data_3LZN
# 
_entry.id   3LZN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LZN         
RCSB  RCSB057923   
WWPDB D_1000057923 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O6C 'Structure of selenomethionyl rTp34 from Treponema pallidum' unspecified 
PDB 2O6D 'Structure of native rTp34 from Treponema pallidum' unspecified 
PDB 2O6E 'Structure of native rTp34 from Treponema pallidum from zinc-soaked crystals' unspecified 
PDB 2O6F 'Structure of metal- free rTp34 from Treponema pallidum' unspecified 
PDB 3LZO 'Crystal Structure Analysis of the copper-reconstituted P19 protein from Campylobacter jejuni at 1.65 A at pH 10.0' 
unspecified 
PDB 3LZP 
;Crystal Structure Analysis of the 'as-isolated' P19 protein from Campylobacter jejuni at 1.65 A at pH 9
;
unspecified 
PDB 3LZQ 'Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 1.41 A at pH 9' unspecified 
PDB 3LZL 'Crystal Structure Analysis of the as-isolated P19 protein from Campylobacter jejuni at 1.45 A at pH 9.0' unspecified 
PDB 3LZR 
;Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 2.73 A at pH 9 and Manganese peak wavelength (1.893 A)
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3LZN 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doukov, T.I.'    1 
'Chan, A.C.K.'    2 
'Scofield, M.'    3 
'Ramin, A.B.'     4 
'Tom-Yew, S.A.L.' 5 
'Murphy, M.E.P.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            401 
_citation.page_first                590 
_citation.page_last                 604 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20600116 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.06.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chan, A.C.'      1 
primary 'Doukov, T.I.'    2 
primary 'Scofield, M.'    3 
primary 'Tom-Yew, S.A.'   4 
primary 'Ramin, A.B.'     5 
primary 'Mackichan, J.K.' 6 
primary 'Gaynor, E.C.'    7 
primary 'Murphy, M.E.'    8 
# 
_cell.entry_id           3LZN 
_cell.length_a           54.396 
_cell.length_b           73.037 
_cell.length_c           74.817 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LZN 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'P19 protein' 17590.859 2   ? ? 'residues 22-179' ? 
2 non-polymer syn 'ZINC ION'    65.409    2   ? ? ?                 ? 
3 non-polymer syn 'SULFATE ION' 96.063    2   ? ? ?                 ? 
4 water       nat water         18.015    282 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   GLU n 
1 4   VAL n 
1 5   PRO n 
1 6   ILE n 
1 7   GLY n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  GLU n 
1 12  LEU n 
1 13  ASN n 
1 14  GLY n 
1 15  MET n 
1 16  GLU n 
1 17  ILE n 
1 18  ALA n 
1 19  ALA n 
1 20  VAL n 
1 21  TYR n 
1 22  LEU n 
1 23  GLN n 
1 24  PRO n 
1 25  ILE n 
1 26  GLU n 
1 27  MET n 
1 28  GLU n 
1 29  PRO n 
1 30  ARG n 
1 31  GLY n 
1 32  ILE n 
1 33  ASP n 
1 34  LEU n 
1 35  ALA n 
1 36  ALA n 
1 37  SER n 
1 38  LEU n 
1 39  ALA n 
1 40  ASP n 
1 41  ILE n 
1 42  HIS n 
1 43  LEU n 
1 44  GLU n 
1 45  ALA n 
1 46  ASP n 
1 47  ILE n 
1 48  HIS n 
1 49  ALA n 
1 50  LEU n 
1 51  LYS n 
1 52  ASN n 
1 53  ASN n 
1 54  PRO n 
1 55  ASN n 
1 56  GLY n 
1 57  PHE n 
1 58  PRO n 
1 59  GLU n 
1 60  GLY n 
1 61  PHE n 
1 62  TRP n 
1 63  MET n 
1 64  PRO n 
1 65  TYR n 
1 66  LEU n 
1 67  THR n 
1 68  ILE n 
1 69  ALA n 
1 70  TYR n 
1 71  GLU n 
1 72  LEU n 
1 73  LYS n 
1 74  ASN n 
1 75  THR n 
1 76  ASP n 
1 77  THR n 
1 78  GLY n 
1 79  ALA n 
1 80  ILE n 
1 81  LYS n 
1 82  ARG n 
1 83  GLY n 
1 84  THR n 
1 85  LEU n 
1 86  MET n 
1 87  PRO n 
1 88  MET n 
1 89  VAL n 
1 90  ALA n 
1 91  ASP n 
1 92  ASP n 
1 93  GLY n 
1 94  PRO n 
1 95  HIS n 
1 96  TYR n 
1 97  GLY n 
1 98  ALA n 
1 99  ASN n 
1 100 ILE n 
1 101 ALA n 
1 102 MET n 
1 103 GLU n 
1 104 LYS n 
1 105 ASP n 
1 106 LYS n 
1 107 LYS n 
1 108 GLY n 
1 109 GLY n 
1 110 PHE n 
1 111 GLY n 
1 112 VAL n 
1 113 GLY n 
1 114 ASN n 
1 115 TYR n 
1 116 GLU n 
1 117 LEU n 
1 118 THR n 
1 119 PHE n 
1 120 TYR n 
1 121 ILE n 
1 122 SER n 
1 123 ASN n 
1 124 PRO n 
1 125 GLU n 
1 126 LYS n 
1 127 GLN n 
1 128 GLY n 
1 129 PHE n 
1 130 GLY n 
1 131 ARG n 
1 132 HIS n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 GLU n 
1 137 THR n 
1 138 GLY n 
1 139 VAL n 
1 140 GLY n 
1 141 LYS n 
1 142 TRP n 
1 143 PHE n 
1 144 GLU n 
1 145 PRO n 
1 146 PHE n 
1 147 LYS n 
1 148 VAL n 
1 149 ASP n 
1 150 TYR n 
1 151 LYS n 
1 152 PHE n 
1 153 LYS n 
1 154 TYR n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 PRO n 
1 159 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CJJ81176_1650, Gene Cj81176_1659' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    81-176 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Campylobacter jejuni' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     354242 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET19 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A1W1R1_CAMJJ 
_struct_ref.pdbx_db_accession          A1W1R1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIK
RGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LZN A 2 ? 159 ? A1W1R1 22 ? 179 ? 2 159 
2 1 3LZN B 2 ? 159 ? A1W1R1 22 ? 179 ? 2 159 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LZN GLY A 1 ? UNP A1W1R1 ? ? 'EXPRESSION TAG' 1 1 
2 3LZN GLY B 1 ? UNP A1W1R1 ? ? 'EXPRESSION TAG' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3LZN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.77 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pdbx_details    
;PROTEIN TREATED WITH 30X EXCESS OF EDTA; WASHED, PRECIPITANT WAS 25-45% POLYETHYLENE GLYCOL (PEG) 350, 0.1 M CHES (2-(N-CYCLOHEXYLAMINO) ETHANE SULFONIC ACID) BUFFER PH 9.0, CRYO FROZEN WITHOUT ANY ADDITION, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-05-21 
_diffrn_detector.details                'Rh coated flat mirror, toroidal focusing mirror, Si 111 monochromator' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.282 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.282 
# 
_reflns.entry_id                     3LZN 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             19.11 
_reflns.d_resolution_high            1.59 
_reflns.number_obs                   40227 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.037 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.6 
_reflns.B_iso_Wilson_estimate        29.6 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.59 
_reflns_shell.d_res_low              1.68 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           0.655 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5772 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3LZN 
_refine.ls_number_reflns_obs                     38270 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.38 
_refine.ls_d_res_high                            1.59 
_refine.ls_percent_reflns_obs                    98.72 
_refine.ls_R_factor_obs                          0.14366 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.14158 
_refine.ls_R_factor_R_free                       0.18413 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1954 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.977 
_refine.correlation_coeff_Fo_to_Fc_free          0.965 
_refine.B_iso_mean                               23.712 
_refine.aniso_B[1][1]                            -0.69 
_refine.aniso_B[2][2]                            1.22 
_refine.aniso_B[3][3]                            -0.53 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'P6222 INCOMPLETE SEMAD MODEL AT 2.8 ANGS RESOLUTION.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.106 
_refine.pdbx_overall_ESU_R_Free                  0.081 
_refine.overall_SU_ML                            0.061 
_refine.overall_SU_B                             4.009 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3LZN 
_refine_analyze.Luzzati_coordinate_error_obs    0.106 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.081 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2470 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             282 
_refine_hist.number_atoms_total               2764 
_refine_hist.d_res_high                       1.59 
_refine_hist.d_res_low                        18.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.014  0.022  ? 2581 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 1770 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.472  1.973  ? 3501 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      1.478  3.000  ? 4343 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.792  5.000  ? 324  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 36.544 25.333 ? 120  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 13.413 15.000 ? 429  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 15.929 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.103  0.200  ? 354  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.007  0.021  ? 2895 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 499  'X-RAY DIFFRACTION' ? 
r_mcbond_it            2.636  3.000  ? 1579 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.894  3.000  ? 649  'X-RAY DIFFRACTION' ? 
r_mcangle_it           3.851  5.000  ? 2537 'X-RAY DIFFRACTION' ? 
r_scbond_it            5.977  8.000  ? 1002 'X-RAY DIFFRACTION' ? 
r_scangle_it           8.175  11.000 ? 959  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr     2.000  3.000  ? 4351 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.590 
_refine_ls_shell.d_res_low                        1.631 
_refine_ls_shell.number_reflns_R_work             2741 
_refine_ls_shell.R_factor_R_work                  0.243 
_refine_ls_shell.percent_reflns_obs               97.06 
_refine_ls_shell.R_factor_R_free                  0.323 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             133 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LZN 
_struct.title                     'Crystal Structure Analysis of the apo P19 protein from Campylobacter jejuni at 1.59 A at pH 9' 
_struct.pdbx_descriptor           P19 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LZN 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'copper binding, iron transport, iron uptake, P19 delition, Cj1658, Cj1659, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 35  ? ALA A 39  ? ALA A 35  ALA A 39  5 ? 5 
HELX_P HELX_P2 2 ASN A 123 ? GLY A 128 ? ASN A 123 GLY A 128 5 ? 6 
HELX_P HELX_P3 3 ALA B 35  ? ALA B 39  ? ALA B 35  ALA B 39  5 ? 5 
HELX_P HELX_P4 4 ASN B 123 ? GLY B 128 ? ASN B 123 GLY B 128 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MET 88  SD  ? ? ? 1_555 E ZN . ZN ? ? B MET 88  B ZN 200 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc2 metalc ? ? A HIS 95  NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 95  A ZN 200 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc3 metalc ? ? B HIS 95  NE2 ? ? ? 1_555 E ZN . ZN ? ? B HIS 95  B ZN 200 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc4 metalc ? ? B HIS 132 NE2 ? ? ? 1_555 C ZN . ZN ? ? B HIS 132 A ZN 200 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc5 metalc ? ? A MET 88  SD  ? ? ? 1_555 C ZN . ZN ? ? A MET 88  A ZN 200 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc6 metalc ? ? A HIS 42  NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 42  A ZN 200 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc7 metalc ? ? B HIS 42  NE2 ? ? ? 1_555 E ZN . ZN ? ? B HIS 42  B ZN 200 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc8 metalc ? ? A HIS 132 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 132 B ZN 200 1_555 ? ? ? ? ? ? ? 2.672 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 28 A . ? GLU 28 A PRO 29 A ? PRO 29 A 1 1.95  
2 GLU 28 B . ? GLU 28 B PRO 29 B ? PRO 29 B 1 -2.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 8 ? 
C ? 7 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 4   ? LEU A 12  ? VAL A 4   LEU A 12  
A 2 MET A 15  ? LEU A 22  ? MET A 15  LEU A 22  
A 3 ILE A 41  ? ALA A 49  ? ILE A 41  ALA A 49  
A 4 GLY A 93  ? ILE A 100 ? GLY A 93  ILE A 100 
A 5 ILE A 80  ? ALA A 90  ? ILE A 80  ALA A 90  
A 6 GLY B 130 ? HIS B 132 ? GLY B 130 HIS B 132 
A 7 MET A 27  ? GLU A 28  ? MET A 27  GLU A 28  
B 1 VAL A 4   ? LEU A 12  ? VAL A 4   LEU A 12  
B 2 MET A 15  ? LEU A 22  ? MET A 15  LEU A 22  
B 3 ILE A 41  ? ALA A 49  ? ILE A 41  ALA A 49  
B 4 GLY A 93  ? ILE A 100 ? GLY A 93  ILE A 100 
B 5 ILE A 80  ? ALA A 90  ? ILE A 80  ALA A 90  
B 6 THR A 67  ? ASN A 74  ? THR A 67  ASN A 74  
B 7 GLY A 113 ? SER A 122 ? GLY A 113 SER A 122 
B 8 PHE A 146 ? TYR A 154 ? PHE A 146 TYR A 154 
C 1 GLU B 3   ? LEU B 12  ? GLU B 3   LEU B 12  
C 2 MET B 15  ? LEU B 22  ? MET B 15  LEU B 22  
C 3 ILE B 41  ? ALA B 49  ? ILE B 41  ALA B 49  
C 4 GLY B 93  ? ILE B 100 ? GLY B 93  ILE B 100 
C 5 MET B 86  ? ALA B 90  ? MET B 86  ALA B 90  
C 6 GLY A 130 ? HIS A 132 ? GLY A 130 HIS A 132 
C 7 MET B 27  ? GLU B 28  ? MET B 27  GLU B 28  
D 1 ILE B 80  ? THR B 84  ? ILE B 80  THR B 84  
D 2 THR B 67  ? ASN B 74  ? THR B 67  ASN B 74  
D 3 GLY B 113 ? SER B 122 ? GLY B 113 SER B 122 
D 4 PHE B 146 ? TYR B 154 ? PHE B 146 TYR B 154 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 4   ? N VAL A 4   O TYR A 21  ? O TYR A 21  
A 2 3 N ALA A 18  ? N ALA A 18  O ASP A 46  ? O ASP A 46  
A 3 4 N LEU A 43  ? N LEU A 43  O ALA A 98  ? O ALA A 98  
A 4 5 O HIS A 95  ? O HIS A 95  N MET A 88  ? N MET A 88  
A 5 6 N VAL A 89  ? N VAL A 89  O HIS B 132 ? O HIS B 132 
A 6 7 O ARG B 131 ? O ARG B 131 N GLU A 28  ? N GLU A 28  
B 1 2 N VAL A 4   ? N VAL A 4   O TYR A 21  ? O TYR A 21  
B 2 3 N ALA A 18  ? N ALA A 18  O ASP A 46  ? O ASP A 46  
B 3 4 N LEU A 43  ? N LEU A 43  O ALA A 98  ? O ALA A 98  
B 4 5 O HIS A 95  ? O HIS A 95  N MET A 88  ? N MET A 88  
B 5 6 O LYS A 81  ? O LYS A 81  N LEU A 72  ? N LEU A 72  
B 6 7 N LYS A 73  ? N LYS A 73  O GLU A 116 ? O GLU A 116 
B 7 8 N ILE A 121 ? N ILE A 121 O PHE A 146 ? O PHE A 146 
C 1 2 N LYS B 10  ? N LYS B 10  O ILE B 17  ? O ILE B 17  
C 2 3 N ALA B 18  ? N ALA B 18  O ASP B 46  ? O ASP B 46  
C 3 4 N ILE B 41  ? N ILE B 41  O ILE B 100 ? O ILE B 100 
C 4 5 O GLY B 97  ? O GLY B 97  N MET B 86  ? N MET B 86  
C 5 6 O PRO B 87  ? O PRO B 87  N GLY A 130 ? N GLY A 130 
C 6 7 N ARG A 131 ? N ARG A 131 O GLU B 28  ? O GLU B 28  
D 1 2 O LYS B 81  ? O LYS B 81  N LEU B 72  ? N LEU B 72  
D 2 3 N LYS B 73  ? N LYS B 73  O GLU B 116 ? O GLU B 116 
D 3 4 N TYR B 115 ? N TYR B 115 O PHE B 152 ? O PHE B 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 200'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 300' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 200'  
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 42  ? HIS A 42   . ? 1_555 ? 
2  AC1 4 MET A 88  ? MET A 88   . ? 1_555 ? 
3  AC1 4 HIS A 95  ? HIS A 95   . ? 1_555 ? 
4  AC1 4 HIS B 132 ? HIS B 132  . ? 1_555 ? 
5  AC2 7 GLY A 7   ? GLY A 7    . ? 1_555 ? 
6  AC2 7 ASP A 8   ? ASP A 8    . ? 1_555 ? 
7  AC2 7 LYS A 10  ? LYS A 10   . ? 1_555 ? 
8  AC2 7 ASP A 149 ? ASP A 149  . ? 1_555 ? 
9  AC2 7 TYR A 150 ? TYR A 150  . ? 1_555 ? 
10 AC2 7 LYS A 151 ? LYS A 151  . ? 1_555 ? 
11 AC2 7 HOH G .   ? HOH A 1082 . ? 1_555 ? 
12 AC3 4 HIS A 132 ? HIS A 132  . ? 1_555 ? 
13 AC3 4 HIS B 42  ? HIS B 42   . ? 1_555 ? 
14 AC3 4 MET B 88  ? MET B 88   . ? 1_555 ? 
15 AC3 4 HIS B 95  ? HIS B 95   . ? 1_555 ? 
16 AC4 5 LEU B 50  ? LEU B 50   . ? 1_555 ? 
17 AC4 5 LYS B 51  ? LYS B 51   . ? 1_555 ? 
18 AC4 5 HOH H .   ? HOH B 1079 . ? 1_555 ? 
19 AC4 5 HOH H .   ? HOH B 1104 . ? 1_555 ? 
20 AC4 5 HOH H .   ? HOH B 1131 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3LZN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LZN 
_atom_sites.fract_transf_matrix[1][1]   0.018384 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013692 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013366 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 2   ? 28.135 24.761 39.394  1.00 47.88 ? 2    GLY A N   1 
ATOM   2    C  CA  . GLY A 1 2   ? 27.627 24.209 40.688  1.00 45.41 ? 2    GLY A CA  1 
ATOM   3    C  C   . GLY A 1 2   ? 26.863 22.906 40.469  1.00 42.70 ? 2    GLY A C   1 
ATOM   4    O  O   . GLY A 1 2   ? 25.747 22.730 40.979  1.00 45.83 ? 2    GLY A O   1 
ATOM   5    N  N   . GLU A 1 3   ? 27.466 21.984 39.725  1.00 52.13 ? 3    GLU A N   1 
ATOM   6    C  CA  . GLU A 1 3   ? 26.832 20.710 39.427  1.00 44.36 ? 3    GLU A CA  1 
ATOM   7    C  C   . GLU A 1 3   ? 27.334 19.682 40.425  1.00 36.85 ? 3    GLU A C   1 
ATOM   8    O  O   . GLU A 1 3   ? 28.493 19.717 40.815  1.00 38.19 ? 3    GLU A O   1 
ATOM   9    C  CB  . GLU A 1 3   ? 27.141 20.290 37.985  1.00 45.39 ? 3    GLU A CB  1 
ATOM   10   C  CG  . GLU A 1 3   ? 26.825 21.389 36.976  1.00 53.67 ? 3    GLU A CG  1 
ATOM   11   C  CD  . GLU A 1 3   ? 27.281 21.080 35.557  1.00 61.48 ? 3    GLU A CD  1 
ATOM   12   O  OE1 . GLU A 1 3   ? 27.842 19.984 35.301  1.00 62.97 ? 3    GLU A OE1 1 
ATOM   13   O  OE2 . GLU A 1 3   ? 27.065 21.952 34.686  1.00 71.95 ? 3    GLU A OE2 1 
ATOM   14   N  N   . VAL A 1 4   ? 26.449 18.803 40.869  1.00 29.08 ? 4    VAL A N   1 
ATOM   15   C  CA  . VAL A 1 4   ? 26.819 17.711 41.743  1.00 25.70 ? 4    VAL A CA  1 
ATOM   16   C  C   . VAL A 1 4   ? 26.860 16.451 40.901  1.00 23.86 ? 4    VAL A C   1 
ATOM   17   O  O   . VAL A 1 4   ? 25.863 16.122 40.250  1.00 23.75 ? 4    VAL A O   1 
ATOM   18   C  CB  . VAL A 1 4   ? 25.799 17.548 42.887  1.00 28.45 ? 4    VAL A CB  1 
ATOM   19   C  CG1 . VAL A 1 4   ? 26.130 16.318 43.757  1.00 26.97 ? 4    VAL A CG1 1 
ATOM   20   C  CG2 . VAL A 1 4   ? 25.773 18.807 43.717  1.00 29.42 ? 4    VAL A CG2 1 
ATOM   21   N  N   . PRO A 1 5   ? 28.007 15.753 40.885  1.00 25.42 ? 5    PRO A N   1 
ATOM   22   C  CA  . PRO A 1 5   ? 28.058 14.504 40.110  1.00 24.60 ? 5    PRO A CA  1 
ATOM   23   C  C   . PRO A 1 5   ? 27.202 13.399 40.706  1.00 24.64 ? 5    PRO A C   1 
ATOM   24   O  O   . PRO A 1 5   ? 27.094 13.276 41.930  1.00 25.90 ? 5    PRO A O   1 
ATOM   25   C  CB  . PRO A 1 5   ? 29.530 14.140 40.104  1.00 27.75 ? 5    PRO A CB  1 
ATOM   26   C  CG  . PRO A 1 5   ? 30.100 14.846 41.235  1.00 32.84 ? 5    PRO A CG  1 
ATOM   27   C  CD  . PRO A 1 5   ? 29.319 16.088 41.448  1.00 28.61 ? 5    PRO A CD  1 
ATOM   28   N  N   . ILE A 1 6   ? 26.550 12.649 39.823  1.00 22.86 ? 6    ILE A N   1 
ATOM   29   C  CA  . ILE A 1 6   ? 25.775 11.473 40.187  1.00 22.60 ? 6    ILE A CA  1 
ATOM   30   C  C   . ILE A 1 6   ? 26.511 10.225 39.703  1.00 24.32 ? 6    ILE A C   1 
ATOM   31   O  O   . ILE A 1 6   ? 26.535 9.933  38.519  1.00 22.59 ? 6    ILE A O   1 
ATOM   32   C  CB  . ILE A 1 6   ? 24.360 11.510 39.601  1.00 21.11 ? 6    ILE A CB  1 
ATOM   33   C  CG1 . ILE A 1 6   ? 23.532 12.606 40.260  1.00 22.72 ? 6    ILE A CG1 1 
ATOM   34   C  CG2 . ILE A 1 6   ? 23.672 10.137 39.720  1.00 21.22 ? 6    ILE A CG2 1 
ATOM   35   C  CD1 . ILE A 1 6   ? 22.254 12.898 39.523  1.00 21.15 ? 6    ILE A CD1 1 
ATOM   36   N  N   . GLY A 1 7   ? 27.089 9.494  40.648  1.00 26.58 ? 7    GLY A N   1 
ATOM   37   C  CA  . GLY A 1 7   ? 27.724 8.216  40.347  1.00 25.83 ? 7    GLY A CA  1 
ATOM   38   C  C   . GLY A 1 7   ? 28.866 8.341  39.356  1.00 26.30 ? 7    GLY A C   1 
ATOM   39   O  O   . GLY A 1 7   ? 29.545 9.373  39.305  1.00 27.20 ? 7    GLY A O   1 
ATOM   40   N  N   . ASP A 1 8   ? 29.108 7.267  38.617  1.00 28.99 ? 8    ASP A N   1 
ATOM   41   C  CA  . ASP A 1 8   ? 30.178 7.207  37.634  1.00 29.39 ? 8    ASP A CA  1 
ATOM   42   C  C   . ASP A 1 8   ? 29.596 7.226  36.236  1.00 26.69 ? 8    ASP A C   1 
ATOM   43   O  O   . ASP A 1 8   ? 28.575 6.616  35.994  1.00 25.87 ? 8    ASP A O   1 
ATOM   44   C  CB  . ASP A 1 8   ? 30.959 5.905  37.801  1.00 32.56 ? 8    ASP A CB  1 
ATOM   45   C  CG  . ASP A 1 8   ? 31.560 5.760  39.183  1.00 43.16 ? 8    ASP A CG  1 
ATOM   46   O  OD1 . ASP A 1 8   ? 32.162 6.748  39.685  1.00 48.47 ? 8    ASP A OD1 1 
ATOM   47   O  OD2 . ASP A 1 8   ? 31.451 4.643  39.760  1.00 51.25 ? 8    ASP A OD2 1 
ATOM   48   N  N   . PRO A 1 9   ? 30.248 7.933  35.315  1.00 26.01 ? 9    PRO A N   1 
ATOM   49   C  CA  . PRO A 1 9   ? 29.823 7.962  33.928  1.00 25.13 ? 9    PRO A CA  1 
ATOM   50   C  C   . PRO A 1 9   ? 29.953 6.588  33.289  1.00 23.92 ? 9    PRO A C   1 
ATOM   51   O  O   . PRO A 1 9   ? 30.795 5.775  33.697  1.00 26.93 ? 9    PRO A O   1 
ATOM   52   C  CB  . PRO A 1 9   ? 30.802 8.941  33.290  1.00 27.95 ? 9    PRO A CB  1 
ATOM   53   C  CG  . PRO A 1 9   ? 31.987 8.848  34.143  1.00 32.65 ? 9    PRO A CG  1 
ATOM   54   C  CD  . PRO A 1 9   ? 31.478 8.714  35.514  1.00 29.45 ? 9    PRO A CD  1 
ATOM   55   N  N   . LYS A 1 10  ? 29.107 6.320  32.317  1.00 23.99 ? 10   LYS A N   1 
ATOM   56   C  CA  . LYS A 1 10  ? 29.133 5.040  31.624  1.00 24.89 ? 10   LYS A CA  1 
ATOM   57   C  C   . LYS A 1 10  ? 29.446 5.311  30.157  1.00 25.32 ? 10   LYS A C   1 
ATOM   58   O  O   . LYS A 1 10  ? 29.039 6.330  29.619  1.00 25.68 ? 10   LYS A O   1 
ATOM   59   C  CB  . LYS A 1 10  ? 27.771 4.375  31.704  1.00 27.87 ? 10   LYS A CB  1 
ATOM   60   C  CG  . LYS A 1 10  ? 27.441 3.825  33.055  1.00 36.41 ? 10   LYS A CG  1 
ATOM   61   C  CD  . LYS A 1 10  ? 26.541 4.745  33.770  1.00 39.48 ? 10   LYS A CD  1 
ATOM   62   C  CE  . LYS A 1 10  ? 26.116 4.161  35.095  1.00 40.49 ? 10   LYS A CE  1 
ATOM   63   N  NZ  . LYS A 1 10  ? 27.215 4.160  36.121  1.00 31.39 ? 10   LYS A NZ  1 
ATOM   64   N  N   . GLU A 1 11  ? 30.202 4.420  29.542  1.00 20.03 ? 11   GLU A N   1 
ATOM   65   C  CA  . GLU A 1 11  ? 30.504 4.499  28.128  1.00 19.72 ? 11   GLU A CA  1 
ATOM   66   C  C   . GLU A 1 11  ? 29.903 3.309  27.430  1.00 22.60 ? 11   GLU A C   1 
ATOM   67   O  O   . GLU A 1 11  ? 30.260 2.166  27.712  1.00 22.83 ? 11   GLU A O   1 
ATOM   68   C  CB  . GLU A 1 11  ? 32.004 4.628  27.863  1.00 22.19 ? 11   GLU A CB  1 
ATOM   69   C  CG  . GLU A 1 11  ? 32.628 5.819  28.473  1.00 25.32 ? 11   GLU A CG  1 
ATOM   70   C  CD  . GLU A 1 11  ? 34.118 5.916  28.224  1.00 33.09 ? 11   GLU A CD  1 
ATOM   71   O  OE1 . GLU A 1 11  ? 34.695 5.017  27.563  1.00 35.91 ? 11   GLU A OE1 1 
ATOM   72   O  OE2 . GLU A 1 11  ? 34.715 6.899  28.721  1.00 38.16 ? 11   GLU A OE2 1 
ATOM   73   N  N   . LEU A 1 12  ? 28.967 3.568  26.521  1.00 22.17 ? 12   LEU A N   1 
ATOM   74   C  CA  . LEU A 1 12  ? 28.356 2.493  25.802  1.00 23.17 ? 12   LEU A CA  1 
ATOM   75   C  C   . LEU A 1 12  ? 27.616 3.026  24.628  1.00 18.94 ? 12   LEU A C   1 
ATOM   76   O  O   . LEU A 1 12  ? 27.163 4.222  24.597  1.00 17.02 ? 12   LEU A O   1 
ATOM   77   C  CB  . LEU A 1 12  ? 27.391 1.725  26.653  1.00 24.48 ? 12   LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 12  ? 26.145 2.408  27.125  1.00 20.18 ? 12   LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 12  ? 25.347 1.415  28.048  1.00 28.43 ? 12   LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 12  ? 26.392 3.679  27.830  1.00 31.60 ? 12   LEU A CD2 1 
ATOM   81   N  N   . ASN A 1 13  ? 27.556 2.163  23.649  1.00 20.11 ? 13   ASN A N   1 
ATOM   82   C  CA  . ASN A 1 13  ? 26.824 2.412  22.419  1.00 19.62 ? 13   ASN A CA  1 
ATOM   83   C  C   . ASN A 1 13  ? 27.288 3.690  21.698  1.00 20.89 ? 13   ASN A C   1 
ATOM   84   O  O   . ASN A 1 13  ? 26.469 4.447  21.171  1.00 26.31 ? 13   ASN A O   1 
ATOM   85   C  CB  . ASN A 1 13  ? 25.339 2.493  22.716  1.00 18.60 ? 13   ASN A CB  1 
ATOM   86   C  CG  . ASN A 1 13  ? 24.812 1.265  23.335  1.00 18.26 ? 13   ASN A CG  1 
ATOM   87   O  OD1 . ASN A 1 13  ? 25.287 0.163  23.058  1.00 19.89 ? 13   ASN A OD1 1 
ATOM   88   N  ND2 . ASN A 1 13  ? 23.815 1.418  24.215  1.00 19.12 ? 13   ASN A ND2 1 
ATOM   89   N  N   . GLY A 1 14  ? 28.574 3.918  21.748  1.00 23.64 ? 14   GLY A N   1 
ATOM   90   C  CA  . GLY A 1 14  ? 29.213 5.096  21.163  1.00 24.58 ? 14   GLY A CA  1 
ATOM   91   C  C   . GLY A 1 14  ? 29.078 6.380  21.959  1.00 20.99 ? 14   GLY A C   1 
ATOM   92   O  O   . GLY A 1 14  ? 29.501 7.404  21.487  1.00 21.26 ? 14   GLY A O   1 
ATOM   93   N  N   . MET A 1 15  ? 28.535 6.320  23.186  1.00 17.93 ? 15   MET A N   1 
ATOM   94   C  CA  . MET A 1 15  ? 28.251 7.507  23.979  1.00 19.59 ? 15   MET A CA  1 
ATOM   95   C  C   . MET A 1 15  ? 28.840 7.421  25.379  1.00 18.68 ? 15   MET A C   1 
ATOM   96   O  O   . MET A 1 15  ? 28.949 6.355  25.969  1.00 19.33 ? 15   MET A O   1 
ATOM   97   C  CB  . MET A 1 15  ? 26.747 7.687  24.105  1.00 17.18 ? 15   MET A CB  1 
ATOM   98   C  CG  . MET A 1 15  ? 26.037 7.639  22.746  1.00 19.03 ? 15   MET A CG  1 
ATOM   99   S  SD  . MET A 1 15  ? 24.260 7.793  22.943  1.00 21.34 ? 15   MET A SD  1 
ATOM   100  C  CE  . MET A 1 15  ? 23.905 6.057  23.159  1.00 26.94 ? 15   MET A CE  1 
ATOM   101  N  N   . GLU A 1 16  ? 29.178 8.587  25.897  1.00 16.87 ? 16   GLU A N   1 
ATOM   102  C  CA  . GLU A 1 16  ? 29.481 8.747  27.298  1.00 19.90 ? 16   GLU A CA  1 
ATOM   103  C  C   . GLU A 1 16  ? 28.213 9.297  27.917  1.00 18.68 ? 16   GLU A C   1 
ATOM   104  O  O   . GLU A 1 16  ? 27.677 10.339 27.473  1.00 19.43 ? 16   GLU A O   1 
ATOM   105  C  CB  . GLU A 1 16  ? 30.627 9.717  27.427  1.00 22.60 ? 16   GLU A CB  1 
ATOM   106  C  CG  . GLU A 1 16  ? 30.930 10.222 28.801  1.00 23.97 ? 16   GLU A CG  1 
ATOM   107  C  CD  . GLU A 1 16  ? 31.935 11.365 28.711  1.00 30.83 ? 16   GLU A CD  1 
ATOM   108  O  OE1 . GLU A 1 16  ? 31.534 12.533 28.479  1.00 32.85 ? 16   GLU A OE1 1 
ATOM   109  O  OE2 . GLU A 1 16  ? 33.143 11.085 28.825  1.00 35.54 ? 16   GLU A OE2 1 
ATOM   110  N  N   . ILE A 1 17  ? 27.744 8.662  28.969  1.00 18.60 ? 17   ILE A N   1 
ATOM   111  C  CA  . ILE A 1 17  ? 26.476 9.047  29.610  1.00 17.22 ? 17   ILE A CA  1 
ATOM   112  C  C   . ILE A 1 17  ? 26.764 9.314  31.065  1.00 16.53 ? 17   ILE A C   1 
ATOM   113  O  O   . ILE A 1 17  ? 27.094 8.404  31.806  1.00 20.43 ? 17   ILE A O   1 
ATOM   114  C  CB  . ILE A 1 17  ? 25.448 7.957  29.476  1.00 18.19 ? 17   ILE A CB  1 
ATOM   115  C  CG1 . ILE A 1 17  ? 25.322 7.573  27.999  1.00 21.96 ? 17   ILE A CG1 1 
ATOM   116  C  CG2 . ILE A 1 17  ? 24.063 8.458  30.026  1.00 21.38 ? 17   ILE A CG2 1 
ATOM   117  C  CD1 . ILE A 1 17  ? 24.508 6.384  27.767  1.00 25.22 ? 17   ILE A CD1 1 
ATOM   118  N  N   . ALA A 1 18  ? 26.710 10.587 31.415  1.00 17.33 ? 18   ALA A N   1 
ATOM   119  C  CA  . ALA A 1 18  ? 27.015 11.035 32.775  1.00 18.02 ? 18   ALA A CA  1 
ATOM   120  C  C   . ALA A 1 18  ? 25.772 11.699 33.304  1.00 17.25 ? 18   ALA A C   1 
ATOM   121  O  O   . ALA A 1 18  ? 24.935 12.199 32.544  1.00 19.06 ? 18   ALA A O   1 
ATOM   122  C  CB  . ALA A 1 18  ? 28.194 12.028 32.781  1.00 20.61 ? 18   ALA A CB  1 
ATOM   123  N  N   . ALA A 1 19  ? 25.651 11.726 34.620  1.00 17.52 ? 19   ALA A N   1 
ATOM   124  C  CA  . ALA A 1 19  ? 24.509 12.373 35.249  1.00 19.75 ? 19   ALA A CA  1 
ATOM   125  C  C   . ALA A 1 19  ? 25.031 13.373 36.262  1.00 18.80 ? 19   ALA A C   1 
ATOM   126  O  O   . ALA A 1 19  ? 26.068 13.161 36.887  1.00 19.00 ? 19   ALA A O   1 
ATOM   127  C  CB  . ALA A 1 19  ? 23.620 11.337 35.940  1.00 20.27 ? 19   ALA A CB  1 
ATOM   128  N  N   . VAL A 1 20  ? 24.323 14.494 36.368  1.00 20.74 ? 20   VAL A N   1 
ATOM   129  C  CA  . VAL A 1 20  ? 24.598 15.526 37.368  1.00 22.96 ? 20   VAL A CA  1 
ATOM   130  C  C   . VAL A 1 20  ? 23.272 16.082 37.846  1.00 20.81 ? 20   VAL A C   1 
ATOM   131  O  O   . VAL A 1 20  ? 22.246 15.959 37.191  1.00 18.16 ? 20   VAL A O   1 
ATOM   132  C  CB  . VAL A 1 20  ? 25.456 16.713 36.878  1.00 23.53 ? 20   VAL A CB  1 
ATOM   133  C  CG1 . VAL A 1 20  ? 26.829 16.257 36.321  1.00 26.44 ? 20   VAL A CG1 1 
ATOM   134  C  CG2 . VAL A 1 20  ? 24.690 17.562 35.890  1.00 27.56 ? 20   VAL A CG2 1 
