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? -24.085 -23.938 27.775 1.00 31.08  ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? -23.152 -23.613 30.719 1.00 32.67  ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? -23.125 -25.059 31.093 1.00 37.42  ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? -22.768 -26.050 30.204 1.00 39.56  ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? -23.399 -25.682 32.264 1.00 39.68  ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? -22.829 -27.223 30.810 1.00 43.41  ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? -23.212 -27.027 32.061 1.00 42.65  ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? -25.635 -25.038 28.976 1.00 31.24  ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? -25.970 -25.969 27.897 1.00 33.05  ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? -26.741 -25.290 26.759 1.00 31.94  ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? -26.976 -25.894 25.711 1.00 29.01  ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? -26.779 -27.194 28.413 1.00 34.52  ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? -27.983 -26.746 29.043 1.00 33.87  ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? -25.969 -28.007 29.415 1.00 36.86  ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? -27.143 -24.040 26.978 1.00 33.39  ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? -27.860 -23.258 25.967 1.00 33.21  ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? -26.945 -22.223 25.304 1.00 30.86  ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? -27.339 -21.526 24.360 1.00 30.06  ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? -29.082 -22.570 26.594 1.00 33.93  ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? -30.106 -23.518 27.206 1.00 37.50  ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? -30.767 -24.388 26.144 1.00 43.94  ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? -31.617 -25.484 26.772 1.00 50.75  ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? -32.516 -24.949 27.835 1.00 53.55  ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? -25.724 -22.121 25.814 1.00 30.36  ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? -24.760 -21.155 25.300 1.00 27.98  ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? -23.857 -21.858 24.310 1.00 27.57  ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? -23.169 -22.820 24.669 1.00 30.52  ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? -23.919 -20.535 26.434 1.00 26.68  ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? -24.825 -19.787 27.419 1.00 22.15  ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? -22.817 -19.617 25.868 1.00 25.33  ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? -24.138 -19.405 28.713 1.00 20.47  ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? -23.852 -21.376 23.071 1.00 24.00  ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? -23.039 -21.991 22.026 1.00 23.38  ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? -21.579 -21.558 22.131 1.00 23.63  ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? -21.211 -20.426 21.777 1.00 24.56  ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? -23.601 -21.690 20.626 1.00 23.23  ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? -23.079 -22.641 19.549 1.00 26.41  ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? -23.716 -22.388 18.182 1.00 29.27  ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? -25.166 -22.580 18.192 1.00 29.74  ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? -25.788 -23.736 17.972 1.00 27.29  ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? -25.093 -24.829 17.714 1.00 22.35  ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? -27.118 -23.796 18.001 1.00 22.09  ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? -20.751 -22.474 22.614 1.00 23.21  ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? -19.313 -22.250 22.723 1.00 23.57  ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? -18.633 -22.965 21.559 1.00 25.50  ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? -18.755 -24.184 21.414 1.00 26.04  ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? -18.779 -22.763 24.080 1.00 24.19  ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? -17.294 -22.517 24.209 1.00 25.47  ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? -19.512 -22.089 25.220 1.00 23.83  ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? -17.937 -22.202 20.718 1.00 26.42  ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? -17.295 -22.752 19.528 1.00 24.57  ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? -15.773 -22.755 19.631 1.00 26.82  ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? -15.167 -21.745 19.987 1.00 30.42  ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? -17.744 -21.995 18.282 1.00 22.67  ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? -15.172 -23.901 19.320 1.00 28.56  ? 112  ASN A N     1 
ATOM   931  C  CA    . ASN A 1 112 ? -13.720 -24.072 19.274 1.00 30.77  ? 112  ASN A CA    1 
ATOM   932  C  C     . ASN A 1 112 ? -13.310 -24.418 17.851 1.00 29.56  ? 112  ASN A C     1 
ATOM   933  O  O     . ASN A 1 112 ? -13.781 -25.410 17.296 1.00 28.31  ? 112  ASN A O     1 
ATOM   934  C  CB    . ASN A 1 112 ? -13.277 -25.228 20.178 1.00 31.72  ? 112  ASN A CB    1 
ATOM   935  C  CG    . ASN A 1 112 ? -13.094 -24.819 21.614 1.00 40.30  ? 112  ASN A CG    1 
ATOM   936  O  OD1   . ASN A 1 112 ? -11.970 -24.811 22.129 1.00 42.94  ? 112  ASN A OD1   1 
ATOM   937  N  ND2   . ASN A 1 112 ? -14.197 -24.500 22.287 1.00 41.80  ? 112  ASN A ND2   1 
ATOM   938  N  N     . PHE A 1 113 ? -12.418 -23.633 17.267 1.00 27.41  ? 113  PHE A N     1 
ATOM   939  C  CA    . PHE A 1 113 ? -11.991 -23.922 15.910 1.00 28.48  ? 113  PHE A CA    1 
ATOM   940  C  C     . PHE A 1 113 ? -10.532 -23.589 15.644 1.00 30.04  ? 113  PHE A C     1 
ATOM   941  O  O     . PHE A 1 113 ? -9.876  -22.933 16.451 1.00 29.05  ? 113  PHE A O     1 
ATOM   942  C  CB    . PHE A 1 113 ? -12.928 -23.249 14.894 1.00 27.72  ? 113  PHE A CB    1 
ATOM   943  C  CG    . PHE A 1 113 ? -12.587 -21.814 14.573 1.00 30.83  ? 113  PHE A CG    1 
ATOM   944  C  CD1   . PHE A 1 113 ? -12.469 -20.852 15.577 1.00 31.55  ? 113  PHE A CD1   1 
ATOM   945  C  CD2   . PHE A 1 113 ? -12.436 -21.416 13.244 1.00 31.36  ? 113  PHE A CD2   1 
ATOM   946  C  CE1   . PHE A 1 113 ? -12.182 -19.528 15.254 1.00 32.34  ? 113  PHE A CE1   1 
ATOM   947  C  CE2   . PHE A 1 113 ? -12.144 -20.106 12.914 1.00 32.39  ? 113  PHE A CE2   1 
ATOM   948  C  CZ    . PHE A 1 113 ? -12.019 -19.154 13.917 1.00 33.80  ? 113  PHE A CZ    1 
ATOM   949  N  N     . ASP A 1 114 ? -10.032 -24.064 14.509 1.00 31.43  ? 114  ASP A N     1 
ATOM   950  C  CA    . ASP A 1 114 ? -8.685  -23.752 14.052 1.00 32.86  ? 114  ASP A CA    1 
ATOM   951  C  C     . ASP A 1 114 ? -8.657  -24.023 12.579 1.00 31.48  ? 114  ASP A C     1 
ATOM   952  O  O     . ASP A 1 114 ? -9.461  -24.800 12.074 1.00 33.17  ? 114  ASP A O     1 
ATOM   953  C  CB    . ASP A 1 114 ? -7.627  -24.609 14.754 1.00 34.29  ? 114  ASP A CB    1 
ATOM   954  C  CG    . ASP A 1 114 ? -6.212  -24.037 14.596 1.00 46.20  ? 114  ASP A CG    1 
ATOM   955  O  OD1   . ASP A 1 114 ? -6.061  -22.845 14.206 1.00 48.91  ? 114  ASP A OD1   1 
ATOM   956  O  OD2   . ASP A 1 114 ? -5.244  -24.785 14.860 1.00 51.87  ? 114  ASP A OD2   1 
ATOM   957  N  N     . ILE A 1 115 ? -7.745  -23.381 11.874 1.00 31.56  ? 115  ILE A N     1 
ATOM   958  C  CA    . ILE A 1 115 ? -7.695  -23.545 10.431 1.00 31.25  ? 115  ILE A CA    1 
ATOM   959  C  C     . ILE A 1 115 ? -6.305  -23.957 10.010 1.00 32.13  ? 115  ILE A C     1 
ATOM   960  O  O     . ILE A 1 115 ? -5.341  -23.755 10.756 1.00 33.33  ? 115  ILE A O     1 
ATOM   961  C  CB    . ILE A 1 115 ? -8.110  -22.249 9.675  1.00 29.14  ? 115  ILE A CB    1 
ATOM   962  C  CG1   . ILE A 1 115 ? -7.010  -21.185 9.764  1.00 28.24  ? 115  ILE A CG1   1 
ATOM   963  C  CG2   . ILE A 1 115 ? -9.434  -21.715 10.203 1.00 30.01  ? 115  ILE A CG2   1 
ATOM   964  C  CD1   . ILE A 1 115 ? -7.268  -19.944 8.926  1.00 30.65  ? 115  ILE A CD1   1 
ATOM   965  N  N     . GLU A 1 116 ? -6.204  -24.532 8.816  1.00 32.30  ? 116  GLU A N     1 
ATOM   966  C  CA    . GLU A 1 116 ? -4.908  -24.795 8.214  1.00 33.02  ? 116  GLU A CA    1 
ATOM   967  C  C     . GLU A 1 116 ? -4.802  -24.015 6.927  1.00 33.22  ? 116  GLU A C     1 
ATOM   968  O  O     . GLU A 1 116 ? -5.792  -23.879 6.187  1.00 34.24  ? 116  GLU A O     1 
ATOM   969  C  CB    . GLU A 1 116 ? -4.714  -26.282 7.940  1.00 33.98  ? 116  GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 116 ? -4.842  -27.191 9.166  1.00 37.97  ? 116  GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 116 ? -3.813  -26.911 10.246 1.00 39.62  ? 116  GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 116 ? -2.774  -26.284 9.952  1.00 40.85  ? 116  GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 116 ? -4.041  -27.329 11.402 1.00 43.07  ? 116  GLU A OE2   1 
ATOM   974  N  N     . VAL A 1 117 ? -3.610  -23.482 6.674  1.00 30.76  ? 117  VAL A N     1 
ATOM   975  C  CA    . VAL A 1 117 ? -3.335  -22.753 5.447  1.00 30.27  ? 117  VAL A CA    1 
ATOM   976  C  C     . VAL A 1 117 ? -1.929  -23.096 4.966  1.00 32.58  ? 117  VAL A C     1 
ATOM   977  O  O     . VAL A 1 117 ? -0.941  -22.633 5.537  1.00 33.28  ? 117  VAL A O     1 
ATOM   978  C  CB    . VAL A 1 117 ? -3.457  -21.228 5.637  1.00 29.66  ? 117  VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 117 ? -3.180  -20.504 4.323  1.00 30.33  ? 117  VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 117 ? -4.836  -20.844 6.186  1.00 30.37  ? 117  VAL A CG2   1 
ATOM   981  N  N     . THR A 1 118 ? -1.842  -23.923 3.925  1.00 34.37  ? 118  THR A N     1 
ATOM   982  C  CA    . THR A 1 118 ? -0.562  -24.234 3.303  1.00 36.50  ? 118  THR A CA    1 
ATOM   983  C  C     . THR A 1 118 ? -0.023  -22.969 2.648  1.00 37.93  ? 118  THR A C     1 
ATOM   984  O  O     . THR A 1 118 ? -0.747  -22.286 1.925  1.00 39.50  ? 118  THR A O     1 
ATOM   985  C  CB    . THR A 1 118 ? -0.685  -25.380 2.285  1.00 36.82  ? 118  THR A CB    1 
ATOM   986  O  OG1   . THR A 1 118 ? -1.059  -26.578 2.976  1.00 38.86  ? 118  THR A OG1   1 
ATOM   987  C  CG2   . THR A 1 118 ? 0.637   -25.623 1.555  1.00 36.58  ? 118  THR A CG2   1 
ATOM   988  N  N     . SER A 1 119 ? 1.234   -22.657 2.955  1.00 39.53  ? 119  SER A N     1 
ATOM   989  C  CA    . SER A 1 119 ? 1.916   -21.480 2.452  1.00 43.76  ? 119  SER A CA    1 
ATOM   990  C  C     . SER A 1 119 ? 3.344   -21.830 2.051  1.00 45.32  ? 119  SER A C     1 
ATOM   991  O  O     . SER A 1 119 ? 4.184   -22.088 2.918  1.00 42.37  ? 119  SER A O     1 
ATOM   992  C  CB    . SER A 1 119 ? 1.945   -20.389 3.522  1.00 45.85  ? 119  SER A CB    1 
ATOM   993  O  OG    . SER A 1 119 ? 2.731   -19.290 3.092  1.00 49.98  ? 119  SER A OG    1 
ATOM   994  N  N     . PRO A 1 120 ? 3.631   -21.823 0.736  1.00 48.61  ? 120  PRO A N     1 
ATOM   995  C  CA    . PRO A 1 120 ? 4.968   -22.165 0.224  1.00 51.25  ? 120  PRO A CA    1 
ATOM   996  C  C     . PRO A 1 120 ? 5.995   -21.037 0.359  1.00 53.18  ? 120  PRO A C     1 
ATOM   997  O  O     . PRO A 1 120 ? 7.180   -21.248 0.073  1.00 54.47  ? 120  PRO A O     1 
ATOM   998  C  CB    . PRO A 1 120 ? 4.709   -22.449 -1.256 1.00 52.10  ? 120  PRO A CB    1 
ATOM   999  C  CG    . PRO A 1 120 ? 3.546   -21.558 -1.594 1.00 53.24  ? 120  PRO A CG    1 
ATOM   1000 C  CD    . PRO A 1 120 ? 2.682   -21.526 -0.354 1.00 50.01  ? 120  PRO A CD    1 
ATOM   1001 N  N     . ASP A 1 121 ? 5.551   -19.858 0.791  1.00 54.73  ? 121  ASP A N     1 
ATOM   1002 C  CA    . ASP A 1 121 ? 6.429   -18.691 0.853  1.00 56.78  ? 121  ASP A CA    1 
ATOM   1003 C  C     . ASP A 1 121 ? 6.396   -17.962 2.197  1.00 55.96  ? 121  ASP A C     1 
ATOM   1004 O  O     . ASP A 1 121 ? 6.165   -16.752 2.258  1.00 56.85  ? 121  ASP A O     1 
ATOM   1005 C  CB    . ASP A 1 121 ? 6.136   -17.733 -0.312 1.00 58.87  ? 121  ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1 121 ? 4.648   -17.497 -0.522 1.00 63.43  ? 121  ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1 121 ? 4.191   -17.618 -1.681 1.00 64.93  ? 121  ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1 121 ? 3.939   -17.200 0.469  1.00 64.50  ? 121  ASP A OD2   1 
ATOM   1009 N  N     . GLY A 1 122 ? 6.652   -18.706 3.269  1.00 54.72  ? 122  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 122 ? 6.701   -18.136 4.615  1.00 52.28  ? 122  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 122 ? 5.338   -18.087 5.275  1.00 49.38  ? 122  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 122 ? 4.329   -18.390 4.641  1.00 49.09  ? 122  GLY A O     1 
ATOM   1013 N  N     . PHE A 1 123 ? 5.312   -17.698 6.549  1.00 47.08  ? 123  PHE A N     1 
ATOM   1014 C  CA    . PHE A 1 123 ? 4.074   -17.592 7.320  1.00 44.70  ? 123  PHE A CA    1 
ATOM   1015 C  C     . PHE A 1 123 ? 2.958   -16.926 6.527  1.00 40.95  ? 123  PHE A C     1 
ATOM   1016 O  O     . PHE A 1 123 ? 3.179   -15.884 5.915  1.00 40.60  ? 123  PHE A O     1 
ATOM   1017 C  CB    . PHE A 1 123 ? 4.318   -16.798 8.599  1.00 46.48  ? 123  PHE A CB    1 
ATOM   1018 C  CG    . PHE A 1 123 ? 3.195   -16.886 9.597  1.00 49.56  ? 123  PHE A CG    1 
ATOM   1019 C  CD1   . PHE A 1 123 ? 3.069   -18.000 10.427 1.00 49.69  ? 123  PHE A CD1   1 
ATOM   1020 C  CD2   . PHE A 1 123 ? 2.272   -15.848 9.721  1.00 48.18  ? 123  PHE A CD2   1 
ATOM   1021 C  CE1   . PHE A 1 123 ? 2.029   -18.082 11.361 1.00 52.49  ? 123  PHE A CE1   1 
ATOM   1022 C  CE2   . PHE A 1 123 ? 1.237   -15.919 10.655 1.00 50.01  ? 123  PHE A CE2   1 
ATOM   1023 C  CZ    . PHE A 1 123 ? 1.116   -17.037 11.477 1.00 49.71  ? 123  PHE A CZ    1 
ATOM   1024 N  N     . PRO A 1 124 ? 1.753   -17.527 6.532  1.00 40.04  ? 124  PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 124 ? 0.640   -16.908 5.803  1.00 38.93  ? 124  PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 124 ? 0.050   -15.761 6.620  1.00 38.90  ? 124  PRO A C     1 
ATOM   1027 O  O     . PRO A 1 124 ? -0.668  -16.006 7.588  1.00 39.95  ? 124  PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 124 ? -0.364  -18.056 5.644  1.00 35.98  ? 124  PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 124 ? -0.098  -18.962 6.816  1.00 39.45  ? 124  PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 124 ? 1.346   -18.757 7.242  1.00 39.19  ? 124  PRO A CD    1 
ATOM   1031 N  N     . GLU A 1 125 ? 0.384   -14.525 6.249  1.00 39.04  ? 125  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 125 ? -0.062  -13.351 6.996  1.00 40.88  ? 125  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 125 ? -1.556  -13.123 6.819  1.00 38.34  ? 125  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 125 ? -2.028  -13.006 5.695  1.00 38.70  ? 125  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 125 ? 0.735   -12.091 6.603  1.00 42.85  ? 125  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 125 ? 2.169   -12.026 7.174  1.00 49.95  ? 125  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 125 ? 2.236   -11.963 8.716  1.00 53.96  ? 125  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 125 ? 1.214   -11.669 9.377  1.00 54.50  ? 125  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 125 ? 3.331   -12.204 9.270  1.00 55.18  ? 125  GLU A OE2   1 
ATOM   1040 N  N     . PRO A 1 126 ? -2.304  -13.067 7.934  1.00 38.23  ? 126  PRO A N     1 
ATOM   1041 C  CA    . PRO A 1 126 ? -3.756  -12.886 7.850  1.00 38.14  ? 126  PRO A CA    1 
ATOM   1042 C  C     . PRO A 1 126 ? -4.170  -11.579 7.168  1.00 39.06  ? 126  PRO A C     1 
ATOM   1043 O  O     . PRO A 1 126 ? -5.176  -11.558 6.456  1.00 40.68  ? 126  PRO A O     1 
ATOM   1044 C  CB    . PRO A 1 126 ? -4.210  -12.910 9.319  1.00 35.72  ? 126  PRO A CB    1 
ATOM   1045 C  CG    . PRO A 1 126 ? -3.155  -13.641 10.031 1.00 36.41  ? 126  PRO A CG    1 
ATOM   1046 C  CD    . PRO A 1 126 ? -1.864  -13.316 9.321  1.00 38.03  ? 126  PRO A CD    1 
ATOM   1047 N  N     . SER A 1 127 ? -3.405  -10.507 7.359  1.00 39.86  ? 127  SER A N     1 
ATOM   1048 C  CA    . SER A 1 127 ? -3.767  -9.216  6.757  1.00 42.04  ? 127  SER A CA    1 
ATOM   1049 C  C     . SER A 1 127 ? -3.697  -9.234  5.218  1.00 42.58  ? 127  SER A C     1 
ATOM   1050 O  O     . SER A 1 127 ? -4.313  -8.400  4.561  1.00 41.57  ? 127  SER A O     1 
ATOM   1051 C  CB    . SER A 1 127 ? -2.920  -8.080  7.334  1.00 41.24  ? 127  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 127 ? -1.572  -8.214  6.927  1.00 45.64  ? 127  SER A OG    1 
ATOM   1053 N  N     . GLN A 1 128 ? -2.937  -10.182 4.663  1.00 43.33  ? 128  GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 128 ? -2.868  -10.399 3.218  1.00 43.07  ? 128  GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 128 ? -3.829  -11.504 2.768  1.00 43.08  ? 128  GLN A C     1 
ATOM   1056 O  O     . GLN A 1 128 ? -4.533  -11.339 1.765  1.00 43.73  ? 128  GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 128 ? -1.447  -10.752 2.788  1.00 44.43  ? 128  GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 128 ? -0.465  -9.591  2.819  1.00 52.97  ? 128  GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 128 ? 0.958   -10.021 2.467  1.00 58.24  ? 128  GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 128 ? 1.645   -10.664 3.266  1.00 59.52  ? 128  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 128 ? 1.404   -9.663  1.266  1.00 59.57  ? 128  GLN A NE2   1 
ATOM   1062 N  N     . ALA A 1 129 ? -3.849  -12.623 3.504  1.00 39.27  ? 129  ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 129 ? -4.676  -13.795 3.165  1.00 37.75  ? 129  ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 129 ? -4.595  -14.218 1.683  1.00 37.16  ? 129  ALA A C     1 
ATOM   1065 O  O     . ALA A 1 129 ? -5.615  -14.388 1.003  1.00 35.13  ? 129  ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 129 ? -6.129  -13.567 3.590  1.00 35.02  ? 129  ALA A CB    1 
ATOM   1067 N  N     . LYS A 1 130 ? -3.377  -14.386 1.186  1.00 38.40  ? 130  LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 130 ? -3.182  -14.722 -0.228 1.00 39.96  ? 130  LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 130 ? -3.106  -16.221 -0.511 1.00 38.18  ? 130  LYS A C     1 
ATOM   1070 O  O     . LYS A 1 130 ? -2.967  -16.617 -1.664 1.00 36.84  ? 130  LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 130 ? -1.973  -13.980 -0.825 1.00 42.45  ? 130  LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 130 ? -0.692  -14.023 -0.002 1.00 46.47  ? 130  LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 130 ? 0.402   -13.180 -0.662 1.00 52.13  ? 130  LYS A CD    1 
ATOM   1074 C  CE    . LYS A 1 130 ? 1.707   -13.233 0.133  1.00 57.98  ? 130  LYS A CE    1 
ATOM   1075 N  NZ    . LYS A 1 130 ? 2.743   -12.267 -0.356 1.00 59.63  ? 130  LYS A NZ    1 
ATOM   1076 N  N     . HIS A 1 131 ? -3.207  -17.044 0.536  1.00 36.74  ? 131  HIS A N     1 
ATOM   1077 C  CA    . HIS A 1 131 ? -3.191  -18.499 0.376  1.00 36.12  ? 131  HIS A CA    1 
ATOM   1078 C  C     . HIS A 1 131 ? -4.509  -19.151 0.800  1.00 35.29  ? 131  HIS A C     1 
ATOM   1079 O  O     . HIS A 1 131 ? -5.161  -18.682 1.739  1.00 36.55  ? 131  HIS A O     1 
ATOM   1080 C  CB    . HIS A 1 131 ? -2.023  -19.120 1.142  1.00 37.94  ? 131  HIS A CB    1 
ATOM   1081 C  CG    . HIS A 1 131 ? -0.694  -18.516 0.816  1.00 40.32  ? 131  HIS A CG    1 
ATOM   1082 N  ND1   . HIS A 1 131 ? -0.029  -17.676 1.682  1.00 43.86  ? 131  HIS A ND1   1 
ATOM   1083 C  CD2   . HIS A 1 131 ? 0.087   -18.618 -0.285 1.00 42.17  ? 131  HIS A CD2   1 
ATOM   1084 C  CE1   . HIS A 1 131 ? 1.107   -17.289 1.131  1.00 44.51  ? 131  HIS A CE1   1 
ATOM   1085 N  NE2   . HIS A 1 131 ? 1.205   -17.851 -0.061 1.00 45.12  ? 131  HIS A NE2   1 
ATOM   1086 N  N     . PRO A 1 132 ? -4.910  -20.232 0.103  1.00 34.22  ? 132  PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 132 ? -6.156  -20.956 0.398  1.00 33.68  ? 132  PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 132 ? -6.244  -21.530 1.817  1.00 33.39  ? 132  PRO A C     1 
ATOM   1089 O  O     . PRO A 1 132 ? -5.262  -22.072 2.335  1.00 30.86  ? 132  PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 132 ? -6.135  -22.110 -0.609 1.00 32.32  ? 132  PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 132 ? -5.317  -21.599 -1.744 1.00 34.64  ? 132  PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 132 ? -4.270  -20.721 -1.135 1.00 33.39  ? 132  PRO A CD    1 
ATOM   1093 N  N     . ILE A 1 133 ? -7.419  -21.399 2.432  1.00 31.69  ? 133  ILE A N     1 
ATOM   1094 C  CA    . ILE A 1 133 ? -7.744  -22.158 3.643  1.00 32.94  ? 133  ILE A CA    1 
ATOM   1095 C  C     . ILE A 1 133 ? -8.015  -23.598 3.203  1.00 32.71  ? 133  ILE A C     1 
ATOM   1096 O  O     . ILE A 1 133 ? -8.962  -23.849 2.466  1.00 32.15  ? 133  ILE A O     1 
ATOM   1097 C  CB    . ILE A 1 133 ? -8.974  -21.579 4.393  1.00 31.38  ? 133  ILE A CB    1 
ATOM   1098 C  CG1   . ILE A 1 133 ? -8.664  -20.165 4.914  1.00 30.85  ? 133  ILE A CG1   1 
ATOM   1099 C  CG2   . ILE A 1 133 ? -9.400  -22.510 5.541  1.00 30.59  ? 133  ILE A CG2   1 
ATOM   1100 C  CD1   . ILE A 1 133 ? -9.886  -19.330 5.314  1.00 25.56  ? 133  ILE A CD1   1 
ATOM   1101 N  N     . ASP A 1 134 ? -7.161  -24.531 3.614  1.00 32.04  ? 134  ASP A N     1 
ATOM   1102 C  CA    . ASP A 1 134 ? -7.342  -25.915 3.184  1.00 31.75  ? 134  ASP A CA    1 
ATOM   1103 C  C     . ASP A 1 134 ? -7.887  -26.858 4.250  1.00 31.37  ? 134  ASP A C     1 
ATOM   1104 O  O     . ASP A 1 134 ? -8.100  -28.047 3.971  1.00 30.81  ? 134  ASP A O     1 
ATOM   1105 C  CB    . ASP A 1 134 ? -6.083  -26.483 2.507  1.00 32.31  ? 134  ASP A CB    1 
ATOM   1106 C  CG    . ASP A 1 134 ? -4.832  -26.265 3.308  1.00 33.35  ? 134  ASP A CG    1 
ATOM   1107 O  OD1   . ASP A 1 134 ? -4.900  -26.220 4.548  1.00 38.64  ? 134  ASP A OD1   1 
ATOM   1108 O  OD2   . ASP A 1 134 ? -3.763  -26.164 2.690  1.00 34.77  ? 134  ASP A OD2   1 
ATOM   1109 N  N     . ALA A 1 135 ? -8.138  -26.336 5.451  1.00 29.34  ? 135  ALA A N     1 
ATOM   1110 C  CA    . ALA A 1 135 ? -8.762  -27.134 6.505  1.00 30.64  ? 135  ALA A CA    1 
ATOM   1111 C  C     . ALA A 1 135 ? -9.332  -26.270 7.610  1.00 31.76  ? 135  ALA A C     1 
ATOM   1112 O  O     . ALA A 1 135 ? -8.689  -25.322 8.040  1.00 34.81  ? 135  ALA A O     1 
ATOM   1113 C  CB    . ALA A 1 135 ? -7.770  -28.142 7.090  1.00 27.26  ? 135  ALA A CB    1 
ATOM   1114 N  N     . ILE A 1 136 ? -10.540 -26.608 8.058  1.00 31.15  ? 136  ILE A N     1 
ATOM   1115 C  CA    . ILE A 1 136 ? -11.143 -26.003 9.239  1.00 29.70  ? 136  ILE A CA    1 
ATOM   1116 C  C     . ILE A 1 136 ? -11.757 -27.123 10.062 1.00 28.47  ? 136  ILE A C     1 
ATOM   1117 O  O     . ILE A 1 136 ? -12.539 -27.914 9.538  1.00 28.33  ? 136  ILE A O     1 
ATOM   1118 C  CB    . ILE A 1 136 ? -12.285 -25.017 8.892  1.00 29.48  ? 136  ILE A CB    1 
ATOM   1119 C  CG1   . ILE A 1 136 ? -11.825 -23.946 7.907  1.00 29.36  ? 136  ILE A CG1   1 
ATOM   1120 C  CG2   . ILE A 1 136 ? -12.825 -24.365 10.163 1.00 29.50  ? 136  ILE A CG2   1 
ATOM   1121 C  CD1   . ILE A 1 136 ? -12.963 -23.055 7.376  1.00 26.81  ? 136  ILE A CD1   1 
ATOM   1122 N  N     . THR A 1 137 ? -11.394 -27.191 11.339 1.00 26.08  ? 137  THR A N     1 
ATOM   1123 C  CA    . THR A 1 137 ? -12.134 -27.990 12.299 1.00 26.91  ? 137  THR A CA    1 
ATOM   1124 C  C     . THR A 1 137 ? -12.801 -27.055 13.288 1.00 26.98  ? 137  THR A C     1 
ATOM   1125 O  O     . THR A 1 137 ? -12.150 -26.217 13.885 1.00 29.70  ? 137  THR A O     1 
ATOM   1126 C  CB    . THR A 1 137 ? -11.249 -28.995 13.048 1.00 28.02  ? 137  THR A CB    1 
ATOM   1127 O  OG1   . THR A 1 137 ? -10.528 -29.785 12.103 1.00 23.80  ? 137  THR A OG1   1 
ATOM   1128 C  CG2   . THR A 1 137 ? -12.109 -29.925 13.896 1.00 27.27  ? 137  THR A CG2   1 
ATOM   1129 N  N     . HIS A 1 138 ? -14.108 -27.215 13.445 1.00 25.99  ? 138  HIS A N     1 
ATOM   1130 C  CA    . HIS A 1 138 ? -14.923 -26.332 14.246 1.00 25.49  ? 138  HIS A CA    1 
ATOM   1131 C  C     . HIS A 1 138 ? -15.757 -27.218 15.163 1.00 26.86  ? 138  HIS A C     1 
ATOM   1132 O  O     . HIS A 1 138 ? -16.587 -28.014 14.701 1.00 28.03  ? 138  HIS A O     1 
ATOM   1133 C  CB    . HIS A 1 138 ? -15.812 -25.498 13.303 1.00 25.94  ? 138  HIS A CB    1 
ATOM   1134 C  CG    . HIS A 1 138 ? -16.766 -24.562 13.989 1.00 22.30  ? 138  HIS A CG    1 
ATOM   1135 N  ND1   . HIS A 1 138 ? -16.906 -23.244 13.609 1.00 21.64  ? 138  HIS A ND1   1 
ATOM   1136 C  CD2   . HIS A 1 138 ? -17.653 -24.758 14.995 1.00 22.19  ? 138  HIS A CD2   1 
ATOM   1137 C  CE1   . HIS A 1 138 ? -17.838 -22.667 14.348 1.00 19.68  ? 138  HIS A CE1   1 
ATOM   1138 N  NE2   . HIS A 1 138 ? -18.300 -23.561 15.202 1.00 25.46  ? 138  HIS A NE2   1 
ATOM   1139 N  N     . TYR A 1 139 ? -15.511 -27.096 16.459 1.00 26.14  ? 139  TYR A N     1 
ATOM   1140 C  CA    . TYR A 1 139 ? -16.259 -27.850 17.456 1.00 27.17  ? 139  TYR A CA    1 
ATOM   1141 C  C     . TYR A 1 139 ? -17.350 -26.967 18.040 1.00 27.52  ? 139  TYR A C     1 
ATOM   1142 O  O     . TYR A 1 139 ? -17.088 -25.843 18.486 1.00 27.13  ? 139  TYR A O     1 
ATOM   1143 C  CB    . TYR A 1 139 ? -15.343 -28.361 18.581 1.00 26.05  ? 139  TYR A CB    1 
ATOM   1144 C  CG    . TYR A 1 139 ? -16.124 -28.976 19.714 1.00 27.19  ? 139  TYR A CG    1 
ATOM   1145 C  CD1   . TYR A 1 139 ? -16.537 -28.209 20.805 1.00 22.12  ? 139  TYR A CD1   1 
ATOM   1146 C  CD2   . TYR A 1 139 ? -16.493 -30.326 19.674 1.00 27.63  ? 139  TYR A CD2   1 
ATOM   1147 C  CE1   . TYR A 1 139 ? -17.280 -28.781 21.847 1.00 19.49  ? 139  TYR A CE1   1 
ATOM   1148 C  CE2   . TYR A 1 139 ? -17.226 -30.901 20.701 1.00 23.83  ? 139  TYR A CE2   1 
ATOM   1149 C  CZ    . TYR A 1 139 ? -17.620 -30.121 21.782 1.00 24.14  ? 139  TYR A CZ    1 
ATOM   1150 O  OH    . TYR A 1 139 ? -18.351 -30.699 22.791 1.00 24.91  ? 139  TYR A OH    1 
ATOM   1151 N  N     . ASP A 1 140 ? -18.566 -27.495 18.037 1.00 26.59  ? 140  ASP A N     1 
ATOM   1152 C  CA    . ASP A 1 140 ? -19.729 -26.812 18.553 1.00 27.50  ? 140  ASP A CA    1 
ATOM   1153 C  C     . ASP A 1 140 ? -20.128 -27.516 19.844 1.00 28.92  ? 140  ASP A C     1 
ATOM   1154 O  O     . ASP A 1 140 ? -20.279 -28.732 19.859 1.00 30.49  ? 140  ASP A O     1 
ATOM   1155 C  CB    . ASP A 1 140 ? -20.852 -26.923 17.530 1.00 30.05  ? 140  ASP A CB    1 
ATOM   1156 C  CG    . ASP A 1 140 ? -22.094 -26.158 17.935 1.00 29.94  ? 140  ASP A CG    1 
ATOM   1157 O  OD1   . ASP A 1 140 ? -22.823 -26.640 18.827 1.00 30.40  ? 140  ASP A OD1   1 
ATOM   1158 O  OD2   . ASP A 1 140 ? -22.344 -25.090 17.340 1.00 30.47  ? 140  ASP A OD2   1 
ATOM   1159 N  N     . SER A 1 141 ? -20.293 -26.762 20.926 1.00 28.64  ? 141  SER A N     1 
ATOM   1160 C  CA    . SER A 1 141 ? -20.532 -27.373 22.236 1.00 28.13  ? 141  SER A CA    1 
ATOM   1161 C  C     . SER A 1 141 ? -21.981 -27.824 22.428 1.00 29.76  ? 141  SER A C     1 
ATOM   1162 O  O     . SER A 1 141 ? -22.273 -28.597 23.347 1.00 27.80  ? 141  SER A O     1 
ATOM   1163 C  CB    . SER A 1 141 ? -20.156 -26.406 23.356 1.00 25.36  ? 141  SER A CB    1 
ATOM   1164 O  OG    . SER A 1 141 ? -21.023 -25.293 23.345 1.00 25.59  ? 141  SER A OG    1 
ATOM   1165 N  N     . ILE A 1 142 ? -22.891 -27.313 21.596 1.00 28.62  ? 142  ILE A N     1 
ATOM   1166 C  CA    . ILE A 1 142 ? -24.296 -27.693 21.716 1.00 29.52  ? 142  ILE A CA    1 
ATOM   1167 C  C     . ILE A 1 142 ? -24.528 -29.023 21.008 1.00 32.10  ? 142  ILE A C     1 
ATOM   1168 O  O     . ILE A 1 142 ? -25.176 -29.920 21.558 1.00 31.15  ? 142  ILE A O     1 
ATOM   1169 C  CB    . ILE A 1 142 ? -25.264 -26.591 21.225 1.00 30.92  ? 142  ILE A CB    1 
ATOM   1170 C  CG1   . ILE A 1 142 ? -25.345 -25.466 22.272 1.00 28.15  ? 142  ILE A CG1   1 
ATOM   1171 C  CG2   . ILE A 1 142 ? -26.671 -27.182 20.943 1.00 27.89  ? 142  ILE A CG2   1 
ATOM   1172 C  CD1   . ILE A 1 142 ? -26.272 -24.310 21.889 1.00 28.47  ? 142  ILE A CD1   1 
ATOM   1173 N  N     . ASP A 1 143 ? -23.963 -29.148 19.808 1.00 32.70  ? 143  ASP A N     1 
ATOM   1174 C  CA    . ASP A 1 143 ? -24.021 -30.388 19.046 1.00 33.99  ? 143  ASP A CA    1 
ATOM   1175 C  C     . ASP A 1 143 ? -23.079 -31.444 19.594 1.00 33.42  ? 143  ASP A C     1 
ATOM   1176 O  O     . ASP A 1 143 ? -23.276 -32.635 19.350 1.00 33.05  ? 143  ASP A O     1 
ATOM   1177 C  CB    . ASP A 1 143 ? -23.677 -30.132 17.577 1.00 34.14  ? 143  ASP A CB    1 
ATOM   1178 C  CG    . ASP A 1 143 ? -24.711 -29.292 16.878 1.00 36.74  ? 143  ASP A CG    1 
ATOM   1179 O  OD1   . ASP A 1 143 ? -25.822 -29.109 17.421 1.00 36.58  ? 143  ASP A OD1   1 
ATOM   1180 O  OD2   . ASP A 1 143 ? -24.408 -28.805 15.775 1.00 41.58  ? 143  ASP A OD2   1 
ATOM   1181 N  N     . ASP A 1 144 ? -22.054 -31.001 20.323 1.00 31.07  ? 144  ASP A N     1 
ATOM   1182 C  CA    . ASP A 1 144 ? -20.982 -31.882 20.790 1.00 31.74  ? 144  ASP A CA    1 
ATOM   1183 C  C     . ASP A 1 144 ? -20.378 -32.643 19.600 1.00 29.16  ? 144  ASP A C     1 
ATOM   1184 O  O     . ASP A 1 144 ? -20.216 -33.867 19.633 1.00 28.58  ? 144  ASP A O     1 
ATOM   1185 C  CB    . ASP A 1 144 ? -21.498 -32.831 21.892 1.00 32.42  ? 144  ASP A CB    1 
ATOM   1186 C  CG    . ASP A 1 144 ? -20.374 -33.601 22.593 1.00 36.16  ? 144  ASP A CG    1 
ATOM   1187 O  OD1   . ASP A 1 144 ? -19.244 -33.075 22.697 1.00 38.28  ? 144  ASP A OD1   1 
ATOM   1188 O  OD2   . ASP A 1 144 ? -20.629 -34.736 23.046 1.00 37.15  ? 144  ASP A OD2   1 
ATOM   1189 N  N     . ARG A 1 145 ? -20.070 -31.895 18.545 1.00 27.00  ? 145  ARG A N     1 
ATOM   1190 C  CA    . ARG A 1 145 ? -19.564 -32.454 17.290 1.00 26.34  ? 145  ARG A CA    1 
ATOM   1191 C  C     . ARG A 1 145 ? -18.426 -31.615 16.722 1.00 26.16  ? 145  ARG A C     1 
ATOM   1192 O  O     . ARG A 1 145 ? -18.465 -30.389 16.777 1.00 26.78  ? 145  ARG A O     1 
ATOM   1193 C  CB    . ARG A 1 145 ? -20.678 -32.525 16.238 1.00 25.51  ? 145  ARG A CB    1 
ATOM   1194 C  CG    . ARG A 1 145 ? -21.826 -33.477 16.563 1.00 29.84  ? 145  ARG A CG    1 
ATOM   1195 C  CD    . ARG A 1 145 ? -21.373 -34.937 16.611 1.00 33.45  ? 145  ARG A CD    1 
ATOM   1196 N  NE    . ARG A 1 145 ? -22.470 -35.839 16.960 1.00 37.23  ? 145  ARG A NE    1 
ATOM   1197 C  CZ    . ARG A 1 145 ? -22.795 -36.210 18.199 1.00 40.69  ? 145  ARG A CZ    1 
ATOM   1198 N  NH1   . ARG A 1 145 ? -22.104 -35.774 19.251 1.00 38.11  ? 145  ARG A NH1   1 
ATOM   1199 N  NH2   . ARG A 1 145 ? -23.815 -37.042 18.386 1.00 38.86  ? 145  ARG A NH2   1 
ATOM   1200 N  N     . PHE A 1 146 ? -17.428 -32.290 16.163 1.00 26.71  ? 146  PHE A N     1 
ATOM   1201 C  CA    . PHE A 1 146 ? -16.329 -31.650 15.462 1.00 24.24  ? 146  PHE A CA    1 
ATOM   1202 C  C     . PHE A 1 146 ? -16.660 -31.623 13.986 1.00 25.95  ? 146  PHE A C     1 
ATOM   1203 O  O     . PHE A 1 146 ? -16.679 -32.671 13.330 1.00 28.81  ? 146  PHE A O     1 
ATOM   1204 C  CB    . PHE A 1 146 ? -15.036 -32.447 15.664 1.00 23.28  ? 146  PHE A CB    1 
ATOM   1205 C  CG    . PHE A 1 146 ? -14.586 -32.541 17.094 1.00 23.99  ? 146  PHE A CG    1 
ATOM   1206 C  CD1   . PHE A 1 146 ? -15.157 -33.463 17.957 1.00 22.66  ? 146  PHE A CD1   1 
ATOM   1207 C  CD2   . PHE A 1 146 ? -13.565 -31.715 17.572 1.00 25.05  ? 146  PHE A CD2   1 
ATOM   1208 C  CE1   . PHE A 1 146 ? -14.733 -33.551 19.288 1.00 26.91  ? 146  PHE A CE1   1 
ATOM   1209 C  CE2   . PHE A 1 146 ? -13.127 -31.804 18.888 1.00 23.05  ? 146  PHE A CE2   1 
ATOM   1210 C  CZ    . PHE A 1 146 ? -13.705 -32.725 19.747 1.00 25.37  ? 146  PHE A CZ    1 
ATOM   1211 N  N     . TYR A 1 147 ? -16.918 -30.436 13.454 1.00 25.10  ? 147  TYR A N     1 
ATOM   1212 C  CA    . TYR A 1 147 ? -17.198 -30.295 12.022 1.00 26.17  ? 147  TYR A CA    1 
ATOM   1213 C  C     . TYR A 1 147 ? -15.923 -30.003 11.239 1.00 26.19  ? 147  TYR A C     1 
ATOM   1214 O  O     . TYR A 1 147 ? -15.299 -28.955 11.432 1.00 28.37  ? 147  TYR A O     1 
ATOM   1215 C  CB    . TYR A 1 147 ? -18.229 -29.193 11.784 1.00 25.01  ? 147  TYR A CB    1 
ATOM   1216 C  CG    . TYR A 1 147 ? -19.579 -29.486 12.384 1.00 24.82  ? 147  TYR A CG    1 
ATOM   1217 C  CD1   . TYR A 1 147 ? -19.874 -29.125 13.696 1.00 24.78  ? 147  TYR A CD1   1 
ATOM   1218 C  CD2   . TYR A 1 147 ? -20.571 -30.117 11.632 1.00 26.74  ? 147  TYR A CD2   1 
ATOM   1219 C  CE1   . TYR A 1 147 ? -21.127 -29.382 14.247 1.00 24.28  ? 147  TYR A CE1   1 
ATOM   1220 C  CE2   . TYR A 1 147 ? -21.825 -30.386 12.167 1.00 27.10  ? 147  TYR A CE2   1 
ATOM   1221 C  CZ    . TYR A 1 147 ? -22.092 -30.017 13.478 1.00 30.03  ? 147  TYR A CZ    1 
ATOM   1222 O  OH    . TYR A 1 147 ? -23.325 -30.286 14.017 1.00 31.74  ? 147  TYR A OH    1 
ATOM   1223 N  N     . VAL A 1 148 ? -15.541 -30.931 10.363 1.00 25.18  ? 148  VAL A N     1 
ATOM   1224 C  CA    . VAL A 1 148 ? -14.277 -30.840 9.617  1.00 26.44  ? 148  VAL A CA    1 
ATOM   1225 C  C     . VAL A 1 148 ? -14.489 -30.488 8.139  1.00 27.04  ? 148  VAL A C     1 
ATOM   1226 O  O     . VAL A 1 148 ? -15.188 -31.184 7.399  1.00 30.58  ? 148  VAL A O     1 
ATOM   1227 C  CB    . VAL A 1 148 ? -13.436 -32.138 9.748  1.00 26.07  ? 148  VAL A CB    1 
ATOM   1228 C  CG1   . VAL A 1 148 ? -12.041 -31.955 9.126  1.00 24.76  ? 148  VAL A CG1   1 
ATOM   1229 C  CG2   . VAL A 1 148 ? -13.317 -32.545 11.231 1.00 25.79  ? 148  VAL A CG2   1 
ATOM   1230 N  N     . PHE A 1 149 ? -13.869 -29.399 7.723  1.00 28.21  ? 149  PHE A N     1 
ATOM   1231 C  CA    . PHE A 1 149 ? -13.991 -28.892 6.365  1.00 27.01  ? 149  PHE A CA    1 
ATOM   1232 C  C     . PHE A 1 149 ? -12.620 -29.075 5.737  1.00 28.11  ? 149  PHE A C     1 
ATOM   1233 O  O     . PHE A 1 149 ? -11.648 -28.486 6.205  1.00 29.45  ? 149  PHE A O     1 
ATOM   1234 C  CB    . PHE A 1 149 ? -14.358 -27.407 6.393  1.00 25.98  ? 149  PHE A CB    1 
ATOM   1235 C  CG    . PHE A 1 149 ? -15.695 -27.101 7.055  1.00 28.18  ? 149  PHE A CG    1 
ATOM   1236 C  CD1   . PHE A 1 149 ? -15.815 -27.070 8.446  1.00 27.82  ? 149  PHE A CD1   1 
ATOM   1237 C  CD2   . PHE A 1 149 ? -16.826 -26.814 6.277  1.00 26.67  ? 149  PHE A CD2   1 
ATOM   1238 C  CE1   . PHE A 1 149 ? -17.039 -26.784 9.053  1.00 29.13  ? 149  PHE A CE1   1 
ATOM   1239 C  CE2   . PHE A 1 149 ? -18.053 -26.526 6.871  1.00 25.59  ? 149  PHE A CE2   1 
ATOM   1240 C  CZ    . PHE A 1 149 ? -18.160 -26.507 8.260  1.00 29.06  ? 149  PHE A CZ    1 
ATOM   1241 N  N     . ASP A 1 150 ? -12.544 -29.897 4.689  1.00 26.30  ? 150  ASP A N     1 
ATOM   1242 C  CA    . ASP A 1 150 ? -11.263 -30.373 4.168  1.00 26.51  ? 150  ASP A CA    1 
ATOM   1243 C  C     . ASP A 1 150 ? -11.155 -30.156 2.667  1.00 28.22  ? 150  ASP A C     1 
ATOM   1244 O  O     . ASP A 1 150 ? -11.964 -30.675 1.891  1.00 27.36  ? 150  ASP A O     1 
ATOM   1245 C  CB    . ASP A 1 150 ? -11.097 -31.866 4.507  1.00 27.06  ? 150  ASP A CB    1 
ATOM   1246 C  CG    . ASP A 1 150 ? -9.828  -32.483 3.930  1.00 29.94  ? 150  ASP A CG    1 
ATOM   1247 O  OD1   . ASP A 1 150 ? -8.905  -31.757 3.502  1.00 33.33  ? 150  ASP A OD1   1 
ATOM   1248 O  OD2   . ASP A 1 150 ? -9.750  -33.724 3.919  1.00 31.60  ? 150  ASP A OD2   1 
ATOM   1249 N  N     . LEU A 1 151 ? -10.136 -29.404 2.266  1.00 28.37  ? 151  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 151 ? -9.939  -29.079 0.868  1.00 29.00  ? 151  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 151 ? -9.123  -30.156 0.144  1.00 30.74  ? 151  LEU A C     1 
ATOM   1252 O  O     . LEU A 1 151 ? -7.965  -30.420 0.496  1.00 30.80  ? 151  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 151 ? -9.281  -27.705 0.728  1.00 27.78  ? 151  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 151 ? -9.127  -27.216 -0.713 1.00 32.89  ? 151  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 151 ? -10.505 -26.916 -1.345 1.00 26.83  ? 151  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 151 ? -8.206  -26.002 -0.774 1.00 32.37  ? 151  LEU A CD2   1 
ATOM   1257 N  N     . LEU A 1 152 ? -9.739  -30.777 -0.861 1.00 29.96  ? 152  LEU A N     1 
ATOM   1258 C  CA    . LEU A 1 152 ? -9.066  -31.797 -1.655 1.00 33.11  ? 152  LEU A CA    1 
ATOM   1259 C  C     . LEU A 1 152 ? -8.258  -31.200 -2.803 1.00 34.11  ? 152  LEU A C     1 
ATOM   1260 O  O     . LEU A 1 152 ? -7.170  -31.688 -3.105 1.00 34.78  ? 152  LEU A O     1 
ATOM   1261 C  CB    . LEU A 1 152 ? -10.053 -32.856 -2.174 1.00 33.10  ? 152  LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1 152 ? -10.901 -33.602 -1.136 1.00 35.57  ? 152  LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1 152 ? -11.752 -34.683 -1.818 1.00 33.43  ? 152  LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1 152 ? -10.056 -34.177 0.053  1.00 29.13  ? 152  LEU A CD2   1 
ATOM   1265 N  N     . ASN A 1 153 ? -8.778  -30.142 -3.423 1.00 36.11  ? 153  ASN A N     1 
ATOM   1266 C  CA    . ASN A 1 153 ? -8.104  -29.512 -4.566 1.00 38.08  ? 153  ASN A CA    1 
ATOM   1267 C  C     . ASN A 1 153 ? -7.606  -28.097 -4.319 1.00 38.54  ? 153  ASN A C     1 
ATOM   1268 O  O     . ASN A 1 153 ? -8.375  -27.194 -3.996 1.00 37.86  ? 153  ASN A O     1 
ATOM   1269 C  CB    . ASN A 1 153 ? -8.983  -29.559 -5.818 1.00 38.06  ? 153  ASN A CB    1 
ATOM   1270 C  CG    . ASN A 1 153 ? -9.279  -30.966 -6.257 1.00 37.86  ? 153  ASN A CG    1 
ATOM   1271 O  OD1   . ASN A 1 153 ? -8.395  -31.823 -6.262 1.00 42.01  ? 153  ASN A OD1   1 
ATOM   1272 N  ND2   . ASN A 1 153 ? -10.529 -31.225 -6.612 1.00 36.86  ? 153  ASN A ND2   1 
ATOM   1273 N  N     . SER A 1 154 ? -6.302  -27.925 -4.508 1.00 39.07  ? 154  SER A N     1 
ATOM   1274 C  CA    . SER A 1 154 ? -5.610  -26.698 -4.184 1.00 39.51  ? 154  SER A CA    1 
ATOM   1275 C  C     . SER A 1 154 ? -4.515  -26.449 -5.215 1.00 39.99  ? 154  SER A C     1 
ATOM   1276 O  O     . SER A 1 154 ? -3.963  -27.398 -5.763 1.00 41.02  ? 154  SER A O     1 
ATOM   1277 C  CB    . SER A 1 154 ? -4.984  -26.831 -2.797 1.00 38.88  ? 154  SER A CB    1 
ATOM   1278 O  OG    . SER A 1 154 ? -4.221  -25.688 -2.462 1.00 40.80  ? 154  SER A OG    1 
ATOM   1279 N  N     . PRO A 1 155 ? -4.196  -25.169 -5.489 1.00 41.02  ? 155  PRO A N     1 
ATOM   1280 C  CA    . PRO A 1 155 ? -3.032  -24.863 -6.328 1.00 41.67  ? 155  PRO A CA    1 
ATOM   1281 C  C     . PRO A 1 155 ? -1.742  -25.438 -5.750 1.00 43.15  ? 155  PRO A C     1 
ATOM   1282 O  O     . PRO A 1 155 ? -0.736  -25.529 -6.460 1.00 45.13  ? 155  PRO A O     1 
ATOM   1283 C  CB    . PRO A 1 155 ? -2.974  -23.327 -6.321 1.00 40.27  ? 155  PRO A CB    1 
ATOM   1284 C  CG    . PRO A 1 155 ? -3.962  -22.883 -5.279 1.00 41.65  ? 155  PRO A CG    1 
ATOM   1285 C  CD    . PRO A 1 155 ? -4.986  -23.962 -5.192 1.00 39.19  ? 155  PRO A CD    1 
ATOM   1286 N  N     . TYR A 1 156 ? -1.781  -25.821 -4.475 1.00 42.10  ? 156  TYR A N     1 
ATOM   1287 C  CA    . TYR A 1 156 ? -0.619  -26.410 -3.808 1.00 42.05  ? 156  TYR A CA    1 
ATOM   1288 C  C     . TYR A 1 156 ? -0.716  -27.933 -3.673 1.00 39.77  ? 156  TYR A C     1 
ATOM   1289 O  O     . TYR A 1 156 ? 0.147   -28.575 -3.063 1.00 39.79  ? 156  TYR A O     1 
ATOM   1290 C  CB    . TYR A 1 156 ? -0.344  -25.712 -2.467 1.00 41.94  ? 156  TYR A CB    1 
ATOM   1291 C  CG    . TYR A 1 156 ? -0.236  -24.202 -2.605 1.00 44.70  ? 156  TYR A CG    1 
ATOM   1292 C  CD1   . TYR A 1 156 ? 0.665   -23.624 -3.508 1.00 47.74  ? 156  TYR A CD1   1 
ATOM   1293 C  CD2   . TYR A 1 156 ? -1.040  -23.355 -1.850 1.00 45.50  ? 156  TYR A CD2   1 
ATOM   1294 C  CE1   . TYR A 1 156 ? 0.763   -22.243 -3.650 1.00 47.60  ? 156  TYR A CE1   1 
ATOM   1295 C  CE2   . TYR A 1 156 ? -0.946  -21.972 -1.981 1.00 48.37  ? 156  TYR A CE2   1 
ATOM   1296 C  CZ    . TYR A 1 156 ? -0.046  -21.424 -2.882 1.00 49.13  ? 156  TYR A CZ    1 
ATOM   1297 O  OH    . TYR A 1 156 ? 0.043   -20.057 -3.012 1.00 50.84  ? 156  TYR A OH    1 
ATOM   1298 N  N     . GLY A 1 157 ? -1.748  -28.509 -4.278 1.00 37.35  ? 157  GLY A N     1 
ATOM   1299 C  CA    . GLY A 1 157 ? -1.821  -29.955 -4.418 1.00 37.00  ? 157  GLY A CA    1 
ATOM   1300 C  C     . GLY A 1 157 ? -3.214  -30.543 -4.346 1.00 37.26  ? 157  GLY A C     1 
ATOM   1301 O  O     . GLY A 1 157 ? -4.086  -30.027 -3.648 1.00 38.41  ? 157  GLY A O     1 
ATOM   1302 N  N     . ASN A 1 158 ? -3.413  -31.631 -5.079 1.00 36.22  ? 158  ASN A N     1 
ATOM   1303 C  CA    . ASN A 1 158 ? -4.633  -32.400 -4.989 1.00 37.13  ? 158  ASN A CA    1 
ATOM   1304 C  C     . ASN A 1 158 ? -4.397  -33.665 -4.165 1.00 37.26  ? 158  ASN A C     1 
ATOM   1305 O  O     . ASN A 1 158 ? -3.404  -34.371 -4.347 1.00 36.06  ? 158  ASN A O     1 
ATOM   1306 C  CB    . ASN A 1 158 ? -5.163  -32.728 -6.383 1.00 37.45  ? 158  ASN A CB    1 
ATOM   1307 C  CG    . ASN A 1 158 ? -5.394  -31.481 -7.236 1.00 42.71  ? 158  ASN A CG    1 
ATOM   1308 O  OD1   . ASN A 1 158 ? -5.448  -30.350 -6.729 1.00 43.60  ? 158  ASN A OD1   1 
ATOM   1309 N  ND2   . ASN A 1 158 ? -5.539  -31.685 -8.542 1.00 42.52  ? 158  ASN A ND2   1 
ATOM   1310 N  N     . VAL A 1 159 ? -5.309  -33.933 -3.242 1.00 37.13  ? 159  VAL A N     1 
ATOM   1311 C  CA    . VAL A 1 159 ? -5.134  -35.020 -2.292 1.00 37.48  ? 159  VAL A CA    1 
ATOM   1312 C  C     . VAL A 1 159 ? -6.388  -35.864 -2.240 1.00 38.43  ? 159  VAL A C     1 
ATOM   1313 O  O     . VAL A 1 159 ? -7.465  -35.414 -2.645 1.00 38.61  ? 159  VAL A O     1 
ATOM   1314 C  CB    . VAL A 1 159 ? -4.806  -34.487 -0.859 1.00 37.83  ? 159  VAL A CB    1 
ATOM   1315 C  CG1   . VAL A 1 159 ? -3.420  -33.840 -0.819 1.00 37.56  ? 159  VAL A CG1   1 
ATOM   1316 C  CG2   . VAL A 1 159 ? -5.869  -33.507 -0.380 1.00 35.05  ? 159  VAL A CG2   1 
ATOM   1317 N  N     . GLU A 1 160 ? -6.245  -37.084 -1.736 1.00 40.25  ? 160  GLU A N     1 
ATOM   1318 C  CA    . GLU A 1 160 ? -7.393  -37.948 -1.484 1.00 41.49  ? 160  GLU A CA    1 
ATOM   1319 C  C     . GLU A 1 160 ? -8.082  -37.609 -0.161 1.00 39.09  ? 160  GLU A C     1 
ATOM   1320 O  O     . GLU A 1 160 ? -7.567  -36.831 0.641  1.00 37.04  ? 160  GLU A O     1 
ATOM   1321 C  CB    . GLU A 1 160 ? -6.971  -39.424 -1.546 1.00 44.98  ? 160  GLU A CB    1 
ATOM   1322 C  CG    . GLU A 1 160 ? -7.333  -40.140 -2.864 1.00 53.09  ? 160  GLU A CG    1 
ATOM   1323 C  CD    . GLU A 1 160 ? -7.264  -39.239 -4.107 1.00 59.24  ? 160  GLU A CD    1 
ATOM   1324 O  OE1   . GLU A 1 160 ? -8.266  -39.179 -4.858 1.00 60.75  ? 160  GLU A OE1   1 
ATOM   1325 O  OE2   . GLU A 1 160 ? -6.215  -38.593 -4.338 1.00 62.03  ? 160  GLU A OE2   1 
ATOM   1326 N  N     . GLU A 1 161 ? -9.259  -38.193 0.045  1.00 38.79  ? 161  GLU A N     1 
ATOM   1327 C  CA    . GLU A 1 161 ? -10.028 -37.989 1.264  1.00 37.33  ? 161  GLU A CA    1 
ATOM   1328 C  C     . GLU A 1 161 ? -9.290  -38.488 2.493  1.00 34.81  ? 161  GLU A C     1 
ATOM   1329 O  O     . GLU A 1 161 ? -8.553  -39.459 2.430  1.00 33.19  ? 161  GLU A O     1 
ATOM   1330 C  CB    . GLU A 1 161 ? -11.395 -38.674 1.167  1.00 37.08  ? 161  GLU A CB    1 
ATOM   1331 C  CG    . GLU A 1 161 ? -12.426 -37.882 0.364  1.00 39.96  ? 161  GLU A CG    1 
ATOM   1332 C  CD    . GLU A 1 161 ? -13.818 -38.496 0.414  1.00 44.38  ? 161  GLU A CD    1 
ATOM   1333 O  OE1   . GLU A 1 161 ? -14.295 -38.830 1.523  1.00 45.44  ? 161  GLU A OE1   1 
ATOM   1334 O  OE2   . GLU A 1 161 ? -14.445 -38.626 -0.658 1.00 43.50  ? 161  GLU A OE2   1 
ATOM   1335 N  N     . TRP A 1 162 ? -9.494  -37.791 3.605  1.00 35.42  ? 162  TRP A N     1 
ATOM   1336 C  CA    . TRP A 1 162 ? -8.975  -38.188 4.905  1.00 32.36  ? 162  TRP A CA    1 
ATOM   1337 C  C     . TRP A 1 162 ? -9.745  -39.408 5.366  1.00 33.77  ? 162  TRP A C     1 
ATOM   1338 O  O     . TRP A 1 162 ? -10.960 -39.487 5.162  1.00 33.73  ? 162  TRP A O     1 
ATOM   1339 C  CB    . TRP A 1 162 ? -9.162  -37.038 5.891  1.00 31.18  ? 162  TRP A CB    1 
ATOM   1340 C  CG    . TRP A 1 162 ? -9.000  -37.383 7.351  1.00 29.34  ? 162  TRP A CG    1 
ATOM   1341 C  CD1   . TRP A 1 162 ? -7.826  -37.484 8.048  1.00 27.55  ? 162  TRP A CD1   1 
ATOM   1342 C  CD2   . TRP A 1 162 ? -10.048 -37.638 8.292  1.00 25.54  ? 162  TRP A CD2   1 
ATOM   1343 N  NE1   . TRP A 1 162 ? -8.081  -37.790 9.365  1.00 30.05  ? 162  TRP A NE1   1 
ATOM   1344 C  CE2   . TRP A 1 162 ? -9.438  -37.882 9.542  1.00 29.92  ? 162  TRP A CE2   1 
ATOM   1345 C  CE3   . TRP A 1 162 ? -11.443 -37.676 8.203  1.00 29.64  ? 162  TRP A CE3   1 
ATOM   1346 C  CZ2   . TRP A 1 162 ? -10.179 -38.164 10.694 1.00 29.40  ? 162  TRP A CZ2   1 
ATOM   1347 C  CZ3   . TRP A 1 162 ? -12.178 -37.959 9.340  1.00 30.72  ? 162  TRP A CZ3   1 
ATOM   1348 C  CH2   . TRP A 1 162 ? -11.543 -38.197 10.575 1.00 32.82  ? 162  TRP A CH2   1 
ATOM   1349 N  N     . SER A 1 163 ? -9.041  -40.353 5.986  1.00 34.18  ? 163  SER A N     1 
ATOM   1350 C  CA    . SER A 1 163 ? -9.652  -41.611 6.409  1.00 34.73  ? 163  SER A CA    1 
ATOM   1351 C  C     . SER A 1 163 ? -9.771  -41.690 7.933  1.00 35.12  ? 163  SER A C     1 
ATOM   1352 O  O     . SER A 1 163 ? -8.763  -41.591 8.648  1.00 35.42  ? 163  SER A O     1 
ATOM   1353 C  CB    . SER A 1 163 ? -8.864  -42.801 5.840  1.00 34.95  ? 163  SER A CB    1 
ATOM   1354 O  OG    . SER A 1 163 ? -9.295  -44.033 6.402  1.00 41.31  ? 163  SER A OG    1 
ATOM   1355 N  N     . ILE A 1 164 ? -11.006 -41.862 8.416  1.00 35.63  ? 164  ILE A N     1 
ATOM   1356 C  CA    . ILE A 1 164 ? -11.301 -41.958 9.856  1.00 36.78  ? 164  ILE A CA    1 
ATOM   1357 C  C     . ILE A 1 164 ? -10.844 -43.300 10.444 1.00 38.90  ? 164  ILE A C     1 
ATOM   1358 O  O     . ILE A 1 164 ? -10.607 -43.417 11.654 1.00 39.85  ? 164  ILE A O     1 
ATOM   1359 C  CB    . ILE A 1 164 ? -12.815 -41.686 10.161 1.00 38.70  ? 164  ILE A CB    1 
ATOM   1360 C  CG1   . ILE A 1 164 ? -13.043 -41.348 11.645 1.00 37.96  ? 164  ILE A CG1   1 
ATOM   1361 C  CG2   . ILE A 1 164 ? -13.716 -42.847 9.682  1.00 34.65  ? 164  ILE A CG2   1 
ATOM   1362 C  CD1   . ILE A 1 164 ? -14.376 -40.654 11.930 1.00 36.01  ? 164  ILE A CD1   1 
ATOM   1363 N  N     . GLU A 1 165 ? -10.717 -44.309 9.586  1.00 40.22  ? 165  GLU A N     1 
ATOM   1364 C  CA    . GLU A 1 165 ? -10.223 -45.616 10.013 1.00 42.37  ? 165  GLU A CA    1 
ATOM   1365 C  C     . GLU A 1 165 ? -8.726  -45.556 10.281 1.00 40.12  ? 165  GLU A C     1 
ATOM   1366 O  O     . GLU A 1 165 ? -8.248  -46.141 11.249 1.00 41.47  ? 165  GLU A O     1 
ATOM   1367 C  CB    . GLU A 1 165 ? -10.530 -46.697 8.972  1.00 45.27  ? 165  GLU A CB    1 
ATOM   1368 C  CG    . GLU A 1 165 ? -12.012 -47.033 8.810  1.00 52.14  ? 165  GLU A CG    1 
ATOM   1369 C  CD    . GLU A 1 165 ? -12.773 -46.046 7.920  1.00 58.56  ? 165  GLU A CD    1 
ATOM   1370 O  OE1   . GLU A 1 165 ? -12.143 -45.154 7.291  1.00 54.60  ? 165  GLU A OE1   1 
ATOM   1371 O  OE2   . GLU A 1 165 ? -14.018 -46.177 7.850  1.00 62.72  ? 165  GLU A OE2   1 
ATOM   1372 N  N     . ILE A 1 166 ? -7.991  -44.851 9.422  1.00 37.92  ? 166  ILE A N     1 
ATOM   1373 C  CA    . ILE A 1 166 ? -6.565  -44.634 9.644  1.00 34.94  ? 166  ILE A CA    1 
ATOM   1374 C  C     . ILE A 1 166 ? -6.314  -43.674 10.816 1.00 32.68  ? 166  ILE A C     1 
ATOM   1375 O  O     . ILE A 1 166 ? -5.394  -43.881 11.607 1.00 32.25  ? 166  ILE A O     1 
ATOM   1376 C  CB    . ILE A 1 166 ? -5.852  -44.157 8.364  1.00 36.02  ? 166  ILE A CB    1 
ATOM   1377 C  CG1   . ILE A 1 166 ? -5.775  -45.300 7.357  1.00 38.51  ? 166  ILE A CG1   1 
ATOM   1378 C  CG2   . ILE A 1 166 ? -4.427  -43.645 8.670  1.00 32.72  ? 166  ILE A CG2   1 
ATOM   1379 C  CD1   . ILE A 1 166 ? -5.553  -44.829 5.931  1.00 42.61  ? 166  ILE A CD1   1 
ATOM   1380 N  N     . ALA A 1 167 ? -7.147  -42.645 10.937 1.00 30.95  ? 167  ALA A N     1 
ATOM   1381 C  CA    . ALA A 1 167 ? -6.968  -41.637 11.979 1.00 32.16  ? 167  ALA A CA    1 
ATOM   1382 C  C     . ALA A 1 167 ? -7.017  -42.245 13.377 1.00 31.91  ? 167  ALA A C     1 
ATOM   1383 O  O     . ALA A 1 167 ? -6.295  -41.799 14.272 1.00 32.21  ? 167  ALA A O     1 
ATOM   1384 C  CB    . ALA A 1 167 ? -8.018  -40.524 11.845 1.00 29.62  ? 167  ALA A CB    1 
ATOM   1385 N  N     . ALA A 1 168 ? -7.870  -43.260 13.545 1.00 32.24  ? 168  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 168 ? -8.120  -43.887 14.843 1.00 31.37  ? 168  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 168 ? -6.991  -44.805 15.307 1.00 33.39  ? 168  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 168 ? -6.826  -45.003 16.511 1.00 33.25  ? 168  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 168 ? -9.432  -44.649 14.817 1.00 30.62  ? 168  ALA A CB    1 
ATOM   1390 N  N     . LYS A 1 169 ? -6.228  -45.356 14.358 1.00 34.28  ? 169  LYS A N     1 
ATOM   1391 C  CA    . LYS A 1 169 ? -5.197  -46.350 14.665 1.00 36.10  ? 169  LYS A CA    1 
ATOM   1392 C  C     . LYS A 1 169 ? -4.009  -45.749 15.397 1.00 36.52  ? 169  LYS A C     1 
ATOM   1393 O  O     . LYS A 1 169 ? -3.673  -44.580 15.210 1.00 38.86  ? 169  LYS A O     1 
ATOM   1394 C  CB    . LYS A 1 169 ? -4.699  -47.058 13.396 1.00 38.27  ? 169  LYS A CB    1 
ATOM   1395 C  CG    . LYS A 1 169 ? -5.793  -47.708 12.556 1.00 42.92  ? 169  LYS A CG    1 
ATOM   1396 C  CD    . LYS A 1 169 ? -5.252  -48.344 11.282 1.00 48.40  ? 169  LYS A CD    1 
ATOM   1397 C  CE    . LYS A 1 169 ? -5.101  -49.854 11.442 1.00 54.98  ? 169  LYS A CE    1 
ATOM   1398 N  NZ    . LYS A 1 169 ? -4.818  -50.543 10.151 1.00 59.20  ? 169  LYS A NZ    1 
ATOM   1399 N  N     . LEU A 1 170 ? -3.376  -46.563 16.233 1.00 35.33  ? 170  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 170 ? -2.135  -46.187 16.888 1.00 34.58  ? 170  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 170 ? -1.140  -45.620 15.884 1.00 35.57  ? 170  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 170 ? -1.052  -46.095 14.751 1.00 36.69  ? 170  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 170 ? -1.518  -47.404 17.574 1.00 32.24  ? 170  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 170 ? -2.233  -48.024 18.777 1.00 33.71  ? 170  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 170 ? -1.534  -49.303 19.170 1.00 27.41  ? 170  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 170 ? -2.293  -47.044 19.960 1.00 33.40  ? 170  LEU A CD2   1 
ATOM   1407 N  N     . GLN A 1 171 ? -0.383  -44.614 16.308 1.00 37.63  ? 171  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 171 ? 0.688   -44.055 15.482 1.00 38.81  ? 171  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 171 ? 1.713   -45.125 15.111 1.00 38.24  ? 171  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 171 ? 2.212   -45.171 13.981 1.00 35.98  ? 171  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 171 ? 1.368   -42.900 16.209 1.00 40.38  ? 171  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 171 ? 0.562   -41.613 16.194 1.00 45.61  ? 171  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 171 ? 1.444   -40.385 16.286 1.00 52.35  ? 171  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 171 ? 2.651   -40.454 16.040 1.00 55.30  ? 171  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 171 ? 0.849   -39.250 16.640 1.00 53.79  ? 171  GLN A NE2   1 
ATOM   1416 N  N     . GLU A 1 172 ? 1.994   -46.001 16.073 1.00 38.30  ? 172  GLU A N     1 
ATOM   1417 C  CA    . GLU A 1 172 ? 2.890   -47.140 15.878 1.00 37.52  ? 172  GLU A CA    1 
ATOM   1418 C  C     . GLU A 1 172 ? 2.360   -48.112 14.818 1.00 36.21  ? 172  GLU A C     1 
ATOM   1419 O  O     . GLU A 1 172 ? 3.104   -48.956 14.330 1.00 37.62  ? 172  GLU A O     1 
ATOM   1420 C  CB    . GLU A 1 172 ? 3.139   -47.866 17.206 1.00 36.90  ? 172  GLU A CB    1 
ATOM   1421 C  CG    . GLU A 1 172 ? 3.876   -47.043 18.273 1.00 37.93  ? 172  GLU A CG    1 
ATOM   1422 C  CD    . GLU A 1 172 ? 2.961   -46.131 19.094 1.00 43.90  ? 172  GLU A CD    1 
ATOM   1423 O  OE1   . GLU A 1 172 ? 3.433   -45.612 20.134 1.00 46.10  ? 172  GLU A OE1   1 
ATOM   1424 O  OE2   . GLU A 1 172 ? 1.778   -45.929 18.715 1.00 41.81  ? 172  GLU A OE2   1 
ATOM   1425 N  N     . GLN A 1 173 ? 1.084   -47.985 14.453 1.00 35.77  ? 173  GLN A N     1 
ATOM   1426 C  CA    . GLN A 1 173 ? 0.521   -48.811 13.377 1.00 35.10  ? 173  GLN A CA    1 
ATOM   1427 C  C     . GLN A 1 173 ? 0.209   -47.995 12.116 1.00 33.89  ? 173  GLN A C     1 
ATOM   1428 O  O     . GLN A 1 173 ? -0.532  -48.439 11.229 1.00 33.47  ? 173  GLN A O     1 
ATOM   1429 C  CB    . GLN A 1 173 ? -0.708  -49.600 13.853 1.00 34.81  ? 173  GLN A CB    1 
ATOM   1430 C  CG    . GLN A 1 173 ? -0.895  -50.912 13.081 1.00 37.24  ? 173  GLN A CG    1 
ATOM   1431 C  CD    . GLN A 1 173 ? -2.259  -51.560 13.257 1.00 38.27  ? 173  GLN A CD    1 
ATOM   1432 O  OE1   . GLN A 1 173 ? -3.188  -50.966 13.809 1.00 39.47  ? 173  GLN A OE1   1 
ATOM   1433 N  NE2   . GLN A 1 173 ? -2.386  -52.791 12.770 1.00 33.50  ? 173  GLN A NE2   1 
ATOM   1434 N  N     . GLY A 1 174 ? 0.793   -46.802 12.043 1.00 34.56  ? 174  GLY A N     1 
ATOM   1435 C  CA    . GLY A 1 174 ? 0.679   -45.953 10.860 1.00 34.80  ? 174  GLY A CA    1 
ATOM   1436 C  C     . GLY A 1 174 ? -0.503  -45.006 10.879 1.00 35.32  ? 174  GLY A C     1 
ATOM   1437 O  O     . GLY A 1 174 ? -0.723  -44.263 9.920  1.00 36.38  ? 174  GLY A O     1 
ATOM   1438 N  N     . GLY A 1 175 ? -1.271  -45.031 11.967 1.00 32.97  ? 175  GLY A N     1 
ATOM   1439 C  CA    . GLY A 1 175 ? -2.430  -44.153 12.098 1.00 30.26  ? 175  GLY A CA    1 
ATOM   1440 C  C     . GLY A 1 175 ? -2.063  -42.851 12.776 1.00 30.62  ? 175  GLY A C     1 
ATOM   1441 O  O     . GLY A 1 175 ? -0.879  -42.538 12.935 1.00 31.46  ? 175  GLY A O     1 
ATOM   1442 N  N     . ASP A 1 176 ? -3.071  -42.093 13.197 1.00 31.76  ? 176  ASP A N     1 
ATOM   1443 C  CA    . ASP A 1 176 ? -2.819  -40.777 13.795 1.00 31.99  ? 176  ASP A CA    1 
ATOM   1444 C  C     . ASP A 1 176 ? -3.157  -40.697 15.283 1.00 32.77  ? 176  ASP A C     1 
ATOM   1445 O  O     . ASP A 1 176 ? -2.892  -39.687 15.929 1.00 33.32  ? 176  ASP A O     1 
ATOM   1446 C  CB    . ASP A 1 176 ? -3.554  -39.692 13.015 1.00 32.47  ? 176  ASP A CB    1 
ATOM   1447 C  CG    . ASP A 1 176 ? -3.277  -39.754 11.509 1.00 34.82  ? 176  ASP A CG    1 
ATOM   1448 O  OD1   . ASP A 1 176 ? -2.100  -39.922 11.119 1.00 33.86  ? 176  ASP A OD1   1 
ATOM   1449 O  OD2   . ASP A 1 176 ? -4.245  -39.630 10.720 1.00 31.79  ? 176  ASP A OD2   1 
ATOM   1450 N  N     . GLU A 1 177 ? -3.726  -41.773 15.820 1.00 32.93  ? 177  GLU A N     1 
ATOM   1451 C  CA    . GLU A 1 177 ? -4.166  -41.824 17.208 1.00 36.55  ? 177  GLU A CA    1 
ATOM   1452 C  C     . GLU A 1 177 ? -5.130  -40.709 17.605 1.00 34.80  ? 177  GLU A C     1 
ATOM   1453 O  O     . GLU A 1 177 ? -5.047  -40.195 18.716 1.00 34.24  ? 177  GLU A O     1 
ATOM   1454 C  CB    . GLU A 1 177 ? -2.977  -41.883 18.182 1.00 38.64  ? 177  GLU A CB    1 
ATOM   1455 C  CG    . GLU A 1 177 ? -2.634  -43.287 18.635 1.00 48.17  ? 177  GLU A CG    1 
ATOM   1456 C  CD    . GLU A 1 177 ? -1.443  -43.341 19.586 1.00 55.62  ? 177  GLU A CD    1 
ATOM   1457 O  OE1   . GLU A 1 177 ? -1.675  -43.221 20.813 1.00 57.96  ? 177  GLU A OE1   1 
ATOM   1458 O  OE2   . GLU A 1 177 ? -0.290  -43.529 19.109 1.00 53.77  ? 177  GLU A OE2   1 
ATOM   1459 N  N     . VAL A 1 178 ? -6.037  -40.334 16.701 1.00 34.31  ? 178  VAL A N     1 
ATOM   1460 C  CA    . VAL A 1 178 ? -7.149  -39.462 17.075 1.00 31.84  ? 178  VAL A CA    1 
ATOM   1461 C  C     . VAL A 1 178 ? -7.891  -40.173 18.199 1.00 33.12  ? 178  VAL A C     1 
ATOM   1462 O  O     . VAL A 1 178 ? -8.337  -41.304 18.014 1.00 36.01  ? 178  VAL A O     1 
ATOM   1463 C  CB    . VAL A 1 178 ? -8.121  -39.191 15.899 1.00 31.11  ? 178  VAL A CB    1 
ATOM   1464 C  CG1   . VAL A 1 178 ? -9.349  -38.397 16.370 1.00 26.74  ? 178  VAL A CG1   1 
ATOM   1465 C  CG2   . VAL A 1 178 ? -7.421  -38.443 14.790 1.00 24.80  ? 178  VAL A CG2   1 
ATOM   1466 N  N     . PRO A 1 179 ? -8.009  -39.524 19.371 1.00 34.34  ? 179  PRO A N     1 
ATOM   1467 C  CA    . PRO A 1 179 ? -8.595  -40.175 20.548 1.00 34.87  ? 179  PRO A CA    1 
ATOM   1468 C  C     . PRO A 1 179 ? -9.933  -40.858 20.267 1.00 35.39  ? 179  PRO A C     1 
ATOM   1469 O  O     . PRO A 1 179 ? -10.793 -40.300 19.585 1.00 36.70  ? 179  PRO A O     1 
ATOM   1470 C  CB    . PRO A 1 179 ? -8.776  -39.010 21.534 1.00 33.83  ? 179  PRO A CB    1 
ATOM   1471 C  CG    . PRO A 1 179 ? -7.669  -38.083 21.198 1.00 35.18  ? 179  PRO A CG    1 
ATOM   1472 C  CD    . PRO A 1 179 ? -7.598  -38.138 19.673 1.00 35.13  ? 179  PRO A CD    1 
ATOM   1473 N  N     . SER A 1 180 ? -10.081 -42.063 20.806 1.00 36.30  ? 180  SER A N     1 
ATOM   1474 C  CA    . SER A 1 180 ? -11.253 -42.913 20.591 1.00 37.35  ? 180  SER A CA    1 
ATOM   1475 C  C     . SER A 1 180 ? -12.560 -42.258 21.020 1.00 35.50  ? 180  SER A C     1 
ATOM   1476 O  O     . SER A 1 180 ? -13.601 -42.477 20.399 1.00 36.71  ? 180  SER A O     1 
ATOM   1477 C  CB    . SER A 1 180 ? -11.074 -44.250 21.328 1.00 37.99  ? 180  SER A CB    1 
ATOM   1478 O  OG    . SER A 1 180 ? -10.763 -44.030 22.699 1.00 41.01  ? 180  SER A OG    1 
ATOM   1479 N  N     . GLU A 1 181 ? -12.501 -41.453 22.077 1.00 32.79  ? 181  GLU A N     1 
ATOM   1480 C  CA    . GLU A 1 181 ? -13.697 -40.823 22.639 1.00 30.85  ? 181  GLU A CA    1 
ATOM   1481 C  C     . GLU A 1 181 ? -14.246 -39.651 21.797 1.00 30.79  ? 181  GLU A C     1 
ATOM   1482 O  O     . GLU A 1 181 ? -15.256 -39.042 22.163 1.00 30.54  ? 181  GLU A O     1 
ATOM   1483 C  CB    . GLU A 1 181 ? -13.441 -40.388 24.085 1.00 31.43  ? 181  GLU A CB    1 
ATOM   1484 C  CG    . GLU A 1 181 ? -12.557 -39.143 24.231 1.00 35.40  ? 181  GLU A CG    1 
ATOM   1485 C  CD    . GLU A 1 181 ? -11.062 -39.451 24.300 1.00 40.89  ? 181  GLU A CD    1 
ATOM   1486 O  OE1   . GLU A 1 181 ? -10.648 -40.608 24.022 1.00 38.00  ? 181  GLU A OE1   1 
ATOM   1487 O  OE2   . GLU A 1 181 ? -10.295 -38.519 24.641 1.00 37.99  ? 181  GLU A OE2   1 
ATOM   1488 N  N     . ILE A 1 182 ? -13.586 -39.327 20.683 1.00 27.73  ? 182  ILE A N     1 
ATOM   1489 C  CA    . ILE A 1 182 ? -14.117 -38.309 19.781 1.00 26.24  ? 182  ILE A CA    1 
ATOM   1490 C  C     . ILE A 1 182 ? -14.338 -38.802 18.351 1.00 26.33  ? 182  ILE A C     1 
ATOM   1491 O  O     . ILE A 1 182 ? -14.904 -38.081 17.542 1.00 26.54  ? 182  ILE A O     1 
ATOM   1492 C  CB    . ILE A 1 182 ? -13.288 -36.989 19.771 1.00 25.73  ? 182  ILE A CB    1 
ATOM   1493 C  CG1   . ILE A 1 182 ? -11.951 -37.176 19.042 1.00 20.58  ? 182  ILE A CG1   1 
ATOM   1494 C  CG2   . ILE A 1 182 ? -13.137 -36.399 21.211 1.00 25.09  ? 182  ILE A CG2   1 
ATOM   1495 C  CD1   . ILE A 1 182 ? -11.305 -35.865 18.603 1.00 18.55  ? 182  ILE A CD1   1 
ATOM   1496 N  N     . ILE A 1 183 ? -13.893 -40.022 18.054 1.00 29.51  ? 183  ILE A N     1 
ATOM   1497 C  CA    . ILE A 1 183 ? -14.058 -40.611 16.728 1.00 30.83  ? 183  ILE A CA    1 
ATOM   1498 C  C     . ILE A 1 183 ? -15.515 -40.567 16.256 1.00 31.65  ? 183  ILE A C     1 
ATOM   1499 O  O     . ILE A 1 183 ? -15.786 -40.174 15.123 1.00 33.90  ? 183  ILE A O     1 
ATOM   1500 C  CB    . ILE A 1 183 ? -13.470 -42.055 16.658 1.00 30.66  ? 183  ILE A CB    1 
ATOM   1501 C  CG1   . ILE A 1 183 ? -11.941 -42.001 16.571 1.00 33.56  ? 183  ILE A CG1   1 
ATOM   1502 C  CG2   . ILE A 1 183 ? -13.996 -42.815 15.442 1.00 32.04  ? 183  ILE A CG2   1 
ATOM   1503 C  CD1   . ILE A 1 183 ? -11.374 -41.398 15.247 1.00 31.31  ? 183  ILE A CD1   1 
ATOM   1504 N  N     . ASP A 1 184 ? -16.443 -40.954 17.127 1.00 31.61  ? 184  ASP A N     1 
ATOM   1505 C  CA    . ASP A 1 184 ? -17.872 -40.958 16.791 1.00 33.64  ? 184  ASP A CA    1 
ATOM   1506 C  C     . ASP A 1 184 ? -18.483 -39.556 16.737 1.00 32.45  ? 184  ASP A C     1 
ATOM   1507 O  O     . ASP A 1 184 ? -19.660 -39.402 16.421 1.00 30.30  ? 184  ASP A O     1 
ATOM   1508 C  CB    . ASP A 1 184 ? -18.661 -41.811 17.795 1.00 36.62  ? 184  ASP A CB    1 
ATOM   1509 C  CG    . ASP A 1 184 ? -18.442 -43.312 17.605 1.00 42.94  ? 184  ASP A CG    1 
ATOM   1510 O  OD1   . ASP A 1 184 ? -17.943 -43.729 16.534 1.00 45.24  ? 184  ASP A OD1   1 
ATOM   1511 O  OD2   . ASP A 1 184 ? -18.785 -44.076 18.537 1.00 45.98  ? 184  ASP A OD2   1 
ATOM   1512 N  N     . LYS A 1 185 ? -17.681 -38.542 17.047 1.00 30.86  ? 185  LYS A N     1 
ATOM   1513 C  CA    . LYS A 1 185 ? -18.177 -37.173 17.168 1.00 29.56  ? 185  LYS A CA    1 
ATOM   1514 C  C     . LYS A 1 185 ? -17.736 -36.297 15.995 1.00 30.27  ? 185  LYS A C     1 
ATOM   1515 O  O     . LYS A 1 185 ? -18.070 -35.108 15.939 1.00 29.90  ? 185  LYS A O     1 
ATOM   1516 C  CB    . LYS A 1 185 ? -17.734 -36.560 18.501 1.00 29.29  ? 185  LYS A CB    1 
ATOM   1517 C  CG    . LYS A 1 185 ? -18.350 -37.248 19.729 1.00 32.75  ? 185  LYS A CG    1 
ATOM   1518 C  CD    . LYS A 1 185 ? -18.046 -36.477 20.998 1.00 27.78  ? 185  LYS A CD    1 
ATOM   1519 C  CE    . LYS A 1 185 ? -18.621 -37.166 22.213 1.00 32.70  ? 185  LYS A CE    1 
ATOM   1520 N  NZ    . LYS A 1 185 ? -18.369 -36.329 23.419 1.00 32.71  ? 185  LYS A NZ    1 
ATOM   1521 N  N     . ILE A 1 186 ? -17.003 -36.890 15.055 1.00 29.34  ? 186  ILE A N     1 
ATOM   1522 C  CA    . ILE A 1 186 ? -16.543 -36.159 13.874 1.00 30.16  ? 186  ILE A CA    1 
ATOM   1523 C  C     . ILE A 1 186 ? -17.567 -36.190 12.741 1.00 30.85  ? 186  ILE A C     1 
ATOM   1524 O  O     . ILE A 1 186 ? -18.093 -37.245 12.393 1.00 28.84  ? 186  ILE A O     1 
ATOM   1525 C  CB    . ILE A 1 186 ? -15.167 -36.669 13.387 1.00 29.11  ? 186  ILE A CB    1 
ATOM   1526 C  CG1   . ILE A 1 186 ? -14.062 -36.133 14.310 1.00 32.43  ? 186  ILE A CG1   1 
ATOM   1527 C  CG2   . ILE A 1 186 ? -14.906 -36.245 11.945 1.00 28.33  ? 186  ILE A CG2   1 
ATOM   1528 C  CD1   . ILE A 1 186 ? -12.951 -37.128 14.610 1.00 25.98  ? 186  ILE A CD1   1 
ATOM   1529 N  N     . ILE A 1 187 ? -17.847 -35.016 12.179 1.00 31.32  ? 187  ILE A N     1 
ATOM   1530 C  CA    . ILE A 1 187 ? -18.650 -34.912 10.972 1.00 31.96  ? 187  ILE A CA    1 
ATOM   1531 C  C     . ILE A 1 187 ? -17.747 -34.352 9.888  1.00 32.98  ? 187  ILE A C     1 
ATOM   1532 O  O     . ILE A 1 187 ? -17.423 -33.158 9.887  1.00 37.57  ? 187  ILE A O     1 
ATOM   1533 C  CB    . ILE A 1 187 ? -19.936 -34.070 11.211 1.00 33.36  ? 187  ILE A CB    1 
ATOM   1534 C  CG1   . ILE A 1 187 ? -20.893 -34.846 12.139 1.00 30.99  ? 187  ILE A CG1   1 
ATOM   1535 C  CG2   . ILE A 1 187 ? -20.630 -33.719 9.884  1.00 29.22  ? 187  ILE A CG2   1 
ATOM   1536 C  CD1   . ILE A 1 187 ? -21.935 -33.999 12.817 1.00 35.14  ? 187  ILE A CD1   1 
ATOM   1537 N  N     . TYR A 1 188 ? -17.319 -35.229 8.984  1.00 30.36  ? 188  TYR A N     1 
ATOM   1538 C  CA    . TYR A 1 188 ? -16.313 -34.886 7.985  1.00 30.75  ? 188  TYR A CA    1 
ATOM   1539 C  C     . TYR A 1 188 ? -16.948 -34.449 6.659  1.00 32.83  ? 188  TYR A C     1 
ATOM   1540 O  O     . TYR A 1 188 ? -17.905 -35.073 6.184  1.00 34.20  ? 188  TYR A O     1 
ATOM   1541 C  CB    . TYR A 1 188 ? -15.331 -36.052 7.804  1.00 28.11  ? 188  TYR A CB    1 
ATOM   1542 C  CG    . TYR A 1 188 ? -14.345 -35.891 6.664  1.00 28.58  ? 188  TYR A CG    1 
ATOM   1543 C  CD1   . TYR A 1 188 ? -13.265 -35.019 6.767  1.00 28.16  ? 188  TYR A CD1   1 
ATOM   1544 C  CD2   . TYR A 1 188 ? -14.486 -36.624 5.487  1.00 28.05  ? 188  TYR A CD2   1 
ATOM   1545 C  CE1   . TYR A 1 188 ? -12.355 -34.868 5.724  1.00 27.02  ? 188  TYR A CE1   1 
ATOM   1546 C  CE2   . TYR A 1 188 ? -13.578 -36.477 4.436  1.00 32.24  ? 188  TYR A CE2   1 
ATOM   1547 C  CZ    . TYR A 1 188 ? -12.516 -35.592 4.563  1.00 30.20  ? 188  TYR A CZ    1 
ATOM   1548 O  OH    . TYR A 1 188 ? -11.606 -35.448 3.533  1.00 30.00  ? 188  TYR A OH    1 
ATOM   1549 N  N     . MET A 1 189 ? -16.416 -33.369 6.078  1.00 32.89  ? 189  MET A N     1 
ATOM   1550 C  CA    . MET A 1 189 ? -16.946 -32.787 4.830  1.00 31.98  ? 189  MET A CA    1 
ATOM   1551 C  C     . MET A 1 189 ? -15.813 -32.341 3.902  1.00 32.05  ? 189  MET A C     1 
ATOM   1552 O  O     . MET A 1 189 ? -15.198 -31.295 4.132  1.00 31.64  ? 189  MET A O     1 
ATOM   1553 C  CB    . MET A 1 189 ? -17.851 -31.588 5.123  1.00 31.51  ? 189  MET A CB    1 
ATOM   1554 C  CG    . MET A 1 189 ? -19.148 -31.904 5.868  1.00 36.09  ? 189  MET A CG    1 
ATOM   1555 S  SD    . MET A 1 189 ? -19.853 -30.465 6.714  1.00 37.31  ? 189  MET A SD    1 
ATOM   1556 C  CE    . MET A 1 189 ? -18.675 -30.239 8.040  1.00 35.17  ? 189  MET A CE    1 
ATOM   1557 N  N     . PRO A 1 190 ? -15.527 -33.141 2.859  1.00 34.07  ? 190  PRO A N     1 
ATOM   1558 C  CA    . PRO A 1 190 ? -14.508 -32.839 1.849  1.00 35.78  ? 190  PRO A CA    1 
ATOM   1559 C  C     . PRO A 1 190 ? -15.018 -31.851 0.806  1.00 37.06  ? 190  PRO A C     1 
ATOM   1560 O  O     . PRO A 1 190 ? -16.231 -31.749 0.590  1.00 38.27  ? 190  PRO A O     1 
ATOM   1561 C  CB    . PRO A 1 190 ? -14.261 -34.196 1.191  1.00 37.31  ? 190  PRO A CB    1 
ATOM   1562 C  CG    . PRO A 1 190 ? -15.575 -34.916 1.316  1.00 37.55  ? 190  PRO A CG    1 
ATOM   1563 C  CD    . PRO A 1 190 ? -16.176 -34.449 2.620  1.00 37.28  ? 190  PRO A CD    1 
ATOM   1564 N  N     . PHE A 1 191 ? -14.103 -31.125 0.170  1.00 37.25  ? 191  PHE A N     1 
ATOM   1565 C  CA    . PHE A 1 191 ? -14.479 -30.141 -0.849 1.00 37.81  ? 191  PHE A CA    1 
ATOM   1566 C  C     . PHE A 1 191 ? -13.523 -30.135 -2.016 1.00 40.08  ? 191  PHE A C     1 
ATOM   1567 O  O     . PHE A 1 191 ? -12.307 -30.221 -1.836 1.00 41.69  ? 191  PHE A O     1 
ATOM   1568 C  CB    . PHE A 1 191 ? -14.591 -28.728 -0.261 1.00 36.06  ? 191  PHE A CB    1 
ATOM   1569 C  CG    . PHE A 1 191 ? -15.743 -28.561 0.678  1.00 35.30  ? 191  PHE A CG    1 
ATOM   1570 C  CD1   . PHE A 1 191 ? -15.555 -28.689 2.054  1.00 28.62  ? 191  PHE A CD1   1 
ATOM   1571 C  CD2   . PHE A 1 191 ? -17.025 -28.304 0.190  1.00 31.59  ? 191  PHE A CD2   1 
ATOM   1572 C  CE1   . PHE A 1 191 ? -16.621 -28.552 2.935  1.00 28.82  ? 191  PHE A CE1   1 
ATOM   1573 C  CE2   . PHE A 1 191 ? -18.095 -28.163 1.064  1.00 30.39  ? 191  PHE A CE2   1 
ATOM   1574 C  CZ    . PHE A 1 191 ? -17.885 -28.288 2.449  1.00 28.96  ? 191  PHE A CZ    1 
ATOM   1575 N  N     . ASP A 1 192 ? -14.094 -30.016 -3.210 1.00 41.09  ? 192  ASP A N     1 
ATOM   1576 C  CA    . ASP A 1 192 ? -13.321 -30.007 -4.440 1.00 44.23  ? 192  ASP A CA    1 
ATOM   1577 C  C     . ASP A 1 192 ? -12.785 -28.611 -4.763 1.00 43.24  ? 192  ASP A C     1 
ATOM   1578 O  O     . ASP A 1 192 ? -11.868 -28.469 -5.571 1.00 43.89  ? 192  ASP A O     1 
ATOM   1579 C  CB    . ASP A 1 192 ? -14.152 -30.567 -5.605 1.00 47.31  ? 192  ASP A CB    1 
ATOM   1580 C  CG    . ASP A 1 192 ? -14.314 -32.097 -5.547 1.00 55.55  ? 192  ASP A CG    1 
ATOM   1581 O  OD1   . ASP A 1 192 ? -13.473 -32.794 -4.925 1.00 57.56  ? 192  ASP A OD1   1 
ATOM   1582 O  OD2   . ASP A 1 192 ? -15.286 -32.610 -6.147 1.00 62.31  ? 192  ASP A OD2   1 
ATOM   1583 N  N     . ASN A 1 193 ? -13.355 -27.585 -4.135 1.00 40.43  ? 193  ASN A N     1 
ATOM   1584 C  CA    . ASN A 1 193 ? -12.838 -26.227 -4.283 1.00 38.67  ? 193  ASN A CA    1 
ATOM   1585 C  C     . ASN A 1 193 ? -13.065 -25.338 -3.055 1.00 36.59  ? 193  ASN A C     1 
ATOM   1586 O  O     . ASN A 1 193 ? -14.036 -25.496 -2.312 1.00 34.27  ? 193  ASN A O     1 
ATOM   1587 C  CB    . ASN A 1 193 ? -13.366 -25.559 -5.563 1.00 40.19  ? 193  ASN A CB    1 
ATOM   1588 C  CG    . ASN A 1 193 ? -14.881 -25.487 -5.603 1.00 41.88  ? 193  ASN A CG    1 
ATOM   1589 O  OD1   . ASN A 1 193 ? -15.493 -24.644 -4.937 1.00 41.28  ? 193  ASN A OD1   1 
ATOM   1590 N  ND2   . ASN A 1 193 ? -15.495 -26.364 -6.394 1.00 41.08  ? 193  ASN A ND2   1 
ATOM   1591 N  N     . GLU A 1 194 ? -12.144 -24.401 -2.861 1.00 36.04  ? 194  GLU A N     1 
ATOM   1592 C  CA    . GLU A 1 194 ? -12.133 -23.537 -1.691 1.00 36.42  ? 194  GLU A CA    1 
ATOM   1593 C  C     . GLU A 1 194 ? -13.382 -22.648 -1.571 1.00 36.35  ? 194  GLU A C     1 
ATOM   1594 O  O     . GLU A 1 194 ? -13.864 -22.404 -0.464 1.00 36.97  ? 194  GLU A O     1 
ATOM   1595 C  CB    . GLU A 1 194 ? -10.850 -22.708 -1.682 1.00 34.16  ? 194  GLU A CB    1 
ATOM   1596 C  CG    . GLU A 1 194 ? -10.594 -21.956 -0.393 1.00 36.62  ? 194  GLU A CG    1 
ATOM   1597 C  CD    . GLU A 1 194 ? -9.632  -20.806 -0.582 1.00 36.14  ? 194  GLU A CD    1 
ATOM   1598 O  OE1   . GLU A 1 194 ? -9.411  -20.050 0.384  1.00 40.68  ? 194  GLU A OE1   1 
ATOM   1599 O  OE2   . GLU A 1 194 ? -9.099  -20.650 -1.699 1.00 37.83  ? 194  GLU A OE2   1 
ATOM   1600 N  N     . LYS A 1 195 ? -13.909 -22.180 -2.700 1.00 36.07  ? 195  LYS A N     1 
ATOM   1601 C  CA    . LYS A 1 195 ? -15.119 -21.352 -2.696 1.00 36.93  ? 195  LYS A CA    1 
ATOM   1602 C  C     . LYS A 1 195 ? -16.311 -22.079 -2.077 1.00 35.67  ? 195  LYS A C     1 
ATOM   1603 O  O     . LYS A 1 195 ? -17.039 -21.509 -1.276 1.00 33.72  ? 195  LYS A O     1 
ATOM   1604 C  CB    . LYS A 1 195 ? -15.465 -20.878 -4.109 1.00 38.64  ? 195  LYS A CB    1 
ATOM   1605 C  CG    . LYS A 1 195 ? -14.517 -19.822 -4.654 1.00 44.84  ? 195  LYS A CG    1 
ATOM   1606 C  CD    . LYS A 1 195 ? -15.027 -19.212 -5.959 1.00 51.06  ? 195  LYS A CD    1 
ATOM   1607 C  CE    . LYS A 1 195 ? -14.052 -18.147 -6.482 1.00 55.30  ? 195  LYS A CE    1 
ATOM   1608 N  NZ    . LYS A 1 195 ? -14.531 -17.469 -7.734 1.00 58.75  ? 195  LYS A NZ    1 
ATOM   1609 N  N     . GLU A 1 196 ? -16.500 -23.338 -2.461 1.00 37.40  ? 196  GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 196 ? -17.583 -24.153 -1.927 1.00 37.38  ? 196  GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 196 ? -17.389 -24.436 -0.442 1.00 35.52  ? 196  GLU A C     1 
ATOM   1612 O  O     . GLU A 1 196 ? -18.356 -24.372 0.328  1.00 34.02  ? 196  GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 196 ? -17.742 -25.446 -2.734 1.00 39.06  ? 196  GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 196 ? -18.864 -25.360 -3.775 1.00 45.70  ? 196  GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 196 ? -18.477 -25.900 -5.156 1.00 51.40  ? 196  GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 196 ? -17.955 -27.037 -5.251 1.00 50.42  ? 196  GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 196 ? -18.714 -25.179 -6.156 1.00 52.77  ? 196  GLU A OE2   1 
ATOM   1618 N  N     . LEU A 1 197 ? -16.143 -24.721 -0.047 1.00 32.78  ? 197  LEU A N     1 
ATOM   1619 C  CA    . LEU A 1 197 ? -15.792 -24.861 1.371  1.00 32.50  ? 197  LEU A CA    1 
ATOM   1620 C  C     . LEU A 1 197 ? -16.165 -23.601 2.163  1.00 32.88  ? 197  LEU A C     1 
ATOM   1621 O  O     . LEU A 1 197 ? -16.855 -23.687 3.192  1.00 33.11  ? 197  LEU A O     1 
ATOM   1622 C  CB    . LEU A 1 197 ? -14.304 -25.178 1.549  1.00 32.73  ? 197  LEU A CB    1 
ATOM   1623 C  CG    . LEU A 1 197 ? -13.793 -25.568 2.945  1.00 29.18  ? 197  LEU A CG    1 
ATOM   1624 C  CD1   . LEU A 1 197 ? -12.462 -26.289 2.820  1.00 22.97  ? 197  LEU A CD1   1 
ATOM   1625 C  CD2   . LEU A 1 197 ? -13.659 -24.375 3.889  1.00 26.87  ? 197  LEU A CD2   1 
ATOM   1626 N  N     . LEU A 1 198 ? -15.730 -22.439 1.679  1.00 29.47  ? 198  LEU A N     1 
ATOM   1627 C  CA    . LEU A 1 198 ? -15.946 -21.201 2.420  1.00 31.86  ? 198  LEU A CA    1 
ATOM   1628 C  C     . LEU A 1 198 ? -17.418 -20.782 2.443  1.00 34.29  ? 198  LEU A C     1 
ATOM   1629 O  O     . LEU A 1 198 ? -17.907 -20.293 3.471  1.00 35.71  ? 198  LEU A O     1 
ATOM   1630 C  CB    . LEU A 1 198 ? -15.020 -20.079 1.935  1.00 31.11  ? 198  LEU A CB    1 
ATOM   1631 C  CG    . LEU A 1 198 ? -13.520 -20.283 2.207  1.00 33.51  ? 198  LEU A CG    1 
ATOM   1632 C  CD1   . LEU A 1 198 ? -12.671 -19.208 1.557  1.00 31.77  ? 198  LEU A CD1   1 
ATOM   1633 C  CD2   . LEU A 1 198 ? -13.196 -20.365 3.699  1.00 35.45  ? 198  LEU A CD2   1 
ATOM   1634 N  N     . MET A 1 199 ? -18.125 -21.007 1.333  1.00 33.43  ? 199  MET A N     1 
ATOM   1635 C  CA    . MET A 1 199 ? -19.564 -20.757 1.270  1.00 34.13  ? 199  MET A CA    1 
ATOM   1636 C  C     . MET A 1 199 ? -20.308 -21.622 2.275  1.00 32.65  ? 199  MET A C     1 
ATOM   1637 O  O     . MET A 1 199 ? -21.130 -21.132 3.049  1.00 31.95  ? 199  MET A O     1 
ATOM   1638 C  CB    . MET A 1 199 ? -20.110 -21.026 -0.133 1.00 37.13  ? 199  MET A CB    1 
ATOM   1639 C  CG    . MET A 1 199 ? -20.050 -19.840 -1.080 1.00 47.55  ? 199  MET A CG    1 
ATOM   1640 S  SD    . MET A 1 199 ? -20.993 -20.111 -2.610 1.00 64.24  ? 199  MET A SD    1 
ATOM   1641 C  CE    . MET A 1 199 ? -19.978 -21.333 -3.461 1.00 58.31  ? 199  MET A CE    1 
ATOM   1642 N  N     . GLU A 1 200 ? -20.017 -22.918 2.252  1.00 33.21  ? 200  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 200 ? -20.655 -23.855 3.156  1.00 34.10  ? 200  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 200 ? -20.314 -23.508 4.610  1.00 31.51  ? 200  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 200 ? -21.175 -23.604 5.484  1.00 29.98  ? 200  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 200 ? -20.231 -25.287 2.831  1.00 37.71  ? 200  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 200 ? -21.118 -26.351 3.466  1.00 49.38  ? 200  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 200 ? -22.391 -26.591 2.672  1.00 57.21  ? 200  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 200 ? -23.408 -25.911 2.945  1.00 56.41  ? 200  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 200 ? -22.362 -27.452 1.762  1.00 62.58  ? 200  GLU A OE2   1 
ATOM   1651 N  N     . TYR A 1 201 ? -19.070 -23.091 4.857  1.00 30.88  ? 201  TYR A N     1 
ATOM   1652 C  CA    . TYR A 1 201 ? -18.643 -22.738 6.211  1.00 32.12  ? 201  TYR A CA    1 
ATOM   1653 C  C     . TYR A 1 201 ? -19.435 -21.547 6.746  1.00 32.60  ? 201  TYR A C     1 
ATOM   1654 O  O     . TYR A 1 201 ? -19.923 -21.582 7.877  1.00 34.45  ? 201  TYR A O     1 
ATOM   1655 C  CB    . TYR A 1 201 ? -17.126 -22.475 6.303  1.00 32.77  ? 201  TYR A CB    1 
ATOM   1656 C  CG    . TYR A 1 201 ? -16.656 -22.214 7.731  1.00 30.59  ? 201  TYR A CG    1 
ATOM   1657 C  CD1   . TYR A 1 201 ? -16.647 -23.237 8.669  1.00 29.70  ? 201  TYR A CD1   1 
ATOM   1658 C  CD2   . TYR A 1 201 ? -16.241 -20.945 8.141  1.00 30.87  ? 201  TYR A CD2   1 
ATOM   1659 C  CE1   . TYR A 1 201 ? -16.241 -23.017 9.978  1.00 30.17  ? 201  TYR A CE1   1 
ATOM   1660 C  CE2   . TYR A 1 201 ? -15.824 -20.710 9.461  1.00 30.96  ? 201  TYR A CE2   1 
ATOM   1661 C  CZ    . TYR A 1 201 ? -15.829 -21.762 10.374 1.00 31.28  ? 201  TYR A CZ    1 
ATOM   1662 O  OH    . TYR A 1 201 ? -15.425 -21.590 11.683 1.00 24.64  ? 201  TYR A OH    1 
ATOM   1663 N  N     . LEU A 1 202 ? -19.559 -20.504 5.929  1.00 32.47  ? 202  LEU A N     1 
ATOM   1664 C  CA    . LEU A 1 202 ? -20.404 -19.358 6.257  1.00 33.01  ? 202  LEU A CA    1 
ATOM   1665 C  C     . LEU A 1 202 ? -21.871 -19.725 6.481  1.00 32.84  ? 202  LEU A C     1 
ATOM   1666 O  O     . LEU A 1 202 ? -22.503 -19.190 7.392  1.00 34.12  ? 202  LEU A O     1 
ATOM   1667 C  CB    . LEU A 1 202 ? -20.324 -18.296 5.171  1.00 31.91  ? 202  LEU A CB    1 
ATOM   1668 C  CG    . LEU A 1 202 ? -19.182 -17.285 5.171  1.00 35.42  ? 202  LEU A CG    1 
ATOM   1669 C  CD1   . LEU A 1 202 ? -19.265 -16.465 3.894  1.00 32.57  ? 202  LEU A CD1   1 
ATOM   1670 C  CD2   . LEU A 1 202 ? -19.192 -16.368 6.414  1.00 31.86  ? 202  LEU A CD2   1 
ATOM   1671 N  N     . ASN A 1 203 ? -22.412 -20.619 5.655  1.00 31.42  ? 203  ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 203 ? -23.800 -21.048 5.818  1.00 35.01  ? 203  ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 203 ? -23.977 -21.791 7.137  1.00 34.81  ? 203  ASN A C     1 
ATOM   1674 O  O     . ASN A 1 203 ? -24.920 -21.533 7.891  1.00 33.99  ? 203  ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 203 ? -24.263 -21.917 4.639  1.00 38.47  ? 203  ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 203 ? -24.549 -21.101 3.372  1.00 45.76  ? 203  ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 203 ? -24.375 -21.592 2.254  1.00 49.19  ? 203  ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 203 ? -24.996 -19.857 3.545  1.00 48.59  ? 203  ASN A ND2   1 
ATOM   1679 N  N     . PHE A 1 204 ? -23.041 -22.705 7.398  1.00 34.68  ? 204  PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 204 ? -22.943 -23.430 8.656  1.00 33.46  ? 204  PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 204 ? -22.867 -22.462 9.849  1.00 31.24  ? 204  PHE A C     1 
ATOM   1682 O  O     . PHE A 1 204 ? -23.582 -22.631 10.837 1.00 29.48  ? 204  PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 204 ? -21.736 -24.384 8.594  1.00 33.66  ? 204  PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 204 ? -21.246 -24.852 9.929  1.00 32.34  ? 204  PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 204 ? -21.791 -25.987 10.526 1.00 37.09  ? 204  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 204 ? -20.217 -24.176 10.579 1.00 33.84  ? 204  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 204 ? -21.325 -26.443 11.774 1.00 38.43  ? 204  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 204 ? -19.744 -24.611 11.833 1.00 38.10  ? 204  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 204 ? -20.302 -25.749 12.428 1.00 36.80  ? 204  PHE A CZ    1 
ATOM   1690 N  N     . TRP A 1 205 ? -22.017 -21.444 9.730  1.00 30.52  ? 205  TRP A N     1 
ATOM   1691 C  CA    . TRP A 1 205 ? -21.867 -20.406 10.757 1.00 31.00  ? 205  TRP A CA    1 
ATOM   1692 C  C     . TRP A 1 205 ? -23.173 -19.621 11.008 1.00 33.14  ? 205  TRP A C     1 
ATOM   1693 O  O     . TRP A 1 205 ? -23.437 -19.215 12.146 1.00 30.57  ? 205  TRP A O     1 
ATOM   1694 C  CB    . TRP A 1 205 ? -20.727 -19.469 10.362 1.00 28.51  ? 205  TRP A CB    1 
ATOM   1695 C  CG    . TRP A 1 205 ? -20.349 -18.389 11.337 1.00 26.93  ? 205  TRP A CG    1 
ATOM   1696 C  CD1   . TRP A 1 205 ? -21.052 -17.258 11.626 1.00 26.90  ? 205  TRP A CD1   1 
ATOM   1697 C  CD2   . TRP A 1 205 ? -19.136 -18.308 12.097 1.00 26.43  ? 205  TRP A CD2   1 
ATOM   1698 N  NE1   . TRP A 1 205 ? -20.369 -16.488 12.537 1.00 27.35  ? 205  TRP A NE1   1 
ATOM   1699 C  CE2   . TRP A 1 205 ? -19.186 -17.104 12.837 1.00 26.97  ? 205  TRP A CE2   1 
ATOM   1700 C  CE3   . TRP A 1 205 ? -18.018 -19.140 12.232 1.00 24.96  ? 205  TRP A CE3   1 
ATOM   1701 C  CZ2   . TRP A 1 205 ? -18.161 -16.709 13.706 1.00 29.52  ? 205  TRP A CZ2   1 
ATOM   1702 C  CZ3   . TRP A 1 205 ? -16.984 -18.737 13.083 1.00 31.12  ? 205  TRP A CZ3   1 
ATOM   1703 C  CH2   . TRP A 1 205 ? -17.069 -17.536 13.813 1.00 29.69  ? 205  TRP A CH2   1 
ATOM   1704 N  N     . GLN A 1 206 ? -23.980 -19.413 9.959  1.00 32.52  ? 206  GLN A N     1 
ATOM   1705 C  CA    . GLN A 1 206 ? -25.292 -18.778 10.131 1.00 35.12  ? 206  GLN A CA    1 
ATOM   1706 C  C     . GLN A 1 206 ? -26.220 -19.649 10.980 1.00 35.76  ? 206  GLN A C     1 
ATOM   1707 O  O     . GLN A 1 206 ? -26.888 -19.150 11.887 1.00 33.62  ? 206  GLN A O     1 
ATOM   1708 C  CB    . GLN A 1 206 ? -25.972 -18.441 8.788  1.00 36.26  ? 206  GLN A CB    1 
ATOM   1709 C  CG    . GLN A 1 206 ? -25.240 -17.434 7.873  1.00 40.38  ? 206  GLN A CG    1 
ATOM   1710 C  CD    . GLN A 1 206 ? -24.358 -16.437 8.625  1.00 47.60  ? 206  GLN A CD    1 
ATOM   1711 O  OE1   . GLN A 1 206 ? -23.128 -16.494 8.530  1.00 50.67  ? 206  GLN A OE1   1 
ATOM   1712 N  NE2   . GLN A 1 206 ? -24.979 -15.532 9.383  1.00 47.32  ? 206  GLN A NE2   1 
ATOM   1713 N  N     . GLN A 1 207 ? -26.249 -20.947 10.680 1.00 33.80  ? 207  GLN A N     1 
ATOM   1714 C  CA    . GLN A 1 207 ? -27.099 -21.882 11.405 1.00 36.07  ? 207  GLN A CA    1 
ATOM   1715 C  C     . GLN A 1 207 ? -26.627 -22.095 12.836 1.00 34.51  ? 207  GLN A C     1 
ATOM   1716 O  O     . GLN A 1 207 ? -27.440 -22.249 13.742 1.00 35.59  ? 207  GLN A O     1 
ATOM   1717 C  CB    . GLN A 1 207 ? -27.190 -23.236 10.676 1.00 39.01  ? 207  GLN A CB    1 
ATOM   1718 C  CG    . GLN A 1 207 ? -27.927 -23.211 9.320  1.00 46.10  ? 207  GLN A CG    1 
ATOM   1719 C  CD    . GLN A 1 207 ? -29.310 -22.543 9.391  1.00 52.69  ? 207  GLN A CD    1 
ATOM   1720 O  OE1   . GLN A 1 207 ? -30.233 -23.046 10.042 1.00 53.87  ? 207  GLN A OE1   1 
ATOM   1721 N  NE2   . GLN A 1 207 ? -29.450 -21.405 8.712  1.00 55.03  ? 207  GLN A NE2   1 
ATOM   1722 N  N     . LYS A 1 208 ? -25.311 -22.101 13.031 1.00 34.82  ? 208  LYS A N     1 
ATOM   1723 C  CA    . LYS A 1 208 ? -24.711 -22.416 14.328 1.00 34.18  ? 208  LYS A CA    1 
ATOM   1724 C  C     . LYS A 1 208 ? -23.760 -21.293 14.758 1.00 33.80  ? 208  LYS A C     1 
ATOM   1725 O  O     . LYS A 1 208 ? -22.549 -21.493 14.872 1.00 35.54  ? 208  LYS A O     1 
ATOM   1726 C  CB    . LYS A 1 208 ? -23.986 -23.769 14.262 1.00 34.02  ? 208  LYS A CB    1 
ATOM   1727 C  CG    . LYS A 1 208 ? -24.914 -24.972 14.083 1.00 32.07  ? 208  LYS A CG    1 
ATOM   1728 C  CD    . LYS A 1 208 ? -24.126 -26.234 13.745 1.00 34.60  ? 208  LYS A CD    1 
ATOM   1729 C  CE    . LYS A 1 208 ? -24.953 -27.249 12.931 1.00 36.90  ? 208  LYS A CE    1 
ATOM   1730 N  NZ    . LYS A 1 208 ? -26.153 -27.751 13.668 1.00 34.26  ? 208  LYS A NZ    1 
ATOM   1731 N  N     . THR A 1 209 ? -24.326 -20.116 14.999 1.00 31.65  ? 209  THR A N     1 
ATOM   1732 C  CA    . THR A 1 209 ? -23.546 -18.914 15.251 1.00 30.51  ? 209  THR A CA    1 
ATOM   1733 C  C     . THR A 1 209 ? -22.969 -18.897 16.659 1.00 30.93  ? 209  THR A C     1 
ATOM   1734 O  O     . THR A 1 209 ? -23.719 -18.830 17.635 1.00 32.02  ? 209  THR A O     1 
ATOM   1735 C  CB    . THR A 1 209 ? -24.384 -17.640 15.007 1.00 30.85  ? 209  THR A CB    1 
ATOM   1736 O  OG1   . THR A 1 209 ? -25.107 -17.771 13.772 1.00 32.60  ? 209  THR A OG1   1 
ATOM   1737 C  CG2   . THR A 1 209 ? -23.488 -16.385 14.949 1.00 23.97  ? 209  THR A CG2   1 
ATOM   1738 N  N     . PRO A 1 210 ? -21.630 -18.945 16.765 1.00 31.18  ? 210  PRO A N     1 
ATOM   1739 C  CA    . PRO A 1 210 ? -20.978 -18.961 18.066 1.00 30.37  ? 210  PRO A CA    1 
ATOM   1740 C  C     . PRO A 1 210 ? -21.432 -17.788 18.904 1.00 29.23  ? 210  PRO A C     1 
ATOM   1741 O  O     . PRO A 1 210 ? -21.690 -16.703 18.366 1.00 26.79  ? 210  PRO A O     1 
ATOM   1742 C  CB    . PRO A 1 210 ? -19.495 -18.785 17.725 1.00 32.00  ? 210  PRO A CB    1 
ATOM   1743 C  CG    . PRO A 1 210 ? -19.367 -19.249 16.326 1.00 34.89  ? 210  PRO A CG    1 
ATOM   1744 C  CD    . PRO A 1 210 ? -20.654 -18.862 15.663 1.00 31.96  ? 210  PRO A CD    1 
ATOM   1745 N  N     . VAL A 1 211 ? -21.563 -18.026 20.207 1.00 28.08  ? 211  VAL A N     1 
ATOM   1746 C  CA    . VAL A 1 211 ? -21.758 -16.955 21.183 1.00 25.62  ? 211  VAL A CA    1 
ATOM   1747 C  C     . VAL A 1 211 ? -20.398 -16.658 21.797 1.00 26.48  ? 211  VAL A C     1 
ATOM   1748 O  O     . VAL A 1 211 ? -19.952 -15.513 21.808 1.00 27.11  ? 211  VAL A O     1 
ATOM   1749 C  CB    . VAL A 1 211 ? -22.766 -17.361 22.277 1.00 26.85  ? 211  VAL A CB    1 
ATOM   1750 C  CG1   . VAL A 1 211 ? -22.786 -16.330 23.417 1.00 24.99  ? 211  VAL A CG1   1 
ATOM   1751 C  CG2   . VAL A 1 211 ? -24.157 -17.537 21.682 1.00 24.65  ? 211  VAL A CG2   1 
ATOM   1752 N  N     . ILE A 1 212 ? -19.755 -17.711 22.307 1.00 26.66  ? 212  ILE A N     1 
ATOM   1753 C  CA    . ILE A 1 212 ? -18.365 -17.690 22.731 1.00 26.48  ? 212  ILE A CA    1 
ATOM   1754 C  C     . ILE A 1 212 ? -17.539 -18.315 21.619 1.00 27.61  ? 212  ILE A C     1 
ATOM   1755 O  O     . ILE A 1 212 ? -17.766 -19.462 21.231 1.00 27.18  ? 212  ILE A O     1 
ATOM   1756 C  CB    . ILE A 1 212 ? -18.140 -18.516 24.025 1.00 29.02  ? 212  ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1 212 ? -19.125 -18.114 25.143 1.00 30.78  ? 212  ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1 212 ? -16.670 -18.466 24.477 1.00 28.50  ? 212  ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1 212 ? -19.152 -16.646 25.501 1.00 30.18  ? 212  ILE A CD1   1 
ATOM   1760 N  N     . LEU A 1 213 ? -16.596 -17.548 21.088 1.00 29.56  ? 213  LEU A N     1 
ATOM   1761 C  CA    . LEU A 1 213 ? -15.646 -18.074 20.119 1.00 30.40  ? 213  LEU A CA    1 
ATOM   1762 C  C     . LEU A 1 213 ? -14.288 -18.162 20.790 1.00 29.97  ? 213  LEU A C     1 
ATOM   1763 O  O     . LEU A 1 213 ? -13.798 -17.182 21.349 1.00 29.78  ? 213  LEU A O     1 
ATOM   1764 C  CB    . LEU A 1 213 ? -15.579 -17.176 18.885 1.00 30.51  ? 213  LEU A CB    1 
ATOM   1765 C  CG    . LEU A 1 213 ? -14.828 -17.650 17.633 1.00 31.55  ? 213  LEU A CG    1 
ATOM   1766 C  CD1   . LEU A 1 213 ? -15.321 -19.005 17.146 1.00 29.98  ? 213  LEU A CD1   1 
ATOM   1767 C  CD2   . LEU A 1 213 ? -14.968 -16.601 16.527 1.00 28.82  ? 213  LEU A CD2   1 
ATOM   1768 N  N     . THR A 1 214 ? -13.694 -19.347 20.750 1.00 31.32  ? 214  THR A N     1 
ATOM   1769 C  CA    . THR A 1 214 ? -12.392 -19.559 21.361 1.00 31.73  ? 214  THR A CA    1 
ATOM   1770 C  C     . THR A 1 214 ? -11.542 -20.503 20.522 1.00 32.33  ? 214  THR A C     1 
ATOM   1771 O  O     . THR A 1 214 ? -11.905 -20.839 19.389 1.00 35.60  ? 214  THR A O     1 
ATOM   1772 C  CB    . THR A 1 214 ? -12.518 -20.004 22.853 1.00 31.86  ? 214  THR A CB    1 
ATOM   1773 O  OG1   . THR A 1 214 ? -11.221 -20.043 23.458 1.00 31.50  ? 214  THR A OG1   1 
ATOM   1774 C  CG2   . THR A 1 214 ? -13.196 -21.350 22.987 1.00 33.69  ? 214  THR A CG2   1 
ATOM   1775 N  N     . GLY A 1 215 ? -10.407 -20.913 21.074 1.00 31.52  ? 215  GLY A N     1 
ATOM   1776 C  CA    . GLY A 1 215 ? -9.420  -21.697 20.346 1.00 30.98  ? 215  GLY A CA    1 
ATOM   1777 C  C     . GLY A 1 215 ? -8.036  -21.169 20.665 1.00 31.71  ? 215  GLY A C     1 
ATOM   1778 O  O     . GLY A 1 215 ? -7.878  -20.269 21.494 1.00 34.16  ? 215  GLY A O     1 
ATOM   1779 N  N     . TRP A 1 216 ? -7.027  -21.723 20.008 1.00 31.84  ? 216  TRP A N     1 
ATOM   1780 C  CA    . TRP A 1 216 ? -5.658  -21.356 20.319 1.00 30.63  ? 216  TRP A CA    1 
ATOM   1781 C  C     . TRP A 1 216 ? -5.142  -20.309 19.351 1.00 31.00  ? 216  TRP A C     1 
ATOM   1782 O  O     . TRP A 1 216 ? -4.884  -20.600 18.179 1.00 30.78  ? 216  TRP A O     1 
ATOM   1783 C  CB    . TRP A 1 216 ? -4.738  -22.573 20.325 1.00 28.46  ? 216  TRP A CB    1 
ATOM   1784 C  CG    . TRP A 1 216 ? -3.477  -22.282 21.073 1.00 28.42  ? 216  TRP A CG    1 
ATOM   1785 C  CD1   . TRP A 1 216 ? -2.271  -21.948 20.544 1.00 24.55  ? 216  TRP A CD1   1 
ATOM   1786 C  CD2   . TRP A 1 216 ? -3.320  -22.252 22.495 1.00 26.03  ? 216  TRP A CD2   1 
ATOM   1787 N  NE1   . TRP A 1 216 ? -1.359  -21.729 21.550 1.00 33.41  ? 216  TRP A NE1   1 
ATOM   1788 C  CE2   . TRP A 1 216 ? -1.979  -21.907 22.759 1.00 30.69  ? 216  TRP A CE2   1 
ATOM   1789 C  CE3   . TRP A 1 216 ? -4.183  -22.494 23.569 1.00 24.90  ? 216  TRP A CE3   1 
ATOM   1790 C  CZ2   . TRP A 1 216 ? -1.470  -21.797 24.063 1.00 32.83  ? 216  TRP A CZ2   1 
ATOM   1791 C  CZ3   . TRP A 1 216 ? -3.683  -22.381 24.866 1.00 34.04  ? 216  TRP A CZ3   1 
ATOM   1792 C  CH2   . TRP A 1 216 ? -2.336  -22.035 25.101 1.00 32.52  ? 216  TRP A CH2   1 
ATOM   1793 N  N     . ASN A 1 217 ? -5.016  -19.081 19.844 1.00 31.71  ? 217  ASN A N     1 
ATOM   1794 C  CA    . ASN A 1 217 ? -4.486  -17.999 19.039 1.00 33.80  ? 217  ASN A CA    1 
ATOM   1795 C  C     . ASN A 1 217 ? -5.450  -17.587 17.915 1.00 32.87  ? 217  ASN A C     1 
ATOM   1796 O  O     . ASN A 1 217 ? -5.029  -17.051 16.886 1.00 31.87  ? 217  ASN A O     1 
ATOM   1797 C  CB    . ASN A 1 217 ? -3.132  -18.435 18.469 1.00 38.12  ? 217  ASN A CB    1 
ATOM   1798 C  CG    . ASN A 1 217 ? -2.237  -17.283 18.158 1.00 42.83  ? 217  ASN A CG    1 
ATOM   1799 O  OD1   . ASN A 1 217 ? -2.065  -16.378 18.975 1.00 45.23  ? 217  ASN A OD1   1 
ATOM   1800 N  ND2   . ASN A 1 217 ? -1.656  -17.297 16.959 1.00 45.65  ? 217  ASN A ND2   1 
ATOM   1801 N  N     . VAL A 1 218 ? -6.747  -17.821 18.124 1.00 31.62  ? 218  VAL A N     1 
ATOM   1802 C  CA    . VAL A 1 218 ? -7.763  -17.498 17.114 1.00 31.03  ? 218  VAL A CA    1 
ATOM   1803 C  C     . VAL A 1 218 ? -7.883  -16.001 16.836 1.00 30.71  ? 218  VAL A C     1 
ATOM   1804 O  O     . VAL A 1 218 ? -8.216  -15.604 15.720 1.00 30.30  ? 218  VAL A O     1 
ATOM   1805 C  CB    . VAL A 1 218 ? -9.165  -18.064 17.463 1.00 30.96  ? 218  VAL A CB    1 
ATOM   1806 C  CG1   . VAL A 1 218 ? -9.176  -19.581 17.350 1.00 35.04  ? 218  VAL A CG1   1 
ATOM   1807 C  CG2   . VAL A 1 218 ? -9.634  -17.598 18.852 1.00 30.26  ? 218  VAL A CG2   1 
ATOM   1808 N  N     . GLU A 1 219 ? -7.612  -15.178 17.844 1.00 31.19  ? 219  GLU A N     1 
ATOM   1809 C  CA    . GLU A 1 219 ? -7.754  -13.733 17.688 1.00 35.70  ? 219  GLU A CA    1 
ATOM   1810 C  C     . GLU A 1 219 ? -6.695  -13.156 16.763 1.00 34.71  ? 219  GLU A C     1 
ATOM   1811 O  O     . GLU A 1 219 ? -6.972  -12.221 16.010 1.00 34.17  ? 219  GLU A O     1 
ATOM   1812 C  CB    . GLU A 1 219 ? -7.728  -13.016 19.035 1.00 38.59  ? 219  GLU A CB    1 
ATOM   1813 C  CG    . GLU A 1 219 ? -8.391  -11.641 19.002 1.00 51.19  ? 219  GLU A CG    1 
ATOM   1814 C  CD    . GLU A 1 219 ? -8.039  -10.775 20.211 1.00 59.91  ? 219  GLU A CD    1 
ATOM   1815 O  OE1   . GLU A 1 219 ? -8.975  -10.249 20.858 1.00 61.87  ? 219  GLU A OE1   1 
ATOM   1816 O  OE2   . GLU A 1 219 ? -6.832  -10.621 20.514 1.00 63.96  ? 219  GLU A OE2   1 
ATOM   1817 N  N     . SER A 1 220 ? -5.492  -13.726 16.802 1.00 35.38  ? 220  SER A N     1 
ATOM   1818 C  CA    . SER A 1 220 ? -4.395  -13.212 15.985 1.00 36.96  ? 220  SER A CA    1 
ATOM   1819 C  C     . SER A 1 220 ? -4.140  -13.994 14.682 1.00 35.82  ? 220  SER A C     1 
ATOM   1820 O  O     . SER A 1 220 ? -3.461  -13.489 13.788 1.00 37.04  ? 220  SER A O     1 
ATOM   1821 C  CB    . SER A 1 220 ? -3.113  -13.064 16.815 1.00 37.87  ? 220  SER A CB    1 
ATOM   1822 O  OG    . SER A 1 220 ? -2.465  -14.316 16.995 1.00 43.71  ? 220  SER A OG    1 
ATOM   1823 N  N     . PHE A 1 221 ? -4.685  -15.204 14.559 1.00 33.39  ? 221  PHE A N     1 
ATOM   1824 C  CA    . PHE A 1 221 ? -4.542  -15.941 13.297 1.00 32.97  ? 221  PHE A CA    1 
ATOM   1825 C  C     . PHE A 1 221 ? -5.869  -16.370 12.637 1.00 31.23  ? 221  PHE A C     1 
ATOM   1826 O  O     . PHE A 1 221 ? -6.276  -15.782 11.640 1.00 32.13  ? 221  PHE A O     1 
ATOM   1827 C  CB    . PHE A 1 221 ? -3.556  -17.117 13.412 1.00 33.95  ? 221  PHE A CB    1 
ATOM   1828 C  CG    . PHE A 1 221 ? -3.416  -17.900 12.135 1.00 36.42  ? 221  PHE A CG    1 
ATOM   1829 C  CD1   . PHE A 1 221 ? -4.037  -19.137 11.990 1.00 38.31  ? 221  PHE A CD1   1 
ATOM   1830 C  CD2   . PHE A 1 221 ? -2.695  -17.381 11.064 1.00 35.38  ? 221  PHE A CD2   1 
ATOM   1831 C  CE1   . PHE A 1 221 ? -3.934  -19.854 10.796 1.00 39.73  ? 221  PHE A CE1   1 
ATOM   1832 C  CE2   . PHE A 1 221 ? -2.587  -18.088 9.867  1.00 40.25  ? 221  PHE A CE2   1 
ATOM   1833 C  CZ    . PHE A 1 221 ? -3.211  -19.328 9.732  1.00 38.42  ? 221  PHE A CZ    1 
ATOM   1834 N  N     . ALA A 1 222 ? -6.514  -17.399 13.185 1.00 29.38  ? 222  ALA A N     1 
ATOM   1835 C  CA    . ALA A 1 222 ? -7.728  -17.998 12.609 1.00 29.58  ? 222  ALA A CA    1 
ATOM   1836 C  C     . ALA A 1 222 ? -8.821  -16.998 12.187 1.00 30.42  ? 222  ALA A C     1 
ATOM   1837 O  O     . ALA A 1 222 ? -9.264  -17.008 11.034 1.00 29.53  ? 222  ALA A O     1 
ATOM   1838 C  CB    . ALA A 1 222 ? -8.309  -19.056 13.557 1.00 26.71  ? 222  ALA A CB    1 
ATOM   1839 N  N     . ILE A 1 223 ? -9.256  -16.146 13.113 1.00 29.75  ? 223  ILE A N     1 
ATOM   1840 C  CA    . ILE A 1 223 ? -10.327 -15.186 12.823 1.00 29.40  ? 223  ILE A CA    1 
ATOM   1841 C  C     . ILE A 1 223 ? -9.936  -14.156 11.735 1.00 31.28  ? 223  ILE A C     1 
ATOM   1842 O  O     . ILE A 1 223 ? -10.638 -14.038 10.726 1.00 31.22  ? 223  ILE A O     1 
ATOM   1843 C  CB    . ILE A 1 223 ? -10.845 -14.496 14.104 1.00 28.99  ? 223  ILE A CB    1 
ATOM   1844 C  CG1   . ILE A 1 223 ? -11.487 -15.534 15.029 1.00 31.74  ? 223  ILE A CG1   1 
ATOM   1845 C  CG2   . ILE A 1 223 ? -11.825 -13.396 13.762 1.00 25.23  ? 223  ILE A CG2   1 
ATOM   1846 C  CD1   . ILE A 1 223 ? -11.426 -15.178 16.491 1.00 30.38  ? 223  ILE A CD1   1 
ATOM   1847 N  N     . PRO A 1 224 ? -8.828  -13.408 11.931 1.00 30.75  ? 224  PRO A N     1 
ATOM   1848 C  CA    . PRO A 1 224 ? -8.473  -12.479 10.858 1.00 29.77  ? 224  PRO A CA    1 
ATOM   1849 C  C     . PRO A 1 224 ? -8.148  -13.183 9.527  1.00 28.93  ? 224  PRO A C     1 
ATOM   1850 O  O     . PRO A 1 224 ? -8.425  -12.627 8.466  1.00 30.06  ? 224  PRO A O     1 
ATOM   1851 C  CB    . PRO A 1 224 ? -7.246  -11.733 11.421 1.00 28.45  ? 224  PRO A CB    1 
ATOM   1852 C  CG    . PRO A 1 224 ? -6.706  -12.623 12.500 1.00 28.62  ? 224  PRO A CG    1 
ATOM   1853 C  CD    . PRO A 1 224 ? -7.939  -13.248 13.099 1.00 30.59  ? 224  PRO A CD    1 
ATOM   1854 N  N     . TYR A 1 225 ? -7.600  -14.393 9.564  1.00 27.90  ? 225  TYR A N     1 
ATOM   1855 C  CA    . TYR A 1 225 ? -7.350  -15.093 8.301  1.00 28.22  ? 225  TYR A CA    1 
ATOM   1856 C  C     . TYR A 1 225 ? -8.645  -15.410 7.571  1.00 29.93  ? 225  TYR A C     1 
ATOM   1857 O  O     . TYR A 1 225 ? -8.785  -15.083 6.386  1.00 29.53  ? 225  TYR A O     1 
ATOM   1858 C  CB    . TYR A 1 225 ? -6.490  -16.351 8.445  1.00 28.14  ? 225  TYR A CB    1 
ATOM   1859 C  CG    . TYR A 1 225 ? -5.830  -16.692 7.131  1.00 25.56  ? 225  TYR A CG    1 
ATOM   1860 C  CD1   . TYR A 1 225 ? -4.543  -16.248 6.854  1.00 28.16  ? 225  TYR A CD1   1 
ATOM   1861 C  CD2   . TYR A 1 225 ? -6.519  -17.384 6.130  1.00 27.45  ? 225  TYR A CD2   1 
ATOM   1862 C  CE1   . TYR A 1 225 ? -3.929  -16.506 5.636  1.00 25.66  ? 225  TYR A CE1   1 
ATOM   1863 C  CE2   . TYR A 1 225 ? -5.913  -17.651 4.894  1.00 27.84  ? 225  TYR A CE2   1 
ATOM   1864 C  CZ    . TYR A 1 225 ? -4.609  -17.206 4.668  1.00 27.46  ? 225  TYR A CZ    1 
ATOM   1865 O  OH    . TYR A 1 225 ? -3.969  -17.451 3.479  1.00 29.86  ? 225  TYR A OH    1 
ATOM   1866 N  N     . VAL A 1 226 ? -9.585  -16.035 8.284  1.00 29.20  ? 226  VAL A N     1 
ATOM   1867 C  CA    . VAL A 1 226 ? -10.889 -16.375 7.723  1.00 30.40  ? 226  VAL A CA    1 
ATOM   1868 C  C     . VAL A 1 226 ? -11.608 -15.130 7.189  1.00 30.75  ? 226  VAL A C     1 
ATOM   1869 O  O     . VAL A 1 226 ? -12.157 -15.156 6.089  1.00 32.43  ? 226  VAL A O     1 
ATOM   1870 C  CB    . VAL A 1 226 ? -11.779 -17.130 8.745  1.00 30.01  ? 226  VAL A CB    1 
ATOM   1871 C  CG1   . VAL A 1 226 ? -13.145 -17.404 8.163  1.00 32.18  ? 226  VAL A CG1   1 
ATOM   1872 C  CG2   . VAL A 1 226 ? -11.134 -18.441 9.124  1.00 30.79  ? 226  VAL A CG2   1 
ATOM   1873 N  N     . TYR A 1 227 ? -11.578 -14.040 7.952  1.00 29.06  ? 227  TYR A N     1 
ATOM   1874 C  CA    . TYR A 1 227 ? -12.237 -12.800 7.532  1.00 30.10  ? 227  TYR A CA    1 
ATOM   1875 C  C     . TYR A 1 227 ? -11.632 -12.248 6.239  1.00 29.74  ? 227  TYR A C     1 
ATOM   1876 O  O     . TYR A 1 227 ? -12.346 -11.956 5.280  1.00 29.49  ? 227  TYR A O     1 
ATOM   1877 C  CB    . TYR A 1 227 ? -12.166 -11.753 8.647  1.00 27.82  ? 227  TYR A CB    1 
ATOM   1878 C  CG    . TYR A 1 227 ? -12.930 -10.470 8.376  1.00 29.43  ? 227  TYR A CG    1 
ATOM   1879 C  CD1   . TYR A 1 227 ? -12.256 -9.306  8.009  1.00 31.24  ? 227  TYR A CD1   1 
ATOM   1880 C  CD2   . TYR A 1 227 ? -14.320 -10.414 8.499  1.00 29.42  ? 227  TYR A CD2   1 
ATOM   1881 C  CE1   . TYR A 1 227 ? -12.933 -8.114  7.763  1.00 29.09  ? 227  TYR A CE1   1 
ATOM   1882 C  CE2   . TYR A 1 227 ? -15.012 -9.226  8.252  1.00 32.29  ? 227  TYR A CE2   1 
ATOM   1883 C  CZ    . TYR A 1 227 ? -14.308 -8.075  7.886  1.00 31.72  ? 227  TYR A CZ    1 
ATOM   1884 O  OH    . TYR A 1 227 ? -14.967 -6.877  7.660  1.00 28.54  ? 227  TYR A OH    1 
ATOM   1885 N  N     . ASN A 1 228 ? -10.314 -12.116 6.226  1.00 29.22  ? 228  ASN A N     1 
ATOM   1886 C  CA    . ASN A 1 228 ? -9.612  -11.546 5.095  1.00 29.10  ? 228  ASN A CA    1 
ATOM   1887 C  C     . ASN A 1 228 ? -9.614  -12.436 3.874  1.00 28.62  ? 228  ASN A C     1 
ATOM   1888 O  O     . ASN A 1 228 ? -9.628  -11.934 2.758  1.00 27.44  ? 228  ASN A O     1 
ATOM   1889 C  CB    . ASN A 1 228 ? -8.184  -11.193 5.470  1.00 27.62  ? 228  ASN A CB    1 
ATOM   1890 C  CG    . ASN A 1 228 ? -8.094  -9.875  6.165  1.00 31.36  ? 228  ASN A CG    1 
ATOM   1891 O  OD1   . ASN A 1 228 ? -8.636  -8.882  5.690  1.00 34.40  ? 228  ASN A OD1   1 
ATOM   1892 N  ND2   . ASN A 1 228 ? -7.416  -9.848  7.305  1.00 33.42  ? 228  ASN A ND2   1 
ATOM   1893 N  N     . ARG A 1 229 ? -9.593  -13.749 4.094  1.00 28.95  ? 229  ARG A N     1 
ATOM   1894 C  CA    . ARG A 1 229 ? -9.654  -14.699 2.995  1.00 30.28  ? 229  ARG A CA    1 
ATOM   1895 C  C     . ARG A 1 229 ? -10.995 -14.615 2.276  1.00 32.05  ? 229  ARG A C     1 
ATOM   1896 O  O     . ARG A 1 229 ? -11.045 -14.579 1.042  1.00 30.94  ? 229  ARG A O     1 
ATOM   1897 C  CB    . ARG A 1 229 ? -9.393  -16.130 3.474  1.00 27.22  ? 229  ARG A CB    1 
ATOM   1898 C  CG    . ARG A 1 229 ? -9.214  -17.154 2.342  1.00 31.02  ? 229  ARG A CG    1 
ATOM   1899 C  CD    . ARG A 1 229 ? -8.118  -16.756 1.335  1.00 29.86  ? 229  ARG A CD    1 
ATOM   1900 N  NE    . ARG A 1 229 ? -8.084  -17.654 0.179  1.00 30.62  ? 229  ARG A NE    1 
ATOM   1901 C  CZ    . ARG A 1 229 ? -7.329  -17.474 -0.907 1.00 31.85  ? 229  ARG A CZ    1 
ATOM   1902 N  NH1   . ARG A 1 229 ? -6.527  -16.425 -1.004 1.00 28.53  ? 229  ARG A NH1   1 
ATOM   1903 N  NH2   . ARG A 1 229 ? -7.375  -18.351 -1.905 1.00 31.08  ? 229  ARG A NH2   1 
ATOM   1904 N  N     . ILE A 1 230 ? -12.070 -14.595 3.060  1.00 32.93  ? 230  ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 230 ? -13.424 -14.478 2.528  1.00 34.30  ? 230  ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 230 ? -13.613 -13.125 1.837  1.00 36.07  ? 230  ILE A C     1 
ATOM   1907 O  O     . ILE A 1 230 ? -14.182 -13.057 0.742  1.00 37.49  ? 230  ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 230 ? -14.478 -14.727 3.638  1.00 34.25  ? 230  ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 230 ? -14.516 -16.226 3.976  1.00 33.97  ? 230  ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 230 ? -15.861 -14.215 3.222  1.00 33.53  ? 230  ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 230 ? -15.432 -16.617 5.132  1.00 32.61  ? 230  ILE A CD1   1 
ATOM   1912 N  N     . LYS A 1 231 ? -13.115 -12.064 2.473  1.00 37.33  ? 231  LYS A N     1 
ATOM   1913 C  CA    . LYS A 1 231 ? -13.118 -10.711 1.902  1.00 38.44  ? 231  LYS A CA    1 
ATOM   1914 C  C     . LYS A 1 231 ? -12.425 -10.656 0.541  1.00 38.57  ? 231  LYS A C     1 
ATOM   1915 O  O     . LYS A 1 231 ? -12.902 -9.985  -0.367 1.00 39.03  ? 231  LYS A O     1 
ATOM   1916 C  CB    . LYS A 1 231 ? -12.455 -9.735  2.868  1.00 39.51  ? 231  LYS A CB    1 
ATOM   1917 C  CG    . LYS A 1 231 ? -12.180 -8.335  2.328  1.00 43.44  ? 231  LYS A CG    1 
ATOM   1918 C  CD    . LYS A 1 231 ? -11.872 -7.382  3.485  1.00 48.99  ? 231  LYS A CD    1 
ATOM   1919 C  CE    . LYS A 1 231 ? -11.172 -6.103  3.029  1.00 56.29  ? 231  LYS A CE    1 
ATOM   1920 N  NZ    . LYS A 1 231 ? -9.672  -6.199  3.034  1.00 58.26  ? 231  LYS A NZ    1 
ATOM   1921 N  N     . ASN A 1 232 ? -11.308 -11.367 0.408  1.00 38.47  ? 232  ASN A N     1 
ATOM   1922 C  CA    . ASN A 1 232 ? -10.543 -11.364 -0.831 1.00 41.43  ? 232  ASN A CA    1 
ATOM   1923 C  C     . ASN A 1 232 ? -11.223 -12.127 -1.970 1.00 40.83  ? 232  ASN A C     1 
ATOM   1924 O  O     . ASN A 1 232 ? -11.041 -11.791 -3.135 1.00 43.49  ? 232  ASN A O     1 
ATOM   1925 C  CB    . ASN A 1 232 ? -9.135  -11.916 -0.599 1.00 41.68  ? 232  ASN A CB    1 
ATOM   1926 C  CG    . ASN A 1 232 ? -8.224  -10.927 0.107  1.00 45.08  ? 232  ASN A CG    1 
ATOM   1927 O  OD1   . ASN A 1 232 ? -8.585  -9.765  0.328  1.00 44.86  ? 232  ASN A OD1   1 
ATOM   1928 N  ND2   . ASN A 1 232 ? -7.029  -11.385 0.464  1.00 42.86  ? 232  ASN A ND2   1 
ATOM   1929 N  N     . ILE A 1 233 ? -12.003 -13.148 -1.627 1.00 38.83  ? 233  ILE A N     1 
ATOM   1930 C  CA    . ILE A 1 233 ? -12.640 -13.997 -2.628 1.00 38.63  ? 233  ILE A CA    1 
ATOM   1931 C  C     . ILE A 1 233 ? -14.043 -13.520 -2.977 1.00 38.54  ? 233  ILE A C     1 
ATOM   1932 O  O     . ILE A 1 233 ? -14.446 -13.578 -4.143 1.00 36.47  ? 233  ILE A O     1 
ATOM   1933 C  CB    . ILE A 1 233 ? -12.700 -15.468 -2.167 1.00 39.57  ? 233  ILE A CB    1 
ATOM   1934 C  CG1   . ILE A 1 233 ? -11.300 -16.091 -2.200 1.00 39.75  ? 233  ILE A CG1   1 
ATOM   1935 C  CG2   . ILE A 1 233 ? -13.685 -16.273 -3.027 1.00 40.81  ? 233  ILE A CG2   1 
ATOM   1936 C  CD1   . ILE A 1 233 ? -11.221 -17.441 -1.524 1.00 37.85  ? 233  ILE A CD1   1 
ATOM   1937 N  N     . PHE A 1 234 ? -14.774 -13.045 -1.965 1.00 36.95  ? 234  PHE A N     1 
ATOM   1938 C  CA    . PHE A 1 234 ? -16.207 -12.776 -2.100 1.00 37.22  ? 234  PHE A CA    1 
ATOM   1939 C  C     . PHE A 1 234 ? -16.597 -11.307 -1.939 1.00 35.66  ? 234  PHE A C     1 
ATOM   1940 O  O     . PHE A 1 234 ? -17.692 -10.909 -2.342 1.00 35.86  ? 234  PHE A O     1 
ATOM   1941 C  CB    . PHE A 1 234 ? -16.998 -13.598 -1.077 1.00 37.12  ? 234  PHE A CB    1 
ATOM   1942 C  CG    . PHE A 1 234 ? -16.938 -15.083 -1.295 1.00 39.13  ? 234  PHE A CG    1 
ATOM   1943 C  CD1   . PHE A 1 234 ? -16.245 -15.901 -0.397 1.00 35.60  ? 234  PHE A CD1   1 
ATOM   1944 C  CD2   . PHE A 1 234 ? -17.592 -15.676 -2.380 1.00 37.36  ? 234  PHE A CD2   1 
ATOM   1945 C  CE1   . PHE A 1 234 ? -16.196 -17.286 -0.583 1.00 32.35  ? 234  PHE A CE1   1 
ATOM   1946 C  CE2   . PHE A 1 234 ? -17.543 -17.062 -2.577 1.00 34.43  ? 234  PHE A CE2   1 
ATOM   1947 C  CZ    . PHE A 1 234 ? -16.846 -17.865 -1.680 1.00 33.36  ? 234  PHE A CZ    1 
ATOM   1948 N  N     . GLY A 1 235 ? -15.721 -10.520 -1.325 1.00 36.35  ? 235  GLY A N     1 
ATOM   1949 C  CA    . GLY A 1 235 ? -16.025 -9.129  -0.986 1.00 36.65  ? 235  GLY A CA    1 
ATOM   1950 C  C     . GLY A 1 235 ? -16.227 -8.970  0.508  1.00 35.77  ? 235  GLY A C     1 
ATOM   1951 O  O     . GLY A 1 235 ? -16.565 -9.932  1.189  1.00 34.97  ? 235  GLY A O     1 
ATOM   1952 N  N     . GLU A 1 236 ? -16.047 -7.753  1.019  1.00 38.08  ? 236  GLU A N     1 
ATOM   1953 C  CA    . GLU A 1 236 ? -16.083 -7.540  2.471  1.00 42.66  ? 236  GLU A CA    1 
ATOM   1954 C  C     . GLU A 1 236 ? -17.429 -7.815  3.150  1.00 40.77  ? 236  GLU A C     1 
ATOM   1955 O  O     . GLU A 1 236 ? -17.465 -8.393  4.237  1.00 42.14  ? 236  GLU A O     1 
ATOM   1956 C  CB    . GLU A 1 236 ? -15.556 -6.159  2.884  1.00 43.77  ? 236  GLU A CB    1 
ATOM   1957 C  CG    . GLU A 1 236 ? -15.261 -6.100  4.392  1.00 49.18  ? 236  GLU A CG    1 
ATOM   1958 C  CD    . GLU A 1 236 ? -14.684 -4.776  4.877  1.00 56.03  ? 236  GLU A CD    1 
ATOM   1959 O  OE1   . GLU A 1 236 ? -14.842 -3.741  4.178  1.00 56.48  ? 236  GLU A OE1   1 
ATOM   1960 O  OE2   . GLU A 1 236 ? -14.081 -4.783  5.980  1.00 54.03  ? 236  GLU A OE2   1 
ATOM   1961 N  N     . SER A 1 237 ? -18.527 -7.411  2.528  1.00 38.16  ? 237  SER A N     1 
ATOM   1962 C  CA    . SER A 1 237 ? -19.833 -7.608  3.162  1.00 38.18  ? 237  SER A CA    1 
ATOM   1963 C  C     . SER A 1 237 ? -20.234 -9.091  3.294  1.00 35.97  ? 237  SER A C     1 
ATOM   1964 O  O     . SER A 1 237 ? -21.025 -9.440  4.168  1.00 38.06  ? 237  SER A O     1 
ATOM   1965 C  CB    . SER A 1 237 ? -20.921 -6.766  2.493  1.00 36.58  ? 237  SER A CB    1 
ATOM   1966 O  OG    . SER A 1 237 ? -20.885 -6.905  1.095  1.00 42.14  ? 237  SER A OG    1 
ATOM   1967 N  N     . THR A 1 238 ? -19.661 -9.952  2.452  1.00 32.97  ? 238  THR A N     1 
ATOM   1968 C  CA    . THR A 1 238 ? -19.757 -11.407 2.637  1.00 31.32  ? 238  THR A CA    1 
ATOM   1969 C  C     . THR A 1 238 ? -18.975 -11.842 3.874  1.00 30.91  ? 238  THR A C     1 
ATOM   1970 O  O     . THR A 1 238 ? -19.462 -12.646 4.670  1.00 31.21  ? 238  THR A O     1 
ATOM   1971 C  CB    . THR A 1 238 ? -19.220 -12.173 1.423  1.00 29.92  ? 238  THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 238 ? -19.933 -11.771 0.249  1.00 26.62  ? 238  THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 238 ? -19.370 -13.678 1.612  1.00 28.59  ? 238  THR A CG2   1 
ATOM   1974 N  N     . ALA A 1 239 ? -17.768 -11.297 4.026  1.00 32.33  ? 239  ALA A N     1 
ATOM   1975 C  CA    . ALA A 1 239 ? -16.915 -11.543 5.197  1.00 31.14  ? 239  ALA A CA    1 
ATOM   1976 C  C     . ALA A 1 239 ? -17.575 -11.061 6.472  1.00 32.07  ? 239  ALA A C     1 
ATOM   1977 O  O     . ALA A 1 239 ? -17.286 -11.572 7.560  1.00 34.34  ? 239  ALA A O     1 
ATOM   1978 C  CB    . ALA A 1 239 ? -15.575 -10.856 5.020  1.00 30.62  ? 239  ALA A CB    1 
ATOM   1979 N  N     . LYS A 1 240 ? -18.460 -10.074 6.327  1.00 30.91  ? 240  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 240 ? -19.196 -9.499  7.449  1.00 32.22  ? 240  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 240 ? -20.337 -10.403 7.921  1.00 31.80  ? 240  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 240 ? -20.910 -10.177 8.985  1.00 33.03  ? 240  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 240 ? -19.706 -8.088  7.101  1.00 33.38  ? 240  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 240 ? -18.616 -7.017  7.171  1.00 37.31  ? 240  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 240 ? -19.143 -5.621  6.892  1.00 32.71  ? 240  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 240 ? -18.000 -4.609  6.894  1.00 38.54  ? 240  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 240 ? -18.482 -3.190  6.807  1.00 42.19  ? 240  LYS A NZ    1 
ATOM   1988 N  N     . ARG A 1 241 ? -20.652 -11.432 7.136  1.00 31.65  ? 241  ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 241 ? -21.605 -12.463 7.559  1.00 31.74  ? 241  ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 241 ? -21.082 -13.293 8.751  1.00 30.62  ? 241  ARG A C     1 
ATOM   1991 O  O     . ARG A 1 241 ? -21.833 -14.084 9.335  1.00 30.39  ? 241  ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 241 ? -22.000 -13.375 6.387  1.00 29.36  ? 241  ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 241 ? -23.063 -12.791 5.439  1.00 35.45  ? 241  ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 241 ? -23.363 -13.739 4.260  1.00 35.38  ? 241  ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 241 ? -23.835 -15.046 4.728  1.00 41.20  ? 241  ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 241 ? -23.789 -16.178 4.029  1.00 39.77  ? 241  ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 241 ? -23.280 -16.204 2.800  1.00 41.77  ? 241  ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 241 ? -24.245 -17.299 4.571  1.00 33.55  ? 241  ARG A NH2   1 
ATOM   1999 N  N     . LEU A 1 242 ? -19.807 -13.117 9.108  1.00 29.48  ? 242  LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 242 ? -19.264 -13.712 10.343 1.00 28.27  ? 242  LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 242 ? -19.747 -12.970 11.588 1.00 26.32  ? 242  LEU A C     1 
ATOM   2002 O  O     . LEU A 1 242 ? -19.655 -13.502 12.687 1.00 25.61  ? 242  LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 242 ? -17.731 -13.765 10.341 1.00 28.48  ? 242  LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 242 ? -17.006 -14.647 9.330  1.00 29.12  ? 242  LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 242 ? -15.548 -14.224 9.247  1.00 27.91  ? 242  LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 242 ? -17.128 -16.137 9.675  1.00 27.87  ? 242  LEU A CD2   1 
ATOM   2007 N  N     . SER A 1 243 ? -20.234 -11.739 11.409 1.00 26.61  ? 243  SER A N     1 
ATOM   2008 C  CA    . SER A 1 243 ? -20.956 -11.029 12.452 1.00 26.39  ? 243  SER A CA    1 
ATOM   2009 C  C     . SER A 1 243 ? -22.454 -11.215 12.257 1.00 28.86  ? 243  SER A C     1 
ATOM   2010 O  O     . SER A 1 243 ? -22.975 -10.956 11.164 1.00 30.03  ? 243  SER A O     1 
ATOM   2011 C  CB    . SER A 1 243 ? -20.629 -9.545  12.423 1.00 30.18  ? 243  SER A CB    1 
ATOM   2012 O  OG    . SER A 1 243 ? -21.565 -8.805  13.197 1.00 29.14  ? 243  SER A OG    1 
ATOM   2013 N  N     . PRO A 1 244 ? -23.162 -11.652 13.317 1.00 30.30  ? 244  PRO A N     1 
ATOM   2014 C  CA    . PRO A 1 244 ? -24.615 -11.822 13.220 1.00 30.12  ? 244  PRO A CA    1 
ATOM   2015 C  C     . PRO A 1 244 ? -25.349 -10.490 13.045 1.00 31.42  ? 244  PRO A C     1 
ATOM   2016 O  O     . PRO A 1 244 ? -26.494 -10.460 12.584 1.00 32.60  ? 244  PRO A O     1 
ATOM   2017 C  CB    . PRO A 1 244 ? -24.982 -12.494 14.548 1.00 30.21  ? 244  PRO A CB    1 
ATOM   2018 C  CG    . PRO A 1 244 ? -23.863 -12.141 15.485 1.00 29.22  ? 244  PRO A CG    1 
ATOM   2019 C  CD    . PRO A 1 244 ? -22.639 -12.075 14.632 1.00 29.50  ? 244  PRO A CD    1 
ATOM   2020 N  N     . HIS A 1 245 ? -24.695 -9.392  13.396 1.00 31.09  ? 245  HIS A N     1 
ATOM   2021 C  CA    . HIS A 1 245 ? -25.274 -8.080  13.138 1.00 30.77  ? 245  HIS A CA    1 
ATOM   2022 C  C     . HIS A 1 245 ? -24.662 -7.433  11.889 1.00 31.90  ? 245  HIS A C     1 
ATOM   2023 O  O     . HIS A 1 245 ? -24.935 -6.271  11.576 1.00 32.23  ? 245  HIS A O     1 
ATOM   2024 C  CB    . HIS A 1 245 ? -25.161 -7.194  14.380 1.00 29.82  ? 245  HIS A CB    1 
ATOM   2025 C  CG    . HIS A 1 245 ? -25.583 -7.880  15.645 1.00 28.21  ? 245  HIS A CG    1 
ATOM   2026 N  ND1   . HIS A 1 245 ? -26.775 -8.566  15.760 1.00 27.29  ? 245  HIS A ND1   1 
ATOM   2027 C  CD2   . HIS A 1 245 ? -24.967 -7.994  16.847 1.00 27.22  ? 245  HIS A CD2   1 
ATOM   2028 C  CE1   . HIS A 1 245 ? -26.874 -9.078  16.974 1.00 25.10  ? 245  HIS A CE1   1 
ATOM   2029 N  NE2   . HIS A 1 245 ? -25.791 -8.741  17.656 1.00 30.53  ? 245  HIS A NE2   1 
ATOM   2030 N  N     . ARG A 1 246 ? -23.856 -8.217  11.170 1.00 33.08  ? 246  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 246 ? -23.173 -7.793  9.932  1.00 35.30  ? 246  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 246 ? -22.304 -6.560  10.143 1.00 34.59  ? 246  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 246 ? -22.190 -5.709  9.271  1.00 36.07  ? 246  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 246 ? -24.168 -7.583  8.766  1.00 35.34  ? 246  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 246 ? -25.178 -8.714  8.563  1.00 37.63  ? 246  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 246 ? -24.522 -9.957  7.993  1.00 38.32  ? 246  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 246 ? -25.474 -11.049 7.758  1.00 38.87  ? 246  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 246 ? -25.622 -12.118 8.541  1.00 38.07  ? 246  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 246 ? -24.892 -12.265 9.643  1.00 32.80  ? 246  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 246 ? -26.506 -13.054 8.220  1.00 35.91  ? 246  ARG A NH2   1 
ATOM   2041 N  N     . LYS A 1 247 ? -21.665 -6.484  11.303 1.00 35.20  ? 247  LYS A N     1 
ATOM   2042 C  CA    . LYS A 1 247 ? -20.891 -5.316  11.652 1.00 36.11  ? 247  LYS A CA    1 
ATOM   2043 C  C     . LYS A 1 247 ? -19.547 -5.738  12.233 1.00 36.38  ? 247  LYS A C     1 
ATOM   2044 O  O     . LYS A 1 247 ? -19.482 -6.562  13.145 1.00 39.89  ? 247  LYS A O     1 
ATOM   2045 C  CB    . LYS A 1 247 ? -21.710 -4.441  12.618 1.00 38.93  ? 247  LYS A CB    1 
ATOM   2046 C  CG    . LYS A 1 247 ? -20.948 -3.382  13.393 1.00 43.75  ? 247  LYS A CG    1 
ATOM   2047 C  CD    . LYS A 1 247 ? -20.744 -2.099  12.617 1.00 51.08  ? 247  LYS A CD    1 
ATOM   2048 C  CE    . LYS A 1 247 ? -20.325 -0.969  13.556 1.00 52.17  ? 247  LYS A CE    1 
ATOM   2049 N  NZ    . LYS A 1 247 ? -19.962 0.255   12.794 1.00 55.14  ? 247  LYS A NZ    1 
ATOM   2050 N  N     . THR A 1 248 ? -18.472 -5.192  11.677 1.00 35.45  ? 248  THR A N     1 
ATOM   2051 C  CA    . THR A 1 248 ? -17.124 -5.530  12.122 1.00 34.86  ? 248  THR A CA    1 
ATOM   2052 C  C     . THR A 1 248 ? -16.258 -4.280  12.284 1.00 38.28  ? 248  THR A C     1 
ATOM   2053 O  O     . THR A 1 248 ? -16.566 -3.210  11.732 1.00 37.57  ? 248  THR A O     1 
ATOM   2054 C  CB    . THR A 1 248 ? -16.412 -6.514  11.161 1.00 33.16  ? 248  THR A CB    1 
ATOM   2055 O  OG1   . THR A 1 248 ? -16.184 -5.883  9.896  1.00 34.56  ? 248  THR A OG1   1 
ATOM   2056 C  CG2   . THR A 1 248 ? -17.230 -7.783  10.959 1.00 28.11  ? 248  THR A CG2   1 
ATOM   2057 N  N     . ARG A 1 249 ? -15.188 -4.411  13.061 1.00 37.86  ? 249  ARG A N     1 
ATOM   2058 C  CA    . ARG A 1 249 ? -14.186 -3.358  13.143 1.00 40.11  ? 249  ARG A CA    1 
ATOM   2059 C  C     . ARG A 1 249 ? -12.827 -3.961  12.860 1.00 40.31  ? 249  ARG A C     1 
ATOM   2060 O  O     . ARG A 1 249 ? -12.476 -5.008  13.400 1.00 39.87  ? 249  ARG A O     1 
ATOM   2061 C  CB    . ARG A 1 249 ? -14.187 -2.690  14.516 1.00 42.06  ? 249  ARG A CB    1 
ATOM   2062 C  CG    . ARG A 1 249 ? -13.813 -1.210  14.479 1.00 49.53  ? 249  ARG A CG    1 
ATOM   2063 C  CD    . ARG A 1 249 ? -13.146 -0.729  15.771 1.00 57.22  ? 249  ARG A CD    1 
ATOM   2064 N  NE    . ARG A 1 249 ? -13.698 -1.349  16.978 1.00 63.25  ? 249  ARG A NE    1 
ATOM   2065 C  CZ    . ARG A 1 249 ? -13.023 -2.176  17.778 1.00 68.49  ? 249  ARG A CZ    1 
ATOM   2066 N  NH1   . ARG A 1 249 ? -11.755 -2.484  17.513 1.00 71.61  ? 249  ARG A NH1   1 
ATOM   2067 N  NH2   . ARG A 1 249 ? -13.614 -2.695  18.852 1.00 69.09  ? 249  ARG A NH2   1 
ATOM   2068 N  N     . VAL A 1 250 ? -12.071 -3.290  12.006 1.00 43.45  ? 250  VAL A N     1 
ATOM   2069 C  CA    . VAL A 1 250 ? -10.745 -3.729  11.634 1.00 47.07  ? 250  VAL A CA    1 
ATOM   2070 C  C     . VAL A 1 250 ? -9.735  -2.695  12.140 1.00 50.90  ? 250  VAL A C     1 
ATOM   2071 O  O     . VAL A 1 250 ? -9.672  -1.575  11.632 1.00 50.62  ? 250  VAL A O     1 
ATOM   2072 C  CB    . VAL A 1 250 ? -10.632 -3.928  10.092 1.00 46.29  ? 250  VAL A CB    1 
ATOM   2073 C  CG1   . VAL A 1 250 ? -9.221  -4.328  9.700  1.00 49.74  ? 250  VAL A CG1   1 
ATOM   2074 C  CG2   . VAL A 1 250 ? -11.622 -4.977  9.606  1.00 44.44  ? 250  VAL A CG2   1 
ATOM   2075 N  N     . LYS A 1 251 ? -8.975  -3.077  13.164 1.00 55.49  ? 251  LYS A N     1 
ATOM   2076 C  CA    . LYS A 1 251 ? -7.872  -2.263  13.675 1.00 60.68  ? 251  LYS A CA    1 
ATOM   2077 C  C     . LYS A 1 251 ? -6.545  -2.793  13.126 1.00 62.65  ? 251  LYS A C     1 
ATOM   2078 O  O     . LYS A 1 251 ? -6.273  -4.001  13.192 1.00 62.42  ? 251  LYS A O     1 
ATOM   2079 C  CB    . LYS A 1 251 ? -7.859  -2.265  15.205 1.00 62.40  ? 251  LYS A CB    1 
ATOM   2080 C  CG    . LYS A 1 251 ? -6.898  -1.250  15.824 1.00 66.10  ? 251  LYS A CG    1 
ATOM   2081 C  CD    . LYS A 1 251 ? -7.015  -1.190  17.344 1.00 69.81  ? 251  LYS A CD    1 
ATOM   2082 C  CE    . LYS A 1 251 ? -6.345  -2.377  18.034 1.00 72.34  ? 251  LYS A CE    1 
ATOM   2083 N  NZ    . LYS A 1 251 ? -6.403  -2.256  19.524 1.00 72.14  ? 251  LYS A NZ    1 
ATOM   2084 N  N     . VAL A 1 252 ? -5.720  -1.882  12.610 1.00 65.87  ? 252  VAL A N     1 
ATOM   2085 C  CA    . VAL A 1 252 ? -4.526  -2.257  11.839 1.00 68.88  ? 252  VAL A CA    1 
ATOM   2086 C  C     . VAL A 1 252 ? -3.195  -2.340  12.622 1.00 70.33  ? 252  VAL A C     1 
ATOM   2087 O  O     . VAL A 1 252 ? -2.696  -3.438  12.850 1.00 70.09  ? 252  VAL A O     1 
ATOM   2088 C  CB    . VAL A 1 252 ? -4.383  -1.403  10.545 1.00 68.32  ? 252  VAL A CB    1 
ATOM   2089 C  CG1   . VAL A 1 252 ? -3.253  -1.930  9.683  1.00 68.70  ? 252  VAL A CG1   1 
ATOM   2090 C  CG2   . VAL A 1 252 ? -5.675  -1.439  9.748  1.00 69.17  ? 252  VAL A CG2   1 
ATOM   2091 N  N     . ILE A 1 253 ? -2.647  -1.196  13.038 1.00 73.68  ? 253  ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 253 ? -1.242  -1.079  13.535 1.00 76.68  ? 253  ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 253 ? -0.155  -1.648  12.583 1.00 77.42  ? 253  ILE A C     1 
ATOM   2094 O  O     . ILE A 1 253 ? 0.054   -2.863  12.480 1.00 75.67  ? 253  ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 253 ? -1.029  -1.517  15.041 1.00 77.08  ? 253  ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 253 ? -1.457  -2.974  15.300 1.00 77.61  ? 253  ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 253 ? -1.725  -0.524  15.989 1.00 78.30  ? 253  ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 253 ? -0.839  -3.618  16.541 1.00 77.55  ? 253  ILE A CD1   1 
ATOM   2099 N  N     . GLU A 1 254 ? 0.536   -0.730  11.908 1.00 78.74  ? 254  GLU A N     1 
ATOM   2100 C  CA    . GLU A 1 254 ? 1.416   -1.054  10.787 1.00 79.91  ? 254  GLU A CA    1 
ATOM   2101 C  C     . GLU A 1 254 ? 2.903   -0.901  11.092 1.00 79.60  ? 254  GLU A C     1 
ATOM   2102 O  O     . GLU A 1 254 ? 3.291   -0.131  11.970 1.00 78.12  ? 254  GLU A O     1 
ATOM   2103 C  CB    . GLU A 1 254 ? 1.071   -0.167  9.581  1.00 81.18  ? 254  GLU A CB    1 
ATOM   2104 C  CG    . GLU A 1 254 ? -0.233  -0.520  8.873  1.00 84.00  ? 254  GLU A CG    1 
ATOM   2105 C  CD    . GLU A 1 254 ? -0.766  0.610   7.998  1.00 86.37  ? 254  GLU A CD    1 
ATOM   2106 O  OE1   . GLU A 1 254 ? -0.092  0.976   7.008  1.00 86.62  ? 254  GLU A OE1   1 
ATOM   2107 O  OE2   . GLU A 1 254 ? -1.870  1.123   8.297  1.00 85.21  ? 254  GLU A OE2   1 
ATOM   2108 N  N     . ASN A 1 255 ? 3.710   -1.664  10.350 1.00 80.39  ? 255  ASN A N     1 
ATOM   2109 C  CA    . ASN A 1 255 ? 5.165   -1.476  10.201 1.00 80.24  ? 255  ASN A CA    1 
ATOM   2110 C  C     . ASN A 1 255 ? 6.025   -1.482  11.480 1.00 79.39  ? 255  ASN A C     1 
ATOM   2111 O  O     . ASN A 1 255 ? 5.489   -1.424  12.584 1.00 78.77  ? 255  ASN A O     1 
ATOM   2112 C  CB    . ASN A 1 255 ? 5.455   -0.255  9.306  1.00 82.00  ? 255  ASN A CB    1 
ATOM   2113 C  CG    . ASN A 1 255 ? 5.299   -0.565  7.808  1.00 83.77  ? 255  ASN A CG    1 
ATOM   2114 O  OD1   . ASN A 1 255 ? 5.138   0.347   6.991  1.00 84.03  ? 255  ASN A OD1   1 
ATOM   2115 N  ND2   . ASN A 1 255 ? 5.352   -1.849  7.448  1.00 82.43  ? 255  ASN A ND2   1 
ATOM   2116 N  N     . MET A 1 256 ? 7.353   -1.576  11.349 1.00 78.81  ? 256  MET A N     1 
ATOM   2117 C  CA    . MET A 1 256 ? 8.072   -1.611  10.063 1.00 77.73  ? 256  MET A CA    1 
ATOM   2118 C  C     . MET A 1 256 ? 8.248   -3.011  9.456  1.00 77.65  ? 256  MET A C     1 
ATOM   2119 O  O     . MET A 1 256 ? 8.740   -3.149  8.332  1.00 76.64  ? 256  MET A O     1 
ATOM   2120 C  CB    . MET A 1 256 ? 9.444   -0.933  10.201 1.00 77.08  ? 256  MET A CB    1 
ATOM   2121 C  CG    . MET A 1 256 ? 10.397  -1.605  11.194 1.00 76.20  ? 256  MET A CG    1 
ATOM   2122 S  SD    . MET A 1 256 ? 12.093  -1.023  11.005 1.00 78.14  ? 256  MET A SD    1 
ATOM   2123 C  CE    . MET A 1 256 ? 12.894  -1.749  12.421 1.00 73.36  ? 256  MET A CE    1 
ATOM   2124 N  N     . TYR A 1 257 ? 7.836   -4.039  10.193 1.00 76.93  ? 257  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 257 ? 8.143   -5.419  9.811  1.00 76.15  ? 257  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 257 ? 7.239   -6.107  8.757  1.00 76.47  ? 257  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 257 ? 7.770   -6.791  7.880  1.00 76.56  ? 257  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 257 ? 8.374   -6.292  11.056 1.00 75.14  ? 257  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 257 ? 9.629   -5.909  11.824 1.00 73.60  ? 257  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 257 ? 9.551   -5.380  13.115 1.00 70.70  ? 257  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 257 ? 10.899  -6.056  11.248 1.00 71.94  ? 257  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 257 ? 10.705  -5.020  13.820 1.00 67.35  ? 257  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 257 ? 12.057  -5.697  11.945 1.00 68.88  ? 257  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 257 ? 11.952  -5.181  13.229 1.00 66.85  ? 257  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 257 ? 13.094  -4.824  13.916 1.00 63.56  ? 257  TYR A OH    1 
ATOM   2136 N  N     . GLY A 1 258 ? 5.911   -5.957  8.804  1.00 76.09  ? 258  GLY A N     1 
ATOM   2137 C  CA    . GLY A 1 258 ? 5.171   -5.186  9.799  1.00 75.70  ? 258  GLY A CA    1 
ATOM   2138 C  C     . GLY A 1 258 ? 3.791   -4.789  9.299  1.00 74.61  ? 258  GLY A C     1 
ATOM   2139 O  O     . GLY A 1 258 ? 3.669   -3.919  8.433  1.00 75.16  ? 258  GLY A O     1 
ATOM   2140 N  N     . SER A 1 259 ? 2.763   -5.455  9.836  1.00 72.75  ? 259  SER A N     1 
ATOM   2141 C  CA    . SER A 1 259 ? 1.342   -5.138  9.610  1.00 69.86  ? 259  SER A CA    1 
ATOM   2142 C  C     . SER A 1 259 ? 0.449   -6.319  9.982  1.00 68.11  ? 259  SER A C     1 
ATOM   2143 O  O     . SER A 1 259 ? 0.422   -7.331  9.278  1.00 68.32  ? 259  SER A O     1 
ATOM   2144 C  CB    . SER A 1 259 ? 1.059   -4.721  8.164  1.00 69.77  ? 259  SER A CB    1 
ATOM   2145 O  OG    . SER A 1 259 ? -0.269  -4.239  8.033  1.00 70.59  ? 259  SER A OG    1 
ATOM   2146 N  N     . ARG A 1 260 ? -0.276  -6.183  11.089 1.00 65.74  ? 260  ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 260 ? -1.253  -7.192  11.518 1.00 64.73  ? 260  ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 260 ? -2.649  -6.580  11.628 1.00 61.35  ? 260  ARG A C     1 
ATOM   2149 O  O     . ARG A 1 260 ? -2.829  -5.393  11.371 1.00 60.85  ? 260  ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 260 ? -0.847  -7.826  12.853 1.00 66.14  ? 260  ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 260 ? 0.356   -8.774  12.797 1.00 70.45  ? 260  ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 260 ? 0.443   -9.677  14.044 1.00 76.14  ? 260  ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 260 ? 0.347   -8.932  15.307 1.00 80.54  ? 260  ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 260 ? -0.749  -8.842  16.066 1.00 82.14  ? 260  ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 260 ? -1.877  -9.453  15.715 1.00 82.26  ? 260  ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 260 ? -0.719  -8.132  17.187 1.00 82.90  ? 260  ARG A NH2   1 
ATOM   2157 N  N     . GLU A 1 261 ? -3.637  -7.395  11.996 1.00 58.21  ? 261  GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 261 ? -5.023  -6.937  12.120 1.00 54.00  ? 261  GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 261 ? -5.761  -7.672  13.220 1.00 53.36  ? 261  GLU A C     1 
ATOM   2160 O  O     . GLU A 1 261 ? -5.657  -8.896  13.341 1.00 52.69  ? 261  GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 261 ? -5.780  -7.141  10.807 1.00 52.38  ? 261  GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 261 ? -5.579  -6.040  9.774  1.00 51.93  ? 261  GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 261 ? -6.307  -6.312  8.472  1.00 51.52  ? 261  GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 261 ? -7.057  -7.309  8.409  1.00 53.78  ? 261  GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 261 ? -6.136  -5.526  7.512  1.00 50.08  ? 261  GLU A OE2   1 
ATOM   2166 N  N     . ILE A 1 262 ? -6.505  -6.929  14.031 1.00 52.80  ? 262  ILE A N     1 
ATOM   2167 C  CA    . ILE A 1 262 ? -7.515  -7.566  14.875 1.00 51.53  ? 262  ILE A CA    1 
ATOM   2168 C  C     . ILE A 1 262 ? -8.912  -7.177  14.388 1.00 46.68  ? 262  ILE A C     1 
ATOM   2169 O  O     . ILE A 1 262 ? -9.220  -6.007  14.195 1.00 45.25  ? 262  ILE A O     1 
ATOM   2170 C  CB    . ILE A 1 262 ? -7.299  -7.364  16.413 1.00 52.97  ? 262  ILE A CB    1 
ATOM   2171 C  CG1   . ILE A 1 262 ? -7.520  -5.914  16.843 1.00 57.80  ? 262  ILE A CG1   1 
ATOM   2172 C  CG2   . ILE A 1 262 ? -5.900  -7.861  16.840 1.00 57.91  ? 262  ILE A CG2   1 
ATOM   2173 C  CD1   . ILE A 1 262 ? -8.058  -5.785  18.274 1.00 62.74  ? 262  ILE A CD1   1 
ATOM   2174 N  N     . ILE A 1 263 ? -9.723  -8.190  14.131 1.00 43.10  ? 263  ILE A N     1 
ATOM   2175 C  CA    . ILE A 1 263 ? -11.064 -7.997  13.629 1.00 41.21  ? 263  ILE A CA    1 
ATOM   2176 C  C     . ILE A 1 263 ? -11.985 -8.103  14.819 1.00 39.95  ? 263  ILE A C     1 
ATOM   2177 O  O     . ILE A 1 263 ? -11.875 -9.049  15.593 1.00 42.76  ? 263  ILE A O     1 
ATOM   2178 C  CB    . ILE A 1 263 ? -11.458 -9.094  12.606 1.00 39.01  ? 263  ILE A CB    1 
ATOM   2179 C  CG1   . ILE A 1 263 ? -10.346 -9.329  11.562 1.00 38.08  ? 263  ILE A CG1   1 
ATOM   2180 C  CG2   . ILE A 1 263 ? -12.825 -8.799  11.987 1.00 38.95  ? 263  ILE A CG2   1 
ATOM   2181 C  CD1   . ILE A 1 263 ? -10.020 -8.167  10.644 1.00 37.13  ? 263  ILE A CD1   1 
ATOM   2182 N  N     . THR A 1 264 ? -12.873 -7.130  14.985 1.00 38.07  ? 264  THR A N     1 
ATOM   2183 C  CA    . THR A 1 264 ? -13.900 -7.244  16.006 1.00 38.45  ? 264  THR A CA    1 
ATOM   2184 C  C     . THR A 1 264 ? -15.175 -7.679  15.323 1.00 37.70  ? 264  THR A C     1 
ATOM   2185 O  O     . THR A 1 264 ? -15.629 -7.027  14.389 1.00 38.30  ? 264  THR A O     1 
ATOM   2186 C  CB    . THR A 1 264 ? -14.101 -5.934  16.801 1.00 39.51  ? 264  THR A CB    1 
ATOM   2187 O  OG1   . THR A 1 264 ? -12.895 -5.622  17.506 1.00 36.88  ? 264  THR A OG1   1 
ATOM   2188 C  CG2   . THR A 1 264 ? -15.224 -6.085  17.816 1.00 41.02  ? 264  THR A CG2   1 
ATOM   2189 N  N     . LEU A 1 265 ? -15.723 -8.806  15.774 1.00 36.11  ? 265  LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 265 ? -16.973 -9.334  15.245 1.00 32.41  ? 265  LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 265 ? -18.075 -8.962  16.208 1.00 32.82  ? 265  LEU A C     1 
ATOM   2192 O  O     . LEU A 1 265 ? -18.206 -9.564  17.279 1.00 34.33  ? 265  LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 265 ? -16.912 -10.857 15.079 1.00 29.78  ? 265  LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 265 ? -15.861 -11.478 14.150 1.00 32.08  ? 265  LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 265 ? -15.969 -12.997 14.178 1.00 32.45  ? 265  LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 265 ? -15.992 -10.970 12.715 1.00 31.15  ? 265  LEU A CD2   1 
ATOM   2197 N  N     . PHE A 1 266 ? -18.850 -7.950  15.831 1.00 31.79  ? 266  PHE A N     1 
ATOM   2198 C  CA    . PHE A 1 266 ? -19.963 -7.490  16.635 1.00 31.45  ? 266  PHE A CA    1 
ATOM   2199 C  C     . PHE A 1 266 ? -20.987 -8.602  16.757 1.00 30.56  ? 266  PHE A C     1 
ATOM   2200 O  O     . PHE A 1 266 ? -21.383 -9.214  15.757 1.00 29.75  ? 266  PHE A O     1 
ATOM   2201 C  CB    . PHE A 1 266 ? -20.595 -6.238  16.011 1.00 35.12  ? 266  PHE A CB    1 
ATOM   2202 C  CG    . PHE A 1 266 ? -19.795 -4.982  16.228 1.00 38.20  ? 266  PHE A CG    1 
ATOM   2203 C  CD1   . PHE A 1 266 ? -18.596 -4.771  15.548 1.00 40.34  ? 266  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE A 1 266 ? -20.239 -4.010  17.109 1.00 40.73  ? 266  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE A 1 266 ? -17.850 -3.612  15.753 1.00 42.92  ? 266  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE A 1 266 ? -19.500 -2.843  17.321 1.00 45.06  ? 266  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE A 1 266 ? -18.301 -2.648  16.645 1.00 44.38  ? 266  PHE A CZ    1 
ATOM   2208 N  N     . GLY A 1 267 ? -21.394 -8.874  17.992 1.00 29.73  ? 267  GLY A N     1 
ATOM   2209 C  CA    . GLY A 1 267 ? -22.422 -9.868  18.262 1.00 30.11  ? 267  GLY A CA    1 
ATOM   2210 C  C     . GLY A 1 267 ? -21.808 -11.193 18.639 1.00 32.63  ? 267  GLY A C     1 
ATOM   2211 O  O     . GLY A 1 267 ? -22.519 -12.194 18.824 1.00 32.45  ? 267  GLY A O     1 
ATOM   2212 N  N     . ILE A 1 268 ? -20.480 -11.196 18.758 1.00 30.91  ? 268  ILE A N     1 
ATOM   2213 C  CA    . ILE A 1 268 ? -19.752 -12.377 19.198 1.00 28.72  ? 268  ILE A CA    1 
ATOM   2214 C  C     . ILE A 1 268 ? -18.789 -12.018 20.314 1.00 29.25  ? 268  ILE A C     1 
ATOM   2215 O  O     . ILE A 1 268 ? -18.351 -10.875 20.429 1.00 32.18  ? 268  ILE A O     1 
ATOM   2216 C  CB    . ILE A 1 268 ? -19.050 -13.079 18.015 1.00 28.97  ? 268  ILE A CB    1 
ATOM   2217 C  CG1   . ILE A 1 268 ? -20.110 -13.665 17.067 1.00 28.34  ? 268  ILE A CG1   1 
ATOM   2218 C  CG2   . ILE A 1 268 ? -18.129 -14.201 18.500 1.00 24.73  ? 268  ILE A CG2   1 
ATOM   2219 C  CD1   . ILE A 1 268 ? -19.569 -14.081 15.765 1.00 28.02  ? 268  ILE A CD1   1 
ATOM   2220 N  N     . SER A 1 269 ? -18.497 -12.992 21.164 1.00 29.71  ? 269  SER A N     1 
ATOM   2221 C  CA    . SER A 1 269 ? -17.601 -12.785 22.280 1.00 28.07  ? 269  SER A CA    1 
ATOM   2222 C  C     . SER A 1 269 ? -16.407 -13.700 22.099 1.00 30.26  ? 269  SER A C     1 
ATOM   2223 O  O     . SER A 1 269 ? -16.482 -14.910 22.357 1.00 29.42  ? 269  SER A O     1 
ATOM   2224 C  CB    . SER A 1 269 ? -18.316 -13.040 23.604 1.00 27.55  ? 269  SER A CB    1 
ATOM   2225 O  OG    . SER A 1 269 ? -19.281 -12.022 23.860 1.00 25.42  ? 269  SER A OG    1 
ATOM   2226 N  N     . VAL A 1 270 ? -15.318 -13.114 21.605 1.00 29.49  ? 270  VAL A N     1 
ATOM   2227 C  CA    . VAL A 1 270 ? -14.080 -13.832 21.396 1.00 30.01  ? 270  VAL A CA    1 
ATOM   2228 C  C     . VAL A 1 270 ? -13.285 -13.938 22.707 1.00 31.26  ? 270  VAL A C     1 
ATOM   2229 O  O     . VAL A 1 270 ? -12.967 -12.934 23.335 1.00 31.81  ? 270  VAL A O     1 
ATOM   2230 C  CB    . VAL A 1 270 ? -13.232 -13.174 20.280 1.00 31.28  ? 270  VAL A CB    1 
ATOM   2231 C  CG1   . VAL A 1 270 ? -11.903 -13.914 20.110 1.00 30.86  ? 270  VAL A CG1   1 
ATOM   2232 C  CG2   . VAL A 1 270 ? -14.011 -13.175 18.951 1.00 31.40  ? 270  VAL A CG2   1 
ATOM   2233 N  N     . LEU A 1 271 ? -12.974 -15.167 23.110 1.00 31.93  ? 271  LEU A N     1 
ATOM   2234 C  CA    . LEU A 1 271 ? -12.156 -15.413 24.287 1.00 30.50  ? 271  LEU A CA    1 
ATOM   2235 C  C     . LEU A 1 271 ? -11.048 -16.358 23.877 1.00 30.75  ? 271  LEU A C     1 
ATOM   2236 O  O     . LEU A 1 271 ? -11.141 -17.571 24.090 1.00 30.48  ? 271  LEU A O     1 
ATOM   2237 C  CB    . LEU A 1 271 ? -12.978 -16.031 25.417 1.00 30.57  ? 271  LEU A CB    1 
ATOM   2238 C  CG    . LEU A 1 271 ? -14.163 -15.252 25.980 1.00 35.57  ? 271  LEU A CG    1 
ATOM   2239 C  CD1   . LEU A 1 271 ? -15.042 -16.190 26.776 1.00 39.29  ? 271  LEU A CD1   1 
ATOM   2240 C  CD2   . LEU A 1 271 ? -13.679 -14.112 26.849 1.00 34.76  ? 271  LEU A CD2   1 
ATOM   2241 N  N     . ASP A 1 272 ? -10.007 -15.793 23.269 1.00 28.13  ? 272  ASP A N     1 
ATOM   2242 C  CA    . ASP A 1 272 ? -8.873  -16.566 22.819 1.00 26.98  ? 272  ASP A CA    1 
ATOM   2243 C  C     . ASP A 1 272 ? -8.305  -17.368 23.990 1.00 26.02  ? 272  ASP A C     1 
ATOM   2244 O  O     . ASP A 1 272 ? -8.028  -16.807 25.044 1.00 28.04  ? 272  ASP A O     1 
ATOM   2245 C  CB    . ASP A 1 272 ? -7.814  -15.637 22.229 1.00 26.85  ? 272  ASP A CB    1 
ATOM   2246 C  CG    . ASP A 1 272 ? -6.815  -16.379 21.367 1.00 30.13  ? 272  ASP A CG    1 
ATOM   2247 O  OD1   . ASP A 1 272 ? -6.424  -17.518 21.727 1.00 30.10  ? 272  ASP A OD1   1 
ATOM   2248 O  OD2   . ASP A 1 272 ? -6.432  -15.827 20.316 1.00 32.65  ? 272  ASP A OD2   1 
ATOM   2249 N  N     . TYR A 1 273 ? -8.128  -18.677 23.808 1.00 25.37  ? 273  TYR A N     1 
ATOM   2250 C  CA    . TYR A 1 273 ? -7.698  -19.512 24.927 1.00 22.91  ? 273  TYR A CA    1 
ATOM   2251 C  C     . TYR A 1 273 ? -6.307  -19.155 25.466 1.00 24.27  ? 273  TYR A C     1 
ATOM   2252 O  O     . TYR A 1 273 ? -6.088  -19.226 26.675 1.00 23.88  ? 273  TYR A O     1 
ATOM   2253 C  CB    . TYR A 1 273 ? -7.844  -21.031 24.667 1.00 23.56  ? 273  TYR A CB    1 
ATOM   2254 C  CG    . TYR A 1 273 ? -8.250  -21.712 25.947 1.00 24.71  ? 273  TYR A CG    1 
ATOM   2255 C  CD1   . TYR A 1 273 ? -7.294  -22.147 26.864 1.00 26.23  ? 273  TYR A CD1   1 
ATOM   2256 C  CD2   . TYR A 1 273 ? -9.595  -21.838 26.291 1.00 24.67  ? 273  TYR A CD2   1 
ATOM   2257 C  CE1   . TYR A 1 273 ? -7.671  -22.721 28.070 1.00 26.57  ? 273  TYR A CE1   1 
ATOM   2258 C  CE2   . TYR A 1 273 ? -9.977  -22.410 27.499 1.00 22.45  ? 273  TYR A CE2   1 
ATOM   2259 C  CZ    . TYR A 1 273 ? -9.013  -22.846 28.381 1.00 26.59  ? 273  TYR A CZ    1 
ATOM   2260 O  OH    . TYR A 1 273 ? -9.390  -23.406 29.582 1.00 26.65  ? 273  TYR A OH    1 
ATOM   2261 N  N     . ILE A 1 274 ? -5.393  -18.734 24.589 1.00 23.92  ? 274  ILE A N     1 
ATOM   2262 C  CA    . ILE A 1 274 ? -4.098  -18.211 25.034 1.00 28.44  ? 274  ILE A CA    1 
ATOM   2263 C  C     . ILE A 1 274 ? -4.242  -17.030 26.025 1.00 28.95  ? 274  ILE A C     1 
ATOM   2264 O  O     . ILE A 1 274 ? -3.513  -16.959 27.031 1.00 26.17  ? 274  ILE A O     1 
ATOM   2265 C  CB    . ILE A 1 274 ? -3.166  -17.877 23.839 1.00 30.97  ? 274  ILE A CB    1 
ATOM   2266 C  CG1   . ILE A 1 274 ? -1.750  -17.555 24.316 1.00 34.48  ? 274  ILE A CG1   1 
ATOM   2267 C  CG2   . ILE A 1 274 ? -3.713  -16.732 22.996 1.00 38.65  ? 274  ILE A CG2   1 
ATOM   2268 C  CD1   . ILE A 1 274 ? -0.697  -17.721 23.219 1.00 39.18  ? 274  ILE A CD1   1 
ATOM   2269 N  N     . ASP A 1 275 ? -5.199  -16.136 25.764 1.00 29.45  ? 275  ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 275 ? -5.463  -15.002 26.666 1.00 29.75  ? 275  ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 275 ? -6.073  -15.446 27.995 1.00 28.98  ? 275  ASP A C     1 
ATOM   2272 O  O     . ASP A 1 275 ? -5.727  -14.914 29.051 1.00 28.57  ? 275  ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 275 ? -6.360  -13.953 25.998 1.00 31.47  ? 275  ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 275 ? -5.684  -13.271 24.814 1.00 34.01  ? 275  ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 275 ? -4.459  -13.043 24.880 1.00 37.34  ? 275  ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 275 ? -6.375  -12.959 23.819 1.00 38.19  ? 275  ASP A OD2   1 
ATOM   2277 N  N     . LEU A 1 276 ? -6.986  -16.415 27.938 1.00 29.21  ? 276  LEU A N     1 
ATOM   2278 C  CA    . LEU A 1 276 ? -7.544  -16.999 29.151 1.00 27.58  ? 276  LEU A CA    1 
ATOM   2279 C  C     . LEU A 1 276 ? -6.422  -17.673 29.933 1.00 27.77  ? 276  LEU A C     1 
ATOM   2280 O  O     . LEU A 1 276 ? -6.255  -17.425 31.142 1.00 26.64  ? 276  LEU A O     1 
ATOM   2281 C  CB    . LEU A 1 276 ? -8.651  -18.010 28.830 1.00 27.51  ? 276  LEU A CB    1 
ATOM   2282 C  CG    . LEU A 1 276 ? -9.974  -17.492 28.258 1.00 26.71  ? 276  LEU A CG    1 
ATOM   2283 C  CD1   . LEU A 1 276 ? -10.849 -18.647 27.914 1.00 20.55  ? 276  LEU A CD1   1 
ATOM   2284 C  CD2   . LEU A 1 276 ? -10.683 -16.577 29.240 1.00 25.20  ? 276  LEU A CD2   1 
ATOM   2285 N  N     . TYR A 1 277 ? -5.643  -18.502 29.232 1.00 24.76  ? 277  TYR A N     1 
ATOM   2286 C  CA    . TYR A 1 277 ? -4.510  -19.188 29.842 1.00 24.20  ? 277  TYR A CA    1 
ATOM   2287 C  C     . TYR A 1 277 ? -3.591  -18.207 30.552 1.00 25.34  ? 277  TYR A C     1 
ATOM   2288 O  O     . TYR A 1 277 ? -3.316  -18.367 31.742 1.00 24.49  ? 277  TYR A O     1 
ATOM   2289 C  CB    . TYR A 1 277 ? -3.723  -20.030 28.829 1.00 23.52  ? 277  TYR A CB    1 
ATOM   2290 C  CG    . TYR A 1 277 ? -2.762  -20.997 29.499 1.00 21.56  ? 277  TYR A CG    1 
ATOM   2291 C  CD1   . TYR A 1 277 ? -3.197  -22.241 29.962 1.00 23.22  ? 277  TYR A CD1   1 
ATOM   2292 C  CD2   . TYR A 1 277 ? -1.428  -20.660 29.682 1.00 19.90  ? 277  TYR A CD2   1 
ATOM   2293 C  CE1   . TYR A 1 277 ? -2.316  -23.119 30.599 1.00 24.22  ? 277  TYR A CE1   1 
ATOM   2294 C  CE2   . TYR A 1 277 ? -0.539  -21.529 30.301 1.00 19.11  ? 277  TYR A CE2   1 
ATOM   2295 C  CZ    . TYR A 1 277 ? -0.980  -22.748 30.761 1.00 23.81  ? 277  TYR A CZ    1 
ATOM   2296 O  OH    . TYR A 1 277 ? -0.079  -23.587 31.383 1.00 25.09  ? 277  TYR A OH    1 
ATOM   2297 N  N     . LYS A 1 278 ? -3.147  -17.178 29.835 1.00 24.88  ? 278  LYS A N     1 
ATOM   2298 C  CA    . LYS A 1 278 ? -2.220  -16.197 30.408 1.00 26.98  ? 278  LYS A CA    1 
ATOM   2299 C  C     . LYS A 1 278 ? -2.758  -15.463 31.636 1.00 25.72  ? 278  LYS A C     1 
ATOM   2300 O  O     . LYS A 1 278 ? -2.030  -15.243 32.609 1.00 24.64  ? 278  LYS A O     1 
ATOM   2301 C  CB    . LYS A 1 278 ? -1.762  -15.195 29.350 1.00 26.19  ? 278  LYS A CB    1 
ATOM   2302 C  CG    . LYS A 1 278 ? -0.679  -15.750 28.445 1.00 32.58  ? 278  LYS A CG    1 
ATOM   2303 C  CD    . LYS A 1 278 ? -0.388  -14.825 27.269 1.00 33.96  ? 278  LYS A CD    1 
ATOM   2304 C  CE    . LYS A 1 278 ? 0.729   -15.378 26.394 1.00 30.85  ? 278  LYS A CE    1 
ATOM   2305 N  NZ    . LYS A 1 278 ? 0.944   -14.522 25.175 1.00 33.89  ? 278  LYS A NZ    1 
ATOM   2306 N  N     . LYS A 1 279 ? -4.028  -15.087 31.600 1.00 28.18  ? 279  LYS A N     1 
ATOM   2307 C  CA    . LYS A 1 279 ? -4.587  -14.304 32.697 1.00 31.16  ? 279  LYS A CA    1 
ATOM   2308 C  C     . LYS A 1 279 ? -4.894  -15.147 33.928 1.00 31.05  ? 279  LYS A C     1 
ATOM   2309 O  O     . LYS A 1 279 ? -4.747  -14.665 35.057 1.00 33.80  ? 279  LYS A O     1 
ATOM   2310 C  CB    . LYS A 1 279 ? -5.850  -13.548 32.269 1.00 33.36  ? 279  LYS A CB    1 
ATOM   2311 C  CG    . LYS A 1 279 ? -6.310  -12.531 33.317 1.00 35.19  ? 279  LYS A CG    1 
ATOM   2312 C  CD    . LYS A 1 279 ? -7.466  -11.669 32.851 1.00 39.60  ? 279  LYS A CD    1 
ATOM   2313 C  CE    . LYS A 1 279 ? -8.012  -10.799 34.000 1.00 41.04  ? 279  LYS A CE    1 
ATOM   2314 N  NZ    . LYS A 1 279 ? -7.041  -9.765  34.482 1.00 39.25  ? 279  LYS A NZ    1 
ATOM   2315 N  N     . PHE A 1 280 ? -5.305  -16.395 33.711 1.00 27.06  ? 280  PHE A N     1 
ATOM   2316 C  CA    . PHE A 1 280 ? -5.911  -17.189 34.769 1.00 26.61  ? 280  PHE A CA    1 
ATOM   2317 C  C     . PHE A 1 280 ? -5.142  -18.441 35.209 1.00 28.03  ? 280  PHE A C     1 
ATOM   2318 O  O     . PHE A 1 280 ? -5.523  -19.061 36.203 1.00 29.24  ? 280  PHE A O     1 
ATOM   2319 C  CB    . PHE A 1 280 ? -7.320  -17.635 34.366 1.00 26.06  ? 280  PHE A CB    1 
ATOM   2320 C  CG    . PHE A 1 280 ? -8.279  -16.520 34.068 1.00 26.69  ? 280  PHE A CG    1 
ATOM   2321 C  CD1   . PHE A 1 280 ? -9.166  -16.639 33.001 1.00 25.56  ? 280  PHE A CD1   1 
ATOM   2322 C  CD2   . PHE A 1 280 ? -8.342  -15.378 34.864 1.00 29.51  ? 280  PHE A CD2   1 
ATOM   2323 C  CE1   . PHE A 1 280 ? -10.091 -15.621 32.721 1.00 31.31  ? 280  PHE A CE1   1 
ATOM   2324 C  CE2   . PHE A 1 280 ? -9.259  -14.349 34.589 1.00 29.27  ? 280  PHE A CE2   1 
ATOM   2325 C  CZ    . PHE A 1 280 ? -10.132 -14.472 33.516 1.00 30.63  ? 280  PHE A CZ    1 
ATOM   2326 N  N     . SER A 1 281 ? -4.107  -18.838 34.469 1.00 26.06  ? 281  SER A N     1 
ATOM   2327 C  CA    . SER A 1 281 ? -3.351  -20.053 34.809 1.00 25.55  ? 281  SER A CA    1 
ATOM   2328 C  C     . SER A 1 281 ? -2.319  -19.882 35.931 1.00 27.07  ? 281  SER A C     1 
ATOM   2329 O  O     . SER A 1 281 ? -1.966  -20.864 36.585 1.00 24.50  ? 281  SER A O     1 
ATOM   2330 C  CB    . SER A 1 281 ? -2.663  -20.654 33.578 1.00 24.53  ? 281  SER A CB    1 
ATOM   2331 O  OG    . SER A 1 281 ? -1.609  -19.823 33.129 1.00 25.01  ? 281  SER A OG    1 
ATOM   2332 N  N     . PHE A 1 282 ? -1.833  -18.655 36.140 1.00 27.82  ? 282  PHE A N     1 
ATOM   2333 C  CA    . PHE A 1 282 ? -0.713  -18.393 37.074 1.00 31.40  ? 282  PHE A CA    1 
ATOM   2334 C  C     . PHE A 1 282 ? 0.505   -19.302 36.856 1.00 31.89  ? 282  PHE A C     1 
ATOM   2335 O  O     . PHE A 1 282 ? 1.057   -19.903 37.786 1.00 33.00  ? 282  PHE A O     1 
ATOM   2336 C  CB    . PHE A 1 282 ? -1.192  -18.357 38.531 1.00 30.86  ? 282  PHE A CB    1 
ATOM   2337 C  CG    . PHE A 1 282 ? -2.063  -17.177 38.822 1.00 35.60  ? 282  PHE A CG    1 
ATOM   2338 C  CD1   . PHE A 1 282 ? -1.508  -15.993 39.301 1.00 34.44  ? 282  PHE A CD1   1 
ATOM   2339 C  CD2   . PHE A 1 282 ? -3.436  -17.221 38.548 1.00 33.49  ? 282  PHE A CD2   1 
ATOM   2340 C  CE1   . PHE A 1 282 ? -2.312  -14.879 39.527 1.00 36.19  ? 282  PHE A CE1   1 
ATOM   2341 C  CE2   . PHE A 1 282 ? -4.245  -16.119 38.780 1.00 31.09  ? 282  PHE A CE2   1 
ATOM   2342 C  CZ    . PHE A 1 282 ? -3.683  -14.947 39.273 1.00 34.70  ? 282  PHE A CZ    1 
ATOM   2343 N  N     . THR A 1 283 ? 0.884   -19.395 35.589 1.00 33.37  ? 283  THR A N     1 
ATOM   2344 C  CA    . THR A 1 283 ? 2.146   -19.962 35.149 1.00 34.53  ? 283  THR A CA    1 
ATOM   2345 C  C     . THR A 1 283 ? 2.834   -18.884 34.334 1.00 36.98  ? 283  THR A C     1 
ATOM   2346 O  O     . THR A 1 283 ? 2.163   -18.006 33.778 1.00 37.29  ? 283  THR A O     1 
ATOM   2347 C  CB    . THR A 1 283 ? 1.915   -21.108 34.166 1.00 34.15  ? 283  THR A CB    1 
ATOM   2348 O  OG1   . THR A 1 283 ? 1.323   -20.578 32.964 1.00 32.62  ? 283  THR A OG1   1 
ATOM   2349 C  CG2   . THR A 1 283 ? 1.018   -22.163 34.769 1.00 30.03  ? 283  THR A CG2   1 
ATOM   2350 N  N     . ASN A 1 284 ? 4.161   -18.931 34.251 1.00 39.22  ? 284  ASN A N     1 
ATOM   2351 C  CA    . ASN A 1 284 ? 4.825   -18.233 33.157 1.00 41.84  ? 284  ASN A CA    1 
ATOM   2352 C  C     . ASN A 1 284 ? 5.610   -19.246 32.365 1.00 40.04  ? 284  ASN A C     1 
ATOM   2353 O  O     . ASN A 1 284 ? 6.523   -19.903 32.871 1.00 42.92  ? 284  ASN A O     1 
ATOM   2354 C  CB    . ASN A 1 284 ? 5.678   -17.032 33.588 1.00 45.21  ? 284  ASN A CB    1 
ATOM   2355 C  CG    . ASN A 1 284 ? 6.029   -16.098 32.399 1.00 52.67  ? 284  ASN A CG    1 
ATOM   2356 O  OD1   . ASN A 1 284 ? 5.476   -16.223 31.297 1.00 55.00  ? 284  ASN A OD1   1 
ATOM   2357 N  ND2   . ASN A 1 284 ? 6.946   -15.162 32.630 1.00 53.41  ? 284  ASN A ND2   1 
ATOM   2358 N  N     . GLN A 1 285 ? 5.205   -19.387 31.116 1.00 36.99  ? 285  GLN A N     1 
ATOM   2359 C  CA    . GLN A 1 285 ? 5.685   -20.452 30.270 1.00 32.96  ? 285  GLN A CA    1 
ATOM   2360 C  C     . GLN A 1 285 ? 6.770   -19.920 29.363 1.00 30.46  ? 285  GLN A C     1 
ATOM   2361 O  O     . GLN A 1 285 ? 6.681   -18.784 28.916 1.00 28.01  ? 285  GLN A O     1 
ATOM   2362 C  CB    . GLN A 1 285 ? 4.519   -21.023 29.453 1.00 32.40  ? 285  GLN A CB    1 
ATOM   2363 C  CG    . GLN A 1 285 ? 3.398   -21.582 30.328 1.00 30.94  ? 285  GLN A CG    1 
ATOM   2364 C  CD    . GLN A 1 285 ? 3.786   -22.870 31.025 1.00 30.52  ? 285  GLN A CD    1 
ATOM   2365 O  OE1   . GLN A 1 285 ? 4.932   -23.302 30.969 1.00 30.48  ? 285  GLN A OE1   1 
ATOM   2366 N  NE2   . GLN A 1 285 ? 2.821   -23.505 31.660 1.00 31.06  ? 285  GLN A NE2   1 
ATOM   2367 N  N     . PRO A 1 286 ? 7.808   -20.737 29.096 1.00 29.59  ? 286  PRO A N     1 
ATOM   2368 C  CA    . PRO A 1 286 ? 8.847   -20.305 28.165 1.00 28.77  ? 286  PRO A CA    1 
ATOM   2369 C  C     . PRO A 1 286 ? 8.350   -20.291 26.730 1.00 27.83  ? 286  PRO A C     1 
ATOM   2370 O  O     . PRO A 1 286 ? 9.015   -19.744 25.867 1.00 28.34  ? 286  PRO A O     1 
ATOM   2371 C  CB    . PRO A 1 286 ? 9.958   -21.348 28.353 1.00 29.35  ? 286  PRO A CB    1 
ATOM   2372 C  CG    . PRO A 1 286 ? 9.291   -22.543 28.907 1.00 29.20  ? 286  PRO A CG    1 
ATOM   2373 C  CD    . PRO A 1 286 ? 8.087   -22.066 29.675 1.00 29.72  ? 286  PRO A CD    1 
ATOM   2374 N  N     . SER A 1 287 ? 7.174   -20.871 26.496 1.00 27.51  ? 287  SER A N     1 
ATOM   2375 C  CA    . SER A 1 287 ? 6.583   -20.961 25.172 1.00 27.03  ? 287  SER A CA    1 
ATOM   2376 C  C     . SER A 1 287 ? 5.073   -21.105 25.251 1.00 28.87  ? 287  SER A C     1 
ATOM   2377 O  O     . SER A 1 287 ? 4.544   -21.686 26.202 1.00 29.14  ? 287  SER A O     1 
ATOM   2378 C  CB    . SER A 1 287 ? 7.151   -22.172 24.434 1.00 28.48  ? 287  SER A CB    1 
ATOM   2379 O  OG    . SER A 1 287 ? 6.440   -22.423 23.239 1.00 33.86  ? 287  SER A OG    1 
ATOM   2380 N  N     . TYR A 1 288 ? 4.391   -20.597 24.228 1.00 28.69  ? 288  TYR A N     1 
ATOM   2381 C  CA    . TYR A 1 288 ? 2.935   -20.681 24.146 1.00 31.21  ? 288  TYR A CA    1 
ATOM   2382 C  C     . TYR A 1 288 ? 2.435   -21.366 22.877 1.00 31.73  ? 288  TYR A C     1 
ATOM   2383 O  O     . TYR A 1 288 ? 1.320   -21.115 22.424 1.00 34.47  ? 288  TYR A O     1 
ATOM   2384 C  CB    . TYR A 1 288 ? 2.278   -19.305 24.357 1.00 28.85  ? 288  TYR A CB    1 
ATOM   2385 C  CG    . TYR A 1 288 ? 2.405   -18.847 25.783 1.00 30.86  ? 288  TYR A CG    1 
ATOM   2386 C  CD1   . TYR A 1 288 ? 3.509   -18.094 26.196 1.00 30.18  ? 288  TYR A CD1   1 
ATOM   2387 C  CD2   . TYR A 1 288 ? 1.455   -19.211 26.738 1.00 27.08  ? 288  TYR A CD2   1 
ATOM   2388 C  CE1   . TYR A 1 288 ? 3.651   -17.696 27.513 1.00 25.56  ? 288  TYR A CE1   1 
ATOM   2389 C  CE2   . TYR A 1 288 ? 1.587   -18.811 28.055 1.00 27.25  ? 288  TYR A CE2   1 
ATOM   2390 C  CZ    . TYR A 1 288 ? 2.690   -18.056 28.435 1.00 29.49  ? 288  TYR A CZ    1 
ATOM   2391 O  OH    . TYR A 1 288 ? 2.836   -17.663 29.743 1.00 36.45  ? 288  TYR A OH    1 
ATOM   2392 N  N     . SER A 1 289 ? 3.258   -22.249 22.319 1.00 32.29  ? 289  SER A N     1 
ATOM   2393 C  CA    . SER A 1 289 ? 2.775   -23.167 21.297 1.00 32.07  ? 289  SER A CA    1 
ATOM   2394 C  C     . SER A 1 289 ? 1.826   -24.165 21.962 1.00 31.56  ? 289  SER A C     1 
ATOM   2395 O  O     . SER A 1 289 ? 1.921   -24.427 23.169 1.00 32.89  ? 289  SER A O     1 
ATOM   2396 C  CB    . SER A 1 289 ? 3.937   -23.887 20.610 1.00 31.44  ? 289  SER A CB    1 
ATOM   2397 O  OG    . SER A 1 289 ? 4.283   -25.088 21.276 1.00 36.13  ? 289  SER A OG    1 
ATOM   2398 N  N     . LEU A 1 290 ? 0.905   -24.714 21.183 1.00 31.41  ? 290  LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 290 ? -0.096  -25.603 21.743 1.00 30.91  ? 290  LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 290 ? 0.528   -26.926 22.174 1.00 32.77  ? 290  LEU A C     1 
ATOM   2401 O  O     . LEU A 1 290 ? 0.137   -27.482 23.199 1.00 35.02  ? 290  LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 290 ? -1.272  -25.801 20.776 1.00 28.51  ? 290  LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 290 ? -2.477  -26.612 21.277 1.00 30.18  ? 290  LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 290 ? -2.956  -26.213 22.679 1.00 24.61  ? 290  LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 290 ? -3.609  -26.513 20.285 1.00 28.02  ? 290  LEU A CD2   1 
ATOM   2406 N  N     . ASP A 1 291 ? 1.495   -27.414 21.396 1.00 34.30  ? 291  ASP A N     1 
ATOM   2407 C  CA    . ASP A 1 291 ? 2.308   -28.571 21.773 1.00 36.17  ? 291  ASP A CA    1 
ATOM   2408 C  C     . ASP A 1 291 ? 2.879   -28.385 23.162 1.00 34.69  ? 291  ASP A C     1 
ATOM   2409 O  O     . ASP A 1 291 ? 2.739   -29.258 24.016 1.00 35.69  ? 291  ASP A O     1 
ATOM   2410 C  CB    . ASP A 1 291 ? 3.477   -28.777 20.798 1.00 39.64  ? 291  ASP A CB    1 
ATOM   2411 C  CG    . ASP A 1 291 ? 3.102   -29.603 19.577 1.00 47.55  ? 291  ASP A CG    1 
ATOM   2412 O  OD1   . ASP A 1 291 ? 2.113   -30.372 19.635 1.00 48.81  ? 291  ASP A OD1   1 
ATOM   2413 O  OD2   . ASP A 1 291 ? 3.822   -29.490 18.554 1.00 51.63  ? 291  ASP A OD2   1 
ATOM   2414 N  N     . TYR A 1 292 ? 3.530   -27.246 23.388 1.00 33.63  ? 292  TYR A N     1 
ATOM   2415 C  CA    . TYR A 1 292 ? 4.182   -27.014 24.670 1.00 33.37  ? 292  TYR A CA    1 
ATOM   2416 C  C     . TYR A 1 292 ? 3.205   -27.021 25.861 1.00 31.39  ? 292  TYR A C     1 
ATOM   2417 O  O     . TYR A 1 292 ? 3.466   -27.674 26.883 1.00 31.88  ? 292  TYR A O     1 
ATOM   2418 C  CB    . TYR A 1 292 ? 5.013   -25.725 24.666 1.00 32.38  ? 292  TYR A CB    1 
ATOM   2419 C  CG    . TYR A 1 292 ? 5.885   -25.643 25.896 1.00 35.60  ? 292  TYR A CG    1 
ATOM   2420 C  CD1   . TYR A 1 292 ? 5.405   -25.088 27.079 1.00 33.20  ? 292  TYR A CD1   1 
ATOM   2421 C  CD2   . TYR A 1 292 ? 7.179   -26.176 25.891 1.00 41.24  ? 292  TYR A CD2   1 
ATOM   2422 C  CE1   . TYR A 1 292 ? 6.194   -25.044 28.226 1.00 40.02  ? 292  TYR A CE1   1 
ATOM   2423 C  CE2   . TYR A 1 292 ? 7.981   -26.132 27.033 1.00 43.06  ? 292  TYR A CE2   1 
ATOM   2424 C  CZ    . TYR A 1 292 ? 7.480   -25.568 28.192 1.00 40.87  ? 292  TYR A CZ    1 
ATOM   2425 O  OH    . TYR A 1 292 ? 8.266   -25.526 29.316 1.00 47.12  ? 292  TYR A OH    1 
ATOM   2426 N  N     . ILE A 1 293 ? 2.097   -26.292 25.724 1.00 28.53  ? 293  ILE A N     1 
ATOM   2427 C  CA    . ILE A 1 293 ? 1.124   -26.153 26.805 1.00 24.54  ? 293  ILE A CA    1 
ATOM   2428 C  C     . ILE A 1 293 ? 0.344   -27.464 27.012 1.00 27.50  ? 293  ILE A C     1 
ATOM   2429 O  O     . ILE A 1 293 ? 0.084   -27.860 28.154 1.00 27.20  ? 293  ILE A O     1 
ATOM   2430 C  CB    . ILE A 1 293 ? 0.178   -24.950 26.548 1.00 22.92  ? 293  ILE A CB    1 
ATOM   2431 C  CG1   . ILE A 1 293 ? 0.969   -23.638 26.393 1.00 23.33  ? 293  ILE A CG1   1 
ATOM   2432 C  CG2   . ILE A 1 293 ? -0.888  -24.825 27.629 1.00 21.29  ? 293  ILE A CG2   1 
ATOM   2433 C  CD1   . ILE A 1 293 ? 1.752   -23.180 27.652 1.00 21.42  ? 293  ILE A CD1   1 
ATOM   2434 N  N     . SER A 1 294 ? -0.001  -28.138 25.911 1.00 27.73  ? 294  SER A N     1 
ATOM   2435 C  CA    . SER A 1 294 ? -0.653  -29.449 25.967 1.00 30.00  ? 294  SER A CA    1 
ATOM   2436 C  C     . SER A 1 294 ? 0.200   -30.466 26.704 1.00 30.30  ? 294  SER A C     1 
ATOM   2437 O  O     . SER A 1 294 ? -0.305  -31.177 27.567 1.00 32.45  ? 294  SER A O     1 
ATOM   2438 C  CB    . SER A 1 294 ? -0.966  -29.987 24.572 1.00 28.94  ? 294  SER A CB    1 
ATOM   2439 O  OG    . SER A 1 294 ? -2.021  -29.269 23.980 1.00 34.88  ? 294  SER A OG    1 
ATOM   2440 N  N     . GLU A 1 295 ? 1.480   -30.542 26.356 1.00 29.94  ? 295  GLU A N     1 
ATOM   2441 C  CA    . GLU A 1 295 ? 2.426   -31.358 27.112 1.00 34.15  ? 295  GLU A CA    1 
ATOM   2442 C  C     . GLU A 1 295 ? 2.404   -30.974 28.600 1.00 33.04  ? 295  GLU A C     1 
ATOM   2443 O  O     . GLU A 1 295 ? 2.269   -31.834 29.466 1.00 30.96  ? 295  GLU A O     1 
ATOM   2444 C  CB    . GLU A 1 295 ? 3.841   -31.209 26.542 1.00 35.94  ? 295  GLU A CB    1 
ATOM   2445 C  CG    . GLU A 1 295 ? 4.831   -32.271 26.995 1.00 49.30  ? 295  GLU A CG    1 
ATOM   2446 C  CD    . GLU A 1 295 ? 5.280   -32.093 28.442 1.00 59.61  ? 295  GLU A CD    1 
ATOM   2447 O  OE1   . GLU A 1 295 ? 5.214   -33.083 29.213 1.00 63.44  ? 295  GLU A OE1   1 
ATOM   2448 O  OE2   . GLU A 1 295 ? 5.686   -30.962 28.810 1.00 62.19  ? 295  GLU A OE2   1 
ATOM   2449 N  N     . PHE A 1 296 ? 2.522   -29.681 28.890 1.00 31.35  ? 296  PHE A N     1 
ATOM   2450 C  CA    . PHE A 1 296 ? 2.599   -29.233 30.275 1.00 31.12  ? 296  PHE A CA    1 
ATOM   2451 C  C     . PHE A 1 296 ? 1.343   -29.605 31.060 1.00 30.02  ? 296  PHE A C     1 
ATOM   2452 O  O     . PHE A 1 296 ? 1.433   -30.035 32.217 1.00 26.70  ? 296  PHE A O     1 
ATOM   2453 C  CB    . PHE A 1 296 ? 2.837   -27.715 30.345 1.00 31.89  ? 296  PHE A CB    1 
ATOM   2454 C  CG    . PHE A 1 296 ? 2.899   -27.175 31.746 1.00 35.39  ? 296  PHE A CG    1 
ATOM   2455 C  CD1   . PHE A 1 296 ? 4.095   -27.201 32.466 1.00 37.20  ? 296  PHE A CD1   1 
ATOM   2456 C  CD2   . PHE A 1 296 ? 1.756   -26.652 32.359 1.00 35.28  ? 296  PHE A CD2   1 
ATOM   2457 C  CE1   . PHE A 1 296 ? 4.153   -26.705 33.778 1.00 38.65  ? 296  PHE A CE1   1 
ATOM   2458 C  CE2   . PHE A 1 296 ? 1.799   -26.155 33.669 1.00 34.82  ? 296  PHE A CE2   1 
ATOM   2459 C  CZ    . PHE A 1 296 ? 3.002   -26.178 34.381 1.00 37.91  ? 296  PHE A CZ    1 
ATOM   2460 N  N     . GLU A 1 297 ? 0.180   -29.442 30.426 1.00 28.01  ? 297  GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 297 ? -1.100  -29.514 31.138 1.00 27.78  ? 297  GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 297 ? -1.656  -30.928 31.186 1.00 29.52  ? 297  GLU A C     1 
ATOM   2463 O  O     . GLU A 1 297 ? -2.358  -31.305 32.139 1.00 24.99  ? 297  GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 297 ? -2.141  -28.597 30.480 1.00 26.14  ? 297  GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 297 ? -1.872  -27.103 30.590 1.00 26.87  ? 297  GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 297 ? -2.003  -26.569 32.008 1.00 32.22  ? 297  GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 297 ? -2.871  -27.060 32.774 1.00 33.52  ? 297  GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 297 ? -1.238  -25.639 32.354 1.00 31.96  ? 297  GLU A OE2   1 
ATOM   2469 N  N     . LEU A 1 298 ? -1.370  -31.695 30.138 1.00 29.80  ? 298  LEU A N     1 
ATOM   2470 C  CA    . LEU A 1 298 ? -2.032  -32.980 29.946 1.00 32.52  ? 298  LEU A CA    1 
ATOM   2471 C  C     . LEU A 1 298 ? -1.061  -34.153 29.901 1.00 34.04  ? 298  LEU A C     1 
ATOM   2472 O  O     . LEU A 1 298 ? -1.488  -35.302 29.938 1.00 34.29  ? 298  LEU A O     1 
ATOM   2473 C  CB    . LEU A 1 298 ? -2.883  -32.965 28.668 1.00 30.87  ? 298  LEU A CB    1 
ATOM   2474 C  CG    . LEU A 1 298 ? -3.874  -31.818 28.462 1.00 31.95  ? 298  LEU A CG    1 
ATOM   2475 C  CD1   . LEU A 1 298 ? -4.348  -31.788 27.017 1.00 26.39  ? 298  LEU A CD1   1 
ATOM   2476 C  CD2   . LEU A 1 298 ? -5.055  -31.898 29.438 1.00 30.48  ? 298  LEU A CD2   1 
ATOM   2477 N  N     . ASN A 1 299 ? 0.233   -33.859 29.805 1.00 37.94  ? 299  ASN A N     1 
ATOM   2478 C  CA    . ASN A 1 299 ? 1.273   -34.894 29.686 1.00 44.22  ? 299  ASN A CA    1 
ATOM   2479 C  C     . ASN A 1 299 ? 1.208   -35.680 28.360 1.00 45.73  ? 299  ASN A C     1 
ATOM   2480 O  O     . ASN A 1 299 ? 1.722   -36.798 28.259 1.00 48.07  ? 299  ASN A O     1 
ATOM   2481 C  CB    . ASN A 1 299 ? 1.264   -35.833 30.914 1.00 45.26  ? 299  ASN A CB    1 
ATOM   2482 C  CG    . ASN A 1 299 ? 2.449   -36.784 30.942 1.00 51.78  ? 299  ASN A CG    1 
ATOM   2483 O  OD1   . ASN A 1 299 ? 2.327   -37.933 31.372 1.00 54.03  ? 299  ASN A OD1   1 
ATOM   2484 N  ND2   . ASN A 1 299 ? 3.605   -36.312 30.472 1.00 56.63  ? 299  ASN A ND2   1 
ATOM   2485 N  N     . VAL A 1 300 ? 0.579   -35.089 27.347 1.00 44.53  ? 300  VAL A N     1 
ATOM   2486 C  CA    . VAL A 1 300 ? 0.518   -35.702 26.026 1.00 45.15  ? 300  VAL A CA    1 
ATOM   2487 C  C     . VAL A 1 300 ? 1.770   -35.365 25.217 1.00 47.48  ? 300  VAL A C     1 
ATOM   2488 O  O     . VAL A 1 300 ? 2.336   -34.274 25.351 1.00 47.23  ? 300  VAL A O     1 
ATOM   2489 C  CB    . VAL A 1 300 ? -0.740  -35.269 25.226 1.00 45.14  ? 300  VAL A CB    1 
ATOM   2490 C  CG1   . VAL A 1 300 ? -1.994  -35.938 25.779 1.00 42.09  ? 300  VAL A CG1   1 
ATOM   2491 C  CG2   . VAL A 1 300 ? -0.885  -33.745 25.214 1.00 41.92  ? 300  VAL A CG2   1 
ATOM   2492 N  N     . GLY A 1 301 ? 2.194   -36.307 24.376 1.00 49.07  ? 301  GLY A N     1 
ATOM   2493 C  CA    . GLY A 1 301 ? 3.337   -36.097 23.496 1.00 51.59  ? 301  GLY A CA    1 
ATOM   2494 C  C     . GLY A 1 301 ? 2.993   -35.115 22.395 1.00 54.09  ? 301  GLY A C     1 
ATOM   2495 O  O     . GLY A 1 301 ? 1.827   -34.981 22.009 1.00 53.77  ? 301  GLY A O     1 
ATOM   2496 N  N     . LYS A 1 302 ? 4.008   -34.415 21.900 1.00 56.09  ? 302  LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 302 ? 3.842   -33.466 20.800 1.00 58.75  ? 302  LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 302 ? 3.381   -34.156 19.517 1.00 59.62  ? 302  LYS A C     1 
ATOM   2499 O  O     . LYS A 1 302 ? 3.686   -35.329 19.288 1.00 59.56  ? 302  LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 302 ? 5.133   -32.662 20.557 1.00 60.50  ? 302  LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 302 ? 6.406   -33.480 20.281 1.00 65.28  ? 302  LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 302 ? 6.892   -34.268 21.514 1.00 72.26  ? 302  LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 302 ? 7.136   -33.368 22.732 1.00 74.98  ? 302  LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 302 ? 6.790   -34.058 24.010 1.00 76.04  ? 302  LYS A NZ    1 
ATOM   2505 N  N     . LEU A 1 303 ? 2.635   -33.417 18.700 1.00 60.49  ? 303  LEU A N     1 
ATOM   2506 C  CA    . LEU A 1 303 ? 2.132   -33.913 17.425 1.00 61.16  ? 303  LEU A CA    1 
ATOM   2507 C  C     . LEU A 1 303 ? 3.261   -33.980 16.399 1.00 60.78  ? 303  LEU A C     1 
ATOM   2508 O  O     . LEU A 1 303 ? 3.565   -32.991 15.722 1.00 60.93  ? 303  LEU A O     1 
ATOM   2509 C  CB    . LEU A 1 303 ? 0.980   -33.026 16.935 1.00 61.33  ? 303  LEU A CB    1 
ATOM   2510 C  CG    . LEU A 1 303 ? -0.478  -33.436 17.199 1.00 62.24  ? 303  LEU A CG    1 
ATOM   2511 C  CD1   . LEU A 1 303 ? -0.663  -34.194 18.500 1.00 59.27  ? 303  LEU A CD1   1 
ATOM   2512 C  CD2   . LEU A 1 303 ? -1.413  -32.220 17.147 1.00 61.07  ? 303  LEU A CD2   1 
ATOM   2513 N  N     . LYS A 1 304 ? 3.876   -35.156 16.300 1.00 60.73  ? 304  LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 304 ? 5.061   -35.367 15.464 1.00 61.30  ? 304  LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 304 ? 4.746   -35.520 13.974 1.00 59.09  ? 304  LYS A C     1 
ATOM   2516 O  O     . LYS A 1 304 ? 3.815   -36.237 13.594 1.00 57.21  ? 304  LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 304 ? 5.837   -36.594 15.955 1.00 62.77  ? 304  LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 304 ? 6.714   -36.333 17.177 1.00 66.94  ? 304  LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 304 ? 6.576   -37.429 18.244 1.00 69.24  ? 304  LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 304 ? 7.045   -38.799 17.763 1.00 70.17  ? 304  LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 304 ? 6.980   -39.802 18.864 1.00 69.42  ? 304  LYS A NZ    1 
ATOM   2522 N  N     . TYR A 1 305 ? 5.534   -34.845 13.139 1.00 57.30  ? 305  TYR A N     1 
ATOM   2523 C  CA    . TYR A 1 305 ? 5.472   -35.037 11.689 1.00 56.26  ? 305  TYR A CA    1 
ATOM   2524 C  C     . TYR A 1 305 ? 6.835   -34.806 11.025 1.00 56.90  ? 305  TYR A C     1 
ATOM   2525 O  O     . TYR A 1 305 ? 7.714   -34.154 11.598 1.00 57.10  ? 305  TYR A O     1 
ATOM   2526 C  CB    . TYR A 1 305 ? 4.366   -34.177 11.051 1.00 55.37  ? 305  TYR A CB    1 
ATOM   2527 C  CG    . TYR A 1 305 ? 4.517   -32.685 11.248 1.00 54.73  ? 305  TYR A CG    1 
ATOM   2528 C  CD1   . TYR A 1 305 ? 5.182   -31.901 10.306 1.00 54.95  ? 305  TYR A CD1   1 
ATOM   2529 C  CD2   . TYR A 1 305 ? 3.986   -32.056 12.370 1.00 55.78  ? 305  TYR A CD2   1 
ATOM   2530 C  CE1   . TYR A 1 305 ? 5.325   -30.524 10.485 1.00 55.81  ? 305  TYR A CE1   1 
ATOM   2531 C  CE2   . TYR A 1 305 ? 4.122   -30.679 12.558 1.00 57.68  ? 305  TYR A CE2   1 
ATOM   2532 C  CZ    . TYR A 1 305 ? 4.791   -29.918 11.611 1.00 56.03  ? 305  TYR A CZ    1 
ATOM   2533 O  OH    . TYR A 1 305 ? 4.922   -28.557 11.799 1.00 53.42  ? 305  TYR A OH    1 
ATOM   2534 N  N     . ASP A 1 306 ? 7.007   -35.354 9.825  1.00 56.46  ? 306  ASP A N     1 
ATOM   2535 C  CA    . ASP A 1 306 ? 8.271   -35.249 9.108  1.00 55.80  ? 306  ASP A CA    1 
ATOM   2536 C  C     . ASP A 1 306 ? 8.193   -34.126 8.072  1.00 54.77  ? 306  ASP A C     1 
ATOM   2537 O  O     . ASP A 1 306 ? 7.142   -33.906 7.462  1.00 53.41  ? 306  ASP A O     1 
ATOM   2538 C  CB    . ASP A 1 306 ? 8.630   -36.585 8.436  1.00 57.51  ? 306  ASP A CB    1 
ATOM   2539 C  CG    . ASP A 1 306 ? 8.579   -37.781 9.400  1.00 60.33  ? 306  ASP A CG    1 
ATOM   2540 O  OD1   . ASP A 1 306 ? 8.023   -38.833 9.007  1.00 61.95  ? 306  ASP A OD1   1 
ATOM   2541 O  OD2   . ASP A 1 306 ? 9.096   -37.684 10.537 1.00 59.17  ? 306  ASP A OD2   1 
ATOM   2542 N  N     . GLY A 1 307 ? 9.308   -33.419 7.885  1.00 52.50  ? 307  GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 307 ? 9.373   -32.273 6.970  1.00 50.75  ? 307  GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 307 ? 8.760   -30.989 7.524  1.00 49.04  ? 307  GLY A C     1 
ATOM   2545 O  O     . GLY A 1 307 ? 8.248   -30.974 8.651  1.00 47.61  ? 307  GLY A O     1 
ATOM   2546 N  N     . PRO A 1 308 ? 8.817   -29.892 6.736  1.00 47.61  ? 308  PRO A N     1 
ATOM   2547 C  CA    . PRO A 1 308 ? 8.171   -28.632 7.136  1.00 44.97  ? 308  PRO A CA    1 
ATOM   2548 C  C     . PRO A 1 308 ? 6.654   -28.686 6.982  1.00 42.79  ? 308  PRO A C     1 
ATOM   2549 O  O     . PRO A 1 308 ? 6.143   -29.424 6.134  1.00 42.29  ? 308  PRO A O     1 
ATOM   2550 C  CB    . PRO A 1 308 ? 8.766   -27.609 6.164  1.00 44.81  ? 308  PRO A CB    1 
ATOM   2551 C  CG    . PRO A 1 308 ? 9.164   -28.401 4.974  1.00 43.29  ? 308  PRO A CG    1 
ATOM   2552 C  CD    . PRO A 1 308 ? 9.592   -29.742 5.488  1.00 45.21  ? 308  PRO A CD    1 
ATOM   2553 N  N     . ILE A 1 309 ? 5.946   -27.905 7.795  1.00 40.87  ? 309  ILE A N     1 
ATOM   2554 C  CA    . ILE A 1 309 ? 4.486   -27.865 7.747  1.00 40.25  ? 309  ILE A CA    1 
ATOM   2555 C  C     . ILE A 1 309 ? 3.981   -27.375 6.378  1.00 38.24  ? 309  ILE A C     1 
ATOM   2556 O  O     . ILE A 1 309 ? 2.872   -27.704 5.960  1.00 35.79  ? 309  ILE A O     1 
ATOM   2557 C  CB    . ILE A 1 309 ? 3.887   -27.038 8.941  1.00 41.06  ? 309  ILE A CB    1 
ATOM   2558 C  CG1   . ILE A 1 309 ? 2.467   -27.519 9.305  1.00 44.74  ? 309  ILE A CG1   1 
ATOM   2559 C  CG2   . ILE A 1 309 ? 4.003   -25.525 8.717  1.00 41.03  ? 309  ILE A CG2   1 
ATOM   2560 C  CD1   . ILE A 1 309 ? 1.317   -26.815 8.604  1.00 46.28  ? 309  ILE A CD1   1 
ATOM   2561 N  N     . SER A 1 310 ? 4.821   -26.621 5.674  1.00 39.52  ? 310  SER A N     1 
ATOM   2562 C  CA    . SER A 1 310 ? 4.496   -26.144 4.331  1.00 40.92  ? 310  SER A CA    1 
ATOM   2563 C  C     . SER A 1 310 ? 4.293   -27.294 3.340  1.00 40.02  ? 310  SER A C     1 
ATOM   2564 O  O     . SER A 1 310 ? 3.622   -27.128 2.324  1.00 39.72  ? 310  SER A O     1 
ATOM   2565 C  CB    . SER A 1 310 ? 5.580   -25.185 3.824  1.00 42.35  ? 310  SER A CB    1 
ATOM   2566 O  OG    . SER A 1 310 ? 6.729   -25.887 3.372  1.00 45.65  ? 310  SER A OG    1 
ATOM   2567 N  N     . LYS A 1 311 ? 4.869   -28.455 3.647  1.00 41.01  ? 311  LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 311 ? 4.805   -29.621 2.760  1.00 41.34  ? 311  LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 311 ? 3.985   -30.769 3.345  1.00 39.82  ? 311  LYS A C     1 
ATOM   2570 O  O     . LYS A 1 311 ? 3.858   -31.826 2.727  1.00 39.60  ? 311  LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 311 ? 6.221   -30.102 2.415  1.00 42.28  ? 311  LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 311 ? 6.918   -29.259 1.350  1.00 47.05  ? 311  LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 311 ? 8.431   -29.215 1.544  1.00 52.25  ? 311  LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 311 ? 9.072   -28.170 0.614  1.00 59.87  ? 311  LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 311 ? 10.306  -27.549 1.187  1.00 61.03  ? 311  LYS A NZ    1 
ATOM   2576 N  N     . LEU A 1 312 ? 3.427   -30.560 4.533  1.00 37.85  ? 312  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1 312 ? 2.751   -31.629 5.253  1.00 35.78  ? 312  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1 312 ? 1.492   -32.100 4.539  1.00 36.09  ? 312  LEU A C     1 
ATOM   2579 O  O     . LEU A 1 312 ? 1.264   -33.304 4.437  1.00 37.01  ? 312  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1 312 ? 2.427   -31.214 6.693  1.00 37.26  ? 312  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1 312 ? 1.748   -32.249 7.610  1.00 37.16  ? 312  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1 312 ? 2.638   -33.488 7.791  1.00 36.21  ? 312  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1 312 ? 1.387   -31.631 8.971  1.00 32.13  ? 312  LEU A CD2   1 
ATOM   2584 N  N     . ARG A 1 313 ? 0.679   -31.162 4.056  1.00 34.88  ? 313  ARG A N     1 
ATOM   2585 C  CA    . ARG A 1 313 ? -0.553  -31.519 3.353  1.00 35.61  ? 313  ARG A CA    1 
ATOM   2586 C  C     . ARG A 1 313 ? -0.268  -32.376 2.119  1.00 37.14  ? 313  ARG A C     1 
ATOM   2587 O  O     . ARG A 1 313 ? -0.921  -33.393 1.910  1.00 39.28  ? 313  ARG A O     1 
ATOM   2588 C  CB    . ARG A 1 313 ? -1.375  -30.279 2.973  1.00 32.97  ? 313  ARG A CB    1 
ATOM   2589 C  CG    . ARG A 1 313 ? -2.591  -30.590 2.088  1.00 32.78  ? 313  ARG A CG    1 
ATOM   2590 C  CD    . ARG A 1 313 ? -3.440  -29.349 1.798  1.00 32.33  ? 313  ARG A CD    1 
ATOM   2591 N  NE    . ARG A 1 313 ? -4.622  -29.693 1.010  1.00 37.54  ? 313  ARG A NE    1 
ATOM   2592 C  CZ    . ARG A 1 313 ? -4.666  -29.722 -0.328 1.00 40.81  ? 313  ARG A CZ    1 
ATOM   2593 N  NH1   . ARG A 1 313 ? -3.591  -29.422 -1.054 1.00 33.49  ? 313  ARG A NH1   1 
ATOM   2594 N  NH2   . ARG A 1 313 ? -5.794  -30.062 -0.948 1.00 34.69  ? 313  ARG A NH2   1 
ATOM   2595 N  N     . GLU A 1 314 ? 0.709   -31.977 1.312  1.00 38.35  ? 314  GLU A N     1 
ATOM   2596 C  CA    . GLU A 1 314 ? 1.018   -32.723 0.084  1.00 39.79  ? 314  GLU A CA    1 
ATOM   2597 C  C     . GLU A 1 314 ? 1.683   -34.083 0.332  1.00 38.23  ? 314  GLU A C     1 
ATOM   2598 O  O     . GLU A 1 314 ? 1.449   -35.027 -0.417 1.00 38.80  ? 314  GLU A O     1 
ATOM   2599 C  CB    . GLU A 1 314 ? 1.838   -31.881 -0.905 1.00 41.46  ? 314  GLU A CB    1 
ATOM   2600 C  CG    . GLU A 1 314 ? 3.166   -31.335 -0.370 1.00 47.12  ? 314  GLU A CG    1 
ATOM   2601 C  CD    . GLU A 1 314 ? 3.876   -30.426 -1.375 1.00 53.80  ? 314  GLU A CD    1 
ATOM   2602 O  OE1   . GLU A 1 314 ? 4.521   -30.968 -2.306 1.00 52.78  ? 314  GLU A OE1   1 
ATOM   2603 O  OE2   . GLU A 1 314 ? 3.789   -29.178 -1.230 1.00 52.41  ? 314  GLU A OE2   1 
ATOM   2604 N  N     . SER A 1 315 ? 2.501   -34.185 1.375  1.00 36.47  ? 315  SER A N     1 
ATOM   2605 C  CA    . SER A 1 315 ? 3.155   -35.456 1.687  1.00 35.62  ? 315  SER A CA    1 
ATOM   2606 C  C     . SER A 1 315 ? 2.281   -36.389 2.523  1.00 35.78  ? 315  SER A C     1 
ATOM   2607 O  O     . SER A 1 315 ? 2.301   -37.606 2.315  1.00 38.22  ? 315  SER A O     1 
ATOM   2608 C  CB    . SER A 1 315 ? 4.523   -35.248 2.352  1.00 35.42  ? 315  SER A CB    1 
ATOM   2609 O  OG    . SER A 1 315 ? 4.452   -34.379 3.465  1.00 33.28  ? 315  SER A OG    1 
ATOM   2610 N  N     . ASN A 1 316 ? 1.511   -35.822 3.454  1.00 33.22  ? 316  ASN A N     1 
ATOM   2611 C  CA    . ASN A 1 316 ? 0.731   -36.624 4.392  1.00 31.95  ? 316  ASN A CA    1 
ATOM   2612 C  C     . ASN A 1 316 ? -0.595  -35.960 4.791  1.00 31.26  ? 316  ASN A C     1 
ATOM   2613 O  O     . ASN A 1 316 ? -0.880  -35.743 5.979  1.00 33.78  ? 316  ASN A O     1 
ATOM   2614 C  CB    . ASN A 1 316 ? 1.577   -36.967 5.629  1.00 29.40  ? 316  ASN A CB    1 
ATOM   2615 C  CG    . ASN A 1 316 ? 1.137   -38.259 6.302  1.00 31.71  ? 316  ASN A CG    1 
ATOM   2616 O  OD1   . ASN A 1 316 ? 0.023   -38.739 6.096  1.00 31.93  ? 316  ASN A OD1   1 
ATOM   2617 N  ND2   . ASN A 1 316 ? 2.019   -38.828 7.114  1.00 30.11  ? 316  ASN A ND2   1 
ATOM   2618 N  N     . HIS A 1 317 ? -1.404  -35.653 3.788  1.00 29.51  ? 317  HIS A N     1 
ATOM   2619 C  CA    . HIS A 1 317 ? -2.704  -35.038 3.996  1.00 28.82  ? 317  HIS A CA    1 
ATOM   2620 C  C     . HIS A 1 317 ? -3.505  -35.727 5.097  1.00 30.01  ? 317  HIS A C     1 
ATOM   2621 O  O     . HIS A 1 317 ? -4.160  -35.065 5.897  1.00 31.59  ? 317  HIS A O     1 
ATOM   2622 C  CB    . HIS A 1 317 ? -3.507  -35.048 2.697  1.00 27.84  ? 317  HIS A CB    1 
ATOM   2623 C  CG    . HIS A 1 317 ? -4.883  -34.482 2.846  1.00 28.39  ? 317  HIS A CG    1 
ATOM   2624 N  ND1   . HIS A 1 317 ? -6.010  -35.273 2.891  1.00 24.21  ? 317  HIS A ND1   1 
ATOM   2625 C  CD2   . HIS A 1 317 ? -5.311  -33.205 2.989  1.00 24.02  ? 317  HIS A CD2   1 
ATOM   2626 C  CE1   . HIS A 1 317 ? -7.076  -34.505 3.025  1.00 24.90  ? 317  HIS A CE1   1 
ATOM   2627 N  NE2   . HIS A 1 317 ? -6.679  -33.247 3.091  1.00 28.05  ? 317  HIS A NE2   1 
ATOM   2628 N  N     . GLN A 1 318 ? -3.446  -37.055 5.132  1.00 29.74  ? 318  GLN A N     1 
ATOM   2629 C  CA    . GLN A 1 318 ? -4.113  -37.835 6.166  1.00 30.54  ? 318  GLN A CA    1 
ATOM   2630 C  C     . GLN A 1 318 ? -3.760  -37.316 7.563  1.00 31.27  ? 318  GLN A C     1 
ATOM   2631 O  O     . GLN A 1 318 ? -4.647  -37.047 8.368  1.00 30.90  ? 318  GLN A O     1 
ATOM   2632 C  CB    . GLN A 1 318 ? -3.743  -39.317 6.040  1.00 28.65  ? 318  GLN A CB    1 
ATOM   2633 C  CG    . GLN A 1 318 ? -4.190  -40.188 7.222  1.00 29.96  ? 318  GLN A CG    1 
ATOM   2634 C  CD    . GLN A 1 318 ? -5.699  -40.342 7.320  1.00 34.77  ? 318  GLN A CD    1 
ATOM   2635 O  OE1   . GLN A 1 318 ? -6.401  -40.315 6.309  1.00 38.05  ? 318  GLN A OE1   1 
ATOM   2636 N  NE2   . GLN A 1 318 ? -6.209  -40.502 8.549  1.00 33.18  ? 318  GLN A NE2   1 
ATOM   2637 N  N     . ARG A 1 319 ? -2.465  -37.181 7.838  1.00 31.51  ? 319  ARG A N     1 
ATOM   2638 C  CA    . ARG A 1 319 ? -1.997  -36.714 9.144  1.00 33.62  ? 319  ARG A CA    1 
ATOM   2639 C  C     . ARG A 1 319 ? -2.320  -35.235 9.354  1.00 32.57  ? 319  ARG A C     1 
ATOM   2640 O  O     . ARG A 1 319 ? -2.705  -34.829 10.450 1.00 32.15  ? 319  ARG A O     1 
ATOM   2641 C  CB    . ARG A 1 319 ? -0.490  -36.962 9.291  1.00 35.53  ? 319  ARG A CB    1 
ATOM   2642 C  CG    . ARG A 1 319 ? 0.084   -36.556 10.628 1.00 38.91  ? 319  ARG A CG    1 
ATOM   2643 C  CD    . ARG A 1 319 ? 1.280   -37.409 10.974 1.00 45.52  ? 319  ARG A CD    1 
ATOM   2644 N  NE    . ARG A 1 319 ? 0.883   -38.666 11.610 1.00 49.63  ? 319  ARG A NE    1 
ATOM   2645 C  CZ    . ARG A 1 319 ? 1.702   -39.693 11.819 1.00 52.17  ? 319  ARG A CZ    1 
ATOM   2646 N  NH1   . ARG A 1 319 ? 2.972   -39.627 11.438 1.00 52.61  ? 319  ARG A NH1   1 
ATOM   2647 N  NH2   . ARG A 1 319 ? 1.247   -40.792 12.407 1.00 56.79  ? 319  ARG A NH2   1 
ATOM   2648 N  N     . TYR A 1 320 ? -2.153  -34.452 8.289  1.00 30.99  ? 320  TYR A N     1 
ATOM   2649 C  CA    . TYR A 1 320 ? -2.479  -33.022 8.253  1.00 30.07  ? 320  TYR A CA    1 
ATOM   2650 C  C     . TYR A 1 320 ? -3.872  -32.734 8.829  1.00 30.73  ? 320  TYR A C     1 
ATOM   2651 O  O     . TYR A 1 320 ? -4.025  -31.865 9.691  1.00 31.51  ? 320  TYR A O     1 
ATOM   2652 C  CB    . TYR A 1 320 ? -2.411  -32.561 6.796  1.00 28.58  ? 320  TYR A CB    1 
ATOM   2653 C  CG    . TYR A 1 320 ? -2.467  -31.082 6.541  1.00 29.70  ? 320  TYR A CG    1 
ATOM   2654 C  CD1   . TYR A 1 320 ? -1.373  -30.266 6.821  1.00 30.27  ? 320  TYR A CD1   1 
ATOM   2655 C  CD2   . TYR A 1 320 ? -3.596  -30.501 5.949  1.00 31.47  ? 320  TYR A CD2   1 
ATOM   2656 C  CE1   . TYR A 1 320 ? -1.410  -28.903 6.558  1.00 30.59  ? 320  TYR A CE1   1 
ATOM   2657 C  CE2   . TYR A 1 320 ? -3.646  -29.143 5.677  1.00 29.12  ? 320  TYR A CE2   1 
ATOM   2658 C  CZ    . TYR A 1 320 ? -2.548  -28.349 5.986  1.00 31.63  ? 320  TYR A CZ    1 
ATOM   2659 O  OH    . TYR A 1 320 ? -2.581  -27.001 5.727  1.00 29.74  ? 320  TYR A OH    1 
ATOM   2660 N  N     . ILE A 1 321 ? -4.876  -33.468 8.348  1.00 28.89  ? 321  ILE A N     1 
ATOM   2661 C  CA    . ILE A 1 321 ? -6.250  -33.277 8.776  1.00 28.69  ? 321  ILE A CA    1 
ATOM   2662 C  C     . ILE A 1 321 ? -6.431  -33.753 10.210 1.00 30.05  ? 321  ILE A C     1 
ATOM   2663 O  O     . ILE A 1 321 ? -6.998  -33.041 11.040 1.00 31.55  ? 321  ILE A O     1 
ATOM   2664 C  CB    . ILE A 1 321 ? -7.255  -33.980 7.818  1.00 28.77  ? 321  ILE A CB    1 
ATOM   2665 C  CG1   . ILE A 1 321 ? -7.286  -33.284 6.449  1.00 29.96  ? 321  ILE A CG1   1 
ATOM   2666 C  CG2   . ILE A 1 321 ? -8.668  -34.025 8.415  1.00 26.60  ? 321  ILE A CG2   1 
ATOM   2667 C  CD1   . ILE A 1 321 ? -7.613  -31.772 6.504  1.00 25.50  ? 321  ILE A CD1   1 
ATOM   2668 N  N     . SER A 1 322 ? -5.930  -34.947 10.506 1.00 29.71  ? 322  SER A N     1 
ATOM   2669 C  CA    . SER A 1 322 ? -6.023  -35.491 11.861 1.00 29.63  ? 322  SER A CA    1 
ATOM   2670 C  C     . SER A 1 322 ? -5.413  -34.587 12.925 1.00 28.27  ? 322  SER A C     1 
ATOM   2671 O  O     . SER A 1 322 ? -5.965  -34.474 14.013 1.00 30.44  ? 322  SER A O     1 
ATOM   2672 C  CB    . SER A 1 322 ? -5.399  -36.880 11.932 1.00 31.74  ? 322  SER A CB    1 
ATOM   2673 O  OG    . SER A 1 322 ? -6.187  -37.822 11.230 1.00 33.01  ? 322  SER A OG    1 
ATOM   2674 N  N     . TYR A 1 323 ? -4.297  -33.934 12.604 1.00 27.35  ? 323  TYR A N     1 
ATOM   2675 C  CA    . TYR A 1 323 ? -3.639  -33.031 13.545 1.00 29.41  ? 323  TYR A CA    1 
ATOM   2676 C  C     . TYR A 1 323 ? -4.425  -31.748 13.742 1.00 30.11  ? 323  TYR A C     1 
ATOM   2677 O  O     . TYR A 1 323 ? -4.428  -31.177 14.847 1.00 29.67  ? 323  TYR A O     1 
ATOM   2678 C  CB    . TYR A 1 323 ? -2.176  -32.740 13.152 1.00 30.95  ? 323  TYR A CB    1 
ATOM   2679 C  CG    . TYR A 1 323 ? -1.208  -33.868 13.520 1.00 36.71  ? 323  TYR A CG    1 
ATOM   2680 C  CD1   . TYR A 1 323 ? 0.133   -33.816 13.131 1.00 39.12  ? 323  TYR A CD1   1 
ATOM   2681 C  CD2   . TYR A 1 323 ? -1.643  -35.002 14.228 1.00 33.99  ? 323  TYR A CD2   1 
ATOM   2682 C  CE1   . TYR A 1 323 ? 1.022   -34.846 13.458 1.00 39.89  ? 323  TYR A CE1   1 
ATOM   2683 C  CE2   . TYR A 1 323 ? -0.766  -36.034 14.557 1.00 38.24  ? 323  TYR A CE2   1 
ATOM   2684 C  CZ    . TYR A 1 323 ? 0.565   -35.950 14.168 1.00 41.86  ? 323  TYR A CZ    1 
ATOM   2685 O  OH    . TYR A 1 323 ? 1.439   -36.970 14.484 1.00 45.15  ? 323  TYR A OH    1 
ATOM   2686 N  N     . ASN A 1 324 ? -5.101  -31.307 12.682 1.00 27.19  ? 324  ASN A N     1 
ATOM   2687 C  CA    . ASN A 1 324 ? -6.012  -30.163 12.767 1.00 29.67  ? 324  ASN A CA    1 
ATOM   2688 C  C     . ASN A 1 324 ? -7.133  -30.423 13.784 1.00 28.64  ? 324  ASN A C     1 
ATOM   2689 O  O     . ASN A 1 324 ? -7.449  -29.566 14.596 1.00 29.38  ? 324  ASN A O     1 
ATOM   2690 C  CB    . ASN A 1 324 ? -6.598  -29.843 11.391 1.00 28.74  ? 324  ASN A CB    1 
ATOM   2691 C  CG    . ASN A 1 324 ? -7.520  -28.643 11.408 1.00 35.49  ? 324  ASN A CG    1 
ATOM   2692 O  OD1   . ASN A 1 324 ? -8.653  -28.728 10.939 1.00 38.95  ? 324  ASN A OD1   1 
ATOM   2693 N  ND2   . ASN A 1 324 ? -7.040  -27.513 11.939 1.00 35.62  ? 324  ASN A ND2   1 
ATOM   2694 N  N     . ILE A 1 325 ? -7.695  -31.627 13.734 1.00 28.31  ? 325  ILE A N     1 
ATOM   2695 C  CA    . ILE A 1 325 ? -8.734  -32.074 14.651 1.00 27.72  ? 325  ILE A CA    1 
ATOM   2696 C  C     . ILE A 1 325 ? -8.188  -32.232 16.076 1.00 29.24  ? 325  ILE A C     1 
ATOM   2697 O  O     . ILE A 1 325 ? -8.842  -31.836 17.044 1.00 27.78  ? 325  ILE A O     1 
ATOM   2698 C  CB    . ILE A 1 325 ? -9.311  -33.431 14.186 1.00 27.20  ? 325  ILE A CB    1 
ATOM   2699 C  CG1   . ILE A 1 325 ? -9.880  -33.317 12.762 1.00 24.39  ? 325  ILE A CG1   1 
ATOM   2700 C  CG2   . ILE A 1 325 ? -10.351 -33.965 15.174 1.00 27.99  ? 325  ILE A CG2   1 
ATOM   2701 C  CD1   . ILE A 1 325 ? -10.101 -34.661 12.079 1.00 18.12  ? 325  ILE A CD1   1 
ATOM   2702 N  N     . ILE A 1 326 ? -7.005  -32.833 16.199 1.00 28.42  ? 326  ILE A N     1 
ATOM   2703 C  CA    . ILE A 1 326 ? -6.418  -33.086 17.515 1.00 27.00  ? 326  ILE A CA    1 
ATOM   2704 C  C     . ILE A 1 326 ? -6.072  -31.774 18.224 1.00 26.68  ? 326  ILE A C     1 
ATOM   2705 O  O     . ILE A 1 326 ? -6.291  -31.634 19.435 1.00 28.88  ? 326  ILE A O     1 
ATOM   2706 C  CB    . ILE A 1 326 ? -5.190  -34.017 17.438 1.00 26.59  ? 326  ILE A CB    1 
ATOM   2707 C  CG1   . ILE A 1 326 ? -5.623  -35.432 17.040 1.00 26.29  ? 326  ILE A CG1   1 
ATOM   2708 C  CG2   . ILE A 1 326 ? -4.446  -34.054 18.785 1.00 27.85  ? 326  ILE A CG2   1 
ATOM   2709 C  CD1   . ILE A 1 326 ? -4.465  -36.387 16.733 1.00 27.64  ? 326  ILE A CD1   1 
ATOM   2710 N  N     . ALA A 1 327 ? -5.564  -30.805 17.468 1.00 22.91  ? 327  ALA A N     1 
ATOM   2711 C  CA    . ALA A 1 327 ? -5.236  -29.513 18.050 1.00 24.02  ? 327  ALA A CA    1 
ATOM   2712 C  C     . ALA A 1 327 ? -6.480  -28.823 18.611 1.00 24.89  ? 327  ALA A C     1 
ATOM   2713 O  O     . ALA A 1 327 ? -6.407  -28.163 19.643 1.00 26.29  ? 327  ALA A O     1 
ATOM   2714 C  CB    . ALA A 1 327 ? -4.503  -28.620 17.054 1.00 21.43  ? 327  ALA A CB    1 
ATOM   2715 N  N     . VAL A 1 328 ? -7.620  -28.994 17.948 1.00 27.24  ? 328  VAL A N     1 
ATOM   2716 C  CA    . VAL A 1 328 ? -8.875  -28.448 18.453 1.00 28.50  ? 328  VAL A CA    1 
ATOM   2717 C  C     . VAL A 1 328 ? -9.310  -29.187 19.720 1.00 30.82  ? 328  VAL A C     1 
ATOM   2718 O  O     . VAL A 1 328 ? -9.727  -28.560 20.689 1.00 29.75  ? 328  VAL A O     1 
ATOM   2719 C  CB    . VAL A 1 328 ? -9.986  -28.455 17.382 1.00 31.96  ? 328  VAL A CB    1 
ATOM   2720 C  CG1   . VAL A 1 328 ? -11.340 -28.098 17.995 1.00 30.96  ? 328  VAL A CG1   1 
ATOM   2721 C  CG2   . VAL A 1 328 ? -9.641  -27.462 16.259 1.00 30.82  ? 328  VAL A CG2   1 
ATOM   2722 N  N     . TYR A 1 329 ? -9.176  -30.513 19.730 1.00 28.34  ? 329  TYR A N     1 
ATOM   2723 C  CA    . TYR A 1 329 ? -9.571  -31.293 20.900 1.00 28.38  ? 329  TYR A CA    1 
ATOM   2724 C  C     . TYR A 1 329 ? -8.708  -30.969 22.119 1.00 27.59  ? 329  TYR A C     1 
ATOM   2725 O  O     . TYR A 1 329 ? -9.192  -30.962 23.257 1.00 26.68  ? 329  TYR A O     1 
ATOM   2726 C  CB    . TYR A 1 329 ? -9.536  -32.796 20.592 1.00 27.04  ? 329  TYR A CB    1 
ATOM   2727 C  CG    . TYR A 1 329 ? -9.968  -33.687 21.733 1.00 28.25  ? 329  TYR A CG    1 
ATOM   2728 C  CD1   . TYR A 1 329 ? -11.132 -33.415 22.463 1.00 28.66  ? 329  TYR A CD1   1 
ATOM   2729 C  CD2   . TYR A 1 329 ? -9.221  -34.816 22.079 1.00 28.58  ? 329  TYR A CD2   1 
ATOM   2730 C  CE1   . TYR A 1 329 ? -11.535 -34.241 23.522 1.00 30.23  ? 329  TYR A CE1   1 
ATOM   2731 C  CE2   . TYR A 1 329 ? -9.624  -35.659 23.129 1.00 28.36  ? 329  TYR A CE2   1 
ATOM   2732 C  CZ    . TYR A 1 329 ? -10.778 -35.363 23.844 1.00 29.09  ? 329  TYR A CZ    1 
ATOM   2733 O  OH    . TYR A 1 329 ? -11.180 -36.177 24.882 1.00 25.91  ? 329  TYR A OH    1 
ATOM   2734 N  N     . ARG A 1 330 ? -7.434  -30.686 21.879 1.00 26.05  ? 330  ARG A N     1 
ATOM   2735 C  CA    . ARG A 1 330 ? -6.518  -30.405 22.974 1.00 26.49  ? 330  ARG A CA    1 
ATOM   2736 C  C     . ARG A 1 330 ? -6.908  -29.175 23.776 1.00 27.44  ? 330  ARG A C     1 
ATOM   2737 O  O     . ARG A 1 330 ? -6.774  -29.164 25.010 1.00 26.72  ? 330  ARG A O     1 
ATOM   2738 C  CB    . ARG A 1 330 ? -5.075  -30.331 22.481 1.00 26.58  ? 330  ARG A CB    1 
ATOM   2739 C  CG    . ARG A 1 330 ? -4.500  -31.712 22.298 1.00 28.13  ? 330  ARG A CG    1 
ATOM   2740 C  CD    . ARG A 1 330 ? -3.122  -31.686 21.733 1.00 35.23  ? 330  ARG A CD    1 
ATOM   2741 N  NE    . ARG A 1 330 ? -2.514  -33.008 21.834 1.00 40.50  ? 330  ARG A NE    1 
ATOM   2742 C  CZ    . ARG A 1 330 ? -1.207  -33.246 21.743 1.00 43.40  ? 330  ARG A CZ    1 
ATOM   2743 N  NH1   . ARG A 1 330 ? -0.336  -32.252 21.555 1.00 37.43  ? 330  ARG A NH1   1 
ATOM   2744 N  NH2   . ARG A 1 330 ? -0.771  -34.491 21.852 1.00 44.94  ? 330  ARG A NH2   1 
ATOM   2745 N  N     . VAL A 1 331 ? -7.413  -28.155 23.082 1.00 26.34  ? 331  VAL A N     1 
ATOM   2746 C  CA    . VAL A 1 331 ? -7.903  -26.961 23.753 1.00 26.33  ? 331  VAL A CA    1 
ATOM   2747 C  C     . VAL A 1 331 ? -9.092  -27.312 24.640 1.00 27.28  ? 331  VAL A C     1 
ATOM   2748 O  O     . VAL A 1 331 ? -9.213  -26.791 25.756 1.00 27.17  ? 331  VAL A O     1 
ATOM   2749 C  CB    . VAL A 1 331 ? -8.268  -25.831 22.756 1.00 28.76  ? 331  VAL A CB    1 
ATOM   2750 C  CG1   . VAL A 1 331 ? -8.776  -24.604 23.495 1.00 28.47  ? 331  VAL A CG1   1 
ATOM   2751 C  CG2   . VAL A 1 331 ? -7.062  -25.463 21.891 1.00 28.91  ? 331  VAL A CG2   1 
ATOM   2752 N  N     . LEU A 1 332 ? -9.963  -28.197 24.150 1.00 28.81  ? 332  LEU A N     1 
ATOM   2753 C  CA    . LEU A 1 332 ? -11.088 -28.688 24.953 1.00 28.25  ? 332  LEU A CA    1 
ATOM   2754 C  C     . LEU A 1 332 ? -10.610 -29.446 26.180 1.00 27.95  ? 332  LEU A C     1 
ATOM   2755 O  O     . LEU A 1 332 ? -11.168 -29.282 27.261 1.00 29.02  ? 332  LEU A O     1 
ATOM   2756 C  CB    . LEU A 1 332 ? -12.018 -29.598 24.145 1.00 27.82  ? 332  LEU A CB    1 
ATOM   2757 C  CG    . LEU A 1 332 ? -13.138 -29.036 23.257 1.00 31.57  ? 332  LEU A CG    1 
ATOM   2758 C  CD1   . LEU A 1 332 ? -13.688 -27.651 23.708 1.00 23.94  ? 332  LEU A CD1   1 
ATOM   2759 C  CD2   . LEU A 1 332 ? -12.692 -29.008 21.824 1.00 29.49  ? 332  LEU A CD2   1 
ATOM   2760 N  N     . GLN A 1 333 ? -9.579  -30.273 26.008 1.00 26.65  ? 333  GLN A N     1 
ATOM   2761 C  CA    . GLN A 1 333 ? -9.056  -31.068 27.105 1.00 26.59  ? 333  GLN A CA    1 
ATOM   2762 C  C     . GLN A 1 333 ? -8.424  -30.200 28.179 1.00 25.71  ? 333  GLN A C     1 
ATOM   2763 O  O     . GLN A 1 333 ? -8.579  -30.474 29.361 1.00 27.85  ? 333  GLN A O     1 
ATOM   2764 C  CB    . GLN A 1 333 ? -8.034  -32.089 26.607 1.00 28.52  ? 333  GLN A CB    1 
ATOM   2765 C  CG    . GLN A 1 333 ? -8.597  -33.155 25.696 1.00 30.25  ? 333  GLN A CG    1 
ATOM   2766 C  CD    . GLN A 1 333 ? -7.542  -34.140 25.280 1.00 30.10  ? 333  GLN A CD    1 
ATOM   2767 O  OE1   . GLN A 1 333 ? -7.526  -35.269 25.751 1.00 33.21  ? 333  GLN A OE1   1 
ATOM   2768 N  NE2   . GLN A 1 333 ? -6.640  -33.715 24.409 1.00 28.06  ? 333  GLN A NE2   1 
ATOM   2769 N  N     . ILE A 1 334 ? -7.707  -29.159 27.764 1.00 23.72  ? 334  ILE A N     1 
ATOM   2770 C  CA    . ILE A 1 334 ? -7.141  -28.213 28.705 1.00 24.08  ? 334  ILE A CA    1 
ATOM   2771 C  C     . ILE A 1 334 ? -8.276  -27.499 29.427 1.00 24.78  ? 334  ILE A C     1 
ATOM   2772 O  O     . ILE A 1 334 ? -8.252  -27.359 30.656 1.00 27.70  ? 334  ILE A O     1 
ATOM   2773 C  CB    . ILE A 1 334 ? -6.228  -27.180 28.009 1.00 24.85  ? 334  ILE A CB    1 
ATOM   2774 C  CG1   . ILE A 1 334 ? -4.963  -27.857 27.475 1.00 23.66  ? 334  ILE A CG1   1 
ATOM   2775 C  CG2   . ILE A 1 334 ? -5.867  -26.019 28.976 1.00 22.50  ? 334  ILE A CG2   1 
ATOM   2776 C  CD1   . ILE A 1 334 ? -4.074  -26.909 26.658 1.00 26.78  ? 334  ILE A CD1   1 
ATOM   2777 N  N     . ASP A 1 335 ? -9.283  -27.068 28.675 1.00 24.50  ? 335  ASP A N     1 
ATOM   2778 C  CA    . ASP A 1 335 ? -10.417 -26.413 29.311 1.00 27.65  ? 335  ASP A CA    1 
ATOM   2779 C  C     . ASP A 1 335 ? -11.170 -27.308 30.303 1.00 29.26  ? 335  ASP A C     1 
ATOM   2780 O  O     . ASP A 1 335 ? -11.625 -26.818 31.333 1.00 29.95  ? 335  ASP A O     1 
ATOM   2781 C  CB    . ASP A 1 335 ? -11.384 -25.782 28.309 1.00 28.10  ? 335  ASP A CB    1 
ATOM   2782 C  CG    . ASP A 1 335 ? -12.362 -24.829 28.988 1.00 32.07  ? 335  ASP A CG    1 
ATOM   2783 O  OD1   . ASP A 1 335 ? -11.895 -23.942 29.734 1.00 30.34  ? 335  ASP A OD1   1 
ATOM   2784 O  OD2   . ASP A 1 335 ? -13.589 -24.992 28.820 1.00 33.46  ? 335  ASP A OD2   1 
ATOM   2785 N  N     . ALA A 1 336 ? -11.281 -28.605 30.003 1.00 27.49  ? 336  ALA A N     1 
ATOM   2786 C  CA    . ALA A 1 336 ? -11.887 -29.564 30.932 1.00 27.77  ? 336  ALA A CA    1 
ATOM   2787 C  C     . ALA A 1 336 ? -11.149 -29.580 32.257 1.00 26.83  ? 336  ALA A C     1 
ATOM   2788 O  O     . ALA A 1 336 ? -11.762 -29.711 33.300 1.00 25.40  ? 336  ALA A O     1 
ATOM   2789 C  CB    . ALA A 1 336 ? -11.918 -30.978 30.337 1.00 28.66  ? 336  ALA A CB    1 
ATOM   2790 N  N     . LYS A 1 337 ? -9.830  -29.441 32.206 1.00 28.11  ? 337  LYS A N     1 
ATOM   2791 C  CA    . LYS A 1 337 ? -9.014  -29.447 33.415 1.00 26.99  ? 337  LYS A CA    1 
ATOM   2792 C  C     . LYS A 1 337 ? -9.102  -28.087 34.115 1.00 25.36  ? 337  LYS A C     1 
ATOM   2793 O  O     . LYS A 1 337 ? -9.368  -28.011 35.316 1.00 24.19  ? 337  LYS A O     1 
ATOM   2794 C  CB    . LYS A 1 337 ? -7.558  -29.799 33.054 1.00 26.14  ? 337  LYS A CB    1 
ATOM   2795 C  CG    . LYS A 1 337 ? -6.593  -29.819 34.221 1.00 28.58  ? 337  LYS A CG    1 
ATOM   2796 C  CD    . LYS A 1 337 ? -5.145  -29.903 33.758 1.00 28.84  ? 337  LYS A CD    1 
ATOM   2797 C  CE    . LYS A 1 337 ? -4.202  -29.895 34.958 1.00 34.94  ? 337  LYS A CE    1 
ATOM   2798 N  NZ    . LYS A 1 337 ? -2.837  -29.357 34.631 1.00 36.83  ? 337  LYS A NZ    1 
ATOM   2799 N  N     . ARG A 1 338 ? -8.895  -27.017 33.352 1.00 24.39  ? 338  ARG A N     1 
ATOM   2800 C  CA    . ARG A 1 338 ? -8.689  -25.685 33.934 1.00 25.79  ? 338  ARG A CA    1 
ATOM   2801 C  C     . ARG A 1 338 ? -9.976  -24.930 34.226 1.00 26.44  ? 338  ARG A C     1 
ATOM   2802 O  O     . ARG A 1 338 ? -10.050 -24.171 35.193 1.00 24.96  ? 338  ARG A O     1 
ATOM   2803 C  CB    . ARG A 1 338 ? -7.785  -24.834 33.034 1.00 24.81  ? 338  ARG A CB    1 
ATOM   2804 C  CG    . ARG A 1 338 ? -6.317  -25.222 33.083 1.00 28.62  ? 338  ARG A CG    1 
ATOM   2805 C  CD    . ARG A 1 338 ? -5.665  -24.966 34.442 1.00 27.50  ? 338  ARG A CD    1 
ATOM   2806 N  NE    . ARG A 1 338 ? -4.207  -24.991 34.322 1.00 25.61  ? 338  ARG A NE    1 
ATOM   2807 C  CZ    . ARG A 1 338 ? -3.375  -24.294 35.087 1.00 26.48  ? 338  ARG A CZ    1 
ATOM   2808 N  NH1   . ARG A 1 338 ? -3.845  -23.492 36.041 1.00 23.79  ? 338  ARG A NH1   1 
ATOM   2809 N  NH2   . ARG A 1 338 ? -2.064  -24.373 34.876 1.00 27.85  ? 338  ARG A NH2   1 
ATOM   2810 N  N     . GLN A 1 339 ? -10.967 -25.124 33.361 1.00 27.04  ? 339  GLN A N     1 