ATOM   135  N  N   . TYR A 1 21  ? 23.290 16.686 39.021  1.00 21.22 ? 21   TYR A N   1 
ATOM   136  C  CA  . TYR A 1 21  ? 22.195 17.574 39.386  1.00 20.47 ? 21   TYR A CA  1 
ATOM   137  C  C   . TYR A 1 21  ? 22.698 18.944 39.783  1.00 22.29 ? 21   TYR A C   1 
ATOM   138  O  O   . TYR A 1 21  ? 23.822 19.124 40.258  1.00 23.70 ? 21   TYR A O   1 
ATOM   139  C  CB  . TYR A 1 21  ? 21.272 16.988 40.448  1.00 21.52 ? 21   TYR A CB  1 
ATOM   140  C  CG  . TYR A 1 21  ? 21.783 16.921 41.870  1.00 22.58 ? 21   TYR A CG  1 
ATOM   141  C  CD1 . TYR A 1 21  ? 21.635 17.991 42.737  1.00 23.45 ? 21   TYR A CD1 1 
ATOM   142  C  CD2 . TYR A 1 21  ? 22.373 15.768 42.359  1.00 25.09 ? 21   TYR A CD2 1 
ATOM   143  C  CE1 . TYR A 1 21  ? 22.088 17.918 44.035  1.00 22.05 ? 21   TYR A CE1 1 
ATOM   144  C  CE2 . TYR A 1 21  ? 22.822 15.683 43.677  1.00 25.07 ? 21   TYR A CE2 1 
ATOM   145  C  CZ  . TYR A 1 21  ? 22.683 16.759 44.493  1.00 26.58 ? 21   TYR A CZ  1 
ATOM   146  O  OH  . TYR A 1 21  ? 23.138 16.665 45.791  1.00 28.34 ? 21   TYR A OH  1 
ATOM   147  N  N   . LEU A 1 22  ? 21.820 19.906 39.635  1.00 20.49 ? 22   LEU A N   1 
ATOM   148  C  CA  . LEU A 1 22  ? 22.115 21.255 40.049  1.00 21.47 ? 22   LEU A CA  1 
ATOM   149  C  C   . LEU A 1 22  ? 20.838 21.896 40.578  1.00 18.87 ? 22   LEU A C   1 
ATOM   150  O  O   . LEU A 1 22  ? 19.839 21.206 40.773  1.00 19.27 ? 22   LEU A O   1 
ATOM   151  C  CB  . LEU A 1 22  ? 22.712 22.032 38.904  1.00 25.00 ? 22   LEU A CB  1 
ATOM   152  C  CG  . LEU A 1 22  ? 21.917 22.255 37.633  1.00 24.85 ? 22   LEU A CG  1 
ATOM   153  C  CD1 . LEU A 1 22  ? 22.357 23.523 36.931  1.00 30.29 ? 22   LEU A CD1 1 
ATOM   154  C  CD2 . LEU A 1 22  ? 22.143 21.062 36.755  1.00 28.04 ? 22   LEU A CD2 1 
ATOM   155  N  N   . GLN A 1 23  ? 20.862 23.201 40.827  1.00 21.13 ? 23   GLN A N   1 
ATOM   156  C  CA  . GLN A 1 23  ? 19.660 23.891 41.263  1.00 21.16 ? 23   GLN A CA  1 
ATOM   157  C  C   . GLN A 1 23  ? 18.631 23.893 40.165  1.00 19.36 ? 23   GLN A C   1 
ATOM   158  O  O   . GLN A 1 23  ? 18.963 23.716 38.985  1.00 20.23 ? 23   GLN A O   1 
ATOM   159  C  CB  . GLN A 1 23  ? 19.955 25.338 41.668  1.00 22.69 ? 23   GLN A CB  1 
ATOM   160  C  CG  . GLN A 1 23  ? 20.296 26.280 40.506  1.00 27.33 ? 23   GLN A CG  1 
ATOM   161  C  CD  . GLN A 1 23  ? 21.706 26.114 39.901  1.00 37.99 ? 23   GLN A CD  1 
ATOM   162  O  OE1 . GLN A 1 23  ? 22.554 25.347 40.396  1.00 35.22 ? 23   GLN A OE1 1 
ATOM   163  N  NE2 . GLN A 1 23  ? 21.955 26.845 38.810  1.00 41.70 ? 23   GLN A NE2 1 
ATOM   164  N  N   . PRO A 1 24  ? 17.364 24.082 40.538  1.00 20.13 ? 24   PRO A N   1 
ATOM   165  C  CA  . PRO A 1 24  ? 16.368 24.119 39.493  1.00 21.72 ? 24   PRO A CA  1 
ATOM   166  C  C   . PRO A 1 24  ? 16.602 25.251 38.526  1.00 21.53 ? 24   PRO A C   1 
ATOM   167  O  O   . PRO A 1 24  ? 17.106 26.321 38.889  1.00 23.25 ? 24   PRO A O   1 
ATOM   168  C  CB  . PRO A 1 24  ? 15.064 24.331 40.270  1.00 21.72 ? 24   PRO A CB  1 
ATOM   169  C  CG  . PRO A 1 24  ? 15.326 23.912 41.590  1.00 23.16 ? 24   PRO A CG  1 
ATOM   170  C  CD  . PRO A 1 24  ? 16.749 24.159 41.874  1.00 21.33 ? 24   PRO A CD  1 
ATOM   171  N  N   . ILE A 1 25  ? 16.215 25.018 37.286  1.00 21.43 ? 25   ILE A N   1 
ATOM   172  C  CA  . ILE A 1 25  ? 16.366 26.014 36.234  1.00 24.40 ? 25   ILE A CA  1 
ATOM   173  C  C   . ILE A 1 25  ? 14.992 26.423 35.717  1.00 25.44 ? 25   ILE A C   1 
ATOM   174  O  O   . ILE A 1 25  ? 14.003 25.717 35.945  1.00 27.81 ? 25   ILE A O   1 
ATOM   175  C  CB  . ILE A 1 25  ? 17.298 25.504 35.098  1.00 24.94 ? 25   ILE A CB  1 
ATOM   176  C  CG1 . ILE A 1 25  ? 16.746 24.234 34.426  1.00 29.23 ? 25   ILE A CG1 1 
ATOM   177  C  CG2 . ILE A 1 25  ? 18.722 25.167 35.684  1.00 27.93 ? 25   ILE A CG2 1 
ATOM   178  C  CD1 . ILE A 1 25  ? 15.697 24.472 33.281  1.00 28.69 ? 25   ILE A CD1 1 
ATOM   179  N  N   . GLU A 1 26  ? 14.940 27.585 35.074  1.00 27.79 ? 26   GLU A N   1 
ATOM   180  C  CA  A GLU A 1 26  ? 13.732 28.088 34.412  0.50 27.66 ? 26   GLU A CA  1 
ATOM   181  C  CA  B GLU A 1 26  ? 13.727 28.062 34.423  0.50 27.53 ? 26   GLU A CA  1 
ATOM   182  C  C   . GLU A 1 26  ? 13.849 27.797 32.931  1.00 27.03 ? 26   GLU A C   1 
ATOM   183  O  O   . GLU A 1 26  ? 14.781 28.274 32.281  1.00 26.84 ? 26   GLU A O   1 
ATOM   184  C  CB  A GLU A 1 26  ? 13.599 29.600 34.589  0.50 31.98 ? 26   GLU A CB  1 
ATOM   185  C  CB  B GLU A 1 26  ? 13.533 29.545 34.706  0.50 31.70 ? 26   GLU A CB  1 
ATOM   186  C  CG  A GLU A 1 26  ? 13.379 30.065 36.004  0.50 37.34 ? 26   GLU A CG  1 
ATOM   187  C  CG  B GLU A 1 26  ? 13.317 29.840 36.176  0.50 35.99 ? 26   GLU A CG  1 
ATOM   188  C  CD  A GLU A 1 26  ? 13.558 31.573 36.138  0.50 43.15 ? 26   GLU A CD  1 
ATOM   189  C  CD  B GLU A 1 26  ? 11.854 29.844 36.569  0.50 40.09 ? 26   GLU A CD  1 
ATOM   190  O  OE1 A GLU A 1 26  ? 13.090 32.328 35.246  0.50 48.06 ? 26   GLU A OE1 1 
ATOM   191  O  OE1 B GLU A 1 26  ? 11.006 29.454 35.744  0.50 45.08 ? 26   GLU A OE1 1 
ATOM   192  O  OE2 A GLU A 1 26  ? 14.179 31.999 37.130  0.50 46.47 ? 26   GLU A OE2 1 
ATOM   193  O  OE2 B GLU A 1 26  ? 11.553 30.236 37.708  0.50 42.95 ? 26   GLU A OE2 1 
ATOM   194  N  N   . MET A 1 27  ? 12.922 27.008 32.395  1.00 28.79 ? 27   MET A N   1 
ATOM   195  C  CA  . MET A 1 27  ? 12.948 26.639 30.985  1.00 29.23 ? 27   MET A CA  1 
ATOM   196  C  C   . MET A 1 27  ? 11.813 27.308 30.212  1.00 28.67 ? 27   MET A C   1 
ATOM   197  O  O   . MET A 1 27  ? 10.693 27.399 30.706  1.00 29.75 ? 27   MET A O   1 
ATOM   198  C  CB  . MET A 1 27  ? 12.809 25.113 30.840  1.00 29.20 ? 27   MET A CB  1 
ATOM   199  C  CG  . MET A 1 27  ? 13.271 24.561 29.477  1.00 30.94 ? 27   MET A CG  1 
ATOM   200  S  SD  . MET A 1 27  ? 12.859 22.838 29.133  1.00 34.41 ? 27   MET A SD  1 
ATOM   201  C  CE  . MET A 1 27  ? 11.105 23.033 28.742  1.00 41.51 ? 27   MET A CE  1 
ATOM   202  N  N   . GLU A 1 28  ? 12.098 27.711 28.979  1.00 28.66 ? 28   GLU A N   1 
ATOM   203  C  CA  . GLU A 1 28  ? 11.054 28.020 28.002  1.00 29.69 ? 28   GLU A CA  1 
ATOM   204  C  C   . GLU A 1 28  ? 11.164 26.940 26.902  1.00 29.05 ? 28   GLU A C   1 
ATOM   205  O  O   . GLU A 1 28  ? 12.249 26.439 26.638  1.00 29.18 ? 28   GLU A O   1 
ATOM   206  C  CB  . GLU A 1 28  ? 11.246 29.405 27.414  1.00 32.64 ? 28   GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 28  ? 10.968 30.549 28.370  1.00 37.96 ? 28   GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 28  ? 11.045 31.925 27.691  1.00 46.03 ? 28   GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 28  ? 11.192 31.982 26.440  1.00 45.76 ? 28   GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 28  ? 10.972 32.956 28.406  1.00 47.76 ? 28   GLU A OE2 1 
ATOM   211  N  N   . PRO A 1 29  ? 10.044 26.545 26.277  1.00 29.99 ? 29   PRO A N   1 
ATOM   212  C  CA  . PRO A 1 29  ? 8.705  27.059 26.496  1.00 32.07 ? 29   PRO A CA  1 
ATOM   213  C  C   . PRO A 1 29  ? 8.155  26.618 27.849  1.00 32.63 ? 29   PRO A C   1 
ATOM   214  O  O   . PRO A 1 29  ? 8.558  25.572 28.376  1.00 29.90 ? 29   PRO A O   1 
ATOM   215  C  CB  . PRO A 1 29  ? 7.904  26.468 25.320  1.00 34.08 ? 29   PRO A CB  1 
ATOM   216  C  CG  . PRO A 1 29  ? 8.606  25.228 24.966  1.00 32.99 ? 29   PRO A CG  1 
ATOM   217  C  CD  . PRO A 1 29  ? 10.064 25.494 25.241  1.00 30.50 ? 29   PRO A CD  1 
ATOM   218  N  N   . ARG A 1 30  ? 7.262  27.440 28.392  1.00 35.98 ? 30   ARG A N   1 
ATOM   219  C  CA  . ARG A 1 30  ? 6.660  27.212 29.700  1.00 40.41 ? 30   ARG A CA  1 
ATOM   220  C  C   . ARG A 1 30  ? 5.711  26.023 29.675  1.00 42.06 ? 30   ARG A C   1 
ATOM   221  O  O   . ARG A 1 30  ? 5.243  25.623 28.623  1.00 43.04 ? 30   ARG A O   1 
ATOM   222  C  CB  . ARG A 1 30  ? 5.875  28.456 30.137  1.00 45.97 ? 30   ARG A CB  1 
ATOM   223  C  CG  . ARG A 1 30  ? 6.735  29.681 30.456  1.00 55.21 ? 30   ARG A CG  1 
ATOM   224  C  CD  . ARG A 1 30  ? 7.616  29.407 31.662  1.00 62.34 ? 30   ARG A CD  1 
ATOM   225  N  NE  . ARG A 1 30  ? 8.445  30.549 32.032  1.00 70.38 ? 30   ARG A NE  1 
ATOM   226  C  CZ  . ARG A 1 30  ? 9.546  30.472 32.784  1.00 73.48 ? 30   ARG A CZ  1 
ATOM   227  N  NH1 . ARG A 1 30  ? 9.969  29.295 33.254  1.00 74.35 ? 30   ARG A NH1 1 
ATOM   228  N  NH2 . ARG A 1 30  ? 10.236 31.578 33.060  1.00 74.19 ? 30   ARG A NH2 1 
ATOM   229  N  N   . GLY A 1 31  ? 5.416  25.473 30.846  1.00 45.05 ? 31   GLY A N   1 
ATOM   230  C  CA  . GLY A 1 31  ? 4.364  24.462 30.973  1.00 47.59 ? 31   GLY A CA  1 
ATOM   231  C  C   . GLY A 1 31  ? 4.755  23.047 30.574  1.00 47.85 ? 31   GLY A C   1 
ATOM   232  O  O   . GLY A 1 31  ? 3.899  22.172 30.495  1.00 50.83 ? 31   GLY A O   1 
ATOM   233  N  N   . ILE A 1 32  ? 6.041  22.820 30.334  1.00 45.49 ? 32   ILE A N   1 
ATOM   234  C  CA  . ILE A 1 32  ? 6.554  21.494 30.021  1.00 46.04 ? 32   ILE A CA  1 
ATOM   235  C  C   . ILE A 1 32  ? 7.333  20.946 31.235  1.00 43.03 ? 32   ILE A C   1 
ATOM   236  O  O   . ILE A 1 32  ? 6.908  19.979 31.873  1.00 46.39 ? 32   ILE A O   1 
ATOM   237  C  CB  . ILE A 1 32  ? 7.474  21.526 28.779  1.00 46.31 ? 32   ILE A CB  1 
ATOM   238  C  CG1 . ILE A 1 32  ? 6.714  22.025 27.545  1.00 47.75 ? 32   ILE A CG1 1 
ATOM   239  C  CG2 . ILE A 1 32  ? 8.061  20.144 28.507  1.00 49.88 ? 32   ILE A CG2 1 
ATOM   240  C  CD1 . ILE A 1 32  ? 5.520  21.164 27.154  1.00 54.65 ? 32   ILE A CD1 1 
ATOM   241  N  N   . ASP A 1 33  ? 8.472  21.566 31.533  1.00 35.49 ? 33   ASP A N   1 
ATOM   242  C  CA  . ASP A 1 33  ? 9.308  21.185 32.682  1.00 33.58 ? 33   ASP A CA  1 
ATOM   243  C  C   . ASP A 1 33  ? 8.565  21.622 33.961  1.00 34.06 ? 33   ASP A C   1 
ATOM   244  O  O   . ASP A 1 33  ? 7.858  22.608 33.944  1.00 32.01 ? 33   ASP A O   1 
ATOM   245  C  CB  . ASP A 1 33  ? 10.643 21.912 32.552  1.00 31.79 ? 33   ASP A CB  1 
ATOM   246  C  CG  . ASP A 1 33  ? 11.732 21.388 33.494  1.00 32.44 ? 33   ASP A CG  1 
ATOM   247  O  OD1 . ASP A 1 33  ? 11.783 20.182 33.791  1.00 29.40 ? 33   ASP A OD1 1 
ATOM   248  O  OD2 . ASP A 1 33  ? 12.582 22.213 33.881  1.00 34.75 ? 33   ASP A OD2 1 
ATOM   249  N  N   . LEU A 1 34  ? 8.701  20.874 35.049  1.00 25.71 ? 34   LEU A N   1 
ATOM   250  C  CA  . LEU A 1 34  ? 8.242  21.334 36.362  1.00 23.46 ? 34   LEU A CA  1 
ATOM   251  C  C   . LEU A 1 34  ? 8.782  22.738 36.652  1.00 24.35 ? 34   LEU A C   1 
ATOM   252  O  O   . LEU A 1 34  ? 9.963  22.996 36.433  1.00 24.70 ? 34   LEU A O   1 
ATOM   253  C  CB  . LEU A 1 34  ? 8.718  20.358 37.439  1.00 23.88 ? 34   LEU A CB  1 
ATOM   254  C  CG  . LEU A 1 34  ? 8.274  20.622 38.878  1.00 22.60 ? 34   LEU A CG  1 
ATOM   255  C  CD1 . LEU A 1 34  ? 6.770  20.479 38.975  1.00 26.81 ? 34   LEU A CD1 1 
ATOM   256  C  CD2 . LEU A 1 34  ? 9.021  19.702 39.903  1.00 23.37 ? 34   LEU A CD2 1 
ATOM   257  N  N   . ALA A 1 35  ? 7.932  23.642 37.112  1.00 23.68 ? 35   ALA A N   1 
ATOM   258  C  CA  . ALA A 1 35  ? 8.354  25.021 37.447  1.00 23.12 ? 35   ALA A CA  1 
ATOM   259  C  C   . ALA A 1 35  ? 9.444  25.009 38.507  1.00 21.32 ? 35   ALA A C   1 
ATOM   260  O  O   . ALA A 1 35  ? 9.423  24.208 39.421  1.00 21.95 ? 35   ALA A O   1 
ATOM   261  C  CB  . ALA A 1 35  ? 7.191  25.898 37.921  1.00 25.44 ? 35   ALA A CB  1 
ATOM   262  N  N   . ALA A 1 36  ? 10.397 25.923 38.359  1.00 25.15 ? 36   ALA A N   1 
ATOM   263  C  CA  . ALA A 1 36  ? 11.577 25.945 39.228  1.00 22.56 ? 36   ALA A CA  1 
ATOM   264  C  C   . ALA A 1 36  ? 11.210 26.039 40.700  1.00 20.69 ? 36   ALA A C   1 
ATOM   265  O  O   . ALA A 1 36  ? 11.801 25.349 41.530  1.00 23.02 ? 36   ALA A O   1 
ATOM   266  C  CB  . ALA A 1 36  ? 12.535 27.061 38.839  1.00 25.61 ? 36   ALA A CB  1 
ATOM   267  N  N   . SER A 1 37  ? 10.224 26.880 41.034  1.00 22.11 ? 37   SER A N   1 
ATOM   268  C  CA  . SER A 1 37  ? 9.770  27.033 42.413  1.00 26.08 ? 37   SER A CA  1 
ATOM   269  C  C   . SER A 1 37  ? 9.131  25.788 43.047  1.00 24.72 ? 37   SER A C   1 
ATOM   270  O  O   . SER A 1 37  ? 9.115  25.675 44.275  1.00 25.91 ? 37   SER A O   1 
ATOM   271  C  CB  . SER A 1 37  ? 8.841  28.253 42.533  1.00 27.92 ? 37   SER A CB  1 
ATOM   272  O  OG  . SER A 1 37  ? 7.592  27.947 41.995  1.00 31.56 ? 37   SER A OG  1 
ATOM   273  N  N   . LEU A 1 38  ? 8.688  24.830 42.238  1.00 22.85 ? 38   LEU A N   1 
ATOM   274  C  CA  . LEU A 1 38  ? 8.161  23.551 42.723  1.00 23.56 ? 38   LEU A CA  1 
ATOM   275  C  C   . LEU A 1 38  ? 9.215  22.481 42.851  1.00 22.31 ? 38   LEU A C   1 
ATOM   276  O  O   . LEU A 1 38  ? 8.924  21.387 43.331  1.00 23.72 ? 38   LEU A O   1 
ATOM   277  C  CB  . LEU A 1 38  ? 7.052  23.057 41.783  1.00 23.32 ? 38   LEU A CB  1 
ATOM   278  C  CG  . LEU A 1 38  ? 5.839  23.964 41.637  1.00 25.65 ? 38   LEU A CG  1 
ATOM   279  C  CD1 . LEU A 1 38  ? 4.875  23.372 40.657  1.00 26.26 ? 38   LEU A CD1 1 
ATOM   280  C  CD2 . LEU A 1 38  ? 5.167  24.211 43.000  1.00 30.96 ? 38   LEU A CD2 1 
ATOM   281  N  N   . ALA A 1 39  ? 10.422 22.767 42.355  1.00 20.92 ? 39   ALA A N   1 
ATOM   282  C  CA  . ALA A 1 39  ? 11.488 21.806 42.258  1.00 18.91 ? 39   ALA A CA  1 
ATOM   283  C  C   . ALA A 1 39  ? 12.548 22.022 43.313  1.00 19.58 ? 39   ALA A C   1 
ATOM   284  O  O   . ALA A 1 39  ? 12.722 23.126 43.838  1.00 21.89 ? 39   ALA A O   1 
ATOM   285  C  CB  . ALA A 1 39  ? 12.149 21.901 40.858  1.00 20.43 ? 39   ALA A CB  1 
ATOM   286  N  N   . ASP A 1 40  ? 13.333 20.984 43.540  1.00 20.06 ? 40   ASP A N   1 
ATOM   287  C  CA  . ASP A 1 40  ? 14.536 21.081 44.359  1.00 20.94 ? 40   ASP A CA  1 
ATOM   288  C  C   . ASP A 1 40  ? 15.839 20.973 43.589  1.00 21.02 ? 40   ASP A C   1 
ATOM   289  O  O   . ASP A 1 40  ? 16.867 21.505 44.038  1.00 20.10 ? 40   ASP A O   1 
ATOM   290  C  CB  . ASP A 1 40  ? 14.472 20.023 45.440  1.00 23.59 ? 40   ASP A CB  1 
ATOM   291  C  CG  . ASP A 1 40  ? 13.401 20.338 46.456  1.00 27.62 ? 40   ASP A CG  1 
ATOM   292  O  OD1 . ASP A 1 40  ? 13.572 21.328 47.232  1.00 30.23 ? 40   ASP A OD1 1 
ATOM   293  O  OD2 . ASP A 1 40  ? 12.380 19.623 46.441  1.00 25.27 ? 40   ASP A OD2 1 
ATOM   294  N  N   . ILE A 1 41  ? 15.822 20.271 42.452  1.00 20.52 ? 41   ILE A N   1 
ATOM   295  C  CA  . ILE A 1 41  ? 17.008 20.086 41.657  1.00 17.47 ? 41   ILE A CA  1 
ATOM   296  C  C   . ILE A 1 41  ? 16.596 20.106 40.196  1.00 17.68 ? 41   ILE A C   1 
ATOM   297  O  O   . ILE A 1 41  ? 15.423 19.990 39.855  1.00 19.05 ? 41   ILE A O   1 
ATOM   298  C  CB  . ILE A 1 41  ? 17.733 18.717 41.946  1.00 18.49 ? 41   ILE A CB  1 
ATOM   299  C  CG1 . ILE A 1 41  ? 16.851 17.505 41.554  1.00 21.63 ? 41   ILE A CG1 1 
ATOM   300  C  CG2 . ILE A 1 41  ? 18.198 18.664 43.377  1.00 20.95 ? 41   ILE A CG2 1 
ATOM   301  C  CD1 . ILE A 1 41  ? 17.517 16.157 41.676  1.00 20.36 ? 41   ILE A CD1 1 
ATOM   302  N  N   . HIS A 1 42  ? 17.596 20.263 39.373  1.00 16.39 ? 42   HIS A N   1 
ATOM   303  C  CA  . HIS A 1 42  ? 17.528 19.962 37.932  1.00 18.38 ? 42   HIS A CA  1 
ATOM   304  C  C   . HIS A 1 42  ? 18.469 18.818 37.686  1.00 19.95 ? 42   HIS A C   1 
ATOM   305  O  O   . HIS A 1 42  ? 19.657 18.893 38.037  1.00 20.99 ? 42   HIS A O   1 
ATOM   306  C  CB  . HIS A 1 42  ? 17.933 21.169 37.116  1.00 18.61 ? 42   HIS A CB  1 
ATOM   307  C  CG  . HIS A 1 42  ? 17.651 21.002 35.657  1.00 20.45 ? 42   HIS A CG  1 
ATOM   308  N  ND1 . HIS A 1 42  ? 16.377 21.065 35.134  1.00 20.30 ? 42   HIS A ND1 1 
ATOM   309  C  CD2 . HIS A 1 42  ? 18.485 20.792 34.613  1.00 22.50 ? 42   HIS A CD2 1 
ATOM   310  C  CE1 . HIS A 1 42  ? 16.437 20.868 33.827  1.00 23.58 ? 42   HIS A CE1 1 
ATOM   311  N  NE2 . HIS A 1 42  ? 17.704 20.698 33.489  1.00 23.21 ? 42   HIS A NE2 1 
ATOM   312  N  N   . LEU A 1 43  ? 17.904 17.715 37.211  1.00 19.78 ? 43   LEU A N   1 
ATOM   313  C  CA  . LEU A 1 43  ? 18.622 16.537 36.877  1.00 19.44 ? 43   LEU A CA  1 
ATOM   314  C  C   . LEU A 1 43  ? 18.998 16.633 35.433  1.00 19.15 ? 43   LEU A C   1 
ATOM   315  O  O   . LEU A 1 43  ? 18.125 16.901 34.596  1.00 20.82 ? 43   LEU A O   1 
ATOM   316  C  CB  . LEU A 1 43  ? 17.746 15.327 37.091  1.00 19.61 ? 43   LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 43  ? 18.357 13.990 36.689  1.00 20.54 ? 43   LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 43  ? 19.617 13.676 37.518  1.00 20.80 ? 43   LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 43  ? 17.292 12.917 36.859  1.00 22.45 ? 43   LEU A CD2 1 
ATOM   320  N  N   . GLU A 1 44  ? 20.265 16.384 35.134  1.00 19.69 ? 44   GLU A N   1 
ATOM   321  C  CA  . GLU A 1 44  ? 20.756 16.383 33.752  1.00 18.55 ? 44   GLU A CA  1 
ATOM   322  C  C   . GLU A 1 44  ? 21.440 15.076 33.371  1.00 20.48 ? 44   GLU A C   1 
ATOM   323  O  O   . GLU A 1 44  ? 22.207 14.518 34.134  1.00 21.48 ? 44   GLU A O   1 
ATOM   324  C  CB  . GLU A 1 44  ? 21.751 17.531 33.512  1.00 21.33 ? 44   GLU A CB  1 
ATOM   325  C  CG  . GLU A 1 44  ? 21.159 18.890 33.630  1.00 27.61 ? 44   GLU A CG  1 
ATOM   326  C  CD  . GLU A 1 44  ? 22.133 19.987 33.211  1.00 34.10 ? 44   GLU A CD  1 
ATOM   327  O  OE1 . GLU A 1 44  ? 23.341 19.682 33.067  1.00 40.50 ? 44   GLU A OE1 1 
ATOM   328  O  OE2 . GLU A 1 44  ? 21.688 21.153 33.029  1.00 39.63 ? 44   GLU A OE2 1 
ATOM   329  N  N   . ALA A 1 45  ? 21.149 14.606 32.160  1.00 19.43 ? 45   ALA A N   1 
ATOM   330  C  CA  . ALA A 1 45  ? 21.906 13.566 31.516  1.00 20.11 ? 45   ALA A CA  1 
ATOM   331  C  C   . ALA A 1 45  ? 22.819 14.273 30.504  1.00 20.99 ? 45   ALA A C   1 
ATOM   332  O  O   . ALA A 1 45  ? 22.334 15.006 29.618  1.00 20.97 ? 45   ALA A O   1 
ATOM   333  C  CB  . ALA A 1 45  ? 20.994 12.540 30.811  1.00 21.55 ? 45   ALA A CB  1 
ATOM   334  N  N   . ASP A 1 46  ? 24.131 14.069 30.665  1.00 18.39 ? 46   ASP A N   1 
ATOM   335  C  CA  . ASP A 1 46  ? 25.151 14.602 29.749  1.00 20.14 ? 46   ASP A CA  1 
ATOM   336  C  C   . ASP A 1 46  ? 25.603 13.446 28.852  1.00 18.32 ? 46   ASP A C   1 
ATOM   337  O  O   . ASP A 1 46  ? 26.223 12.493 29.310  1.00 18.74 ? 46   ASP A O   1 
ATOM   338  C  CB  . ASP A 1 46  ? 26.328 15.151 30.538  1.00 22.45 ? 46   ASP A CB  1 
ATOM   339  C  CG  . ASP A 1 46  ? 26.052 16.514 31.134  1.00 31.71 ? 46   ASP A CG  1 
ATOM   340  O  OD1 . ASP A 1 46  ? 25.327 17.333 30.517  1.00 31.22 ? 46   ASP A OD1 1 
ATOM   341  O  OD2 . ASP A 1 46  ? 26.560 16.768 32.246  1.00 35.68 ? 46   ASP A OD2 1 
ATOM   342  N  N   . ILE A 1 47  ? 25.242 13.541 27.572  1.00 16.50 ? 47   ILE A N   1 
ATOM   343  C  CA  . ILE A 1 47  ? 25.380 12.454 26.616  1.00 19.38 ? 47   ILE A CA  1 
ATOM   344  C  C   . ILE A 1 47  ? 26.084 12.977 25.349  1.00 17.22 ? 47   ILE A C   1 
ATOM   345  O  O   . ILE A 1 47  ? 25.548 13.819 24.599  1.00 19.90 ? 47   ILE A O   1 
ATOM   346  C  CB  . ILE A 1 47  ? 24.011 11.817 26.234  1.00 17.82 ? 47   ILE A CB  1 
ATOM   347  C  CG1 . ILE A 1 47  ? 23.201 11.462 27.485  1.00 20.35 ? 47   ILE A CG1 1 
ATOM   348  C  CG2 . ILE A 1 47  ? 24.229 10.543 25.394  1.00 19.90 ? 47   ILE A CG2 1 
ATOM   349  C  CD1 . ILE A 1 47  ? 21.899 10.734 27.230  1.00 21.00 ? 47   ILE A CD1 1 
ATOM   350  N  N   . HIS A 1 48  ? 27.323 12.532 25.179  1.00 16.72 ? 48   HIS A N   1 
ATOM   351  C  CA  . HIS A 1 48  ? 28.160 12.914 24.057  1.00 17.47 ? 48   HIS A CA  1 
ATOM   352  C  C   . HIS A 1 48  ? 28.788 11.709 23.379  1.00 16.49 ? 48   HIS A C   1 
ATOM   353  O  O   . HIS A 1 48  ? 28.991 10.658 23.993  1.00 17.58 ? 48   HIS A O   1 
ATOM   354  C  CB  . HIS A 1 48  ? 29.205 13.920 24.510  1.00 18.38 ? 48   HIS A CB  1 
ATOM   355  C  CG  . HIS A 1 48  ? 28.602 15.158 25.097  1.00 23.31 ? 48   HIS A CG  1 
ATOM   356  N  ND1 . HIS A 1 48  ? 28.219 15.224 26.420  1.00 18.82 ? 48   HIS A ND1 1 
ATOM   357  C  CD2 . HIS A 1 48  ? 28.234 16.332 24.530  1.00 20.65 ? 48   HIS A CD2 1 
ATOM   358  C  CE1 . HIS A 1 48  ? 27.659 16.412 26.640  1.00 19.20 ? 48   HIS A CE1 1 
ATOM   359  N  NE2 . HIS A 1 48  ? 27.665 17.101 25.513  1.00 19.53 ? 48   HIS A NE2 1 
ATOM   360  N  N   . ALA A 1 49  ? 29.088 11.851 22.082  1.00 16.08 ? 49   ALA A N   1 
ATOM   361  C  CA  . ALA A 1 49  ? 29.773 10.834 21.340  1.00 17.22 ? 49   ALA A CA  1 
ATOM   362  C  C   . ALA A 1 49  ? 31.188 10.595 21.825  1.00 16.93 ? 49   ALA A C   1 
ATOM   363  O  O   . ALA A 1 49  ? 31.911 11.539 22.179  1.00 19.51 ? 49   ALA A O   1 
ATOM   364  C  CB  . ALA A 1 49  ? 29.795 11.185 19.875  1.00 14.89 ? 49   ALA A CB  1 
ATOM   365  N  N   . LEU A 1 50  ? 31.517 9.309  21.924  1.00 17.94 ? 50   LEU A N   1 
ATOM   366  C  CA  . LEU A 1 50  ? 32.847 8.835  22.127  1.00 20.92 ? 50   LEU A CA  1 
ATOM   367  C  C   . LEU A 1 50  ? 33.603 8.927  20.803  1.00 19.58 ? 50   LEU A C   1 
ATOM   368  O  O   . LEU A 1 50  ? 33.024 9.207  19.769  1.00 20.62 ? 50   LEU A O   1 
ATOM   369  C  CB  . LEU A 1 50  ? 32.819 7.359  22.546  1.00 22.62 ? 50   LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 50  ? 31.999 7.008  23.755  1.00 26.14 ? 50   LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 50  ? 31.885 5.477  23.915  1.00 29.83 ? 50   LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 50  ? 32.640 7.672  24.905  1.00 25.60 ? 50   LEU A CD2 1 
ATOM   373  N  N   . LYS A 1 51  ? 34.888 8.602  20.857  1.00 22.01 ? 51   LYS A N   1 
ATOM   374  C  CA  . LYS A 1 51  ? 35.672 8.357  19.652  1.00 19.66 ? 51   LYS A CA  1 
ATOM   375  C  C   . LYS A 1 51  ? 35.097 7.207  18.828  1.00 20.91 ? 51   LYS A C   1 
ATOM   376  O  O   . LYS A 1 51  ? 34.588 6.223  19.373  1.00 21.20 ? 51   LYS A O   1 
ATOM   377  C  CB  . LYS A 1 51  ? 37.122 8.010  20.034  1.00 22.53 ? 51   LYS A CB  1 
ATOM   378  C  CG  . LYS A 1 51  ? 37.870 9.149  20.665  1.00 23.57 ? 51   LYS A CG  1 
ATOM   379  C  CD  . LYS A 1 51  ? 39.213 8.654  21.191  1.00 30.54 ? 51   LYS A CD  1 
ATOM   380  C  CE  . LYS A 1 51  ? 40.087 9.764  21.687  1.00 32.83 ? 51   LYS A CE  1 
ATOM   381  N  NZ  . LYS A 1 51  ? 39.512 10.459 22.851  1.00 33.17 ? 51   LYS A NZ  1 
ATOM   382  N  N   . ASN A 1 52  ? 35.213 7.304  17.514  1.00 21.33 ? 52   ASN A N   1 
ATOM   383  C  CA  . ASN A 1 52  ? 34.778 6.232  16.641  1.00 21.55 ? 52   ASN A CA  1 
ATOM   384  C  C   . ASN A 1 52  ? 33.324 5.806  16.868  1.00 22.22 ? 52   ASN A C   1 
ATOM   385  O  O   . ASN A 1 52  ? 32.959 4.627  16.811  1.00 24.70 ? 52   ASN A O   1 
ATOM   386  C  CB  . ASN A 1 52  ? 35.760 5.070  16.741  1.00 20.60 ? 52   ASN A CB  1 
ATOM   387  C  CG  . ASN A 1 52  ? 37.010 5.330  15.932  1.00 25.51 ? 52   ASN A CG  1 
ATOM   388  O  OD1 . ASN A 1 52  ? 36.932 5.572  14.723  1.00 24.78 ? 52   ASN A OD1 1 
ATOM   389  N  ND2 . ASN A 1 52  ? 38.167 5.291  16.582  1.00 33.05 ? 52   ASN A ND2 1 
ATOM   390  N  N   . ASN A 1 53  ? 32.485 6.798  17.120  1.00 21.45 ? 53   ASN A N   1 
ATOM   391  C  CA  . ASN A 1 53  ? 31.072 6.486  17.361  1.00 21.86 ? 53   ASN A CA  1 
ATOM   392  C  C   . ASN A 1 53  ? 30.544 5.706  16.144  1.00 18.67 ? 53   ASN A C   1 
ATOM   393  O  O   . ASN A 1 53  ? 30.774 6.084  14.984  1.00 21.62 ? 53   ASN A O   1 
ATOM   394  C  CB  . ASN A 1 53  ? 30.323 7.787  17.624  1.00 19.91 ? 53   ASN A CB  1 
ATOM   395  C  CG  . ASN A 1 53  ? 28.818 7.621  17.644  1.00 16.11 ? 53   ASN A CG  1 
ATOM   396  O  OD1 . ASN A 1 53  ? 28.192 7.543  16.590  1.00 18.80 ? 53   ASN A OD1 1 
ATOM   397  N  ND2 . ASN A 1 53  ? 28.221 7.564  18.844  1.00 17.14 ? 53   ASN A ND2 1 
ATOM   398  N  N   . PRO A 1 54  ? 29.830 4.607  16.403  1.00 21.73 ? 54   PRO A N   1 
ATOM   399  C  CA  . PRO A 1 54  ? 29.416 3.755  15.307  1.00 24.95 ? 54   PRO A CA  1 
ATOM   400  C  C   . PRO A 1 54  ? 28.258 4.277  14.465  1.00 23.76 ? 54   PRO A C   1 
ATOM   401  O  O   . PRO A 1 54  ? 27.966 3.704  13.394  1.00 26.98 ? 54   PRO A O   1 
ATOM   402  C  CB  . PRO A 1 54  ? 29.050 2.446  16.020  1.00 28.64 ? 54   PRO A CB  1 
ATOM   403  C  CG  . PRO A 1 54  ? 28.547 2.865  17.334  1.00 27.11 ? 54   PRO A CG  1 
ATOM   404  C  CD  . PRO A 1 54  ? 29.385 4.091  17.710  1.00 21.88 ? 54   PRO A CD  1 
ATOM   405  N  N   . ASN A 1 55  ? 27.633 5.368  14.901  1.00 23.09 ? 55   ASN A N   1 
ATOM   406  C  CA  . ASN A 1 55  ? 26.546 5.990  14.138  1.00 20.56 ? 55   ASN A CA  1 
ATOM   407  C  C   . ASN A 1 55  ? 26.949 7.316  13.522  1.00 20.03 ? 55   ASN A C   1 
ATOM   408  O  O   . ASN A 1 55  ? 26.103 8.011  13.000  1.00 23.31 ? 55   ASN A O   1 
ATOM   409  C  CB  . ASN A 1 55  ? 25.333 6.128  15.049  1.00 20.60 ? 55   ASN A CB  1 
ATOM   410  C  CG  . ASN A 1 55  ? 24.966 4.804  15.679  1.00 21.15 ? 55   ASN A CG  1 
ATOM   411  O  OD1 . ASN A 1 55  ? 25.158 4.597  16.876  1.00 23.51 ? 55   ASN A OD1 1 
ATOM   412  N  ND2 . ASN A 1 55  ? 24.474 3.879  14.856  1.00 23.59 ? 55   ASN A ND2 1 
ATOM   413  N  N   . GLY A 1 56  ? 28.250 7.558  13.439  1.00 18.48 ? 56   GLY A N   1 
ATOM   414  C  CA  . GLY A 1 56  ? 28.758 8.705  12.733  1.00 18.88 ? 56   GLY A CA  1 
ATOM   415  C  C   . GLY A 1 56  ? 28.832 9.998  13.467  1.00 17.55 ? 56   GLY A C   1 
ATOM   416  O  O   . GLY A 1 56  ? 29.196 10.962 12.859  1.00 20.12 ? 56   GLY A O   1 
ATOM   417  N  N   . PHE A 1 57  ? 28.536 10.039 14.765  1.00 15.81 ? 57   PHE A N   1 
ATOM   418  C  CA  . PHE A 1 57  ? 28.612 11.286 15.466  1.00 17.76 ? 57   PHE A CA  1 
ATOM   419  C  C   . PHE A 1 57  ? 30.043 11.614 15.852  1.00 19.01 ? 57   PHE A C   1 
ATOM   420  O  O   . PHE A 1 57  ? 30.734 10.771 16.417  1.00 20.44 ? 57   PHE A O   1 
ATOM   421  C  CB  . PHE A 1 57  ? 27.746 11.269 16.707  1.00 16.01 ? 57   PHE A CB  1 
ATOM   422  C  CG  . PHE A 1 57  ? 26.352 11.618 16.405  1.00 16.34 ? 57   PHE A CG  1 
ATOM   423  C  CD1 . PHE A 1 57  ? 25.452 10.650 16.004  1.00 21.14 ? 57   PHE A CD1 1 
ATOM   424  C  CD2 . PHE A 1 57  ? 25.957 12.959 16.457  1.00 21.95 ? 57   PHE A CD2 1 
ATOM   425  C  CE1 . PHE A 1 57  ? 24.142 11.041 15.687  1.00 22.26 ? 57   PHE A CE1 1 
ATOM   426  C  CE2 . PHE A 1 57  ? 24.660 13.319 16.139  1.00 23.20 ? 57   PHE A CE2 1 
ATOM   427  C  CZ  . PHE A 1 57  ? 23.792 12.360 15.728  1.00 20.13 ? 57   PHE A CZ  1 
ATOM   428  N  N   . PRO A 1 58  ? 30.472 12.841 15.540  1.00 18.59 ? 58   PRO A N   1 
ATOM   429  C  CA  . PRO A 1 58  ? 31.817 13.257 15.890  1.00 17.99 ? 58   PRO A CA  1 
ATOM   430  C  C   . PRO A 1 58  ? 32.037 13.217 17.378  1.00 17.13 ? 58   PRO A C   1 
ATOM   431  O  O   . PRO A 1 58  ? 31.153 13.587 18.163  1.00 16.13 ? 58   PRO A O   1 
ATOM   432  C  CB  . PRO A 1 58  ? 31.866 14.708 15.413  1.00 17.78 ? 58   PRO A CB  1 
ATOM   433  C  CG  . PRO A 1 58  ? 30.913 14.736 14.208  1.00 21.72 ? 58   PRO A CG  1 
ATOM   434  C  CD  . PRO A 1 58  ? 29.804 13.806 14.638  1.00 20.88 ? 58   PRO A CD  1 
ATOM   435  N  N   . GLU A 1 59  ? 33.227 12.776 17.756  1.00 18.76 ? 59   GLU A N   1 
ATOM   436  C  CA  . GLU A 1 59  ? 33.622 12.776 19.168  1.00 18.40 ? 59   GLU A CA  1 
ATOM   437  C  C   . GLU A 1 59  ? 33.275 14.091 19.822  1.00 19.81 ? 59   GLU A C   1 
ATOM   438  O  O   . GLU A 1 59  ? 33.665 15.152 19.341  1.00 18.63 ? 59   GLU A O   1 
ATOM   439  C  CB  . GLU A 1 59  ? 35.138 12.563 19.294  1.00 22.09 ? 59   GLU A CB  1 
ATOM   440  C  CG  . GLU A 1 59  ? 35.573 12.445 20.741  1.00 24.73 ? 59   GLU A CG  1 
ATOM   441  C  CD  . GLU A 1 59  ? 37.081 12.388 20.938  1.00 32.11 ? 59   GLU A CD  1 
ATOM   442  O  OE1 . GLU A 1 59  ? 37.844 12.652 19.977  1.00 29.33 ? 59   GLU A OE1 1 
ATOM   443  O  OE2 . GLU A 1 59  ? 37.491 12.100 22.092  1.00 32.45 ? 59   GLU A OE2 1 
ATOM   444  N  N   . GLY A 1 60  ? 32.595 14.012 20.960  1.00 19.02 ? 60   GLY A N   1 
ATOM   445  C  CA  . GLY A 1 60  ? 32.294 15.205 21.722  1.00 20.12 ? 60   GLY A CA  1 
ATOM   446  C  C   . GLY A 1 60  ? 30.957 15.815 21.396  1.00 19.37 ? 60   GLY A C   1 
ATOM   447  O  O   . GLY A 1 60  ? 30.434 16.619 22.170  1.00 21.03 ? 60   GLY A O   1 