ATOM   2811 C  CA    . GLN A 1 339 ? -12.298 -24.541 33.520 1.00 29.32  ? 339  GLN A CA    1 
ATOM   2812 C  C     . GLN A 1 339 ? -12.335 -23.006 33.451 1.00 29.23  ? 339  GLN A C     1 
ATOM   2813 O  O     . GLN A 1 339 ? -13.032 -22.342 34.222 1.00 29.19  ? 339  GLN A O     1 
ATOM   2814 C  CB    . GLN A 1 339 ? -12.969 -25.106 34.772 1.00 29.47  ? 339  GLN A CB    1 
ATOM   2815 C  CG    . GLN A 1 339 ? -13.454 -26.535 34.521 1.00 35.23  ? 339  GLN A CG    1 
ATOM   2816 C  CD    . GLN A 1 339 ? -13.709 -27.334 35.776 1.00 34.46  ? 339  GLN A CD    1 
ATOM   2817 O  OE1   . GLN A 1 339 ? -13.619 -28.556 35.754 1.00 41.57  ? 339  GLN A OE1   1 
ATOM   2818 N  NE2   . GLN A 1 339 ? -14.035 -26.663 36.870 1.00 34.84  ? 339  GLN A NE2   1 
ATOM   2819 N  N     . PHE A 1 340 ? -11.588 -22.455 32.500 1.00 27.82  ? 340  PHE A N     1 
ATOM   2820 C  CA    . PHE A 1 340 ? -11.556 -21.007 32.316 1.00 28.71  ? 340  PHE A CA    1 
ATOM   2821 C  C     . PHE A 1 340 ? -12.830 -20.466 31.656 1.00 28.98  ? 340  PHE A C     1 
ATOM   2822 O  O     . PHE A 1 340 ? -13.245 -19.348 31.949 1.00 31.08  ? 340  PHE A O     1 
ATOM   2823 C  CB    . PHE A 1 340 ? -10.310 -20.568 31.536 1.00 24.87  ? 340  PHE A CB    1 
ATOM   2824 C  CG    . PHE A 1 340 ? -9.009  -20.893 32.225 1.00 26.78  ? 340  PHE A CG    1 
ATOM   2825 C  CD1   . PHE A 1 340 ? -8.893  -20.813 33.620 1.00 23.84  ? 340  PHE A CD1   1 
ATOM   2826 C  CD2   . PHE A 1 340 ? -7.883  -21.258 31.477 1.00 24.23  ? 340  PHE A CD2   1 
ATOM   2827 C  CE1   . PHE A 1 340 ? -7.683  -21.125 34.254 1.00 26.70  ? 340  PHE A CE1   1 
ATOM   2828 C  CE2   . PHE A 1 340 ? -6.670  -21.563 32.106 1.00 22.11  ? 340  PHE A CE2   1 
ATOM   2829 C  CZ    . PHE A 1 340 ? -6.569  -21.493 33.492 1.00 23.28  ? 340  PHE A CZ    1 
ATOM   2830 N  N     . ILE A 1 341 ? -13.447 -21.244 30.773 1.00 27.28  ? 341  ILE A N     1 
ATOM   2831 C  CA    . ILE A 1 341 ? -14.684 -20.792 30.152 1.00 29.84  ? 341  ILE A CA    1 
ATOM   2832 C  C     . ILE A 1 341 ? -15.783 -20.692 31.208 1.00 28.86  ? 341  ILE A C     1 
ATOM   2833 O  O     . ILE A 1 341 ? -16.525 -19.713 31.225 1.00 30.40  ? 341  ILE A O     1 
ATOM   2834 C  CB    . ILE A 1 341 ? -15.137 -21.675 28.968 1.00 31.12  ? 341  ILE A CB    1 
ATOM   2835 C  CG1   . ILE A 1 341 ? -14.061 -21.741 27.878 1.00 29.83  ? 341  ILE A CG1   1 
ATOM   2836 C  CG2   . ILE A 1 341 ? -16.433 -21.132 28.364 1.00 34.03  ? 341  ILE A CG2   1 
ATOM   2837 C  CD1   . ILE A 1 341 ? -14.022 -20.544 26.979 1.00 26.51  ? 341  ILE A CD1   1 
ATOM   2838 N  N     . ASN A 1 342 ? -15.864 -21.691 32.091 1.00 28.55  ? 342  ASN A N     1 
ATOM   2839 C  CA    . ASN A 1 342 ? -16.795 -21.663 33.219 1.00 28.23  ? 342  ASN A CA    1 
ATOM   2840 C  C     . ASN A 1 342 ? -16.564 -20.426 34.099 1.00 27.83  ? 342  ASN A C     1 
ATOM   2841 O  O     . ASN A 1 342 ? -17.502 -19.703 34.438 1.00 28.69  ? 342  ASN A O     1 
ATOM   2842 C  CB    . ASN A 1 342 ? -16.691 -22.949 34.052 1.00 28.49  ? 342  ASN A CB    1 
ATOM   2843 C  CG    . ASN A 1 342 ? -17.562 -22.908 35.301 1.00 32.57  ? 342  ASN A CG    1 
ATOM   2844 O  OD1   . ASN A 1 342 ? -18.785 -23.080 35.226 1.00 35.51  ? 342  ASN A OD1   1 
ATOM   2845 N  ND2   . ASN A 1 342 ? -16.937 -22.662 36.459 1.00 29.95  ? 342  ASN A ND2   1 
ATOM   2846 N  N     . LEU A 1 343 ? -15.302 -20.191 34.449 1.00 27.60  ? 343  LEU A N     1 
ATOM   2847 C  CA    . LEU A 1 343 ? -14.903 -19.024 35.217 1.00 26.67  ? 343  LEU A CA    1 
ATOM   2848 C  C     . LEU A 1 343 ? -15.373 -17.742 34.540 1.00 27.70  ? 343  LEU A C     1 
ATOM   2849 O  O     . LEU A 1 343 ? -15.953 -16.880 35.183 1.00 26.10  ? 343  LEU A O     1 
ATOM   2850 C  CB    . LEU A 1 343 ? -13.387 -18.997 35.383 1.00 25.30  ? 343  LEU A CB    1 
ATOM   2851 C  CG    . LEU A 1 343 ? -12.788 -17.764 36.065 1.00 28.19  ? 343  LEU A CG    1 
ATOM   2852 C  CD1   . LEU A 1 343 ? -13.103 -17.746 37.572 1.00 28.76  ? 343  LEU A CD1   1 
ATOM   2853 C  CD2   . LEU A 1 343 ? -11.285 -17.698 35.812 1.00 26.28  ? 343  LEU A CD2   1 
ATOM   2854 N  N     . SER A 1 344 ? -15.126 -17.642 33.235 1.00 27.65  ? 344  SER A N     1 
ATOM   2855 C  CA    . SER A 1 344 ? -15.496 -16.474 32.461 1.00 26.81  ? 344  SER A CA    1 
ATOM   2856 C  C     . SER A 1 344 ? -16.996 -16.225 32.475 1.00 26.35  ? 344  SER A C     1 
ATOM   2857 O  O     . SER A 1 344 ? -17.431 -15.079 32.660 1.00 26.77  ? 344  SER A O     1 
ATOM   2858 C  CB    . SER A 1 344 ? -14.975 -16.586 31.020 1.00 25.36  ? 344  SER A CB    1 
ATOM   2859 O  OG    . SER A 1 344 ? -13.557 -16.592 31.027 1.00 25.46  ? 344  SER A OG    1 
ATOM   2860 N  N     . LEU A 1 345 ? -17.778 -17.288 32.286 1.00 23.91  ? 345  LEU A N     1 
ATOM   2861 C  CA    . LEU A 1 345 ? -19.229 -17.156 32.277 1.00 24.79  ? 345  LEU A CA    1 
ATOM   2862 C  C     . LEU A 1 345 ? -19.700 -16.765 33.678 1.00 26.58  ? 345  LEU A C     1 
ATOM   2863 O  O     . LEU A 1 345 ? -20.480 -15.818 33.830 1.00 27.86  ? 345  LEU A O     1 
ATOM   2864 C  CB    . LEU A 1 345 ? -19.919 -18.432 31.769 1.00 23.44  ? 345  LEU A CB    1 
ATOM   2865 C  CG    . LEU A 1 345 ? -19.637 -18.864 30.323 1.00 26.34  ? 345  LEU A CG    1 
ATOM   2866 C  CD1   . LEU A 1 345 ? -20.135 -20.283 30.037 1.00 22.86  ? 345  LEU A CD1   1 
ATOM   2867 C  CD2   . LEU A 1 345 ? -20.200 -17.885 29.296 1.00 27.97  ? 345  LEU A CD2   1 
ATOM   2868 N  N     . ASP A 1 346 ? -19.184 -17.447 34.698 1.00 24.95  ? 346  ASP A N     1 
ATOM   2869 C  CA    . ASP A 1 346 ? -19.507 -17.100 36.077 1.00 29.88  ? 346  ASP A CA    1 
ATOM   2870 C  C     . ASP A 1 346 ? -19.308 -15.618 36.338 1.00 29.42  ? 346  ASP A C     1 
ATOM   2871 O  O     . ASP A 1 346 ? -20.173 -14.970 36.918 1.00 29.37  ? 346  ASP A O     1 
ATOM   2872 C  CB    . ASP A 1 346 ? -18.641 -17.900 37.054 1.00 33.82  ? 346  ASP A CB    1 
ATOM   2873 C  CG    . ASP A 1 346 ? -19.263 -19.226 37.446 1.00 37.99  ? 346  ASP A CG    1 
ATOM   2874 O  OD1   . ASP A 1 346 ? -20.246 -19.663 36.803 1.00 39.77  ? 346  ASP A OD1   1 
ATOM   2875 O  OD2   . ASP A 1 346 ? -18.756 -19.839 38.413 1.00 45.23  ? 346  ASP A OD2   1 
ATOM   2876 N  N     . MET A 1 347 ? -18.176 -15.091 35.871 1.00 30.61  ? 347  MET A N     1 
ATOM   2877 C  CA    . MET A 1 347 ? -17.746 -13.722 36.157 1.00 30.09  ? 347  MET A CA    1 
ATOM   2878 C  C     . MET A 1 347 ? -18.534 -12.713 35.345 1.00 28.56  ? 347  MET A C     1 
ATOM   2879 O  O     . MET A 1 347 ? -18.979 -11.695 35.875 1.00 28.27  ? 347  MET A O     1 
ATOM   2880 C  CB    . MET A 1 347 ? -16.255 -13.562 35.858 1.00 31.14  ? 347  MET A CB    1 
ATOM   2881 C  CG    . MET A 1 347 ? -15.299 -14.068 36.951 1.00 40.54  ? 347  MET A CG    1 
ATOM   2882 S  SD    . MET A 1 347 ? -13.531 -13.783 36.543 1.00 53.03  ? 347  MET A SD    1 
ATOM   2883 C  CE    . MET A 1 347 ? -13.469 -11.991 36.455 1.00 43.26  ? 347  MET A CE    1 
ATOM   2884 N  N     . GLY A 1 348 ? -18.696 -12.994 34.056 1.00 26.02  ? 348  GLY A N     1 
ATOM   2885 C  CA    . GLY A 1 348 ? -19.460 -12.124 33.168 1.00 22.99  ? 348  GLY A CA    1 
ATOM   2886 C  C     . GLY A 1 348 ? -20.875 -11.904 33.682 1.00 25.08  ? 348  GLY A C     1 
ATOM   2887 O  O     . GLY A 1 348 ? -21.331 -10.763 33.793 1.00 26.54  ? 348  GLY A O     1 
ATOM   2888 N  N     . TYR A 1 349 ? -21.565 -13.000 33.996 1.00 26.00  ? 349  TYR A N     1 
ATOM   2889 C  CA    . TYR A 1 349 ? -22.960 -12.944 34.438 1.00 26.63  ? 349  TYR A CA    1 
ATOM   2890 C  C     . TYR A 1 349 ? -23.154 -12.369 35.832 1.00 27.50  ? 349  TYR A C     1 
ATOM   2891 O  O     . TYR A 1 349 ? -24.133 -11.673 36.066 1.00 26.89  ? 349  TYR A O     1 
ATOM   2892 C  CB    . TYR A 1 349 ? -23.620 -14.308 34.314 1.00 27.23  ? 349  TYR A CB    1 
ATOM   2893 C  CG    . TYR A 1 349 ? -23.880 -14.671 32.876 1.00 25.95  ? 349  TYR A CG    1 
ATOM   2894 C  CD1   . TYR A 1 349 ? -24.729 -13.897 32.096 1.00 27.54  ? 349  TYR A CD1   1 
ATOM   2895 C  CD2   . TYR A 1 349 ? -23.259 -15.761 32.284 1.00 24.34  ? 349  TYR A CD2   1 
ATOM   2896 C  CE1   . TYR A 1 349 ? -24.958 -14.198 30.762 1.00 23.72  ? 349  TYR A CE1   1 
ATOM   2897 C  CE2   . TYR A 1 349 ? -23.492 -16.075 30.944 1.00 24.73  ? 349  TYR A CE2   1 
ATOM   2898 C  CZ    . TYR A 1 349 ? -24.350 -15.283 30.200 1.00 20.67  ? 349  TYR A CZ    1 
ATOM   2899 O  OH    . TYR A 1 349 ? -24.614 -15.574 28.893 1.00 25.32  ? 349  TYR A OH    1 
ATOM   2900 N  N     . TYR A 1 350 ? -22.223 -12.647 36.744 1.00 25.70  ? 350  TYR A N     1 
ATOM   2901 C  CA    . TYR A 1 350 ? -22.227 -12.031 38.066 1.00 28.71  ? 350  TYR A CA    1 
ATOM   2902 C  C     . TYR A 1 350 ? -22.123 -10.486 37.970 1.00 31.09  ? 350  TYR A C     1 
ATOM   2903 O  O     . TYR A 1 350 ? -22.842 -9.754  38.654 1.00 32.74  ? 350  TYR A O     1 
ATOM   2904 C  CB    . TYR A 1 350 ? -21.069 -12.602 38.893 1.00 29.43  ? 350  TYR A CB    1 
ATOM   2905 C  CG    . TYR A 1 350 ? -20.947 -12.051 40.299 1.00 30.63  ? 350  TYR A CG    1 
ATOM   2906 C  CD1   . TYR A 1 350 ? -21.574 -12.682 41.372 1.00 32.11  ? 350  TYR A CD1   1 
ATOM   2907 C  CD2   . TYR A 1 350 ? -20.195 -10.907 40.555 1.00 27.59  ? 350  TYR A CD2   1 
ATOM   2908 C  CE1   . TYR A 1 350 ? -21.455 -12.184 42.661 1.00 32.47  ? 350  TYR A CE1   1 
ATOM   2909 C  CE2   . TYR A 1 350 ? -20.072 -10.398 41.833 1.00 28.57  ? 350  TYR A CE2   1 
ATOM   2910 C  CZ    . TYR A 1 350 ? -20.702 -11.042 42.884 1.00 32.54  ? 350  TYR A CZ    1 
ATOM   2911 O  OH    . TYR A 1 350 ? -20.578 -10.538 44.154 1.00 29.87  ? 350  TYR A OH    1 
ATOM   2912 N  N     . ALA A 1 351 ? -21.225 -10.010 37.111 1.00 29.38  ? 351  ALA A N     1 
ATOM   2913 C  CA    . ALA A 1 351 ? -20.956 -8.591  36.970 1.00 29.31  ? 351  ALA A CA    1 
ATOM   2914 C  C     . ALA A 1 351 ? -21.955 -7.890  36.048 1.00 31.69  ? 351  ALA A C     1 
ATOM   2915 O  O     . ALA A 1 351 ? -22.151 -6.676  36.156 1.00 32.99  ? 351  ALA A O     1 
ATOM   2916 C  CB    . ALA A 1 351 ? -19.554 -8.388  36.466 1.00 27.74  ? 351  ALA A CB    1 
ATOM   2917 N  N     . LYS A 1 352 ? -22.576 -8.662  35.153 1.00 31.26  ? 352  LYS A N     1 
ATOM   2918 C  CA    . LYS A 1 352 ? -23.488 -8.153  34.119 1.00 31.68  ? 352  LYS A CA    1 
ATOM   2919 C  C     . LYS A 1 352 ? -22.751 -7.360  33.038 1.00 30.26  ? 352  LYS A C     1 
ATOM   2920 O  O     . LYS A 1 352 ? -23.078 -6.210  32.742 1.00 32.64  ? 352  LYS A O     1 
ATOM   2921 C  CB    . LYS A 1 352 ? -24.676 -7.382  34.727 1.00 31.98  ? 352  LYS A CB    1 
ATOM   2922 C  CG    . LYS A 1 352 ? -25.753 -8.292  35.313 1.00 34.09  ? 352  LYS A CG    1 
ATOM   2923 C  CD    . LYS A 1 352 ? -26.935 -7.525  35.952 1.00 33.64  ? 352  LYS A CD    1 
ATOM   2924 C  CE    . LYS A 1 352 ? -27.648 -8.469  36.917 1.00 37.68  ? 352  LYS A CE    1 
ATOM   2925 N  NZ    . LYS A 1 352 ? -28.565 -7.814  37.905 1.00 39.92  ? 352  LYS A NZ    1 
ATOM   2926 N  N     . ILE A 1 353 ? -21.740 -7.993  32.459 1.00 30.47  ? 353  ILE A N     1 
ATOM   2927 C  CA    . ILE A 1 353 ? -20.919 -7.371  31.432 1.00 30.23  ? 353  ILE A CA    1 
ATOM   2928 C  C     . ILE A 1 353 ? -20.903 -8.240  30.189 1.00 29.02  ? 353  ILE A C     1 
ATOM   2929 O  O     . ILE A 1 353 ? -21.406 -9.356  30.210 1.00 29.24  ? 353  ILE A O     1 
ATOM   2930 C  CB    . ILE A 1 353 ? -19.458 -7.147  31.911 1.00 30.51  ? 353  ILE A CB    1 
ATOM   2931 C  CG1   . ILE A 1 353 ? -18.849 -8.438  32.472 1.00 33.02  ? 353  ILE A CG1   1 
ATOM   2932 C  CG2   . ILE A 1 353 ? -19.397 -6.039  32.935 1.00 29.49  ? 353  ILE A CG2   1 
ATOM   2933 C  CD1   . ILE A 1 353 ? -17.367 -8.314  32.887 1.00 32.97  ? 353  ILE A CD1   1 
ATOM   2934 N  N     . GLN A 1 354 ? -20.321 -7.728  29.108 1.00 29.22  ? 354  GLN A N     1 
ATOM   2935 C  CA    . GLN A 1 354 ? -19.999 -8.572  27.968 1.00 28.64  ? 354  GLN A CA    1 
ATOM   2936 C  C     . GLN A 1 354 ? -19.017 -9.605  28.503 1.00 28.88  ? 354  GLN A C     1 
ATOM   2937 O  O     . GLN A 1 354 ? -18.150 -9.277  29.327 1.00 27.61  ? 354  GLN A O     1 
ATOM   2938 C  CB    . GLN A 1 354 ? -19.336 -7.764  26.860 1.00 28.08  ? 354  GLN A CB    1 
ATOM   2939 C  CG    . GLN A 1 354 ? -20.187 -6.655  26.258 1.00 29.51  ? 354  GLN A CG    1 
ATOM   2940 C  CD    . GLN A 1 354 ? -19.464 -5.933  25.127 1.00 36.54  ? 354  GLN A CD    1 
ATOM   2941 O  OE1   . GLN A 1 354 ? -19.880 -5.990  23.968 1.00 38.93  ? 354  GLN A OE1   1 
ATOM   2942 N  NE2   . GLN A 1 354 ? -18.367 -5.266  25.456 1.00 36.64  ? 354  GLN A NE2   1 
ATOM   2943 N  N     . ILE A 1 355 ? -19.153 -10.849 28.058 1.00 28.32  ? 355  ILE A N     1 
ATOM   2944 C  CA    . ILE A 1 355 ? -18.273 -11.909 28.560 1.00 29.45  ? 355  ILE A CA    1 
ATOM   2945 C  C     . ILE A 1 355 ? -16.776 -11.613 28.320 1.00 29.79  ? 355  ILE A C     1 
ATOM   2946 O  O     . ILE A 1 355 ? -15.955 -11.879 29.208 1.00 29.40  ? 355  ILE A O     1 
ATOM   2947 C  CB    . ILE A 1 355 ? -18.677 -13.313 28.049 1.00 26.50  ? 355  ILE A CB    1 
ATOM   2948 C  CG1   . ILE A 1 355 ? -20.159 -13.614 28.333 1.00 26.51  ? 355  ILE A CG1   1 
ATOM   2949 C  CG2   . ILE A 1 355 ? -17.782 -14.382 28.631 1.00 30.44  ? 355  ILE A CG2   1 
ATOM   2950 C  CD1   . ILE A 1 355 ? -20.599 -13.521 29.776 1.00 31.26  ? 355  ILE A CD1   1 
ATOM   2951 N  N     . GLN A 1 356 ? -16.434 -11.033 27.162 1.00 26.25  ? 356  GLN A N     1 
ATOM   2952 C  CA    . GLN A 1 356 ? -15.027 -10.714 26.851 1.00 27.48  ? 356  GLN A CA    1 
ATOM   2953 C  C     . GLN A 1 356 ? -14.397 -9.654  27.767 1.00 29.23  ? 356  GLN A C     1 
ATOM   2954 O  O     . GLN A 1 356 ? -13.176 -9.494  27.778 1.00 33.18  ? 356  GLN A O     1 
ATOM   2955 C  CB    . GLN A 1 356 ? -14.816 -10.343 25.376 1.00 24.79  ? 356  GLN A CB    1 
ATOM   2956 C  CG    . GLN A 1 356 ? -15.467 -9.022  24.925 1.00 28.06  ? 356  GLN A CG    1 
ATOM   2957 C  CD    . GLN A 1 356 ? -16.852 -9.230  24.319 1.00 28.22  ? 356  GLN A CD    1 
ATOM   2958 O  OE1   . GLN A 1 356 ? -17.598 -10.114 24.740 1.00 26.85  ? 356  GLN A OE1   1 
ATOM   2959 N  NE2   . GLN A 1 356 ? -17.192 -8.422  23.317 1.00 25.34  ? 356  GLN A NE2   1 
ATOM   2960 N  N     . SER A 1 357 ? -15.221 -8.958  28.547 1.00 27.85  ? 357  SER A N     1 
ATOM   2961 C  CA    . SER A 1 357 ? -14.730 -7.935  29.479 1.00 29.40  ? 357  SER A CA    1 
ATOM   2962 C  C     . SER A 1 357 ? -14.146 -8.516  30.761 1.00 29.72  ? 357  SER A C     1 
ATOM   2963 O  O     . SER A 1 357 ? -13.580 -7.772  31.567 1.00 30.03  ? 357  SER A O     1 
ATOM   2964 C  CB    . SER A 1 357 ? -15.846 -6.943  29.848 1.00 29.29  ? 357  SER A CB    1 
ATOM   2965 O  OG    . SER A 1 357 ? -16.237 -6.171  28.730 1.00 32.34  ? 357  SER A OG    1 
ATOM   2966 N  N     . VAL A 1 358 ? -14.287 -9.832  30.957 1.00 27.72  ? 358  VAL A N     1 
ATOM   2967 C  CA    . VAL A 1 358 ? -13.735 -10.487 32.141 1.00 27.42  ? 358  VAL A CA    1 
ATOM   2968 C  C     . VAL A 1 358 ? -12.210 -10.321 32.188 1.00 29.13  ? 358  VAL A C     1 
ATOM   2969 O  O     . VAL A 1 358 ? -11.586 -10.550 33.231 1.00 28.03  ? 358  VAL A O     1 
ATOM   2970 C  CB    . VAL A 1 358 ? -14.151 -12.001 32.283 1.00 27.78  ? 358  VAL A CB    1 
ATOM   2971 C  CG1   . VAL A 1 358 ? -15.686 -12.146 32.444 1.00 25.69  ? 358  VAL A CG1   1 
ATOM   2972 C  CG2   . VAL A 1 358 ? -13.619 -12.863 31.125 1.00 25.67  ? 358  VAL A CG2   1 
ATOM   2973 N  N     . PHE A 1 359 ? -11.629 -9.913  31.056 1.00 26.99  ? 359  PHE A N     1 
ATOM   2974 C  CA    . PHE A 1 359 ? -10.201 -9.609  30.977 1.00 28.74  ? 359  PHE A CA    1 
ATOM   2975 C  C     . PHE A 1 359 ? -9.855  -8.329  31.709 1.00 27.13  ? 359  PHE A C     1 
ATOM   2976 O  O     . PHE A 1 359 ? -8.714  -8.141  32.089 1.00 27.28  ? 359  PHE A O     1 
ATOM   2977 C  CB    . PHE A 1 359 ? -9.732  -9.504  29.518 1.00 28.15  ? 359  PHE A CB    1 
ATOM   2978 C  CG    . PHE A 1 359 ? -9.733  -10.822 28.789 1.00 30.28  ? 359  PHE A CG    1 
ATOM   2979 C  CD1   . PHE A 1 359 ? -8.885  -11.854 29.186 1.00 29.10  ? 359  PHE A CD1   1 
ATOM   2980 C  CD2   . PHE A 1 359 ? -10.576 -11.031 27.707 1.00 28.40  ? 359  PHE A CD2   1 
ATOM   2981 C  CE1   . PHE A 1 359 ? -8.881  -13.078 28.518 1.00 30.64  ? 359  PHE A CE1   1 
ATOM   2982 C  CE2   . PHE A 1 359 ? -10.571 -12.254 27.027 1.00 31.04  ? 359  PHE A CE2   1 
ATOM   2983 C  CZ    . PHE A 1 359 ? -9.726  -13.275 27.437 1.00 30.48  ? 359  PHE A CZ    1 
ATOM   2984 N  N     . SER A 1 360 ? -10.845 -7.457  31.894 1.00 24.81  ? 360  SER A N     1 
ATOM   2985 C  CA    . SER A 1 360 ? -10.643 -6.150  32.522 1.00 24.00  ? 360  SER A CA    1 
ATOM   2986 C  C     . SER A 1 360 ? -11.320 -6.069  33.896 1.00 23.38  ? 360  SER A C     1 
ATOM   2987 O  O     . SER A 1 360 ? -12.542 -6.034  33.983 1.00 23.15  ? 360  SER A O     1 
ATOM   2988 C  CB    . SER A 1 360 ? -11.196 -5.053  31.617 1.00 23.65  ? 360  SER A CB    1 
ATOM   2989 O  OG    . SER A 1 360 ? -11.228 -3.820  32.303 1.00 27.17  ? 360  SER A OG    1 
ATOM   2990 N  N     . PRO A 1 361 ? -10.530 -6.066  34.975 1.00 23.94  ? 361  PRO A N     1 
ATOM   2991 C  CA    . PRO A 1 361 ? -11.132 -5.924  36.307 1.00 25.78  ? 361  PRO A CA    1 
ATOM   2992 C  C     . PRO A 1 361 ? -11.760 -4.548  36.530 1.00 28.80  ? 361  PRO A C     1 
ATOM   2993 O  O     . PRO A 1 361 ? -12.673 -4.411  37.356 1.00 31.27  ? 361  PRO A O     1 
ATOM   2994 C  CB    . PRO A 1 361 ? -9.950  -6.144  37.260 1.00 25.09  ? 361  PRO A CB    1 
ATOM   2995 C  CG    . PRO A 1 361 ? -8.721  -6.055  36.407 1.00 25.50  ? 361  PRO A CG    1 
ATOM   2996 C  CD    . PRO A 1 361 ? -9.129  -6.512  35.049 1.00 23.21  ? 361  PRO A CD    1 
ATOM   2997 N  N     . ILE A 1 362 ? -11.286 -3.549  35.788 1.00 26.14  ? 362  ILE A N     1 
ATOM   2998 C  CA    . ILE A 1 362 ? -11.867 -2.216  35.837 1.00 27.05  ? 362  ILE A CA    1 
ATOM   2999 C  C     . ILE A 1 362 ? -13.276 -2.200  35.255 1.00 28.57  ? 362  ILE A C     1 
ATOM   3000 O  O     . ILE A 1 362 ? -14.193 -1.609  35.851 1.00 29.37  ? 362  ILE A O     1 
ATOM   3001 C  CB    . ILE A 1 362 ? -10.956 -1.147  35.157 1.00 27.50  ? 362  ILE A CB    1 
ATOM   3002 C  CG1   . ILE A 1 362 ? -9.845  -0.718  36.122 1.00 23.79  ? 362  ILE A CG1   1 
ATOM   3003 C  CG2   . ILE A 1 362 ? -11.762 0.095   34.718 1.00 25.41  ? 362  ILE A CG2   1 
ATOM   3004 C  CD1   . ILE A 1 362 ? -8.813  0.185   35.478 1.00 27.76  ? 362  ILE A CD1   1 
ATOM   3005 N  N     . LYS A 1 363 ? -13.461 -2.843  34.104 1.00 26.87  ? 363  LYS A N     1 
ATOM   3006 C  CA    . LYS A 1 363 ? -14.793 -2.903  33.518 1.00 27.29  ? 363  LYS A CA    1 
ATOM   3007 C  C     . LYS A 1 363 ? -15.689 -3.750  34.429 1.00 26.40  ? 363  LYS A C     1 
ATOM   3008 O  O     . LYS A 1 363 ? -16.819 -3.365  34.739 1.00 26.12  ? 363  LYS A O     1 
ATOM   3009 C  CB    . LYS A 1 363 ? -14.740 -3.430  32.079 1.00 27.01  ? 363  LYS A CB    1 
ATOM   3010 C  CG    . LYS A 1 363 ? -16.092 -3.572  31.375 1.00 30.02  ? 363  LYS A CG    1 
ATOM   3011 C  CD    . LYS A 1 363 ? -16.847 -2.251  31.203 1.00 36.26  ? 363  LYS A CD    1 
ATOM   3012 C  CE    . LYS A 1 363 ? -16.289 -1.392  30.077 1.00 37.98  ? 363  LYS A CE    1 
ATOM   3013 N  NZ    . LYS A 1 363 ? -17.048 -0.099  29.962 1.00 34.85  ? 363  LYS A NZ    1 
ATOM   3014 N  N     . THR A 1 364 ? -15.150 -4.876  34.884 1.00 23.47  ? 364  THR A N     1 
ATOM   3015 C  CA    . THR A 1 364 ? -15.851 -5.779  35.786 1.00 24.17  ? 364  THR A CA    1 
ATOM   3016 C  C     . THR A 1 364 ? -16.341 -5.073  37.045 1.00 24.07  ? 364  THR A C     1 
ATOM   3017 O  O     . THR A 1 364 ? -17.511 -5.182  37.386 1.00 25.99  ? 364  THR A O     1 
ATOM   3018 C  CB    . THR A 1 364 ? -14.953 -6.972  36.184 1.00 24.07  ? 364  THR A CB    1 
ATOM   3019 O  OG1   . THR A 1 364 ? -14.619 -7.719  35.008 1.00 24.90  ? 364  THR A OG1   1 
ATOM   3020 C  CG2   . THR A 1 364 ? -15.673 -7.883  37.167 1.00 23.73  ? 364  THR A CG2   1 
ATOM   3021 N  N     . TRP A 1 365 ? -15.453 -4.343  37.720 1.00 25.29  ? 365  TRP A N     1 
ATOM   3022 C  CA    . TRP A 1 365 ? -15.823 -3.670  38.970 1.00 25.21  ? 365  TRP A CA    1 
ATOM   3023 C  C     . TRP A 1 365 ? -16.686 -2.439  38.753 1.00 25.63  ? 365  TRP A C     1 
ATOM   3024 O  O     . TRP A 1 365 ? -17.496 -2.124  39.607 1.00 29.47  ? 365  TRP A O     1 
ATOM   3025 C  CB    . TRP A 1 365 ? -14.602 -3.346  39.841 1.00 24.86  ? 365  TRP A CB    1 
ATOM   3026 C  CG    . TRP A 1 365 ? -14.063 -4.540  40.595 1.00 24.08  ? 365  TRP A CG    1 
ATOM   3027 C  CD1   . TRP A 1 365 ? -12.867 -5.184  40.379 1.00 23.34  ? 365  TRP A CD1   1 
ATOM   3028 C  CD2   . TRP A 1 365 ? -14.697 -5.227  41.685 1.00 24.88  ? 365  TRP A CD2   1 
ATOM   3029 N  NE1   . TRP A 1 365 ? -12.722 -6.219  41.274 1.00 25.10  ? 365  TRP A NE1   1 
ATOM   3030 C  CE2   . TRP A 1 365 ? -13.829 -6.271  42.083 1.00 25.30  ? 365  TRP A CE2   1 
ATOM   3031 C  CE3   . TRP A 1 365 ? -15.911 -5.054  42.371 1.00 26.57  ? 365  TRP A CE3   1 
ATOM   3032 C  CZ2   . TRP A 1 365 ? -14.143 -7.149  43.122 1.00 25.26  ? 365  TRP A CZ2   1 
ATOM   3033 C  CZ3   . TRP A 1 365 ? -16.223 -5.924  43.407 1.00 25.60  ? 365  TRP A CZ3   1 
ATOM   3034 C  CH2   . TRP A 1 365 ? -15.341 -6.965  43.768 1.00 29.41  ? 365  TRP A CH2   1 
ATOM   3035 N  N     . ASP A 1 366 ? -16.527 -1.745  37.623 1.00 25.19  ? 366  ASP A N     1 
ATOM   3036 C  CA    . ASP A 1 366 ? -17.425 -0.632  37.295 1.00 26.47  ? 366  ASP A CA    1 
ATOM   3037 C  C     . ASP A 1 366 ? -18.863 -1.145  37.195 1.00 27.06  ? 366  ASP A C     1 
ATOM   3038 O  O     . ASP A 1 366 ? -19.788 -0.487  37.664 1.00 29.90  ? 366  ASP A O     1 
ATOM   3039 C  CB    . ASP A 1 366 ? -17.010 0.078   35.989 1.00 26.43  ? 366  ASP A CB    1 
ATOM   3040 C  CG    . ASP A 1 366 ? -17.559 1.507   35.883 1.00 30.53  ? 366  ASP A CG    1 
ATOM   3041 O  OD1   . ASP A 1 366 ? -17.580 2.246   36.895 1.00 30.90  ? 366  ASP A OD1   1 
ATOM   3042 O  OD2   . ASP A 1 366 ? -17.956 1.910   34.771 1.00 31.24  ? 366  ASP A OD2   1 
ATOM   3043 N  N     . ALA A 1 367 ? -19.044 -2.330  36.609 1.00 27.33  ? 367  ALA A N     1 
ATOM   3044 C  CA    . ALA A 1 367 ? -20.382 -2.911  36.445 1.00 26.54  ? 367  ALA A CA    1 
ATOM   3045 C  C     . ALA A 1 367 ? -20.974 -3.402  37.762 1.00 26.00  ? 367  ALA A C     1 
ATOM   3046 O  O     . ALA A 1 367 ? -22.162 -3.187  38.029 1.00 27.53  ? 367  ALA A O     1 
ATOM   3047 C  CB    . ALA A 1 367 ? -20.362 -4.023  35.435 1.00 24.91  ? 367  ALA A CB    1 
ATOM   3048 N  N     . ILE A 1 368 ? -20.149 -4.057  38.575 1.00 24.21  ? 368  ILE A N     1 
ATOM   3049 C  CA    . ILE A 1 368 ? -20.588 -4.574  39.868 1.00 23.67  ? 368  ILE A CA    1 
ATOM   3050 C  C     . ILE A 1 368 ? -21.040 -3.418  40.744 1.00 24.62  ? 368  ILE A C     1 
ATOM   3051 O  O     . ILE A 1 368 ? -22.148 -3.436  41.287 1.00 25.00  ? 368  ILE A O     1 
ATOM   3052 C  CB    . ILE A 1 368 ? -19.461 -5.360  40.580 1.00 23.92  ? 368  ILE A CB    1 
ATOM   3053 C  CG1   . ILE A 1 368 ? -19.102 -6.605  39.774 1.00 22.40  ? 368  ILE A CG1   1 
ATOM   3054 C  CG2   . ILE A 1 368 ? -19.849 -5.699  42.037 1.00 20.14  ? 368  ILE A CG2   1 
ATOM   3055 C  CD1   . ILE A 1 368 ? -17.912 -7.374  40.311 1.00 27.49  ? 368  ILE A CD1   1 
ATOM   3056 N  N     . ILE A 1 369 ? -20.180 -2.411  40.865 1.00 24.96  ? 369  ILE A N     1 
ATOM   3057 C  CA    . ILE A 1 369 ? -20.462 -1.257  41.718 1.00 26.24  ? 369  ILE A CA    1 
ATOM   3058 C  C     . ILE A 1 369 ? -21.644 -0.458  41.175 1.00 26.48  ? 369  ILE A C     1 
ATOM   3059 O  O     . ILE A 1 369 ? -22.532 -0.072  41.937 1.00 27.07  ? 369  ILE A O     1 
ATOM   3060 C  CB    . ILE A 1 369 ? -19.232 -0.344  41.880 1.00 25.10  ? 369  ILE A CB    1 
ATOM   3061 C  CG1   . ILE A 1 369 ? -18.122 -1.072  42.643 1.00 25.35  ? 369  ILE A CG1   1 
ATOM   3062 C  CG2   . ILE A 1 369 ? -19.619 0.951   42.577 1.00 25.42  ? 369  ILE A CG2   1 
ATOM   3063 C  CD1   . ILE A 1 369 ? -16.728 -0.412  42.494 1.00 21.96  ? 369  ILE A CD1   1 
ATOM   3064 N  N     . PHE A 1 370 ? -21.650 -0.223  39.860 1.00 27.79  ? 370  PHE A N     1 
ATOM   3065 C  CA    . PHE A 1 370 ? -22.776 0.430   39.200 1.00 26.51  ? 370  PHE A CA    1 
ATOM   3066 C  C     . PHE A 1 370 ? -24.091 -0.234  39.584 1.00 28.51  ? 370  PHE A C     1 
ATOM   3067 O  O     . PHE A 1 370 ? -25.017 0.449   39.998 1.00 27.80  ? 370  PHE A O     1 
ATOM   3068 C  CB    . PHE A 1 370 ? -22.629 0.417   37.677 1.00 24.66  ? 370  PHE A CB    1 
ATOM   3069 C  CG    . PHE A 1 370 ? -23.917 0.680   36.939 1.00 25.12  ? 370  PHE A CG    1 
ATOM   3070 C  CD1   . PHE A 1 370 ? -24.373 -0.210  35.977 1.00 25.70  ? 370  PHE A CD1   1 
ATOM   3071 C  CD2   . PHE A 1 370 ? -24.687 1.811   37.221 1.00 28.29  ? 370  PHE A CD2   1 
ATOM   3072 C  CE1   . PHE A 1 370 ? -25.571 0.023   35.296 1.00 26.12  ? 370  PHE A CE1   1 
ATOM   3073 C  CE2   . PHE A 1 370 ? -25.885 2.053   36.549 1.00 28.26  ? 370  PHE A CE2   1 
ATOM   3074 C  CZ    . PHE A 1 370 ? -26.325 1.157   35.582 1.00 23.54  ? 370  PHE A CZ    1 
ATOM   3075 N  N     . ASN A 1 371 ? -24.153 -1.559  39.431 1.00 29.77  ? 371  ASN A N     1 
ATOM   3076 C  CA    . ASN A 1 371 ? -25.338 -2.342  39.765 1.00 30.59  ? 371  ASN A CA    1 
ATOM   3077 C  C     . ASN A 1 371 ? -25.696 -2.313  41.242 1.00 31.24  ? 371  ASN A C     1 
ATOM   3078 O  O     . ASN A 1 371 ? -26.871 -2.274  41.596 1.00 32.34  ? 371  ASN A O     1 
ATOM   3079 C  CB    . ASN A 1 371 ? -25.173 -3.785  39.297 1.00 29.20  ? 371  ASN A CB    1 
ATOM   3080 C  CG    . ASN A 1 371 ? -25.508 -3.962  37.821 1.00 31.12  ? 371  ASN A CG    1 
ATOM   3081 O  OD1   . ASN A 1 371 ? -26.675 -3.965  37.439 1.00 31.14  ? 371  ASN A OD1   1 
ATOM   3082 N  ND2   . ASN A 1 371 ? -24.482 -4.118  36.989 1.00 26.39  ? 371  ASN A ND2   1 
ATOM   3083 N  N     . SER A 1 372 ? -24.680 -2.342  42.098 1.00 33.60  ? 372  SER A N     1 
ATOM   3084 C  CA    . SER A 1 372 ? -24.873 -2.239  43.546 1.00 33.50  ? 372  SER A CA    1 
ATOM   3085 C  C     . SER A 1 372 ? -25.514 -0.897  43.942 1.00 34.09  ? 372  SER A C     1 
ATOM   3086 O  O     . SER A 1 372 ? -26.446 -0.863  44.751 1.00 33.58  ? 372  SER A O     1 
ATOM   3087 C  CB    . SER A 1 372 ? -23.533 -2.402  44.255 1.00 32.13  ? 372  SER A CB    1 
ATOM   3088 O  OG    . SER A 1 372 ? -23.716 -2.625  45.638 1.00 34.36  ? 372  SER A OG    1 
ATOM   3089 N  N     . LEU A 1 373 ? -25.018 0.193   43.354 1.00 33.33  ? 373  LEU A N     1 
ATOM   3090 C  CA    . LEU A 1 373 ? -25.489 1.541   43.683 1.00 33.31  ? 373  LEU A CA    1 
ATOM   3091 C  C     . LEU A 1 373 ? -26.845 1.903   43.072 1.00 35.89  ? 373  LEU A C     1 
ATOM   3092 O  O     . LEU A 1 373 ? -27.646 2.595   43.709 1.00 33.84  ? 373  LEU A O     1 
ATOM   3093 C  CB    . LEU A 1 373 ? -24.452 2.584   43.286 1.00 31.70  ? 373  LEU A CB    1 
ATOM   3094 C  CG    . LEU A 1 373 ? -23.146 2.589   44.083 1.00 32.98  ? 373  LEU A CG    1 
ATOM   3095 C  CD1   . LEU A 1 373 ? -22.165 3.540   43.439 1.00 30.05  ? 373  LEU A CD1   1 
ATOM   3096 C  CD2   . LEU A 1 373 ? -23.363 2.951   45.556 1.00 31.04  ? 373  LEU A CD2   1 
ATOM   3097 N  N     . LYS A 1 374 ? -27.090 1.444   41.842 1.00 36.68  ? 374  LYS A N     1 
ATOM   3098 C  CA    . LYS A 1 374 ? -28.382 1.617   41.173 1.00 39.29  ? 374  LYS A CA    1 
ATOM   3099 C  C     . LYS A 1 374 ? -29.552 1.022   41.985 1.00 41.48  ? 374  LYS A C     1 
ATOM   3100 O  O     . LYS A 1 374 ? -30.656 1.565   41.970 1.00 40.98  ? 374  LYS A O     1 
ATOM   3101 C  CB    . LYS A 1 374 ? -28.337 1.022   39.758 1.00 37.98  ? 374  LYS A CB    1 
ATOM   3102 C  CG    . LYS A 1 374 ? -29.696 0.884   39.075 1.00 38.80  ? 374  LYS A CG    1 
ATOM   3103 C  CD    . LYS A 1 374 ? -29.539 0.488   37.616 1.00 41.35  ? 374  LYS A CD    1 
ATOM   3104 C  CE    . LYS A 1 374 ? -30.853 0.011   37.024 1.00 42.36  ? 374  LYS A CE    1 
ATOM   3105 N  NZ    . LYS A 1 374 ? -31.076 -1.447  37.254 1.00 50.09  ? 374  LYS A NZ    1 
ATOM   3106 N  N     . GLU A 1 375 ? -29.304 -0.080  42.694 1.00 42.56  ? 375  GLU A N     1 
ATOM   3107 C  CA    . GLU A 1 375 ? -30.340 -0.702  43.518 1.00 45.80  ? 375  GLU A CA    1 
ATOM   3108 C  C     . GLU A 1 375 ? -30.766 0.199   44.664 1.00 44.07  ? 375  GLU A C     1 
ATOM   3109 O  O     . GLU A 1 375 ? -31.913 0.147   45.103 1.00 43.76  ? 375  GLU A O     1 
ATOM   3110 C  CB    . GLU A 1 375 ? -29.900 -2.069  44.061 1.00 48.15  ? 375  GLU A CB    1 
ATOM   3111 C  CG    . GLU A 1 375 ? -30.180 -3.232  43.123 1.00 56.14  ? 375  GLU A CG    1 
ATOM   3112 C  CD    . GLU A 1 375 ? -31.650 -3.331  42.712 1.00 64.48  ? 375  GLU A CD    1 
ATOM   3113 O  OE1   . GLU A 1 375 ? -32.489 -3.754  43.546 1.00 63.71  ? 375  GLU A OE1   1 
ATOM   3114 O  OE2   . GLU A 1 375 ? -31.959 -2.989  41.544 1.00 67.70  ? 375  GLU A OE2   1 
ATOM   3115 N  N     . GLN A 1 376 ? -29.838 1.026   45.130 1.00 43.57  ? 376  GLN A N     1 
ATOM   3116 C  CA    . GLN A 1 376 ? -30.104 1.956   46.219 1.00 43.63  ? 376  GLN A CA    1 
ATOM   3117 C  C     . GLN A 1 376 ? -30.508 3.318   45.674 1.00 42.99  ? 376  GLN A C     1 
ATOM   3118 O  O     . GLN A 1 376 ? -30.579 4.295   46.418 1.00 43.38  ? 376  GLN A O     1 
ATOM   3119 C  CB    . GLN A 1 376 ? -28.878 2.090   47.115 1.00 43.31  ? 376  GLN A CB    1 
ATOM   3120 C  CG    . GLN A 1 376 ? -28.224 0.765   47.481 1.00 48.24  ? 376  GLN A CG    1 
ATOM   3121 C  CD    . GLN A 1 376 ? -26.994 0.941   48.358 1.00 54.06  ? 376  GLN A CD    1 
ATOM   3122 O  OE1   . GLN A 1 376 ? -26.789 0.179   49.305 1.00 59.39  ? 376  GLN A OE1   1 
ATOM   3123 N  NE2   . GLN A 1 376 ? -26.177 1.954   48.059 1.00 52.32  ? 376  GLN A NE2   1 
ATOM   3124 N  N     . ASN A 1 377 ? -30.778 3.365   44.370 1.00 43.05  ? 377  ASN A N     1 
ATOM   3125 C  CA    . ASN A 1 377 ? -31.150 4.596   43.662 1.00 42.68  ? 377  ASN A CA    1 
ATOM   3126 C  C     . ASN A 1 377 ? -30.104 5.704   43.726 1.00 40.17  ? 377  ASN A C     1 
ATOM   3127 O  O     . ASN A 1 377 ? -30.425 6.885   43.623 1.00 42.85  ? 377  ASN A O     1 
ATOM   3128 C  CB    . ASN A 1 377 ? -32.527 5.088   44.113 1.00 45.31  ? 377  ASN A CB    1 
ATOM   3129 C  CG    . ASN A 1 377 ? -33.645 4.229   43.566 1.00 49.51  ? 377  ASN A CG    1 
ATOM   3130 O  OD1   . ASN A 1 377 ? -33.709 3.978   42.362 1.00 52.10  ? 377  ASN A OD1   1 
ATOM   3131 N  ND2   . ASN A 1 377 ? -34.524 3.758   44.446 1.00 50.83  ? 377  ASN A ND2   1 
ATOM   3132 N  N     . LYS A 1 378 ? -28.849 5.306   43.885 1.00 36.98  ? 378  LYS A N     1 
ATOM   3133 C  CA    . LYS A 1 378 ? -27.742 6.233   43.878 1.00 34.02  ? 378  LYS A CA    1 
ATOM   3134 C  C     . LYS A 1 378 ? -27.201 6.381   42.461 1.00 35.04  ? 378  LYS A C     1 
ATOM   3135 O  O     . LYS A 1 378 ? -27.367 5.487   41.614 1.00 33.05  ? 378  LYS A O     1 
ATOM   3136 C  CB    . LYS A 1 378 ? -26.661 5.781   44.851 1.00 34.21  ? 378  LYS A CB    1 
ATOM   3137 C  CG    . LYS A 1 378 ? -27.158 5.708   46.284 1.00 36.32  ? 378  LYS A CG    1 
ATOM   3138 C  CD    . LYS A 1 378 ? -26.022 5.565   47.279 1.00 42.70  ? 378  LYS A CD    1 
ATOM   3139 C  CE    . LYS A 1 378 ? -26.569 5.490   48.708 1.00 47.68  ? 378  LYS A CE    1 
ATOM   3140 N  NZ    . LYS A 1 378 ? -25.545 5.022   49.688 1.00 47.02  ? 378  LYS A NZ    1 
ATOM   3141 N  N     . VAL A 1 379 ? -26.579 7.531   42.214 1.00 32.69  ? 379  VAL A N     1 
ATOM   3142 C  CA    . VAL A 1 379 ? -26.109 7.908   40.898 1.00 32.00  ? 379  VAL A CA    1 
ATOM   3143 C  C     . VAL A 1 379 ? -24.575 7.898   40.887 1.00 33.53  ? 379  VAL A C     1 
ATOM   3144 O  O     . VAL A 1 379 ? -23.942 8.518   41.745 1.00 35.17  ? 379  VAL A O     1 
ATOM   3145 C  CB    . VAL A 1 379 ? -26.670 9.304   40.500 1.00 32.84  ? 379  VAL A CB    1 
ATOM   3146 C  CG1   . VAL A 1 379 ? -26.093 9.754   39.192 1.00 32.43  ? 379  VAL A CG1   1 
ATOM   3147 C  CG2   . VAL A 1 379 ? -28.199 9.264   40.396 1.00 29.14  ? 379  VAL A CG2   1 
ATOM   3148 N  N     . ILE A 1 380 ? -23.983 7.188   39.926 1.00 30.62  ? 380  ILE A N     1 
ATOM   3149 C  CA    . ILE A 1 380 ? -22.529 7.034   39.884 1.00 30.23  ? 380  ILE A CA    1 
ATOM   3150 C  C     . ILE A 1 380 ? -21.826 8.301   39.356 1.00 32.23  ? 380  ILE A C     1 
ATOM   3151 O  O     . ILE A 1 380 ? -22.396 9.041   38.540 1.00 32.61  ? 380  ILE A O     1 
ATOM   3152 C  CB    . ILE A 1 380 ? -22.089 5.767   39.092 1.00 29.72  ? 380  ILE A CB    1 
ATOM   3153 C  CG1   . ILE A 1 380 ? -22.390 5.906   37.592 1.00 28.71  ? 380  ILE A CG1   1 
ATOM   3154 C  CG2   . ILE A 1 380 ? -22.733 4.513   39.683 1.00 30.85  ? 380  ILE A CG2   1 
ATOM   3155 C  CD1   . ILE A 1 380 ? -21.753 4.832   36.733 1.00 25.26  ? 380  ILE A CD1   1 
ATOM   3156 N  N     . PRO A 1 381 ? -20.591 8.558   39.824 1.00 29.77  ? 381  PRO A N     1 
ATOM   3157 C  CA    . PRO A 1 381 ? -19.863 9.738   39.376 1.00 30.77  ? 381  PRO A CA    1 
ATOM   3158 C  C     . PRO A 1 381 ? -19.348 9.625   37.942 1.00 31.74  ? 381  PRO A C     1 
ATOM   3159 O  O     . PRO A 1 381 ? -19.180 8.523   37.427 1.00 32.33  ? 381  PRO A O     1 
ATOM   3160 C  CB    . PRO A 1 381 ? -18.681 9.811   40.359 1.00 30.15  ? 381  PRO A CB    1 
ATOM   3161 C  CG    . PRO A 1 381 ? -18.465 8.416   40.794 1.00 27.93  ? 381  PRO A CG    1 
ATOM   3162 C  CD    . PRO A 1 381 ? -19.842 7.812   40.855 1.00 31.93  ? 381  PRO A CD    1 
ATOM   3163 N  N     . GLN A 1 382 ? -19.095 10.769  37.312 1.00 33.24  ? 382  GLN A N     1 
ATOM   3164 C  CA    . GLN A 1 382 ? -18.469 10.802  36.000 1.00 34.79  ? 382  GLN A CA    1 
ATOM   3165 C  C     . GLN A 1 382 ? -17.001 10.408  36.137 1.00 35.45  ? 382  GLN A C     1 
ATOM   3166 O  O     . GLN A 1 382 ? -16.358 10.700  37.150 1.00 34.19  ? 382  GLN A O     1 
ATOM   3167 C  CB    . GLN A 1 382 ? -18.593 12.198  35.382 1.00 36.28  ? 382  GLN A CB    1 
ATOM   3168 C  CG    . GLN A 1 382 ? -18.052 12.323  33.949 1.00 40.89  ? 382  GLN A CG    1 
ATOM   3169 C  CD    . GLN A 1 382 ? -18.480 13.607  33.234 1.00 45.83  ? 382  GLN A CD    1 
ATOM   3170 O  OE1   . GLN A 1 382 ? -18.620 14.671  33.843 1.00 47.96  ? 382  GLN A OE1   1 
ATOM   3171 N  NE2   . GLN A 1 382 ? -18.686 13.501  31.928 1.00 48.41  ? 382  GLN A NE2   1 
ATOM   3172 N  N     . GLY A 1 383 ? -16.492 9.709   35.128 1.00 37.20  ? 383  GLY A N     1 
ATOM   3173 C  CA    . GLY A 1 383 ? -15.070 9.399   35.049 1.00 40.25  ? 383  GLY A CA    1 
ATOM   3174 C  C     . GLY A 1 383 ? -14.348 10.669  34.666 1.00 41.98  ? 383  GLY A C     1 
ATOM   3175 O  O     . GLY A 1 383 ? -14.847 11.431  33.833 1.00 43.44  ? 383  GLY A O     1 
ATOM   3176 N  N     . ARG A 1 384 ? -13.197 10.913  35.291 1.00 42.97  ? 384  ARG A N     1 
ATOM   3177 C  CA    . ARG A 1 384 ? -12.389 12.108  35.017 1.00 44.71  ? 384  ARG A CA    1 
ATOM   3178 C  C     . ARG A 1 384 ? -10.978 11.727  34.584 1.00 43.87  ? 384  ARG A C     1 
ATOM   3179 O  O     . ARG A 1 384 ? -10.516 10.616  34.847 1.00 41.95  ? 384  ARG A O     1 
ATOM   3180 C  CB    . ARG A 1 384 ? -12.313 13.011  36.252 1.00 46.26  ? 384  ARG A CB    1 
ATOM   3181 C  CG    . ARG A 1 384 ? -13.607 13.749  36.604 1.00 51.72  ? 384  ARG A CG    1 
ATOM   3182 C  CD    . ARG A 1 384 ? -13.598 14.152  38.077 1.00 57.64  ? 384  ARG A CD    1 
ATOM   3183 N  NE    . ARG A 1 384 ? -13.403 12.977  38.931 1.00 63.75  ? 384  ARG A NE    1 
ATOM   3184 C  CZ    . ARG A 1 384 ? -12.831 12.979  40.135 1.00 64.24  ? 384  ARG A CZ    1 
ATOM   3185 N  NH1   . ARG A 1 384 ? -12.372 14.107  40.675 1.00 64.86  ? 384  ARG A NH1   1 
ATOM   3186 N  NH2   . ARG A 1 384 ? -12.712 11.837  40.798 1.00 61.56  ? 384  ARG A NH2   1 
ATOM   3187 N  N     . SER A 1 385 ? -10.292 12.648  33.912 1.00 44.21  ? 385  SER A N     1 
ATOM   3188 C  CA    . SER A 1 385 ? -8.904  12.406  33.547 1.00 44.89  ? 385  SER A CA    1 
ATOM   3189 C  C     . SER A 1 385 ? -8.034  12.672  34.764 1.00 42.28  ? 385  SER A C     1 
ATOM   3190 O  O     . SER A 1 385 ? -8.310  13.575  35.545 1.00 43.73  ? 385  SER A O     1 
ATOM   3191 C  CB    . SER A 1 385 ? -8.472  13.270  32.358 1.00 46.20  ? 385  SER A CB    1 
ATOM   3192 O  OG    . SER A 1 385 ? -8.254  14.616  32.747 1.00 51.62  ? 385  SER A OG    1 
ATOM   3193 N  N     . HIS A 1 386 ? -7.009  11.855  34.950 1.00 40.46  ? 386  HIS A N     1 
ATOM   3194 C  CA    . HIS A 1 386 ? -6.048  12.089  36.018 1.00 37.62  ? 386  HIS A CA    1 
ATOM   3195 C  C     . HIS A 1 386 ? -4.670  11.849  35.458 1.00 36.92  ? 386  HIS A C     1 
ATOM   3196 O  O     . HIS A 1 386 ? -4.497  10.974  34.605 1.00 36.02  ? 386  HIS A O     1 
ATOM   3197 C  CB    . HIS A 1 386 ? -6.285  11.157  37.213 1.00 37.55  ? 386  HIS A CB    1 
ATOM   3198 C  CG    . HIS A 1 386 ? -7.674  11.212  37.763 1.00 34.16  ? 386  HIS A CG    1 
ATOM   3199 N  ND1   . HIS A 1 386 ? -8.069  12.145  38.695 1.00 36.66  ? 386  HIS A ND1   1 
ATOM   3200 C  CD2   . HIS A 1 386 ? -8.765  10.456  37.500 1.00 33.87  ? 386  HIS A CD2   1 
ATOM   3201 C  CE1   . HIS A 1 386 ? -9.343  11.960  38.989 1.00 34.81  ? 386  HIS A CE1   1 
ATOM   3202 N  NE2   . HIS A 1 386 ? -9.789  10.939  38.279 1.00 35.12  ? 386  HIS A NE2   1 
ATOM   3203 N  N     . PRO A 1 387 ? -3.679  12.630  35.921 1.00 37.34  ? 387  PRO A N     1 
ATOM   3204 C  CA    . PRO A 1 387 ? -2.306  12.309  35.545 1.00 37.46  ? 387  PRO A CA    1 
ATOM   3205 C  C     . PRO A 1 387 ? -1.843  11.086  36.326 1.00 35.86  ? 387  PRO A C     1 
ATOM   3206 O  O     . PRO A 1 387 ? -2.240  10.910  37.476 1.00 35.62  ? 387  PRO A O     1 
ATOM   3207 C  CB    . PRO A 1 387 ? -1.521  13.554  35.965 1.00 37.95  ? 387  PRO A CB    1 
ATOM   3208 C  CG    . PRO A 1 387 ? -2.336  14.180  37.045 1.00 38.02  ? 387  PRO A CG    1 
ATOM   3209 C  CD    . PRO A 1 387 ? -3.769  13.853  36.741 1.00 37.46  ? 387  PRO A CD    1 
ATOM   3210 N  N     . VAL A 1 388 ? -1.036  10.242  35.692 1.00 36.47  ? 388  VAL A N     1 
ATOM   3211 C  CA    . VAL A 1 388 ? -0.479  9.066   36.353 1.00 37.70  ? 388  VAL A CA    1 
ATOM   3212 C  C     . VAL A 1 388 ? 0.558   9.484   37.394 1.00 37.26  ? 388  VAL A C     1 
ATOM   3213 O  O     . VAL A 1 388 ? 1.498   10.226  37.087 1.00 36.86  ? 388  VAL A O     1 
ATOM   3214 C  CB    . VAL A 1 388 ? 0.123   8.068   35.345 1.00 40.43  ? 388  VAL A CB    1 
ATOM   3215 C  CG1   . VAL A 1 388 ? 0.758   6.884   36.078 1.00 42.37  ? 388  VAL A CG1   1 
ATOM   3216 C  CG2   . VAL A 1 388 ? -0.951  7.569   34.369 1.00 39.26  ? 388  VAL A CG2   1 
ATOM   3217 N  N     . GLN A 1 389 ? 0.350   9.031   38.629 1.00 35.98  ? 389  GLN A N     1 
ATOM   3218 C  CA    . GLN A 1 389 ? 1.223   9.360   39.756 1.00 36.83  ? 389  GLN A CA    1 
ATOM   3219 C  C     . GLN A 1 389 ? 1.718   8.088   40.452 1.00 35.81  ? 389  GLN A C     1 
ATOM   3220 O  O     . GLN A 1 389 ? 0.917   7.266   40.901 1.00 34.40  ? 389  GLN A O     1 
ATOM   3221 C  CB    . GLN A 1 389 ? 0.509   10.258  40.772 1.00 36.34  ? 389  GLN A CB    1 
ATOM   3222 C  CG    . GLN A 1 389 ? 0.121   11.632  40.248 1.00 45.67  ? 389  GLN A CG    1 
ATOM   3223 C  CD    . GLN A 1 389 ? -0.351  12.581  41.345 1.00 47.04  ? 389  GLN A CD    1 
ATOM   3224 O  OE1   . GLN A 1 389 ? -1.442  12.426  41.900 1.00 44.51  ? 389  GLN A OE1   1 
ATOM   3225 N  NE2   . GLN A 1 389 ? 0.473   13.577  41.650 1.00 47.68  ? 389  GLN A NE2   1 
ATOM   3226 N  N     . PRO A 1 390 ? 3.043   7.918   40.537 1.00 36.12  ? 390  PRO A N     1 
ATOM   3227 C  CA    . PRO A 1 390 ? 3.596   6.808   41.314 1.00 37.98  ? 390  PRO A CA    1 
ATOM   3228 C  C     . PRO A 1 390 ? 3.173   6.918   42.778 1.00 35.99  ? 390  PRO A C     1 
ATOM   3229 O  O     . PRO A 1 390 ? 3.019   8.030   43.278 1.00 38.90  ? 390  PRO A O     1 
ATOM   3230 C  CB    . PRO A 1 390 ? 5.112   7.005   41.175 1.00 39.36  ? 390  PRO A CB    1 
ATOM   3231 C  CG    . PRO A 1 390 ? 5.276   7.765   39.876 1.00 40.84  ? 390  PRO A CG    1 
ATOM   3232 C  CD    . PRO A 1 390 ? 4.084   8.679   39.821 1.00 38.24  ? 390  PRO A CD    1 
ATOM   3233 N  N     . TYR A 1 391 ? 2.953   5.781   43.438 1.00 33.62  ? 391  TYR A N     1 
ATOM   3234 C  CA    . TYR A 1 391 ? 2.622   5.752   44.870 1.00 32.00  ? 391  TYR A CA    1 
ATOM   3235 C  C     . TYR A 1 391 ? 3.238   4.548   45.595 1.00 33.20  ? 391  TYR A C     1 
ATOM   3236 O  O     . TYR A 1 391 ? 3.591   3.565   44.950 1.00 35.04  ? 391  TYR A O     1 
ATOM   3237 C  CB    . TYR A 1 391 ? 1.105   5.817   45.096 1.00 32.51  ? 391  TYR A CB    1 
ATOM   3238 C  CG    . TYR A 1 391 ? 0.289   4.619   44.628 1.00 29.60  ? 391  TYR A CG    1 
ATOM   3239 C  CD1   . TYR A 1 391 ? -0.148  4.517   43.302 1.00 29.35  ? 391  TYR A CD1   1 
ATOM   3240 C  CD2   . TYR A 1 391 ? -0.089  3.623   45.520 1.00 31.21  ? 391  TYR A CD2   1 
ATOM   3241 C  CE1   . TYR A 1 391 ? -0.918  3.442   42.875 1.00 28.00  ? 391  TYR A CE1   1 
ATOM   3242 C  CE2   . TYR A 1 391 ? -0.860  2.543   45.109 1.00 31.88  ? 391  TYR A CE2   1 
ATOM   3243 C  CZ    . TYR A 1 391 ? -1.273  2.460   43.784 1.00 32.02  ? 391  TYR A CZ    1 
ATOM   3244 O  OH    . TYR A 1 391 ? -2.038  1.392   43.377 1.00 32.14  ? 391  TYR A OH    1 
ATOM   3245 N  N     . PRO A 1 392 ? 3.386   4.629   46.937 1.00 32.05  ? 392  PRO A N     1 
ATOM   3246 C  CA    . PRO A 1 392 ? 4.006   3.541   47.705 1.00 31.00  ? 392  PRO A CA    1 
ATOM   3247 C  C     . PRO A 1 392 ? 3.126   2.311   47.938 1.00 30.68  ? 392  PRO A C     1 
ATOM   3248 O  O     . PRO A 1 392 ? 1.914   2.424   48.173 1.00 28.25  ? 392  PRO A O     1 
ATOM   3249 C  CB    . PRO A 1 392 ? 4.372   4.201   49.043 1.00 30.34  ? 392  PRO A CB    1 
ATOM   3250 C  CG    . PRO A 1 392 ? 3.493   5.362   49.155 1.00 34.83  ? 392  PRO A CG    1 
ATOM   3251 C  CD    . PRO A 1 392 ? 3.185   5.834   47.759 1.00 31.83  ? 392  PRO A CD    1 
ATOM   3252 N  N     . GLY A 1 393 ? 3.758   1.142   47.859 1.00 30.15  ? 393  GLY A N     1 
ATOM   3253 C  CA    . GLY A 1 393 ? 3.090   -0.132  48.071 1.00 29.31  ? 393  GLY A CA    1 
ATOM   3254 C  C     . GLY A 1 393 ? 3.551   -0.802  49.351 1.00 27.95  ? 393  GLY A C     1 
ATOM   3255 O  O     . GLY A 1 393 ? 3.558   -0.185  50.406 1.00 27.31  ? 393  GLY A O     1 
ATOM   3256 N  N     . ALA A 1 394 ? 3.963   -2.065  49.248 1.00 28.21  ? 394  ALA A N     1 
ATOM   3257 C  CA    . ALA A 1 394 ? 4.246   -2.885  50.425 1.00 27.19  ? 394  ALA A CA    1 
ATOM   3258 C  C     . ALA A 1 394 ? 5.660   -2.726  50.985 1.00 24.87  ? 394  ALA A C     1 
ATOM   3259 O  O     . ALA A 1 394 ? 6.545   -2.225  50.305 1.00 24.92  ? 394  ALA A O     1 
ATOM   3260 C  CB    . ALA A 1 394 ? 3.964   -4.349  50.119 1.00 26.86  ? 394  ALA A CB    1 
ATOM   3261 N  N     . PHE A 1 395 ? 5.839   -3.165  52.229 1.00 25.13  ? 395  PHE A N     1 
ATOM   3262 C  CA    . PHE A 1 395 ? 7.133   -3.217  52.900 1.00 27.67  ? 395  PHE A CA    1 
ATOM   3263 C  C     . PHE A 1 395 ? 7.720   -4.610  52.780 1.00 28.68  ? 395  PHE A C     1 
ATOM   3264 O  O     . PHE A 1 395 ? 7.041   -5.601  53.037 1.00 31.91  ? 395  PHE A O     1 
ATOM   3265 C  CB    . PHE A 1 395 ? 6.961   -2.895  54.390 1.00 29.58  ? 395  PHE A CB    1 
ATOM   3266 C  CG    . PHE A 1 395 ? 8.192   -3.182  55.236 1.00 32.74  ? 395  PHE A CG    1 
ATOM   3267 C  CD1   . PHE A 1 395 ? 9.252   -2.275  55.286 1.00 32.06  ? 395  PHE A CD1   1 
ATOM   3268 C  CD2   . PHE A 1 395 ? 8.275   -4.343  55.998 1.00 31.48  ? 395  PHE A CD2   1 
ATOM   3269 C  CE1   . PHE A 1 395 ? 10.382  -2.531  56.063 1.00 32.47  ? 395  PHE A CE1   1 
ATOM   3270 C  CE2   . PHE A 1 395 ? 9.398   -4.601  56.788 1.00 33.04  ? 395  PHE A CE2   1 
ATOM   3271 C  CZ    . PHE A 1 395 ? 10.454  -3.690  56.815 1.00 29.59  ? 395  PHE A CZ    1 
ATOM   3272 N  N     . VAL A 1 396 ? 8.987   -4.685  52.406 1.00 29.27  ? 396  VAL A N     1 
ATOM   3273 C  CA    . VAL A 1 396 ? 9.704   -5.952  52.389 1.00 28.39  ? 396  VAL A CA    1 
ATOM   3274 C  C     . VAL A 1 396 ? 10.929  -5.822  53.294 1.00 30.48  ? 396  VAL A C     1 
ATOM   3275 O  O     . VAL A 1 396 ? 11.712  -4.879  53.150 1.00 29.42  ? 396  VAL A O     1 
ATOM   3276 C  CB    . VAL A 1 396 ? 10.107  -6.363  50.963 1.00 27.44  ? 396  VAL A CB    1 
ATOM   3277 C  CG1   . VAL A 1 396 ? 10.627  -7.799  50.944 1.00 31.18  ? 396  VAL A CG1   1 
ATOM   3278 C  CG2   . VAL A 1 396 ? 8.928   -6.233  50.029 1.00 25.66  ? 396  VAL A CG2   1 
ATOM   3279 N  N     . LYS A 1 397 ? 11.057  -6.750  54.244 1.00 31.31  ? 397  LYS A N     1 
ATOM   3280 C  CA    . LYS A 1 397 ? 12.139  -6.736  55.226 1.00 33.49  ? 397  LYS A CA    1 
ATOM   3281 C  C     . LYS A 1 397 ? 13.432  -7.215  54.585 1.00 33.17  ? 397  LYS A C     1 
ATOM   3282 O  O     . LYS A 1 397 ? 13.411  -8.138  53.785 1.00 35.10  ? 397  LYS A O     1 
ATOM   3283 C  CB    . LYS A 1 397 ? 11.782  -7.641  56.414 1.00 35.32  ? 397  LYS A CB    1 
ATOM   3284 C  CG    . LYS A 1 397 ? 12.800  -7.615  57.546 1.00 36.62  ? 397  LYS A CG    1 
ATOM   3285 C  CD    . LYS A 1 397 ? 12.433  -8.562  58.668 1.00 38.35  ? 397  LYS A CD    1 
ATOM   3286 C  CE    . LYS A 1 397 ? 13.595  -8.710  59.655 1.00 42.43  ? 397  LYS A CE    1 
ATOM   3287 N  NZ    . LYS A 1 397 ? 13.917  -7.415  60.325 1.00 43.34  ? 397  LYS A NZ    1 
ATOM   3288 N  N     . GLU A 1 398 ? 14.547  -6.580  54.932 1.00 34.68  ? 398  GLU A N     1 
ATOM   3289 C  CA    . GLU A 1 398 ? 15.877  -7.004  54.461 1.00 34.17  ? 398  GLU A CA    1 
ATOM   3290 C  C     . GLU A 1 398 ? 16.390  -8.162  55.330 1.00 32.34  ? 398  GLU A C     1 
ATOM   3291 O  O     . GLU A 1 398 ? 16.702  -7.965  56.497 1.00 34.29  ? 398  GLU A O     1 
ATOM   3292 C  CB    . GLU A 1 398 ? 16.854  -5.811  54.477 1.00 32.98  ? 398  GLU A CB    1 
ATOM   3293 C  CG    . GLU A 1 398 ? 18.204  -6.057  53.809 1.00 37.97  ? 398  GLU A CG    1 
ATOM   3294 C  CD    . GLU A 1 398 ? 18.135  -6.065  52.275 1.00 40.42  ? 398  GLU A CD    1 
ATOM   3295 O  OE1   . GLU A 1 398 ? 17.839  -5.009  51.669 1.00 41.35  ? 398  GLU A OE1   1 
ATOM   3296 O  OE2   . GLU A 1 398 ? 18.396  -7.125  51.673 1.00 37.07  ? 398  GLU A OE2   1 
ATOM   3297 N  N     . PRO A 1 399 ? 16.468  -9.379  54.767 1.00 33.10  ? 399  PRO A N     1 
ATOM   3298 C  CA    . PRO A 1 399 ? 16.920  -10.531 55.554 1.00 32.73  ? 399  PRO A CA    1 
ATOM   3299 C  C     . PRO A 1 399 ? 18.446  -10.645 55.593 1.00 33.80  ? 399  PRO A C     1 
ATOM   3300 O  O     . PRO A 1 399 ? 19.123  -10.319 54.612 1.00 36.13  ? 399  PRO A O     1 
ATOM   3301 C  CB    . PRO A 1 399 ? 16.353  -11.717 54.778 1.00 31.04  ? 399  PRO A CB    1 
ATOM   3302 C  CG    . PRO A 1 399 ? 16.340  -11.246 53.333 1.00 31.35  ? 399  PRO A CG    1 
ATOM   3303 C  CD    . PRO A 1 399 ? 16.263  -9.730  53.346 1.00 31.56  ? 399  PRO A CD    1 
ATOM   3304 N  N     . ILE A 1 400 ? 18.979  -11.108 56.713 1.00 33.50  ? 400  ILE A N     1 
ATOM   3305 C  CA    . ILE A 1 400 ? 20.398  -11.440 56.792 1.00 35.74  ? 400  ILE A CA    1 
ATOM   3306 C  C     . ILE A 1 400 ? 20.616  -12.703 55.961 1.00 35.79  ? 400  ILE A C     1 
ATOM   3307 O  O     . ILE A 1 400 ? 20.024  -13.743 56.256 1.00 35.62  ? 400  ILE A O     1 
ATOM   3308 C  CB    . ILE A 1 400 ? 20.865  -11.666 58.261 1.00 35.48  ? 400  ILE A CB    1 
ATOM   3309 C  CG1   . ILE A 1 400 ? 20.716  -10.370 59.074 1.00 38.83  ? 400  ILE A CG1   1 
ATOM   3310 C  CG2   . ILE A 1 400 ? 22.311  -12.176 58.298 1.00 33.03  ? 400  ILE A CG2   1 
ATOM   3311 C  CD1   . ILE A 1 400 ? 20.830  -10.556 60.615 1.00 44.80  ? 400  ILE A CD1   1 
ATOM   3312 N  N     . PRO A 1 401 ? 21.449  -12.615 54.905 1.00 36.69  ? 401  PRO A N     1 
ATOM   3313 C  CA    . PRO A 1 401 ? 21.645  -13.812 54.093 1.00 36.98  ? 401  PRO A CA    1 
ATOM   3314 C  C     . PRO A 1 401 ? 22.319  -14.883 54.930 1.00 37.78  ? 401  PRO A C     1 
ATOM   3315 O  O     . PRO A 1 401 ? 23.334  -14.615 55.571 1.00 40.58  ? 401  PRO A O     1 
ATOM   3316 C  CB    . PRO A 1 401 ? 22.558  -13.326 52.954 1.00 36.94  ? 401  PRO A CB    1 
ATOM   3317 C  CG    . PRO A 1 401 ? 22.381  -11.821 52.927 1.00 36.54  ? 401  PRO A CG    1 
ATOM   3318 C  CD    . PRO A 1 401 ? 22.209  -11.465 54.378 1.00 35.62  ? 401  PRO A CD    1 
ATOM   3319 N  N     . ASN A 1 402 ? 21.733  -16.077 54.943 1.00 38.46  ? 402  ASN A N     1 
ATOM   3320 C  CA    . ASN A 1 402 ? 22.189  -17.165 55.802 1.00 40.11  ? 402  ASN A CA    1 
ATOM   3321 C  C     . ASN A 1 402 ? 21.415  -18.445 55.532 1.00 40.81  ? 402  ASN A C     1 
ATOM   3322 O  O     . ASN A 1 402 ? 20.442  -18.447 54.771 1.00 43.13  ? 402  ASN A O     1 
ATOM   3323 C  CB    . ASN A 1 402 ? 22.029  -16.773 57.272 1.00 42.16  ? 402  ASN A CB    1 
ATOM   3324 C  CG    . ASN A 1 402 ? 22.938  -17.556 58.193 1.00 45.02  ? 402  ASN A CG    1 
ATOM   3325 O  OD1   . ASN A 1 402 ? 23.778  -18.337 57.744 1.00 51.81  ? 402  ASN A OD1   1 
ATOM   3326 N  ND2   . ASN A 1 402 ? 22.775  -17.350 59.497 1.00 44.62  ? 402  ASN A ND2   1 
ATOM   3327 N  N     . ARG A 1 403 ? 21.861  -19.537 56.142 1.00 40.86  ? 403  ARG A N     1 
ATOM   3328 C  CA    . ARG A 1 403 ? 21.036  -20.727 56.268 1.00 39.17  ? 403  ARG A CA    1 
ATOM   3329 C  C     . ARG A 1 403 ? 20.125  -20.548 57.486 1.00 39.39  ? 403  ARG A C     1 
ATOM   3330 O  O     . ARG A 1 403 ? 20.500  -19.915 58.480 1.00 38.85  ? 403  ARG A O     1 
ATOM   3331 C  CB    . ARG A 1 403 ? 21.905  -21.971 56.432 1.00 38.45  ? 403  ARG A CB    1 
ATOM   3332 C  CG    . ARG A 1 403 ? 22.604  -22.082 57.789 1.00 42.83  ? 403  ARG A CG    1 
ATOM   3333 C  CD    . ARG A 1 403 ? 23.397  -23.370 57.910 1.00 46.04  ? 403  ARG A CD    1 
ATOM   3334 N  NE    . ARG A 1 403 ? 24.695  -23.270 57.249 1.00 49.61  ? 403  ARG A NE    1 
ATOM   3335 C  CZ    . ARG A 1 403 ? 25.568  -24.267 57.147 1.00 50.93  ? 403  ARG A CZ    1 
ATOM   3336 N  NH1   . ARG A 1 403 ? 25.297  -25.459 57.664 1.00 51.97  ? 403  ARG A NH1   1 
ATOM   3337 N  NH2   . ARG A 1 403 ? 26.720  -24.065 56.531 1.00 52.95  ? 403  ARG A NH2   1 
ATOM   3338 N  N     . TYR A 1 404 ? 18.920  -21.089 57.404 1.00 39.32  ? 404  TYR A N     1 
ATOM   3339 C  CA    . TYR A 1 404 ? 18.019  -21.074 58.549 1.00 38.95  ? 404  TYR A CA    1 
ATOM   3340 C  C     . TYR A 1 404 ? 17.437  -22.473 58.704 1.00 39.92  ? 404  TYR A C     1 
ATOM   3341 O  O     . TYR A 1 404 ? 16.767  -22.984 57.795 1.00 41.79  ? 404  TYR A O     1 
ATOM   3342 C  CB    . TYR A 1 404 ? 16.927  -20.006 58.381 1.00 38.18  ? 404  TYR A CB    1 
ATOM   3343 C  CG    . TYR A 1 404 ? 17.444  -18.575 58.339 1.00 34.14  ? 404  TYR A CG    1 
ATOM   3344 C  CD1   . TYR A 1 404 ? 17.554  -17.818 59.506 1.00 34.29  ? 404  TYR A CD1   1 
ATOM   3345 C  CD2   . TYR A 1 404 ? 17.824  -17.979 57.134 1.00 31.77  ? 404  TYR A CD2   1 
ATOM   3346 C  CE1   . TYR A 1 404 ? 18.028  -16.501 59.477 1.00 30.43  ? 404  TYR A CE1   1 
ATOM   3347 C  CE2   . TYR A 1 404 ? 18.304  -16.668 57.098 1.00 34.05  ? 404  TYR A CE2   1 
ATOM   3348 C  CZ    . TYR A 1 404 ? 18.396  -15.937 58.273 1.00 34.04  ? 404  TYR A CZ    1 
ATOM   3349 O  OH    . TYR A 1 404 ? 18.861  -14.641 58.248 1.00 37.25  ? 404  TYR A OH    1 
ATOM   3350 N  N     . LYS A 1 405 ? 17.712  -23.092 59.849 1.00 39.68  ? 405  LYS A N     1 
ATOM   3351 C  CA    . LYS A 1 405 ? 17.453  -24.515 60.037 1.00 40.45  ? 405  LYS A CA    1 
ATOM   3352 C  C     . LYS A 1 405 ? 15.965  -24.843 60.146 1.00 39.41  ? 405  LYS A C     1 
ATOM   3353 O  O     . LYS A 1 405 ? 15.428  -25.578 59.319 1.00 39.67  ? 405  LYS A O     1 
ATOM   3354 C  CB    . LYS A 1 405 ? 18.230  -25.051 61.247 1.00 41.06  ? 405  LYS A CB    1 
ATOM   3355 C  CG    . LYS A 1 405 ? 18.420  -26.560 61.232 1.00 45.24  ? 405  LYS A CG    1 
ATOM   3356 C  CD    . LYS A 1 405 ? 19.149  -27.043 62.488 1.00 47.89  ? 405  LYS A CD    1 
ATOM   3357 C  CE    . LYS A 1 405 ? 19.416  -28.544 62.438 1.00 49.29  ? 405  LYS A CE    1 
ATOM   3358 N  NZ    . LYS A 1 405 ? 19.939  -29.059 63.738 1.00 51.65  ? 405  LYS A NZ    1 
ATOM   3359 N  N     . TYR A 1 406 ? 15.312  -24.291 61.162 1.00 40.34  ? 406  TYR A N     1 
ATOM   3360 C  CA    . TYR A 1 406 ? 13.895  -24.555 61.418 1.00 42.09  ? 406  TYR A CA    1 
ATOM   3361 C  C     . TYR A 1 406 ? 13.091  -23.265 61.240 1.00 40.77  ? 406  TYR A C     1 
ATOM   3362 O  O     . TYR A 1 406 ? 13.354  -22.265 61.906 1.00 41.06  ? 406  TYR A O     1 
ATOM   3363 C  CB    . TYR A 1 406 ? 13.694  -25.137 62.833 1.00 42.93  ? 406  TYR A CB    1 
ATOM   3364 C  CG    . TYR A 1 406 ? 14.209  -26.562 63.023 1.00 42.92  ? 406  TYR A CG    1 
ATOM   3365 C  CD1   . TYR A 1 406 ? 15.411  -26.811 63.703 1.00 42.83  ? 406  TYR A CD1   1 
ATOM   3366 C  CD2   . TYR A 1 406 ? 13.487  -27.660 62.540 1.00 41.18  ? 406  TYR A CD2   1 
ATOM   3367 C  CE1   . TYR A 1 406 ? 15.888  -28.123 63.890 1.00 41.12  ? 406  TYR A CE1   1 
ATOM   3368 C  CE2   . TYR A 1 406 ? 13.955  -28.973 62.715 1.00 41.70  ? 406  TYR A CE2   1 
ATOM   3369 C  CZ    . TYR A 1 406 ? 15.157  -29.196 63.391 1.00 42.99  ? 406  TYR A CZ    1 
ATOM   3370 O  OH    . TYR A 1 406 ? 15.625  -30.490 63.565 1.00 41.66  ? 406  TYR A OH    1 
ATOM   3371 N  N     . VAL A 1 407 ? 12.121  -23.286 60.331 1.00 38.89  ? 407  VAL A N     1 
ATOM   3372 C  CA    . VAL A 1 407 ? 11.379  -22.075 59.979 1.00 37.01  ? 407  VAL A CA    1 
ATOM   3373 C  C     . VAL A 1 407 ? 9.874   -22.316 60.015 1.00 35.62  ? 407  VAL A C     1 
ATOM   3374 O  O     . VAL A 1 407 ? 9.381   -23.356 59.565 1.00 35.97  ? 407  VAL A O     1 
ATOM   3375 C  CB    . VAL A 1 407 ? 11.801  -21.511 58.581 1.00 36.71  ? 407  VAL A CB    1 
ATOM   3376 C  CG1   . VAL A 1 407 ? 11.036  -20.239 58.246 1.00 38.10  ? 407  VAL A CG1   1 
ATOM   3377 C  CG2   . VAL A 1 407 ? 13.288  -21.207 58.543 1.00 41.27  ? 407  VAL A CG2   1 
ATOM   3378 N  N     . MET A 1 408 ? 9.164   -21.345 60.575 1.00 35.83  ? 408  MET A N     1 
ATOM   3379 C  CA    . MET A 1 408 ? 7.715   -21.289 60.547 1.00 37.63  ? 408  MET A CA    1 
ATOM   3380 C  C     . MET A 1 408 ? 7.303   -19.960 59.958 1.00 37.93  ? 408  MET A C     1 
ATOM   3381 O  O     . MET A 1 408 ? 7.872   -18.914 60.291 1.00 37.65  ? 408  MET A O     1 
ATOM   3382 C  CB    . MET A 1 408 ? 7.136   -21.402 61.948 1.00 41.26  ? 408  MET A CB    1 
ATOM   3383 C  CG    . MET A 1 408 ? 6.802   -22.826 62.357 1.00 50.43  ? 408  MET A CG    1 
ATOM   3384 S  SD    . MET A 1 408 ? 5.769   -22.916 63.842 1.00 59.55  ? 408  MET A SD    1 
ATOM   3385 C  CE    . MET A 1 408 ? 6.765   -22.012 65.030 1.00 48.01  ? 408  MET A CE    1 
ATOM   3386 N  N     . SER A 1 409 ? 6.315   -20.003 59.075 1.00 35.35  ? 409  SER A N     1 
ATOM   3387 C  CA    . SER A 1 409 ? 5.811   -18.795 58.461 1.00 34.25  ? 409  SER A CA    1 
ATOM   3388 C  C     . SER A 1 409 ? 4.333   -18.602 58.793 1.00 34.33  ? 409  SER A C     1 
ATOM   3389 O  O     . SER A 1 409 ? 3.629   -19.553 59.150 1.00 34.98  ? 409  SER A O     1 
ATOM   3390 C  CB    . SER A 1 409 ? 6.014   -18.848 56.960 1.00 30.99  ? 409  SER A CB    1 
ATOM   3391 O  OG    . SER A 1 409 ? 5.133   -19.786 56.399 1.00 30.89  ? 409  SER A OG    1 
ATOM   3392 N  N     . PHE A 1 410 ? 3.888   -17.356 58.673 1.00 33.19  ? 410  PHE A N     1 
ATOM   3393 C  CA    . PHE A 1 410 ? 2.562   -16.927 59.082 1.00 34.52  ? 410  PHE A CA    1 
ATOM   3394 C  C     . PHE A 1 410 ? 2.113   -15.900 58.083 1.00 35.60  ? 410  PHE A C     1 
ATOM   3395 O  O     . PHE A 1 410 ? 2.912   -15.068 57.651 1.00 37.65  ? 410  PHE A O     1 
ATOM   3396 C  CB    . PHE A 1 410 ? 2.612   -16.300 60.474 1.00 33.70  ? 410  PHE A CB    1 
ATOM   3397 C  CG    . PHE A 1 410 ? 2.948   -17.280 61.565 1.00 35.28  ? 410  PHE A CG    1 
ATOM   3398 C  CD1   . PHE A 1 410 ? 4.265   -17.506 61.931 1.00 35.12  ? 410  PHE A CD1   1 
ATOM   3399 C  CD2   . PHE A 1 410 ? 1.939   -17.986 62.218 1.00 36.93  ? 410  PHE A CD2   1 
ATOM   3400 C  CE1   . PHE A 1 410 ? 4.570   -18.416 62.941 1.00 40.46  ? 410  PHE A CE1   1 
ATOM   3401 C  CE2   . PHE A 1 410 ? 2.232   -18.900 63.226 1.00 36.00  ? 410  PHE A CE2   1 
ATOM   3402 C  CZ    . PHE A 1 410 ? 3.546   -19.113 63.592 1.00 37.43  ? 410  PHE A CZ    1 
ATOM   3403 N  N     . ASP A 1 411 ? 0.838   -15.943 57.720 1.00 34.63  ? 411  ASP A N     1 
ATOM   3404 C  CA    . ASP A 1 411 ? 0.359   -15.119 56.629 1.00 36.33  ? 411  ASP A CA    1 
ATOM   3405 C  C     . ASP A 1 411 ? -1.044  -14.567 56.878 1.00 36.09  ? 411  ASP A C     1 
ATOM   3406 O  O     . ASP A 1 411 ? -1.910  -15.257 57.417 1.00 36.48  ? 411  ASP A O     1 
ATOM   3407 C  CB    . ASP A 1 411 ? 0.406   -15.929 55.331 1.00 39.03  ? 411  ASP A CB    1 
ATOM   3408 C  CG    . ASP A 1 411 ? -0.135  -15.170 54.158 1.00 42.39  ? 411  ASP A CG    1 
ATOM   3409 O  OD1   . ASP A 1 411 ? 0.527   -14.224 53.690 1.00 49.05  ? 411  ASP A OD1   1 
ATOM   3410 O  OD2   . ASP A 1 411 ? -1.237  -15.512 53.700 1.00 46.57  ? 411  ASP A OD2   1 
ATOM   3411 N  N     . LEU A 1 412 ? -1.254  -13.312 56.483 1.00 34.79  ? 412  LEU A N     1 
ATOM   3412 C  CA    . LEU A 1 412 ? -2.558  -12.672 56.603 1.00 31.84  ? 412  LEU A CA    1 
ATOM   3413 C  C     . LEU A 1 412 ? -3.459  -13.126 55.469 1.00 30.39  ? 412  LEU A C     1 
ATOM   3414 O  O     . LEU A 1 412 ? -3.024  -13.220 54.330 1.00 31.94  ? 412  LEU A O     1 
ATOM   3415 C  CB    . LEU A 1 412 ? -2.417  -11.145 56.611 1.00 27.90  ? 412  LEU A CB    1 
ATOM   3416 C  CG    . LEU A 1 412 ? -1.856  -10.576 57.925 1.00 29.07  ? 412  LEU A CG    1 
ATOM   3417 C  CD1   . LEU A 1 412 ? -1.079  -9.281  57.700 1.00 27.29  ? 412  LEU A CD1   1 
ATOM   3418 C  CD2   . LEU A 1 412 ? -2.945  -10.375 58.977 1.00 25.94  ? 412  LEU A CD2   1 
ATOM   3419 N  N     . THR A 1 413 ? -4.707  -13.428 55.792 1.00 29.77  ? 413  THR A N     1 
ATOM   3420 C  CA    . THR A 1 413 ? -5.673  -13.878 54.793 1.00 31.48  ? 413  THR A CA    1 
ATOM   3421 C  C     . THR A 1 413 ? -6.117  -12.692 53.942 1.00 30.89  ? 413  THR A C     1 
ATOM   3422 O  O     . THR A 1 413 ? -6.535  -11.659 54.472 1.00 28.97  ? 413  THR A O     1 
ATOM   3423 C  CB    . THR A 1 413 ? -6.912  -14.530 55.462 1.00 32.32  ? 413  THR A CB    1 
ATOM   3424 O  OG1   . THR A 1 413 ? -6.476  -15.513 56.404 1.00 38.74  ? 413  THR A OG1   1 
ATOM   3425 C  CG2   . THR A 1 413 ? -7.807  -15.214 54.437 1.00 34.29  ? 413  THR A CG2   1 
ATOM   3426 N  N     . SER A 1 414 ? -5.998  -12.838 52.625 1.00 29.74  ? 414  SER A N     1 
ATOM   3427 C  CA    . SER A 1 414 ? -6.606  -11.902 51.684 1.00 29.30  ? 414  SER A CA    1 
ATOM   3428 C  C     . SER A 1 414 ? -6.392  -10.458 52.159 1.00 30.38  ? 414  SER A C     1 
ATOM   3429 O  O     . SER A 1 414 ? -7.350  -9.719  52.404 1.00 32.04  ? 414  SER A O     1 
ATOM   3430 C  CB    . SER A 1 414 ? -8.095  -12.238 51.575 1.00 30.49  ? 414  SER A CB    1 
ATOM   3431 O  OG    . SER A 1 414 ? -8.658  -11.727 50.388 1.00 36.93  ? 414  SER A OG    1 
ATOM   3432 N  N     . LEU A 1 415 ? -5.128  -10.064 52.302 1.00 30.68  ? 415  LEU A N     1 
ATOM   3433 C  CA    . LEU A 1 415 ? -4.800  -8.865  53.068 1.00 29.06  ? 415  LEU A CA    1 
ATOM   3434 C  C     . LEU A 1 415 ? -5.446  -7.578  52.562 1.00 29.74  ? 415  LEU A C     1 
ATOM   3435 O  O     . LEU A 1 415 ? -6.211  -6.948  53.295 1.00 31.95  ? 415  LEU A O     1 
ATOM   3436 C  CB    . LEU A 1 415 ? -3.287  -8.692  53.240 1.00 28.05  ? 415  LEU A CB    1 
ATOM   3437 C  CG    . LEU A 1 415 ? -2.957  -7.388  53.976 1.00 27.75  ? 415  LEU A CG    1 
ATOM   3438 C  CD1   . LEU A 1 415 ? -3.389  -7.459  55.451 1.00 27.31  ? 415  LEU A CD1   1 
ATOM   3439 C  CD2   . LEU A 1 415 ? -1.486  -7.007  53.840 1.00 27.15  ? 415  LEU A CD2   1 
ATOM   3440 N  N     . TYR A 1 416 ? -5.153  -7.176  51.328 1.00 28.99  ? 416  TYR A N     1 
ATOM   3441 C  CA    . TYR A 1 416 ? -5.672  -5.890  50.849 1.00 29.44  ? 416  TYR A CA    1 
ATOM   3442 C  C     . TYR A 1 416 ? -7.206  -5.783  50.922 1.00 29.49  ? 416  TYR A C     1 
ATOM   3443 O  O     . TYR A 1 416 ? -7.709  -4.795  51.438 1.00 31.28  ? 416  TYR A O     1 
ATOM   3444 C  CB    . TYR A 1 416 ? -5.113  -5.522  49.474 1.00 28.03  ? 416  TYR A CB    1 
ATOM   3445 C  CG    . TYR A 1 416 ? -3.682  -5.023  49.516 1.00 28.12  ? 416  TYR A CG    1 
ATOM   3446 C  CD1   . TYR A 1 416 ? -2.895  -5.172  50.662 1.00 27.10  ? 416  TYR A CD1   1 
ATOM   3447 C  CD2   . TYR A 1 416 ? -3.112  -4.410  48.409 1.00 28.19  ? 416  TYR A CD2   1 
ATOM   3448 C  CE1   . TYR A 1 416 ? -1.585  -4.730  50.694 1.00 27.22  ? 416  TYR A CE1   1 
ATOM   3449 C  CE2   . TYR A 1 416 ? -1.801  -3.958  48.435 1.00 27.34  ? 416  TYR A CE2   1 
ATOM   3450 C  CZ    . TYR A 1 416 ? -1.047  -4.127  49.577 1.00 26.52  ? 416  TYR A CZ    1 
ATOM   3451 O  OH    . TYR A 1 416 ? 0.254   -3.689  49.601 1.00 33.98  ? 416  TYR A OH    1 
ATOM   3452 N  N     . PRO A 1 417 ? -7.943  -6.811  50.441 1.00 30.22  ? 417  PRO A N     1 
ATOM   3453 C  CA    . PRO A 1 417 ? -9.400  -6.853  50.638 1.00 29.72  ? 417  PRO A CA    1 
ATOM   3454 C  C     . PRO A 1 417 ? -9.814  -6.813  52.120 1.00 30.45  ? 417  PRO A C     1 
ATOM   3455 O  O     . PRO A 1 417 ? -10.786 -6.139  52.459 1.00 30.73  ? 417  PRO A O     1 
ATOM   3456 C  CB    . PRO A 1 417 ? -9.802  -8.196  50.022 1.00 29.95  ? 417  PRO A CB    1 
ATOM   3457 C  CG    . PRO A 1 417 ? -8.739  -8.514  49.051 1.00 28.23  ? 417  PRO A CG    1 
ATOM   3458 C  CD    . PRO A 1 417 ? -7.475  -7.925  49.589 1.00 28.50  ? 417  PRO A CD    1 
ATOM   3459 N  N     . SER A 1 418 ? -9.078  -7.515  52.983 1.00 28.33  ? 418  SER A N     1 
ATOM   3460 C  CA    . SER A 1 418 ? -9.356  -7.511  54.416 1.00 26.39  ? 418  SER A CA    1 
ATOM   3461 C  C     . SER A 1 418 ? -9.146  -6.132  55.027 1.00 27.43  ? 418  SER A C     1 
ATOM   3462 O  O     . SER A 1 418 ? -9.873  -5.751  55.939 1.00 28.58  ? 418  SER A O     1 
ATOM   3463 C  CB    . SER A 1 418 ? -8.493  -8.540  55.157 1.00 27.43  ? 418  SER A CB    1 
ATOM   3464 O  OG    . SER A 1 418 ? -8.854  -9.873  54.816 1.00 27.86  ? 418  SER A OG    1 
ATOM   3465 N  N     . ILE A 1 419 ? -8.152  -5.393  54.529 1.00 29.01  ? 419  ILE A N     1 
ATOM   3466 C  CA    . ILE A 1 419 ? -7.894  -4.021  54.980 1.00 27.25  ? 419  ILE A CA    1 
ATOM   3467 C  C     . ILE A 1 419 ? -9.037  -3.108  54.557 1.00 28.52  ? 419  ILE A C     1 
ATOM   3468 O  O     . ILE A 1 419 ? -9.521  -2.302  55.355 1.00 31.92  ? 419  ILE A O     1 
ATOM   3469 C  CB    . ILE A 1 419 ? -6.553  -3.455  54.452 1.00 25.50  ? 419  ILE A CB    1 
ATOM   3470 C  CG1   . ILE A 1 419 ? -5.371  -4.213  55.056 1.00 27.11  ? 419  ILE A CG1   1 
ATOM   3471 C  CG2   . ILE A 1 419 ? -6.427  -1.940  54.754 1.00 21.43  ? 419  ILE A CG2   1 
ATOM   3472 C  CD1   . ILE A 1 419 ? -4.013  -3.829  54.435 1.00 22.54  ? 419  ILE A CD1   1 
ATOM   3473 N  N     . ILE A 1 420 ? -9.467  -3.234  53.309 1.00 26.87  ? 420  ILE A N     1 
ATOM   3474 C  CA    . ILE A 1 420 ? -10.624 -2.479  52.828 1.00 27.22  ? 420  ILE A CA    1 
ATOM   3475 C  C     . ILE A 1 420 ? -11.847 -2.713  53.721 1.00 28.47  ? 420  ILE A C     1 
ATOM   3476 O  O     . ILE A 1 420 ? -12.581 -1.778  54.051 1.00 28.10  ? 420  ILE A O     1 
ATOM   3477 C  CB    . ILE A 1 420 ? -10.993 -2.872  51.381 1.00 27.67  ? 420  ILE A CB    1 
ATOM   3478 C  CG1   . ILE A 1 420 ? -9.887  -2.444  50.398 1.00 27.84  ? 420  ILE A CG1   1 
ATOM   3479 C  CG2   . ILE A 1 420 ? -12.377 -2.301  51.007 1.00 21.23  ? 420  ILE A CG2   1 
ATOM   3480 C  CD1   . ILE A 1 420 ? -10.168 -2.804  48.918 1.00 28.66  ? 420  ILE A CD1   1 
ATOM   3481 N  N     . ARG A 1 421 ? -12.063 -3.967  54.104 1.00 28.73  ? 421  ARG A N     1 
ATOM   3482 C  CA    . ARG A 1 421 ? -13.236 -4.338  54.888 1.00 29.24  ? 421  ARG A CA    1 
ATOM   3483 C  C     . ARG A 1 421 ? -13.093 -3.855  56.337 1.00 30.46  ? 421  ARG A C     1 
ATOM   3484 O  O     . ARG A 1 421 ? -14.031 -3.295  56.901 1.00 32.89  ? 421  ARG A O     1 
ATOM   3485 C  CB    . ARG A 1 421 ? -13.463 -5.856  54.819 1.00 27.61  ? 421  ARG A CB    1 
ATOM   3486 C  CG    . ARG A 1 421 ? -13.974 -6.367  53.472 1.00 27.58  ? 421  ARG A CG    1 
ATOM   3487 C  CD    . ARG A 1 421 ? -14.075 -7.901  53.446 1.00 31.27  ? 421  ARG A CD    1 
ATOM   3488 N  NE    . ARG A 1 421 ? -14.895 -8.430  54.546 1.00 32.11  ? 421  ARG A NE    1 
ATOM   3489 C  CZ    . ARG A 1 421 ? -14.619 -9.550  55.212 1.00 31.56  ? 421  ARG A CZ    1 
ATOM   3490 N  NH1   . ARG A 1 421 ? -13.551 -10.269 54.894 1.00 27.77  ? 421  ARG A NH1   1 
ATOM   3491 N  NH2   . ARG A 1 421 ? -15.405 -9.955  56.200 1.00 33.03  ? 421  ARG A NH2   1 
ATOM   3492 N  N     . GLN A 1 422 ? -11.908 -4.052  56.916 1.00 29.93  ? 422  GLN A N     1 
ATOM   3493 C  CA    . GLN A 1 422 ? -11.610 -3.637  58.293 1.00 29.48  ? 422  GLN A CA    1 
ATOM   3494 C  C     . GLN A 1 422 ? -11.687 -2.119  58.495 1.00 30.88  ? 422  GLN A C     1 
ATOM   3495 O  O     . GLN A 1 422 ? -12.295 -1.648  59.452 1.00 32.19  ? 422  GLN A O     1 
ATOM   3496 C  CB    . GLN A 1 422 ? -10.223 -4.155  58.712 1.00 27.49  ? 422  GLN A CB    1 
ATOM   3497 C  CG    . GLN A 1 422 ? -9.616  -3.463  59.947 1.00 29.49  ? 422  GLN A CG    1 
ATOM   3498 C  CD    . GLN A 1 422 ? -8.764  -4.385  60.799 1.00 28.75  ? 422  GLN A CD    1 
ATOM   3499 O  OE1   . GLN A 1 422 ? -8.784  -5.601  60.625 1.00 32.27  ? 422  GLN A OE1   1 
ATOM   3500 N  NE2   . GLN A 1 422 ? -8.010  -3.810  61.724 1.00 27.11  ? 422  GLN A NE2   1 
ATOM   3501 N  N     . VAL A 1 423 ? -11.057 -1.364  57.596 1.00 30.20  ? 423  VAL A N     1 
ATOM   3502 C  CA    . VAL A 1 423 ? -10.986 0.085   57.715 1.00 29.20  ? 423  VAL A CA    1 
ATOM   3503 C  C     . VAL A 1 423 ? -12.273 0.751   57.208 1.00 30.60  ? 423  VAL A C     1 
ATOM   3504 O  O     . VAL A 1 423 ? -12.637 1.837   57.674 1.00 30.08  ? 423  VAL A O     1 
ATOM   3505 C  CB    . VAL A 1 423 ? -9.742  0.645   56.978 1.00 30.04  ? 423  VAL A CB    1 
ATOM   3506 C  CG1   . VAL A 1 423 ? -9.653  2.160   57.119 1.00 31.78  ? 423  VAL A CG1   1 
ATOM   3507 C  CG2   . VAL A 1 423 ? -8.467  0.010   57.523 1.00 29.40  ? 423  VAL A CG2   1 
ATOM   3508 N  N     . ASN A 1 424 ? -12.960 0.081   56.276 1.00 29.17  ? 424  ASN A N     1 
ATOM   3509 C  CA    . ASN A 1 424 ? -14.168 0.597   55.613 1.00 29.01  ? 424  ASN A CA    1 
ATOM   3510 C  C     . ASN A 1 424 ? -13.846 1.622   54.518 1.00 29.54  ? 424  ASN A C     1 
ATOM   3511 O  O     . ASN A 1 424 ? -14.505 2.659   54.388 1.00 28.95  ? 424  ASN A O     1 
ATOM   3512 C  CB    . ASN A 1 424 ? -15.195 1.141   56.617 1.00 30.20  ? 424  ASN A CB    1 
ATOM   3513 C  CG    . ASN A 1 424 ? -16.621 1.065   56.096 1.00 32.35  ? 424  ASN A CG    1 
ATOM   3514 O  OD1   . ASN A 1 424 ? -17.006 0.091   55.440 1.00 32.51  ? 424  ASN A OD1   1 
ATOM   3515 N  ND2   . ASN A 1 424 ? -17.419 2.091   56.395 1.00 32.99  ? 424  ASN A ND2   1 
ATOM   3516 N  N     . ILE A 1 425 ? -12.837 1.294   53.716 1.00 28.24  ? 425  ILE A N     1 
ATOM   3517 C  CA    . ILE A 1 425 ? -12.342 2.157   52.652 1.00 26.68  ? 425  ILE A CA    1 
ATOM   3518 C  C     . ILE A 1 425 ? -13.253 2.074   51.426 1.00 28.66  ? 425  ILE A C     1 
ATOM   3519 O  O     . ILE A 1 425 ? -13.412 1.015   50.829 1.00 30.36  ? 425  ILE A O     1 
ATOM   3520 C  CB    . ILE A 1 425 ? -10.901 1.733   52.259 1.00 25.34  ? 425  ILE A CB    1 
ATOM   3521 C  CG1   . ILE A 1 425 ? -9.995  1.747   53.489 1.00 21.63  ? 425  ILE A CG1   1 
ATOM   3522 C  CG2   . ILE A 1 425 ? -10.358 2.613   51.131 1.00 24.41  ? 425  ILE A CG2   1 
ATOM   3523 C  CD1   . ILE A 1 425 ? -8.560  1.225   53.253 1.00 26.40  ? 425  ILE A CD1   1 
ATOM   3524 N  N     . SER A 1 426 ? -13.846 3.203   51.054 1.00 31.86  ? 426  SER A N     1 
ATOM   3525 C  CA    . SER A 1 426 ? -14.757 3.286   49.916 1.00 32.14  ? 426  SER A CA    1 
ATOM   3526 C  C     . SER A 1 426 ? -14.806 4.755   49.509 1.00 34.65  ? 426  SER A C     1 
ATOM   3527 O  O     . SER A 1 426 ? -14.517 5.623   50.337 1.00 36.12  ? 426  SER A O     1 
ATOM   3528 C  CB    . SER A 1 426 ? -16.147 2.818   50.340 1.00 33.90  ? 426  SER A CB    1 
ATOM   3529 O  OG    . SER A 1 426 ? -16.930 2.425   49.228 1.00 36.95  ? 426  SER A OG    1 
ATOM   3530 N  N     . PRO A 1 427 ? -15.166 5.052   48.245 1.00 35.32  ? 427  PRO A N     1 
ATOM   3531 C  CA    . PRO A 1 427 ? -15.228 6.456   47.831 1.00 36.62  ? 427  PRO A CA    1 
ATOM   3532 C  C     . PRO A 1 427 ? -16.263 7.271   48.601 1.00 38.13  ? 427  PRO A C     1 
ATOM   3533 O  O     . PRO A 1 427 ? -16.046 8.465   48.839 1.00 40.12  ? 427  PRO A O     1 
ATOM   3534 C  CB    . PRO A 1 427 ? -15.621 6.374   46.353 1.00 36.32  ? 427  PRO A CB    1 
ATOM   3535 C  CG    . PRO A 1 427 ? -16.213 5.022   46.184 1.00 36.88  ? 427  PRO A CG    1 
ATOM   3536 C  CD    . PRO A 1 427 ? -15.454 4.150   47.119 1.00 35.91  ? 427  PRO A CD    1 
ATOM   3537 N  N     . GLU A 1 428 ? -17.370 6.640   48.990 1.00 35.71  ? 428  GLU A N     1 
ATOM   3538 C  CA    . GLU A 1 428 ? -18.418 7.354   49.707 1.00 34.06  ? 428  GLU A CA    1 
ATOM   3539 C  C     . GLU A 1 428 ? -18.345 7.269   51.249 1.00 31.74  ? 428  GLU A C     1 
ATOM   3540 O  O     . GLU A 1 428 ? -19.216 7.792   51.924 1.00 30.72  ? 428  GLU A O     1 
ATOM   3541 C  CB    . GLU A 1 428 ? -19.814 6.991   49.158 1.00 34.06  ? 428  GLU A CB    1 
ATOM   3542 C  CG    . GLU A 1 428 ? -20.462 5.721   49.708 1.00 39.04  ? 428  GLU A CG    1 
ATOM   3543 C  CD    . GLU A 1 428 ? -19.861 4.420   49.175 1.00 40.36  ? 428  GLU A CD    1 
ATOM   3544 O  OE1   . GLU A 1 428 ? -18.691 4.412   48.731 1.00 38.30  ? 428  GLU A OE1   1 
ATOM   3545 O  OE2   . GLU A 1 428 ? -20.574 3.393   49.218 1.00 41.60  ? 428  GLU A OE2   1 
ATOM   3546 N  N     . THR A 1 429 ? -17.300 6.647   51.801 1.00 32.22  ? 429  THR A N     1 
ATOM   3547 C  CA    . THR A 1 429 ? -17.163 6.550   53.273 1.00 31.78  ? 429  THR A CA    1 
ATOM   3548 C  C     . THR A 1 429 ? -16.061 7.412   53.911 1.00 31.95  ? 429  THR A C     1 
ATOM   3549 O  O     . THR A 1 429 ? -15.848 7.364   55.137 1.00 32.71  ? 429  THR A O     1 
ATOM   3550 C  CB    . THR A 1 429 ? -16.984 5.103   53.757 1.00 30.20  ? 429  THR A CB    1 
ATOM   3551 O  OG1   . THR A 1 429 ? -15.784 4.557   53.203 1.00 31.85  ? 429  THR A OG1   1 
ATOM   3552 C  CG2   . THR A 1 429 ? -18.176 4.254   53.367 1.00 31.61  ? 429  THR A CG2   1 
ATOM   3553 N  N     . ILE A 1 430 ? -15.384 8.207   53.089 1.00 30.59  ? 430  ILE A N     1 
ATOM   3554 C  CA    . ILE A 1 430 ? -14.355 9.127   53.564 1.00 31.08  ? 430  ILE A CA    1 
ATOM   3555 C  C     . ILE A 1 430 ? -14.938 10.142  54.563 1.00 34.05  ? 430  ILE A C     1 
ATOM   3556 O  O     . ILE A 1 430 ? -15.873 10.884  54.249 1.00 36.63  ? 430  ILE A O     1 
ATOM   3557 C  CB    . ILE A 1 430 ? -13.650 9.824   52.383 1.00 30.96  ? 430  ILE A CB    1 
ATOM   3558 C  CG1   . ILE A 1 430 ? -12.844 8.798   51.575 1.00 28.78  ? 430  ILE A CG1   1 
ATOM   3559 C  CG2   . ILE A 1 430 ? -12.765 10.988  52.860 1.00 29.12  ? 430  ILE A CG2   1 
ATOM   3560 C  CD1   . ILE A 1 430 ? -12.219 9.350   50.289 1.00 32.08  ? 430  ILE A CD1   1 
ATOM   3561 N  N     . ALA A 1 431 ? -14.380 10.146  55.770 1.00 34.28  ? 431  ALA A N     1 
ATOM   3562 C  CA    . ALA A 1 431 ? -14.832 11.012  56.855 1.00 35.69  ? 431  ALA A CA    1 
ATOM   3563 C  C     . ALA A 1 431 ? -14.015 12.296  56.938 1.00 37.21  ? 431  ALA A C     1 
ATOM   3564 O  O     . ALA A 1 431 ? -14.547 13.344  57.283 1.00 38.03  ? 431  ALA A O     1 
ATOM   3565 C  CB    . ALA A 1 431 ? -14.772 10.267  58.188 1.00 33.21  ? 431  ALA A CB    1 
ATOM   3566 N  N     . GLY A 1 432 ? -12.721 12.209  56.634 1.00 38.91  ? 432  GLY A N     1 
ATOM   3567 C  CA    . GLY A 1 432 ? -11.828 13.366  56.712 1.00 38.39  ? 432  GLY A CA    1 
ATOM   3568 C  C     . GLY A 1 432 ? -10.374 12.942  56.765 1.00 39.67  ? 432  GLY A C     1 
ATOM   3569 O  O     . GLY A 1 432 ? -10.010 11.885  56.242 1.00 40.29  ? 432  GLY A O     1 
ATOM   3570 N  N     . THR A 1 433 ? -9.538  13.773  57.386 1.00 37.94  ? 433  THR A N     1 
ATOM   3571 C  CA    . THR A 1 433 ? -8.134  13.454  57.583 1.00 36.12  ? 433  THR A CA    1 
ATOM   3572 C  C     . THR A 1 433 ? -7.711  13.754  59.016 1.00 36.17  ? 433  THR A C     1 
ATOM   3573 O  O     . THR A 1 433 ? -8.419  14.446  59.750 1.00 34.15  ? 433  THR A O     1 
ATOM   3574 C  CB    . THR A 1 433 ? -7.211  14.266  56.637 1.00 38.10  ? 433  THR A CB    1 
ATOM   3575 O  OG1   . THR A 1 433 ? -7.388  15.673  56.883 1.00 39.93  ? 433  THR A OG1   1 
ATOM   3576 C  CG2   . THR A 1 433 ? -7.476  13.941  55.148 1.00 33.76  ? 433  THR A CG2   1 
ATOM   3577 N  N     . PHE A 1 434 ? -6.548  13.228  59.396 1.00 34.34  ? 434  PHE A N     1 
ATOM   3578 C  CA    . PHE A 1 434 ? -5.870  13.603  60.628 1.00 35.28  ? 434  PHE A CA    1 
ATOM   3579 C  C     . PHE A 1 434 ? -4.396  13.896  60.306 1.00 36.52  ? 434  PHE A C     1 
ATOM   3580 O  O     . PHE A 1 434 ? -3.900  13.479  59.262 1.00 35.64  ? 434  PHE A O     1 
ATOM   3581 C  CB    . PHE A 1 434 ? -6.020  12.501  61.697 1.00 34.11  ? 434  PHE A CB    1 
ATOM   3582 C  CG    . PHE A 1 434 ? -5.347  11.193  61.338 1.00 35.98  ? 434  PHE A CG    1 
ATOM   3583 C  CD1   . PHE A 1 434 ? -6.031  10.205  60.629 1.00 34.44  ? 434  PHE A CD1   1 
ATOM   3584 C  CD2   . PHE A 1 434 ? -4.030  10.945  61.715 1.00 33.29  ? 434  PHE A CD2   1 
ATOM   3585 C  CE1   . PHE A 1 434 ? -5.404  9.006   60.292 1.00 30.87  ? 434  PHE A CE1   1 
ATOM   3586 C  CE2   . PHE A 1 434 ? -3.404  9.741   61.385 1.00 32.30  ? 434  PHE A CE2   1 
ATOM   3587 C  CZ    . PHE A 1 434 ? -4.096  8.773   60.674 1.00 27.35  ? 434  PHE A CZ    1 
ATOM   3588 N  N     . LYS A 1 435 ? -3.719  14.626  61.194 1.00 38.68  ? 435  LYS A N     1 
ATOM   3589 C  CA    . LYS A 1 435 ? -2.279  14.918  61.088 1.00 40.64  ? 435  LYS A CA    1 
ATOM   3590 C  C     . LYS A 1 435 ? -1.464  13.632  61.209 1.00 39.17  ? 435  LYS A C     1 
ATOM   3591 O  O     . LYS A 1 435 ? -1.541  12.948  62.231 1.00 36.42  ? 435  LYS A O     1 
ATOM   3592 C  CB    . LYS A 1 435 ? -1.866  15.861  62.215 1.00 44.81  ? 435  LYS A CB    1 
ATOM   3593 C  CG    . LYS A 1 435 ? -2.009  17.348  61.918 1.00 50.29  ? 435  LYS A CG    1 
ATOM   3594 C  CD    . LYS A 1 435 ? -0.636  18.024  61.872 1.00 53.31  ? 435  LYS A CD    1 
ATOM   3595 C  CE    . LYS A 1 435 ? 0.026   18.068  63.257 1.00 52.62  ? 435  LYS A CE    1 
ATOM   3596 N  NZ    . LYS A 1 435 ? -0.542  19.113  64.153 1.00 54.69  ? 435  LYS A NZ    1 
ATOM   3597 N  N     . VAL A 1 436 ? -0.669  13.319  60.186 1.00 37.37  ? 436  VAL A N     1 
ATOM   3598 C  CA    . VAL A 1 436 ? -0.079  11.978  60.092 1.00 39.02  ? 436  VAL A CA    1 
ATOM   3599 C  C     . VAL A 1 436 ? 0.938   11.575  61.186 1.00 40.57  ? 436  VAL A C     1 
ATOM   3600 O  O     . VAL A 1 436 ? 0.543   10.925  62.151 1.00 45.07  ? 436  VAL A O     1 
ATOM   3601 C  CB    . VAL A 1 436 ? 0.314   11.553  58.630 1.00 37.49  ? 436  VAL A CB    1 
ATOM   3602 C  CG1   . VAL A 1 436 ? 1.499   12.364  58.062 1.00 31.97  ? 436  VAL A CG1   1 
ATOM   3603 C  CG2   . VAL A 1 436 ? 0.588   10.083  58.581 1.00 38.14  ? 436  VAL A CG2   1 
ATOM   3604 N  N     . ALA A 1 437 ? 2.206   11.955  61.079 1.00 39.41  ? 437  ALA A N     1 
ATOM   3605 C  CA    . ALA A 1 437 ? 3.240   11.361  61.953 1.00 39.91  ? 437  ALA A CA    1 
ATOM   3606 C  C     . ALA A 1 437 ? 3.941   10.203  61.237 1.00 39.81  ? 437  ALA A C     1 
ATOM   3607 O  O     . ALA A 1 437 ? 3.305   9.481   60.459 1.00 41.86  ? 437  ALA A O     1 
ATOM   3608 C  CB    . ALA A 1 437 ? 2.638   10.868  63.294 1.00 37.35  ? 437  ALA A CB    1 
ATOM   3609 N  N     . PRO A 1 438 ? 5.248   10.007  61.507 1.00 39.18  ? 438  PRO A N     1 
ATOM   3610 C  CA    . PRO A 1 438 ? 6.000   9.003   60.768 1.00 38.83  ? 438  PRO A CA    1 
ATOM   3611 C  C     . PRO A 1 438 ? 5.473   7.603   61.056 1.00 38.85  ? 438  PRO A C     1 
ATOM   3612 O  O     . PRO A 1 438 ? 5.072   7.315   62.194 1.00 36.01  ? 438  PRO A O     1 
ATOM   3613 C  CB    . PRO A 1 438 ? 7.430   9.150   61.313 1.00 39.69  ? 438  PRO A CB    1 
ATOM   3614 C  CG    . PRO A 1 438 ? 7.452   10.427  62.083 1.00 39.59  ? 438  PRO A CG    1 
ATOM   3615 C  CD    . PRO A 1 438 ? 6.058   10.608  62.582 1.00 39.78  ? 438  PRO A CD    1 
ATOM   3616 N  N     . LEU A 1 439 ? 5.486   6.749   60.030 1.00 38.48  ? 439  LEU A N     1 
ATOM   3617 C  CA    . LEU A 1 439 ? 4.949   5.385   60.125 1.00 38.10  ? 439  LEU A CA    1 
ATOM   3618 C  C     . LEU A 1 439 ? 5.567   4.587   61.272 1.00 37.18  ? 439  LEU A C     1 
ATOM   3619 O  O     . LEU A 1 439 ? 4.875   3.822   61.951 1.00 36.26  ? 439  LEU A O     1 
ATOM   3620 C  CB    . LEU A 1 439 ? 5.124   4.642   58.794 1.00 37.76  ? 439  LEU A CB    1 
ATOM   3621 C  CG    . LEU A 1 439 ? 4.503   3.247   58.638 1.00 38.44  ? 439  LEU A CG    1 
ATOM   3622 C  CD1   . LEU A 1 439 ? 2.977   3.310   58.562 1.00 37.34  ? 439  LEU A CD1   1 
ATOM   3623 C  CD2   . LEU A 1 439 ? 5.065   2.566   57.406 1.00 41.05  ? 439  LEU A CD2   1 
ATOM   3624 N  N     . HIS A 1 440 ? 6.864   4.785   61.488 1.00 37.24  ? 440  HIS A N     1 
ATOM   3625 C  CA    . HIS A 1 440 ? 7.599   4.122   62.567 1.00 41.46  ? 440  HIS A CA    1 
ATOM   3626 C  C     . HIS A 1 440 ? 6.940   4.362   63.944 1.00 40.43  ? 440  HIS A C     1 
ATOM   3627 O  O     . HIS A 1 440 ? 6.943   3.483   64.814 1.00 40.65  ? 440  HIS A O     1 
ATOM   3628 C  CB    . HIS A 1 440 ? 9.075   4.566   62.504 1.00 45.23  ? 440  HIS A CB    1 
ATOM   3629 C  CG    . HIS A 1 440 ? 9.841   4.405   63.783 1.00 55.64  ? 440  HIS A CG    1 
ATOM   3630 N  ND1   . HIS A 1 440 ? 9.829   5.355   64.785 1.00 60.85  ? 440  HIS A ND1   1 
ATOM   3631 C  CD2   . HIS A 1 440 ? 10.685  3.430   64.201 1.00 60.62  ? 440  HIS A CD2   1 
ATOM   3632 C  CE1   . HIS A 1 440 ? 10.610  4.960   65.776 1.00 61.94  ? 440  HIS A CE1   1 
ATOM   3633 N  NE2   . HIS A 1 440 ? 11.145  3.798   65.445 1.00 64.45  ? 440  HIS A NE2   1 
ATOM   3634 N  N     . ASP A 1 441 ? 6.344   5.536   64.124 1.00 38.65  ? 441  ASP A N     1 
ATOM   3635 C  CA    . ASP A 1 441 ? 5.725   5.877   65.396 1.00 40.27  ? 441  ASP A CA    1 
ATOM   3636 C  C     . ASP A 1 441 ? 4.464   5.074   65.683 1.00 39.24  ? 441  ASP A C     1 
ATOM   3637 O  O     . ASP A 1 441 ? 4.166   4.783   66.840 1.00 38.09  ? 441  ASP A O     1 
ATOM   3638 C  CB    . ASP A 1 441 ? 5.446   7.382   65.489 1.00 41.27  ? 441  ASP A CB    1 
ATOM   3639 C  CG    . ASP A 1 441 ? 6.677   8.184   65.896 1.00 46.25  ? 441  ASP A CG    1 
ATOM   3640 O  OD1   . ASP A 1 441 ? 7.697   7.580   66.308 1.00 49.99  ? 441  ASP A OD1   1 
ATOM   3641 O  OD2   . ASP A 1 441 ? 6.620   9.428   65.817 1.00 48.13  ? 441  ASP A OD2   1 
ATOM   3642 N  N     . TYR A 1 442 ? 3.733   4.718   64.630 1.00 37.60  ? 442  TYR A N     1 
ATOM   3643 C  CA    . TYR A 1 442 ? 2.552   3.868   64.755 1.00 36.78  ? 442  TYR A CA    1 
ATOM   3644 C  C     . TYR A 1 442 ? 2.952   2.414   65.011 1.00 36.59  ? 442  TYR A C     1 
ATOM   3645 O  O     . TYR A 1 442 ? 2.376   1.738   65.866 1.00 35.15  ? 442  TYR A O     1 
ATOM   3646 C  CB    . TYR A 1 442 ? 1.683   3.976   63.499 1.00 35.84  ? 442  TYR A CB    1 
ATOM   3647 C  CG    . TYR A 1 442 ? 1.066   5.340   63.308 1.00 35.78  ? 442  TYR A CG    1 
ATOM   3648 C  CD1   . TYR A 1 442 ? 0.104   5.822   64.207 1.00 33.58  ? 442  TYR A CD1   1 
ATOM   3649 C  CD2   . TYR A 1 442 ? 1.443   6.157   62.239 1.00 35.80  ? 442  TYR A CD2   1 
ATOM   3650 C  CE1   . TYR A 1 442 ? -0.463  7.070   64.045 1.00 32.11  ? 442  TYR A CE1   1 
ATOM   3651 C  CE2   . TYR A 1 442 ? 0.875   7.423   62.064 1.00 33.62  ? 442  TYR A CE2   1 
ATOM   3652 C  CZ    . TYR A 1 442 ? -0.078  7.869   62.973 1.00 36.03  ? 442  TYR A CZ    1 
ATOM   3653 O  OH    . TYR A 1 442 ? -0.657  9.109   62.819 1.00 35.09  ? 442  TYR A OH    1 
ATOM   3654 N  N     . ILE A 1 443 ? 3.951   1.955   64.260 1.00 36.12  ? 443  ILE A N     1 
ATOM   3655 C  CA    . ILE A 1 443 ? 4.524   0.619   64.400 1.00 35.73  ? 443  ILE A CA    1 
ATOM   3656 C  C     . ILE A 1 443 ? 4.906   0.323   65.858 1.00 37.58  ? 443  ILE A C     1 
ATOM   3657 O  O     . ILE A 1 443 ? 4.722   -0.797  66.336 1.00 38.52  ? 443  ILE A O     1 
ATOM   3658 C  CB    . ILE A 1 443 ? 5.737   0.462   63.443 1.00 35.02  ? 443  ILE A CB    1 
ATOM   3659 C  CG1   . ILE A 1 443 ? 5.247   0.378   61.988 1.00 37.03  ? 443  ILE A CG1   1 
ATOM   3660 C  CG2   . ILE A 1 443 ? 6.588   -0.741  63.804 1.00 31.92  ? 443  ILE A CG2   1 
ATOM   3661 C  CD1   . ILE A 1 443 ? 6.300   0.746   60.945 1.00 35.08  ? 443  ILE A CD1   1 
ATOM   3662 N  N     . ASN A 1 444 ? 5.409   1.341   66.557 1.00 38.74  ? 444  ASN A N     1 
ATOM   3663 C  CA    . ASN A 1 444 ? 5.833   1.219   67.950 1.00 40.41  ? 444  ASN A CA    1 
ATOM   3664 C  C     . ASN A 1 444 ? 4.802   1.752   68.951 1.00 42.00  ? 444  ASN A C     1 
ATOM   3665 O  O     . ASN A 1 444 ? 5.106   1.924   70.131 1.00 43.19  ? 444  ASN A O     1 
ATOM   3666 C  CB    . ASN A 1 444 ? 7.186   1.913   68.162 1.00 40.74  ? 444  ASN A CB    1 
ATOM   3667 C  CG    . ASN A 1 444 ? 8.287   1.337   67.286 1.00 44.38  ? 444  ASN A CG    1 
ATOM   3668 O  OD1   . ASN A 1 444 ? 8.369   0.128   67.079 1.00 43.25  ? 444  ASN A OD1   1 
ATOM   3669 N  ND2   . ASN A 1 444 ? 9.143   2.207   66.767 1.00 46.76  ? 444  ASN A ND2   1 
ATOM   3670 N  N     . ALA A 1 445 ? 3.588   2.013   68.473 1.00 43.03  ? 445  ALA A N     1 
ATOM   3671 C  CA    . ALA A 1 445 ? 2.475   2.472   69.319 1.00 44.28  ? 445  ALA A CA    1 
ATOM   3672 C  C     . ALA A 1 445 ? 2.837   3.643   70.238 1.00 44.66  ? 445  ALA A C     1 
ATOM   3673 O  O     . ALA A 1 445 ? 2.497   3.646   71.424 1.00 45.58  ? 445  ALA A O     1 
ATOM   3674 C  CB    . ALA A 1 445 ? 1.897   1.297   70.128 1.00 43.16  ? 445  ALA A CB    1 
ATOM   3675 N  N     . VAL A 1 446 ? 3.538   4.631   69.690 1.00 45.97  ? 446  VAL A N     1 
ATOM   3676 C  CA    . VAL A 1 446 ? 3.933   5.811   70.467 1.00 45.70  ? 446  VAL A CA    1 
ATOM   3677 C  C     . VAL A 1 446 ? 3.252   7.069   69.948 1.00 45.79  ? 446  VAL A C     1 
ATOM   3678 O  O     . VAL A 1 446 ? 3.146   8.066   70.666 1.00 46.66  ? 446  VAL A O     1 
ATOM   3679 C  CB    . VAL A 1 446 ? 5.475   6.019   70.520 1.00 45.86  ? 446  VAL A CB    1 
ATOM   3680 C  CG1   . VAL A 1 446 ? 6.152   4.882   71.290 1.00 48.03  ? 446  VAL A CG1   1 
ATOM   3681 C  CG2   . VAL A 1 446 ? 6.067   6.163   69.126 1.00 45.39  ? 446  VAL A CG2   1 
ATOM   3682 N  N     . ALA A 1 447 ? 2.779   7.014   68.706 1.00 43.22  ? 447  ALA A N     1 
ATOM   3683 C  CA    . ALA A 1 447 ? 2.078   8.142   68.117 1.00 44.02  ? 447  ALA A CA    1 
ATOM   3684 C  C     . ALA A 1 447 ? 0.717   8.322   68.781 1.00 43.79  ? 447  ALA A C     1 
ATOM   3685 O  O     . ALA A 1 447 ? 0.123   7.362   69.272 1.00 42.97  ? 447  ALA A O     1 
ATOM   3686 C  CB    . ALA A 1 447 ? 1.925   7.957   66.610 1.00 42.17  ? 447  ALA A CB    1 
ATOM   3687 N  N     . GLU A 1 448 ? 0.253   9.566   68.809 1.00 43.95  ? 448  GLU A N     1 
ATOM   3688 C  CA    . GLU A 1 448 ? -1.104  9.907   69.206 1.00 46.40  ? 448  GLU A CA    1 
ATOM   3689 C  C     . GLU A 1 448 ? -2.099  9.010   68.461 1.00 44.53  ? 448  GLU A C     1 
ATOM   3690 O  O     . GLU A 1 448 ? -1.944  8.767   67.257 1.00 44.44  ? 448  GLU A O     1 
ATOM   3691 C  CB    . GLU A 1 448 ? -1.361  11.373  68.851 1.00 49.54  ? 448  GLU A CB    1 
ATOM   3692 C  CG    . GLU A 1 448 ? -2.533  12.042  69.575 1.00 59.54  ? 448  GLU A CG    1 
ATOM   3693 C  CD    . GLU A 1 448 ? -2.760  13.496  69.137 1.00 64.82  ? 448  GLU A CD    1 
ATOM   3694 O  OE1   . GLU A 1 448 ? -3.846  14.037  69.437 1.00 65.59  ? 448  GLU A OE1   1 
ATOM   3695 O  OE2   . GLU A 1 448 ? -1.863  14.097  68.495 1.00 66.37  ? 448  GLU A OE2   1 
ATOM   3696 N  N     . ARG A 1 449 ? -3.100  8.504   69.178 1.00 42.57  ? 449  ARG A N     1 
ATOM   3697 C  CA    . ARG A 1 449 ? -4.199  7.778   68.548 1.00 41.06  ? 449  ARG A CA    1 
ATOM   3698 C  C     . ARG A 1 449 ? -4.848  8.666   67.489 1.00 41.59  ? 449  ARG A C     1 
ATOM   3699 O  O     . ARG A 1 449 ? -5.223  9.804   67.786 1.00 41.92  ? 449  ARG A O     1 
ATOM   3700 C  CB    . ARG A 1 449 ? -5.233  7.326   69.582 1.00 41.17  ? 449  ARG A CB    1 
ATOM   3701 C  CG    . ARG A 1 449 ? -6.316  6.398   69.020 1.00 39.75  ? 449  ARG A CG    1 
ATOM   3702 C  CD    . ARG A 1 449 ? -6.920  5.557   70.112 1.00 37.98  ? 449  ARG A CD    1 
ATOM   3703 N  NE    . ARG A 1 449 ? -7.940  4.631   69.625 1.00 36.36  ? 449  ARG A NE    1 
ATOM   3704 C  CZ    . ARG A 1 449 ? -9.245  4.783   69.828 1.00 34.62  ? 449  ARG A CZ    1 
ATOM   3705 N  NH1   . ARG A 1 449 ? -9.693  5.837   70.500 1.00 32.22  ? 449  ARG A NH1   1 
ATOM   3706 N  NH2   . ARG A 1 449 ? -10.103 3.883   69.360 1.00 32.16  ? 449  ARG A NH2   1 
ATOM   3707 N  N     . PRO A 1 450 ? -4.955  8.158   66.242 1.00 41.50  ? 450  PRO A N     1 
ATOM   3708 C  CA    . PRO A 1 450 ? -5.444  8.960   65.120 1.00 41.02  ? 450  PRO A CA    1 
ATOM   3709 C  C     . PRO A 1 450 ? -6.823  9.583   65.368 1.00 41.21  ? 450  PRO A C     1 
ATOM   3710 O  O     . PRO A 1 450 ? -6.997  10.784  65.135 1.00 42.04  ? 450  PRO A O     1 
ATOM   3711 C  CB    . PRO A 1 450 ? -5.495  7.948   63.970 1.00 41.30  ? 450  PRO A CB    1 
ATOM   3712 C  CG    . PRO A 1 450 ? -4.437  6.977   64.301 1.00 40.20  ? 450  PRO A CG    1 
ATOM   3713 C  CD    . PRO A 1 450 ? -4.499  6.830   65.793 1.00 40.92  ? 450  PRO A CD    1 
ATOM   3714 N  N     . SER A 1 451 ? -7.772  8.779   65.850 1.00 38.75  ? 451  SER A N     1 
ATOM   3715 C  CA    . SER A 1 451 ? -9.139  9.241   66.105 1.00 39.12  ? 451  SER A CA    1 
ATOM   3716 C  C     . SER A 1 451 ? -9.841  8.356   67.138 1.00 38.72  ? 451  SER A C     1 
ATOM   3717 O  O     . SER A 1 451 ? -9.494  7.197   67.293 1.00 38.46  ? 451  SER A O     1 
ATOM   3718 C  CB    . SER A 1 451 ? -9.930  9.243   64.795 1.00 38.14  ? 451  SER A CB    1 
ATOM   3719 O  OG    . SER A 1 451 ? -11.297 9.550   65.000 1.00 40.75  ? 451  SER A OG    1 
ATOM   3720 N  N     . ASP A 1 452 ? -10.824 8.900   67.850 1.00 39.75  ? 452  ASP A N     1 
ATOM   3721 C  CA    . ASP A 1 452 ? -11.685 8.064   68.695 1.00 40.26  ? 452  ASP A CA    1 
ATOM   3722 C  C     . ASP A 1 452 ? -13.124 8.054   68.186 1.00 38.23  ? 452  ASP A C     1 
ATOM   3723 O  O     . ASP A 1 452 ? -14.045 7.610   68.868 1.00 38.34  ? 452  ASP A O     1 
ATOM   3724 C  CB    . ASP A 1 452 ? -11.594 8.448   70.184 1.00 42.07  ? 452  ASP A CB    1 
ATOM   3725 C  CG    . ASP A 1 452 ? -11.782 9.938   70.435 1.00 48.39  ? 452  ASP A CG    1 
ATOM   3726 O  OD1   . ASP A 1 452 ? -12.259 10.665  69.530 1.00 48.18  ? 452  ASP A OD1   1 
ATOM   3727 O  OD2   . ASP A 1 452 ? -11.451 10.379  71.566 1.00 50.92  ? 452  ASP A OD2   1 
ATOM   3728 N  N     . VAL A 1 453 ? -13.290 8.526   66.958 1.00 38.48  ? 453  VAL A N     1 
ATOM   3729 C  CA    . VAL A 1 453 ? -14.595 8.647   66.324 1.00 38.00  ? 453  VAL A CA    1 
ATOM   3730 C  C     . VAL A 1 453 ? -14.647 7.839   65.020 1.00 37.16  ? 453  VAL A C     1 
ATOM   3731 O  O     . VAL A 1 453 ? -15.627 7.134   64.768 1.00 36.26  ? 453  VAL A O     1 
ATOM   3732 C  CB    . VAL A 1 453 ? -14.942 10.139  66.047 1.00 38.27  ? 453  VAL A CB    1 
ATOM   3733 C  CG1   . VAL A 1 453 ? -16.239 10.264  65.258 1.00 36.83  ? 453  VAL A CG1   1 
ATOM   3734 C  CG2   . VAL A 1 453 ? -15.043 10.918  67.358 1.00 41.11  ? 453  VAL A CG2   1 
ATOM   3735 N  N     . TYR A 1 454 ? -13.593 7.943   64.206 1.00 35.65  ? 454  TYR A N     1 
ATOM   3736 C  CA    . TYR A 1 454 ? -13.579 7.331   62.867 1.00 35.50  ? 454  TYR A CA    1 
ATOM   3737 C  C     . TYR A 1 454 ? -12.549 6.208   62.701 1.00 35.70  ? 454  TYR A C     1 
ATOM   3738 O  O     . TYR A 1 454 ? -11.598 6.085   63.481 1.00 36.36  ? 454  TYR A O     1 
ATOM   3739 C  CB    . TYR A 1 454 ? -13.388 8.403   61.773 1.00 35.36  ? 454  TYR A CB    1 
ATOM   3740 C  CG    . TYR A 1 454 ? -14.434 9.502   61.783 1.00 34.27  ? 454  TYR A CG    1 
ATOM   3741 C  CD1   . TYR A 1 454 ? -15.777 9.222   61.507 1.00 34.44  ? 454  TYR A CD1   1 
ATOM   3742 C  CD2   . TYR A 1 454 ? -14.081 10.816  62.068 1.00 32.01  ? 454  TYR A CD2   1 
ATOM   3743 C  CE1   . TYR A 1 454 ? -16.745 10.232  61.520 1.00 35.95  ? 454  TYR A CE1   1 
ATOM   3744 C  CE2   . TYR A 1 454 ? -15.040 11.837  62.084 1.00 36.12  ? 454  TYR A CE2   1 
ATOM   3745 C  CZ    . TYR A 1 454 ? -16.372 11.537  61.808 1.00 35.70  ? 454  TYR A CZ    1 
ATOM   3746 O  OH    . TYR A 1 454 ? -17.326 12.541  61.834 1.00 35.50  ? 454  TYR A OH    1 
ATOM   3747 N  N     . SER A 1 455 ? -12.754 5.398   61.666 1.00 35.14  ? 455  SER A N     1 
ATOM   3748 C  CA    . SER A 1 455 ? -11.847 4.307   61.331 1.00 33.75  ? 455  SER A CA    1 
ATOM   3749 C  C     . SER A 1 455 ? -10.690 4.829   60.478 1.00 33.89  ? 455  SER A C     1 
ATOM   3750 O  O     . SER A 1 455 ? -10.915 5.505   59.469 1.00 35.97  ? 455  SER A O     1 
ATOM   3751 C  CB    . SER A 1 455 ? -12.614 3.196   60.613 1.00 31.49  ? 455  SER A CB    1 
ATOM   3752 O  OG    . SER A 1 455 ? -11.759 2.116   60.284 1.00 35.49  ? 455  SER A OG    1 
ATOM   3753 N  N     . CYS A 1 456 ? -9.460  4.496   60.870 1.00 31.52  ? 456  CYS A N     1 
ATOM   3754 C  CA    . CYS A 1 456 ? -8.278  5.170   60.324 1.00 30.65  ? 456  CYS A CA    1 
ATOM   3755 C  C     . CYS A 1 456 ? -7.214  4.280   59.699 1.00 31.14  ? 456  CYS A C     1 
ATOM   3756 O  O     . CYS A 1 456 ? -7.012  3.145   60.117 1.00 30.96  ? 456  CYS A O     1 
ATOM   3757 C  CB    . CYS A 1 456 ? -7.600  5.997   61.416 1.00 31.12  ? 456  CYS A CB    1 
ATOM   3758 S  SG    . CYS A 1 456 ? -8.605  7.319   62.133 1.00 33.40  ? 456  CYS A SG    1 
ATOM   3759 N  N     . SER A 1 457 ? -6.519  4.840   58.709 1.00 31.14  ? 457  SER A N     1 
ATOM   3760 C  CA    . SER A 1 457 ? -5.272  4.298   58.189 1.00 30.78  ? 457  SER A CA    1 
ATOM   3761 C  C     . SER A 1 457 ? -4.122  5.255   58.510 1.00 31.58  ? 457  SER A C     1 
ATOM   3762 O  O     . SER A 1 457 ? -4.327  6.473   58.522 1.00 31.18  ? 457  SER A O     1 
ATOM   3763 C  CB    . SER A 1 457 ? -5.361  4.132   56.672 1.00 33.15  ? 457  SER A CB    1 
ATOM   3764 O  OG    . SER A 1 457 ? -4.139  3.636   56.160 1.00 32.22  ? 457  SER A OG    1 
ATOM   3765 N  N     . PRO A 1 458 ? -2.904  4.715   58.745 1.00 31.01  ? 458  PRO A N     1 
ATOM   3766 C  CA    . PRO A 1 458 ? -1.731  5.549   59.009 1.00 30.00  ? 458  PRO A CA    1 
ATOM   3767 C  C     . PRO A 1 458 ? -1.280  6.444   57.846 1.00 30.92  ? 458  PRO A C     1 
ATOM   3768 O  O     . PRO A 1 458 ? -0.295  7.166   57.987 1.00 30.95  ? 458  PRO A O     1 
ATOM   3769 C  CB    . PRO A 1 458 ? -0.638  4.524   59.345 1.00 29.42  ? 458  PRO A CB    1 
ATOM   3770 C  CG    . PRO A 1 458 ? -1.122  3.239   58.770 1.00 32.20  ? 458  PRO A CG    1 
ATOM   3771 C  CD    . PRO A 1 458 ? -2.602  3.288   58.969 1.00 30.84  ? 458  PRO A CD    1 
ATOM   3772 N  N     . ASN A 1 459 ? -1.986  6.408   56.721 1.00 29.83  ? 459  ASN A N     1 
ATOM   3773 C  CA    . ASN A 1 459 ? -1.718  7.341   55.629 1.00 31.42  ? 459  ASN A CA    1 
ATOM   3774 C  C     . ASN A 1 459 ? -2.427  8.679   55.837 1.00 32.46  ? 459  ASN A C     1 
ATOM   3775 O  O     . ASN A 1 459 ? -2.345  9.565   54.985 1.00 33.90  ? 459  ASN A O     1 
ATOM   3776 C  CB    . ASN A 1 459 ? -2.128  6.744   54.277 1.00 29.07  ? 459  ASN A CB    1 
ATOM   3777 C  CG    . ASN A 1 459 ? -3.592  6.976   53.957 1.00 30.25  ? 459  ASN A CG    1 
ATOM   3778 O  OD1   . ASN A 1 459 ? -4.448  6.946   54.848 1.00 28.57  ? 459  ASN A OD1   1 
ATOM   3779 N  ND2   . ASN A 1 459 ? -3.892  7.208   52.678 1.00 23.86  ? 459  ASN A ND2   1 
ATOM   3780 N  N     . GLY A 1 460 ? -3.148  8.817   56.950 1.00 30.55  ? 460  GLY A N     1 
ATOM   3781 C  CA    . GLY A 1 460 ? -3.845  10.065  57.242 1.00 30.30  ? 460  GLY A CA    1 
ATOM   3782 C  C     . GLY A 1 460 ? -5.356  10.092  57.057 1.00 31.81  ? 460  GLY A C     1 
ATOM   3783 O  O     . GLY A 1 460 ? -5.995  11.073  57.423 1.00 33.48  ? 460  GLY A O     1 
ATOM   3784 N  N     . MET A 1 461 ? -5.937  9.022   56.518 1.00 32.14  ? 461  MET A N     1 
ATOM   3785 C  CA    . MET A 1 461 ? -7.368  9.008   56.171 1.00 31.29  ? 461  MET A CA    1 
ATOM   3786 C  C     . MET A 1 461 ? -8.312  8.500   57.280 1.00 31.62  ? 461  MET A C     1 
ATOM   3787 O  O     . MET A 1 461 ? -7.981  7.588   58.032 1.00 32.42  ? 461  MET A O     1 
ATOM   3788 C  CB    . MET A 1 461 ? -7.586  8.204   54.886 1.00 32.05  ? 461  MET A CB    1 
ATOM   3789 C  CG    . MET A 1 461 ? -6.985  8.830   53.630 1.00 31.22  ? 461  MET A CG    1 
ATOM   3790 S  SD    . MET A 1 461 ? -7.720  10.439  53.250 1.00 37.24  ? 461  MET A SD    1 
ATOM   3791 C  CE    . MET A 1 461 ? -9.382  9.941   52.803 1.00 33.33  ? 461  MET A CE    1 
ATOM   3792 N  N     . MET A 1 462 ? -9.496  9.097   57.360 1.00 32.15  ? 462  MET A N     1 
ATOM   3793 C  CA    . MET A 1 462 ? -10.531 8.686   58.311 1.00 32.10  ? 462  MET A CA    1 
ATOM   3794 C  C     . MET A 1 462 ? -11.775 8.246   57.558 1.00 31.74  ? 462  MET A C     1 
ATOM   3795 O  O     . MET A 1 462 ? -12.158 8.878   56.577 1.00 31.33  ? 462  MET A O     1 
ATOM   3796 C  CB    . MET A 1 462 ? -10.885 9.836   59.266 1.00 31.58  ? 462  MET A CB    1 
ATOM   3797 C  CG    . MET A 1 462 ? -9.704  10.370  60.048 1.00 34.48  ? 462  MET A CG    1 
ATOM   3798 S  SD    . MET A 1 462 ? -10.120 11.305  61.539 1.00 37.50  ? 462  MET A SD    1 
ATOM   3799 C  CE    . MET A 1 462 ? -11.018 12.693  60.840 1.00 32.76  ? 462  MET A CE    1 
ATOM   3800 N  N     . TYR A 1 463 ? -12.401 7.164   58.024 1.00 32.12  ? 463  TYR A N     1 
ATOM   3801 C  CA    . TYR A 1 463 ? -13.599 6.608   57.385 1.00 30.40  ? 463  TYR A CA    1 
ATOM   3802 C  C     . TYR A 1 463 ? -14.719 6.411   58.406 1.00 31.12  ? 463  TYR A C     1 
ATOM   3803 O  O     . TYR A 1 463 ? -14.458 6.090   59.570 1.00 28.54  ? 463  TYR A O     1 
ATOM   3804 C  CB    . TYR A 1 463 ? -13.271 5.275   56.684 1.00 27.19  ? 463  TYR A CB    1 
ATOM   3805 C  CG    . TYR A 1 463 ? -12.211 5.407   55.616 1.00 25.25  ? 463  TYR A CG    1 
ATOM   3806 C  CD1   . TYR A 1 463 ? -10.853 5.306   55.929 1.00 25.86  ? 463  TYR A CD1   1 
ATOM   3807 C  CD2   . TYR A 1 463 ? -12.562 5.665   54.293 1.00 27.14  ? 463  TYR A CD2   1 
ATOM   3808 C  CE1   . TYR A 1 463 ? -9.874  5.445   54.947 1.00 26.99  ? 463  TYR A CE1   1 
ATOM   3809 C  CE2   . TYR A 1 463 ? -11.593 5.807   53.303 1.00 24.81  ? 463  TYR A CE2   1 
ATOM   3810 C  CZ    . TYR A 1 463 ? -10.251 5.695   53.631 1.00 27.81  ? 463  TYR A CZ    1 
ATOM   3811 O  OH    . TYR A 1 463 ? -9.295  5.852   52.640 1.00 27.11  ? 463  TYR A OH    1 
ATOM   3812 N  N     . TYR A 1 464 ? -15.960 6.609   57.968 1.00 32.26  ? 464  TYR A N     1 
ATOM   3813 C  CA    . TYR A 1 464 ? -17.127 6.313   58.803 1.00 34.05  ? 464  TYR A CA    1 
ATOM   3814 C  C     . TYR A 1 464 ? -17.163 4.827   59.160 1.00 35.64  ? 464  TYR A C     1 
ATOM   3815 O  O     . TYR A 1 464 ? -16.904 3.979   58.306 1.00 34.45  ? 464  TYR A O     1 
ATOM   3816 C  CB    . TYR A 1 464 ? -18.422 6.672   58.067 1.00 34.50  ? 464  TYR A CB    1 
ATOM   3817 C  CG    . TYR A 1 464 ? -18.607 8.140   57.762 1.00 38.98  ? 464  TYR A CG    1 
ATOM   3818 C  CD1   . TYR A 1 464 ? -18.630 8.600   56.448 1.00 39.54  ? 464  TYR A CD1   1 
ATOM   3819 C  CD2   . TYR A 1 464 ? -18.773 9.074   58.791 1.00 41.05  ? 464  TYR A CD2   1 
ATOM   3820 C  CE1   . TYR A 1 464 ? -18.803 9.953   56.162 1.00 41.80  ? 464  TYR A CE1   1 
ATOM   3821 C  CE2   . TYR A 1 464 ? -18.946 10.422  58.515 1.00 41.38  ? 464  TYR A CE2   1 
ATOM   3822 C  CZ    . TYR A 1 464 ? -18.963 10.857  57.201 1.00 41.82  ? 464  TYR A CZ    1 
ATOM   3823 O  OH    . TYR A 1 464 ? -19.137 12.200  56.932 1.00 43.91  ? 464  TYR A OH    1 
ATOM   3824 N  N     . LYS A 1 465 ? -17.480 4.507   60.413 1.00 40.08  ? 465  LYS A N     1 
ATOM   3825 C  CA    . LYS A 1 465 ? -17.603 3.099   60.813 1.00 42.31  ? 465  LYS A CA    1 
ATOM   3826 C  C     . LYS A 1 465 ? -19.036 2.595   61.064 1.00 43.64  ? 465  LYS A C     1 
ATOM   3827 O  O     . LYS A 1 465 ? -19.241 1.496   61.580 1.00 44.21  ? 465  LYS A O     1 
ATOM   3828 C  CB    . LYS A 1 465 ? -16.651 2.741   61.966 1.00 43.09  ? 465  LYS A CB    1 
ATOM   3829 C  CG    . LYS A 1 465 ? -16.363 3.828   62.983 1.00 43.93  ? 465  LYS A CG    1 
ATOM   3830 C  CD    . LYS A 1 465 ? -15.255 3.394   63.956 1.00 41.21  ? 465  LYS A CD    1 
ATOM   3831 C  CE    . LYS A 1 465 ? -15.691 2.235   64.858 1.00 42.93  ? 465  LYS A CE    1 
ATOM   3832 N  NZ    . LYS A 1 465 ? -14.692 1.867   65.906 1.00 42.21  ? 465  LYS A NZ    1 
ATOM   3833 N  N     . ASP A 1 466 ? -20.021 3.382   60.657 1.00 46.01  ? 466  ASP A N     1 
ATOM   3834 C  CA    . ASP A 1 466 ? -21.416 3.044   60.921 1.00 50.96  ? 466  ASP A CA    1 
ATOM   3835 C  C     . ASP A 1 466 ? -22.306 3.244   59.693 1.00 52.66  ? 466  ASP A C     1 
ATOM   3836 O  O     . ASP A 1 466 ? -23.530 3.325   59.809 1.00 54.90  ? 466  ASP A O     1 
ATOM   3837 C  CB    . ASP A 1 466 ? -21.948 3.838   62.134 1.00 52.23  ? 466  ASP A CB    1 
ATOM   3838 C  CG    . ASP A 1 466 ? -21.718 5.360   62.018 1.00 56.24  ? 466  ASP A CG    1 
ATOM   3839 O  OD1   . ASP A 1 466 ? -22.249 6.099   62.882 1.00 56.48  ? 466  ASP A OD1   1 
ATOM   3840 O  OD2   . ASP A 1 466 ? -21.013 5.829   61.088 1.00 57.42  ? 466  ASP A OD2   1 
ATOM   3841 N  N     . ARG A 1 467 ? -21.689 3.317   58.519 1.00 53.41  ? 467  ARG A N     1 
ATOM   3842 C  CA    . ARG A 1 467 ? -22.436 3.578   57.294 1.00 55.19  ? 467  ARG A CA    1 
ATOM   3843 C  C     . ARG A 1 467 ? -22.365 2.415   56.307 1.00 55.05  ? 467  ARG A C     1 
ATOM   3844 O  O     . ARG A 1 467 ? -23.367 2.081   55.673 1.00 56.68  ? 467  ARG A O     1 
ATOM   3845 C  CB    . ARG A 1 467 ? -21.974 4.886   56.631 1.00 56.48  ? 467  ARG A CB    1 
ATOM   3846 C  CG    . ARG A 1 467 ? -22.023 6.093   57.561 1.00 60.94  ? 467  ARG A CG    1 
ATOM   3847 C  CD    . ARG A 1 467 ? -22.466 7.379   56.855 1.00 66.16  ? 467  ARG A CD    1 
ATOM   3848 N  NE    . ARG A 1 467 ? -22.584 8.559   57.735 1.00 72.77  ? 467  ARG A NE    1 
ATOM   3849 C  CZ    . ARG A 1 467 ? -22.800 8.555   59.059 1.00 75.48  ? 467  ARG A CZ    1 
ATOM   3850 N  NH1   . ARG A 1 467 ? -22.946 7.424   59.746 1.00 75.58  ? 467  ARG A NH1   1 
ATOM   3851 N  NH2   . ARG A 1 467 ? -22.878 9.710   59.712 1.00 74.96  ? 467  ARG A NH2   1 
ATOM   3852 N  N     . ASP A 1 468 ? -21.186 1.800   56.203 1.00 52.23  ? 468  ASP A N     1 
ATOM   3853 C  CA    . ASP A 1 468 ? -20.875 0.778   55.187 1.00 52.55  ? 468  ASP A CA    1 
ATOM   3854 C  C     . ASP A 1 468 ? -20.741 1.344   53.761 1.00 49.23  ? 468  ASP A C     1 
ATOM   3855 O  O     . ASP A 1 468 ? -21.394 2.326   53.387 1.00 47.77  ? 468  ASP A O     1 
ATOM   3856 C  CB    . ASP A 1 468 ? -21.778 -0.482  55.277 1.00 55.84  ? 468  ASP A CB    1 
ATOM   3857 C  CG    . ASP A 1 468 ? -23.019 -0.420  54.378 1.00 59.07  ? 468  ASP A CG    1 
ATOM   3858 O  OD1   . ASP A 1 468 ? -22.983 0.207   53.302 1.00 62.00  ? 468  ASP A OD1   1 
ATOM   3859 O  OD2   . ASP A 1 468 ? -24.041 -1.043  54.743 1.00 62.61  ? 468  ASP A OD2   1 
ATOM   3860 N  N     . GLY A 1 469 ? -19.858 0.729   52.985 1.00 43.58  ? 469  GLY A N     1 
ATOM   3861 C  CA    . GLY A 1 469 ? -19.502 1.260   51.687 1.00 37.44  ? 469  GLY A CA    1 
ATOM   3862 C  C     . GLY A 1 469 ? -19.684 0.246   50.592 1.00 34.99  ? 469  GLY A C     1 
ATOM   3863 O  O     . GLY A 1 469 ? -19.602 -0.968  50.827 1.00 32.80  ? 469  GLY A O     1 
ATOM   3864 N  N     . VAL A 1 470 ? -19.918 0.755   49.388 1.00 32.65  ? 470  VAL A N     1 
ATOM   3865 C  CA    . VAL A 1 470 ? -20.153 -0.083  48.226 1.00 30.69  ? 470  VAL A CA    1 
ATOM   3866 C  C     . VAL A 1 470 ? -18.965 -1.012  47.955 1.00 30.80  ? 470  VAL A C     1 
ATOM   3867 O  O     . VAL A 1 470 ? -19.158 -2.167  47.579 1.00 33.68  ? 470  VAL A O     1 
ATOM   3868 C  CB    . VAL A 1 470 ? -20.562 0.760   46.979 1.00 31.20  ? 470  VAL A CB    1 
ATOM   3869 C  CG1   . VAL A 1 470 ? -19.412 1.663   46.497 1.00 24.09  ? 470  VAL A CG1   1 
ATOM   3870 C  CG2   . VAL A 1 470 ? -21.091 -0.146  45.851 1.00 30.38  ? 470  VAL A CG2   1 
ATOM   3871 N  N     . VAL A 1 471 ? -17.748 -0.523  48.190 1.00 32.21  ? 471  VAL A N     1 
ATOM   3872 C  CA    . VAL A 1 471 ? -16.533 -1.321  47.955 1.00 32.35  ? 471  VAL A CA    1 
ATOM   3873 C  C     . VAL A 1 471 ? -16.361 -2.450  48.994 1.00 32.77  ? 471  VAL A C     1 
ATOM   3874 O  O     . VAL A 1 471 ? -16.185 -3.605  48.611 1.00 33.89  ? 471  VAL A O     1 
ATOM   3875 C  CB    . VAL A 1 471 ? -15.257 -0.432  47.819 1.00 32.45  ? 471  VAL A CB    1 
ATOM   3876 C  CG1   . VAL A 1 471 ? -14.002 -1.272  47.794 1.00 27.72  ? 471  VAL A CG1   1 
ATOM   3877 C  CG2   . VAL A 1 471 ? -15.334 0.415   46.576 1.00 31.61  ? 471  VAL A CG2   1 
ATOM   3878 N  N     . PRO A 1 472 ? -16.422 -2.132  50.305 1.00 31.66  ? 472  PRO A N     1 
ATOM   3879 C  CA    . PRO A 1 472 ? -16.424 -3.229  51.284 1.00 31.58  ? 472  PRO A CA    1 
ATOM   3880 C  C     . PRO A 1 472 ? -17.575 -4.219  51.091 1.00 30.20  ? 472  PRO A C     1 
ATOM   3881 O  O     . PRO A 1 472 ? -17.374 -5.419  51.241 1.00 30.42  ? 472  PRO A O     1 
ATOM   3882 C  CB    . PRO A 1 472 ? -16.589 -2.506  52.620 1.00 31.42  ? 472  PRO A CB    1 
ATOM   3883 C  CG    . PRO A 1 472 ? -15.941 -1.187  52.394 1.00 32.80  ? 472  PRO A CG    1 
ATOM   3884 C  CD    . PRO A 1 472 ? -16.274 -0.821  50.964 1.00 32.54  ? 472  PRO A CD    1 
ATOM   3885 N  N     . THR A 1 473 ? -18.765 -3.725  50.760 1.00 30.62  ? 473  THR A N     1 
ATOM   3886 C  CA    . THR A 1 473 ? -19.919 -4.606  50.583 1.00 30.08  ? 473  THR A CA    1 
ATOM   3887 C  C     . THR A 1 473 ? -19.704 -5.568  49.412 1.00 28.85  ? 473  THR A C     1 
ATOM   3888 O  O     . THR A 1 473 ? -19.762 -6.778  49.582 1.00 28.39  ? 473  THR A O     1 
ATOM   3889 C  CB    . THR A 1 473 ? -21.230 -3.815  50.416 1.00 31.19  ? 473  THR A CB    1 
ATOM   3890 O  OG1   . THR A 1 473 ? -21.456 -3.025  51.592 1.00 34.38  ? 473  THR A OG1   1 
ATOM   3891 C  CG2   . THR A 1 473 ? -22.427 -4.765  50.209 1.00 29.94  ? 473  THR A CG2   1 
ATOM   3892 N  N     . GLU A 1 474 ? -19.419 -5.024  48.236 1.00 29.46  ? 474  GLU A N     1 
ATOM   3893 C  CA    . GLU A 1 474 ? -19.228 -5.850  47.044 1.00 30.75  ? 474  GLU A CA    1 
ATOM   3894 C  C     . GLU A 1 474 ? -17.958 -6.712  47.066 1.00 31.30  ? 474  GLU A C     1 
ATOM   3895 O  O     . GLU A 1 474 ? -17.946 -7.803  46.512 1.00 32.33  ? 474  GLU A O     1 
ATOM   3896 C  CB    . GLU A 1 474 ? -19.301 -4.993  45.779 1.00 29.77  ? 474  GLU A CB    1 
ATOM   3897 C  CG    . GLU A 1 474 ? -20.652 -4.319  45.584 1.00 31.26  ? 474  GLU A CG    1 
ATOM   3898 C  CD    . GLU A 1 474 ? -21.840 -5.300  45.600 1.00 34.81  ? 474  GLU A CD    1 
ATOM   3899 O  OE1   . GLU A 1 474 ? -22.902 -4.942  46.164 1.00 36.23  ? 474  GLU A OE1   1 
ATOM   3900 O  OE2   . GLU A 1 474 ? -21.720 -6.420  45.043 1.00 31.85  ? 474  GLU A OE2   1 
ATOM   3901 N  N     . ILE A 1 475 ? -16.905 -6.241  47.725 1.00 31.10  ? 475  ILE A N     1 
ATOM   3902 C  CA    . ILE A 1 475 ? -15.691 -7.040  47.843 1.00 32.19  ? 475  ILE A CA    1 
ATOM   3903 C  C     . ILE A 1 475 ? -15.849 -8.234  48.805 1.00 33.09  ? 475  ILE A C     1 
ATOM   3904 O  O     . ILE A 1 475 ? -15.221 -9.279  48.597 1.00 33.22  ? 475  ILE A O     1 
ATOM   3905 C  CB    . ILE A 1 475 ? -14.463 -6.181  48.229 1.00 32.23  ? 475  ILE A CB    1 
ATOM   3906 C  CG1   . ILE A 1 475 ? -13.201 -6.773  47.605 1.00 32.57  ? 475  ILE A CG1   1 
ATOM   3907 C  CG2   . ILE A 1 475 ? -14.332 -6.045  49.763 1.00 32.85  ? 475  ILE A CG2   1 
ATOM   3908 C  CD1   . ILE A 1 475 ? -11.975 -5.929  47.748 1.00 28.19  ? 475  ILE A CD1   1 
ATOM   3909 N  N     . THR A 1 476 ? -16.671 -8.076  49.848 1.00 32.03  ? 476  THR A N     1 
ATOM   3910 C  CA    . THR A 1 476 ? -16.932 -9.155  50.821 1.00 30.85  ? 476  THR A CA    1 
ATOM   3911 C  C     . THR A 1 476 ? -17.626 -10.342 50.145 1.00 30.87  ? 476  THR A C     1 
ATOM   3912 O  O     . THR A 1 476 ? -17.318 -11.504 50.430 1.00 29.92  ? 476  THR A O     1 
ATOM   3913 C  CB    . THR A 1 476 ? -17.820 -8.671  52.003 1.00 31.27  ? 476  THR A CB    1 
ATOM   3914 O  OG1   . THR A 1 476 ? -17.304 -7.442  52.524 1.00 29.66  ? 476  THR A OG1   1 
ATOM   3915 C  CG2   . THR A 1 476 ? -17.867 -9.709  53.127 1.00 30.08  ? 476  THR A CG2   1 
ATOM   3916 N  N     . LYS A 1 477 ? -18.568 -10.039 49.255 1.00 30.49  ? 477  LYS A N     1 
ATOM   3917 C  CA    . LYS A 1 477 ? -19.304 -11.078 48.544 1.00 31.51  ? 477  LYS A CA    1 
ATOM   3918 C  C     . LYS A 1 477 ? -18.395 -11.964 47.698 1.00 29.57  ? 477  LYS A C     1 
ATOM   3919 O  O     . LYS A 1 477 ? -18.529 -13.186 47.735 1.00 33.46  ? 477  LYS A O     1 
ATOM   3920 C  CB    . LYS A 1 477 ? -20.427 -10.489 47.692 1.00 30.51  ? 477  LYS A CB    1 
ATOM   3921 C  CG    . LYS A 1 477 ? -21.462 -9.747  48.510 1.00 31.91  ? 477  LYS A CG    1 
ATOM   3922 C  CD    . LYS A 1 477 ? -22.756 -9.568  47.751 1.00 35.10  ? 477  LYS A CD    1 
ATOM   3923 C  CE    . LYS A 1 477 ? -22.528 -8.937  46.404 1.00 37.69  ? 477  LYS A CE    1 
ATOM   3924 N  NZ    . LYS A 1 477 ? -23.757 -8.941  45.579 1.00 40.99  ? 477  LYS A NZ    1 
ATOM   3925 N  N     . VAL A 1 478 ? -17.468 -11.358 46.966 1.00 27.13  ? 478  VAL A N     1 
ATOM   3926 C  CA    . VAL A 1 478 ? -16.521 -12.118 46.138 1.00 30.23  ? 478  VAL A CA    1 
ATOM   3927 C  C     . VAL A 1 478 ? -15.483 -12.824 46.998 1.00 31.70  ? 478  VAL A C     1 
ATOM   3928 O  O     . VAL A 1 478 ? -15.128 -13.979 46.732 1.00 34.13  ? 478  VAL A O     1 
ATOM   3929 C  CB    . VAL A 1 478 ? -15.827 -11.251 45.052 1.00 30.17  ? 478  VAL A CB    1 
ATOM   3930 C  CG1   . VAL A 1 478 ? -14.951 -12.120 44.156 1.00 29.68  ? 478  VAL A CG1   1 
ATOM   3931 C  CG2   . VAL A 1 478 ? -16.862 -10.538 44.200 1.00 32.13  ? 478  VAL A CG2   1 
ATOM   3932 N  N     . PHE A 1 479 ? -15.012 -12.142 48.038 1.00 32.80  ? 479  PHE A N     1 
ATOM   3933 C  CA    . PHE A 1 479 ? -14.162 -12.784 49.029 1.00 31.99  ? 479  PHE A CA    1 
ATOM   3934 C  C     . PHE A 1 479 ? -14.783 -14.046 49.624 1.00 34.33  ? 479  PHE A C     1 
ATOM   3935 O  O     . PHE A 1 479 ? -14.102 -15.068 49.733 1.00 36.55  ? 479  PHE A O     1 
ATOM   3936 C  CB    . PHE A 1 479 ? -13.796 -11.837 50.169 1.00 32.13  ? 479  PHE A CB    1 
ATOM   3937 C  CG    . PHE A 1 479 ? -13.149 -12.541 51.316 1.00 35.38  ? 479  PHE A CG    1 
ATOM   3938 C  CD1   . PHE A 1 479 ? -11.856 -13.063 51.189 1.00 34.04  ? 479  PHE A CD1   1 
ATOM   3939 C  CD2   . PHE A 1 479 ? -13.847 -12.754 52.501 1.00 35.69  ? 479  PHE A CD2   1 
ATOM   3940 C  CE1   . PHE A 1 479 ? -11.263 -13.758 52.238 1.00 33.93  ? 479  PHE A CE1   1 
ATOM   3941 C  CE2   . PHE A 1 479 ? -13.252 -13.450 53.559 1.00 37.00  ? 479  PHE A CE2   1 
ATOM   3942 C  CZ    . PHE A 1 479 ? -11.956 -13.947 53.424 1.00 34.50  ? 479  PHE A CZ    1 
ATOM   3943 N  N     . ASN A 1 480 ? -16.054 -13.979 50.034 1.00 34.65  ? 480  ASN A N     1 
ATOM   3944 C  CA    . ASN A 1 480 ? -16.700 -15.140 50.669 1.00 35.23  ? 480  ASN A CA    1 
ATOM   3945 C  C     . ASN A 1 480 ? -16.794 -16.338 49.721 1.00 35.65  ? 480  ASN A C     1 
ATOM   3946 O  O     . ASN A 1 480 ? -16.644 -17.484 50.139 1.00 37.21  ? 480  ASN A O     1 
ATOM   3947 C  CB    . ASN A 1 480 ? -18.075 -14.789 51.246 1.00 33.01  ? 480  ASN A CB    1 
ATOM   3948 C  CG    . ASN A 1 480 ? -17.985 -14.070 52.589 1.00 34.93  ? 480  ASN A CG    1 
ATOM   3949 O  OD1   . ASN A 1 480 ? -17.029 -14.248 53.346 1.00 34.61  ? 480  ASN A OD1   1 
ATOM   3950 N  ND2   . ASN A 1 480 ? -18.991 -13.264 52.893 1.00 27.97  ? 480  ASN A ND2   1 
ATOM   3951 N  N     . GLN A 1 481 ? -17.031 -16.050 48.447 1.00 35.48  ? 481  GLN A N     1 
ATOM   3952 C  CA    . GLN A 1 481 ? -17.021 -17.058 47.400 1.00 37.44  ? 481  GLN A CA    1 
ATOM   3953 C  C     . GLN A 1 481 ? -15.642 -17.679 47.280 1.00 36.50  ? 481  GLN A C     1 
ATOM   3954 O  O     . GLN A 1 481 ? -15.512 -18.897 47.158 1.00 37.35  ? 481  GLN A O     1 
ATOM   3955 C  CB    . GLN A 1 481 ? -17.438 -16.437 46.063 1.00 36.70  ? 481  GLN A CB    1 
ATOM   3956 C  CG    . GLN A 1 481 ? -18.918 -16.096 45.980 1.00 42.61  ? 481  GLN A CG    1 
ATOM   3957 C  CD    . GLN A 1 481 ? -19.291 -15.372 44.694 1.00 50.61  ? 481  GLN A CD    1 
ATOM   3958 O  OE1   . GLN A 1 481 ? -18.544 -15.388 43.705 1.00 55.35  ? 481  GLN A OE1   1 
ATOM   3959 N  NE2   . GLN A 1 481 ? -20.455 -14.731 44.702 1.00 50.60  ? 481  GLN A NE2   1 
ATOM   3960 N  N     . ARG A 1 482 ? -14.616 -16.834 47.331 1.00 36.91  ? 482  ARG A N     1 
ATOM   3961 C  CA    . ARG A 1 482 ? -13.236 -17.291 47.228 1.00 37.67  ? 482  ARG A CA    1 
ATOM   3962 C  C     . ARG A 1 482 ? -12.868 -18.281 48.321 1.00 38.00  ? 482  ARG A C     1 
ATOM   3963 O  O     . ARG A 1 482 ? -12.270 -19.314 48.034 1.00 42.42  ? 482  ARG A O     1 
ATOM   3964 C  CB    . ARG A 1 482 ? -12.262 -16.109 47.236 1.00 37.52  ? 482  ARG A CB    1 
ATOM   3965 C  CG    . ARG A 1 482 ? -10.816 -16.506 46.981 1.00 34.52  ? 482  ARG A CG    1 
ATOM   3966 C  CD    . ARG A 1 482 ? -9.965  -16.452 48.237 1.00 33.22  ? 482  ARG A CD    1 
ATOM   3967 N  NE    . ARG A 1 482 ? -8.615  -16.941 47.970 1.00 29.13  ? 482  ARG A NE    1 
ATOM   3968 C  CZ    . ARG A 1 482 ? -7.555  -16.722 48.741 1.00 31.23  ? 482  ARG A CZ    1 
ATOM   3969 N  NH1   . ARG A 1 482 ? -7.658  -15.995 49.847 1.00 29.75  ? 482  ARG A NH1   1 
ATOM   3970 N  NH2   . ARG A 1 482 ? -6.375  -17.226 48.396 1.00 27.58  ? 482  ARG A NH2   1 
ATOM   3971 N  N     . LYS A 1 483 ? -13.230 -17.986 49.565 1.00 37.27  ? 483  LYS A N     1 
ATOM   3972 C  CA    . LYS A 1 483 ? -12.817 -18.855 50.666 1.00 37.11  ? 483  LYS A CA    1 
ATOM   3973 C  C     . LYS A 1 483 ? -13.489 -20.229 50.630 1.00 34.94  ? 483  LYS A C     1 
ATOM   3974 O  O     . LYS A 1 483 ? -12.891 -21.234 51.046 1.00 35.14  ? 483  LYS A O     1 
ATOM   3975 C  CB    . LYS A 1 483 ? -12.952 -18.164 52.031 1.00 37.38  ? 483  LYS A CB    1 
ATOM   3976 C  CG    . LYS A 1 483 ? -14.353 -18.014 52.561 1.00 43.82  ? 483  LYS A CG    1 
ATOM   3977 C  CD    . LYS A 1 483 ? -14.357 -17.543 54.028 1.00 51.98  ? 483  LYS A CD    1 
ATOM   3978 C  CE    . LYS A 1 483 ? -13.804 -18.620 54.982 1.00 55.11  ? 483  LYS A CE    1 
ATOM   3979 N  NZ    . LYS A 1 483 ? -14.515 -18.652 56.296 1.00 57.62  ? 483  LYS A NZ    1 
ATOM   3980 N  N     . GLU A 1 484 ? -14.720 -20.261 50.126 1.00 33.27  ? 484  GLU A N     1 
ATOM   3981 C  CA    . GLU A 1 484 ? -15.460 -21.500 49.920 1.00 33.45  ? 484  GLU A CA    1 
ATOM   3982 C  C     . GLU A 1 484 ? -14.699 -22.382 48.926 1.00 33.55  ? 484  GLU A C     1 
ATOM   3983 O  O     . GLU A 1 484 ? -14.412 -23.545 49.221 1.00 34.15  ? 484  GLU A O     1 
ATOM   3984 C  CB    . GLU A 1 484 ? -16.871 -21.194 49.388 1.00 34.78  ? 484  GLU A CB    1 
ATOM   3985 C  CG    . GLU A 1 484 ? -17.831 -22.385 49.394 1.00 42.28  ? 484  GLU A CG    1 
ATOM   3986 C  CD    . GLU A 1 484 ? -18.980 -22.258 48.383 1.00 49.16  ? 484  GLU A CD    1 
ATOM   3987 O  OE1   . GLU A 1 484 ? -19.454 -21.129 48.120 1.00 49.40  ? 484  GLU A OE1   1 
ATOM   3988 O  OE2   . GLU A 1 484 ? -19.418 -23.304 47.852 1.00 49.11  ? 484  GLU A OE2   1 
ATOM   3989 N  N     . HIS A 1 485 ? -14.367 -21.821 47.757 1.00 30.56  ? 485  HIS A N     1 
ATOM   3990 C  CA    . HIS A 1 485 ? -13.627 -22.560 46.740 1.00 31.64  ? 485  HIS A CA    1 
ATOM   3991 C  C     . HIS A 1 485 ? -12.241 -22.949 47.224 1.00 31.51  ? 485  HIS A C     1 
ATOM   3992 O  O     . HIS A 1 485 ? -11.763 -24.042 46.901 1.00 31.79  ? 485  HIS A O     1 
ATOM   3993 C  CB    . HIS A 1 485 ? -13.555 -21.801 45.412 1.00 29.83  ? 485  HIS A CB    1 
ATOM   3994 C  CG    . HIS A 1 485 ? -14.863 -21.740 44.693 1.00 30.01  ? 485  HIS A CG    1 
ATOM   3995 N  ND1   . HIS A 1 485 ? -15.466 -22.856 44.154 1.00 33.74  ? 485  HIS A ND1   1 
ATOM   3996 C  CD2   . HIS A 1 485 ? -15.692 -20.703 44.433 1.00 31.76  ? 485  HIS A CD2   1 
ATOM   3997 C  CE1   . HIS A 1 485 ? -16.606 -22.509 43.586 1.00 31.61  ? 485  HIS A CE1   1 
ATOM   3998 N  NE2   . HIS A 1 485 ? -16.767 -21.208 43.741 1.00 33.79  ? 485  HIS A NE2   1 
ATOM   3999 N  N     . LYS A 1 486 ? -11.612 -22.077 48.014 1.00 31.06  ? 486  LYS A N     1 
ATOM   4000 C  CA    . LYS A 1 486 ? -10.316 -22.415 48.606 1.00 32.66  ? 486  LYS A CA    1 
ATOM   4001 C  C     . LYS A 1 486 ? -10.427 -23.612 49.542 1.00 31.77  ? 486  LYS A C     1 
ATOM   4002 O  O     . LYS A 1 486 ? -9.517  -24.443 49.592 1.00 33.75  ? 486  LYS A O     1 
ATOM   4003 C  CB    . LYS A 1 486 ? -9.673  -21.233 49.339 1.00 33.97  ? 486  LYS A CB    1 
ATOM   4004 C  CG    . LYS A 1 486 ? -8.168  -21.431 49.514 1.00 35.10  ? 486  LYS A CG    1 
ATOM   4005 C  CD    . LYS A 1 486 ? -7.560  -20.553 50.573 1.00 36.20  ? 486  LYS A CD    1 
ATOM   4006 C  CE    . LYS A 1 486 ? -6.034  -20.630 50.496 1.00 40.54  ? 486  LYS A CE    1 
ATOM   4007 N  NZ    . LYS A 1 486 ? -5.378  -19.922 51.641 1.00 41.68  ? 486  LYS A NZ    1 
ATOM   4008 N  N     . GLY A 1 487 ? -11.543 -23.698 50.266 1.00 31.48  ? 487  GLY A N     1 
ATOM   4009 C  CA    . GLY A 1 487 ? -11.842 -24.851 51.122 1.00 33.06  ? 487  GLY A CA    1 
ATOM   4010 C  C     . GLY A 1 487 ? -11.977 -26.160 50.353 1.00 34.10  ? 487  GLY A C     1 
ATOM   4011 O  O     . GLY A 1 487 ? -11.491 -27.205 50.794 1.00 34.80  ? 487  GLY A O     1 
ATOM   4012 N  N     . TYR A 1 488 ? -12.639 -26.097 49.198 1.00 34.09  ? 488  TYR A N     1 
ATOM   4013 C  CA    . TYR A 1 488 ? -12.756 -27.244 48.308 1.00 32.50  ? 488  TYR A CA    1 
ATOM   4014 C  C     . TYR A 1 488 ? -11.385 -27.617 47.801 1.00 32.00  ? 488  TYR A C     1 
ATOM   4015 O  O     . TYR A 1 488 ? -11.043 -28.798 47.749 1.00 31.76  ? 488  TYR A O     1 
ATOM   4016 C  CB    . TYR A 1 488 ? -13.699 -26.954 47.132 1.00 32.17  ? 488  TYR A CB    1 
ATOM   4017 C  CG    . TYR A 1 488 ? -15.129 -26.642 47.547 1.00 35.00  ? 488  TYR A CG    1 
ATOM   4018 C  CD1   . TYR A 1 488 ? -15.637 -27.080 48.784 1.00 33.43  ? 488  TYR A CD1   1 
ATOM   4019 C  CD2   . TYR A 1 488 ? -15.981 -25.928 46.697 1.00 27.80  ? 488  TYR A CD2   1 
ATOM   4020 C  CE1   . TYR A 1 488 ? -16.945 -26.793 49.164 1.00 34.19  ? 488  TYR A CE1   1 
ATOM   4021 C  CE2   . TYR A 1 488 ? -17.292 -25.644 47.062 1.00 31.43  ? 488  TYR A CE2   1 
ATOM   4022 C  CZ    . TYR A 1 488 ? -17.766 -26.080 48.296 1.00 35.42  ? 488  TYR A CZ    1 
ATOM   4023 O  OH    . TYR A 1 488 ? -19.054 -25.800 48.674 1.00 38.67  ? 488  TYR A OH    1 
ATOM   4024 N  N     . MET A 1 489 ? -10.592 -26.606 47.456 1.00 32.27  ? 489  MET A N     1 
ATOM   4025 C  CA    . MET A 1 489 ? -9.245  -26.843 46.950 1.00 33.00  ? 489  MET A CA    1 
ATOM   4026 C  C     . MET A 1 489 ? -8.395  -27.582 47.983 1.00 32.31  ? 489  MET A C     1 
ATOM   4027 O  O     . MET A 1 489 ? -7.878  -28.664 47.693 1.00 32.43  ? 489  MET A O     1 
ATOM   4028 C  CB    . MET A 1 489 ? -8.562  -25.539 46.539 1.00 31.45  ? 489  MET A CB    1 
ATOM   4029 C  CG    . MET A 1 489 ? -7.247  -25.789 45.842 1.00 35.64  ? 489  MET A CG    1 
ATOM   4030 S  SD    . MET A 1 489 ? -6.237  -24.345 45.548 1.00 44.90  ? 489  MET A SD    1 
ATOM   4031 C  CE    . MET A 1 489 ? -5.604  -24.028 47.199 1.00 40.74  ? 489  MET A CE    1 
ATOM   4032 N  N     . LEU A 1 490 ? -8.275  -26.997 49.175 1.00 30.24  ? 490  LEU A N     1 
ATOM   4033 C  CA    . LEU A 1 490 ? -7.479  -27.569 50.267 1.00 33.10  ? 490  LEU A CA    1 
ATOM   4034 C  C     . LEU A 1 490 ? -7.907  -28.978 50.684 1.00 33.16  ? 490  LEU A C     1 
ATOM   4035 O  O     . LEU A 1 490 ? -7.062  -29.839 50.895 1.00 34.45  ? 490  LEU A O     1 
ATOM   4036 C  CB    . LEU A 1 490 ? -7.447  -26.626 51.482 1.00 31.46  ? 490  LEU A CB    1 
ATOM   4037 C  CG    . LEU A 1 490 ? -6.657  -25.313 51.335 1.00 33.46  ? 490  LEU A CG    1 
ATOM   4038 C  CD1   . LEU A 1 490 ? -6.645  -24.519 52.631 1.00 32.12  ? 490  LEU A CD1   1 
ATOM   4039 C  CD2   . LEU A 1 490 ? -5.211  -25.554 50.866 1.00 35.79  ? 490  LEU A CD2   1 
ATOM   4040 N  N     . ALA A 1 491 ? -9.209  -29.217 50.795 1.00 33.43  ? 491  ALA A N     1 
ATOM   4041 C  CA    . ALA A 1 491 ? -9.700  -30.555 51.135 1.00 32.97  ? 491  ALA A CA    1 
ATOM   4042 C  C     . ALA A 1 491 ? -9.287  -31.581 50.073 1.00 33.45  ? 491  ALA A C     1 
ATOM   4043 O  O     . ALA A 1 491 ? -8.820  -32.673 50.405 1.00 34.20  ? 491  ALA A O     1 
ATOM   4044 C  CB    . ALA A 1 491 ? -11.226 -30.543 51.333 1.00 33.00  ? 491  ALA A CB    1 
ATOM   4045 N  N     . ALA A 1 492 ? -9.427  -31.215 48.801 1.00 31.99  ? 492  ALA A N     1 
ATOM   4046 C  CA    . ALA A 1 492 ? -9.003  -32.078 47.703 1.00 32.61  ? 492  ALA A CA    1 
ATOM   4047 C  C     . ALA A 1 492 ? -7.502  -32.340 47.771 1.00 33.17  ? 492  ALA A C     1 
ATOM   4048 O  O     . ALA A 1 492 ? -7.032  -33.416 47.398 1.00 36.24  ? 492  ALA A O     1 
ATOM   4049 C  CB    . ALA A 1 492 ? -9.386  -31.462 46.358 1.00 31.67  ? 492  ALA A CB    1 
ATOM   4050 N  N     . GLN A 1 493 ? -6.762  -31.353 48.258 1.00 32.12  ? 493  GLN A N     1 
ATOM   4051 C  CA    . GLN A 1 493 ? -5.317  -31.455 48.435 1.00 33.65  ? 493  GLN A CA    1 
ATOM   4052 C  C     . GLN A 1 493 ? -4.983  -32.430 49.578 1.00 34.16  ? 493  GLN A C     1 
ATOM   4053 O  O     . GLN A 1 493 ? -4.176  -33.347 49.405 1.00 34.14  ? 493  GLN A O     1 
ATOM   4054 C  CB    . GLN A 1 493 ? -4.751  -30.053 48.695 1.00 35.19  ? 493  GLN A CB    1 
ATOM   4055 C  CG    . GLN A 1 493 ? -3.235  -29.928 48.810 1.00 38.35  ? 493  GLN A CG    1 
ATOM   4056 C  CD    . GLN A 1 493 ? -2.805  -28.500 49.154 1.00 37.82  ? 493  GLN A CD    1 
ATOM   4057 O  OE1   . GLN A 1 493 ? -2.460  -28.205 50.294 1.00 40.81  ? 493  GLN A OE1   1 
ATOM   4058 N  NE2   . GLN A 1 493 ? -2.850  -27.609 48.172 1.00 35.67  ? 493  GLN A NE2   1 
ATOM   4059 N  N     . ARG A 1 494 ? -5.626  -32.246 50.730 1.00 31.91  ? 494  ARG A N     1 
ATOM   4060 C  CA    . ARG A 1 494 ? -5.437  -33.143 51.873 1.00 31.48  ? 494  ARG A CA    1 
ATOM   4061 C  C     . ARG A 1 494 ? -5.841  -34.579 51.539 1.00 34.83  ? 494  ARG A C     1 
ATOM   4062 O  O     . ARG A 1 494 ? -5.111  -35.519 51.866 1.00 35.48  ? 494  ARG A O     1 
ATOM   4063 C  CB    . ARG A 1 494 ? -6.221  -32.654 53.087 1.00 28.60  ? 494  ARG A CB    1 
ATOM   4064 C  CG    . ARG A 1 494 ? -5.727  -31.360 53.679 1.00 24.10  ? 494  ARG A CG    1 
ATOM   4065 C  CD    . ARG A 1 494 ? -6.421  -31.051 55.005 1.00 27.68  ? 494  ARG A CD    1 
ATOM   4066 N  NE    . ARG A 1 494 ? -7.849  -30.765 54.859 1.00 25.42  ? 494  ARG A NE    1 
ATOM   4067 C  CZ    . ARG A 1 494 ? -8.362  -29.562 54.597 1.00 30.64  ? 494  ARG A CZ    1 
ATOM   4068 N  NH1   . ARG A 1 494 ? -7.567  -28.514 54.428 1.00 25.58  ? 494  ARG A NH1   1 
ATOM   4069 N  NH2   . ARG A 1 494 ? -9.679  -29.407 54.489 1.00 30.79  ? 494  ARG A NH2   1 
ATOM   4070 N  N     . ASN A 1 495 ? -7.000  -34.733 50.889 1.00 36.76  ? 495  ASN A N     1 
ATOM   4071 C  CA    . ASN A 1 495 ? -7.497  -36.031 50.406 1.00 36.79  ? 495  ASN A CA    1 
ATOM   4072 C  C     . ASN A 1 495 ? -6.517  -36.695 49.452 1.00 38.30  ? 495  ASN A C     1 
ATOM   4073 O  O     . ASN A 1 495 ? -6.376  -37.917 49.445 1.00 38.24  ? 495  ASN A O     1 
ATOM   4074 C  CB    . ASN A 1 495 ? -8.848  -35.880 49.690 1.00 37.16  ? 495  ASN A CB    1 
ATOM   4075 C  CG    . ASN A 1 495 ? -10.014 -35.709 50.647 1.00 37.66  ? 495  ASN A CG    1 
ATOM   4076 O  OD1   . ASN A 1 495 ? -9.895  -35.965 51.847 1.00 38.63  ? 495  ASN A OD1   1 
ATOM   4077 N  ND2   . ASN A 1 495 ? -11.162 -35.281 50.112 1.00 36.20  ? 495  ASN A ND2   1 
ATOM   4078 N  N     . GLY A 1 496 ? -5.851  -35.879 48.639 1.00 39.78  ? 496  GLY A N     1 
ATOM   4079 C  CA    . GLY A 1 496 ? -4.811  -36.361 47.741 1.00 39.60  ? 496  GLY A CA    1 
ATOM   4080 C  C     . GLY A 1 496 ? -3.661  -37.024 48.472 1.00 41.39  ? 496  GLY A C     1 
ATOM   4081 O  O     . GLY A 1 496 ? -3.127  -38.022 47.998 1.00 43.19  ? 496  GLY A O     1 
ATOM   4082 N  N     . GLU A 1 497 ? -3.284  -36.477 49.627 1.00 42.67  ? 497  GLU A N     1 
ATOM   4083 C  CA    . GLU A 1 497 ? -2.176  -37.022 50.415 1.00 43.86  ? 497  GLU A CA    1 
ATOM   4084 C  C     . GLU A 1 497 ? -2.574  -38.293 51.152 1.00 43.57  ? 497  GLU A C     1 
ATOM   4085 O  O     . GLU A 1 497 ? -1.717  -39.122 51.450 1.00 45.40  ? 497  GLU A O     1 
ATOM   4086 C  CB    . GLU A 1 497 ? -1.623  -35.991 51.406 1.00 44.13  ? 497  GLU A CB    1 
ATOM   4087 C  CG    . GLU A 1 497 ? -1.078  -34.713 50.775 1.00 46.15  ? 497  GLU A CG    1 
ATOM   4088 C  CD    . GLU A 1 497 ? 0.175   -34.918 49.925 1.00 48.62  ? 497  GLU A CD    1 
ATOM   4089 O  OE1   . GLU A 1 497 ? 1.167   -35.490 50.417 1.00 48.75  ? 497  GLU A OE1   1 
ATOM   4090 O  OE2   . GLU A 1 497 ? 0.172   -34.480 48.758 1.00 52.12  ? 497  GLU A OE2   1 
ATOM   4091 N  N     . ILE A 1 498 ? -3.866  -38.437 51.444 1.00 42.33  ? 498  ILE A N     1 
ATOM   4092 C  CA    . ILE A 1 498 ? -4.410  -39.686 51.989 1.00 42.69  ? 498  ILE A CA    1 
ATOM   4093 C  C     . ILE A 1 498 ? -4.283  -40.835 50.981 1.00 43.72  ? 498  ILE A C     1 
ATOM   4094 O  O     . ILE A 1 498 ? -3.873  -41.942 51.342 1.00 42.86  ? 498  ILE A O     1 
ATOM   4095 C  CB    . ILE A 1 498 ? -5.889  -39.531 52.434 1.00 42.70  ? 498  ILE A CB    1 
ATOM   4096 C  CG1   . ILE A 1 498 ? -5.974  -38.669 53.693 1.00 44.36  ? 498  ILE A CG1   1 
ATOM   4097 C  CG2   . ILE A 1 498 ? -6.541  -40.904 52.687 1.00 41.73  ? 498  ILE A CG2   1 
ATOM   4098 C  CD1   . ILE A 1 498 ? -7.358  -38.117 53.979 1.00 46.76  ? 498  ILE A CD1   1 
ATOM   4099 N  N     . ILE A 1 499 ? -4.628  -40.568 49.722 1.00 43.85  ? 499  ILE A N     1 
ATOM   4100 C  CA    . ILE A 1 499 ? -4.496  -41.573 48.663 1.00 43.24  ? 499  ILE A CA    1 
ATOM   4101 C  C     . ILE A 1 499 ? -3.030  -41.976 48.468 1.00 44.18  ? 499  ILE A C     1 
ATOM   4102 O  O     . ILE A 1 499 ? -2.728  -43.153 48.267 1.00 42.23  ? 499  ILE A O     1 
ATOM   4103 C  CB    . ILE A 1 499 ? -5.121  -41.103 47.321 1.00 41.20  ? 499  ILE A CB    1 
ATOM   4104 C  CG1   . ILE A 1 499 ? -6.600  -40.770 47.521 1.00 38.89  ? 499  ILE A CG1   1 
ATOM   4105 C  CG2   . ILE A 1 499 ? -4.984  -42.187 46.254 1.00 37.85  ? 499  ILE A CG2   1 
ATOM   4106 C  CD1   . ILE A 1 499 ? -7.258  -40.094 46.342 1.00 36.39  ? 499  ILE A CD1   1 
ATOM   4107 N  N     . LYS A 1 500 ? -2.126  -41.001 48.548 1.00 44.55  ? 500  LYS A N     1 
ATOM   4108 C  CA    . LYS A 1 500 ? -0.703  -41.268 48.355 1.00 46.80  ? 500  LYS A CA    1 
ATOM   4109 C  C     . LYS A 1 500 ? -0.110  -42.171 49.445 1.00 48.84  ? 500  LYS A C     1 
ATOM   4110 O  O     . LYS A 1 500 ? 0.718   -43.034 49.154 1.00 51.14  ? 500  LYS A O     1 
ATOM   4111 C  CB    . LYS A 1 500 ? 0.090   -39.964 48.244 1.00 46.47  ? 500  LYS A CB    1 
ATOM   4112 C  CG    . LYS A 1 500 ? -0.076  -39.240 46.920 1.00 46.75  ? 500  LYS A CG    1 
ATOM   4113 C  CD    . LYS A 1 500 ? 0.777   -37.978 46.884 1.00 48.54  ? 500  LYS A CD    1 
ATOM   4114 C  CE    . LYS A 1 500 ? 0.393   -37.073 45.719 1.00 49.38  ? 500  LYS A CE    1 
ATOM   4115 N  NZ    . LYS A 1 500 ? 1.114   -35.774 45.780 1.00 50.82  ? 500  LYS A NZ    1 
ATOM   4116 N  N     . GLU A 1 501 ? -0.536  -41.966 50.689 1.00 50.65  ? 501  GLU A N     1 
ATOM   4117 C  CA    . GLU A 1 501 ? -0.105  -42.799 51.812 1.00 52.31  ? 501  GLU A CA    1 
ATOM   4118 C  C     . GLU A 1 501 ? -0.656  -44.212 51.670 1.00 51.86  ? 501  GLU A C     1 
ATOM   4119 O  O     . GLU A 1 501 ? 0.018   -45.191 52.004 1.00 53.19  ? 501  GLU A O     1 
ATOM   4120 C  CB    . GLU A 1 501 ? -0.550  -42.192 53.145 1.00 52.57  ? 501  GLU A CB    1 
ATOM   4121 C  CG    . GLU A 1 501 ? 0.301   -41.004 53.611 1.00 60.17  ? 501  GLU A CG    1 
ATOM   4122 C  CD    . GLU A 1 501 ? 1.614   -41.406 54.300 1.00 64.76  ? 501  GLU A CD    1 
ATOM   4123 O  OE1   . GLU A 1 501 ? 1.830   -42.611 54.576 1.00 65.78  ? 501  GLU A OE1   1 
ATOM   4124 O  OE2   . GLU A 1 501 ? 2.431   -40.500 54.577 1.00 65.52  ? 501  GLU A OE2   1 
ATOM   4125 N  N     . ALA A 1 502 ? -1.878  -44.307 51.158 1.00 50.17  ? 502  ALA A N     1 
ATOM   4126 C  CA    . ALA A 1 502 ? -2.526  -45.589 50.941 1.00 49.55  ? 502  ALA A CA    1 
ATOM   4127 C  C     . ALA A 1 502 ? -1.857  -46.374 49.805 1.00 49.56  ? 502  ALA A C     1 
ATOM   4128 O  O     . ALA A 1 502 ? -1.874  -47.607 49.804 1.00 46.92  ? 502  ALA A O     1 
ATOM   4129 C  CB    . ALA A 1 502 ? -3.994  -45.392 50.668 1.00 48.63  ? 502  ALA A CB    1 
ATOM   4130 N  N     . LEU A 1 503 ? -1.254  -45.645 48.865 1.00 50.21  ? 503  LEU A N     1 
ATOM   4131 C  CA    . LEU A 1 503 ? -0.539  -46.229 47.735 1.00 50.71  ? 503  LEU A CA    1 
ATOM   4132 C  C     . LEU A 1 503 ? 0.767   -46.919 48.125 1.00 52.15  ? 503  LEU A C     1 
ATOM   4133 O  O     . LEU A 1 503 ? 1.446   -47.491 47.273 1.00 53.01  ? 503  LEU A O     1 
ATOM   4134 C  CB    . LEU A 1 503 ? -0.279  -45.172 46.661 1.00 50.62  ? 503  LEU A CB    1 
ATOM   4135 C  CG    . LEU A 1 503 ? -1.356  -45.007 45.585 1.00 52.79  ? 503  LEU A CG    1 
ATOM   4136 C  CD1   . LEU A 1 503 ? -1.140  -43.725 44.794 1.00 53.40  ? 503  LEU A CD1   1 
ATOM   4137 C  CD2   . LEU A 1 503 ? -1.382  -46.211 44.648 1.00 52.10  ? 503  LEU A CD2   1 
ATOM   4138 N  N     . HIS A 1 504 ? 1.118   -46.864 49.407 1.00 53.73  ? 504  HIS A N     1 
ATOM   4139 C  CA    . HIS A 1 504 ? 2.268   -47.614 49.914 1.00 55.07  ? 504  HIS A CA    1 
ATOM   4140 C  C     . HIS A 1 504 ? 1.927   -49.080 50.195 1.00 53.36  ? 504  HIS A C     1 
ATOM   4141 O  O     . HIS A 1 504 ? 2.816   -49.921 50.301 1.00 51.98  ? 504  HIS A O     1 
ATOM   4142 C  CB    . HIS A 1 504 ? 2.873   -46.930 51.145 1.00 56.15  ? 504  HIS A CB    1 
ATOM   4143 C  CG    . HIS A 1 504 ? 3.504   -45.607 50.837 1.00 59.99  ? 504  HIS A CG    1 
ATOM   4144 N  ND1   . HIS A 1 504 ? 4.404   -45.435 49.807 1.00 61.60  ? 504  HIS A ND1   1 
ATOM   4145 C  CD2   . HIS A 1 504 ? 3.360   -44.392 51.418 1.00 61.52  ? 504  HIS A CD2   1 
ATOM   4146 C  CE1   . HIS A 1 504 ? 4.784   -44.170 49.763 1.00 63.39  ? 504  HIS A CE1   1 
ATOM   4147 N  NE2   . HIS A 1 504 ? 4.166   -43.516 50.730 1.00 62.91  ? 504  HIS A NE2   1 
ATOM   4148 N  N     . ASN A 1 505 ? 0.635   -49.376 50.295 1.00 52.15  ? 505  ASN A N     1 
ATOM   4149 C  CA    . ASN A 1 505 ? 0.167   -50.733 50.524 1.00 51.84  ? 505  ASN A CA    1 
ATOM   4150 C  C     . ASN A 1 505 ? -1.050  -51.084 49.669 1.00 51.61  ? 505  ASN A C     1 
ATOM   4151 O  O     . ASN A 1 505 ? -2.151  -51.243 50.200 1.00 49.24  ? 505  ASN A O     1 
ATOM   4152 C  CB    . ASN A 1 505 ? -0.138  -50.943 52.012 1.00 52.97  ? 505  ASN A CB    1 
ATOM   4153 C  CG    . ASN A 1 505 ? 1.121   -51.152 52.843 1.00 54.02  ? 505  ASN A CG    1 
ATOM   4154 O  OD1   . ASN A 1 505 ? 1.562   -50.253 53.561 1.00 53.49  ? 505  ASN A OD1   1 
ATOM   4155 N  ND2   . ASN A 1 505 ? 1.709   -52.341 52.741 1.00 53.56  ? 505  ASN A ND2   1 
ATOM   4156 N  N     . PRO A 1 506 ? -0.860  -51.192 48.336 1.00 51.97  ? 506  PRO A N     1 
ATOM   4157 C  CA    . PRO A 1 506 ? -1.986  -51.573 47.483 1.00 53.86  ? 506  PRO A CA    1 
ATOM   4158 C  C     . PRO A 1 506 ? -2.364  -53.035 47.656 1.00 54.81  ? 506  PRO A C     1 
ATOM   4159 O  O     . PRO A 1 506 ? -1.493  -53.877 47.862 1.00 56.05  ? 506  PRO A O     1 
ATOM   4160 C  CB    . PRO A 1 506 ? -1.464  -51.324 46.061 1.00 52.98  ? 506  PRO A CB    1 
ATOM   4161 C  CG    . PRO A 1 506 ? 0.009   -51.289 46.178 1.00 52.70  ? 506  PRO A CG    1 
ATOM   4162 C  CD    . PRO A 1 506 ? 0.311   -50.775 47.546 1.00 51.59  ? 506  PRO A CD    1 
ATOM   4163 N  N     . ASN A 1 507 ? -3.660  -53.319 47.580 1.00 55.62  ? 507  ASN A N     1 
ATOM   4164 C  CA    . ASN A 1 507 ? -4.162  -54.683 47.681 1.00 55.59  ? 507  ASN A CA    1 
ATOM   4165 C  C     . ASN A 1 507 ? -4.105  -55.412 46.352 1.00 56.26  ? 507  ASN A C     1 
ATOM   4166 O  O     . ASN A 1 507 ? -4.255  -54.802 45.292 1.00 57.58  ? 507  ASN A O     1 
ATOM   4167 C  CB    . ASN A 1 507 ? -5.594  -54.687 48.208 1.00 55.28  ? 507  ASN A CB    1 
ATOM   4168 C  CG    . ASN A 1 507 ? -5.693  -54.125 49.599 1.00 55.09  ? 507  ASN A CG    1 
ATOM   4169 O  OD1   . ASN A 1 507 ? -5.432  -52.938 49.821 1.00 53.50  ? 507  ASN A OD1   1 
ATOM   4170 N  ND2   . ASN A 1 507 ? -6.064  -54.973 50.554 1.00 52.70  ? 507  ASN A ND2   1 
ATOM   4171 N  N     . LEU A 1 508 ? -3.881  -56.719 46.414 1.00 56.44  ? 508  LEU A N     1 
ATOM   4172 C  CA    . LEU A 1 508 ? -3.872  -57.544 45.218 1.00 57.79  ? 508  LEU A CA    1 
ATOM   4173 C  C     . LEU A 1 508 ? -5.308  -57.940 44.922 1.00 57.10  ? 508  LEU A C     1 
ATOM   4174 O  O     . LEU A 1 508 ? -5.780  -59.010 45.327 1.00 57.44  ? 508  LEU A O     1 
ATOM   4175 C  CB    . LEU A 1 508 ? -2.983  -58.776 45.406 1.00 58.57  ? 508  LEU A CB    1 
ATOM   4176 C  CG    . LEU A 1 508 ? -1.523  -58.564 45.824 1.00 60.16  ? 508  LEU A CG    1 
ATOM   4177 C  CD1   . LEU A 1 508 ? -0.921  -59.908 46.227 1.00 62.31  ? 508  LEU A CD1   1 
ATOM   4178 C  CD2   . LEU A 1 508 ? -0.692  -57.896 44.722 1.00 58.40  ? 508  LEU A CD2   1 
ATOM   4179 N  N     . SER A 1 509 ? -6.006  -57.050 44.229 1.00 55.21  ? 509  SER A N     1 
ATOM   4180 C  CA    . SER A 1 509 ? -7.430  -57.225 43.980 1.00 53.65  ? 509  SER A CA    1 
ATOM   4181 C  C     . SER A 1 509 ? -7.859  -56.559 42.682 1.00 53.29  ? 509  SER A C     1 
ATOM   4182 O  O     . SER A 1 509 ? -7.058  -55.887 42.018 1.00 51.87  ? 509  SER A O     1 
ATOM   4183 C  CB    . SER A 1 509 ? -8.250  -56.675 45.159 1.00 52.42  ? 509  SER A CB    1 
ATOM   4184 O  OG    . SER A 1 509 ? -7.914  -55.327 45.434 1.00 46.85  ? 509  SER A OG    1 
ATOM   4185 N  N     . VAL A 1 510 ? -9.122  -56.776 42.321 1.00 52.50  ? 510  VAL A N     1 
ATOM   4186 C  CA    . VAL A 1 510 ? -9.758  -56.072 41.216 1.00 53.43  ? 510  VAL A CA    1 
ATOM   4187 C  C     . VAL A 1 510 ? -11.018 -55.406 41.743 1.00 53.44  ? 510  VAL A C     1 
ATOM   4188 O  O     . VAL A 1 510 ? -11.950 -56.078 42.190 1.00 52.96  ? 510  VAL A O     1 
ATOM   4189 C  CB    . VAL A 1 510 ? -10.099 -57.000 40.033 1.00 52.87  ? 510  VAL A CB    1 
ATOM   4190 C  CG1   . VAL A 1 510 ? -10.864 -56.220 38.958 1.00 52.38  ? 510  VAL A CG1   1 
ATOM   4191 C  CG2   . VAL A 1 510 ? -8.832  -57.602 39.450 1.00 53.53  ? 510  VAL A CG2   1 
ATOM   4192 N  N     . ASP A 1 511 ? -11.030 -54.079 41.687 1.00 53.72  ? 511  ASP A N     1 
ATOM   4193 C  CA    . ASP A 1 511 ? -12.086 -53.282 42.297 1.00 52.35  ? 511  ASP A CA    1 
ATOM   4194 C  C     . ASP A 1 511 ? -12.372 -52.016 41.490 1.00 51.57  ? 511  ASP A C     1 
ATOM   4195 O  O     . ASP A 1 511 ? -11.961 -51.891 40.336 1.00 51.63  ? 511  ASP A O     1 
ATOM   4196 C  CB    . ASP A 1 511 ? -11.704 -52.931 43.745 1.00 51.38  ? 511  ASP A CB    1 
ATOM   4197 C  CG    . ASP A 1 511 ? -10.258 -52.451 43.875 1.00 49.55  ? 511  ASP A CG    1 
ATOM   4198 O  OD1   . ASP A 1 511 ? -9.769  -51.748 42.969 1.00 49.92  ? 511  ASP A OD1   1 
ATOM   4199 O  OD2   . ASP A 1 511 ? -9.610  -52.772 44.891 1.00 48.60  ? 511  ASP A OD2   1 
ATOM   4200 N  N     . GLU A 1 512 ? -13.088 -51.086 42.111 1.00 50.88  ? 512  GLU A N     1 
ATOM   4201 C  CA    . GLU A 1 512 ? -13.427 -49.820 41.490 1.00 49.97  ? 512  GLU A CA    1 
ATOM   4202 C  C     . GLU A 1 512 ? -13.055 -48.675 42.427 1.00 47.62  ? 512  GLU A C     1 
ATOM   4203 O  O     . GLU A 1 512 ? -13.074 -48.849 43.649 1.00 47.10  ? 512  GLU A O     1 
ATOM   4204 C  CB    . GLU A 1 512 ? -14.923 -49.774 41.163 1.00 50.50  ? 512  GLU A CB    1 
ATOM   4205 C  CG    . GLU A 1 512 ? -15.341 -50.688 40.015 1.00 57.47  ? 512  GLU A CG    1 
ATOM   4206 C  CD    . GLU A 1 512 ? -15.247 -50.022 38.645 1.00 63.98  ? 512  GLU A CD    1 
ATOM   4207 O  OE1   . GLU A 1 512 ? -16.306 -49.877 37.994 1.00 65.70  ? 512  GLU A OE1   1 
ATOM   4208 O  OE2   . GLU A 1 512 ? -14.131 -49.644 38.215 1.00 65.24  ? 512  GLU A OE2   1 
ATOM   4209 N  N     . PRO A 1 513 ? -12.691 -47.508 41.858 1.00 46.82  ? 513  PRO A N     1 
ATOM   4210 C  CA    . PRO A 1 513 ? -12.552 -46.289 42.648 1.00 46.67  ? 513  PRO A CA    1 
ATOM   4211 C  C     . PRO A 1 513 ? -13.874 -45.939 43.334 1.00 48.24  ? 513  PRO A C     1 
ATOM   4212 O  O     . PRO A 1 513 ? -14.947 -46.116 42.745 1.00 47.58  ? 513  PRO A O     1 
ATOM   4213 C  CB    . PRO A 1 513 ? -12.204 -45.224 41.594 1.00 45.86  ? 513  PRO A CB    1 
ATOM   4214 C  CG    . PRO A 1 513 ? -12.629 -45.812 40.289 1.00 44.69  ? 513  PRO A CG    1 
ATOM   4215 C  CD    . PRO A 1 513 ? -12.358 -47.270 40.442 1.00 45.96  ? 513  PRO A CD    1 
ATOM   4216 N  N     . LEU A 1 514 ? -13.785 -45.466 44.575 1.00 50.05  ? 514  LEU A N     1 
ATOM   4217 C  CA    . LEU A 1 514 ? -14.953 -45.054 45.350 1.00 53.20  ? 514  LEU A CA    1 
ATOM   4218 C  C     . LEU A 1 514 ? -15.652 -43.862 44.713 1.00 54.46  ? 514  LEU A C     1 
ATOM   4219 O  O     . LEU A 1 514 ? -15.010 -43.030 44.069 1.00 54.84  ? 514  LEU A O     1 
ATOM   4220 C  CB    . LEU A 1 514 ? -14.538 -44.691 46.780 1.00 52.97  ? 514  LEU A CB    1 
ATOM   4221 C  CG    . LEU A 1 514 ? -14.659 -45.712 47.913 1.00 53.99  ? 514  LEU A CG    1 
ATOM   4222 C  CD1   . LEU A 1 514 ? -14.297 -47.131 47.479 1.00 57.22  ? 514  LEU A CD1   1 
ATOM   4223 C  CD2   . LEU A 1 514 ? -13.811 -45.277 49.102 1.00 53.02  ? 514  LEU A CD2   1 
ATOM   4224 N  N     . ASP A 1 515 ? -16.966 -43.782 44.887 1.00 55.75  ? 515  ASP A N     1 
ATOM   4225 C  CA    . ASP A 1 515 ? -17.694 -42.610 44.427 1.00 57.44  ? 515  ASP A CA    1 
ATOM   4226 C  C     . ASP A 1 515 ? -17.873 -41.643 45.588 1.00 55.78  ? 515  ASP A C     1 
ATOM   4227 O  O     . ASP A 1 515 ? -18.710 -41.850 46.470 1.00 56.54  ? 515  ASP A O     1 
ATOM   4228 C  CB    . ASP A 1 515 ? -19.032 -42.974 43.774 1.00 59.58  ? 515  ASP A CB    1 
ATOM   4229 C  CG    . ASP A 1 515 ? -19.502 -41.911 42.795 1.00 64.87  ? 515  ASP A CG    1 
ATOM   4230 O  OD1   . ASP A 1 515 ? -20.644 -41.427 42.940 1.00 69.24  ? 515  ASP A OD1   1 
ATOM   4231 O  OD2   . ASP A 1 515 ? -18.721 -41.542 41.887 1.00 67.19  ? 515  ASP A OD2   1 
ATOM   4232 N  N     . VAL A 1 516 ? -17.051 -40.598 45.578 1.00 53.91  ? 516  VAL A N     1 
ATOM   4233 C  CA    . VAL A 1 516 ? -16.974 -39.626 46.664 1.00 51.95  ? 516  VAL A CA    1 
ATOM   4234 C  C     . VAL A 1 516 ? -16.821 -38.211 46.116 1.00 50.13  ? 516  VAL A C     1 
ATOM   4235 O  O     . VAL A 1 516 ? -16.445 -38.018 44.956 1.00 49.73  ? 516  VAL A O     1 
ATOM   4236 C  CB    . VAL A 1 516 ? -15.781 -39.916 47.632 1.00 52.41  ? 516  VAL A CB    1 
ATOM   4237 C  CG1   . VAL A 1 516 ? -16.071 -41.117 48.511 1.00 53.12  ? 516  VAL A CG1   1 
ATOM   4238 C  CG2   . VAL A 1 516 ? -14.468 -40.104 46.861 1.00 50.71  ? 516  VAL A CG2   1 
ATOM   4239 N  N     . ASP A 1 517 ? -17.119 -37.232 46.965 1.00 47.30  ? 517  ASP A N     1 
ATOM   4240 C  CA    . ASP A 1 517 ? -16.930 -35.832 46.637 1.00 43.83  ? 517  ASP A CA    1 
ATOM   4241 C  C     . ASP A 1 517 ? -15.591 -35.384 47.218 1.00 41.42  ? 517  ASP A C     1 
ATOM   4242 O  O     . ASP A 1 517 ? -15.458 -35.179 48.431 1.00 40.99  ? 517  ASP A O     1 
ATOM   4243 C  CB    . ASP A 1 517 ? -18.091 -34.994 47.189 1.00 44.73  ? 517  ASP A CB    1 
ATOM   4244 C  CG    . ASP A 1 517 ? -18.099 -33.561 46.657 1.00 47.19  ? 517  ASP A CG    1 
ATOM   4245 O  OD1   . ASP A 1 517 ? -19.151 -32.902 46.790 1.00 49.13  ? 517  ASP A OD1   1 
ATOM   4246 O  OD2   . ASP A 1 517 ? -17.073 -33.087 46.115 1.00 44.27  ? 517  ASP A OD2   1 
ATOM   4247 N  N     . TYR A 1 518 ? -14.603 -35.238 46.338 1.00 38.13  ? 518  TYR A N     1 
ATOM   4248 C  CA    . TYR A 1 518 ? -13.247 -34.873 46.733 1.00 35.66  ? 518  TYR A CA    1 
ATOM   4249 C  C     . TYR A 1 518 ? -13.125 -33.452 47.318 1.00 33.16  ? 518  TYR A C     1 
ATOM   4250 O  O     . TYR A 1 518 ? -12.079 -33.077 47.842 1.00 30.40  ? 518  TYR A O     1 
ATOM   4251 C  CB    . TYR A 1 518 ? -12.300 -35.038 45.553 1.00 35.89  ? 518  TYR A CB    1 
ATOM   4252 C  CG    . TYR A 1 518 ? -12.148 -36.459 45.073 1.00 35.79  ? 518  TYR A CG    1 
ATOM   4253 C  CD1   . TYR A 1 518 ? -12.856 -36.918 43.961 1.00 34.16  ? 518  TYR A CD1   1 
ATOM   4254 C  CD2   . TYR A 1 518 ? -11.278 -37.343 45.720 1.00 37.04  ? 518  TYR A CD2   1 
ATOM   4255 C  CE1   . TYR A 1 518 ? -12.719 -38.225 43.510 1.00 33.05  ? 518  TYR A CE1   1 
ATOM   4256 C  CE2   . TYR A 1 518 ? -11.124 -38.662 45.277 1.00 36.68  ? 518  TYR A CE2   1 
ATOM   4257 C  CZ    . TYR A 1 518 ? -11.843 -39.093 44.165 1.00 38.83  ? 518  TYR A CZ    1 
ATOM   4258 O  OH    . TYR A 1 518 ? -11.692 -40.394 43.720 1.00 39.74  ? 518  TYR A OH    1 
ATOM   4259 N  N     . ARG A 1 519 ? -14.209 -32.684 47.261 1.00 32.36  ? 519  ARG A N     1 
ATOM   4260 C  CA    . ARG A 1 519 ? -14.225 -31.335 47.823 1.00 32.05  ? 519  ARG A CA    1 
ATOM   4261 C  C     . ARG A 1 519 ? -14.312 -31.335 49.348 1.00 32.91  ? 519  ARG A C     1 
ATOM   4262 O  O     . ARG A 1 519 ? -14.165 -30.290 49.980 1.00 34.05  ? 519  ARG A O     1 
ATOM   4263 C  CB    . ARG A 1 519 ? -15.359 -30.519 47.209 1.00 29.99  ? 519  ARG A CB    1 
ATOM   4264 C  CG    . ARG A 1 519 ? -15.209 -30.313 45.685 1.00 32.81  ? 519  ARG A CG    1 
ATOM   4265 C  CD    . ARG A 1 519 ? -16.396 -29.570 45.084 1.00 34.08  ? 519  ARG A CD    1 
ATOM   4266 N  NE    . ARG A 1 519 ? -17.648 -30.282 45.339 1.00 34.34  ? 519  ARG A NE    1 
ATOM   4267 C  CZ    . ARG A 1 519 ? -18.854 -29.725 45.327 1.00 35.93  ? 519  ARG A CZ    1 
ATOM   4268 N  NH1   . ARG A 1 519 ? -19.004 -28.428 45.067 1.00 32.56  ? 519  ARG A NH1   1 
ATOM   4269 N  NH2   . ARG A 1 519 ? -19.919 -30.473 45.581 1.00 36.99  ? 519  ARG A NH2   1 
ATOM   4270 N  N     . PHE A 1 520 ? -14.531 -32.510 49.941 1.00 33.08  ? 520  PHE A N     1 
ATOM   4271 C  CA    . PHE A 1 520 ? -14.725 -32.608 51.384 1.00 34.49  ? 520  PHE A CA    1 
ATOM   4272 C  C     . PHE A 1 520 ? -13.815 -33.652 51.981 1.00 35.92  ? 520  PHE A C     1 
ATOM   4273 O  O     . PHE A 1 520 ? -13.688 -34.745 51.435 1.00 37.78  ? 520  PHE A O     1 
ATOM   4274 C  CB    . PHE A 1 520 ? -16.194 -32.918 51.711 1.00 35.42  ? 520  PHE A CB    1 
ATOM   4275 C  CG    . PHE A 1 520 ? -17.152 -31.884 51.193 1.00 37.36  ? 520  PHE A CG    1 
ATOM   4276 C  CD1   . PHE A 1 520 ? -17.493 -30.781 51.977 1.00 39.31  ? 520  PHE A CD1   1 
ATOM   4277 C  CD2   . PHE A 1 520 ? -17.686 -31.990 49.908 1.00 39.77  ? 520  PHE A CD2   1 
ATOM   4278 C  CE1   . PHE A 1 520 ? -18.361 -29.805 51.496 1.00 41.66  ? 520  PHE A CE1   1 
ATOM   4279 C  CE2   . PHE A 1 520 ? -18.562 -31.024 49.415 1.00 41.41  ? 520  PHE A CE2   1 
ATOM   4280 C  CZ    . PHE A 1 520 ? -18.902 -29.930 50.211 1.00 42.00  ? 520  PHE A CZ    1 
ATOM   4281 N  N     . ASP A 1 521 ? -13.188 -33.318 53.106 1.00 37.56  ? 521  ASP A N     1 
ATOM   4282 C  CA    . ASP A 1 521 ? -12.263 -34.241 53.771 1.00 40.01  ? 521  ASP A CA    1 
ATOM   4283 C  C     . ASP A 1 521 ? -12.899 -35.604 53.929 1.00 39.24  ? 521  ASP A C     1 
ATOM   4284 O  O     . ASP A 1 521 ? -14.070 -35.700 54.289 1.00 39.91  ? 521  ASP A O     1 
ATOM   4285 C  CB    . ASP A 1 521 ? -11.812 -33.695 55.128 1.00 39.77  ? 521  ASP A CB    1 
ATOM   4286 C  CG    . ASP A 1 521 ? -10.832 -32.553 54.985 1.00 43.55  ? 521  ASP A CG    1 
ATOM   4287 O  OD1   . ASP A 1 521 ? -9.739  -32.782 54.421 1.00 45.06  ? 521  ASP A OD1   1 
ATOM   4288 O  OD2   . ASP A 1 521 ? -11.154 -31.425 55.418 1.00 45.27  ? 521  ASP A OD2   1 
ATOM   4289 N  N     . PHE A 1 522 ? -12.130 -36.648 53.630 1.00 38.36  ? 522  PHE A N     1 
ATOM   4290 C  CA    . PHE A 1 522 ? -12.632 -38.016 53.695 1.00 38.53  ? 522  PHE A CA    1 
ATOM   4291 C  C     . PHE A 1 522 ? -13.084 -38.376 55.103 1.00 40.95  ? 522  PHE A C     1 
ATOM   4292 O  O     . PHE A 1 522 ? -12.461 -37.975 56.086 1.00 40.36  ? 522  PHE A O     1 
ATOM   4293 C  CB    . PHE A 1 522 ? -11.579 -39.017 53.218 1.00 37.97  ? 522  PHE A CB    1 
ATOM   4294 C  CG    . PHE A 1 522 ? -11.332 -38.991 51.725 1.00 38.12  ? 522  PHE A CG    1 
ATOM   4295 C  CD1   . PHE A 1 522 ? -12.324 -38.569 50.841 1.00 33.96  ? 522  PHE A CD1   1 
ATOM   4296 C  CD2   . PHE A 1 522 ? -10.113 -39.424 51.204 1.00 33.85  ? 522  PHE A CD2   1 
ATOM   4297 C  CE1   . PHE A 1 522 ? -12.090 -38.556 49.466 1.00 34.54  ? 522  PHE A CE1   1 
ATOM   4298 C  CE2   . PHE A 1 522 ? -9.879  -39.424 49.837 1.00 35.06  ? 522  PHE A CE2   1 
ATOM   4299 C  CZ    . PHE A 1 522 ? -10.870 -38.982 48.965 1.00 31.63  ? 522  PHE A CZ    1 
ATOM   4300 N  N     . SER A 1 523 ? -14.187 -39.114 55.186 1.00 43.79  ? 523  SER A N     1 
ATOM   4301 C  CA    . SER A 1 523 ? -14.677 -39.625 56.458 1.00 45.41  ? 523  SER A CA    1 
ATOM   4302 C  C     . SER A 1 523 ? -13.842 -40.832 56.880 1.00 46.63  ? 523  SER A C     1 
ATOM   4303 O  O     . SER A 1 523 ? -13.162 -41.440 56.045 1.00 46.24  ? 523  SER A O     1 
ATOM   4304 C  CB    . SER A 1 523 ? -16.158 -40.004 56.354 1.00 44.94  ? 523  SER A CB    1 
ATOM   4305 O  OG    . SER A 1 523 ? -16.358 -41.053 55.421 1.00 46.24  ? 523  SER A OG    1 
ATOM   4306 N  N     . ASP A 1 524 ? -13.898 -41.173 58.167 1.00 47.75  ? 524  ASP A N     1 
ATOM   4307 C  CA    . ASP A 1 524 ? -13.188 -42.344 58.692 1.00 50.63  ? 524  ASP A CA    1 
ATOM   4308 C  C     . ASP A 1 524 ? -13.499 -43.616 57.890 1.00 49.58  ? 524  ASP A C     1 
ATOM   4309 O  O     . ASP A 1 524 ? -12.597 -44.406 57.611 1.00 49.08  ? 524  ASP A O     1 
ATOM   4310 C  CB    . ASP A 1 524 ? -13.510 -42.561 60.179 1.00 52.50  ? 524  ASP A CB    1 
ATOM   4311 C  CG    . ASP A 1 524 ? -12.957 -41.453 61.080 1.00 56.42  ? 524  ASP A CG    1 
ATOM   4312 O  OD1   . ASP A 1 524 ? -12.297 -40.513 60.580 1.00 57.09  ? 524  ASP A OD1   1 
ATOM   4313 O  OD2   . ASP A 1 524 ? -13.187 -41.531 62.305 1.00 57.20  ? 524  ASP A OD2   1 
ATOM   4314 N  N     . GLU A 1 525 ? -14.765 -43.792 57.507 1.00 48.69  ? 525  GLU A N     1 
ATOM   4315 C  CA    . GLU A 1 525 ? -15.196 -45.004 56.812 1.00 50.75  ? 525  GLU A CA    1 
ATOM   4316 C  C     . GLU A 1 525 ? -14.722 -45.080 55.353 1.00 49.51  ? 525  GLU A C     1 
ATOM   4317 O  O     . GLU A 1 525 ? -14.468 -46.165 54.832 1.00 49.65  ? 525  GLU A O     1 
ATOM   4318 C  CB    . GLU A 1 525 ? -16.717 -45.204 56.927 1.00 52.01  ? 525  GLU A CB    1 
ATOM   4319 C  CG    . GLU A 1 525 ? -17.560 -44.489 55.872 1.00 59.30  ? 525  GLU A CG    1 
ATOM   4320 C  CD    . GLU A 1 525 ? -18.792 -45.291 55.452 1.00 66.29  ? 525  GLU A CD    1 
ATOM   4321 O  OE1   . GLU A 1 525 ? -19.491 -45.845 56.336 1.00 68.95  ? 525  GLU A OE1   1 
ATOM   4322 O  OE2   . GLU A 1 525 ? -19.061 -45.365 54.230 1.00 67.24  ? 525  GLU A OE2   1 
ATOM   4323 N  N     . ILE A 1 526 ? -14.615 -43.924 54.702 1.00 50.69  ? 526  ILE A N     1 
ATOM   4324 C  CA    . ILE A 1 526 ? -14.038 -43.832 53.358 1.00 49.29  ? 526  ILE A CA    1 
ATOM   4325 C  C     . ILE A 1 526 ? -12.554 -44.172 53.438 1.00 48.12  ? 526  ILE A C     1 
ATOM   4326 O  O     . ILE A 1 526 ? -12.013 -44.833 52.555 1.00 45.94  ? 526  ILE A O     1 
ATOM   4327 C  CB    . ILE A 1 526 ? -14.260 -42.417 52.742 1.00 49.40  ? 526  ILE A CB    1 
ATOM   4328 C  CG1   . ILE A 1 526 ? -15.697 -42.281 52.223 1.00 48.44  ? 526  ILE A CG1   1 
ATOM   4329 C  CG2   . ILE A 1 526 ? -13.255 -42.122 51.621 1.00 47.07  ? 526  ILE A CG2   1 
ATOM   4330 C  CD1   . ILE A 1 526 ? -16.210 -40.836 52.163 1.00 51.66  ? 526  ILE A CD1   1 
ATOM   4331 N  N     . LYS A 1 527 ? -11.915 -43.738 54.520 1.00 48.91  ? 527  LYS A N     1 
ATOM   4332 C  CA    . LYS A 1 527 ? -10.493 -43.981 54.725 1.00 52.02  ? 527  LYS A CA    1 
ATOM   4333 C  C     . LYS A 1 527 ? -10.192 -45.462 54.922 1.00 54.40  ? 527  LYS A C     1 
ATOM   4334 O  O     . LYS A 1 527 ? -9.176  -45.961 54.437 1.00 54.45  ? 527  LYS A O     1 
ATOM   4335 C  CB    . LYS A 1 527 ? -9.950  -43.140 55.887 1.00 51.50  ? 527  LYS A CB    1 
ATOM   4336 C  CG    . LYS A 1 527 ? -9.817  -41.658 55.543 1.00 48.53  ? 527  LYS A CG    1 
ATOM   4337 C  CD    . LYS A 1 527 ? -8.899  -40.912 56.498 1.00 47.87  ? 527  LYS A CD    1 
ATOM   4338 C  CE    . LYS A 1 527 ? -9.670  -40.246 57.621 1.00 52.23  ? 527  LYS A CE    1 
ATOM   4339 N  NZ    . LYS A 1 527 ? -8.872  -39.164 58.258 1.00 52.77  ? 527  LYS A NZ    1 
ATOM   4340 N  N     . GLU A 1 528 ? -11.086 -46.163 55.615 1.00 58.03  ? 528  GLU A N     1 
ATOM   4341 C  CA    . GLU A 1 528 ? -10.952 -47.608 55.795 1.00 59.87  ? 528  GLU A CA    1 
ATOM   4342 C  C     . GLU A 1 528 ? -11.129 -48.337 54.467 1.00 59.26  ? 528  GLU A C     1 
ATOM   4343 O  O     . GLU A 1 528 ? -10.291 -49.161 54.101 1.00 59.78  ? 528  GLU A O     1 
ATOM   4344 C  CB    . GLU A 1 528 ? -11.935 -48.135 56.848 1.00 62.27  ? 528  GLU A CB    1 
ATOM   4345 C  CG    . GLU A 1 528 ? -11.534 -47.816 58.294 1.00 68.17  ? 528  GLU A CG    1 
ATOM   4346 C  CD    . GLU A 1 528 ? -10.333 -48.621 58.768 1.00 70.93  ? 528  GLU A CD    1 
ATOM   4347 O  OE1   . GLU A 1 528 ? -9.228  -48.039 58.865 1.00 71.42  ? 528  GLU A OE1   1 
ATOM   4348 O  OE2   . GLU A 1 528 ? -10.494 -49.835 59.032 1.00 71.61  ? 528  GLU A OE2   1 
ATOM   4349 N  N     . LYS A 1 529 ? -12.204 -48.016 53.742 1.00 57.76  ? 529  LYS A N     1 
ATOM   4350 C  CA    . LYS A 1 529 ? -12.465 -48.615 52.428 1.00 57.09  ? 529  LYS A CA    1 
ATOM   4351 C  C     . LYS A 1 529 ? -11.290 -48.438 51.473 1.00 56.16  ? 529  LYS A C     1 
ATOM   4352 O  O     . LYS A 1 529 ? -11.010 -49.315 50.649 1.00 55.77  ? 529  LYS A O     1 
ATOM   4353 C  CB    . LYS A 1 529 ? -13.742 -48.055 51.803 1.00 57.58  ? 529  LYS A CB    1 
ATOM   4354 C  CG    . LYS A 1 529 ? -15.004 -48.744 52.281 1.00 60.61  ? 529  LYS A CG    1 
ATOM   4355 C  CD    . LYS A 1 529 ? -16.250 -48.106 51.697 1.00 62.58  ? 529  LYS A CD    1 
ATOM   4356 C  CE    . LYS A 1 529 ? -17.499 -48.723 52.303 1.00 64.39  ? 529  LYS A CE    1 
ATOM   4357 N  NZ    . LYS A 1 529 ? -18.738 -48.029 51.848 1.00 67.35  ? 529  LYS A NZ    1 
ATOM   4358 N  N     . ILE A 1 530 ? -10.603 -47.306 51.606 1.00 55.43  ? 530  ILE A N     1 
ATOM   4359 C  CA    . ILE A 1 530 ? -9.428  -46.999 50.792 1.00 54.98  ? 530  ILE A CA    1 
ATOM   4360 C  C     . ILE A 1 530 ? -8.261  -47.957 51.079 1.00 54.17  ? 530  ILE A C     1 
ATOM   4361 O  O     . ILE A 1 530 ? -7.561  -48.376 50.155 1.00 52.68  ? 530  ILE A O     1 
ATOM   4362 C  CB    . ILE A 1 530 ? -9.049  -45.495 50.910 1.00 54.36  ? 530  ILE A CB    1 
ATOM   4363 C  CG1   . ILE A 1 530 ? -9.841  -44.687 49.874 1.00 53.78  ? 530  ILE A CG1   1 
ATOM   4364 C  CG2   . ILE A 1 530 ? -7.559  -45.264 50.727 1.00 53.50  ? 530  ILE A CG2   1 
ATOM   4365 C  CD1   . ILE A 1 530 ? -9.890  -43.194 50.150 1.00 55.92  ? 530  ILE A CD1   1 
ATOM   4366 N  N     . LYS A 1 531 ? -8.094  -48.333 52.348 1.00 55.24  ? 531  LYS A N     1 
ATOM   4367 C  CA    . LYS A 1 531 ? -7.043  -49.277 52.760 1.00 55.28  ? 531  LYS A CA    1 
ATOM   4368 C  C     . LYS A 1 531 ? -7.188  -50.677 52.153 1.00 53.75  ? 531  LYS A C     1 
ATOM   4369 O  O     . LYS A 1 531 ? -6.274  -51.491 52.251 1.00 54.01  ? 531  LYS A O     1 
ATOM   4370 C  CB    . LYS A 1 531 ? -6.968  -49.379 54.286 1.00 55.01  ? 531  LYS A CB    1 
ATOM   4371 C  CG    . LYS A 1 531 ? -6.241  -48.228 54.966 1.00 58.02  ? 531  LYS A CG    1 
ATOM   4372 C  CD    . LYS A 1 531 ? -6.527  -48.236 56.464 1.00 61.38  ? 531  LYS A CD    1 
ATOM   4373 C  CE    . LYS A 1 531 ? -5.970  -47.008 57.164 1.00 62.96  ? 531  LYS A CE    1 
ATOM   4374 N  NZ    . LYS A 1 531 ? -6.464  -46.926 58.568 1.00 61.54  ? 531  LYS A NZ    1 
ATOM   4375 N  N     . LYS A 1 532 ? -8.324  -50.947 51.521 1.00 53.53  ? 532  LYS A N     1 
ATOM   4376 C  CA    . LYS A 1 532 ? -8.575  -52.243 50.899 1.00 53.65  ? 532  LYS A CA    1 
ATOM   4377 C  C     . LYS A 1 532 ? -8.505  -52.213 49.359 1.00 52.39  ? 532  LYS A C     1 
ATOM   4378 O  O     . LYS A 1 532 ? -8.696  -53.245 48.698 1.00 52.55  ? 532  LYS A O     1 
ATOM   4379 C  CB    . LYS A 1 532 ? -9.927  -52.805 51.374 1.00 55.12  ? 532  LYS A CB    1 
ATOM   4380 C  CG    . LYS A 1 532 ? -9.915  -53.410 52.791 1.00 60.33  ? 532  LYS A CG    1 
ATOM   4381 C  CD    . LYS A 1 532 ? -9.981  -52.346 53.892 1.00 64.42  ? 532  LYS A CD    1 
ATOM   4382 C  CE    . LYS A 1 532 ? -9.964  -52.960 55.289 1.00 68.66  ? 532  LYS A CE    1 
ATOM   4383 N  NZ    . LYS A 1 532 ? -10.106 -51.922 56.360 1.00 69.58  ? 532  LYS A NZ    1 
ATOM   4384 N  N     . LEU A 1 533 ? -8.220  -51.044 48.788 1.00 49.35  ? 533  LEU A N     1 
ATOM   4385 C  CA    . LEU A 1 533 ? -8.247  -50.892 47.325 1.00 47.28  ? 533  LEU A CA    1 
ATOM   4386 C  C     . LEU A 1 533 ? -6.930  -51.239 46.622 1.00 44.45  ? 533  LEU A C     1 
ATOM   4387 O  O     . LEU A 1 533 ? -5.847  -51.095 47.195 1.00 43.13  ? 533  LEU A O     1 
ATOM   4388 C  CB    . LEU A 1 533 ? -8.757  -49.500 46.907 1.00 44.57  ? 533  LEU A CB    1 
ATOM   4389 C  CG    . LEU A 1 533 ? -10.250 -49.205 47.126 1.00 44.62  ? 533  LEU A CG    1 
ATOM   4390 C  CD1   . LEU A 1 533 ? -10.604 -47.786 46.702 1.00 44.77  ? 533  LEU A CD1   1 
ATOM   4391 C  CD2   . LEU A 1 533 ? -11.165 -50.217 46.424 1.00 44.33  ? 533  LEU A CD2   1 
ATOM   4392 N  N     . SER A 1 534 ? -7.052  -51.701 45.377 1.00 44.73  ? 534  SER A N     1 
ATOM   4393 C  CA    . SER A 1 534 ? -5.910  -51.927 44.483 1.00 44.26  ? 534  SER A CA    1 
ATOM   4394 C  C     . SER A 1 534 ? -5.266  -50.610 44.046 1.00 44.19  ? 534  SER A C     1 
ATOM   4395 O  O     . SER A 1 534 ? -5.907  -49.558 44.088 1.00 45.19  ? 534  SER A O     1 
ATOM   4396 C  CB    . SER A 1 534 ? -6.360  -52.719 43.249 1.00 44.60  ? 534  SER A CB    1 
ATOM   4397 O  OG    . SER A 1 534 ? -7.343  -52.013 42.501 1.00 40.67  ? 534  SER A OG    1 
ATOM   4398 N  N     . ALA A 1 535 ? -4.007  -50.677 43.618 1.00 45.08  ? 535  ALA A N     1 
ATOM   4399 C  CA    . ALA A 1 535 ? -3.272  -49.497 43.141 1.00 46.36  ? 535  ALA A CA    1 
ATOM   4400 C  C     . ALA A 1 535 ? -3.974  -48.794 41.977 1.00 47.09  ? 535  ALA A C     1 
ATOM   4401 O  O     . ALA A 1 535 ? -4.101  -47.565 41.970 1.00 47.88  ? 535  ALA A O     1 
ATOM   4402 C  CB    . ALA A 1 535 ? -1.844  -49.870 42.752 1.00 45.53  ? 535  ALA A CB    1 
ATOM   4403 N  N     . LYS A 1 536 ? -4.431  -49.579 41.003 1.00 47.20  ? 536  LYS A N     1 
ATOM   4404 C  CA    . LYS A 1 536 ? -5.140  -49.061 39.833 1.00 48.70  ? 536  LYS A CA    1 
ATOM   4405 C  C     . LYS A 1 536 ? -6.311  -48.153 40.225 1.00 48.41  ? 536  LYS A C     1 
ATOM   4406 O  O     . LYS A 1 536 ? -6.496  -47.098 39.635 1.00 48.41  ? 536  LYS A O     1 
ATOM   4407 C  CB    . LYS A 1 536 ? -5.625  -50.222 38.954 1.00 50.40  ? 536  LYS A CB    1 
ATOM   4408 C  CG    . LYS A 1 536 ? -6.455  -49.823 37.734 1.00 52.82  ? 536  LYS A CG    1 
ATOM   4409 C  CD    . LYS A 1 536 ? -7.110  -51.053 37.099 1.00 56.05  ? 536  LYS A CD    1 
ATOM   4410 C  CE    . LYS A 1 536 ? -8.005  -50.691 35.916 1.00 54.33  ? 536  LYS A CE    1 
ATOM   4411 N  NZ    . LYS A 1 536 ? -7.218  -50.340 34.707 1.00 56.05  ? 536  LYS A NZ    1 
ATOM   4412 N  N     . SER A 1 537 ? -7.088  -48.571 41.223 1.00 48.21  ? 537  SER A N     1 
ATOM   4413 C  CA    . SER A 1 537 ? -8.215  -47.778 41.704 1.00 48.60  ? 537  SER A CA    1 
ATOM   4414 C  C     . SER A 1 537 ? -7.766  -46.592 42.562 1.00 48.46  ? 537  SER A C     1 
ATOM   4415 O  O     . SER A 1 537 ? -8.400  -45.539 42.546 1.00 47.31  ? 537  SER A O     1 
ATOM   4416 C  CB    . SER A 1 537 ? -9.208  -48.650 42.472 1.00 48.86  ? 537  SER A CB    1 
ATOM   4417 O  OG    . SER A 1 537 ? -9.929  -49.485 41.586 1.00 49.43  ? 537  SER A OG    1 
ATOM   4418 N  N     . LEU A 1 538 ? -6.676  -46.768 43.307 1.00 47.64  ? 538  LEU A N     1 
ATOM   4419 C  CA    . LEU A 1 538 ? -6.095  -45.674 44.076 1.00 46.52  ? 538  LEU A CA    1 
ATOM   4420 C  C     . LEU A 1 538 ? -5.523  -44.596 43.153 1.00 45.29  ? 538  LEU A C     1 
ATOM   4421 O  O     . LEU A 1 538 ? -5.722  -43.404 43.387 1.00 45.38  ? 538  LEU A O     1 
ATOM   4422 C  CB    . LEU A 1 538 ? -5.027  -46.190 45.040 1.00 46.81  ? 538  LEU A CB    1 
ATOM   4423 C  CG    . LEU A 1 538 ? -5.506  -46.970 46.268 1.00 49.23  ? 538  LEU A CG    1 
ATOM   4424 C  CD1   . LEU A 1 538 ? -4.314  -47.404 47.109 1.00 49.37  ? 538  LEU A CD1   1 
ATOM   4425 C  CD2   . LEU A 1 538 ? -6.477  -46.143 47.110 1.00 51.47  ? 538  LEU A CD2   1 
ATOM   4426 N  N     . ASN A 1 539 ? -4.832  -45.028 42.101 1.00 44.35  ? 539  ASN A N     1 
ATOM   4427 C  CA    . ASN A 1 539 ? -4.290  -44.118 41.101 1.00 45.21  ? 539  ASN A CA    1 
ATOM   4428 C  C     . ASN A 1 539 ? -5.363  -43.376 40.318 1.00 43.50  ? 539  ASN A C     1 
ATOM   4429 O  O     . ASN A 1 539 ? -5.168  -42.222 39.933 1.00 44.45  ? 539  ASN A O     1 
ATOM   4430 C  CB    . ASN A 1 539 ? -3.347  -44.852 40.145 1.00 45.81  ? 539  ASN A CB    1 
ATOM   4431 C  CG    . ASN A 1 539 ? -1.982  -45.091 40.751 1.00 45.61  ? 539  ASN A CG    1 
ATOM   4432 O  OD1   . ASN A 1 539 ? -1.494  -46.217 40.772 1.00 49.86  ? 539  ASN A OD1   1 
ATOM   4433 N  ND2   . ASN A 1 539 ? -1.361  -44.031 41.258 1.00 43.53  ? 539  ASN A ND2   1 
ATOM   4434 N  N     . GLU A 1 540 ? -6.491  -44.040 40.089 1.00 41.90  ? 540  GLU A N     1 
ATOM   4435 C  CA    . GLU A 1 540 ? -7.635  -43.385 39.481 1.00 42.61  ? 540  GLU A CA    1 
ATOM   4436 C  C     . GLU A 1 540 ? -8.180  -42.320 40.428 1.00 42.47  ? 540  GLU A C     1 
ATOM   4437 O  O     . GLU A 1 540 ? -8.489  -41.212 40.000 1.00 43.87  ? 540  GLU A O     1 
ATOM   4438 C  CB    . GLU A 1 540 ? -8.702  -44.406 39.081 1.00 42.57  ? 540  GLU A CB    1 
ATOM   4439 C  CG    . GLU A 1 540 ? -8.459  -44.995 37.680 1.00 49.13  ? 540  GLU A CG    1 
ATOM   4440 C  CD    . GLU A 1 540 ? -9.094  -46.377 37.437 1.00 52.79  ? 540  GLU A CD    1 
ATOM   4441 O  OE1   . GLU A 1 540 ? -8.546  -47.135 36.608 1.00 52.46  ? 540  GLU A OE1   1 
ATOM   4442 O  OE2   . GLU A 1 540 ? -10.133 -46.708 38.051 1.00 55.49  ? 540  GLU A OE2   1 
ATOM   4443 N  N     . MET A 1 541 ? -8.250  -42.647 41.718 1.00 41.73  ? 541  MET A N     1 
ATOM   4444 C  CA    . MET A 1 541 ? -8.764  -41.724 42.732 1.00 40.86  ? 541  MET A CA    1 
ATOM   4445 C  C     . MET A 1 541 ? -7.863  -40.510 42.931 1.00 39.79  ? 541  MET A C     1 
ATOM   4446 O  O     . MET A 1 541 ? -8.359  -39.401 43.146 1.00 38.92  ? 541  MET A O     1 
ATOM   4447 C  CB    . MET A 1 541 ? -8.993  -42.436 44.067 1.00 40.89  ? 541  MET A CB    1 
ATOM   4448 C  CG    . MET A 1 541 ? -10.208 -43.360 44.090 1.00 40.36  ? 541  MET A CG    1 
ATOM   4449 S  SD    . MET A 1 541 ? -10.521 -44.074 45.720 1.00 45.18  ? 541  MET A SD    1 
ATOM   4450 C  CE    . MET A 1 541 ? -11.141 -42.668 46.647 1.00 42.59  ? 541  MET A CE    1 
ATOM   4451 N  N     . LEU A 1 542 ? -6.549  -40.717 42.858 1.00 37.73  ? 542  LEU A N     1 
ATOM   4452 C  CA    . LEU A 1 542 ? -5.597  -39.618 43.000 1.00 36.29  ? 542  LEU A CA    1 
ATOM   4453 C  C     . LEU A 1 542 ? -5.764  -38.614 41.863 1.00 36.24  ? 542  LEU A C     1 
ATOM   4454 O  O     . LEU A 1 542 ? -5.808  -37.404 42.093 1.00 36.19  ? 542  LEU A O     1 
ATOM   4455 C  CB    . LEU A 1 542 ? -4.152  -40.132 43.074 1.00 35.54  ? 542  LEU A CB    1 
ATOM   4456 C  CG    . LEU A 1 542 ? -3.049  -39.066 43.199 1.00 35.10  ? 542  LEU A CG    1 
ATOM   4457 C  CD1   . LEU A 1 542 ? -3.155  -38.254 44.504 1.00 31.79  ? 542  LEU A CD1   1 
ATOM   4458 C  CD2   . LEU A 1 542 ? -1.668  -39.683 43.062 1.00 31.12  ? 542  LEU A CD2   1 
ATOM   4459 N  N     . PHE A 1 543 ? -5.879  -39.130 40.642 1.00 36.77  ? 543  PHE A N     1 
ATOM   4460 C  CA    . PHE A 1 543 ? -6.112  -38.302 39.468 1.00 36.11  ? 543  PHE A CA    1 
ATOM   4461 C  C     . PHE A 1 543 ? -7.403  -37.481 39.585 1.00 35.83  ? 543  PHE A C     1 
ATOM   4462 O  O     . PHE A 1 543 ? -7.424  -36.308 39.222 1.00 35.58  ? 543  PHE A O     1 
ATOM   4463 C  CB    . PHE A 1 543 ? -6.127  -39.168 38.199 1.00 38.35  ? 543  PHE A CB    1 
ATOM   4464 C  CG    . PHE A 1 543 ? -6.527  -38.417 36.957 1.00 38.80  ? 543  PHE A CG    1 
ATOM   4465 C  CD1   . PHE A 1 543 ? -5.571  -37.752 36.193 1.00 38.73  ? 543  PHE A CD1   1 
ATOM   4466 C  CD2   . PHE A 1 543 ? -7.863  -38.370 36.556 1.00 36.97  ? 543  PHE A CD2   1 
ATOM   4467 C  CE1   . PHE A 1 543 ? -5.942  -37.046 35.051 1.00 41.98  ? 543  PHE A CE1   1 
ATOM   4468 C  CE2   . PHE A 1 543 ? -8.244  -37.673 35.417 1.00 39.25  ? 543  PHE A CE2   1 
ATOM   4469 C  CZ    . PHE A 1 543 ? -7.281  -37.007 34.662 1.00 40.84  ? 543  PHE A CZ    1 
ATOM   4470 N  N     . ARG A 1 544 ? -8.475  -38.093 40.087 1.00 36.21  ? 544  ARG A N     1 
ATOM   4471 C  CA    . ARG A 1 544 ? -9.743  -37.380 40.264 1.00 36.83  ? 544  ARG A CA    1 
ATOM   4472 C  C     . ARG A 1 544 ? -9.638  -36.309 41.347 1.00 36.04  ? 544  ARG A C     1 
ATOM   4473 O  O     . ARG A 1 544 ? -10.206 -35.224 41.216 1.00 37.12  ? 544  ARG A O     1 
ATOM   4474 C  CB    . ARG A 1 544 ? -10.877 -38.351 40.593 1.00 39.42  ? 544  ARG A CB    1 
ATOM   4475 C  CG    . ARG A 1 544 ? -11.367 -39.181 39.409 1.00 41.41  ? 544  ARG A CG    1 
ATOM   4476 C  CD    . ARG A 1 544 ? -12.334 -40.250 39.870 1.00 42.54  ? 544  ARG A CD    1 
ATOM   4477 N  NE    . ARG A 1 544 ? -12.567 -41.245 38.828 1.00 46.08  ? 544  ARG A NE    1 
ATOM   4478 C  CZ    . ARG A 1 544 ? -13.526 -42.166 38.861 1.00 42.54  ? 544  ARG A CZ    1 
ATOM   4479 N  NH1   . ARG A 1 544 ? -14.371 -42.234 39.884 1.00 39.88  ? 544  ARG A NH1   1 
ATOM   4480 N  NH2   . ARG A 1 544 ? -13.646 -43.014 37.855 1.00 42.74  ? 544  ARG A NH2   1 
ATOM   4481 N  N     . ALA A 1 545 ? -8.909  -36.631 42.413 1.00 33.98  ? 545  ALA A N     1 
ATOM   4482 C  CA    . ALA A 1 545 ? -8.660  -35.705 43.508 1.00 34.07  ? 545  ALA A CA    1 
ATOM   4483 C  C     . ALA A 1 545 ? -7.903  -34.464 43.031 1.00 32.59  ? 545  ALA A C     1 
ATOM   4484 O  O     . ALA A 1 545 ? -8.303  -33.335 43.321 1.00 31.03  ? 545  ALA A O     1 
ATOM   4485 C  CB    . ALA A 1 545 ? -7.879  -36.403 44.614 1.00 34.45  ? 545  ALA A CB    1 
ATOM   4486 N  N     . GLN A 1 546 ? -6.806  -34.704 42.313 1.00 31.95  ? 546  GLN A N     1 
ATOM   4487 C  CA    . GLN A 1 546 ? -5.971  -33.659 41.732 1.00 30.65  ? 546  GLN A CA    1 
ATOM   4488 C  C     . GLN A 1 546 ? -6.735  -32.772 40.755 1.00 29.00  ? 546  GLN A C     1 
ATOM   4489 O  O     . GLN A 1 546 ? -6.488  -31.576 40.687 1.00 28.04  ? 546  GLN A O     1 
ATOM   4490 C  CB    . GLN A 1 546 ? -4.750  -34.270 41.045 1.00 29.24  ? 546  GLN A CB    1 
ATOM   4491 C  CG    . GLN A 1 546 ? -3.795  -34.925 42.027 1.00 34.97  ? 546  GLN A CG    1 
ATOM   4492 C  CD    . GLN A 1 546 ? -2.616  -35.609 41.363 1.00 37.99  ? 546  GLN A CD    1 
ATOM   4493 O  OE1   . GLN A 1 546 ? -1.501  -35.538 41.867 1.00 41.47  ? 546  GLN A OE1   1 
ATOM   4494 N  NE2   . GLN A 1 546 ? -2.855  -36.281 40.239 1.00 36.01  ? 546  GLN A NE2   1 
ATOM   4495 N  N     . ARG A 1 547 ? -7.669  -33.364 40.021 1.00 30.07  ? 547  ARG A N     1 
ATOM   4496 C  CA    . ARG A 1 547 ? -8.533  -32.610 39.131 1.00 29.97  ? 547  ARG A CA    1 
ATOM   4497 C  C     . ARG A 1 547 ? -9.500  -31.740 39.911 1.00 30.68  ? 547  ARG A C     1 
ATOM   4498 O  O     . ARG A 1 547 ? -9.810  -30.617 39.501 1.00 31.04  ? 547  ARG A O     1 
ATOM   4499 C  CB    . ARG A 1 547 ? -9.298  -33.545 38.196 1.00 31.84  ? 547  ARG A CB    1 
ATOM   4500 C  CG    . ARG A 1 547 ? -8.493  -34.004 36.974 1.00 34.81  ? 547  ARG A CG    1 
ATOM   4501 C  CD    . ARG A 1 547 ? -7.984  -32.816 36.167 1.00 33.72  ? 547  ARG A CD    1 
ATOM   4502 N  NE    . ARG A 1 547 ? -7.190  -33.231 35.015 1.00 37.87  ? 547  ARG A NE    1 
ATOM   4503 C  CZ    . ARG A 1 547 ? -7.681  -33.397 33.789 1.00 38.39  ? 547  ARG A CZ    1 
ATOM   4504 N  NH1   . ARG A 1 547 ? -8.976  -33.189 33.547 1.00 38.76  ? 547  ARG A NH1   1 
ATOM   4505 N  NH2   . ARG A 1 547 ? -6.875  -33.772 32.802 1.00 37.45  ? 547  ARG A NH2   1 
ATOM   4506 N  N     . THR A 1 548 ? -9.975  -32.259 41.037 1.00 31.70  ? 548  THR A N     1 
ATOM   4507 C  CA    . THR A 1 548 ? -10.854 -31.502 41.912 1.00 32.52  ? 548  THR A CA    1 
ATOM   4508 C  C     . THR A 1 548 ? -10.072 -30.327 42.500 1.00 32.17  ? 548  THR A C     1 
ATOM   4509 O  O     . THR A 1 548 ? -10.575 -29.204 42.561 1.00 32.78  ? 548  THR A O     1 
ATOM   4510 C  CB    . THR A 1 548 ? -11.428 -32.397 43.016 1.00 33.70  ? 548  THR A CB    1 
ATOM   4511 O  OG1   . THR A 1 548 ? -12.103 -33.510 42.413 1.00 36.00  ? 548  THR A OG1   1 
ATOM   4512 C  CG2   . THR A 1 548 ? -12.407 -31.621 43.882 1.00 33.77  ? 548  THR A CG2   1 
ATOM   4513 N  N     . GLU A 1 549 ? -8.827  -30.586 42.892 1.00 30.83  ? 549  GLU A N     1 
ATOM   4514 C  CA    . GLU A 1 549 ? -7.950  -29.543 43.414 1.00 29.39  ? 549  GLU A CA    1 
ATOM   4515 C  C     . GLU A 1 549 ? -7.643  -28.466 42.364 1.00 28.64  ? 549  GLU A C     1 
ATOM   4516 O  O     . GLU A 1 549 ? -7.667  -27.280 42.681 1.00 29.68  ? 549  GLU A O     1 
ATOM   4517 C  CB    . GLU A 1 549 ? -6.663  -30.154 43.970 1.00 30.49  ? 549  GLU A CB    1 
ATOM   4518 C  CG    . GLU A 1 549 ? -5.728  -29.145 44.632 1.00 34.34  ? 549  GLU A CG    1 
ATOM   4519 C  CD    . GLU A 1 549 ? -4.409  -29.755 45.092 1.00 38.74  ? 549  GLU A CD    1 
ATOM   4520 O  OE1   . GLU A 1 549 ? -4.301  -31.004 45.173 1.00 40.09  ? 549  GLU A OE1   1 
ATOM   4521 O  OE2   . GLU A 1 549 ? -3.474  -28.979 45.379 1.00 38.93  ? 549  GLU A OE2   1 
ATOM   4522 N  N     . VAL A 1 550 ? -7.368  -28.864 41.121 1.00 25.80  ? 550  VAL A N     1 
ATOM   4523 C  CA    . VAL A 1 550 ? -7.156  -27.874 40.058 1.00 26.23  ? 550  VAL A CA    1 
ATOM   4524 C  C     . VAL A 1 550 ? -8.402  -27.013 39.825 1.00 27.81  ? 550  VAL A C     1 
ATOM   4525 O  O     . VAL A 1 550 ? -8.309  -25.787 39.730 1.00 27.43  ? 550  VAL A O     1 
ATOM   4526 C  CB    . VAL A 1 550 ? -6.677  -28.496 38.727 1.00 25.28  ? 550  VAL A CB    1 
ATOM   4527 C  CG1   . VAL A 1 550 ? -6.679  -27.437 37.611 1.00 20.55  ? 550  VAL A CG1   1 
ATOM   4528 C  CG2   . VAL A 1 550 ? -5.273  -29.119 38.885 1.00 21.47  ? 550  VAL A CG2   1 
ATOM   4529 N  N     . ALA A 1 551 ? -9.564  -27.655 39.736 1.00 29.07  ? 551  ALA A N     1 
ATOM   4530 C  CA    . ALA A 1 551 ? -10.815 -26.932 39.580 1.00 29.58  ? 551  ALA A CA    1 
ATOM   4531 C  C     . ALA A 1 551 ? -10.991 -25.886 40.695 1.00 31.21  ? 551  ALA A C     1 
ATOM   4532 O  O     . ALA A 1 551 ? -11.250 -24.719 40.410 1.00 32.78  ? 551  ALA A O     1 
ATOM   4533 C  CB    . ALA A 1 551 ? -11.986 -27.897 39.542 1.00 31.08  ? 551  ALA A CB    1 
ATOM   4534 N  N     . GLY A 1 552 ? -10.817 -26.303 41.950 1.00 31.12  ? 552  GLY A N     1 
ATOM   4535 C  CA    . GLY A 1 552 ? -10.862 -25.395 43.105 1.00 29.19  ? 552  GLY A CA    1 
ATOM   4536 C  C     . GLY A 1 552 ? -9.853  -24.255 43.011 1.00 29.32  ? 552  GLY A C     1 
ATOM   4537 O  O     . GLY A 1 552 ? -10.184 -23.102 43.302 1.00 27.20  ? 552  GLY A O     1 
ATOM   4538 N  N     . MET A 1 553 ? -8.632  -24.583 42.581 1.00 28.75  ? 553  MET A N     1 
ATOM   4539 C  CA    . MET A 1 553 ? -7.560  -23.609 42.361 1.00 29.24  ? 553  MET A CA    1 
ATOM   4540 C  C     . MET A 1 553 ? -7.992  -22.471 41.425 1.00 31.31  ? 553  MET A C     1 
ATOM   4541 O  O     . MET A 1 553 ? -7.866  -21.285 41.774 1.00 30.80  ? 553  MET A O     1 
ATOM   4542 C  CB    . MET A 1 553 ? -6.296  -24.316 41.826 1.00 28.48  ? 553  MET A CB    1 
ATOM   4543 C  CG    . MET A 1 553 ? -5.135  -23.388 41.482 1.00 30.09  ? 553  MET A CG    1 
ATOM   4544 S  SD    . MET A 1 553 ? -4.535  -22.379 42.864 1.00 43.23  ? 553  MET A SD    1 
ATOM   4545 C  CE    . MET A 1 553 ? -3.220  -23.407 43.515 1.00 42.08  ? 553  MET A CE    1 
ATOM   4546 N  N     . THR A 1 554 ? -8.497  -22.844 40.246 1.00 30.32  ? 554  THR A N     1 
ATOM   4547 C  CA    . THR A 1 554 ? -9.015  -21.897 39.263 1.00 29.64  ? 554  THR A CA    1 
ATOM   4548 C  C     . THR A 1 554 ? -10.116 -21.011 39.832 1.00 30.07  ? 554  THR A C     1 
ATOM   4549 O  O     . THR A 1 554 ? -10.093 -19.794 39.653 1.00 33.88  ? 554  THR A O     1 
ATOM   4550 C  CB    . THR A 1 554 ? -9.577  -22.632 38.039 1.00 28.59  ? 554  THR A CB    1 
ATOM   4551 O  OG1   . THR A 1 554 ? -8.513  -23.289 37.356 1.00 30.35  ? 554  THR A OG1   1 
ATOM   4552 C  CG2   . THR A 1 554 ? -10.257 -21.670 37.091 1.00 29.82  ? 554  THR A CG2   1 
ATOM   4553 N  N     . ALA A 1 555 ? -11.086 -21.624 40.500 1.00 29.85  ? 555  ALA A N     1 
ATOM   4554 C  CA    . ALA A 1 555 ? -12.194 -20.879 41.107 1.00 28.95  ? 555  ALA A CA    1 
ATOM   4555 C  C     . ALA A 1 555 ? -11.724 -19.896 42.185 1.00 26.89  ? 555  ALA A C     1 
ATOM   4556 O  O     . ALA A 1 555 ? -12.186 -18.759 42.253 1.00 27.11  ? 555  ALA A O     1 
ATOM   4557 C  CB    . ALA A 1 555 ? -13.240 -21.849 41.677 1.00 24.43  ? 555  ALA A CB    1 
ATOM   4558 N  N     . GLN A 1 556 ? -10.788 -20.326 43.019 1.00 27.72  ? 556  GLN A N     1 
ATOM   4559 C  CA    . GLN A 1 556 ? -10.384 -19.500 44.146 1.00 27.43  ? 556  GLN A CA    1 
ATOM   4560 C  C     . GLN A 1 556 ? -9.300  -18.483 43.799 1.00 27.91  ? 556  GLN A C     1 
ATOM   4561 O  O     . GLN A 1 556 ? -9.372  -17.327 44.233 1.00 28.42  ? 556  GLN A O     1 
ATOM   4562 C  CB    . GLN A 1 556 ? -9.982  -20.363 45.348 1.00 25.89  ? 556  GLN A CB    1 
ATOM   4563 C  CG    . GLN A 1 556 ? -8.617  -21.040 45.244 1.00 27.98  ? 556  GLN A CG    1 
ATOM   4564 C  CD    . GLN A 1 556 ? -7.484  -20.149 45.719 1.00 26.28  ? 556  GLN A CD    1 
ATOM   4565 O  OE1   . GLN A 1 556 ? -7.708  -19.181 46.432 1.00 28.55  ? 556  GLN A OE1   1 
ATOM   4566 N  NE2   . GLN A 1 556 ? -6.264  -20.464 45.304 1.00 26.45  ? 556  GLN A NE2   1 
ATOM   4567 N  N     . ILE A 1 557 ? -8.299  -18.892 43.026 1.00 25.20  ? 557  ILE A N     1 
ATOM   4568 C  CA    . ILE A 1 557 ? -7.193  -17.987 42.780 1.00 25.40  ? 557  ILE A CA    1 
ATOM   4569 C  C     . ILE A 1 557 ? -7.667  -16.819 41.938 1.00 25.39  ? 557  ILE A C     1 
ATOM   4570 O  O     . ILE A 1 557 ? -7.158  -15.707 42.076 1.00 25.45  ? 557  ILE A O     1 
ATOM   4571 C  CB    . ILE A 1 557 ? -5.957  -18.668 42.137 1.00 27.81  ? 557  ILE A CB    1 
ATOM   4572 C  CG1   . ILE A 1 557 ? -4.689  -17.882 42.541 1.00 28.76  ? 557  ILE A CG1   1 
ATOM   4573 C  CG2   . ILE A 1 557 ? -6.138  -18.837 40.597 1.00 24.40  ? 557  ILE A CG2   1 
ATOM   4574 C  CD1   . ILE A 1 557 ? -3.381  -18.416 42.027 1.00 34.77  ? 557  ILE A CD1   1 
ATOM   4575 N  N     . ASN A 1 558 ? -8.669  -17.055 41.093 1.00 23.23  ? 558  ASN A N     1 
ATOM   4576 C  CA    . ASN A 1 558 ? -9.108  -15.989 40.197 1.00 25.98  ? 558  ASN A CA    1 
ATOM   4577 C  C     . ASN A 1 558 ? -10.107 -15.045 40.815 1.00 26.10  ? 558  ASN A C     1 
ATOM   4578 O  O     . ASN A 1 558 ? -10.220 -13.899 40.381 1.00 29.47  ? 558  ASN A O     1 
ATOM   4579 C  CB    . ASN A 1 558 ? -9.592  -16.544 38.882 1.00 24.21  ? 558  ASN A CB    1 
ATOM   4580 C  CG    . ASN A 1 558 ? -8.453  -17.006 38.036 1.00 27.49  ? 558  ASN A CG    1 
ATOM   4581 O  OD1   . ASN A 1 558 ? -7.673  -16.187 37.557 1.00 30.34  ? 558  ASN A OD1   1 
ATOM   4582 N  ND2   . ASN A 1 558 ? -8.310  -18.327 37.880 1.00 26.65  ? 558  ASN A ND2   1 
ATOM   4583 N  N     . ARG A 1 559 ? -10.807 -15.522 41.837 1.00 24.60  ? 559  ARG A N     1 
ATOM   4584 C  CA    . ARG A 1 559 ? -11.612 -14.646 42.665 1.00 28.30  ? 559  ARG A CA    1 
ATOM   4585 C  C     . ARG A 1 559 ? -10.667 -13.797 43.517 1.00 28.86  ? 559  ARG A C     1 
ATOM   4586 O  O     . ARG A 1 559 ? -10.836 -12.579 43.612 1.00 31.22  ? 559  ARG A O     1 
ATOM   4587 C  CB    . ARG A 1 559 ? -12.624 -15.444 43.503 1.00 27.16  ? 559  ARG A CB    1 
ATOM   4588 C  CG    . ARG A 1 559 ? -13.890 -15.794 42.695 1.00 30.85  ? 559  ARG A CG    1 
ATOM   4589 C  CD    . ARG A 1 559 ? -14.748 -16.896 43.326 1.00 25.66  ? 559  ARG A CD    1 
ATOM   4590 N  NE    . ARG A 1 559 ? -15.882 -17.238 42.470 1.00 33.26  ? 559  ARG A NE    1 
ATOM   4591 C  CZ    . ARG A 1 559 ? -15.829 -18.068 41.422 1.00 35.34  ? 559  ARG A CZ    1 
ATOM   4592 N  NH1   . ARG A 1 559 ? -14.685 -18.654 41.075 1.00 32.10  ? 559  ARG A NH1   1 
ATOM   4593 N  NH2   . ARG A 1 559 ? -16.924 -18.305 40.705 1.00 32.92  ? 559  ARG A NH2   1 
ATOM   4594 N  N     . LYS A 1 560 ? -9.649  -14.432 44.095 1.00 29.36  ? 560  LYS A N     1 
ATOM   4595 C  CA    . LYS A 1 560 ? -8.573  -13.692 44.758 1.00 29.86  ? 560  LYS A CA    1 
ATOM   4596 C  C     . LYS A 1 560 ? -8.015  -12.587 43.842 1.00 29.93  ? 560  LYS A C     1 
ATOM   4597 O  O     . LYS A 1 560 ? -7.880  -11.428 44.269 1.00 30.88  ? 560  LYS A O     1 
ATOM   4598 C  CB    . LYS A 1 560 ? -7.452  -14.621 45.217 1.00 26.94  ? 560  LYS A CB    1 
ATOM   4599 C  CG    . LYS A 1 560 ? -6.201  -13.868 45.664 1.00 28.65  ? 560  LYS A CG    1 
ATOM   4600 C  CD    . LYS A 1 560 ? -5.021  -14.803 45.844 1.00 30.01  ? 560  LYS A CD    1 
ATOM   4601 C  CE    . LYS A 1 560 ? -3.736  -14.020 46.050 1.00 31.45  ? 560  LYS A CE    1 
ATOM   4602 N  NZ    . LYS A 1 560 ? -2.668  -14.869 46.643 1.00 32.02  ? 560  LYS A NZ    1 
ATOM   4603 N  N     . LEU A 1 561 ? -7.727  -12.933 42.585 1.00 27.60  ? 561  LEU A N     1 
ATOM   4604 C  CA    . LEU A 1 561 ? -7.229  -11.937 41.618 1.00 26.15  ? 561  LEU A CA    1 
ATOM   4605 C  C     . LEU A 1 561 ? -8.214  -10.767 41.442 1.00 26.82  ? 561  LEU A C     1 
ATOM   4606 O  O     . LEU A 1 561 ? -7.806  -9.597  41.421 1.00 28.24  ? 561  LEU A O     1 
ATOM   4607 C  CB    . LEU A 1 561 ? -6.907  -12.585 40.256 1.00 24.38  ? 561  LEU A CB    1 
ATOM   4608 C  CG    . LEU A 1 561 ? -6.502  -11.635 39.106 1.00 29.60  ? 561  LEU A CG    1 
ATOM   4609 C  CD1   . LEU A 1 561 ? -5.181  -10.905 39.406 1.00 29.14  ? 561  LEU A CD1   1 
ATOM   4610 C  CD2   . LEU A 1 561 ? -6.427  -12.333 37.746 1.00 22.46  ? 561  LEU A CD2   1 
ATOM   4611 N  N     . LEU A 1 562 ? -9.507  -11.079 41.338 1.00 25.38  ? 562  LEU A N     1 
ATOM   4612 C  CA    . LEU A 1 562 ? -10.508 -10.031 41.132 1.00 24.24  ? 562  LEU A CA    1 
ATOM   4613 C  C     . LEU A 1 562 ? -10.572 -9.024  42.294 1.00 22.53  ? 562  LEU A C     1 
ATOM   4614 O  O     . LEU A 1 562 ? -10.522 -7.824  42.066 1.00 24.30  ? 562  LEU A O     1 
ATOM   4615 C  CB    . LEU A 1 562 ? -11.884 -10.616 40.816 1.00 23.41  ? 562  LEU A CB    1 
ATOM   4616 C  CG    . LEU A 1 562 ? -12.942 -9.588  40.393 1.00 30.83  ? 562  LEU A CG    1 
ATOM   4617 C  CD1   . LEU A 1 562 ? -12.568 -8.934  39.052 1.00 29.00  ? 562  LEU A CD1   1 
ATOM   4618 C  CD2   . LEU A 1 562 ? -14.336 -10.203 40.323 1.00 30.09  ? 562  LEU A CD2   1 
ATOM   4619 N  N     . ILE A 1 563 ? -10.657 -9.505  43.530 1.00 21.57  ? 563  ILE A N     1 
ATOM   4620 C  CA    . ILE A 1 563 ? -10.688 -8.592  44.678 1.00 21.69  ? 563  ILE A CA    1 
ATOM   4621 C  C     . ILE A 1 563 ? -9.361  -7.837  44.906 1.00 24.93  ? 563  ILE A C     1 
ATOM   4622 O  O     . ILE A 1 563 ? -9.381  -6.664  45.244 1.00 27.74  ? 563  ILE A O     1 
ATOM   4623 C  CB    . ILE A 1 563 ? -11.206 -9.270  45.985 1.00 21.64  ? 563  ILE A CB    1 
ATOM   4624 C  CG1   . ILE A 1 563 ? -10.351 -10.475 46.398 1.00 19.84  ? 563  ILE A CG1   1 
ATOM   4625 C  CG2   . ILE A 1 563 ? -12.662 -9.691  45.808 1.00 19.09  ? 563  ILE A CG2   1 
ATOM   4626 C  CD1   . ILE A 1 563 ? -10.847 -11.195 47.695 1.00 21.21  ? 563  ILE A CD1   1 
ATOM   4627 N  N     . ASN A 1 564 ? -8.218  -8.494  44.702 1.00 25.20  ? 564  ASN A N     1 
ATOM   4628 C  CA    . ASN A 1 564 ? -6.934  -7.802  44.757 1.00 24.01  ? 564  ASN A CA    1 
ATOM   4629 C  C     . ASN A 1 564 ? -6.849  -6.708  43.683 1.00 26.35  ? 564  ASN A C     1 
ATOM   4630 O  O     . ASN A 1 564 ? -6.296  -5.633  43.927 1.00 29.05  ? 564  ASN A O     1 
ATOM   4631 C  CB    . ASN A 1 564 ? -5.780  -8.793  44.606 1.00 21.99  ? 564  ASN A CB    1 
ATOM   4632 C  CG    . ASN A 1 564 ? -5.561  -9.631  45.844 1.00 22.51  ? 564  ASN A CG    1 
ATOM   4633 O  OD1   . ASN A 1 564 ? -4.768  -10.571 45.834 1.00 29.62  ? 564  ASN A OD1   1 
ATOM   4634 N  ND2   . ASN A 1 564 ? -6.257  -9.303  46.917 1.00 17.85  ? 564  ASN A ND2   1 
ATOM   4635 N  N     . SER A 1 565 ? -7.422  -6.982  42.508 1.00 26.18  ? 565  SER A N     1 
ATOM   4636 C  CA    . SER A 1 565 ? -7.483  -6.009  41.413 1.00 24.37  ? 565  SER A CA    1 
ATOM   4637 C  C     . SER A 1 565 ? -8.357  -4.784  41.727 1.00 26.77  ? 565  SER A C     1 
ATOM   4638 O  O     . SER A 1 565 ? -8.168  -3.707  41.141 1.00 26.05  ? 565  SER A O     1 
ATOM   4639 C  CB    . SER A 1 565 ? -7.971  -6.686  40.134 1.00 26.12  ? 565  SER A CB    1 
ATOM   4640 O  OG    . SER A 1 565 ? -7.040  -7.662  39.688 1.00 23.75  ? 565  SER A OG    1 
ATOM   4641 N  N     . LEU A 1 566 ? -9.306  -4.939  42.647 1.00 25.99  ? 566  LEU A N     1 
ATOM   4642 C  CA    . LEU A 1 566 ? -10.117 -3.809  43.079 1.00 28.28  ? 566  LEU A CA    1 
ATOM   4643 C  C     . LEU A 1 566 ? -9.247  -2.822  43.853 1.00 27.63  ? 566  LEU A C     1 
ATOM   4644 O  O     . LEU A 1 566 ? -9.279  -1.624  43.590 1.00 28.86  ? 566  LEU A O     1 
ATOM   4645 C  CB    . LEU A 1 566 ? -11.343 -4.256  43.900 1.00 28.63  ? 566  LEU A CB    1 
ATOM   4646 C  CG    . LEU A 1 566 ? -12.286 -3.162  44.433 1.00 29.64  ? 566  LEU A CG    1 
ATOM   4647 C  CD1   . LEU A 1 566 ? -12.626 -2.136  43.361 1.00 29.66  ? 566  LEU A CD1   1 
ATOM   4648 C  CD2   . LEU A 1 566 ? -13.572 -3.771  45.004 1.00 31.71  ? 566  LEU A CD2   1 
ATOM   4649 N  N     . ALA A 1 567 ? -8.455  -3.334  44.787 1.00 29.56  ? 567  ALA A N     1 
ATOM   4650 C  CA    . ALA A 1 567 ? -7.510  -2.494  45.528 1.00 28.53  ? 567  ALA A CA    1 
ATOM   4651 C  C     . ALA A 1 567 ? -6.493  -1.794  44.617 1.00 26.94  ? 567  ALA A C     1 
ATOM   4652 O  O     . ALA A 1 567 ? -6.159  -0.643  44.852 1.00 28.29  ? 567  ALA A O     1 
ATOM   4653 C  CB    . ALA A 1 567 ? -6.806  -3.307  46.601 1.00 28.61  ? 567  ALA A CB    1 
ATOM   4654 N  N     . GLY A 1 568 ? -6.001  -2.479  43.582 1.00 26.74  ? 568  GLY A N     1 
ATOM   4655 C  CA    . GLY A 1 568 ? -5.082  -1.844  42.627 1.00 24.66  ? 568  GLY A CA    1 
ATOM   4656 C  C     . GLY A 1 568 ? -5.757  -0.837  41.691 1.00 26.79  ? 568  GLY A C     1 
ATOM   4657 O  O     . GLY A 1 568 ? -5.158  0.179   41.322 1.00 25.26  ? 568  GLY A O     1 
ATOM   4658 N  N     . ALA A 1 569 ? -7.008  -1.117  41.314 1.00 25.42  ? 569  ALA A N     1 
ATOM   4659 C  CA    . ALA A 1 569 ? -7.779  -0.262  40.397 1.00 25.06  ? 569  ALA A CA    1 
ATOM   4660 C  C     . ALA A 1 569 ? -7.972  1.136   40.959 1.00 27.66  ? 569  ALA A C     1 
ATOM   4661 O  O     . ALA A 1 569 ? -7.982  2.124   40.211 1.00 29.31  ? 569  ALA A O     1 
ATOM   4662 C  CB    . ALA A 1 569 ? -9.128  -0.898  40.066 1.00 22.83  ? 569  ALA A CB    1 
ATOM   4663 N  N     . LEU A 1 570 ? -8.103  1.213   42.281 1.00 28.05  ? 570  LEU A N     1 
ATOM   4664 C  CA    . LEU A 1 570 ? -8.155  2.477   42.990 1.00 28.18  ? 570  LEU A CA    1 
ATOM   4665 C  C     . LEU A 1 570 ? -6.915  3.320   42.728 1.00 28.89  ? 570  LEU A C     1 
ATOM   4666 O  O     . LEU A 1 570 ? -6.887  4.505   43.056 1.00 28.89  ? 570  LEU A O     1 
ATOM   4667 C  CB    . LEU A 1 570 ? -8.291  2.217   44.489 1.00 29.88  ? 570  LEU A CB    1 
ATOM   4668 C  CG    . LEU A 1 570 ? -9.609  1.601   44.950 1.00 29.67  ? 570  LEU A CG    1 
ATOM   4669 C  CD1   . LEU A 1 570 ? -9.491  1.129   46.389 1.00 26.49  ? 570  LEU A CD1   1 
ATOM   4670 C  CD2   . LEU A 1 570 ? -10.734 2.616   44.788 1.00 25.73  ? 570  LEU A CD2   1 
ATOM   4671 N  N     . GLY A 1 571 ? -5.887  2.693   42.153 1.00 29.62  ? 571  GLY A N     1 
ATOM   4672 C  CA    . GLY A 1 571 ? -4.640  3.372   41.813 1.00 28.63  ? 571  GLY A CA    1 
ATOM   4673 C  C     . GLY A 1 571 ? -4.416  3.453   40.310 1.00 29.67  ? 571  GLY A C     1 
ATOM   4674 O  O     . GLY A 1 571 ? -3.299  3.730   39.859 1.00 28.89  ? 571  GLY A O     1 
ATOM   4675 N  N     . ASN A 1 572 ? -5.474  3.209   39.535 1.00 27.39  ? 572  ASN A N     1 
ATOM   4676 C  CA    . ASN A 1 572 ? -5.413  3.327   38.077 1.00 27.45  ? 572  ASN A CA    1 
ATOM   4677 C  C     . ASN A 1 572 ? -6.328  4.456   37.599 1.00 27.06  ? 572  ASN A C     1 
ATOM   4678 O  O     . ASN A 1 572 ? -7.522  4.503   37.921 1.00 27.02  ? 572  ASN A O     1 
ATOM   4679 C  CB    . ASN A 1 572 ? -5.718  1.985   37.383 1.00 26.12  ? 572  ASN A CB    1 
ATOM   4680 C  CG    . ASN A 1 572 ? -5.799  2.103   35.855 1.00 31.01  ? 572  ASN A CG    1 
ATOM   4681 O  OD1   . ASN A 1 572 ? -6.734  2.702   35.305 1.00 32.93  ? 572  ASN A OD1   1 
ATOM   4682 N  ND2   . ASN A 1 572 ? -4.829  1.513   35.167 1.00 30.77  ? 572  ASN A ND2   1 
ATOM   4683 N  N     . VAL A 1 573 ? -5.747  5.356   36.814 1.00 28.32  ? 573  VAL A N     1 
ATOM   4684 C  CA    . VAL A 1 573 ? -6.397  6.603   36.405 1.00 27.41  ? 573  VAL A CA    1 
ATOM   4685 C  C     . VAL A 1 573 ? -7.660  6.431   35.547 1.00 29.36  ? 573  VAL A C     1 
ATOM   4686 O  O     . VAL A 1 573 ? -8.424  7.376   35.397 1.00 32.83  ? 573  VAL A O     1 
ATOM   4687 C  CB    . VAL A 1 573 ? -5.389  7.566   35.717 1.00 28.61  ? 573  VAL A CB    1 
ATOM   4688 C  CG1   . VAL A 1 573 ? -4.273  7.972   36.705 1.00 23.56  ? 573  VAL A CG1   1 
ATOM   4689 C  CG2   . VAL A 1 573 ? -4.816  6.952   34.424 1.00 27.18  ? 573  VAL A CG2   1 
ATOM   4690 N  N     . TRP A 1 574 ? -7.883  5.232   35.014 1.00 27.44  ? 574  TRP A N     1 
ATOM   4691 C  CA    . TRP A 1 574 ? -9.065  4.959   34.208 1.00 30.47  ? 574  TRP A CA    1 
ATOM   4692 C  C     . TRP A 1 574 ? -10.225 4.380   35.014 1.00 31.96  ? 574  TRP A C     1 
ATOM   4693 O  O     . TRP A 1 574 ? -11.330 4.219   34.487 1.00 33.22  ? 574  TRP A O     1 
ATOM   4694 C  CB    . TRP A 1 574 ? -8.711  4.041   33.037 1.00 30.07  ? 574  TRP A CB    1 
ATOM   4695 C  CG    . TRP A 1 574 ? -7.672  4.650   32.171 1.00 32.68  ? 574  TRP A CG    1 
ATOM   4696 C  CD1   . TRP A 1 574 ? -6.347  4.332   32.135 1.00 30.61  ? 574  TRP A CD1   1 
ATOM   4697 C  CD2   . TRP A 1 574 ? -7.857  5.719   31.237 1.00 37.82  ? 574  TRP A CD2   1 
ATOM   4698 N  NE1   . TRP A 1 574 ? -5.699  5.125   31.225 1.00 36.21  ? 574  TRP A NE1   1 
ATOM   4699 C  CE2   . TRP A 1 574 ? -6.599  5.990   30.662 1.00 36.88  ? 574  TRP A CE2   1 
ATOM   4700 C  CE3   . TRP A 1 574 ? -8.968  6.477   30.830 1.00 44.33  ? 574  TRP A CE3   1 
ATOM   4701 C  CZ2   . TRP A 1 574 ? -6.413  6.985   29.692 1.00 41.32  ? 574  TRP A CZ2   1 
ATOM   4702 C  CZ3   . TRP A 1 574 ? -8.787  7.465   29.862 1.00 44.65  ? 574  TRP A CZ3   1 
ATOM   4703 C  CH2   . TRP A 1 574 ? -7.516  7.706   29.303 1.00 43.67  ? 574  TRP A CH2   1 
ATOM   4704 N  N     . PHE A 1 575 ? -9.971  4.069   36.286 1.00 30.82  ? 575  PHE A N     1 
ATOM   4705 C  CA    . PHE A 1 575 ? -11.001 3.566   37.183 1.00 27.75  ? 575  PHE A CA    1 
ATOM   4706 C  C     . PHE A 1 575 ? -11.843 4.741   37.648 1.00 27.95  ? 575  PHE A C     1 
ATOM   4707 O  O     . PHE A 1 575 ? -11.309 5.741   38.139 1.00 26.79  ? 575  PHE A O     1 
ATOM   4708 C  CB    . PHE A 1 575 ? -10.366 2.848   38.383 1.00 27.39  ? 575  PHE A CB    1 
ATOM   4709 C  CG    . PHE A 1 575 ? -11.338 2.051   39.228 1.00 26.21  ? 575  PHE A CG    1 
ATOM   4710 C  CD1   . PHE A 1 575 ? -12.337 1.266   38.642 1.00 28.48  ? 575  PHE A CD1   1 
ATOM   4711 C  CD2   . PHE A 1 575 ? -11.226 2.051   40.616 1.00 26.00  ? 575  PHE A CD2   1 
ATOM   4712 C  CE1   . PHE A 1 575 ? -13.233 0.512   39.436 1.00 24.27  ? 575  PHE A CE1   1 
ATOM   4713 C  CE2   . PHE A 1 575 ? -12.109 1.294   41.418 1.00 25.68  ? 575  PHE A CE2   1 
ATOM   4714 C  CZ    . PHE A 1 575 ? -13.111 0.524   40.822 1.00 20.44  ? 575  PHE A CZ    1 
ATOM   4715 N  N     . ARG A 1 576 ? -13.159 4.608   37.488 1.00 25.43  ? 576  ARG A N     1 
ATOM   4716 C  CA    . ARG A 1 576 ? -14.119 5.641   37.871 1.00 26.58  ? 576  ARG A CA    1 
ATOM   4717 C  C     . ARG A 1 576 ? -13.875 6.100   39.310 1.00 26.94  ? 576  ARG A C     1 
ATOM   4718 O  O     . ARG A 1 576 ? -13.974 7.283   39.610 1.00 29.32  ? 576  ARG A O     1 
ATOM   4719 C  CB    . ARG A 1 576 ? -15.564 5.124   37.684 1.00 25.75  ? 576  ARG A CB    1 
ATOM   4720 C  CG    . ARG A 1 576 ? -16.698 6.153   37.872 1.00 24.86  ? 576  ARG A CG    1 
ATOM   4721 C  CD    . ARG A 1 576 ? -18.098 5.492   37.732 1.00 21.29  ? 576  ARG A CD    1 
ATOM   4722 N  NE    . ARG A 1 576 ? -18.165 4.707   36.504 1.00 23.41  ? 576  ARG A NE    1 
ATOM   4723 C  CZ    . ARG A 1 576 ? -18.403 5.229   35.301 1.00 26.97  ? 576  ARG A CZ    1 
ATOM   4724 N  NH1   . ARG A 1 576 ? -18.641 6.528   35.175 1.00 23.65  ? 576  ARG A NH1   1 
ATOM   4725 N  NH2   . ARG A 1 576 ? -18.416 4.456   34.222 1.00 23.52  ? 576  ARG A NH2   1 
ATOM   4726 N  N     . TYR A 1 577 ? -13.515 5.170   40.185 1.00 26.29  ? 577  TYR A N     1 
ATOM   4727 C  CA    . TYR A 1 577 ? -13.339 5.488   41.599 1.00 26.47  ? 577  TYR A CA    1 
ATOM   4728 C  C     . TYR A 1 577 ? -11.873 5.668   42.000 1.00 26.39  ? 577  TYR A C     1 
ATOM   4729 O  O     . TYR A 1 577 ? -11.512 5.550   43.179 1.00 27.16  ? 577  TYR A O     1 
ATOM   4730 C  CB    . TYR A 1 577 ? -14.052 4.430   42.458 1.00 28.04  ? 577  TYR A CB    1 
ATOM   4731 C  CG    . TYR A 1 577 ? -15.499 4.279   42.048 1.00 29.87  ? 577  TYR A CG    1 
ATOM   4732 C  CD1   . TYR A 1 577 ? -15.895 3.267   41.169 1.00 31.01  ? 577  TYR A CD1   1 
ATOM   4733 C  CD2   . TYR A 1 577 ? -16.466 5.185   42.490 1.00 26.20  ? 577  TYR A CD2   1 
ATOM   4734 C  CE1   . TYR A 1 577 ? -17.232 3.140   40.767 1.00 27.63  ? 577  TYR A CE1   1 
ATOM   4735 C  CE2   . TYR A 1 577 ? -17.788 5.064   42.096 1.00 27.81  ? 577  TYR A CE2   1 
ATOM   4736 C  CZ    . TYR A 1 577 ? -18.164 4.040   41.232 1.00 27.79  ? 577  TYR A CZ    1 
ATOM   4737 O  OH    . TYR A 1 577 ? -19.474 3.923   40.844 1.00 25.48  ? 577  TYR A OH    1 
ATOM   4738 N  N     . TYR A 1 578 ? -11.039 5.989   41.016 1.00 27.35  ? 578  TYR A N     1 
ATOM   4739 C  CA    . TYR A 1 578 ? -9.620  6.254   41.255 1.00 29.06  ? 578  TYR A CA    1 
ATOM   4740 C  C     . TYR A 1 578 ? -9.447  7.239   42.391 1.00 28.41  ? 578  TYR A C     1 
ATOM   4741 O  O     . TYR A 1 578 ? -10.124 8.267   42.427 1.00 26.71  ? 578  TYR A O     1 
ATOM   4742 C  CB    . TYR A 1 578 ? -8.986  6.832   40.003 1.00 28.78  ? 578  TYR A CB    1 
ATOM   4743 C  CG    . TYR A 1 578 ? -7.581  7.369   40.185 1.00 31.20  ? 578  TYR A CG    1 
ATOM   4744 C  CD1   . TYR A 1 578 ? -7.350  8.738   40.353 1.00 28.16  ? 578  TYR A CD1   1 
ATOM   4745 C  CD2   . TYR A 1 578 ? -6.481  6.511   40.156 1.00 24.39  ? 578  TYR A CD2   1 
ATOM   4746 C  CE1   . TYR A 1 578 ? -6.048  9.236   40.493 1.00 30.78  ? 578  TYR A CE1   1 
ATOM   4747 C  CE2   . TYR A 1 578 ? -5.191  6.992   40.298 1.00 27.87  ? 578  TYR A CE2   1 
ATOM   4748 C  CZ    . TYR A 1 578 ? -4.981  8.347   40.458 1.00 29.48  ? 578  TYR A CZ    1 
ATOM   4749 O  OH    . TYR A 1 578 ? -3.706  8.798   40.588 1.00 28.02  ? 578  TYR A OH    1 
ATOM   4750 N  N     . ASP A 1 579 ? -8.547  6.921   43.316 1.00 28.44  ? 579  ASP A N     1 
ATOM   4751 C  CA    . ASP A 1 579 ? -8.290  7.788   44.464 1.00 30.14  ? 579  ASP A CA    1 
ATOM   4752 C  C     . ASP A 1 579 ? -7.085  7.289   45.245 1.00 29.84  ? 579  ASP A C     1 
ATOM   4753 O  O     . ASP A 1 579 ? -7.141  6.260   45.940 1.00 33.11  ? 579  ASP A O     1 
ATOM   4754 C  CB    . ASP A 1 579 ? -9.524  7.887   45.371 1.00 30.60  ? 579  ASP A CB    1 
ATOM   4755 C  CG    . ASP A 1 579 ? -9.453  9.056   46.343 1.00 37.54  ? 579  ASP A CG    1 
ATOM   4756 O  OD1   . ASP A 1 579 ? -10.534 9.504   46.772 1.00 43.34  ? 579  ASP A OD1   1 
ATOM   4757 O  OD2   . ASP A 1 579 ? -8.341  9.537   46.682 1.00 34.71  ? 579  ASP A OD2   1 
ATOM   4758 N  N     . LEU A 1 580 ? -5.994  8.031   45.121 1.00 26.95  ? 580  LEU A N     1 
ATOM   4759 C  CA    . LEU A 1 580 ? -4.752  7.709   45.787 1.00 26.26  ? 580  LEU A CA    1 
ATOM   4760 C  C     . LEU A 1 580 ? -4.859  7.759   47.307 1.00 27.00  ? 580  LEU A C     1 
ATOM   4761 O  O     . LEU A 1 580 ? -4.106  7.073   47.984 1.00 27.36  ? 580  LEU A O     1 
ATOM   4762 C  CB    . LEU A 1 580 ? -3.629  8.616   45.280 1.00 26.67  ? 580  LEU A CB    1 
ATOM   4763 C  CG    . LEU A 1 580 ? -2.623  8.099   44.226 1.00 28.25  ? 580  LEU A CG    1 
ATOM   4764 C  CD1   . LEU A 1 580 ? -3.103  6.906   43.387 1.00 23.64  ? 580  LEU A CD1   1 
ATOM   4765 C  CD2   . LEU A 1 580 ? -2.177  9.228   43.334 1.00 22.21  ? 580  LEU A CD2   1 
ATOM   4766 N  N     . ARG A 1 581 ? -5.790  8.556   47.836 1.00 25.46  ? 581  ARG A N     1 