ATOM   448  N  N   . PHE A 1 61  ? 30.429 15.523 20.211  1.00 18.67 ? 61   PHE A N   1 
ATOM   449  C  CA  . PHE A 1 61  ? 29.102 16.047 19.870  1.00 18.90 ? 61   PHE A CA  1 
ATOM   450  C  C   . PHE A 1 61  ? 28.072 15.570 20.866  1.00 18.72 ? 61   PHE A C   1 
ATOM   451  O  O   . PHE A 1 61  ? 28.044 14.410 21.266  1.00 17.09 ? 61   PHE A O   1 
ATOM   452  C  CB  . PHE A 1 61  ? 28.664 15.631 18.459  1.00 20.56 ? 61   PHE A CB  1 
ATOM   453  C  CG  . PHE A 1 61  ? 29.004 16.610 17.393  1.00 21.95 ? 61   PHE A CG  1 
ATOM   454  C  CD1 . PHE A 1 61  ? 30.109 17.436 17.506  1.00 20.70 ? 61   PHE A CD1 1 
ATOM   455  C  CD2 . PHE A 1 61  ? 28.218 16.703 16.235  1.00 21.35 ? 61   PHE A CD2 1 
ATOM   456  C  CE1 . PHE A 1 61  ? 30.402 18.373 16.529  1.00 22.46 ? 61   PHE A CE1 1 
ATOM   457  C  CE2 . PHE A 1 61  ? 28.535 17.631 15.233  1.00 23.87 ? 61   PHE A CE2 1 
ATOM   458  C  CZ  . PHE A 1 61  ? 29.629 18.451 15.381  1.00 24.04 ? 61   PHE A CZ  1 
ATOM   459  N  N   . TRP A 1 62  ? 27.149 16.455 21.181  1.00 18.32 ? 62   TRP A N   1 
ATOM   460  C  CA  . TRP A 1 62  ? 25.957 16.098 21.903  1.00 16.77 ? 62   TRP A CA  1 
ATOM   461  C  C   . TRP A 1 62  ? 25.151 15.103 21.087  1.00 16.73 ? 62   TRP A C   1 
ATOM   462  O  O   . TRP A 1 62  ? 25.067 15.211 19.859  1.00 18.47 ? 62   TRP A O   1 
ATOM   463  C  CB  . TRP A 1 62  ? 25.115 17.346 22.143  1.00 18.56 ? 62   TRP A CB  1 
ATOM   464  C  CG  . TRP A 1 62  ? 23.882 17.090 22.953  1.00 17.06 ? 62   TRP A CG  1 
ATOM   465  C  CD1 . TRP A 1 62  ? 23.837 16.606 24.194  1.00 19.33 ? 62   TRP A CD1 1 
ATOM   466  C  CD2 . TRP A 1 62  ? 22.535 17.344 22.571  1.00 16.17 ? 62   TRP A CD2 1 
ATOM   467  N  NE1 . TRP A 1 62  ? 22.556 16.509 24.631  1.00 17.33 ? 62   TRP A NE1 1 
ATOM   468  C  CE2 . TRP A 1 62  ? 21.724 16.991 23.669  1.00 16.39 ? 62   TRP A CE2 1 
ATOM   469  C  CE3 . TRP A 1 62  ? 21.934 17.881 21.429  1.00 17.56 ? 62   TRP A CE3 1 
ATOM   470  C  CZ2 . TRP A 1 62  ? 20.325 17.120 23.648  1.00 19.82 ? 62   TRP A CZ2 1 
ATOM   471  C  CZ3 . TRP A 1 62  ? 20.556 18.007 21.401  1.00 19.94 ? 62   TRP A CZ3 1 
ATOM   472  C  CH2 . TRP A 1 62  ? 19.759 17.624 22.506  1.00 19.41 ? 62   TRP A CH2 1 
ATOM   473  N  N   . MET A 1 63  ? 24.571 14.128 21.756  1.00 18.40 ? 63   MET A N   1 
ATOM   474  C  CA  . MET A 1 63  ? 23.769 13.148 21.083  1.00 17.49 ? 63   MET A CA  1 
ATOM   475  C  C   . MET A 1 63  ? 22.304 13.592 21.092  1.00 17.49 ? 63   MET A C   1 
ATOM   476  O  O   . MET A 1 63  ? 21.673 13.582 22.132  1.00 17.74 ? 63   MET A O   1 
ATOM   477  C  CB  . MET A 1 63  ? 23.906 11.793 21.747  1.00 17.06 ? 63   MET A CB  1 
ATOM   478  C  CG  . MET A 1 63  ? 25.312 11.248 21.811  1.00 20.21 ? 63   MET A CG  1 
ATOM   479  S  SD  . MET A 1 63  ? 25.988 10.890 20.182  1.00 23.41 ? 63   MET A SD  1 
ATOM   480  C  CE  . MET A 1 63  ? 24.875 9.621  19.593  1.00 23.93 ? 63   MET A CE  1 
ATOM   481  N  N   . PRO A 1 64  ? 21.760 13.968 19.936  1.00 19.05 ? 64   PRO A N   1 
ATOM   482  C  CA  . PRO A 1 64  ? 20.435 14.553 19.853  1.00 19.55 ? 64   PRO A CA  1 
ATOM   483  C  C   . PRO A 1 64  ? 19.349 13.526 19.562  1.00 18.90 ? 64   PRO A C   1 
ATOM   484  O  O   . PRO A 1 64  ? 19.649 12.380 19.195  1.00 17.66 ? 64   PRO A O   1 
ATOM   485  C  CB  . PRO A 1 64  ? 20.597 15.528 18.701  1.00 20.56 ? 64   PRO A CB  1 
ATOM   486  C  CG  . PRO A 1 64  ? 21.428 14.769 17.715  1.00 20.98 ? 64   PRO A CG  1 
ATOM   487  C  CD  . PRO A 1 64  ? 22.410 13.957 18.604  1.00 19.60 ? 64   PRO A CD  1 
ATOM   488  N  N   . TYR A 1 65  ? 18.092 13.938 19.743  1.00 18.87 ? 65   TYR A N   1 
ATOM   489  C  CA  . TYR A 1 65  ? 16.910 13.145 19.386  1.00 19.27 ? 65   TYR A CA  1 
ATOM   490  C  C   . TYR A 1 65  ? 16.739 11.865 20.181  1.00 19.35 ? 65   TYR A C   1 
ATOM   491  O  O   . TYR A 1 65  ? 15.998 10.995 19.771  1.00 20.07 ? 65   TYR A O   1 
ATOM   492  C  CB  . TYR A 1 65  ? 16.891 12.852 17.871  1.00 21.57 ? 65   TYR A CB  1 
ATOM   493  C  CG  . TYR A 1 65  ? 16.773 14.098 17.026  1.00 20.17 ? 65   TYR A CG  1 
ATOM   494  C  CD1 . TYR A 1 65  ? 15.531 14.598 16.662  1.00 23.31 ? 65   TYR A CD1 1 
ATOM   495  C  CD2 . TYR A 1 65  ? 17.878 14.742 16.555  1.00 22.22 ? 65   TYR A CD2 1 
ATOM   496  C  CE1 . TYR A 1 65  ? 15.409 15.730 15.912  1.00 24.54 ? 65   TYR A CE1 1 
ATOM   497  C  CE2 . TYR A 1 65  ? 17.776 15.874 15.805  1.00 21.80 ? 65   TYR A CE2 1 
ATOM   498  C  CZ  . TYR A 1 65  ? 16.547 16.367 15.459  1.00 20.54 ? 65   TYR A CZ  1 
ATOM   499  O  OH  . TYR A 1 65  ? 16.454 17.471 14.680  1.00 20.86 ? 65   TYR A OH  1 
ATOM   500  N  N   . LEU A 1 66  ? 17.416 11.750 21.336  1.00 17.51 ? 66   LEU A N   1 
ATOM   501  C  CA  . LEU A 1 66  ? 17.226 10.614 22.192  1.00 16.79 ? 66   LEU A CA  1 
ATOM   502  C  C   . LEU A 1 66  ? 15.925 10.754 22.978  1.00 17.54 ? 66   LEU A C   1 
ATOM   503  O  O   . LEU A 1 66  ? 15.487 11.860 23.273  1.00 20.72 ? 66   LEU A O   1 
ATOM   504  C  CB  . LEU A 1 66  ? 18.375 10.471 23.167  1.00 16.15 ? 66   LEU A CB  1 
ATOM   505  C  CG  . LEU A 1 66  ? 19.722 10.197 22.514  1.00 18.24 ? 66   LEU A CG  1 
ATOM   506  C  CD1 . LEU A 1 66  ? 20.795 10.246 23.626  1.00 19.17 ? 66   LEU A CD1 1 
ATOM   507  C  CD2 . LEU A 1 66  ? 19.776 8.834  21.742  1.00 19.50 ? 66   LEU A CD2 1 
ATOM   508  N  N   . THR A 1 67  ? 15.272 9.628  23.220  1.00 18.33 ? 67   THR A N   1 
ATOM   509  C  CA  . THR A 1 67  ? 14.141 9.579  24.145  1.00 20.36 ? 67   THR A CA  1 
ATOM   510  C  C   . THR A 1 67  ? 14.685 9.007  25.447  1.00 21.86 ? 67   THR A C   1 
ATOM   511  O  O   . THR A 1 67  ? 15.283 7.905  25.463  1.00 21.92 ? 67   THR A O   1 
ATOM   512  C  CB  . THR A 1 67  ? 13.013 8.707  23.575  1.00 24.88 ? 67   THR A CB  1 
ATOM   513  O  OG1 . THR A 1 67  ? 12.664 9.167  22.254  1.00 24.13 ? 67   THR A OG1 1 
ATOM   514  C  CG2 . THR A 1 67  ? 11.768 8.736  24.460  1.00 28.10 ? 67   THR A CG2 1 
ATOM   515  N  N   . ILE A 1 68  ? 14.515 9.750  26.522  1.00 21.49 ? 68   ILE A N   1 
ATOM   516  C  CA  . ILE A 1 68  ? 15.117 9.406  27.805  1.00 20.20 ? 68   ILE A CA  1 
ATOM   517  C  C   . ILE A 1 68  ? 14.104 9.562  28.914  1.00 20.66 ? 68   ILE A C   1 
ATOM   518  O  O   . ILE A 1 68  ? 13.493 10.621 29.095  1.00 23.54 ? 68   ILE A O   1 
ATOM   519  C  CB  . ILE A 1 68  ? 16.354 10.237 28.157  1.00 20.89 ? 68   ILE A CB  1 
ATOM   520  C  CG1 . ILE A 1 68  ? 17.379 10.201 27.066  1.00 25.77 ? 68   ILE A CG1 1 
ATOM   521  C  CG2 . ILE A 1 68  ? 17.008 9.739  29.433  1.00 23.07 ? 68   ILE A CG2 1 
ATOM   522  C  CD1 . ILE A 1 68  ? 18.570 11.110 27.395  1.00 29.93 ? 68   ILE A CD1 1 
ATOM   523  N  N   . ALA A 1 69  ? 13.926 8.468  29.630  1.00 21.08 ? 69   ALA A N   1 
ATOM   524  C  CA  . ALA A 1 69  ? 13.169 8.451  30.845  1.00 23.12 ? 69   ALA A CA  1 
ATOM   525  C  C   . ALA A 1 69  ? 14.130 8.187  32.012  1.00 22.18 ? 69   ALA A C   1 
ATOM   526  O  O   . ALA A 1 69  ? 15.216 7.659  31.842  1.00 21.56 ? 69   ALA A O   1 
ATOM   527  C  CB  . ALA A 1 69  ? 12.112 7.376  30.787  1.00 25.56 ? 69   ALA A CB  1 
ATOM   528  N  N   . TYR A 1 70  ? 13.671 8.502  33.211  1.00 23.37 ? 70   TYR A N   1 
ATOM   529  C  CA  . TYR A 1 70  ? 14.450 8.237  34.402  1.00 22.04 ? 70   TYR A CA  1 
ATOM   530  C  C   . TYR A 1 70  ? 13.572 7.605  35.449  1.00 22.41 ? 70   TYR A C   1 
ATOM   531  O  O   . TYR A 1 70  ? 12.325 7.730  35.454  1.00 21.24 ? 70   TYR A O   1 
ATOM   532  C  CB  . TYR A 1 70  ? 15.095 9.522  34.912  1.00 22.55 ? 70   TYR A CB  1 
ATOM   533  C  CG  . TYR A 1 70  ? 14.128 10.466 35.568  1.00 23.45 ? 70   TYR A CG  1 
ATOM   534  C  CD1 . TYR A 1 70  ? 13.816 10.349 36.924  1.00 22.99 ? 70   TYR A CD1 1 
ATOM   535  C  CD2 . TYR A 1 70  ? 13.522 11.489 34.841  1.00 23.69 ? 70   TYR A CD2 1 
ATOM   536  C  CE1 . TYR A 1 70  ? 12.915 11.187 37.509  1.00 26.43 ? 70   TYR A CE1 1 
ATOM   537  C  CE2 . TYR A 1 70  ? 12.617 12.334 35.421  1.00 25.53 ? 70   TYR A CE2 1 
ATOM   538  C  CZ  . TYR A 1 70  ? 12.327 12.175 36.777  1.00 25.31 ? 70   TYR A CZ  1 
ATOM   539  O  OH  . TYR A 1 70  ? 11.445 12.977 37.446  1.00 32.76 ? 70   TYR A OH  1 
ATOM   540  N  N   . GLU A 1 71  ? 14.252 6.894  36.341  1.00 24.31 ? 71   GLU A N   1 
ATOM   541  C  CA  A GLU A 1 71  ? 13.646 6.383  37.548  0.50 23.11 ? 71   GLU A CA  1 
ATOM   542  C  CA  B GLU A 1 71  ? 13.637 6.408  37.554  0.50 22.76 ? 71   GLU A CA  1 
ATOM   543  C  C   . GLU A 1 71  ? 14.585 6.748  38.685  1.00 22.36 ? 71   GLU A C   1 
ATOM   544  O  O   . GLU A 1 71  ? 15.786 6.490  38.620  1.00 23.98 ? 71   GLU A O   1 
ATOM   545  C  CB  A GLU A 1 71  ? 13.449 4.872  37.452  0.50 25.82 ? 71   GLU A CB  1 
ATOM   546  C  CB  B GLU A 1 71  ? 13.362 4.907  37.490  0.50 24.89 ? 71   GLU A CB  1 
ATOM   547  C  CG  A GLU A 1 71  ? 12.939 4.212  38.702  0.50 28.68 ? 71   GLU A CG  1 
ATOM   548  C  CG  B GLU A 1 71  ? 12.758 4.335  38.742  0.50 27.73 ? 71   GLU A CG  1 
ATOM   549  C  CD  A GLU A 1 71  ? 12.665 2.742  38.472  0.50 36.33 ? 71   GLU A CD  1 
ATOM   550  C  CD  B GLU A 1 71  ? 12.339 2.896  38.546  0.50 36.17 ? 71   GLU A CD  1 
ATOM   551  O  OE1 A GLU A 1 71  ? 12.920 2.266  37.340  0.50 39.53 ? 71   GLU A OE1 1 
ATOM   552  O  OE1 B GLU A 1 71  ? 11.398 2.648  37.753  0.50 40.68 ? 71   GLU A OE1 1 
ATOM   553  O  OE2 A GLU A 1 71  ? 12.193 2.070  39.412  0.50 44.30 ? 71   GLU A OE2 1 
ATOM   554  O  OE2 B GLU A 1 71  ? 12.969 2.018  39.173  0.50 42.99 ? 71   GLU A OE2 1 
ATOM   555  N  N   . LEU A 1 72  ? 14.041 7.349  39.711  1.00 22.52 ? 72   LEU A N   1 
ATOM   556  C  CA  . LEU A 1 72  ? 14.818 7.772  40.834  1.00 21.89 ? 72   LEU A CA  1 
ATOM   557  C  C   . LEU A 1 72  ? 14.293 7.087  42.074  1.00 22.96 ? 72   LEU A C   1 
ATOM   558  O  O   . LEU A 1 72  ? 13.121 7.161  42.382  1.00 25.17 ? 72   LEU A O   1 
ATOM   559  C  CB  . LEU A 1 72  ? 14.692 9.279  40.959  1.00 24.55 ? 72   LEU A CB  1 
ATOM   560  C  CG  . LEU A 1 72  ? 15.558 9.986  41.972  1.00 26.50 ? 72   LEU A CG  1 
ATOM   561  C  CD1 . LEU A 1 72  ? 17.054 9.763  41.729  1.00 23.61 ? 72   LEU A CD1 1 
ATOM   562  C  CD2 . LEU A 1 72  ? 15.197 11.515 41.930  1.00 32.16 ? 72   LEU A CD2 1 
ATOM   563  N  N   . LYS A 1 73  ? 15.167 6.413  42.803  1.00 23.19 ? 73   LYS A N   1 
ATOM   564  C  CA  . LYS A 1 73  ? 14.721 5.647  43.964  1.00 22.87 ? 73   LYS A CA  1 
ATOM   565  C  C   . LYS A 1 73  ? 15.546 6.042  45.152  1.00 23.08 ? 73   LYS A C   1 
ATOM   566  O  O   . LYS A 1 73  ? 16.768 5.983  45.096  1.00 22.63 ? 73   LYS A O   1 
ATOM   567  C  CB  . LYS A 1 73  ? 14.875 4.137  43.709  1.00 24.10 ? 73   LYS A CB  1 
ATOM   568  C  CG  . LYS A 1 73  ? 14.631 3.257  44.961  1.00 29.89 ? 73   LYS A CG  1 
ATOM   569  C  CD  . LYS A 1 73  ? 15.150 1.821  44.781  1.00 40.63 ? 73   LYS A CD  1 
ATOM   570  C  CE  . LYS A 1 73  ? 14.371 1.081  43.717  1.00 52.78 ? 73   LYS A CE  1 
ATOM   571  N  NZ  . LYS A 1 73  ? 14.643 1.566  42.315  1.00 61.03 ? 73   LYS A NZ  1 
ATOM   572  N  N   . ASN A 1 74  ? 14.876 6.461  46.222  1.00 23.56 ? 74   ASN A N   1 
ATOM   573  C  CA  . ASN A 1 74  ? 15.527 6.643  47.501  1.00 23.41 ? 74   ASN A CA  1 
ATOM   574  C  C   . ASN A 1 74  ? 15.620 5.241  48.098  1.00 24.59 ? 74   ASN A C   1 
ATOM   575  O  O   . ASN A 1 74  ? 14.594 4.644  48.425  1.00 26.24 ? 74   ASN A O   1 
ATOM   576  C  CB  . ASN A 1 74  ? 14.665 7.535  48.363  1.00 24.91 ? 74   ASN A CB  1 
ATOM   577  C  CG  . ASN A 1 74  ? 15.271 7.798  49.711  1.00 26.98 ? 74   ASN A CG  1 
ATOM   578  O  OD1 . ASN A 1 74  ? 15.779 6.883  50.379  1.00 27.50 ? 74   ASN A OD1 1 
ATOM   579  N  ND2 . ASN A 1 74  ? 15.260 9.051  50.108  1.00 25.00 ? 74   ASN A ND2 1 
ATOM   580  N  N   . THR A 1 75  ? 16.835 4.725  48.248  1.00 25.06 ? 75   THR A N   1 
ATOM   581  C  CA  . THR A 1 75  ? 16.981 3.365  48.718  1.00 26.91 ? 75   THR A CA  1 
ATOM   582  C  C   . THR A 1 75  ? 16.745 3.258  50.235  1.00 29.89 ? 75   THR A C   1 
ATOM   583  O  O   . THR A 1 75  ? 16.513 2.169  50.711  1.00 34.87 ? 75   THR A O   1 
ATOM   584  C  CB  . THR A 1 75  ? 18.336 2.737  48.326  1.00 28.92 ? 75   THR A CB  1 
ATOM   585  O  OG1 . THR A 1 75  ? 19.400 3.541  48.827  1.00 30.74 ? 75   THR A OG1 1 
ATOM   586  C  CG2 . THR A 1 75  ? 18.448 2.645  46.833  1.00 31.80 ? 75   THR A CG2 1 
ATOM   587  N  N   . ASP A 1 76  ? 16.806 4.383  50.961  1.00 29.59 ? 76   ASP A N   1 
ATOM   588  C  CA  . ASP A 1 76  ? 16.529 4.404  52.397  1.00 31.52 ? 76   ASP A CA  1 
ATOM   589  C  C   . ASP A 1 76  ? 15.030 4.343  52.686  1.00 34.01 ? 76   ASP A C   1 
ATOM   590  O  O   . ASP A 1 76  ? 14.627 3.693  53.635  1.00 36.58 ? 76   ASP A O   1 
ATOM   591  C  CB  . ASP A 1 76  ? 17.071 5.659  53.079  1.00 32.22 ? 76   ASP A CB  1 
ATOM   592  C  CG  . ASP A 1 76  ? 18.526 5.987  52.722  1.00 35.25 ? 76   ASP A CG  1 
ATOM   593  O  OD1 . ASP A 1 76  ? 19.389 5.080  52.735  1.00 36.62 ? 76   ASP A OD1 1 
ATOM   594  O  OD2 . ASP A 1 76  ? 18.792 7.194  52.478  1.00 39.64 ? 76   ASP A OD2 1 
ATOM   595  N  N   . THR A 1 77  ? 14.210 5.055  51.906  1.00 32.56 ? 77   THR A N   1 
ATOM   596  C  CA  . THR A 1 77  ? 12.764 5.133  52.166  1.00 32.29 ? 77   THR A CA  1 
ATOM   597  C  C   . THR A 1 77  ? 12.018 4.169  51.274  1.00 31.52 ? 77   THR A C   1 
ATOM   598  O  O   . THR A 1 77  ? 10.917 3.744  51.594  1.00 36.59 ? 77   THR A O   1 
ATOM   599  C  CB  . THR A 1 77  ? 12.203 6.550  51.904  1.00 31.75 ? 77   THR A CB  1 
ATOM   600  O  OG1 . THR A 1 77  ? 12.387 6.890  50.512  1.00 30.04 ? 77   THR A OG1 1 
ATOM   601  C  CG2 . THR A 1 77  ? 12.909 7.587  52.786  1.00 32.95 ? 77   THR A CG2 1 
ATOM   602  N  N   . GLY A 1 78  ? 12.610 3.855  50.126  1.00 30.55 ? 78   GLY A N   1 
ATOM   603  C  CA  . GLY A 1 78  ? 11.965 3.034  49.117  1.00 31.21 ? 78   GLY A CA  1 
ATOM   604  C  C   . GLY A 1 78  ? 11.109 3.811  48.130  1.00 28.10 ? 78   GLY A C   1 
ATOM   605  O  O   . GLY A 1 78  ? 10.489 3.211  47.260  1.00 32.35 ? 78   GLY A O   1 
ATOM   606  N  N   . ALA A 1 79  ? 11.088 5.140  48.241  1.00 27.34 ? 79   ALA A N   1 
ATOM   607  C  CA  . ALA A 1 79  ? 10.275 5.979  47.393  1.00 26.88 ? 79   ALA A CA  1 
ATOM   608  C  C   . ALA A 1 79  ? 10.876 5.997  45.979  1.00 24.19 ? 79   ALA A C   1 
ATOM   609  O  O   . ALA A 1 79  ? 12.093 5.979  45.809  1.00 24.33 ? 79   ALA A O   1 
ATOM   610  C  CB  . ALA A 1 79  ? 10.204 7.393  47.974  1.00 27.38 ? 79   ALA A CB  1 
ATOM   611  N  N   . ILE A 1 80  ? 10.004 5.913  44.985  1.00 24.02 ? 80   ILE A N   1 
ATOM   612  C  CA  . ILE A 1 80  ? 10.408 5.818  43.607  1.00 24.84 ? 80   ILE A CA  1 
ATOM   613  C  C   . ILE A 1 80  ? 9.563  6.783  42.789  1.00 25.97 ? 80   ILE A C   1 
ATOM   614  O  O   . ILE A 1 80  ? 8.344  6.826  42.919  1.00 26.99 ? 80   ILE A O   1 
ATOM   615  C  CB  . ILE A 1 80  ? 10.201 4.399  43.062  1.00 27.91 ? 80   ILE A CB  1 
ATOM   616  C  CG1 . ILE A 1 80  ? 11.099 3.371  43.796  1.00 32.26 ? 80   ILE A CG1 1 
ATOM   617  C  CG2 . ILE A 1 80  ? 10.481 4.362  41.558  1.00 28.50 ? 80   ILE A CG2 1 
ATOM   618  C  CD1 . ILE A 1 80  ? 10.746 1.897  43.486  1.00 38.98 ? 80   ILE A CD1 1 
ATOM   619  N  N   . LYS A 1 81  ? 10.220 7.573  41.961  1.00 25.04 ? 81   LYS A N   1 
ATOM   620  C  CA  . LYS A 1 81  ? 9.495  8.354  40.980  1.00 25.57 ? 81   LYS A CA  1 
ATOM   621  C  C   . LYS A 1 81  ? 10.101 8.185  39.598  1.00 24.39 ? 81   LYS A C   1 
ATOM   622  O  O   . LYS A 1 81  ? 11.275 7.859  39.440  1.00 23.74 ? 81   LYS A O   1 
ATOM   623  C  CB  . LYS A 1 81  ? 9.437  9.823  41.376  1.00 27.96 ? 81   LYS A CB  1 
ATOM   624  C  CG  . LYS A 1 81  ? 10.751 10.497 41.554  1.00 30.40 ? 81   LYS A CG  1 
ATOM   625  C  CD  . LYS A 1 81  ? 10.598 12.024 41.442  1.00 38.42 ? 81   LYS A CD  1 
ATOM   626  C  CE  . LYS A 1 81  ? 9.983  12.650 42.643  1.00 37.00 ? 81   LYS A CE  1 
ATOM   627  N  NZ  . LYS A 1 81  ? 9.620  14.086 42.405  1.00 26.83 ? 81   LYS A NZ  1 
ATOM   628  N  N   . ARG A 1 82  ? 9.275  8.407  38.594  1.00 24.85 ? 82   ARG A N   1 
ATOM   629  C  CA  . ARG A 1 82  ? 9.703  8.275  37.217  1.00 23.48 ? 82   ARG A CA  1 
ATOM   630  C  C   . ARG A 1 82  ? 9.295  9.514  36.468  1.00 23.35 ? 82   ARG A C   1 
ATOM   631  O  O   . ARG A 1 82  ? 8.302  10.171 36.810  1.00 28.74 ? 82   ARG A O   1 
ATOM   632  C  CB  . ARG A 1 82  ? 9.065  7.050  36.567  1.00 27.05 ? 82   ARG A CB  1 
ATOM   633  C  CG  . ARG A 1 82  ? 9.438  5.737  37.215  1.00 34.40 ? 82   ARG A CG  1 
ATOM   634  C  CD  . ARG A 1 82  ? 8.613  4.563  36.680  1.00 46.53 ? 82   ARG A CD  1 
ATOM   635  N  NE  . ARG A 1 82  ? 8.777  3.436  37.596  1.00 56.63 ? 82   ARG A NE  1 
ATOM   636  C  CZ  . ARG A 1 82  ? 8.028  3.209  38.683  1.00 60.15 ? 82   ARG A CZ  1 
ATOM   637  N  NH1 . ARG A 1 82  ? 7.002  4.007  39.004  1.00 63.49 ? 82   ARG A NH1 1 
ATOM   638  N  NH2 . ARG A 1 82  ? 8.304  2.162  39.457  1.00 61.78 ? 82   ARG A NH2 1 
ATOM   639  N  N   . GLY A 1 83  ? 10.048 9.821  35.424  1.00 22.03 ? 83   GLY A N   1 
ATOM   640  C  CA  . GLY A 1 83  ? 9.680  10.898 34.536  1.00 20.56 ? 83   GLY A CA  1 
ATOM   641  C  C   . GLY A 1 83  ? 10.461 10.820 33.258  1.00 22.88 ? 83   GLY A C   1 
ATOM   642  O  O   . GLY A 1 83  ? 11.108 9.838  32.983  1.00 22.76 ? 83   GLY A O   1 
ATOM   643  N  N   . THR A 1 84  ? 10.309 11.891 32.508  1.00 21.17 ? 84   THR A N   1 
ATOM   644  C  CA  A THR A 1 84  ? 11.081 12.124 31.299  0.50 22.93 ? 84   THR A CA  1 
ATOM   645  C  CA  B THR A 1 84  ? 10.996 12.183 31.256  0.50 23.71 ? 84   THR A CA  1 
ATOM   646  C  C   . THR A 1 84  ? 12.083 13.240 31.371  1.00 21.63 ? 84   THR A C   1 
ATOM   647  O  O   . THR A 1 84  ? 11.850 14.226 32.094  1.00 25.85 ? 84   THR A O   1 
ATOM   648  C  CB  A THR A 1 84  ? 10.279 12.071 30.014  0.50 24.69 ? 84   THR A CB  1 
ATOM   649  C  CB  B THR A 1 84  ? 10.042 12.292 30.017  0.50 26.49 ? 84   THR A CB  1 
ATOM   650  O  OG1 A THR A 1 84  ? 9.360  13.165 30.076  0.50 28.29 ? 84   THR A OG1 1 
ATOM   651  O  OG1 B THR A 1 84  ? 8.994  11.307 30.088  0.50 30.03 ? 84   THR A OG1 1 
ATOM   652  C  CG2 A THR A 1 84  ? 9.525  10.733 29.863  0.50 27.26 ? 84   THR A CG2 1 
ATOM   653  C  CG2 B THR A 1 84  ? 10.818 12.182 28.721  0.50 27.91 ? 84   THR A CG2 1 
ATOM   654  N  N   . LEU A 1 85  ? 13.193 13.095 30.655  1.00 21.05 ? 85   LEU A N   1 
ATOM   655  C  CA  . LEU A 1 85  ? 14.105 14.209 30.517  1.00 21.27 ? 85   LEU A CA  1 
ATOM   656  C  C   . LEU A 1 85  ? 13.818 14.813 29.145  1.00 22.64 ? 85   LEU A C   1 
ATOM   657  O  O   . LEU A 1 85  ? 13.450 14.109 28.176  1.00 28.66 ? 85   LEU A O   1 
ATOM   658  C  CB  . LEU A 1 85  ? 15.559 13.812 30.642  1.00 21.87 ? 85   LEU A CB  1 
ATOM   659  C  CG  . LEU A 1 85  ? 15.974 13.052 31.920  1.00 22.92 ? 85   LEU A CG  1 
ATOM   660  C  CD1 . LEU A 1 85  ? 17.486 12.645 31.888  1.00 26.24 ? 85   LEU A CD1 1 
ATOM   661  C  CD2 . LEU A 1 85  ? 15.641 13.840 33.183  1.00 22.84 ? 85   LEU A CD2 1 
ATOM   662  N  N   . MET A 1 86  ? 13.976 16.117 29.053  1.00 21.52 ? 86   MET A N   1 
ATOM   663  C  CA  . MET A 1 86  ? 13.666 16.831 27.843  1.00 22.70 ? 86   MET A CA  1 
ATOM   664  C  C   . MET A 1 86  ? 14.934 17.520 27.305  1.00 18.71 ? 86   MET A C   1 
ATOM   665  O  O   . MET A 1 86  ? 15.787 17.950 28.081  1.00 18.85 ? 86   MET A O   1 
ATOM   666  C  CB  . MET A 1 86  ? 12.587 17.863 28.144  1.00 24.93 ? 86   MET A CB  1 
ATOM   667  C  CG  . MET A 1 86  ? 11.237 17.188 28.465  1.00 36.79 ? 86   MET A CG  1 
ATOM   668  S  SD  . MET A 1 86  ? 10.544 16.349 27.011  1.00 56.65 ? 86   MET A SD  1 
ATOM   669  C  CE  . MET A 1 86  ? 10.034 17.750 25.985  1.00 58.01 ? 86   MET A CE  1 
ATOM   670  N  N   . PRO A 1 87  ? 15.065 17.600 25.989  1.00 18.04 ? 87   PRO A N   1 
ATOM   671  C  CA  . PRO A 1 87  ? 16.206 18.269 25.412  1.00 15.84 ? 87   PRO A CA  1 
ATOM   672  C  C   . PRO A 1 87  ? 16.101 19.781 25.544  1.00 17.78 ? 87   PRO A C   1 
ATOM   673  O  O   . PRO A 1 87  ? 15.038 20.350 25.317  1.00 19.22 ? 87   PRO A O   1 
ATOM   674  C  CB  . PRO A 1 87  ? 16.170 17.855 23.953  1.00 19.30 ? 87   PRO A CB  1 
ATOM   675  C  CG  . PRO A 1 87  ? 14.714 17.629 23.672  1.00 18.42 ? 87   PRO A CG  1 
ATOM   676  C  CD  . PRO A 1 87  ? 14.166 17.052 24.947  1.00 20.27 ? 87   PRO A CD  1 
ATOM   677  N  N   . MET A 1 88  ? 17.205 20.410 25.888  1.00 17.60 ? 88   MET A N   1 
ATOM   678  C  CA  . MET A 1 88  ? 17.221 21.868 26.070  1.00 18.12 ? 88   MET A CA  1 
ATOM   679  C  C   . MET A 1 88  ? 18.645 22.368 26.037  1.00 18.86 ? 88   MET A C   1 
ATOM   680  O  O   . MET A 1 88  ? 19.601 21.604 26.163  1.00 17.81 ? 88   MET A O   1 
ATOM   681  C  CB  . MET A 1 88  ? 16.566 22.256 27.389  1.00 19.48 ? 88   MET A CB  1 
ATOM   682  C  CG  . MET A 1 88  ? 17.269 21.764 28.595  1.00 20.32 ? 88   MET A CG  1 
ATOM   683  S  SD  . MET A 1 88  ? 16.339 21.976 30.106  1.00 24.10 ? 88   MET A SD  1 
ATOM   684  C  CE  . MET A 1 88  ? 15.303 20.555 30.063  1.00 22.63 ? 88   MET A CE  1 
ATOM   685  N  N   . VAL A 1 89  ? 18.806 23.674 25.936  1.00 19.00 ? 89   VAL A N   1 
ATOM   686  C  CA  . VAL A 1 89  ? 20.135 24.252 25.913  1.00 18.76 ? 89   VAL A CA  1 
ATOM   687  C  C   . VAL A 1 89  ? 20.305 25.252 27.063  1.00 21.55 ? 89   VAL A C   1 
ATOM   688  O  O   . VAL A 1 89  ? 19.432 26.048 27.357  1.00 18.52 ? 89   VAL A O   1 
ATOM   689  C  CB  . VAL A 1 89  ? 20.441 24.903 24.539  1.00 19.26 ? 89   VAL A CB  1 
ATOM   690  C  CG1 . VAL A 1 89  ? 19.584 26.136 24.238  1.00 21.53 ? 89   VAL A CG1 1 
ATOM   691  C  CG2 . VAL A 1 89  ? 21.927 25.260 24.430  1.00 20.05 ? 89   VAL A CG2 1 
ATOM   692  N  N   . ALA A 1 90  ? 21.473 25.196 27.696  1.00 22.83 ? 90   ALA A N   1 
ATOM   693  C  CA  . ALA A 1 90  ? 21.872 26.131 28.717  1.00 22.12 ? 90   ALA A CA  1 
ATOM   694  C  C   . ALA A 1 90  ? 23.147 26.859 28.246  1.00 20.00 ? 90   ALA A C   1 
ATOM   695  O  O   . ALA A 1 90  ? 23.638 26.650 27.123  1.00 19.46 ? 90   ALA A O   1 
ATOM   696  C  CB  . ALA A 1 90  ? 22.148 25.360 30.055  1.00 23.87 ? 90   ALA A CB  1 
ATOM   697  N  N   . ASP A 1 91  ? 23.707 27.698 29.123  1.00 23.10 ? 91   ASP A N   1 
ATOM   698  C  CA  . ASP A 1 91  ? 24.881 28.443 28.754  1.00 23.81 ? 91   ASP A CA  1 
ATOM   699  C  C   . ASP A 1 91  ? 26.085 27.549 28.515  1.00 24.70 ? 91   ASP A C   1 
ATOM   700  O  O   . ASP A 1 91  ? 27.028 27.965 27.868  1.00 25.90 ? 91   ASP A O   1 
ATOM   701  C  CB  . ASP A 1 91  ? 25.214 29.550 29.752  1.00 27.34 ? 91   ASP A CB  1 
ATOM   702  C  CG  . ASP A 1 91  ? 25.431 29.049 31.157  1.00 35.54 ? 91   ASP A CG  1 
ATOM   703  O  OD1 . ASP A 1 91  ? 25.405 27.841 31.430  1.00 38.30 ? 91   ASP A OD1 1 
ATOM   704  O  OD2 . ASP A 1 91  ? 25.627 29.902 32.025  1.00 47.64 ? 91   ASP A OD2 1 
ATOM   705  N  N   . ASP A 1 92  ? 26.033 26.333 29.033  1.00 24.84 ? 92   ASP A N   1 
ATOM   706  C  CA  . ASP A 1 92  ? 27.070 25.347 28.728  1.00 27.12 ? 92   ASP A CA  1 
ATOM   707  C  C   . ASP A 1 92  ? 26.703 24.316 27.644  1.00 25.00 ? 92   ASP A C   1 
ATOM   708  O  O   . ASP A 1 92  ? 27.366 23.297 27.513  1.00 27.16 ? 92   ASP A O   1 
ATOM   709  C  CB  . ASP A 1 92  ? 27.542 24.679 30.026  1.00 30.05 ? 92   ASP A CB  1 
ATOM   710  C  CG  . ASP A 1 92  ? 26.466 23.897 30.727  1.00 33.74 ? 92   ASP A CG  1 
ATOM   711  O  OD1 . ASP A 1 92  ? 25.269 24.059 30.413  1.00 32.68 ? 92   ASP A OD1 1 
ATOM   712  O  OD2 . ASP A 1 92  ? 26.834 23.080 31.621  1.00 44.42 ? 92   ASP A OD2 1 
ATOM   713  N  N   . GLY A 1 93  ? 25.674 24.613 26.855  1.00 20.66 ? 93   GLY A N   1 
ATOM   714  C  CA  . GLY A 1 93  ? 25.278 23.783 25.752  1.00 21.35 ? 93   GLY A CA  1 
ATOM   715  C  C   . GLY A 1 93  ? 24.098 22.882 26.026  1.00 19.47 ? 93   GLY A C   1 
ATOM   716  O  O   . GLY A 1 93  ? 23.431 22.973 27.095  1.00 18.35 ? 93   GLY A O   1 
ATOM   717  N  N   . PRO A 1 94  ? 23.797 22.049 25.032  1.00 18.82 ? 94   PRO A N   1 
ATOM   718  C  CA  . PRO A 1 94  ? 22.583 21.229 25.093  1.00 18.59 ? 94   PRO A CA  1 
ATOM   719  C  C   . PRO A 1 94  ? 22.744 20.065 26.042  1.00 19.83 ? 94   PRO A C   1 
ATOM   720  O  O   . PRO A 1 94  ? 23.869 19.580 26.273  1.00 19.98 ? 94   PRO A O   1 
ATOM   721  C  CB  . PRO A 1 94  ? 22.427 20.740 23.660  1.00 19.22 ? 94   PRO A CB  1 
ATOM   722  C  CG  . PRO A 1 94  ? 23.832 20.672 23.135  1.00 18.06 ? 94   PRO A CG  1 
ATOM   723  C  CD  . PRO A 1 94  ? 24.468 21.943 23.714  1.00 20.61 ? 94   PRO A CD  1 
ATOM   724  N  N   . HIS A 1 95  ? 21.638 19.719 26.685  1.00 20.66 ? 95   HIS A N   1 
ATOM   725  C  CA  . HIS A 1 95  ? 21.566 18.549 27.498  1.00 18.90 ? 95   HIS A CA  1 
ATOM   726  C  C   . HIS A 1 95  ? 20.133 18.023 27.545  1.00 18.40 ? 95   HIS A C   1 
ATOM   727  O  O   . HIS A 1 95  ? 19.244 18.595 26.911  1.00 19.38 ? 95   HIS A O   1 
ATOM   728  C  CB  . HIS A 1 95  ? 22.065 18.833 28.925  1.00 22.47 ? 95   HIS A CB  1 
ATOM   729  C  CG  . HIS A 1 95  ? 21.155 19.724 29.715  1.00 22.37 ? 95   HIS A CG  1 
ATOM   730  N  ND1 . HIS A 1 95  ? 21.294 21.096 29.711  1.00 33.71 ? 95   HIS A ND1 1 
ATOM   731  C  CD2 . HIS A 1 95  ? 20.092 19.458 30.522  1.00 27.20 ? 95   HIS A CD2 1 
ATOM   732  C  CE1 . HIS A 1 95  ? 20.365 21.629 30.485  1.00 28.26 ? 95   HIS A CE1 1 
ATOM   733  N  NE2 . HIS A 1 95  ? 19.615 20.664 30.988  1.00 27.70 ? 95   HIS A NE2 1 
ATOM   734  N  N   . TYR A 1 96  ? 19.945 16.891 28.214  1.00 16.70 ? 96   TYR A N   1 
ATOM   735  C  CA  . TYR A 1 96  ? 18.609 16.398 28.549  1.00 13.29 ? 96   TYR A CA  1 
ATOM   736  C  C   . TYR A 1 96  ? 18.426 16.665 30.035  1.00 16.63 ? 96   TYR A C   1 
ATOM   737  O  O   . TYR A 1 96  ? 19.305 16.340 30.824  1.00 19.26 ? 96   TYR A O   1 
ATOM   738  C  CB  . TYR A 1 96  ? 18.523 14.886 28.250  1.00 14.98 ? 96   TYR A CB  1 
ATOM   739  C  CG  . TYR A 1 96  ? 18.678 14.572 26.790  1.00 15.99 ? 96   TYR A CG  1 
ATOM   740  C  CD1 . TYR A 1 96  ? 17.626 14.669 25.921  1.00 17.08 ? 96   TYR A CD1 1 
ATOM   741  C  CD2 . TYR A 1 96  ? 19.920 14.215 26.281  1.00 16.15 ? 96   TYR A CD2 1 
ATOM   742  C  CE1 . TYR A 1 96  ? 17.786 14.374 24.590  1.00 17.63 ? 96   TYR A CE1 1 
ATOM   743  C  CE2 . TYR A 1 96  ? 20.102 13.914 24.975  1.00 16.71 ? 96   TYR A CE2 1 
ATOM   744  C  CZ  . TYR A 1 96  ? 19.018 13.991 24.106  1.00 17.29 ? 96   TYR A CZ  1 
ATOM   745  O  OH  . TYR A 1 96  ? 19.217 13.707 22.788  1.00 16.62 ? 96   TYR A OH  1 
ATOM   746  N  N   . GLY A 1 97  ? 17.308 17.237 30.428  1.00 17.28 ? 97   GLY A N   1 
ATOM   747  C  CA  . GLY A 1 97  ? 17.095 17.527 31.831  1.00 17.94 ? 97   GLY A CA  1 
ATOM   748  C  C   . GLY A 1 97  ? 15.654 17.575 32.262  1.00 16.59 ? 97   GLY A C   1 
ATOM   749  O  O   . GLY A 1 97  ? 14.739 17.575 31.449  1.00 18.06 ? 97   GLY A O   1 
ATOM   750  N  N   . ALA A 1 98  ? 15.470 17.635 33.573  1.00 19.24 ? 98   ALA A N   1 
ATOM   751  C  CA  . ALA A 1 98  ? 14.166 17.794 34.173  1.00 17.23 ? 98   ALA A CA  1 
ATOM   752  C  C   . ALA A 1 98  ? 14.333 18.416 35.535  1.00 19.08 ? 98   ALA A C   1 
ATOM   753  O  O   . ALA A 1 98  ? 15.171 17.981 36.303  1.00 19.08 ? 98   ALA A O   1 
ATOM   754  C  CB  . ALA A 1 98  ? 13.468 16.410 34.342  1.00 21.29 ? 98   ALA A CB  1 
ATOM   755  N  N   . ASN A 1 99  ? 13.493 19.397 35.857  1.00 19.29 ? 99   ASN A N   1 
ATOM   756  C  CA  . ASN A 1 99  ? 13.346 19.835 37.238  1.00 18.35 ? 99   ASN A CA  1 
ATOM   757  C  C   . ASN A 1 99  ? 12.608 18.767 38.043  1.00 19.48 ? 99   ASN A C   1 
ATOM   758  O  O   . ASN A 1 99  ? 11.634 18.184 37.561  1.00 25.51 ? 99   ASN A O   1 
ATOM   759  C  CB  . ASN A 1 99  ? 12.568 21.150 37.321  1.00 17.75 ? 99   ASN A CB  1 
ATOM   760  C  CG  . ASN A 1 99  ? 13.408 22.374 37.067  1.00 19.30 ? 99   ASN A CG  1 
ATOM   761  O  OD1 . ASN A 1 99  ? 14.662 22.306 36.996  1.00 19.80 ? 99   ASN A OD1 1 
ATOM   762  N  ND2 . ASN A 1 99  ? 12.725 23.532 36.930  1.00 23.82 ? 99   ASN A ND2 1 
ATOM   763  N  N   . ILE A 1 100 ? 13.047 18.516 39.271  1.00 19.20 ? 100  ILE A N   1 
ATOM   764  C  CA  . ILE A 1 100 ? 12.462 17.445 40.048  1.00 19.17 ? 100  ILE A CA  1 
ATOM   765  C  C   . ILE A 1 100 ? 12.257 17.958 41.451  1.00 20.46 ? 100  ILE A C   1 
ATOM   766  O  O   . ILE A 1 100 ? 13.144 18.601 42.005  1.00 19.47 ? 100  ILE A O   1 
ATOM   767  C  CB  . ILE A 1 100 ? 13.373 16.197 40.058  1.00 21.03 ? 100  ILE A CB  1 
ATOM   768  C  CG1 . ILE A 1 100 ? 13.575 15.653 38.625  1.00 22.89 ? 100  ILE A CG1 1 
ATOM   769  C  CG2 . ILE A 1 100 ? 12.764 15.095 40.917  1.00 21.45 ? 100  ILE A CG2 1 
ATOM   770  C  CD1 . ILE A 1 100 ? 14.327 14.318 38.562  1.00 25.62 ? 100  ILE A CD1 1 
ATOM   771  N  N   . ALA A 1 101 ? 11.088 17.666 42.008  1.00 20.36 ? 101  ALA A N   1 
ATOM   772  C  CA  . ALA A 1 101 ? 10.777 17.954 43.392  1.00 19.13 ? 101  ALA A CA  1 
ATOM   773  C  C   . ALA A 1 101 ? 11.371 16.816 44.202  1.00 17.12 ? 101  ALA A C   1 
ATOM   774  O  O   . ALA A 1 101 ? 11.170 15.634 43.895  1.00 23.69 ? 101  ALA A O   1 
ATOM   775  C  CB  . ALA A 1 101 ? 9.266  18.040 43.560  1.00 20.28 ? 101  ALA A CB  1 
ATOM   776  N  N   . MET A 1 102 ? 12.113 17.169 45.252  1.00 19.26 ? 102  MET A N   1 
ATOM   777  C  CA  . MET A 1 102 ? 12.717 16.187 46.146  1.00 20.13 ? 102  MET A CA  1 
ATOM   778  C  C   . MET A 1 102 ? 12.077 16.366 47.521  1.00 21.20 ? 102  MET A C   1 
ATOM   779  O  O   . MET A 1 102 ? 11.002 15.829 47.769  1.00 24.71 ? 102  MET A O   1 
ATOM   780  C  CB  . MET A 1 102 ? 14.249 16.329 46.175  1.00 19.40 ? 102  MET A CB  1 
ATOM   781  C  CG  . MET A 1 102 ? 14.912 16.068 44.775  1.00 17.49 ? 102  MET A CG  1 
ATOM   782  S  SD  . MET A 1 102 ? 14.823 14.355 44.265  1.00 23.11 ? 102  MET A SD  1 
ATOM   783  C  CE  . MET A 1 102 ? 15.988 13.600 45.430  1.00 27.89 ? 102  MET A CE  1 
ATOM   784  N  N   . GLU A 1 103 ? 12.674 17.192 48.370  1.00 24.33 ? 103  GLU A N   1 
ATOM   785  C  CA  . GLU A 1 103 ? 12.021 17.613 49.614  1.00 25.98 ? 103  GLU A CA  1 
ATOM   786  C  C   . GLU A 1 103 ? 10.614 18.168 49.376  1.00 28.10 ? 103  GLU A C   1 
ATOM   787  O  O   . GLU A 1 103 ? 9.729  18.010 50.232  1.00 28.40 ? 103  GLU A O   1 
ATOM   788  C  CB  . GLU A 1 103 ? 12.857 18.691 50.307  1.00 28.78 ? 103  GLU A CB  1 
ATOM   789  C  CG  . GLU A 1 103 ? 14.249 18.233 50.788  1.00 32.24 ? 103  GLU A CG  1 
ATOM   790  C  CD  . GLU A 1 103 ? 15.374 18.542 49.783  1.00 30.28 ? 103  GLU A CD  1 
ATOM   791  O  OE1 . GLU A 1 103 ? 15.170 18.447 48.557  1.00 27.90 ? 103  GLU A OE1 1 
ATOM   792  O  OE2 . GLU A 1 103 ? 16.475 18.893 50.233  1.00 33.79 ? 103  GLU A OE2 1 
ATOM   793  N  N   . LYS A 1 104 ? 10.415 18.847 48.244  1.00 26.57 ? 104  LYS A N   1 
ATOM   794  C  CA  . LYS A 1 104 ? 9.119  19.441 47.898  1.00 28.31 ? 104  LYS A CA  1 
ATOM   795  C  C   . LYS A 1 104 ? 8.121  18.483 47.277  1.00 27.39 ? 104  LYS A C   1 
ATOM   796  O  O   . LYS A 1 104 ? 6.979  18.880 47.023  1.00 30.50 ? 104  LYS A O   1 
ATOM   797  C  CB  . LYS A 1 104 ? 9.327  20.602 46.922  1.00 30.28 ? 104  LYS A CB  1 
ATOM   798  C  CG  . LYS A 1 104 ? 10.115 21.736 47.512  1.00 34.12 ? 104  LYS A CG  1 
ATOM   799  C  CD  . LYS A 1 104 ? 9.932  23.012 46.730  1.00 39.62 ? 104  LYS A CD  1 
ATOM   800  C  CE  . LYS A 1 104 ? 8.482  23.516 46.877  1.00 45.41 ? 104  LYS A CE  1 
ATOM   801  N  NZ  . LYS A 1 104 ? 8.377  25.001 46.871  1.00 50.54 ? 104  LYS A NZ  1 
ATOM   802  N  N   . ASP A 1 105 ? 8.504  17.225 47.052  1.00 24.29 ? 105  ASP A N   1 
ATOM   803  C  CA  . ASP A 1 105 ? 7.540  16.254 46.519  1.00 24.45 ? 105  ASP A CA  1 
ATOM   804  C  C   . ASP A 1 105 ? 6.473  16.016 47.572  1.00 23.98 ? 105  ASP A C   1 
ATOM   805  O  O   . ASP A 1 105 ? 6.781  15.615 48.681  1.00 25.36 ? 105  ASP A O   1 
ATOM   806  C  CB  . ASP A 1 105 ? 8.182  14.929 46.171  1.00 25.13 ? 105  ASP A CB  1 
ATOM   807  C  CG  . ASP A 1 105 ? 7.255  14.050 45.318  1.00 32.16 ? 105  ASP A CG  1 
ATOM   808  O  OD1 . ASP A 1 105 ? 6.126  13.740 45.758  1.00 33.48 ? 105  ASP A OD1 1 
ATOM   809  O  OD2 . ASP A 1 105 ? 7.628  13.663 44.197  1.00 33.93 ? 105  ASP A OD2 1 
ATOM   810  N  N   . LYS A 1 106 ? 5.224  16.320 47.246  1.00 24.56 ? 106  LYS A N   1 
ATOM   811  C  CA  . LYS A 1 106 ? 4.166  16.233 48.252  1.00 25.64 ? 106  LYS A CA  1 
ATOM   812  C  C   . LYS A 1 106 ? 3.930  14.811 48.764  1.00 26.74 ? 106  LYS A C   1 
ATOM   813  O  O   . LYS A 1 106 ? 3.340  14.634 49.838  1.00 28.28 ? 106  LYS A O   1 
ATOM   814  C  CB  . LYS A 1 106 ? 2.877  16.820 47.709  1.00 27.80 ? 106  LYS A CB  1 
ATOM   815  C  CG  . LYS A 1 106 ? 2.276  16.059 46.536  1.00 30.83 ? 106  LYS A CG  1 
ATOM   816  C  CD  . LYS A 1 106 ? 0.981  16.734 46.055  1.00 38.89 ? 106  LYS A CD  1 
ATOM   817  C  CE  . LYS A 1 106 ? 0.379  16.045 44.850  1.00 43.81 ? 106  LYS A CE  1 
ATOM   818  N  NZ  . LYS A 1 106 ? -1.022 16.513 44.588  1.00 47.02 ? 106  LYS A NZ  1 
ATOM   819  N  N   . LYS A 1 107 ? 4.377  13.808 48.016  1.00 27.67 ? 107  LYS A N   1 
ATOM   820  C  CA  . LYS A 1 107 ? 4.301  12.403 48.454  1.00 30.92 ? 107  LYS A CA  1 
ATOM   821  C  C   . LYS A 1 107 ? 5.245  12.057 49.604  1.00 29.43 ? 107  LYS A C   1 
ATOM   822  O  O   . LYS A 1 107 ? 5.023  11.069 50.312  1.00 29.85 ? 107  LYS A O   1 
ATOM   823  C  CB  . LYS A 1 107 ? 4.595  11.454 47.302  1.00 33.50 ? 107  LYS A CB  1 
ATOM   824  C  CG  . LYS A 1 107 ? 3.433  11.132 46.423  1.00 41.89 ? 107  LYS A CG  1 
ATOM   825  C  CD  . LYS A 1 107 ? 3.884  10.287 45.225  1.00 50.36 ? 107  LYS A CD  1 
ATOM   826  C  CE  . LYS A 1 107 ? 2.900  9.159  44.863  1.00 58.94 ? 107  LYS A CE  1 
ATOM   827  N  NZ  . LYS A 1 107 ? 3.167  7.855  45.565  1.00 60.83 ? 107  LYS A NZ  1 
ATOM   828  N  N   . GLY A 1 108 ? 6.312  12.844 49.747  1.00 29.15 ? 108  GLY A N   1 
ATOM   829  C  CA  . GLY A 1 108 ? 7.334  12.580 50.739  1.00 28.80 ? 108  GLY A CA  1 
ATOM   830  C  C   . GLY A 1 108 ? 8.235  11.431 50.301  1.00 28.31 ? 108  GLY A C   1 
ATOM   831  O  O   . GLY A 1 108 ? 8.010  10.814 49.266  1.00 26.11 ? 108  GLY A O   1 
ATOM   832  N  N   . GLY A 1 109 ? 9.290  11.190 51.063  1.00 28.24 ? 109  GLY A N   1 
ATOM   833  C  CA  . GLY A 1 109 ? 10.177 10.086 50.807  1.00 27.99 ? 109  GLY A CA  1 
ATOM   834  C  C   . GLY A 1 109 ? 11.354 10.401 49.904  1.00 25.84 ? 109  GLY A C   1 
ATOM   835  O  O   . GLY A 1 109 ? 12.200 9.521  49.692  1.00 25.62 ? 109  GLY A O   1 
ATOM   836  N  N   . PHE A 1 110 ? 11.437 11.650 49.423  1.00 23.32 ? 110  PHE A N   1 
ATOM   837  C  CA  . PHE A 1 110 ? 12.472 12.078 48.497  1.00 23.43 ? 110  PHE A CA  1 
ATOM   838  C  C   . PHE A 1 110 ? 13.375 13.148 49.069  1.00 23.23 ? 110  PHE A C   1 
ATOM   839  O  O   . PHE A 1 110 ? 13.749 14.119 48.384  1.00 26.01 ? 110  PHE A O   1 
ATOM   840  C  CB  . PHE A 1 110 ? 11.874 12.549 47.174  1.00 24.33 ? 110  PHE A CB  1 
ATOM   841  C  CG  . PHE A 1 110 ? 11.131 11.490 46.438  1.00 25.87 ? 110  PHE A CG  1 
ATOM   842  C  CD1 . PHE A 1 110 ? 11.809 10.547 45.706  1.00 29.50 ? 110  PHE A CD1 1 
ATOM   843  C  CD2 . PHE A 1 110 ? 9.745  11.459 46.455  1.00 28.62 ? 110  PHE A CD2 1 
ATOM   844  C  CE1 . PHE A 1 110 ? 11.117 9.569  45.025  1.00 30.18 ? 110  PHE A CE1 1 
ATOM   845  C  CE2 . PHE A 1 110 ? 9.048  10.499 45.764  1.00 29.58 ? 110  PHE A CE2 1 
ATOM   846  C  CZ  . PHE A 1 110 ? 9.726  9.549  45.056  1.00 30.10 ? 110  PHE A CZ  1 
ATOM   847  N  N   . GLY A 1 111 ? 13.752 12.968 50.325  1.00 25.85 ? 111  GLY A N   1 
ATOM   848  C  CA  . GLY A 1 111 ? 14.638 13.908 50.974  1.00 28.30 ? 111  GLY A CA  1 
ATOM   849  C  C   . GLY A 1 111 ? 16.088 13.464 50.896  1.00 28.32 ? 111  GLY A C   1 
ATOM   850  O  O   . GLY A 1 111 ? 16.445 12.560 50.128  1.00 26.30 ? 111  GLY A O   1 
ATOM   851  N  N   . VAL A 1 112 ? 16.920 14.081 51.732  1.00 28.81 ? 112  VAL A N   1 
ATOM   852  C  CA  . VAL A 1 112 ? 18.336 13.755 51.759  1.00 31.05 ? 112  VAL A CA  1 
ATOM   853  C  C   . VAL A 1 112 ? 18.516 12.252 52.013  1.00 29.39 ? 112  VAL A C   1 
ATOM   854  O  O   . VAL A 1 112 ? 17.815 11.650 52.814  1.00 30.45 ? 112  VAL A O   1 
ATOM   855  C  CB  . VAL A 1 112 ? 19.088 14.639 52.771  1.00 35.58 ? 112  VAL A CB  1 
ATOM   856  C  CG1 . VAL A 1 112 ? 20.519 14.135 52.988  1.00 43.18 ? 112  VAL A CG1 1 
ATOM   857  C  CG2 . VAL A 1 112 ? 19.078 16.117 52.264  1.00 35.33 ? 112  VAL A CG2 1 
ATOM   858  N  N   . GLY A 1 113 ? 19.413 11.625 51.275  1.00 28.50 ? 113  GLY A N   1 
ATOM   859  C  CA  . GLY A 1 113 ? 19.575 10.200 51.399  1.00 28.88 ? 113  GLY A CA  1 
ATOM   860  C  C   . GLY A 1 113 ? 20.337 9.547  50.286  1.00 27.20 ? 113  GLY A C   1 
ATOM   861  O  O   . GLY A 1 113 ? 20.975 10.221 49.502  1.00 28.31 ? 113  GLY A O   1 
ATOM   862  N  N   . ASN A 1 114 ? 20.291 8.216  50.272  1.00 27.83 ? 114  ASN A N   1 
ATOM   863  C  CA  . ASN A 1 114 ? 20.971 7.428  49.280  1.00 26.70 ? 114  ASN A CA  1 
ATOM   864  C  C   . ASN A 1 114 ? 19.985 7.105  48.159  1.00 24.55 ? 114  ASN A C   1 
ATOM   865  O  O   . ASN A 1 114 ? 18.846 6.714  48.412  1.00 25.49 ? 114  ASN A O   1 
ATOM   866  C  CB  . ASN A 1 114 ? 21.491 6.154  49.902  1.00 29.42 ? 114  ASN A CB  1 
ATOM   867  C  CG  . ASN A 1 114 ? 22.500 6.420  51.010  1.00 31.55 ? 114  ASN A CG  1 
ATOM   868  O  OD1 . ASN A 1 114 ? 23.557 6.988  50.771  1.00 39.52 ? 114  ASN A OD1 1 
ATOM   869  N  ND2 . ASN A 1 114 ? 22.163 6.030  52.228  1.00 39.98 ? 114  ASN A ND2 1 
ATOM   870  N  N   . TYR A 1 115 ? 20.435 7.271  46.919  1.00 22.77 ? 115  TYR A N   1 
ATOM   871  C  CA  . TYR A 1 115 ? 19.574 7.153  45.753  1.00 22.57 ? 115  TYR A CA  1 
ATOM   872  C  C   . TYR A 1 115 ? 20.189 6.239  44.717  1.00 23.31 ? 115  TYR A C   1 
ATOM   873  O  O   . TYR A 1 115 ? 21.410 6.118  44.646  1.00 23.94 ? 115  TYR A O   1 
ATOM   874  C  CB  . TYR A 1 115 ? 19.335 8.534  45.118  1.00 22.91 ? 115  TYR A CB  1 
ATOM   875  C  CG  . TYR A 1 115 ? 18.309 9.307  45.889  1.00 21.94 ? 115  TYR A CG  1 
ATOM   876  C  CD1 . TYR A 1 115 ? 18.630 9.917  47.078  1.00 22.36 ? 115  TYR A CD1 1 
ATOM   877  C  CD2 . TYR A 1 115 ? 16.989 9.346  45.473  1.00 21.91 ? 115  TYR A CD2 1 
ATOM   878  C  CE1 . TYR A 1 115 ? 17.663 10.619 47.828  1.00 23.93 ? 115  TYR A CE1 1 
ATOM   879  C  CE2 . TYR A 1 115 ? 16.043 10.000 46.181  1.00 22.20 ? 115  TYR A CE2 1 
ATOM   880  C  CZ  . TYR A 1 115 ? 16.375 10.630 47.373  1.00 24.49 ? 115  TYR A CZ  1 
ATOM   881  O  OH  . TYR A 1 115 ? 15.395 11.270 48.068  1.00 26.00 ? 115  TYR A OH  1 
ATOM   882  N  N   . GLU A 1 116 ? 19.305 5.645  43.914  1.00 24.13 ? 116  GLU A N   1 
ATOM   883  C  CA  . GLU A 1 116 ? 19.641 4.924  42.721  1.00 22.60 ? 116  GLU A CA  1 
ATOM   884  C  C   . GLU A 1 116 ? 18.920 5.667  41.606  1.00 22.76 ? 116  GLU A C   1 
ATOM   885  O  O   . GLU A 1 116 ? 17.739 6.003  41.722  1.00 23.79 ? 116  GLU A O   1 
ATOM   886  C  CB  . GLU A 1 116 ? 19.171 3.460  42.770  1.00 24.02 ? 116  GLU A CB  1 
ATOM   887  C  CG  . GLU A 1 116 ? 19.916 2.636  43.776  1.00 32.05 ? 116  GLU A CG  1 
ATOM   888  C  CD  . GLU A 1 116 ? 19.434 1.192  43.888  1.00 41.43 ? 116  GLU A CD  1 
ATOM   889  O  OE1 . GLU A 1 116 ? 18.369 0.829  43.344  1.00 39.44 ? 116  GLU A OE1 1 
ATOM   890  O  OE2 . GLU A 1 116 ? 20.141 0.406  44.549  1.00 52.16 ? 116  GLU A OE2 1 
ATOM   891  N  N   . LEU A 1 117 ? 19.649 5.988  40.557  1.00 24.56 ? 117  LEU A N   1 
ATOM   892  C  CA  . LEU A 1 117 ? 19.061 6.658  39.417  1.00 21.78 ? 117  LEU A CA  1 
ATOM   893  C  C   . LEU A 1 117 ? 19.263 5.757  38.215  1.00 23.49 ? 117  LEU A C   1 
ATOM   894  O  O   . LEU A 1 117 ? 20.383 5.263  37.991  1.00 24.68 ? 117  LEU A O   1 
ATOM   895  C  CB  . LEU A 1 117 ? 19.751 8.003  39.147  1.00 21.90 ? 117  LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 117 ? 19.395 8.661  37.822  1.00 20.55 ? 117  LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 117 ? 17.940 9.154  37.826  1.00 21.05 ? 117  LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 117 ? 20.432 9.785  37.596  1.00 22.22 ? 117  LEU A CD2 1 
ATOM   899  N  N   . THR A 1 118 ? 18.198 5.592  37.435  1.00 20.77 ? 118  THR A N   1 
ATOM   900  C  CA  . THR A 1 118 ? 18.264 4.865  36.180  1.00 21.08 ? 118  THR A CA  1 
ATOM   901  C  C   . THR A 1 118 ? 17.776 5.726  35.038  1.00 19.10 ? 118  THR A C   1 
ATOM   902  O  O   . THR A 1 118 ? 16.759 6.388  35.146  1.00 21.81 ? 118  THR A O   1 
ATOM   903  C  CB  . THR A 1 118 ? 17.416 3.571  36.264  1.00 23.88 ? 118  THR A CB  1 
ATOM   904  O  OG1 . THR A 1 118 ? 17.841 2.833  37.408  1.00 26.21 ? 118  THR A OG1 1 
ATOM   905  C  CG2 . THR A 1 118 ? 17.529 2.745  34.962  1.00 24.36 ? 118  THR A CG2 1 
ATOM   906  N  N   . PHE A 1 119 ? 18.540 5.745  33.951  1.00 19.24 ? 119  PHE A N   1 
ATOM   907  C  CA  . PHE A 1 119 ? 18.083 6.281  32.671  1.00 19.44 ? 119  PHE A CA  1 
ATOM   908  C  C   . PHE A 1 119 ? 17.711 5.157  31.747  1.00 19.74 ? 119  PHE A C   1 
ATOM   909  O  O   . PHE A 1 119 ? 18.436 4.193  31.652  1.00 21.45 ? 119  PHE A O   1 
ATOM   910  C  CB  . PHE A 1 119 ? 19.169 7.091  31.951  1.00 21.07 ? 119  PHE A CB  1 
ATOM   911  C  CG  . PHE A 1 119 ? 19.595 8.356  32.669  1.00 21.03 ? 119  PHE A CG  1 
ATOM   912  C  CD1 . PHE A 1 119 ? 18.711 9.135  33.417  1.00 22.21 ? 119  PHE A CD1 1 
ATOM   913  C  CD2 . PHE A 1 119 ? 20.912 8.786  32.568  1.00 21.44 ? 119  PHE A CD2 1 
ATOM   914  C  CE1 . PHE A 1 119 ? 19.167 10.288 34.054  1.00 23.45 ? 119  PHE A CE1 1 
ATOM   915  C  CE2 . PHE A 1 119 ? 21.323 9.962  33.164  1.00 19.77 ? 119  PHE A CE2 1 
ATOM   916  C  CZ  . PHE A 1 119 ? 20.458 10.684 33.917  1.00 21.08 ? 119  PHE A CZ  1 
ATOM   917  N  N   . TYR A 1 120 ? 16.613 5.349  31.033  1.00 20.28 ? 120  TYR A N   1 
ATOM   918  C  CA  . TYR A 1 120 ? 16.095 4.457  30.019  1.00 21.80 ? 120  TYR A CA  1 
ATOM   919  C  C   . TYR A 1 120 ? 16.155 5.201  28.709  1.00 20.81 ? 120  TYR A C   1 
ATOM   920  O  O   . TYR A 1 120 ? 15.499 6.215  28.527  1.00 21.71 ? 120  TYR A O   1 
ATOM   921  C  CB  . TYR A 1 120 ? 14.651 4.054  30.324  1.00 23.11 ? 120  TYR A CB  1 
ATOM   922  C  CG  . TYR A 1 120 ? 14.503 3.322  31.617  1.00 27.69 ? 120  TYR A CG  1 
ATOM   923  C  CD1 . TYR A 1 120 ? 14.620 1.932  31.679  1.00 34.28 ? 120  TYR A CD1 1 
ATOM   924  C  CD2 . TYR A 1 120 ? 14.234 4.012  32.785  1.00 32.22 ? 120  TYR A CD2 1 
ATOM   925  C  CE1 . TYR A 1 120 ? 14.472 1.260  32.889  1.00 37.85 ? 120  TYR A CE1 1 
ATOM   926  C  CE2 . TYR A 1 120 ? 14.081 3.352  33.992  1.00 35.78 ? 120  TYR A CE2 1 
ATOM   927  C  CZ  . TYR A 1 120 ? 14.205 1.982  34.039  1.00 37.47 ? 120  TYR A CZ  1 
ATOM   928  O  OH  . TYR A 1 120 ? 14.039 1.349  35.255  1.00 45.39 ? 120  TYR A OH  1 
ATOM   929  N  N   . ILE A 1 121 ? 16.956 4.715  27.778  1.00 21.52 ? 121  ILE A N   1 
ATOM   930  C  CA  . ILE A 1 121 ? 17.282 5.507  26.611  1.00 21.16 ? 121  ILE A CA  1 
ATOM   931  C  C   . ILE A 1 121 ? 16.967 4.732  25.354  1.00 20.78 ? 121  ILE A C   1 
ATOM   932  O  O   . ILE A 1 121 ? 17.286 3.569  25.231  1.00 19.53 ? 121  ILE A O   1 
ATOM   933  C  CB  . ILE A 1 121 ? 18.774 5.890  26.626  1.00 21.18 ? 121  ILE A CB  1 
ATOM   934  C  CG1 . ILE A 1 121 ? 19.101 6.683  27.900  1.00 23.06 ? 121  ILE A CG1 1 
ATOM   935  C  CG2 . ILE A 1 121 ? 19.212 6.672  25.360  1.00 19.94 ? 121  ILE A CG2 1 
ATOM   936  C  CD1 . ILE A 1 121 ? 20.549 6.990  28.101  1.00 21.71 ? 121  ILE A CD1 1 
ATOM   937  N  N   . SER A 1 122 ? 16.301 5.395  24.439  1.00 18.53 ? 122  SER A N   1 
ATOM   938  C  CA  . SER A 1 122 ? 15.985 4.875  23.117  1.00 18.89 ? 122  SER A CA  1 
ATOM   939  C  C   . SER A 1 122 ? 16.572 5.745  22.041  1.00 19.22 ? 122  SER A C   1 
ATOM   940  O  O   . SER A 1 122 ? 16.770 6.979  22.219  1.00 20.22 ? 122  SER A O   1 
ATOM   941  C  CB  . SER A 1 122 ? 14.462 4.755  22.947  1.00 23.49 ? 122  SER A CB  1 
ATOM   942  O  OG  . SER A 1 122 ? 13.968 3.772  23.802  1.00 33.28 ? 122  SER A OG  1 
ATOM   943  N  N   . ASN A 1 123 ? 16.812 5.132  20.892  1.00 20.27 ? 123  ASN A N   1 
ATOM   944  C  CA  . ASN A 1 123 ? 17.581 5.752  19.844  1.00 19.87 ? 123  ASN A CA  1 
ATOM   945  C  C   . ASN A 1 123 ? 16.789 6.806  19.046  1.00 19.66 ? 123  ASN A C   1 
ATOM   946  O  O   . ASN A 1 123 ? 15.562 6.854  19.125  1.00 18.82 ? 123  ASN A O   1 
ATOM   947  C  CB  . ASN A 1 123 ? 18.210 4.689  18.905  1.00 19.62 ? 123  ASN A CB  1 
ATOM   948  C  CG  . ASN A 1 123 ? 17.190 4.022  17.956  1.00 21.30 ? 123  ASN A CG  1 
ATOM   949  O  OD1 . ASN A 1 123 ? 16.412 4.684  17.305  1.00 22.94 ? 123  ASN A OD1 1 
ATOM   950  N  ND2 . ASN A 1 123 ? 17.236 2.698  17.857  1.00 21.67 ? 123  ASN A ND2 1 
ATOM   951  N  N   . PRO A 1 124 ? 17.488 7.612  18.250  1.00 18.98 ? 124  PRO A N   1 
ATOM   952  C  CA  . PRO A 1 124 ? 16.900 8.749  17.555  1.00 19.87 ? 124  PRO A CA  1 
ATOM   953  C  C   . PRO A 1 124 ? 15.842 8.377  16.504  1.00 21.33 ? 124  PRO A C   1 
ATOM   954  O  O   . PRO A 1 124 ? 15.058 9.236  16.110  1.00 22.18 ? 124  PRO A O   1 
ATOM   955  C  CB  . PRO A 1 124 ? 18.116 9.387  16.892  1.00 20.60 ? 124  PRO A CB  1 
ATOM   956  C  CG  . PRO A 1 124 ? 19.187 9.080  17.850  1.00 18.32 ? 124  PRO A CG  1 
ATOM   957  C  CD  . PRO A 1 124 ? 18.946 7.640  18.108  1.00 19.61 ? 124  PRO A CD  1 
ATOM   958  N  N   . GLU A 1 125 ? 15.822 7.130  16.043  1.00 22.26 ? 125  GLU A N   1 
ATOM   959  C  CA  . GLU A 1 125 ? 14.860 6.762  15.014  1.00 24.66 ? 125  GLU A CA  1 
ATOM   960  C  C   . GLU A 1 125 ? 13.443 6.871  15.525  1.00 27.27 ? 125  GLU A C   1 
ATOM   961  O  O   . GLU A 1 125 ? 12.544 7.162  14.763  1.00 28.94 ? 125  GLU A O   1 
ATOM   962  C  CB  . GLU A 1 125 ? 15.123 5.348  14.481  1.00 24.49 ? 125  GLU A CB  1 
ATOM   963  C  CG  . GLU A 1 125 ? 16.470 5.245  13.831  1.00 31.78 ? 125  GLU A CG  1 
ATOM   964  C  CD  . GLU A 1 125 ? 16.687 3.994  12.982  1.00 43.45 ? 125  GLU A CD  1 
ATOM   965  O  OE1 . GLU A 1 125 ? 15.738 3.199  12.742  1.00 53.52 ? 125  GLU A OE1 1 
ATOM   966  O  OE2 . GLU A 1 125 ? 17.843 3.838  12.521  1.00 50.37 ? 125  GLU A OE2 1 
ATOM   967  N  N   . LYS A 1 126 ? 13.262 6.676  16.831  1.00 29.16 ? 126  LYS A N   1 
ATOM   968  C  CA  . LYS A 1 126 ? 11.948 6.816  17.458  1.00 33.62 ? 126  LYS A CA  1 
ATOM   969  C  C   . LYS A 1 126 ? 11.357 8.180  17.135  1.00 33.24 ? 126  LYS A C   1 
ATOM   970  O  O   . LYS A 1 126 ? 10.156 8.321  16.966  1.00 37.33 ? 126  LYS A O   1 
ATOM   971  C  CB  . LYS A 1 126 ? 12.073 6.650  18.979  1.00 34.63 ? 126  LYS A CB  1 
ATOM   972  C  CG  . LYS A 1 126 ? 10.769 6.301  19.708  1.00 42.41 ? 126  LYS A CG  1 
ATOM   973  C  CD  . LYS A 1 126 ? 11.074 5.742  21.096  1.00 46.96 ? 126  LYS A CD  1 
ATOM   974  C  CE  . LYS A 1 126 ? 9.801  5.392  21.884  1.00 53.92 ? 126  LYS A CE  1 
ATOM   975  N  NZ  . LYS A 1 126 ? 9.137  6.592  22.473  1.00 58.59 ? 126  LYS A NZ  1 
ATOM   976  N  N   . GLN A 1 127 ? 12.227 9.176  17.023  1.00 26.52 ? 127  GLN A N   1 
ATOM   977  C  CA  . GLN A 1 127 ? 11.824 10.542 16.770  1.00 28.59 ? 127  GLN A CA  1 
ATOM   978  C  C   . GLN A 1 127 ? 12.010 10.961 15.309  1.00 31.67 ? 127  GLN A C   1 
ATOM   979  O  O   . GLN A 1 127 ? 11.989 12.151 15.003  1.00 35.12 ? 127  GLN A O   1 
ATOM   980  C  CB  . GLN A 1 127 ? 12.623 11.463 17.679  1.00 27.81 ? 127  GLN A CB  1 
ATOM   981  C  CG  . GLN A 1 127 ? 12.243 11.282 19.113  1.00 28.00 ? 127  GLN A CG  1 
ATOM   982  C  CD  . GLN A 1 127 ? 12.862 12.276 20.066  1.00 31.81 ? 127  GLN A CD  1 
ATOM   983  O  OE1 . GLN A 1 127 ? 13.318 13.359 19.672  1.00 30.35 ? 127  GLN A OE1 1 
ATOM   984  N  NE2 . GLN A 1 127 ? 12.864 11.911 21.362  1.00 31.46 ? 127  GLN A NE2 1 
ATOM   985  N  N   . GLY A 1 128 ? 12.200 9.993  14.412  1.00 31.26 ? 128  GLY A N   1 
ATOM   986  C  CA  . GLY A 1 128 ? 12.257 10.296 12.971  1.00 33.31 ? 128  GLY A CA  1 
ATOM   987  C  C   . GLY A 1 128 ? 13.613 10.694 12.417  1.00 30.82 ? 128  GLY A C   1 
ATOM   988  O  O   . GLY A 1 128 ? 13.724 11.153 11.288  1.00 31.20 ? 128  GLY A O   1 
ATOM   989  N  N   . PHE A 1 129 ? 14.646 10.519 13.217  1.00 25.30 ? 129  PHE A N   1 
ATOM   990  C  CA  . PHE A 1 129 ? 16.003 10.847 12.789  1.00 21.50 ? 129  PHE A CA  1 
ATOM   991  C  C   . PHE A 1 129 ? 16.531 9.758  11.881  1.00 23.07 ? 129  PHE A C   1 
ATOM   992  O  O   . PHE A 1 129 ? 16.435 8.585  12.239  1.00 24.27 ? 129  PHE A O   1 
ATOM   993  C  CB  . PHE A 1 129 ? 16.852 10.964 14.058  1.00 21.77 ? 129  PHE A CB  1 
ATOM   994  C  CG  . PHE A 1 129 ? 18.221 11.510 13.819  1.00 17.70 ? 129  PHE A CG  1 
ATOM   995  C  CD1 . PHE A 1 129 ? 18.461 12.875 13.850  1.00 20.82 ? 129  PHE A CD1 1 
ATOM   996  C  CD2 . PHE A 1 129 ? 19.263 10.675 13.554  1.00 21.53 ? 129  PHE A CD2 1 
ATOM   997  C  CE1 . PHE A 1 129 ? 19.717 13.384 13.588  1.00 20.76 ? 129  PHE A CE1 1 
ATOM   998  C  CE2 . PHE A 1 129 ? 20.545 11.201 13.314  1.00 21.89 ? 129  PHE A CE2 1 
ATOM   999  C  CZ  . PHE A 1 129 ? 20.755 12.564 13.345  1.00 20.67 ? 129  PHE A CZ  1 
ATOM   1000 N  N   . GLY A 1 130 ? 17.093 10.105 10.712  1.00 22.26 ? 130  GLY A N   1 
ATOM   1001 C  CA  . GLY A 1 130 ? 17.577 9.070  9.800   1.00 22.86 ? 130  GLY A CA  1 
ATOM   1002 C  C   . GLY A 1 130 ? 19.053 8.745  9.882   1.00 22.51 ? 130  GLY A C   1 
ATOM   1003 O  O   . GLY A 1 130 ? 19.820 9.390  10.597  1.00 19.83 ? 130  GLY A O   1 
ATOM   1004 N  N   . ARG A 1 131 ? 19.445 7.755  9.096   1.00 21.89 ? 131  ARG A N   1 
ATOM   1005 C  CA  . ARG A 1 131 ? 20.863 7.404  8.942   1.00 21.59 ? 131  ARG A CA  1 
ATOM   1006 C  C   . ARG A 1 131 ? 21.152 6.955  7.538   1.00 19.85 ? 131  ARG A C   1 
ATOM   1007 O  O   . ARG A 1 131 ? 20.345 6.246  6.911   1.00 22.23 ? 131  ARG A O   1 
ATOM   1008 C  CB  . ARG A 1 131 ? 21.344 6.378  9.981   1.00 25.62 ? 131  ARG A CB  1 
ATOM   1009 C  CG  . ARG A 1 131 ? 20.862 5.001  9.794   1.00 28.50 ? 131  ARG A CG  1 
ATOM   1010 C  CD  . ARG A 1 131 ? 21.257 4.076  10.945  1.00 30.71 ? 131  ARG A CD  1 
ATOM   1011 N  NE  . ARG A 1 131 ? 20.501 2.857  10.749  1.00 32.87 ? 131  ARG A NE  1 
ATOM   1012 C  CZ  . ARG A 1 131 ? 20.931 1.728  10.194  1.00 32.89 ? 131  ARG A CZ  1 
ATOM   1013 N  NH1 . ARG A 1 131 ? 22.187 1.549  9.820   1.00 28.49 ? 131  ARG A NH1 1 
ATOM   1014 N  NH2 . ARG A 1 131 ? 20.074 0.724  10.068  1.00 36.83 ? 131  ARG A NH2 1 
ATOM   1015 N  N   . HIS A 1 132 ? 22.310 7.355  7.057   1.00 19.32 ? 132  HIS A N   1 
ATOM   1016 C  CA  . HIS A 1 132 ? 22.806 6.883  5.771   1.00 20.35 ? 132  HIS A CA  1 
ATOM   1017 C  C   . HIS A 1 132 ? 23.129 5.405  5.959   1.00 21.61 ? 132  HIS A C   1 
ATOM   1018 O  O   . HIS A 1 132 ? 23.704 5.017  7.003   1.00 20.36 ? 132  HIS A O   1 
ATOM   1019 C  CB  . HIS A 1 132 ? 24.087 7.572  5.387   1.00 20.03 ? 132  HIS A CB  1 
ATOM   1020 C  CG  . HIS A 1 132 ? 23.933 9.022  5.055   1.00 21.45 ? 132  HIS A CG  1 
ATOM   1021 N  ND1 . HIS A 1 132 ? 24.725 9.638  4.109   1.00 22.16 ? 132  HIS A ND1 1 
ATOM   1022 C  CD2 . HIS A 1 132 ? 23.091 9.974  5.523   1.00 25.28 ? 132  HIS A CD2 1 
ATOM   1023 C  CE1 . HIS A 1 132 ? 24.386 10.915 4.034   1.00 22.16 ? 132  HIS A CE1 1 
ATOM   1024 N  NE2 . HIS A 1 132 ? 23.395 11.141 4.874   1.00 24.01 ? 132  HIS A NE2 1 
ATOM   1025 N  N   . VAL A 1 133 ? 22.835 4.616  4.949   1.00 19.70 ? 133  VAL A N   1 
ATOM   1026 C  CA  . VAL A 1 133 ? 23.134 3.196  4.973   1.00 21.23 ? 133  VAL A CA  1 
ATOM   1027 C  C   . VAL A 1 133 ? 23.873 2.742  3.708   1.00 25.74 ? 133  VAL A C   1 
ATOM   1028 O  O   . VAL A 1 133 ? 24.155 1.548  3.536   1.00 26.69 ? 133  VAL A O   1 
ATOM   1029 C  CB  . VAL A 1 133 ? 21.866 2.345  5.229   1.00 23.58 ? 133  VAL A CB  1 
ATOM   1030 C  CG1 . VAL A 1 133 ? 21.231 2.683  6.616   1.00 25.88 ? 133  VAL A CG1 1 
ATOM   1031 C  CG2 . VAL A 1 133 ? 20.865 2.506  4.103   1.00 24.73 ? 133  VAL A CG2 1 
ATOM   1032 N  N   . ASP A 1 134 ? 24.232 3.701  2.870   1.00 25.33 ? 134  ASP A N   1 
ATOM   1033 C  CA  . ASP A 1 134 ? 24.991 3.409  1.644   1.00 29.01 ? 134  ASP A CA  1 
ATOM   1034 C  C   . ASP A 1 134 ? 26.424 3.009  1.972   1.00 29.13 ? 134  ASP A C   1 
ATOM   1035 O  O   . ASP A 1 134 ? 26.925 3.245  3.050   1.00 27.73 ? 134  ASP A O   1 
ATOM   1036 C  CB  . ASP A 1 134 ? 24.990 4.617  0.722   1.00 30.53 ? 134  ASP A CB  1 
ATOM   1037 C  CG  . ASP A 1 134 ? 25.464 5.884  1.412   1.00 35.50 ? 134  ASP A CG  1 
ATOM   1038 O  OD1 . ASP A 1 134 ? 24.815 6.298  2.424   1.00 38.28 ? 134  ASP A OD1 1 
ATOM   1039 O  OD2 . ASP A 1 134 ? 26.477 6.456  0.959   1.00 41.83 ? 134  ASP A OD2 1 
ATOM   1040 N  N   . GLU A 1 135 ? 27.101 2.412  1.003   1.00 30.33 ? 135  GLU A N   1 
ATOM   1041 C  CA  . GLU A 1 135 ? 28.433 1.901  1.246   1.00 32.61 ? 135  GLU A CA  1 
ATOM   1042 C  C   . GLU A 1 135 ? 29.424 3.021  1.561   1.00 30.66 ? 135  GLU A C   1 
ATOM   1043 O  O   . GLU A 1 135 ? 30.273 2.874  2.429   1.00 33.20 ? 135  GLU A O   1 
ATOM   1044 C  CB  . GLU A 1 135 ? 28.889 1.113  0.022   1.00 36.71 ? 135  GLU A CB  1 
ATOM   1045 C  CG  . GLU A 1 135 ? 30.192 0.423  0.188   1.00 40.61 ? 135  GLU A CG  1 
ATOM   1046 C  CD  . GLU A 1 135 ? 30.356 -0.709 -0.803  1.00 49.87 ? 135  GLU A CD  1 
ATOM   1047 O  OE1 . GLU A 1 135 ? 29.350 -1.412 -1.095  1.00 46.83 ? 135  GLU A OE1 1 
ATOM   1048 O  OE2 . GLU A 1 135 ? 31.492 -0.890 -1.284  1.00 61.29 ? 135  GLU A OE2 1 
ATOM   1049 N  N   . GLU A 1 136 ? 29.301 4.146  0.866   1.00 30.09 ? 136  GLU A N   1 
ATOM   1050 C  CA  . GLU A 1 136 ? 30.309 5.209  0.956   1.00 31.67 ? 136  GLU A CA  1 
ATOM   1051 C  C   . GLU A 1 136 ? 30.208 6.009  2.240   1.00 30.62 ? 136  GLU A C   1 
ATOM   1052 O  O   . GLU A 1 136 ? 31.229 6.316  2.846   1.00 31.58 ? 136  GLU A O   1 
ATOM   1053 C  CB  . GLU A 1 136 ? 30.217 6.159  -0.232  1.00 34.08 ? 136  GLU A CB  1 
ATOM   1054 C  CG  . GLU A 1 136 ? 31.461 7.104  -0.356  1.00 43.87 ? 136  GLU A CG  1 
ATOM   1055 C  CD  . GLU A 1 136 ? 31.378 8.126  -1.501  1.00 53.51 ? 136  GLU A CD  1 
ATOM   1056 O  OE1 . GLU A 1 136 ? 30.374 8.116  -2.256  1.00 59.68 ? 136  GLU A OE1 1 
ATOM   1057 O  OE2 . GLU A 1 136 ? 32.324 8.947  -1.638  1.00 56.34 ? 136  GLU A OE2 1 
ATOM   1058 N  N   . THR A 1 137 ? 28.983 6.362  2.642   1.00 27.32 ? 137  THR A N   1 
ATOM   1059 C  CA  . THR A 1 137 ? 28.795 7.295  3.768   1.00 26.45 ? 137  THR A CA  1 
ATOM   1060 C  C   . THR A 1 137 ? 27.935 6.725  4.879   1.00 23.82 ? 137  THR A C   1 
ATOM   1061 O  O   . THR A 1 137 ? 27.601 7.427  5.826   1.00 24.27 ? 137  THR A O   1 
ATOM   1062 C  CB  . THR A 1 137 ? 28.168 8.627  3.289   1.00 27.64 ? 137  THR A CB  1 
ATOM   1063 O  OG1 . THR A 1 137 ? 26.812 8.384  2.897   1.00 28.27 ? 137  THR A OG1 1 
ATOM   1064 C  CG2 . THR A 1 137 ? 28.951 9.206  2.089   1.00 31.44 ? 137  THR A CG2 1 
ATOM   1065 N  N   . GLY A 1 138 ? 27.584 5.449  4.776   1.00 21.68 ? 138  GLY A N   1 
ATOM   1066 C  CA  . GLY A 1 138 ? 26.654 4.845  5.717   1.00 21.15 ? 138  GLY A CA  1 
ATOM   1067 C  C   . GLY A 1 138 ? 27.267 4.510  7.052   1.00 20.73 ? 138  GLY A C   1 
ATOM   1068 O  O   . GLY A 1 138 ? 28.491 4.442  7.204   1.00 23.94 ? 138  GLY A O   1 
ATOM   1069 N  N   . VAL A 1 139 ? 26.377 4.282  8.016   1.00 18.90 ? 139  VAL A N   1 
ATOM   1070 C  CA  . VAL A 1 139 ? 26.759 3.960  9.380   1.00 21.41 ? 139  VAL A CA  1 
ATOM   1071 C  C   . VAL A 1 139 ? 25.907 2.778  9.821   1.00 23.18 ? 139  VAL A C   1 
ATOM   1072 O  O   . VAL A 1 139 ? 24.858 2.460  9.213   1.00 23.49 ? 139  VAL A O   1 
ATOM   1073 C  CB  . VAL A 1 139 ? 26.556 5.156  10.357  1.00 20.54 ? 139  VAL A CB  1 
ATOM   1074 C  CG1 . VAL A 1 139 ? 27.375 6.381  9.911   1.00 24.16 ? 139  VAL A CG1 1 
ATOM   1075 C  CG2 . VAL A 1 139 ? 25.044 5.498  10.465  1.00 17.19 ? 139  VAL A CG2 1 
ATOM   1076 N  N   . GLY A 1 140 ? 26.326 2.152  10.910  1.00 22.58 ? 140  GLY A N   1 