ATOM   4767 C  CA    . ARG A 1 581 ? -6.061  8.563   49.277 1.00 28.44  ? 581  ARG A CA    1 
ATOM   4768 C  C     . ARG A 1 581 ? -6.472  7.163   49.733 1.00 29.08  ? 581  ARG A C     1 
ATOM   4769 O  O     . ARG A 1 581 ? -5.978  6.662   50.744 1.00 30.51  ? 581  ARG A O     1 
ATOM   4770 C  CB    . ARG A 1 581 ? -7.155  9.579   49.650 1.00 28.82  ? 581  ARG A CB    1 
ATOM   4771 C  CG    . ARG A 1 581 ? -6.770  11.056  49.425 1.00 30.04  ? 581  ARG A CG    1 
ATOM   4772 C  CD    . ARG A 1 581 ? -7.937  12.005  49.701 1.00 28.35  ? 581  ARG A CD    1 
ATOM   4773 N  NE    . ARG A 1 581 ? -9.081  11.726  48.837 1.00 30.38  ? 581  ARG A NE    1 
ATOM   4774 C  CZ    . ARG A 1 581 ? -10.282 12.293  48.947 1.00 35.46  ? 581  ARG A CZ    1 
ATOM   4775 N  NH1   . ARG A 1 581 ? -10.532 13.189  49.905 1.00 30.90  ? 581  ARG A NH1   1 
ATOM   4776 N  NH2   . ARG A 1 581 ? -11.247 11.948  48.096 1.00 33.66  ? 581  ARG A NH2   1 
ATOM   4777 N  N     . ASN A 1 582 ? -7.365  6.538   48.970 1.00 27.48  ? 582  ASN A N     1 
ATOM   4778 C  CA    . ASN A 1 582 ? -7.819  5.179   49.265 1.00 28.68  ? 582  ASN A CA    1 
ATOM   4779 C  C     . ASN A 1 582 ? -6.773  4.110   48.942 1.00 29.22  ? 582  ASN A C     1 
ATOM   4780 O  O     . ASN A 1 582 ? -6.491  3.246   49.783 1.00 30.16  ? 582  ASN A O     1 
ATOM   4781 C  CB    . ASN A 1 582 ? -9.149  4.896   48.567 1.00 26.54  ? 582  ASN A CB    1 
ATOM   4782 C  CG    . ASN A 1 582 ? -10.318 5.624   49.223 1.00 28.68  ? 582  ASN A CG    1 
ATOM   4783 O  OD1   . ASN A 1 582 ? -10.249 6.014   50.400 1.00 23.35  ? 582  ASN A OD1   1 
ATOM   4784 N  ND2   . ASN A 1 582 ? -11.398 5.807   48.469 1.00 27.73  ? 582  ASN A ND2   1 
ATOM   4785 N  N     . ALA A 1 583 ? -6.184  4.191   47.745 1.00 28.53  ? 583  ALA A N     1 
ATOM   4786 C  CA    . ALA A 1 583 ? -5.090  3.289   47.345 1.00 27.43  ? 583  ALA A CA    1 
ATOM   4787 C  C     . ALA A 1 583 ? -3.949  3.270   48.368 1.00 26.28  ? 583  ALA A C     1 
ATOM   4788 O  O     . ALA A 1 583 ? -3.535  2.205   48.790 1.00 26.27  ? 583  ALA A O     1 
ATOM   4789 C  CB    . ALA A 1 583 ? -4.568  3.636   45.949 1.00 23.31  ? 583  ALA A CB    1 
ATOM   4790 N  N     . THR A 1 584 ? -3.466  4.440   48.789 1.00 28.54  ? 584  THR A N     1 
ATOM   4791 C  CA    . THR A 1 584 ? -2.396  4.495   49.793 1.00 29.56  ? 584  THR A CA    1 
ATOM   4792 C  C     . THR A 1 584 ? -2.867  4.185   51.215 1.00 29.27  ? 584  THR A C     1 
ATOM   4793 O  O     . THR A 1 584 ? -2.057  3.807   52.052 1.00 29.95  ? 584  THR A O     1 
ATOM   4794 C  CB    . THR A 1 584 ? -1.653  5.846   49.826 1.00 30.52  ? 584  THR A CB    1 
ATOM   4795 O  OG1   . THR A 1 584 ? -2.547  6.871   50.272 1.00 26.95  ? 584  THR A OG1   1 
ATOM   4796 C  CG2   . THR A 1 584 ? -1.060  6.188   48.455 1.00 25.72  ? 584  THR A CG2   1 
ATOM   4797 N  N     . ALA A 1 585 ? -4.160  4.345   51.488 1.00 30.08  ? 585  ALA A N     1 
ATOM   4798 C  CA    . ALA A 1 585 ? -4.716  3.938   52.785 1.00 30.58  ? 585  ALA A CA    1 
ATOM   4799 C  C     . ALA A 1 585 ? -4.595  2.429   52.964 1.00 31.23  ? 585  ALA A C     1 
ATOM   4800 O  O     . ALA A 1 585 ? -4.326  1.948   54.067 1.00 31.87  ? 585  ALA A O     1 
ATOM   4801 C  CB    . ALA A 1 585 ? -6.175  4.378   52.932 1.00 29.44  ? 585  ALA A CB    1 
ATOM   4802 N  N     . ILE A 1 586 ? -4.785  1.693   51.870 1.00 27.07  ? 586  ILE A N     1 
ATOM   4803 C  CA    . ILE A 1 586 ? -4.593  0.240   51.869 1.00 26.31  ? 586  ILE A CA    1 
ATOM   4804 C  C     . ILE A 1 586 ? -3.103  -0.123  52.047 1.00 27.13  ? 586  ILE A C     1 
ATOM   4805 O  O     . ILE A 1 586 ? -2.740  -0.883  52.943 1.00 26.45  ? 586  ILE A O     1 
ATOM   4806 C  CB    . ILE A 1 586 ? -5.136  -0.397  50.560 1.00 22.29  ? 586  ILE A CB    1 
ATOM   4807 C  CG1   . ILE A 1 586 ? -6.651  -0.221  50.453 1.00 19.88  ? 586  ILE A CG1   1 
ATOM   4808 C  CG2   . ILE A 1 586 ? -4.751  -1.870  50.472 1.00 22.87  ? 586  ILE A CG2   1 
ATOM   4809 C  CD1   . ILE A 1 586 ? -7.174  -0.155  48.991 1.00 21.56  ? 586  ILE A CD1   1 
ATOM   4810 N  N     . THR A 1 587 ? -2.245  0.425   51.196 1.00 25.41  ? 587  THR A N     1 
ATOM   4811 C  CA    . THR A 1 587 ? -0.848  0.002   51.196 1.00 27.12  ? 587  THR A CA    1 
ATOM   4812 C  C     . THR A 1 587 ? -0.104  0.428   52.462 1.00 28.33  ? 587  THR A C     1 
ATOM   4813 O  O     . THR A 1 587 ? 0.739   -0.317  52.971 1.00 30.89  ? 587  THR A O     1 
ATOM   4814 C  CB    . THR A 1 587 ? -0.105  0.472   49.931 1.00 26.37  ? 587  THR A CB    1 
ATOM   4815 O  OG1   . THR A 1 587 ? -0.076  1.902   49.903 1.00 24.78  ? 587  THR A OG1   1 
ATOM   4816 C  CG2   . THR A 1 587 ? -0.816  -0.049  48.659 1.00 20.20  ? 587  THR A CG2   1 
ATOM   4817 N  N     . THR A 1 588 ? -0.435  1.603   52.987 1.00 28.26  ? 588  THR A N     1 
ATOM   4818 C  CA    . THR A 1 588 ? 0.241   2.100   54.184 1.00 30.27  ? 588  THR A CA    1 
ATOM   4819 C  C     . THR A 1 588 ? -0.198  1.340   55.431 1.00 28.79  ? 588  THR A C     1 
ATOM   4820 O  O     . THR A 1 588 ? 0.635   0.971   56.252 1.00 28.97  ? 588  THR A O     1 
ATOM   4821 C  CB    . THR A 1 588 ? 0.082   3.635   54.359 1.00 32.11  ? 588  THR A CB    1 
ATOM   4822 O  OG1   . THR A 1 588 ? 0.271   4.277   53.094 1.00 30.81  ? 588  THR A OG1   1 
ATOM   4823 C  CG2   . THR A 1 588 ? 1.122   4.179   55.328 1.00 33.00  ? 588  THR A CG2   1 
ATOM   4824 N  N     . PHE A 1 589 ? -1.500  1.079   55.552 1.00 28.91  ? 589  PHE A N     1 
ATOM   4825 C  CA    . PHE A 1 589 ? -2.021  0.246   56.626 1.00 28.65  ? 589  PHE A CA    1 
ATOM   4826 C  C     . PHE A 1 589 ? -1.351  -1.134  56.598 1.00 28.02  ? 589  PHE A C     1 
ATOM   4827 O  O     . PHE A 1 589 ? -1.020  -1.705  57.645 1.00 25.48  ? 589  PHE A O     1 
ATOM   4828 C  CB    . PHE A 1 589 ? -3.537  0.096   56.478 1.00 30.44  ? 589  PHE A CB    1 
ATOM   4829 C  CG    . PHE A 1 589 ? -4.216  -0.550  57.659 1.00 27.56  ? 589  PHE A CG    1 
ATOM   4830 C  CD1   . PHE A 1 589 ? -4.334  -1.936  57.744 1.00 27.37  ? 589  PHE A CD1   1 
ATOM   4831 C  CD2   . PHE A 1 589 ? -4.771  0.231   58.668 1.00 26.84  ? 589  PHE A CD2   1 
ATOM   4832 C  CE1   . PHE A 1 589 ? -4.975  -2.530  58.823 1.00 25.85  ? 589  PHE A CE1   1 
ATOM   4833 C  CE2   . PHE A 1 589 ? -5.419  -0.359  59.761 1.00 29.55  ? 589  PHE A CE2   1 
ATOM   4834 C  CZ    . PHE A 1 589 ? -5.522  -1.740  59.837 1.00 27.93  ? 589  PHE A CZ    1 
ATOM   4835 N  N     . GLY A 1 590 ? -1.180  -1.669  55.391 1.00 28.39  ? 590  GLY A N     1 
ATOM   4836 C  CA    . GLY A 1 590 ? -0.473  -2.933  55.189 1.00 28.34  ? 590  GLY A CA    1 
ATOM   4837 C  C     . GLY A 1 590 ? 0.949   -2.891  55.725 1.00 29.13  ? 590  GLY A C     1 
ATOM   4838 O  O     . GLY A 1 590 ? 1.367   -3.803  56.447 1.00 27.54  ? 590  GLY A O     1 
ATOM   4839 N  N     . GLN A 1 591 ? 1.679   -1.826  55.395 1.00 29.90  ? 591  GLN A N     1 
ATOM   4840 C  CA    . GLN A 1 591 ? 3.060   -1.637  55.875 1.00 32.85  ? 591  GLN A CA    1 
ATOM   4841 C  C     . GLN A 1 591 ? 3.132   -1.602  57.398 1.00 34.26  ? 591  GLN A C     1 
ATOM   4842 O  O     . GLN A 1 591 ? 4.039   -2.177  58.006 1.00 33.84  ? 591  GLN A O     1 
ATOM   4843 C  CB    . GLN A 1 591 ? 3.667   -0.342  55.318 1.00 33.78  ? 591  GLN A CB    1 
ATOM   4844 C  CG    . GLN A 1 591 ? 4.040   -0.374  53.848 1.00 36.24  ? 591  GLN A CG    1 
ATOM   4845 C  CD    . GLN A 1 591 ? 5.205   0.566   53.512 1.00 41.76  ? 591  GLN A CD    1 
ATOM   4846 O  OE1   . GLN A 1 591 ? 6.012   0.917   54.379 1.00 45.48  ? 591  GLN A OE1   1 
ATOM   4847 N  NE2   . GLN A 1 591 ? 5.298   0.965   52.246 1.00 38.93  ? 591  GLN A NE2   1 
ATOM   4848 N  N     . MET A 1 592 ? 2.178   -0.905  58.009 1.00 35.64  ? 592  MET A N     1 
ATOM   4849 C  CA    . MET A 1 592 ? 2.100   -0.840  59.464 1.00 36.81  ? 592  MET A CA    1 
ATOM   4850 C  C     . MET A 1 592 ? 1.850   -2.228  60.048 1.00 37.06  ? 592  MET A C     1 
ATOM   4851 O  O     . MET A 1 592 ? 2.554   -2.662  60.955 1.00 38.00  ? 592  MET A O     1 
ATOM   4852 C  CB    . MET A 1 592 ? 0.995   0.131   59.901 1.00 37.47  ? 592  MET A CB    1 
ATOM   4853 C  CG    . MET A 1 592 ? 0.744   0.148   61.404 1.00 37.09  ? 592  MET A CG    1 
ATOM   4854 S  SD    . MET A 1 592 ? -0.603  1.249   61.844 1.00 41.81  ? 592  MET A SD    1 
ATOM   4855 C  CE    . MET A 1 592 ? -2.016  0.329   61.217 1.00 40.79  ? 592  MET A CE    1 
ATOM   4856 N  N     . ALA A 1 593 ? 0.853   -2.920  59.501 1.00 37.66  ? 593  ALA A N     1 
ATOM   4857 C  CA    . ALA A 1 593 ? 0.403   -4.210  60.025 1.00 37.39  ? 593  ALA A CA    1 
ATOM   4858 C  C     . ALA A 1 593 ? 1.514   -5.255  60.102 1.00 37.73  ? 593  ALA A C     1 
ATOM   4859 O  O     . ALA A 1 593 ? 1.649   -5.943  61.117 1.00 40.40  ? 593  ALA A O     1 
ATOM   4860 C  CB    . ALA A 1 593 ? -0.772  -4.732  59.194 1.00 36.94  ? 593  ALA A CB    1 
ATOM   4861 N  N     . LEU A 1 594 ? 2.295   -5.372  59.028 1.00 36.06  ? 594  LEU A N     1 
ATOM   4862 C  CA    . LEU A 1 594 ? 3.390   -6.341  58.948 1.00 36.53  ? 594  LEU A CA    1 
ATOM   4863 C  C     . LEU A 1 594 ? 4.462   -6.050  59.995 1.00 35.21  ? 594  LEU A C     1 
ATOM   4864 O  O     . LEU A 1 594 ? 4.887   -6.944  60.734 1.00 32.98  ? 594  LEU A O     1 
ATOM   4865 C  CB    . LEU A 1 594 ? 4.029   -6.290  57.561 1.00 37.85  ? 594  LEU A CB    1 
ATOM   4866 C  CG    . LEU A 1 594 ? 4.765   -7.502  56.984 1.00 39.79  ? 594  LEU A CG    1 
ATOM   4867 C  CD1   . LEU A 1 594 ? 5.582   -7.057  55.777 1.00 41.82  ? 594  LEU A CD1   1 
ATOM   4868 C  CD2   . LEU A 1 594 ? 5.661   -8.202  57.981 1.00 40.79  ? 594  LEU A CD2   1 
ATOM   4869 N  N     . GLN A 1 595 ? 4.898   -4.792  60.032 1.00 33.43  ? 595  GLN A N     1 
ATOM   4870 C  CA    . GLN A 1 595 ? 5.921   -4.351  60.959 1.00 33.26  ? 595  GLN A CA    1 
ATOM   4871 C  C     . GLN A 1 595 ? 5.412   -4.380  62.407 1.00 33.93  ? 595  GLN A C     1 
ATOM   4872 O  O     . GLN A 1 595 ? 6.139   -4.785  63.309 1.00 30.88  ? 595  GLN A O     1 
ATOM   4873 C  CB    . GLN A 1 595 ? 6.441   -2.968  60.544 1.00 34.68  ? 595  GLN A CB    1 
ATOM   4874 C  CG    . GLN A 1 595 ? 7.513   -3.036  59.450 1.00 34.12  ? 595  GLN A CG    1 
ATOM   4875 C  CD    . GLN A 1 595 ? 7.678   -1.746  58.658 1.00 36.37  ? 595  GLN A CD    1 
ATOM   4876 O  OE1   . GLN A 1 595 ? 8.693   -1.057  58.773 1.00 35.71  ? 595  GLN A OE1   1 
ATOM   4877 N  NE2   . GLN A 1 595 ? 6.684   -1.423  57.843 1.00 36.04  ? 595  GLN A NE2   1 
ATOM   4878 N  N     . TRP A 1 596 ? 4.152   -3.984  62.608 1.00 35.16  ? 596  TRP A N     1 
ATOM   4879 C  CA    . TRP A 1 596 ? 3.498   -4.060  63.918 1.00 33.16  ? 596  TRP A CA    1 
ATOM   4880 C  C     . TRP A 1 596 ? 3.608   -5.475  64.475 1.00 34.62  ? 596  TRP A C     1 
ATOM   4881 O  O     . TRP A 1 596 ? 4.041   -5.673  65.613 1.00 35.01  ? 596  TRP A O     1 
ATOM   4882 C  CB    . TRP A 1 596 ? 2.023   -3.640  63.808 1.00 31.93  ? 596  TRP A CB    1 
ATOM   4883 C  CG    . TRP A 1 596 ? 1.210   -3.801  65.073 1.00 31.87  ? 596  TRP A CG    1 
ATOM   4884 C  CD1   . TRP A 1 596 ? 0.621   -4.948  65.528 1.00 30.03  ? 596  TRP A CD1   1 
ATOM   4885 C  CD2   . TRP A 1 596 ? 0.888   -2.782  66.031 1.00 30.68  ? 596  TRP A CD2   1 
ATOM   4886 N  NE1   . TRP A 1 596 ? -0.034  -4.711  66.708 1.00 29.54  ? 596  TRP A NE1   1 
ATOM   4887 C  CE2   . TRP A 1 596 ? 0.109   -3.390  67.041 1.00 30.90  ? 596  TRP A CE2   1 
ATOM   4888 C  CE3   . TRP A 1 596 ? 1.182   -1.415  66.135 1.00 31.61  ? 596  TRP A CE3   1 
ATOM   4889 C  CZ2   . TRP A 1 596 ? -0.387  -2.679  68.144 1.00 30.66  ? 596  TRP A CZ2   1 
ATOM   4890 C  CZ3   . TRP A 1 596 ? 0.687   -0.705  67.240 1.00 33.16  ? 596  TRP A CZ3   1 
ATOM   4891 C  CH2   . TRP A 1 596 ? -0.088  -1.345  68.227 1.00 29.11  ? 596  TRP A CH2   1 
ATOM   4892 N  N     . ILE A 1 597 ? 3.229   -6.457  63.663 1.00 34.64  ? 597  ILE A N     1 
ATOM   4893 C  CA    . ILE A 1 597 ? 3.180   -7.840  64.124 1.00 34.50  ? 597  ILE A CA    1 
ATOM   4894 C  C     . ILE A 1 597 ? 4.566   -8.487  64.205 1.00 37.15  ? 597  ILE A C     1 
ATOM   4895 O  O     . ILE A 1 597 ? 4.769   -9.403  65.005 1.00 37.71  ? 597  ILE A O     1 
ATOM   4896 C  CB    . ILE A 1 597 ? 2.186   -8.701  63.295 1.00 32.98  ? 597  ILE A CB    1 
ATOM   4897 C  CG1   . ILE A 1 597 ? 1.581   -9.797  64.169 1.00 31.22  ? 597  ILE A CG1   1 
ATOM   4898 C  CG2   . ILE A 1 597 ? 2.841   -9.280  62.045 1.00 30.21  ? 597  ILE A CG2   1 
ATOM   4899 C  CD1   . ILE A 1 597 ? 0.567   -9.281  65.172 1.00 34.30  ? 597  ILE A CD1   1 
ATOM   4900 N  N     . GLU A 1 598 ? 5.504   -8.017  63.379 1.00 37.34  ? 598  GLU A N     1 
ATOM   4901 C  CA    . GLU A 1 598 ? 6.908   -8.361  63.552 1.00 38.41  ? 598  GLU A CA    1 
ATOM   4902 C  C     . GLU A 1 598 ? 7.314   -8.060  64.996 1.00 38.79  ? 598  GLU A C     1 
ATOM   4903 O  O     . GLU A 1 598 ? 7.760   -8.955  65.713 1.00 37.80  ? 598  GLU A O     1 
ATOM   4904 C  CB    . GLU A 1 598 ? 7.810   -7.588  62.580 1.00 39.25  ? 598  GLU A CB    1 
ATOM   4905 C  CG    . GLU A 1 598 ? 9.310   -7.841  62.803 1.00 41.04  ? 598  GLU A CG    1 
ATOM   4906 C  CD    . GLU A 1 598 ? 10.228  -6.968  61.947 1.00 45.03  ? 598  GLU A CD    1 
ATOM   4907 O  OE1   . GLU A 1 598 ? 9.762   -5.995  61.311 1.00 47.55  ? 598  GLU A OE1   1 
ATOM   4908 O  OE2   . GLU A 1 598 ? 11.441  -7.254  61.918 1.00 46.28  ? 598  GLU A OE2   1 
ATOM   4909 N  N     . ARG A 1 599 ? 7.135   -6.807  65.413 1.00 37.88  ? 599  ARG A N     1 
ATOM   4910 C  CA    . ARG A 1 599 ? 7.465   -6.385  66.770 1.00 38.22  ? 599  ARG A CA    1 
ATOM   4911 C  C     . ARG A 1 599 ? 6.771   -7.269  67.806 1.00 38.92  ? 599  ARG A C     1 
ATOM   4912 O  O     . ARG A 1 599 ? 7.415   -7.765  68.731 1.00 40.91  ? 599  ARG A O     1 
ATOM   4913 C  CB    . ARG A 1 599 ? 7.098   -4.909  66.986 1.00 39.81  ? 599  ARG A CB    1 
ATOM   4914 C  CG    . ARG A 1 599 ? 7.321   -4.402  68.421 1.00 40.51  ? 599  ARG A CG    1 
ATOM   4915 C  CD    . ARG A 1 599 ? 6.994   -2.914  68.588 1.00 41.90  ? 599  ARG A CD    1 
ATOM   4916 N  NE    . ARG A 1 599 ? 5.581   -2.600  68.348 1.00 41.94  ? 599  ARG A NE    1 
ATOM   4917 C  CZ    . ARG A 1 599 ? 4.597   -2.779  69.233 1.00 41.90  ? 599  ARG A CZ    1 
ATOM   4918 N  NH1   . ARG A 1 599 ? 4.850   -3.283  70.432 1.00 41.31  ? 599  ARG A NH1   1 
ATOM   4919 N  NH2   . ARG A 1 599 ? 3.352   -2.460  68.915 1.00 40.99  ? 599  ARG A NH2   1 
ATOM   4920 N  N     . LYS A 1 600 ? 5.467   -7.483  67.631 1.00 37.24  ? 600  LYS A N     1 
ATOM   4921 C  CA    . LYS A 1 600 ? 4.670   -8.238  68.594 1.00 36.75  ? 600  LYS A CA    1 
ATOM   4922 C  C     . LYS A 1 600 ? 5.076   -9.700  68.680 1.00 36.46  ? 600  LYS A C     1 
ATOM   4923 O  O     . LYS A 1 600 ? 5.005   -10.294 69.760 1.00 38.33  ? 600  LYS A O     1 
ATOM   4924 C  CB    . LYS A 1 600 ? 3.172   -8.130  68.279 1.00 36.83  ? 600  LYS A CB    1 
ATOM   4925 C  CG    . LYS A 1 600 ? 2.549   -6.787  68.622 1.00 36.65  ? 600  LYS A CG    1 
ATOM   4926 C  CD    . LYS A 1 600 ? 2.256   -6.659  70.113 1.00 36.22  ? 600  LYS A CD    1 
ATOM   4927 C  CE    . LYS A 1 600 ? 1.489   -5.379  70.415 1.00 39.21  ? 600  LYS A CE    1 
ATOM   4928 N  NZ    . LYS A 1 600 ? 1.022   -5.333  71.830 1.00 37.40  ? 600  LYS A NZ    1 
ATOM   4929 N  N     . VAL A 1 601 ? 5.479   -10.282 67.549 1.00 34.15  ? 601  VAL A N     1 
ATOM   4930 C  CA    . VAL A 1 601 ? 5.956   -11.664 67.521 1.00 33.16  ? 601  VAL A CA    1 
ATOM   4931 C  C     . VAL A 1 601 ? 7.327   -11.764 68.181 1.00 35.28  ? 601  VAL A C     1 
ATOM   4932 O  O     . VAL A 1 601 ? 7.586   -12.709 68.933 1.00 36.89  ? 601  VAL A O     1 
ATOM   4933 C  CB    . VAL A 1 601 ? 5.967   -12.276 66.086 1.00 32.81  ? 601  VAL A CB    1 
ATOM   4934 C  CG1   . VAL A 1 601 ? 6.850   -13.507 66.019 1.00 32.56  ? 601  VAL A CG1   1 
ATOM   4935 C  CG2   . VAL A 1 601 ? 4.565   -12.642 65.659 1.00 31.05  ? 601  VAL A CG2   1 
ATOM   4936 N  N     . ASN A 1 602 ? 8.194   -10.785 67.927 1.00 35.57  ? 602  ASN A N     1 
ATOM   4937 C  CA    . ASN A 1 602 ? 9.490   -10.749 68.602 1.00 36.22  ? 602  ASN A CA    1 
ATOM   4938 C  C     . ASN A 1 602 ? 9.286   -10.608 70.110 1.00 38.76  ? 602  ASN A C     1 
ATOM   4939 O  O     . ASN A 1 602 ? 9.937   -11.292 70.898 1.00 39.95  ? 602  ASN A O     1 
ATOM   4940 C  CB    . ASN A 1 602 ? 10.386  -9.632  68.042 1.00 35.30  ? 602  ASN A CB    1 
ATOM   4941 C  CG    . ASN A 1 602 ? 11.055  -10.014 66.714 1.00 36.71  ? 602  ASN A CG    1 
ATOM   4942 O  OD1   . ASN A 1 602 ? 11.202  -11.200 66.385 1.00 35.40  ? 602  ASN A OD1   1 
ATOM   4943 N  ND2   . ASN A 1 602 ? 11.479  -9.003  65.956 1.00 31.76  ? 602  ASN A ND2   1 
ATOM   4944 N  N     . GLU A 1 603 ? 8.348   -9.750  70.501 1.00 40.22  ? 603  GLU A N     1 
ATOM   4945 C  CA    . GLU A 1 603 ? 8.049   -9.529  71.911 1.00 42.21  ? 603  GLU A CA    1 
ATOM   4946 C  C     . GLU A 1 603 ? 7.525   -10.784 72.597 1.00 41.93  ? 603  GLU A C     1 
ATOM   4947 O  O     . GLU A 1 603 ? 7.936   -11.090 73.712 1.00 41.81  ? 603  GLU A O     1 
ATOM   4948 C  CB    . GLU A 1 603 ? 7.083   -8.347  72.097 1.00 43.71  ? 603  GLU A CB    1 
ATOM   4949 C  CG    . GLU A 1 603 ? 7.780   -6.981  72.150 1.00 47.07  ? 603  GLU A CG    1 
ATOM   4950 C  CD    . GLU A 1 603 ? 6.823   -5.794  72.032 1.00 51.92  ? 603  GLU A CD    1 
ATOM   4951 O  OE1   . GLU A 1 603 ? 5.610   -5.951  72.311 1.00 55.94  ? 603  GLU A OE1   1 
ATOM   4952 O  OE2   . GLU A 1 603 ? 7.293   -4.693  71.665 1.00 51.68  ? 603  GLU A OE2   1 
ATOM   4953 N  N     . TYR A 1 604 ? 6.645   -11.525 71.924 1.00 43.57  ? 604  TYR A N     1 
ATOM   4954 C  CA    . TYR A 1 604 ? 6.078   -12.742 72.514 1.00 45.12  ? 604  TYR A CA    1 
ATOM   4955 C  C     . TYR A 1 604 ? 7.100   -13.876 72.663 1.00 45.41  ? 604  TYR A C     1 
ATOM   4956 O  O     . TYR A 1 604 ? 7.168   -14.521 73.706 1.00 44.31  ? 604  TYR A O     1 
ATOM   4957 C  CB    . TYR A 1 604 ? 4.841   -13.226 71.739 1.00 46.01  ? 604  TYR A CB    1 
ATOM   4958 C  CG    . TYR A 1 604 ? 4.271   -14.540 72.254 1.00 44.11  ? 604  TYR A CG    1 
ATOM   4959 C  CD1   . TYR A 1 604 ? 4.565   -15.751 71.621 1.00 43.49  ? 604  TYR A CD1   1 
ATOM   4960 C  CD2   . TYR A 1 604 ? 3.454   -14.571 73.379 1.00 43.79  ? 604  TYR A CD2   1 
ATOM   4961 C  CE1   . TYR A 1 604 ? 4.055   -16.955 72.093 1.00 44.50  ? 604  TYR A CE1   1 
ATOM   4962 C  CE2   . TYR A 1 604 ? 2.932   -15.769 73.857 1.00 46.54  ? 604  TYR A CE2   1 
ATOM   4963 C  CZ    . TYR A 1 604 ? 3.240   -16.957 73.212 1.00 47.67  ? 604  TYR A CZ    1 
ATOM   4964 O  OH    . TYR A 1 604 ? 2.726   -18.142 73.692 1.00 50.03  ? 604  TYR A OH    1 
ATOM   4965 N  N     . LEU A 1 605 ? 7.886   -14.122 71.621 1.00 46.94  ? 605  LEU A N     1 
ATOM   4966 C  CA    . LEU A 1 605 ? 8.834   -15.241 71.642 1.00 48.15  ? 605  LEU A CA    1 
ATOM   4967 C  C     . LEU A 1 605 ? 10.052  -15.020 72.536 1.00 48.28  ? 605  LEU A C     1 
ATOM   4968 O  O     . LEU A 1 605 ? 10.593  -15.979 73.075 1.00 47.62  ? 605  LEU A O     1 
ATOM   4969 C  CB    . LEU A 1 605 ? 9.261   -15.632 70.230 1.00 47.86  ? 605  LEU A CB    1 
ATOM   4970 C  CG    . LEU A 1 605 ? 8.158   -16.280 69.396 1.00 48.94  ? 605  LEU A CG    1 
ATOM   4971 C  CD1   . LEU A 1 605 ? 8.696   -16.539 68.014 1.00 51.23  ? 605  LEU A CD1   1 
ATOM   4972 C  CD2   . LEU A 1 605 ? 7.631   -17.569 70.036 1.00 46.46  ? 605  LEU A CD2   1 
ATOM   4973 N  N     . ASN A 1 606 ? 10.478  -13.768 72.691 1.00 49.10  ? 606  ASN A N     1 
ATOM   4974 C  CA    . ASN A 1 606 ? 11.488  -13.435 73.698 1.00 49.76  ? 606  ASN A CA    1 
ATOM   4975 C  C     . ASN A 1 606 ? 10.987  -13.740 75.110 1.00 52.05  ? 606  ASN A C     1 
ATOM   4976 O  O     . ASN A 1 606 ? 11.741  -14.258 75.937 1.00 53.24  ? 606  ASN A O     1 
ATOM   4977 C  CB    . ASN A 1 606 ? 11.931  -11.971 73.594 1.00 47.19  ? 606  ASN A CB    1 
ATOM   4978 C  CG    . ASN A 1 606 ? 12.953  -11.744 72.496 1.00 46.11  ? 606  ASN A CG    1 
ATOM   4979 O  OD1   . ASN A 1 606 ? 14.069  -12.262 72.551 1.00 44.21  ? 606  ASN A OD1   1 
ATOM   4980 N  ND2   . ASN A 1 606 ? 12.583  -10.945 71.501 1.00 42.71  ? 606  ASN A ND2   1 
ATOM   4981 N  N     . GLU A 1 607 ? 9.715   -13.433 75.375 1.00 53.26  ? 607  GLU A N     1 
ATOM   4982 C  CA    . GLU A 1 607 ? 9.117   -13.710 76.679 1.00 55.42  ? 607  GLU A CA    1 
ATOM   4983 C  C     . GLU A 1 607 ? 9.102   -15.205 76.970 1.00 54.76  ? 607  GLU A C     1 
ATOM   4984 O  O     . GLU A 1 607 ? 9.646   -15.640 77.979 1.00 55.81  ? 607  GLU A O     1 
ATOM   4985 C  CB    . GLU A 1 607 ? 7.702   -13.122 76.796 1.00 57.50  ? 607  GLU A CB    1 
ATOM   4986 C  CG    . GLU A 1 607 ? 7.068   -13.310 78.184 1.00 64.21  ? 607  GLU A CG    1 
ATOM   4987 C  CD    . GLU A 1 607 ? 5.677   -12.686 78.330 1.00 69.70  ? 607  GLU A CD    1 
ATOM   4988 O  OE1   . GLU A 1 607 ? 5.024   -12.372 77.306 1.00 70.37  ? 607  GLU A OE1   1 
ATOM   4989 O  OE2   . GLU A 1 607 ? 5.233   -12.519 79.491 1.00 71.82  ? 607  GLU A OE2   1 
ATOM   4990 N  N     . VAL A 1 608 ? 8.510   -15.987 76.071 1.00 54.74  ? 608  VAL A N     1 
ATOM   4991 C  CA    . VAL A 1 608 ? 8.338   -17.429 76.296 1.00 54.51  ? 608  VAL A CA    1 
ATOM   4992 C  C     . VAL A 1 608 ? 9.653   -18.216 76.284 1.00 56.20  ? 608  VAL A C     1 
ATOM   4993 O  O     . VAL A 1 608 ? 9.732   -19.300 76.869 1.00 55.38  ? 608  VAL A O     1 
ATOM   4994 C  CB    . VAL A 1 608 ? 7.309   -18.071 75.315 1.00 53.36  ? 608  VAL A CB    1 
ATOM   4995 C  CG1   . VAL A 1 608 ? 5.957   -17.370 75.411 1.00 51.06  ? 608  VAL A CG1   1 
ATOM   4996 C  CG2   . VAL A 1 608 ? 7.828   -18.072 73.879 1.00 50.78  ? 608  VAL A CG2   1 
ATOM   4997 N  N     . CYS A 1 609 ? 10.675  -17.662 75.630 1.00 57.72  ? 609  CYS A N     1 
ATOM   4998 C  CA    . CYS A 1 609 ? 11.977  -18.320 75.523 1.00 59.71  ? 609  CYS A CA    1 
ATOM   4999 C  C     . CYS A 1 609 ? 13.013  -17.800 76.519 1.00 61.56  ? 609  CYS A C     1 
ATOM   5000 O  O     . CYS A 1 609 ? 14.189  -18.180 76.455 1.00 62.01  ? 609  CYS A O     1 
ATOM   5001 C  CB    . CYS A 1 609 ? 12.518  -18.200 74.100 1.00 59.41  ? 609  CYS A CB    1 
ATOM   5002 S  SG    . CYS A 1 609 ? 11.591  -19.175 72.913 1.00 61.92  ? 609  CYS A SG    1 
ATOM   5003 N  N     . GLY A 1 610 ? 12.576  -16.938 77.434 1.00 62.93  ? 610  GLY A N     1 
ATOM   5004 C  CA    . GLY A 1 610 ? 13.467  -16.351 78.433 1.00 65.05  ? 610  GLY A CA    1 
ATOM   5005 C  C     . GLY A 1 610 ? 14.698  -15.739 77.801 1.00 66.51  ? 610  GLY A C     1 
ATOM   5006 O  O     . GLY A 1 610 ? 15.822  -16.195 78.023 1.00 67.19  ? 610  GLY A O     1 
ATOM   5007 N  N     . THR A 1 611 ? 14.467  -14.719 76.984 1.00 66.98  ? 611  THR A N     1 
ATOM   5008 C  CA    . THR A 1 611 ? 15.533  -13.964 76.340 1.00 67.71  ? 611  THR A CA    1 
ATOM   5009 C  C     . THR A 1 611 ? 15.058  -12.528 76.083 1.00 67.48  ? 611  THR A C     1 
ATOM   5010 O  O     . THR A 1 611 ? 13.901  -12.185 76.360 1.00 66.49  ? 611  THR A O     1 
ATOM   5011 C  CB    . THR A 1 611 ? 16.061  -14.670 75.050 1.00 68.65  ? 611  THR A CB    1 
ATOM   5012 O  OG1   . THR A 1 611 ? 17.034  -13.843 74.399 1.00 70.84  ? 611  THR A OG1   1 
ATOM   5013 C  CG2   . THR A 1 611 ? 14.925  -14.998 74.077 1.00 69.17  ? 611  THR A CG2   1 
ATOM   5014 N  N     . GLU A 1 612 ? 15.959  -11.685 75.588 1.00 67.66  ? 612  GLU A N     1 
ATOM   5015 C  CA    . GLU A 1 612 ? 15.637  -10.285 75.343 1.00 67.90  ? 612  GLU A CA    1 
ATOM   5016 C  C     . GLU A 1 612 ? 16.401  -9.795  74.121 1.00 66.39  ? 612  GLU A C     1 
ATOM   5017 O  O     . GLU A 1 612 ? 17.587  -10.101 73.958 1.00 65.93  ? 612  GLU A O     1 
ATOM   5018 C  CB    . GLU A 1 612 ? 15.984  -9.441  76.574 1.00 69.63  ? 612  GLU A CB    1 
ATOM   5019 C  CG    . GLU A 1 612 ? 14.959  -8.353  76.920 1.00 72.93  ? 612  GLU A CG    1 
ATOM   5020 C  CD    . GLU A 1 612 ? 15.086  -7.835  78.363 1.00 75.60  ? 612  GLU A CD    1 
ATOM   5021 O  OE1   . GLU A 1 612 ? 14.201  -7.067  78.798 1.00 74.92  ? 612  GLU A OE1   1 
ATOM   5022 O  OE2   . GLU A 1 612 ? 16.062  -8.194  79.065 1.00 76.22  ? 612  GLU A OE2   1 
ATOM   5023 N  N     . GLY A 1 613 ? 15.704  -9.062  73.254 1.00 64.06  ? 613  GLY A N     1 
ATOM   5024 C  CA    . GLY A 1 613 ? 16.318  -8.425  72.089 1.00 61.71  ? 613  GLY A CA    1 
ATOM   5025 C  C     . GLY A 1 613 ? 16.775  -9.354  70.980 1.00 59.82  ? 613  GLY A C     1 
ATOM   5026 O  O     . GLY A 1 613 ? 17.491  -8.930  70.069 1.00 59.82  ? 613  GLY A O     1 
ATOM   5027 N  N     . GLU A 1 614 ? 16.371  -10.619 71.053 1.00 57.93  ? 614  GLU A N     1 
ATOM   5028 C  CA    . GLU A 1 614 ? 16.695  -11.583 70.007 1.00 56.57  ? 614  GLU A CA    1 
ATOM   5029 C  C     . GLU A 1 614 ? 15.699  -11.461 68.853 1.00 53.96  ? 614  GLU A C     1 
ATOM   5030 O  O     . GLU A 1 614 ? 14.499  -11.268 69.069 1.00 52.71  ? 614  GLU A O     1 
ATOM   5031 C  CB    . GLU A 1 614 ? 16.720  -13.012 70.567 1.00 58.16  ? 614  GLU A CB    1 
ATOM   5032 C  CG    . GLU A 1 614 ? 17.496  -14.032 69.710 1.00 62.19  ? 614  GLU A CG    1 
ATOM   5033 C  CD    . GLU A 1 614 ? 19.011  -13.817 69.735 1.00 65.14  ? 614  GLU A CD    1 
ATOM   5034 O  OE1   . GLU A 1 614 ? 19.597  -13.729 70.840 1.00 66.03  ? 614  GLU A OE1   1 
ATOM   5035 O  OE2   . GLU A 1 614 ? 19.615  -13.743 68.643 1.00 65.05  ? 614  GLU A OE2   1 
ATOM   5036 N  N     . ALA A 1 615 ? 16.206  -11.559 67.628 1.00 51.23  ? 615  ALA A N     1 
ATOM   5037 C  CA    . ALA A 1 615 ? 15.364  -11.460 66.446 1.00 48.61  ? 615  ALA A CA    1 
ATOM   5038 C  C     . ALA A 1 615 ? 14.857  -12.836 66.010 1.00 46.32  ? 615  ALA A C     1 
ATOM   5039 O  O     . ALA A 1 615 ? 15.619  -13.658 65.504 1.00 47.07  ? 615  ALA A O     1 
ATOM   5040 C  CB    . ALA A 1 615 ? 16.112  -10.765 65.314 1.00 48.61  ? 615  ALA A CB    1 
ATOM   5041 N  N     . PHE A 1 616 ? 13.569  -13.082 66.226 1.00 42.98  ? 616  PHE A N     1 
ATOM   5042 C  CA    . PHE A 1 616 ? 12.946  -14.328 65.796 1.00 41.08  ? 616  PHE A CA    1 
ATOM   5043 C  C     . PHE A 1 616 ? 12.408  -14.220 64.370 1.00 38.88  ? 616  PHE A C     1 
ATOM   5044 O  O     . PHE A 1 616 ? 12.504  -15.171 63.599 1.00 39.82  ? 616  PHE A O     1 
ATOM   5045 C  CB    . PHE A 1 616 ? 11.826  -14.736 66.756 1.00 40.63  ? 616  PHE A CB    1 
ATOM   5046 C  CG    . PHE A 1 616 ? 12.317  -15.275 68.076 1.00 42.87  ? 616  PHE A CG    1 
ATOM   5047 C  CD1   . PHE A 1 616 ? 12.592  -16.635 68.231 1.00 40.56  ? 616  PHE A CD1   1 
ATOM   5048 C  CD2   . PHE A 1 616 ? 12.492  -14.426 69.173 1.00 43.03  ? 616  PHE A CD2   1 
ATOM   5049 C  CE1   . PHE A 1 616 ? 13.045  -17.142 69.455 1.00 44.28  ? 616  PHE A CE1   1 
ATOM   5050 C  CE2   . PHE A 1 616 ? 12.941  -14.927 70.410 1.00 43.97  ? 616  PHE A CE2   1 
ATOM   5051 C  CZ    . PHE A 1 616 ? 13.218  -16.283 70.549 1.00 40.93  ? 616  PHE A CZ    1 
ATOM   5052 N  N     . VAL A 1 617 ? 11.841  -13.061 64.031 1.00 36.95  ? 617  VAL A N     1 
ATOM   5053 C  CA    . VAL A 1 617 ? 11.334  -12.798 62.683 1.00 34.64  ? 617  VAL A CA    1 
ATOM   5054 C  C     . VAL A 1 617 ? 12.519  -12.493 61.761 1.00 34.57  ? 617  VAL A C     1 
ATOM   5055 O  O     . VAL A 1 617 ? 13.165  -11.451 61.872 1.00 34.27  ? 617  VAL A O     1 
ATOM   5056 C  CB    . VAL A 1 617 ? 10.304  -11.641 62.676 1.00 34.81  ? 617  VAL A CB    1 
ATOM   5057 C  CG1   . VAL A 1 617 ? 9.881   -11.280 61.250 1.00 37.38  ? 617  VAL A CG1   1 
ATOM   5058 C  CG2   . VAL A 1 617 ? 9.084   -12.003 63.504 1.00 32.84  ? 617  VAL A CG2   1 
ATOM   5059 N  N     . LEU A 1 618 ? 12.816  -13.423 60.865 1.00 33.45  ? 618  LEU A N     1 
ATOM   5060 C  CA    . LEU A 1 618 ? 14.023  -13.320 60.063 1.00 35.66  ? 618  LEU A CA    1 
ATOM   5061 C  C     . LEU A 1 618 ? 13.767  -12.603 58.746 1.00 35.80  ? 618  LEU A C     1 
ATOM   5062 O  O     . LEU A 1 618 ? 14.712  -12.152 58.083 1.00 38.06  ? 618  LEU A O     1 
ATOM   5063 C  CB    . LEU A 1 618 ? 14.618  -14.715 59.827 1.00 33.69  ? 618  LEU A CB    1 
ATOM   5064 C  CG    . LEU A 1 618 ? 13.855  -15.675 58.909 1.00 36.58  ? 618  LEU A CG    1 
ATOM   5065 C  CD1   . LEU A 1 618 ? 14.596  -15.801 57.579 1.00 33.64  ? 618  LEU A CD1   1 
ATOM   5066 C  CD2   . LEU A 1 618 ? 13.660  -17.042 59.560 1.00 29.53  ? 618  LEU A CD2   1 
ATOM   5067 N  N     . TYR A 1 619 ? 12.488  -12.512 58.377 1.00 34.01  ? 619  TYR A N     1 
ATOM   5068 C  CA    . TYR A 1 619 ? 12.059  -12.017 57.059 1.00 31.60  ? 619  TYR A CA    1 
ATOM   5069 C  C     . TYR A 1 619 ? 10.556  -11.776 57.015 1.00 31.35  ? 619  TYR A C     1 
ATOM   5070 O  O     . TYR A 1 619 ? 9.786   -12.399 57.753 1.00 31.81  ? 619  TYR A O     1 
ATOM   5071 C  CB    . TYR A 1 619 ? 12.434  -13.008 55.946 1.00 28.35  ? 619  TYR A CB    1 
ATOM   5072 C  CG    . TYR A 1 619 ? 12.062  -12.541 54.554 1.00 24.98  ? 619  TYR A CG    1 
ATOM   5073 C  CD1   . TYR A 1 619 ? 11.083  -13.201 53.805 1.00 25.95  ? 619  TYR A CD1   1 
ATOM   5074 C  CD2   . TYR A 1 619 ? 12.673  -11.427 53.990 1.00 28.62  ? 619  TYR A CD2   1 
ATOM   5075 C  CE1   . TYR A 1 619 ? 10.742  -12.767 52.506 1.00 25.30  ? 619  TYR A CE1   1 
ATOM   5076 C  CE2   . TYR A 1 619 ? 12.331  -10.983 52.710 1.00 30.27  ? 619  TYR A CE2   1 
ATOM   5077 C  CZ    . TYR A 1 619 ? 11.376  -11.655 51.978 1.00 28.10  ? 619  TYR A CZ    1 
ATOM   5078 O  OH    . TYR A 1 619 ? 11.071  -11.196 50.721 1.00 33.81  ? 619  TYR A OH    1 
ATOM   5079 N  N     . GLY A 1 620 ? 10.147  -10.877 56.127 1.00 32.76  ? 620  GLY A N     1 
ATOM   5080 C  CA    . GLY A 1 620 ? 8.735   -10.611 55.877 1.00 31.80  ? 620  GLY A CA    1 
ATOM   5081 C  C     . GLY A 1 620 ? 8.546   -9.888  54.563 1.00 30.10  ? 620  GLY A C     1 
ATOM   5082 O  O     . GLY A 1 620 ? 9.374   -9.047  54.190 1.00 29.09  ? 620  GLY A O     1 
ATOM   5083 N  N     . ASP A 1 621 ? 7.467   -10.228 53.856 1.00 29.66  ? 621  ASP A N     1 
ATOM   5084 C  CA    . ASP A 1 621 ? 7.121   -9.570  52.597 1.00 31.61  ? 621  ASP A CA    1 
ATOM   5085 C  C     . ASP A 1 621 ? 5.626   -9.298  52.531 1.00 32.17  ? 621  ASP A C     1 
ATOM   5086 O  O     . ASP A 1 621 ? 4.830   -10.232 52.450 1.00 34.73  ? 621  ASP A O     1 
ATOM   5087 C  CB    . ASP A 1 621 ? 7.567   -10.414 51.391 1.00 30.24  ? 621  ASP A CB    1 
ATOM   5088 C  CG    . ASP A 1 621 ? 7.312   -9.722  50.039 1.00 37.57  ? 621  ASP A CG    1 
ATOM   5089 O  OD1   . ASP A 1 621 ? 6.582   -8.702  49.985 1.00 36.09  ? 621  ASP A OD1   1 
ATOM   5090 O  OD2   . ASP A 1 621 ? 7.845   -10.214 49.010 1.00 37.72  ? 621  ASP A OD2   1 
ATOM   5091 N  N     . THR A 1 622 ? 5.269   -8.014  52.562 1.00 29.21  ? 622  THR A N     1 
ATOM   5092 C  CA    . THR A 1 622 ? 3.890   -7.549  52.396 1.00 30.80  ? 622  THR A CA    1 
ATOM   5093 C  C     . THR A 1 622 ? 2.947   -7.930  53.536 1.00 32.17  ? 622  THR A C     1 
ATOM   5094 O  O     . THR A 1 622 ? 2.486   -7.052  54.264 1.00 34.49  ? 622  THR A O     1 
ATOM   5095 C  CB    . THR A 1 622 ? 3.286   -7.986  51.041 1.00 29.05  ? 622  THR A CB    1 
ATOM   5096 O  OG1   . THR A 1 622 ? 4.183   -7.617  49.987 1.00 32.22  ? 622  THR A OG1   1 
ATOM   5097 C  CG2   . THR A 1 622 ? 1.938   -7.329  50.819 1.00 23.30  ? 622  THR A CG2   1 
ATOM   5098 N  N     . ASP A 1 623 ? 2.664   -9.222  53.686 1.00 35.25  ? 623  ASP A N     1 
ATOM   5099 C  CA    . ASP A 1 623 ? 1.698   -9.708  54.681 1.00 38.71  ? 623  ASP A CA    1 
ATOM   5100 C  C     . ASP A 1 623 ? 2.128   -10.992 55.392 1.00 38.31  ? 623  ASP A C     1 
ATOM   5101 O  O     . ASP A 1 623 ? 1.305   -11.676 56.018 1.00 41.28  ? 623  ASP A O     1 
ATOM   5102 C  CB    . ASP A 1 623 ? 0.345   -9.947  54.003 1.00 39.43  ? 623  ASP A CB    1 
ATOM   5103 C  CG    . ASP A 1 623 ? 0.378   -11.102 53.029 1.00 40.84  ? 623  ASP A CG    1 
ATOM   5104 O  OD1   . ASP A 1 623 ? -0.675  -11.731 52.819 1.00 43.57  ? 623  ASP A OD1   1 
ATOM   5105 O  OD2   . ASP A 1 623 ? 1.453   -11.393 52.470 1.00 45.28  ? 623  ASP A OD2   1 
ATOM   5106 N  N     . SER A 1 624 ? 3.402   -11.334 55.274 1.00 37.37  ? 624  SER A N     1 
ATOM   5107 C  CA    . SER A 1 624 ? 3.897   -12.593 55.810 1.00 39.04  ? 624  SER A CA    1 
ATOM   5108 C  C     . SER A 1 624 ? 5.120   -12.367 56.668 1.00 37.22  ? 624  SER A C     1 
ATOM   5109 O  O     . SER A 1 624 ? 5.899   -11.449 56.410 1.00 38.82  ? 624  SER A O     1 
ATOM   5110 C  CB    . SER A 1 624 ? 4.286   -13.523 54.673 1.00 40.53  ? 624  SER A CB    1 
ATOM   5111 O  OG    . SER A 1 624 ? 5.508   -13.076 54.107 1.00 45.45  ? 624  SER A OG    1 
ATOM   5112 N  N     . ILE A 1 625 ? 5.292   -13.213 57.676 1.00 32.74  ? 625  ILE A N     1 
ATOM   5113 C  CA    . ILE A 1 625 ? 6.525   -13.225 58.451 1.00 33.48  ? 625  ILE A CA    1 
ATOM   5114 C  C     . ILE A 1 625 ? 7.110   -14.630 58.477 1.00 33.72  ? 625  ILE A C     1 
ATOM   5115 O  O     . ILE A 1 625 ? 6.374   -15.616 58.404 1.00 32.64  ? 625  ILE A O     1 
ATOM   5116 C  CB    . ILE A 1 625 ? 6.331   -12.714 59.908 1.00 31.53  ? 625  ILE A CB    1 
ATOM   5117 C  CG1   . ILE A 1 625 ? 5.153   -13.424 60.589 1.00 31.82  ? 625  ILE A CG1   1 
ATOM   5118 C  CG2   . ILE A 1 625 ? 6.152   -11.213 59.921 1.00 32.21  ? 625  ILE A CG2   1 
ATOM   5119 C  CD1   . ILE A 1 625 ? 5.128   -13.307 62.125 1.00 30.37  ? 625  ILE A CD1   1 
ATOM   5120 N  N     . TYR A 1 626 ? 8.435   -14.705 58.574 1.00 34.54  ? 626  TYR A N     1 
ATOM   5121 C  CA    . TYR A 1 626 ? 9.140   -15.972 58.723 1.00 34.53  ? 626  TYR A CA    1 
ATOM   5122 C  C     . TYR A 1 626 ? 9.915   -15.966 60.032 1.00 35.09  ? 626  TYR A C     1 
ATOM   5123 O  O     . TYR A 1 626 ? 10.718  -15.074 60.296 1.00 35.13  ? 626  TYR A O     1 
ATOM   5124 C  CB    . TYR A 1 626 ? 10.034  -16.251 57.511 1.00 33.31  ? 626  TYR A CB    1 
ATOM   5125 C  CG    . TYR A 1 626 ? 9.230   -16.424 56.246 1.00 33.53  ? 626  TYR A CG    1 
ATOM   5126 C  CD1   . TYR A 1 626 ? 8.676   -15.320 55.596 1.00 35.33  ? 626  TYR A CD1   1 
ATOM   5127 C  CD2   . TYR A 1 626 ? 9.000   -17.685 55.707 1.00 35.66  ? 626  TYR A CD2   1 
ATOM   5128 C  CE1   . TYR A 1 626 ? 7.920   -15.461 54.438 1.00 40.68  ? 626  TYR A CE1   1 
ATOM   5129 C  CE2   . TYR A 1 626 ? 8.237   -17.840 54.535 1.00 37.74  ? 626  TYR A CE2   1 
ATOM   5130 C  CZ    . TYR A 1 626 ? 7.704   -16.718 53.911 1.00 40.58  ? 626  TYR A CZ    1 
ATOM   5131 O  OH    . TYR A 1 626 ? 6.947   -16.835 52.763 1.00 45.68  ? 626  TYR A OH    1 
ATOM   5132 N  N     . VAL A 1 627 ? 9.628   -16.964 60.854 1.00 36.20  ? 627  VAL A N     1 
ATOM   5133 C  CA    . VAL A 1 627 ? 10.106  -17.032 62.220 1.00 37.11  ? 627  VAL A CA    1 
ATOM   5134 C  C     . VAL A 1 627 ? 11.116  -18.162 62.314 1.00 37.01  ? 627  VAL A C     1 
ATOM   5135 O  O     . VAL A 1 627 ? 10.808  -19.301 61.956 1.00 35.76  ? 627  VAL A O     1 
ATOM   5136 C  CB    . VAL A 1 627 ? 8.935   -17.342 63.183 1.00 36.41  ? 627  VAL A CB    1 
ATOM   5137 C  CG1   . VAL A 1 627 ? 9.399   -17.312 64.615 1.00 39.61  ? 627  VAL A CG1   1 
ATOM   5138 C  CG2   . VAL A 1 627 ? 7.791   -16.351 62.983 1.00 39.86  ? 627  VAL A CG2   1 
ATOM   5139 N  N     . SER A 1 628 ? 12.323  -17.846 62.773 1.00 37.88  ? 628  SER A N     1 
ATOM   5140 C  CA    . SER A 1 628 ? 13.311  -18.879 63.089 1.00 39.54  ? 628  SER A CA    1 
ATOM   5141 C  C     . SER A 1 628 ? 12.835  -19.648 64.315 1.00 41.58  ? 628  SER A C     1 
ATOM   5142 O  O     . SER A 1 628 ? 12.543  -19.054 65.360 1.00 42.52  ? 628  SER A O     1 
ATOM   5143 C  CB    . SER A 1 628 ? 14.685  -18.261 63.349 1.00 40.87  ? 628  SER A CB    1 
ATOM   5144 O  OG    . SER A 1 628 ? 15.662  -19.263 63.566 1.00 39.69  ? 628  SER A OG    1 
ATOM   5145 N  N     . ALA A 1 629 ? 12.731  -20.965 64.182 1.00 42.43  ? 629  ALA A N     1 
ATOM   5146 C  CA    . ALA A 1 629 ? 12.228  -21.796 65.275 1.00 43.58  ? 629  ALA A CA    1 
ATOM   5147 C  C     . ALA A 1 629 ? 13.326  -22.613 65.958 1.00 44.83  ? 629  ALA A C     1 
ATOM   5148 O  O     . ALA A 1 629 ? 13.031  -23.492 66.759 1.00 46.17  ? 629  ALA A O     1 
ATOM   5149 C  CB    . ALA A 1 629 ? 11.105  -22.701 64.781 1.00 42.20  ? 629  ALA A CB    1 
ATOM   5150 N  N     . ASP A 1 630 ? 14.585  -22.309 65.648 1.00 46.67  ? 630  ASP A N     1 
ATOM   5151 C  CA    . ASP A 1 630 ? 15.727  -23.037 66.201 1.00 47.25  ? 630  ASP A CA    1 
ATOM   5152 C  C     . ASP A 1 630 ? 15.709  -23.050 67.719 1.00 47.72  ? 630  ASP A C     1 
ATOM   5153 O  O     . ASP A 1 630 ? 15.864  -24.103 68.330 1.00 48.92  ? 630  ASP A O     1 
ATOM   5154 C  CB    . ASP A 1 630 ? 17.045  -22.430 65.715 1.00 48.24  ? 630  ASP A CB    1 
ATOM   5155 C  CG    . ASP A 1 630 ? 17.318  -22.706 64.246 1.00 49.64  ? 630  ASP A CG    1 
ATOM   5156 O  OD1   . ASP A 1 630 ? 16.386  -23.119 63.515 1.00 50.37  ? 630  ASP A OD1   1 
ATOM   5157 O  OD2   . ASP A 1 630 ? 18.477  -22.499 63.821 1.00 49.86  ? 630  ASP A OD2   1 
ATOM   5158 N  N     . LYS A 1 631 ? 15.513  -21.880 68.318 1.00 48.57  ? 631  LYS A N     1 
ATOM   5159 C  CA    . LYS A 1 631 ? 15.505  -21.745 69.775 1.00 49.62  ? 631  LYS A CA    1 
ATOM   5160 C  C     . LYS A 1 631 ? 14.329  -22.468 70.431 1.00 49.95  ? 631  LYS A C     1 
ATOM   5161 O  O     . LYS A 1 631 ? 14.444  -22.929 71.567 1.00 49.40  ? 631  LYS A O     1 
ATOM   5162 C  CB    . LYS A 1 631 ? 15.526  -20.268 70.187 1.00 49.96  ? 631  LYS A CB    1 
ATOM   5163 C  CG    . LYS A 1 631 ? 16.881  -19.593 69.995 1.00 51.74  ? 631  LYS A CG    1 
ATOM   5164 C  CD    . LYS A 1 631 ? 16.893  -18.180 70.568 1.00 55.08  ? 631  LYS A CD    1 
ATOM   5165 C  CE    . LYS A 1 631 ? 18.317  -17.676 70.804 1.00 57.34  ? 631  LYS A CE    1 
ATOM   5166 N  NZ    . LYS A 1 631 ? 19.007  -17.301 69.541 1.00 57.94  ? 631  LYS A NZ    1 
ATOM   5167 N  N     . ILE A 1 632 ? 13.210  -22.563 69.710 1.00 50.29  ? 632  ILE A N     1 
ATOM   5168 C  CA    . ILE A 1 632 ? 12.021  -23.280 70.175 1.00 50.03  ? 632  ILE A CA    1 
ATOM   5169 C  C     . ILE A 1 632 ? 12.327  -24.770 70.235 1.00 52.46  ? 632  ILE A C     1 
ATOM   5170 O  O     . ILE A 1 632 ? 11.997  -25.441 71.221 1.00 53.78  ? 632  ILE A O     1 
ATOM   5171 C  CB    . ILE A 1 632 ? 10.793  -23.011 69.259 1.00 49.61  ? 632  ILE A CB    1 
ATOM   5172 C  CG1   . ILE A 1 632 ? 10.339  -21.559 69.399 1.00 46.98  ? 632  ILE A CG1   1 
ATOM   5173 C  CG2   . ILE A 1 632 ? 9.632   -23.971 69.566 1.00 48.17  ? 632  ILE A CG2   1 
ATOM   5174 C  CD1   . ILE A 1 632 ? 9.399   -21.099 68.315 1.00 47.10  ? 632  ILE A CD1   1 
ATOM   5175 N  N     . ILE A 1 633 ? 12.964  -25.272 69.177 1.00 53.07  ? 633  ILE A N     1 
ATOM   5176 C  CA    . ILE A 1 633 ? 13.415  -26.660 69.104 1.00 53.54  ? 633  ILE A CA    1 
ATOM   5177 C  C     . ILE A 1 633 ? 14.506  -26.924 70.157 1.00 55.51  ? 633  ILE A C     1 
ATOM   5178 O  O     . ILE A 1 633 ? 14.502  -27.971 70.808 1.00 54.34  ? 633  ILE A O     1 
ATOM   5179 C  CB    . ILE A 1 633 ? 13.909  -27.021 67.661 1.00 52.63  ? 633  ILE A CB    1 
ATOM   5180 C  CG1   . ILE A 1 633 ? 12.757  -26.950 66.642 1.00 53.04  ? 633  ILE A CG1   1 
ATOM   5181 C  CG2   . ILE A 1 633 ? 14.607  -28.385 67.615 1.00 50.55  ? 633  ILE A CG2   1 
ATOM   5182 C  CD1   . ILE A 1 633 ? 11.592  -27.930 66.881 1.00 50.13  ? 633  ILE A CD1   1 
ATOM   5183 N  N     . ASP A 1 634 ? 15.414  -25.961 70.332 1.00 57.94  ? 634  ASP A N     1 
ATOM   5184 C  CA    . ASP A 1 634 ? 16.528  -26.086 71.285 1.00 60.05  ? 634  ASP A CA    1 
ATOM   5185 C  C     . ASP A 1 634 ? 16.073  -26.164 72.750 1.00 61.69  ? 634  ASP A C     1 
ATOM   5186 O  O     . ASP A 1 634 ? 16.690  -26.865 73.556 1.00 62.54  ? 634  ASP A O     1 
ATOM   5187 C  CB    . ASP A 1 634 ? 17.536  -24.939 71.107 1.00 60.00  ? 634  ASP A CB    1 
ATOM   5188 C  CG    . ASP A 1 634 ? 18.433  -25.115 69.880 1.00 61.50  ? 634  ASP A CG    1 
ATOM   5189 O  OD1   . ASP A 1 634 ? 18.614  -26.262 69.407 1.00 60.44  ? 634  ASP A OD1   1 
ATOM   5190 O  OD2   . ASP A 1 634 ? 18.967  -24.093 69.391 1.00 60.16  ? 634  ASP A OD2   1 
ATOM   5191 N  N     . LYS A 1 635 ? 14.997  -25.451 73.085 1.00 62.75  ? 635  LYS A N     1 
ATOM   5192 C  CA    . LYS A 1 635 ? 14.453  -25.442 74.448 1.00 63.93  ? 635  LYS A CA    1 
ATOM   5193 C  C     . LYS A 1 635 ? 13.981  -26.835 74.885 1.00 63.93  ? 635  LYS A C     1 
ATOM   5194 O  O     . LYS A 1 635 ? 13.965  -27.152 76.077 1.00 64.21  ? 635  LYS A O     1 
ATOM   5195 C  CB    . LYS A 1 635 ? 13.320  -24.415 74.564 1.00 64.01  ? 635  LYS A CB    1 
ATOM   5196 C  CG    . LYS A 1 635 ? 13.007  -23.931 75.989 1.00 67.38  ? 635  LYS A CG    1 
ATOM   5197 C  CD    . LYS A 1 635 ? 14.175  -23.178 76.639 1.00 68.07  ? 635  LYS A CD    1 
ATOM   5198 C  CE    . LYS A 1 635 ? 13.687  -22.061 77.564 1.00 67.76  ? 635  LYS A CE    1 
ATOM   5199 N  NZ    . LYS A 1 635 ? 13.000  -22.545 78.798 1.00 67.90  ? 635  LYS A NZ    1 
ATOM   5200 N  N     . VAL A 1 636 ? 13.624  -27.660 73.904 1.00 63.23  ? 636  VAL A N     1 
ATOM   5201 C  CA    . VAL A 1 636 ? 13.199  -29.039 74.129 1.00 62.29  ? 636  VAL A CA    1 
ATOM   5202 C  C     . VAL A 1 636 ? 14.351  -30.018 73.859 1.00 62.64  ? 636  VAL A C     1 
ATOM   5203 O  O     . VAL A 1 636 ? 14.500  -31.023 74.559 1.00 61.61  ? 636  VAL A O     1 
ATOM   5204 C  CB    . VAL A 1 636 ? 11.963  -29.372 73.248 1.00 61.82  ? 636  VAL A CB    1 
ATOM   5205 C  CG1   . VAL A 1 636 ? 11.689  -30.870 73.191 1.00 60.84  ? 636  VAL A CG1   1 
ATOM   5206 C  CG2   . VAL A 1 636 ? 10.740  -28.619 73.754 1.00 62.49  ? 636  VAL A CG2   1 
ATOM   5207 N  N     . GLY A 1 637 ? 15.162  -29.700 72.850 1.00 64.02  ? 637  GLY A N     1 
ATOM   5208 C  CA    . GLY A 1 637 ? 16.287  -30.533 72.429 1.00 63.54  ? 637  GLY A CA    1 
ATOM   5209 C  C     . GLY A 1 637 ? 15.911  -31.426 71.263 1.00 65.07  ? 637  GLY A C     1 
ATOM   5210 O  O     . GLY A 1 637 ? 14.854  -32.055 71.278 1.00 65.25  ? 637  GLY A O     1 
ATOM   5211 N  N     . GLU A 1 638 ? 16.769  -31.481 70.245 1.00 65.98  ? 638  GLU A N     1 
ATOM   5212 C  CA    . GLU A 1 638 ? 16.586  -32.423 69.134 1.00 67.52  ? 638  GLU A CA    1 
ATOM   5213 C  C     . GLU A 1 638 ? 16.714  -33.868 69.618 1.00 68.68  ? 638  GLU A C     1 
ATOM   5214 O  O     . GLU A 1 638 ? 16.438  -34.807 68.864 1.00 69.36  ? 638  GLU A O     1 
ATOM   5215 C  CB    . GLU A 1 638 ? 17.619  -32.172 68.031 1.00 68.06  ? 638  GLU A CB    1 
ATOM   5216 C  CG    . GLU A 1 638 ? 17.279  -31.054 67.054 1.00 68.14  ? 638  GLU A CG    1 
ATOM   5217 C  CD    . GLU A 1 638 ? 18.344  -30.866 65.973 1.00 71.34  ? 638  GLU A CD    1 
ATOM   5218 O  OE1   . GLU A 1 638 ? 19.550  -31.025 66.272 1.00 70.52  ? 638  GLU A OE1   1 
ATOM   5219 O  OE2   . GLU A 1 638 ? 17.974  -30.549 64.819 1.00 72.91  ? 638  GLU A OE2   1 
ATOM   5220 N  N     . SER A 1 639 ? 17.107  -34.012 70.887 1.00 69.06  ? 639  SER A N     1 
ATOM   5221 C  CA    . SER A 1 639 ? 17.547  -35.277 71.507 1.00 69.11  ? 639  SER A CA    1 
ATOM   5222 C  C     . SER A 1 639 ? 16.945  -36.597 70.966 1.00 68.60  ? 639  SER A C     1 
ATOM   5223 O  O     . SER A 1 639 ? 17.713  -37.360 70.377 1.00 69.44  ? 639  SER A O     1 
ATOM   5224 C  CB    . SER A 1 639 ? 17.529  -35.203 73.051 1.00 69.84  ? 639  SER A CB    1 
ATOM   5225 O  OG    . SER A 1 639 ? 18.073  -33.979 73.529 1.00 69.05  ? 639  SER A OG    1 
ATOM   5226 N  N     . LYS A 1 640 ? 15.650  -36.938 71.122 1.00 66.90  ? 640  LYS A N     1 
ATOM   5227 C  CA    . LYS A 1 640 ? 14.534  -36.331 71.906 1.00 65.47  ? 640  LYS A CA    1 
ATOM   5228 C  C     . LYS A 1 640 ? 13.217  -36.464 71.132 1.00 63.48  ? 640  LYS A C     1 
ATOM   5229 O  O     . LYS A 1 640 ? 12.172  -36.752 71.723 1.00 62.29  ? 640  LYS A O     1 
ATOM   5230 C  CB    . LYS A 1 640 ? 14.747  -34.880 72.359 1.00 66.41  ? 640  LYS A CB    1 
ATOM   5231 C  CG    . LYS A 1 640 ? 13.671  -34.310 73.315 1.00 69.43  ? 640  LYS A CG    1 
ATOM   5232 C  CD    . LYS A 1 640 ? 13.368  -35.201 74.531 1.00 73.20  ? 640  LYS A CD    1 
ATOM   5233 C  CE    . LYS A 1 640 ? 14.536  -35.285 75.511 1.00 75.17  ? 640  LYS A CE    1 
ATOM   5234 N  NZ    . LYS A 1 640 ? 14.180  -36.100 76.712 1.00 77.43  ? 640  LYS A NZ    1 
ATOM   5235 N  N     . PHE A 1 641 ? 13.270  -36.247 69.818 1.00 60.97  ? 641  PHE A N     1 
ATOM   5236 C  CA    . PHE A 1 641 ? 12.123  -36.529 68.959 1.00 59.28  ? 641  PHE A CA    1 
ATOM   5237 C  C     . PHE A 1 641 ? 12.213  -37.933 68.366 1.00 59.06  ? 641  PHE A C     1 
ATOM   5238 O  O     . PHE A 1 641 ? 13.302  -38.422 68.068 1.00 58.08  ? 641  PHE A O     1 
ATOM   5239 C  CB    . PHE A 1 641 ? 11.963  -35.467 67.867 1.00 58.65  ? 641  PHE A CB    1 
ATOM   5240 C  CG    . PHE A 1 641 ? 11.505  -34.130 68.387 1.00 55.30  ? 641  PHE A CG    1 
ATOM   5241 C  CD1   . PHE A 1 641 ? 12.422  -33.116 68.639 1.00 52.12  ? 641  PHE A CD1   1 
ATOM   5242 C  CD2   . PHE A 1 641 ? 10.158  -33.887 68.640 1.00 51.81  ? 641  PHE A CD2   1 
ATOM   5243 C  CE1   . PHE A 1 641 ? 12.003  -31.881 69.134 1.00 48.25  ? 641  PHE A CE1   1 
ATOM   5244 C  CE2   . PHE A 1 641 ? 9.733   -32.658 69.137 1.00 48.42  ? 641  PHE A CE2   1 
ATOM   5245 C  CZ    . PHE A 1 641 ? 10.659  -31.654 69.380 1.00 45.68  ? 641  PHE A CZ    1 
ATOM   5246 N  N     . ARG A 1 642 ? 11.057  -38.576 68.222 1.00 60.06  ? 642  ARG A N     1 
ATOM   5247 C  CA    . ARG A 1 642 ? 10.957  -39.929 67.667 1.00 60.02  ? 642  ARG A CA    1 
ATOM   5248 C  C     . ARG A 1 642 ? 11.328  -39.958 66.186 1.00 58.14  ? 642  ARG A C     1 
ATOM   5249 O  O     . ARG A 1 642 ? 12.073  -40.832 65.747 1.00 56.52  ? 642  ARG A O     1 
ATOM   5250 C  CB    . ARG A 1 642 ? 9.541   -40.484 67.871 1.00 62.11  ? 642  ARG A CB    1 
ATOM   5251 C  CG    . ARG A 1 642 ? 9.212   -40.847 69.316 1.00 66.73  ? 642  ARG A CG    1 
ATOM   5252 C  CD    . ARG A 1 642 ? 7.757   -41.294 69.480 1.00 71.22  ? 642  ARG A CD    1 
ATOM   5253 N  NE    . ARG A 1 642 ? 6.937   -40.317 70.203 1.00 73.49  ? 642  ARG A NE    1 
ATOM   5254 C  CZ    . ARG A 1 642 ? 6.179   -39.380 69.632 1.00 75.08  ? 642  ARG A CZ    1 
ATOM   5255 N  NH1   . ARG A 1 642 ? 6.120   -39.263 68.309 1.00 73.49  ? 642  ARG A NH1   1 
ATOM   5256 N  NH2   . ARG A 1 642 ? 5.474   -38.552 70.393 1.00 75.01  ? 642  ARG A NH2   1 
ATOM   5257 N  N     . ASP A 1 643 ? 10.799  -38.994 65.430 1.00 56.75  ? 643  ASP A N     1 
ATOM   5258 C  CA    . ASP A 1 643 ? 11.093  -38.840 64.005 1.00 54.42  ? 643  ASP A CA    1 
ATOM   5259 C  C     . ASP A 1 643 ? 10.824  -37.401 63.522 1.00 53.55  ? 643  ASP A C     1 
ATOM   5260 O  O     . ASP A 1 643 ? 10.600  -36.499 64.339 1.00 52.59  ? 643  ASP A O     1 
ATOM   5261 C  CB    . ASP A 1 643 ? 10.316  -39.872 63.168 1.00 54.81  ? 643  ASP A CB    1 
ATOM   5262 C  CG    . ASP A 1 643 ? 8.834   -39.921 63.501 1.00 56.80  ? 643  ASP A CG    1 
ATOM   5263 O  OD1   . ASP A 1 643 ? 8.257   -38.884 63.895 1.00 58.46  ? 643  ASP A OD1   1 
ATOM   5264 O  OD2   . ASP A 1 643 ? 8.237   -41.008 63.353 1.00 58.14  ? 643  ASP A OD2   1 
ATOM   5265 N  N     . THR A 1 644 ? 10.867  -37.192 62.204 1.00 50.51  ? 644  THR A N     1 
ATOM   5266 C  CA    . THR A 1 644 ? 10.574  -35.887 61.613 1.00 48.36  ? 644  THR A CA    1 
ATOM   5267 C  C     . THR A 1 644 ? 9.163   -35.417 61.972 1.00 46.78  ? 644  THR A C     1 
ATOM   5268 O  O     . THR A 1 644 ? 8.975   -34.319 62.504 1.00 44.90  ? 644  THR A O     1 
ATOM   5269 C  CB    . THR A 1 644 ? 10.721  -35.910 60.073 1.00 49.13  ? 644  THR A CB    1 
ATOM   5270 O  OG1   . THR A 1 644 ? 12.069  -36.234 59.712 1.00 47.86  ? 644  THR A OG1   1 
ATOM   5271 C  CG2   . THR A 1 644 ? 10.366  -34.553 59.495 1.00 48.86  ? 644  THR A CG2   1 
ATOM   5272 N  N     . ASN A 1 645 ? 8.181   -36.266 61.681 1.00 45.82  ? 645  ASN A N     1 
ATOM   5273 C  CA    . ASN A 1 645 ? 6.780   -35.980 61.956 1.00 45.68  ? 645  ASN A CA    1 
ATOM   5274 C  C     . ASN A 1 645 ? 6.521   -35.561 63.405 1.00 46.08  ? 645  ASN A C     1 
ATOM   5275 O  O     . ASN A 1 645 ? 5.598   -34.787 63.670 1.00 46.65  ? 645  ASN A O     1 
ATOM   5276 C  CB    . ASN A 1 645 ? 5.907   -37.183 61.578 1.00 46.94  ? 645  ASN A CB    1 
ATOM   5277 C  CG    . ASN A 1 645 ? 4.461   -36.797 61.326 1.00 51.70  ? 645  ASN A CG    1 
ATOM   5278 O  OD1   . ASN A 1 645 ? 4.154   -36.066 60.377 1.00 53.01  ? 645  ASN A OD1   1 
ATOM   5279 N  ND2   . ASN A 1 645 ? 3.563   -37.280 62.181 1.00 50.94  ? 645  ASN A ND2   1 
ATOM   5280 N  N     . HIS A 1 646 ? 7.346   -36.050 64.332 1.00 45.50  ? 646  HIS A N     1 
ATOM   5281 C  CA    . HIS A 1 646 ? 7.220   -35.673 65.740 1.00 46.91  ? 646  HIS A CA    1 
ATOM   5282 C  C     . HIS A 1 646 ? 7.467   -34.177 65.971 1.00 46.17  ? 646  HIS A C     1 
ATOM   5283 O  O     . HIS A 1 646 ? 6.612   -33.497 66.555 1.00 46.82  ? 646  HIS A O     1 
ATOM   5284 C  CB    . HIS A 1 646 ? 8.110   -36.546 66.642 1.00 48.89  ? 646  HIS A CB    1 
ATOM   5285 C  CG    . HIS A 1 646 ? 7.871   -36.352 68.113 1.00 52.50  ? 646  HIS A CG    1 
ATOM   5286 N  ND1   . HIS A 1 646 ? 8.833   -36.623 69.064 1.00 54.81  ? 646  HIS A ND1   1 
ATOM   5287 C  CD2   . HIS A 1 646 ? 6.787   -35.905 68.795 1.00 53.23  ? 646  HIS A CD2   1 
ATOM   5288 C  CE1   . HIS A 1 646 ? 8.352   -36.356 70.266 1.00 54.06  ? 646  HIS A CE1   1 
ATOM   5289 N  NE2   . HIS A 1 646 ? 7.114   -35.916 70.131 1.00 52.15  ? 646  HIS A NE2   1 
ATOM   5290 N  N     . TRP A 1 647 ? 8.599   -33.649 65.503 1.00 43.26  ? 647  TRP A N     1 
ATOM   5291 C  CA    . TRP A 1 647 ? 8.870   -32.215 65.704 1.00 43.12  ? 647  TRP A CA    1 
ATOM   5292 C  C     . TRP A 1 647 ? 7.954   -31.290 64.887 1.00 42.02  ? 647  TRP A C     1 
ATOM   5293 O  O     . TRP A 1 647 ? 7.736   -30.145 65.266 1.00 44.43  ? 647  TRP A O     1 
ATOM   5294 C  CB    . TRP A 1 647 ? 10.369  -31.849 65.555 1.00 42.02  ? 647  TRP A CB    1 
ATOM   5295 C  CG    . TRP A 1 647 ? 10.985  -31.972 64.170 1.00 40.86  ? 647  TRP A CG    1 
ATOM   5296 C  CD1   . TRP A 1 647 ? 11.846  -32.939 63.747 1.00 40.84  ? 647  TRP A CD1   1 
ATOM   5297 C  CD2   . TRP A 1 647 ? 10.817  -31.072 63.055 1.00 41.65  ? 647  TRP A CD2   1 
ATOM   5298 N  NE1   . TRP A 1 647 ? 12.212  -32.714 62.438 1.00 43.40  ? 647  TRP A NE1   1 
ATOM   5299 C  CE2   . TRP A 1 647 ? 11.596  -31.575 61.990 1.00 41.12  ? 647  TRP A CE2   1 
ATOM   5300 C  CE3   . TRP A 1 647 ? 10.078  -29.894 62.854 1.00 40.56  ? 647  TRP A CE3   1 
ATOM   5301 C  CZ2   . TRP A 1 647 ? 11.661  -30.942 60.736 1.00 42.28  ? 647  TRP A CZ2   1 
ATOM   5302 C  CZ3   . TRP A 1 647 ? 10.138  -29.268 61.601 1.00 41.22  ? 647  TRP A CZ3   1 
ATOM   5303 C  CH2   . TRP A 1 647 ? 10.927  -29.795 60.562 1.00 37.86  ? 647  TRP A CH2   1 
ATOM   5304 N  N     . VAL A 1 648 ? 7.420   -31.797 63.778 1.00 41.19  ? 648  VAL A N     1 
ATOM   5305 C  CA    . VAL A 1 648 ? 6.474   -31.045 62.958 1.00 41.00  ? 648  VAL A CA    1 
ATOM   5306 C  C     . VAL A 1 648 ? 5.137   -30.910 63.700 1.00 41.75  ? 648  VAL A C     1 
ATOM   5307 O  O     . VAL A 1 648 ? 4.561   -29.814 63.748 1.00 39.29  ? 648  VAL A O     1 
ATOM   5308 C  CB    . VAL A 1 648 ? 6.280   -31.686 61.555 1.00 40.14  ? 648  VAL A CB    1 
ATOM   5309 C  CG1   . VAL A 1 648 ? 5.286   -30.902 60.737 1.00 38.94  ? 648  VAL A CG1   1 
ATOM   5310 C  CG2   . VAL A 1 648 ? 7.600   -31.765 60.814 1.00 38.00  ? 648  VAL A CG2   1 
ATOM   5311 N  N     . ASP A 1 649 ? 4.661   -32.012 64.290 1.00 42.34  ? 649  ASP A N     1 
ATOM   5312 C  CA    . ASP A 1 649 ? 3.456   -31.975 65.130 1.00 44.31  ? 649  ASP A CA    1 
ATOM   5313 C  C     . ASP A 1 649 ? 3.637   -30.988 66.281 1.00 43.28  ? 649  ASP A C     1 
ATOM   5314 O  O     . ASP A 1 649 ? 2.704   -30.276 66.646 1.00 45.73  ? 649  ASP A O     1 
ATOM   5315 C  CB    . ASP A 1 649 ? 3.089   -33.368 65.668 1.00 46.49  ? 649  ASP A CB    1 
ATOM   5316 C  CG    . ASP A 1 649 ? 2.334   -34.225 64.648 1.00 51.07  ? 649  ASP A CG    1 
ATOM   5317 O  OD1   . ASP A 1 649 ? 1.399   -33.716 63.991 1.00 54.28  ? 649  ASP A OD1   1 
ATOM   5318 O  OD2   . ASP A 1 649 ? 2.665   -35.426 64.517 1.00 55.50  ? 649  ASP A OD2   1 
ATOM   5319 N  N     . PHE A 1 650 ? 4.850   -30.937 66.823 1.00 42.33  ? 650  PHE A N     1 
ATOM   5320 C  CA    . PHE A 1 650 ? 5.202   -30.019 67.901 1.00 41.54  ? 650  PHE A CA    1 
ATOM   5321 C  C     . PHE A 1 650 ? 5.123   -28.546 67.493 1.00 41.48  ? 650  PHE A C     1 
ATOM   5322 O  O     . PHE A 1 650 ? 4.559   -27.726 68.218 1.00 42.85  ? 650  PHE A O     1 
ATOM   5323 C  CB    . PHE A 1 650 ? 6.600   -30.352 68.440 1.00 42.25  ? 650  PHE A CB    1 
ATOM   5324 C  CG    . PHE A 1 650 ? 7.098   -29.388 69.485 1.00 45.37  ? 650  PHE A CG    1 
ATOM   5325 C  CD1   . PHE A 1 650 ? 6.546   -29.376 70.763 1.00 45.16  ? 650  PHE A CD1   1 
ATOM   5326 C  CD2   . PHE A 1 650 ? 8.121   -28.492 69.189 1.00 45.76  ? 650  PHE A CD2   1 
ATOM   5327 C  CE1   . PHE A 1 650 ? 7.003   -28.480 71.724 1.00 46.33  ? 650  PHE A CE1   1 
ATOM   5328 C  CE2   . PHE A 1 650 ? 8.586   -27.599 70.147 1.00 46.12  ? 650  PHE A CE2   1 
ATOM   5329 C  CZ    . PHE A 1 650 ? 8.026   -27.593 71.417 1.00 44.55  ? 650  PHE A CZ    1 
ATOM   5330 N  N     . LEU A 1 651 ? 5.693   -28.205 66.343 1.00 41.09  ? 651  LEU A N     1 
ATOM   5331 C  CA    . LEU A 1 651 ? 5.670   -26.818 65.875 1.00 40.15  ? 651  LEU A CA    1 
ATOM   5332 C  C     . LEU A 1 651 ? 4.257   -26.397 65.467 1.00 38.26  ? 651  LEU A C     1 
ATOM   5333 O  O     . LEU A 1 651 ? 3.832   -25.264 65.730 1.00 33.50  ? 651  LEU A O     1 
ATOM   5334 C  CB    . LEU A 1 651 ? 6.670   -26.595 64.732 1.00 39.72  ? 651  LEU A CB    1 
ATOM   5335 C  CG    . LEU A 1 651 ? 8.159   -26.709 65.083 1.00 42.03  ? 651  LEU A CG    1 
ATOM   5336 C  CD1   . LEU A 1 651 ? 9.024   -26.462 63.841 1.00 38.09  ? 651  LEU A CD1   1 
ATOM   5337 C  CD2   . LEU A 1 651 ? 8.567   -25.754 66.218 1.00 39.97  ? 651  LEU A CD2   1 
ATOM   5338 N  N     . ASP A 1 652 ? 3.538   -27.324 64.841 1.00 37.78  ? 652  ASP A N     1 
ATOM   5339 C  CA    . ASP A 1 652 ? 2.142   -27.114 64.488 1.00 39.17  ? 652  ASP A CA    1 
ATOM   5340 C  C     . ASP A 1 652 ? 1.367   -26.736 65.742 1.00 40.61  ? 652  ASP A C     1 
ATOM   5341 O  O     . ASP A 1 652 ? 0.743   -25.675 65.797 1.00 42.15  ? 652  ASP A O     1 
ATOM   5342 C  CB    . ASP A 1 652 ? 1.558   -28.379 63.846 1.00 39.02  ? 652  ASP A CB    1 
ATOM   5343 C  CG    . ASP A 1 652 ? 0.181   -28.159 63.242 1.00 40.48  ? 652  ASP A CG    1 
ATOM   5344 O  OD1   . ASP A 1 652 ? -0.221  -26.994 63.011 1.00 44.73  ? 652  ASP A OD1   1 
ATOM   5345 O  OD2   . ASP A 1 652 ? -0.505  -29.164 62.984 1.00 41.18  ? 652  ASP A OD2   1 
ATOM   5346 N  N     . LYS A 1 653 ? 1.441   -27.590 66.760 1.00 42.56  ? 653  LYS A N     1 
ATOM   5347 C  CA    . LYS A 1 653 ? 0.753   -27.343 68.025 1.00 44.58  ? 653  LYS A CA    1 
ATOM   5348 C  C     . LYS A 1 653 ? 1.137   -25.990 68.640 1.00 42.31  ? 653  LYS A C     1 
ATOM   5349 O  O     . LYS A 1 653 ? 0.266   -25.233 69.067 1.00 42.90  ? 653  LYS A O     1 
ATOM   5350 C  CB    . LYS A 1 653 ? 1.021   -28.488 69.000 1.00 47.30  ? 653  LYS A CB    1 
ATOM   5351 C  CG    . LYS A 1 653 ? -0.140  -28.786 69.944 1.00 55.89  ? 653  LYS A CG    1 
ATOM   5352 C  CD    . LYS A 1 653 ? -0.045  -30.192 70.569 1.00 62.65  ? 653  LYS A CD    1 
ATOM   5353 C  CE    . LYS A 1 653 ? -0.462  -31.286 69.579 1.00 65.27  ? 653  LYS A CE    1 
ATOM   5354 N  NZ    . LYS A 1 653 ? -0.511  -32.637 70.207 1.00 65.69  ? 653  LYS A NZ    1 
ATOM   5355 N  N     . PHE A 1 654 ? 2.434   -25.686 68.650 1.00 40.01  ? 654  PHE A N     1 
ATOM   5356 C  CA    . PHE A 1 654 ? 2.959   -24.441 69.211 1.00 40.16  ? 654  PHE A CA    1 
ATOM   5357 C  C     . PHE A 1 654 ? 2.470   -23.198 68.460 1.00 43.95  ? 654  PHE A C     1 
ATOM   5358 O  O     . PHE A 1 654 ? 2.204   -22.159 69.073 1.00 45.74  ? 654  PHE A O     1 
ATOM   5359 C  CB    . PHE A 1 654 ? 4.492   -24.482 69.220 1.00 39.90  ? 654  PHE A CB    1 
ATOM   5360 C  CG    . PHE A 1 654 ? 5.142   -23.347 69.981 1.00 38.65  ? 654  PHE A CG    1 
ATOM   5361 C  CD1   . PHE A 1 654 ? 5.498   -22.168 69.335 1.00 38.88  ? 654  PHE A CD1   1 
ATOM   5362 C  CD2   . PHE A 1 654 ? 5.429   -23.475 71.334 1.00 37.18  ? 654  PHE A CD2   1 
ATOM   5363 C  CE1   . PHE A 1 654 ? 6.110   -21.127 70.029 1.00 38.36  ? 654  PHE A CE1   1 
ATOM   5364 C  CE2   . PHE A 1 654 ? 6.048   -22.441 72.031 1.00 39.31  ? 654  PHE A CE2   1 
ATOM   5365 C  CZ    . PHE A 1 654 ? 6.387   -21.265 71.377 1.00 36.42  ? 654  PHE A CZ    1 
ATOM   5366 N  N     . ALA A 1 655 ? 2.361   -23.302 67.137 1.00 44.97  ? 655  ALA A N     1 
ATOM   5367 C  CA    . ALA A 1 655 ? 1.863   -22.198 66.321 1.00 46.69  ? 655  ALA A CA    1 
ATOM   5368 C  C     . ALA A 1 655 ? 0.372   -21.976 66.562 1.00 49.39  ? 655  ALA A C     1 
ATOM   5369 O  O     . ALA A 1 655 ? -0.090  -20.837 66.712 1.00 49.77  ? 655  ALA A O     1 
ATOM   5370 C  CB    . ALA A 1 655 ? 2.130   -22.466 64.850 1.00 45.55  ? 655  ALA A CB    1 
ATOM   5371 N  N     . ARG A 1 656 ? -0.366  -23.081 66.615 1.00 51.84  ? 656  ARG A N     1 
ATOM   5372 C  CA    . ARG A 1 656 ? -1.813  -23.050 66.700 1.00 53.35  ? 656  ARG A CA    1 
ATOM   5373 C  C     . ARG A 1 656 ? -2.275  -22.659 68.101 1.00 53.47  ? 656  ARG A C     1 
ATOM   5374 O  O     . ARG A 1 656 ? -3.181  -21.837 68.250 1.00 54.45  ? 656  ARG A O     1 
ATOM   5375 C  CB    . ARG A 1 656 ? -2.384  -24.410 66.286 1.00 55.04  ? 656  ARG A CB    1 
ATOM   5376 C  CG    . ARG A 1 656 ? -3.860  -24.403 65.901 1.00 61.14  ? 656  ARG A CG    1 
ATOM   5377 C  CD    . ARG A 1 656 ? -4.309  -25.751 65.331 1.00 66.47  ? 656  ARG A CD    1 
ATOM   5378 N  NE    . ARG A 1 656 ? -4.188  -26.842 66.303 1.00 70.39  ? 656  ARG A NE    1 
ATOM   5379 C  CZ    . ARG A 1 656 ? -3.273  -27.809 66.247 1.00 70.93  ? 656  ARG A CZ    1 
ATOM   5380 N  NH1   . ARG A 1 656 ? -2.389  -27.842 65.257 1.00 70.97  ? 656  ARG A NH1   1 
ATOM   5381 N  NH2   . ARG A 1 656 ? -3.243  -28.752 67.182 1.00 69.56  ? 656  ARG A NH2   1 
ATOM   5382 N  N     . GLU A 1 657 ? -1.631  -23.225 69.118 1.00 52.45  ? 657  GLU A N     1 
ATOM   5383 C  CA    . GLU A 1 657 ? -2.082  -23.055 70.499 1.00 53.07  ? 657  GLU A CA    1 
ATOM   5384 C  C     . GLU A 1 657 ? -1.433  -21.899 71.255 1.00 51.55  ? 657  GLU A C     1 
ATOM   5385 O  O     . GLU A 1 657 ? -2.036  -21.357 72.180 1.00 50.29  ? 657  GLU A O     1 
ATOM   5386 C  CB    . GLU A 1 657 ? -1.926  -24.362 71.290 1.00 53.95  ? 657  GLU A CB    1 
ATOM   5387 C  CG    . GLU A 1 657 ? -2.907  -25.460 70.875 1.00 58.21  ? 657  GLU A CG    1 
ATOM   5388 C  CD    . GLU A 1 657 ? -2.763  -26.742 71.689 1.00 61.66  ? 657  GLU A CD    1 
ATOM   5389 O  OE1   . GLU A 1 657 ? -1.633  -27.071 72.111 1.00 64.06  ? 657  GLU A OE1   1 
ATOM   5390 O  OE2   . GLU A 1 657 ? -3.788  -27.426 71.906 1.00 61.28  ? 657  GLU A OE2   1 
ATOM   5391 N  N     . ARG A 1 658 ? -0.221  -21.512 70.861 1.00 50.32  ? 658  ARG A N     1 
ATOM   5392 C  CA    . ARG A 1 658 ? 0.489   -20.433 71.554 1.00 49.99  ? 658  ARG A CA    1 
ATOM   5393 C  C     . ARG A 1 658 ? 0.684   -19.173 70.702 1.00 49.84  ? 658  ARG A C     1 
ATOM   5394 O  O     . ARG A 1 658 ? 0.315   -18.071 71.113 1.00 50.85  ? 658  ARG A O     1 
ATOM   5395 C  CB    . ARG A 1 658 ? 1.837   -20.925 72.096 1.00 50.56  ? 658  ARG A CB    1 
ATOM   5396 C  CG    . ARG A 1 658 ? 1.762   -22.192 72.939 1.00 53.82  ? 658  ARG A CG    1 
ATOM   5397 C  CD    . ARG A 1 658 ? 1.091   -21.938 74.281 1.00 55.72  ? 658  ARG A CD    1 
ATOM   5398 N  NE    . ARG A 1 658 ? 0.915   -23.179 75.026 1.00 59.74  ? 658  ARG A NE    1 
ATOM   5399 C  CZ    . ARG A 1 658 ? 0.549   -23.251 76.304 1.00 62.58  ? 658  ARG A CZ    1 
ATOM   5400 N  NH1   . ARG A 1 658 ? 0.314   -22.144 77.005 1.00 62.23  ? 658  ARG A NH1   1 
ATOM   5401 N  NH2   . ARG A 1 658 ? 0.421   -24.439 76.886 1.00 60.86  ? 658  ARG A NH2   1 
ATOM   5402 N  N     . MET A 1 659 ? 1.254   -19.339 69.512 1.00 49.83  ? 659  MET A N     1 
ATOM   5403 C  CA    . MET A 1 659 ? 1.609   -18.196 68.669 1.00 46.32  ? 659  MET A CA    1 
ATOM   5404 C  C     . MET A 1 659 ? 0.420   -17.450 68.067 1.00 44.02  ? 659  MET A C     1 
ATOM   5405 O  O     . MET A 1 659 ? 0.361   -16.221 68.133 1.00 44.02  ? 659  MET A O     1 
ATOM   5406 C  CB    . MET A 1 659 ? 2.579   -18.618 67.577 1.00 45.64  ? 659  MET A CB    1 
ATOM   5407 C  CG    . MET A 1 659 ? 3.941   -18.985 68.105 1.00 49.10  ? 659  MET A CG    1 
ATOM   5408 S  SD    . MET A 1 659 ? 5.183   -18.962 66.814 1.00 48.37  ? 659  MET A SD    1 
ATOM   5409 C  CE    . MET A 1 659 ? 5.402   -17.201 66.572 1.00 42.15  ? 659  MET A CE    1 
ATOM   5410 N  N     . GLU A 1 660 ? -0.519  -18.188 67.482 1.00 42.54  ? 660  GLU A N     1 
ATOM   5411 C  CA    . GLU A 1 660 ? -1.692  -17.573 66.852 1.00 41.04  ? 660  GLU A CA    1 
ATOM   5412 C  C     . GLU A 1 660 ? -2.565  -16.735 67.822 1.00 40.44  ? 660  GLU A C     1 
ATOM   5413 O  O     . GLU A 1 660 ? -3.003  -15.648 67.451 1.00 39.20  ? 660  GLU A O     1 
ATOM   5414 C  CB    . GLU A 1 660 ? -2.511  -18.610 66.060 1.00 41.31  ? 660  GLU A CB    1 
ATOM   5415 C  CG    . GLU A 1 660 ? -1.968  -18.897 64.650 1.00 42.47  ? 660  GLU A CG    1 
ATOM   5416 C  CD    . GLU A 1 660 ? -2.737  -19.993 63.899 1.00 48.08  ? 660  GLU A CD    1 
ATOM   5417 O  OE1   . GLU A 1 660 ? -2.158  -20.601 62.968 1.00 46.70  ? 660  GLU A OE1   1 
ATOM   5418 O  OE2   . GLU A 1 660 ? -3.918  -20.250 64.231 1.00 49.35  ? 660  GLU A OE2   1 
ATOM   5419 N  N     . PRO A 1 661 ? -2.807  -17.221 69.068 1.00 40.25  ? 661  PRO A N     1 
ATOM   5420 C  CA    . PRO A 1 661 ? -3.495  -16.341 70.028 1.00 40.84  ? 661  PRO A CA    1 
ATOM   5421 C  C     . PRO A 1 661 ? -2.732  -15.051 70.351 1.00 39.84  ? 661  PRO A C     1 
ATOM   5422 O  O     . PRO A 1 661 ? -3.343  -13.984 70.437 1.00 40.98  ? 661  PRO A O     1 
ATOM   5423 C  CB    . PRO A 1 661 ? -3.630  -17.220 71.275 1.00 40.46  ? 661  PRO A CB    1 
ATOM   5424 C  CG    . PRO A 1 661 ? -3.733  -18.592 70.723 1.00 41.65  ? 661  PRO A CG    1 
ATOM   5425 C  CD    . PRO A 1 661 ? -2.770  -18.612 69.556 1.00 38.79  ? 661  PRO A CD    1 
ATOM   5426 N  N     . ALA A 1 662 ? -1.415  -15.152 70.516 1.00 36.95  ? 662  ALA A N     1 
ATOM   5427 C  CA    . ALA A 1 662 ? -0.574  -13.974 70.718 1.00 36.13  ? 662  ALA A CA    1 
ATOM   5428 C  C     . ALA A 1 662 ? -0.628  -13.024 69.519 1.00 35.65  ? 662  ALA A C     1 
ATOM   5429 O  O     . ALA A 1 662 ? -0.648  -11.803 69.689 1.00 35.08  ? 662  ALA A O     1 
ATOM   5430 C  CB    . ALA A 1 662 ? 0.854   -14.386 71.004 1.00 36.52  ? 662  ALA A CB    1 
ATOM   5431 N  N     . ILE A 1 663 ? -0.651  -13.587 68.313 1.00 32.90  ? 663  ILE A N     1 
ATOM   5432 C  CA    . ILE A 1 663 ? -0.792  -12.776 67.101 1.00 33.86  ? 663  ILE A CA    1 
ATOM   5433 C  C     . ILE A 1 663 ? -2.170  -12.100 67.067 1.00 35.33  ? 663  ILE A C     1 
ATOM   5434 O  O     . ILE A 1 663 ? -2.260  -10.898 66.847 1.00 35.54  ? 663  ILE A O     1 
ATOM   5435 C  CB    . ILE A 1 663 ? -0.512  -13.604 65.819 1.00 30.83  ? 663  ILE A CB    1 
ATOM   5436 C  CG1   . ILE A 1 663 ? 0.990   -13.895 65.723 1.00 27.76  ? 663  ILE A CG1   1 
ATOM   5437 C  CG2   . ILE A 1 663 ? -1.027  -12.884 64.569 1.00 27.49  ? 663  ILE A CG2   1 
ATOM   5438 C  CD1   . ILE A 1 663 ? 1.373   -14.978 64.720 1.00 28.74  ? 663  ILE A CD1   1 
ATOM   5439 N  N     . ASP A 1 664 ? -3.221  -12.878 67.320 1.00 37.16  ? 664  ASP A N     1 
ATOM   5440 C  CA    . ASP A 1 664 ? -4.588  -12.365 67.372 1.00 41.87  ? 664  ASP A CA    1 
ATOM   5441 C  C     . ASP A 1 664 ? -4.726  -11.228 68.390 1.00 41.89  ? 664  ASP A C     1 
ATOM   5442 O  O     . ASP A 1 664 ? -5.419  -10.246 68.134 1.00 40.32  ? 664  ASP A O     1 
ATOM   5443 C  CB    . ASP A 1 664 ? -5.591  -13.492 67.688 1.00 44.64  ? 664  ASP A CB    1 
ATOM   5444 C  CG    . ASP A 1 664 ? -5.860  -14.411 66.490 1.00 53.69  ? 664  ASP A CG    1 
ATOM   5445 O  OD1   . ASP A 1 664 ? -6.078  -13.903 65.366 1.00 60.94  ? 664  ASP A OD1   1 
ATOM   5446 O  OD2   . ASP A 1 664 ? -5.877  -15.653 66.672 1.00 59.96  ? 664  ASP A OD2   1 
ATOM   5447 N  N     . ARG A 1 665 ? -4.060  -11.362 69.537 1.00 43.42  ? 665  ARG A N     1 
ATOM   5448 C  CA    . ARG A 1 665 ? -4.035  -10.296 70.542 1.00 43.28  ? 665  ARG A CA    1 
ATOM   5449 C  C     . ARG A 1 665 ? -3.366  -9.033  70.004 1.00 42.74  ? 665  ARG A C     1 
ATOM   5450 O  O     . ARG A 1 665 ? -3.843  -7.918  70.238 1.00 42.68  ? 665  ARG A O     1 
ATOM   5451 C  CB    . ARG A 1 665 ? -3.314  -10.760 71.803 1.00 44.13  ? 665  ARG A CB    1 
ATOM   5452 C  CG    . ARG A 1 665 ? -4.163  -11.610 72.726 1.00 48.40  ? 665  ARG A CG    1 
ATOM   5453 C  CD    . ARG A 1 665 ? -3.490  -11.758 74.093 1.00 49.20  ? 665  ARG A CD    1 
ATOM   5454 N  NE    . ARG A 1 665 ? -2.224  -12.495 74.024 1.00 47.18  ? 665  ARG A NE    1 
ATOM   5455 C  CZ    . ARG A 1 665 ? -2.129  -13.825 73.980 1.00 43.78  ? 665  ARG A CZ    1 
ATOM   5456 N  NH1   . ARG A 1 665 ? -3.221  -14.579 73.989 1.00 40.03  ? 665  ARG A NH1   1 
ATOM   5457 N  NH2   . ARG A 1 665 ? -0.937  -14.403 73.928 1.00 42.69  ? 665  ARG A NH2   1 
ATOM   5458 N  N     . GLY A 1 666 ? -2.265  -9.220  69.276 1.00 41.01  ? 666  GLY A N     1 
ATOM   5459 C  CA    . GLY A 1 666 ? -1.505  -8.113  68.714 1.00 39.70  ? 666  GLY A CA    1 
ATOM   5460 C  C     . GLY A 1 666 ? -2.339  -7.286  67.756 1.00 40.29  ? 666  GLY A C     1 
ATOM   5461 O  O     . GLY A 1 666 ? -2.329  -6.051  67.820 1.00 38.91  ? 666  GLY A O     1 
ATOM   5462 N  N     . PHE A 1 667 ? -3.081  -7.972  66.887 1.00 38.73  ? 667  PHE A N     1 
ATOM   5463 C  CA    . PHE A 1 667 ? -3.850  -7.314  65.838 1.00 39.62  ? 667  PHE A CA    1 
ATOM   5464 C  C     . PHE A 1 667 ? -5.131  -6.673  66.346 1.00 39.98  ? 667  PHE A C     1 
ATOM   5465 O  O     . PHE A 1 667 ? -5.569  -5.649  65.813 1.00 39.72  ? 667  PHE A O     1 
ATOM   5466 C  CB    . PHE A 1 667 ? -4.165  -8.288  64.704 1.00 40.53  ? 667  PHE A CB    1 
ATOM   5467 C  CG    . PHE A 1 667 ? -3.056  -8.437  63.712 1.00 41.54  ? 667  PHE A CG    1 
ATOM   5468 C  CD1   . PHE A 1 667 ? -2.442  -7.313  63.159 1.00 43.19  ? 667  PHE A CD1   1 
ATOM   5469 C  CD2   . PHE A 1 667 ? -2.631  -9.697  63.313 1.00 39.74  ? 667  PHE A CD2   1 
ATOM   5470 C  CE1   . PHE A 1 667 ? -1.415  -7.443  62.232 1.00 42.76  ? 667  PHE A CE1   1 
ATOM   5471 C  CE2   . PHE A 1 667 ? -1.613  -9.837  62.387 1.00 40.37  ? 667  PHE A CE2   1 
ATOM   5472 C  CZ    . PHE A 1 667 ? -1.004  -8.710  61.843 1.00 43.63  ? 667  PHE A CZ    1 
ATOM   5473 N  N     . ARG A 1 668 ? -5.738  -7.284  67.360 1.00 40.22  ? 668  ARG A N     1 
ATOM   5474 C  CA    . ARG A 1 668 ? -6.892  -6.688  68.032 1.00 41.16  ? 668  ARG A CA    1 
ATOM   5475 C  C     . ARG A 1 668 ? -6.501  -5.362  68.668 1.00 39.39  ? 668  ARG A C     1 
ATOM   5476 O  O     . ARG A 1 668 ? -7.273  -4.403  68.632 1.00 39.15  ? 668  ARG A O     1 
ATOM   5477 C  CB    . ARG A 1 668 ? -7.493  -7.647  69.069 1.00 43.65  ? 668  ARG A CB    1 
ATOM   5478 C  CG    . ARG A 1 668 ? -8.832  -8.270  68.645 1.00 50.15  ? 668  ARG A CG    1 
ATOM   5479 C  CD    . ARG A 1 668 ? -8.899  -9.775  68.920 1.00 55.39  ? 668  ARG A CD    1 
ATOM   5480 N  NE    . ARG A 1 668 ? -8.361  -10.141 70.232 1.00 61.84  ? 668  ARG A NE    1 
ATOM   5481 C  CZ    . ARG A 1 668 ? -8.007  -11.375 70.590 1.00 65.10  ? 668  ARG A CZ    1 
ATOM   5482 N  NH1   . ARG A 1 668 ? -8.124  -12.388 69.737 1.00 65.41  ? 668  ARG A NH1   1 
ATOM   5483 N  NH2   . ARG A 1 668 ? -7.528  -11.598 71.808 1.00 66.66  ? 668  ARG A NH2   1 
ATOM   5484 N  N     . GLU A 1 669 ? -5.290  -5.305  69.219 1.00 38.79  ? 669  GLU A N     1 
ATOM   5485 C  CA    . GLU A 1 669 ? -4.773  -4.067  69.796 1.00 39.45  ? 669  GLU A CA    1 
ATOM   5486 C  C     . GLU A 1 669 ? -4.594  -3.009  68.707 1.00 37.80  ? 669  GLU A C     1 
ATOM   5487 O  O     . GLU A 1 669 ? -4.901  -1.835  68.921 1.00 36.87  ? 669  GLU A O     1 
ATOM   5488 C  CB    . GLU A 1 669 ? -3.454  -4.307  70.540 1.00 40.01  ? 669  GLU A CB    1 
ATOM   5489 C  CG    . GLU A 1 669 ? -2.938  -3.078  71.287 1.00 45.61  ? 669  GLU A CG    1 
ATOM   5490 C  CD    . GLU A 1 669 ? -1.585  -3.297  71.945 1.00 51.86  ? 669  GLU A CD    1 
ATOM   5491 O  OE1   . GLU A 1 669 ? -1.494  -4.124  72.882 1.00 54.39  ? 669  GLU A OE1   1 
ATOM   5492 O  OE2   . GLU A 1 669 ? -0.614  -2.624  71.532 1.00 53.78  ? 669  GLU A OE2   1 
ATOM   5493 N  N     . MET A 1 670 ? -4.099  -3.440  67.547 1.00 34.37  ? 670  MET A N     1 
ATOM   5494 C  CA    . MET A 1 670 ? -3.890  -2.548  66.413 1.00 35.14  ? 670  MET A CA    1 
ATOM   5495 C  C     . MET A 1 670 ? -5.222  -2.049  65.863 1.00 35.51  ? 670  MET A C     1 
ATOM   5496 O  O     . MET A 1 670 ? -5.347  -0.881  65.484 1.00 35.02  ? 670  MET A O     1 
ATOM   5497 C  CB    . MET A 1 670 ? -3.083  -3.239  65.310 1.00 34.35  ? 670  MET A CB    1 
ATOM   5498 C  CG    . MET A 1 670 ? -2.459  -2.283  64.317 1.00 35.54  ? 670  MET A CG    1 
ATOM   5499 S  SD    . MET A 1 670 ? -1.681  -3.132  62.934 1.00 35.96  ? 670  MET A SD    1 
ATOM   5500 C  CE    . MET A 1 670 ? -3.087  -3.435  61.882 1.00 36.52  ? 670  MET A CE    1 
ATOM   5501 N  N     . CYS A 1 671 ? -6.215  -2.935  65.832 1.00 35.73  ? 671  CYS A N     1 
ATOM   5502 C  CA    . CYS A 1 671 ? -7.552  -2.558  65.406 1.00 36.23  ? 671  CYS A CA    1 
ATOM   5503 C  C     . CYS A 1 671 ? -8.136  -1.482  66.332 1.00 38.32  ? 671  CYS A C     1 
ATOM   5504 O  O     . CYS A 1 671 ? -8.794  -0.544  65.862 1.00 39.38  ? 671  CYS A O     1 
ATOM   5505 C  CB    . CYS A 1 671 ? -8.461  -3.781  65.350 1.00 35.65  ? 671  CYS A CB    1 
ATOM   5506 S  SG    . CYS A 1 671 ? -10.155 -3.426  64.844 1.00 36.76  ? 671  CYS A SG    1 
ATOM   5507 N  N     . GLU A 1 672 ? -7.873  -1.614  67.635 1.00 39.39  ? 672  GLU A N     1 
ATOM   5508 C  CA    . GLU A 1 672 ? -8.287  -0.614  68.633 1.00 40.92  ? 672  GLU A CA    1 
ATOM   5509 C  C     . GLU A 1 672 ? -7.596  0.721   68.413 1.00 37.60  ? 672  GLU A C     1 
ATOM   5510 O  O     . GLU A 1 672 ? -8.248  1.765   68.405 1.00 38.22  ? 672  GLU A O     1 
ATOM   5511 C  CB    . GLU A 1 672 ? -8.015  -1.105  70.061 1.00 43.08  ? 672  GLU A CB    1 
ATOM   5512 C  CG    . GLU A 1 672 ? -9.137  -1.926  70.659 1.00 52.29  ? 672  GLU A CG    1 
ATOM   5513 C  CD    . GLU A 1 672 ? -10.371 -1.086  70.990 1.00 61.33  ? 672  GLU A CD    1 
ATOM   5514 O  OE1   . GLU A 1 672 ? -11.492 -1.525  70.640 1.00 63.56  ? 672  GLU A OE1   1 
ATOM   5515 O  OE2   . GLU A 1 672 ? -10.222 0.009   71.592 1.00 62.64  ? 672  GLU A OE2   1 
ATOM   5516 N  N     . TYR A 1 673 ? -6.277  0.666   68.237 1.00 34.26  ? 673  TYR A N     1 
ATOM   5517 C  CA    . TYR A 1 673 ? -5.443  1.833   67.932 1.00 32.87  ? 673  TYR A CA    1 
ATOM   5518 C  C     . TYR A 1 673 ? -5.988  2.619   66.745 1.00 33.45  ? 673  TYR A C     1 
ATOM   5519 O  O     . TYR A 1 673 ? -6.196  3.829   66.849 1.00 34.02  ? 673  TYR A O     1 
ATOM   5520 C  CB    . TYR A 1 673 ? -4.018  1.359   67.639 1.00 33.97  ? 673  TYR A CB    1 
ATOM   5521 C  CG    . TYR A 1 673 ? -2.906  2.398   67.655 1.00 34.21  ? 673  TYR A CG    1 
ATOM   5522 C  CD1   . TYR A 1 673 ? -3.009  3.583   68.391 1.00 33.68  ? 673  TYR A CD1   1 
ATOM   5523 C  CD2   . TYR A 1 673 ? -1.709  2.150   66.976 1.00 33.69  ? 673  TYR A CD2   1 
ATOM   5524 C  CE1   . TYR A 1 673 ? -1.953  4.514   68.410 1.00 33.96  ? 673  TYR A CE1   1 
ATOM   5525 C  CE2   . TYR A 1 673 ? -0.657  3.058   66.997 1.00 34.71  ? 673  TYR A CE2   1 
ATOM   5526 C  CZ    . TYR A 1 673 ? -0.776  4.234   67.718 1.00 35.56  ? 673  TYR A CZ    1 
ATOM   5527 O  OH    . TYR A 1 673 ? 0.286   5.123   67.721 1.00 37.35  ? 673  TYR A OH    1 
ATOM   5528 N  N     . MET A 1 674 ? -6.242  1.931   65.628 1.00 32.07  ? 674  MET A N     1 
ATOM   5529 C  CA    . MET A 1 674 ? -6.722  2.596   64.421 1.00 31.52  ? 674  MET A CA    1 
ATOM   5530 C  C     . MET A 1 674 ? -8.222  2.849   64.489 1.00 32.46  ? 674  MET A C     1 
ATOM   5531 O  O     . MET A 1 674 ? -8.804  3.407   63.550 1.00 32.69  ? 674  MET A O     1 
ATOM   5532 C  CB    . MET A 1 674 ? -6.398  1.778   63.167 1.00 31.36  ? 674  MET A CB    1 
ATOM   5533 C  CG    . MET A 1 674 ? -4.947  1.803   62.693 1.00 32.52  ? 674  MET A CG    1 
ATOM   5534 S  SD    . MET A 1 674 ? -4.188  3.424   62.461 1.00 38.65  ? 674  MET A SD    1 
ATOM   5535 C  CE    . MET A 1 674 ? -3.101  3.434   63.883 1.00 31.30  ? 674  MET A CE    1 
ATOM   5536 N  N     . ASN A 1 675 ? -8.840  2.435   65.595 1.00 32.04  ? 675  ASN A N     1 
ATOM   5537 C  CA    . ASN A 1 675 ? -10.295 2.563   65.795 1.00 34.09  ? 675  ASN A CA    1 
ATOM   5538 C  C     . ASN A 1 675 ? -11.106 2.029   64.606 1.00 34.41  ? 675  ASN A C     1 
ATOM   5539 O  O     . ASN A 1 675 ? -12.032 2.685   64.122 1.00 34.90  ? 675  ASN A O     1 
ATOM   5540 C  CB    . ASN A 1 675 ? -10.685 4.019   66.116 1.00 32.07  ? 675  ASN A CB    1 
ATOM   5541 C  CG    . ASN A 1 675 ? -12.117 4.145   66.629 1.00 33.97  ? 675  ASN A CG    1 
ATOM   5542 O  OD1   . ASN A 1 675 ? -12.599 3.284   67.364 1.00 33.43  ? 675  ASN A OD1   1 
ATOM   5543 N  ND2   . ASN A 1 675 ? -12.805 5.221   66.234 1.00 27.92  ? 675  ASN A ND2   1 
ATOM   5544 N  N     . ASN A 1 676 ? -10.745 0.840   64.131 1.00 34.66  ? 676  ASN A N     1 
ATOM   5545 C  CA    . ASN A 1 676 ? -11.366 0.287   62.926 1.00 34.87  ? 676  ASN A CA    1 
ATOM   5546 C  C     . ASN A 1 676 ? -12.759 -0.313  63.151 1.00 34.55  ? 676  ASN A C     1 
ATOM   5547 O  O     . ASN A 1 676 ? -13.113 -0.685  64.274 1.00 34.57  ? 676  ASN A O     1 
ATOM   5548 C  CB    . ASN A 1 676 ? -10.443 -0.740  62.273 1.00 36.64  ? 676  ASN A CB    1 
ATOM   5549 C  CG    . ASN A 1 676 ? -9.139  -0.141  61.788 1.00 35.13  ? 676  ASN A CG    1 
ATOM   5550 O  OD1   . ASN A 1 676 ? -8.077  -0.726  61.990 1.00 32.75  ? 676  ASN A OD1   1 
ATOM   5551 N  ND2   . ASN A 1 676 ? -9.211  1.020   61.134 1.00 33.55  ? 676  ASN A ND2   1 
ATOM   5552 N  N     . LYS A 1 677 ? -13.526 -0.396  62.065 1.00 33.65  ? 677  LYS A N     1 
ATOM   5553 C  CA    . LYS A 1 677 ? -14.912 -0.871  62.066 1.00 35.68  ? 677  LYS A CA    1 
ATOM   5554 C  C     . LYS A 1 677 ? -15.028 -2.324  62.516 1.00 36.86  ? 677  LYS A C     1 
ATOM   5555 O  O     . LYS A 1 677 ? -15.931 -2.672  63.288 1.00 35.16  ? 677  LYS A O     1 
ATOM   5556 C  CB    . LYS A 1 677 ? -15.501 -0.721  60.659 1.00 36.88  ? 677  LYS A CB    1 
ATOM   5557 C  CG    . LYS A 1 677 ? -16.942 -1.185  60.489 1.00 36.74  ? 677  LYS A CG    1 
ATOM   5558 C  CD    . LYS A 1 677 ? -17.379 -0.943  59.047 1.00 40.78  ? 677  LYS A CD    1 
ATOM   5559 C  CE    . LYS A 1 677 ? -18.883 -0.742  58.916 1.00 36.70  ? 677  LYS A CE    1 
ATOM   5560 N  NZ    . LYS A 1 677 ? -19.623 -1.991  59.159 1.00 39.24  ? 677  LYS A NZ    1 
ATOM   5561 N  N     . GLN A 1 678 ? -14.100 -3.155  62.035 1.00 36.14  ? 678  GLN A N     1 
ATOM   5562 C  CA    . GLN A 1 678 ? -14.147 -4.599  62.235 1.00 37.40  ? 678  GLN A CA    1 
ATOM   5563 C  C     . GLN A 1 678 ? -12.748 -5.216  62.205 1.00 37.25  ? 678  GLN A C     1 
ATOM   5564 O  O     . GLN A 1 678 ? -11.943 -4.926  61.321 1.00 37.17  ? 678  GLN A O     1 
ATOM   5565 C  CB    . GLN A 1 678 ? -15.025 -5.241  61.154 1.00 37.93  ? 678  GLN A CB    1 
ATOM   5566 C  CG    . GLN A 1 678 ? -15.417 -6.689  61.415 1.00 38.42  ? 678  GLN A CG    1 
ATOM   5567 C  CD    . GLN A 1 678 ? -16.121 -7.331  60.222 1.00 40.03  ? 678  GLN A CD    1 
ATOM   5568 O  OE1   . GLN A 1 678 ? -16.330 -6.696  59.182 1.00 38.61  ? 678  GLN A OE1   1 
ATOM   5569 N  NE2   . GLN A 1 678 ? -16.490 -8.597  60.372 1.00 41.80  ? 678  GLN A NE2   1 
ATOM   5570 N  N     . HIS A 1 679 ? -12.461 -6.074  63.174 1.00 37.57  ? 679  HIS A N     1 
ATOM   5571 C  CA    . HIS A 1 679 ? -11.192 -6.775  63.185 1.00 36.77  ? 679  HIS A CA    1 
ATOM   5572 C  C     . HIS A 1 679 ? -11.199 -7.921  62.163 1.00 36.99  ? 679  HIS A C     1 
ATOM   5573 O  O     . HIS A 1 679 ? -12.017 -8.846  62.254 1.00 36.92  ? 679  HIS A O     1 
ATOM   5574 C  CB    . HIS A 1 679 ? -10.872 -7.304  64.578 1.00 35.10  ? 679  HIS A CB    1 
ATOM   5575 C  CG    . HIS A 1 679 ? -9.719  -8.254  64.598 1.00 34.84  ? 679  HIS A CG    1 
ATOM   5576 N  ND1   . HIS A 1 679 ? -9.832  -9.551  65.054 1.00 31.44  ? 679  HIS A ND1   1 
ATOM   5577 C  CD2   . HIS A 1 679 ? -8.440  -8.108  64.179 1.00 29.44  ? 679  HIS A CD2   1 
ATOM   5578 C  CE1   . HIS A 1 679 ? -8.661  -10.154 64.942 1.00 33.33  ? 679  HIS A CE1   1 
ATOM   5579 N  NE2   . HIS A 1 679 ? -7.801  -9.301  64.413 1.00 33.28  ? 679  HIS A NE2   1 
ATOM   5580 N  N     . LEU A 1 680 ? -10.279 -7.848  61.201 1.00 33.69  ? 680  LEU A N     1 
ATOM   5581 C  CA    . LEU A 1 680 ? -10.197 -8.827  60.124 1.00 31.70  ? 680  LEU A CA    1 
ATOM   5582 C  C     . LEU A 1 680 ? -8.766  -9.227  59.750 1.00 31.71  ? 680  LEU A C     1 
ATOM   5583 O  O     . LEU A 1 680 ? -8.545  -9.834  58.703 1.00 32.01  ? 680  LEU A O     1 
ATOM   5584 C  CB    . LEU A 1 680 ? -10.947 -8.329  58.892 1.00 26.71  ? 680  LEU A CB    1 
ATOM   5585 C  CG    . LEU A 1 680 ? -12.471 -8.299  58.995 1.00 30.72  ? 680  LEU A CG    1 
ATOM   5586 C  CD1   . LEU A 1 680 ? -13.057 -7.535  57.812 1.00 25.68  ? 680  LEU A CD1   1 
ATOM   5587 C  CD2   . LEU A 1 680 ? -13.079 -9.720  59.104 1.00 26.37  ? 680  LEU A CD2   1 
ATOM   5588 N  N     . MET A 1 681 ? -7.798  -8.876  60.597 1.00 32.99  ? 681  MET A N     1 
ATOM   5589 C  CA    . MET A 1 681 ? -6.403  -9.284  60.381 1.00 31.63  ? 681  MET A CA    1 
ATOM   5590 C  C     . MET A 1 681 ? -6.213  -10.688 60.941 1.00 31.36  ? 681  MET A C     1 
ATOM   5591 O  O     . MET A 1 681 ? -5.939  -10.865 62.132 1.00 31.45  ? 681  MET A O     1 
ATOM   5592 C  CB    . MET A 1 681 ? -5.417  -8.303  61.026 1.00 30.65  ? 681  MET A CB    1 
ATOM   5593 C  CG    . MET A 1 681 ? -5.407  -6.898  60.440 1.00 30.87  ? 681  MET A CG    1 
ATOM   5594 S  SD    . MET A 1 681 ? -5.014  -6.827  58.671 1.00 32.94  ? 681  MET A SD    1 
ATOM   5595 C  CE    . MET A 1 681 ? -6.645  -6.584  57.966 1.00 28.43  ? 681  MET A CE    1 
ATOM   5596 N  N     . PHE A 1 682 ? -6.386  -11.680 60.072 1.00 31.58  ? 682  PHE A N     1 
ATOM   5597 C  CA    . PHE A 1 682 ? -6.320  -13.081 60.456 1.00 33.86  ? 682  PHE A CA    1 
ATOM   5598 C  C     . PHE A 1 682 ? -5.033  -13.660 59.907 1.00 35.79  ? 682  PHE A C     1 
ATOM   5599 O  O     . PHE A 1 682 ? -4.919  -13.942 58.706 1.00 34.26  ? 682  PHE A O     1 
ATOM   5600 C  CB    . PHE A 1 682 ? -7.538  -13.879 59.940 1.00 32.34  ? 682  PHE A CB    1 
ATOM   5601 C  CG    . PHE A 1 682 ? -8.875  -13.357 60.415 1.00 32.71  ? 682  PHE A CG    1 
ATOM   5602 C  CD1   . PHE A 1 682 ? -9.023  -12.787 61.687 1.00 35.81  ? 682  PHE A CD1   1 
ATOM   5603 C  CD2   . PHE A 1 682 ? -10.003 -13.478 59.604 1.00 32.80  ? 682  PHE A CD2   1 
ATOM   5604 C  CE1   . PHE A 1 682 ? -10.269 -12.311 62.129 1.00 34.99  ? 682  PHE A CE1   1 
ATOM   5605 C  CE2   . PHE A 1 682 ? -11.252 -13.009 60.028 1.00 34.48  ? 682  PHE A CE2   1 
ATOM   5606 C  CZ    . PHE A 1 682 ? -11.385 -12.422 61.298 1.00 36.79  ? 682  PHE A CZ    1 
ATOM   5607 N  N     . MET A 1 683 ? -4.057  -13.807 60.797 1.00 39.67  ? 683  MET A N     1 
ATOM   5608 C  CA    . MET A 1 683 ? -2.758  -14.348 60.440 1.00 41.34  ? 683  MET A CA    1 
ATOM   5609 C  C     . MET A 1 683 ? -2.611  -15.773 60.991 1.00 43.68  ? 683  MET A C     1 
ATOM   5610 O  O     . MET A 1 683 ? -2.473  -15.975 62.205 1.00 42.26  ? 683  MET A O     1 
ATOM   5611 C  CB    . MET A 1 683 ? -1.649  -13.419 60.935 1.00 40.69  ? 683  MET A CB    1 
ATOM   5612 C  CG    . MET A 1 683 ? -0.243  -13.984 60.791 1.00 41.44  ? 683  MET A CG    1 
ATOM   5613 S  SD    . MET A 1 683 ? 1.042   -12.761 61.096 1.00 38.34  ? 683  MET A SD    1 
ATOM   5614 C  CE    . MET A 1 683 ? 1.302   -12.179 59.413 1.00 35.32  ? 683  MET A CE    1 
ATOM   5615 N  N     . ASP A 1 684 ? -2.662  -16.747 60.081 1.00 44.01  ? 684  ASP A N     1 
ATOM   5616 C  CA    . ASP A 1 684 ? -2.563  -18.170 60.421 1.00 44.49  ? 684  ASP A CA    1 
ATOM   5617 C  C     . ASP A 1 684 ? -1.207  -18.725 59.991 1.00 43.34  ? 684  ASP A C     1 
ATOM   5618 O  O     . ASP A 1 684 ? -0.587  -18.207 59.060 1.00 45.52  ? 684  ASP A O     1 
ATOM   5619 C  CB    . ASP A 1 684 ? -3.679  -18.969 59.723 1.00 46.72  ? 684  ASP A CB    1 
ATOM   5620 C  CG    . ASP A 1 684 ? -5.084  -18.567 60.183 1.00 52.66  ? 684  ASP A CG    1 
ATOM   5621 O  OD1   . ASP A 1 684 ? -5.349  -18.543 61.412 1.00 56.42  ? 684  ASP A OD1   1 
ATOM   5622 O  OD2   . ASP A 1 684 ? -5.933  -18.296 59.307 1.00 52.17  ? 684  ASP A OD2   1 
ATOM   5623 N  N     . ARG A 1 685 ? -0.756  -19.783 60.659 1.00 39.58  ? 685  ARG A N     1 
ATOM   5624 C  CA    . ARG A 1 685 ? 0.475   -20.463 60.277 1.00 38.86  ? 685  ARG A CA    1 
ATOM   5625 C  C     . ARG A 1 685 ? 0.367   -20.960 58.834 1.00 38.52  ? 685  ARG A C     1 
ATOM   5626 O  O     . ARG A 1 685 ? -0.672  -21.471 58.420 1.00 37.65  ? 685  ARG A O     1 
ATOM   5627 C  CB    . ARG A 1 685 ? 0.755   -21.619 61.235 1.00 36.78  ? 685  ARG A CB    1 
ATOM   5628 C  CG    . ARG A 1 685 ? 2.152   -22.225 61.139 1.00 37.87  ? 685  ARG A CG    1 
ATOM   5629 C  CD    . ARG A 1 685 ? 2.224   -23.364 60.127 1.00 36.63  ? 685  ARG A CD    1 
ATOM   5630 N  NE    . ARG A 1 685 ? 1.419   -24.519 60.524 1.00 39.31  ? 685  ARG A NE    1 
ATOM   5631 C  CZ    . ARG A 1 685 ? 1.108   -25.539 59.724 1.00 38.69  ? 685  ARG A CZ    1 
ATOM   5632 N  NH1   . ARG A 1 685 ? 1.524   -25.558 58.460 1.00 34.40  ? 685  ARG A NH1   1 
ATOM   5633 N  NH2   . ARG A 1 685 ? 0.372   -26.542 60.190 1.00 36.00  ? 685  ARG A NH2   1 
ATOM   5634 N  N     . GLU A 1 686 ? 1.428   -20.772 58.060 1.00 37.06  ? 686  GLU A N     1 
ATOM   5635 C  CA    . GLU A 1 686 ? 1.433   -21.245 56.689 1.00 37.86  ? 686  GLU A CA    1 
ATOM   5636 C  C     . GLU A 1 686 ? 2.301   -22.498 56.566 1.00 37.36  ? 686  GLU A C     1 
ATOM   5637 O  O     . GLU A 1 686 ? 1.775   -23.606 56.417 1.00 38.01  ? 686  GLU A O     1 
ATOM   5638 C  CB    . GLU A 1 686 ? 1.858   -20.139 55.714 1.00 40.85  ? 686  GLU A CB    1 
ATOM   5639 C  CG    . GLU A 1 686 ? 1.306   -20.319 54.296 1.00 50.41  ? 686  GLU A CG    1 
ATOM   5640 C  CD    . GLU A 1 686 ? 1.163   -19.009 53.513 1.00 59.68  ? 686  GLU A CD    1 
ATOM   5641 O  OE1   . GLU A 1 686 ? 0.039   -18.719 53.023 1.00 60.21  ? 686  GLU A OE1   1 
ATOM   5642 O  OE2   . GLU A 1 686 ? 2.170   -18.272 53.385 1.00 65.29  ? 686  GLU A OE2   1 
ATOM   5643 N  N     . ALA A 1 687 ? 3.617   -22.342 56.670 1.00 33.94  ? 687  ALA A N     1 
ATOM   5644 C  CA    . ALA A 1 687 ? 4.521   -23.467 56.419 1.00 34.44  ? 687  ALA A CA    1 
ATOM   5645 C  C     . ALA A 1 687 ? 5.334   -23.899 57.642 1.00 34.75  ? 687  ALA A C     1 
ATOM   5646 O  O     . ALA A 1 687 ? 5.737   -23.063 58.451 1.00 35.11  ? 687  ALA A O     1 
ATOM   5647 C  CB    . ALA A 1 687 ? 5.449   -23.134 55.275 1.00 29.50  ? 687  ALA A CB    1 
ATOM   5648 N  N     . ILE A 1 688 ? 5.581   -25.205 57.761 1.00 35.08  ? 688  ILE A N     1 
ATOM   5649 C  CA    . ILE A 1 688 ? 6.599   -25.696 58.698 1.00 36.54  ? 688  ILE A CA    1 
ATOM   5650 C  C     . ILE A 1 688 ? 7.793   -26.275 57.942 1.00 34.20  ? 688  ILE A C     1 
ATOM   5651 O  O     . ILE A 1 688 ? 7.642   -27.185 57.139 1.00 32.92  ? 688  ILE A O     1 
ATOM   5652 C  CB    . ILE A 1 688 ? 6.030   -26.696 59.737 1.00 36.79  ? 688  ILE A CB    1 
ATOM   5653 C  CG1   . ILE A 1 688 ? 4.960   -26.002 60.587 1.00 36.71  ? 688  ILE A CG1   1 
ATOM   5654 C  CG2   . ILE A 1 688 ? 7.145   -27.201 60.645 1.00 35.24  ? 688  ILE A CG2   1 
ATOM   5655 C  CD1   . ILE A 1 688 ? 4.029   -26.954 61.303 1.00 41.37  ? 688  ILE A CD1   1 
ATOM   5656 N  N     . ALA A 1 689 ? 8.978   -25.730 58.209 1.00 36.08  ? 689  ALA A N     1 
ATOM   5657 C  CA    . ALA A 1 689 ? 10.168  -26.056 57.422 1.00 36.97  ? 689  ALA A CA    1 
ATOM   5658 C  C     . ALA A 1 689 ? 11.368  -26.522 58.251 1.00 37.34  ? 689  ALA A C     1 
ATOM   5659 O  O     . ALA A 1 689 ? 11.595  -26.043 59.364 1.00 38.42  ? 689  ALA A O     1 
ATOM   5660 C  CB    . ALA A 1 689 ? 10.556  -24.872 56.549 1.00 35.39  ? 689  ALA A CB    1 
ATOM   5661 N  N     . GLY A 1 690 ? 12.138  -27.450 57.688 1.00 36.30  ? 690  GLY A N     1 
ATOM   5662 C  CA    . GLY A 1 690 ? 13.344  -27.945 58.339 1.00 37.09  ? 690  GLY A CA    1 
ATOM   5663 C  C     . GLY A 1 690 ? 13.900  -29.182 57.661 1.00 37.89  ? 690  GLY A C     1 
ATOM   5664 O  O     . GLY A 1 690 ? 13.256  -29.749 56.783 1.00 37.84  ? 690  GLY A O     1 
ATOM   5665 N  N     . PRO A 1 691 ? 15.102  -29.620 58.073 1.00 40.74  ? 691  PRO A N     1 
ATOM   5666 C  CA    . PRO A 1 691 ? 15.713  -30.817 57.484 1.00 40.84  ? 691  PRO A CA    1 
ATOM   5667 C  C     . PRO A 1 691 ? 15.066  -32.106 58.001 1.00 40.62  ? 691  PRO A C     1 
ATOM   5668 O  O     . PRO A 1 691 ? 14.394  -32.073 59.032 1.00 41.17  ? 691  PRO A O     1 
ATOM   5669 C  CB    . PRO A 1 691 ? 17.168  -30.723 57.936 1.00 38.55  ? 691  PRO A CB    1 
ATOM   5670 C  CG    . PRO A 1 691 ? 17.127  -29.955 59.197 1.00 40.10  ? 691  PRO A CG    1 
ATOM   5671 C  CD    . PRO A 1 691 ? 15.923  -29.056 59.162 1.00 40.87  ? 691  PRO A CD    1 
ATOM   5672 N  N     . PRO A 1 692 ? 15.237  -33.229 57.276 1.00 42.48  ? 692  PRO A N     1 
ATOM   5673 C  CA    . PRO A 1 692 ? 14.849  -34.515 57.861 1.00 43.32  ? 692  PRO A CA    1 
ATOM   5674 C  C     . PRO A 1 692 ? 15.652  -34.745 59.134 1.00 45.19  ? 692  PRO A C     1 
ATOM   5675 O  O     . PRO A 1 692 ? 16.822  -34.344 59.200 1.00 44.18  ? 692  PRO A O     1 
ATOM   5676 C  CB    . PRO A 1 692 ? 15.255  -35.527 56.787 1.00 43.79  ? 692  PRO A CB    1 
ATOM   5677 C  CG    . PRO A 1 692 ? 15.254  -34.736 55.496 1.00 41.50  ? 692  PRO A CG    1 
ATOM   5678 C  CD    . PRO A 1 692 ? 15.737  -33.377 55.893 1.00 40.65  ? 692  PRO A CD    1 
ATOM   5679 N  N     . LEU A 1 693 ? 15.021  -35.356 60.138 1.00 47.38  ? 693  LEU A N     1 
ATOM   5680 C  CA    . LEU A 1 693 ? 15.652  -35.567 61.444 1.00 49.43  ? 693  LEU A CA    1 
ATOM   5681 C  C     . LEU A 1 693 ? 16.893  -36.464 61.323 1.00 49.99  ? 693  LEU A C     1 
ATOM   5682 O  O     . LEU A 1 693 ? 16.839  -37.535 60.718 1.00 49.95  ? 693  LEU A O     1 
ATOM   5683 C  CB    . LEU A 1 693 ? 14.651  -36.179 62.436 1.00 49.66  ? 693  LEU A CB    1 
ATOM   5684 C  CG    . LEU A 1 693 ? 14.628  -35.725 63.907 1.00 51.85  ? 693  LEU A CG    1 
ATOM   5685 C  CD1   . LEU A 1 693 ? 14.119  -36.853 64.799 1.00 50.85  ? 693  LEU A CD1   1 
ATOM   5686 C  CD2   . LEU A 1 693 ? 15.971  -35.216 64.436 1.00 52.00  ? 693  LEU A CD2   1 
ATOM   5687 N  N     . GLY A 1 694 ? 18.011  -36.008 61.883 1.00 50.37  ? 694  GLY A N     1 
ATOM   5688 C  CA    . GLY A 1 694 ? 19.258  -36.763 61.832 1.00 50.65  ? 694  GLY A CA    1 
ATOM   5689 C  C     . GLY A 1 694 ? 19.932  -36.819 60.466 1.00 51.28  ? 694  GLY A C     1 
ATOM   5690 O  O     . GLY A 1 694 ? 20.701  -37.748 60.189 1.00 52.72  ? 694  GLY A O     1 
ATOM   5691 N  N     . SER A 1 695 ? 19.641  -35.842 59.606 1.00 48.95  ? 695  SER A N     1 
ATOM   5692 C  CA    . SER A 1 695 ? 20.392  -35.675 58.358 1.00 46.86  ? 695  SER A CA    1 
ATOM   5693 C  C     . SER A 1 695 ? 21.336  -34.472 58.459 1.00 45.85  ? 695  SER A C     1 
ATOM   5694 O  O     . SER A 1 695 ? 21.455  -33.853 59.522 1.00 44.08  ? 695  SER A O     1 
ATOM   5695 C  CB    . SER A 1 695 ? 19.453  -35.556 57.148 1.00 46.23  ? 695  SER A CB    1 
ATOM   5696 O  OG    . SER A 1 695 ? 18.983  -34.232 56.972 1.00 45.03  ? 695  SER A OG    1 
ATOM   5697 N  N     . LYS A 1 696 ? 22.007  -34.150 57.357 1.00 46.25  ? 696  LYS A N     1 
ATOM   5698 C  CA    . LYS A 1 696 ? 22.956  -33.035 57.325 1.00 48.38  ? 696  LYS A CA    1 
ATOM   5699 C  C     . LYS A 1 696 ? 22.435  -31.806 56.547 1.00 47.82  ? 696  LYS A C     1 
ATOM   5700 O  O     . LYS A 1 696 ? 23.143  -30.804 56.383 1.00 46.30  ? 696  LYS A O     1 
ATOM   5701 C  CB    . LYS A 1 696 ? 24.310  -33.516 56.789 1.00 49.46  ? 696  LYS A CB    1 
ATOM   5702 C  CG    . LYS A 1 696 ? 25.051  -34.452 57.747 1.00 54.19  ? 696  LYS A CG    1 
ATOM   5703 C  CD    . LYS A 1 696 ? 26.398  -34.899 57.173 1.00 58.21  ? 696  LYS A CD    1 
ATOM   5704 C  CE    . LYS A 1 696 ? 27.303  -35.491 58.256 1.00 59.32  ? 696  LYS A CE    1 
ATOM   5705 N  NZ    . LYS A 1 696 ? 28.736  -35.524 57.823 1.00 59.69  ? 696  LYS A NZ    1 
ATOM   5706 N  N     . GLY A 1 697 ? 21.187  -31.892 56.092 1.00 46.55  ? 697  GLY A N     1 
ATOM   5707 C  CA    . GLY A 1 697 ? 20.526  -30.800 55.386 1.00 45.30  ? 697  GLY A CA    1 
ATOM   5708 C  C     . GLY A 1 697 ? 20.379  -29.534 56.215 1.00 44.28  ? 697  GLY A C     1 
ATOM   5709 O  O     . GLY A 1 697 ? 20.308  -29.582 57.447 1.00 42.72  ? 697  GLY A O     1 
ATOM   5710 N  N     . ILE A 1 698 ? 20.326  -28.395 55.530 1.00 42.12  ? 698  ILE A N     1 
ATOM   5711 C  CA    . ILE A 1 698 ? 20.316  -27.098 56.204 1.00 39.97  ? 698  ILE A CA    1 
ATOM   5712 C  C     . ILE A 1 698 ? 18.903  -26.540 56.419 1.00 38.70  ? 698  ILE A C     1 
ATOM   5713 O  O     . ILE A 1 698 ? 18.731  -25.521 57.084 1.00 37.97  ? 698  ILE A O     1 
ATOM   5714 C  CB    . ILE A 1 698 ? 21.236  -26.069 55.491 1.00 39.69  ? 698  ILE A CB    1 
ATOM   5715 C  CG1   . ILE A 1 698 ? 20.846  -25.907 54.016 1.00 39.20  ? 698  ILE A CG1   1 
ATOM   5716 C  CG2   . ILE A 1 698 ? 22.697  -26.489 55.618 1.00 40.37  ? 698  ILE A CG2   1 
ATOM   5717 C  CD1   . ILE A 1 698 ? 21.374  -24.651 53.379 1.00 34.14  ? 698  ILE A CD1   1 
ATOM   5718 N  N     . GLY A 1 699 ? 17.900  -27.217 55.862 1.00 38.99  ? 699  GLY A N     1 
ATOM   5719 C  CA    . GLY A 1 699 ? 16.496  -26.844 56.071 1.00 38.84  ? 699  GLY A CA    1 
ATOM   5720 C  C     . GLY A 1 699 ? 16.032  -25.696 55.187 1.00 39.19  ? 699  GLY A C     1 
ATOM   5721 O  O     . GLY A 1 699 ? 15.056  -25.828 54.445 1.00 40.81  ? 699  GLY A O     1 
ATOM   5722 N  N     . GLY A 1 700 ? 16.728  -24.567 55.275 1.00 36.40  ? 700  GLY A N     1 
ATOM   5723 C  CA    . GLY A 1 700 ? 16.427  -23.419 54.444 1.00 36.91  ? 700  GLY A CA    1 
ATOM   5724 C  C     . GLY A 1 700 ? 17.589  -22.461 54.257 1.00 36.94  ? 700  GLY A C     1 
ATOM   5725 O  O     . GLY A 1 700 ? 18.650  -22.631 54.857 1.00 36.97  ? 700  GLY A O     1 
ATOM   5726 N  N     . PHE A 1 701 ? 17.374  -21.468 53.392 1.00 36.01  ? 701  PHE A N     1 
ATOM   5727 C  CA    . PHE A 1 701 ? 18.287  -20.345 53.204 1.00 33.99  ? 701  PHE A CA    1 
ATOM   5728 C  C     . PHE A 1 701 ? 17.603  -19.158 52.524 1.00 34.04  ? 701  PHE A C     1 
ATOM   5729 O  O     . PHE A 1 701 ? 16.650  -19.329 51.759 1.00 36.86  ? 701  PHE A O     1 
ATOM   5730 C  CB    . PHE A 1 701 ? 19.588  -20.759 52.471 1.00 33.62  ? 701  PHE A CB    1 
ATOM   5731 C  CG    . PHE A 1 701 ? 19.423  -21.075 50.999 1.00 31.11  ? 701  PHE A CG    1 
ATOM   5732 C  CD1   . PHE A 1 701 ? 19.241  -22.389 50.568 1.00 31.54  ? 701  PHE A CD1   1 
ATOM   5733 C  CD2   . PHE A 1 701 ? 19.509  -20.067 50.036 1.00 29.93  ? 701  PHE A CD2   1 
ATOM   5734 C  CE1   . PHE A 1 701 ? 19.116  -22.693 49.197 1.00 25.68  ? 701  PHE A CE1   1 
ATOM   5735 C  CE2   . PHE A 1 701 ? 19.380  -20.358 48.670 1.00 26.04  ? 701  PHE A CE2   1 
ATOM   5736 C  CZ    . PHE A 1 701 ? 19.195  -21.673 48.254 1.00 27.42  ? 701  PHE A CZ    1 
ATOM   5737 N  N     . TRP A 1 702 ? 18.090  -17.963 52.838 1.00 31.99  ? 702  TRP A N     1 
ATOM   5738 C  CA    . TRP A 1 702 ? 17.750  -16.736 52.133 1.00 29.98  ? 702  TRP A CA    1 
ATOM   5739 C  C     . TRP A 1 702 ? 19.017  -16.183 51.502 1.00 32.50  ? 702  TRP A C     1 
ATOM   5740 O  O     . TRP A 1 702 ? 20.099  -16.236 52.104 1.00 31.80  ? 702  TRP A O     1 
ATOM   5741 C  CB    . TRP A 1 702 ? 17.218  -15.679 53.107 1.00 29.39  ? 702  TRP A CB    1 
ATOM   5742 C  CG    . TRP A 1 702 ? 15.742  -15.630 53.212 1.00 27.22  ? 702  TRP A CG    1 
ATOM   5743 C  CD1   . TRP A 1 702 ? 14.920  -14.695 52.671 1.00 27.44  ? 702  TRP A CD1   1 