ATOM   1077 C  CA  . GLY A 1 140 ? 25.646 0.983  11.411  1.00 22.40 ? 140  GLY A CA  1 
ATOM   1078 C  C   . GLY A 1 140 ? 24.367 1.283  12.131  1.00 19.82 ? 140  GLY A C   1 
ATOM   1079 O  O   . GLY A 1 140 ? 23.972 2.467  12.301  1.00 20.81 ? 140  GLY A O   1 
ATOM   1080 N  N   . LYS A 1 141 ? 23.718 0.201  12.520  1.00 22.98 ? 141  LYS A N   1 
ATOM   1081 C  CA  . LYS A 1 141 ? 22.486 0.208  13.298  1.00 23.32 ? 141  LYS A CA  1 
ATOM   1082 C  C   . LYS A 1 141 ? 22.599 0.969  14.583  1.00 23.00 ? 141  LYS A C   1 
ATOM   1083 O  O   . LYS A 1 141 ? 23.648 0.990  15.206  1.00 21.85 ? 141  LYS A O   1 
ATOM   1084 C  CB  . LYS A 1 141 ? 22.074 -1.238 13.648  1.00 26.01 ? 141  LYS A CB  1 
ATOM   1085 C  CG  . LYS A 1 141 ? 21.429 -1.996 12.557  1.00 32.41 ? 141  LYS A CG  1 
ATOM   1086 C  CD  . LYS A 1 141 ? 20.793 -3.304 13.128  1.00 35.44 ? 141  LYS A CD  1 
ATOM   1087 C  CE  . LYS A 1 141 ? 20.117 -4.123 12.058  1.00 39.85 ? 141  LYS A CE  1 
ATOM   1088 N  NZ  . LYS A 1 141 ? 19.590 -5.391 12.645  1.00 39.56 ? 141  LYS A NZ  1 
ATOM   1089 N  N   . TRP A 1 142 ? 21.479 1.549  15.015  1.00 24.61 ? 142  TRP A N   1 
ATOM   1090 C  CA  . TRP A 1 142 ? 21.367 2.129  16.330  1.00 28.14 ? 142  TRP A CA  1 
ATOM   1091 C  C   . TRP A 1 142 ? 21.166 1.067  17.407  1.00 24.68 ? 142  TRP A C   1 
ATOM   1092 O  O   . TRP A 1 142 ? 20.565 0.003  17.185  1.00 25.80 ? 142  TRP A O   1 
ATOM   1093 C  CB  . TRP A 1 142 ? 20.191 3.092  16.380  1.00 30.01 ? 142  TRP A CB  1 
ATOM   1094 C  CG  . TRP A 1 142 ? 20.429 4.459  15.735  1.00 32.07 ? 142  TRP A CG  1 
ATOM   1095 C  CD1 . TRP A 1 142 ? 19.865 4.911  14.606  1.00 31.16 ? 142  TRP A CD1 1 
ATOM   1096 C  CD2 . TRP A 1 142 ? 21.282 5.512  16.218  1.00 30.45 ? 142  TRP A CD2 1 
ATOM   1097 N  NE1 . TRP A 1 142 ? 20.279 6.186  14.341  1.00 33.63 ? 142  TRP A NE1 1 
ATOM   1098 C  CE2 . TRP A 1 142 ? 21.163 6.581  15.312  1.00 31.38 ? 142  TRP A CE2 1 
ATOM   1099 C  CE3 . TRP A 1 142 ? 22.109 5.659  17.333  1.00 34.21 ? 142  TRP A CE3 1 
ATOM   1100 C  CZ2 . TRP A 1 142 ? 21.822 7.809  15.486  1.00 30.00 ? 142  TRP A CZ2 1 
ATOM   1101 C  CZ3 . TRP A 1 142 ? 22.790 6.900  17.513  1.00 39.28 ? 142  TRP A CZ3 1 
ATOM   1102 C  CH2 . TRP A 1 142 ? 22.639 7.942  16.589  1.00 39.78 ? 142  TRP A CH2 1 
ATOM   1103 N  N   . PHE A 1 143 ? 21.675 1.363  18.588  1.00 22.42 ? 143  PHE A N   1 
ATOM   1104 C  CA  . PHE A 1 143 ? 21.394 0.613  19.759  1.00 21.37 ? 143  PHE A CA  1 
ATOM   1105 C  C   . PHE A 1 143 ? 19.888 0.410  20.014  1.00 22.28 ? 143  PHE A C   1 
ATOM   1106 O  O   . PHE A 1 143 ? 19.063 1.275  19.753  1.00 23.80 ? 143  PHE A O   1 
ATOM   1107 C  CB  . PHE A 1 143 ? 22.021 1.301  21.002  1.00 23.23 ? 143  PHE A CB  1 
ATOM   1108 C  CG  . PHE A 1 143 ? 21.502 2.660  21.282  1.00 25.39 ? 143  PHE A CG  1 
ATOM   1109 C  CD1 . PHE A 1 143 ? 20.351 2.822  22.026  1.00 22.17 ? 143  PHE A CD1 1 
ATOM   1110 C  CD2 . PHE A 1 143 ? 22.187 3.779  20.849  1.00 22.76 ? 143  PHE A CD2 1 
ATOM   1111 C  CE1 . PHE A 1 143 ? 19.858 4.062  22.304  1.00 27.80 ? 143  PHE A CE1 1 
ATOM   1112 C  CE2 . PHE A 1 143 ? 21.705 5.035  21.142  1.00 26.47 ? 143  PHE A CE2 1 
ATOM   1113 C  CZ  . PHE A 1 143 ? 20.527 5.154  21.877  1.00 26.03 ? 143  PHE A CZ  1 
ATOM   1114 N  N   . GLU A 1 144 ? 19.581 -0.764 20.532  1.00 19.08 ? 144  GLU A N   1 
ATOM   1115 C  CA  . GLU A 1 144 ? 18.311 -1.102 21.157  1.00 21.93 ? 144  GLU A CA  1 
ATOM   1116 C  C   . GLU A 1 144 ? 18.113 -0.338 22.476  1.00 25.29 ? 144  GLU A C   1 
ATOM   1117 O  O   . GLU A 1 144 ? 19.086 0.067  23.135  1.00 22.62 ? 144  GLU A O   1 
ATOM   1118 C  CB  . GLU A 1 144 ? 18.282 -2.622 21.414  1.00 25.00 ? 144  GLU A CB  1 
ATOM   1119 C  CG  . GLU A 1 144 ? 18.241 -3.431 20.163  1.00 30.06 ? 144  GLU A CG  1 
ATOM   1120 C  CD  . GLU A 1 144 ? 16.860 -3.423 19.535  1.00 33.38 ? 144  GLU A CD  1 
ATOM   1121 O  OE1 . GLU A 1 144 ? 15.948 -4.023 20.144  1.00 43.23 ? 144  GLU A OE1 1 
ATOM   1122 O  OE2 . GLU A 1 144 ? 16.697 -2.810 18.463  1.00 35.96 ? 144  GLU A OE2 1 
ATOM   1123 N  N   . PRO A 1 145 ? 16.858 -0.134 22.882  1.00 23.19 ? 145  PRO A N   1 
ATOM   1124 C  CA  . PRO A 1 145 ? 16.672 0.554  24.152  1.00 21.18 ? 145  PRO A CA  1 
ATOM   1125 C  C   . PRO A 1 145 ? 17.451 -0.067 25.271  1.00 18.37 ? 145  PRO A C   1 
ATOM   1126 O  O   . PRO A 1 145 ? 17.563 -1.326 25.334  1.00 22.13 ? 145  PRO A O   1 
ATOM   1127 C  CB  . PRO A 1 145 ? 15.171 0.419  24.403  1.00 23.14 ? 145  PRO A CB  1 
ATOM   1128 C  CG  . PRO A 1 145 ? 14.590 0.265  23.009  1.00 24.31 ? 145  PRO A CG  1 
ATOM   1129 C  CD  . PRO A 1 145 ? 15.573 -0.564 22.300  1.00 26.19 ? 145  PRO A CD  1 
ATOM   1130 N  N   . PHE A 1 146 ? 18.033 0.786  26.100  1.00 19.45 ? 146  PHE A N   1 
ATOM   1131 C  CA  . PHE A 1 146 ? 18.902 0.337  27.181  1.00 20.78 ? 146  PHE A CA  1 
ATOM   1132 C  C   . PHE A 1 146 ? 18.720 1.164  28.421  1.00 21.07 ? 146  PHE A C   1 
ATOM   1133 O  O   . PHE A 1 146 ? 18.038 2.201  28.396  1.00 22.45 ? 146  PHE A O   1 
ATOM   1134 C  CB  . PHE A 1 146 ? 20.360 0.290  26.753  1.00 20.50 ? 146  PHE A CB  1 
ATOM   1135 C  CG  . PHE A 1 146 ? 20.963 1.629  26.547  1.00 21.91 ? 146  PHE A CG  1 
ATOM   1136 C  CD1 . PHE A 1 146 ? 20.831 2.278  25.342  1.00 18.80 ? 146  PHE A CD1 1 
ATOM   1137 C  CD2 . PHE A 1 146 ? 21.694 2.215  27.543  1.00 19.00 ? 146  PHE A CD2 1 
ATOM   1138 C  CE1 . PHE A 1 146 ? 21.402 3.504  25.157  1.00 20.78 ? 146  PHE A CE1 1 
ATOM   1139 C  CE2 . PHE A 1 146 ? 22.286 3.454  27.341  1.00 22.85 ? 146  PHE A CE2 1 
ATOM   1140 C  CZ  . PHE A 1 146 ? 22.152 4.079  26.145  1.00 24.11 ? 146  PHE A CZ  1 
ATOM   1141 N  N   . LYS A 1 147 ? 19.251 0.656  29.531  1.00 23.46 ? 147  LYS A N   1 
ATOM   1142 C  CA  . LYS A 1 147 ? 19.284 1.436  30.731  1.00 25.00 ? 147  LYS A CA  1 
ATOM   1143 C  C   . LYS A 1 147 ? 20.695 1.520  31.281  1.00 24.85 ? 147  LYS A C   1 
ATOM   1144 O  O   . LYS A 1 147 ? 21.538 0.679  31.000  1.00 26.85 ? 147  LYS A O   1 
ATOM   1145 C  CB  . LYS A 1 147 ? 18.317 0.895  31.781  1.00 27.40 ? 147  LYS A CB  1 
ATOM   1146 C  CG  . LYS A 1 147 ? 18.669 -0.451 32.302  1.00 30.86 ? 147  LYS A CG  1 
ATOM   1147 C  CD  . LYS A 1 147 ? 17.707 -0.859 33.419  1.00 40.16 ? 147  LYS A CD  1 
ATOM   1148 C  CE  . LYS A 1 147 ? 18.394 -1.761 34.446  1.00 50.14 ? 147  LYS A CE  1 
ATOM   1149 N  NZ  . LYS A 1 147 ? 18.859 -3.029 33.834  1.00 55.47 ? 147  LYS A NZ  1 
ATOM   1150 N  N   . VAL A 1 148 ? 20.929 2.588  32.017  1.00 22.43 ? 148  VAL A N   1 
ATOM   1151 C  CA  . VAL A 1 148 ? 22.165 2.768  32.762  1.00 22.29 ? 148  VAL A CA  1 
ATOM   1152 C  C   . VAL A 1 148 ? 21.752 3.208  34.159  1.00 21.29 ? 148  VAL A C   1 
ATOM   1153 O  O   . VAL A 1 148 ? 20.786 3.968  34.301  1.00 22.72 ? 148  VAL A O   1 
ATOM   1154 C  CB  . VAL A 1 148 ? 23.092 3.784  32.116  1.00 22.50 ? 148  VAL A CB  1 
ATOM   1155 C  CG1 . VAL A 1 148 ? 23.730 3.205  30.857  1.00 28.51 ? 148  VAL A CG1 1 
ATOM   1156 C  CG2 . VAL A 1 148 ? 22.368 5.066  31.763  1.00 24.59 ? 148  VAL A CG2 1 
ATOM   1157 N  N   . ASP A 1 149 ? 22.524 2.772  35.151  1.00 21.81 ? 149  ASP A N   1 
ATOM   1158 C  CA  . ASP A 1 149 ? 22.205 2.935  36.569  1.00 25.05 ? 149  ASP A CA  1 
ATOM   1159 C  C   . ASP A 1 149 ? 23.331 3.678  37.257  1.00 24.05 ? 149  ASP A C   1 
ATOM   1160 O  O   . ASP A 1 149 ? 24.511 3.431  36.943  1.00 24.70 ? 149  ASP A O   1 
ATOM   1161 C  CB  . ASP A 1 149 ? 22.105 1.579  37.249  1.00 31.07 ? 149  ASP A CB  1 
ATOM   1162 C  CG  . ASP A 1 149 ? 21.025 0.703  36.659  1.00 38.86 ? 149  ASP A CG  1 
ATOM   1163 O  OD1 . ASP A 1 149 ? 19.886 1.183  36.491  1.00 45.91 ? 149  ASP A OD1 1 
ATOM   1164 O  OD2 . ASP A 1 149 ? 21.315 -0.474 36.387  1.00 50.57 ? 149  ASP A OD2 1 
ATOM   1165 N  N   . TYR A 1 150 ? 22.978 4.539  38.205  1.00 21.70 ? 150  TYR A N   1 
ATOM   1166 C  CA  . TYR A 1 150 ? 23.921 5.313  38.995  1.00 23.08 ? 150  TYR A CA  1 
ATOM   1167 C  C   . TYR A 1 150 ? 23.512 5.204  40.448  1.00 24.47 ? 150  TYR A C   1 
ATOM   1168 O  O   . TYR A 1 150 ? 22.320 5.062  40.773  1.00 27.50 ? 150  TYR A O   1 
ATOM   1169 C  CB  . TYR A 1 150 ? 23.912 6.818  38.602  1.00 22.43 ? 150  TYR A CB  1 
ATOM   1170 C  CG  . TYR A 1 150 ? 24.127 7.048  37.139  1.00 17.62 ? 150  TYR A CG  1 
ATOM   1171 C  CD1 . TYR A 1 150 ? 23.069 6.971  36.253  1.00 19.74 ? 150  TYR A CD1 1 
ATOM   1172 C  CD2 . TYR A 1 150 ? 25.389 7.350  36.629  1.00 17.20 ? 150  TYR A CD2 1 
ATOM   1173 C  CE1 . TYR A 1 150 ? 23.255 7.192  34.910  1.00 22.00 ? 150  TYR A CE1 1 
ATOM   1174 C  CE2 . TYR A 1 150 ? 25.589 7.533  35.286  1.00 19.42 ? 150  TYR A CE2 1 
ATOM   1175 C  CZ  . TYR A 1 150 ? 24.516 7.471  34.427  1.00 21.47 ? 150  TYR A CZ  1 
ATOM   1176 O  OH  . TYR A 1 150 ? 24.740 7.652  33.085  1.00 25.14 ? 150  TYR A OH  1 
ATOM   1177 N  N   . LYS A 1 151 ? 24.484 5.308  41.330  1.00 23.86 ? 151  LYS A N   1 
ATOM   1178 C  CA  . LYS A 1 151 ? 24.175 5.449  42.764  1.00 26.28 ? 151  LYS A CA  1 
ATOM   1179 C  C   . LYS A 1 151 ? 24.809 6.733  43.244  1.00 25.66 ? 151  LYS A C   1 
ATOM   1180 O  O   . LYS A 1 151 ? 25.926 7.050  42.833  1.00 26.77 ? 151  LYS A O   1 
ATOM   1181 C  CB  . LYS A 1 151 ? 24.680 4.272  43.565  1.00 29.69 ? 151  LYS A CB  1 
ATOM   1182 C  CG  . LYS A 1 151 ? 23.852 3.028  43.353  1.00 37.77 ? 151  LYS A CG  1 
ATOM   1183 C  CD  . LYS A 1 151 ? 24.303 1.903  44.273  1.00 48.38 ? 151  LYS A CD  1 
ATOM   1184 C  CE  . LYS A 1 151 ? 23.604 0.587  43.920  1.00 52.78 ? 151  LYS A CE  1 
ATOM   1185 N  NZ  . LYS A 1 151 ? 23.636 0.265  42.456  1.00 57.12 ? 151  LYS A NZ  1 
ATOM   1186 N  N   . PHE A 1 152 ? 24.083 7.472  44.073  1.00 25.32 ? 152  PHE A N   1 
ATOM   1187 C  CA  . PHE A 1 152 ? 24.587 8.734  44.613  1.00 25.17 ? 152  PHE A CA  1 
ATOM   1188 C  C   . PHE A 1 152 ? 23.940 9.116  45.934  1.00 26.10 ? 152  PHE A C   1 
ATOM   1189 O  O   . PHE A 1 152 ? 22.881 8.584  46.303  1.00 24.92 ? 152  PHE A O   1 
ATOM   1190 C  CB  . PHE A 1 152 ? 24.423 9.847  43.588  1.00 25.33 ? 152  PHE A CB  1 
ATOM   1191 C  CG  . PHE A 1 152 ? 23.015 10.359 43.439  1.00 22.03 ? 152  PHE A CG  1 
ATOM   1192 C  CD1 . PHE A 1 152 ? 22.072 9.651  42.722  1.00 26.34 ? 152  PHE A CD1 1 
ATOM   1193 C  CD2 . PHE A 1 152 ? 22.657 11.603 43.950  1.00 26.72 ? 152  PHE A CD2 1 
ATOM   1194 C  CE1 . PHE A 1 152 ? 20.810 10.144 42.556  1.00 23.41 ? 152  PHE A CE1 1 
ATOM   1195 C  CE2 . PHE A 1 152 ? 21.373 12.098 43.794  1.00 25.35 ? 152  PHE A CE2 1 
ATOM   1196 C  CZ  . PHE A 1 152 ? 20.447 11.357 43.081  1.00 22.21 ? 152  PHE A CZ  1 
ATOM   1197 N  N   . LYS A 1 153 ? 24.581 10.060 46.630  1.00 26.24 ? 153  LYS A N   1 
ATOM   1198 C  CA  . LYS A 1 153 ? 24.020 10.629 47.838  1.00 26.65 ? 153  LYS A CA  1 
ATOM   1199 C  C   . LYS A 1 153 ? 23.445 11.986 47.491  1.00 26.14 ? 153  LYS A C   1 
ATOM   1200 O  O   . LYS A 1 153 ? 24.130 12.840 46.935  1.00 28.27 ? 153  LYS A O   1 
ATOM   1201 C  CB  . LYS A 1 153 ? 25.074 10.756 48.963  1.00 30.95 ? 153  LYS A CB  1 
ATOM   1202 C  CG  . LYS A 1 153 ? 24.454 11.250 50.288  1.00 41.94 ? 153  LYS A CG  1 
ATOM   1203 C  CD  . LYS A 1 153 ? 24.921 10.483 51.539  1.00 53.00 ? 153  LYS A CD  1 
ATOM   1204 C  CE  . LYS A 1 153 ? 23.803 10.409 52.608  1.00 59.12 ? 153  LYS A CE  1 
ATOM   1205 N  NZ  . LYS A 1 153 ? 23.120 11.724 52.844  1.00 63.13 ? 153  LYS A NZ  1 
ATOM   1206 N  N   . TYR A 1 154 ? 22.167 12.170 47.774  1.00 25.92 ? 154  TYR A N   1 
ATOM   1207 C  CA  . TYR A 1 154 ? 21.550 13.481 47.626  1.00 24.40 ? 154  TYR A CA  1 
ATOM   1208 C  C   . TYR A 1 154 ? 21.659 14.205 48.942  1.00 28.75 ? 154  TYR A C   1 
ATOM   1209 O  O   . TYR A 1 154 ? 21.120 13.743 49.946  1.00 27.04 ? 154  TYR A O   1 
ATOM   1210 C  CB  . TYR A 1 154 ? 20.095 13.325 47.227  1.00 23.91 ? 154  TYR A CB  1 
ATOM   1211 C  CG  . TYR A 1 154 ? 19.319 14.614 47.173  1.00 21.82 ? 154  TYR A CG  1 
ATOM   1212 C  CD1 . TYR A 1 154 ? 19.740 15.675 46.367  1.00 24.91 ? 154  TYR A CD1 1 
ATOM   1213 C  CD2 . TYR A 1 154 ? 18.190 14.797 47.947  1.00 23.89 ? 154  TYR A CD2 1 
ATOM   1214 C  CE1 . TYR A 1 154 ? 19.048 16.876 46.339  1.00 24.28 ? 154  TYR A CE1 1 
ATOM   1215 C  CE2 . TYR A 1 154 ? 17.477 15.990 47.921  1.00 24.07 ? 154  TYR A CE2 1 
ATOM   1216 C  CZ  . TYR A 1 154 ? 17.907 17.021 47.097  1.00 25.55 ? 154  TYR A CZ  1 
ATOM   1217 O  OH  . TYR A 1 154 ? 17.195 18.201 47.059  1.00 24.92 ? 154  TYR A OH  1 
ATOM   1218 N  N   . THR A 1 155 ? 22.342 15.353 48.938  1.00 30.41 ? 155  THR A N   1 
ATOM   1219 C  CA  . THR A 1 155 ? 22.646 16.044 50.181  1.00 32.30 ? 155  THR A CA  1 
ATOM   1220 C  C   . THR A 1 155 ? 21.745 17.246 50.387  1.00 33.79 ? 155  THR A C   1 
ATOM   1221 O  O   . THR A 1 155 ? 21.945 18.018 51.307  1.00 35.31 ? 155  THR A O   1 
ATOM   1222 C  CB  . THR A 1 155 ? 24.110 16.495 50.204  1.00 32.72 ? 155  THR A CB  1 
ATOM   1223 O  OG1 . THR A 1 155 ? 24.393 17.252 49.015  1.00 30.98 ? 155  THR A OG1 1 
ATOM   1224 C  CG2 . THR A 1 155 ? 25.046 15.260 50.291  1.00 35.29 ? 155  THR A CG2 1 
ATOM   1225 N  N   . GLY A 1 156 ? 20.753 17.412 49.519  1.00 34.23 ? 156  GLY A N   1 
ATOM   1226 C  CA  . GLY A 1 156 ? 19.788 18.473 49.696  1.00 36.23 ? 156  GLY A CA  1 
ATOM   1227 C  C   . GLY A 1 156 ? 19.789 19.510 48.620  1.00 36.77 ? 156  GLY A C   1 
ATOM   1228 O  O   . GLY A 1 156 ? 20.723 19.604 47.793  1.00 33.89 ? 156  GLY A O   1 
ATOM   1229 N  N   . THR A 1 157 ? 18.712 20.285 48.604  1.00 39.56 ? 157  THR A N   1 
ATOM   1230 C  CA  . THR A 1 157 ? 18.493 21.180 47.495  1.00 42.09 ? 157  THR A CA  1 
ATOM   1231 C  C   . THR A 1 157 ? 19.606 22.205 47.508  1.00 45.45 ? 157  THR A C   1 
ATOM   1232 O  O   . THR A 1 157 ? 19.889 22.796 48.560  1.00 44.61 ? 157  THR A O   1 
ATOM   1233 C  CB  . THR A 1 157 ? 17.114 21.881 47.500  1.00 42.96 ? 157  THR A CB  1 
ATOM   1234 O  OG1 . THR A 1 157 ? 17.041 22.747 46.351  1.00 38.98 ? 157  THR A OG1 1 
ATOM   1235 C  CG2 . THR A 1 157 ? 16.870 22.682 48.790  1.00 43.76 ? 157  THR A CG2 1 
ATOM   1236 N  N   . PRO A 1 158 ? 20.269 22.390 46.357  1.00 48.94 ? 158  PRO A N   1 
ATOM   1237 C  CA  . PRO A 1 158 ? 21.348 23.361 46.320  1.00 55.33 ? 158  PRO A CA  1 
ATOM   1238 C  C   . PRO A 1 158 ? 20.901 24.780 45.878  1.00 62.70 ? 158  PRO A C   1 
ATOM   1239 O  O   . PRO A 1 158 ? 21.754 25.647 45.664  1.00 65.09 ? 158  PRO A O   1 
ATOM   1240 C  CB  . PRO A 1 158 ? 22.341 22.727 45.332  1.00 53.78 ? 158  PRO A CB  1 
ATOM   1241 C  CG  . PRO A 1 158 ? 21.510 21.837 44.437  1.00 49.77 ? 158  PRO A CG  1 
ATOM   1242 C  CD  . PRO A 1 158 ? 20.174 21.626 45.097  1.00 48.02 ? 158  PRO A CD  1 
ATOM   1243 N  N   . LYS A 1 159 ? 19.587 25.020 45.785  1.00 51.06 ? 159  LYS A N   1 
ATOM   1244 C  CA  . LYS A 1 159 ? 19.050 26.312 45.301  1.00 54.64 ? 159  LYS A CA  1 
ATOM   1245 C  C   . LYS A 1 159 ? 19.240 27.472 46.296  1.00 56.83 ? 159  LYS A C   1 
ATOM   1246 O  O   . LYS A 1 159 ? 19.116 27.289 47.515  1.00 58.29 ? 159  LYS A O   1 
ATOM   1247 C  CB  . LYS A 1 159 ? 17.566 26.178 44.919  1.00 55.44 ? 159  LYS A CB  1 
ATOM   1248 C  CG  . LYS A 1 159 ? 16.603 26.005 46.092  1.00 59.22 ? 159  LYS A CG  1 
ATOM   1249 C  CD  . LYS A 1 159 ? 15.174 25.844 45.600  1.00 60.60 ? 159  LYS A CD  1 
ATOM   1250 C  CE  . LYS A 1 159 ? 14.208 25.436 46.718  1.00 62.79 ? 159  LYS A CE  1 
ATOM   1251 N  NZ  . LYS A 1 159 ? 14.162 23.954 46.898  1.00 61.83 ? 159  LYS A NZ  1 
ATOM   1252 N  N   . GLY B 1 2   ? 30.349 12.705 -5.008  1.00 46.05 ? 2    GLY B N   1 
ATOM   1253 C  CA  . GLY B 1 2   ? 30.806 14.124 -5.008  1.00 44.35 ? 2    GLY B CA  1 
ATOM   1254 C  C   . GLY B 1 2   ? 29.841 14.991 -4.215  1.00 42.06 ? 2    GLY B C   1 
ATOM   1255 O  O   . GLY B 1 2   ? 28.631 14.691 -4.170  1.00 46.18 ? 2    GLY B O   1 
ATOM   1256 N  N   . GLU B 1 3   ? 30.376 16.012 -3.544  1.00 78.24 ? 3    GLU B N   1 
ATOM   1257 C  CA  . GLU B 1 3   ? 29.563 17.058 -2.916  1.00 65.22 ? 3    GLU B CA  1 
ATOM   1258 C  C   . GLU B 1 3   ? 29.741 18.335 -3.704  1.00 56.46 ? 3    GLU B C   1 
ATOM   1259 O  O   . GLU B 1 3   ? 30.866 18.811 -3.865  1.00 58.70 ? 3    GLU B O   1 
ATOM   1260 C  CB  . GLU B 1 3   ? 29.958 17.298 -1.450  1.00 68.20 ? 3    GLU B CB  1 
ATOM   1261 C  CG  . GLU B 1 3   ? 28.895 16.848 -0.452  1.00 67.90 ? 3    GLU B CG  1 
ATOM   1262 C  CD  . GLU B 1 3   ? 29.320 16.988 1.004   1.00 81.28 ? 3    GLU B CD  1 
ATOM   1263 O  OE1 . GLU B 1 3   ? 29.600 18.130 1.434   1.00 73.63 ? 3    GLU B OE1 1 
ATOM   1264 O  OE2 . GLU B 1 3   ? 29.351 15.953 1.719   1.00 82.37 ? 3    GLU B OE2 1 
ATOM   1265 N  N   . VAL B 1 4   ? 28.636 18.881 -4.194  1.00 45.11 ? 4    VAL B N   1 
ATOM   1266 C  CA  . VAL B 1 4   ? 28.655 20.113 -4.943  1.00 42.49 ? 4    VAL B CA  1 
ATOM   1267 C  C   . VAL B 1 4   ? 28.121 21.226 -4.042  1.00 37.84 ? 4    VAL B C   1 
ATOM   1268 O  O   . VAL B 1 4   ? 26.976 21.120 -3.540  1.00 33.07 ? 4    VAL B O   1 
ATOM   1269 C  CB  . VAL B 1 4   ? 27.821 20.009 -6.250  1.00 43.35 ? 4    VAL B CB  1 
ATOM   1270 C  CG1 . VAL B 1 4   ? 27.801 21.368 -7.005  1.00 43.87 ? 4    VAL B CG1 1 
ATOM   1271 C  CG2 . VAL B 1 4   ? 28.390 18.911 -7.157  1.00 49.46 ? 4    VAL B CG2 1 
ATOM   1272 N  N   . PRO B 1 5   ? 28.939 22.277 -3.815  1.00 38.53 ? 5    PRO B N   1 
ATOM   1273 C  CA  . PRO B 1 5   ? 28.492 23.413 -3.024  1.00 36.72 ? 5    PRO B CA  1 
ATOM   1274 C  C   . PRO B 1 5   ? 27.465 24.262 -3.760  1.00 33.73 ? 5    PRO B C   1 
ATOM   1275 O  O   . PRO B 1 5   ? 27.595 24.531 -4.945  1.00 35.62 ? 5    PRO B O   1 
ATOM   1276 C  CB  . PRO B 1 5   ? 29.775 24.203 -2.744  1.00 41.40 ? 5    PRO B CB  1 
ATOM   1277 C  CG  . PRO B 1 5   ? 30.722 23.807 -3.791  1.00 47.68 ? 5    PRO B CG  1 
ATOM   1278 C  CD  . PRO B 1 5   ? 30.351 22.421 -4.231  1.00 44.53 ? 5    PRO B CD  1 
ATOM   1279 N  N   . ILE B 1 6   ? 26.436 24.648 -3.033  1.00 31.47 ? 6    ILE B N   1 
ATOM   1280 C  CA  . ILE B 1 6   ? 25.388 25.500 -3.541  1.00 33.91 ? 6    ILE B CA  1 
ATOM   1281 C  C   . ILE B 1 6   ? 25.631 26.889 -2.990  1.00 36.65 ? 6    ILE B C   1 
ATOM   1282 O  O   . ILE B 1 6   ? 25.497 27.145 -1.780  1.00 35.58 ? 6    ILE B O   1 
ATOM   1283 C  CB  . ILE B 1 6   ? 24.000 24.975 -3.152  1.00 33.08 ? 6    ILE B CB  1 
ATOM   1284 C  CG1 . ILE B 1 6   ? 23.720 23.652 -3.873  1.00 31.81 ? 6    ILE B CG1 1 
ATOM   1285 C  CG2 . ILE B 1 6   ? 22.932 25.992 -3.466  1.00 34.89 ? 6    ILE B CG2 1 
ATOM   1286 C  CD1 . ILE B 1 6   ? 22.524 22.909 -3.341  1.00 32.62 ? 6    ILE B CD1 1 
ATOM   1287 N  N   . GLY B 1 7   ? 26.022 27.778 -3.882  1.00 40.82 ? 7    GLY B N   1 
ATOM   1288 C  CA  . GLY B 1 7   ? 26.265 29.158 -3.528  1.00 46.08 ? 7    GLY B CA  1 
ATOM   1289 C  C   . GLY B 1 7   ? 27.343 29.255 -2.462  1.00 43.89 ? 7    GLY B C   1 
ATOM   1290 O  O   . GLY B 1 7   ? 28.276 28.448 -2.423  1.00 39.80 ? 7    GLY B O   1 
ATOM   1291 N  N   . ASP B 1 8   ? 27.200 30.261 -1.608  1.00 46.41 ? 8    ASP B N   1 
ATOM   1292 C  CA  . ASP B 1 8   ? 28.182 30.566 -0.588  1.00 48.10 ? 8    ASP B CA  1 
ATOM   1293 C  C   . ASP B 1 8   ? 27.526 30.404 0.760   1.00 47.38 ? 8    ASP B C   1 
ATOM   1294 O  O   . ASP B 1 8   ? 26.352 30.765 0.929   1.00 49.33 ? 8    ASP B O   1 
ATOM   1295 C  CB  . ASP B 1 8   ? 28.667 32.010 -0.729  1.00 52.86 ? 8    ASP B CB  1 
ATOM   1296 C  CG  . ASP B 1 8   ? 29.547 32.217 -1.939  1.00 58.71 ? 8    ASP B CG  1 
ATOM   1297 O  OD1 . ASP B 1 8   ? 30.492 31.414 -2.149  1.00 61.37 ? 8    ASP B OD1 1 
ATOM   1298 O  OD2 . ASP B 1 8   ? 29.300 33.198 -2.673  1.00 68.57 ? 8    ASP B OD2 1 
ATOM   1299 N  N   . PRO B 1 9   ? 28.273 29.874 1.735   1.00 47.58 ? 9    PRO B N   1 
ATOM   1300 C  CA  . PRO B 1 9   ? 27.697 29.712 3.063   1.00 49.59 ? 9    PRO B CA  1 
ATOM   1301 C  C   . PRO B 1 9   ? 27.521 31.066 3.746   1.00 54.12 ? 9    PRO B C   1 
ATOM   1302 O  O   . PRO B 1 9   ? 28.325 31.981 3.527   1.00 53.63 ? 9    PRO B O   1 
ATOM   1303 C  CB  . PRO B 1 9   ? 28.737 28.866 3.795   1.00 50.40 ? 9    PRO B CB  1 
ATOM   1304 C  CG  . PRO B 1 9   ? 30.030 29.269 3.145   1.00 52.70 ? 9    PRO B CG  1 
ATOM   1305 C  CD  . PRO B 1 9   ? 29.689 29.469 1.696   1.00 48.00 ? 9    PRO B CD  1 
ATOM   1306 N  N   . LYS B 1 10  ? 26.455 31.172 4.541   1.00 38.54 ? 10   LYS B N   1 
ATOM   1307 C  CA  . LYS B 1 10  ? 26.078 32.404 5.238   1.00 40.23 ? 10   LYS B CA  1 
ATOM   1308 C  C   . LYS B 1 10  ? 26.436 32.224 6.712   1.00 38.18 ? 10   LYS B C   1 
ATOM   1309 O  O   . LYS B 1 10  ? 26.380 31.119 7.230   1.00 37.24 ? 10   LYS B O   1 
ATOM   1310 C  CB  . LYS B 1 10  ? 24.564 32.634 5.151   1.00 42.03 ? 10   LYS B CB  1 
ATOM   1311 C  CG  . LYS B 1 10  ? 23.879 32.374 3.784   1.00 47.75 ? 10   LYS B CG  1 
ATOM   1312 C  CD  . LYS B 1 10  ? 24.244 33.388 2.749   1.00 55.59 ? 10   LYS B CD  1 
ATOM   1313 C  CE  . LYS B 1 10  ? 23.337 33.320 1.505   1.00 59.19 ? 10   LYS B CE  1 
ATOM   1314 N  NZ  . LYS B 1 10  ? 23.839 32.391 0.472   1.00 54.87 ? 10   LYS B NZ  1 
ATOM   1315 N  N   . GLU B 1 11  ? 26.793 33.323 7.368   1.00 35.85 ? 11   GLU B N   1 
ATOM   1316 C  CA  . GLU B 1 11  ? 26.921 33.370 8.802   1.00 31.93 ? 11   GLU B CA  1 
ATOM   1317 C  C   . GLU B 1 11  ? 25.792 34.236 9.286   1.00 29.97 ? 11   GLU B C   1 
ATOM   1318 O  O   . GLU B 1 11  ? 25.795 35.428 9.042   1.00 31.20 ? 11   GLU B O   1 
ATOM   1319 C  CB  . GLU B 1 11  ? 28.269 33.943 9.204   1.00 32.37 ? 11   GLU B CB  1 
ATOM   1320 C  CG  . GLU B 1 11  ? 29.424 32.991 8.816   1.00 40.79 ? 11   GLU B CG  1 
ATOM   1321 C  CD  . GLU B 1 11  ? 30.760 33.363 9.444   1.00 47.10 ? 11   GLU B CD  1 
ATOM   1322 O  OE1 . GLU B 1 11  ? 30.805 34.248 10.333  1.00 48.35 ? 11   GLU B OE1 1 
ATOM   1323 O  OE2 . GLU B 1 11  ? 31.773 32.747 9.052   1.00 52.01 ? 11   GLU B OE2 1 
ATOM   1324 N  N   . LEU B 1 12  ? 24.813 33.643 9.957   1.00 27.86 ? 12   LEU B N   1 
ATOM   1325 C  CA  . LEU B 1 12  ? 23.605 34.355 10.318  1.00 27.50 ? 12   LEU B CA  1 
ATOM   1326 C  C   . LEU B 1 12  ? 23.048 33.794 11.618  1.00 23.82 ? 12   LEU B C   1 
ATOM   1327 O  O   . LEU B 1 12  ? 22.992 32.578 11.805  1.00 21.78 ? 12   LEU B O   1 
ATOM   1328 C  CB  . LEU B 1 12  ? 22.545 34.212 9.209   1.00 28.83 ? 12   LEU B CB  1 
ATOM   1329 C  CG  . LEU B 1 12  ? 22.830 34.850 7.856   1.00 36.14 ? 12   LEU B CG  1 
ATOM   1330 C  CD1 . LEU B 1 12  ? 21.865 34.294 6.806   1.00 38.22 ? 12   LEU B CD1 1 
ATOM   1331 C  CD2 . LEU B 1 12  ? 22.699 36.342 7.994   1.00 38.99 ? 12   LEU B CD2 1 
ATOM   1332 N  N   . ASN B 1 13  ? 22.623 34.663 12.514  1.00 24.35 ? 13   ASN B N   1 
ATOM   1333 C  CA  . ASN B 1 13  ? 21.919 34.212 13.720  1.00 25.08 ? 13   ASN B CA  1 
ATOM   1334 C  C   . ASN B 1 13  ? 22.723 33.176 14.536  1.00 24.35 ? 13   ASN B C   1 
ATOM   1335 O  O   . ASN B 1 13  ? 22.162 32.265 15.111  1.00 24.65 ? 13   ASN B O   1 
ATOM   1336 C  CB  . ASN B 1 13  ? 20.525 33.658 13.358  1.00 26.79 ? 13   ASN B CB  1 
ATOM   1337 C  CG  . ASN B 1 13  ? 19.550 34.746 12.943  1.00 27.63 ? 13   ASN B CG  1 
ATOM   1338 O  OD1 . ASN B 1 13  ? 19.556 35.827 13.515  1.00 33.84 ? 13   ASN B OD1 1 
ATOM   1339 N  ND2 . ASN B 1 13  ? 18.695 34.459 11.956  1.00 28.24 ? 13   ASN B ND2 1 
ATOM   1340 N  N   . GLY B 1 14  ? 24.048 33.343 14.562  1.00 25.73 ? 14   GLY B N   1 
ATOM   1341 C  CA  . GLY B 1 14  ? 24.928 32.554 15.399  1.00 25.57 ? 14   GLY B CA  1 
ATOM   1342 C  C   . GLY B 1 14  ? 25.300 31.225 14.797  1.00 23.38 ? 14   GLY B C   1 
ATOM   1343 O  O   . GLY B 1 14  ? 25.863 30.396 15.485  1.00 24.77 ? 14   GLY B O   1 
ATOM   1344 N  N   . MET B 1 15  ? 25.014 31.049 13.496  1.00 22.40 ? 15   MET B N   1 
ATOM   1345 C  CA  . MET B 1 15  ? 25.185 29.794 12.794  1.00 22.10 ? 15   MET B CA  1 
ATOM   1346 C  C   . MET B 1 15  ? 25.881 30.019 11.444  1.00 21.63 ? 15   MET B C   1 
ATOM   1347 O  O   . MET B 1 15  ? 25.747 31.053 10.829  1.00 24.05 ? 15   MET B O   1 
ATOM   1348 C  CB  . MET B 1 15  ? 23.837 29.096 12.548  1.00 19.80 ? 15   MET B CB  1 
ATOM   1349 C  CG  . MET B 1 15  ? 22.989 28.887 13.790  1.00 22.34 ? 15   MET B CG  1 
ATOM   1350 S  SD  . MET B 1 15  ? 21.327 28.224 13.374  1.00 25.11 ? 15   MET B SD  1 
ATOM   1351 C  CE  . MET B 1 15  ? 20.474 29.695 12.786  1.00 27.02 ? 15   MET B CE  1 
ATOM   1352 N  N   . GLU B 1 16  ? 26.654 29.021 11.036  1.00 23.54 ? 16   GLU B N   1 
ATOM   1353 C  CA  . GLU B 1 16  ? 27.142 28.885 9.674   1.00 25.27 ? 16   GLU B CA  1 
ATOM   1354 C  C   . GLU B 1 16  ? 26.146 28.022 8.920   1.00 24.93 ? 16   GLU B C   1 
ATOM   1355 O  O   . GLU B 1 16  ? 25.850 26.908 9.350   1.00 24.15 ? 16   GLU B O   1 
ATOM   1356 C  CB  . GLU B 1 16  ? 28.552 28.258 9.626   1.00 27.75 ? 16   GLU B CB  1 
ATOM   1357 C  CG  . GLU B 1 16  ? 29.097 28.164 8.191   1.00 33.94 ? 16   GLU B CG  1 
ATOM   1358 C  CD  . GLU B 1 16  ? 30.432 27.419 8.051   1.00 50.00 ? 16   GLU B CD  1 
ATOM   1359 O  OE1 . GLU B 1 16  ? 31.214 27.359 9.018   1.00 54.87 ? 16   GLU B OE1 1 
ATOM   1360 O  OE2 . GLU B 1 16  ? 30.709 26.909 6.940   1.00 59.40 ? 16   GLU B OE2 1 
ATOM   1361 N  N   . ILE B 1 17  ? 25.629 28.516 7.799   1.00 24.54 ? 17   ILE B N   1 
ATOM   1362 C  CA  . ILE B 1 17  ? 24.561 27.836 7.075   1.00 26.02 ? 17   ILE B CA  1 
ATOM   1363 C  C   . ILE B 1 17  ? 24.945 27.603 5.614   1.00 27.64 ? 17   ILE B C   1 
ATOM   1364 O  O   . ILE B 1 17  ? 24.859 28.502 4.794   1.00 30.27 ? 17   ILE B O   1 
ATOM   1365 C  CB  . ILE B 1 17  ? 23.273 28.650 7.072   1.00 27.30 ? 17   ILE B CB  1 
ATOM   1366 C  CG1 . ILE B 1 17  ? 22.810 28.975 8.501   1.00 27.04 ? 17   ILE B CG1 1 
ATOM   1367 C  CG2 . ILE B 1 17  ? 22.145 27.870 6.333   1.00 30.45 ? 17   ILE B CG2 1 
ATOM   1368 C  CD1 . ILE B 1 17  ? 22.146 30.270 8.550   1.00 30.38 ? 17   ILE B CD1 1 
ATOM   1369 N  N   . ALA B 1 18  ? 25.311 26.372 5.296   1.00 23.37 ? 18   ALA B N   1 
ATOM   1370 C  CA  . ALA B 1 18  ? 25.765 26.029 3.955   1.00 24.78 ? 18   ALA B CA  1 
ATOM   1371 C  C   . ALA B 1 18  ? 24.792 25.068 3.280   1.00 24.24 ? 18   ALA B C   1 
ATOM   1372 O  O   . ALA B 1 18  ? 24.120 24.253 3.932   1.00 25.97 ? 18   ALA B O   1 
ATOM   1373 C  CB  . ALA B 1 18  ? 27.151 25.371 4.033   1.00 26.53 ? 18   ALA B CB  1 
ATOM   1374 N  N   . ALA B 1 19  ? 24.743 25.118 1.960   1.00 26.88 ? 19   ALA B N   1 
ATOM   1375 C  CA  . ALA B 1 19  ? 23.931 24.191 1.197   1.00 27.14 ? 19   ALA B CA  1 
ATOM   1376 C  C   . ALA B 1 19  ? 24.850 23.464 0.259   1.00 25.62 ? 19   ALA B C   1 
ATOM   1377 O  O   . ALA B 1 19  ? 25.774 24.055 -0.271  1.00 27.43 ? 19   ALA B O   1 
ATOM   1378 C  CB  . ALA B 1 19  ? 22.888 24.927 0.409   1.00 29.11 ? 19   ALA B CB  1 
ATOM   1379 N  N   . VAL B 1 20  ? 24.627 22.163 0.114   1.00 26.34 ? 20   VAL B N   1 
ATOM   1380 C  CA  . VAL B 1 20  ? 25.310 21.361 -0.868  1.00 29.43 ? 20   VAL B CA  1 
ATOM   1381 C  C   . VAL B 1 20  ? 24.325 20.374 -1.469  1.00 28.17 ? 20   VAL B C   1 
ATOM   1382 O  O   . VAL B 1 20  ? 23.256 20.121 -0.900  1.00 26.12 ? 20   VAL B O   1 
ATOM   1383 C  CB  . VAL B 1 20  ? 26.475 20.573 -0.254  1.00 31.20 ? 20   VAL B CB  1 
ATOM   1384 C  CG1 . VAL B 1 20  ? 27.481 21.530 0.372   1.00 36.52 ? 20   VAL B CG1 1 
ATOM   1385 C  CG2 . VAL B 1 20  ? 25.955 19.569 0.767   1.00 28.66 ? 20   VAL B CG2 1 
ATOM   1386 N  N   . TYR B 1 21  ? 24.661 19.846 -2.640  1.00 29.27 ? 21   TYR B N   1 
ATOM   1387 C  CA  . TYR B 1 21  ? 23.997 18.631 -3.096  1.00 29.15 ? 21   TYR B CA  1 
ATOM   1388 C  C   . TYR B 1 21  ? 24.957 17.486 -3.397  1.00 31.16 ? 21   TYR B C   1 
ATOM   1389 O  O   . TYR B 1 21  ? 26.132 17.694 -3.695  1.00 33.59 ? 21   TYR B O   1 
ATOM   1390 C  CB  . TYR B 1 21  ? 23.014 18.902 -4.240  1.00 29.58 ? 21   TYR B CB  1 
ATOM   1391 C  CG  . TYR B 1 21  ? 23.606 19.180 -5.579  1.00 31.13 ? 21   TYR B CG  1 