ATOM   5744 C  CD2   . TRP A 1 702 ? 14.898  -16.558 53.907 1.00 27.26  ? 702  TRP A CD2   1 
ATOM   5745 N  NE1   . TRP A 1 702 ? 13.606  -14.982 52.973 1.00 26.51  ? 702  TRP A NE1   1 
ATOM   5746 C  CE2   . TRP A 1 702 ? 13.566  -16.123 53.730 1.00 26.67  ? 702  TRP A CE2   1 
ATOM   5747 C  CE3   . TRP A 1 702 ? 15.136  -17.728 54.641 1.00 24.75  ? 702  TRP A CE3   1 
ATOM   5748 C  CZ2   . TRP A 1 702 ? 12.474  -16.802 54.280 1.00 25.96  ? 702  TRP A CZ2   1 
ATOM   5749 C  CZ3   . TRP A 1 702 ? 14.049  -18.406 55.188 1.00 26.91  ? 702  TRP A CZ3   1 
ATOM   5750 C  CH2   . TRP A 1 702 ? 12.736  -17.938 55.006 1.00 25.63  ? 702  TRP A CH2   1 
ATOM   5751 N  N     . THR A 1 703 ? 18.881  -15.636 50.299 1.00 32.76  ? 703  THR A N     1 
ATOM   5752 C  CA    . THR A 1 703 ? 19.972  -14.910 49.672 1.00 33.54  ? 703  THR A CA    1 
ATOM   5753 C  C     . THR A 1 703 ? 19.741  -13.400 49.726 1.00 33.71  ? 703  THR A C     1 
ATOM   5754 O  O     . THR A 1 703 ? 20.680  -12.613 49.607 1.00 35.46  ? 703  THR A O     1 
ATOM   5755 C  CB    . THR A 1 703 ? 20.158  -15.326 48.201 1.00 33.01  ? 703  THR A CB    1 
ATOM   5756 O  OG1   . THR A 1 703 ? 19.121  -14.745 47.406 1.00 34.42  ? 703  THR A OG1   1 
ATOM   5757 C  CG2   . THR A 1 703 ? 20.123  -16.830 48.061 1.00 35.07  ? 703  THR A CG2   1 
ATOM   5758 N  N     . GLY A 1 704 ? 18.484  -13.007 49.885 1.00 32.50  ? 704  GLY A N     1 
ATOM   5759 C  CA    . GLY A 1 704 ? 18.088  -11.606 49.802 1.00 31.57  ? 704  GLY A CA    1 
ATOM   5760 C  C     . GLY A 1 704 ? 16.577  -11.485 49.816 1.00 29.72  ? 704  GLY A C     1 
ATOM   5761 O  O     . GLY A 1 704 ? 15.869  -12.467 50.057 1.00 25.69  ? 704  GLY A O     1 
ATOM   5762 N  N     . LYS A 1 705 ? 16.087  -10.272 49.585 1.00 30.79  ? 705  LYS A N     1 
ATOM   5763 C  CA    . LYS A 1 705 ? 14.653  -10.029 49.446 1.00 31.72  ? 705  LYS A CA    1 
ATOM   5764 C  C     . LYS A 1 705 ? 14.083  -10.863 48.297 1.00 31.03  ? 705  LYS A C     1 
ATOM   5765 O  O     . LYS A 1 705 ? 14.683  -10.939 47.231 1.00 32.88  ? 705  LYS A O     1 
ATOM   5766 C  CB    . LYS A 1 705 ? 14.384  -8.541  49.204 1.00 30.19  ? 705  LYS A CB    1 
ATOM   5767 C  CG    . LYS A 1 705 ? 14.459  -7.695  50.461 1.00 30.51  ? 705  LYS A CG    1 
ATOM   5768 C  CD    . LYS A 1 705 ? 14.365  -6.214  50.134 1.00 29.05  ? 705  LYS A CD    1 
ATOM   5769 C  CE    . LYS A 1 705 ? 14.410  -5.376  51.395 1.00 27.15  ? 705  LYS A CE    1 
ATOM   5770 N  NZ    . LYS A 1 705 ? 14.232  -3.930  51.098 1.00 30.68  ? 705  LYS A NZ    1 
ATOM   5771 N  N     . LYS A 1 706 ? 12.944  -11.508 48.540 1.00 32.28  ? 706  LYS A N     1 
ATOM   5772 C  CA    . LYS A 1 706 ? 12.202  -12.257 47.523 1.00 30.12  ? 706  LYS A CA    1 
ATOM   5773 C  C     . LYS A 1 706 ? 12.995  -13.428 46.941 1.00 31.97  ? 706  LYS A C     1 
ATOM   5774 O  O     . LYS A 1 706 ? 12.717  -13.886 45.828 1.00 32.07  ? 706  LYS A O     1 
ATOM   5775 C  CB    . LYS A 1 706 ? 11.688  -11.319 46.410 1.00 30.30  ? 706  LYS A CB    1 
ATOM   5776 C  CG    . LYS A 1 706 ? 10.554  -10.390 46.868 1.00 29.64  ? 706  LYS A CG    1 
ATOM   5777 C  CD    . LYS A 1 706 ? 10.167  -9.375  45.805 1.00 29.26  ? 706  LYS A CD    1 
ATOM   5778 C  CE    . LYS A 1 706 ? 9.294   -8.259  46.374 1.00 26.75  ? 706  LYS A CE    1 
ATOM   5779 N  NZ    . LYS A 1 706 ? 7.933   -8.690  46.821 1.00 28.45  ? 706  LYS A NZ    1 
ATOM   5780 N  N     . ARG A 1 707 ? 13.973  -13.917 47.701 1.00 31.17  ? 707  ARG A N     1 
ATOM   5781 C  CA    . ARG A 1 707 ? 14.826  -15.012 47.249 1.00 30.41  ? 707  ARG A CA    1 
ATOM   5782 C  C     . ARG A 1 707 ? 15.208  -15.967 48.376 1.00 31.36  ? 707  ARG A C     1 
ATOM   5783 O  O     . ARG A 1 707 ? 16.077  -15.665 49.208 1.00 29.63  ? 707  ARG A O     1 
ATOM   5784 C  CB    . ARG A 1 707 ? 16.060  -14.458 46.544 1.00 29.37  ? 707  ARG A CB    1 
ATOM   5785 C  CG    . ARG A 1 707 ? 15.722  -13.969 45.156 1.00 33.05  ? 707  ARG A CG    1 
ATOM   5786 C  CD    . ARG A 1 707 ? 16.876  -13.335 44.441 1.00 38.56  ? 707  ARG A CD    1 
ATOM   5787 N  NE    . ARG A 1 707 ? 16.571  -13.010 43.037 1.00 51.22  ? 707  ARG A NE    1 
ATOM   5788 C  CZ    . ARG A 1 707 ? 15.362  -12.752 42.513 1.00 51.96  ? 707  ARG A CZ    1 
ATOM   5789 N  NH1   . ARG A 1 707 ? 14.251  -12.756 43.248 1.00 49.58  ? 707  ARG A NH1   1 
ATOM   5790 N  NH2   . ARG A 1 707 ? 15.267  -12.470 41.221 1.00 52.93  ? 707  ARG A NH2   1 
ATOM   5791 N  N     . TYR A 1 708 ? 14.545  -17.124 48.390 1.00 30.39  ? 708  TYR A N     1 
ATOM   5792 C  CA    . TYR A 1 708 ? 14.732  -18.115 49.440 1.00 28.49  ? 708  TYR A CA    1 
ATOM   5793 C  C     . TYR A 1 708 ? 14.232  -19.501 49.049 1.00 29.52  ? 708  TYR A C     1 
ATOM   5794 O  O     . TYR A 1 708 ? 13.556  -19.680 48.027 1.00 27.75  ? 708  TYR A O     1 
ATOM   5795 C  CB    . TYR A 1 708 ? 14.066  -17.645 50.743 1.00 28.72  ? 708  TYR A CB    1 
ATOM   5796 C  CG    . TYR A 1 708 ? 12.567  -17.411 50.664 1.00 30.36  ? 708  TYR A CG    1 
ATOM   5797 C  CD1   . TYR A 1 708 ? 12.052  -16.187 50.235 1.00 27.27  ? 708  TYR A CD1   1 
ATOM   5798 C  CD2   . TYR A 1 708 ? 11.666  -18.403 51.043 1.00 28.82  ? 708  TYR A CD2   1 
ATOM   5799 C  CE1   . TYR A 1 708 ? 10.679  -15.964 50.170 1.00 28.21  ? 708  TYR A CE1   1 
ATOM   5800 C  CE2   . TYR A 1 708 ? 10.284  -18.191 50.986 1.00 29.80  ? 708  TYR A CE2   1 
ATOM   5801 C  CZ    . TYR A 1 708 ? 9.799   -16.968 50.552 1.00 31.78  ? 708  TYR A CZ    1 
ATOM   5802 O  OH    . TYR A 1 708 ? 8.432   -16.747 50.492 1.00 29.30  ? 708  TYR A OH    1 
ATOM   5803 N  N     . ALA A 1 709 ? 14.585  -20.486 49.873 1.00 31.42  ? 709  ALA A N     1 
ATOM   5804 C  CA    . ALA A 1 709 ? 14.153  -21.862 49.674 1.00 30.73  ? 709  ALA A CA    1 
ATOM   5805 C  C     . ALA A 1 709 ? 13.893  -22.511 51.021 1.00 33.95  ? 709  ALA A C     1 
ATOM   5806 O  O     . ALA A 1 709 ? 14.609  -22.242 51.995 1.00 35.45  ? 709  ALA A O     1 
ATOM   5807 C  CB    . ALA A 1 709 ? 15.201  -22.649 48.887 1.00 30.50  ? 709  ALA A CB    1 
ATOM   5808 N  N     . LEU A 1 710 ? 12.860  -23.352 51.077 1.00 32.78  ? 710  LEU A N     1 
ATOM   5809 C  CA    . LEU A 1 710 ? 12.482  -24.039 52.309 1.00 34.76  ? 710  LEU A CA    1 
ATOM   5810 C  C     . LEU A 1 710 ? 12.115  -25.486 52.038 1.00 34.93  ? 710  LEU A C     1 
ATOM   5811 O  O     . LEU A 1 710 ? 11.407  -25.787 51.063 1.00 36.76  ? 710  LEU A O     1 
ATOM   5812 C  CB    . LEU A 1 710 ? 11.292  -23.347 52.991 1.00 34.74  ? 710  LEU A CB    1 
ATOM   5813 C  CG    . LEU A 1 710 ? 11.465  -21.920 53.520 1.00 35.52  ? 710  LEU A CG    1 
ATOM   5814 C  CD1   . LEU A 1 710 ? 10.127  -21.373 54.002 1.00 35.14  ? 710  LEU A CD1   1 
ATOM   5815 C  CD2   . LEU A 1 710 ? 12.514  -21.857 54.622 1.00 35.06  ? 710  LEU A CD2   1 
ATOM   5816 N  N     . ASN A 1 711 ? 12.608  -26.376 52.895 1.00 32.57  ? 711  ASN A N     1 
ATOM   5817 C  CA    . ASN A 1 711 ? 12.166  -27.759 52.891 1.00 33.44  ? 711  ASN A CA    1 
ATOM   5818 C  C     . ASN A 1 711 ? 10.931  -27.847 53.761 1.00 33.51  ? 711  ASN A C     1 
ATOM   5819 O  O     . ASN A 1 711 ? 11.024  -27.802 54.985 1.00 35.49  ? 711  ASN A O     1 
ATOM   5820 C  CB    . ASN A 1 711 ? 13.252  -28.693 53.422 1.00 32.61  ? 711  ASN A CB    1 
ATOM   5821 C  CG    . ASN A 1 711 ? 12.926  -30.142 53.168 1.00 34.93  ? 711  ASN A CG    1 
ATOM   5822 O  OD1   . ASN A 1 711 ? 12.671  -30.531 52.022 1.00 33.40  ? 711  ASN A OD1   1 
ATOM   5823 N  ND2   . ASN A 1 711 ? 12.899  -30.953 54.235 1.00 28.51  ? 711  ASN A ND2   1 
ATOM   5824 N  N     . VAL A 1 712 ? 9.773   -27.959 53.124 1.00 35.27  ? 712  VAL A N     1 
ATOM   5825 C  CA    . VAL A 1 712 ? 8.499   -27.793 53.826 1.00 34.75  ? 712  VAL A CA    1 
ATOM   5826 C  C     . VAL A 1 712 ? 7.823   -29.131 54.118 1.00 35.89  ? 712  VAL A C     1 
ATOM   5827 O  O     . VAL A 1 712 ? 7.701   -29.988 53.229 1.00 34.99  ? 712  VAL A O     1 
ATOM   5828 C  CB    . VAL A 1 712 ? 7.543   -26.857 53.042 1.00 32.78  ? 712  VAL A CB    1 
ATOM   5829 C  CG1   . VAL A 1 712 ? 6.158   -26.838 53.670 1.00 33.91  ? 712  VAL A CG1   1 
ATOM   5830 C  CG2   . VAL A 1 712 ? 8.108   -25.455 52.973 1.00 28.60  ? 712  VAL A CG2   1 
ATOM   5831 N  N     . TRP A 1 713 ? 7.375   -29.290 55.363 1.00 35.98  ? 713  TRP A N     1 
ATOM   5832 C  CA    . TRP A 1 713 ? 6.731   -30.526 55.816 1.00 36.14  ? 713  TRP A CA    1 
ATOM   5833 C  C     . TRP A 1 713 ? 5.198   -30.443 55.909 1.00 38.03  ? 713  TRP A C     1 
ATOM   5834 O  O     . TRP A 1 713 ? 4.501   -31.439 55.675 1.00 39.58  ? 713  TRP A O     1 
ATOM   5835 C  CB    . TRP A 1 713 ? 7.324   -30.947 57.156 1.00 35.35  ? 713  TRP A CB    1 
ATOM   5836 C  CG    . TRP A 1 713 ? 8.775   -31.280 57.072 1.00 34.92  ? 713  TRP A CG    1 
ATOM   5837 C  CD1   . TRP A 1 713 ? 9.817   -30.459 57.370 1.00 34.46  ? 713  TRP A CD1   1 
ATOM   5838 C  CD2   . TRP A 1 713 ? 9.350   -32.520 56.634 1.00 35.71  ? 713  TRP A CD2   1 
ATOM   5839 N  NE1   . TRP A 1 713 ? 11.011  -31.113 57.170 1.00 38.19  ? 713  TRP A NE1   1 
ATOM   5840 C  CE2   . TRP A 1 713 ? 10.755  -32.378 56.709 1.00 36.33  ? 713  TRP A CE2   1 
ATOM   5841 C  CE3   . TRP A 1 713 ? 8.814   -33.739 56.191 1.00 35.33  ? 713  TRP A CE3   1 
ATOM   5842 C  CZ2   . TRP A 1 713 ? 11.639  -33.409 56.358 1.00 35.91  ? 713  TRP A CZ2   1 
ATOM   5843 C  CZ3   . TRP A 1 713 ? 9.698   -34.772 55.842 1.00 39.21  ? 713  TRP A CZ3   1 
ATOM   5844 C  CH2   . TRP A 1 713 ? 11.095  -34.592 55.924 1.00 37.89  ? 713  TRP A CH2   1 
ATOM   5845 N  N     . ASP A 1 714 ? 4.689   -29.266 56.277 1.00 37.95  ? 714  ASP A N     1 
ATOM   5846 C  CA    . ASP A 1 714 ? 3.246   -29.006 56.360 1.00 37.66  ? 714  ASP A CA    1 
ATOM   5847 C  C     . ASP A 1 714 ? 2.946   -27.610 55.815 1.00 36.61  ? 714  ASP A C     1 
ATOM   5848 O  O     . ASP A 1 714 ? 3.645   -26.648 56.144 1.00 36.53  ? 714  ASP A O     1 
ATOM   5849 C  CB    . ASP A 1 714 ? 2.728   -29.147 57.803 1.00 37.47  ? 714  ASP A CB    1 
ATOM   5850 C  CG    . ASP A 1 714 ? 1.198   -29.028 57.906 1.00 40.57  ? 714  ASP A CG    1 
ATOM   5851 O  OD1   . ASP A 1 714 ? 0.633   -27.940 57.628 1.00 39.13  ? 714  ASP A OD1   1 
ATOM   5852 O  OD2   . ASP A 1 714 ? 0.553   -30.028 58.281 1.00 43.73  ? 714  ASP A OD2   1 
ATOM   5853 N  N     . MET A 1 715 ? 1.909   -27.511 54.985 1.00 36.18  ? 715  MET A N     1 
ATOM   5854 C  CA    . MET A 1 715 ? 1.543   -26.251 54.338 1.00 38.21  ? 715  MET A CA    1 
ATOM   5855 C  C     . MET A 1 715 ? 0.043   -25.991 54.399 1.00 37.96  ? 715  MET A C     1 
ATOM   5856 O  O     . MET A 1 715 ? -0.724  -26.578 53.637 1.00 36.81  ? 715  MET A O     1 
ATOM   5857 C  CB    . MET A 1 715 ? 2.029   -26.241 52.885 1.00 39.42  ? 715  MET A CB    1 
ATOM   5858 C  CG    . MET A 1 715 ? 1.760   -24.959 52.130 1.00 44.58  ? 715  MET A CG    1 
ATOM   5859 S  SD    . MET A 1 715 ? 2.838   -23.606 52.629 1.00 52.10  ? 715  MET A SD    1 
ATOM   5860 C  CE    . MET A 1 715 ? 2.235   -22.308 51.551 1.00 58.06  ? 715  MET A CE    1 
ATOM   5861 N  N     . GLU A 1 716 ? -0.351  -25.096 55.307 1.00 40.05  ? 716  GLU A N     1 
ATOM   5862 C  CA    . GLU A 1 716 ? -1.754  -24.713 55.531 1.00 42.73  ? 716  GLU A CA    1 
ATOM   5863 C  C     . GLU A 1 716 ? -2.634  -25.900 55.945 1.00 41.28  ? 716  GLU A C     1 
ATOM   5864 O  O     . GLU A 1 716 ? -3.777  -26.025 55.506 1.00 44.50  ? 716  GLU A O     1 
ATOM   5865 C  CB    . GLU A 1 716 ? -2.345  -23.982 54.310 1.00 42.92  ? 716  GLU A CB    1 
ATOM   5866 C  CG    . GLU A 1 716 ? -1.811  -22.576 54.098 1.00 49.59  ? 716  GLU A CG    1 
ATOM   5867 C  CD    . GLU A 1 716 ? -2.505  -21.838 52.948 1.00 56.49  ? 716  GLU A CD    1 
ATOM   5868 O  OE1   . GLU A 1 716 ? -3.162  -20.803 53.215 1.00 58.43  ? 716  GLU A OE1   1 
ATOM   5869 O  OE2   . GLU A 1 716 ? -2.393  -22.288 51.780 1.00 56.27  ? 716  GLU A OE2   1 
ATOM   5870 N  N     . GLY A 1 717 ? -2.093  -26.772 56.784 1.00 39.21  ? 717  GLY A N     1 
ATOM   5871 C  CA    . GLY A 1 717 ? -2.844  -27.922 57.272 1.00 39.59  ? 717  GLY A CA    1 
ATOM   5872 C  C     . GLY A 1 717 ? -2.655  -29.194 56.464 1.00 39.92  ? 717  GLY A C     1 
ATOM   5873 O  O     . GLY A 1 717 ? -3.056  -30.271 56.903 1.00 41.55  ? 717  GLY A O     1 
ATOM   5874 N  N     . THR A 1 718 ? -2.057  -29.077 55.283 1.00 36.26  ? 718  THR A N     1 
ATOM   5875 C  CA    . THR A 1 718 ? -1.745  -30.249 54.488 1.00 35.86  ? 718  THR A CA    1 
ATOM   5876 C  C     . THR A 1 718 ? -0.412  -30.833 54.949 1.00 36.63  ? 718  THR A C     1 
ATOM   5877 O  O     . THR A 1 718 ? 0.637   -30.216 54.757 1.00 36.18  ? 718  THR A O     1 
ATOM   5878 C  CB    . THR A 1 718 ? -1.652  -29.917 52.973 1.00 34.23  ? 718  THR A CB    1 
ATOM   5879 O  OG1   . THR A 1 718 ? -2.877  -29.326 52.521 1.00 31.89  ? 718  THR A OG1   1 
ATOM   5880 C  CG2   . THR A 1 718 ? -1.378  -31.162 52.174 1.00 33.76  ? 718  THR A CG2   1 
ATOM   5881 N  N     . ARG A 1 719 ? -0.454  -32.016 55.555 1.00 35.97  ? 719  ARG A N     1 
ATOM   5882 C  CA    . ARG A 1 719 ? 0.772   -32.731 55.883 1.00 38.07  ? 719  ARG A CA    1 
ATOM   5883 C  C     . ARG A 1 719 ? 1.185   -33.584 54.687 1.00 37.87  ? 719  ARG A C     1 
ATOM   5884 O  O     . ARG A 1 719 ? 0.455   -34.483 54.269 1.00 36.71  ? 719  ARG A O     1 
ATOM   5885 C  CB    . ARG A 1 719 ? 0.594   -33.591 57.137 1.00 38.30  ? 719  ARG A CB    1 
ATOM   5886 C  CG    . ARG A 1 719 ? 1.898   -34.192 57.669 1.00 39.83  ? 719  ARG A CG    1 
ATOM   5887 C  CD    . ARG A 1 719 ? 2.794   -33.140 58.310 1.00 36.69  ? 719  ARG A CD    1 
ATOM   5888 N  NE    . ARG A 1 719 ? 2.094   -32.397 59.355 1.00 42.22  ? 719  ARG A NE    1 
ATOM   5889 C  CZ    . ARG A 1 719 ? 1.938   -32.816 60.610 1.00 44.22  ? 719  ARG A CZ    1 
ATOM   5890 N  NH1   . ARG A 1 719 ? 2.426   -33.986 61.000 1.00 44.11  ? 719  ARG A NH1   1 
ATOM   5891 N  NH2   . ARG A 1 719 ? 1.286   -32.058 61.480 1.00 43.25  ? 719  ARG A NH2   1 
ATOM   5892 N  N     . TYR A 1 720 ? 2.349   -33.281 54.126 1.00 40.15  ? 720  TYR A N     1 
ATOM   5893 C  CA    . TYR A 1 720 ? 2.814   -33.974 52.926 1.00 41.43  ? 720  TYR A CA    1 
ATOM   5894 C  C     . TYR A 1 720 ? 3.308   -35.378 53.244 1.00 41.74  ? 720  TYR A C     1 
ATOM   5895 O  O     . TYR A 1 720 ? 3.930   -35.609 54.285 1.00 41.42  ? 720  TYR A O     1 
ATOM   5896 C  CB    . TYR A 1 720 ? 3.939   -33.198 52.245 1.00 41.59  ? 720  TYR A CB    1 
ATOM   5897 C  CG    . TYR A 1 720 ? 3.592   -31.812 51.764 1.00 43.37  ? 720  TYR A CG    1 
ATOM   5898 C  CD1   . TYR A 1 720 ? 2.466   -31.581 50.973 1.00 46.78  ? 720  TYR A CD1   1 
ATOM   5899 C  CD2   . TYR A 1 720 ? 4.424   -30.734 52.056 1.00 48.68  ? 720  TYR A CD2   1 
ATOM   5900 C  CE1   . TYR A 1 720 ? 2.157   -30.296 50.513 1.00 50.51  ? 720  TYR A CE1   1 
ATOM   5901 C  CE2   . TYR A 1 720 ? 4.127   -29.438 51.601 1.00 51.29  ? 720  TYR A CE2   1 
ATOM   5902 C  CZ    . TYR A 1 720 ? 2.993   -29.229 50.832 1.00 51.72  ? 720  TYR A CZ    1 
ATOM   5903 O  OH    . TYR A 1 720 ? 2.703   -27.959 50.377 1.00 52.89  ? 720  TYR A OH    1 
ATOM   5904 N  N     . ALA A 1 721 ? 3.025   -36.307 52.335 1.00 43.07  ? 721  ALA A N     1 
ATOM   5905 C  CA    . ALA A 1 721 ? 3.572   -37.658 52.392 1.00 44.64  ? 721  ALA A CA    1 
ATOM   5906 C  C     . ALA A 1 721 ? 5.095   -37.578 52.318 1.00 45.15  ? 721  ALA A C     1 
ATOM   5907 O  O     . ALA A 1 721 ? 5.800   -38.168 53.135 1.00 45.78  ? 721  ALA A O     1 
ATOM   5908 C  CB    . ALA A 1 721 ? 3.016   -38.502 51.243 1.00 44.10  ? 721  ALA A CB    1 
ATOM   5909 N  N     . GLU A 1 722 ? 5.574   -36.819 51.337 1.00 45.71  ? 722  GLU A N     1 
ATOM   5910 C  CA    . GLU A 1 722 ? 6.986   -36.541 51.142 1.00 47.56  ? 722  GLU A CA    1 
ATOM   5911 C  C     . GLU A 1 722 ? 7.198   -35.031 51.203 1.00 45.65  ? 722  GLU A C     1 
ATOM   5912 O  O     . GLU A 1 722 ? 6.374   -34.282 50.664 1.00 44.09  ? 722  GLU A O     1 
ATOM   5913 C  CB    . GLU A 1 722 ? 7.432   -37.061 49.767 1.00 50.79  ? 722  GLU A CB    1 
ATOM   5914 C  CG    . GLU A 1 722 ? 7.723   -38.556 49.711 1.00 58.99  ? 722  GLU A CG    1 
ATOM   5915 C  CD    . GLU A 1 722 ? 9.078   -38.908 50.311 1.00 64.70  ? 722  GLU A CD    1 
ATOM   5916 O  OE1   . GLU A 1 722 ? 10.116  -38.541 49.706 1.00 64.93  ? 722  GLU A OE1   1 
ATOM   5917 O  OE2   . GLU A 1 722 ? 9.097   -39.556 51.384 1.00 65.50  ? 722  GLU A OE2   1 
ATOM   5918 N  N     . PRO A 1 723 ? 8.316   -34.578 51.822 1.00 44.39  ? 723  PRO A N     1 
ATOM   5919 C  CA    . PRO A 1 723 ? 8.625   -33.149 51.937 1.00 44.02  ? 723  PRO A CA    1 
ATOM   5920 C  C     . PRO A 1 723 ? 8.683   -32.464 50.573 1.00 43.35  ? 723  PRO A C     1 
ATOM   5921 O  O     . PRO A 1 723 ? 9.069   -33.081 49.580 1.00 42.58  ? 723  PRO A O     1 
ATOM   5922 C  CB    . PRO A 1 723 ? 10.012  -33.139 52.589 1.00 43.15  ? 723  PRO A CB    1 
ATOM   5923 C  CG    . PRO A 1 723 ? 10.595  -34.449 52.249 1.00 42.87  ? 723  PRO A CG    1 
ATOM   5924 C  CD    . PRO A 1 723 ? 9.436   -35.397 52.316 1.00 45.05  ? 723  PRO A CD    1 
ATOM   5925 N  N     . LYS A 1 724 ? 8.301   -31.194 50.544 1.00 42.61  ? 724  LYS A N     1 
ATOM   5926 C  CA    . LYS A 1 724 ? 8.187   -30.440 49.300 1.00 43.28  ? 724  LYS A CA    1 
ATOM   5927 C  C     . LYS A 1 724 ? 9.035   -29.168 49.376 1.00 39.19  ? 724  LYS A C     1 
ATOM   5928 O  O     . LYS A 1 724 ? 9.111   -28.520 50.422 1.00 39.27  ? 724  LYS A O     1 
ATOM   5929 C  CB    . LYS A 1 724 ? 6.708   -30.112 49.048 1.00 46.02  ? 724  LYS A CB    1 
ATOM   5930 C  CG    . LYS A 1 724 ? 6.358   -29.637 47.634 1.00 55.56  ? 724  LYS A CG    1 
ATOM   5931 C  CD    . LYS A 1 724 ? 4.897   -29.974 47.289 1.00 62.34  ? 724  LYS A CD    1 
ATOM   5932 C  CE    . LYS A 1 724 ? 4.128   -28.764 46.729 1.00 65.02  ? 724  LYS A CE    1 
ATOM   5933 N  NZ    . LYS A 1 724 ? 4.516   -28.377 45.343 1.00 66.27  ? 724  LYS A NZ    1 
ATOM   5934 N  N     . LEU A 1 725 ? 9.686   -28.817 48.274 1.00 37.29  ? 725  LEU A N     1 
ATOM   5935 C  CA    . LEU A 1 725 ? 10.503  -27.608 48.256 1.00 35.21  ? 725  LEU A CA    1 
ATOM   5936 C  C     . LEU A 1 725 ? 9.635   -26.412 47.962 1.00 34.63  ? 725  LEU A C     1 
ATOM   5937 O  O     . LEU A 1 725 ? 8.947   -26.382 46.941 1.00 37.19  ? 725  LEU A O     1 
ATOM   5938 C  CB    . LEU A 1 725 ? 11.613  -27.681 47.212 1.00 33.77  ? 725  LEU A CB    1 
ATOM   5939 C  CG    . LEU A 1 725 ? 12.690  -28.760 47.297 1.00 34.24  ? 725  LEU A CG    1 
ATOM   5940 C  CD1   . LEU A 1 725 ? 13.696  -28.552 46.161 1.00 31.29  ? 725  LEU A CD1   1 
ATOM   5941 C  CD2   . LEU A 1 725 ? 13.388  -28.758 48.653 1.00 33.14  ? 725  LEU A CD2   1 
ATOM   5942 N  N     . LYS A 1 726 ? 9.657   -25.438 48.864 1.00 30.36  ? 726  LYS A N     1 
ATOM   5943 C  CA    . LYS A 1 726 ? 9.071   -24.151 48.582 1.00 31.78  ? 726  LYS A CA    1 
ATOM   5944 C  C     . LYS A 1 726 ? 10.212  -23.218 48.207 1.00 30.77  ? 726  LYS A C     1 
ATOM   5945 O  O     . LYS A 1 726 ? 10.971  -22.788 49.069 1.00 32.41  ? 726  LYS A O     1 
ATOM   5946 C  CB    . LYS A 1 726 ? 8.271   -23.627 49.790 1.00 32.06  ? 726  LYS A CB    1 
ATOM   5947 C  CG    . LYS A 1 726 ? 7.771   -22.179 49.651 1.00 36.85  ? 726  LYS A CG    1 
ATOM   5948 C  CD    . LYS A 1 726 ? 6.581   -21.891 50.561 1.00 38.63  ? 726  LYS A CD    1 
ATOM   5949 C  CE    . LYS A 1 726 ? 6.383   -20.402 50.806 1.00 39.62  ? 726  LYS A CE    1 
ATOM   5950 N  NZ    . LYS A 1 726 ? 6.019   -19.634 49.590 1.00 39.06  ? 726  LYS A NZ    1 
ATOM   5951 N  N     . ILE A 1 727 ? 10.340  -22.942 46.912 1.00 29.55  ? 727  ILE A N     1 
ATOM   5952 C  CA    . ILE A 1 727 ? 11.381  -22.066 46.384 1.00 29.02  ? 727  ILE A CA    1 
ATOM   5953 C  C     . ILE A 1 727 ? 10.750  -20.812 45.790 1.00 30.50  ? 727  ILE A C     1 
ATOM   5954 O  O     . ILE A 1 727 ? 9.908   -20.901 44.907 1.00 32.78  ? 727  ILE A O     1 
ATOM   5955 C  CB    . ILE A 1 727 ? 12.205  -22.760 45.277 1.00 30.47  ? 727  ILE A CB    1 
ATOM   5956 C  CG1   . ILE A 1 727 ? 12.824  -24.066 45.794 1.00 32.49  ? 727  ILE A CG1   1 
ATOM   5957 C  CG2   . ILE A 1 727 ? 13.284  -21.809 44.735 1.00 33.05  ? 727  ILE A CG2   1 
ATOM   5958 C  CD1   . ILE A 1 727 ? 13.364  -24.994 44.698 1.00 29.27  ? 727  ILE A CD1   1 
ATOM   5959 N  N     . MET A 1 728 ? 11.170  -19.645 46.268 1.00 29.82  ? 728  MET A N     1 
ATOM   5960 C  CA    . MET A 1 728 ? 10.637  -18.393 45.782 1.00 30.03  ? 728  MET A CA    1 
ATOM   5961 C  C     . MET A 1 728 ? 11.748  -17.531 45.202 1.00 29.13  ? 728  MET A C     1 
ATOM   5962 O  O     . MET A 1 728 ? 12.802  -17.380 45.814 1.00 31.17  ? 728  MET A O     1 
ATOM   5963 C  CB    . MET A 1 728 ? 9.918   -17.640 46.912 1.00 33.23  ? 728  MET A CB    1 
ATOM   5964 C  CG    . MET A 1 728 ? 8.844   -18.452 47.665 1.00 37.58  ? 728  MET A CG    1 
ATOM   5965 S  SD    . MET A 1 728 ? 7.498   -19.157 46.665 1.00 43.83  ? 728  MET A SD    1 
ATOM   5966 C  CE    . MET A 1 728 ? 7.044   -17.815 45.588 1.00 31.07  ? 728  MET A CE    1 
ATOM   5967 N  N     . GLY A 1 729 ? 11.519  -16.989 44.009 1.00 27.12  ? 729  GLY A N     1 
ATOM   5968 C  CA    . GLY A 1 729 ? 12.418  -16.001 43.424 1.00 25.54  ? 729  GLY A CA    1 
ATOM   5969 C  C     . GLY A 1 729 ? 13.652  -16.535 42.724 1.00 27.07  ? 729  GLY A C     1 
ATOM   5970 O  O     . GLY A 1 729 ? 14.139  -15.927 41.765 1.00 28.25  ? 729  GLY A O     1 
ATOM   5971 N  N     . LEU A 1 730 ? 14.162  -17.672 43.192 1.00 27.61  ? 730  LEU A N     1 
ATOM   5972 C  CA    . LEU A 1 730 ? 15.414  -18.212 42.667 1.00 28.33  ? 730  LEU A CA    1 
ATOM   5973 C  C     . LEU A 1 730 ? 15.248  -18.660 41.218 1.00 28.62  ? 730  LEU A C     1 
ATOM   5974 O  O     . LEU A 1 730 ? 14.122  -18.841 40.742 1.00 27.64  ? 730  LEU A O     1 
ATOM   5975 C  CB    . LEU A 1 730 ? 15.923  -19.355 43.543 1.00 28.26  ? 730  LEU A CB    1 
ATOM   5976 C  CG    . LEU A 1 730 ? 16.121  -19.024 45.026 1.00 29.64  ? 730  LEU A CG    1 
ATOM   5977 C  CD1   . LEU A 1 730 ? 16.632  -20.247 45.755 1.00 29.76  ? 730  LEU A CD1   1 
ATOM   5978 C  CD2   . LEU A 1 730 ? 17.063  -17.848 45.227 1.00 27.40  ? 730  LEU A CD2   1 
ATOM   5979 N  N     . GLU A 1 731 ? 16.376  -18.844 40.536 1.00 26.90  ? 731  GLU A N     1 
ATOM   5980 C  CA    . GLU A 1 731 ? 16.410  -19.156 39.112 1.00 29.66  ? 731  GLU A CA    1 
ATOM   5981 C  C     . GLU A 1 731 ? 15.584  -20.377 38.715 1.00 32.84  ? 731  GLU A C     1 
ATOM   5982 O  O     . GLU A 1 731 ? 15.093  -20.452 37.589 1.00 35.01  ? 731  GLU A O     1 
ATOM   5983 C  CB    . GLU A 1 731 ? 17.858  -19.272 38.633 1.00 30.56  ? 731  GLU A CB    1 
ATOM   5984 C  CG    . GLU A 1 731 ? 18.544  -17.906 38.391 1.00 33.39  ? 731  GLU A CG    1 
ATOM   5985 C  CD    . GLU A 1 731 ? 19.017  -17.174 39.669 1.00 33.89  ? 731  GLU A CD    1 
ATOM   5986 O  OE1   . GLU A 1 731 ? 18.798  -17.668 40.794 1.00 27.47  ? 731  GLU A OE1   1 
ATOM   5987 O  OE2   . GLU A 1 731 ? 19.626  -16.084 39.538 1.00 40.22  ? 731  GLU A OE2   1 
ATOM   5988 N  N     . THR A 1 732 ? 15.407  -21.314 39.645 1.00 32.27  ? 732  THR A N     1 
ATOM   5989 C  CA    . THR A 1 732 ? 14.536  -22.464 39.426 1.00 33.01  ? 732  THR A CA    1 
ATOM   5990 C  C     . THR A 1 732 ? 13.100  -22.058 39.101 1.00 34.61  ? 732  THR A C     1 
ATOM   5991 O  O     . THR A 1 732 ? 12.383  -22.794 38.423 1.00 36.86  ? 732  THR A O     1 
ATOM   5992 C  CB    . THR A 1 732 ? 14.500  -23.391 40.650 1.00 34.81  ? 732  THR A CB    1 
ATOM   5993 O  OG1   . THR A 1 732 ? 14.138  -22.640 41.821 1.00 32.22  ? 732  THR A OG1   1 
ATOM   5994 C  CG2   . THR A 1 732 ? 15.843  -24.042 40.861 1.00 33.90  ? 732  THR A CG2   1 
ATOM   5995 N  N     . GLN A 1 733 ? 12.690  -20.885 39.578 1.00 34.67  ? 733  GLN A N     1 
ATOM   5996 C  CA    . GLN A 1 733 ? 11.306  -20.425 39.428 1.00 33.57  ? 733  GLN A CA    1 
ATOM   5997 C  C     . GLN A 1 733 ? 11.061  -19.537 38.211 1.00 31.89  ? 733  GLN A C     1 
ATOM   5998 O  O     . GLN A 1 733 ? 9.916   -19.219 37.917 1.00 32.18  ? 733  GLN A O     1 
ATOM   5999 C  CB    . GLN A 1 733 ? 10.849  -19.687 40.694 1.00 33.42  ? 733  GLN A CB    1 
ATOM   6000 C  CG    . GLN A 1 733 ? 11.031  -20.476 41.984 1.00 36.54  ? 733  GLN A CG    1 
ATOM   6001 C  CD    . GLN A 1 733 ? 10.618  -21.928 41.850 1.00 37.29  ? 733  GLN A CD    1 
ATOM   6002 O  OE1   . GLN A 1 733 ? 11.466  -22.827 41.836 1.00 37.76  ? 733  GLN A OE1   1 
ATOM   6003 N  NE2   . GLN A 1 733 ? 9.319   -22.166 41.717 1.00 34.13  ? 733  GLN A NE2   1 
ATOM   6004 N  N     . LYS A 1 734 ? 12.130  -19.142 37.518 1.00 31.72  ? 734  LYS A N     1 
ATOM   6005 C  CA    . LYS A 1 734 ? 12.046  -18.171 36.417 1.00 33.71  ? 734  LYS A CA    1 
ATOM   6006 C  C     . LYS A 1 734 ? 12.000  -18.845 35.058 1.00 31.67  ? 734  LYS A C     1 
ATOM   6007 O  O     . LYS A 1 734 ? 12.803  -19.744 34.769 1.00 29.27  ? 734  LYS A O     1 
ATOM   6008 C  CB    . LYS A 1 734 ? 13.240  -17.203 36.441 1.00 37.71  ? 734  LYS A CB    1 
ATOM   6009 C  CG    . LYS A 1 734 ? 13.380  -16.350 37.703 1.00 42.91  ? 734  LYS A CG    1 
ATOM   6010 C  CD    . LYS A 1 734 ? 14.720  -15.598 37.722 1.00 51.74  ? 734  LYS A CD    1 
ATOM   6011 C  CE    . LYS A 1 734 ? 14.770  -14.408 36.740 1.00 56.85  ? 734  LYS A CE    1 
ATOM   6012 N  NZ    . LYS A 1 734 ? 14.219  -13.147 37.336 1.00 59.28  ? 734  LYS A NZ    1 
ATOM   6013 N  N     . SER A 1 735 ? 11.084  -18.371 34.216 1.00 31.08  ? 735  SER A N     1 
ATOM   6014 C  CA    . SER A 1 735 ? 10.885  -18.907 32.870 1.00 33.07  ? 735  SER A CA    1 
ATOM   6015 C  C     . SER A 1 735 ? 12.067  -18.644 31.923 1.00 33.22  ? 735  SER A C     1 
ATOM   6016 O  O     . SER A 1 735 ? 12.184  -19.275 30.874 1.00 34.88  ? 735  SER A O     1 
ATOM   6017 C  CB    . SER A 1 735 ? 9.588   -18.361 32.271 1.00 34.42  ? 735  SER A CB    1 
ATOM   6018 O  OG    . SER A 1 735 ? 9.670   -16.962 32.032 1.00 38.97  ? 735  SER A OG    1 
ATOM   6019 N  N     . SER A 1 736 ? 12.933  -17.710 32.300 1.00 33.14  ? 736  SER A N     1 
ATOM   6020 C  CA    . SER A 1 736 ? 14.112  -17.362 31.504 1.00 33.76  ? 736  SER A CA    1 
ATOM   6021 C  C     . SER A 1 736 ? 15.286  -18.338 31.704 1.00 32.93  ? 736  SER A C     1 
ATOM   6022 O  O     . SER A 1 736 ? 16.231  -18.361 30.913 1.00 33.06  ? 736  SER A O     1 
ATOM   6023 C  CB    . SER A 1 736 ? 14.542  -15.924 31.817 1.00 32.37  ? 736  SER A CB    1 
ATOM   6024 O  OG    . SER A 1 736 ? 14.578  -15.707 33.216 1.00 34.45  ? 736  SER A OG    1 
ATOM   6025 N  N     . THR A 1 737 ? 15.211  -19.134 32.766 1.00 32.67  ? 737  THR A N     1 
ATOM   6026 C  CA    . THR A 1 737 ? 16.236  -20.116 33.112 1.00 31.19  ? 737  THR A CA    1 
ATOM   6027 C  C     . THR A 1 737 ? 16.058  -21.365 32.253 1.00 30.38  ? 737  THR A C     1 
ATOM   6028 O  O     . THR A 1 737 ? 14.962  -21.919 32.195 1.00 28.23  ? 737  THR A O     1 
ATOM   6029 C  CB    . THR A 1 737 ? 16.132  -20.513 34.608 1.00 30.98  ? 737  THR A CB    1 
ATOM   6030 O  OG1   . THR A 1 737 ? 16.158  -19.338 35.420 1.00 35.80  ? 737  THR A OG1   1 
ATOM   6031 C  CG2   . THR A 1 737 ? 17.264  -21.435 35.028 1.00 26.59  ? 737  THR A CG2   1 
ATOM   6032 N  N     . PRO A 1 738 ? 17.139  -21.822 31.595 1.00 30.21  ? 738  PRO A N     1 
ATOM   6033 C  CA    . PRO A 1 738 ? 17.049  -23.042 30.775 1.00 29.91  ? 738  PRO A CA    1 
ATOM   6034 C  C     . PRO A 1 738 ? 16.403  -24.206 31.538 1.00 30.44  ? 738  PRO A C     1 
ATOM   6035 O  O     . PRO A 1 738 ? 16.676  -24.403 32.728 1.00 31.97  ? 738  PRO A O     1 
ATOM   6036 C  CB    . PRO A 1 738 ? 18.515  -23.370 30.454 1.00 28.99  ? 738  PRO A CB    1 
ATOM   6037 C  CG    . PRO A 1 738 ? 19.259  -22.082 30.621 1.00 28.66  ? 738  PRO A CG    1 
ATOM   6038 C  CD    . PRO A 1 738 ? 18.501  -21.249 31.622 1.00 28.59  ? 738  PRO A CD    1 
ATOM   6039 N  N     . LYS A 1 739 ? 15.545  -24.955 30.853 1.00 31.30  ? 739  LYS A N     1 
ATOM   6040 C  CA    . LYS A 1 739 ? 14.856  -26.106 31.434 1.00 34.30  ? 739  LYS A CA    1 
ATOM   6041 C  C     . LYS A 1 739 ? 15.756  -27.002 32.284 1.00 32.26  ? 739  LYS A C     1 
ATOM   6042 O  O     . LYS A 1 739 ? 15.467  -27.241 33.462 1.00 31.36  ? 739  LYS A O     1 
ATOM   6043 C  CB    . LYS A 1 739 ? 14.195  -26.947 30.329 1.00 38.27  ? 739  LYS A CB    1 
ATOM   6044 C  CG    . LYS A 1 739 ? 12.705  -26.737 30.165 1.00 46.49  ? 739  LYS A CG    1 
ATOM   6045 C  CD    . LYS A 1 739 ? 11.920  -27.429 31.278 1.00 54.23  ? 739  LYS A CD    1 
ATOM   6046 C  CE    . LYS A 1 739 ? 10.417  -27.401 31.008 1.00 59.33  ? 739  LYS A CE    1 
ATOM   6047 N  NZ    . LYS A 1 739 ? 10.027  -28.342 29.907 1.00 63.89  ? 739  LYS A NZ    1 
ATOM   6048 N  N     . ALA A 1 740 ? 16.842  -27.494 31.687 1.00 30.57  ? 740  ALA A N     1 
ATOM   6049 C  CA    . ALA A 1 740 ? 17.717  -28.459 32.361 1.00 30.23  ? 740  ALA A CA    1 
ATOM   6050 C  C     . ALA A 1 740 ? 18.496  -27.816 33.503 1.00 30.80  ? 740  ALA A C     1 
ATOM   6051 O  O     . ALA A 1 740 ? 18.896  -28.491 34.452 1.00 33.21  ? 740  ALA A O     1 
ATOM   6052 C  CB    . ALA A 1 740 ? 18.651  -29.129 31.377 1.00 28.73  ? 740  ALA A CB    1 
ATOM   6053 N  N     . VAL A 1 741 ? 18.670  -26.500 33.431 1.00 31.73  ? 741  VAL A N     1 
ATOM   6054 C  CA    . VAL A 1 741 ? 19.303  -25.770 34.515 1.00 30.25  ? 741  VAL A CA    1 
ATOM   6055 C  C     . VAL A 1 741 ? 18.331  -25.587 35.693 1.00 31.61  ? 741  VAL A C     1 
ATOM   6056 O  O     . VAL A 1 741 ? 18.743  -25.668 36.862 1.00 30.76  ? 741  VAL A O     1 
ATOM   6057 C  CB    . VAL A 1 741 ? 19.898  -24.441 34.023 1.00 30.91  ? 741  VAL A CB    1 
ATOM   6058 C  CG1   . VAL A 1 741 ? 20.479  -23.647 35.175 1.00 30.33  ? 741  VAL A CG1   1 
ATOM   6059 C  CG2   . VAL A 1 741 ? 20.970  -24.707 32.970 1.00 28.35  ? 741  VAL A CG2   1 
ATOM   6060 N  N     . GLN A 1 742 ? 17.043  -25.391 35.395 1.00 31.24  ? 742  GLN A N     1 
ATOM   6061 C  CA    . GLN A 1 742 ? 16.031  -25.299 36.461 1.00 34.02  ? 742  GLN A CA    1 
ATOM   6062 C  C     . GLN A 1 742 ? 16.070  -26.601 37.246 1.00 32.22  ? 742  GLN A C     1 
ATOM   6063 O  O     . GLN A 1 742 ? 16.135  -26.611 38.479 1.00 30.34  ? 742  GLN A O     1 
ATOM   6064 C  CB    . GLN A 1 742 ? 14.613  -25.100 35.905 1.00 33.69  ? 742  GLN A CB    1 
ATOM   6065 C  CG    . GLN A 1 742 ? 14.351  -23.787 35.177 1.00 36.17  ? 742  GLN A CG    1 
ATOM   6066 C  CD    . GLN A 1 742 ? 12.915  -23.687 34.664 1.00 34.87  ? 742  GLN A CD    1 
ATOM   6067 O  OE1   . GLN A 1 742 ? 12.279  -24.692 34.376 1.00 39.74  ? 742  GLN A OE1   1 
ATOM   6068 N  NE2   . GLN A 1 742 ? 12.412  -22.474 34.545 1.00 29.60  ? 742  GLN A NE2   1 
ATOM   6069 N  N     . LYS A 1 743 ? 16.067  -27.692 36.492 1.00 33.75  ? 743  LYS A N     1 
ATOM   6070 C  CA    . LYS A 1 743 ? 16.070  -29.039 37.029 1.00 34.96  ? 743  LYS A CA    1 
ATOM   6071 C  C     . LYS A 1 743 ? 17.343  -29.289 37.844 1.00 33.47  ? 743  LYS A C     1 
ATOM   6072 O  O     . LYS A 1 743 ? 17.270  -29.830 38.939 1.00 36.84  ? 743  LYS A O     1 
ATOM   6073 C  CB    . LYS A 1 743 ? 15.919  -30.028 35.876 1.00 36.52  ? 743  LYS A CB    1 
ATOM   6074 C  CG    . LYS A 1 743 ? 15.412  -31.393 36.255 1.00 44.32  ? 743  LYS A CG    1 
ATOM   6075 C  CD    . LYS A 1 743 ? 14.805  -32.086 35.033 1.00 50.28  ? 743  LYS A CD    1 
ATOM   6076 C  CE    . LYS A 1 743 ? 15.077  -33.595 35.019 1.00 52.21  ? 743  LYS A CE    1 
ATOM   6077 N  NZ    . LYS A 1 743 ? 14.762  -34.282 36.310 1.00 50.62  ? 743  LYS A NZ    1 
ATOM   6078 N  N     . ALA A 1 744 ? 18.495  -28.852 37.336 1.00 32.11  ? 744  ALA A N     1 
ATOM   6079 C  CA    . ALA A 1 744 ? 19.768  -29.035 38.052 1.00 31.70  ? 744  ALA A CA    1 
ATOM   6080 C  C     . ALA A 1 744 ? 19.889  -28.199 39.334 1.00 32.18  ? 744  ALA A C     1 
ATOM   6081 O  O     . ALA A 1 744 ? 20.407  -28.678 40.349 1.00 31.46  ? 744  ALA A O     1 
ATOM   6082 C  CB    . ALA A 1 744 ? 20.936  -28.754 37.137 1.00 29.64  ? 744  ALA A CB    1 
ATOM   6083 N  N     . LEU A 1 745 ? 19.423  -26.951 39.287 1.00 32.61  ? 745  LEU A N     1 
ATOM   6084 C  CA    . LEU A 1 745 ? 19.488  -26.075 40.460 1.00 32.42  ? 745  LEU A CA    1 
ATOM   6085 C  C     . LEU A 1 745 ? 18.500  -26.525 41.539 1.00 32.23  ? 745  LEU A C     1 
ATOM   6086 O  O     . LEU A 1 745 ? 18.778  -26.409 42.729 1.00 33.62  ? 745  LEU A O     1 
ATOM   6087 C  CB    . LEU A 1 745 ? 19.267  -24.601 40.079 1.00 32.20  ? 745  LEU A CB    1 
ATOM   6088 C  CG    . LEU A 1 745 ? 20.390  -23.838 39.354 1.00 34.35  ? 745  LEU A CG    1 
ATOM   6089 C  CD1   . LEU A 1 745 ? 19.863  -22.544 38.739 1.00 33.12  ? 745  LEU A CD1   1 
ATOM   6090 C  CD2   . LEU A 1 745 ? 21.587  -23.538 40.273 1.00 34.20  ? 745  LEU A CD2   1 
ATOM   6091 N  N     . LYS A 1 746 ? 17.362  -27.066 41.122 1.00 31.65  ? 746  LYS A N     1 
ATOM   6092 C  CA    . LYS A 1 746 ? 16.397  -27.579 42.077 1.00 32.88  ? 746  LYS A CA    1 
ATOM   6093 C  C     . LYS A 1 746 ? 16.981  -28.783 42.825 1.00 32.66  ? 746  LYS A C     1 
ATOM   6094 O  O     . LYS A 1 746 ? 16.915  -28.855 44.055 1.00 32.99  ? 746  LYS A O     1 
ATOM   6095 C  CB    . LYS A 1 746 ? 15.078  -27.930 41.390 1.00 31.77  ? 746  LYS A CB    1 
ATOM   6096 C  CG    . LYS A 1 746 ? 13.961  -28.220 42.358 1.00 36.00  ? 746  LYS A CG    1 
ATOM   6097 C  CD    . LYS A 1 746 ? 12.601  -28.245 41.688 1.00 41.82  ? 746  LYS A CD    1 
ATOM   6098 C  CE    . LYS A 1 746 ? 11.517  -28.553 42.715 1.00 47.15  ? 746  LYS A CE    1 
ATOM   6099 N  NZ    . LYS A 1 746 ? 10.382  -29.306 42.111 1.00 49.83  ? 746  LYS A NZ    1 
ATOM   6100 N  N     . GLU A 1 747 ? 17.566  -29.716 42.089 1.00 31.81  ? 747  GLU A N     1 
ATOM   6101 C  CA    . GLU A 1 747 ? 18.196  -30.871 42.726 1.00 34.76  ? 747  GLU A CA    1 
ATOM   6102 C  C     . GLU A 1 747 ? 19.393  -30.455 43.612 1.00 33.86  ? 747  GLU A C     1 
ATOM   6103 O  O     . GLU A 1 747 ? 19.617  -31.037 44.672 1.00 34.79  ? 747  GLU A O     1 
ATOM   6104 C  CB    . GLU A 1 747 ? 18.566  -31.944 41.687 1.00 35.07  ? 747  GLU A CB    1 
ATOM   6105 C  CG    . GLU A 1 747 ? 19.277  -33.193 42.247 1.00 39.89  ? 747  GLU A CG    1 
ATOM   6106 C  CD    . GLU A 1 747 ? 18.417  -34.053 43.186 1.00 41.58  ? 747  GLU A CD    1 
ATOM   6107 O  OE1   . GLU A 1 747 ? 18.996  -34.932 43.853 1.00 39.13  ? 747  GLU A OE1   1 
ATOM   6108 O  OE2   . GLU A 1 747 ? 17.178  -33.872 43.256 1.00 42.15  ? 747  GLU A OE2   1 
ATOM   6109 N  N     . CYS A 1 748 ? 20.135  -29.437 43.184 1.00 33.03  ? 748  CYS A N     1 
ATOM   6110 C  CA    . CYS A 1 748 ? 21.175  -28.841 44.018 1.00 33.11  ? 748  CYS A CA    1 
ATOM   6111 C  C     . CYS A 1 748 ? 20.584  -28.286 45.314 1.00 33.35  ? 748  CYS A C     1 
ATOM   6112 O  O     . CYS A 1 748 ? 21.097  -28.544 46.412 1.00 32.65  ? 748  CYS A O     1 
ATOM   6113 C  CB    . CYS A 1 748 ? 21.899  -27.732 43.263 1.00 32.11  ? 748  CYS A CB    1 
ATOM   6114 S  SG    . CYS A 1 748 ? 23.153  -28.320 42.126 1.00 37.45  ? 748  CYS A SG    1 
ATOM   6115 N  N     . ILE A 1 749 ? 19.503  -27.526 45.179 1.00 30.92  ? 749  ILE A N     1 
ATOM   6116 C  CA    . ILE A 1 749 ? 18.801  -27.004 46.339 1.00 32.48  ? 749  ILE A CA    1 
ATOM   6117 C  C     . ILE A 1 749 ? 18.265  -28.145 47.206 1.00 33.33  ? 749  ILE A C     1 
ATOM   6118 O  O     . ILE A 1 749 ? 18.461  -28.142 48.430 1.00 33.01  ? 749  ILE A O     1 
ATOM   6119 C  CB    . ILE A 1 749 ? 17.675  -26.012 45.931 1.00 32.76  ? 749  ILE A CB    1 
ATOM   6120 C  CG1   . ILE A 1 749 ? 18.298  -24.696 45.457 1.00 33.56  ? 749  ILE A CG1   1 
ATOM   6121 C  CG2   . ILE A 1 749 ? 16.711  -25.760 47.088 1.00 26.78  ? 749  ILE A CG2   1 
ATOM   6122 C  CD1   . ILE A 1 749 ? 17.367  -23.825 44.669 1.00 31.36  ? 749  ILE A CD1   1 
ATOM   6123 N  N     . ARG A 1 750 ? 17.615  -29.124 46.578 1.00 34.68  ? 750  ARG A N     1 
ATOM   6124 C  CA    . ARG A 1 750 ? 17.077  -30.260 47.329 1.00 36.08  ? 750  ARG A CA    1 
ATOM   6125 C  C     . ARG A 1 750 ? 18.155  -30.888 48.202 1.00 35.73  ? 750  ARG A C     1 
ATOM   6126 O  O     . ARG A 1 750 ? 17.949  -31.113 49.398 1.00 37.06  ? 750  ARG A O     1 
ATOM   6127 C  CB    . ARG A 1 750 ? 16.460  -31.321 46.417 1.00 36.57  ? 750  ARG A CB    1 
ATOM   6128 C  CG    . ARG A 1 750 ? 15.566  -32.297 47.194 1.00 38.82  ? 750  ARG A CG    1 
ATOM   6129 C  CD    . ARG A 1 750 ? 15.247  -33.552 46.417 1.00 38.11  ? 750  ARG A CD    1 
ATOM   6130 N  NE    . ARG A 1 750 ? 16.453  -34.272 46.009 1.00 41.23  ? 750  ARG A NE    1 
ATOM   6131 C  CZ    . ARG A 1 750 ? 17.150  -35.098 46.788 1.00 39.48  ? 750  ARG A CZ    1 
ATOM   6132 N  NH1   . ARG A 1 750 ? 16.774  -35.316 48.043 1.00 35.21  ? 750  ARG A NH1   1 
ATOM   6133 N  NH2   . ARG A 1 750 ? 18.231  -35.710 46.302 1.00 35.60  ? 750  ARG A NH2   1 
ATOM   6134 N  N     . ARG A 1 751 ? 19.315  -31.135 47.609 1.00 35.46  ? 751  ARG A N     1 
ATOM   6135 C  CA    . ARG A 1 751 ? 20.419  -31.762 48.334 1.00 33.91  ? 751  ARG A CA    1 
ATOM   6136 C  C     . ARG A 1 751 ? 20.954  -30.904 49.480 1.00 33.99  ? 751  ARG A C     1 
ATOM   6137 O  O     . ARG A 1 751 ? 21.313  -31.433 50.525 1.00 33.95  ? 751  ARG A O     1 
ATOM   6138 C  CB    . ARG A 1 751 ? 21.522  -32.200 47.370 1.00 31.30  ? 751  ARG A CB    1 
ATOM   6139 C  CG    . ARG A 1 751 ? 21.114  -33.433 46.563 1.00 31.13  ? 751  ARG A CG    1 
ATOM   6140 C  CD    . ARG A 1 751 ? 22.035  -33.682 45.391 1.00 33.41  ? 751  ARG A CD    1 
ATOM   6141 N  NE    . ARG A 1 751 ? 21.689  -34.921 44.698 1.00 33.56  ? 751  ARG A NE    1 
ATOM   6142 C  CZ    . ARG A 1 751 ? 22.474  -35.996 44.611 1.00 35.25  ? 751  ARG A CZ    1 
ATOM   6143 N  NH1   . ARG A 1 751 ? 23.682  -36.007 45.166 1.00 31.41  ? 751  ARG A NH1   1 
ATOM   6144 N  NH2   . ARG A 1 751 ? 22.042  -37.071 43.959 1.00 35.23  ? 751  ARG A NH2   1 
ATOM   6145 N  N     . MET A 1 752 ? 20.988  -29.588 49.287 1.00 33.70  ? 752  MET A N     1 
ATOM   6146 C  CA    . MET A 1 752 ? 21.442  -28.670 50.325 1.00 34.46  ? 752  MET A CA    1 
ATOM   6147 C  C     . MET A 1 752 ? 20.516  -28.752 51.535 1.00 35.10  ? 752  MET A C     1 
ATOM   6148 O  O     . MET A 1 752 ? 20.962  -28.900 52.677 1.00 34.28  ? 752  MET A O     1 
ATOM   6149 C  CB    . MET A 1 752 ? 21.465  -27.231 49.802 1.00 36.78  ? 752  MET A CB    1 
ATOM   6150 C  CG    . MET A 1 752 ? 22.510  -26.930 48.729 1.00 39.34  ? 752  MET A CG    1 
ATOM   6151 S  SD    . MET A 1 752 ? 22.334  -25.305 47.927 1.00 43.41  ? 752  MET A SD    1 
ATOM   6152 C  CE    . MET A 1 752 ? 22.376  -24.201 49.334 1.00 37.61  ? 752  MET A CE    1 
ATOM   6153 N  N     . LEU A 1 753 ? 19.219  -28.668 51.264 1.00 35.90  ? 753  LEU A N     1 
ATOM   6154 C  CA    . LEU A 1 753 ? 18.204  -28.579 52.304 1.00 35.36  ? 753  LEU A CA    1 
ATOM   6155 C  C     . LEU A 1 753 ? 17.934  -29.893 53.024 1.00 35.40  ? 753  LEU A C     1 
ATOM   6156 O  O     . LEU A 1 753 ? 17.653  -29.892 54.230 1.00 37.49  ? 753  LEU A O     1 
ATOM   6157 C  CB    . LEU A 1 753 ? 16.894  -28.028 51.731 1.00 33.68  ? 753  LEU A CB    1 
ATOM   6158 C  CG    . LEU A 1 753 ? 16.844  -26.651 51.057 1.00 35.80  ? 753  LEU A CG    1 
ATOM   6159 C  CD1   . LEU A 1 753 ? 15.396  -26.184 51.044 1.00 36.43  ? 753  LEU A CD1   1 
ATOM   6160 C  CD2   . LEU A 1 753 ? 17.732  -25.576 51.699 1.00 32.04  ? 753  LEU A CD2   1 
ATOM   6161 N  N     . GLN A 1 754 ? 18.012  -31.004 52.296 1.00 34.43  ? 754  GLN A N     1 
ATOM   6162 C  CA    . GLN A 1 754 ? 17.626  -32.310 52.843 1.00 35.25  ? 754  GLN A CA    1 
ATOM   6163 C  C     . GLN A 1 754 ? 18.798  -33.227 53.197 1.00 37.48  ? 754  GLN A C     1 
ATOM   6164 O  O     . GLN A 1 754 ? 18.696  -34.039 54.124 1.00 40.68  ? 754  GLN A O     1 
ATOM   6165 C  CB    . GLN A 1 754 ? 16.710  -33.049 51.866 1.00 35.79  ? 754  GLN A CB    1 
ATOM   6166 C  CG    . GLN A 1 754 ? 15.426  -32.318 51.482 1.00 35.43  ? 754  GLN A CG    1 
ATOM   6167 C  CD    . GLN A 1 754 ? 14.558  -33.137 50.546 1.00 37.86  ? 754  GLN A CD    1 
ATOM   6168 O  OE1   . GLN A 1 754 ? 14.976  -34.187 50.051 1.00 40.82  ? 754  GLN A OE1   1 
ATOM   6169 N  NE2   . GLN A 1 754 ? 13.345  -32.667 50.300 1.00 35.10  ? 754  GLN A NE2   1 
ATOM   6170 N  N     . GLU A 1 755 ? 19.901  -33.111 52.464 1.00 36.46  ? 755  GLU A N     1 
ATOM   6171 C  CA    . GLU A 1 755 ? 20.984  -34.094 52.565 1.00 38.35  ? 755  GLU A CA    1 
ATOM   6172 C  C     . GLU A 1 755 ? 22.314  -33.527 53.082 1.00 38.61  ? 755  GLU A C     1 
ATOM   6173 O  O     . GLU A 1 755 ? 23.001  -34.184 53.865 1.00 39.29  ? 755  GLU A O     1 
ATOM   6174 C  CB    . GLU A 1 755 ? 21.148  -34.868 51.241 1.00 36.78  ? 755  GLU A CB    1 
ATOM   6175 C  CG    . GLU A 1 755 ? 19.962  -35.821 50.953 1.00 38.87  ? 755  GLU A CG    1 
ATOM   6176 C  CD    . GLU A 1 755 ? 19.985  -36.482 49.566 1.00 41.09  ? 755  GLU A CD    1 
ATOM   6177 O  OE1   . GLU A 1 755 ? 18.947  -37.064 49.169 1.00 37.49  ? 755  GLU A OE1   1 
ATOM   6178 O  OE2   . GLU A 1 755 ? 21.030  -36.442 48.877 1.00 39.99  ? 755  GLU A OE2   1 
ATOM   6179 N  N     . GLY A 1 756 ? 22.666  -32.316 52.653 1.00 39.40  ? 756  GLY A N     1 
ATOM   6180 C  CA    . GLY A 1 756 ? 23.846  -31.622 53.169 1.00 40.25  ? 756  GLY A CA    1 
ATOM   6181 C  C     . GLY A 1 756 ? 24.882  -31.248 52.123 1.00 41.16  ? 756  GLY A C     1 
ATOM   6182 O  O     . GLY A 1 756 ? 24.738  -31.575 50.941 1.00 40.20  ? 756  GLY A O     1 
ATOM   6183 N  N     . GLU A 1 757 ? 25.933  -30.567 52.577 1.00 42.86  ? 757  GLU A N     1 
ATOM   6184 C  CA    . GLU A 1 757 ? 27.007  -30.065 51.710 1.00 45.47  ? 757  GLU A CA    1 
ATOM   6185 C  C     . GLU A 1 757 ? 27.615  -31.142 50.816 1.00 45.59  ? 757  GLU A C     1 
ATOM   6186 O  O     . GLU A 1 757 ? 27.775  -30.927 49.610 1.00 44.84  ? 757  GLU A O     1 
ATOM   6187 C  CB    . GLU A 1 757 ? 28.103  -29.401 52.554 1.00 47.03  ? 757  GLU A CB    1 
ATOM   6188 C  CG    . GLU A 1 757 ? 29.254  -28.775 51.763 1.00 49.13  ? 757  GLU A CG    1 
ATOM   6189 C  CD    . GLU A 1 757 ? 30.251  -28.032 52.654 1.00 52.51  ? 757  GLU A CD    1 
ATOM   6190 O  OE1   . GLU A 1 757 ? 30.551  -28.517 53.772 1.00 54.63  ? 757  GLU A OE1   1 
ATOM   6191 O  OE2   . GLU A 1 757 ? 30.744  -26.963 52.232 1.00 52.08  ? 757  GLU A OE2   1 
ATOM   6192 N  N     . GLU A 1 758 ? 27.938  -32.291 51.410 1.00 46.11  ? 758  GLU A N     1 
ATOM   6193 C  CA    . GLU A 1 758 ? 28.633  -33.365 50.701 1.00 47.66  ? 758  GLU A CA    1 
ATOM   6194 C  C     . GLU A 1 758 ? 27.837  -33.854 49.499 1.00 44.78  ? 758  GLU A C     1 
ATOM   6195 O  O     . GLU A 1 758 ? 28.372  -33.945 48.396 1.00 44.79  ? 758  GLU A O     1 
ATOM   6196 C  CB    . GLU A 1 758 ? 28.974  -34.523 51.650 1.00 50.69  ? 758  GLU A CB    1 
ATOM   6197 C  CG    . GLU A 1 758 ? 29.901  -35.570 51.033 1.00 57.37  ? 758  GLU A CG    1 
ATOM   6198 C  CD    . GLU A 1 758 ? 30.968  -36.079 52.003 1.00 64.15  ? 758  GLU A CD    1 
ATOM   6199 O  OE1   . GLU A 1 758 ? 32.170  -35.998 51.651 1.00 63.98  ? 758  GLU A OE1   1 
ATOM   6200 O  OE2   . GLU A 1 758 ? 30.609  -36.554 53.110 1.00 63.99  ? 758  GLU A OE2   1 
ATOM   6201 N  N     . SER A 1 759 ? 26.557  -34.146 49.722 1.00 43.85  ? 759  SER A N     1 
ATOM   6202 C  CA    . SER A 1 759 ? 25.651  -34.595 48.672 1.00 41.52  ? 759  SER A CA    1 
ATOM   6203 C  C     . SER A 1 759 ? 25.567  -33.596 47.520 1.00 41.36  ? 759  SER A C     1 
ATOM   6204 O  O     . SER A 1 759 ? 25.488  -33.979 46.349 1.00 40.92  ? 759  SER A O     1 
ATOM   6205 C  CB    . SER A 1 759 ? 24.259  -34.835 49.253 1.00 41.45  ? 759  SER A CB    1 
ATOM   6206 O  OG    . SER A 1 759 ? 23.328  -35.151 48.229 1.00 39.14  ? 759  SER A OG    1 
ATOM   6207 N  N     . LEU A 1 760 ? 25.572  -32.316 47.868 1.00 40.83  ? 760  LEU A N     1 
ATOM   6208 C  CA    . LEU A 1 760 ? 25.546  -31.245 46.888 1.00 43.42  ? 760  LEU A CA    1 
ATOM   6209 C  C     . LEU A 1 760 ? 26.780  -31.293 45.971 1.00 44.00  ? 760  LEU A C     1 
ATOM   6210 O  O     . LEU A 1 760 ? 26.658  -31.164 44.749 1.00 43.97  ? 760  LEU A O     1 
ATOM   6211 C  CB    . LEU A 1 760 ? 25.406  -29.897 47.611 1.00 44.18  ? 760  LEU A CB    1 
ATOM   6212 C  CG    . LEU A 1 760 ? 25.315  -28.527 46.928 1.00 44.00  ? 760  LEU A CG    1 
ATOM   6213 C  CD1   . LEU A 1 760 ? 26.659  -27.863 46.899 1.00 45.51  ? 760  LEU A CD1   1 
ATOM   6214 C  CD2   . LEU A 1 760 ? 24.684  -28.557 45.539 1.00 44.42  ? 760  LEU A CD2   1 
ATOM   6215 N  N     . GLN A 1 761 ? 27.956  -31.504 46.556 1.00 43.55  ? 761  GLN A N     1 
ATOM   6216 C  CA    . GLN A 1 761 ? 29.192  -31.569 45.770 1.00 46.16  ? 761  GLN A CA    1 
ATOM   6217 C  C     . GLN A 1 761 ? 29.193  -32.753 44.813 1.00 46.07  ? 761  GLN A C     1 
ATOM   6218 O  O     . GLN A 1 761 ? 29.586  -32.610 43.658 1.00 47.13  ? 761  GLN A O     1 
ATOM   6219 C  CB    . GLN A 1 761 ? 30.425  -31.596 46.671 1.00 45.02  ? 761  GLN A CB    1 
ATOM   6220 C  CG    . GLN A 1 761 ? 30.669  -30.280 47.384 1.00 45.22  ? 761  GLN A CG    1 
ATOM   6221 C  CD    . GLN A 1 761 ? 31.623  -30.409 48.557 1.00 45.71  ? 761  GLN A CD    1 
ATOM   6222 O  OE1   . GLN A 1 761 ? 31.728  -29.502 49.381 1.00 47.38  ? 761  GLN A OE1   1 
ATOM   6223 N  NE2   . GLN A 1 761 ? 32.320  -31.534 48.640 1.00 39.99  ? 761  GLN A NE2   1 
ATOM   6224 N  N     . GLU A 1 762 ? 28.738  -33.909 45.299 1.00 46.43  ? 762  GLU A N     1 
ATOM   6225 C  CA    . GLU A 1 762 ? 28.523  -35.088 44.459 1.00 47.38  ? 762  GLU A CA    1 
ATOM   6226 C  C     . GLU A 1 762 ? 27.755  -34.741 43.180 1.00 45.59  ? 762  GLU A C     1 
ATOM   6227 O  O     . GLU A 1 762 ? 28.221  -35.023 42.072 1.00 45.91  ? 762  GLU A O     1 
ATOM   6228 C  CB    . GLU A 1 762 ? 27.760  -36.175 45.229 1.00 49.50  ? 762  GLU A CB    1 
ATOM   6229 C  CG    . GLU A 1 762 ? 28.598  -37.359 45.701 1.00 55.39  ? 762  GLU A CG    1 
ATOM   6230 C  CD    . GLU A 1 762 ? 27.751  -38.527 46.219 1.00 60.99  ? 762  GLU A CD    1 
ATOM   6231 O  OE1   . GLU A 1 762 ? 26.515  -38.540 45.990 1.00 62.91  ? 762  GLU A OE1   1 
ATOM   6232 O  OE2   . GLU A 1 762 ? 28.329  -39.434 46.859 1.00 58.92  ? 762  GLU A OE2   1 
ATOM   6233 N  N     . TYR A 1 763 ? 26.584  -34.127 43.344 1.00 40.81  ? 763  TYR A N     1 
ATOM   6234 C  CA    . TYR A 1 763 ? 25.711  -33.837 42.213 1.00 38.44  ? 763  TYR A CA    1 
ATOM   6235 C  C     . TYR A 1 763 ? 26.283  -32.806 41.242 1.00 38.02  ? 763  TYR A C     1 
ATOM   6236 O  O     . TYR A 1 763 ? 26.151  -32.965 40.018 1.00 36.33  ? 763  TYR A O     1 
ATOM   6237 C  CB    . TYR A 1 763 ? 24.328  -33.388 42.677 1.00 35.70  ? 763  TYR A CB    1 
ATOM   6238 C  CG    . TYR A 1 763 ? 23.373  -33.218 41.528 1.00 37.29  ? 763  TYR A CG    1 
ATOM   6239 C  CD1   . TYR A 1 763 ? 23.077  -31.950 41.017 1.00 35.09  ? 763  TYR A CD1   1 
ATOM   6240 C  CD2   . TYR A 1 763 ? 22.787  -34.331 40.923 1.00 37.30  ? 763  TYR A CD2   1 
ATOM   6241 C  CE1   . TYR A 1 763 ? 22.199  -31.798 39.947 1.00 38.01  ? 763  TYR A CE1   1 
ATOM   6242 C  CE2   . TYR A 1 763 ? 21.913  -34.192 39.856 1.00 40.90  ? 763  TYR A CE2   1 
ATOM   6243 C  CZ    . TYR A 1 763 ? 21.623  -32.925 39.370 1.00 40.93  ? 763  TYR A CZ    1 
ATOM   6244 O  OH    . TYR A 1 763 ? 20.748  -32.799 38.311 1.00 45.10  ? 763  TYR A OH    1 
ATOM   6245 N  N     . PHE A 1 764 ? 26.887  -31.751 41.796 1.00 35.74  ? 764  PHE A N     1 
ATOM   6246 C  CA    . PHE A 1 764 ? 27.488  -30.685 41.009 1.00 35.43  ? 764  PHE A CA    1 
ATOM   6247 C  C     . PHE A 1 764 ? 28.533  -31.261 40.076 1.00 36.89  ? 764  PHE A C     1 
ATOM   6248 O  O     . PHE A 1 764 ? 28.586  -30.918 38.888 1.00 34.21  ? 764  PHE A O     1 
ATOM   6249 C  CB    . PHE A 1 764 ? 28.149  -29.636 41.909 1.00 35.41  ? 764  PHE A CB    1 
ATOM   6250 C  CG    . PHE A 1 764 ? 28.926  -28.600 41.145 1.00 35.73  ? 764  PHE A CG    1 
ATOM   6251 C  CD1   . PHE A 1 764 ? 28.269  -27.529 40.536 1.00 34.09  ? 764  PHE A CD1   1 
ATOM   6252 C  CD2   . PHE A 1 764 ? 30.310  -28.705 41.004 1.00 35.23  ? 764  PHE A CD2   1 
ATOM   6253 C  CE1   . PHE A 1 764 ? 28.977  -26.573 39.799 1.00 33.60  ? 764  PHE A CE1   1 
ATOM   6254 C  CE2   . PHE A 1 764 ? 31.032  -27.751 40.271 1.00 32.74  ? 764  PHE A CE2   1 
ATOM   6255 C  CZ    . PHE A 1 764 ? 30.360  -26.680 39.669 1.00 34.60  ? 764  PHE A CZ    1 
ATOM   6256 N  N     . LYS A 1 765 ? 29.352  -32.148 40.638 1.00 39.10  ? 765  LYS A N     1 
ATOM   6257 C  CA    . LYS A 1 765 ? 30.453  -32.776 39.933 1.00 40.46  ? 765  LYS A CA    1 
ATOM   6258 C  C     . LYS A 1 765 ? 29.903  -33.496 38.705 1.00 39.12  ? 765  LYS A C     1 
ATOM   6259 O  O     . LYS A 1 765 ? 30.436  -33.367 37.604 1.00 38.00  ? 765  LYS A O     1 
ATOM   6260 C  CB    . LYS A 1 765 ? 31.153  -33.767 40.870 1.00 42.49  ? 765  LYS A CB    1 
ATOM   6261 C  CG    . LYS A 1 765 ? 32.669  -33.579 41.010 1.00 48.76  ? 765  LYS A CG    1 
ATOM   6262 C  CD    . LYS A 1 765 ? 33.278  -34.619 41.972 1.00 55.03  ? 765  LYS A CD    1 
ATOM   6263 C  CE    . LYS A 1 765 ? 32.826  -34.409 43.434 1.00 58.21  ? 765  LYS A CE    1 
ATOM   6264 N  NZ    . LYS A 1 765 ? 32.951  -35.635 44.299 1.00 57.01  ? 765  LYS A NZ    1 
ATOM   6265 N  N     . GLU A 1 766 ? 28.815  -34.235 38.901 1.00 38.15  ? 766  GLU A N     1 
ATOM   6266 C  CA    . GLU A 1 766 ? 28.214  -35.004 37.823 1.00 38.68  ? 766  GLU A CA    1 
ATOM   6267 C  C     . GLU A 1 766 ? 27.600  -34.089 36.764 1.00 38.95  ? 766  GLU A C     1 
ATOM   6268 O  O     . GLU A 1 766 ? 27.787  -34.311 35.559 1.00 40.19  ? 766  GLU A O     1 
ATOM   6269 C  CB    . GLU A 1 766 ? 27.176  -35.989 38.374 1.00 38.69  ? 766  GLU A CB    1 
ATOM   6270 C  CG    . GLU A 1 766 ? 26.994  -37.230 37.509 1.00 41.52  ? 766  GLU A CG    1 
ATOM   6271 C  CD    . GLU A 1 766 ? 28.218  -38.142 37.511 1.00 42.69  ? 766  GLU A CD    1 
ATOM   6272 O  OE1   . GLU A 1 766 ? 28.595  -38.634 38.601 1.00 42.42  ? 766  GLU A OE1   1 
ATOM   6273 O  OE2   . GLU A 1 766 ? 28.796  -38.374 36.420 1.00 43.41  ? 766  GLU A OE2   1 
ATOM   6274 N  N     . PHE A 1 767 ? 26.890  -33.053 37.208 1.00 36.48  ? 767  PHE A N     1 
ATOM   6275 C  CA    . PHE A 1 767 ? 26.236  -32.156 36.269 1.00 36.54  ? 767  PHE A CA    1 
ATOM   6276 C  C     . PHE A 1 767 ? 27.260  -31.422 35.408 1.00 37.38  ? 767  PHE A C     1 
ATOM   6277 O  O     . PHE A 1 767 ? 27.068  -31.269 34.200 1.00 34.07  ? 767  PHE A O     1 
ATOM   6278 C  CB    . PHE A 1 767 ? 25.307  -31.170 36.972 1.00 34.49  ? 767  PHE A CB    1 
ATOM   6279 C  CG    . PHE A 1 767 ? 24.519  -30.321 36.021 1.00 33.20  ? 767  PHE A CG    1 
ATOM   6280 C  CD1   . PHE A 1 767 ? 24.893  -29.010 35.770 1.00 31.41  ? 767  PHE A CD1   1 
ATOM   6281 C  CD2   . PHE A 1 767 ? 23.413  -30.844 35.348 1.00 32.49  ? 767  PHE A CD2   1 
ATOM   6282 C  CE1   . PHE A 1 767 ? 24.177  -28.225 34.867 1.00 29.96  ? 767  PHE A CE1   1 
ATOM   6283 C  CE2   . PHE A 1 767 ? 22.699  -30.064 34.439 1.00 30.37  ? 767  PHE A CE2   1 
ATOM   6284 C  CZ    . PHE A 1 767 ? 23.078  -28.755 34.206 1.00 27.84  ? 767  PHE A CZ    1 
ATOM   6285 N  N     . GLU A 1 768 ? 28.348  -30.980 36.038 1.00 39.23  ? 768  GLU A N     1 
ATOM   6286 C  CA    . GLU A 1 768 ? 29.438  -30.319 35.322 1.00 41.73  ? 768  GLU A CA    1 
ATOM   6287 C  C     . GLU A 1 768 ? 30.037  -31.211 34.223 1.00 41.91  ? 768  GLU A C     1 
ATOM   6288 O  O     . GLU A 1 768 ? 30.291  -30.743 33.113 1.00 39.90  ? 768  GLU A O     1 
ATOM   6289 C  CB    . GLU A 1 768 ? 30.521  -29.835 36.295 1.00 43.93  ? 768  GLU A CB    1 
ATOM   6290 C  CG    . GLU A 1 768 ? 31.721  -29.173 35.599 1.00 50.91  ? 768  GLU A CG    1 
ATOM   6291 C  CD    . GLU A 1 768 ? 32.557  -28.303 36.521 1.00 54.30  ? 768  GLU A CD    1 
ATOM   6292 O  OE1   . GLU A 1 768 ? 32.920  -27.186 36.089 1.00 57.29  ? 768  GLU A OE1   1 
ATOM   6293 O  OE2   . GLU A 1 768 ? 32.853  -28.731 37.661 1.00 54.23  ? 768  GLU A OE2   1 
ATOM   6294 N  N     . LYS A 1 769 ? 30.238  -32.492 34.532 1.00 42.41  ? 769  LYS A N     1 
ATOM   6295 C  CA    . LYS A 1 769 ? 30.764  -33.451 33.555 1.00 43.98  ? 769  LYS A CA    1 
ATOM   6296 C  C     . LYS A 1 769 ? 29.791  -33.771 32.420 1.00 43.41  ? 769  LYS A C     1 
ATOM   6297 O  O     . LYS A 1 769 ? 30.214  -34.088 31.311 1.00 42.50  ? 769  LYS A O     1 
ATOM   6298 C  CB    . LYS A 1 769 ? 31.164  -34.751 34.247 1.00 45.51  ? 769  LYS A CB    1 
ATOM   6299 C  CG    . LYS A 1 769 ? 32.602  -34.798 34.712 1.00 48.00  ? 769  LYS A CG    1 
ATOM   6300 C  CD    . LYS A 1 769 ? 32.987  -36.204 35.210 1.00 51.04  ? 769  LYS A CD    1 
ATOM   6301 C  CE    . LYS A 1 769 ? 32.375  -36.519 36.578 1.00 49.94  ? 769  LYS A CE    1 
ATOM   6302 N  NZ    . LYS A 1 769 ? 33.117  -37.596 37.289 1.00 47.52  ? 769  LYS A NZ    1 
ATOM   6303 N  N     . GLU A 1 770 ? 28.493  -33.695 32.708 1.00 43.52  ? 770  GLU A N     1 
ATOM   6304 C  CA    . GLU A 1 770 ? 27.462  -34.104 31.758 1.00 42.03  ? 770  GLU A CA    1 
ATOM   6305 C  C     . GLU A 1 770 ? 26.830  -32.965 30.959 1.00 40.90  ? 770  GLU A C     1 
ATOM   6306 O  O     . GLU A 1 770 ? 26.173  -33.216 29.948 1.00 41.02  ? 770  GLU A O     1 
ATOM   6307 C  CB    . GLU A 1 770 ? 26.368  -34.907 32.472 1.00 43.66  ? 770  GLU A CB    1 
ATOM   6308 C  CG    . GLU A 1 770 ? 26.758  -36.342 32.819 1.00 43.40  ? 770  GLU A CG    1 
ATOM   6309 C  CD    . GLU A 1 770 ? 27.214  -37.164 31.615 1.00 47.19  ? 770  GLU A CD    1 
ATOM   6310 O  OE1   . GLU A 1 770 ? 28.071  -38.059 31.807 1.00 46.81  ? 770  GLU A OE1   1 
ATOM   6311 O  OE2   . GLU A 1 770 ? 26.719  -36.924 30.487 1.00 46.05  ? 770  GLU A OE2   1 
ATOM   6312 N  N     . PHE A 1 771 ? 27.039  -31.728 31.411 1.00 40.24  ? 771  PHE A N     1 
ATOM   6313 C  CA    . PHE A 1 771 ? 26.444  -30.527 30.807 1.00 38.75  ? 771  PHE A CA    1 
ATOM   6314 C  C     . PHE A 1 771 ? 26.467  -30.495 29.267 1.00 38.12  ? 771  PHE A C     1 
ATOM   6315 O  O     . PHE A 1 771 ? 25.432  -30.259 28.624 1.00 34.58  ? 771  PHE A O     1 
ATOM   6316 C  CB    . PHE A 1 771 ? 27.121  -29.271 31.367 1.00 38.44  ? 771  PHE A CB    1 
ATOM   6317 C  CG    . PHE A 1 771 ? 26.496  -27.986 30.897 1.00 38.32  ? 771  PHE A CG    1 
ATOM   6318 C  CD1   . PHE A 1 771 ? 27.134  -27.193 29.949 1.00 38.11  ? 771  PHE A CD1   1 
ATOM   6319 C  CD2   . PHE A 1 771 ? 25.261  -27.574 31.396 1.00 40.72  ? 771  PHE A CD2   1 
ATOM   6320 C  CE1   . PHE A 1 771 ? 26.556  -26.005 29.501 1.00 41.45  ? 771  PHE A CE1   1 
ATOM   6321 C  CE2   . PHE A 1 771 ? 24.665  -26.378 30.957 1.00 43.08  ? 771  PHE A CE2   1 
ATOM   6322 C  CZ    . PHE A 1 771 ? 25.312  -25.596 30.008 1.00 43.73  ? 771  PHE A CZ    1 
ATOM   6323 N  N     . ARG A 1 772 ? 27.643  -30.751 28.693 1.00 37.12  ? 772  ARG A N     1 
ATOM   6324 C  CA    . ARG A 1 772 ? 27.852  -30.692 27.244 1.00 37.85  ? 772  ARG A CA    1 
ATOM   6325 C  C     . ARG A 1 772 ? 27.076  -31.752 26.456 1.00 37.46  ? 772  ARG A C     1 
ATOM   6326 O  O     . ARG A 1 772 ? 27.066  -31.725 25.221 1.00 36.07  ? 772  ARG A O     1 
ATOM   6327 C  CB    . ARG A 1 772 ? 29.345  -30.783 26.925 1.00 39.52  ? 772  ARG A CB    1 
ATOM   6328 C  CG    . ARG A 1 772 ? 30.092  -29.473 27.111 1.00 47.69  ? 772  ARG A CG    1 
ATOM   6329 C  CD    . ARG A 1 772 ? 31.611  -29.652 26.994 1.00 53.81  ? 772  ARG A CD    1 
ATOM   6330 N  NE    . ARG A 1 772 ? 32.250  -28.491 26.370 1.00 60.07  ? 772  ARG A NE    1 
ATOM   6331 C  CZ    . ARG A 1 772 ? 32.580  -27.366 27.008 1.00 63.04  ? 772  ARG A CZ    1 
ATOM   6332 N  NH1   . ARG A 1 772 ? 32.332  -27.227 28.310 1.00 62.84  ? 772  ARG A NH1   1 
ATOM   6333 N  NH2   . ARG A 1 772 ? 33.154  -26.372 26.338 1.00 60.98  ? 772  ARG A NH2   1 
ATOM   6334 N  N     . GLN A 1 773 ? 26.427  -32.671 27.173 1.00 36.92  ? 773  GLN A N     1 
ATOM   6335 C  CA    . GLN A 1 773 ? 25.677  -33.769 26.557 1.00 38.52  ? 773  GLN A CA    1 
ATOM   6336 C  C     . GLN A 1 773 ? 24.183  -33.476 26.458 1.00 37.30  ? 773  GLN A C     1 
ATOM   6337 O  O     . GLN A 1 773 ? 23.442  -34.200 25.791 1.00 36.40  ? 773  GLN A O     1 
ATOM   6338 C  CB    . GLN A 1 773 ? 25.910  -35.077 27.325 1.00 39.74  ? 773  GLN A CB    1 
ATOM   6339 C  CG    . GLN A 1 773 ? 27.370  -35.512 27.381 1.00 44.01  ? 773  GLN A CG    1 
ATOM   6340 C  CD    . GLN A 1 773 ? 28.008  -35.516 26.009 1.00 49.44  ? 773  GLN A CD    1 
ATOM   6341 O  OE1   . GLN A 1 773 ? 27.582  -36.256 25.117 1.00 51.14  ? 773  GLN A OE1   1 
ATOM   6342 N  NE2   . GLN A 1 773 ? 29.023  -34.670 25.822 1.00 51.36  ? 773  GLN A NE2   1 
ATOM   6343 N  N     . LEU A 1 774 ? 23.751  -32.407 27.116 1.00 35.65  ? 774  LEU A N     1 
ATOM   6344 C  CA    . LEU A 1 774 ? 22.342  -32.043 27.140 1.00 34.18  ? 774  LEU A CA    1 
ATOM   6345 C  C     . LEU A 1 774 ? 21.914  -31.449 25.814 1.00 33.34  ? 774  LEU A C     1 
ATOM   6346 O  O     . LEU A 1 774 ? 22.687  -30.735 25.175 1.00 33.69  ? 774  LEU A O     1 
ATOM   6347 C  CB    . LEU A 1 774 ? 22.079  -31.050 28.265 1.00 33.95  ? 774  LEU A CB    1 
ATOM   6348 C  CG    . LEU A 1 774 ? 22.368  -31.560 29.675 1.00 36.35  ? 774  LEU A CG    1 
ATOM   6349 C  CD1   . LEU A 1 774 ? 22.538  -30.394 30.640 1.00 34.09  ? 774  LEU A CD1   1 
ATOM   6350 C  CD2   . LEU A 1 774 ? 21.263  -32.501 30.138 1.00 37.38  ? 774  LEU A CD2   1 
ATOM   6351 N  N     . ASN A 1 775 ? 20.683  -31.751 25.409 1.00 32.02  ? 775  ASN A N     1 
ATOM   6352 C  CA    . ASN A 1 775 ? 20.099  -31.186 24.204 1.00 32.15  ? 775  ASN A CA    1 
ATOM   6353 C  C     . ASN A 1 775 ? 20.100  -29.658 24.248 1.00 31.93  ? 775  ASN A C     1 
ATOM   6354 O  O     . ASN A 1 775 ? 19.863  -29.070 25.306 1.00 31.26  ? 775  ASN A O     1 
ATOM   6355 C  CB    . ASN A 1 775 ? 18.673  -31.691 24.034 1.00 35.75  ? 775  ASN A CB    1 
ATOM   6356 C  CG    . ASN A 1 775 ? 18.110  -31.382 22.664 1.00 40.38  ? 775  ASN A CG    1 
ATOM   6357 O  OD1   . ASN A 1 775 ? 17.219  -30.553 22.532 1.00 43.65  ? 775  ASN A OD1   1 
ATOM   6358 N  ND2   . ASN A 1 775 ? 18.649  -32.029 21.633 1.00 41.27  ? 775  ASN A ND2   1 
ATOM   6359 N  N     . TYR A 1 776 ? 20.366  -29.021 23.106 1.00 29.74  ? 776  TYR A N     1 
ATOM   6360 C  CA    . TYR A 1 776 ? 20.560  -27.569 23.062 1.00 32.04  ? 776  TYR A CA    1 
ATOM   6361 C  C     . TYR A 1 776 ? 19.351  -26.760 23.520 1.00 32.81  ? 776  TYR A C     1 
ATOM   6362 O  O     . TYR A 1 776 ? 19.509  -25.686 24.117 1.00 34.25  ? 776  TYR A O     1 
ATOM   6363 C  CB    . TYR A 1 776 ? 21.042  -27.093 21.682 1.00 33.04  ? 776  TYR A CB    1 
ATOM   6364 C  CG    . TYR A 1 776 ? 19.991  -27.056 20.590 1.00 34.48  ? 776  TYR A CG    1 
ATOM   6365 C  CD1   . TYR A 1 776 ? 19.562  -25.842 20.061 1.00 37.08  ? 776  TYR A CD1   1 
ATOM   6366 C  CD2   . TYR A 1 776 ? 19.441  -28.230 20.075 1.00 35.13  ? 776  TYR A CD2   1 
ATOM   6367 C  CE1   . TYR A 1 776 ? 18.611  -25.791 19.056 1.00 36.24  ? 776  TYR A CE1   1 
ATOM   6368 C  CE2   . TYR A 1 776 ? 18.481  -28.189 19.069 1.00 36.51  ? 776  TYR A CE2   1 
ATOM   6369 C  CZ    . TYR A 1 776 ? 18.075  -26.964 18.564 1.00 36.77  ? 776  TYR A CZ    1 
ATOM   6370 O  OH    . TYR A 1 776 ? 17.129  -26.903 17.567 1.00 40.42  ? 776  TYR A OH    1 
ATOM   6371 N  N     . ILE A 1 777 ? 18.156  -27.276 23.248 1.00 31.38  ? 777  ILE A N     1 
ATOM   6372 C  CA    . ILE A 1 777 ? 16.939  -26.597 23.641 1.00 32.41  ? 777  ILE A CA    1 
ATOM   6373 C  C     . ILE A 1 777 ? 16.831  -26.568 25.159 1.00 33.06  ? 777  ILE A C     1 
ATOM   6374 O  O     . ILE A 1 777 ? 16.391  -25.573 25.729 1.00 35.19  ? 777  ILE A O     1 
ATOM   6375 C  CB    . ILE A 1 777 ? 15.698  -27.215 22.968 1.00 34.42  ? 777  ILE A CB    1 
ATOM   6376 C  CG1   . ILE A 1 777 ? 15.538  -26.634 21.559 1.00 35.59  ? 777  ILE A CG1   1 
ATOM   6377 C  CG2   . ILE A 1 777 ? 14.417  -26.976 23.794 1.00 35.41  ? 777  ILE A CG2   1 
ATOM   6378 C  CD1   . ILE A 1 777 ? 14.814  -27.557 20.583 1.00 39.25  ? 777  ILE A CD1   1 
ATOM   6379 N  N     . SER A 1 778 ? 17.275  -27.634 25.815 1.00 31.73  ? 778  SER A N     1 
ATOM   6380 C  CA    . SER A 1 778 ? 17.150  -27.719 27.264 1.00 33.25  ? 778  SER A CA    1 
ATOM   6381 C  C     . SER A 1 778 ? 18.114  -26.781 27.976 1.00 33.08  ? 778  SER A C     1 
ATOM   6382 O  O     . SER A 1 778 ? 17.932  -26.475 29.154 1.00 34.30  ? 778  SER A O     1 
ATOM   6383 C  CB    . SER A 1 778 ? 17.329  -29.157 27.755 1.00 33.33  ? 778  SER A CB    1 
ATOM   6384 O  OG    . SER A 1 778 ? 18.617  -29.647 27.431 1.00 39.84  ? 778  SER A OG    1 
ATOM   6385 N  N     . ILE A 1 779 ? 19.129  -26.309 27.260 1.00 29.88  ? 779  ILE A N     1 
ATOM   6386 C  CA    . ILE A 1 779 ? 20.114  -25.438 27.883 1.00 29.12  ? 779  ILE A CA    1 
ATOM   6387 C  C     . ILE A 1 779 ? 20.070  -23.989 27.365 1.00 29.36  ? 779  ILE A C     1 
ATOM   6388 O  O     . ILE A 1 779 ? 20.848  -23.138 27.807 1.00 28.29  ? 779  ILE A O     1 
ATOM   6389 C  CB    . ILE A 1 779 ? 21.544  -26.064 27.885 1.00 28.38  ? 779  ILE A CB    1 
ATOM   6390 C  CG1   . ILE A 1 779 ? 21.970  -26.502 26.485 1.00 27.29  ? 779  ILE A CG1   1 
ATOM   6391 C  CG2   . ILE A 1 779 ? 21.588  -27.252 28.848 1.00 24.38  ? 779  ILE A CG2   1 
ATOM   6392 C  CD1   . ILE A 1 779 ? 23.372  -27.107 26.434 1.00 30.14  ? 779  ILE A CD1   1 
ATOM   6393 N  N     . ALA A 1 780 ? 19.122  -23.706 26.472 1.00 26.76  ? 780  ALA A N     1 
ATOM   6394 C  CA    . ALA A 1 780 ? 18.918  -22.352 25.972 1.00 27.22  ? 780  ALA A CA    1 
ATOM   6395 C  C     . ALA A 1 780 ? 18.178  -21.492 26.995 1.00 27.54  ? 780  ALA A C     1 
ATOM   6396 O  O     . ALA A 1 780 ? 17.322  -21.987 27.721 1.00 29.07  ? 780  ALA A O     1 
ATOM   6397 C  CB    . ALA A 1 780 ? 18.155  -22.388 24.641 1.00 27.77  ? 780  ALA A CB    1 
ATOM   6398 N  N     . SER A 1 781 ? 18.525  -20.211 27.062 1.00 29.71  ? 781  SER A N     1 
ATOM   6399 C  CA    . SER A 1 781 ? 17.811  -19.259 27.921 1.00 32.37  ? 781  SER A CA    1 
ATOM   6400 C  C     . SER A 1 781 ? 16.623  -18.777 27.127 1.00 30.13  ? 781  SER A C     1 
ATOM   6401 O  O     . SER A 1 781 ? 16.615  -18.898 25.911 1.00 30.80  ? 781  SER A O     1 
ATOM   6402 C  CB    . SER A 1 781 ? 18.688  -18.054 28.278 1.00 30.91  ? 781  SER A CB    1 
ATOM   6403 O  OG    . SER A 1 781 ? 19.944  -18.465 28.760 1.00 39.74  ? 781  SER A OG    1 
ATOM   6404 N  N     . VAL A 1 782 ? 15.633  -18.223 27.813 1.00 28.99  ? 782  VAL A N     1 
ATOM   6405 C  CA    . VAL A 1 782 ? 14.435  -17.712 27.153 1.00 27.72  ? 782  VAL A CA    1 
ATOM   6406 C  C     . VAL A 1 782 ? 14.240  -16.257 27.542 1.00 29.55  ? 782  VAL A C     1 
ATOM   6407 O  O     . VAL A 1 782 ? 14.552  -15.872 28.672 1.00 29.26  ? 782  VAL A O     1 
ATOM   6408 C  CB    . VAL A 1 782 ? 13.182  -18.510 27.555 1.00 26.01  ? 782  VAL A CB    1 
ATOM   6409 C  CG1   . VAL A 1 782 ? 11.965  -18.056 26.755 1.00 24.41  ? 782  VAL A CG1   1 
ATOM   6410 C  CG2   . VAL A 1 782 ? 13.415  -19.997 27.370 1.00 23.56  ? 782  VAL A CG2   1 
ATOM   6411 N  N     . SER A 1 783 ? 13.744  -15.453 26.606 1.00 31.12  ? 783  SER A N     1 
ATOM   6412 C  CA    . SER A 1 783 ? 13.377  -14.072 26.901 1.00 35.45  ? 783  SER A CA    1 
ATOM   6413 C  C     . SER A 1 783 ? 12.269  -13.560 25.982 1.00 36.69  ? 783  SER A C     1 
ATOM   6414 O  O     . SER A 1 783 ? 12.215  -13.919 24.808 1.00 33.61  ? 783  SER A O     1 
ATOM   6415 C  CB    . SER A 1 783 ? 14.601  -13.148 26.806 1.00 35.12  ? 783  SER A CB    1 
ATOM   6416 O  OG    . SER A 1 783 ? 14.251  -11.822 27.189 1.00 40.68  ? 783  SER A OG    1 
ATOM   6417 N  N     . SER A 1 784 ? 11.390  -12.721 26.532 1.00 40.29  ? 784  SER A N     1 
ATOM   6418 C  CA    . SER A 1 784 ? 10.408  -11.987 25.739 1.00 40.39  ? 784  SER A CA    1 
ATOM   6419 C  C     . SER A 1 784 ? 11.136  -11.028 24.815 1.00 41.14  ? 784  SER A C     1 
ATOM   6420 O  O     . SER A 1 784 ? 12.180  -10.495 25.172 1.00 42.90  ? 784  SER A O     1 
ATOM   6421 C  CB    . SER A 1 784 ? 9.477   -11.177 26.641 1.00 41.20  ? 784  SER A CB    1 
ATOM   6422 O  OG    . SER A 1 784 ? 8.694   -12.010 27.461 1.00 42.66  ? 784  SER A OG    1 
ATOM   6423 N  N     . ALA A 1 785 ? 10.571  -10.804 23.637 1.00 44.20  ? 785  ALA A N     1 
ATOM   6424 C  CA    . ALA A 1 785 ? 11.169  -9.925  22.644 1.00 46.11  ? 785  ALA A CA    1 
ATOM   6425 C  C     . ALA A 1 785 ? 10.305  -8.685  22.369 1.00 46.70  ? 785  ALA A C     1 
ATOM   6426 O  O     . ALA A 1 785 ? 9.554   -8.634  21.388 1.00 48.76  ? 785  ALA A O     1 
ATOM   6427 C  CB    . ALA A 1 785 ? 11.429  -10.697 21.363 1.00 46.67  ? 785  ALA A CB    1 
ATOM   6428 N  N     . ASN A 1 786 ? 10.411  -7.694  23.245 1.00 45.03  ? 786  ASN A N     1 
ATOM   6429 C  CA    . ASN A 1 786 ? 9.713   -6.435  23.054 1.00 44.46  ? 786  ASN A CA    1 
ATOM   6430 C  C     . ASN A 1 786 ? 10.616  -5.428  22.365 1.00 45.51  ? 786  ASN A C     1 
ATOM   6431 O  O     . ASN A 1 786 ? 11.847  -5.568  22.389 1.00 44.99  ? 786  ASN A O     1 
ATOM   6432 C  CB    . ASN A 1 786 ? 9.237   -5.874  24.393 1.00 45.51  ? 786  ASN A CB    1 
ATOM   6433 C  CG    . ASN A 1 786 ? 8.404   -6.869  25.182 1.00 46.96  ? 786  ASN A CG    1 
ATOM   6434 O  OD1   . ASN A 1 786 ? 8.795   -7.297  26.270 1.00 45.50  ? 786  ASN A OD1   1 
ATOM   6435 N  ND2   . ASN A 1 786 ? 7.251   -7.244  24.636 1.00 44.83  ? 786  ASN A ND2   1 
ATOM   6436 N  N     . ASN A 1 787 ? 9.997   -4.427  21.735 1.00 46.04  ? 787  ASN A N     1 
ATOM   6437 C  CA    . ASN A 1 787 ? 10.705  -3.255  21.216 1.00 46.12  ? 787  ASN A CA    1 
ATOM   6438 C  C     . ASN A 1 787 ? 11.842  -3.550  20.243 1.00 46.15  ? 787  ASN A C     1 
ATOM   6439 O  O     . ASN A 1 787 ? 12.857  -2.842  20.234 1.00 46.33  ? 787  ASN A O     1 
ATOM   6440 C  CB    . ASN A 1 787 ? 11.230  -2.410  22.379 1.00 46.17  ? 787  ASN A CB    1 
ATOM   6441 C  CG    . ASN A 1 787 ? 10.510  -1.106  22.505 1.00 48.75  ? 787  ASN A CG    1 
ATOM   6442 O  OD1   . ASN A 1 787 ? 11.035  -0.061  22.115 1.00 46.18  ? 787  ASN A OD1   1 
ATOM   6443 N  ND2   . ASN A 1 787 ? 9.286   -1.151  23.026 1.00 52.90  ? 787  ASN A ND2   1 
ATOM   6444 N  N     . ILE A 1 788 ? 11.667  -4.589  19.431 1.00 44.47  ? 788  ILE A N     1 
ATOM   6445 C  CA    . ILE A 1 788 ? 12.691  -5.011  18.480 1.00 43.91  ? 788  ILE A CA    1 
ATOM   6446 C  C     . ILE A 1 788 ? 13.055  -3.882  17.508 1.00 45.28  ? 788  ILE A C     1 
ATOM   6447 O  O     . ILE A 1 788 ? 14.233  -3.552  17.352 1.00 46.39  ? 788  ILE A O     1 
ATOM   6448 C  CB    . ILE A 1 788 ? 12.263  -6.286  17.708 1.00 41.77  ? 788  ILE A CB    1 
ATOM   6449 C  CG1   . ILE A 1 788 ? 11.915  -7.407  18.692 1.00 41.53  ? 788  ILE A CG1   1 
ATOM   6450 C  CG2   . ILE A 1 788 ? 13.364  -6.735  16.746 1.00 38.36  ? 788  ILE A CG2   1 
ATOM   6451 C  CD1   . ILE A 1 788 ? 11.079  -8.522  18.114 1.00 42.98  ? 788  ILE A CD1   1 
ATOM   6452 N  N     . ALA A 1 789 ? 12.034  -3.292  16.883 1.00 45.88  ? 789  ALA A N     1 
ATOM   6453 C  CA    . ALA A 1 789 ? 12.199  -2.241  15.876 1.00 46.48  ? 789  ALA A CA    1 
ATOM   6454 C  C     . ALA A 1 789 ? 13.133  -1.126  16.346 1.00 47.88  ? 789  ALA A C     1 
ATOM   6455 O  O     . ALA A 1 789 ? 14.108  -0.779  15.665 1.00 47.51  ? 789  ALA A O     1 
ATOM   6456 C  CB    . ALA A 1 789 ? 10.835  -1.671  15.494 1.00 46.81  ? 789  ALA A CB    1 
ATOM   6457 N  N     . LYS A 1 790 ? 12.835  -0.595  17.530 1.00 47.39  ? 790  LYS A N     1 
ATOM   6458 C  CA    . LYS A 1 790 ? 13.640  0.431   18.180 1.00 47.92  ? 790  LYS A CA    1 
ATOM   6459 C  C     . LYS A 1 790 ? 15.154  0.230   18.021 1.00 47.10  ? 790  LYS A C     1 
ATOM   6460 O  O     . LYS A 1 790 ? 15.881  1.184   17.740 1.00 48.27  ? 790  LYS A O     1 
ATOM   6461 C  CB    . LYS A 1 790 ? 13.280  0.494   19.670 1.00 47.60  ? 790  LYS A CB    1 
ATOM   6462 C  CG    . LYS A 1 790 ? 13.287  1.895   20.260 1.00 47.84  ? 790  LYS A CG    1 
ATOM   6463 C  CD    . LYS A 1 790 ? 14.681  2.378   20.642 1.00 47.50  ? 790  LYS A CD    1 
ATOM   6464 C  CE    . LYS A 1 790 ? 15.027  2.031   22.073 1.00 45.07  ? 790  LYS A CE    1 
ATOM   6465 N  NZ    . LYS A 1 790 ? 16.131  2.908   22.556 1.00 47.08  ? 790  LYS A NZ    1 
ATOM   6466 N  N     . TYR A 1 791 ? 15.613  -1.010  18.194 1.00 46.90  ? 791  TYR A N     1 
ATOM   6467 C  CA    . TYR A 1 791 ? 17.043  -1.319  18.278 1.00 44.62  ? 791  TYR A CA    1 
ATOM   6468 C  C     . TYR A 1 791 ? 17.647  -1.784  16.949 1.00 45.06  ? 791  TYR A C     1 
ATOM   6469 O  O     . TYR A 1 791 ? 18.856  -2.010  16.850 1.00 43.16  ? 791  TYR A O     1 
ATOM   6470 C  CB    . TYR A 1 791 ? 17.296  -2.355  19.390 1.00 43.21  ? 791  TYR A CB    1 
ATOM   6471 C  CG    . TYR A 1 791 ? 17.133  -1.821  20.802 1.00 37.95  ? 791  TYR A CG    1 
ATOM   6472 C  CD1   . TYR A 1 791 ? 15.996  -2.123  21.561 1.00 34.56  ? 791  TYR A CD1   1 
ATOM   6473 C  CD2   . TYR A 1 791 ? 18.120  -1.011  21.379 1.00 32.61  ? 791  TYR A CD2   1 
ATOM   6474 C  CE1   . TYR A 1 791 ? 15.845  -1.628  22.877 1.00 34.04  ? 791  TYR A CE1   1 
ATOM   6475 C  CE2   . TYR A 1 791 ? 17.982  -0.515  22.672 1.00 33.28  ? 791  TYR A CE2   1 
ATOM   6476 C  CZ    . TYR A 1 791 ? 16.847  -0.827  23.421 1.00 37.30  ? 791  TYR A CZ    1 
ATOM   6477 O  OH    . TYR A 1 791 ? 16.727  -0.333  24.707 1.00 41.21  ? 791  TYR A OH    1 
ATOM   6478 N  N     . ASP A 1 792 ? 16.796  -1.916  15.937 1.00 47.39  ? 792  ASP A N     1 
ATOM   6479 C  CA    . ASP A 1 792 ? 17.200  -2.372  14.608 1.00 50.75  ? 792  ASP A CA    1 
ATOM   6480 C  C     . ASP A 1 792 ? 17.679  -1.186  13.760 1.00 52.50  ? 792  ASP A C     1 
ATOM   6481 O  O     . ASP A 1 792 ? 17.050  -0.124  13.775 1.00 54.24  ? 792  ASP A O     1 
ATOM   6482 C  CB    . ASP A 1 792 ? 15.997  -3.048  13.939 1.00 51.18  ? 792  ASP A CB    1 
ATOM   6483 C  CG    . ASP A 1 792 ? 16.379  -3.941  12.768 1.00 51.33  ? 792  ASP A CG    1 
ATOM   6484 O  OD1   . ASP A 1 792 ? 15.503  -4.714  12.322 1.00 51.28  ? 792  ASP A OD1   1 
ATOM   6485 O  OD2   . ASP A 1 792 ? 17.532  -3.876  12.288 1.00 52.60  ? 792  ASP A OD2   1 
ATOM   6486 N  N     . VAL A 1 793 ? 18.770  -1.362  13.011 1.00 53.52  ? 793  VAL A N     1 
ATOM   6487 C  CA    . VAL A 1 793 ? 19.290  -0.257  12.178 1.00 55.92  ? 793  VAL A CA    1 
ATOM   6488 C  C     . VAL A 1 793 ? 18.823  -0.171  10.692 1.00 59.00  ? 793  VAL A C     1 
ATOM   6489 O  O     . VAL A 1 793 ? 18.300  0.873   10.286 1.00 60.67  ? 793  VAL A O     1 
ATOM   6490 C  CB    . VAL A 1 793 ? 20.837  0.000   12.337 1.00 54.95  ? 793  VAL A CB    1 
ATOM   6491 C  CG1   . VAL A 1 793 ? 21.195  0.274   13.798 1.00 55.90  ? 793  VAL A CG1   1 
ATOM   6492 C  CG2   . VAL A 1 793 ? 21.673  -1.127  11.770 1.00 49.38  ? 793  VAL A CG2   1 
ATOM   6493 N  N     . GLY A 1 794 ? 18.966  -1.230  9.888  1.00 59.42  ? 794  GLY A N     1 
ATOM   6494 C  CA    . GLY A 1 794 ? 19.425  -2.546  10.324 1.00 60.86  ? 794  GLY A CA    1 
ATOM   6495 C  C     . GLY A 1 794 ? 20.403  -3.222  9.381  1.00 60.11  ? 794  GLY A C     1 
ATOM   6496 O  O     . GLY A 1 794 ? 21.056  -2.565  8.577  1.00 61.14  ? 794  GLY A O     1 
ATOM   6497 N  N     . GLY A 1 795 ? 20.536  -4.539  9.507  1.00 59.32  ? 795  GLY A N     1 
ATOM   6498 C  CA    . GLY A 1 795 ? 19.885  -5.293  10.579 1.00 56.74  ? 795  GLY A CA    1 
ATOM   6499 C  C     . GLY A 1 795 ? 20.882  -5.570  11.684 1.00 55.11  ? 795  GLY A C     1 
ATOM   6500 O  O     . GLY A 1 795 ? 21.110  -6.724  12.050 1.00 56.17  ? 795  GLY A O     1 
ATOM   6501 N  N     . PHE A 1 796 ? 21.478  -4.500  12.204 1.00 53.32  ? 796  PHE A N     1 
ATOM   6502 C  CA    . PHE A 1 796 ? 22.537  -4.582  13.209 1.00 52.52  ? 796  PHE A CA    1 
ATOM   6503 C  C     . PHE A 1 796 ? 22.127  -3.890  14.509 1.00 51.12  ? 796  PHE A C     1 
ATOM   6504 O  O     . PHE A 1 796 ? 21.224  -3.049  14.506 1.00 50.04  ? 796  PHE A O     1 
ATOM   6505 C  CB    . PHE A 1 796 ? 23.840  -3.980  12.667 1.00 53.38  ? 796  PHE A CB    1 
ATOM   6506 C  CG    . PHE A 1 796 ? 24.478  -4.800  11.581 1.00 56.81  ? 796  PHE A CG    1 
ATOM   6507 C  CD1   . PHE A 1 796 ? 25.310  -5.874  11.899 1.00 58.47  ? 796  PHE A CD1   1 
ATOM   6508 C  CD2   . PHE A 1 796 ? 24.243  -4.506  10.239 1.00 58.21  ? 796  PHE A CD2   1 
ATOM   6509 C  CE1   . PHE A 1 796 ? 25.902  -6.642  10.897 1.00 59.92  ? 796  PHE A CE1   1 
ATOM   6510 C  CE2   . PHE A 1 796 ? 24.830  -5.270  9.226  1.00 60.91  ? 796  PHE A CE2   1 
ATOM   6511 C  CZ    . PHE A 1 796 ? 25.662  -6.341  9.557  1.00 60.58  ? 796  PHE A CZ    1 
ATOM   6512 N  N     . PRO A 1 797 ? 22.786  -4.250  15.629 1.00 49.90  ? 797  PRO A N     1 
ATOM   6513 C  CA    . PRO A 1 797 ? 22.436  -3.707  16.936 1.00 49.09  ? 797  PRO A CA    1 
ATOM   6514 C  C     . PRO A 1 797 ? 22.598  -2.191  17.046 1.00 47.71  ? 797  PRO A C     1 
ATOM   6515 O  O     . PRO A 1 797 ? 23.673  -1.655  16.763 1.00 46.34  ? 797  PRO A O     1 
ATOM   6516 C  CB    . PRO A 1 797 ? 23.425  -4.404  17.879 1.00 48.58  ? 797  PRO A CB    1 
ATOM   6517 C  CG    . PRO A 1 797 ? 23.832  -5.615  17.172 1.00 49.33  ? 797  PRO A CG    1 
ATOM   6518 C  CD    . PRO A 1 797 ? 23.852  -5.262  15.735 1.00 49.66  ? 797  PRO A CD    1 
ATOM   6519 N  N     . GLY A 1 798 ? 21.527  -1.522  17.466 1.00 46.96  ? 798  GLY A N     1 
ATOM   6520 C  CA    . GLY A 1 798 ? 21.577  -0.107  17.821 1.00 45.55  ? 798  GLY A CA    1 
ATOM   6521 C  C     . GLY A 1 798 ? 22.224  0.079   19.183 1.00 46.31  ? 798  GLY A C     1 
ATOM   6522 O  O     . GLY A 1 798 ? 22.638  -0.900  19.812 1.00 47.60  ? 798  GLY A O     1 
ATOM   6523 N  N     . PRO A 1 799 ? 22.330  1.335   19.649 1.00 45.30  ? 799  PRO A N     1 
ATOM   6524 C  CA    . PRO A 1 799 ? 22.945  1.594   20.951 1.00 44.59  ? 799  PRO A CA    1 
ATOM   6525 C  C     . PRO A 1 799 ? 22.109  1.045   22.101 1.00 42.89  ? 799  PRO A C     1 
ATOM   6526 O  O     . PRO A 1 799 ? 20.879  1.118   22.058 1.00 39.73  ? 799  PRO A O     1 
ATOM   6527 C  CB    . PRO A 1 799 ? 23.007  3.127   21.016 1.00 45.66  ? 799  PRO A CB    1 
ATOM   6528 C  CG    . PRO A 1 799 ? 22.894  3.580   19.582 1.00 46.40  ? 799  PRO A CG    1 
ATOM   6529 C  CD    . PRO A 1 799 ? 21.983  2.584   18.947 1.00 45.61  ? 799  PRO A CD    1 
ATOM   6530 N  N     . LYS A 1 800 ? 22.795  0.494   23.106 1.00 42.64  ? 800  LYS A N     1 
ATOM   6531 C  CA    . LYS A 1 800 ? 22.179  -0.138  24.287 1.00 43.86  ? 800  LYS A CA    1 
ATOM   6532 C  C     . LYS A 1 800 ? 21.314  -1.353  23.948 1.00 42.73  ? 800  LYS A C     1 
ATOM   6533 O  O     . LYS A 1 800 ? 20.457  -1.755  24.746 1.00 42.96  ? 800  LYS A O     1 
ATOM   6534 C  CB    . LYS A 1 800 ? 21.380  0.874   25.125 1.00 45.48  ? 800  LYS A CB    1 
ATOM   6535 C  CG    . LYS A 1 800 ? 22.228  1.795   25.985 1.00 51.00  ? 800  LYS A CG    1 
ATOM   6536 C  CD    . LYS A 1 800 ? 21.551  3.152   26.160 1.00 56.71  ? 800  LYS A CD    1 
ATOM   6537 C  CE    . LYS A 1 800 ? 22.573  4.265   26.402 1.00 57.75  ? 800  LYS A CE    1 
ATOM   6538 N  NZ    . LYS A 1 800 ? 22.039  5.598   26.008 1.00 53.61  ? 800  LYS A NZ    1 
ATOM   6539 N  N     . CYS A 1 801 ? 21.551  -1.946  22.778 1.00 40.47  ? 801  CYS A N     1 
ATOM   6540 C  CA    . CYS A 1 801 ? 20.785  -3.107  22.349 1.00 39.42  ? 801  CYS A CA    1 
ATOM   6541 C  C     . CYS A 1 801 ? 20.888  -4.251  23.365 1.00 39.63  ? 801  CYS A C     1 
ATOM   6542 O  O     . CYS A 1 801 ? 21.991  -4.691  23.677 1.00 39.93  ? 801  CYS A O     1 
ATOM   6543 C  CB    . CYS A 1 801 ? 21.253  -3.579  20.979 1.00 38.52  ? 801  CYS A CB    1 
ATOM   6544 S  SG    . CYS A 1 801 ? 20.261  -4.928  20.326 1.00 39.17  ? 801  CYS A SG    1 
ATOM   6545 N  N     . PRO A 1 802 ? 19.737  -4.717  23.903 1.00 40.90  ? 802  PRO A N     1 
ATOM   6546 C  CA    . PRO A 1 802 ? 19.763  -5.849  24.839 1.00 38.09  ? 802  PRO A CA    1 
ATOM   6547 C  C     . PRO A 1 802 ? 20.291  -7.117  24.176 1.00 38.05  ? 802  PRO A C     1 
ATOM   6548 O  O     . PRO A 1 802 ? 20.165  -7.286  22.952 1.00 38.31  ? 802  PRO A O     1 
ATOM   6549 C  CB    . PRO A 1 802 ? 18.291  -6.014  25.234 1.00 34.97  ? 802  PRO A CB    1 
ATOM   6550 C  CG    . PRO A 1 802 ? 17.705  -4.656  25.047 1.00 36.41  ? 802  PRO A CG    1 
ATOM   6551 C  CD    . PRO A 1 802 ? 18.385  -4.125  23.813 1.00 39.74  ? 802  PRO A CD    1 
ATOM   6552 N  N     . PHE A 1 803 ? 20.894  -7.977  24.992 1.00 35.26  ? 803  PHE A N     1 
ATOM   6553 C  CA    . PHE A 1 803 ? 21.467  -9.245  24.556 1.00 33.88  ? 803  PHE A CA    1 
ATOM   6554 C  C     . PHE A 1 803 ? 20.485  -10.073 23.743 1.00 35.08  ? 803  PHE A C     1 
ATOM   6555 O  O     . PHE A 1 803 ? 20.826  -10.550 22.660 1.00 38.53  ? 803  PHE A O     1 
ATOM   6556 C  CB    . PHE A 1 803 ? 21.912  -10.038 25.782 1.00 32.95  ? 803  PHE A CB    1 
ATOM   6557 C  CG    . PHE A 1 803 ? 22.797  -11.227 25.482 1.00 34.58  ? 803  PHE A CG    1 
ATOM   6558 C  CD1   . PHE A 1 803 ? 24.160  -11.060 25.231 1.00 33.48  ? 803  PHE A CD1   1 
ATOM   6559 C  CD2   . PHE A 1 803 ? 22.283  -12.518 25.524 1.00 33.16  ? 803  PHE A CD2   1 
ATOM   6560 C  CE1   . PHE A 1 803 ? 24.988  -12.160 24.982 1.00 31.72  ? 803  PHE A CE1   1 
ATOM   6561 C  CE2   . PHE A 1 803 ? 23.101  -13.626 25.268 1.00 33.61  ? 803  PHE A CE2   1 
ATOM   6562 C  CZ    . PHE A 1 803 ? 24.463  -13.443 25.000 1.00 32.13  ? 803  PHE A CZ    1 
ATOM   6563 N  N     . HIS A 1 804 ? 19.272  -10.259 24.256 1.00 34.10  ? 804  HIS A N     1 
ATOM   6564 C  CA    . HIS A 1 804 ? 18.316  -11.130 23.577 1.00 33.86  ? 804  HIS A CA    1 
ATOM   6565 C  C     . HIS A 1 804 ? 17.874  -10.520 22.245 1.00 34.86  ? 804  HIS A C     1 
ATOM   6566 O  O     . HIS A 1 804 ? 17.650  -11.227 21.271 1.00 35.79  ? 804  HIS A O     1 
ATOM   6567 C  CB    . HIS A 1 804 ? 17.124  -11.491 24.486 1.00 32.84  ? 804  HIS A CB    1 
ATOM   6568 C  CG    . HIS A 1 804 ? 16.294  -10.320 24.914 1.00 32.10  ? 804  HIS A CG    1 
ATOM   6569 N  ND1   . HIS A 1 804 ? 16.672  -9.469  25.932 1.00 34.74  ? 804  HIS A ND1   1 
ATOM   6570 C  CD2   . HIS A 1 804 ? 15.096  -9.867  24.472 1.00 30.62  ? 804  HIS A CD2   1 
ATOM   6571 C  CE1   . HIS A 1 804 ? 15.748  -8.537  26.092 1.00 30.98  ? 804  HIS A CE1   1 
ATOM   6572 N  NE2   . HIS A 1 804 ? 14.780  -8.756  25.220 1.00 31.55  ? 804  HIS A NE2   1 
ATOM   6573 N  N     . ILE A 1 805 ? 17.785  -9.197  22.204 1.00 35.69  ? 805  ILE A N     1 
ATOM   6574 C  CA    . ILE A 1 805 ? 17.404  -8.498  20.982 1.00 36.06  ? 805  ILE A CA    1 
ATOM   6575 C  C     . ILE A 1 805 ? 18.549  -8.583  19.982 1.00 36.94  ? 805  ILE A C     1 
ATOM   6576 O  O     . ILE A 1 805 ? 18.313  -8.688  18.783 1.00 38.64  ? 805  ILE A O     1 
ATOM   6577 C  CB    . ILE A 1 805 ? 16.997  -7.027  21.266 1.00 35.95  ? 805  ILE A CB    1 
ATOM   6578 C  CG1   . ILE A 1 805 ? 15.898  -6.967  22.349 1.00 35.65  ? 805  ILE A CG1   1 
ATOM   6579 C  CG2   . ILE A 1 805 ? 16.596  -6.285  19.980 1.00 35.82  ? 805  ILE A CG2   1 
ATOM   6580 C  CD1   . ILE A 1 805 ? 14.547  -7.532  21.934 1.00 33.84  ? 805  ILE A CD1   1 
ATOM   6581 N  N     . ARG A 1 806 ? 19.785  -8.560  20.481 1.00 36.34  ? 806  ARG A N     1 
ATOM   6582 C  CA    . ARG A 1 806 ? 20.959  -8.703  19.620 1.00 36.38  ? 806  ARG A CA    1 
ATOM   6583 C  C     . ARG A 1 806 ? 20.906  -10.036 18.897 1.00 35.37  ? 806  ARG A C     1 
ATOM   6584 O  O     . ARG A 1 806 ? 21.097  -10.102 17.683 1.00 35.91  ? 806  ARG A O     1 
ATOM   6585 C  CB    . ARG A 1 806 ? 22.256  -8.576  20.429 1.00 36.23  ? 806  ARG A CB    1 
ATOM   6586 C  CG    . ARG A 1 806 ? 23.516  -8.911  19.646 1.00 34.90  ? 806  ARG A CG    1 
ATOM   6587 C  CD    . ARG A 1 806 ? 24.774  -8.786  20.514 1.00 35.93  ? 806  ARG A CD    1 
ATOM   6588 N  NE    . ARG A 1 806 ? 24.995  -7.406  20.945 1.00 34.16  ? 806  ARG A NE    1 
ATOM   6589 C  CZ    . ARG A 1 806 ? 25.696  -6.499  20.268 1.00 32.85  ? 806  ARG A CZ    1 
ATOM   6590 N  NH1   . ARG A 1 806 ? 26.278  -6.812  19.118 1.00 33.17  ? 806  ARG A NH1   1 
ATOM   6591 N  NH2   . ARG A 1 806 ? 25.818  -5.273  20.751 1.00 33.84  ? 806  ARG A NH2   1 
ATOM   6592 N  N     . GLY A 1 807 ? 20.617  -11.088 19.657 1.00 35.77  ? 807  GLY A N     1 
ATOM   6593 C  CA    . GLY A 1 807 ? 20.465  -12.430 19.113 1.00 36.28  ? 807  GLY A CA    1 
ATOM   6594 C  C     . GLY A 1 807 ? 19.381  -12.577 18.062 1.00 36.47  ? 807  GLY A C     1 
ATOM   6595 O  O     . GLY A 1 807 ? 19.549  -13.336 17.108 1.00 36.74  ? 807  GLY A O     1 
ATOM   6596 N  N     . ILE A 1 808 ? 18.266  -11.866 18.240 1.00 37.30  ? 808  ILE A N     1 
ATOM   6597 C  CA    . ILE A 1 808 ? 17.182  -11.871 17.252 1.00 39.07  ? 808  ILE A CA    1 
ATOM   6598 C  C     . ILE A 1 808 ? 17.674  -11.259 15.944 1.00 39.11  ? 808  ILE A C     1 
ATOM   6599 O  O     . ILE A 1 808 ? 17.439  -11.806 14.871 1.00 40.79  ? 808  ILE A O     1 
ATOM   6600 C  CB    . ILE A 1 808 ? 15.923  -11.124 17.745 1.00 37.98  ? 808  ILE A CB    1 
ATOM   6601 C  CG1   . ILE A 1 808 ? 15.290  -11.864 18.920 1.00 39.41  ? 808  ILE A CG1   1 
ATOM   6602 C  CG2   . ILE A 1 808 ? 14.893  -10.999 16.630 1.00 39.43  ? 808  ILE A CG2   1 
ATOM   6603 C  CD1   . ILE A 1 808 ? 14.374  -10.995 19.756 1.00 35.81  ? 808  ILE A CD1   1 
ATOM   6604 N  N     . LEU A 1 809 ? 18.379  -10.137 16.052 1.00 39.50  ? 809  LEU A N     1 
ATOM   6605 C  CA    . LEU A 1 809 ? 18.931  -9.446  14.891 1.00 39.56  ? 809  LEU A CA    1 
ATOM   6606 C  C     . LEU A 1 809 ? 19.962  -10.297 14.167 1.00 41.31  ? 809  LEU A C     1 
ATOM   6607 O  O     . LEU A 1 809 ? 20.063  -10.241 12.945 1.00 44.45  ? 809  LEU A O     1 
ATOM   6608 C  CB    . LEU A 1 809 ? 19.539  -8.107  15.301 1.00 37.89  ? 809  LEU A CB    1 
ATOM   6609 C  CG    . LEU A 1 809 ? 18.583  -7.071  15.910 1.00 37.63  ? 809  LEU A CG    1 
ATOM   6610 C  CD1   . LEU A 1 809 ? 19.335  -5.777  16.235 1.00 36.24  ? 809  LEU A CD1   1 
ATOM   6611 C  CD2   . LEU A 1 809 ? 17.365  -6.787  15.005 1.00 34.54  ? 809  LEU A CD2   1 
ATOM   6612 N  N     . THR A 1 810 ? 20.720  -11.083 14.927 1.00 42.43  ? 810  THR A N     1 
ATOM   6613 C  CA    . THR A 1 810 ? 21.675  -12.034 14.370 1.00 42.12  ? 810  THR A CA    1 
ATOM   6614 C  C     . THR A 1 810 ? 20.925  -13.128 13.615 1.00 42.83  ? 810  THR A C     1 
ATOM   6615 O  O     . THR A 1 810 ? 21.324  -13.523 12.517 1.00 43.27  ? 810  THR A O     1 
ATOM   6616 C  CB    . THR A 1 810 ? 22.519  -12.679 15.492 1.00 43.35  ? 810  THR A CB    1 
ATOM   6617 O  OG1   . THR A 1 810 ? 23.179  -11.658 16.248 1.00 42.94  ? 810  THR A OG1   1 
ATOM   6618 C  CG2   . THR A 1 810 ? 23.556  -13.648 14.921 1.00 43.28  ? 810  THR A CG2   1 
ATOM   6619 N  N     . TYR A 1 811 ? 19.836  -13.608 14.216 1.00 43.34  ? 811  TYR A N     1 
ATOM   6620 C  CA    . TYR A 1 811 ? 18.993  -14.632 13.604 1.00 43.72  ? 811  TYR A CA    1 
ATOM   6621 C  C     . TYR A 1 811 ? 18.394  -14.088 12.314 1.00 44.02  ? 811  TYR A C     1 
ATOM   6622 O  O     . TYR A 1 811 ? 18.390  -14.778 11.290 1.00 43.85  ? 811  TYR A O     1 
ATOM   6623 C  CB    . TYR A 1 811 ? 17.891  -15.080 14.574 1.00 42.78  ? 811  TYR A CB    1 
ATOM   6624 C  CG    . TYR A 1 811 ? 16.869  -16.043 14.003 1.00 41.00  ? 811  TYR A CG    1 
ATOM   6625 C  CD1   . TYR A 1 811 ? 17.180  -17.389 13.809 1.00 40.89  ? 811  TYR A CD1   1 
ATOM   6626 C  CD2   . TYR A 1 811 ? 15.580  -15.614 13.676 1.00 40.97  ? 811  TYR A CD2   1 
ATOM   6627 C  CE1   . TYR A 1 811 ? 16.242  -18.286 13.292 1.00 37.67  ? 811  TYR A CE1   1 
ATOM   6628 C  CE2   . TYR A 1 811 ? 14.630  -16.503 13.158 1.00 38.64  ? 811  TYR A CE2   1 
ATOM   6629 C  CZ    . TYR A 1 811 ? 14.971  -17.840 12.964 1.00 39.08  ? 811  TYR A CZ    1 
ATOM   6630 O  OH    . TYR A 1 811 ? 14.047  -18.735 12.445 1.00 40.30  ? 811  TYR A OH    1 
ATOM   6631 N  N     . ASN A 1 812 ? 17.925  -12.841 12.366 1.00 42.95  ? 812  ASN A N     1 
ATOM   6632 C  CA    . ASN A 1 812 ? 17.298  -12.197 11.208 1.00 45.48  ? 812  ASN A CA    1 
ATOM   6633 C  C     . ASN A 1 812 ? 18.214  -12.017 10.011 1.00 45.97  ? 812  ASN A C     1 
ATOM   6634 O  O     . ASN A 1 812 ? 17.738  -11.972 8.876  1.00 49.32  ? 812  ASN A O     1 
ATOM   6635 C  CB    . ASN A 1 812 ? 16.649  -10.867 11.596 1.00 43.63  ? 812  ASN A CB    1 
ATOM   6636 C  CG    . ASN A 1 812 ? 15.297  -11.056 12.265 1.00 43.12  ? 812  ASN A CG    1 
ATOM   6637 O  OD1   . ASN A 1 812 ? 14.814  -12.184 12.416 1.00 43.45  ? 812  ASN A OD1   1 
ATOM   6638 N  ND2   . ASN A 1 812 ? 14.673  -9.953  12.658 1.00 37.16  ? 812  ASN A ND2   1 
ATOM   6639 N  N     . ARG A 1 813 ? 19.517  -11.912 10.263 1.00 47.03  ? 813  ARG A N     1 
ATOM   6640 C  CA    . ARG A 1 813 ? 20.505  -11.827 9.184  1.00 49.11  ? 813  ARG A CA    1 
ATOM   6641 C  C     . ARG A 1 813 ? 20.806  -13.212 8.614  1.00 49.71  ? 813  ARG A C     1 
ATOM   6642 O  O     . ARG A 1 813 ? 20.987  -13.367 7.408  1.00 50.17  ? 813  ARG A O     1 
ATOM   6643 C  CB    . ARG A 1 813 ? 21.797  -11.165 9.666  1.00 48.36  ? 813  ARG A CB    1 
ATOM   6644 C  CG    . ARG A 1 813 ? 21.664  -9.688  10.018 1.00 48.34  ? 813  ARG A CG    1 
ATOM   6645 C  CD    . ARG A 1 813 ? 23.037  -9.018  10.165 1.00 46.45  ? 813  ARG A CD    1 
ATOM   6646 N  NE    . ARG A 1 813 ? 23.880  -9.646  11.183 1.00 45.43  ? 813  ARG A NE    1 
ATOM   6647 C  CZ    . ARG A 1 813 ? 23.851  -9.333  12.476 1.00 45.07  ? 813  ARG A CZ    1 
ATOM   6648 N  NH1   . ARG A 1 813 ? 23.020  -8.400  12.921 1.00 46.80  ? 813  ARG A NH1   1 
ATOM   6649 N  NH2   . ARG A 1 813 ? 24.652  -9.955  13.326 1.00 42.28  ? 813  ARG A NH2   1 
ATOM   6650 N  N     . ALA A 1 814 ? 20.839  -14.212 9.493  1.00 52.22  ? 814  ALA A N     1 
ATOM   6651 C  CA    . ALA A 1 814 ? 21.160  -15.588 9.115  1.00 54.05  ? 814  ALA A CA    1 
ATOM   6652 C  C     . ALA A 1 814 ? 20.044  -16.256 8.308  1.00 55.72  ? 814  ALA A C     1 
ATOM   6653 O  O     . ALA A 1 814 ? 20.295  -17.202 7.557  1.00 55.82  ? 814  ALA A O     1 
ATOM   6654 C  CB    . ALA A 1 814 ? 21.490  -16.409 10.351 1.00 53.59  ? 814  ALA A CB    1 
ATOM   6655 N  N     . ILE A 1 815 ? 18.818  -15.762 8.459  1.00 57.07  ? 815  ILE A N     1 
ATOM   6656 C  CA    . ILE A 1 815 ? 17.690  -16.321 7.724  1.00 60.30  ? 815  ILE A CA    1 
ATOM   6657 C  C     . ILE A 1 815 ? 17.171  -15.424 6.590  1.00 63.27  ? 815  ILE A C     1 
ATOM   6658 O  O     . ILE A 1 815 ? 16.020  -15.557 6.168  1.00 64.69  ? 815  ILE A O     1 
ATOM   6659 C  CB    . ILE A 1 815 ? 16.527  -16.753 8.663  1.00 59.68  ? 815  ILE A CB    1 
ATOM   6660 C  CG1   . ILE A 1 815 ? 15.864  -15.539 9.329  1.00 59.41  ? 815  ILE A CG1   1 
ATOM   6661 C  CG2   . ILE A 1 815 ? 17.019  -17.775 9.687  1.00 59.72  ? 815  ILE A CG2   1 
ATOM   6662 C  CD1   . ILE A 1 815 ? 14.384  -15.709 9.574  1.00 56.64  ? 815  ILE A CD1   1 
ATOM   6663 N  N     . LYS A 1 816 ? 18.010  -14.518 6.093  1.00 67.03  ? 816  LYS A N     1 
ATOM   6664 C  CA    . LYS A 1 816 ? 17.640  -13.724 4.918  1.00 70.74  ? 816  LYS A CA    1 
ATOM   6665 C  C     . LYS A 1 816 ? 17.511  -14.600 3.677  1.00 72.57  ? 816  LYS A C     1 
ATOM   6666 O  O     . LYS A 1 816 ? 18.288  -15.538 3.476  1.00 71.65  ? 816  LYS A O     1 
ATOM   6667 C  CB    . LYS A 1 816 ? 18.622  -12.574 4.666  1.00 71.33  ? 816  LYS A CB    1 
ATOM   6668 C  CG    . LYS A 1 816 ? 18.062  -11.185 4.999  1.00 74.08  ? 816  LYS A CG    1 
ATOM   6669 C  CD    . LYS A 1 816 ? 16.911  -10.784 4.059  1.00 75.48  ? 816  LYS A CD    1 
ATOM   6670 C  CE    . LYS A 1 816 ? 16.275  -9.446  4.454  1.00 75.13  ? 816  LYS A CE    1 
ATOM   6671 N  NZ    . LYS A 1 816 ? 17.067  -8.263  4.005  1.00 72.85  ? 816  LYS A NZ    1 
ATOM   6672 N  N     . GLY A 1 817 ? 16.512  -14.290 2.859  1.00 75.15  ? 817  GLY A N     1 
ATOM   6673 C  CA    . GLY A 1 817 ? 16.238  -15.061 1.654  1.00 78.24  ? 817  GLY A CA    1 
ATOM   6674 C  C     . GLY A 1 817 ? 15.311  -16.226 1.938  1.00 79.89  ? 817  GLY A C     1 
ATOM   6675 O  O     . GLY A 1 817 ? 14.087  -16.066 1.932  1.00 79.95  ? 817  GLY A O     1 
ATOM   6676 N  N     . ASN A 1 818 ? 15.900  -17.390 2.206  1.00 81.28  ? 818  ASN A N     1 
ATOM   6677 C  CA    . ASN A 1 818 ? 15.150  -18.645 2.345  1.00 81.92  ? 818  ASN A CA    1 
ATOM   6678 C  C     . ASN A 1 818 ? 14.084  -18.617 3.443  1.00 80.83  ? 818  ASN A C     1 
ATOM   6679 O  O     . ASN A 1 818 ? 14.358  -18.250 4.585  1.00 80.11  ? 818  ASN A O     1 
ATOM   6680 C  CB    . ASN A 1 818 ? 16.101  -19.842 2.495  1.00 82.83  ? 818  ASN A CB    1 
ATOM   6681 C  CG    . ASN A 1 818 ? 16.922  -20.106 1.228  1.00 82.87  ? 818  ASN A CG    1 
ATOM   6682 O  OD1   . ASN A 1 818 ? 18.081  -20.514 1.303  1.00 83.19  ? 818  ASN A OD1   1 
ATOM   6683 N  ND2   . ASN A 1 818 ? 16.321  -19.870 0.063  1.00 81.71  ? 818  ASN A ND2   1 
ATOM   6684 N  N     . ILE A 1 819 ? 12.874  -19.026 3.067  1.00 80.46  ? 819  ILE A N     1 
ATOM   6685 C  CA    . ILE A 1 819 ? 11.653  -18.681 3.799  1.00 80.14  ? 819  ILE A CA    1 
ATOM   6686 C  C     . ILE A 1 819 ? 11.026  -19.831 4.580  1.00 79.08  ? 819  ILE A C     1 
ATOM   6687 O  O     . ILE A 1 819 ? 9.919   -19.699 5.105  1.00 79.18  ? 819  ILE A O     1 
ATOM   6688 C  CB    . ILE A 1 819 ? 10.567  -18.074 2.858  1.00 81.03  ? 819  ILE A CB    1 
ATOM   6689 C  CG1   . ILE A 1 819 ? 11.090  -17.875 1.423  1.00 81.51  ? 819  ILE A CG1   1 
ATOM   6690 C  CG2   . ILE A 1 819 ? 10.006  -16.779 3.455  1.00 81.68  ? 819  ILE A CG2   1 
ATOM   6691 C  CD1   . ILE A 1 819 ? 10.922  -19.091 0.508  1.00 80.21  ? 819  ILE A CD1   1 
ATOM   6692 N  N     . ASP A 1 820 ? 11.726  -20.959 4.656  1.00 78.67  ? 820  ASP A N     1 
ATOM   6693 C  CA    . ASP A 1 820 ? 11.302  -22.059 5.525  1.00 78.02  ? 820  ASP A CA    1 
ATOM   6694 C  C     . ASP A 1 820 ? 11.546  -21.695 6.990  1.00 76.40  ? 820  ASP A C     1 
ATOM   6695 O  O     . ASP A 1 820 ? 11.052  -22.365 7.903  1.00 75.77  ? 820  ASP A O     1 
ATOM   6696 C  CB    . ASP A 1 820 ? 12.027  -23.359 5.156  1.00 79.31  ? 820  ASP A CB    1 
ATOM   6697 C  CG    . ASP A 1 820 ? 11.494  -23.984 3.872  1.00 81.11  ? 820  ASP A CG    1 
ATOM   6698 O  OD1   . ASP A 1 820 ? 11.473  -23.295 2.826  1.00 80.93  ? 820  ASP A OD1   1 
ATOM   6699 O  OD2   . ASP A 1 820 ? 11.098  -25.171 3.913  1.00 81.79  ? 820  ASP A OD2   1 
ATOM   6700 N  N     . ALA A 1 821 ? 12.303  -20.616 7.191  1.00 74.64  ? 821  ALA A N     1 
ATOM   6701 C  CA    . ALA A 1 821 ? 12.638  -20.102 8.512  1.00 71.68  ? 821  ALA A CA    1 
ATOM   6702 C  C     . ALA A 1 821 ? 11.520  -19.219 9.063  1.00 69.83  ? 821  ALA A C     1 
ATOM   6703 O  O     . ALA A 1 821 ? 11.164  -18.205 8.448  1.00 70.34  ? 821  ALA A O     1 
ATOM   6704 C  CB    . ALA A 1 821 ? 13.938  -19.329 8.452  1.00 71.71  ? 821  ALA A CB    1 
ATOM   6705 N  N     . PRO A 1 822 ? 10.963  -19.606 10.224 1.00 66.46  ? 822  PRO A N     1 
ATOM   6706 C  CA    . PRO A 1 822 ? 9.895   -18.863 10.886 1.00 64.87  ? 822  PRO A CA    1 
ATOM   6707 C  C     . PRO A 1 822 ? 10.396  -17.562 11.514 1.00 63.08  ? 822  PRO A C     1 
ATOM   6708 O  O     . PRO A 1 822 ? 11.483  -17.526 12.100 1.00 62.06  ? 822  PRO A O     1 
ATOM   6709 C  CB    . PRO A 1 822 ? 9.410   -19.834 11.961 1.00 65.24  ? 822  PRO A CB    1 
ATOM   6710 C  CG    . PRO A 1 822 ? 10.581  -20.701 12.238 1.00 66.00  ? 822  PRO A CG    1 
ATOM   6711 C  CD    . PRO A 1 822 ? 11.311  -20.840 10.950 1.00 66.31  ? 822  PRO A CD    1 
ATOM   6712 N  N     . GLN A 1 823 ? 9.602   -16.504 11.379 1.00 61.43  ? 823  GLN A N     1 
ATOM   6713 C  CA    . GLN A 1 823 ? 10.009  -15.168 11.812 1.00 60.18  ? 823  GLN A CA    1 
ATOM   6714 C  C     . GLN A 1 823 ? 9.794   -14.977 13.317 1.00 57.55  ? 823  GLN A C     1 
ATOM   6715 O  O     . GLN A 1 823 ? 8.978   -15.669 13.929 1.00 57.40  ? 823  GLN A O     1 
ATOM   6716 C  CB    . GLN A 1 823 ? 9.260   -14.083 11.019 1.00 61.34  ? 823  GLN A CB    1 
ATOM   6717 C  CG    . GLN A 1 823 ? 9.417   -14.148 9.493  1.00 63.62  ? 823  GLN A CG    1 
ATOM   6718 C  CD    . GLN A 1 823 ? 10.835  -13.855 9.002  1.00 67.84  ? 823  GLN A CD    1 
ATOM   6719 O  OE1   . GLN A 1 823 ? 11.401  -14.625 8.225  1.00 69.34  ? 823  GLN A OE1   1 
ATOM   6720 N  NE2   . GLN A 1 823 ? 11.407  -12.734 9.445  1.00 68.55  ? 823  GLN A NE2   1 
ATOM   6721 N  N     . VAL A 1 824 ? 10.540  -14.047 13.909 1.00 53.09  ? 824  VAL A N     1 