ATOM   1392 C  CD1 . TYR B 1 21  ? 23.811 18.164 -6.484  1.00 34.86 ? 21   TYR B CD1 1 
ATOM   1393 C  CD2 . TYR B 1 21  ? 23.889 20.479 -5.975  1.00 35.65 ? 21   TYR B CD2 1 
ATOM   1394 C  CE1 . TYR B 1 21  ? 24.322 18.423 -7.719  1.00 39.07 ? 21   TYR B CE1 1 
ATOM   1395 C  CE2 . TYR B 1 21  ? 24.396 20.746 -7.214  1.00 41.73 ? 21   TYR B CE2 1 
ATOM   1396 C  CZ  . TYR B 1 21  ? 24.608 19.720 -8.088  1.00 39.09 ? 21   TYR B CZ  1 
ATOM   1397 O  OH  . TYR B 1 21  ? 25.125 19.991 -9.334  1.00 45.51 ? 21   TYR B OH  1 
ATOM   1398 N  N   . LEU B 1 22  ? 24.440 16.272 -3.249  1.00 32.07 ? 22   LEU B N   1 
ATOM   1399 C  CA  . LEU B 1 22  ? 25.215 15.043 -3.362  1.00 32.97 ? 22   LEU B CA  1 
ATOM   1400 C  C   . LEU B 1 22  ? 24.430 14.045 -4.171  1.00 30.97 ? 22   LEU B C   1 
ATOM   1401 O  O   . LEU B 1 22  ? 23.300 14.330 -4.567  1.00 28.54 ? 22   LEU B O   1 
ATOM   1402 C  CB  . LEU B 1 22  ? 25.461 14.407 -1.986  1.00 34.32 ? 22   LEU B CB  1 
ATOM   1403 C  CG  . LEU B 1 22  ? 25.586 15.126 -0.655  1.00 37.58 ? 22   LEU B CG  1 
ATOM   1404 C  CD1 . LEU B 1 22  ? 24.323 15.815 -0.275  1.00 44.72 ? 22   LEU B CD1 1 
ATOM   1405 C  CD2 . LEU B 1 22  ? 25.955 14.062 0.393   1.00 46.44 ? 22   LEU B CD2 1 
ATOM   1406 N  N   . GLN B 1 23  ? 25.018 12.871 -4.397  1.00 30.36 ? 23   GLN B N   1 
ATOM   1407 C  CA  . GLN B 1 23  ? 24.303 11.754 -4.967  1.00 31.55 ? 23   GLN B CA  1 
ATOM   1408 C  C   . GLN B 1 23  ? 23.148 11.402 -4.013  1.00 27.04 ? 23   GLN B C   1 
ATOM   1409 O  O   . GLN B 1 23  ? 23.227 11.664 -2.807  1.00 25.82 ? 23   GLN B O   1 
ATOM   1410 C  CB  . GLN B 1 23  ? 25.221 10.534 -5.162  1.00 36.94 ? 23   GLN B CB  1 
ATOM   1411 C  CG  . GLN B 1 23  ? 25.730 9.819  -3.863  1.00 45.31 ? 23   GLN B CG  1 
ATOM   1412 C  CD  . GLN B 1 23  ? 26.843 10.572 -3.064  1.00 50.59 ? 23   GLN B CD  1 
ATOM   1413 O  OE1 . GLN B 1 23  ? 27.306 11.650 -3.462  1.00 45.42 ? 23   GLN B OE1 1 
ATOM   1414 N  NE2 . GLN B 1 23  ? 27.263 9.988  -1.931  1.00 49.26 ? 23   GLN B NE2 1 
ATOM   1415 N  N   . PRO B 1 24  ? 22.078 10.804 -4.539  1.00 25.11 ? 24   PRO B N   1 
ATOM   1416 C  CA  . PRO B 1 24  ? 21.023 10.342 -3.636  1.00 26.39 ? 24   PRO B CA  1 
ATOM   1417 C  C   . PRO B 1 24  ? 21.561 9.443  -2.531  1.00 27.81 ? 24   PRO B C   1 
ATOM   1418 O  O   . PRO B 1 24  ? 22.479 8.664  -2.751  1.00 32.30 ? 24   PRO B O   1 
ATOM   1419 C  CB  . PRO B 1 24  ? 20.097 9.562  -4.564  1.00 28.83 ? 24   PRO B CB  1 
ATOM   1420 C  CG  . PRO B 1 24  ? 20.241 10.248 -5.859  1.00 29.72 ? 24   PRO B CG  1 
ATOM   1421 C  CD  . PRO B 1 24  ? 21.707 10.596 -5.949  1.00 29.29 ? 24   PRO B CD  1 
ATOM   1422 N  N   . ILE B 1 25  ? 20.982 9.557  -1.350  1.00 28.09 ? 25   ILE B N   1 
ATOM   1423 C  CA  . ILE B 1 25  ? 21.456 8.853  -0.191  1.00 28.27 ? 25   ILE B CA  1 
ATOM   1424 C  C   . ILE B 1 25  ? 20.444 7.764  0.155   1.00 29.16 ? 25   ILE B C   1 
ATOM   1425 O  O   . ILE B 1 25  ? 19.239 8.029  0.371   1.00 28.50 ? 25   ILE B O   1 
ATOM   1426 C  CB  . ILE B 1 25  ? 21.620 9.827  1.003   1.00 30.25 ? 25   ILE B CB  1 
ATOM   1427 C  CG1 . ILE B 1 25  ? 22.738 10.852 0.707   1.00 29.91 ? 25   ILE B CG1 1 
ATOM   1428 C  CG2 . ILE B 1 25  ? 21.941 9.090  2.284   1.00 30.69 ? 25   ILE B CG2 1 
ATOM   1429 C  CD1 . ILE B 1 25  ? 24.091 10.227 0.403   1.00 30.48 ? 25   ILE B CD1 1 
ATOM   1430 N  N   . GLU B 1 26  ? 20.936 6.538  0.219   1.00 29.26 ? 26   GLU B N   1 
ATOM   1431 C  CA  . GLU B 1 26  ? 20.138 5.459  0.753   1.00 28.28 ? 26   GLU B CA  1 
ATOM   1432 C  C   . GLU B 1 26  ? 20.048 5.657  2.264   1.00 23.90 ? 26   GLU B C   1 
ATOM   1433 O  O   . GLU B 1 26  ? 21.055 5.692  2.975   1.00 23.81 ? 26   GLU B O   1 
ATOM   1434 C  CB  . GLU B 1 26  ? 20.758 4.113  0.431   1.00 30.20 ? 26   GLU B CB  1 
ATOM   1435 C  CG  . GLU B 1 26  ? 19.830 2.921  0.672   1.00 34.22 ? 26   GLU B CG  1 
ATOM   1436 C  CD  . GLU B 1 26  ? 18.614 2.895  -0.270  1.00 38.50 ? 26   GLU B CD  1 
ATOM   1437 O  OE1 . GLU B 1 26  ? 18.764 3.149  -1.477  1.00 40.21 ? 26   GLU B OE1 1 
ATOM   1438 O  OE2 . GLU B 1 26  ? 17.498 2.616  0.210   1.00 46.96 ? 26   GLU B OE2 1 
ATOM   1439 N  N   . MET B 1 27  ? 18.829 5.765  2.755   1.00 26.34 ? 27   MET B N   1 
ATOM   1440 C  CA  . MET B 1 27  ? 18.600 6.150  4.125   1.00 26.37 ? 27   MET B CA  1 
ATOM   1441 C  C   . MET B 1 27  ? 17.633 5.236  4.834   1.00 26.77 ? 27   MET B C   1 
ATOM   1442 O  O   . MET B 1 27  ? 16.717 4.694  4.254   1.00 30.88 ? 27   MET B O   1 
ATOM   1443 C  CB  . MET B 1 27  ? 18.088 7.609  4.194   1.00 25.01 ? 27   MET B CB  1 
ATOM   1444 C  CG  . MET B 1 27  ? 18.215 8.278  5.566   1.00 32.28 ? 27   MET B CG  1 
ATOM   1445 S  SD  . MET B 1 27  ? 17.100 9.687  5.768   1.00 33.71 ? 27   MET B SD  1 
ATOM   1446 C  CE  . MET B 1 27  ? 15.516 8.835  5.915   1.00 33.48 ? 27   MET B CE  1 
ATOM   1447 N  N   . GLU B 1 28  ? 17.858 5.047  6.120   1.00 26.13 ? 28   GLU B N   1 
ATOM   1448 C  CA  . GLU B 1 28  ? 16.890 4.348  6.944   1.00 30.60 ? 28   GLU B CA  1 
ATOM   1449 C  C   . GLU B 1 28  ? 16.455 5.260  8.078   1.00 31.47 ? 28   GLU B C   1 
ATOM   1450 O  O   . GLU B 1 28  ? 17.163 6.207  8.420   1.00 29.59 ? 28   GLU B O   1 
ATOM   1451 C  CB  . GLU B 1 28  ? 17.487 3.060  7.475   1.00 34.04 ? 28   GLU B CB  1 
ATOM   1452 C  CG  . GLU B 1 28  ? 17.477 1.991  6.421   1.00 38.97 ? 28   GLU B CG  1 
ATOM   1453 C  CD  . GLU B 1 28  ? 17.750 0.616  6.959   1.00 49.57 ? 28   GLU B CD  1 
ATOM   1454 O  OE1 . GLU B 1 28  ? 17.818 0.454  8.199   1.00 56.51 ? 28   GLU B OE1 1 
ATOM   1455 O  OE2 . GLU B 1 28  ? 17.898 -0.302 6.133   1.00 53.37 ? 28   GLU B OE2 1 
ATOM   1456 N  N   . PRO B 1 29  ? 15.284 4.998  8.666   1.00 35.78 ? 29   PRO B N   1 
ATOM   1457 C  CA  . PRO B 1 29  ? 14.332 3.944  8.317   1.00 35.73 ? 29   PRO B CA  1 
ATOM   1458 C  C   . PRO B 1 29  ? 13.658 4.236  6.985   1.00 35.23 ? 29   PRO B C   1 
ATOM   1459 O  O   . PRO B 1 29  ? 13.482 5.384  6.628   1.00 37.28 ? 29   PRO B O   1 
ATOM   1460 C  CB  . PRO B 1 29  ? 13.303 4.019  9.448   1.00 37.82 ? 29   PRO B CB  1 
ATOM   1461 C  CG  . PRO B 1 29  ? 13.307 5.418  9.852   1.00 42.22 ? 29   PRO B CG  1 
ATOM   1462 C  CD  . PRO B 1 29  ? 14.730 5.912  9.685   1.00 38.59 ? 29   PRO B CD  1 
ATOM   1463 N  N   . ARG B 1 30  ? 13.293 3.198  6.263   1.00 37.18 ? 30   ARG B N   1 
ATOM   1464 C  CA  . ARG B 1 30  ? 12.660 3.361  4.953   1.00 41.21 ? 30   ARG B CA  1 
ATOM   1465 C  C   . ARG B 1 30  ? 11.280 3.966  5.096   1.00 43.27 ? 30   ARG B C   1 
ATOM   1466 O  O   . ARG B 1 30  ? 10.632 3.811  6.133   1.00 43.73 ? 30   ARG B O   1 
ATOM   1467 C  CB  . ARG B 1 30  ? 12.568 2.013  4.248   1.00 45.42 ? 30   ARG B CB  1 
ATOM   1468 C  CG  . ARG B 1 30  ? 13.933 1.374  4.025   1.00 50.53 ? 30   ARG B CG  1 
ATOM   1469 C  CD  . ARG B 1 30  ? 13.918 -0.110 4.320   1.00 61.14 ? 30   ARG B CD  1 
ATOM   1470 N  NE  . ARG B 1 30  ? 13.580 -0.897 3.144   1.00 67.43 ? 30   ARG B NE  1 
ATOM   1471 C  CZ  . ARG B 1 30  ? 13.523 -2.225 3.133   1.00 71.17 ? 30   ARG B CZ  1 
ATOM   1472 N  NH1 . ARG B 1 30  ? 13.768 -2.927 4.238   1.00 73.66 ? 30   ARG B NH1 1 
ATOM   1473 N  NH2 . ARG B 1 30  ? 13.225 -2.856 2.012   1.00 72.07 ? 30   ARG B NH2 1 
ATOM   1474 N  N   . GLY B 1 31  ? 10.858 4.687  4.063   1.00 45.50 ? 31   GLY B N   1 
ATOM   1475 C  CA  . GLY B 1 31  ? 9.533  5.286  4.028   1.00 51.13 ? 31   GLY B CA  1 
ATOM   1476 C  C   . GLY B 1 31  ? 9.445  6.745  4.441   1.00 52.35 ? 31   GLY B C   1 
ATOM   1477 O  O   . GLY B 1 31  ? 8.511  7.428  4.024   1.00 56.80 ? 31   GLY B O   1 
ATOM   1478 N  N   . ILE B 1 32  ? 10.383 7.228  5.263   1.00 49.15 ? 32   ILE B N   1 
ATOM   1479 C  CA  . ILE B 1 32  ? 10.341 8.623  5.729   1.00 50.16 ? 32   ILE B CA  1 
ATOM   1480 C  C   . ILE B 1 32  ? 10.659 9.610  4.604   1.00 47.82 ? 32   ILE B C   1 
ATOM   1481 O  O   . ILE B 1 32  ? 10.053 10.676 4.524   1.00 49.77 ? 32   ILE B O   1 
ATOM   1482 C  CB  . ILE B 1 32  ? 11.342 8.933  6.866   1.00 50.05 ? 32   ILE B CB  1 
ATOM   1483 C  CG1 . ILE B 1 32  ? 11.141 8.034  8.080   1.00 53.74 ? 32   ILE B CG1 1 
ATOM   1484 C  CG2 . ILE B 1 32  ? 11.170 10.381 7.350   1.00 54.17 ? 32   ILE B CG2 1 
ATOM   1485 C  CD1 . ILE B 1 32  ? 12.078 8.417  9.223   1.00 53.62 ? 32   ILE B CD1 1 
ATOM   1486 N  N   . ASP B 1 33  ? 11.618 9.266  3.755   1.00 43.34 ? 33   ASP B N   1 
ATOM   1487 C  CA  . ASP B 1 33  ? 12.036 10.153 2.667   1.00 42.16 ? 33   ASP B CA  1 
ATOM   1488 C  C   . ASP B 1 33  ? 11.983 9.426  1.348   1.00 40.80 ? 33   ASP B C   1 
ATOM   1489 O  O   . ASP B 1 33  ? 11.979 8.205  1.319   1.00 38.19 ? 33   ASP B O   1 
ATOM   1490 C  CB  . ASP B 1 33  ? 13.464 10.671 2.891   1.00 39.12 ? 33   ASP B CB  1 
ATOM   1491 C  CG  . ASP B 1 33  ? 13.797 11.890 2.024   1.00 39.14 ? 33   ASP B CG  1 
ATOM   1492 O  OD1 . ASP B 1 33  ? 12.864 12.643 1.646   1.00 41.51 ? 33   ASP B OD1 1 
ATOM   1493 O  OD2 . ASP B 1 33  ? 14.986 12.094 1.723   1.00 31.52 ? 33   ASP B OD2 1 
ATOM   1494 N  N   . LEU B 1 34  ? 11.964 10.192 0.258   1.00 31.57 ? 34   LEU B N   1 
ATOM   1495 C  CA  . LEU B 1 34  ? 12.067 9.631  -1.092  1.00 31.40 ? 34   LEU B CA  1 
ATOM   1496 C  C   . LEU B 1 34  ? 13.201 8.641  -1.172  1.00 31.70 ? 34   LEU B C   1 
ATOM   1497 O  O   . LEU B 1 34  ? 14.310 8.903  -0.716  1.00 30.52 ? 34   LEU B O   1 
ATOM   1498 C  CB  . LEU B 1 34  ? 12.306 10.701 -2.140  1.00 30.30 ? 34   LEU B CB  1 
ATOM   1499 C  CG  . LEU B 1 34  ? 12.274 10.264 -3.609  1.00 30.84 ? 34   LEU B CG  1 
ATOM   1500 C  CD1 . LEU B 1 34  ? 10.912 9.704  -4.039  1.00 32.47 ? 34   LEU B CD1 1 
ATOM   1501 C  CD2 . LEU B 1 34  ? 12.658 11.454 -4.477  1.00 30.81 ? 34   LEU B CD2 1 
ATOM   1502 N  N   . ALA B 1 35  ? 12.908 7.493  -1.751  1.00 32.70 ? 35   ALA B N   1 
ATOM   1503 C  CA  . ALA B 1 35  ? 13.897 6.449  -1.923  1.00 33.60 ? 35   ALA B CA  1 
ATOM   1504 C  C   . ALA B 1 35  ? 15.018 6.947  -2.835  1.00 31.61 ? 35   ALA B C   1 
ATOM   1505 O  O   . ALA B 1 35  ? 14.766 7.644  -3.843  1.00 29.41 ? 35   ALA B O   1 
ATOM   1506 C  CB  . ALA B 1 35  ? 13.251 5.215  -2.503  1.00 35.23 ? 35   ALA B CB  1 
ATOM   1507 N  N   . ALA B 1 36  ? 16.257 6.557  -2.500  1.00 30.45 ? 36   ALA B N   1 
ATOM   1508 C  CA  . ALA B 1 36  ? 17.413 6.948  -3.323  1.00 30.19 ? 36   ALA B CA  1 
ATOM   1509 C  C   . ALA B 1 36  ? 17.309 6.593  -4.811  1.00 32.37 ? 36   ALA B C   1 
ATOM   1510 O  O   . ALA B 1 36  ? 17.708 7.392  -5.660  1.00 31.74 ? 36   ALA B O   1 
ATOM   1511 C  CB  . ALA B 1 36  ? 18.736 6.426  -2.721  1.00 30.36 ? 36   ALA B CB  1 
ATOM   1512 N  N   . SER B 1 37  ? 16.773 5.412  -5.133  1.00 34.37 ? 37   SER B N   1 
ATOM   1513 C  CA  . SER B 1 37  ? 16.639 4.974  -6.530  1.00 37.16 ? 37   SER B CA  1 
ATOM   1514 C  C   . SER B 1 37  ? 15.657 5.817  -7.361  1.00 36.38 ? 37   SER B C   1 
ATOM   1515 O  O   . SER B 1 37  ? 15.695 5.785  -8.596  1.00 37.83 ? 37   SER B O   1 
ATOM   1516 C  CB  . SER B 1 37  ? 16.169 3.517  -6.580  1.00 39.10 ? 37   SER B CB  1 
ATOM   1517 O  OG  . SER B 1 37  ? 14.895 3.420  -5.967  1.00 40.45 ? 37   SER B OG  1 
ATOM   1518 N  N   . LEU B 1 38  ? 14.767 6.528  -6.677  1.00 32.62 ? 38   LEU B N   1 
ATOM   1519 C  CA  . LEU B 1 38  ? 13.784 7.382  -7.311  1.00 33.37 ? 38   LEU B CA  1 
ATOM   1520 C  C   . LEU B 1 38  ? 14.228 8.841  -7.331  1.00 30.25 ? 38   LEU B C   1 
ATOM   1521 O  O   . LEU B 1 38  ? 13.462 9.708  -7.740  1.00 34.11 ? 38   LEU B O   1 
ATOM   1522 C  CB  . LEU B 1 38  ? 12.439 7.259  -6.590  1.00 35.36 ? 38   LEU B CB  1 
ATOM   1523 C  CG  . LEU B 1 38  ? 11.902 5.831  -6.398  1.00 39.65 ? 38   LEU B CG  1 
ATOM   1524 C  CD1 . LEU B 1 38  ? 10.636 5.805  -5.517  1.00 46.34 ? 38   LEU B CD1 1 
ATOM   1525 C  CD2 . LEU B 1 38  ? 11.636 5.223  -7.743  1.00 41.91 ? 38   LEU B CD2 1 
ATOM   1526 N  N   . ALA B 1 39  ? 15.457 9.117  -6.888  1.00 28.16 ? 39   ALA B N   1 
ATOM   1527 C  CA  . ALA B 1 39  ? 15.974 10.489 -6.763  1.00 27.44 ? 39   ALA B CA  1 
ATOM   1528 C  C   . ALA B 1 39  ? 17.167 10.706 -7.682  1.00 27.22 ? 39   ALA B C   1 
ATOM   1529 O  O   . ALA B 1 39  ? 17.745 9.764  -8.180  1.00 29.06 ? 39   ALA B O   1 
ATOM   1530 C  CB  . ALA B 1 39  ? 16.412 10.758 -5.332  1.00 24.40 ? 39   ALA B CB  1 
ATOM   1531 N  N   . ASP B 1 40  ? 17.527 11.969 -7.881  1.00 26.45 ? 40   ASP B N   1 
ATOM   1532 C  CA  . ASP B 1 40  ? 18.734 12.350 -8.619  1.00 27.59 ? 40   ASP B CA  1 
ATOM   1533 C  C   . ASP B 1 40  ? 19.776 13.045 -7.774  1.00 26.12 ? 40   ASP B C   1 
ATOM   1534 O  O   . ASP B 1 40  ? 20.964 13.012 -8.100  1.00 25.50 ? 40   ASP B O   1 
ATOM   1535 C  CB  . ASP B 1 40  ? 18.368 13.237 -9.801  1.00 28.94 ? 40   ASP B CB  1 
ATOM   1536 C  CG  . ASP B 1 40  ? 17.520 12.510 -10.801 1.00 32.60 ? 40   ASP B CG  1 
ATOM   1537 O  OD1 . ASP B 1 40  ? 18.079 11.633 -11.522 1.00 34.23 ? 40   ASP B OD1 1 
ATOM   1538 O  OD2 . ASP B 1 40  ? 16.303 12.801 -10.839 1.00 34.41 ? 40   ASP B OD2 1 
ATOM   1539 N  N   . ILE B 1 41  ? 19.346 13.659 -6.683  1.00 25.05 ? 41   ILE B N   1 
ATOM   1540 C  CA  . ILE B 1 41  ? 20.265 14.309 -5.774  1.00 25.50 ? 41   ILE B CA  1 
ATOM   1541 C  C   . ILE B 1 41  ? 19.794 14.184 -4.339  1.00 22.76 ? 41   ILE B C   1 
ATOM   1542 O  O   . ILE B 1 41  ? 18.647 13.847 -4.056  1.00 25.34 ? 41   ILE B O   1 
ATOM   1543 C  CB  . ILE B 1 41  ? 20.470 15.828 -6.072  1.00 27.22 ? 41   ILE B CB  1 
ATOM   1544 C  CG1 . ILE B 1 41  ? 19.197 16.634 -5.804  1.00 24.65 ? 41   ILE B CG1 1 
ATOM   1545 C  CG2 . ILE B 1 41  ? 21.024 16.076 -7.519  1.00 30.04 ? 41   ILE B CG2 1 
ATOM   1546 C  CD1 . ILE B 1 41  ? 19.413 18.143 -5.948  1.00 27.21 ? 41   ILE B CD1 1 
ATOM   1547 N  N   . HIS B 1 42  ? 20.727 14.461 -3.454  1.00 21.73 ? 42   HIS B N   1 
ATOM   1548 C  CA  . HIS B 1 42  ? 20.429 14.698 -2.048  1.00 21.92 ? 42   HIS B CA  1 
ATOM   1549 C  C   . HIS B 1 42  ? 20.789 16.139 -1.751  1.00 26.31 ? 42   HIS B C   1 
ATOM   1550 O  O   . HIS B 1 42  ? 21.937 16.562 -1.948  1.00 28.43 ? 42   HIS B O   1 
ATOM   1551 C  CB  . HIS B 1 42  ? 21.243 13.804 -1.171  1.00 22.11 ? 42   HIS B CB  1 
ATOM   1552 C  CG  . HIS B 1 42  ? 20.820 13.847 0.256   1.00 20.75 ? 42   HIS B CG  1 
ATOM   1553 N  ND1 . HIS B 1 42  ? 19.724 13.148 0.713   1.00 24.55 ? 42   HIS B ND1 1 
ATOM   1554 C  CD2 . HIS B 1 42  ? 21.352 14.472 1.334   1.00 24.12 ? 42   HIS B CD2 1 
ATOM   1555 C  CE1 . HIS B 1 42  ? 19.610 13.336 2.020   1.00 29.58 ? 42   HIS B CE1 1 
ATOM   1556 N  NE2 . HIS B 1 42  ? 20.565 14.159 2.413   1.00 22.89 ? 42   HIS B NE2 1 
ATOM   1557 N  N   . LEU B 1 43  ? 19.793 16.891 -1.319  1.00 23.08 ? 43   LEU B N   1 
ATOM   1558 C  CA  . LEU B 1 43  ? 19.956 18.298 -0.961  1.00 24.12 ? 43   LEU B CA  1 
ATOM   1559 C  C   . LEU B 1 43  ? 20.227 18.319 0.524   1.00 22.55 ? 43   LEU B C   1 
ATOM   1560 O  O   . LEU B 1 43  ? 19.461 17.755 1.300   1.00 23.03 ? 43   LEU B O   1 
ATOM   1561 C  CB  . LEU B 1 43  ? 18.686 19.074 -1.244  1.00 21.81 ? 43   LEU B CB  1 
ATOM   1562 C  CG  . LEU B 1 43  ? 18.669 20.560 -0.867  1.00 25.51 ? 43   LEU B CG  1 
ATOM   1563 C  CD1 . LEU B 1 43  ? 19.813 21.293 -1.558  1.00 26.59 ? 43   LEU B CD1 1 
ATOM   1564 C  CD2 . LEU B 1 43  ? 17.327 21.165 -1.235  1.00 29.25 ? 43   LEU B CD2 1 
ATOM   1565 N  N   . GLU B 1 44  ? 21.302 18.986 0.904   1.00 23.43 ? 44   GLU B N   1 
ATOM   1566 C  CA  . GLU B 1 44  ? 21.747 19.037 2.280   1.00 22.32 ? 44   GLU B CA  1 
ATOM   1567 C  C   . GLU B 1 44  ? 21.946 20.462 2.785   1.00 21.67 ? 44   GLU B C   1 
ATOM   1568 O  O   . GLU B 1 44  ? 22.465 21.301 2.072   1.00 22.33 ? 44   GLU B O   1 
ATOM   1569 C  CB  . GLU B 1 44  ? 23.023 18.198 2.374   1.00 24.31 ? 44   GLU B CB  1 
ATOM   1570 C  CG  . GLU B 1 44  ? 23.818 18.363 3.627   1.00 25.05 ? 44   GLU B CG  1 
ATOM   1571 C  CD  . GLU B 1 44  ? 24.860 17.283 3.812   1.00 30.44 ? 44   GLU B CD  1 
ATOM   1572 O  OE1 . GLU B 1 44  ? 24.758 16.233 3.154   1.00 29.62 ? 44   GLU B OE1 1 
ATOM   1573 O  OE2 . GLU B 1 44  ? 25.781 17.477 4.652   1.00 30.29 ? 44   GLU B OE2 1 
ATOM   1574 N  N   . ALA B 1 45  ? 21.548 20.715 4.035   1.00 21.63 ? 45   ALA B N   1 
ATOM   1575 C  CA  . ALA B 1 45  ? 21.832 21.949 4.737   1.00 21.27 ? 45   ALA B CA  1 
ATOM   1576 C  C   . ALA B 1 45  ? 22.777 21.562 5.854   1.00 21.01 ? 45   ALA B C   1 
ATOM   1577 O  O   . ALA B 1 45  ? 22.501 20.644 6.647   1.00 21.96 ? 45   ALA B O   1 
ATOM   1578 C  CB  . ALA B 1 45  ? 20.559 22.600 5.349   1.00 21.14 ? 45   ALA B CB  1 
ATOM   1579 N  N   . ASP B 1 46  ? 23.914 22.250 5.871   1.00 21.07 ? 46   ASP B N   1 
ATOM   1580 C  CA  . ASP B 1 46  ? 24.951 22.066 6.892   1.00 20.83 ? 46   ASP B CA  1 
ATOM   1581 C  C   . ASP B 1 46  ? 24.928 23.302 7.760   1.00 19.05 ? 46   ASP B C   1 
ATOM   1582 O  O   . ASP B 1 46  ? 25.273 24.418 7.325   1.00 20.96 ? 46   ASP B O   1 
ATOM   1583 C  CB  . ASP B 1 46  ? 26.286 21.875 6.212   1.00 22.33 ? 46   ASP B CB  1 
ATOM   1584 C  CG  . ASP B 1 46  ? 26.399 20.552 5.487   1.00 29.34 ? 46   ASP B CG  1 
ATOM   1585 O  OD1 . ASP B 1 46  ? 25.784 19.542 5.928   1.00 28.03 ? 46   ASP B OD1 1 
ATOM   1586 O  OD2 . ASP B 1 46  ? 27.141 20.526 4.473   1.00 35.33 ? 46   ASP B OD2 1 
ATOM   1587 N  N   . ILE B 1 47  ? 24.474 23.092 8.994   1.00 20.32 ? 47   ILE B N   1 
ATOM   1588 C  CA  . ILE B 1 47  ? 24.224 24.153 9.910   1.00 20.22 ? 47   ILE B CA  1 
ATOM   1589 C  C   . ILE B 1 47  ? 24.899 23.879 11.238  1.00 20.30 ? 47   ILE B C   1 
ATOM   1590 O  O   . ILE B 1 47  ? 24.564 22.908 11.911  1.00 20.53 ? 47   ILE B O   1 
ATOM   1591 C  CB  . ILE B 1 47  ? 22.715 24.397 10.120  1.00 20.02 ? 47   ILE B CB  1 
ATOM   1592 C  CG1 . ILE B 1 47  ? 22.041 24.570 8.762   1.00 21.79 ? 47   ILE B CG1 1 
ATOM   1593 C  CG2 . ILE B 1 47  ? 22.464 25.669 10.993  1.00 18.55 ? 47   ILE B CG2 1 
ATOM   1594 C  CD1 . ILE B 1 47  ? 20.549 24.839 8.797   1.00 23.36 ? 47   ILE B CD1 1 
ATOM   1595 N  N   . HIS B 1 48  ? 25.863 24.738 11.590  1.00 18.08 ? 48   HIS B N   1 
ATOM   1596 C  CA  . HIS B 1 48  ? 26.655 24.592 12.807  1.00 17.68 ? 48   HIS B CA  1 
ATOM   1597 C  C   . HIS B 1 48  ? 26.826 25.880 13.524  1.00 17.99 ? 48   HIS B C   1 
ATOM   1598 O  O   . HIS B 1 48  ? 26.769 26.954 12.901  1.00 19.67 ? 48   HIS B O   1 
ATOM   1599 C  CB  . HIS B 1 48  ? 28.036 23.982 12.485  1.00 17.84 ? 48   HIS B CB  1 
ATOM   1600 C  CG  . HIS B 1 48  ? 27.958 22.615 11.879  1.00 17.37 ? 48   HIS B CG  1 
ATOM   1601 N  ND1 . HIS B 1 48  ? 27.702 22.420 10.529  1.00 20.26 ? 48   HIS B ND1 1 
ATOM   1602 C  CD2 . HIS B 1 48  ? 28.075 21.385 12.424  1.00 21.10 ? 48   HIS B CD2 1 
ATOM   1603 C  CE1 . HIS B 1 48  ? 27.661 21.114 10.286  1.00 22.55 ? 48   HIS B CE1 1 
ATOM   1604 N  NE2 . HIS B 1 48  ? 27.880 20.470 11.415  1.00 21.15 ? 48   HIS B NE2 1 
ATOM   1605 N  N   . ALA B 1 49  ? 27.001 25.805 14.855  1.00 19.13 ? 49   ALA B N   1 
ATOM   1606 C  CA  . ALA B 1 49  ? 27.143 27.024 15.642  1.00 19.31 ? 49   ALA B CA  1 
ATOM   1607 C  C   . ALA B 1 49  ? 28.469 27.715 15.355  1.00 19.14 ? 49   ALA B C   1 
ATOM   1608 O  O   . ALA B 1 49  ? 29.511 27.095 15.197  1.00 20.44 ? 49   ALA B O   1 
ATOM   1609 C  CB  . ALA B 1 49  ? 27.011 26.716 17.157  1.00 19.55 ? 49   ALA B CB  1 
ATOM   1610 N  N   . LEU B 1 50  ? 28.384 29.035 15.234  1.00 20.21 ? 50   LEU B N   1 
ATOM   1611 C  CA  . LEU B 1 50  ? 29.557 29.863 15.155  1.00 21.94 ? 50   LEU B CA  1 
ATOM   1612 C  C   . LEU B 1 50  ? 30.111 30.029 16.577  1.00 21.32 ? 50   LEU B C   1 
ATOM   1613 O  O   . LEU B 1 50  ? 29.436 29.675 17.562  1.00 24.01 ? 50   LEU B O   1 
ATOM   1614 C  CB  . LEU B 1 50  ? 29.183 31.240 14.633  1.00 24.87 ? 50   LEU B CB  1 
ATOM   1615 C  CG  . LEU B 1 50  ? 28.519 31.336 13.265  1.00 27.22 ? 50   LEU B CG  1 
ATOM   1616 C  CD1 . LEU B 1 50  ? 28.157 32.800 13.047  1.00 31.59 ? 50   LEU B CD1 1 
ATOM   1617 C  CD2 . LEU B 1 50  ? 29.433 30.815 12.180  1.00 28.36 ? 50   LEU B CD2 1 
ATOM   1618 N  N   . LYS B 1 51  ? 31.300 30.643 16.672  1.00 23.59 ? 51   LYS B N   1 
ATOM   1619 C  CA  A LYS B 1 51  ? 31.791 31.109 17.963  0.50 25.53 ? 51   LYS B CA  1 
ATOM   1620 C  CA  B LYS B 1 51  ? 31.834 31.195 17.918  0.50 25.83 ? 51   LYS B CA  1 
ATOM   1621 C  C   . LYS B 1 51  ? 30.796 32.137 18.499  1.00 25.24 ? 51   LYS B C   1 
ATOM   1622 O  O   . LYS B 1 51  ? 30.092 32.819 17.729  1.00 27.08 ? 51   LYS B O   1 
ATOM   1623 C  CB  A LYS B 1 51  ? 33.199 31.733 17.859  0.50 27.35 ? 51   LYS B CB  1 
ATOM   1624 C  CB  B LYS B 1 51  ? 33.100 32.044 17.654  0.50 28.15 ? 51   LYS B CB  1 
ATOM   1625 C  CG  A LYS B 1 51  ? 33.910 31.949 19.211  0.50 30.63 ? 51   LYS B CG  1 
ATOM   1626 C  CG  B LYS B 1 51  ? 34.375 31.301 17.225  0.50 30.68 ? 51   LYS B CG  1 
ATOM   1627 C  CD  A LYS B 1 51  ? 35.166 32.799 19.095  0.50 31.86 ? 51   LYS B CD  1 
ATOM   1628 C  CD  B LYS B 1 51  ? 35.576 32.266 17.214  0.50 38.06 ? 51   LYS B CD  1 
ATOM   1629 C  CE  A LYS B 1 51  ? 35.872 32.944 20.461  0.50 29.59 ? 51   LYS B CE  1 
ATOM   1630 C  CE  B LYS B 1 51  ? 36.666 31.881 16.209  0.50 41.65 ? 51   LYS B CE  1 
ATOM   1631 N  NZ  A LYS B 1 51  ? 36.694 31.757 20.737  0.50 31.34 ? 51   LYS B NZ  1 
ATOM   1632 N  NZ  B LYS B 1 51  ? 37.012 30.445 16.247  0.50 41.00 ? 51   LYS B NZ  1 
ATOM   1633 N  N   . ASN B 1 52  ? 30.733 32.240 19.818  1.00 26.13 ? 52   ASN B N   1 
ATOM   1634 C  CA  . ASN B 1 52  ? 29.879 33.229 20.488  1.00 24.22 ? 52   ASN B CA  1 
ATOM   1635 C  C   . ASN B 1 52  ? 28.396 33.075 20.125  1.00 23.99 ? 52   ASN B C   1 
ATOM   1636 O  O   . ASN B 1 52  ? 27.666 34.027 19.954  1.00 26.76 ? 52   ASN B O   1 
ATOM   1637 C  CB  . ASN B 1 52  ? 30.360 34.660 20.205  1.00 24.95 ? 52   ASN B CB  1 
ATOM   1638 C  CG  . ASN B 1 52  ? 31.817 34.865 20.589  1.00 26.28 ? 52   ASN B CG  1 
ATOM   1639 O  OD1 . ASN B 1 52  ? 32.215 34.561 21.721  1.00 34.45 ? 52   ASN B OD1 1 
ATOM   1640 N  ND2 . ASN B 1 52  ? 32.617 35.395 19.658  1.00 27.29 ? 52   ASN B ND2 1 
ATOM   1641 N  N   . ASN B 1 53  ? 27.975 31.844 19.961  1.00 22.21 ? 53   ASN B N   1 
ATOM   1642 C  CA  . ASN B 1 53  ? 26.594 31.589 19.651  1.00 20.43 ? 53   ASN B CA  1 
ATOM   1643 C  C   . ASN B 1 53  ? 25.736 32.078 20.824  1.00 23.98 ? 53   ASN B C   1 
ATOM   1644 O  O   . ASN B 1 53  ? 26.024 31.782 21.998  1.00 23.88 ? 53   ASN B O   1 
ATOM   1645 C  CB  . ASN B 1 53  ? 26.379 30.096 19.427  1.00 20.27 ? 53   ASN B CB  1 
ATOM   1646 C  CG  . ASN B 1 53  ? 24.930 29.758 19.211  1.00 19.63 ? 53   ASN B CG  1 
ATOM   1647 O  OD1 . ASN B 1 53  ? 24.192 29.524 20.187  1.00 19.71 ? 53   ASN B OD1 1 
ATOM   1648 N  ND2 . ASN B 1 53  ? 24.496 29.711 17.930  1.00 20.23 ? 53   ASN B ND2 1 
ATOM   1649 N  N   . PRO B 1 54  ? 24.670 32.835 20.517  1.00 23.97 ? 54   PRO B N   1 
ATOM   1650 C  CA  . PRO B 1 54  ? 23.957 33.419 21.633  1.00 23.75 ? 54   PRO B CA  1 
ATOM   1651 C  C   . PRO B 1 54  ? 22.946 32.547 22.341  1.00 24.21 ? 54   PRO B C   1 
ATOM   1652 O  O   . PRO B 1 54  ? 22.340 32.977 23.329  1.00 24.12 ? 54   PRO B O   1 
ATOM   1653 C  CB  . PRO B 1 54  ? 23.263 34.610 20.990  1.00 25.53 ? 54   PRO B CB  1 
ATOM   1654 C  CG  . PRO B 1 54  ? 23.021 34.186 19.609  1.00 28.02 ? 54   PRO B CG  1 
ATOM   1655 C  CD  . PRO B 1 54  ? 24.103 33.230 19.227  1.00 25.92 ? 54   PRO B CD  1 
ATOM   1656 N  N   . ASN B 1 55  ? 22.801 31.317 21.862  1.00 23.12 ? 55   ASN B N   1 
ATOM   1657 C  CA  . ASN B 1 55  ? 21.828 30.383 22.395  1.00 21.01 ? 55   ASN B CA  1 
ATOM   1658 C  C   . ASN B 1 55  ? 22.501 29.222 23.093  1.00 21.07 ? 55   ASN B C   1 
ATOM   1659 O  O   . ASN B 1 55  ? 21.851 28.218 23.397  1.00 23.04 ? 55   ASN B O   1 
ATOM   1660 C  CB  . ASN B 1 55  ? 20.930 29.917 21.278  1.00 21.60 ? 55   ASN B CB  1 
ATOM   1661 C  CG  . ASN B 1 55  ? 20.273 31.034 20.559  1.00 24.06 ? 55   ASN B CG  1 
ATOM   1662 O  OD1 . ASN B 1 55  ? 20.443 31.179 19.337  1.00 25.84 ? 55   ASN B OD1 1 
ATOM   1663 N  ND2 . ASN B 1 55  ? 19.487 31.839 21.284  1.00 24.42 ? 55   ASN B ND2 1 
ATOM   1664 N  N   . GLY B 1 56  ? 23.798 29.357 23.353  1.00 21.19 ? 56   GLY B N   1 
ATOM   1665 C  CA  . GLY B 1 56  ? 24.529 28.471 24.221  1.00 21.96 ? 56   GLY B CA  1 
ATOM   1666 C  C   . GLY B 1 56  ? 25.187 27.304 23.518  1.00 19.38 ? 56   GLY B C   1 
ATOM   1667 O  O   . GLY B 1 56  ? 25.751 26.444 24.172  1.00 20.87 ? 56   GLY B O   1 
ATOM   1668 N  N   . PHE B 1 57  ? 25.134 27.259 22.183  1.00 18.18 ? 57   PHE B N   1 
ATOM   1669 C  CA  . PHE B 1 57  ? 25.727 26.150 21.462  1.00 18.45 ? 57   PHE B CA  1 
ATOM   1670 C  C   . PHE B 1 57  ? 27.209 26.380 21.266  1.00 20.60 ? 57   PHE B C   1 
ATOM   1671 O  O   . PHE B 1 57  ? 27.615 27.445 20.780  1.00 23.96 ? 57   PHE B O   1 
ATOM   1672 C  CB  . PHE B 1 57  ? 25.046 25.881 20.118  1.00 19.04 ? 57   PHE B CB  1 
ATOM   1673 C  CG  . PHE B 1 57  ? 23.792 25.082 20.271  1.00 18.57 ? 57   PHE B CG  1 
ATOM   1674 C  CD1 . PHE B 1 57  ? 22.593 25.694 20.585  1.00 25.84 ? 57   PHE B CD1 1 
ATOM   1675 C  CD2 . PHE B 1 57  ? 23.834 23.721 20.146  1.00 20.06 ? 57   PHE B CD2 1 
ATOM   1676 C  CE1 . PHE B 1 57  ? 21.455 24.914 20.772  1.00 24.24 ? 57   PHE B CE1 1 
ATOM   1677 C  CE2 . PHE B 1 57  ? 22.701 22.948 20.330  1.00 24.76 ? 57   PHE B CE2 1 
ATOM   1678 C  CZ  . PHE B 1 57  ? 21.529 23.554 20.639  1.00 24.07 ? 57   PHE B CZ  1 
ATOM   1679 N  N   . PRO B 1 58  ? 28.027 25.402 21.663  1.00 21.45 ? 58   PRO B N   1 
ATOM   1680 C  CA  . PRO B 1 58  ? 29.473 25.535 21.451  1.00 22.54 ? 58   PRO B CA  1 
ATOM   1681 C  C   . PRO B 1 58  ? 29.819 25.614 19.982  1.00 19.50 ? 58   PRO B C   1 
ATOM   1682 O  O   . PRO B 1 58  ? 29.166 25.012 19.169  1.00 19.66 ? 58   PRO B O   1 
ATOM   1683 C  CB  . PRO B 1 58  ? 30.034 24.203 22.003  1.00 24.72 ? 58   PRO B CB  1 
ATOM   1684 C  CG  . PRO B 1 58  ? 29.014 23.693 22.843  1.00 27.62 ? 58   PRO B CG  1 
ATOM   1685 C  CD  . PRO B 1 58  ? 27.710 24.104 22.283  1.00 22.83 ? 58   PRO B CD  1 
ATOM   1686 N  N   . GLU B 1 59  ? 30.910 26.308 19.677  1.00 19.89 ? 59   GLU B N   1 
ATOM   1687 C  CA  . GLU B 1 59  ? 31.381 26.471 18.302  1.00 20.56 ? 59   GLU B CA  1 
ATOM   1688 C  C   . GLU B 1 59  ? 31.537 25.109 17.658  1.00 19.41 ? 59   GLU B C   1 
ATOM   1689 O  O   . GLU B 1 59  ? 32.144 24.227 18.224  1.00 21.69 ? 59   GLU B O   1 
ATOM   1690 C  CB  . GLU B 1 59  ? 32.724 27.185 18.276  1.00 23.44 ? 59   GLU B CB  1 
ATOM   1691 C  CG  . GLU B 1 59  ? 33.270 27.361 16.858  1.00 27.03 ? 59   GLU B CG  1 
ATOM   1692 C  CD  . GLU B 1 59  ? 34.594 28.103 16.797  1.00 37.05 ? 59   GLU B CD  1 
ATOM   1693 O  OE1 . GLU B 1 59  ? 35.279 28.238 17.838  1.00 40.30 ? 59   GLU B OE1 1 
ATOM   1694 O  OE2 . GLU B 1 59  ? 34.942 28.547 15.693  1.00 41.75 ? 59   GLU B OE2 1 
ATOM   1695 N  N   . GLY B 1 60  ? 30.980 24.966 16.457  1.00 20.97 ? 60   GLY B N   1 
ATOM   1696 C  CA  . GLY B 1 60  ? 31.123 23.784 15.653  1.00 21.74 ? 60   GLY B CA  1 
ATOM   1697 C  C   . GLY B 1 60  ? 30.057 22.736 15.872  1.00 19.08 ? 60   GLY B C   1 
ATOM   1698 O  O   . GLY B 1 60  ? 29.924 21.823 15.080  1.00 20.40 ? 60   GLY B O   1 
ATOM   1699 N  N   . PHE B 1 61  ? 29.268 22.868 16.954  1.00 19.84 ? 61   PHE B N   1 
ATOM   1700 C  CA  . PHE B 1 61  ? 28.198 21.892 17.185  1.00 19.17 ? 61   PHE B CA  1 
ATOM   1701 C  C   . PHE B 1 61  ? 27.153 21.976 16.087  1.00 17.17 ? 61   PHE B C   1 
ATOM   1702 O  O   . PHE B 1 61  ? 26.827 23.062 15.609  1.00 19.18 ? 61   PHE B O   1 
ATOM   1703 C  CB  . PHE B 1 61  ? 27.465 22.126 18.496  1.00 18.98 ? 61   PHE B CB  1 
ATOM   1704 C  CG  . PHE B 1 61  ? 27.993 21.347 19.663  1.00 19.45 ? 61   PHE B CG  1 
ATOM   1705 C  CD1 . PHE B 1 61  ? 29.317 20.904 19.735  1.00 27.13 ? 61   PHE B CD1 1 
ATOM   1706 C  CD2 . PHE B 1 61  ? 27.133 21.004 20.708  1.00 19.71 ? 61   PHE B CD2 1 