ATOM   6722 C  CA    . VAL A 1 824 ? 10.359  -13.707 15.312 1.00 49.73  ? 824  VAL A CA    1 
ATOM   6723 C  C     . VAL A 1 824 ? 9.193   -12.725 15.439 1.00 48.65  ? 824  VAL A C     1 
ATOM   6724 O  O     . VAL A 1 824 ? 9.143   -11.722 14.732 1.00 49.79  ? 824  VAL A O     1 
ATOM   6725 C  CB    . VAL A 1 824 ? 11.652  -13.108 15.928 1.00 48.98  ? 824  VAL A CB    1 
ATOM   6726 C  CG1   . VAL A 1 824 ? 11.407  -12.617 17.349 1.00 44.30  ? 824  VAL A CG1   1 
ATOM   6727 C  CG2   . VAL A 1 824 ? 12.776  -14.129 15.913 1.00 46.72  ? 824  VAL A CG2   1 
ATOM   6728 N  N     . VAL A 1 825 ? 8.261   -13.020 16.338 1.00 46.56  ? 825  VAL A N     1 
ATOM   6729 C  CA    . VAL A 1 825 ? 7.094   -12.162 16.550 1.00 45.55  ? 825  VAL A CA    1 
ATOM   6730 C  C     . VAL A 1 825 ? 7.301   -11.218 17.750 1.00 46.13  ? 825  VAL A C     1 
ATOM   6731 O  O     . VAL A 1 825 ? 7.552   -11.662 18.879 1.00 46.21  ? 825  VAL A O     1 
ATOM   6732 C  CB    . VAL A 1 825 ? 5.796   -13.001 16.734 1.00 43.84  ? 825  VAL A CB    1 
ATOM   6733 C  CG1   . VAL A 1 825 ? 4.582   -12.098 16.915 1.00 42.71  ? 825  VAL A CG1   1 
ATOM   6734 C  CG2   . VAL A 1 825 ? 5.585   -13.966 15.553 1.00 43.12  ? 825  VAL A CG2   1 
ATOM   6735 N  N     . GLU A 1 826 ? 7.200   -9.920  17.483 1.00 46.29  ? 826  GLU A N     1 
ATOM   6736 C  CA    . GLU A 1 826 ? 7.245   -8.870  18.503 1.00 48.51  ? 826  GLU A CA    1 
ATOM   6737 C  C     . GLU A 1 826 ? 6.372   -9.202  19.725 1.00 48.66  ? 826  GLU A C     1 
ATOM   6738 O  O     . GLU A 1 826 ? 5.181   -9.502  19.587 1.00 48.77  ? 826  GLU A O     1 
ATOM   6739 C  CB    . GLU A 1 826 ? 6.831   -7.531  17.867 1.00 49.69  ? 826  GLU A CB    1 
ATOM   6740 C  CG    . GLU A 1 826 ? 6.353   -6.444  18.830 1.00 53.70  ? 826  GLU A CG    1 
ATOM   6741 C  CD    . GLU A 1 826 ? 7.487   -5.746  19.566 1.00 57.47  ? 826  GLU A CD    1 
ATOM   6742 O  OE1   . GLU A 1 826 ? 7.318   -5.486  20.780 1.00 58.14  ? 826  GLU A OE1   1 
ATOM   6743 O  OE2   . GLU A 1 826 ? 8.535   -5.455  18.938 1.00 58.06  ? 826  GLU A OE2   1 
ATOM   6744 N  N     . GLY A 1 827 ? 6.981   -9.166  20.911 1.00 48.54  ? 827  GLY A N     1 
ATOM   6745 C  CA    . GLY A 1 827 ? 6.279   -9.444  22.166 1.00 47.22  ? 827  GLY A CA    1 
ATOM   6746 C  C     . GLY A 1 827 ? 6.274   -10.908 22.577 1.00 47.31  ? 827  GLY A C     1 
ATOM   6747 O  O     . GLY A 1 827 ? 5.889   -11.233 23.698 1.00 48.29  ? 827  GLY A O     1 
ATOM   6748 N  N     . GLU A 1 828 ? 6.691   -11.792 21.672 1.00 46.66  ? 828  GLU A N     1 
ATOM   6749 C  CA    . GLU A 1 828 ? 6.750   -13.231 21.950 1.00 46.53  ? 828  GLU A CA    1 
ATOM   6750 C  C     . GLU A 1 828 ? 8.118   -13.639 22.490 1.00 45.52  ? 828  GLU A C     1 
ATOM   6751 O  O     . GLU A 1 828 ? 9.078   -12.867 22.426 1.00 45.92  ? 828  GLU A O     1 
ATOM   6752 C  CB    . GLU A 1 828 ? 6.433   -14.043 20.691 1.00 49.43  ? 828  GLU A CB    1 
ATOM   6753 C  CG    . GLU A 1 828 ? 5.047   -13.791 20.106 1.00 56.51  ? 828  GLU A CG    1 
ATOM   6754 C  CD    . GLU A 1 828 ? 3.992   -14.765 20.599 1.00 64.28  ? 828  GLU A CD    1 
ATOM   6755 O  OE1   . GLU A 1 828 ? 3.344   -15.398 19.736 1.00 66.00  ? 828  GLU A OE1   1 
ATOM   6756 O  OE2   . GLU A 1 828 ? 3.810   -14.902 21.836 1.00 68.40  ? 828  GLU A OE2   1 
ATOM   6757 N  N     . LYS A 1 829 ? 8.205   -14.858 23.016 1.00 42.44  ? 829  LYS A N     1 
ATOM   6758 C  CA    . LYS A 1 829 ? 9.442   -15.339 23.613 1.00 38.48  ? 829  LYS A CA    1 
ATOM   6759 C  C     . LYS A 1 829 ? 10.342  -16.025 22.600 1.00 37.73  ? 829  LYS A C     1 
ATOM   6760 O  O     . LYS A 1 829 ? 9.875   -16.640 21.633 1.00 37.09  ? 829  LYS A O     1 
ATOM   6761 C  CB    . LYS A 1 829 ? 9.156   -16.265 24.800 1.00 37.31  ? 829  LYS A CB    1 
ATOM   6762 C  CG    . LYS A 1 829 ? 8.176   -15.666 25.788 1.00 37.11  ? 829  LYS A CG    1 
ATOM   6763 C  CD    . LYS A 1 829 ? 8.333   -16.222 27.160 1.00 36.38  ? 829  LYS A CD    1 
ATOM   6764 C  CE    . LYS A 1 829 ? 7.523   -15.410 28.152 1.00 37.19  ? 829  LYS A CE    1 
ATOM   6765 N  NZ    . LYS A 1 829 ? 7.795   -15.882 29.529 1.00 39.75  ? 829  LYS A NZ    1 
ATOM   6766 N  N     . VAL A 1 830 ? 11.641  -15.915 22.855 1.00 36.16  ? 830  VAL A N     1 
ATOM   6767 C  CA    . VAL A 1 830 ? 12.679  -16.511 22.028 1.00 34.84  ? 830  VAL A CA    1 
ATOM   6768 C  C     . VAL A 1 830 ? 13.615  -17.356 22.882 1.00 34.38  ? 830  VAL A C     1 
ATOM   6769 O  O     . VAL A 1 830 ? 13.803  -17.072 24.068 1.00 33.96  ? 830  VAL A O     1 
ATOM   6770 C  CB    . VAL A 1 830 ? 13.511  -15.414 21.286 1.00 37.57  ? 830  VAL A CB    1 
ATOM   6771 C  CG1   . VAL A 1 830 ? 12.738  -14.857 20.093 1.00 32.60  ? 830  VAL A CG1   1 
ATOM   6772 C  CG2   . VAL A 1 830 ? 13.925  -14.284 22.243 1.00 31.60  ? 830  VAL A CG2   1 
ATOM   6773 N  N     . TYR A 1 831 ? 14.178  -18.404 22.290 1.00 33.01  ? 831  TYR A N     1 
ATOM   6774 C  CA    . TYR A 1 831 ? 15.339  -19.092 22.879 1.00 34.47  ? 831  TYR A CA    1 
ATOM   6775 C  C     . TYR A 1 831 ? 16.599  -18.266 22.617 1.00 34.07  ? 831  TYR A C     1 
ATOM   6776 O  O     . TYR A 1 831 ? 16.692  -17.617 21.570 1.00 30.94  ? 831  TYR A O     1 
ATOM   6777 C  CB    . TYR A 1 831 ? 15.519  -20.486 22.278 1.00 34.43  ? 831  TYR A CB    1 
ATOM   6778 C  CG    . TYR A 1 831 ? 14.539  -21.512 22.787 1.00 35.15  ? 831  TYR A CG    1 
ATOM   6779 C  CD1   . TYR A 1 831 ? 14.321  -21.677 24.153 1.00 32.70  ? 831  TYR A CD1   1 
ATOM   6780 C  CD2   . TYR A 1 831 ? 13.844  -22.335 21.903 1.00 37.36  ? 831  TYR A CD2   1 
ATOM   6781 C  CE1   . TYR A 1 831 ? 13.424  -22.618 24.626 1.00 31.11  ? 831  TYR A CE1   1 
ATOM   6782 C  CE2   . TYR A 1 831 ? 12.952  -23.287 22.367 1.00 36.90  ? 831  TYR A CE2   1 
ATOM   6783 C  CZ    . TYR A 1 831 ? 12.745  -23.419 23.731 1.00 35.98  ? 831  TYR A CZ    1 
ATOM   6784 O  OH    . TYR A 1 831 ? 11.852  -24.356 24.202 1.00 40.22  ? 831  TYR A OH    1 
ATOM   6785 N  N     . VAL A 1 832 ? 17.558  -18.290 23.549 1.00 33.10  ? 832  VAL A N     1 
ATOM   6786 C  CA    . VAL A 1 832 ? 18.795  -17.493 23.409 1.00 34.19  ? 832  VAL A CA    1 
ATOM   6787 C  C     . VAL A 1 832 ? 20.049  -18.318 23.716 1.00 35.90  ? 832  VAL A C     1 
ATOM   6788 O  O     . VAL A 1 832 ? 20.131  -18.956 24.765 1.00 38.59  ? 832  VAL A O     1 
ATOM   6789 C  CB    . VAL A 1 832 ? 18.785  -16.228 24.332 1.00 34.76  ? 832  VAL A CB    1 
ATOM   6790 C  CG1   . VAL A 1 832 ? 20.065  -15.396 24.163 1.00 29.36  ? 832  VAL A CG1   1 
ATOM   6791 C  CG2   . VAL A 1 832 ? 17.542  -15.360 24.089 1.00 31.67  ? 832  VAL A CG2   1 
ATOM   6792 N  N     . LEU A 1 833 ? 21.021  -18.303 22.802 1.00 36.17  ? 833  LEU A N     1 
ATOM   6793 C  CA    . LEU A 1 833 ? 22.312  -18.984 23.019 1.00 35.13  ? 833  LEU A CA    1 
ATOM   6794 C  C     . LEU A 1 833 ? 23.529  -18.088 22.740 1.00 36.45  ? 833  LEU A C     1 
ATOM   6795 O  O     . LEU A 1 833 ? 23.554  -17.360 21.749 1.00 37.00  ? 833  LEU A O     1 
ATOM   6796 C  CB    . LEU A 1 833 ? 22.415  -20.263 22.178 1.00 32.24  ? 833  LEU A CB    1 
ATOM   6797 C  CG    . LEU A 1 833 ? 21.582  -21.483 22.582 1.00 31.20  ? 833  LEU A CG    1 
ATOM   6798 C  CD1   . LEU A 1 833 ? 21.639  -22.539 21.501 1.00 25.18  ? 833  LEU A CD1   1 
ATOM   6799 C  CD2   . LEU A 1 833 ? 22.018  -22.075 23.925 1.00 27.28  ? 833  LEU A CD2   1 
ATOM   6800 N  N     . PRO A 1 834 ? 24.546  -18.142 23.619 1.00 37.39  ? 834  PRO A N     1 
ATOM   6801 C  CA    . PRO A 1 834 ? 25.814  -17.464 23.340 1.00 36.78  ? 834  PRO A CA    1 
ATOM   6802 C  C     . PRO A 1 834 ? 26.606  -18.201 22.270 1.00 37.48  ? 834  PRO A C     1 
ATOM   6803 O  O     . PRO A 1 834 ? 26.544  -19.430 22.186 1.00 35.82  ? 834  PRO A O     1 
ATOM   6804 C  CB    . PRO A 1 834 ? 26.554  -17.541 24.679 1.00 36.27  ? 834  PRO A CB    1 
ATOM   6805 C  CG    . PRO A 1 834 ? 25.991  -18.754 25.346 1.00 36.79  ? 834  PRO A CG    1 
ATOM   6806 C  CD    . PRO A 1 834 ? 24.541  -18.780 24.949 1.00 36.54  ? 834  PRO A CD    1 
ATOM   6807 N  N     . LEU A 1 835 ? 27.339  -17.443 21.462 1.00 39.68  ? 835  LEU A N     1 
ATOM   6808 C  CA    . LEU A 1 835 ? 28.175  -17.989 20.392 1.00 41.15  ? 835  LEU A CA    1 
ATOM   6809 C  C     . LEU A 1 835 ? 29.643  -17.708 20.693 1.00 42.89  ? 835  LEU A C     1 
ATOM   6810 O  O     . LEU A 1 835 ? 29.969  -16.695 21.323 1.00 43.65  ? 835  LEU A O     1 
ATOM   6811 C  CB    . LEU A 1 835 ? 27.788  -17.347 19.062 1.00 41.37  ? 835  LEU A CB    1 
ATOM   6812 C  CG    . LEU A 1 835 ? 26.765  -17.991 18.113 1.00 43.66  ? 835  LEU A CG    1 
ATOM   6813 C  CD1   . LEU A 1 835 ? 25.863  -19.045 18.756 1.00 40.28  ? 835  LEU A CD1   1 
ATOM   6814 C  CD2   . LEU A 1 835 ? 25.944  -16.904 17.434 1.00 40.47  ? 835  LEU A CD2   1 
ATOM   6815 N  N     . ARG A 1 836 ? 30.524  -18.602 20.254 1.00 44.14  ? 836  ARG A N     1 
ATOM   6816 C  CA    . ARG A 1 836 ? 31.971  -18.414 20.450 1.00 46.53  ? 836  ARG A CA    1 
ATOM   6817 C  C     . ARG A 1 836 ? 32.567  -17.387 19.488 1.00 47.70  ? 836  ARG A C     1 
ATOM   6818 O  O     . ARG A 1 836 ? 32.103  -17.230 18.347 1.00 44.79  ? 836  ARG A O     1 
ATOM   6819 C  CB    . ARG A 1 836 ? 32.737  -19.740 20.333 1.00 46.27  ? 836  ARG A CB    1 
ATOM   6820 C  CG    . ARG A 1 836 ? 32.631  -20.658 21.562 1.00 47.40  ? 836  ARG A CG    1 
ATOM   6821 C  CD    . ARG A 1 836 ? 33.657  -21.793 21.509 1.00 48.68  ? 836  ARG A CD    1 
ATOM   6822 N  NE    . ARG A 1 836 ? 33.725  -22.392 20.175 1.00 51.49  ? 836  ARG A NE    1 
ATOM   6823 C  CZ    . ARG A 1 836 ? 32.895  -23.327 19.718 1.00 51.38  ? 836  ARG A CZ    1 
ATOM   6824 N  NH1   . ARG A 1 836 ? 31.915  -23.807 20.485 1.00 48.54  ? 836  ARG A NH1   1 
ATOM   6825 N  NH2   . ARG A 1 836 ? 33.051  -23.789 18.485 1.00 48.21  ? 836  ARG A NH2   1 
ATOM   6826 N  N     . GLU A 1 837 ? 33.602  -16.700 19.972 1.00 49.50  ? 837  GLU A N     1 
ATOM   6827 C  CA    . GLU A 1 837 ? 34.348  -15.715 19.197 1.00 52.32  ? 837  GLU A CA    1 
ATOM   6828 C  C     . GLU A 1 837 ? 34.814  -16.313 17.869 1.00 51.82  ? 837  GLU A C     1 
ATOM   6829 O  O     . GLU A 1 837 ? 35.509  -17.335 17.845 1.00 50.92  ? 837  GLU A O     1 
ATOM   6830 C  CB    . GLU A 1 837 ? 35.552  -15.225 20.013 1.00 54.22  ? 837  GLU A CB    1 
ATOM   6831 C  CG    . GLU A 1 837 ? 35.971  -13.783 19.747 1.00 59.41  ? 837  GLU A CG    1 
ATOM   6832 C  CD    . GLU A 1 837 ? 36.990  -13.281 20.767 1.00 65.21  ? 837  GLU A CD    1 
ATOM   6833 O  OE1   . GLU A 1 837 ? 36.582  -12.550 21.698 1.00 66.23  ? 837  GLU A OE1   1 
ATOM   6834 O  OE2   . GLU A 1 837 ? 38.191  -13.627 20.649 1.00 66.93  ? 837  GLU A OE2   1 
ATOM   6835 N  N     . GLY A 1 838 ? 34.402  -15.685 16.771 1.00 51.45  ? 838  GLY A N     1 
ATOM   6836 C  CA    . GLY A 1 838 ? 34.835  -16.097 15.439 1.00 49.35  ? 838  GLY A CA    1 
ATOM   6837 C  C     . GLY A 1 838 ? 33.832  -16.914 14.654 1.00 48.13  ? 838  GLY A C     1 
ATOM   6838 O  O     . GLY A 1 838 ? 34.152  -17.411 13.571 1.00 49.64  ? 838  GLY A O     1 
ATOM   6839 N  N     . ASN A 1 839 ? 32.620  -17.049 15.191 1.00 46.12  ? 839  ASN A N     1 
ATOM   6840 C  CA    . ASN A 1 839 ? 31.535  -17.804 14.547 1.00 44.82  ? 839  ASN A CA    1 
ATOM   6841 C  C     . ASN A 1 839 ? 31.124  -17.199 13.196 1.00 43.59  ? 839  ASN A C     1 
ATOM   6842 O  O     . ASN A 1 839 ? 31.332  -16.005 12.972 1.00 39.63  ? 839  ASN A O     1 
ATOM   6843 C  CB    . ASN A 1 839 ? 30.324  -17.895 15.486 1.00 43.76  ? 839  ASN A CB    1 
ATOM   6844 C  CG    . ASN A 1 839 ? 29.733  -16.529 15.813 1.00 47.76  ? 839  ASN A CG    1 
ATOM   6845 O  OD1   . ASN A 1 839 ? 28.912  -15.998 15.064 1.00 47.44  ? 839  ASN A OD1   1 
ATOM   6846 N  ND2   . ASN A 1 839 ? 30.151  -15.955 16.937 1.00 46.89  ? 839  ASN A ND2   1 
ATOM   6847 N  N     . PRO A 1 840 ? 30.532  -18.015 12.297 1.00 44.62  ? 840  PRO A N     1 
ATOM   6848 C  CA    . PRO A 1 840 ? 30.150  -17.490 10.977 1.00 44.87  ? 840  PRO A CA    1 
ATOM   6849 C  C     . PRO A 1 840 ? 28.936  -16.560 11.026 1.00 44.37  ? 840  PRO A C     1 
ATOM   6850 O  O     . PRO A 1 840 ? 28.654  -15.882 10.037 1.00 42.46  ? 840  PRO A O     1 
ATOM   6851 C  CB    . PRO A 1 840 ? 29.823  -18.753 10.171 1.00 43.42  ? 840  PRO A CB    1 
ATOM   6852 C  CG    . PRO A 1 840 ? 29.391  -19.746 11.194 1.00 45.06  ? 840  PRO A CG    1 
ATOM   6853 C  CD    . PRO A 1 840 ? 30.183  -19.443 12.443 1.00 44.65  ? 840  PRO A CD    1 
ATOM   6854 N  N     . PHE A 1 841 ? 28.238  -16.530 12.165 1.00 43.11  ? 841  PHE A N     1 
ATOM   6855 C  CA    . PHE A 1 841 ? 27.066  -15.663 12.337 1.00 43.60  ? 841  PHE A CA    1 
ATOM   6856 C  C     . PHE A 1 841 ? 27.435  -14.198 12.541 1.00 44.29  ? 841  PHE A C     1 
ATOM   6857 O  O     . PHE A 1 841 ? 26.608  -13.306 12.316 1.00 43.58  ? 841  PHE A O     1 
ATOM   6858 C  CB    . PHE A 1 841 ? 26.191  -16.149 13.495 1.00 43.25  ? 841  PHE A CB    1 
ATOM   6859 C  CG    . PHE A 1 841 ? 25.581  -17.497 13.262 1.00 39.56  ? 841  PHE A CG    1 
ATOM   6860 C  CD1   . PHE A 1 841 ? 24.461  -17.638 12.438 1.00 38.69  ? 841  PHE A CD1   1 
ATOM   6861 C  CD2   . PHE A 1 841 ? 26.124  -18.628 13.859 1.00 38.20  ? 841  PHE A CD2   1 
ATOM   6862 C  CE1   . PHE A 1 841 ? 23.885  -18.889 12.213 1.00 33.15  ? 841  PHE A CE1   1 
ATOM   6863 C  CE2   . PHE A 1 841 ? 25.556  -19.887 13.639 1.00 35.44  ? 841  PHE A CE2   1 
ATOM   6864 C  CZ    . PHE A 1 841 ? 24.437  -20.012 12.814 1.00 35.69  ? 841  PHE A CZ    1 
ATOM   6865 N  N     . GLY A 1 842 ? 28.670  -13.966 12.985 1.00 46.02  ? 842  GLY A N     1 
ATOM   6866 C  CA    . GLY A 1 842 ? 29.236  -12.624 13.088 1.00 46.70  ? 842  GLY A CA    1 
ATOM   6867 C  C     . GLY A 1 842 ? 28.796  -11.828 14.300 1.00 47.88  ? 842  GLY A C     1 
ATOM   6868 O  O     . GLY A 1 842 ? 28.750  -10.595 14.241 1.00 48.19  ? 842  GLY A O     1 
ATOM   6869 N  N     . ASP A 1 843 ? 28.484  -12.524 15.397 1.00 46.95  ? 843  ASP A N     1 
ATOM   6870 C  CA    . ASP A 1 843 ? 28.053  -11.885 16.652 1.00 47.18  ? 843  ASP A CA    1 
ATOM   6871 C  C     . ASP A 1 843 ? 28.152  -12.844 17.851 1.00 45.02  ? 843  ASP A C     1 
ATOM   6872 O  O     . ASP A 1 843 ? 28.359  -14.054 17.679 1.00 44.35  ? 843  ASP A O     1 
ATOM   6873 C  CB    . ASP A 1 843 ? 26.619  -11.349 16.522 1.00 49.39  ? 843  ASP A CB    1 
ATOM   6874 C  CG    . ASP A 1 843 ? 26.476  -9.910  17.016 1.00 52.01  ? 843  ASP A CG    1 
ATOM   6875 O  OD1   . ASP A 1 843 ? 27.197  -9.502  17.958 1.00 52.86  ? 843  ASP A OD1   1 
ATOM   6876 O  OD2   . ASP A 1 843 ? 25.631  -9.183  16.454 1.00 52.96  ? 843  ASP A OD2   1 
ATOM   6877 N  N     . LYS A 1 844 ? 27.988  -12.303 19.058 1.00 41.23  ? 844  LYS A N     1 
ATOM   6878 C  CA    . LYS A 1 844 ? 28.192  -13.078 20.292 1.00 40.07  ? 844  LYS A CA    1 
ATOM   6879 C  C     . LYS A 1 844 ? 27.032  -13.992 20.738 1.00 38.57  ? 844  LYS A C     1 
ATOM   6880 O  O     . LYS A 1 844 ? 27.171  -14.739 21.701 1.00 37.07  ? 844  LYS A O     1 
ATOM   6881 C  CB    . LYS A 1 844 ? 28.635  -12.164 21.444 1.00 39.89  ? 844  LYS A CB    1 
ATOM   6882 C  CG    . LYS A 1 844 ? 27.662  -11.051 21.818 1.00 41.01  ? 844  LYS A CG    1 
ATOM   6883 C  CD    . LYS A 1 844 ? 28.253  -10.186 22.926 1.00 43.02  ? 844  LYS A CD    1 
ATOM   6884 C  CE    . LYS A 1 844 ? 27.273  -9.135  23.414 1.00 44.57  ? 844  LYS A CE    1 
ATOM   6885 N  NZ    . LYS A 1 844 ? 27.681  -8.563  24.732 1.00 43.80  ? 844  LYS A NZ    1 
ATOM   6886 N  N     . CYS A 1 845 ? 25.902  -13.942 20.042 1.00 37.77  ? 845  CYS A N     1 
ATOM   6887 C  CA    . CYS A 1 845 ? 24.743  -14.740 20.425 1.00 38.02  ? 845  CYS A CA    1 
ATOM   6888 C  C     . CYS A 1 845 ? 23.728  -14.820 19.295 1.00 36.78  ? 845  CYS A C     1 
ATOM   6889 O  O     . CYS A 1 845 ? 23.778  -14.029 18.355 1.00 36.24  ? 845  CYS A O     1 
ATOM   6890 C  CB    . CYS A 1 845 ? 24.073  -14.151 21.675 1.00 37.86  ? 845  CYS A CB    1 
ATOM   6891 S  SG    . CYS A 1 845 ? 23.309  -12.524 21.416 1.00 41.62  ? 845  CYS A SG    1 
ATOM   6892 N  N     . ILE A 1 846 ? 22.812  -15.782 19.408 1.00 35.69  ? 846  ILE A N     1 
ATOM   6893 C  CA    . ILE A 1 846 ? 21.696  -15.940 18.481 1.00 33.09  ? 846  ILE A CA    1 
ATOM   6894 C  C     . ILE A 1 846 ? 20.418  -16.281 19.260 1.00 33.50  ? 846  ILE A C     1 
ATOM   6895 O  O     . ILE A 1 846 ? 20.482  -16.840 20.354 1.00 33.22  ? 846  ILE A O     1 
ATOM   6896 C  CB    . ILE A 1 846 ? 21.999  -17.012 17.385 1.00 32.99  ? 846  ILE A CB    1 
ATOM   6897 C  CG1   . ILE A 1 846 ? 21.057  -16.842 16.185 1.00 33.15  ? 846  ILE A CG1   1 
ATOM   6898 C  CG2   . ILE A 1 846 ? 21.966  -18.428 17.956 1.00 30.69  ? 846  ILE A CG2   1 
ATOM   6899 C  CD1   . ILE A 1 846 ? 21.401  -17.704 14.992 1.00 30.46  ? 846  ILE A CD1   1 
ATOM   6900 N  N     . ALA A 1 847 ? 19.270  -15.925 18.688 1.00 34.00  ? 847  ALA A N     1 
ATOM   6901 C  CA    . ALA A 1 847 ? 17.965  -16.162 19.296 1.00 32.79  ? 847  ALA A CA    1 
ATOM   6902 C  C     . ALA A 1 847 ? 16.927  -16.544 18.241 1.00 34.53  ? 847  ALA A C     1 
ATOM   6903 O  O     . ALA A 1 847 ? 16.890  -15.967 17.152 1.00 36.11  ? 847  ALA A O     1 
ATOM   6904 C  CB    . ALA A 1 847 ? 17.502  -14.932 20.072 1.00 32.39  ? 847  ALA A CB    1 
ATOM   6905 N  N     . TRP A 1 848 ? 16.078  -17.512 18.567 1.00 33.49  ? 848  TRP A N     1 
ATOM   6906 C  CA    . TRP A 1 848 ? 15.020  -17.933 17.654 1.00 32.90  ? 848  TRP A CA    1 
ATOM   6907 C  C     . TRP A 1 848 ? 13.709  -18.161 18.433 1.00 33.15  ? 848  TRP A C     1 
ATOM   6908 O  O     . TRP A 1 848 ? 13.730  -18.160 19.659 1.00 35.96  ? 848  TRP A O     1 
ATOM   6909 C  CB    . TRP A 1 848 ? 15.476  -19.160 16.856 1.00 30.36  ? 848  TRP A CB    1 
ATOM   6910 C  CG    . TRP A 1 848 ? 15.486  -20.445 17.628 1.00 27.42  ? 848  TRP A CG    1 
ATOM   6911 C  CD1   . TRP A 1 848 ? 14.542  -21.422 17.589 1.00 26.29  ? 848  TRP A CD1   1 
ATOM   6912 C  CD2   . TRP A 1 848 ? 16.496  -20.893 18.547 1.00 27.51  ? 848  TRP A CD2   1 
ATOM   6913 N  NE1   . TRP A 1 848 ? 14.892  -22.456 18.435 1.00 31.65  ? 848  TRP A NE1   1 
ATOM   6914 C  CE2   . TRP A 1 848 ? 16.089  -22.153 19.032 1.00 30.90  ? 848  TRP A CE2   1 
ATOM   6915 C  CE3   . TRP A 1 848 ? 17.704  -20.347 19.009 1.00 27.54  ? 848  TRP A CE3   1 
ATOM   6916 C  CZ2   . TRP A 1 848 ? 16.846  -22.880 19.961 1.00 31.96  ? 848  TRP A CZ2   1 
ATOM   6917 C  CZ3   . TRP A 1 848 ? 18.456  -21.068 19.933 1.00 26.35  ? 848  TRP A CZ3   1 
ATOM   6918 C  CH2   . TRP A 1 848 ? 18.024  -22.319 20.397 1.00 32.27  ? 848  TRP A CH2   1 
ATOM   6919 N  N     . PRO A 1 849 ? 12.567  -18.338 17.738 1.00 33.27  ? 849  PRO A N     1 
ATOM   6920 C  CA    . PRO A 1 849 ? 11.293  -18.473 18.480 1.00 34.26  ? 849  PRO A CA    1 
ATOM   6921 C  C     . PRO A 1 849 ? 11.257  -19.688 19.419 1.00 34.54  ? 849  PRO A C     1 
ATOM   6922 O  O     . PRO A 1 849 ? 11.621  -20.787 19.018 1.00 32.77  ? 849  PRO A O     1 
ATOM   6923 C  CB    . PRO A 1 849 ? 10.248  -18.633 17.367 1.00 33.81  ? 849  PRO A CB    1 
ATOM   6924 C  CG    . PRO A 1 849 ? 10.897  -18.047 16.139 1.00 33.26  ? 849  PRO A CG    1 
ATOM   6925 C  CD    . PRO A 1 849 ? 12.356  -18.384 16.278 1.00 32.50  ? 849  PRO A CD    1 
ATOM   6926 N  N     . SER A 1 850 ? 10.824  -19.480 20.659 1.00 35.95  ? 850  SER A N     1 
ATOM   6927 C  CA    . SER A 1 850 ? 10.797  -20.555 21.643 1.00 38.56  ? 850  SER A CA    1 
ATOM   6928 C  C     . SER A 1 850 ? 9.724   -21.575 21.326 1.00 40.94  ? 850  SER A C     1 
ATOM   6929 O  O     . SER A 1 850 ? 8.752   -21.278 20.617 1.00 41.02  ? 850  SER A O     1 
ATOM   6930 C  CB    . SER A 1 850 ? 10.605  -20.013 23.056 1.00 39.39  ? 850  SER A CB    1 
ATOM   6931 O  OG    . SER A 1 850 ? 9.355   -19.357 23.181 1.00 44.60  ? 850  SER A OG    1 
ATOM   6932 N  N     . GLY A 1 851 ? 9.912   -22.781 21.856 1.00 42.49  ? 851  GLY A N     1 
ATOM   6933 C  CA    . GLY A 1 851 ? 9.011   -23.891 21.599 1.00 46.47  ? 851  GLY A CA    1 
ATOM   6934 C  C     . GLY A 1 851 ? 9.353   -24.606 20.306 1.00 49.38  ? 851  GLY A C     1 
ATOM   6935 O  O     . GLY A 1 851 ? 8.833   -25.691 20.035 1.00 49.23  ? 851  GLY A O     1 
ATOM   6936 N  N     . THR A 1 852 ? 10.231  -24.003 19.505 1.00 50.55  ? 852  THR A N     1 
ATOM   6937 C  CA    . THR A 1 852 ? 10.590  -24.577 18.208 1.00 51.54  ? 852  THR A CA    1 
ATOM   6938 C  C     . THR A 1 852 ? 12.063  -24.960 18.111 1.00 52.47  ? 852  THR A C     1 
ATOM   6939 O  O     . THR A 1 852 ? 12.919  -24.385 18.790 1.00 52.68  ? 852  THR A O     1 
ATOM   6940 C  CB    . THR A 1 852 ? 10.248  -23.635 17.036 1.00 49.33  ? 852  THR A CB    1 
ATOM   6941 O  OG1   . THR A 1 852 ? 11.175  -22.543 17.015 1.00 51.36  ? 852  THR A OG1   1 
ATOM   6942 C  CG2   . THR A 1 852 ? 8.822   -23.107 17.157 1.00 48.60  ? 852  THR A CG2   1 
ATOM   6943 N  N     . GLU A 1 853 ? 12.328  -25.953 17.263 1.00 53.43  ? 853  GLU A N     1 
ATOM   6944 C  CA    . GLU A 1 853 ? 13.670  -26.294 16.820 1.00 51.99  ? 853  GLU A CA    1 
ATOM   6945 C  C     . GLU A 1 853 ? 14.172  -25.166 15.931 1.00 51.06  ? 853  GLU A C     1 
ATOM   6946 O  O     . GLU A 1 853 ? 13.389  -24.523 15.227 1.00 48.19  ? 853  GLU A O     1 
ATOM   6947 C  CB    . GLU A 1 853 ? 13.627  -27.593 16.016 1.00 53.79  ? 853  GLU A CB    1 
ATOM   6948 C  CG    . GLU A 1 853 ? 13.574  -28.872 16.859 1.00 58.60  ? 853  GLU A CG    1 
ATOM   6949 C  CD    . GLU A 1 853 ? 14.958  -29.360 17.287 1.00 62.54  ? 853  GLU A CD    1 
ATOM   6950 O  OE1   . GLU A 1 853 ? 15.956  -29.003 16.620 1.00 61.43  ? 853  GLU A OE1   1 
ATOM   6951 O  OE2   . GLU A 1 853 ? 15.051  -30.108 18.285 1.00 64.76  ? 853  GLU A OE2   1 
ATOM   6952 N  N     . ILE A 1 854 ? 15.473  -24.907 15.963 1.00 51.41  ? 854  ILE A N     1 
ATOM   6953 C  CA    . ILE A 1 854 ? 16.030  -23.915 15.048 1.00 52.11  ? 854  ILE A CA    1 
ATOM   6954 C  C     . ILE A 1 854 ? 16.127  -24.519 13.639 1.00 52.43  ? 854  ILE A C     1 
ATOM   6955 O  O     . ILE A 1 854 ? 16.558  -25.668 13.476 1.00 50.75  ? 854  ILE A O     1 
ATOM   6956 C  CB    . ILE A 1 854 ? 17.360  -23.277 15.571 1.00 51.52  ? 854  ILE A CB    1 
ATOM   6957 C  CG1   . ILE A 1 854 ? 17.768  -22.080 14.706 1.00 52.76  ? 854  ILE A CG1   1 
ATOM   6958 C  CG2   . ILE A 1 854 ? 18.483  -24.303 15.684 1.00 51.62  ? 854  ILE A CG2   1 
ATOM   6959 C  CD1   . ILE A 1 854 ? 18.487  -20.980 15.475 1.00 51.59  ? 854  ILE A CD1   1 
ATOM   6960 N  N     . THR A 1 855 ? 15.680  -23.751 12.642 1.00 53.94  ? 855  THR A N     1 
ATOM   6961 C  CA    . THR A 1 855 ? 15.616  -24.212 11.246 1.00 54.86  ? 855  THR A CA    1 
ATOM   6962 C  C     . THR A 1 855 ? 16.873  -24.974 10.803 1.00 54.94  ? 855  THR A C     1 
ATOM   6963 O  O     . THR A 1 855 ? 17.997  -24.547 11.074 1.00 54.80  ? 855  THR A O     1 
ATOM   6964 C  CB    . THR A 1 855 ? 15.274  -23.066 10.254 1.00 54.46  ? 855  THR A CB    1 
ATOM   6965 O  OG1   . THR A 1 855 ? 15.339  -23.565 8.914  1.00 57.11  ? 855  THR A OG1   1 
ATOM   6966 C  CG2   . THR A 1 855 ? 16.234  -21.881 10.399 1.00 53.17  ? 855  THR A CG2   1 
ATOM   6967 N  N     . ASP A 1 856 ? 16.661  -26.099 10.123 1.00 56.82  ? 856  ASP A N     1 
ATOM   6968 C  CA    . ASP A 1 856 ? 17.735  -27.049 9.804  1.00 58.44  ? 856  ASP A CA    1 
ATOM   6969 C  C     . ASP A 1 856 ? 18.918  -26.457 9.026  1.00 57.14  ? 856  ASP A C     1 
ATOM   6970 O  O     . ASP A 1 856 ? 20.034  -26.984 9.090  1.00 56.64  ? 856  ASP A O     1 
ATOM   6971 C  CB    . ASP A 1 856 ? 17.169  -28.293 9.094  1.00 59.84  ? 856  ASP A CB    1 
ATOM   6972 C  CG    . ASP A 1 856 ? 16.565  -29.305 10.072 1.00 63.67  ? 856  ASP A CG    1 
ATOM   6973 O  OD1   . ASP A 1 856 ? 15.406  -29.734 9.868  1.00 66.56  ? 856  ASP A OD1   1 
ATOM   6974 O  OD2   . ASP A 1 856 ? 17.248  -29.670 11.054 1.00 62.77  ? 856  ASP A OD2   1 
ATOM   6975 N  N     . LEU A 1 857 ? 18.677  -25.358 8.315  1.00 55.63  ? 857  LEU A N     1 
ATOM   6976 C  CA    . LEU A 1 857 ? 19.722  -24.717 7.522  1.00 54.67  ? 857  LEU A CA    1 
ATOM   6977 C  C     . LEU A 1 857 ? 20.790  -23.975 8.327  1.00 52.64  ? 857  LEU A C     1 
ATOM   6978 O  O     . LEU A 1 857 ? 21.869  -23.694 7.801  1.00 53.05  ? 857  LEU A O     1 
ATOM   6979 C  CB    . LEU A 1 857 ? 19.119  -23.812 6.441  1.00 56.48  ? 857  LEU A CB    1 
ATOM   6980 C  CG    . LEU A 1 857 ? 18.950  -24.495 5.074  1.00 58.80  ? 857  LEU A CG    1 
ATOM   6981 C  CD1   . LEU A 1 857 ? 18.166  -23.608 4.110  1.00 60.38  ? 857  LEU A CD1   1 
ATOM   6982 C  CD2   . LEU A 1 857 ? 20.304  -24.901 4.470  1.00 57.58  ? 857  LEU A CD2   1 
ATOM   6983 N  N     . ILE A 1 858 ? 20.493  -23.651 9.586  1.00 49.01  ? 858  ILE A N     1 
ATOM   6984 C  CA    . ILE A 1 858 ? 21.465  -22.983 10.456 1.00 45.42  ? 858  ILE A CA    1 
ATOM   6985 C  C     . ILE A 1 858 ? 21.707  -23.743 11.762 1.00 44.85  ? 858  ILE A C     1 
ATOM   6986 O  O     . ILE A 1 858 ? 22.600  -23.390 12.537 1.00 44.70  ? 858  ILE A O     1 
ATOM   6987 C  CB    . ILE A 1 858 ? 21.090  -21.488 10.753 1.00 45.74  ? 858  ILE A CB    1 
ATOM   6988 C  CG1   . ILE A 1 858 ? 19.830  -21.385 11.627 1.00 44.31  ? 858  ILE A CG1   1 
ATOM   6989 C  CG2   . ILE A 1 858 ? 20.951  -20.683 9.457  1.00 42.57  ? 858  ILE A CG2   1 
ATOM   6990 C  CD1   . ILE A 1 858 ? 19.497  -19.964 12.081 1.00 44.82  ? 858  ILE A CD1   1 
ATOM   6991 N  N     . LYS A 1 859 ? 20.914  -24.788 11.992 1.00 44.38  ? 859  LYS A N     1 
ATOM   6992 C  CA    . LYS A 1 859 ? 20.990  -25.579 13.225 1.00 44.94  ? 859  LYS A CA    1 
ATOM   6993 C  C     . LYS A 1 859 ? 22.375  -26.180 13.488 1.00 45.08  ? 859  LYS A C     1 
ATOM   6994 O  O     . LYS A 1 859 ? 22.843  -26.192 14.629 1.00 43.28  ? 859  LYS A O     1 
ATOM   6995 C  CB    . LYS A 1 859 ? 19.924  -26.683 13.225 1.00 44.43  ? 859  LYS A CB    1 
ATOM   6996 C  CG    . LYS A 1 859 ? 19.856  -27.488 14.523 1.00 42.76  ? 859  LYS A CG    1 
ATOM   6997 C  CD    . LYS A 1 859 ? 18.854  -28.628 14.452 1.00 41.03  ? 859  LYS A CD    1 
ATOM   6998 C  CE    . LYS A 1 859 ? 19.002  -29.527 15.666 1.00 43.22  ? 859  LYS A CE    1 
ATOM   6999 N  NZ    . LYS A 1 859 ? 18.132  -30.742 15.626 1.00 45.05  ? 859  LYS A NZ    1 
ATOM   7000 N  N     . ASP A 1 860 ? 23.015  -26.675 12.430 1.00 45.93  ? 860  ASP A N     1 
ATOM   7001 C  CA    . ASP A 1 860 ? 24.315  -27.340 12.536 1.00 47.79  ? 860  ASP A CA    1 
ATOM   7002 C  C     . ASP A 1 860 ? 25.423  -26.376 12.964 1.00 47.20  ? 860  ASP A C     1 
ATOM   7003 O  O     . ASP A 1 860 ? 26.324  -26.756 13.714 1.00 45.99  ? 860  ASP A O     1 
ATOM   7004 C  CB    . ASP A 1 860 ? 24.678  -28.027 11.212 1.00 50.37  ? 860  ASP A CB    1 
ATOM   7005 C  CG    . ASP A 1 860 ? 24.754  -27.047 10.042 1.00 57.22  ? 860  ASP A CG    1 
ATOM   7006 O  OD1   . ASP A 1 860 ? 23.740  -26.361 9.766  1.00 60.41  ? 860  ASP A OD1   1 
ATOM   7007 O  OD2   . ASP A 1 860 ? 25.831  -26.959 9.402  1.00 59.94  ? 860  ASP A OD2   1 
ATOM   7008 N  N     . ASP A 1 861 ? 25.343  -25.135 12.482 1.00 48.24  ? 861  ASP A N     1 
ATOM   7009 C  CA    . ASP A 1 861 ? 26.305  -24.085 12.824 1.00 48.34  ? 861  ASP A CA    1 
ATOM   7010 C  C     . ASP A 1 861 ? 26.115  -23.592 14.257 1.00 47.60  ? 861  ASP A C     1 
ATOM   7011 O  O     . ASP A 1 861 ? 27.093  -23.326 14.962 1.00 47.11  ? 861  ASP A O     1 
ATOM   7012 C  CB    . ASP A 1 861 ? 26.195  -22.905 11.853 1.00 48.74  ? 861  ASP A CB    1 
ATOM   7013 C  CG    . ASP A 1 861 ? 26.584  -23.269 10.427 1.00 50.71  ? 861  ASP A CG    1 
ATOM   7014 O  OD1   . ASP A 1 861 ? 25.760  -23.036 9.517  1.00 53.59  ? 861  ASP A OD1   1 
ATOM   7015 O  OD2   . ASP A 1 861 ? 27.707  -23.776 10.212 1.00 49.02  ? 861  ASP A OD2   1 
ATOM   7016 N  N     . VAL A 1 862 ? 24.858  -23.471 14.682 1.00 46.12  ? 862  VAL A N     1 
ATOM   7017 C  CA    . VAL A 1 862 ? 24.552  -23.097 16.063 1.00 45.68  ? 862  VAL A CA    1 
ATOM   7018 C  C     . VAL A 1 862 ? 25.137  -24.133 17.018 1.00 47.04  ? 862  VAL A C     1 
ATOM   7019 O  O     . VAL A 1 862 ? 25.834  -23.778 17.973 1.00 48.37  ? 862  VAL A O     1 
ATOM   7020 C  CB    . VAL A 1 862 ? 23.034  -22.942 16.316 1.00 44.74  ? 862  VAL A CB    1 
ATOM   7021 C  CG1   . VAL A 1 862 ? 22.750  -22.731 17.809 1.00 43.17  ? 862  VAL A CG1   1 
ATOM   7022 C  CG2   . VAL A 1 862 ? 22.474  -21.787 15.510 1.00 43.42  ? 862  VAL A CG2   1 
ATOM   7023 N  N     . LEU A 1 863 ? 24.872  -25.408 16.741 1.00 46.02  ? 863  LEU A N     1 
ATOM   7024 C  CA    . LEU A 1 863 ? 25.390  -26.499 17.564 1.00 46.24  ? 863  LEU A CA    1 
ATOM   7025 C  C     . LEU A 1 863 ? 26.913  -26.534 17.611 1.00 46.70  ? 863  LEU A C     1 
ATOM   7026 O  O     . LEU A 1 863 ? 27.493  -26.813 18.657 1.00 47.95  ? 863  LEU A O     1 
ATOM   7027 C  CB    . LEU A 1 863 ? 24.848  -27.852 17.088 1.00 46.80  ? 863  LEU A CB    1 
ATOM   7028 C  CG    . LEU A 1 863 ? 23.366  -28.146 17.315 1.00 45.84  ? 863  LEU A CG    1 
ATOM   7029 C  CD1   . LEU A 1 863 ? 22.982  -29.473 16.659 1.00 47.85  ? 863  LEU A CD1   1 
ATOM   7030 C  CD2   . LEU A 1 863 ? 23.043  -28.157 18.803 1.00 47.06  ? 863  LEU A CD2   1 
ATOM   7031 N  N     . HIS A 1 864 ? 27.555  -26.241 16.485 1.00 46.42  ? 864  HIS A N     1 
ATOM   7032 C  CA    . HIS A 1 864 ? 29.012  -26.259 16.418 1.00 47.69  ? 864  HIS A CA    1 
ATOM   7033 C  C     . HIS A 1 864 ? 29.643  -25.057 17.133 1.00 45.58  ? 864  HIS A C     1 
ATOM   7034 O  O     . HIS A 1 864 ? 30.735  -25.176 17.692 1.00 44.40  ? 864  HIS A O     1 
ATOM   7035 C  CB    . HIS A 1 864 ? 29.505  -26.376 14.962 1.00 49.21  ? 864  HIS A CB    1 
ATOM   7036 C  CG    . HIS A 1 864 ? 30.987  -26.572 14.835 1.00 55.53  ? 864  HIS A CG    1 
ATOM   7037 N  ND1   . HIS A 1 864 ? 31.767  -25.833 13.970 1.00 59.30  ? 864  HIS A ND1   1 
ATOM   7038 C  CD2   . HIS A 1 864 ? 31.835  -27.412 15.477 1.00 59.30  ? 864  HIS A CD2   1 
ATOM   7039 C  CE1   . HIS A 1 864 ? 33.027  -26.214 14.078 1.00 60.09  ? 864  HIS A CE1   1 
ATOM   7040 N  NE2   . HIS A 1 864 ? 33.096  -27.170 14.986 1.00 60.61  ? 864  HIS A NE2   1 
ATOM   7041 N  N     . TRP A 1 865 ? 28.948  -23.919 17.141 1.00 44.53  ? 865  TRP A N     1 
ATOM   7042 C  CA    . TRP A 1 865 ? 29.496  -22.693 17.740 1.00 45.07  ? 865  TRP A CA    1 
ATOM   7043 C  C     . TRP A 1 865 ? 28.956  -22.266 19.132 1.00 45.12  ? 865  TRP A C     1 
ATOM   7044 O  O     . TRP A 1 865 ? 29.505  -21.345 19.751 1.00 45.05  ? 865  TRP A O     1 
ATOM   7045 C  CB    . TRP A 1 865 ? 29.438  -21.536 16.733 1.00 45.71  ? 865  TRP A CB    1 
ATOM   7046 C  CG    . TRP A 1 865 ? 30.420  -21.704 15.612 1.00 48.46  ? 865  TRP A CG    1 
ATOM   7047 C  CD1   . TRP A 1 865 ? 30.203  -22.334 14.419 1.00 50.26  ? 865  TRP A CD1   1 
ATOM   7048 C  CD2   . TRP A 1 865 ? 31.786  -21.264 15.590 1.00 50.05  ? 865  TRP A CD2   1 
ATOM   7049 N  NE1   . TRP A 1 865 ? 31.345  -22.301 13.648 1.00 51.57  ? 865  TRP A NE1   1 
ATOM   7050 C  CE2   . TRP A 1 865 ? 32.330  -21.651 14.343 1.00 51.53  ? 865  TRP A CE2   1 
ATOM   7051 C  CE3   . TRP A 1 865 ? 32.601  -20.574 16.499 1.00 51.85  ? 865  TRP A CE3   1 
ATOM   7052 C  CZ2   . TRP A 1 865 ? 33.651  -21.370 13.983 1.00 52.56  ? 865  TRP A CZ2   1 
ATOM   7053 C  CZ3   . TRP A 1 865 ? 33.915  -20.292 16.138 1.00 52.62  ? 865  TRP A CZ3   1 
ATOM   7054 C  CH2   . TRP A 1 865 ? 34.425  -20.691 14.890 1.00 54.06  ? 865  TRP A CH2   1 
ATOM   7055 N  N     . MET A 1 866 ? 27.904  -22.931 19.614 1.00 43.59  ? 866  MET A N     1 
ATOM   7056 C  CA    . MET A 1 866 ? 27.393  -22.744 20.984 1.00 42.74  ? 866  MET A CA    1 
ATOM   7057 C  C     . MET A 1 866 ? 28.525  -22.626 21.990 1.00 41.91  ? 866  MET A C     1 
ATOM   7058 O  O     . MET A 1 866 ? 29.420  -23.479 22.012 1.00 43.68  ? 866  MET A O     1 
ATOM   7059 C  CB    . MET A 1 866 ? 26.605  -23.976 21.420 1.00 43.06  ? 866  MET A CB    1 
ATOM   7060 C  CG    . MET A 1 866 ? 25.220  -24.128 20.898 1.00 42.05  ? 866  MET A CG    1 
ATOM   7061 S  SD    . MET A 1 866 ? 24.651  -25.729 21.474 1.00 43.93  ? 866  MET A SD    1 
ATOM   7062 C  CE    . MET A 1 866 ? 24.250  -25.350 23.184 1.00 40.97  ? 866  MET A CE    1 
ATOM   7063 N  N     . ASP A 1 867 ? 28.477  -21.617 22.851 1.00 40.39  ? 867  ASP A N     1 
ATOM   7064 C  CA    . ASP A 1 867 ? 29.495  -21.491 23.896 1.00 40.04  ? 867  ASP A CA    1 
ATOM   7065 C  C     . ASP A 1 867 ? 29.030  -22.125 25.216 1.00 40.56  ? 867  ASP A C     1 
ATOM   7066 O  O     . ASP A 1 867 ? 28.439  -21.457 26.081 1.00 41.74  ? 867  ASP A O     1 
ATOM   7067 C  CB    . ASP A 1 867 ? 29.906  -20.028 24.083 1.00 39.24  ? 867  ASP A CB    1 
ATOM   7068 C  CG    . ASP A 1 867 ? 31.203  -19.876 24.860 1.00 42.05  ? 867  ASP A CG    1 
ATOM   7069 O  OD1   . ASP A 1 867 ? 31.533  -20.766 25.674 1.00 38.59  ? 867  ASP A OD1   1 
ATOM   7070 O  OD2   . ASP A 1 867 ? 31.898  -18.852 24.664 1.00 45.63  ? 867  ASP A OD2   1 
ATOM   7071 N  N     . TYR A 1 868 ? 29.311  -23.418 25.364 1.00 39.41  ? 868  TYR A N     1 
ATOM   7072 C  CA    . TYR A 1 868 ? 28.921  -24.169 26.557 1.00 39.15  ? 868  TYR A CA    1 
ATOM   7073 C  C     . TYR A 1 868 ? 29.537  -23.593 27.828 1.00 40.35  ? 868  TYR A C     1 
ATOM   7074 O  O     . TYR A 1 868 ? 28.887  -23.566 28.877 1.00 42.49  ? 868  TYR A O     1 
ATOM   7075 C  CB    . TYR A 1 868 ? 29.313  -25.644 26.435 1.00 39.82  ? 868  TYR A CB    1 
ATOM   7076 C  CG    . TYR A 1 868 ? 28.506  -26.463 25.445 1.00 38.01  ? 868  TYR A CG    1 
ATOM   7077 C  CD1   . TYR A 1 868 ? 27.357  -27.149 25.847 1.00 37.52  ? 868  TYR A CD1   1 
ATOM   7078 C  CD2   . TYR A 1 868 ? 28.906  -26.575 24.119 1.00 38.16  ? 868  TYR A CD2   1 
ATOM   7079 C  CE1   . TYR A 1 868 ? 26.619  -27.910 24.952 1.00 33.57  ? 868  TYR A CE1   1 
ATOM   7080 C  CE2   . TYR A 1 868 ? 28.177  -27.341 23.211 1.00 38.11  ? 868  TYR A CE2   1 
ATOM   7081 C  CZ    . TYR A 1 868 ? 27.034  -28.004 23.638 1.00 36.90  ? 868  TYR A CZ    1 
ATOM   7082 O  OH    . TYR A 1 868 ? 26.318  -28.758 22.747 1.00 32.78  ? 868  TYR A OH    1 
ATOM   7083 N  N     . THR A 1 869 ? 30.783  -23.132 27.739 1.00 39.96  ? 869  THR A N     1 
ATOM   7084 C  CA    . THR A 1 869 ? 31.500  -22.634 28.917 1.00 38.96  ? 869  THR A CA    1 
ATOM   7085 C  C     . THR A 1 869 ? 30.791  -21.415 29.487 1.00 39.52  ? 869  THR A C     1 
ATOM   7086 O  O     . THR A 1 869 ? 30.567  -21.326 30.699 1.00 40.81  ? 869  THR A O     1 
ATOM   7087 C  CB    . THR A 1 869 ? 32.978  -22.297 28.600 1.00 38.66  ? 869  THR A CB    1 
ATOM   7088 O  OG1   . THR A 1 869 ? 33.603  -23.436 27.993 1.00 39.37  ? 869  THR A OG1   1 
ATOM   7089 C  CG2   . THR A 1 869 ? 33.744  -21.910 29.872 1.00 33.73  ? 869  THR A CG2   1 
ATOM   7090 N  N     . VAL A 1 870 ? 30.425  -20.494 28.604 1.00 38.64  ? 870  VAL A N     1 
ATOM   7091 C  CA    . VAL A 1 870 ? 29.696  -19.295 29.000 1.00 40.12  ? 870  VAL A CA    1 
ATOM   7092 C  C     . VAL A 1 870 ? 28.284  -19.640 29.476 1.00 38.80  ? 870  VAL A C     1 
ATOM   7093 O  O     . VAL A 1 870 ? 27.812  -19.080 30.461 1.00 37.45  ? 870  VAL A O     1 
ATOM   7094 C  CB    . VAL A 1 870 ? 29.683  -18.224 27.868 1.00 42.22  ? 870  VAL A CB    1 
ATOM   7095 C  CG1   . VAL A 1 870 ? 28.655  -17.139 28.144 1.00 40.65  ? 870  VAL A CG1   1 
ATOM   7096 C  CG2   . VAL A 1 870 ? 31.072  -17.600 27.708 1.00 40.59  ? 870  VAL A CG2   1 
ATOM   7097 N  N     . LEU A 1 871 ? 27.623  -20.571 28.790 1.00 38.48  ? 871  LEU A N     1 
ATOM   7098 C  CA    . LEU A 1 871 ? 26.302  -21.020 29.209 1.00 37.25  ? 871  LEU A CA    1 
ATOM   7099 C  C     . LEU A 1 871 ? 26.297  -21.537 30.630 1.00 37.30  ? 871  LEU A C     1 
ATOM   7100 O  O     . LEU A 1 871 ? 25.481  -21.111 31.451 1.00 38.74  ? 871  LEU A O     1 
ATOM   7101 C  CB    . LEU A 1 871 ? 25.777  -22.119 28.294 1.00 39.52  ? 871  LEU A CB    1 
ATOM   7102 C  CG    . LEU A 1 871 ? 24.640  -21.786 27.342 1.00 41.34  ? 871  LEU A CG    1 
ATOM   7103 C  CD1   . LEU A 1 871 ? 24.164  -23.073 26.722 1.00 42.84  ? 871  LEU A CD1   1 
ATOM   7104 C  CD2   . LEU A 1 871 ? 23.489  -21.057 28.041 1.00 42.49  ? 871  LEU A CD2   1 
ATOM   7105 N  N     . LEU A 1 872 ? 27.214  -22.454 30.915 1.00 37.84  ? 872  LEU A N     1 
ATOM   7106 C  CA    . LEU A 1 872 ? 27.272  -23.109 32.222 1.00 36.08  ? 872  LEU A CA    1 
ATOM   7107 C  C     . LEU A 1 872 ? 27.591  -22.114 33.324 1.00 36.33  ? 872  LEU A C     1 
ATOM   7108 O  O     . LEU A 1 872 ? 27.001  -22.185 34.409 1.00 36.28  ? 872  LEU A O     1 
ATOM   7109 C  CB    . LEU A 1 872 ? 28.286  -24.261 32.223 1.00 36.27  ? 872  LEU A CB    1 
ATOM   7110 C  CG    . LEU A 1 872 ? 28.459  -25.026 33.547 1.00 37.68  ? 872  LEU A CG    1 
ATOM   7111 C  CD1   . LEU A 1 872 ? 27.246  -25.894 33.829 1.00 34.92  ? 872  LEU A CD1   1 
ATOM   7112 C  CD2   . LEU A 1 872 ? 29.745  -25.853 33.587 1.00 34.21  ? 872  LEU A CD2   1 
ATOM   7113 N  N     . GLU A 1 873 ? 28.510  -21.188 33.035 1.00 36.87  ? 873  GLU A N     1 
ATOM   7114 C  CA    . GLU A 1 873 ? 28.927  -20.166 33.999 1.00 40.44  ? 873  GLU A CA    1 
ATOM   7115 C  C     . GLU A 1 873 ? 27.815  -19.149 34.289 1.00 40.67  ? 873  GLU A C     1 
ATOM   7116 O  O     . GLU A 1 873 ? 27.553  -18.818 35.452 1.00 40.76  ? 873  GLU A O     1 
ATOM   7117 C  CB    . GLU A 1 873 ? 30.212  -19.466 33.537 1.00 41.49  ? 873  GLU A CB    1 
ATOM   7118 C  CG    . GLU A 1 873 ? 30.599  -18.211 34.342 1.00 50.23  ? 873  GLU A CG    1 
ATOM   7119 C  CD    . GLU A 1 873 ? 30.869  -18.484 35.831 1.00 59.39  ? 873  GLU A CD    1 
ATOM   7120 O  OE1   . GLU A 1 873 ? 31.536  -19.498 36.157 1.00 60.95  ? 873  GLU A OE1   1 
ATOM   7121 O  OE2   . GLU A 1 873 ? 30.424  -17.668 36.676 1.00 61.06  ? 873  GLU A OE2   1 
ATOM   7122 N  N     . LYS A 1 874 ? 27.169  -18.667 33.227 1.00 40.24  ? 874  LYS A N     1 
ATOM   7123 C  CA    . LYS A 1 874 ? 26.077  -17.695 33.337 1.00 39.98  ? 874  LYS A CA    1 
ATOM   7124 C  C     . LYS A 1 874 ? 24.797  -18.251 33.964 1.00 37.87  ? 874  LYS A C     1 
ATOM   7125 O  O     . LYS A 1 874 ? 24.195  -17.600 34.812 1.00 38.73  ? 874  LYS A O     1 
ATOM   7126 C  CB    . LYS A 1 874 ? 25.765  -17.075 31.969 1.00 41.02  ? 874  LYS A CB    1 
ATOM   7127 C  CG    . LYS A 1 874 ? 26.197  -15.615 31.850 1.00 50.93  ? 874  LYS A CG    1 
ATOM   7128 C  CD    . LYS A 1 874 ? 26.725  -15.221 30.451 1.00 57.14  ? 874  LYS A CD    1 
ATOM   7129 C  CE    . LYS A 1 874 ? 25.667  -15.308 29.335 1.00 60.17  ? 874  LYS A CE    1 
ATOM   7130 N  NZ    . LYS A 1 874 ? 26.049  -14.497 28.129 1.00 57.85  ? 874  LYS A NZ    1 
ATOM   7131 N  N     . THR A 1 875 ? 24.375  -19.444 33.552 1.00 35.04  ? 875  THR A N     1 
ATOM   7132 C  CA    . THR A 1 875 ? 23.050  -19.923 33.951 1.00 31.90  ? 875  THR A CA    1 
ATOM   7133 C  C     . THR A 1 875 ? 23.068  -20.839 35.154 1.00 31.68  ? 875  THR A C     1 
ATOM   7134 O  O     . THR A 1 875 ? 22.109  -20.876 35.910 1.00 32.98  ? 875  THR A O     1 
ATOM   7135 C  CB    . THR A 1 875 ? 22.301  -20.616 32.805 1.00 31.16  ? 875  THR A CB    1 
ATOM   7136 O  OG1   . THR A 1 875 ? 23.061  -21.740 32.335 1.00 32.39  ? 875  THR A OG1   1 
ATOM   7137 C  CG2   . THR A 1 875 ? 22.058  -19.644 31.666 1.00 28.88  ? 875  THR A CG2   1 
ATOM   7138 N  N     . PHE A 1 876 ? 24.160  -21.563 35.350 1.00 31.74  ? 876  PHE A N     1 
ATOM   7139 C  CA    . PHE A 1 876 ? 24.211  -22.526 36.441 1.00 31.23  ? 876  PHE A CA    1 
ATOM   7140 C  C     . PHE A 1 876 ? 25.144  -22.094 37.584 1.00 32.15  ? 876  PHE A C     1 
ATOM   7141 O  O     . PHE A 1 876 ? 24.707  -21.947 38.726 1.00 31.54  ? 876  PHE A O     1 
ATOM   7142 C  CB    . PHE A 1 876 ? 24.568  -23.914 35.894 1.00 28.48  ? 876  PHE A CB    1 
ATOM   7143 C  CG    . PHE A 1 876 ? 24.641  -24.991 36.944 1.00 28.56  ? 876  PHE A CG    1 
ATOM   7144 C  CD1   . PHE A 1 876 ? 23.495  -25.433 37.591 1.00 28.20  ? 876  PHE A CD1   1 
ATOM   7145 C  CD2   . PHE A 1 876 ? 25.857  -25.591 37.253 1.00 29.95  ? 876  PHE A CD2   1 
ATOM   7146 C  CE1   . PHE A 1 876 ? 23.555  -26.430 38.554 1.00 29.47  ? 876  PHE A CE1   1 
ATOM   7147 C  CE2   . PHE A 1 876 ? 25.932  -26.604 38.206 1.00 31.31  ? 876  PHE A CE2   1 
ATOM   7148 C  CZ    . PHE A 1 876 ? 24.781  -27.025 38.860 1.00 29.24  ? 876  PHE A CZ    1 
ATOM   7149 N  N     . ILE A 1 877 ? 26.416  -21.869 37.271 1.00 32.81  ? 877  ILE A N     1 
ATOM   7150 C  CA    . ILE A 1 877 ? 27.421  -21.593 38.296 1.00 33.29  ? 877  ILE A CA    1 
ATOM   7151 C  C     . ILE A 1 877 ? 27.163  -20.292 39.067 1.00 35.43  ? 877  ILE A C     1 
ATOM   7152 O  O     . ILE A 1 877 ? 27.131  -20.283 40.299 1.00 37.65  ? 877  ILE A O     1 
ATOM   7153 C  CB    . ILE A 1 877 ? 28.845  -21.637 37.701 1.00 33.47  ? 877  ILE A CB    1 
ATOM   7154 C  CG1   . ILE A 1 877 ? 29.209  -23.087 37.346 1.00 31.85  ? 877  ILE A CG1   1 
ATOM   7155 C  CG2   . ILE A 1 877 ? 29.875  -21.014 38.680 1.00 34.38  ? 877  ILE A CG2   1 
ATOM   7156 C  CD1   . ILE A 1 877 ? 30.505  -23.247 36.547 1.00 35.20  ? 877  ILE A CD1   1 
ATOM   7157 N  N     . LYS A 1 878 ? 26.957  -19.203 38.341 1.00 36.86  ? 878  LYS A N     1 
ATOM   7158 C  CA    . LYS A 1 878 ? 26.740  -17.914 38.970 1.00 38.82  ? 878  LYS A CA    1 
ATOM   7159 C  C     . LYS A 1 878 ? 25.548  -17.951 39.947 1.00 38.21  ? 878  LYS A C     1 
ATOM   7160 O  O     . LYS A 1 878 ? 25.708  -17.561 41.105 1.00 39.35  ? 878  LYS A O     1 
ATOM   7161 C  CB    . LYS A 1 878 ? 26.611  -16.810 37.912 1.00 40.70  ? 878  LYS A CB    1 
ATOM   7162 C  CG    . LYS A 1 878 ? 27.120  -15.453 38.365 1.00 47.62  ? 878  LYS A CG    1 
ATOM   7163 C  CD    . LYS A 1 878 ? 27.377  -14.532 37.173 1.00 51.86  ? 878  LYS A CD    1 
ATOM   7164 C  CE    . LYS A 1 878 ? 27.447  -13.071 37.615 1.00 57.01  ? 878  LYS A CE    1 
ATOM   7165 N  NZ    . LYS A 1 878 ? 27.897  -12.160 36.515 1.00 58.17  ? 878  LYS A NZ    1 
ATOM   7166 N  N     . PRO A 1 879 ? 24.362  -18.434 39.499 1.00 37.34  ? 879  PRO A N     1 
ATOM   7167 C  CA    . PRO A 1 879 ? 23.239  -18.617 40.438 1.00 37.10  ? 879  PRO A CA    1 
ATOM   7168 C  C     . PRO A 1 879 ? 23.569  -19.508 41.637 1.00 36.26  ? 879  PRO A C     1 
ATOM   7169 O  O     . PRO A 1 879 ? 23.263  -19.148 42.773 1.00 35.47  ? 879  PRO A O     1 
ATOM   7170 C  CB    . PRO A 1 879 ? 22.163  -19.279 39.570 1.00 37.65  ? 879  PRO A CB    1 
ATOM   7171 C  CG    . PRO A 1 879 ? 22.432  -18.759 38.211 1.00 38.29  ? 879  PRO A CG    1 
ATOM   7172 C  CD    . PRO A 1 879 ? 23.935  -18.675 38.105 1.00 36.90  ? 879  PRO A CD    1 
ATOM   7173 N  N     . LEU A 1 880 ? 24.204  -20.652 41.384 1.00 36.81  ? 880  LEU A N     1 
ATOM   7174 C  CA    . LEU A 1 880 ? 24.560  -21.580 42.452 1.00 36.28  ? 880  LEU A CA    1 
ATOM   7175 C  C     . LEU A 1 880 ? 25.555  -20.978 43.468 1.00 38.16  ? 880  LEU A C     1 
ATOM   7176 O  O     . LEU A 1 880 ? 25.457  -21.249 44.677 1.00 38.81  ? 880  LEU A O     1 
ATOM   7177 C  CB    . LEU A 1 880 ? 25.072  -22.897 41.857 1.00 35.89  ? 880  LEU A CB    1 
ATOM   7178 C  CG    . LEU A 1 880 ? 25.390  -24.065 42.795 1.00 36.83  ? 880  LEU A CG    1 
ATOM   7179 C  CD1   . LEU A 1 880 ? 24.171  -24.497 43.615 1.00 37.59  ? 880  LEU A CD1   1 
ATOM   7180 C  CD2   . LEU A 1 880 ? 25.932  -25.216 41.994 1.00 36.04  ? 880  LEU A CD2   1 
ATOM   7181 N  N     . GLU A 1 881 ? 26.483  -20.156 42.972 1.00 37.82  ? 881  GLU A N     1 
ATOM   7182 C  CA    . GLU A 1 881 ? 27.415  -19.387 43.808 1.00 40.39  ? 881  GLU A CA    1 
ATOM   7183 C  C     . GLU A 1 881 ? 26.649  -18.490 44.775 1.00 40.32  ? 881  GLU A C     1 
ATOM   7184 O  O     . GLU A 1 881 ? 27.011  -18.366 45.953 1.00 39.97  ? 881  GLU A O     1 
ATOM   7185 C  CB    . GLU A 1 881 ? 28.316  -18.503 42.929 1.00 42.42  ? 881  GLU A CB    1 
ATOM   7186 C  CG    . GLU A 1 881 ? 29.785  -18.450 43.349 1.00 49.42  ? 881  GLU A CG    1 
ATOM   7187 C  CD    . GLU A 1 881 ? 30.044  -17.631 44.609 1.00 55.09  ? 881  GLU A CD    1 
ATOM   7188 O  OE1   . GLU A 1 881 ? 30.789  -18.131 45.486 1.00 59.44  ? 881  GLU A OE1   1 
ATOM   7189 O  OE2   . GLU A 1 881 ? 29.522  -16.496 44.723 1.00 54.53  ? 881  GLU A OE2   1 
ATOM   7190 N  N     . GLY A 1 882 ? 25.600  -17.852 44.258 1.00 38.69  ? 882  GLY A N     1 
ATOM   7191 C  CA    . GLY A 1 882 ? 24.726  -17.016 45.065 1.00 37.79  ? 882  GLY A CA    1 
ATOM   7192 C  C     . GLY A 1 882 ? 24.070  -17.836 46.159 1.00 38.47  ? 882  GLY A C     1 
ATOM   7193 O  O     . GLY A 1 882 ? 24.106  -17.438 47.324 1.00 40.87  ? 882  GLY A O     1 
ATOM   7194 N  N     . PHE A 1 883 ? 23.495  -18.989 45.793 1.00 37.08  ? 883  PHE A N     1 
ATOM   7195 C  CA    . PHE A 1 883 ? 22.795  -19.847 46.765 1.00 37.09  ? 883  PHE A CA    1 
ATOM   7196 C  C     . PHE A 1 883 ? 23.742  -20.305 47.867 1.00 37.33  ? 883  PHE A C     1 
ATOM   7197 O  O     . PHE A 1 883 ? 23.429  -20.190 49.053 1.00 39.67  ? 883  PHE A O     1 
ATOM   7198 C  CB    . PHE A 1 883 ? 22.167  -21.114 46.139 1.00 35.74  ? 883  PHE A CB    1 
ATOM   7199 C  CG    . PHE A 1 883 ? 21.259  -20.871 44.958 1.00 34.01  ? 883  PHE A CG    1 
ATOM   7200 C  CD1   . PHE A 1 883 ? 20.732  -19.616 44.676 1.00 33.95  ? 883  PHE A CD1   1 
ATOM   7201 C  CD2   . PHE A 1 883 ? 20.903  -21.935 44.140 1.00 32.48  ? 883  PHE A CD2   1 
ATOM   7202 C  CE1   . PHE A 1 883 ? 19.895  -19.424 43.576 1.00 33.42  ? 883  PHE A CE1   1 
ATOM   7203 C  CE2   . PHE A 1 883 ? 20.058  -21.753 43.050 1.00 33.67  ? 883  PHE A CE2   1 
ATOM   7204 C  CZ    . PHE A 1 883 ? 19.556  -20.494 42.767 1.00 31.44  ? 883  PHE A CZ    1 
ATOM   7205 N  N     . THR A 1 884 ? 24.896  -20.830 47.468 1.00 36.31  ? 884  THR A N     1 
ATOM   7206 C  CA    . THR A 1 884 ? 25.796  -21.510 48.407 1.00 35.28  ? 884  THR A CA    1 
ATOM   7207 C  C     . THR A 1 884 ? 26.565  -20.558 49.323 1.00 36.12  ? 884  THR A C     1 
ATOM   7208 O  O     . THR A 1 884 ? 26.769  -20.864 50.500 1.00 36.96  ? 884  THR A O     1 
ATOM   7209 C  CB    . THR A 1 884 ? 26.764  -22.481 47.688 1.00 34.81  ? 884  THR A CB    1 
ATOM   7210 O  OG1   . THR A 1 884 ? 27.537  -21.771 46.714 1.00 33.58  ? 884  THR A OG1   1 
ATOM   7211 C  CG2   . THR A 1 884 ? 25.988  -23.595 47.003 1.00 31.07  ? 884  THR A CG2   1 
ATOM   7212 N  N     . SER A 1 885 ? 26.961  -19.399 48.801 1.00 35.91  ? 885  SER A N     1 
ATOM   7213 C  CA    . SER A 1 885 ? 27.668  -18.409 49.616 1.00 37.83  ? 885  SER A CA    1 
ATOM   7214 C  C     . SER A 1 885 ? 26.746  -17.791 50.673 1.00 37.83  ? 885  SER A C     1 
ATOM   7215 O  O     . SER A 1 885 ? 27.190  -17.419 51.762 1.00 38.27  ? 885  SER A O     1 
ATOM   7216 C  CB    . SER A 1 885 ? 28.296  -17.323 48.740 1.00 37.90  ? 885  SER A CB    1 
ATOM   7217 O  OG    . SER A 1 885 ? 27.302  -16.509 48.153 1.00 41.93  ? 885  SER A OG    1 
ATOM   7218 N  N     . ALA A 1 886 ? 25.466  -17.678 50.335 1.00 37.64  ? 886  ALA A N     1 
ATOM   7219 C  CA    . ALA A 1 886 ? 24.453  -17.233 51.279 1.00 36.94  ? 886  ALA A CA    1 
ATOM   7220 C  C     . ALA A 1 886 ? 24.277  -18.271 52.386 1.00 36.80  ? 886  ALA A C     1 
ATOM   7221 O  O     . ALA A 1 886 ? 24.198  -17.924 53.562 1.00 36.19  ? 886  ALA A O     1 
ATOM   7222 C  CB    . ALA A 1 886 ? 23.133  -16.988 50.559 1.00 36.93  ? 886  ALA A CB    1 
ATOM   7223 N  N     . ALA A 1 887 ? 24.239  -19.543 51.992 1.00 37.53  ? 887  ALA A N     1 
ATOM   7224 C  CA    . ALA A 1 887 ? 24.034  -20.667 52.916 1.00 37.79  ? 887  ALA A CA    1 
ATOM   7225 C  C     . ALA A 1 887 ? 25.300  -21.139 53.641 1.00 37.35  ? 887  ALA A C     1 
ATOM   7226 O  O     . ALA A 1 887 ? 25.257  -22.143 54.354 1.00 36.06  ? 887  ALA A O     1 
ATOM   7227 C  CB    . ALA A 1 887 ? 23.397  -21.839 52.172 1.00 35.31  ? 887  ALA A CB    1 
ATOM   7228 N  N     . LYS A 1 888 ? 26.410  -20.417 53.458 1.00 39.65  ? 888  LYS A N     1 
ATOM   7229 C  CA    . LYS A 1 888 ? 27.722  -20.786 54.027 1.00 42.67  ? 888  LYS A CA    1 
ATOM   7230 C  C     . LYS A 1 888 ? 28.148  -22.201 53.610 1.00 43.70  ? 888  LYS A C     1 
ATOM   7231 O  O     . LYS A 1 888 ? 28.606  -22.999 54.431 1.00 43.11  ? 888  LYS A O     1 
ATOM   7232 C  CB    . LYS A 1 888 ? 27.738  -20.635 55.564 1.00 42.84  ? 888  LYS A CB    1 
ATOM   7233 C  CG    . LYS A 1 888 ? 27.250  -19.292 56.084 1.00 45.68  ? 888  LYS A CG    1 
ATOM   7234 C  CD    . LYS A 1 888 ? 28.146  -18.137 55.649 1.00 52.61  ? 888  LYS A CD    1 
ATOM   7235 C  CE    . LYS A 1 888 ? 27.506  -16.783 55.965 1.00 55.50  ? 888  LYS A CE    1 
ATOM   7236 N  NZ    . LYS A 1 888 ? 28.457  -15.653 55.753 1.00 56.37  ? 888  LYS A NZ    1 
ATOM   7237 N  N     . LEU A 1 889 ? 27.967  -22.497 52.325 1.00 44.48  ? 889  LEU A N     1 
ATOM   7238 C  CA    . LEU A 1 889 ? 28.315  -23.788 51.740 1.00 45.87  ? 889  LEU A CA    1 
ATOM   7239 C  C     . LEU A 1 889 ? 29.206  -23.567 50.527 1.00 45.39  ? 889  LEU A C     1 
ATOM   7240 O  O     . LEU A 1 889 ? 29.240  -22.474 49.958 1.00 44.36  ? 889  LEU A O     1 
ATOM   7241 C  CB    . LEU A 1 889 ? 27.043  -24.527 51.296 1.00 48.41  ? 889  LEU A CB    1 
ATOM   7242 C  CG    . LEU A 1 889 ? 26.346  -25.584 52.168 1.00 50.76  ? 889  LEU A CG    1 
ATOM   7243 C  CD1   . LEU A 1 889 ? 26.164  -25.155 53.610 1.00 53.84  ? 889  LEU A CD1   1 
ATOM   7244 C  CD2   . LEU A 1 889 ? 24.999  -25.951 51.567 1.00 51.09  ? 889  LEU A CD2   1 
ATOM   7245 N  N     . ASP A 1 890 ? 29.928  -24.608 50.134 1.00 45.03  ? 890  ASP A N     1 
ATOM   7246 C  CA    . ASP A 1 890 ? 30.678  -24.585 48.888 1.00 45.05  ? 890  ASP A CA    1 
ATOM   7247 C  C     . ASP A 1 890 ? 30.180  -25.712 48.005 1.00 44.41  ? 890  ASP A C     1 
ATOM   7248 O  O     . ASP A 1 890 ? 29.841  -26.788 48.498 1.00 44.42  ? 890  ASP A O     1 
ATOM   7249 C  CB    . ASP A 1 890 ? 32.180  -24.716 49.153 1.00 46.79  ? 890  ASP A CB    1 
ATOM   7250 C  CG    . ASP A 1 890 ? 32.773  -23.463 49.782 1.00 49.17  ? 890  ASP A CG    1 
ATOM   7251 O  OD1   . ASP A 1 890 ? 32.726  -22.389 49.136 1.00 49.95  ? 890  ASP A OD1   1 
ATOM   7252 O  OD2   . ASP A 1 890 ? 33.293  -23.555 50.918 1.00 50.72  ? 890  ASP A OD2   1 
ATOM   7253 N  N     . TYR A 1 891 ? 30.105  -25.452 46.705 1.00 44.53  ? 891  TYR A N     1 
ATOM   7254 C  CA    . TYR A 1 891 ? 29.612  -26.447 45.758 1.00 44.00  ? 891  TYR A CA    1 
ATOM   7255 C  C     . TYR A 1 891 ? 30.745  -27.341 45.230 1.00 45.51  ? 891  TYR A C     1 
ATOM   7256 O  O     . TYR A 1 891 ? 30.491  -28.415 44.689 1.00 46.02  ? 891  TYR A O     1 
ATOM   7257 C  CB    . TYR A 1 891 ? 28.808  -25.790 44.621 1.00 40.13  ? 891  TYR A CB    1 
ATOM   7258 C  CG    . TYR A 1 891 ? 29.565  -24.734 43.860 1.00 38.04  ? 891  TYR A CG    1 
ATOM   7259 C  CD1   . TYR A 1 891 ? 29.481  -23.392 44.224 1.00 35.09  ? 891  TYR A CD1   1 
ATOM   7260 C  CD2   . TYR A 1 891 ? 30.365  -25.076 42.771 1.00 36.62  ? 891  TYR A CD2   1 
ATOM   7261 C  CE1   . TYR A 1 891 ? 30.187  -22.415 43.532 1.00 37.63  ? 891  TYR A CE1   1 
ATOM   7262 C  CE2   . TYR A 1 891 ? 31.074  -24.106 42.067 1.00 39.02  ? 891  TYR A CE2   1 
ATOM   7263 C  CZ    . TYR A 1 891 ? 30.987  -22.776 42.453 1.00 39.61  ? 891  TYR A CZ    1 
ATOM   7264 O  OH    . TYR A 1 891 ? 31.691  -21.814 41.752 1.00 38.99  ? 891  TYR A OH    1 
ATOM   7265 N  N     . GLU A 1 892 ? 31.985  -26.878 45.386 1.00 48.17  ? 892  GLU A N     1 
ATOM   7266 C  CA    . GLU A 1 892 ? 33.179  -27.715 45.200 1.00 51.63  ? 892  GLU A CA    1 
ATOM   7267 C  C     . GLU A 1 892 ? 34.130  -27.521 46.389 1.00 52.37  ? 892  GLU A C     1 
ATOM   7268 O  O     . GLU A 1 892 ? 34.181  -26.428 46.959 1.00 53.38  ? 892  GLU A O     1 
ATOM   7269 C  CB    . GLU A 1 892 ? 33.877  -27.414 43.866 1.00 52.07  ? 892  GLU A CB    1 
ATOM   7270 C  CG    . GLU A 1 892 ? 34.344  -25.968 43.681 1.00 54.83  ? 892  GLU A CG    1 
ATOM   7271 C  CD    . GLU A 1 892 ? 34.811  -25.653 42.260 1.00 57.46  ? 892  GLU A CD    1 
ATOM   7272 O  OE1   . GLU A 1 892 ? 35.058  -26.592 41.469 1.00 57.04  ? 892  GLU A OE1   1 
ATOM   7273 O  OE2   . GLU A 1 892 ? 34.937  -24.451 41.937 1.00 58.12  ? 892  GLU A OE2   1 
ATOM   7274 N  N     . LYS A 1 893 ? 34.864  -28.575 46.762 1.00 53.65  ? 893  LYS A N     1 
ATOM   7275 C  CA    . LYS A 1 893 ? 35.775  -28.549 47.928 1.00 55.00  ? 893  LYS A CA    1 
ATOM   7276 C  C     . LYS A 1 893 ? 36.817  -27.432 47.857 1.00 53.75  ? 893  LYS A C     1 
ATOM   7277 O  O     . LYS A 1 893 ? 37.399  -27.188 46.803 1.00 51.45  ? 893  LYS A O     1 
ATOM   7278 C  CB    . LYS A 1 893 ? 36.483  -29.898 48.092 1.00 56.72  ? 893  LYS A CB    1 
ATOM   7279 C  CG    . LYS A 1 893 ? 36.625  -30.384 49.547 1.00 62.88  ? 893  LYS A CG    1 
ATOM   7280 C  CD    . LYS A 1 893 ? 37.779  -29.719 50.330 1.00 67.31  ? 893  LYS A CD    1 
ATOM   7281 C  CE    . LYS A 1 893 ? 39.101  -30.490 50.218 1.00 68.29  ? 893  LYS A CE    1 
ATOM   7282 N  NZ    . LYS A 1 893 ? 39.839  -30.235 48.944 1.00 67.92  ? 893  LYS A NZ    1 
ATOM   7283 N  N     . LYS A 1 894 ? 37.047  -26.771 48.992 1.00 56.47  ? 894  LYS A N     1 
ATOM   7284 C  CA    . LYS A 1 894 ? 37.963  -25.623 49.073 1.00 58.82  ? 894  LYS A CA    1 
ATOM   7285 C  C     . LYS A 1 894 ? 39.440  -25.983 49.297 1.00 59.53  ? 894  LYS A C     1 
ATOM   7286 O  O     . LYS A 1 894 ? 39.969  -26.867 48.625 1.00 58.45  ? 894  LYS A O     1 
ATOM   7287 C  CB    . LYS A 1 894 ? 37.489  -24.615 50.133 1.00 59.27  ? 894  LYS A CB    1 
ATOM   7288 C  CG    . LYS A 1 894 ? 36.339  -23.697 49.714 1.00 62.20  ? 894  LYS A CG    1 
ATOM   7289 C  CD    . LYS A 1 894 ? 36.636  -22.858 48.460 1.00 63.84  ? 894  LYS A CD    1 
ATOM   7290 C  CE    . LYS A 1 894 ? 35.884  -23.394 47.231 1.00 63.28  ? 894  LYS A CE    1 
ATOM   7291 N  NZ    . LYS A 1 894 ? 35.857  -22.421 46.096 1.00 62.68  ? 894  LYS A NZ    1 
ATOM   7292 N  N     . ALA A 1 895 ? 40.071  -25.298 50.259 1.00 61.96  ? 895  ALA A N     1 
ATOM   7293 C  CA    . ALA A 1 895 ? 41.536  -25.250 50.453 1.00 62.22  ? 895  ALA A CA    1 
ATOM   7294 C  C     . ALA A 1 895 ? 42.315  -26.523 50.051 1.00 62.81  ? 895  ALA A C     1 
ATOM   7295 O  O     . ALA A 1 895 ? 42.586  -26.677 48.862 1.00 63.11  ? 895  ALA A O     1 
ATOM   7296 C  CB    . ALA A 1 895 ? 41.889  -24.746 51.865 1.00 62.79  ? 895  ALA A CB    1 
ATOM   7297 N  N     . SER A 1 896 ? 42.732  -27.407 50.966 1.00 62.95  ? 896  SER A N     1 
ATOM   7298 C  CA    . SER A 1 896 ? 42.890  -27.192 52.409 1.00 62.97  ? 896  SER A CA    1 
ATOM   7299 C  C     . SER A 1 896 ? 44.233  -27.821 52.778 1.00 63.42  ? 896  SER A C     1 
ATOM   7300 O  O     . SER A 1 896 ? 44.920  -28.368 51.911 1.00 62.33  ? 896  SER A O     1 
ATOM   7301 C  CB    . SER A 1 896 ? 41.754  -27.849 53.207 1.00 62.18  ? 896  SER A CB    1 
ATOM   7302 O  OG    . SER A 1 896 ? 41.837  -29.265 53.184 1.00 61.31  ? 896  SER A OG    1 
ATOM   7303 N  N     . LEU A 1 897 ? 44.608  -27.753 54.054 1.00 64.77  ? 897  LEU A N     1 
ATOM   7304 C  CA    . LEU A 1 897 ? 45.833  -28.407 54.526 1.00 65.57  ? 897  LEU A CA    1 
ATOM   7305 C  C     . LEU A 1 897 ? 45.780  -29.929 54.360 1.00 65.98  ? 897  LEU A C     1 
ATOM   7306 O  O     . LEU A 1 897 ? 46.815  -30.574 54.181 1.00 64.61  ? 897  LEU A O     1 
ATOM   7307 C  CB    . LEU A 1 897 ? 46.129  -28.038 55.986 1.00 66.51  ? 897  LEU A CB    1 
ATOM   7308 C  CG    . LEU A 1 897 ? 46.496  -26.582 56.301 1.00 67.69  ? 897  LEU A CG    1 
ATOM   7309 C  CD1   . LEU A 1 897 ? 46.477  -26.329 57.805 1.00 66.91  ? 897  LEU A CD1   1 
ATOM   7310 C  CD2   . LEU A 1 897 ? 47.850  -26.201 55.703 1.00 67.66  ? 897  LEU A CD2   1 
ATOM   7311 N  N     . PHE A 1 898 ? 44.570  -30.487 54.408 1.00 67.60  ? 898  PHE A N     1 
ATOM   7312 C  CA    . PHE A 1 898 ? 44.349  -31.928 54.247 1.00 69.53  ? 898  PHE A CA    1 
ATOM   7313 C  C     . PHE A 1 898 ? 44.712  -32.432 52.859 1.00 70.68  ? 898  PHE A C     1 
ATOM   7314 O  O     . PHE A 1 898 ? 45.112  -33.585 52.704 1.00 69.56  ? 898  PHE A O     1 
ATOM   7315 C  CB    . PHE A 1 898 ? 42.890  -32.293 54.530 1.00 69.77  ? 898  PHE A CB    1 
ATOM   7316 C  CG    . PHE A 1 898 ? 42.445  -31.978 55.920 1.00 71.10  ? 898  PHE A CG    1 
ATOM   7317 C  CD1   . PHE A 1 898 ? 42.778  -32.819 56.976 1.00 71.25  ? 898  PHE A CD1   1 
ATOM   7318 C  CD2   . PHE A 1 898 ? 41.681  -30.843 56.175 1.00 73.05  ? 898  PHE A CD2   1 
ATOM   7319 C  CE1   . PHE A 1 898 ? 42.364  -32.533 58.267 1.00 72.43  ? 898  PHE A CE1   1 
ATOM   7320 C  CE2   . PHE A 1 898 ? 41.258  -30.546 57.465 1.00 74.45  ? 898  PHE A CE2   1 
ATOM   7321 C  CZ    . PHE A 1 898 ? 41.600  -31.395 58.515 1.00 74.08  ? 898  PHE A CZ    1 
ATOM   7322 N  N     . ASP A 1 899 ? 44.557  -31.565 51.859 1.00 72.90  ? 899  ASP A N     1 
ATOM   7323 C  CA    . ASP A 1 899 ? 44.811  -31.908 50.456 1.00 76.04  ? 899  ASP A CA    1 
ATOM   7324 C  C     . ASP A 1 899 ? 45.937  -32.921 50.230 1.00 77.66  ? 899  ASP A C     1 
ATOM   7325 O  O     . ASP A 1 899 ? 45.818  -33.804 49.379 1.00 78.38  ? 899  ASP A O     1 
ATOM   7326 C  CB    . ASP A 1 899 ? 45.082  -30.643 49.640 1.00 76.03  ? 899  ASP A CB    1 
ATOM   7327 C  CG    . ASP A 1 899 ? 43.810  -29.911 49.252 1.00 76.28  ? 899  ASP A CG    1 
ATOM   7328 O  OD1   . ASP A 1 899 ? 43.906  -28.989 48.418 1.00 76.67  ? 899  ASP A OD1   1 
ATOM   7329 O  OD2   . ASP A 1 899 ? 42.721  -30.253 49.770 1.00 74.56  ? 899  ASP A OD2   1 
ATOM   7330 N  N     . MET A 1 900 ? 47.015  -32.789 50.999 1.00 79.13  ? 900  MET A N     1 
ATOM   7331 C  CA    . MET A 1 900 ? 48.182  -33.663 50.873 1.00 81.38  ? 900  MET A CA    1 
ATOM   7332 C  C     . MET A 1 900 ? 48.127  -34.902 51.779 1.00 82.61  ? 900  MET A C     1 
ATOM   7333 O  O     . MET A 1 900 ? 49.076  -35.182 52.512 1.00 82.46  ? 900  MET A O     1 
ATOM   7334 C  CB    . MET A 1 900 ? 49.479  -32.864 51.094 1.00 81.58  ? 900  MET A CB    1 
ATOM   7335 C  CG    . MET A 1 900 ? 49.414  -31.818 52.216 1.00 80.94  ? 900  MET A CG    1 
ATOM   7336 S  SD    . MET A 1 900 ? 50.720  -30.567 52.144 1.00 79.07  ? 900  MET A SD    1 
ATOM   7337 C  CE    . MET A 1 900 ? 50.378  -29.779 50.567 1.00 80.85  ? 900  MET A CE    1 
ATOM   7338 N  N     . PHE A 1 901 ? 47.023  -35.647 51.709 1.00 84.49  ? 901  PHE A N     1 
ATOM   7339 C  CA    . PHE A 1 901 ? 46.860  -36.877 52.490 1.00 87.20  ? 901  PHE A CA    1 
ATOM   7340 C  C     . PHE A 1 901 ? 46.159  -38.020 51.729 1.00 91.14  ? 901  PHE A C     1 
ATOM   7341 O  O     . PHE A 1 901 ? 45.035  -38.405 52.066 1.00 91.67  ? 901  PHE A O     1 
ATOM   7342 C  CB    . PHE A 1 901 ? 46.130  -36.591 53.814 1.00 85.50  ? 901  PHE A CB    1 
ATOM   7343 C  CG    . PHE A 1 901 ? 46.999  -35.970 54.883 1.00 82.21  ? 901  PHE A CG    1 
ATOM   7344 C  CD1   . PHE A 1 901 ? 48.055  -36.684 55.452 1.00 81.05  ? 901  PHE A CD1   1 
ATOM   7345 C  CD2   . PHE A 1 901 ? 46.739  -34.682 55.345 1.00 79.53  ? 901  PHE A CD2   1 
ATOM   7346 C  CE1   . PHE A 1 901 ? 48.852  -36.113 56.447 1.00 79.19  ? 901  PHE A CE1   1 
ATOM   7347 C  CE2   . PHE A 1 901 ? 47.525  -34.103 56.340 1.00 77.99  ? 901  PHE A CE2   1 
ATOM   7348 C  CZ    . PHE A 1 901 ? 48.584  -34.820 56.891 1.00 79.11  ? 901  PHE A CZ    1 
ATOM   7349 N  N     . ASP A 1 902 ? 46.832  -38.555 50.710 1.00 95.82  ? 902  ASP A N     1 
ATOM   7350 C  CA    . ASP A 1 902 ? 46.388  -39.773 50.002 1.00 100.51 ? 902  ASP A CA    1 
ATOM   7351 C  C     . ASP A 1 902 ? 47.570  -40.659 49.581 1.00 103.08 ? 902  ASP A C     1 
ATOM   7352 O  O     . ASP A 1 902 ? 47.412  -41.870 49.400 1.00 103.15 ? 902  ASP A O     1 
ATOM   7353 C  CB    . ASP A 1 902 ? 45.485  -39.447 48.799 1.00 101.64 ? 902  ASP A CB    1 
ATOM   7354 C  CG    . ASP A 1 902 ? 44.007  -39.783 49.050 1.00 103.11 ? 902  ASP A CG    1 
ATOM   7355 O  OD1   . ASP A 1 902 ? 43.197  -39.641 48.105 1.00 102.21 ? 902  ASP A OD1   1 
ATOM   7356 O  OD2   . ASP A 1 902 ? 43.649  -40.195 50.178 1.00 103.88 ? 902  ASP A OD2   1 
ATOM   7357 N  N     . PHE A 1 903 ? 48.739  -40.039 49.404 1.00 106.04 ? 903  PHE A N     1 
ATOM   7358 C  CA    . PHE A 1 903 ? 50.011  -40.760 49.336 1.00 107.74 ? 903  PHE A CA    1 
ATOM   7359 C  C     . PHE A 1 903 ? 50.810  -40.426 50.589 1.00 107.47 ? 903  PHE A C     1 
ATOM   7360 O  O     . PHE A 1 903 ? 51.203  -39.277 50.806 1.00 107.08 ? 903  PHE A O     1 
ATOM   7361 C  CB    . PHE A 1 903 ? 50.818  -40.402 48.074 1.00 109.52 ? 903  PHE A CB    1 
ATOM   7362 C  CG    . PHE A 1 903 ? 52.231  -40.964 48.069 1.00 113.22 ? 903  PHE A CG    1 
ATOM   7363 C  CD1   . PHE A 1 903 ? 53.322  -40.160 48.424 1.00 114.12 ? 903  PHE A CD1   1 
ATOM   7364 C  CD2   . PHE A 1 903 ? 52.470  -42.297 47.720 1.00 114.41 ? 903  PHE A CD2   1 
ATOM   7365 C  CE1   . PHE A 1 903 ? 54.627  -40.672 48.430 1.00 114.02 ? 903  PHE A CE1   1 
ATOM   7366 C  CE2   . PHE A 1 903 ? 53.774  -42.819 47.722 1.00 115.35 ? 903  PHE A CE2   1 
ATOM   7367 C  CZ    . PHE A 1 903 ? 54.852  -42.003 48.077 1.00 114.57 ? 903  PHE A CZ    1 
ATOM   7368 P  P     . DT  B 2 1   ? -16.648 -1.062  22.737 1.00 147.31 ? 1    DT  T P     1 
ATOM   7369 O  OP1   . DT  B 2 1   ? -18.110 -1.304  22.772 1.00 147.52 ? 1    DT  T OP1   1 
ATOM   7370 O  OP2   . DT  B 2 1   ? -15.815 -1.699  21.688 1.00 147.06 ? 1    DT  T OP2   1 
ATOM   7371 O  "O5'" . DT  B 2 1   ? -16.380 0.518   22.694 1.00 147.09 ? 1    DT  T "O5'" 1 
ATOM   7372 C  "C5'" . DT  B 2 1   ? -16.047 1.247   23.882 1.00 146.42 ? 1    DT  T "C5'" 1 
ATOM   7373 C  "C4'" . DT  B 2 1   ? -14.561 1.174   24.216 1.00 145.60 ? 1    DT  T "C4'" 1 
ATOM   7374 O  "O4'" . DT  B 2 1   ? -13.816 0.579   23.117 1.00 146.25 ? 1    DT  T "O4'" 1 
ATOM   7375 C  "C3'" . DT  B 2 1   ? -13.881 2.515   24.518 1.00 144.11 ? 1    DT  T "C3'" 1 
ATOM   7376 O  "O3'" . DT  B 2 1   ? -13.170 2.577   25.785 1.00 140.56 ? 1    DT  T "O3'" 1 
ATOM   7377 C  "C2'" . DT  B 2 1   ? -12.904 2.699   23.350 1.00 145.13 ? 1    DT  T "C2'" 1 
ATOM   7378 C  "C1'" . DT  B 2 1   ? -12.576 1.245   23.011 1.00 146.46 ? 1    DT  T "C1'" 1 
ATOM   7379 N  N1    . DT  B 2 1   ? -11.948 0.912   21.666 1.00 147.58 ? 1    DT  T N1    1 
ATOM   7380 C  C2    . DT  B 2 1   ? -12.078 1.712   20.534 1.00 148.08 ? 1    DT  T C2    1 
ATOM   7381 O  O2    . DT  B 2 1   ? -12.697 2.763   20.484 1.00 148.28 ? 1    DT  T O2    1 
ATOM   7382 N  N3    . DT  B 2 1   ? -11.435 1.227   19.416 1.00 148.19 ? 1    DT  T N3    1 
ATOM   7383 C  C4    . DT  B 2 1   ? -10.695 0.059   19.303 1.00 148.21 ? 1    DT  T C4    1 
ATOM   7384 O  O4    . DT  B 2 1   ? -10.166 -0.270  18.244 1.00 148.27 ? 1    DT  T O4    1 
ATOM   7385 C  C5    . DT  B 2 1   ? -10.600 -0.731  20.513 1.00 147.92 ? 1    DT  T C5    1 
ATOM   7386 C  C7    . DT  B 2 1   ? -9.832  -2.023  20.544 1.00 147.25 ? 1    DT  T C7    1 
ATOM   7387 C  C6    . DT  B 2 1   ? -11.224 -0.269  21.609 1.00 147.81 ? 1    DT  T C6    1 
ATOM   7388 P  P     . DC  B 2 2   ? -13.188 1.521   27.006 1.00 137.49 ? 2    DC  T P     1 
ATOM   7389 O  OP1   . DC  B 2 2   ? -13.298 0.135   26.500 1.00 136.85 ? 2    DC  T OP1   1 
ATOM   7390 O  OP2   . DC  B 2 2   ? -14.172 2.009   27.998 1.00 136.81 ? 2    DC  T OP2   1 
ATOM   7391 O  "O5'" . DC  B 2 2   ? -11.706 1.672   27.615 1.00 133.91 ? 2    DC  T "O5'" 1 
ATOM   7392 C  "C5'" . DC  B 2 2   ? -10.578 2.135   26.840 1.00 127.93 ? 2    DC  T "C5'" 1 
ATOM   7393 C  "C4'" . DC  B 2 2   ? -10.124 1.120   25.798 1.00 123.02 ? 2    DC  T "C4'" 1 
ATOM   7394 O  "O4'" . DC  B 2 2   ? -9.258  1.716   24.801 1.00 123.30 ? 2    DC  T "O4'" 1 
ATOM   7395 C  "C3'" . DC  B 2 2   ? -9.307  -0.062  26.302 1.00 118.72 ? 2    DC  T "C3'" 1 
ATOM   7396 O  "O3'" . DC  B 2 2   ? -10.201 -1.068  26.763 1.00 110.76 ? 2    DC  T "O3'" 1 
ATOM   7397 C  "C2'" . DC  B 2 2   ? -8.521  -0.510  25.062 1.00 120.78 ? 2    DC  T "C2'" 1 
ATOM   7398 C  "C1'" . DC  B 2 2   ? -8.780  0.616   24.054 1.00 123.43 ? 2    DC  T "C1'" 1 
ATOM   7399 N  N1    . DC  B 2 2   ? -7.613  1.009   23.175 1.00 125.35 ? 2    DC  T N1    1 
ATOM   7400 C  C2    . DC  B 2 2   ? -6.417  1.566   23.684 1.00 126.35 ? 2    DC  T C2    1 
ATOM   7401 O  O2    . DC  B 2 2   ? -6.269  1.760   24.901 1.00 125.82 ? 2    DC  T O2    1 
ATOM   7402 N  N3    . DC  B 2 2   ? -5.425  1.887   22.804 1.00 127.10 ? 2    DC  T N3    1 
ATOM   7403 C  C4    . DC  B 2 2   ? -5.583  1.679   21.489 1.00 126.86 ? 2    DC  T C4    1 
ATOM   7404 N  N4    . DC  B 2 2   ? -4.578  2.011   20.672 1.00 126.29 ? 2    DC  T N4    1 
ATOM   7405 C  C5    . DC  B 2 2   ? -6.783  1.117   20.955 1.00 126.44 ? 2    DC  T C5    1 
ATOM   7406 C  C6    . DC  B 2 2   ? -7.753  0.805   21.827 1.00 126.03 ? 2    DC  T C6    1 
ATOM   7407 P  P     . DA  B 2 3   ? -9.735  -2.248  27.742 1.00 104.20 ? 3    DA  T P     1 
ATOM   7408 O  OP1   . DA  B 2 3   ? -9.108  -3.297  26.904 1.00 104.07 ? 3    DA  T OP1   1 
ATOM   7409 O  OP2   . DA  B 2 3   ? -10.897 -2.582  28.595 1.00 104.13 ? 3    DA  T OP2   1 
ATOM   7410 O  "O5'" . DA  B 2 3   ? -8.577  -1.600  28.646 1.00 99.32  ? 3    DA  T "O5'" 1 
ATOM   7411 C  "C5'" . DA  B 2 3   ? -8.739  -1.450  30.056 1.00 88.43  ? 3    DA  T "C5'" 1 
ATOM   7412 C  "C4'" . DA  B 2 3   ? -7.416  -1.486  30.808 1.00 78.68  ? 3    DA  T "C4'" 1 
ATOM   7413 O  "O4'" . DA  B 2 3   ? -6.373  -0.747  30.122 1.00 78.19  ? 3    DA  T "O4'" 1 
ATOM   7414 C  "C3'" . DA  B 2 3   ? -7.514  -0.895  32.208 1.00 73.23  ? 3    DA  T "C3'" 1 
ATOM   7415 O  "O3'" . DA  B 2 3   ? -7.155  -1.892  33.142 1.00 55.68  ? 3    DA  T "O3'" 1 
ATOM   7416 C  "C2'" . DA  B 2 3   ? -6.543  0.291   32.247 1.00 74.44  ? 3    DA  T "C2'" 1 
ATOM   7417 C  "C1'" . DA  B 2 3   ? -6.084  0.461   30.802 1.00 76.98  ? 3    DA  T "C1'" 1 
ATOM   7418 N  N9    . DA  B 2 3   ? -6.725  1.538   30.043 1.00 77.53  ? 3    DA  T N9    1 
ATOM   7419 C  C8    . DA  B 2 3   ? -8.065  1.807   29.927 1.00 77.28  ? 3    DA  T C8    1 
ATOM   7420 N  N7    . DA  B 2 3   ? -8.346  2.831   29.163 1.00 77.07  ? 3    DA  T N7    1 
ATOM   7421 C  C5    . DA  B 2 3   ? -7.104  3.263   28.738 1.00 77.63  ? 3    DA  T C5    1 
ATOM   7422 C  C6    . DA  B 2 3   ? -6.714  4.322   27.892 1.00 79.35  ? 3    DA  T C6    1 
ATOM   7423 N  N6    . DA  B 2 3   ? -7.596  5.150   27.324 1.00 78.92  ? 3    DA  T N6    1 
ATOM   7424 N  N1    . DA  B 2 3   ? -5.387  4.501   27.668 1.00 80.88  ? 3    DA  T N1    1 
ATOM   7425 C  C2    . DA  B 2 3   ? -4.509  3.662   28.249 1.00 81.64  ? 3    DA  T C2    1 
ATOM   7426 N  N3    . DA  B 2 3   ? -4.762  2.627   29.061 1.00 80.59  ? 3    DA  T N3    1 
ATOM   7427 C  C4    . DA  B 2 3   ? -6.090  2.480   29.265 1.00 78.62  ? 3    DA  T C4    1 
HETATM 7428 P  P     . 8OG B 2 4   ? -7.383  -3.314  33.458 1.00 29.13  ? 4    8OG T P     1 
HETATM 7429 O  OP1   . 8OG B 2 4   ? -6.528  -4.778  32.751 1.00 32.11  ? 4    8OG T OP1   1 
HETATM 7430 O  OP2   . 8OG B 2 4   ? -9.172  -3.535  33.366 1.00 26.19  ? 4    8OG T OP2   1 
HETATM 7431 O  "O5'" . 8OG B 2 4   ? -7.027  -3.098  35.151 1.00 28.50  ? 4    8OG T "O5'" 1 
HETATM 7432 C  "C5'" . 8OG B 2 4   ? -5.612  -3.091  35.509 1.00 22.06  ? 4    8OG T "C5'" 1 
HETATM 7433 C  "C4'" . 8OG B 2 4   ? -5.585  -2.586  36.762 1.00 26.15  ? 4    8OG T "C4'" 1 
HETATM 7434 O  "O4'" . 8OG B 2 4   ? -6.310  -3.483  37.676 1.00 18.86  ? 4    8OG T "O4'" 1 
HETATM 7435 C  "C3'" . 8OG B 2 4   ? -4.351  -2.342  37.249 1.00 22.69  ? 4    8OG T "C3'" 1 
HETATM 7436 O  "O3'" . 8OG B 2 4   ? -3.822  -1.125  36.958 1.00 25.75  ? 4    8OG T "O3'" 1 
HETATM 7437 C  "C2'" . 8OG B 2 4   ? -4.485  -2.540  38.735 1.00 24.02  ? 4    8OG T "C2'" 1 
HETATM 7438 C  "C1'" . 8OG B 2 4   ? -5.547  -3.611  38.865 1.00 26.11  ? 4    8OG T "C1'" 1 
HETATM 7439 N  N9    . 8OG B 2 4   ? -4.841  -4.918  38.933 1.00 29.41  ? 4    8OG T N9    1 
HETATM 7440 C  C8    . 8OG B 2 4   ? -4.248  -5.423  40.010 1.00 29.08  ? 4    8OG T C8    1 
HETATM 7441 N  N7    . 8OG B 2 4   ? -3.666  -6.620  39.843 1.00 23.81  ? 4    8OG T N7    1 
HETATM 7442 C  C5    . 8OG B 2 4   ? -3.919  -6.902  38.545 1.00 29.15  ? 4    8OG T C5    1 
HETATM 7443 C  C6    . 8OG B 2 4   ? -3.591  -7.986  37.735 1.00 28.86  ? 4    8OG T C6    1 
HETATM 7444 O  O6    . 8OG B 2 4   ? -2.882  -9.019  38.255 1.00 32.11  ? 4    8OG T O6    1 
HETATM 7445 N  N1    . 8OG B 2 4   ? -3.972  -8.015  36.435 1.00 28.09  ? 4    8OG T N1    1 
HETATM 7446 C  C2    . 8OG B 2 4   ? -4.682  -6.988  35.925 1.00 28.11  ? 4    8OG T C2    1 
HETATM 7447 N  N2    . 8OG B 2 4   ? -5.068  -7.010  34.630 1.00 30.89  ? 4    8OG T N2    1 
HETATM 7448 N  N3    . 8OG B 2 4   ? -5.016  -5.924  36.689 1.00 27.50  ? 4    8OG T N3    1 
HETATM 7449 C  C4    . 8OG B 2 4   ? -4.647  -5.847  37.986 1.00 27.60  ? 4    8OG T C4    1 
HETATM 7450 O  O8    . 8OG B 2 4   ? -4.248  -4.675  41.288 1.00 24.63  ? 4    8OG T O8    1 
ATOM   7451 P  P     . DG  B 2 5   ? -2.384  -0.841  36.738 1.00 25.22  ? 5    DG  T P     1 
ATOM   7452 O  OP1   . DG  B 2 5   ? -2.266  0.482   36.113 1.00 27.04  ? 5    DG  T OP1   1 
ATOM   7453 O  OP2   . DG  B 2 5   ? -1.745  -2.007  36.100 1.00 24.97  ? 5    DG  T OP2   1 
ATOM   7454 O  "O5'" . DG  B 2 5   ? -1.773  -0.753  38.209 1.00 21.90  ? 5    DG  T "O5'" 1 
ATOM   7455 C  "C5'" . DG  B 2 5   ? -2.303  0.224   39.095 1.00 25.66  ? 5    DG  T "C5'" 1 
ATOM   7456 C  "C4'" . DG  B 2 5   ? -1.855  -0.064  40.507 1.00 26.75  ? 5    DG  T "C4'" 1 
ATOM   7457 O  "O4'" . DG  B 2 5   ? -2.331  -1.367  40.919 1.00 27.08  ? 5    DG  T "O4'" 1 
ATOM   7458 C  "C3'" . DG  B 2 5   ? -0.349  -0.157  40.655 1.00 28.15  ? 5    DG  T "C3'" 1 
ATOM   7459 O  "O3'" . DG  B 2 5   ? 0.191   1.170   40.727 1.00 23.32  ? 5    DG  T "O3'" 1 
ATOM   7460 C  "C2'" . DG  B 2 5   ? -0.252  -0.958  41.954 1.00 25.47  ? 5    DG  T "C2'" 1 
ATOM   7461 C  "C1'" . DG  B 2 5   ? -1.398  -1.959  41.805 1.00 24.63  ? 5    DG  T "C1'" 1 
ATOM   7462 N  N9    . DG  B 2 5   ? -0.977  -3.249  41.261 1.00 23.38  ? 5    DG  T N9    1 
ATOM   7463 C  C8    . DG  B 2 5   ? -1.131  -3.693  39.965 1.00 23.66  ? 5    DG  T C8    1 
ATOM   7464 N  N7    . DG  B 2 5   ? -0.632  -4.881  39.747 1.00 25.55  ? 5    DG  T N7    1 
ATOM   7465 C  C5    . DG  B 2 5   ? -0.117  -5.255  40.978 1.00 25.58  ? 5    DG  T C5    1 
ATOM   7466 C  C6    . DG  B 2 5   ? 0.531   -6.456  41.356 1.00 25.37  ? 5    DG  T C6    1 
ATOM   7467 O  O6    . DG  B 2 5   ? 0.769   -7.439  40.634 1.00 21.88  ? 5    DG  T O6    1 
ATOM   7468 N  N1    . DG  B 2 5   ? 0.909   -6.443  42.712 1.00 22.94  ? 5    DG  T N1    1 
ATOM   7469 C  C2    . DG  B 2 5   ? 0.664   -5.394  43.579 1.00 22.57  ? 5    DG  T C2    1 
ATOM   7470 N  N2    . DG  B 2 5   ? 1.081   -5.535  44.840 1.00 23.81  ? 5    DG  T N2    1 
ATOM   7471 N  N3    . DG  B 2 5   ? 0.050   -4.266  43.229 1.00 25.64  ? 5    DG  T N3    1 
ATOM   7472 C  C4    . DG  B 2 5   ? -0.315  -4.261  41.920 1.00 24.84  ? 5    DG  T C4    1 
ATOM   7473 P  P     . DT  B 2 6   ? 1.764   1.426   40.681 1.00 25.30  ? 6    DT  T P     1 
ATOM   7474 O  OP1   . DT  B 2 6   ? 1.976   2.887   40.675 1.00 20.64  ? 6    DT  T OP1   1 
ATOM   7475 O  OP2   . DT  B 2 6   ? 2.349   0.600   39.593 1.00 27.49  ? 6    DT  T OP2   1 
ATOM   7476 O  "O5'" . DT  B 2 6   ? 2.305   0.730   42.013 1.00 25.42  ? 6    DT  T "O5'" 1 
ATOM   7477 C  "C5'" . DT  B 2 6   ? 2.201   1.276   43.312 1.00 22.99  ? 6    DT  T "C5'" 1 
ATOM   7478 C  "C4'" . DT  B 2 6   ? 3.117   0.515   44.263 1.00 20.90  ? 6    DT  T "C4'" 1 
ATOM   7479 O  "O4'" . DT  B 2 6   ? 2.990   -0.931  44.137 1.00 19.94  ? 6    DT  T "O4'" 1 
ATOM   7480 C  "C3'" . DT  B 2 6   ? 4.608   0.766   44.094 1.00 23.35  ? 6    DT  T "C3'" 1 
ATOM   7481 O  "O3'" . DT  B 2 6   ? 5.156   0.589   45.381 1.00 26.84  ? 6    DT  T "O3'" 1 
ATOM   7482 C  "C2'" . DT  B 2 6   ? 5.014   -0.350  43.142 1.00 19.11  ? 6    DT  T "C2'" 1 
ATOM   7483 C  "C1'" . DT  B 2 6   ? 4.228   -1.504  43.753 1.00 20.75  ? 6    DT  T "C1'" 1 
ATOM   7484 N  N1    . DT  B 2 6   ? 4.017   -2.643  42.804 1.00 24.10  ? 6    DT  T N1    1 
ATOM   7485 C  C2    . DT  B 2 6   ? 4.442   -3.913  43.169 1.00 24.60  ? 6    DT  T C2    1 
ATOM   7486 O  O2    . DT  B 2 6   ? 4.974   -4.191  44.236 1.00 27.76  ? 6    DT  T O2    1 
ATOM   7487 N  N3    . DT  B 2 6   ? 4.208   -4.882  42.226 1.00 17.22  ? 6    DT  T N3    1 
ATOM   7488 C  C4    . DT  B 2 6   ? 3.622   -4.728  40.988 1.00 17.73  ? 6    DT  T C4    1 
ATOM   7489 O  O4    . DT  B 2 6   ? 3.468   -5.684  40.233 1.00 24.65  ? 6    DT  T O4    1 
ATOM   7490 C  C5    . DT  B 2 6   ? 3.203   -3.392  40.652 1.00 19.62  ? 6    DT  T C5    1 
ATOM   7491 C  C7    . DT  B 2 6   ? 2.551   -3.129  39.314 1.00 20.69  ? 6    DT  T C7    1 
ATOM   7492 C  C6    . DT  B 2 6   ? 3.410   -2.418  41.567 1.00 20.36  ? 6    DT  T C6    1 
ATOM   7493 P  P     . DA  B 2 7   ? 6.678   0.864   45.756 1.00 31.53  ? 7    DA  T P     1 
ATOM   7494 O  OP1   . DA  B 2 7   ? 6.656   1.566   47.056 1.00 31.86  ? 7    DA  T OP1   1 
ATOM   7495 O  OP2   . DA  B 2 7   ? 7.378   1.488   44.610 1.00 33.78  ? 7    DA  T OP2   1 
ATOM   7496 O  "O5'" . DA  B 2 7   ? 7.241   -0.617  45.951 1.00 29.05  ? 7    DA  T "O5'" 1 
ATOM   7497 C  "C5'" . DA  B 2 7   ? 6.788   -1.476  46.998 1.00 28.66  ? 7    DA  T "C5'" 1 
ATOM   7498 C  "C4'" . DA  B 2 7   ? 7.812   -2.580  47.269 1.00 33.19  ? 7    DA  T "C4'" 1 
ATOM   7499 O  "O4'" . DA  B 2 7   ? 7.678   -3.677  46.313 1.00 30.39  ? 7    DA  T "O4'" 1 
ATOM   7500 C  "C3'" . DA  B 2 7   ? 9.294   -2.188  47.230 1.00 30.65  ? 7    DA  T "C3'" 1 
ATOM   7501 O  "O3'" . DA  B 2 7   ? 9.998   -2.930  48.243 1.00 29.56  ? 7    DA  T "O3'" 1 
ATOM   7502 C  "C2'" . DA  B 2 7   ? 9.715   -2.561  45.801 1.00 28.04  ? 7    DA  T "C2'" 1 
ATOM   7503 C  "C1'" . DA  B 2 7   ? 8.838   -3.783  45.506 1.00 29.18  ? 7    DA  T "C1'" 1 
ATOM   7504 N  N9    . DA  B 2 7   ? 8.341   -3.904  44.140 1.00 26.27  ? 7    DA  T N9    1 
ATOM   7505 C  C8    . DA  B 2 7   ? 7.772   -2.924  43.380 1.00 24.85  ? 7    DA  T C8    1 
ATOM   7506 N  N7    . DA  B 2 7   ? 7.391   -3.322  42.184 1.00 28.06  ? 7    DA  T N7    1 
ATOM   7507 C  C5    . DA  B 2 7   ? 7.728   -4.668  42.161 1.00 26.64  ? 7    DA  T C5    1 
ATOM   7508 C  C6    . DA  B 2 7   ? 7.585   -5.679  41.177 1.00 26.83  ? 7    DA  T C6    1 
ATOM   7509 N  N6    . DA  B 2 7   ? 7.035   -5.456  39.969 1.00 21.12  ? 7    DA  T N6    1 
ATOM   7510 N  N1    . DA  B 2 7   ? 8.026   -6.931  41.484 1.00 24.54  ? 7    DA  T N1    1 
ATOM   7511 C  C2    . DA  B 2 7   ? 8.584   -7.149  42.682 1.00 23.15  ? 7    DA  T C2    1 
ATOM   7512 N  N3    . DA  B 2 7   ? 8.753   -6.273  43.684 1.00 26.83  ? 7    DA  T N3    1 
ATOM   7513 C  C4    . DA  B 2 7   ? 8.313   -5.042  43.362 1.00 26.04  ? 7    DA  T C4    1 
ATOM   7514 P  P     . DA  B 2 8   ? 11.577  -2.779  48.491 1.00 27.40  ? 8    DA  T P     1 
ATOM   7515 O  OP1   . DA  B 2 8   ? 11.890  -3.327  49.831 1.00 26.74  ? 8    DA  T OP1   1 
ATOM   7516 O  OP2   . DA  B 2 8   ? 11.986  -1.413  48.131 1.00 29.80  ? 8    DA  T OP2   1 
ATOM   7517 O  "O5'" . DA  B 2 8   ? 12.177  -3.749  47.388 1.00 29.60  ? 8    DA  T "O5'" 1 
ATOM   7518 C  "C5'" . DA  B 2 8   ? 11.929  -5.169  47.463 1.00 29.68  ? 8    DA  T "C5'" 1 
ATOM   7519 C  "C4'" . DA  B 2 8   ? 12.630  -5.863  46.308 1.00 29.62  ? 8    DA  T "C4'" 1 
ATOM   7520 O  "O4'" . DA  B 2 8   ? 11.801  -5.752  45.112 1.00 29.49  ? 8    DA  T "O4'" 1 
ATOM   7521 C  "C3'" . DA  B 2 8   ? 14.007  -5.276  45.955 1.00 28.24  ? 8    DA  T "C3'" 1 
ATOM   7522 O  "O3'" . DA  B 2 8   ? 14.970  -6.322  45.822 1.00 28.33  ? 8    DA  T "O3'" 1 
ATOM   7523 C  "C2'" . DA  B 2 8   ? 13.739  -4.585  44.623 1.00 28.07  ? 8    DA  T "C2'" 1 
ATOM   7524 C  "C1'" . DA  B 2 8   ? 12.690  -5.532  44.035 1.00 31.39  ? 8    DA  T "C1'" 1 
ATOM   7525 N  N9    . DA  B 2 8   ? 12.030  -5.018  42.830 1.00 30.48  ? 8    DA  T N9    1 
ATOM   7526 C  C8    . DA  B 2 8   ? 11.663  -3.720  42.569 1.00 29.27  ? 8    DA  T C8    1 
ATOM   7527 N  N7    . DA  B 2 8   ? 11.107  -3.546  41.393 1.00 28.61  ? 8    DA  T N7    1 
ATOM   7528 C  C5    . DA  B 2 8   ? 11.107  -4.818  40.844 1.00 29.65  ? 8    DA  T C5    1 
ATOM   7529 C  C6    . DA  B 2 8   ? 10.647  -5.316  39.604 1.00 31.35  ? 8    DA  T C6    1 
ATOM   7530 N  N6    . DA  B 2 8   ? 10.083  -4.534  38.674 1.00 24.11  ? 8    DA  T N6    1 
ATOM   7531 N  N1    . DA  B 2 8   ? 10.796  -6.645  39.364 1.00 28.80  ? 8    DA  T N1    1 
ATOM   7532 C  C2    . DA  B 2 8   ? 11.366  -7.425  40.300 1.00 27.46  ? 8    DA  T C2    1 
ATOM   7533 N  N3    . DA  B 2 8   ? 11.835  -7.067  41.497 1.00 30.29  ? 8    DA  T N3    1 
ATOM   7534 C  C4    . DA  B 2 8   ? 11.674  -5.741  41.711 1.00 29.75  ? 8    DA  T C4    1 
ATOM   7535 P  P     . DG  B 2 9   ? 16.541  -6.149  46.126 1.00 30.79  ? 9    DG  T P     1 
ATOM   7536 O  OP1   . DG  B 2 9   ? 16.759  -6.274  47.582 1.00 32.82  ? 9    DG  T OP1   1 
ATOM   7537 O  OP2   . DG  B 2 9   ? 17.112  -5.002  45.402 1.00 29.86  ? 9    DG  T OP2   1 
ATOM   7538 O  "O5'" . DG  B 2 9   ? 17.101  -7.452  45.416 1.00 30.05  ? 9    DG  T "O5'" 1 
ATOM   7539 C  "C5'" . DG  B 2 9   ? 16.534  -8.728  45.687 1.00 35.38  ? 9    DG  T "C5'" 1 
ATOM   7540 C  "C4'" . DG  B 2 9   ? 16.622  -9.584  44.437 1.00 37.54  ? 9    DG  T "C4'" 1 
ATOM   7541 O  "O4'" . DG  B 2 9   ? 15.689  -9.074  43.450 1.00 35.11  ? 9    DG  T "O4'" 1 
ATOM   7542 C  "C3'" . DG  B 2 9   ? 18.007  -9.520  43.805 1.00 37.78  ? 9    DG  T "C3'" 1 
ATOM   7543 O  "O3'" . DG  B 2 9   ? 18.583  -10.787 43.575 1.00 41.73  ? 9    DG  T "O3'" 1 
ATOM   7544 C  "C2'" . DG  B 2 9   ? 17.817  -8.739  42.505 1.00 39.56  ? 9    DG  T "C2'" 1 
ATOM   7545 C  "C1'" . DG  B 2 9   ? 16.337  -8.911  42.204 1.00 36.36  ? 9    DG  T "C1'" 1 
ATOM   7546 N  N9    . DG  B 2 9   ? 15.749  -7.763  41.511 1.00 32.80  ? 9    DG  T N9    1 
ATOM   7547 C  C8    . DG  B 2 9   ? 15.596  -6.479  41.987 1.00 30.56  ? 9    DG  T C8    1 
ATOM   7548 N  N7    . DG  B 2 9   ? 15.022  -5.671  41.135 1.00 30.80  ? 9    DG  T N7    1 
ATOM   7549 C  C5    . DG  B 2 9   ? 14.778  -6.469  40.018 1.00 31.69  ? 9    DG  T C5    1 
ATOM   7550 C  C6    . DG  B 2 9   ? 14.184  -6.157  38.765 1.00 28.72  ? 9    DG  T C6    1 
ATOM   7551 O  O6    . DG  B 2 9   ? 13.722  -5.089  38.355 1.00 33.66  ? 9    DG  T O6    1 
ATOM   7552 N  N1    . DG  B 2 9   ? 14.137  -7.249  37.920 1.00 29.45  ? 9    DG  T N1    1 
ATOM   7553 C  C2    . DG  B 2 9   ? 14.608  -8.497  38.230 1.00 30.32  ? 9    DG  T C2    1 
ATOM   7554 N  N2    . DG  B 2 9   ? 14.470  -9.411  37.268 1.00 26.21  ? 9    DG  T N2    1 
ATOM   7555 N  N3    . DG  B 2 9   ? 15.170  -8.813  39.394 1.00 30.07  ? 9    DG  T N3    1 
ATOM   7556 C  C4    . DG  B 2 9   ? 15.225  -7.757  40.237 1.00 30.05  ? 9    DG  T C4    1 
ATOM   7557 P  P     . DC  B 2 10  ? 20.175  -10.828 43.317 1.00 47.00  ? 10   DC  T P     1 
ATOM   7558 O  OP1   . DC  B 2 10  ? 20.745  -12.016 43.993 1.00 42.00  ? 10   DC  T OP1   1 
ATOM   7559 O  OP2   . DC  B 2 10  ? 20.751  -9.485  43.598 1.00 42.17  ? 10   DC  T OP2   1 
ATOM   7560 O  "O5'" . DC  B 2 10  ? 20.210  -11.003 41.730 1.00 42.56  ? 10   DC  T "O5'" 1 
ATOM   7561 C  "C5'" . DC  B 2 10  ? 19.473  -12.030 41.106 1.00 42.34  ? 10   DC  T "C5'" 1 
ATOM   7562 C  "C4'" . DC  B 2 10  ? 19.699  -11.951 39.607 1.00 40.83  ? 10   DC  T "C4'" 1 
ATOM   7563 O  "O4'" . DC  B 2 10  ? 18.895  -10.891 39.028 1.00 39.61  ? 10   DC  T "O4'" 1 
ATOM   7564 C  "C3'" . DC  B 2 10  ? 21.138  -11.675 39.188 1.00 41.64  ? 10   DC  T "C3'" 1 
ATOM   7565 O  "O3'" . DC  B 2 10  ? 21.411  -12.573 38.123 1.00 43.16  ? 10   DC  T "O3'" 1 
ATOM   7566 C  "C2'" . DC  B 2 10  ? 21.132  -10.197 38.785 1.00 39.78  ? 10   DC  T "C2'" 1 
ATOM   7567 C  "C1'" . DC  B 2 10  ? 19.701  -9.998  38.288 1.00 37.57  ? 10   DC  T "C1'" 1 
ATOM   7568 N  N1    . DC  B 2 10  ? 19.123  -8.621  38.449 1.00 35.60  ? 10   DC  T N1    1 
ATOM   7569 C  C2    . DC  B 2 10  ? 18.295  -8.079  37.444 1.00 34.96  ? 10   DC  T C2    1 
ATOM   7570 O  O2    . DC  B 2 10  ? 18.060  -8.735  36.425 1.00 31.86  ? 10   DC  T O2    1 
ATOM   7571 N  N3    . DC  B 2 10  ? 17.768  -6.832  37.607 1.00 35.32  ? 10   DC  T N3    1 
ATOM   7572 C  C4    . DC  B 2 10  ? 18.035  -6.130  38.717 1.00 38.49  ? 10   DC  T C4    1 
ATOM   7573 N  N4    . DC  B 2 10  ? 17.499  -4.901  38.836 1.00 35.83  ? 10   DC  T N4    1 
ATOM   7574 C  C5    . DC  B 2 10  ? 18.873  -6.664  39.753 1.00 36.98  ? 10   DC  T C5    1 
ATOM   7575 C  C6    . DC  B 2 10  ? 19.384  -7.894  39.581 1.00 35.88  ? 10   DC  T C6    1 
ATOM   7576 P  P     . DA  B 2 11  ? 22.779  -12.633 37.298 1.00 39.38  ? 11   DA  T P     1 
ATOM   7577 O  OP1   . DA  B 2 11  ? 23.075  -14.072 37.154 1.00 40.65  ? 11   DA  T OP1   1 
ATOM   7578 O  OP2   . DA  B 2 11  ? 23.776  -11.706 37.877 1.00 40.75  ? 11   DA  T OP2   1 
ATOM   7579 O  "O5'" . DA  B 2 11  ? 22.333  -12.052 35.881 1.00 38.21  ? 11   DA  T "O5'" 1 
ATOM   7580 C  "C5'" . DA  B 2 11  ? 21.318  -12.715 35.140 1.00 40.73  ? 11   DA  T "C5'" 1 
ATOM   7581 C  "C4'" . DA  B 2 11  ? 21.282  -12.167 33.726 1.00 44.54  ? 11   DA  T "C4'" 1 
ATOM   7582 O  "O4'" . DA  B 2 11  ? 20.594  -10.888 33.710 1.00 45.77  ? 11   DA  T "O4'" 1 
ATOM   7583 C  "C3'" . DA  B 2 11  ? 22.642  -11.905 33.096 1.00 47.13  ? 11   DA  T "C3'" 1 
ATOM   7584 O  "O3'" . DA  B 2 11  ? 22.557  -12.200 31.715 1.00 50.61  ? 11   DA  T "O3'" 1 
ATOM   7585 C  "C2'" . DA  B 2 11  ? 22.874  -10.416 33.334 1.00 44.87  ? 11   DA  T "C2'" 1 
ATOM   7586 C  "C1'" . DA  B 2 11  ? 21.452  -9.854  33.305 1.00 41.86  ? 11   DA  T "C1'" 1 
ATOM   7587 N  N9    . DA  B 2 11  ? 21.261  -8.733  34.217 1.00 40.51  ? 11   DA  T N9    1 
ATOM   7588 C  C8    . DA  B 2 11  ? 21.708  -8.630  35.511 1.00 39.89  ? 11   DA  T C8    1 
ATOM   7589 N  N7    . DA  B 2 11  ? 21.403  -7.494  36.092 1.00 37.15  ? 11   DA  T N7    1 
ATOM   7590 C  C5    . DA  B 2 11  ? 20.706  -6.808  35.110 1.00 37.75  ? 11   DA  T C5    1 
ATOM   7591 C  C6    . DA  B 2 11  ? 20.105  -5.532  35.087 1.00 36.73  ? 11   DA  T C6    1 
ATOM   7592 N  N6    . DA  B 2 11  ? 20.116  -4.690  36.129 1.00 36.58  ? 11   DA  T N6    1 
ATOM   7593 N  N1    . DA  B 2 11  ? 19.497  -5.148  33.944 1.00 37.00  ? 11   DA  T N1    1 
ATOM   7594 C  C2    . DA  B 2 11  ? 19.482  -5.974  32.884 1.00 38.13  ? 11   DA  T C2    1 
ATOM   7595 N  N3    . DA  B 2 11  ? 20.011  -7.195  32.790 1.00 40.13  ? 11   DA  T N3    1 
ATOM   7596 C  C4    . DA  B 2 11  ? 20.612  -7.554  33.946 1.00 38.11  ? 11   DA  T C4    1 
ATOM   7597 P  P     . DG  B 2 12  ? 23.865  -12.171 30.801 1.00 53.53  ? 12   DG  T P     1 
ATOM   7598 O  OP1   . DG  B 2 12  ? 23.544  -13.125 29.714 1.00 51.29  ? 12   DG  T OP1   1 
ATOM   7599 O  OP2   . DG  B 2 12  ? 25.086  -12.284 31.644 1.00 50.32  ? 12   DG  T OP2   1 
ATOM   7600 O  "O5'" . DG  B 2 12  ? 23.907  -10.685 30.198 1.00 50.88  ? 12   DG  T "O5'" 1 
ATOM   7601 C  "C5'" . DG  B 2 12  ? 22.947  -10.291 29.244 1.00 43.05  ? 12   DG  T "C5'" 1 
ATOM   7602 C  "C4'" . DG  B 2 12  ? 22.916  -8.787  29.140 1.00 43.07  ? 12   DG  T "C4'" 1 
ATOM   7603 O  "O4'" . DG  B 2 12  ? 22.547  -8.219  30.420 1.00 42.44  ? 12   DG  T "O4'" 1 
ATOM   7604 C  "C3'" . DG  B 2 12  ? 24.254  -8.168  28.763 1.00 43.49  ? 12   DG  T "C3'" 1 
ATOM   7605 O  "O3'" . DG  B 2 12  ? 24.197  -7.660  27.436 1.00 42.37  ? 12   DG  T "O3'" 1 
ATOM   7606 C  "C2'" . DG  B 2 12  ? 24.434  -7.042  29.770 1.00 42.53  ? 12   DG  T "C2'" 1 
ATOM   7607 C  "C1'" . DG  B 2 12  ? 23.079  -6.919  30.441 1.00 39.65  ? 12   DG  T "C1'" 1 
ATOM   7608 N  N9    . DG  B 2 12  ? 23.237  -6.445  31.809 1.00 37.65  ? 12   DG  T N9    1 
ATOM   7609 C  C8    . DG  B 2 12  ? 23.801  -7.109  32.879 1.00 34.84  ? 12   DG  T C8    1 
ATOM   7610 N  N7    . DG  B 2 12  ? 23.812  -6.404  33.976 1.00 32.30  ? 12   DG  T N7    1 
ATOM   7611 C  C5    . DG  B 2 12  ? 23.222  -5.198  33.612 1.00 34.55  ? 12   DG  T C5    1 
ATOM   7612 C  C6    . DG  B 2 12  ? 22.955  -4.034  34.378 1.00 34.30  ? 12   DG  T C6    1 
ATOM   7613 O  O6    . DG  B 2 12  ? 23.205  -3.837  35.576 1.00 35.51  ? 12   DG  T O6    1 
ATOM   7614 N  N1    . DG  B 2 12  ? 22.349  -3.033  33.617 1.00 33.25  ? 12   DG  T N1    1 
ATOM   7615 C  C2    . DG  B 2 12  ? 22.041  -3.149  32.280 1.00 34.07  ? 12   DG  T C2    1 
ATOM   7616 N  N2    . DG  B 2 12  ? 21.462  -2.096  31.696 1.00 35.16  ? 12   DG  T N2    1 
ATOM   7617 N  N3    . DG  B 2 12  ? 22.284  -4.229  31.555 1.00 33.56  ? 12   DG  T N3    1 
ATOM   7618 C  C4    . DG  B 2 12  ? 22.872  -5.207  32.280 1.00 33.85  ? 12   DG  T C4    1 
ATOM   7619 P  P     . DT  B 2 13  ? 25.429  -6.877  26.782 1.00 35.31  ? 13   DT  T P     1 
ATOM   7620 O  OP1   . DT  B 2 13  ? 25.391  -7.128  25.329 1.00 42.07  ? 13   DT  T OP1   1 
ATOM   7621 O  OP2   . DT  B 2 13  ? 26.643  -7.167  27.581 1.00 39.47  ? 13   DT  T OP2   1 
ATOM   7622 O  "O5'" . DT  B 2 13  ? 25.047  -5.351  26.992 1.00 40.75  ? 13   DT  T "O5'" 1 
ATOM   7623 C  "C5'" . DT  B 2 13  ? 24.037  -4.746  26.205 1.00 40.23  ? 13   DT  T "C5'" 1 
ATOM   7624 C  "C4'" . DT  B 2 13  ? 24.155  -3.243  26.360 1.00 43.67  ? 13   DT  T "C4'" 1 
ATOM   7625 O  "O4'" . DT  B 2 13  ? 24.039  -2.891  27.764 1.00 42.49  ? 13   DT  T "O4'" 1 
ATOM   7626 C  "C3'" . DT  B 2 13  ? 25.481  -2.650  25.887 1.00 45.51  ? 13   DT  T "C3'" 1 
ATOM   7627 O  "O3'" . DT  B 2 13  ? 25.200  -1.462  25.115 1.00 47.82  ? 13   DT  T "O3'" 1 
ATOM   7628 C  "C2'" . DT  B 2 13  ? 26.257  -2.389  27.183 1.00 42.18  ? 13   DT  T "C2'" 1 
ATOM   7629 C  "C1'" . DT  B 2 13  ? 25.138  -2.096  28.180 1.00 41.80  ? 13   DT  T "C1'" 1 
ATOM   7630 N  N1    . DT  B 2 13  ? 25.394  -2.417  29.645 1.00 38.89  ? 13   DT  T N1    1 
ATOM   7631 C  C2    . DT  B 2 13  ? 25.089  -1.475  30.619 1.00 36.66  ? 13   DT  T C2    1 
ATOM   7632 O  O2    . DT  B 2 13  ? 24.638  -0.368  30.396 1.00 30.34  ? 13   DT  T O2    1 
ATOM   7633 N  N3    . DT  B 2 13  ? 25.334  -1.863  31.914 1.00 38.06  ? 13   DT  T N3    1 
ATOM   7634 C  C4    . DT  B 2 13  ? 25.839  -3.073  32.339 1.00 39.71  ? 13   DT  T C4    1 
ATOM   7635 O  O4    . DT  B 2 13  ? 26.009  -3.292  33.535 1.00 42.03  ? 13   DT  T O4    1 
ATOM   7636 C  C5    . DT  B 2 13  ? 26.143  -4.029  31.282 1.00 41.99  ? 13   DT  T C5    1 
ATOM   7637 C  C7    . DT  B 2 13  ? 26.702  -5.393  31.608 1.00 36.96  ? 13   DT  T C7    1 
ATOM   7638 C  C6    . DT  B 2 13  ? 25.903  -3.658  30.005 1.00 39.52  ? 13   DT  T C6    1 
ATOM   7639 P  P     . DC  B 2 14  ? 26.306  -0.691  24.250 1.00 47.38  ? 14   DC  T P     1 
ATOM   7640 O  OP1   . DC  B 2 14  ? 25.601  0.047   23.179 1.00 47.32  ? 14   DC  T OP1   1 
ATOM   7641 O  OP2   . DC  B 2 14  ? 27.401  -1.617  23.887 1.00 44.65  ? 14   DC  T OP2   1 
ATOM   7642 O  "O5'" . DC  B 2 14  ? 26.854  0.361   25.322 1.00 47.82  ? 14   DC  T "O5'" 1 
ATOM   7643 C  "C5'" . DC  B 2 14  ? 25.980  1.409   25.750 1.00 50.25  ? 14   DC  T "C5'" 1 
ATOM   7644 C  "C4'" . DC  B 2 14  ? 26.625  2.341   26.761 1.00 52.60  ? 14   DC  T "C4'" 1 
ATOM   7645 O  "O4'" . DC  B 2 14  ? 26.655  1.729   28.076 1.00 51.54  ? 14   DC  T "O4'" 1 
ATOM   7646 C  "C3'" . DC  B 2 14  ? 28.058  2.743   26.438 1.00 55.74  ? 14   DC  T "C3'" 1 
ATOM   7647 O  "O3'" . DC  B 2 14  ? 28.170  4.144   26.594 1.00 63.49  ? 14   DC  T "O3'" 1 
ATOM   7648 C  "C2'" . DC  B 2 14  ? 28.910  1.997   27.462 1.00 54.27  ? 14   DC  T "C2'" 1 
ATOM   7649 C  "C1'" . DC  B 2 14  ? 27.948  1.873   28.638 1.00 50.92  ? 14   DC  T "C1'" 1 
ATOM   7650 N  N1    . DC  B 2 14  ? 28.223  0.712   29.549 1.00 43.80  ? 14   DC  T N1    1 
ATOM   7651 C  C2    . DC  B 2 14  ? 28.106  0.883   30.940 1.00 42.09  ? 14   DC  T C2    1 
ATOM   7652 O  O2    . DC  B 2 14  ? 27.779  1.993   31.389 1.00 39.74  ? 14   DC  T O2    1 
ATOM   7653 N  N3    . DC  B 2 14  ? 28.353  -0.183  31.755 1.00 41.03  ? 14   DC  T N3    1 
ATOM   7654 C  C4    . DC  B 2 14  ? 28.697  -1.367  31.225 1.00 40.95  ? 14   DC  T C4    1 
ATOM   7655 N  N4    . DC  B 2 14  ? 28.932  -2.388  32.056 1.00 42.71  ? 14   DC  T N4    1 
ATOM   7656 C  C5    . DC  B 2 14  ? 28.820  -1.558  29.812 1.00 39.23  ? 14   DC  T C5    1 
ATOM   7657 C  C6    . DC  B 2 14  ? 28.575  -0.502  29.022 1.00 40.58  ? 14   DC  T C6    1 
ATOM   7658 P  P     . DC  B 2 15  ? 29.458  4.934   26.059 1.00 68.30  ? 15   DC  T P     1 
ATOM   7659 O  OP1   . DC  B 2 15  ? 28.942  6.224   25.542 1.00 68.81  ? 15   DC  T OP1   1 
ATOM   7660 O  OP2   . DC  B 2 15  ? 30.262  4.058   25.167 1.00 67.27  ? 15   DC  T OP2   1 
ATOM   7661 O  "O5'" . DC  B 2 15  ? 30.290  5.160   27.414 1.00 65.41  ? 15   DC  T "O5'" 1 
ATOM   7662 C  "C5'" . DC  B 2 15  ? 29.704  5.939   28.469 1.00 64.37  ? 15   DC  T "C5'" 1 
ATOM   7663 C  "C4'" . DC  B 2 15  ? 30.431  5.750   29.786 1.00 61.05  ? 15   DC  T "C4'" 1 
ATOM   7664 O  "O4'" . DC  B 2 15  ? 30.275  4.386   30.252 1.00 60.41  ? 15   DC  T "O4'" 1 
ATOM   7665 C  "C3'" . DC  B 2 15  ? 31.933  5.997   29.701 1.00 60.63  ? 15   DC  T "C3'" 1 
ATOM   7666 O  "O3'" . DC  B 2 15  ? 32.293  6.964   30.670 1.00 60.40  ? 15   DC  T "O3'" 1 
ATOM   7667 C  "C2'" . DC  B 2 15  ? 32.570  4.641   29.996 1.00 58.19  ? 15   DC  T "C2'" 1 
ATOM   7668 C  "C1'" . DC  B 2 15  ? 31.489  3.976   30.842 1.00 57.80  ? 15   DC  T "C1'" 1 
ATOM   7669 N  N1    . DC  B 2 15  ? 31.592  2.477   30.889 1.00 54.21  ? 15   DC  T N1    1 
ATOM   7670 C  C2    . DC  B 2 15  ? 31.605  1.817   32.131 1.00 51.90  ? 15   DC  T C2    1 
ATOM   7671 O  O2    . DC  B 2 15  ? 31.517  2.473   33.180 1.00 49.09  ? 15   DC  T O2    1 
ATOM   7672 N  N3    . DC  B 2 15  ? 31.715  0.461   32.143 1.00 51.18  ? 15   DC  T N3    1 
ATOM   7673 C  C4    . DC  B 2 15  ? 31.810  -0.225  30.996 1.00 51.26  ? 15   DC  T C4    1 
ATOM   7674 N  N4    . DC  B 2 15  ? 31.915  -1.558  31.064 1.00 51.06  ? 15   DC  T N4    1 
ATOM   7675 C  C5    . DC  B 2 15  ? 31.803  0.424   29.724 1.00 50.79  ? 15   DC  T C5    1 
ATOM   7676 C  C6    . DC  B 2 15  ? 31.694  1.759   29.724 1.00 53.56  ? 15   DC  T C6    1 
ATOM   7677 P  P     . DG  B 2 16  ? 33.658  7.794   30.538 1.00 59.33  ? 16   DG  T P     1 
ATOM   7678 O  OP1   . DG  B 2 16  ? 33.312  9.229   30.617 1.00 58.56  ? 16   DG  T OP1   1 
ATOM   7679 O  OP2   . DG  B 2 16  ? 34.468  7.270   29.403 1.00 53.35  ? 16   DG  T OP2   1 
ATOM   7680 O  "O5'" . DG  B 2 16  ? 34.362  7.375   31.906 1.00 57.99  ? 16   DG  T "O5'" 1 
ATOM   7681 C  "C5'" . DG  B 2 16  ? 33.632  7.432   33.131 1.00 54.86  ? 16   DG  T "C5'" 1 
ATOM   7682 C  "C4'" . DG  B 2 16  ? 34.413  6.710   34.214 1.00 53.67  ? 16   DG  T "C4'" 1 
ATOM   7683 O  "O4'" . DG  B 2 16  ? 34.261  5.276   34.062 1.00 52.55  ? 16   DG  T "O4'" 1 
ATOM   7684 C  "C3'" . DG  B 2 16  ? 35.916  6.984   34.195 1.00 54.94  ? 16   DG  T "C3'" 1 
ATOM   7685 O  "O3'" . DG  B 2 16  ? 36.329  7.292   35.523 1.00 54.76  ? 16   DG  T "O3'" 1 
ATOM   7686 C  "C2'" . DG  B 2 16  ? 36.541  5.697   33.643 1.00 53.02  ? 16   DG  T "C2'" 1 
ATOM   7687 C  "C1'" . DG  B 2 16  ? 35.524  4.641   34.071 1.00 52.61  ? 16   DG  T "C1'" 1 
ATOM   7688 N  N9    . DG  B 2 16  ? 35.409  3.485   33.183 1.00 52.30  ? 16   DG  T N9    1 
ATOM   7689 C  C8    . DG  B 2 16  ? 35.349  3.494   31.809 1.00 49.27  ? 16   DG  T C8    1 
ATOM   7690 N  N7    . DG  B 2 16  ? 35.239  2.306   31.291 1.00 49.32  ? 16   DG  T N7    1 
ATOM   7691 C  C5    . DG  B 2 16  ? 35.221  1.450   32.386 1.00 49.13  ? 16   DG  T C5    1 
ATOM   7692 C  C6    . DG  B 2 16  ? 35.117  0.036   32.440 1.00 48.60  ? 16   DG  T C6    1 
ATOM   7693 O  O6    . DG  B 2 16  ? 35.016  -0.756  31.488 1.00 48.64  ? 16   DG  T O6    1 
ATOM   7694 N  N1    . DG  B 2 16  ? 35.138  -0.439  33.757 1.00 47.69  ? 16   DG  T N1    1 
ATOM   7695 C  C2    . DG  B 2 16  ? 35.249  0.362   34.881 1.00 48.99  ? 16   DG  T C2    1 
ATOM   7696 N  N2    . DG  B 2 16  ? 35.251  -0.254  36.076 1.00 46.11  ? 16   DG  T N2    1 
ATOM   7697 N  N3    . DG  B 2 16  ? 35.348  1.688   34.835 1.00 47.86  ? 16   DG  T N3    1 
ATOM   7698 C  C4    . DG  B 2 16  ? 35.326  2.162   33.562 1.00 49.67  ? 16   DG  T C4    1 