ATOM   1707 C  CE1 . PHE B 1 61  ? 29.762 20.171 20.831  1.00 28.50 ? 61   PHE B CE1 1 
ATOM   1708 C  CE2 . PHE B 1 61  ? 27.583 20.249 21.797  1.00 21.17 ? 61   PHE B CE2 1 
ATOM   1709 C  CZ  . PHE B 1 61  ? 28.895 19.857 21.869  1.00 24.20 ? 61   PHE B CZ  1 
ATOM   1710 N  N   . TRP B 1 62  ? 26.641 20.820 15.702  1.00 17.19 ? 62   TRP B N   1 
ATOM   1711 C  CA  . TRP B 1 62  ? 25.499 20.795 14.803  1.00 16.36 ? 62   TRP B CA  1 
ATOM   1712 C  C   . TRP B 1 62  ? 24.322 21.431 15.517  1.00 17.69 ? 62   TRP B C   1 
ATOM   1713 O  O   . TRP B 1 62  ? 24.115 21.207 16.703  1.00 20.15 ? 62   TRP B O   1 
ATOM   1714 C  CB  . TRP B 1 62  ? 25.170 19.349 14.468  1.00 17.22 ? 62   TRP B CB  1 
ATOM   1715 C  CG  . TRP B 1 62  ? 24.048 19.182 13.553  1.00 15.90 ? 62   TRP B CG  1 
ATOM   1716 C  CD1 . TRP B 1 62  ? 23.943 19.654 12.286  1.00 18.15 ? 62   TRP B CD1 1 
ATOM   1717 C  CD2 . TRP B 1 62  ? 22.870 18.421 13.797  1.00 16.97 ? 62   TRP B CD2 1 
ATOM   1718 N  NE1 . TRP B 1 62  ? 22.767 19.250 11.710  1.00 17.73 ? 62   TRP B NE1 1 
ATOM   1719 C  CE2 . TRP B 1 62  ? 22.072 18.507 12.630  1.00 16.93 ? 62   TRP B CE2 1 
ATOM   1720 C  CE3 . TRP B 1 62  ? 22.408 17.680 14.874  1.00 19.14 ? 62   TRP B CE3 1 
ATOM   1721 C  CZ2 . TRP B 1 62  ? 20.848 17.885 12.524  1.00 18.32 ? 62   TRP B CZ2 1 
ATOM   1722 C  CZ3 . TRP B 1 62  ? 21.188 17.053 14.759  1.00 18.68 ? 62   TRP B CZ3 1 
ATOM   1723 C  CH2 . TRP B 1 62  ? 20.420 17.159 13.591  1.00 21.11 ? 62   TRP B CH2 1 
ATOM   1724 N  N   . MET B 1 63  ? 23.548 22.220 14.801  1.00 17.06 ? 63   MET B N   1 
ATOM   1725 C  CA  . MET B 1 63  ? 22.352 22.813 15.370  1.00 18.24 ? 63   MET B CA  1 
ATOM   1726 C  C   . MET B 1 63  ? 21.170 21.869 15.147  1.00 15.99 ? 63   MET B C   1 
ATOM   1727 O  O   . MET B 1 63  ? 20.711 21.731 14.022  1.00 17.55 ? 63   MET B O   1 
ATOM   1728 C  CB  . MET B 1 63  ? 22.037 24.142 14.732  1.00 20.54 ? 63   MET B CB  1 
ATOM   1729 C  CG  . MET B 1 63  ? 23.120 25.196 14.832  1.00 22.20 ? 63   MET B CG  1 
ATOM   1730 S  SD  . MET B 1 63  ? 23.438 25.724 16.495  1.00 27.06 ? 63   MET B SD  1 
ATOM   1731 C  CE  . MET B 1 63  ? 21.905 26.516 16.966  1.00 25.29 ? 63   MET B CE  1 
ATOM   1732 N  N   . PRO B 1 64  ? 20.617 21.308 16.219  1.00 19.10 ? 64   PRO B N   1 
ATOM   1733 C  CA  . PRO B 1 64  ? 19.615 20.266 16.148  1.00 18.53 ? 64   PRO B CA  1 
ATOM   1734 C  C   . PRO B 1 64  ? 18.202 20.874 16.304  1.00 18.37 ? 64   PRO B C   1 
ATOM   1735 O  O   . PRO B 1 64  ? 18.060 22.032 16.692  1.00 20.75 ? 64   PRO B O   1 
ATOM   1736 C  CB  . PRO B 1 64  ? 19.958 19.424 17.362  1.00 20.32 ? 64   PRO B CB  1 
ATOM   1737 C  CG  . PRO B 1 64  ? 20.270 20.435 18.414  1.00 21.35 ? 64   PRO B CG  1 
ATOM   1738 C  CD  . PRO B 1 64  ? 21.002 21.546 17.626  1.00 19.90 ? 64   PRO B CD  1 
ATOM   1739 N  N   . TYR B 1 65  ? 17.204 20.095 15.934  1.00 18.76 ? 65   TYR B N   1 
ATOM   1740 C  CA  . TYR B 1 65  ? 15.794 20.421 16.068  1.00 18.09 ? 65   TYR B CA  1 
ATOM   1741 C  C   . TYR B 1 65  ? 15.358 21.633 15.284  1.00 20.19 ? 65   TYR B C   1 
ATOM   1742 O  O   . TYR B 1 65  ? 14.297 22.169 15.584  1.00 21.85 ? 65   TYR B O   1 
ATOM   1743 C  CB  . TYR B 1 65  ? 15.386 20.584 17.538  1.00 19.20 ? 65   TYR B CB  1 
ATOM   1744 C  CG  . TYR B 1 65  ? 15.675 19.381 18.377  1.00 20.92 ? 65   TYR B CG  1 
ATOM   1745 C  CD1 . TYR B 1 65  ? 14.784 18.321 18.457  1.00 26.26 ? 65   TYR B CD1 1 
ATOM   1746 C  CD2 . TYR B 1 65  ? 16.828 19.304 19.122  1.00 20.61 ? 65   TYR B CD2 1 
ATOM   1747 C  CE1 . TYR B 1 65  ? 15.054 17.229 19.259  1.00 27.77 ? 65   TYR B CE1 1 
ATOM   1748 C  CE2 . TYR B 1 65  ? 17.107 18.206 19.921  1.00 23.25 ? 65   TYR B CE2 1 
ATOM   1749 C  CZ  . TYR B 1 65  ? 16.240 17.169 19.970  1.00 21.40 ? 65   TYR B CZ  1 
ATOM   1750 O  OH  . TYR B 1 65  ? 16.523 16.112 20.789  1.00 24.67 ? 65   TYR B OH  1 
ATOM   1751 N  N   . LEU B 1 66  ? 16.101 21.999 14.220  1.00 18.96 ? 66   LEU B N   1 
ATOM   1752 C  CA  . LEU B 1 66  ? 15.670 23.075 13.347  1.00 20.87 ? 66   LEU B CA  1 
ATOM   1753 C  C   . LEU B 1 66  ? 14.596 22.564 12.407  1.00 21.64 ? 66   LEU B C   1 
ATOM   1754 O  O   . LEU B 1 66  ? 14.583 21.400 12.025  1.00 23.22 ? 66   LEU B O   1 
ATOM   1755 C  CB  . LEU B 1 66  ? 16.818 23.654 12.496  1.00 19.72 ? 66   LEU B CB  1 
ATOM   1756 C  CG  . LEU B 1 66  ? 17.955 24.315 13.281  1.00 19.32 ? 66   LEU B CG  1 
ATOM   1757 C  CD1 . LEU B 1 66  ? 19.121 24.637 12.315  1.00 18.47 ? 66   LEU B CD1 1 
ATOM   1758 C  CD2 . LEU B 1 66  ? 17.467 25.595 14.017  1.00 21.70 ? 66   LEU B CD2 1 
ATOM   1759 N  N   . THR B 1 67  ? 13.647 23.422 12.104  1.00 21.57 ? 67   THR B N   1 
ATOM   1760 C  CA  . THR B 1 67  ? 12.726 23.162 11.009  1.00 23.58 ? 67   THR B CA  1 
ATOM   1761 C  C   . THR B 1 67  ? 13.239 23.885 9.769   1.00 23.30 ? 67   THR B C   1 
ATOM   1762 O  O   . THR B 1 67  ? 13.425 25.127 9.773   1.00 26.39 ? 67   THR B O   1 
ATOM   1763 C  CB  . THR B 1 67  ? 11.299 23.601 11.384  1.00 24.86 ? 67   THR B CB  1 
ATOM   1764 O  OG1 . THR B 1 67  ? 10.956 22.992 12.654  1.00 24.64 ? 67   THR B OG1 1 
ATOM   1765 C  CG2 . THR B 1 67  ? 10.313 23.205 10.276  1.00 26.00 ? 67   THR B CG2 1 
ATOM   1766 N  N   . ILE B 1 68  ? 13.499 23.116 8.715   1.00 23.96 ? 68   ILE B N   1 
ATOM   1767 C  CA  . ILE B 1 68  ? 14.053 23.672 7.492   1.00 23.87 ? 68   ILE B CA  1 
ATOM   1768 C  C   . ILE B 1 68  ? 13.176 23.296 6.290   1.00 23.88 ? 68   ILE B C   1 
ATOM   1769 O  O   . ILE B 1 68  ? 13.145 22.139 5.865   1.00 26.21 ? 68   ILE B O   1 
ATOM   1770 C  CB  . ILE B 1 68  ? 15.487 23.257 7.232   1.00 24.98 ? 68   ILE B CB  1 
ATOM   1771 C  CG1 . ILE B 1 68  ? 16.367 23.505 8.484   1.00 25.54 ? 68   ILE B CG1 1 
ATOM   1772 C  CG2 . ILE B 1 68  ? 16.039 23.994 6.037   1.00 24.68 ? 68   ILE B CG2 1 
ATOM   1773 C  CD1 . ILE B 1 68  ? 17.742 22.985 8.336   1.00 26.77 ? 68   ILE B CD1 1 
ATOM   1774 N  N   . ALA B 1 69  ? 12.432 24.276 5.821   1.00 23.71 ? 69   ALA B N   1 
ATOM   1775 C  CA  . ALA B 1 69  ? 11.637 24.123 4.623   1.00 24.30 ? 69   ALA B CA  1 
ATOM   1776 C  C   . ALA B 1 69  ? 12.513 24.580 3.479   1.00 27.73 ? 69   ALA B C   1 
ATOM   1777 O  O   . ALA B 1 69  ? 13.360 25.458 3.650   1.00 27.14 ? 69   ALA B O   1 
ATOM   1778 C  CB  . ALA B 1 69  ? 10.363 24.937 4.701   1.00 27.89 ? 69   ALA B CB  1 
ATOM   1779 N  N   . TYR B 1 70  ? 12.301 24.008 2.306   1.00 23.49 ? 70   TYR B N   1 
ATOM   1780 C  CA  . TYR B 1 70  ? 13.040 24.457 1.130   1.00 21.88 ? 70   TYR B CA  1 
ATOM   1781 C  C   . TYR B 1 70  ? 12.101 24.737 -0.010  1.00 21.82 ? 70   TYR B C   1 
ATOM   1782 O  O   . TYR B 1 70  ? 11.014 24.151 -0.092  1.00 21.26 ? 70   TYR B O   1 
ATOM   1783 C  CB  . TYR B 1 70  ? 14.125 23.469 0.666   1.00 23.01 ? 70   TYR B CB  1 
ATOM   1784 C  CG  . TYR B 1 70  ? 13.620 22.173 0.118   1.00 22.91 ? 70   TYR B CG  1 
ATOM   1785 C  CD1 . TYR B 1 70  ? 13.301 22.047 -1.232  1.00 25.09 ? 70   TYR B CD1 1 
ATOM   1786 C  CD2 . TYR B 1 70  ? 13.460 21.065 0.938   1.00 27.38 ? 70   TYR B CD2 1 
ATOM   1787 C  CE1 . TYR B 1 70  ? 12.820 20.859 -1.723  1.00 28.47 ? 70   TYR B CE1 1 
ATOM   1788 C  CE2 . TYR B 1 70  ? 12.997 19.876 0.459   1.00 27.28 ? 70   TYR B CE2 1 
ATOM   1789 C  CZ  . TYR B 1 70  ? 12.665 19.779 -0.870  1.00 28.97 ? 70   TYR B CZ  1 
ATOM   1790 O  OH  . TYR B 1 70  ? 12.189 18.591 -1.331  1.00 30.54 ? 70   TYR B OH  1 
ATOM   1791 N  N   . GLU B 1 71  ? 12.547 25.646 -0.871  1.00 21.67 ? 71   GLU B N   1 
ATOM   1792 C  CA  . GLU B 1 71  ? 11.936 25.860 -2.180  1.00 22.46 ? 71   GLU B CA  1 
ATOM   1793 C  C   . GLU B 1 71  ? 13.035 25.797 -3.203  1.00 22.43 ? 71   GLU B C   1 
ATOM   1794 O  O   . GLU B 1 71  ? 14.042 26.464 -3.077  1.00 26.04 ? 71   GLU B O   1 
ATOM   1795 C  CB  . GLU B 1 71  ? 11.202 27.195 -2.241  1.00 26.78 ? 71   GLU B CB  1 
ATOM   1796 C  CG  . GLU B 1 71  ? 10.521 27.500 -3.567  1.00 29.47 ? 71   GLU B CG  1 
ATOM   1797 C  CD  . GLU B 1 71  ? 9.912  28.888 -3.541  1.00 42.83 ? 71   GLU B CD  1 
ATOM   1798 O  OE1 . GLU B 1 71  ? 8.835  29.060 -2.923  1.00 45.71 ? 71   GLU B OE1 1 
ATOM   1799 O  OE2 . GLU B 1 71  ? 10.550 29.813 -4.097  1.00 52.81 ? 71   GLU B OE2 1 
ATOM   1800 N  N   . LEU B 1 72  ? 12.836 24.976 -4.221  1.00 22.57 ? 72   LEU B N   1 
ATOM   1801 C  CA  . LEU B 1 72  ? 13.804 24.810 -5.278  1.00 23.08 ? 72   LEU B CA  1 
ATOM   1802 C  C   . LEU B 1 72  ? 13.125 25.206 -6.561  1.00 23.66 ? 72   LEU B C   1 
ATOM   1803 O  O   . LEU B 1 72  ? 12.091 24.665 -6.882  1.00 23.07 ? 72   LEU B O   1 
ATOM   1804 C  CB  . LEU B 1 72  ? 14.270 23.361 -5.340  1.00 22.99 ? 72   LEU B CB  1 
ATOM   1805 C  CG  . LEU B 1 72  ? 15.439 23.062 -6.254  1.00 28.75 ? 72   LEU B CG  1 
ATOM   1806 C  CD1 . LEU B 1 72  ? 16.673 23.955 -5.986  1.00 28.57 ? 72   LEU B CD1 1 
ATOM   1807 C  CD2 . LEU B 1 72  ? 15.806 21.593 -6.060  1.00 32.78 ? 72   LEU B CD2 1 
ATOM   1808 N  N   . LYS B 1 73  ? 13.701 26.186 -7.246  1.00 22.87 ? 73   LYS B N   1 
ATOM   1809 C  CA  A LYS B 1 73  ? 13.130 26.790 -8.443  0.50 23.40 ? 73   LYS B CA  1 
ATOM   1810 C  CA  B LYS B 1 73  ? 13.107 26.714 -8.464  0.50 22.52 ? 73   LYS B CA  1 
ATOM   1811 C  C   . LYS B 1 73  ? 14.126 26.722 -9.598  1.00 23.17 ? 73   LYS B C   1 
ATOM   1812 O  O   . LYS B 1 73  ? 15.244 27.231 -9.477  1.00 24.36 ? 73   LYS B O   1 
ATOM   1813 C  CB  A LYS B 1 73  ? 12.825 28.278 -8.198  0.50 27.35 ? 73   LYS B CB  1 
ATOM   1814 C  CB  B LYS B 1 73  ? 12.522 28.122 -8.260  0.50 25.20 ? 73   LYS B CB  1 
ATOM   1815 C  CG  A LYS B 1 73  ? 11.654 28.579 -7.294  0.50 30.19 ? 73   LYS B CG  1 
ATOM   1816 C  CG  B LYS B 1 73  ? 12.044 28.766 -9.557  0.50 26.09 ? 73   LYS B CG  1 
ATOM   1817 C  CD  A LYS B 1 73  ? 10.769 29.665 -7.927  0.50 38.51 ? 73   LYS B CD  1 
ATOM   1818 C  CD  B LYS B 1 73  ? 11.253 30.061 -9.347  0.50 34.18 ? 73   LYS B CD  1 
ATOM   1819 C  CE  A LYS B 1 73  ? 11.062 31.065 -7.442  0.50 41.64 ? 73   LYS B CE  1 
ATOM   1820 C  CE  B LYS B 1 73  ? 10.446 30.466 -10.601 0.50 36.82 ? 73   LYS B CE  1 
ATOM   1821 N  NZ  A LYS B 1 73  ? 10.486 31.300 -6.094  0.50 43.28 ? 73   LYS B NZ  1 
ATOM   1822 N  NZ  B LYS B 1 73  ? 9.184  29.679 -10.810 0.50 33.39 ? 73   LYS B NZ  1 
ATOM   1823 N  N   . ASN B 1 74  ? 13.694 26.173 -10.721 1.00 22.18 ? 74   ASN B N   1 
ATOM   1824 C  CA  . ASN B 1 74  ? 14.435 26.231 -11.951 1.00 25.19 ? 74   ASN B CA  1 
ATOM   1825 C  C   . ASN B 1 74  ? 13.989 27.515 -12.601 1.00 24.87 ? 74   ASN B C   1 
ATOM   1826 O  O   . ASN B 1 74  ? 12.815 27.650 -13.015 1.00 26.57 ? 74   ASN B O   1 
ATOM   1827 C  CB  . ASN B 1 74  ? 14.109 25.037 -12.845 1.00 22.48 ? 74   ASN B CB  1 
ATOM   1828 C  CG  . ASN B 1 74  ? 14.846 25.091 -14.160 1.00 25.77 ? 74   ASN B CG  1 
ATOM   1829 O  OD1 . ASN B 1 74  ? 14.994 26.170 -14.762 1.00 26.86 ? 74   ASN B OD1 1 
ATOM   1830 N  ND2 . ASN B 1 74  ? 15.345 23.938 -14.603 1.00 23.81 ? 74   ASN B ND2 1 
ATOM   1831 N  N   . THR B 1 75  ? 14.892 28.487 -12.676 1.00 25.71 ? 75   THR B N   1 
ATOM   1832 C  CA  . THR B 1 75  ? 14.500 29.817 -13.157 1.00 30.15 ? 75   THR B CA  1 
ATOM   1833 C  C   . THR B 1 75  ? 14.339 29.859 -14.687 1.00 30.67 ? 75   THR B C   1 
ATOM   1834 O  O   . THR B 1 75  ? 13.663 30.738 -15.223 1.00 32.87 ? 75   THR B O   1 
ATOM   1835 C  CB  . THR B 1 75  ? 15.461 30.895 -12.679 1.00 32.00 ? 75   THR B CB  1 
ATOM   1836 O  OG1 . THR B 1 75  ? 16.787 30.568 -13.075 1.00 35.25 ? 75   THR B OG1 1 
ATOM   1837 C  CG2 . THR B 1 75  ? 15.440 31.015 -11.147 1.00 39.20 ? 75   THR B CG2 1 
ATOM   1838 N  N   . ASP B 1 76  ? 14.932 28.883 -15.367 1.00 29.85 ? 76   ASP B N   1 
ATOM   1839 C  CA  . ASP B 1 76  ? 14.788 28.738 -16.815 1.00 30.59 ? 76   ASP B CA  1 
ATOM   1840 C  C   . ASP B 1 76  ? 13.396 28.248 -17.159 1.00 28.82 ? 76   ASP B C   1 
ATOM   1841 O  O   . ASP B 1 76  ? 12.764 28.784 -18.067 1.00 29.09 ? 76   ASP B O   1 
ATOM   1842 C  CB  . ASP B 1 76  ? 15.782 27.721 -17.390 1.00 31.44 ? 76   ASP B CB  1 
ATOM   1843 C  CG  . ASP B 1 76  ? 17.239 27.986 -16.986 1.00 34.69 ? 76   ASP B CG  1 
ATOM   1844 O  OD1 . ASP B 1 76  ? 17.685 29.162 -16.957 1.00 37.63 ? 76   ASP B OD1 1 
ATOM   1845 O  OD2 . ASP B 1 76  ? 17.943 26.982 -16.742 1.00 35.34 ? 76   ASP B OD2 1 
ATOM   1846 N  N   . THR B 1 77  ? 12.930 27.203 -16.470 1.00 25.09 ? 77   THR B N   1 
ATOM   1847 C  CA  . THR B 1 77  ? 11.674 26.563 -16.819 1.00 23.22 ? 77   THR B CA  1 
ATOM   1848 C  C   . THR B 1 77  ? 10.485 27.054 -15.981 1.00 24.01 ? 77   THR B C   1 
ATOM   1849 O  O   . THR B 1 77  ? 9.342  26.909 -16.386 1.00 24.03 ? 77   THR B O   1 
ATOM   1850 C  CB  . THR B 1 77  ? 11.760 25.049 -16.625 1.00 22.58 ? 77   THR B CB  1 
ATOM   1851 O  OG1 . THR B 1 77  ? 11.900 24.774 -15.224 1.00 22.96 ? 77   THR B OG1 1 
ATOM   1852 C  CG2 . THR B 1 77  ? 12.957 24.475 -17.356 1.00 24.89 ? 77   THR B CG2 1 
ATOM   1853 N  N   . GLY B 1 78  ? 10.783 27.539 -14.779 1.00 25.77 ? 78   GLY B N   1 
ATOM   1854 C  CA  . GLY B 1 78  ? 9.791  27.975 -13.796 1.00 27.11 ? 78   GLY B CA  1 
ATOM   1855 C  C   . GLY B 1 78  ? 9.341  26.876 -12.859 1.00 26.16 ? 78   GLY B C   1 
ATOM   1856 O  O   . GLY B 1 78  ? 8.509  27.109 -11.971 1.00 25.80 ? 78   GLY B O   1 
ATOM   1857 N  N   . ALA B 1 79  ? 9.872  25.671 -13.046 1.00 23.38 ? 79   ALA B N   1 
ATOM   1858 C  CA  . ALA B 1 79  ? 9.498  24.565 -12.203 1.00 22.47 ? 79   ALA B CA  1 
ATOM   1859 C  C   . ALA B 1 79  ? 9.883  24.833 -10.732 1.00 21.66 ? 79   ALA B C   1 
ATOM   1860 O  O   . ALA B 1 79  ? 10.947 25.374 -10.422 1.00 23.80 ? 79   ALA B O   1 
ATOM   1861 C  CB  . ALA B 1 79  ? 10.146 23.296 -12.688 1.00 23.78 ? 79   ALA B CB  1 
ATOM   1862 N  N   . ILE B 1 80  ? 8.969  24.474 -9.848  1.00 22.45 ? 80   ILE B N   1 
ATOM   1863 C  CA  . ILE B 1 80  ? 9.137  24.719 -8.424  1.00 21.88 ? 80   ILE B CA  1 
ATOM   1864 C  C   . ILE B 1 80  ? 8.770  23.489 -7.643  1.00 23.61 ? 80   ILE B C   1 
ATOM   1865 O  O   . ILE B 1 80  ? 7.742  22.851 -7.908  1.00 24.90 ? 80   ILE B O   1 
ATOM   1866 C  CB  . ILE B 1 80  ? 8.168  25.798 -7.924  1.00 25.26 ? 80   ILE B CB  1 
ATOM   1867 C  CG1 . ILE B 1 80  ? 8.517  27.160 -8.465  1.00 30.81 ? 80   ILE B CG1 1 
ATOM   1868 C  CG2 . ILE B 1 80  ? 8.127  25.843 -6.388  1.00 30.51 ? 80   ILE B CG2 1 
ATOM   1869 C  CD1 . ILE B 1 80  ? 7.331  28.168 -8.365  1.00 39.85 ? 80   ILE B CD1 1 
ATOM   1870 N  N   . LYS B 1 81  ? 9.609  23.176 -6.663  1.00 23.34 ? 81   LYS B N   1 
ATOM   1871 C  CA  . LYS B 1 81  ? 9.238  22.196 -5.702  1.00 26.03 ? 81   LYS B CA  1 
ATOM   1872 C  C   . LYS B 1 81  ? 9.663  22.577 -4.318  1.00 23.73 ? 81   LYS B C   1 
ATOM   1873 O  O   . LYS B 1 81  ? 10.607 23.340 -4.119  1.00 26.32 ? 81   LYS B O   1 
ATOM   1874 C  CB  . LYS B 1 81  ? 9.727  20.839 -6.107  1.00 29.85 ? 81   LYS B CB  1 
ATOM   1875 C  CG  . LYS B 1 81  ? 11.173 20.636 -6.103  1.00 30.97 ? 81   LYS B CG  1 
ATOM   1876 C  CD  . LYS B 1 81  ? 11.477 19.128 -6.150  1.00 37.74 ? 81   LYS B CD  1 
ATOM   1877 C  CE  . LYS B 1 81  ? 11.121 18.530 -7.482  1.00 34.21 ? 81   LYS B CE  1 
ATOM   1878 N  NZ  . LYS B 1 81  ? 10.989 17.046 -7.469  1.00 29.85 ? 81   LYS B NZ  1 
ATOM   1879 N  N   . ARG B 1 82  ? 8.839  22.151 -3.377  1.00 24.73 ? 82   ARG B N   1 
ATOM   1880 C  CA  . ARG B 1 82  ? 9.021  22.488 -1.978  1.00 24.64 ? 82   ARG B CA  1 
ATOM   1881 C  C   . ARG B 1 82  ? 9.010  21.249 -1.142  1.00 23.22 ? 82   ARG B C   1 
ATOM   1882 O  O   . ARG B 1 82  ? 8.420  20.212 -1.493  1.00 24.85 ? 82   ARG B O   1 
ATOM   1883 C  CB  . ARG B 1 82  ? 7.877  23.360 -1.474  1.00 27.36 ? 82   ARG B CB  1 
ATOM   1884 C  CG  . ARG B 1 82  ? 7.828  24.697 -2.084  1.00 35.67 ? 82   ARG B CG  1 
ATOM   1885 C  CD  . ARG B 1 82  ? 6.595  25.449 -1.629  1.00 39.26 ? 82   ARG B CD  1 
ATOM   1886 N  NE  . ARG B 1 82  ? 6.623  26.711 -2.325  1.00 42.75 ? 82   ARG B NE  1 
ATOM   1887 C  CZ  . ARG B 1 82  ? 5.902  27.016 -3.396  1.00 36.86 ? 82   ARG B CZ  1 
ATOM   1888 N  NH1 . ARG B 1 82  ? 4.997  26.170 -3.889  1.00 34.91 ? 82   ARG B NH1 1 
ATOM   1889 N  NH2 . ARG B 1 82  ? 6.068  28.212 -3.943  1.00 36.82 ? 82   ARG B NH2 1 
ATOM   1890 N  N   . GLY B 1 83  ? 9.631  21.372 0.014   1.00 22.72 ? 83   GLY B N   1 
ATOM   1891 C  CA  . GLY B 1 83  ? 9.611  20.284 0.938   1.00 23.54 ? 83   GLY B CA  1 
ATOM   1892 C  C   . GLY B 1 83  ? 10.272 20.707 2.212   1.00 23.53 ? 83   GLY B C   1 
ATOM   1893 O  O   . GLY B 1 83  ? 10.491 21.902 2.462   1.00 25.37 ? 83   GLY B O   1 
ATOM   1894 N  N   . THR B 1 84  ? 10.586 19.724 3.028   1.00 24.58 ? 84   THR B N   1 
ATOM   1895 C  CA  . THR B 1 84  ? 11.308 19.989 4.263   1.00 23.99 ? 84   THR B CA  1 
ATOM   1896 C  C   . THR B 1 84  ? 12.496 19.027 4.333   1.00 25.23 ? 84   THR B C   1 
ATOM   1897 O  O   . THR B 1 84  ? 12.443 17.882 3.861   1.00 28.68 ? 84   THR B O   1 
ATOM   1898 C  CB  . THR B 1 84  ? 10.410 19.793 5.481   1.00 28.07 ? 84   THR B CB  1 
ATOM   1899 O  OG1 . THR B 1 84  ? 9.869  18.483 5.427   1.00 39.04 ? 84   THR B OG1 1 
ATOM   1900 C  CG2 . THR B 1 84  ? 9.266  20.778 5.486   1.00 29.10 ? 84   THR B CG2 1 
ATOM   1901 N  N   . LEU B 1 85  ? 13.589 19.494 4.907   1.00 25.35 ? 85   LEU B N   1 
ATOM   1902 C  CA  . LEU B 1 85  ? 14.723 18.639 5.096   1.00 25.90 ? 85   LEU B CA  1 
ATOM   1903 C  C   . LEU B 1 85  ? 14.531 17.922 6.424   1.00 26.12 ? 85   LEU B C   1 
ATOM   1904 O  O   . LEU B 1 85  ? 13.825 18.382 7.313   1.00 30.54 ? 85   LEU B O   1 
ATOM   1905 C  CB  . LEU B 1 85  ? 16.016 19.445 5.088   1.00 27.63 ? 85   LEU B CB  1 
ATOM   1906 C  CG  . LEU B 1 85  ? 16.293 20.321 3.864   1.00 27.24 ? 85   LEU B CG  1 
ATOM   1907 C  CD1 . LEU B 1 85  ? 17.696 20.956 4.040   1.00 30.47 ? 85   LEU B CD1 1 
ATOM   1908 C  CD2 . LEU B 1 85  ? 16.230 19.521 2.616   1.00 26.04 ? 85   LEU B CD2 1 
ATOM   1909 N  N   . MET B 1 86  ? 15.073 16.735 6.517   1.00 22.55 ? 86   MET B N   1 
ATOM   1910 C  CA  . MET B 1 86  ? 14.961 15.989 7.743   1.00 23.14 ? 86   MET B CA  1 
ATOM   1911 C  C   . MET B 1 86  ? 16.353 15.752 8.330   1.00 19.54 ? 86   MET B C   1 
ATOM   1912 O  O   . MET B 1 86  ? 17.371 15.740 7.608   1.00 20.05 ? 86   MET B O   1 
ATOM   1913 C  CB  . MET B 1 86  ? 14.246 14.671 7.484   1.00 25.50 ? 86   MET B CB  1 
ATOM   1914 C  CG  . MET B 1 86  ? 14.891 13.735 6.531   1.00 24.62 ? 86   MET B CG  1 
ATOM   1915 S  SD  . MET B 1 86  ? 14.200 12.051 6.693   1.00 31.21 ? 86   MET B SD  1 
ATOM   1916 C  CE  . MET B 1 86  ? 14.988 11.505 8.246   1.00 35.60 ? 86   MET B CE  1 
ATOM   1917 N  N   . PRO B 1 87  ? 16.408 15.569 9.623   1.00 18.66 ? 87   PRO B N   1 
ATOM   1918 C  CA  . PRO B 1 87  ? 17.668 15.350 10.283  1.00 18.99 ? 87   PRO B CA  1 
ATOM   1919 C  C   . PRO B 1 87  ? 18.130 13.902 10.108  1.00 18.70 ? 87   PRO B C   1 
ATOM   1920 O  O   . PRO B 1 87  ? 17.312 12.979 10.151  1.00 19.44 ? 87   PRO B O   1 
ATOM   1921 C  CB  . PRO B 1 87  ? 17.346 15.598 11.735  1.00 19.33 ? 87   PRO B CB  1 
ATOM   1922 C  CG  . PRO B 1 87  ? 15.944 15.291 11.843  1.00 17.86 ? 87   PRO B CG  1 
ATOM   1923 C  CD  . PRO B 1 87  ? 15.304 15.664 10.575  1.00 19.74 ? 87   PRO B CD  1 
ATOM   1924 N  N   . MET B 1 88  ? 19.427 13.724 9.914   1.00 18.94 ? 88   MET B N   1 
ATOM   1925 C  CA  . MET B 1 88  ? 19.957 12.374 9.746   1.00 20.09 ? 88   MET B CA  1 
ATOM   1926 C  C   . MET B 1 88  ? 21.450 12.388 9.980   1.00 20.42 ? 88   MET B C   1 
ATOM   1927 O  O   . MET B 1 88  ? 22.046 13.443 10.082  1.00 19.19 ? 88   MET B O   1 
ATOM   1928 C  CB  . MET B 1 88  ? 19.636 11.861 8.342   1.00 21.55 ? 88   MET B CB  1 
ATOM   1929 C  CG  . MET B 1 88  ? 20.419 12.549 7.252   1.00 22.55 ? 88   MET B CG  1 
ATOM   1930 S  SD  . MET B 1 88  ? 19.873 12.112 5.603   1.00 25.59 ? 88   MET B SD  1 
ATOM   1931 C  CE  . MET B 1 88  ? 18.306 12.958 5.524   1.00 26.49 ? 88   MET B CE  1 
ATOM   1932 N  N   . VAL B 1 89  ? 22.059 11.216 10.066  1.00 17.55 ? 89   VAL B N   1 
ATOM   1933 C  CA  . VAL B 1 89  ? 23.486 11.118 10.327  1.00 19.23 ? 89   VAL B CA  1 
ATOM   1934 C  C   . VAL B 1 89  ? 24.167 10.271 9.267   1.00 20.68 ? 89   VAL B C   1 
ATOM   1935 O  O   . VAL B 1 89  ? 23.649 9.246  8.838   1.00 20.62 ? 89   VAL B O   1 
ATOM   1936 C  CB  . VAL B 1 89  ? 23.823 10.625 11.768  1.00 18.58 ? 89   VAL B CB  1 
ATOM   1937 C  CG1 . VAL B 1 89  ? 23.437 9.111  11.960  1.00 18.57 ? 89   VAL B CG1 1 
ATOM   1938 C  CG2 . VAL B 1 89  ? 25.316 10.840 12.081  1.00 16.84 ? 89   VAL B CG2 1 
ATOM   1939 N  N   . ALA B 1 90  ? 25.330 10.748 8.853   1.00 21.40 ? 90   ALA B N   1 
ATOM   1940 C  CA  . ALA B 1 90  ? 26.225 10.038 7.961   1.00 21.27 ? 90   ALA B CA  1 
ATOM   1941 C  C   . ALA B 1 90  ? 27.531 9.748  8.671   1.00 19.84 ? 90   ALA B C   1 
ATOM   1942 O  O   . ALA B 1 90  ? 27.768 10.133 9.811   1.00 19.86 ? 90   ALA B O   1 
ATOM   1943 C  CB  . ALA B 1 90  ? 26.494 10.901 6.729   1.00 24.00 ? 90   ALA B CB  1 
ATOM   1944 N  N   . ASP B 1 91  ? 28.440 9.094  7.964   1.00 20.41 ? 91   ASP B N   1 
ATOM   1945 C  CA  . ASP B 1 91  ? 29.665 8.682  8.597   1.00 21.66 ? 91   ASP B CA  1 
ATOM   1946 C  C   . ASP B 1 91  ? 30.530 9.876  9.056   1.00 21.90 ? 91   ASP B C   1 
ATOM   1947 O  O   . ASP B 1 91  ? 31.360 9.732  9.908   1.00 21.98 ? 91   ASP B O   1 
ATOM   1948 C  CB  . ASP B 1 91  ? 30.436 7.668  7.728   1.00 25.25 ? 91   ASP B CB  1 
ATOM   1949 C  CG  . ASP B 1 91  ? 30.991 8.266  6.468   1.00 30.75 ? 91   ASP B CG  1 
ATOM   1950 O  OD1 . ASP B 1 91  ? 30.641 9.424  6.106   1.00 27.86 ? 91   ASP B OD1 1 
ATOM   1951 O  OD2 . ASP B 1 91  ? 31.811 7.553  5.834   1.00 34.03 ? 91   ASP B OD2 1 
ATOM   1952 N  N   . ASP B 1 92  ? 30.268 11.046 8.491   1.00 22.01 ? 92   ASP B N   1 
ATOM   1953 C  CA  . ASP B 1 92  ? 30.944 12.273 8.873   1.00 25.03 ? 92   ASP B CA  1 
ATOM   1954 C  C   . ASP B 1 92  ? 30.078 13.239 9.673   1.00 25.00 ? 92   ASP B C   1 
ATOM   1955 O  O   . ASP B 1 92  ? 30.476 14.407 9.895   1.00 25.81 ? 92   ASP B O   1 
ATOM   1956 C  CB  . ASP B 1 92  ? 31.508 12.965 7.636   1.00 27.67 ? 92   ASP B CB  1 
ATOM   1957 C  CG  . ASP B 1 92  ? 30.445 13.525 6.726   1.00 31.08 ? 92   ASP B CG  1 
ATOM   1958 O  OD1 . ASP B 1 92  ? 29.269 13.081 6.763   1.00 31.14 ? 92   ASP B OD1 1 
ATOM   1959 O  OD2 . ASP B 1 92  ? 30.814 14.417 5.936   1.00 44.13 ? 92   ASP B OD2 1 
ATOM   1960 N  N   . GLY B 1 93  ? 28.956 12.741 10.167  1.00 24.04 ? 93   GLY B N   1 
ATOM   1961 C  CA  . GLY B 1 93  ? 28.158 13.474 11.155  1.00 22.00 ? 93   GLY B CA  1 
ATOM   1962 C  C   . GLY B 1 93  ? 26.778 13.839 10.725  1.00 18.54 ? 93   GLY B C   1 
ATOM   1963 O  O   . GLY B 1 93  ? 26.343 13.527 9.616   1.00 18.95 ? 93   GLY B O   1 
ATOM   1964 N  N   . PRO B 1 94  ? 26.049 14.504 11.633  1.00 19.04 ? 94   PRO B N   1 
ATOM   1965 C  CA  . PRO B 1 94  ? 24.653 14.821 11.336  1.00 18.94 ? 94   PRO B CA  1 
ATOM   1966 C  C   . PRO B 1 94  ? 24.487 15.984 10.360  1.00 19.37 ? 94   PRO B C   1 
ATOM   1967 O  O   . PRO B 1 94  ? 25.346 16.864 10.260  1.00 19.62 ? 94   PRO B O   1 
ATOM   1968 C  CB  . PRO B 1 94  ? 24.097 15.198 12.711  1.00 20.01 ? 94   PRO B CB  1 
ATOM   1969 C  CG  . PRO B 1 94  ? 25.236 15.744 13.435  1.00 19.08 ? 94   PRO B CG  1 
ATOM   1970 C  CD  . PRO B 1 94  ? 26.437 14.929 12.989  1.00 20.02 ? 94   PRO B CD  1 
ATOM   1971 N  N   . HIS B 1 95  ? 23.389 15.950 9.622   1.00 19.02 ? 95   HIS B N   1 
ATOM   1972 C  CA  . HIS B 1 95  ? 23.004 17.037 8.758   1.00 18.06 ? 95   HIS B CA  1 
ATOM   1973 C  C   . HIS B 1 95  ? 21.508 17.008 8.524   1.00 19.87 ? 95   HIS B C   1 
ATOM   1974 O  O   . HIS B 1 95  ? 20.811 16.127 9.061   1.00 20.51 ? 95   HIS B O   1 
ATOM   1975 C  CB  . HIS B 1 95  ? 23.758 16.974 7.443   1.00 20.66 ? 95   HIS B CB  1 
ATOM   1976 C  CG  . HIS B 1 95  ? 23.307 15.865 6.554   1.00 22.96 ? 95   HIS B CG  1 
ATOM   1977 N  ND1 . HIS B 1 95  ? 23.820 14.589 6.637   1.00 29.46 ? 95   HIS B ND1 1 
ATOM   1978 C  CD2 . HIS B 1 95  ? 22.354 15.830 5.597   1.00 22.77 ? 95   HIS B CD2 1 
ATOM   1979 C  CE1 . HIS B 1 95  ? 23.228 13.827 5.734   1.00 22.80 ? 95   HIS B CE1 1 
ATOM   1980 N  NE2 . HIS B 1 95  ? 22.335 14.551 5.092   1.00 27.56 ? 95   HIS B NE2 1 
ATOM   1981 N  N   . TYR B 1 96  ? 21.010 18.022 7.812   1.00 18.63 ? 96   TYR B N   1 
ATOM   1982 C  CA  . TYR B 1 96  ? 19.612 18.053 7.354   1.00 15.61 ? 96   TYR B CA  1 
ATOM   1983 C  C   . TYR B 1 96  ? 19.592 17.747 5.885   1.00 17.80 ? 96   TYR B C   1 
ATOM   1984 O  O   . TYR B 1 96  ? 20.453 18.223 5.142   1.00 21.27 ? 96   TYR B O   1 
ATOM   1985 C  CB  . TYR B 1 96  ? 18.954 19.410 7.605   1.00 17.37 ? 96   TYR B CB  1 
ATOM   1986 C  CG  . TYR B 1 96  ? 18.851 19.759 9.064   1.00 16.65 ? 96   TYR B CG  1 
ATOM   1987 C  CD1 . TYR B 1 96  ? 17.777 19.318 9.833   1.00 15.55 ? 96   TYR B CD1 1 
ATOM   1988 C  CD2 . TYR B 1 96  ? 19.807 20.537 9.677   1.00 19.23 ? 96   TYR B CD2 1 
ATOM   1989 C  CE1 . TYR B 1 96  ? 17.680 19.617 11.162  1.00 17.45 ? 96   TYR B CE1 1 
ATOM   1990 C  CE2 . TYR B 1 96  ? 19.709 20.876 11.008  1.00 17.67 ? 96   TYR B CE2 1 
ATOM   1991 C  CZ  . TYR B 1 96  ? 18.628 20.402 11.760  1.00 18.64 ? 96   TYR B CZ  1 
ATOM   1992 O  OH  . TYR B 1 96  ? 18.513 20.680 13.076  1.00 18.07 ? 96   TYR B OH  1 
ATOM   1993 N  N   . GLY B 1 97  ? 18.657 16.905 5.444   1.00 19.15 ? 97   GLY B N   1 
ATOM   1994 C  CA  . GLY B 1 97  ? 18.659 16.577 4.020   1.00 21.05 ? 97   GLY B CA  1 
ATOM   1995 C  C   . GLY B 1 97  ? 17.395 16.000 3.491   1.00 20.29 ? 97   GLY B C   1 
ATOM   1996 O  O   . GLY B 1 97  ? 16.503 15.691 4.248   1.00 22.23 ? 97   GLY B O   1 
ATOM   1997 N  N   . ALA B 1 98  ? 17.351 15.874 2.176   1.00 21.21 ? 98   ALA B N   1 
ATOM   1998 C  CA  . ALA B 1 98  ? 16.214 15.294 1.456   1.00 21.84 ? 98   ALA B CA  1 
ATOM   1999 C  C   . ALA B 1 98  ? 16.690 14.797 0.096   1.00 21.94 ? 98   ALA B C   1 
ATOM   2000 O  O   . ALA B 1 98  ? 17.406 15.493 -0.608  1.00 22.98 ? 98   ALA B O   1 
ATOM   2001 C  CB  . ALA B 1 98  ? 15.084 16.345 1.274   1.00 21.65 ? 98   ALA B CB  1 
ATOM   2002 N  N   . ASN B 1 99  ? 16.322 13.568 -0.254  1.00 21.13 ? 99   ASN B N   1 
ATOM   2003 C  CA  . ASN B 1 99  ? 16.469 13.123 -1.636  1.00 23.08 ? 99   ASN B CA  1 
ATOM   2004 C  C   . ASN B 1 99  ? 15.436 13.797 -2.528  1.00 24.23 ? 99   ASN B C   1 
ATOM   2005 O  O   . ASN B 1 99  ? 14.251 13.922 -2.157  1.00 26.47 ? 99   ASN B O   1 
ATOM   2006 C  CB  . ASN B 1 99  ? 16.290 11.601 -1.737  1.00 24.77 ? 99   ASN B CB  1 
ATOM   2007 C  CG  . ASN B 1 99  ? 17.458 10.829 -1.190  1.00 24.04 ? 99   ASN B CG  1 
ATOM   2008 O  OD1 . ASN B 1 99  ? 18.599 11.313 -1.164  1.00 23.68 ? 99   ASN B OD1 1 
ATOM   2009 N  ND2 . ASN B 1 99  ? 17.187 9.584  -0.792  1.00 26.33 ? 99   ASN B ND2 1 
ATOM   2010 N  N   . ILE B 1 100 ? 15.867 14.181 -3.723  1.00 23.56 ? 100  ILE B N   1 
ATOM   2011 C  CA  . ILE B 1 100 ? 15.013 14.935 -4.634  1.00 23.75 ? 100  ILE B CA  1 
ATOM   2012 C  C   . ILE B 1 100 ? 15.143 14.389 -6.034  1.00 23.85 ? 100  ILE B C   1 
ATOM   2013 O  O   . ILE B 1 100 ? 16.248 14.143 -6.496  1.00 24.54 ? 100  ILE B O   1 
ATOM   2014 C  CB  . ILE B 1 100 ? 15.391 16.458 -4.642  1.00 25.64 ? 100  ILE B CB  1 
ATOM   2015 C  CG1 . ILE B 1 100 ? 15.312 17.041 -3.196  1.00 25.96 ? 100  ILE B CG1 1 
ATOM   2016 C  CG2 . ILE B 1 100 ? 14.499 17.227 -5.604  1.00 26.67 ? 100  ILE B CG2 1 
ATOM   2017 C  CD1 . ILE B 1 100 ? 15.475 18.535 -3.083  1.00 28.79 ? 100  ILE B CD1 1 
ATOM   2018 N  N   . ALA B 1 101 ? 13.994 14.159 -6.664  1.00 24.74 ? 101  ALA B N   1 
ATOM   2019 C  CA  . ALA B 1 101 ? 13.936 13.752 -8.055  1.00 25.99 ? 101  ALA B CA  1 
ATOM   2020 C  C   . ALA B 1 101 ? 14.116 15.003 -8.877  1.00 26.65 ? 101  ALA B C   1 