ATOM   7699 P  P     . DC  B 2 17  ? 37.799  7.845   35.808 1.00 56.30  ? 17   DC  T P     1 
ATOM   7700 O  OP1   . DC  B 2 17  ? 37.799  8.474   37.149 1.00 55.92  ? 17   DC  T OP1   1 
ATOM   7701 O  OP2   . DC  B 2 17  ? 38.240  8.604   34.612 1.00 54.06  ? 17   DC  T OP2   1 
ATOM   7702 O  "O5'" . DC  B 2 17  ? 38.657  6.491   35.908 1.00 55.45  ? 17   DC  T "O5'" 1 
ATOM   7703 C  "C5'" . DC  B 2 17  ? 38.705  5.753   37.129 1.00 50.86  ? 17   DC  T "C5'" 1 
ATOM   7704 C  "C4'" . DC  B 2 17  ? 39.366  4.408   36.904 1.00 48.46  ? 17   DC  T "C4'" 1 
ATOM   7705 O  "O4'" . DC  B 2 17  ? 38.667  3.707   35.844 1.00 46.17  ? 17   DC  T "O4'" 1 
ATOM   7706 C  "C3'" . DC  B 2 17  ? 40.837  4.473   36.473 1.00 48.76  ? 17   DC  T "C3'" 1 
ATOM   7707 O  "O3'" . DC  B 2 17  ? 41.606  3.571   37.268 1.00 47.11  ? 17   DC  T "O3'" 1 
ATOM   7708 C  "C2'" . DC  B 2 17  ? 40.803  4.006   35.018 1.00 47.49  ? 17   DC  T "C2'" 1 
ATOM   7709 C  "C1'" . DC  B 2 17  ? 39.669  2.996   35.152 1.00 47.33  ? 17   DC  T "C1'" 1 
ATOM   7710 N  N1    . DC  B 2 17  ? 39.191  2.351   33.879 1.00 45.08  ? 17   DC  T N1    1 
ATOM   7711 C  C2    . DC  B 2 17  ? 38.832  0.991   33.902 1.00 44.32  ? 17   DC  T C2    1 
ATOM   7712 O  O2    . DC  B 2 17  ? 38.890  0.364   34.962 1.00 44.13  ? 17   DC  T O2    1 
ATOM   7713 N  N3    . DC  B 2 17  ? 38.419  0.393   32.753 1.00 45.30  ? 17   DC  T N3    1 
ATOM   7714 C  C4    . DC  B 2 17  ? 38.362  1.098   31.620 1.00 45.97  ? 17   DC  T C4    1 
ATOM   7715 N  N4    . DC  B 2 17  ? 37.939  0.469   30.523 1.00 47.95  ? 17   DC  T N4    1 
ATOM   7716 C  C5    . DC  B 2 17  ? 38.725  2.480   31.569 1.00 44.77  ? 17   DC  T C5    1 
ATOM   7717 C  C6    . DC  B 2 17  ? 39.133  3.059   32.708 1.00 43.80  ? 17   DC  T C6    1 
ATOM   7718 P  P     . DG  B 2 18  ? 43.080  3.928   37.780 1.00 42.52  ? 18   DG  T P     1 
ATOM   7719 O  OP1   . DG  B 2 18  ? 43.781  2.656   38.048 1.00 48.53  ? 18   DG  T OP1   1 
ATOM   7720 O  OP2   . DG  B 2 18  ? 42.953  4.924   38.855 1.00 45.70  ? 18   DG  T OP2   1 
ATOM   7721 O  "O5'" . DG  B 2 18  ? 43.739  4.637   36.510 1.00 42.26  ? 18   DG  T "O5'" 1 
ATOM   7722 C  "C5'" . DG  B 2 18  ? 45.129  4.882   36.465 1.00 35.98  ? 18   DG  T "C5'" 1 
ATOM   7723 C  "C4'" . DG  B 2 18  ? 45.598  4.754   35.029 1.00 33.91  ? 18   DG  T "C4'" 1 
ATOM   7724 O  "O4'" . DG  B 2 18  ? 46.892  5.398   34.848 1.00 27.80  ? 18   DG  T "O4'" 1 
ATOM   7725 C  "C3'" . DG  B 2 18  ? 45.775  3.316   34.572 1.00 32.85  ? 18   DG  T "C3'" 1 
ATOM   7726 O  "O3'" . DG  B 2 18  ? 45.498  3.237   33.166 1.00 33.32  ? 18   DG  T "O3'" 1 
ATOM   7727 C  "C2'" . DG  B 2 18  ? 47.245  3.078   34.912 1.00 29.91  ? 18   DG  T "C2'" 1 
ATOM   7728 C  "C1'" . DG  B 2 18  ? 47.858  4.418   34.508 1.00 28.95  ? 18   DG  T "C1'" 1 
ATOM   7729 N  N9    . DG  B 2 18  ? 49.110  4.810   35.151 1.00 24.66  ? 18   DG  T N9    1 
ATOM   7730 C  C8    . DG  B 2 18  ? 50.264  5.161   34.497 1.00 26.98  ? 18   DG  T C8    1 
ATOM   7731 N  N7    . DG  B 2 18  ? 51.246  5.485   35.297 1.00 28.41  ? 18   DG  T N7    1 
ATOM   7732 C  C5    . DG  B 2 18  ? 50.694  5.354   36.569 1.00 26.42  ? 18   DG  T C5    1 
ATOM   7733 C  C6    . DG  B 2 18  ? 51.275  5.581   37.845 1.00 24.92  ? 18   DG  T C6    1 
ATOM   7734 O  O6    . DG  B 2 18  ? 52.422  5.950   38.119 1.00 25.51  ? 18   DG  T O6    1 
ATOM   7735 N  N1    . DG  B 2 18  ? 50.383  5.336   38.884 1.00 23.86  ? 18   DG  T N1    1 
ATOM   7736 C  C2    . DG  B 2 18  ? 49.087  4.919   38.717 1.00 22.08  ? 18   DG  T C2    1 
ATOM   7737 N  N2    . DG  B 2 18  ? 48.403  4.740   39.848 1.00 23.89  ? 18   DG  T N2    1 
ATOM   7738 N  N3    . DG  B 2 18  ? 48.520  4.701   37.536 1.00 23.05  ? 18   DG  T N3    1 
ATOM   7739 C  C4    . DG  B 2 18  ? 49.376  4.943   36.500 1.00 24.99  ? 18   DG  T C4    1 
ATOM   7740 O  "O5'" . DG  C 3 1   ? 39.695  -10.613 33.839 1.00 86.99  ? 103  DG  P "O5'" 1 
ATOM   7741 C  "C5'" . DG  C 3 1   ? 39.636  -10.369 35.240 1.00 88.12  ? 103  DG  P "C5'" 1 
ATOM   7742 C  "C4'" . DG  C 3 1   ? 38.737  -9.183  35.562 1.00 88.37  ? 103  DG  P "C4'" 1 
ATOM   7743 O  "O4'" . DG  C 3 1   ? 38.964  -8.088  34.630 1.00 86.61  ? 103  DG  P "O4'" 1 
ATOM   7744 C  "C3'" . DG  C 3 1   ? 37.230  -9.472  35.531 1.00 89.10  ? 103  DG  P "C3'" 1 
ATOM   7745 O  "O3'" . DG  C 3 1   ? 36.613  -8.997  36.733 1.00 91.90  ? 103  DG  P "O3'" 1 
ATOM   7746 C  "C2'" . DG  C 3 1   ? 36.746  -8.656  34.334 1.00 87.40  ? 103  DG  P "C2'" 1 
ATOM   7747 C  "C1'" . DG  C 3 1   ? 37.707  -7.475  34.434 1.00 84.39  ? 103  DG  P "C1'" 1 
ATOM   7748 N  N9    . DG  C 3 1   ? 37.702  -6.546  33.295 1.00 79.39  ? 103  DG  P N9    1 
ATOM   7749 C  C8    . DG  C 3 1   ? 37.545  -6.842  31.959 1.00 78.09  ? 103  DG  P C8    1 
ATOM   7750 N  N7    . DG  C 3 1   ? 37.571  -5.793  31.182 1.00 76.70  ? 103  DG  P N7    1 
ATOM   7751 C  C5    . DG  C 3 1   ? 37.755  -4.723  32.053 1.00 74.12  ? 103  DG  P C5    1 
ATOM   7752 C  C6    . DG  C 3 1   ? 37.861  -3.325  31.795 1.00 70.26  ? 103  DG  P C6    1 
ATOM   7753 O  O6    . DG  C 3 1   ? 37.816  -2.734  30.707 1.00 67.13  ? 103  DG  P O6    1 
ATOM   7754 N  N1    . DG  C 3 1   ? 38.041  -2.584  32.966 1.00 68.47  ? 103  DG  P N1    1 
ATOM   7755 C  C2    . DG  C 3 1   ? 38.109  -3.129  34.233 1.00 68.91  ? 103  DG  P C2    1 
ATOM   7756 N  N2    . DG  C 3 1   ? 38.288  -2.267  35.243 1.00 66.13  ? 103  DG  P N2    1 
ATOM   7757 N  N3    . DG  C 3 1   ? 38.010  -4.432  34.489 1.00 70.83  ? 103  DG  P N3    1 
ATOM   7758 C  C4    . DG  C 3 1   ? 37.836  -5.173  33.359 1.00 75.14  ? 103  DG  P C4    1 
ATOM   7759 P  P     . DC  C 3 2   ? 36.422  -9.926  38.028 1.00 93.52  ? 104  DC  P P     1 
ATOM   7760 O  OP1   . DC  C 3 2   ? 37.757  -10.384 38.481 1.00 92.89  ? 104  DC  P OP1   1 
ATOM   7761 O  OP2   . DC  C 3 2   ? 35.376  -10.920 37.697 1.00 93.92  ? 104  DC  P OP2   1 
ATOM   7762 O  "O5'" . DC  C 3 2   ? 35.807  -8.936  39.134 1.00 92.96  ? 104  DC  P "O5'" 1 
ATOM   7763 C  "C5'" . DC  C 3 2   ? 36.388  -7.658  39.418 1.00 89.77  ? 104  DC  P "C5'" 1 
ATOM   7764 C  "C4'" . DC  C 3 2   ? 35.396  -6.527  39.188 1.00 88.04  ? 104  DC  P "C4'" 1 
ATOM   7765 O  "O4'" . DC  C 3 2   ? 35.615  -5.923  37.882 1.00 86.01  ? 104  DC  P "O4'" 1 
ATOM   7766 C  "C3'" . DC  C 3 2   ? 33.909  -6.914  39.227 1.00 88.13  ? 104  DC  P "C3'" 1 
ATOM   7767 O  "O3'" . DC  C 3 2   ? 33.155  -5.974  39.991 1.00 89.49  ? 104  DC  P "O3'" 1 
ATOM   7768 C  "C2'" . DC  C 3 2   ? 33.493  -6.816  37.759 1.00 86.01  ? 104  DC  P "C2'" 1 
ATOM   7769 C  "C1'" . DC  C 3 2   ? 34.329  -5.596  37.393 1.00 83.14  ? 104  DC  P "C1'" 1 
ATOM   7770 N  N1    . DC  C 3 2   ? 34.348  -5.130  35.950 1.00 77.93  ? 104  DC  P N1    1 
ATOM   7771 C  C2    . DC  C 3 2   ? 34.648  -3.780  35.692 1.00 73.93  ? 104  DC  P C2    1 
ATOM   7772 O  O2    . DC  C 3 2   ? 34.894  -3.017  36.632 1.00 70.39  ? 104  DC  P O2    1 
ATOM   7773 N  N3    . DC  C 3 2   ? 34.666  -3.337  34.408 1.00 73.38  ? 104  DC  P N3    1 
ATOM   7774 C  C4    . DC  C 3 2   ? 34.396  -4.179  33.405 1.00 72.69  ? 104  DC  P C4    1 
ATOM   7775 N  N4    . DC  C 3 2   ? 34.429  -3.685  32.164 1.00 70.00  ? 104  DC  P N4    1 
ATOM   7776 C  C5    . DC  C 3 2   ? 34.083  -5.558  33.640 1.00 74.27  ? 104  DC  P C5    1 
ATOM   7777 C  C6    . DC  C 3 2   ? 34.068  -5.986  34.913 1.00 75.64  ? 104  DC  P C6    1 
ATOM   7778 P  P     . DG  C 3 3   ? 33.209  -5.878  41.588 1.00 91.67  ? 105  DG  P P     1 
ATOM   7779 O  OP1   . DG  C 3 3   ? 34.503  -5.263  41.974 1.00 91.85  ? 105  DG  P OP1   1 
ATOM   7780 O  OP2   . DG  C 3 3   ? 32.838  -7.195  42.151 1.00 90.85  ? 105  DG  P OP2   1 
ATOM   7781 O  "O5'" . DG  C 3 3   ? 32.000  -4.854  41.863 1.00 90.85  ? 105  DG  P "O5'" 1 
ATOM   7782 C  "C5'" . DG  C 3 3   ? 32.134  -3.759  42.777 1.00 89.66  ? 105  DG  P "C5'" 1 
ATOM   7783 C  "C4'" . DG  C 3 3   ? 31.987  -2.407  42.096 1.00 87.22  ? 105  DG  P "C4'" 1 
ATOM   7784 O  "O4'" . DG  C 3 3   ? 32.755  -2.342  40.868 1.00 84.45  ? 105  DG  P "O4'" 1 
ATOM   7785 C  "C3'" . DG  C 3 3   ? 30.582  -2.046  41.627 1.00 88.22  ? 105  DG  P "C3'" 1 
ATOM   7786 O  "O3'" . DG  C 3 3   ? 29.697  -1.728  42.726 1.00 88.17  ? 105  DG  P "O3'" 1 
ATOM   7787 C  "C2'" . DG  C 3 3   ? 30.889  -0.882  40.685 1.00 86.29  ? 105  DG  P "C2'" 1 
ATOM   7788 C  "C1'" . DG  C 3 3   ? 32.163  -1.373  40.009 1.00 83.73  ? 105  DG  P "C1'" 1 
ATOM   7789 N  N9    . DG  C 3 3   ? 31.948  -1.930  38.666 1.00 80.24  ? 105  DG  P N9    1 
ATOM   7790 C  C8    . DG  C 3 3   ? 31.811  -3.258  38.336 1.00 78.20  ? 105  DG  P C8    1 
ATOM   7791 N  N7    . DG  C 3 3   ? 31.643  -3.467  37.059 1.00 76.16  ? 105  DG  P N7    1 
ATOM   7792 C  C5    . DG  C 3 3   ? 31.672  -2.199  36.495 1.00 74.46  ? 105  DG  P C5    1 
ATOM   7793 C  C6    . DG  C 3 3   ? 31.543  -1.801  35.136 1.00 72.26  ? 105  DG  P C6    1 
ATOM   7794 O  O6    . DG  C 3 3   ? 31.370  -2.523  34.142 1.00 70.15  ? 105  DG  P O6    1 
ATOM   7795 N  N1    . DG  C 3 3   ? 31.624  -0.415  34.985 1.00 68.77  ? 105  DG  P N1    1 
ATOM   7796 C  C2    . DG  C 3 3   ? 31.812  0.473   36.021 1.00 70.31  ? 105  DG  P C2    1 
ATOM   7797 N  N2    . DG  C 3 3   ? 31.870  1.773   35.692 1.00 67.61  ? 105  DG  P N2    1 
ATOM   7798 N  N3    . DG  C 3 3   ? 31.935  0.110   37.297 1.00 73.40  ? 105  DG  P N3    1 
ATOM   7799 C  C4    . DG  C 3 3   ? 31.857  -1.238  37.468 1.00 75.89  ? 105  DG  P C4    1 
ATOM   7800 P  P     . DG  C 3 4   ? 29.671  -0.325  43.511 1.00 89.29  ? 106  DG  P P     1 
ATOM   7801 O  OP1   . DG  C 3 4   ? 31.054  0.009   43.932 1.00 88.43  ? 106  DG  P OP1   1 
ATOM   7802 O  OP2   . DG  C 3 4   ? 28.594  -0.429  44.524 1.00 88.90  ? 106  DG  P OP2   1 
ATOM   7803 O  "O5'" . DG  C 3 4   ? 29.178  0.735   42.417 1.00 84.42  ? 106  DG  P "O5'" 1 
ATOM   7804 C  "C5'" . DG  C 3 4   ? 29.512  2.112   42.534 1.00 78.80  ? 106  DG  P "C5'" 1 
ATOM   7805 C  "C4'" . DG  C 3 4   ? 28.892  2.890   41.389 1.00 75.58  ? 106  DG  P "C4'" 1 
ATOM   7806 O  "O4'" . DG  C 3 4   ? 29.162  2.224   40.125 1.00 73.58  ? 106  DG  P "O4'" 1 
ATOM   7807 C  "C3'" . DG  C 3 4   ? 27.378  3.047   41.475 1.00 74.61  ? 106  DG  P "C3'" 1 
ATOM   7808 O  "O3'" . DG  C 3 4   ? 27.065  4.405   41.191 1.00 75.84  ? 106  DG  P "O3'" 1 
ATOM   7809 C  "C2'" . DG  C 3 4   ? 26.842  2.074   40.417 1.00 72.36  ? 106  DG  P "C2'" 1 
ATOM   7810 C  "C1'" . DG  C 3 4   ? 27.961  2.095   39.379 1.00 70.09  ? 106  DG  P "C1'" 1 
ATOM   7811 N  N9    . DG  C 3 4   ? 28.077  0.909   38.522 1.00 62.52  ? 106  DG  P N9    1 
ATOM   7812 C  C8    . DG  C 3 4   ? 28.154  -0.408  38.917 1.00 59.68  ? 106  DG  P C8    1 
ATOM   7813 N  N7    . DG  C 3 4   ? 28.268  -1.250  37.927 1.00 55.42  ? 106  DG  P N7    1 
ATOM   7814 C  C5    . DG  C 3 4   ? 28.266  -0.447  36.795 1.00 53.60  ? 106  DG  P C5    1 
ATOM   7815 C  C6    . DG  C 3 4   ? 28.363  -0.794  35.422 1.00 50.26  ? 106  DG  P C6    1 
ATOM   7816 O  O6    . DG  C 3 4   ? 28.465  -1.922  34.920 1.00 50.61  ? 106  DG  P O6    1 
ATOM   7817 N  N1    . DG  C 3 4   ? 28.319  0.323   34.590 1.00 48.03  ? 106  DG  P N1    1 
ATOM   7818 C  C2    . DG  C 3 4   ? 28.203  1.621   35.034 1.00 49.62  ? 106  DG  P C2    1 
ATOM   7819 N  N2    . DG  C 3 4   ? 28.175  2.573   34.089 1.00 49.54  ? 106  DG  P N2    1 
ATOM   7820 N  N3    . DG  C 3 4   ? 28.113  1.961   36.318 1.00 51.83  ? 106  DG  P N3    1 
ATOM   7821 C  C4    . DG  C 3 4   ? 28.151  0.884   37.144 1.00 55.96  ? 106  DG  P C4    1 
ATOM   7822 P  P     . DA  C 3 5   ? 25.575  4.986   41.302 1.00 77.63  ? 107  DA  P P     1 
ATOM   7823 O  OP1   . DA  C 3 5   ? 25.674  6.349   41.878 1.00 77.83  ? 107  DA  P OP1   1 
ATOM   7824 O  OP2   . DA  C 3 5   ? 24.678  3.988   41.933 1.00 76.94  ? 107  DA  P OP2   1 
ATOM   7825 O  "O5'" . DA  C 3 5   ? 25.166  5.090   39.763 1.00 75.70  ? 107  DA  P "O5'" 1 
ATOM   7826 C  "C5'" . DA  C 3 5   ? 25.643  6.163   38.956 1.00 72.47  ? 107  DA  P "C5'" 1 
ATOM   7827 C  "C4'" . DA  C 3 5   ? 24.914  6.170   37.625 1.00 68.18  ? 107  DA  P "C4'" 1 
ATOM   7828 O  "O4'" . DA  C 3 5   ? 25.255  4.979   36.865 1.00 64.66  ? 107  DA  P "O4'" 1 
ATOM   7829 C  "C3'" . DA  C 3 5   ? 23.396  6.162   37.728 1.00 67.31  ? 107  DA  P "C3'" 1 
ATOM   7830 O  "O3'" . DA  C 3 5   ? 22.881  6.902   36.642 1.00 69.33  ? 107  DA  P "O3'" 1 
ATOM   7831 C  "C2'" . DA  C 3 5   ? 23.044  4.683   37.604 1.00 63.63  ? 107  DA  P "C2'" 1 
ATOM   7832 C  "C1'" . DA  C 3 5   ? 24.080  4.247   36.572 1.00 59.54  ? 107  DA  P "C1'" 1 
ATOM   7833 N  N9    . DA  C 3 5   ? 24.406  2.825   36.604 1.00 51.31  ? 107  DA  P N9    1 
ATOM   7834 C  C8    . DA  C 3 5   ? 24.597  2.043   37.709 1.00 48.52  ? 107  DA  P C8    1 
ATOM   7835 N  N7    . DA  C 3 5   ? 24.879  0.795   37.425 1.00 47.40  ? 107  DA  P N7    1 
ATOM   7836 C  C5    . DA  C 3 5   ? 24.878  0.764   36.041 1.00 41.24  ? 107  DA  P C5    1 
ATOM   7837 C  C6    . DA  C 3 5   ? 25.106  -0.268  35.118 1.00 38.04  ? 107  DA  P C6    1 
ATOM   7838 N  N6    . DA  C 3 5   ? 25.395  -1.521  35.490 1.00 38.00  ? 107  DA  P N6    1 
ATOM   7839 N  N1    . DA  C 3 5   ? 25.023  0.034   33.797 1.00 39.97  ? 107  DA  P N1    1 
ATOM   7840 C  C2    . DA  C 3 5   ? 24.734  1.288   33.415 1.00 38.31  ? 107  DA  P C2    1 
ATOM   7841 N  N3    . DA  C 3 5   ? 24.497  2.339   34.204 1.00 43.33  ? 107  DA  P N3    1 
ATOM   7842 C  C4    . DA  C 3 5   ? 24.587  2.007   35.513 1.00 45.22  ? 107  DA  P C4    1 
ATOM   7843 P  P     . DC  C 3 6   ? 21.360  7.368   36.675 1.00 73.07  ? 108  DC  P P     1 
ATOM   7844 O  OP1   . DC  C 3 6   ? 21.223  8.442   35.659 1.00 71.80  ? 108  DC  P OP1   1 
ATOM   7845 O  OP2   . DC  C 3 6   ? 20.993  7.607   38.091 1.00 72.90  ? 108  DC  P OP2   1 
ATOM   7846 O  "O5'" . DC  C 3 6   ? 20.556  6.062   36.218 1.00 69.32  ? 108  DC  P "O5'" 1 
ATOM   7847 C  "C5'" . DC  C 3 6   ? 19.649  6.125   35.127 1.00 64.12  ? 108  DC  P "C5'" 1 
ATOM   7848 C  "C4'" . DC  C 3 6   ? 20.061  5.182   34.012 1.00 59.11  ? 108  DC  P "C4'" 1 
ATOM   7849 O  "O4'" . DC  C 3 6   ? 21.127  4.289   34.431 1.00 55.67  ? 108  DC  P "O4'" 1 
ATOM   7850 C  "C3'" . DC  C 3 6   ? 18.954  4.233   33.610 1.00 55.83  ? 108  DC  P "C3'" 1 
ATOM   7851 O  "O3'" . DC  C 3 6   ? 18.053  4.873   32.725 1.00 53.83  ? 108  DC  P "O3'" 1 
ATOM   7852 C  "C2'" . DC  C 3 6   ? 19.724  3.108   32.926 1.00 55.04  ? 108  DC  P "C2'" 1 
ATOM   7853 C  "C1'" . DC  C 3 6   ? 21.051  3.087   33.678 1.00 51.95  ? 108  DC  P "C1'" 1 
ATOM   7854 N  N1    . DC  C 3 6   ? 21.268  1.876   34.564 1.00 47.84  ? 108  DC  P N1    1 
ATOM   7855 C  C2    . DC  C 3 6   ? 21.508  0.616   33.989 1.00 44.32  ? 108  DC  P C2    1 
ATOM   7856 O  O2    . DC  C 3 6   ? 21.526  0.500   32.756 1.00 45.00  ? 108  DC  P O2    1 
ATOM   7857 N  N3    . DC  C 3 6   ? 21.719  -0.455  34.800 1.00 44.03  ? 108  DC  P N3    1 
ATOM   7858 C  C4    . DC  C 3 6   ? 21.692  -0.304  36.129 1.00 45.68  ? 108  DC  P C4    1 
ATOM   7859 N  N4    . DC  C 3 6   ? 21.902  -1.381  36.897 1.00 41.25  ? 108  DC  P N4    1 
ATOM   7860 C  C5    . DC  C 3 6   ? 21.444  0.969   36.733 1.00 46.89  ? 108  DC  P C5    1 
ATOM   7861 C  C6    . DC  C 3 6   ? 21.238  2.014   35.924 1.00 46.82  ? 108  DC  P C6    1 
ATOM   7862 P  P     . DT  C 3 7   ? 16.600  4.227   32.504 1.00 53.98  ? 109  DT  P P     1 
ATOM   7863 O  OP1   . DT  C 3 7   ? 15.778  5.206   31.761 1.00 53.13  ? 109  DT  P OP1   1 
ATOM   7864 O  OP2   . DT  C 3 7   ? 16.126  3.669   33.795 1.00 51.07  ? 109  DT  P OP2   1 
ATOM   7865 O  "O5'" . DT  C 3 7   ? 16.894  2.970   31.558 1.00 51.17  ? 109  DT  P "O5'" 1 
ATOM   7866 C  "C5'" . DT  C 3 7   ? 17.419  3.082   30.235 1.00 49.38  ? 109  DT  P "C5'" 1 
ATOM   7867 C  "C4'" . DT  C 3 7   ? 17.348  1.714   29.573 1.00 48.69  ? 109  DT  P "C4'" 1 
ATOM   7868 O  "O4'" . DT  C 3 7   ? 18.091  0.757   30.382 1.00 48.42  ? 109  DT  P "O4'" 1 
ATOM   7869 C  "C3'" . DT  C 3 7   ? 15.929  1.154   29.419 1.00 46.71  ? 109  DT  P "C3'" 1 
ATOM   7870 O  "O3'" . DT  C 3 7   ? 15.743  0.613   28.097 1.00 47.04  ? 109  DT  P "O3'" 1 
ATOM   7871 C  "C2'" . DT  C 3 7   ? 15.811  0.104   30.531 1.00 46.03  ? 109  DT  P "C2'" 1 
ATOM   7872 C  "C1'" . DT  C 3 7   ? 17.265  -0.357  30.696 1.00 46.27  ? 109  DT  P "C1'" 1 
ATOM   7873 N  N1    . DT  C 3 7   ? 17.648  -0.901  32.065 1.00 42.44  ? 109  DT  P N1    1 
ATOM   7874 C  C2    . DT  C 3 7   ? 18.138  -2.201  32.164 1.00 39.02  ? 109  DT  P C2    1 
ATOM   7875 O  O2    . DT  C 3 7   ? 18.281  -2.959  31.220 1.00 39.98  ? 109  DT  P O2    1 
ATOM   7876 N  N3    . DT  C 3 7   ? 18.466  -2.599  33.438 1.00 35.06  ? 109  DT  P N3    1 
ATOM   7877 C  C4    . DT  C 3 7   ? 18.358  -1.863  34.600 1.00 31.95  ? 109  DT  P C4    1 
ATOM   7878 O  O4    . DT  C 3 7   ? 18.678  -2.316  35.688 1.00 32.21  ? 109  DT  P O4    1 
ATOM   7879 C  C5    . DT  C 3 7   ? 17.848  -0.526  34.443 1.00 33.91  ? 109  DT  P C5    1 
ATOM   7880 C  C7    . DT  C 3 7   ? 17.702  0.342   35.660 1.00 35.96  ? 109  DT  P C7    1 
ATOM   7881 C  C6    . DT  C 3 7   ? 17.520  -0.107  33.202 1.00 36.43  ? 109  DT  P C6    1 
ATOM   7882 P  P     . DG  C 3 8   ? 14.354  -0.054  27.625 1.00 46.27  ? 110  DG  P P     1 
ATOM   7883 O  OP1   . DG  C 3 8   ? 14.395  -0.190  26.154 1.00 46.39  ? 110  DG  P OP1   1 
ATOM   7884 O  OP2   . DG  C 3 8   ? 13.230  0.673   28.252 1.00 48.71  ? 110  DG  P OP2   1 
ATOM   7885 O  "O5'" . DG  C 3 8   ? 14.435  -1.513  28.275 1.00 43.61  ? 110  DG  P "O5'" 1 
ATOM   7886 C  "C5'" . DG  C 3 8   ? 15.403  -2.440  27.746 1.00 43.15  ? 110  DG  P "C5'" 1 
ATOM   7887 C  "C4'" . DG  C 3 8   ? 15.178  -3.855  28.239 1.00 40.23  ? 110  DG  P "C4'" 1 
ATOM   7888 O  "O4'" . DG  C 3 8   ? 15.679  -3.981  29.590 1.00 36.91  ? 110  DG  P "O4'" 1 
ATOM   7889 C  "C3'" . DG  C 3 8   ? 13.722  -4.307  28.247 1.00 39.01  ? 110  DG  P "C3'" 1 
ATOM   7890 O  "O3'" . DG  C 3 8   ? 13.677  -5.415  27.356 1.00 39.94  ? 110  DG  P "O3'" 1 
ATOM   7891 C  "C2'" . DG  C 3 8   ? 13.421  -4.644  29.714 1.00 37.98  ? 110  DG  P "C2'" 1 
ATOM   7892 C  "C1'" . DG  C 3 8   ? 14.810  -4.798  30.343 1.00 37.77  ? 110  DG  P "C1'" 1 
ATOM   7893 N  N9    . DG  C 3 8   ? 14.963  -4.346  31.732 1.00 35.69  ? 110  DG  P N9    1 
ATOM   7894 C  C8    . DG  C 3 8   ? 14.625  -3.115  32.247 1.00 31.52  ? 110  DG  P C8    1 
ATOM   7895 N  N7    . DG  C 3 8   ? 14.888  -2.998  33.520 1.00 33.83  ? 110  DG  P N7    1 
ATOM   7896 C  C5    . DG  C 3 8   ? 15.444  -4.223  33.877 1.00 31.81  ? 110  DG  P C5    1 
ATOM   7897 C  C6    . DG  C 3 8   ? 15.932  -4.689  35.129 1.00 33.17  ? 110  DG  P C6    1 
ATOM   7898 O  O6    . DG  C 3 8   ? 15.976  -4.085  36.204 1.00 33.80  ? 110  DG  P O6    1 
ATOM   7899 N  N1    . DG  C 3 8   ? 16.421  -5.996  35.074 1.00 31.61  ? 110  DG  P N1    1 
ATOM   7900 C  C2    . DG  C 3 8   ? 16.425  -6.753  33.923 1.00 36.01  ? 110  DG  P C2    1 
ATOM   7901 N  N2    . DG  C 3 8   ? 16.931  -7.985  34.037 1.00 35.73  ? 110  DG  P N2    1 
ATOM   7902 N  N3    . DG  C 3 8   ? 15.980  -6.333  32.735 1.00 35.63  ? 110  DG  P N3    1 
ATOM   7903 C  C4    . DG  C 3 8   ? 15.505  -5.060  32.783 1.00 33.97  ? 110  DG  P C4    1 
ATOM   7904 P  P     . DC  C 3 9   ? 12.354  -6.259  27.085 1.00 41.57  ? 111  DC  P P     1 
ATOM   7905 O  OP1   . DC  C 3 9   ? 12.589  -6.986  25.817 1.00 41.68  ? 111  DC  P OP1   1 
ATOM   7906 O  OP2   . DC  C 3 9   ? 11.180  -5.365  27.231 1.00 47.52  ? 111  DC  P OP2   1 
ATOM   7907 O  "O5'" . DC  C 3 9   ? 12.295  -7.272  28.331 1.00 40.58  ? 111  DC  P "O5'" 1 
ATOM   7908 C  "C5'" . DC  C 3 9   ? 13.395  -8.143  28.639 1.00 39.31  ? 111  DC  P "C5'" 1 
ATOM   7909 C  "C4'" . DC  C 3 9   ? 13.205  -8.912  29.942 1.00 37.95  ? 111  DC  P "C4'" 1 
ATOM   7910 O  "O4'" . DC  C 3 9   ? 13.468  -8.063  31.087 1.00 36.17  ? 111  DC  P "O4'" 1 
ATOM   7911 C  "C3'" . DC  C 3 9   ? 11.811  -9.497  30.170 1.00 38.48  ? 111  DC  P "C3'" 1 
ATOM   7912 O  "O3'" . DC  C 3 9   ? 11.951  -10.907 30.198 1.00 39.96  ? 111  DC  P "O3'" 1 
ATOM   7913 C  "C2'" . DC  C 3 9   ? 11.353  -8.922  31.514 1.00 37.69  ? 111  DC  P "C2'" 1 
ATOM   7914 C  "C1'" . DC  C 3 9   ? 12.669  -8.503  32.162 1.00 36.14  ? 111  DC  P "C1'" 1 
ATOM   7915 N  N1    . DC  C 3 9   ? 12.584  -7.400  33.181 1.00 35.25  ? 111  DC  P N1    1 
ATOM   7916 C  C2    . DC  C 3 9   ? 13.013  -7.628  34.496 1.00 35.40  ? 111  DC  P C2    1 
ATOM   7917 O  O2    . DC  C 3 9   ? 13.453  -8.734  34.811 1.00 41.20  ? 111  DC  P O2    1 
ATOM   7918 N  N3    . DC  C 3 9   ? 12.931  -6.623  35.406 1.00 35.39  ? 111  DC  P N3    1 
ATOM   7919 C  C4    . DC  C 3 9   ? 12.457  -5.419  35.056 1.00 33.20  ? 111  DC  P C4    1 
ATOM   7920 N  N4    . DC  C 3 9   ? 12.408  -4.462  35.995 1.00 30.07  ? 111  DC  P N4    1 
ATOM   7921 C  C5    . DC  C 3 9   ? 12.009  -5.160  33.727 1.00 30.61  ? 111  DC  P C5    1 
ATOM   7922 C  C6    . DC  C 3 9   ? 12.099  -6.164  32.835 1.00 34.09  ? 111  DC  P C6    1 
ATOM   7923 P  P     . DT  C 3 10  ? 10.681  -11.879 30.255 1.00 41.46  ? 112  DT  P P     1 
ATOM   7924 O  OP1   . DT  C 3 10  ? 11.055  -13.069 29.469 1.00 40.90  ? 112  DT  P OP1   1 
ATOM   7925 O  OP2   . DT  C 3 10  ? 9.448   -11.141 29.922 1.00 37.57  ? 112  DT  P OP2   1 
ATOM   7926 O  "O5'" . DT  C 3 10  ? 10.621  -12.241 31.818 1.00 38.44  ? 112  DT  P "O5'" 1 
ATOM   7927 C  "C5'" . DT  C 3 10  ? 11.778  -12.699 32.504 1.00 34.41  ? 112  DT  P "C5'" 1 
ATOM   7928 C  "C4'" . DT  C 3 10  ? 11.500  -12.723 33.987 1.00 36.76  ? 112  DT  P "C4'" 1 
ATOM   7929 O  "O4'" . DT  C 3 10  ? 11.644  -11.395 34.536 1.00 37.12  ? 112  DT  P "O4'" 1 
ATOM   7930 C  "C3'" . DT  C 3 10  ? 10.090  -13.181 34.341 1.00 36.77  ? 112  DT  P "C3'" 1 
ATOM   7931 O  "O3'" . DT  C 3 10  ? 10.187  -14.417 35.009 1.00 37.84  ? 112  DT  P "O3'" 1 
ATOM   7932 C  "C2'" . DT  C 3 10  ? 9.532   -12.108 35.266 1.00 36.14  ? 112  DT  P "C2'" 1 
ATOM   7933 C  "C1'" . DT  C 3 10  ? 10.736  -11.244 35.601 1.00 32.53  ? 112  DT  P "C1'" 1 
ATOM   7934 N  N1    . DT  C 3 10  ? 10.363  -9.795  35.780 1.00 32.19  ? 112  DT  P N1    1 
ATOM   7935 C  C2    . DT  C 3 10  ? 10.690  -9.159  36.971 1.00 30.46  ? 112  DT  P C2    1 
ATOM   7936 O  O2    . DT  C 3 10  ? 11.276  -9.693  37.894 1.00 36.03  ? 112  DT  P O2    1 
ATOM   7937 N  N3    . DT  C 3 10  ? 10.305  -7.848  37.057 1.00 27.77  ? 112  DT  P N3    1 
ATOM   7938 C  C4    . DT  C 3 10  ? 9.649   -7.107  36.101 1.00 27.61  ? 112  DT  P C4    1 
ATOM   7939 O  O4    . DT  C 3 10  ? 9.364   -5.931  36.296 1.00 24.02  ? 112  DT  P O4    1 
ATOM   7940 C  C5    . DT  C 3 10  ? 9.331   -7.818  34.876 1.00 30.60  ? 112  DT  P C5    1 
ATOM   7941 C  C7    . DT  C 3 10  ? 8.605   -7.115  33.765 1.00 33.01  ? 112  DT  P C7    1 
ATOM   7942 C  C6    . DT  C 3 10  ? 9.693   -9.111  34.774 1.00 29.38  ? 112  DT  P C6    1 
ATOM   7943 P  P     . DT  C 3 11  ? 8.897   -15.248 35.409 1.00 34.34  ? 113  DT  P P     1 
ATOM   7944 O  OP1   . DT  C 3 11  ? 9.197   -16.661 35.143 1.00 34.96  ? 113  DT  P OP1   1 
ATOM   7945 O  OP2   . DT  C 3 11  ? 7.663   -14.651 34.875 1.00 42.57  ? 113  DT  P OP2   1 
ATOM   7946 O  "O5'" . DT  C 3 11  ? 8.798   -14.997 36.973 1.00 37.35  ? 113  DT  P "O5'" 1 
ATOM   7947 C  "C5'" . DT  C 3 11  ? 9.839   -15.432 37.798 1.00 34.54  ? 113  DT  P "C5'" 1 
ATOM   7948 C  "C4'" . DT  C 3 11  ? 9.806   -14.690 39.109 1.00 33.71  ? 113  DT  P "C4'" 1 
ATOM   7949 O  "O4'" . DT  C 3 11  ? 9.738   -13.257 38.907 1.00 31.04  ? 113  DT  P "O4'" 1 
ATOM   7950 C  "C3'" . DT  C 3 11  ? 8.618   -15.065 39.969 1.00 31.22  ? 113  DT  P "C3'" 1 
ATOM   7951 O  "O3'" . DT  C 3 11  ? 9.138   -15.686 41.131 1.00 27.51  ? 113  DT  P "O3'" 1 
ATOM   7952 C  "C2'" . DT  C 3 11  ? 7.943   -13.730 40.282 1.00 31.62  ? 113  DT  P "C2'" 1 
ATOM   7953 C  "C1'" . DT  C 3 11  ? 9.026   -12.696 39.977 1.00 29.73  ? 113  DT  P "C1'" 1 
ATOM   7954 N  N1    . DT  C 3 11  ? 8.438   -11.394 39.528 1.00 31.32  ? 113  DT  P N1    1 
ATOM   7955 C  C2    . DT  C 3 11  ? 8.602   -10.259 40.298 1.00 30.73  ? 113  DT  P C2    1 
ATOM   7956 O  O2    . DT  C 3 11  ? 9.212   -10.233 41.343 1.00 34.00  ? 113  DT  P O2    1 
ATOM   7957 N  N3    . DT  C 3 11  ? 8.007   -9.130  39.799 1.00 32.52  ? 113  DT  P N3    1 
ATOM   7958 C  C4    . DT  C 3 11  ? 7.274   -9.025  38.632 1.00 29.78  ? 113  DT  P C4    1 
ATOM   7959 O  O4    . DT  C 3 11  ? 6.793   -7.957  38.276 1.00 31.08  ? 113  DT  P O4    1 
ATOM   7960 C  C5    . DT  C 3 11  ? 7.138   -10.245 37.868 1.00 30.74  ? 113  DT  P C5    1 
ATOM   7961 C  C7    . DT  C 3 11  ? 6.365   -10.265 36.579 1.00 27.66  ? 113  DT  P C7    1 
ATOM   7962 C  C6    . DT  C 3 11  ? 7.715   -11.354 38.347 1.00 27.22  ? 113  DT  P C6    1 
ATOM   7963 P  P     . DA  C 3 12  ? 8.169   -16.245 42.261 1.00 29.23  ? 114  DA  P P     1 
ATOM   7964 O  OP1   . DA  C 3 12  ? 8.924   -17.360 42.877 1.00 31.50  ? 114  DA  P OP1   1 
ATOM   7965 O  OP2   . DA  C 3 12  ? 6.808   -16.459 41.709 1.00 32.26  ? 114  DA  P OP2   1 
ATOM   7966 O  "O5'" . DA  C 3 12  ? 8.019   -15.022 43.270 1.00 30.04  ? 114  DA  P "O5'" 1 
ATOM   7967 C  "C5'" . DA  C 3 12  ? 9.138   -14.425 43.917 1.00 27.63  ? 114  DA  P "C5'" 1 
ATOM   7968 C  "C4'" . DA  C 3 12  ? 8.631   -13.556 45.052 1.00 31.71  ? 114  DA  P "C4'" 1 
ATOM   7969 O  "O4'" . DA  C 3 12  ? 8.220   -12.277 44.494 1.00 31.10  ? 114  DA  P "O4'" 1 
ATOM   7970 C  "C3'" . DA  C 3 12  ? 7.416   -14.117 45.792 1.00 29.24  ? 114  DA  P "C3'" 1 
ATOM   7971 O  "O3'" . DA  C 3 12  ? 7.556   -14.005 47.209 1.00 30.84  ? 114  DA  P "O3'" 1 
ATOM   7972 C  "C2'" . DA  C 3 12  ? 6.241   -13.304 45.249 1.00 27.80  ? 114  DA  P "C2'" 1 
ATOM   7973 C  "C1'" . DA  C 3 12  ? 6.884   -11.988 44.841 1.00 30.09  ? 114  DA  P "C1'" 1 
ATOM   7974 N  N9    . DA  C 3 12  ? 6.251   -11.354 43.684 1.00 29.22  ? 114  DA  P N9    1 
ATOM   7975 C  C8    . DA  C 3 12  ? 5.846   -11.963 42.528 1.00 29.75  ? 114  DA  P C8    1 
ATOM   7976 N  N7    . DA  C 3 12  ? 5.315   -11.147 41.651 1.00 30.53  ? 114  DA  P N7    1 
ATOM   7977 C  C5    . DA  C 3 12  ? 5.375   -9.914  42.278 1.00 24.00  ? 114  DA  P C5    1 
ATOM   7978 C  C6    . DA  C 3 12  ? 4.963   -8.633  41.879 1.00 26.73  ? 114  DA  P C6    1 
ATOM   7979 N  N6    . DA  C 3 12  ? 4.387   -8.396  40.693 1.00 21.48  ? 114  DA  P N6    1 
ATOM   7980 N  N1    . DA  C 3 12  ? 5.159   -7.605  42.748 1.00 25.63  ? 114  DA  P N1    1 
ATOM   7981 C  C2    . DA  C 3 12  ? 5.723   -7.857  43.933 1.00 20.37  ? 114  DA  P C2    1 
ATOM   7982 N  N3    . DA  C 3 12  ? 6.152   -9.025  44.411 1.00 24.24  ? 114  DA  P N3    1 
ATOM   7983 C  C4    . DA  C 3 12  ? 5.947   -10.020 43.529 1.00 25.57  ? 114  DA  P C4    1 
HETATM 7984 N  N1    . DOC C 3 13  ? 3.063   -10.149 45.512 1.00 28.89  ? 115  DOC P N1    1 
HETATM 7985 C  C2    . DOC C 3 13  ? 2.638   -8.984  44.842 1.00 28.71  ? 115  DOC P C2    1 
HETATM 7986 N  N3    . DOC C 3 13  ? 2.136   -9.067  43.581 1.00 27.91  ? 115  DOC P N3    1 
HETATM 7987 C  C4    . DOC C 3 13  ? 2.037   -10.266 42.947 1.00 28.19  ? 115  DOC P C4    1 
HETATM 7988 C  C5    . DOC C 3 13  ? 2.452   -11.432 43.596 1.00 23.10  ? 115  DOC P C5    1 
HETATM 7989 C  C6    . DOC C 3 13  ? 2.958   -11.345 44.896 1.00 28.10  ? 115  DOC P C6    1 
HETATM 7990 O  O2    . DOC C 3 13  ? 2.726   -7.877  45.415 1.00 26.28  ? 115  DOC P O2    1 
HETATM 7991 N  N4    . DOC C 3 13  ? 1.528   -10.324 41.685 1.00 21.28  ? 115  DOC P N4    1 
HETATM 7992 C  "C1'" . DOC C 3 13  ? 3.597   -10.027 46.873 1.00 29.25  ? 115  DOC P "C1'" 1 
HETATM 7993 C  "C2'" . DOC C 3 13  ? 2.495   -10.227 47.911 1.00 27.02  ? 115  DOC P "C2'" 1 
HETATM 7994 C  "C3'" . DOC C 3 13  ? 3.015   -11.333 48.816 1.00 29.44  ? 115  DOC P "C3'" 1 
HETATM 7995 C  "C4'" . DOC C 3 13  ? 4.510   -11.244 48.563 1.00 30.22  ? 115  DOC P "C4'" 1 
HETATM 7996 O  "O4'" . DOC C 3 13  ? 4.574   -11.029 47.160 1.00 31.51  ? 115  DOC P "O4'" 1 
HETATM 7997 C  "C5'" . DOC C 3 13  ? 5.321   -12.420 49.115 1.00 31.42  ? 115  DOC P "C5'" 1 
HETATM 7998 O  "O5'" . DOC C 3 13  ? 5.382   -13.513 48.223 1.00 32.81  ? 115  DOC P "O5'" 1 
HETATM 7999 P  P     . DOC C 3 13  ? 6.623   -14.554 48.219 1.00 35.41  ? 115  DOC P P     1 
HETATM 8000 O  OP1   . DOC C 3 13  ? 7.307   -14.518 49.566 1.00 28.80  ? 115  DOC P OP1   1 
HETATM 8001 O  OP2   . DOC C 3 13  ? 5.980   -15.826 47.735 1.00 34.65  ? 115  DOC P OP2   1 
HETATM 8002 P  PG    . DTP D 4 .   ? -4.194  -15.333 50.535 1.00 29.70  ? 904  DTP A PG    1 
HETATM 8003 O  O1G   . DTP D 4 .   ? -4.075  -16.317 49.396 1.00 30.75  ? 904  DTP A O1G   1 
HETATM 8004 O  O2G   . DTP D 4 .   ? -2.941  -15.174 51.365 1.00 28.35  ? 904  DTP A O2G   1 
HETATM 8005 O  O3G   . DTP D 4 .   ? -5.448  -15.522 51.345 1.00 28.23  ? 904  DTP A O3G   1 
HETATM 8006 P  PB    . DTP D 4 .   ? -3.587  -12.598 49.844 1.00 30.21  ? 904  DTP A PB    1 
HETATM 8007 O  O1B   . DTP D 4 .   ? -4.411  -11.492 49.243 1.00 30.45  ? 904  DTP A O1B   1 
HETATM 8008 O  O2B   . DTP D 4 .   ? -3.037  -12.391 51.233 1.00 30.39  ? 904  DTP A O2B   1 
HETATM 8009 O  O3B   . DTP D 4 .   ? -4.458  -13.940 49.757 1.00 28.57  ? 904  DTP A O3B   1 
HETATM 8010 P  PA    . DTP D 4 .   ? -0.872  -12.799 48.853 1.00 28.85  ? 904  DTP A PA    1 
HETATM 8011 O  O1A   . DTP D 4 .   ? -0.320  -13.440 47.599 1.00 31.92  ? 904  DTP A O1A   1 
HETATM 8012 O  O2A   . DTP D 4 .   ? -0.449  -13.282 50.210 1.00 30.12  ? 904  DTP A O2A   1 
HETATM 8013 O  O3A   . DTP D 4 .   ? -2.462  -12.984 48.763 1.00 32.77  ? 904  DTP A O3A   1 
HETATM 8014 O  "O5'" . DTP D 4 .   ? -0.572  -11.224 48.665 1.00 26.94  ? 904  DTP A "O5'" 1 
HETATM 8015 C  "C5'" . DTP D 4 .   ? -0.767  -10.280 49.720 1.00 26.85  ? 904  DTP A "C5'" 1 
HETATM 8016 C  "C4'" . DTP D 4 .   ? -1.231  -8.949  49.129 1.00 27.55  ? 904  DTP A "C4'" 1 
HETATM 8017 O  "O4'" . DTP D 4 .   ? -0.378  -8.509  48.062 1.00 28.15  ? 904  DTP A "O4'" 1 
HETATM 8018 C  "C3'" . DTP D 4 .   ? -2.604  -9.028  48.495 1.00 23.80  ? 904  DTP A "C3'" 1 
HETATM 8019 O  "O3'" . DTP D 4 .   ? -3.654  -8.935  49.459 1.00 27.09  ? 904  DTP A "O3'" 1 
HETATM 8020 C  "C2'" . DTP D 4 .   ? -2.572  -7.860  47.532 1.00 25.35  ? 904  DTP A "C2'" 1 
HETATM 8021 C  "C1'" . DTP D 4 .   ? -1.130  -7.862  47.041 1.00 23.82  ? 904  DTP A "C1'" 1 
HETATM 8022 N  N9    . DTP D 4 .   ? -1.117  -8.679  45.804 1.00 24.62  ? 904  DTP A N9    1 
HETATM 8023 C  C8    . DTP D 4 .   ? -0.683  -9.944  45.666 1.00 24.06  ? 904  DTP A C8    1 
HETATM 8024 N  N7    . DTP D 4 .   ? -0.855  -10.389 44.394 1.00 24.62  ? 904  DTP A N7    1 
HETATM 8025 C  C5    . DTP D 4 .   ? -1.402  -9.384  43.687 1.00 24.53  ? 904  DTP A C5    1 
HETATM 8026 C  C6    . DTP D 4 .   ? -1.850  -9.159  42.291 1.00 25.45  ? 904  DTP A C6    1 
HETATM 8027 N  N6    . DTP D 4 .   ? -1.732  -10.126 41.344 1.00 26.40  ? 904  DTP A N6    1 
HETATM 8028 N  N1    . DTP D 4 .   ? -2.389  -7.953  41.985 1.00 26.07  ? 904  DTP A N1    1 
HETATM 8029 C  C2    . DTP D 4 .   ? -2.523  -6.977  42.899 1.00 26.47  ? 904  DTP A C2    1 
HETATM 8030 N  N3    . DTP D 4 .   ? -2.136  -7.118  44.179 1.00 25.43  ? 904  DTP A N3    1 
HETATM 8031 C  C4    . DTP D 4 .   ? -1.581  -8.266  44.625 1.00 23.74  ? 904  DTP A C4    1 
HETATM 8032 CA CA    . CA  E 5 .   ? -1.739  -13.562 52.399 1.00 41.95  ? 905  CA  A CA    1 
HETATM 8033 CA CA    . CA  F 5 .   ? -4.046  -51.470 51.437 1.00 63.63  ? 906  CA  A CA    1 
HETATM 8034 CA CA    . CA  G 5 .   ? 1.880   -13.900 51.215 1.00 74.71  ? 907  CA  A CA    1 
HETATM 8035 CA CA    . CA  H 5 .   ? -3.168  -18.594 54.514 1.00 87.54  ? 908  CA  A CA    1 
HETATM 8036 CA CA    . CA  I 5 .   ? -1.780  -26.252 12.517 1.00 62.72  ? 909  CA  A CA    1 
HETATM 8037 O  O     . HOH J 6 .   ? -3.279  -23.735 12.773 1.00 39.38  ? 910  HOH A O     1 
HETATM 8038 O  O     . HOH J 6 .   ? -29.575 4.324   31.057 1.00 24.26  ? 911  HOH A O     1 
HETATM 8039 O  O     . HOH J 6 .   ? -6.865  -11.503 48.271 1.00 32.85  ? 912  HOH A O     1 
HETATM 8040 O  O     . HOH J 6 .   ? -19.720 -8.176  44.584 1.00 19.46  ? 913  HOH A O     1 
HETATM 8041 O  O     . HOH J 6 .   ? -25.182 -8.844  20.250 1.00 27.83  ? 914  HOH A O     1 
HETATM 8042 O  O     . HOH J 6 .   ? 9.331   -12.370 49.316 1.00 42.51  ? 915  HOH A O     1 
HETATM 8043 O  O     . HOH J 6 .   ? -14.633 -24.511 31.394 1.00 35.36  ? 916  HOH A O     1 
HETATM 8044 O  O     . HOH J 6 .   ? 14.602  -3.989  56.465 1.00 28.43  ? 917  HOH A O     1 
HETATM 8045 O  O     . HOH J 6 .   ? -8.834  -35.191 54.107 1.00 31.63  ? 918  HOH A O     1 
HETATM 8046 O  O     . HOH J 6 .   ? -9.572  -17.537 51.912 1.00 25.92  ? 919  HOH A O     1 
HETATM 8047 O  O     . HOH J 6 .   ? -6.832  -5.649  63.326 1.00 23.09  ? 920  HOH A O     1 
HETATM 8048 O  O     . HOH J 6 .   ? -6.521  -30.163 2.998  1.00 30.31  ? 921  HOH A O     1 
HETATM 8049 O  O     . HOH J 6 .   ? 1.085   -3.123  52.186 1.00 22.23  ? 922  HOH A O     1 
HETATM 8050 O  O     . HOH J 6 .   ? -20.651 -22.954 16.496 1.00 28.19  ? 923  HOH A O     1 
HETATM 8051 O  O     . HOH J 6 .   ? -0.761  -10.238 9.004  1.00 33.64  ? 924  HOH A O     1 
HETATM 8052 O  O     . HOH J 6 .   ? 3.893   -6.395  47.563 1.00 19.06  ? 925  HOH A O     1 
HETATM 8053 O  O     . HOH J 6 .   ? -25.253 -23.545 33.742 1.00 41.19  ? 926  HOH A O     1 
HETATM 8054 O  O     . HOH J 6 .   ? -11.790 -51.222 37.871 1.00 30.98  ? 927  HOH A O     1 
HETATM 8055 O  O     . HOH J 6 .   ? -21.478 -9.156  24.478 1.00 29.19  ? 928  HOH A O     1 
HETATM 8056 O  O     . HOH J 6 .   ? -22.130 19.733  39.206 1.00 41.76  ? 929  HOH A O     1 
HETATM 8057 O  O     . HOH J 6 .   ? 32.171  -24.398 23.851 1.00 19.36  ? 930  HOH A O     1 
HETATM 8058 O  O     . HOH J 6 .   ? -27.201 5.381   31.002 1.00 25.34  ? 931  HOH A O     1 
HETATM 8059 O  O     . HOH J 6 .   ? -7.707  -7.643  1.269  1.00 47.83  ? 932  HOH A O     1 
HETATM 8060 O  O     . HOH J 6 .   ? -5.344  -50.111 49.546 1.00 47.96  ? 933  HOH A O     1 
HETATM 8061 O  O     . HOH J 6 .   ? -27.499 -18.744 14.338 1.00 42.96  ? 934  HOH A O     1 
HETATM 8062 O  O     . HOH J 6 .   ? -12.241 5.720   45.808 1.00 25.43  ? 935  HOH A O     1 
HETATM 8063 O  O     . HOH J 6 .   ? -23.996 -7.432  42.193 1.00 29.92  ? 936  HOH A O     1 
HETATM 8064 O  O     . HOH J 6 .   ? -14.739 -0.806  67.303 1.00 35.54  ? 937  HOH A O     1 
HETATM 8065 O  O     . HOH J 6 .   ? -18.488 -15.496 40.379 1.00 36.03  ? 938  HOH A O     1 
HETATM 8066 O  O     . HOH J 6 .   ? 20.331  -7.504  27.843 1.00 24.93  ? 939  HOH A O     1 
HETATM 8067 O  O     . HOH J 6 .   ? -15.070 -5.756  -0.667 1.00 38.06  ? 940  HOH A O     1 
HETATM 8068 O  O     . HOH J 6 .   ? -4.857  -28.114 53.925 1.00 31.67  ? 941  HOH A O     1 
HETATM 8069 O  O     . HOH J 6 .   ? -12.354 12.299  44.223 1.00 33.22  ? 942  HOH A O     1 
HETATM 8070 O  O     . HOH J 6 .   ? -15.002 -32.936 24.353 1.00 33.71  ? 943  HOH A O     1 
HETATM 8071 O  O     . HOH J 6 .   ? 3.832   -3.829  46.945 1.00 22.70  ? 944  HOH A O     1 
HETATM 8072 O  O     . HOH J 6 .   ? -24.590 -11.390 43.466 1.00 28.29  ? 945  HOH A O     1 
HETATM 8073 O  O     . HOH J 6 .   ? -20.543 -38.122 25.064 1.00 38.08  ? 946  HOH A O     1 
HETATM 8074 O  O     . HOH J 6 .   ? 6.273   -32.103 5.550  1.00 31.14  ? 947  HOH A O     1 
HETATM 8075 O  O     . HOH J 6 .   ? -26.972 18.596  43.908 1.00 40.74  ? 948  HOH A O     1 
HETATM 8076 O  O     . HOH J 6 .   ? -18.724 -24.817 30.845 1.00 51.13  ? 949  HOH A O     1 
HETATM 8077 O  O     . HOH J 6 .   ? 0.812   -23.541 18.286 1.00 25.90  ? 950  HOH A O     1 
HETATM 8078 O  O     . HOH J 6 .   ? 5.767   -14.532 51.892 1.00 38.21  ? 951  HOH A O     1 
HETATM 8079 O  O     . HOH J 6 .   ? -26.357 -20.030 22.345 1.00 30.37  ? 952  HOH A O     1 
HETATM 8080 O  O     . HOH J 6 .   ? 12.718  -9.291  63.183 1.00 28.12  ? 953  HOH A O     1 
HETATM 8081 O  O     . HOH J 6 .   ? -21.228 -11.566 25.815 1.00 28.71  ? 954  HOH A O     1 
HETATM 8082 O  O     . HOH J 6 .   ? -18.732 -5.322  29.007 1.00 30.23  ? 955  HOH A O     1 
HETATM 8083 O  O     . HOH J 6 .   ? -21.727 9.802   42.524 1.00 37.28  ? 956  HOH A O     1 
HETATM 8084 O  O     . HOH J 6 .   ? 24.609  -24.619 7.939  1.00 39.43  ? 957  HOH A O     1 
HETATM 8085 O  O     . HOH J 6 .   ? -23.688 -9.640  42.197 1.00 26.01  ? 958  HOH A O     1 
HETATM 8086 O  O     . HOH J 6 .   ? -3.253  -37.628 -0.565 1.00 21.09  ? 959  HOH A O     1 
HETATM 8087 O  O     . HOH J 6 .   ? -6.074  -18.017 63.707 1.00 42.45  ? 960  HOH A O     1 
HETATM 8088 O  O     . HOH J 6 .   ? -24.306 -3.915  34.070 1.00 23.89  ? 961  HOH A O     1 
HETATM 8089 O  O     . HOH J 6 .   ? 10.905  -15.723 30.060 1.00 29.26  ? 962  HOH A O     1 
HETATM 8090 O  O     . HOH J 6 .   ? -13.010 8.380   45.817 1.00 29.90  ? 963  HOH A O     1 
HETATM 8091 O  O     . HOH J 6 .   ? -1.295  -41.751 9.357  1.00 26.81  ? 964  HOH A O     1 
HETATM 8092 O  O     . HOH J 6 .   ? -15.365 5.735   34.049 1.00 38.49  ? 965  HOH A O     1 
HETATM 8093 O  O     . HOH J 6 .   ? -17.502 -8.003  19.557 1.00 35.72  ? 966  HOH A O     1 
HETATM 8094 O  O     . HOH J 6 .   ? -7.862  6.093   65.644 1.00 33.41  ? 967  HOH A O     1 
HETATM 8095 O  O     . HOH J 6 .   ? 12.078  -39.305 60.725 1.00 33.11  ? 968  HOH A O     1 
HETATM 8096 O  O     . HOH J 6 .   ? 12.353  -12.823 12.235 1.00 45.47  ? 969  HOH A O     1 
HETATM 8097 O  O     . HOH J 6 .   ? -1.935  -15.994 35.058 1.00 30.99  ? 970  HOH A O     1 
HETATM 8098 O  O     . HOH J 6 .   ? 1.452   -44.133 21.079 1.00 63.80  ? 971  HOH A O     1 
HETATM 8099 O  O     . HOH J 6 .   ? 12.073  -0.861  53.272 1.00 37.14  ? 972  HOH A O     1 
HETATM 8100 O  O     . HOH J 6 .   ? 13.510  -3.027  54.037 1.00 34.57  ? 973  HOH A O     1 
HETATM 8101 O  O     . HOH J 6 .   ? -26.096 20.537  36.952 1.00 36.30  ? 974  HOH A O     1 
HETATM 8102 O  O     . HOH J 6 .   ? -23.720 -6.721  38.748 1.00 27.35  ? 975  HOH A O     1 
HETATM 8103 O  O     . HOH J 6 .   ? -13.596 -32.913 26.689 1.00 31.39  ? 976  HOH A O     1 
HETATM 8104 O  O     . HOH J 6 .   ? -3.928  -25.382 0.055  1.00 30.77  ? 977  HOH A O     1 
HETATM 8105 O  O     . HOH J 6 .   ? 2.247   7.209   58.771 1.00 36.16  ? 978  HOH A O     1 
HETATM 8106 O  O     . HOH J 6 .   ? 3.324   -4.239  53.548 1.00 32.36  ? 979  HOH A O     1 
HETATM 8107 O  O     . HOH J 6 .   ? -35.448 13.406  38.537 1.00 25.47  ? 980  HOH A O     1 
HETATM 8108 O  O     . HOH J 6 .   ? 6.354   6.617   45.261 1.00 33.71  ? 981  HOH A O     1 
HETATM 8109 O  O     . HOH J 6 .   ? 2.081   -31.935 23.292 1.00 44.12  ? 982  HOH A O     1 
HETATM 8110 O  O     . HOH J 6 .   ? -3.780  -49.211 51.975 1.00 45.77  ? 983  HOH A O     1 
HETATM 8111 O  O     . HOH J 6 .   ? -2.206  -33.519 47.540 1.00 36.80  ? 984  HOH A O     1 
HETATM 8112 O  O     . HOH J 6 .   ? -5.157  -33.530 45.298 1.00 41.17  ? 985  HOH A O     1 
HETATM 8113 O  O     . HOH J 6 .   ? 21.896  -30.760 21.237 1.00 30.30  ? 986  HOH A O     1 
HETATM 8114 O  O     . HOH J 6 .   ? 15.775  -28.532 12.969 1.00 51.09  ? 987  HOH A O     1 
HETATM 8115 O  O     . HOH J 6 .   ? -25.287 10.221  59.959 1.00 37.29  ? 988  HOH A O     1 
HETATM 8116 O  O     . HOH J 6 .   ? -21.028 9.650   33.491 1.00 27.06  ? 989  HOH A O     1 
HETATM 8117 O  O     . HOH J 6 .   ? -18.572 -5.820  -0.370 1.00 31.83  ? 990  HOH A O     1 
HETATM 8118 O  O     . HOH J 6 .   ? 0.005   -7.215  5.181  1.00 60.82  ? 991  HOH A O     1 
HETATM 8119 O  O     . HOH J 6 .   ? 24.388  -3.982  22.722 1.00 35.69  ? 992  HOH A O     1 
HETATM 8120 O  O     . HOH J 6 .   ? -17.424 -18.837 52.361 1.00 37.53  ? 993  HOH A O     1 
HETATM 8121 O  O     . HOH J 6 .   ? -15.017 -39.308 59.723 1.00 29.63  ? 994  HOH A O     1 
HETATM 8122 O  O     . HOH J 6 .   ? 1.777   -29.076 1.365  1.00 30.96  ? 995  HOH A O     1 
HETATM 8123 O  O     . HOH J 6 .   ? -22.846 -25.464 25.318 1.00 38.84  ? 996  HOH A O     1 
HETATM 8124 O  O     . HOH J 6 .   ? -35.494 -13.789 17.596 1.00 32.51  ? 997  HOH A O     1 
HETATM 8125 O  O     . HOH J 6 .   ? -29.818 -27.861 27.134 1.00 44.43  ? 998  HOH A O     1 
HETATM 8126 O  O     . HOH J 6 .   ? -9.449  -12.943 23.707 1.00 31.46  ? 999  HOH A O     1 
HETATM 8127 O  O     . HOH J 6 .   ? 9.940   -0.784  18.867 1.00 35.22  ? 1000 HOH A O     1 
HETATM 8128 O  O     . HOH J 6 .   ? 4.926   -19.564 53.649 1.00 41.03  ? 1001 HOH A O     1 
HETATM 8129 O  O     . HOH J 6 .   ? -9.359  -11.088 15.410 1.00 37.39  ? 1002 HOH A O     1 
HETATM 8130 O  O     . HOH J 6 .   ? 19.506  -9.218  52.258 1.00 42.50  ? 1003 HOH A O     1 
HETATM 8131 O  O     . HOH J 6 .   ? 29.748  -25.767 20.453 1.00 36.58  ? 1004 HOH A O     1 
HETATM 8132 O  O     . HOH J 6 .   ? -20.896 -14.331 48.641 1.00 38.64  ? 1005 HOH A O     1 
HETATM 8133 O  O     . HOH J 6 .   ? -2.815  -53.491 43.226 1.00 36.77  ? 1006 HOH A O     1 
HETATM 8134 O  O     . HOH J 6 .   ? -4.247  -14.404 19.710 1.00 50.40  ? 1007 HOH A O     1 
HETATM 8135 O  O     . HOH J 6 .   ? -26.091 -11.695 37.782 1.00 32.44  ? 1008 HOH A O     1 
HETATM 8136 O  O     . HOH J 6 .   ? 18.887  -32.982 27.511 1.00 49.46  ? 1009 HOH A O     1 
HETATM 8137 O  O     . HOH J 6 .   ? 15.275  -32.252 42.353 1.00 35.06  ? 1010 HOH A O     1 
HETATM 8138 O  O     . HOH J 6 .   ? -19.156 -2.882  27.895 1.00 34.18  ? 1011 HOH A O     1 
HETATM 8139 O  O     . HOH J 6 .   ? 5.210   -34.257 56.160 1.00 33.82  ? 1012 HOH A O     1 
HETATM 8140 O  O     . HOH J 6 .   ? -13.889 -28.883 27.502 1.00 35.15  ? 1013 HOH A O     1 
HETATM 8141 O  O     . HOH J 6 .   ? 1.078   -28.138 4.118  1.00 28.54  ? 1014 HOH A O     1 
HETATM 8142 O  O     . HOH J 6 .   ? 9.361   -21.116 14.784 1.00 52.13  ? 1015 HOH A O     1 
HETATM 8143 O  O     . HOH J 6 .   ? -17.461 -14.438 -6.113 1.00 34.66  ? 1016 HOH A O     1 
HETATM 8144 O  O     . HOH J 6 .   ? -17.884 -17.380 54.621 1.00 46.51  ? 1017 HOH A O     1 
HETATM 8145 O  O     . HOH J 6 .   ? -19.059 -2.962  9.636  1.00 32.50  ? 1018 HOH A O     1 
HETATM 8146 O  O     . HOH J 6 .   ? 0.313   -28.367 12.972 1.00 38.69  ? 1019 HOH A O     1 
HETATM 8147 O  O     . HOH J 6 .   ? -11.283 -10.384 52.879 1.00 45.86  ? 1020 HOH A O     1 
HETATM 8148 O  O     . HOH J 6 .   ? -7.693  9.512   33.058 1.00 48.74  ? 1021 HOH A O     1 
HETATM 8149 O  O     . HOH J 6 .   ? -15.293 -24.657 51.514 1.00 33.94  ? 1022 HOH A O     1 
HETATM 8150 O  O     . HOH J 6 .   ? -30.887 4.830   21.339 1.00 39.11  ? 1023 HOH A O     1 
HETATM 8151 O  O     . HOH J 6 .   ? 15.143  -31.376 39.815 1.00 28.47  ? 1024 HOH A O     1 
HETATM 8152 O  O     . HOH J 6 .   ? -25.600 0.415   55.920 1.00 40.56  ? 1025 HOH A O     1 
HETATM 8153 O  O     . HOH J 6 .   ? 0.972   -18.263 31.205 1.00 30.23  ? 1026 HOH A O     1 
HETATM 8154 O  O     . HOH J 6 .   ? -14.715 9.805   47.042 1.00 30.91  ? 1027 HOH A O     1 
HETATM 8155 O  O     . HOH J 6 .   ? 1.213   -3.124  47.141 1.00 33.19  ? 1028 HOH A O     1 
HETATM 8156 O  O     . HOH J 6 .   ? -33.191 5.240   30.979 1.00 31.27  ? 1029 HOH A O     1 
HETATM 8157 O  O     . HOH J 6 .   ? 9.074   5.952   59.671 1.00 40.14  ? 1030 HOH A O     1 
HETATM 8158 O  O     . HOH J 6 .   ? -4.040  -4.966  45.444 1.00 31.78  ? 1031 HOH A O     1 
HETATM 8159 O  O     . HOH J 6 .   ? -13.110 -41.079 6.817  1.00 44.61  ? 1032 HOH A O     1 
HETATM 8160 O  O     . HOH J 6 .   ? -16.004 -40.067 7.829  1.00 32.00  ? 1033 HOH A O     1 
HETATM 8161 O  O     . HOH J 6 .   ? 13.883  -24.273 57.301 1.00 40.24  ? 1034 HOH A O     1 
HETATM 8162 O  O     . HOH J 6 .   ? -24.855 -27.739 25.092 1.00 42.21  ? 1035 HOH A O     1 
HETATM 8163 O  O     . HOH J 6 .   ? 18.185  -15.255 42.510 1.00 40.00  ? 1036 HOH A O     1 
HETATM 8164 O  O     . HOH J 6 .   ? -28.479 -5.735  41.764 1.00 39.57  ? 1037 HOH A O     1 
HETATM 8165 O  O     . HOH J 6 .   ? 3.937   -22.045 75.948 1.00 46.53  ? 1038 HOH A O     1 
HETATM 8166 O  O     . HOH J 6 .   ? 15.524  -24.248 27.883 1.00 24.72  ? 1039 HOH A O     1 
HETATM 8167 O  O     . HOH J 6 .   ? -10.567 -3.884  1.039  1.00 46.52  ? 1040 HOH A O     1 
HETATM 8168 O  O     . HOH J 6 .   ? -34.000 15.326  28.912 1.00 45.40  ? 1041 HOH A O     1 
HETATM 8169 O  O     . HOH J 6 .   ? -2.618  -38.929 2.845  1.00 34.42  ? 1042 HOH A O     1 
HETATM 8170 O  O     . HOH J 6 .   ? -22.036 -13.485 -0.160 1.00 44.36  ? 1043 HOH A O     1 
HETATM 8171 O  O     . HOH J 6 .   ? -26.125 -19.750 18.123 1.00 33.05  ? 1044 HOH A O     1 
HETATM 8172 O  O     . HOH J 6 .   ? -19.334 -9.648  -0.771 1.00 41.57  ? 1045 HOH A O     1 
HETATM 8173 O  O     . HOH J 6 .   ? -5.565  -19.664 15.275 1.00 33.14  ? 1046 HOH A O     1 
HETATM 8174 O  O     . HOH J 6 .   ? -13.180 6.661   33.728 1.00 39.51  ? 1047 HOH A O     1 
HETATM 8175 O  O     . HOH J 6 .   ? 13.785  -8.658  69.695 1.00 41.13  ? 1048 HOH A O     1 
HETATM 8176 O  O     . HOH J 6 .   ? 14.437  -21.241 13.574 1.00 37.03  ? 1049 HOH A O     1 
HETATM 8177 O  O     . HOH J 6 .   ? -6.865  -35.301 55.785 1.00 35.79  ? 1050 HOH A O     1 
HETATM 8178 O  O     . HOH J 6 .   ? 27.116  -18.072 58.637 1.00 52.15  ? 1051 HOH A O     1 
HETATM 8179 O  O     . HOH J 6 .   ? -20.752 -2.508  20.884 1.00 39.09  ? 1052 HOH A O     1 
HETATM 8180 O  O     . HOH J 6 .   ? 5.187   -16.211 23.727 1.00 48.91  ? 1053 HOH A O     1 
HETATM 8181 O  O     . HOH J 6 .   ? -8.850  -8.772  3.011  1.00 53.51  ? 1054 HOH A O     1 
HETATM 8182 O  O     . HOH J 6 .   ? -0.440  -7.820  72.204 1.00 31.75  ? 1055 HOH A O     1 
HETATM 8183 O  O     . HOH J 6 .   ? 6.289   -3.764  13.009 1.00 56.90  ? 1056 HOH A O     1 
HETATM 8184 O  O     . HOH J 6 .   ? -25.643 -5.852  42.877 1.00 37.82  ? 1057 HOH A O     1 
HETATM 8185 O  O     . HOH J 6 .   ? 5.226   -20.640 35.897 1.00 40.43  ? 1058 HOH A O     1 
HETATM 8186 O  O     . HOH J 6 .   ? -21.174 -30.964 3.021  1.00 32.91  ? 1059 HOH A O     1 
HETATM 8187 O  O     . HOH J 6 .   ? 20.879  -24.945 59.146 1.00 38.49  ? 1060 HOH A O     1 
HETATM 8188 O  O     . HOH J 6 .   ? 8.588   1.076   12.696 1.00 35.57  ? 1061 HOH A O     1 
HETATM 8189 O  O     . HOH J 6 .   ? -3.841  -25.202 39.081 1.00 28.44  ? 1062 HOH A O     1 
HETATM 8190 O  O     . HOH J 6 .   ? -16.227 -37.533 25.230 1.00 40.37  ? 1063 HOH A O     1 
HETATM 8191 O  O     . HOH J 6 .   ? 19.577  -12.237 46.718 1.00 43.54  ? 1064 HOH A O     1 
HETATM 8192 O  O     . HOH J 6 .   ? -4.179  -33.748 33.903 1.00 41.69  ? 1065 HOH A O     1 
HETATM 8193 O  O     . HOH J 6 .   ? -10.712 -5.070  16.172 1.00 37.77  ? 1066 HOH A O     1 
HETATM 8194 O  O     . HOH J 6 .   ? -14.184 -22.441 36.818 1.00 28.33  ? 1067 HOH A O     1 
HETATM 8195 O  O     . HOH J 6 .   ? -0.232  -16.512 51.135 1.00 64.14  ? 1068 HOH A O     1 
HETATM 8196 O  O     . HOH J 6 .   ? 1.686   -15.540 48.604 1.00 36.56  ? 1069 HOH A O     1 
HETATM 8197 O  O     . HOH J 6 .   ? -0.515  -25.372 14.483 1.00 43.94  ? 1070 HOH A O     1 
HETATM 8198 O  O     . HOH K 6 .   ? 0.040   -8.243  38.261 1.00 26.68  ? 19   HOH T O     1 
HETATM 8199 O  O     . HOH K 6 .   ? 6.496   -6.078  47.239 1.00 25.86  ? 20   HOH T O     1 
HETATM 8200 O  O     . HOH K 6 .   ? 10.295  -2.324  51.718 1.00 24.13  ? 30   HOH T O     1 
HETATM 8201 O  O     . HOH K 6 .   ? -2.805  -1.594  31.005 1.00 36.23  ? 44   HOH T O     1 
HETATM 8202 O  O     . HOH K 6 .   ? 4.244   3.593   41.501 1.00 39.15  ? 71   HOH T O     1 
HETATM 8203 O  O     . HOH K 6 .   ? 23.645  -6.832  23.373 1.00 29.15  ? 90   HOH T O     1 
HETATM 8204 O  O     . HOH K 6 .   ? 17.840  -8.134  49.215 1.00 34.43  ? 96   HOH T O     1 
HETATM 8205 O  O     . HOH K 6 .   ? -1.276  -5.597  37.043 1.00 32.08  ? 121  HOH T O     1 
HETATM 8206 O  O     . HOH K 6 .   ? -0.885  -8.532  35.735 1.00 39.87  ? 131  HOH T O     1 
HETATM 8207 O  O     . HOH K 6 .   ? 9.576   0.234   39.215 1.00 42.92  ? 139  HOH T O     1 
HETATM 8208 O  O     . HOH K 6 .   ? 4.968   -0.292  39.175 1.00 22.18  ? 140  HOH T O     1 
HETATM 8209 O  O     . HOH K 6 .   ? 0.235   -8.142  31.186 1.00 47.64  ? 145  HOH T O     1 
HETATM 8210 O  O     . HOH K 6 .   ? 0.503   -6.742  36.439 1.00 36.79  ? 159  HOH T O     1 
HETATM 8211 O  O     . HOH L 6 .   ? 13.847  -4.523  24.642 1.00 30.52  ? 63   HOH P O     1 
HETATM 8212 O  O     . HOH L 6 .   ? 1.286   -12.835 40.597 1.00 33.94  ? 127  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  ARG 66  66  66  ARG ARG A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 MET 189 189 189 MET MET A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 MET 199 199 199 MET MET A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 TRP 205 205 205 TRP TRP A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 LYS 208 208 208 LYS LYS A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 PHE 221 221 221 PHE PHE A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 ARG 241 241 241 ARG ARG A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 ARG 249 249 249 ARG ARG A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 MET 256 256 256 MET MET A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 TYR 277 277 277 TYR TYR A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PHE 282 282 282 PHE PHE A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 ASN 284 284 284 ASN ASN A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 TYR 288 288 288 TYR TYR A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 ASP 291 291 291 ASP ASP A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 SER 294 294 294 SER SER A . n 
A 1 295 GLU 295 295 295 GLU GLU A . n 
A 1 296 PHE 296 296 296 PHE PHE A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ASN 299 299 299 ASN ASN A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 GLY 301 301 301 GLY GLY A . n 
A 1 302 LYS 302 302 302 LYS LYS A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 LYS 304 304 304 LYS LYS A . n 
A 1 305 TYR 305 305 305 TYR TYR A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 PRO 308 308 308 PRO PRO A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 SER 315 315 315 SER SER A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 HIS 317 317 317 HIS HIS A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ARG 319 319 319 ARG ARG A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 ILE 321 321 321 ILE ILE A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 TYR 329 329 329 TYR TYR A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 GLN 333 333 333 GLN GLN A . n 
A 1 334 ILE 334 334 334 ILE ILE A . n 
A 1 335 ASP 335 335 335 ASP ASP A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 LYS 337 337 337 LYS LYS A . n 
A 1 338 ARG 338 338 338 ARG ARG A . n 
A 1 339 GLN 339 339 339 GLN GLN A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 SER 344 344 344 SER SER A . n 
A 1 345 LEU 345 345 345 LEU LEU A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 MET 347 347 347 MET MET A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 TYR 349 349 349 TYR TYR A . n 
A 1 350 TYR 350 350 350 TYR TYR A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 LYS 352 352 352 LYS LYS A . n 
A 1 353 ILE 353 353 353 ILE ILE A . n 
A 1 354 GLN 354 354 354 GLN GLN A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 GLN 356 356 356 GLN GLN A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 SER 360 360 360 SER SER A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 ILE 362 362 362 ILE ILE A . n 
A 1 363 LYS 363 363 363 LYS LYS A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 TRP 365 365 365 TRP TRP A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 ILE 369 369 369 ILE ILE A . n 
A 1 370 PHE 370 370 370 PHE PHE A . n 
A 1 371 ASN 371 371 371 ASN ASN A . n 
A 1 372 SER 372 372 372 SER SER A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 GLU 375 375 375 GLU GLU A . n 
A 1 376 GLN 376 376 376 GLN GLN A . n 
A 1 377 ASN 377 377 377 ASN ASN A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 PRO 381 381 381 PRO PRO A . n 
A 1 382 GLN 382 382 382 GLN GLN A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 ARG 384 384 384 ARG ARG A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 HIS 386 386 386 HIS HIS A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 GLN 389 389 389 GLN GLN A . n 
A 1 390 PRO 390 390 390 PRO PRO A . n 
A 1 391 TYR 391 391 391 TYR TYR A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLY 393 393 393 GLY GLY A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 PHE 395 395 395 PHE PHE A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 LYS 397 397 397 LYS LYS A . n 
A 1 398 GLU 398 398 398 GLU GLU A . n 
A 1 399 PRO 399 399 399 PRO PRO A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 ASN 402 402 402 ASN ASN A . n 
A 1 403 ARG 403 403 403 ARG ARG A . n 
A 1 404 TYR 404 404 404 TYR TYR A . n 
A 1 405 LYS 405 405 405 LYS LYS A . n 
A 1 406 TYR 406 406 406 TYR TYR A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 MET 408 408 408 MET MET A . n 
A 1 409 SER 409 409 409 SER SER A . n 
A 1 410 PHE 410 410 410 PHE PHE A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 LEU 412 412 412 LEU LEU A . n 
A 1 413 THR 413 413 413 THR THR A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 PRO 417 417 417 PRO PRO A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 ILE 419 419 419 ILE ILE A . n 
A 1 420 ILE 420 420 420 ILE ILE A . n 
A 1 421 ARG 421 421 421 ARG ARG A . n 
A 1 422 GLN 422 422 422 GLN GLN A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 ILE 425 425 425 ILE ILE A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 GLU 428 428 428 GLU GLU A . n 
A 1 429 THR 429 429 429 THR THR A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 THR 433 433 433 THR THR A . n 
A 1 434 PHE 434 434 434 PHE PHE A . n 
A 1 435 LYS 435 435 435 LYS LYS A . n 
A 1 436 VAL 436 436 436 VAL VAL A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 PRO 438 438 438 PRO PRO A . n 
A 1 439 LEU 439 439 439 LEU LEU A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 ASP 441 441 441 ASP ASP A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 ILE 443 443 443 ILE ILE A . n 
A 1 444 ASN 444 444 444 ASN ASN A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 VAL 446 446 446 VAL VAL A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 GLU 448 448 448 GLU GLU A . n 
A 1 449 ARG 449 449 449 ARG ARG A . n 
A 1 450 PRO 450 450 450 PRO PRO A . n 
A 1 451 SER 451 451 451 SER SER A . n 
A 1 452 ASP 452 452 452 ASP ASP A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 TYR 454 454 454 TYR TYR A . n 
A 1 455 SER 455 455 455 SER SER A . n 
A 1 456 CYS 456 456 456 CYS CYS A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 ASN 459 459 459 ASN ASN A . n 
A 1 460 GLY 460 460 460 GLY GLY A . n 
A 1 461 MET 461 461 461 MET MET A . n 
A 1 462 MET 462 462 462 MET MET A . n 
A 1 463 TYR 463 463 463 TYR TYR A . n 
A 1 464 TYR 464 464 464 TYR TYR A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 ASP 466 466 466 ASP ASP A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 GLY 469 469 469 GLY GLY A . n 
A 1 470 VAL 470 470 470 VAL VAL A . n 
A 1 471 VAL 471 471 471 VAL VAL A . n 
A 1 472 PRO 472 472 472 PRO PRO A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 ILE 475 475 475 ILE ILE A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 PHE 479 479 479 PHE PHE A . n 
A 1 480 ASN 480 480 480 ASN ASN A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 LYS 483 483 483 LYS LYS A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 HIS 485 485 485 HIS HIS A . n 
A 1 486 LYS 486 486 486 LYS LYS A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 TYR 488 488 488 TYR TYR A . n 
A 1 489 MET 489 489 489 MET MET A . n 
A 1 490 LEU 490 490 490 LEU LEU A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 ALA 492 492 492 ALA ALA A . n 
A 1 493 GLN 493 493 493 GLN GLN A . n 
A 1 494 ARG 494 494 494 ARG ARG A . n 
A 1 495 ASN 495 495 495 ASN ASN A . n 
A 1 496 GLY 496 496 496 GLY GLY A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 ILE 498 498 498 ILE ILE A . n 
A 1 499 ILE 499 499 499 ILE ILE A . n 
A 1 500 LYS 500 500 500 LYS LYS A . n 
A 1 501 GLU 501 501 501 GLU GLU A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 HIS 504 504 504 HIS HIS A . n 
A 1 505 ASN 505 505 505 ASN ASN A . n 
A 1 506 PRO 506 506 506 PRO PRO A . n 
A 1 507 ASN 507 507 507 ASN ASN A . n 
A 1 508 LEU 508 508 508 LEU LEU A . n 
A 1 509 SER 509 509 509 SER SER A . n 
A 1 510 VAL 510 510 510 VAL VAL A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLU 512 512 512 GLU GLU A . n 
A 1 513 PRO 513 513 513 PRO PRO A . n 
A 1 514 LEU 514 514 514 LEU LEU A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ASP 517 517 517 ASP ASP A . n 
A 1 518 TYR 518 518 518 TYR TYR A . n 
A 1 519 ARG 519 519 519 ARG ARG A . n 
A 1 520 PHE 520 520 520 PHE PHE A . n 
A 1 521 ASP 521 521 521 ASP ASP A . n 
A 1 522 PHE 522 522 522 PHE PHE A . n 
A 1 523 SER 523 523 523 SER SER A . n 
A 1 524 ASP 524 524 524 ASP ASP A . n 
A 1 525 GLU 525 525 525 GLU GLU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 LYS 529 529 529 LYS LYS A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 LYS 531 531 531 LYS LYS A . n 
A 1 532 LYS 532 532 532 LYS LYS A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 SER 534 534 534 SER SER A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 LYS 536 536 536 LYS LYS A . n 
A 1 537 SER 537 537 537 SER SER A . n 
A 1 538 LEU 538 538 538 LEU LEU A . n 
A 1 539 ASN 539 539 539 ASN ASN A . n 
A 1 540 GLU 540 540 540 GLU GLU A . n 
A 1 541 MET 541 541 541 MET MET A . n 
A 1 542 LEU 542 542 542 LEU LEU A . n 
A 1 543 PHE 543 543 543 PHE PHE A . n 
A 1 544 ARG 544 544 544 ARG ARG A . n 
A 1 545 ALA 545 545 545 ALA ALA A . n 
A 1 546 GLN 546 546 546 GLN GLN A . n 
A 1 547 ARG 547 547 547 ARG ARG A . n 
A 1 548 THR 548 548 548 THR THR A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 VAL 550 550 550 VAL VAL A . n 
A 1 551 ALA 551 551 551 ALA ALA A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 MET 553 553 553 MET MET A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 GLN 556 556 556 GLN GLN A . n 
A 1 557 ILE 557 557 557 ILE ILE A . n 
A 1 558 ASN 558 558 558 ASN ASN A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 LYS 560 560 560 LYS LYS A . n 
A 1 561 LEU 561 561 561 LEU LEU A . n 
A 1 562 LEU 562 562 562 LEU LEU A . n 
A 1 563 ILE 563 563 563 ILE ILE A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 SER 565 565 565 SER SER A . n 
A 1 566 LEU 566 566 566 LEU LEU A . n 
A 1 567 ALA 567 567 567 ALA ALA A . n 
A 1 568 GLY 568 568 568 GLY GLY A . n 
A 1 569 ALA 569 569 569 ALA ALA A . n 
A 1 570 LEU 570 570 570 LEU LEU A . n 
A 1 571 GLY 571 571 571 GLY GLY A . n 
A 1 572 ASN 572 572 572 ASN ASN A . n 
A 1 573 VAL 573 573 573 VAL VAL A . n 
A 1 574 TRP 574 574 574 TRP TRP A . n 
A 1 575 PHE 575 575 575 PHE PHE A . n 
A 1 576 ARG 576 576 576 ARG ARG A . n 
A 1 577 TYR 577 577 577 TYR TYR A . n 
A 1 578 TYR 578 578 578 TYR TYR A . n 
A 1 579 ASP 579 579 579 ASP ASP A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 ARG 581 581 581 ARG ARG A . n 
A 1 582 ASN 582 582 582 ASN ASN A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 THR 584 584 584 THR THR A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 ILE 586 586 586 ILE ILE A . n 
A 1 587 THR 587 587 587 THR THR A . n 
A 1 588 THR 588 588 588 THR THR A . n 
A 1 589 PHE 589 589 589 PHE PHE A . n 
A 1 590 GLY 590 590 590 GLY GLY A . n 
A 1 591 GLN 591 591 591 GLN GLN A . n 
A 1 592 MET 592 592 592 MET MET A . n 
A 1 593 ALA 593 593 593 ALA ALA A . n 
A 1 594 LEU 594 594 594 LEU LEU A . n 
A 1 595 GLN 595 595 595 GLN GLN A . n 
A 1 596 TRP 596 596 596 TRP TRP A . n 
A 1 597 ILE 597 597 597 ILE ILE A . n 
A 1 598 GLU 598 598 598 GLU GLU A . n 
A 1 599 ARG 599 599 599 ARG ARG A . n 
A 1 600 LYS 600 600 600 LYS LYS A . n 
A 1 601 VAL 601 601 601 VAL VAL A . n 
A 1 602 ASN 602 602 602 ASN ASN A . n 
A 1 603 GLU 603 603 603 GLU GLU A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 LEU 605 605 605 LEU LEU A . n 
A 1 606 ASN 606 606 606 ASN ASN A . n 
A 1 607 GLU 607 607 607 GLU GLU A . n 
A 1 608 VAL 608 608 608 VAL VAL A . n 
A 1 609 CYS 609 609 609 CYS CYS A . n 
A 1 610 GLY 610 610 610 GLY GLY A . n 
A 1 611 THR 611 611 611 THR THR A . n 
A 1 612 GLU 612 612 612 GLU GLU A . n 
A 1 613 GLY 613 613 613 GLY GLY A . n 
A 1 614 GLU 614 614 614 GLU GLU A . n 
A 1 615 ALA 615 615 615 ALA ALA A . n 
A 1 616 PHE 616 616 616 PHE PHE A . n 
A 1 617 VAL 617 617 617 VAL VAL A . n 
A 1 618 LEU 618 618 618 LEU LEU A . n 
A 1 619 TYR 619 619 619 TYR TYR A . n 
A 1 620 GLY 620 620 620 GLY GLY A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 ASP 623 623 623 ASP ASP A . n 
A 1 624 SER 624 624 624 SER SER A . n 
A 1 625 ILE 625 625 625 ILE ILE A . n 
A 1 626 TYR 626 626 626 TYR TYR A . n 
A 1 627 VAL 627 627 627 VAL VAL A . n 
A 1 628 SER 628 628 628 SER SER A . n 
A 1 629 ALA 629 629 629 ALA ALA A . n 
A 1 630 ASP 630 630 630 ASP ASP A . n 
A 1 631 LYS 631 631 631 LYS LYS A . n 
A 1 632 ILE 632 632 632 ILE ILE A . n 
A 1 633 ILE 633 633 633 ILE ILE A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 LYS 635 635 635 LYS LYS A . n 
A 1 636 VAL 636 636 636 VAL VAL A . n 
A 1 637 GLY 637 637 637 GLY GLY A . n 
A 1 638 GLU 638 638 638 GLU GLU A . n 
A 1 639 SER 639 639 639 SER SER A . n 
A 1 640 LYS 640 640 640 LYS LYS A . n 
A 1 641 PHE 641 641 641 PHE PHE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ASP 643 643 643 ASP ASP A . n 
A 1 644 THR 644 644 644 THR THR A . n 
A 1 645 ASN 645 645 645 ASN ASN A . n 
A 1 646 HIS 646 646 646 HIS HIS A . n 
A 1 647 TRP 647 647 647 TRP TRP A . n 
A 1 648 VAL 648 648 648 VAL VAL A . n 
A 1 649 ASP 649 649 649 ASP ASP A . n 
A 1 650 PHE 650 650 650 PHE PHE A . n 
A 1 651 LEU 651 651 651 LEU LEU A . n 
A 1 652 ASP 652 652 652 ASP ASP A . n 
A 1 653 LYS 653 653 653 LYS LYS A . n 
A 1 654 PHE 654 654 654 PHE PHE A . n 
A 1 655 ALA 655 655 655 ALA ALA A . n 
A 1 656 ARG 656 656 656 ARG ARG A . n 
A 1 657 GLU 657 657 657 GLU GLU A . n 
A 1 658 ARG 658 658 658 ARG ARG A . n 
A 1 659 MET 659 659 659 MET MET A . n 
A 1 660 GLU 660 660 660 GLU GLU A . n 
A 1 661 PRO 661 661 661 PRO PRO A . n 
A 1 662 ALA 662 662 662 ALA ALA A . n 
A 1 663 ILE 663 663 663 ILE ILE A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 ARG 665 665 665 ARG ARG A . n 
A 1 666 GLY 666 666 666 GLY GLY A . n 
A 1 667 PHE 667 667 667 PHE PHE A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 MET 670 670 670 MET MET A . n 
A 1 671 CYS 671 671 671 CYS CYS A . n 
A 1 672 GLU 672 672 672 GLU GLU A . n 
A 1 673 TYR 673 673 673 TYR TYR A . n 
A 1 674 MET 674 674 674 MET MET A . n 
A 1 675 ASN 675 675 675 ASN ASN A . n 
A 1 676 ASN 676 676 676 ASN ASN A . n 
A 1 677 LYS 677 677 677 LYS LYS A . n 
A 1 678 GLN 678 678 678 GLN GLN A . n 
A 1 679 HIS 679 679 679 HIS HIS A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 MET 681 681 681 MET MET A . n 
A 1 682 PHE 682 682 682 PHE PHE A . n 
A 1 683 MET 683 683 683 MET MET A . n 
A 1 684 ASP 684 684 684 ASP ASP A . n 
A 1 685 ARG 685 685 685 ARG ARG A . n 
A 1 686 GLU 686 686 686 GLU GLU A . n 
A 1 687 ALA 687 687 687 ALA ALA A . n 
A 1 688 ILE 688 688 688 ILE ILE A . n 
A 1 689 ALA 689 689 689 ALA ALA A . n 
A 1 690 GLY 690 690 690 GLY GLY A . n 
A 1 691 PRO 691 691 691 PRO PRO A . n 
A 1 692 PRO 692 692 692 PRO PRO A . n 
A 1 693 LEU 693 693 693 LEU LEU A . n 
A 1 694 GLY 694 694 694 GLY GLY A . n 
A 1 695 SER 695 695 695 SER SER A . n 
A 1 696 LYS 696 696 696 LYS LYS A . n 
A 1 697 GLY 697 697 697 GLY GLY A . n 
A 1 698 ILE 698 698 698 ILE ILE A . n 
A 1 699 GLY 699 699 699 GLY GLY A . n 
A 1 700 GLY 700 700 700 GLY GLY A . n 
A 1 701 PHE 701 701 701 PHE PHE A . n 
A 1 702 TRP 702 702 702 TRP TRP A . n 
A 1 703 THR 703 703 703 THR THR A . n 
A 1 704 GLY 704 704 704 GLY GLY A . n 
A 1 705 LYS 705 705 705 LYS LYS A . n 
A 1 706 LYS 706 706 706 LYS LYS A . n 
A 1 707 ARG 707 707 707 ARG ARG A . n 
A 1 708 TYR 708 708 708 TYR TYR A . n 
A 1 709 ALA 709 709 709 ALA ALA A . n 
A 1 710 LEU 710 710 710 LEU LEU A . n 
A 1 711 ASN 711 711 711 ASN ASN A . n 
A 1 712 VAL 712 712 712 VAL VAL A . n 
A 1 713 TRP 713 713 713 TRP TRP A . n 
A 1 714 ASP 714 714 714 ASP ASP A . n 
A 1 715 MET 715 715 715 MET MET A . n 
A 1 716 GLU 716 716 716 GLU GLU A . n 
A 1 717 GLY 717 717 717 GLY GLY A . n 
A 1 718 THR 718 718 718 THR THR A . n 
A 1 719 ARG 719 719 719 ARG ARG A . n 
A 1 720 TYR 720 720 720 TYR TYR A . n 
A 1 721 ALA 721 721 721 ALA ALA A . n 
A 1 722 GLU 722 722 722 GLU GLU A . n 
A 1 723 PRO 723 723 723 PRO PRO A . n 
A 1 724 LYS 724 724 724 LYS LYS A . n 
A 1 725 LEU 725 725 725 LEU LEU A . n 
A 1 726 LYS 726 726 726 LYS LYS A . n 
A 1 727 ILE 727 727 727 ILE ILE A . n 
A 1 728 MET 728 728 728 MET MET A . n 
A 1 729 GLY 729 729 729 GLY GLY A . n 
A 1 730 LEU 730 730 730 LEU LEU A . n 
A 1 731 GLU 731 731 731 GLU GLU A . n 
A 1 732 THR 732 732 732 THR THR A . n 
A 1 733 GLN 733 733 733 GLN GLN A . n 
A 1 734 LYS 734 734 734 LYS LYS A . n 
A 1 735 SER 735 735 735 SER SER A . n 
A 1 736 SER 736 736 736 SER SER A . n 
A 1 737 THR 737 737 737 THR THR A . n 
A 1 738 PRO 738 738 738 PRO PRO A . n 
A 1 739 LYS 739 739 739 LYS LYS A . n 
A 1 740 ALA 740 740 740 ALA ALA A . n 
A 1 741 VAL 741 741 741 VAL VAL A . n 
A 1 742 GLN 742 742 742 GLN GLN A . n 
A 1 743 LYS 743 743 743 LYS LYS A . n 
A 1 744 ALA 744 744 744 ALA ALA A . n 
A 1 745 LEU 745 745 745 LEU LEU A . n 
A 1 746 LYS 746 746 746 LYS LYS A . n 
A 1 747 GLU 747 747 747 GLU GLU A . n 
A 1 748 CYS 748 748 748 CYS CYS A . n 
A 1 749 ILE 749 749 749 ILE ILE A . n 
A 1 750 ARG 750 750 750 ARG ARG A . n 
A 1 751 ARG 751 751 751 ARG ARG A . n 
A 1 752 MET 752 752 752 MET MET A . n 
A 1 753 LEU 753 753 753 LEU LEU A . n 
A 1 754 GLN 754 754 754 GLN GLN A . n 
A 1 755 GLU 755 755 755 GLU GLU A . n 
A 1 756 GLY 756 756 756 GLY GLY A . n 
A 1 757 GLU 757 757 757 GLU GLU A . n 
A 1 758 GLU 758 758 758 GLU GLU A . n 
A 1 759 SER 759 759 759 SER SER A . n 
A 1 760 LEU 760 760 760 LEU LEU A . n 
A 1 761 GLN 761 761 761 GLN GLN A . n 
A 1 762 GLU 762 762 762 GLU GLU A . n 
A 1 763 TYR 763 763 763 TYR TYR A . n 
A 1 764 PHE 764 764 764 PHE PHE A . n 
A 1 765 LYS 765 765 765 LYS LYS A . n 
A 1 766 GLU 766 766 766 GLU GLU A . n 
A 1 767 PHE 767 767 767 PHE PHE A . n 
A 1 768 GLU 768 768 768 GLU GLU A . n 
A 1 769 LYS 769 769 769 LYS LYS A . n 
A 1 770 GLU 770 770 770 GLU GLU A . n 
A 1 771 PHE 771 771 771 PHE PHE A . n 
A 1 772 ARG 772 772 772 ARG ARG A . n 
A 1 773 GLN 773 773 773 GLN GLN A . n 
A 1 774 LEU 774 774 774 LEU LEU A . n 
A 1 775 ASN 775 775 775 ASN ASN A . n 
A 1 776 TYR 776 776 776 TYR TYR A . n 
A 1 777 ILE 777 777 777 ILE ILE A . n 
A 1 778 SER 778 778 778 SER SER A . n 
A 1 779 ILE 779 779 779 ILE ILE A . n 
A 1 780 ALA 780 780 780 ALA ALA A . n 
A 1 781 SER 781 781 781 SER SER A . n 
A 1 782 VAL 782 782 782 VAL VAL A . n 
A 1 783 SER 783 783 783 SER SER A . n 
A 1 784 SER 784 784 784 SER SER A . n 
A 1 785 ALA 785 785 785 ALA ALA A . n 
A 1 786 ASN 786 786 786 ASN ASN A . n 
A 1 787 ASN 787 787 787 ASN ASN A . n 
A 1 788 ILE 788 788 788 ILE ILE A . n 
A 1 789 ALA 789 789 789 ALA ALA A . n 
A 1 790 LYS 790 790 790 LYS LYS A . n 
A 1 791 TYR 791 791 791 TYR TYR A . n 
A 1 792 ASP 792 792 792 ASP ASP A . n 
A 1 793 VAL 793 793 793 VAL VAL A . n 
A 1 794 GLY 794 794 794 GLY GLY A . n 
A 1 795 GLY 795 795 795 GLY GLY A . n 
A 1 796 PHE 796 796 796 PHE PHE A . n 
A 1 797 PRO 797 797 797 PRO PRO A . n 
A 1 798 GLY 798 798 798 GLY GLY A . n 
A 1 799 PRO 799 799 799 PRO PRO A . n 
A 1 800 LYS 800 800 800 LYS LYS A . n 
A 1 801 CYS 801 801 801 CYS CYS A . n 
A 1 802 PRO 802 802 802 PRO PRO A . n 
A 1 803 PHE 803 803 803 PHE PHE A . n 
A 1 804 HIS 804 804 804 HIS HIS A . n 
A 1 805 ILE 805 805 805 ILE ILE A . n 
A 1 806 ARG 806 806 806 ARG ARG A . n 
A 1 807 GLY 807 807 807 GLY GLY A . n 
A 1 808 ILE 808 808 808 ILE ILE A . n 
A 1 809 LEU 809 809 809 LEU LEU A . n 
A 1 810 THR 810 810 810 THR THR A . n 
A 1 811 TYR 811 811 811 TYR TYR A . n 
A 1 812 ASN 812 812 812 ASN ASN A . n 
A 1 813 ARG 813 813 813 ARG ARG A . n 
A 1 814 ALA 814 814 814 ALA ALA A . n 
A 1 815 ILE 815 815 815 ILE ILE A . n 
A 1 816 LYS 816 816 816 LYS LYS A . n 
A 1 817 GLY 817 817 817 GLY GLY A . n 
A 1 818 ASN 818 818 818 ASN ASN A . n 
A 1 819 ILE 819 819 819 ILE ILE A . n 
A 1 820 ASP 820 820 820 ASP ASP A . n 
A 1 821 ALA 821 821 821 ALA ALA A . n 
A 1 822 PRO 822 822 822 PRO PRO A . n 
A 1 823 GLN 823 823 823 GLN GLN A . n 
A 1 824 VAL 824 824 824 VAL VAL A . n 
A 1 825 VAL 825 825 825 VAL VAL A . n 
A 1 826 GLU 826 826 826 GLU GLU A . n 
A 1 827 GLY 827 827 827 GLY GLY A . n 
A 1 828 GLU 828 828 828 GLU GLU A . n 
A 1 829 LYS 829 829 829 LYS LYS A . n 
A 1 830 VAL 830 830 830 VAL VAL A . n 
A 1 831 TYR 831 831 831 TYR TYR A . n 
A 1 832 VAL 832 832 832 VAL VAL A . n 
A 1 833 LEU 833 833 833 LEU LEU A . n 
A 1 834 PRO 834 834 834 PRO PRO A . n 
A 1 835 LEU 835 835 835 LEU LEU A . n 
A 1 836 ARG 836 836 836 ARG ARG A . n 
A 1 837 GLU 837 837 837 GLU GLU A . n 
A 1 838 GLY 838 838 838 GLY GLY A . n 
A 1 839 ASN 839 839 839 ASN ASN A . n 
A 1 840 PRO 840 840 840 PRO PRO A . n 
A 1 841 PHE 841 841 841 PHE PHE A . n 
A 1 842 GLY 842 842 842 GLY GLY A . n 
A 1 843 ASP 843 843 843 ASP ASP A . n 
A 1 844 LYS 844 844 844 LYS LYS A . n 
A 1 845 CYS 845 845 845 CYS CYS A . n 
A 1 846 ILE 846 846 846 ILE ILE A . n 
A 1 847 ALA 847 847 847 ALA ALA A . n 
A 1 848 TRP 848 848 848 TRP TRP A . n 
A 1 849 PRO 849 849 849 PRO PRO A . n 
A 1 850 SER 850 850 850 SER SER A . n 
A 1 851 GLY 851 851 851 GLY GLY A . n 
A 1 852 THR 852 852 852 THR THR A . n 
A 1 853 GLU 853 853 853 GLU GLU A . n 
A 1 854 ILE 854 854 854 ILE ILE A . n 
A 1 855 THR 855 855 855 THR THR A . n 
A 1 856 ASP 856 856 856 ASP ASP A . n 
A 1 857 LEU 857 857 857 LEU LEU A . n 
A 1 858 ILE 858 858 858 ILE ILE A . n 
A 1 859 LYS 859 859 859 LYS LYS A . n 
A 1 860 ASP 860 860 860 ASP ASP A . n 
A 1 861 ASP 861 861 861 ASP ASP A . n 
A 1 862 VAL 862 862 862 VAL VAL A . n 
A 1 863 LEU 863 863 863 LEU LEU A . n 
A 1 864 HIS 864 864 864 HIS HIS A . n 
A 1 865 TRP 865 865 865 TRP TRP A . n 
A 1 866 MET 866 866 866 MET MET A . n 
A 1 867 ASP 867 867 867 ASP ASP A . n 
A 1 868 TYR 868 868 868 TYR TYR A . n 
A 1 869 THR 869 869 869 THR THR A . n 
A 1 870 VAL 870 870 870 VAL VAL A . n 
A 1 871 LEU 871 871 871 LEU LEU A . n 
A 1 872 LEU 872 872 872 LEU LEU A . n 
A 1 873 GLU 873 873 873 GLU GLU A . n 
A 1 874 LYS 874 874 874 LYS LYS A . n 
A 1 875 THR 875 875 875 THR THR A . n 
A 1 876 PHE 876 876 876 PHE PHE A . n 
A 1 877 ILE 877 877 877 ILE ILE A . n 
A 1 878 LYS 878 878 878 LYS LYS A . n 
A 1 879 PRO 879 879 879 PRO PRO A . n 
A 1 880 LEU 880 880 880 LEU LEU A . n 
A 1 881 GLU 881 881 881 GLU GLU A . n 
A 1 882 GLY 882 882 882 GLY GLY A . n 
A 1 883 PHE 883 883 883 PHE PHE A . n 
A 1 884 THR 884 884 884 THR THR A . n 
A 1 885 SER 885 885 885 SER SER A . n 
A 1 886 ALA 886 886 886 ALA ALA A . n 
A 1 887 ALA 887 887 887 ALA ALA A . n 
A 1 888 LYS 888 888 888 LYS LYS A . n 
A 1 889 LEU 889 889 889 LEU LEU A . n 
A 1 890 ASP 890 890 890 ASP ASP A . n 
A 1 891 TYR 891 891 891 TYR TYR A . n 
A 1 892 GLU 892 892 892 GLU GLU A . n 
A 1 893 LYS 893 893 893 LYS LYS A . n 
A 1 894 LYS 894 894 894 LYS LYS A . n 
A 1 895 ALA 895 895 895 ALA ALA A . n 
A 1 896 SER 896 896 896 SER SER A . n 
A 1 897 LEU 897 897 897 LEU LEU A . n 
A 1 898 PHE 898 898 898 PHE PHE A . n 
A 1 899 ASP 899 899 899 ASP ASP A . n 
A 1 900 MET 900 900 900 MET MET A . n 
A 1 901 PHE 901 901 901 PHE PHE A . n 
A 1 902 ASP 902 902 902 ASP ASP A . n 
A 1 903 PHE 903 903 903 PHE PHE A . n 
B 2 1   DT  1   1   1   DT  DT  T . n 
B 2 2   DC  2   2   2   DC  DC  T . n 
B 2 3   DA  3   3   3   DA  DA  T . n 
B 2 4   8OG 4   4   4   8OG 8OG T . n 
B 2 5   DG  5   5   5   DG  DG  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
B 2 10  DC  10  10  10  DC  DC  T . n 
B 2 11  DA  11  11  11  DA  DA  T . n 
B 2 12  DG  12  12  12  DG  DG  T . n 
B 2 13  DT  13  13  13  DT  DT  T . n 
B 2 14  DC  14  14  14  DC  DC  T . n 
B 2 15  DC  15  15  15  DC  DC  T . n 
B 2 16  DG  16  16  16  DG  DG  T . n 
B 2 17  DC  17  17  17  DC  DC  T . n 
B 2 18  DG  18  18  18  DG  DG  T . n 
C 3 1   DG  1   103 103 DG  DG  P . n 
C 3 2   DC  2   104 104 DC  DC  P . n 
C 3 3   DG  3   105 105 DG  DG  P . n 
C 3 4   DG  4   106 106 DG  DG  P . n 
C 3 5   DA  5   107 107 DA  DA  P . n 
C 3 6   DC  6   108 108 DC  DC  P . n 
C 3 7   DT  7   109 109 DT  DT  P . n 
C 3 8   DG  8   110 110 DG  DG  P . n 
C 3 9   DC  9   111 111 DC  DC  P . n 
C 3 10  DT  10  112 112 DT  DT  P . n 
C 3 11  DT  11  113 113 DT  DT  P . n 
C 3 12  DA  12  114 114 DA  DA  P . n 
C 3 13  DOC 13  115 115 DOC DOC P . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B 8OG 4  T 8OG 4   ? DG ?                                        
2 C DOC 13 P DOC 115 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7300  ? 
1 MORE         -64   ? 
1 'SSA (A^2)'  43360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 623 ? A ASP 623  ? 1_555 86.5  ? 
2  O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2G ? D DTP .   ? A DTP 904  ? 1_555 79.3  ? 
3  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2G ? D DTP .   ? A DTP 904  ? 1_555 162.9 ? 
4  O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 92.1  ? 
5  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 89.2  ? 
6  O2G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 100.9 ? 
7  O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 152.1 ? 
8  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 118.8 ? 
9  O2G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 77.3  ? 
10 O   ? A LEU 412 ? A LEU 412  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 77.7  ? 
11 O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 77.0  ? 
12 OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 79.9  ? 
13 O2G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 87.4  ? 
14 O   ? A LEU 412 ? A LEU 412  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 165.0 ? 
15 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 116.6 ? 
16 O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 157.5 ? 
17 OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 72.6  ? 
18 O2G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 119.5 ? 
19 O   ? A LEU 412 ? A LEU 412  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 95.9  ? 
20 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 50.4  ? 
21 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 90.7  ? 
22 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? A LYS 531 ? A LYS 531  ? 1_555 166.0 ? 
23 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 99.4  ? 
24 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 72.9  ? 
25 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 983  ? 1_555 86.2  ? 
26 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 983  ? 1_555 92.1  ? 
27 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 983  ? 1_555 138.9 ? 
28 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 933  ? 1_555 88.2  ? 
29 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 933  ? 1_555 77.9  ? 
30 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 933  ? 1_555 65.5  ? 
31 O   ? J HOH .   ? A HOH 983  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? J HOH .   ? A HOH 933  ? 1_555 74.1  ? 
32 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 OD2 ? A ASP 623 ? A ASP 623  ? 1_555 80.0  ? 
33 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 86.4  ? 
34 OD2 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 69.1  ? 
35 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? J HOH .   ? A HOH 1069 ? 1_555 75.2  ? 
36 OD2 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? J HOH .   ? A HOH 1069 ? 1_555 146.5 ? 
37 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? J HOH .   ? A HOH 1069 ? 1_555 130.3 ? 
38 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 47.0  ? 
39 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 1070 ? 1_555 151.2 ? 
40 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 1070 ? 1_555 157.1 ? 
41 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 910  ? 1_555 87.2  ? 
42 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 910  ? 1_555 84.7  ? 
43 O   ? J HOH .   ? A HOH 1070 ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 910  ? 1_555 83.6  ? 
44 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 1019 ? 1_555 111.0 ? 
45 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 1019 ? 1_555 112.6 ? 
46 O   ? J HOH .   ? A HOH 1070 ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 1019 ? 1_555 77.1  ? 
47 O   ? J HOH .   ? A HOH 910  ? 1_555 CA ? I CA . ? A CA 909 ? 1_555 O   ? J HOH .   ? A HOH 1019 ? 1_555 160.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-12 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 17.7340  -3.8350  36.9210 0.0393 0.0851 0.1721 -0.0168 -0.0008 -0.0032 0.8830 0.0258 0.1223 
-0.0580 -0.2513 -0.0130 -0.0782 0.0073  0.0709  -0.0115 0.0967  -0.0648 0.0007  0.0287  -0.0144 
'X-RAY DIFFRACTION' 2 ? refined -25.2010 -0.0080  32.3590 0.0283 0.0460 0.1068 -0.0017 0.0199  0.0041  0.2905 1.1449 0.2171 
-0.1022 -0.0714 0.3038  0.0424  -0.0135 -0.0289 -0.0082 0.0618  0.0852  -0.0026 0.0147  -0.0181 
'X-RAY DIFFRACTION' 3 ? refined -8.6740  -23.8160 13.4280 0.0722 0.0784 0.0518 0.0123  -0.0170 0.0099  0.0726 0.5550 0.2570 
-0.0825 -0.0826 -0.0617 0.0002  -0.0436 0.0434  0.0158  0.0115  0.0012  -0.0760 0.0482  0.0368  
'X-RAY DIFFRACTION' 4 ? refined 2.0190   -9.4730  60.6070 0.0660 0.1293 0.0226 -0.0001 0.0154  -0.0336 0.3125 0.4734 0.2611 
-0.1396 -0.1582 -0.1727 0.0209  -0.0006 -0.0203 -0.1548 0.0300  0.0325  0.0663  -0.0214 0.1246  
'X-RAY DIFFRACTION' 5 ? refined -9.9350  -28.9750 46.2080 0.0853 0.0616 0.0380 0.0153  0.0144  0.0050  0.2302 2.9883 0.1351 
-0.4620 -0.0734 -0.1690 -0.0730 0.0942  -0.0213 -0.0941 -0.0260 0.1092  0.0211  0.0705  0.0370  
'X-RAY DIFFRACTION' 6 ? refined 9.0640   -24.9120 48.1970 0.0628 0.1186 0.0335 0.0478  0.0181  0.0158  0.8184 0.5266 1.9471 0.1422 
-1.1897 0.0401  -0.0152 0.0172  -0.0020 -0.0885 -0.0077 -0.0341 0.0297  0.0444  0.0574  
'X-RAY DIFFRACTION' 7 ? refined 22.7090  -20.9430 28.4690 0.0800 0.0335 0.0771 -0.0249 0.0577  -0.0178 0.9792 0.5977 1.1542 
-0.3207 0.1027  -0.4266 -0.1163 0.0468  0.0695  0.0025  -0.0697 -0.1353 -0.1234 0.0238  0.0626  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1 T 1   T 18  ? . . . . ? 
'X-RAY DIFFRACTION' 2  1 P 103 P 115 ? . . . . ? 
'X-RAY DIFFRACTION' 3  1 X 1   X 1   ? . . . . ? 
'X-RAY DIFFRACTION' 4  2 A 1   A 105 ? . . . . ? 
'X-RAY DIFFRACTION' 5  2 A 340 A 389 ? . . . . ? 
'X-RAY DIFFRACTION' 6  3 A 106 A 339 ? . . . . ? 
'X-RAY DIFFRACTION' 7  4 A 390 A 468 ? . . . . ? 
'X-RAY DIFFRACTION' 8  4 A 576 A 706 ? . . . . ? 
'X-RAY DIFFRACTION' 9  5 A 469 A 575 ? . . . . ? 
'X-RAY DIFFRACTION' 10 6 A 707 A 737 ? . . . . ? 
'X-RAY DIFFRACTION' 11 7 A 738 A 901 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
AMoRE    phasing           .        ? 2 
REFMAC   refinement        5.4.0077 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" T DA  3   ? ? P T 8OG 4   ? ? 1.474 1.607 -0.133 0.012 Y 
2 1 "O3'" T 8OG 4   ? ? P T DG  5   ? ? 1.482 1.607 -0.125 0.012 Y 
3 1 "O3'" P DA  114 ? ? P P DOC 115 ? ? 1.481 1.607 -0.126 0.012 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" T DT 1   ? ? "O3'" T DT  1   ? ? P   T DC  2   ? ? 128.73 119.70 9.03  1.20 Y 
2  1 "O4'" T DC 2   ? ? "C1'" T DC  2   ? ? N1  T DC  2   ? ? 111.46 108.30 3.16  0.30 N 
3  1 "C3'" T DA 3   ? ? "O3'" T DA  3   ? ? P   T 8OG 4   ? ? 141.55 119.70 21.85 1.20 Y 
4  1 "O3'" T DA 3   ? ? P     T 8OG 4   ? ? OP1 T 8OG 4   ? ? 127.89 110.50 17.39 1.10 Y 
5  1 "O4'" T DT 6   ? ? "C1'" T DT  6   ? ? N1  T DT  6   ? ? 110.86 108.30 2.56  0.30 N 
6  1 "O4'" T DA 8   ? ? "C1'" T DA  8   ? ? N9  T DA  8   ? ? 113.42 108.30 5.12  0.30 N 
7  1 "O4'" T DG 12  ? ? "C1'" T DG  12  ? ? N9  T DG  12  ? ? 110.87 108.30 2.57  0.30 N 
8  1 "O4'" T DC 15  ? ? "C1'" T DC  15  ? ? N1  T DC  15  ? ? 111.21 108.30 2.91  0.30 N 
9  1 "O4'" T DC 17  ? ? "C1'" T DC  17  ? ? N1  T DC  17  ? ? 113.92 108.30 5.62  0.30 N 
10 1 "O4'" P DG 103 ? ? "C1'" P DG  103 ? ? N9  P DG  103 ? ? 112.64 108.30 4.34  0.30 N 
11 1 "O4'" P DC 104 ? ? "C1'" P DC  104 ? ? N1  P DC  104 ? ? 112.87 108.30 4.57  0.30 N 
12 1 "O4'" P DG 105 ? ? "C1'" P DG  105 ? ? N9  P DG  105 ? ? 110.74 108.30 2.44  0.30 N 
13 1 "O4'" P DC 108 ? ? "C1'" P DC  108 ? ? N1  P DC  108 ? ? 111.01 108.30 2.71  0.30 N 
14 1 "O4'" P DT 112 ? ? "C1'" P DT  112 ? ? N1  P DT  112 ? ? 110.65 108.30 2.35  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 11  ? ? -100.49 -76.71  
2  1 PRO A 42  ? ? -28.39  -80.30  
3  1 GLU A 43  ? ? 169.11  -52.33  
4  1 SER A 44  ? ? 84.89   38.09   
5  1 ALA A 46  ? ? 48.01   87.83   
6  1 THR A 47  ? ? -124.54 -52.85  
7  1 LYS A 48  ? ? 92.14   -39.12  
8  1 PHE A 221 ? ? -123.46 -75.22  
9  1 VAL A 252 ? ? -94.72  -71.09  
10 1 ILE A 253 ? ? 52.82   103.65  
11 1 ASN A 255 ? ? 57.09   167.14  
12 1 SER A 259 ? ? 161.76  108.15  
13 1 ASN A 316 ? ? -147.10 56.72   
14 1 LYS A 352 ? ? 70.06   53.89   
15 1 ASN A 424 ? ? 77.94   44.07   
16 1 VAL A 436 ? ? -65.44  -82.62  
17 1 ALA A 437 ? ? 95.87   146.52  
18 1 PRO A 458 ? ? -64.84  0.97    
19 1 ASP A 468 ? ? 71.14   146.84  
20 1 ASP A 579 ? ? -171.81 107.59  
21 1 THR A 622 ? ? 67.49   -67.32  
22 1 SER A 639 ? ? -29.80  -67.92  
23 1 LYS A 640 ? ? 143.61  -40.88  
24 1 GLU A 686 ? ? -105.01 -71.29  
25 1 LYS A 894 ? ? -85.81  -132.18 
26 1 ALA A 895 ? ? -31.70  -101.10 
27 1 ASP A 899 ? ? -33.09  -39.74  
28 1 MET A 900 ? ? -91.17  52.06   
29 1 ASP A 902 ? ? -143.51 -25.73  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3LZI 'double helix'        
3LZI 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 5  1_555 C DOC 13 1_555 -0.534 -0.032 -0.139 -9.440 -15.679 1.677  1  T_DG5:DOC115_P T 5  ? P 115 ? 19 1 
1 B DT 6  1_555 C DA  12 1_555 -0.193 -0.059 -0.156 -1.165 0.188   -4.232 2  T_DT6:DA114_P  T 6  ? P 114 ? 20 1 
1 B DA 7  1_555 C DT  11 1_555 0.071  -0.137 -0.226 -4.680 -7.270  3.468  3  T_DA7:DT113_P  T 7  ? P 113 ? 20 1 
1 B DA 8  1_555 C DT  10 1_555 0.106  -0.283 -0.102 3.596  -5.081  2.169  4  T_DA8:DT112_P  T 8  ? P 112 ? 20 1 
1 B DG 9  1_555 C DC  9  1_555 -0.327 -0.215 0.283  6.956  -3.067  -1.428 5  T_DG9:DC111_P  T 9  ? P 111 ? 19 1 
1 B DC 10 1_555 C DG  8  1_555 0.576  -0.022 -0.150 13.393 -5.302  3.372  6  T_DC10:DG110_P T 10 ? P 110 ? 19 1 
1 B DA 11 1_555 C DT  7  1_555 0.332  -0.174 0.056  6.939  -10.162 -3.160 7  T_DA11:DT109_P T 11 ? P 109 ? 20 1 
1 B DG 12 1_555 C DC  6  1_555 -0.035 -0.067 0.276  6.127  -16.543 1.686  8  T_DG12:DC108_P T 12 ? P 108 ? 19 1 
1 B DT 13 1_555 C DA  5  1_555 -0.065 -0.293 -0.170 2.635  -8.732  -2.228 9  T_DT13:DA107_P T 13 ? P 107 ? 20 1 
1 B DC 14 1_555 C DG  4  1_555 0.209  -0.130 -0.089 -0.131 -10.822 0.709  10 T_DC14:DG106_P T 14 ? P 106 ? 19 1 
1 B DC 15 1_555 C DG  3  1_555 0.603  -0.067 0.303  2.408  -12.193 5.158  11 T_DC15:DG105_P T 15 ? P 105 ? 19 1 
1 B DG 16 1_555 C DC  2  1_555 0.025  0.044  -0.026 -8.253 -4.042  0.871  12 T_DG16:DC104_P T 16 ? P 104 ? 19 1 
1 B DC 17 1_555 C DG  1  1_555 0.264  0.056  -0.334 10.236 5.563   4.353  13 T_DC17:DG103_P T 17 ? P 103 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 5  1_555 C DOC 13 1_555 B DT 6  1_555 C DA 12 1_555 -0.931 -1.040 3.227 2.781  6.870  28.075 -3.492 2.432  2.795 13.857 
-5.610 29.018 1  TT_DG5DT6:DA114DOC115_PP  T 5  ? P 115 ? T 6  ? P 114 ? 
1 B DT 6  1_555 C DA  12 1_555 B DA 7  1_555 C DT 11 1_555 -0.019 -0.422 3.415 -2.741 2.954  40.914 -0.934 -0.282 3.372 4.213  
3.910  41.103 2  TT_DT6DA7:DT113DA114_PP   T 6  ? P 114 ? T 7  ? P 113 ? 
1 B DA 7  1_555 C DT  11 1_555 B DA 8  1_555 C DT 10 1_555 0.370  -0.503 3.303 -1.736 -1.840 27.045 -0.602 -1.229 3.300 -3.923 
3.702  27.161 3  TT_DA7DA8:DT112DT113_PP   T 7  ? P 113 ? T 8  ? P 112 ? 
1 B DA 8  1_555 C DT  10 1_555 B DG 9  1_555 C DC 9  1_555 -0.913 -0.284 3.170 -5.712 1.032  33.546 -0.648 0.658  3.266 1.771  
9.805  34.030 4  TT_DA8DG9:DC111DT112_PP   T 8  ? P 112 ? T 9  ? P 111 ? 
1 B DG 9  1_555 C DC  9  1_555 B DC 10 1_555 C DG 8  1_555 -0.282 -0.250 3.276 4.206  5.358  33.733 -1.252 1.127  3.144 9.118  
-7.157 34.394 5  TT_DG9DC10:DG110DC111_PP  T 9  ? P 111 ? T 10 ? P 110 ? 
1 B DC 10 1_555 C DG  8  1_555 B DA 11 1_555 C DT 7  1_555 -0.901 -0.267 3.454 -4.127 4.960  36.260 -1.141 0.828  3.467 7.892  
6.567  36.810 6  TT_DC10DA11:DT109DG110_PP T 10 ? P 110 ? T 11 ? P 109 ? 
1 B DA 11 1_555 C DT  7  1_555 B DG 12 1_555 C DC 6  1_555 0.733  -0.858 3.312 -5.624 6.507  30.810 -2.700 -2.317 2.899 11.958 
10.336 31.960 7  TT_DA11DG12:DC108DT109_PP T 11 ? P 109 ? T 12 ? P 108 ? 
1 B DG 12 1_555 C DC  6  1_555 B DT 13 1_555 C DA 5  1_555 -0.907 -0.676 3.306 3.458  3.583  34.512 -1.666 2.032  3.120 6.000  
-5.791 34.859 8  TT_DG12DT13:DA107DC108_PP T 12 ? P 108 ? T 13 ? P 107 ? 
1 B DT 13 1_555 C DA  5  1_555 B DC 14 1_555 C DG 4  1_555 0.545  0.043  3.236 2.244  8.776  37.747 -1.005 -0.548 3.193 13.331 
-3.408 38.780 9  TT_DT13DC14:DG106DA107_PP T 13 ? P 107 ? T 14 ? P 106 ? 
1 B DC 14 1_555 C DG  4  1_555 B DC 15 1_555 C DG 3  1_555 0.751  -0.138 3.219 -2.290 10.483 33.296 -1.771 -1.587 2.984 17.731 
3.873  34.935 10 TT_DC14DC15:DG105DG106_PP T 14 ? P 106 ? T 15 ? P 105 ? 
1 B DC 15 1_555 C DG  3  1_555 B DG 16 1_555 C DC 2  1_555 0.421  0.267  3.462 6.750  6.154  39.607 -0.353 0.202  3.487 8.938  
-9.804 40.605 11 TT_DC15DG16:DC104DG105_PP T 15 ? P 105 ? T 16 ? P 104 ? 
1 B DG 16 1_555 C DC  2  1_555 B DC 17 1_555 C DG 1  1_555 0.787  -0.028 2.953 0.765  5.570  23.035 -1.740 -1.686 2.889 13.686 
-1.879 23.702 12 TT_DG16DC17:DG103DC104_PP T 16 ? P 104 ? T 17 ? P 103 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DTP 1   904  1   DTP DTP A . 
E 5 CA  1   905  1   CA  CA  A . 
F 5 CA  1   906  2   CA  CA  A . 
G 5 CA  1   907  3   CA  CA  A . 
H 5 CA  1   908  4   CA  CA  A . 
I 5 CA  1   909  5   CA  CA  A . 
J 6 HOH 1   910  1   HOH HOH A . 
J 6 HOH 2   911  2   HOH HOH A . 
J 6 HOH 3   912  3   HOH HOH A . 
J 6 HOH 4   913  4   HOH HOH A . 
J 6 HOH 5   914  5   HOH HOH A . 
J 6 HOH 6   915  6   HOH HOH A . 
J 6 HOH 7   916  7   HOH HOH A . 
J 6 HOH 8   917  8   HOH HOH A . 
J 6 HOH 9   918  9   HOH HOH A . 
J 6 HOH 10  919  10  HOH HOH A . 
J 6 HOH 11  920  11  HOH HOH A . 
J 6 HOH 12  921  12  HOH HOH A . 
J 6 HOH 13  922  13  HOH HOH A . 
J 6 HOH 14  923  14  HOH HOH A . 
J 6 HOH 15  924  16  HOH HOH A . 
J 6 HOH 16  925  17  HOH HOH A . 
J 6 HOH 17  926  18  HOH HOH A . 
J 6 HOH 18  927  20  HOH HOH A . 
J 6 HOH 19  928  21  HOH HOH A . 
J 6 HOH 20  929  22  HOH HOH A . 
J 6 HOH 21  930  23  HOH HOH A . 
J 6 HOH 22  931  24  HOH HOH A . 
J 6 HOH 23  932  25  HOH HOH A . 
J 6 HOH 24  933  26  HOH HOH A . 
J 6 HOH 25  934  27  HOH HOH A . 
J 6 HOH 26  935  28  HOH HOH A . 
J 6 HOH 27  936  29  HOH HOH A . 
J 6 HOH 28  937  31  HOH HOH A . 
J 6 HOH 29  938  32  HOH HOH A . 
J 6 HOH 30  939  33  HOH HOH A . 
J 6 HOH 31  940  34  HOH HOH A . 
J 6 HOH 32  941  35  HOH HOH A . 
J 6 HOH 33  942  36  HOH HOH A . 
J 6 HOH 34  943  37  HOH HOH A . 
J 6 HOH 35  944  38  HOH HOH A . 
J 6 HOH 36  945  39  HOH HOH A . 
J 6 HOH 37  946  40  HOH HOH A . 
J 6 HOH 38  947  41  HOH HOH A . 
J 6 HOH 39  948  42  HOH HOH A . 
J 6 HOH 40  949  43  HOH HOH A . 
J 6 HOH 41  950  45  HOH HOH A . 
J 6 HOH 42  951  46  HOH HOH A . 
J 6 HOH 43  952  47  HOH HOH A . 
J 6 HOH 44  953  48  HOH HOH A . 
J 6 HOH 45  954  49  HOH HOH A . 
J 6 HOH 46  955  50  HOH HOH A . 
J 6 HOH 47  956  51  HOH HOH A . 
J 6 HOH 48  957  52  HOH HOH A . 
J 6 HOH 49  958  53  HOH HOH A . 
J 6 HOH 50  959  54  HOH HOH A . 
J 6 HOH 51  960  55  HOH HOH A . 
J 6 HOH 52  961  56  HOH HOH A . 
J 6 HOH 53  962  57  HOH HOH A . 
J 6 HOH 54  963  58  HOH HOH A . 
J 6 HOH 55  964  59  HOH HOH A . 
J 6 HOH 56  965  60  HOH HOH A . 
J 6 HOH 57  966  61  HOH HOH A . 
J 6 HOH 58  967  62  HOH HOH A . 
J 6 HOH 59  968  64  HOH HOH A . 
J 6 HOH 60  969  65  HOH HOH A . 
J 6 HOH 61  970  66  HOH HOH A . 
J 6 HOH 62  971  67  HOH HOH A . 
J 6 HOH 63  972  68  HOH HOH A . 
J 6 HOH 64  973  69  HOH HOH A . 
J 6 HOH 65  974  70  HOH HOH A . 
J 6 HOH 66  975  72  HOH HOH A . 
J 6 HOH 67  976  73  HOH HOH A . 
J 6 HOH 68  977  74  HOH HOH A . 
J 6 HOH 69  978  75  HOH HOH A . 
J 6 HOH 70  979  76  HOH HOH A . 
J 6 HOH 71  980  77  HOH HOH A . 
J 6 HOH 72  981  78  HOH HOH A . 
J 6 HOH 73  982  79  HOH HOH A . 
J 6 HOH 74  983  80  HOH HOH A . 
J 6 HOH 75  984  81  HOH HOH A . 
J 6 HOH 76  985  82  HOH HOH A . 
J 6 HOH 77  986  83  HOH HOH A . 
J 6 HOH 78  987  84  HOH HOH A . 
J 6 HOH 79  988  85  HOH HOH A . 
J 6 HOH 80  989  86  HOH HOH A . 
J 6 HOH 81  990  87  HOH HOH A . 
J 6 HOH 82  991  88  HOH HOH A . 
J 6 HOH 83  992  89  HOH HOH A . 
J 6 HOH 84  993  91  HOH HOH A . 
J 6 HOH 85  994  92  HOH HOH A . 
J 6 HOH 86  995  93  HOH HOH A . 
J 6 HOH 87  996  94  HOH HOH A . 
J 6 HOH 88  997  95  HOH HOH A . 
J 6 HOH 89  998  97  HOH HOH A . 
J 6 HOH 90  999  98  HOH HOH A . 
J 6 HOH 91  1000 99  HOH HOH A . 
J 6 HOH 92  1001 100 HOH HOH A . 
J 6 HOH 93  1002 101 HOH HOH A . 
J 6 HOH 94  1003 102 HOH HOH A . 
J 6 HOH 95  1004 103 HOH HOH A . 
J 6 HOH 96  1005 104 HOH HOH A . 
J 6 HOH 97  1006 105 HOH HOH A . 
J 6 HOH 98  1007 106 HOH HOH A . 
J 6 HOH 99  1008 107 HOH HOH A . 
J 6 HOH 100 1009 108 HOH HOH A . 
J 6 HOH 101 1010 109 HOH HOH A . 
J 6 HOH 102 1011 110 HOH HOH A . 
J 6 HOH 103 1012 111 HOH HOH A . 
J 6 HOH 104 1013 112 HOH HOH A . 
J 6 HOH 105 1014 113 HOH HOH A . 
J 6 HOH 106 1015 114 HOH HOH A . 
J 6 HOH 107 1016 115 HOH HOH A . 
J 6 HOH 108 1017 116 HOH HOH A . 
J 6 HOH 109 1018 117 HOH HOH A . 
J 6 HOH 110 1019 118 HOH HOH A . 
J 6 HOH 111 1020 119 HOH HOH A . 
J 6 HOH 112 1021 120 HOH HOH A . 
J 6 HOH 113 1022 122 HOH HOH A . 
J 6 HOH 114 1023 123 HOH HOH A . 
J 6 HOH 115 1024 124 HOH HOH A . 
J 6 HOH 116 1025 125 HOH HOH A . 
J 6 HOH 117 1026 126 HOH HOH A . 
J 6 HOH 118 1027 128 HOH HOH A . 
J 6 HOH 119 1028 129 HOH HOH A . 
J 6 HOH 120 1029 130 HOH HOH A . 
J 6 HOH 121 1030 132 HOH HOH A . 
J 6 HOH 122 1031 133 HOH HOH A . 
J 6 HOH 123 1032 134 HOH HOH A . 
J 6 HOH 124 1033 135 HOH HOH A . 
J 6 HOH 125 1034 136 HOH HOH A . 
J 6 HOH 126 1035 137 HOH HOH A . 
J 6 HOH 127 1036 138 HOH HOH A . 
J 6 HOH 128 1037 141 HOH HOH A . 
J 6 HOH 129 1038 142 HOH HOH A . 
J 6 HOH 130 1039 143 HOH HOH A . 
J 6 HOH 131 1040 144 HOH HOH A . 
J 6 HOH 132 1041 146 HOH HOH A . 
J 6 HOH 133 1042 147 HOH HOH A . 
J 6 HOH 134 1043 148 HOH HOH A . 
J 6 HOH 135 1044 149 HOH HOH A . 
J 6 HOH 136 1045 150 HOH HOH A . 
J 6 HOH 137 1046 151 HOH HOH A . 
J 6 HOH 138 1047 152 HOH HOH A . 
J 6 HOH 139 1048 153 HOH HOH A . 
J 6 HOH 140 1049 154 HOH HOH A . 
J 6 HOH 141 1050 155 HOH HOH A . 
J 6 HOH 142 1051 156 HOH HOH A . 
J 6 HOH 143 1052 157 HOH HOH A . 
J 6 HOH 144 1053 158 HOH HOH A . 
J 6 HOH 145 1054 160 HOH HOH A . 
J 6 HOH 146 1055 161 HOH HOH A . 
J 6 HOH 147 1056 162 HOH HOH A . 
J 6 HOH 148 1057 163 HOH HOH A . 
J 6 HOH 149 1058 164 HOH HOH A . 
J 6 HOH 150 1059 165 HOH HOH A . 
J 6 HOH 151 1060 166 HOH HOH A . 
J 6 HOH 152 1061 167 HOH HOH A . 
J 6 HOH 153 1062 168 HOH HOH A . 
J 6 HOH 154 1063 169 HOH HOH A . 
J 6 HOH 155 1064 170 HOH HOH A . 
J 6 HOH 156 1065 171 HOH HOH A . 
J 6 HOH 157 1066 172 HOH HOH A . 
J 6 HOH 158 1067 173 HOH HOH A . 
J 6 HOH 159 1068 174 HOH HOH A . 
J 6 HOH 160 1069 175 HOH HOH A . 
J 6 HOH 161 1070 176 HOH HOH A . 
K 6 HOH 1   19   19  HOH HOH T . 
K 6 HOH 2   20   15  HOH HOH T . 
K 6 HOH 3   30   30  HOH HOH T . 
K 6 HOH 4   44   44  HOH HOH T . 
K 6 HOH 5   71   71  HOH HOH T . 
K 6 HOH 6   90   90  HOH HOH T . 
K 6 HOH 7   96   96  HOH HOH T . 
K 6 HOH 8   121  121 HOH HOH T . 
K 6 HOH 9   131  131 HOH HOH T . 
K 6 HOH 10  139  139 HOH HOH T . 
K 6 HOH 11  140  140 HOH HOH T . 
K 6 HOH 12  145  145 HOH HOH T . 
K 6 HOH 13  159  159 HOH HOH T . 
L 6 HOH 1   63   63  HOH HOH P . 
L 6 HOH 2   127  127 HOH HOH P . 
#