ATOM   2021 O  O   . ALA B 1 101 ? 13.439 15.990 -8.627  1.00 27.40 ? 101  ALA B O   1 
ATOM   2022 C  CB  . ALA B 1 101 ? 12.595 13.093 -8.352  1.00 26.96 ? 101  ALA B CB  1 
ATOM   2023 N  N   . MET B 1 102 ? 15.033 14.977 -9.848  1.00 26.32 ? 102  MET B N   1 
ATOM   2024 C  CA  . MET B 1 102 ? 15.296 16.118 -10.725 1.00 26.63 ? 102  MET B CA  1 
ATOM   2025 C  C   . MET B 1 102 ? 14.907 15.673 -12.116 1.00 27.76 ? 102  MET B C   1 
ATOM   2026 O  O   . MET B 1 102 ? 13.743 15.767 -12.479 1.00 27.52 ? 102  MET B O   1 
ATOM   2027 C  CB  . MET B 1 102 ? 16.748 16.572 -10.632 1.00 23.85 ? 102  MET B CB  1 
ATOM   2028 C  CG  . MET B 1 102 ? 17.155 17.037 -9.226  1.00 25.40 ? 102  MET B CG  1 
ATOM   2029 S  SD  . MET B 1 102 ? 16.345 18.571 -8.706  1.00 28.33 ? 102  MET B SD  1 
ATOM   2030 C  CE  . MET B 1 102 ? 17.298 19.797 -9.648  1.00 32.77 ? 102  MET B CE  1 
ATOM   2031 N  N   . GLU B 1 103 ? 15.841 15.111 -12.865 1.00 29.52 ? 103  GLU B N   1 
ATOM   2032 C  CA  . GLU B 1 103 ? 15.516 14.537 -14.164 1.00 32.25 ? 103  GLU B CA  1 
ATOM   2033 C  C   . GLU B 1 103 ? 14.419 13.474 -14.042 1.00 33.19 ? 103  GLU B C   1 
ATOM   2034 O  O   . GLU B 1 103 ? 13.541 13.354 -14.936 1.00 33.12 ? 103  GLU B O   1 
ATOM   2035 C  CB  . GLU B 1 103 ? 16.768 13.944 -14.805 1.00 33.38 ? 103  GLU B CB  1 
ATOM   2036 C  CG  . GLU B 1 103 ? 17.812 14.972 -15.174 1.00 37.30 ? 103  GLU B CG  1 
ATOM   2037 C  CD  . GLU B 1 103 ? 18.929 15.147 -14.146 1.00 38.88 ? 103  GLU B CD  1 
ATOM   2038 O  OE1 . GLU B 1 103 ? 18.669 15.081 -12.913 1.00 33.57 ? 103  GLU B OE1 1 
ATOM   2039 O  OE2 . GLU B 1 103 ? 20.079 15.390 -14.593 1.00 44.57 ? 103  GLU B OE2 1 
ATOM   2040 N  N   . LYS B 1 104 ? 14.417 12.743 -12.926 1.00 32.68 ? 104  LYS B N   1 
ATOM   2041 C  CA  . LYS B 1 104 ? 13.413 11.689 -12.727 1.00 33.40 ? 104  LYS B CA  1 
ATOM   2042 C  C   . LYS B 1 104 ? 11.994 12.187 -12.499 1.00 33.37 ? 104  LYS B C   1 
ATOM   2043 O  O   . LYS B 1 104 ? 11.053 11.414 -12.644 1.00 35.46 ? 104  LYS B O   1 
ATOM   2044 C  CB  . LYS B 1 104 ? 13.821 10.753 -11.593 1.00 32.86 ? 104  LYS B CB  1 
ATOM   2045 C  CG  . LYS B 1 104 ? 14.947 9.809  -11.982 1.00 34.45 ? 104  LYS B CG  1 
ATOM   2046 C  CD  . LYS B 1 104 ? 15.481 9.077  -10.738 1.00 35.76 ? 104  LYS B CD  1 
ATOM   2047 C  CE  . LYS B 1 104 ? 16.534 8.034  -11.121 1.00 40.53 ? 104  LYS B CE  1 
ATOM   2048 N  NZ  . LYS B 1 104 ? 17.596 7.925  -10.093 1.00 47.79 ? 104  LYS B NZ  1 
ATOM   2049 N  N   . ASP B 1 105 ? 11.832 13.462 -12.149 1.00 31.40 ? 105  ASP B N   1 
ATOM   2050 C  CA  . ASP B 1 105 ? 10.503 14.007 -11.904 1.00 32.38 ? 105  ASP B CA  1 
ATOM   2051 C  C   . ASP B 1 105 ? 9.809  14.401 -13.210 1.00 34.64 ? 105  ASP B C   1 
ATOM   2052 O  O   . ASP B 1 105 ? 10.187 15.364 -13.826 1.00 35.31 ? 105  ASP B O   1 
ATOM   2053 C  CB  . ASP B 1 105 ? 10.594 15.203 -10.966 1.00 30.82 ? 105  ASP B CB  1 
ATOM   2054 C  CG  . ASP B 1 105 ? 9.240  15.637 -10.449 1.00 34.44 ? 105  ASP B CG  1 
ATOM   2055 O  OD1 . ASP B 1 105 ? 8.216  15.305 -11.086 1.00 34.95 ? 105  ASP B OD1 1 
ATOM   2056 O  OD2 . ASP B 1 105 ? 9.193  16.298 -9.400  1.00 36.08 ? 105  ASP B OD2 1 
ATOM   2057 N  N   . LYS B 1 106 ? 8.778  13.685 -13.643 1.00 35.87 ? 106  LYS B N   1 
ATOM   2058 C  CA  . LYS B 1 106 ? 8.114  14.085 -14.887 1.00 38.81 ? 106  LYS B CA  1 
ATOM   2059 C  C   . LYS B 1 106 ? 6.989  15.112 -14.686 1.00 38.32 ? 106  LYS B C   1 
ATOM   2060 O  O   . LYS B 1 106 ? 6.374  15.567 -15.661 1.00 38.07 ? 106  LYS B O   1 
ATOM   2061 C  CB  . LYS B 1 106 ? 7.617  12.877 -15.677 1.00 42.81 ? 106  LYS B CB  1 
ATOM   2062 C  CG  . LYS B 1 106 ? 8.685  11.784 -15.864 1.00 51.23 ? 106  LYS B CG  1 
ATOM   2063 C  CD  . LYS B 1 106 ? 9.786  12.180 -16.848 1.00 55.47 ? 106  LYS B CD  1 
ATOM   2064 C  CE  . LYS B 1 106 ? 11.053 11.365 -16.577 1.00 59.22 ? 106  LYS B CE  1 
ATOM   2065 N  NZ  . LYS B 1 106 ? 11.928 11.306 -17.771 1.00 61.44 ? 106  LYS B NZ  1 
ATOM   2066 N  N   . LYS B 1 107 ? 6.751  15.524 -13.449 1.00 37.43 ? 107  LYS B N   1 
ATOM   2067 C  CA  . LYS B 1 107 ? 5.652  16.473 -13.177 1.00 38.94 ? 107  LYS B CA  1 
ATOM   2068 C  C   . LYS B 1 107 ? 6.100  17.912 -13.318 1.00 37.98 ? 107  LYS B C   1 
ATOM   2069 O  O   . LYS B 1 107 ? 5.314  18.822 -13.040 1.00 39.83 ? 107  LYS B O   1 
ATOM   2070 C  CB  . LYS B 1 107 ? 5.073  16.259 -11.778 1.00 38.65 ? 107  LYS B CB  1 
ATOM   2071 C  CG  . LYS B 1 107 ? 4.630  14.784 -11.511 1.00 45.34 ? 107  LYS B CG  1 
ATOM   2072 C  CD  . LYS B 1 107 ? 4.053  14.569 -10.103 1.00 47.77 ? 107  LYS B CD  1 
ATOM   2073 C  CE  . LYS B 1 107 ? 4.960  15.083 -8.980  1.00 53.35 ? 107  LYS B CE  1 
ATOM   2074 N  NZ  . LYS B 1 107 ? 6.358  14.536 -9.014  1.00 55.57 ? 107  LYS B NZ  1 
ATOM   2075 N  N   . GLY B 1 108 ? 7.353  18.115 -13.737 1.00 36.91 ? 108  GLY B N   1 
ATOM   2076 C  CA  . GLY B 1 108 ? 7.934  19.455 -13.873 1.00 36.20 ? 108  GLY B CA  1 
ATOM   2077 C  C   . GLY B 1 108 ? 9.303  19.468 -14.572 1.00 34.38 ? 108  GLY B C   1 
ATOM   2078 O  O   . GLY B 1 108 ? 9.875  18.437 -14.887 1.00 39.13 ? 108  GLY B O   1 
ATOM   2079 N  N   . GLY B 1 109 ? 9.803  20.657 -14.864 1.00 33.77 ? 109  GLY B N   1 
ATOM   2080 C  CA  . GLY B 1 109 ? 11.076 20.807 -15.593 1.00 29.49 ? 109  GLY B CA  1 
ATOM   2081 C  C   . GLY B 1 109 ? 12.232 21.008 -14.655 1.00 26.38 ? 109  GLY B C   1 
ATOM   2082 O  O   . GLY B 1 109 ? 12.717 22.130 -14.449 1.00 24.48 ? 109  GLY B O   1 
ATOM   2083 N  N   . PHE B 1 110 ? 12.719 19.886 -14.147 1.00 24.79 ? 110  PHE B N   1 
ATOM   2084 C  CA  . PHE B 1 110 ? 13.752 19.889 -13.129 1.00 24.41 ? 110  PHE B CA  1 
ATOM   2085 C  C   . PHE B 1 110 ? 15.039 19.281 -13.641 1.00 27.05 ? 110  PHE B C   1 
ATOM   2086 O  O   . PHE B 1 110 ? 15.674 18.519 -12.949 1.00 29.29 ? 110  PHE B O   1 
ATOM   2087 C  CB  . PHE B 1 110 ? 13.281 19.151 -11.888 1.00 25.80 ? 110  PHE B CB  1 
ATOM   2088 C  CG  . PHE B 1 110 ? 12.129 19.804 -11.194 1.00 27.75 ? 110  PHE B CG  1 
ATOM   2089 C  CD1 . PHE B 1 110 ? 12.314 20.960 -10.437 1.00 28.15 ? 110  PHE B CD1 1 
ATOM   2090 C  CD2 . PHE B 1 110 ? 10.857 19.241 -11.263 1.00 31.74 ? 110  PHE B CD2 1 
ATOM   2091 C  CE1 . PHE B 1 110 ? 11.217 21.545 -9.774  1.00 29.72 ? 110  PHE B CE1 1 
ATOM   2092 C  CE2 . PHE B 1 110 ? 9.773  19.824 -10.609 1.00 34.49 ? 110  PHE B CE2 1 
ATOM   2093 C  CZ  . PHE B 1 110 ? 9.953  20.963 -9.870  1.00 31.56 ? 110  PHE B CZ  1 
ATOM   2094 N  N   . GLY B 1 111 ? 15.422 19.625 -14.864 1.00 29.23 ? 111  GLY B N   1 
ATOM   2095 C  CA  . GLY B 1 111 ? 16.645 19.114 -15.418 1.00 31.56 ? 111  GLY B CA  1 
ATOM   2096 C  C   . GLY B 1 111 ? 17.787 20.073 -15.176 1.00 33.07 ? 111  GLY B C   1 
ATOM   2097 O  O   . GLY B 1 111 ? 17.671 21.052 -14.416 1.00 31.36 ? 111  GLY B O   1 
ATOM   2098 N  N   . VAL B 1 112 ? 18.891 19.785 -15.850 1.00 33.80 ? 112  VAL B N   1 
ATOM   2099 C  CA  . VAL B 1 112 ? 20.053 20.626 -15.828 1.00 33.64 ? 112  VAL B CA  1 
ATOM   2100 C  C   . VAL B 1 112 ? 19.632 22.065 -16.124 1.00 32.15 ? 112  VAL B C   1 
ATOM   2101 O  O   . VAL B 1 112 ? 18.827 22.339 -17.019 1.00 31.80 ? 112  VAL B O   1 
ATOM   2102 C  CB  . VAL B 1 112 ? 21.117 20.125 -16.854 1.00 37.95 ? 112  VAL B CB  1 
ATOM   2103 C  CG1 . VAL B 1 112 ? 22.157 21.202 -17.159 1.00 44.03 ? 112  VAL B CG1 1 
ATOM   2104 C  CG2 . VAL B 1 112 ? 21.784 18.842 -16.330 1.00 41.85 ? 112  VAL B CG2 1 
ATOM   2105 N  N   . GLY B 1 113 ? 20.177 22.989 -15.349 1.00 32.13 ? 113  GLY B N   1 
ATOM   2106 C  CA  . GLY B 1 113 ? 19.886 24.390 -15.556 1.00 32.60 ? 113  GLY B CA  1 
ATOM   2107 C  C   . GLY B 1 113 ? 20.211 25.276 -14.378 1.00 31.11 ? 113  GLY B C   1 
ATOM   2108 O  O   . GLY B 1 113 ? 20.942 24.894 -13.471 1.00 30.64 ? 113  GLY B O   1 
ATOM   2109 N  N   . ASN B 1 114 ? 19.632 26.469 -14.416 1.00 28.54 ? 114  ASN B N   1 
ATOM   2110 C  CA  . ASN B 1 114 ? 19.840 27.490 -13.414 1.00 29.80 ? 114  ASN B CA  1 
ATOM   2111 C  C   . ASN B 1 114 ? 18.758 27.429 -12.364 1.00 28.15 ? 114  ASN B C   1 
ATOM   2112 O  O   . ASN B 1 114 ? 17.543 27.388 -12.697 1.00 27.80 ? 114  ASN B O   1 
ATOM   2113 C  CB  . ASN B 1 114 ? 19.813 28.857 -14.079 1.00 32.13 ? 114  ASN B CB  1 
ATOM   2114 C  CG  . ASN B 1 114 ? 20.936 29.032 -15.054 1.00 35.06 ? 114  ASN B CG  1 
ATOM   2115 O  OD1 . ASN B 1 114 ? 22.100 28.981 -14.664 1.00 35.12 ? 114  ASN B OD1 1 
ATOM   2116 N  ND2 . ASN B 1 114 ? 20.609 29.219 -16.332 1.00 37.24 ? 114  ASN B ND2 1 
ATOM   2117 N  N   . TYR B 1 115 ? 19.196 27.408 -11.110 1.00 27.70 ? 115  TYR B N   1 
ATOM   2118 C  CA  . TYR B 1 115 ? 18.296 27.220 -9.986  1.00 27.00 ? 115  TYR B CA  1 
ATOM   2119 C  C   . TYR B 1 115 ? 18.444 28.280 -8.926  1.00 27.30 ? 115  TYR B C   1 
ATOM   2120 O  O   . TYR B 1 115 ? 19.515 28.815 -8.697  1.00 27.19 ? 115  TYR B O   1 
ATOM   2121 C  CB  . TYR B 1 115 ? 18.529 25.854 -9.309  1.00 26.63 ? 115  TYR B CB  1 
ATOM   2122 C  CG  . TYR B 1 115 ? 17.926 24.740 -10.101 1.00 23.79 ? 115  TYR B CG  1 
ATOM   2123 C  CD1 . TYR B 1 115 ? 18.534 24.268 -11.248 1.00 26.13 ? 115  TYR B CD1 1 
ATOM   2124 C  CD2 . TYR B 1 115 ? 16.672 24.232 -9.779  1.00 23.84 ? 115  TYR B CD2 1 
ATOM   2125 C  CE1 . TYR B 1 115 ? 17.923 23.287 -12.029 1.00 26.08 ? 115  TYR B CE1 1 
ATOM   2126 C  CE2 . TYR B 1 115 ? 16.084 23.240 -10.536 1.00 24.12 ? 115  TYR B CE2 1 
ATOM   2127 C  CZ  . TYR B 1 115 ? 16.732 22.766 -11.660 1.00 24.65 ? 115  TYR B CZ  1 
ATOM   2128 O  OH  . TYR B 1 115 ? 16.146 21.797 -12.437 1.00 27.95 ? 115  TYR B OH  1 
ATOM   2129 N  N   . GLU B 1 116 ? 17.331 28.527 -8.250  1.00 27.15 ? 116  GLU B N   1 
ATOM   2130 C  CA  . GLU B 1 116 ? 17.324 29.264 -7.000  1.00 27.45 ? 116  GLU B CA  1 
ATOM   2131 C  C   . GLU B 1 116 ? 16.844 28.332 -5.885  1.00 24.19 ? 116  GLU B C   1 
ATOM   2132 O  O   . GLU B 1 116 ? 15.869 27.612 -6.037  1.00 24.46 ? 116  GLU B O   1 
ATOM   2133 C  CB  . GLU B 1 116 ? 16.418 30.499 -7.123  1.00 29.52 ? 116  GLU B CB  1 
ATOM   2134 C  CG  . GLU B 1 116 ? 16.931 31.577 -8.069  1.00 37.63 ? 116  GLU B CG  1 
ATOM   2135 C  CD  . GLU B 1 116 ? 15.926 32.733 -8.287  1.00 44.26 ? 116  GLU B CD  1 
ATOM   2136 O  OE1 . GLU B 1 116 ? 14.827 32.722 -7.685  1.00 44.30 ? 116  GLU B OE1 1 
ATOM   2137 O  OE2 . GLU B 1 116 ? 16.241 33.655 -9.068  1.00 49.99 ? 116  GLU B OE2 1 
ATOM   2138 N  N   . LEU B 1 117 ? 17.566 28.332 -4.769  1.00 24.95 ? 117  LEU B N   1 
ATOM   2139 C  CA  . LEU B 1 117 ? 17.224 27.558 -3.623  1.00 25.76 ? 117  LEU B CA  1 
ATOM   2140 C  C   . LEU B 1 117 ? 16.986 28.501 -2.455  1.00 25.83 ? 117  LEU B C   1 
ATOM   2141 O  O   . LEU B 1 117 ? 17.796 29.403 -2.189  1.00 27.35 ? 117  LEU B O   1 
ATOM   2142 C  CB  . LEU B 1 117 ? 18.353 26.566 -3.285  1.00 25.60 ? 117  LEU B CB  1 
ATOM   2143 C  CG  . LEU B 1 117 ? 18.222 25.817 -1.972  1.00 23.97 ? 117  LEU B CG  1 
ATOM   2144 C  CD1 . LEU B 1 117 ? 17.027 24.848 -1.981  1.00 22.90 ? 117  LEU B CD1 1 
ATOM   2145 C  CD2 . LEU B 1 117 ? 19.546 25.102 -1.698  1.00 25.52 ? 117  LEU B CD2 1 
ATOM   2146 N  N   . THR B 1 118 ? 15.873 28.301 -1.755  1.00 25.11 ? 118  THR B N   1 
ATOM   2147 C  CA  . THR B 1 118 ? 15.601 29.077 -0.553  1.00 26.37 ? 118  THR B CA  1 
ATOM   2148 C  C   . THR B 1 118 ? 15.381 28.109 0.578   1.00 23.17 ? 118  THR B C   1 
ATOM   2149 O  O   . THR B 1 118 ? 14.683 27.110 0.412   1.00 23.55 ? 118  THR B O   1 
ATOM   2150 C  CB  . THR B 1 118 ? 14.356 29.986 -0.714  1.00 29.75 ? 118  THR B CB  1 
ATOM   2151 O  OG1 . THR B 1 118 ? 14.489 30.788 -1.906  1.00 29.14 ? 118  THR B OG1 1 
ATOM   2152 C  CG2 . THR B 1 118 ? 14.182 30.888 0.543   1.00 28.47 ? 118  THR B CG2 1 
ATOM   2153 N  N   . PHE B 1 119 ? 16.016 28.374 1.713   1.00 20.60 ? 119  PHE B N   1 
ATOM   2154 C  CA  . PHE B 1 119 ? 15.706 27.686 2.970   1.00 23.37 ? 119  PHE B CA  1 
ATOM   2155 C  C   . PHE B 1 119 ? 14.945 28.655 3.836   1.00 25.01 ? 119  PHE B C   1 
ATOM   2156 O  O   . PHE B 1 119 ? 15.351 29.837 3.956   1.00 27.79 ? 119  PHE B O   1 
ATOM   2157 C  CB  . PHE B 1 119 ? 16.967 27.289 3.744   1.00 24.03 ? 119  PHE B CB  1 
ATOM   2158 C  CG  . PHE B 1 119 ? 17.793 26.169 3.120   1.00 25.44 ? 119  PHE B CG  1 
ATOM   2159 C  CD1 . PHE B 1 119 ? 17.209 25.147 2.374   1.00 27.05 ? 119  PHE B CD1 1 
ATOM   2160 C  CD2 . PHE B 1 119 ? 19.174 26.127 3.340   1.00 25.20 ? 119  PHE B CD2 1 
ATOM   2161 C  CE1 . PHE B 1 119 ? 18.002 24.111 1.856   1.00 28.68 ? 119  PHE B CE1 1 
ATOM   2162 C  CE2 . PHE B 1 119 ? 19.971 25.100 2.815   1.00 24.40 ? 119  PHE B CE2 1 
ATOM   2163 C  CZ  . PHE B 1 119 ? 19.372 24.098 2.065   1.00 29.71 ? 119  PHE B CZ  1 
ATOM   2164 N  N   . TYR B 1 120 ? 13.881 28.157 4.462   1.00 23.49 ? 120  TYR B N   1 
ATOM   2165 C  CA  . TYR B 1 120 ? 13.145 28.876 5.511   1.00 25.45 ? 120  TYR B CA  1 
ATOM   2166 C  C   . TYR B 1 120 ? 13.385 28.095 6.801   1.00 25.50 ? 120  TYR B C   1 
ATOM   2167 O  O   . TYR B 1 120 ? 12.943 26.946 6.939   1.00 25.82 ? 120  TYR B O   1 
ATOM   2168 C  CB  . TYR B 1 120 ? 11.660 28.879 5.190   1.00 25.83 ? 120  TYR B CB  1 
ATOM   2169 C  CG  . TYR B 1 120 ? 10.752 29.552 6.225   1.00 33.59 ? 120  TYR B CG  1 
ATOM   2170 C  CD1 . TYR B 1 120 ? 10.985 30.858 6.662   1.00 38.38 ? 120  TYR B CD1 1 
ATOM   2171 C  CD2 . TYR B 1 120 ? 9.644  28.876 6.744   1.00 40.80 ? 120  TYR B CD2 1 
ATOM   2172 C  CE1 . TYR B 1 120 ? 10.129 31.475 7.578   1.00 45.32 ? 120  TYR B CE1 1 
ATOM   2173 C  CE2 . TYR B 1 120 ? 8.798  29.475 7.659   1.00 45.87 ? 120  TYR B CE2 1 
ATOM   2174 C  CZ  . TYR B 1 120 ? 9.038  30.766 8.072   1.00 49.12 ? 120  TYR B CZ  1 
ATOM   2175 O  OH  . TYR B 1 120 ? 8.176  31.319 8.997   1.00 50.49 ? 120  TYR B OH  1 
ATOM   2176 N  N   . ILE B 1 121 ? 14.090 28.735 7.734   1.00 23.56 ? 121  ILE B N   1 
ATOM   2177 C  CA  . ILE B 1 121 ? 14.627 28.083 8.907   1.00 24.57 ? 121  ILE B CA  1 
ATOM   2178 C  C   . ILE B 1 121 ? 13.901 28.617 10.130  1.00 22.21 ? 121  ILE B C   1 
ATOM   2179 O  O   . ILE B 1 121 ? 13.834 29.838 10.311  1.00 24.62 ? 121  ILE B O   1 
ATOM   2180 C  CB  . ILE B 1 121 ? 16.113 28.350 9.023   1.00 24.84 ? 121  ILE B CB  1 
ATOM   2181 C  CG1 . ILE B 1 121 ? 16.840 27.849 7.765   1.00 25.60 ? 121  ILE B CG1 1 
ATOM   2182 C  CG2 . ILE B 1 121 ? 16.673 27.688 10.342  1.00 22.15 ? 121  ILE B CG2 1 
ATOM   2183 C  CD1 . ILE B 1 121 ? 18.301 28.179 7.679   1.00 24.48 ? 121  ILE B CD1 1 
ATOM   2184 N  N   . SER B 1 122 ? 13.357 27.723 10.939  1.00 22.38 ? 122  SER B N   1 
ATOM   2185 C  CA  . SER B 1 122 ? 12.764 28.112 12.221  1.00 23.37 ? 122  SER B CA  1 
ATOM   2186 C  C   . SER B 1 122 ? 13.537 27.495 13.386  1.00 24.58 ? 122  SER B C   1 
ATOM   2187 O  O   . SER B 1 122 ? 14.094 26.410 13.278  1.00 24.67 ? 122  SER B O   1 
ATOM   2188 C  CB  . SER B 1 122 ? 11.291 27.694 12.283  1.00 25.30 ? 122  SER B CB  1 
ATOM   2189 O  OG  . SER B 1 122 ? 10.538 28.322 11.247  1.00 30.91 ? 122  SER B OG  1 
ATOM   2190 N  N   . ASN B 1 123 ? 13.506 28.188 14.510  1.00 23.81 ? 123  ASN B N   1 
ATOM   2191 C  CA  . ASN B 1 123 ? 14.304 27.841 15.645  1.00 23.19 ? 123  ASN B CA  1 
ATOM   2192 C  C   . ASN B 1 123 ? 13.836 26.523 16.321  1.00 22.66 ? 123  ASN B C   1 
ATOM   2193 O  O   . ASN B 1 123 ? 12.749 26.005 16.046  1.00 21.70 ? 123  ASN B O   1 
ATOM   2194 C  CB  . ASN B 1 123 ? 14.381 29.033 16.619  1.00 23.88 ? 123  ASN B CB  1 
ATOM   2195 C  CG  . ASN B 1 123 ? 13.089 29.267 17.365  1.00 23.73 ? 123  ASN B CG  1 
ATOM   2196 O  OD1 . ASN B 1 123 ? 12.539 28.337 17.940  1.00 23.98 ? 123  ASN B OD1 1 
ATOM   2197 N  ND2 . ASN B 1 123 ? 12.648 30.536 17.454  1.00 24.24 ? 123  ASN B ND2 1 
ATOM   2198 N  N   . PRO B 1 124 ? 14.678 25.954 17.178  1.00 20.93 ? 124  PRO B N   1 
ATOM   2199 C  CA  . PRO B 1 124 ? 14.362 24.642 17.766  1.00 20.92 ? 124  PRO B CA  1 
ATOM   2200 C  C   . PRO B 1 124 ? 13.122 24.596 18.677  1.00 20.51 ? 124  PRO B C   1 
ATOM   2201 O  O   . PRO B 1 124 ? 12.563 23.517 18.898  1.00 21.32 ? 124  PRO B O   1 
ATOM   2202 C  CB  . PRO B 1 124 ? 15.599 24.345 18.598  1.00 21.70 ? 124  PRO B CB  1 
ATOM   2203 C  CG  . PRO B 1 124 ? 16.705 25.123 17.922  1.00 21.41 ? 124  PRO B CG  1 
ATOM   2204 C  CD  . PRO B 1 124 ? 16.033 26.405 17.550  1.00 22.71 ? 124  PRO B CD  1 
ATOM   2205 N  N   . GLU B 1 125 ? 12.661 25.752 19.148  1.00 22.61 ? 125  GLU B N   1 
ATOM   2206 C  CA  . GLU B 1 125 ? 11.509 25.798 20.037  1.00 23.57 ? 125  GLU B CA  1 
ATOM   2207 C  C   . GLU B 1 125 ? 10.245 25.362 19.312  1.00 24.35 ? 125  GLU B C   1 
ATOM   2208 O  O   . GLU B 1 125 ? 9.316  24.851 19.936  1.00 29.76 ? 125  GLU B O   1 
ATOM   2209 C  CB  . GLU B 1 125 ? 11.341 27.196 20.658  1.00 27.52 ? 125  GLU B CB  1 
ATOM   2210 C  CG  . GLU B 1 125 ? 10.281 27.237 21.733  1.00 32.58 ? 125  GLU B CG  1 
ATOM   2211 C  CD  . GLU B 1 125 ? 10.328 28.520 22.543  1.00 43.88 ? 125  GLU B CD  1 
ATOM   2212 O  OE1 . GLU B 1 125 ? 11.399 28.825 23.128  1.00 53.94 ? 125  GLU B OE1 1 
ATOM   2213 O  OE2 . GLU B 1 125 ? 9.294  29.206 22.602  1.00 49.55 ? 125  GLU B OE2 1 
ATOM   2214 N  N   . LYS B 1 126 ? 10.228 25.491 17.987  1.00 25.04 ? 126  LYS B N   1 
ATOM   2215 C  CA  . LYS B 1 126 ? 9.066  25.047 17.210  1.00 27.79 ? 126  LYS B CA  1 
ATOM   2216 C  C   . LYS B 1 126 ? 8.862  23.538 17.354  1.00 28.50 ? 126  LYS B C   1 
ATOM   2217 O  O   . LYS B 1 126 ? 7.737  23.043 17.242  1.00 33.14 ? 126  LYS B O   1 
ATOM   2218 C  CB  . LYS B 1 126 ? 9.252  25.387 15.736  1.00 28.32 ? 126  LYS B CB  1 
ATOM   2219 C  CG  . LYS B 1 126 ? 7.979  25.200 14.904  1.00 35.56 ? 126  LYS B CG  1 
ATOM   2220 C  CD  . LYS B 1 126 ? 8.153  25.696 13.503  1.00 39.20 ? 126  LYS B CD  1 
ATOM   2221 C  CE  . LYS B 1 126 ? 6.892  25.391 12.666  1.00 45.16 ? 126  LYS B CE  1 
ATOM   2222 N  NZ  . LYS B 1 126 ? 6.941  26.117 11.383  1.00 50.59 ? 126  LYS B NZ  1 
ATOM   2223 N  N   . GLN B 1 127 ? 9.951  22.815 17.596  1.00 25.54 ? 127  GLN B N   1 
ATOM   2224 C  CA  . GLN B 1 127 ? 9.897  21.361 17.810  1.00 25.83 ? 127  GLN B CA  1 
ATOM   2225 C  C   . GLN B 1 127 ? 9.911  20.987 19.286  1.00 26.28 ? 127  GLN B C   1 
ATOM   2226 O  O   . GLN B 1 127 ? 9.989  19.820 19.630  1.00 30.33 ? 127  GLN B O   1 
ATOM   2227 C  CB  . GLN B 1 127 ? 11.047 20.687 17.064  1.00 23.92 ? 127  GLN B CB  1 
ATOM   2228 C  CG  . GLN B 1 127 ? 10.806 20.689 15.603  1.00 25.48 ? 127  GLN B CG  1 
ATOM   2229 C  CD  . GLN B 1 127 ? 11.882 20.011 14.784  1.00 24.23 ? 127  GLN B CD  1 
ATOM   2230 O  OE1 . GLN B 1 127 ? 12.550 19.083 15.262  1.00 28.73 ? 127  GLN B OE1 1 
ATOM   2231 N  NE2 . GLN B 1 127 ? 12.040 20.456 13.516  1.00 26.79 ? 127  GLN B NE2 1 
ATOM   2232 N  N   . GLY B 1 128 ? 9.833  21.984 20.154  1.00 25.81 ? 128  GLY B N   1 
ATOM   2233 C  CA  . GLY B 1 128 ? 9.728  21.752 21.588  1.00 26.61 ? 128  GLY B CA  1 
ATOM   2234 C  C   . GLY B 1 128 ? 11.032 21.666 22.365  1.00 24.68 ? 128  GLY B C   1 
ATOM   2235 O  O   . GLY B 1 128 ? 11.015 21.329 23.542  1.00 25.95 ? 128  GLY B O   1 
ATOM   2236 N  N   . PHE B 1 129 ? 12.139 21.988 21.707  1.00 23.42 ? 129  PHE B N   1 
ATOM   2237 C  CA  . PHE B 1 129 ? 13.451 22.062 22.345  1.00 22.09 ? 129  PHE B CA  1 
ATOM   2238 C  C   . PHE B 1 129 ? 13.480 23.270 23.243  1.00 21.59 ? 129  PHE B C   1 
ATOM   2239 O  O   . PHE B 1 129 ? 12.995 24.346 22.864  1.00 22.52 ? 129  PHE B O   1 
ATOM   2240 C  CB  . PHE B 1 129 ? 14.508 22.233 21.269  1.00 21.59 ? 129  PHE B CB  1 
ATOM   2241 C  CG  . PHE B 1 129 ? 15.903 22.198 21.782  1.00 17.39 ? 129  PHE B CG  1 
ATOM   2242 C  CD1 . PHE B 1 129 ? 16.534 20.999 21.998  1.00 18.65 ? 129  PHE B CD1 1 
ATOM   2243 C  CD2 . PHE B 1 129 ? 16.612 23.358 21.986  1.00 18.91 ? 129  PHE B CD2 1 
ATOM   2244 C  CE1 . PHE B 1 129 ? 17.850 20.964 22.444  1.00 18.67 ? 129  PHE B CE1 1 
ATOM   2245 C  CE2 . PHE B 1 129 ? 17.953 23.329 22.429  1.00 18.83 ? 129  PHE B CE2 1 
ATOM   2246 C  CZ  . PHE B 1 129 ? 18.565 22.142 22.635  1.00 17.51 ? 129  PHE B CZ  1 
ATOM   2247 N  N   . GLY B 1 130 ? 14.011 23.084 24.448  1.00 22.17 ? 130  GLY B N   1 
ATOM   2248 C  CA  . GLY B 1 130 ? 13.917 24.051 25.492  1.00 22.64 ? 130  GLY B CA  1 
ATOM   2249 C  C   . GLY B 1 130 ? 15.148 24.893 25.614  1.00 20.86 ? 130  GLY B C   1 
ATOM   2250 O  O   . GLY B 1 130 ? 16.214 24.607 25.025  1.00 19.53 ? 130  GLY B O   1 
ATOM   2251 N  N   . ARG B 1 131 ? 14.996 25.997 26.325  1.00 23.54 ? 131  ARG B N   1 
ATOM   2252 C  CA  . ARG B 1 131 ? 16.155 26.842 26.630  1.00 23.17 ? 131  ARG B CA  1 
ATOM   2253 C  C   . ARG B 1 131 ? 16.053 27.353 28.049  1.00 22.14 ? 131  ARG B C   1 
ATOM   2254 O  O   . ARG B 1 131 ? 14.959 27.669 28.529  1.00 23.06 ? 131  ARG B O   1 
ATOM   2255 C  CB  . ARG B 1 131 ? 16.360 27.951 25.607  1.00 27.68 ? 131  ARG B CB  1 
ATOM   2256 C  CG  . ARG B 1 131 ? 15.330 28.999 25.593  1.00 27.64 ? 131  ARG B CG  1 
ATOM   2257 C  CD  . ARG B 1 131 ? 15.821 30.270 24.864  1.00 27.59 ? 131  ARG B CD  1 
ATOM   2258 N  NE  . ARG B 1 131 ? 14.787 31.248 25.096  1.00 31.27 ? 131  ARG B NE  1 
ATOM   2259 C  CZ  . ARG B 1 131 ? 14.892 32.421 25.695  1.00 30.72 ? 131  ARG B CZ  1 
ATOM   2260 N  NH1 . ARG B 1 131 ? 16.033 32.914 26.165  1.00 27.80 ? 131  ARG B NH1 1 
ATOM   2261 N  NH2 . ARG B 1 131 ? 13.801 33.139 25.798  1.00 34.54 ? 131  ARG B NH2 1 
ATOM   2262 N  N   . HIS B 1 132 ? 17.182 27.398 28.727  1.00 19.63 ? 132  HIS B N   1 
ATOM   2263 C  CA  . HIS B 1 132 ? 17.260 27.899 30.074  1.00 21.18 ? 132  HIS B CA  1 
ATOM   2264 C  C   . HIS B 1 132 ? 17.134 29.413 29.963  1.00 22.44 ? 132  HIS B C   1 
ATOM   2265 O  O   . HIS B 1 132 ? 17.747 30.025 29.074  1.00 22.60 ? 132  HIS B O   1 
ATOM   2266 C  CB  . HIS B 1 132 ? 18.607 27.546 30.727  1.00 22.87 ? 132  HIS B CB  1 
ATOM   2267 C  CG  . HIS B 1 132 ? 18.798 26.093 31.065  1.00 20.86 ? 132  HIS B CG  1 
ATOM   2268 N  ND1 . HIS B 1 132 ? 19.513 25.707 32.169  1.00 22.92 ? 132  HIS B ND1 1 
ATOM   2269 C  CD2 . HIS B 1 132 ? 18.403 24.949 30.460  1.00 22.64 ? 132  HIS B CD2 1 
ATOM   2270 C  CE1 . HIS B 1 132 ? 19.560 24.392 32.232  1.00 23.93 ? 132  HIS B CE1 1 
ATOM   2271 N  NE2 . HIS B 1 132 ? 18.889 23.914 31.205  1.00 23.40 ? 132  HIS B NE2 1 
ATOM   2272 N  N   . VAL B 1 133 ? 16.329 30.008 30.836  1.00 24.52 ? 133  VAL B N   1 
ATOM   2273 C  CA  . VAL B 1 133 ? 16.192 31.467 30.859  1.00 25.82 ? 133  VAL B CA  1 
ATOM   2274 C  C   . VAL B 1 133 ? 16.508 32.078 32.232  1.00 27.74 ? 133  VAL B C   1 
ATOM   2275 O  O   . VAL B 1 133 ? 16.486 33.298 32.389  1.00 30.45 ? 133  VAL B O   1 
ATOM   2276 C  CB  . VAL B 1 133 ? 14.812 31.922 30.324  1.00 28.04 ? 133  VAL B CB  1 
ATOM   2277 C  CG1 . VAL B 1 133 ? 14.586 31.347 28.937  1.00 27.69 ? 133  VAL B CG1 1 
ATOM   2278 C  CG2 . VAL B 1 133 ? 13.651 31.533 31.249  1.00 27.82 ? 133  VAL B CG2 1 
ATOM   2279 N  N   . ASP B 1 134 ? 16.831 31.256 33.220  1.00 31.14 ? 134  ASP B N   1 
ATOM   2280 C  CA  . ASP B 1 134 ? 17.275 31.768 34.510  1.00 32.43 ? 134  ASP B CA  1 
ATOM   2281 C  C   . ASP B 1 134 ? 18.603 32.516 34.370  1.00 33.53 ? 134  ASP B C   1 
ATOM   2282 O  O   . ASP B 1 134 ? 19.361 32.305 33.431  1.00 29.52 ? 134  ASP B O   1 
ATOM   2283 C  CB  . ASP B 1 134 ? 17.414 30.636 35.527  1.00 35.56 ? 134  ASP B CB  1 
ATOM   2284 C  CG  . ASP B 1 134 ? 18.197 29.473 34.978  1.00 32.96 ? 134  ASP B CG  1 
ATOM   2285 O  OD1 . ASP B 1 134 ? 17.613 28.738 34.153  1.00 32.43 ? 134  ASP B OD1 1 
ATOM   2286 O  OD2 . ASP B 1 134 ? 19.383 29.313 35.350  1.00 35.26 ? 134  ASP B OD2 1 
ATOM   2287 N  N   . GLU B 1 135 ? 18.873 33.410 35.309  1.00 37.38 ? 135  GLU B N   1 
ATOM   2288 C  CA  . GLU B 1 135 ? 20.057 34.268 35.229  1.00 40.68 ? 135  GLU B CA  1 
ATOM   2289 C  C   . GLU B 1 135 ? 21.332 33.430 35.277  1.00 39.63 ? 135  GLU B C   1 
ATOM   2290 O  O   . GLU B 1 135 ? 22.310 33.718 34.580  1.00 39.35 ? 135  GLU B O   1 
ATOM   2291 C  CB  . GLU B 1 135 ? 20.046 35.283 36.383  1.00 46.62 ? 135  GLU B CB  1 
ATOM   2292 C  CG  . GLU B 1 135 ? 21.125 36.354 36.309  1.00 55.54 ? 135  GLU B CG  1 
ATOM   2293 C  CD  . GLU B 1 135 ? 21.290 37.116 37.617  1.00 64.01 ? 135  GLU B CD  1 
ATOM   2294 O  OE1 . GLU B 1 135 ? 20.359 37.102 38.463  1.00 70.78 ? 135  GLU B OE1 1 
ATOM   2295 O  OE2 . GLU B 1 135 ? 22.365 37.726 37.799  1.00 72.57 ? 135  GLU B OE2 1 
ATOM   2296 N  N   . GLU B 1 136 ? 21.298 32.384 36.095  1.00 39.34 ? 136  GLU B N   1 
ATOM   2297 C  CA  . GLU B 1 136 ? 22.470 31.579 36.368  1.00 41.12 ? 136  GLU B CA  1 
ATOM   2298 C  C   . GLU B 1 136 ? 22.923 30.759 35.157  1.00 36.63 ? 136  GLU B C   1 
ATOM   2299 O  O   . GLU B 1 136 ? 24.120 30.639 34.914  1.00 38.28 ? 136  GLU B O   1 
ATOM   2300 C  CB  . GLU B 1 136 ? 22.200 30.637 37.546  1.00 45.51 ? 136  GLU B CB  1 
ATOM   2301 C  CG  . GLU B 1 136 ? 23.432 30.300 38.374  1.00 57.98 ? 136  GLU B CG  1 
ATOM   2302 C  CD  . GLU B 1 136 ? 23.672 31.286 39.511  1.00 66.76 ? 136  GLU B CD  1 
ATOM   2303 O  OE1 . GLU B 1 136 ? 23.075 32.389 39.494  1.00 78.80 ? 136  GLU B OE1 1 
ATOM   2304 O  OE2 . GLU B 1 136 ? 24.457 30.953 40.429  1.00 81.76 ? 136  GLU B OE2 1 
ATOM   2305 N  N   . THR B 1 137 ? 21.976 30.169 34.424  1.00 32.32 ? 137  THR B N   1 
ATOM   2306 C  CA  . THR B 1 137 ? 22.326 29.197 33.372  1.00 29.67 ? 137  THR B CA  1 
ATOM   2307 C  C   . THR B 1 137 ? 21.733 29.537 32.033  1.00 26.87 ? 137  THR B C   1 
ATOM   2308 O  O   . THR B 1 137 ? 21.888 28.764 31.087  1.00 27.02 ? 137  THR B O   1 
ATOM   2309 C  CB  . THR B 1 137 ? 21.867 27.742 33.743  1.00 30.41 ? 137  THR B CB  1 
ATOM   2310 O  OG1 . THR B 1 137 ? 20.434 27.669 33.805  1.00 30.62 ? 137  THR B OG1 1 
ATOM   2311 C  CG2 . THR B 1 137 ? 22.451 27.296 35.084  1.00 34.31 ? 137  THR B CG2 1 
ATOM   2312 N  N   . GLY B 1 138 ? 21.088 30.705 31.943  1.00 25.83 ? 138  GLY B N   1 
ATOM   2313 C  CA  . GLY B 1 138 ? 20.258 31.052 30.818  1.00 23.43 ? 138  GLY B CA  1 
ATOM   2314 C  C   . GLY B 1 138 ? 21.040 31.526 29.605  1.00 23.09 ? 138  GLY B C   1 
ATOM   2315 O  O   . GLY B 1 138 ? 22.215 31.885 29.681  1.00 25.44 ? 138  GLY B O   1 
ATOM   2316 N  N   . VAL B 1 139 ? 20.358 31.504 28.478  1.00 21.94 ? 139  VAL B N   1 
ATOM   2317 C  CA  . VAL B 1 139 ? 20.918 31.907 27.198  1.00 23.78 ? 139  VAL B CA  1 
ATOM   2318 C  C   . VAL B 1 139 ? 19.958 32.879 26.540  1.00 25.53 ? 139  VAL B C   1 
ATOM   2319 O  O   . VAL B 1 139 ? 18.822 33.113 27.021  1.00 25.81 ? 139  VAL B O   1 
ATOM   2320 C  CB  . VAL B 1 139 ? 21.182 30.684 26.241  1.00 23.69 ? 139  VAL B CB  1 
ATOM   2321 C  CG1 . VAL B 1 139 ? 22.044 29.631 26.905  1.00 26.50 ? 139  VAL B CG1 1 
ATOM   2322 C  CG2 . VAL B 1 139 ? 19.870 30.094 25.698  1.00 23.11 ? 139  VAL B CG2 1 
ATOM   2323 N  N   . GLY B 1 140 ? 20.423 33.452 25.437  1.00 24.99 ? 140  GLY B N   1 
ATOM   2324 C  CA  . GLY B 1 140 ? 19.686 34.425 24.703  1.00 25.02 ? 140  GLY B CA  1 
ATOM   2325 C  C   . GLY B 1 140 ? 18.491 33.867 23.990  1.00 24.37 ? 140  GLY B C   1 
ATOM   2326 O  O   . GLY B 1 140 ? 18.368 32.655 23.745  1.00 23.80 ? 140  GLY B O   1 
ATOM   2327 N  N   . LYS B 1 141 ? 17.602 34.751 23.613  1.00 24.13 ? 141  LYS B N   1 
ATOM   2328 C  CA  . LYS B 1 141 ? 16.382 34.316 22.962  1.00 25.61 ? 141  LYS B CA  1 
ATOM   2329 C  C   . LYS B 1 141 ? 16.733 33.795 21.544  1.00 23.59 ? 141  LYS B C   1 
ATOM   2330 O  O   . LYS B 1 141 ? 17.739 34.184 20.927  1.00 24.48 ? 141  LYS B O   1 
ATOM   2331 C  CB  . LYS B 1 141 ? 15.331 35.453 22.968  1.00 31.45 ? 141  LYS B CB  1 
ATOM   2332 C  CG  . LYS B 1 141 ? 15.326 36.369 21.839  1.00 39.59 ? 141  LYS B CG  1 
ATOM   2333 C  CD  . LYS B 1 141 ? 14.129 37.338 21.987  1.00 49.07 ? 141  LYS B CD  1 
ATOM   2334 C  CE  . LYS B 1 141 ? 12.779 36.597 22.053  1.00 52.43 ? 141  LYS B CE  1 
ATOM   2335 N  NZ  . LYS B 1 141 ? 11.606 37.490 21.801  1.00 61.21 ? 141  LYS B NZ  1 
ATOM   2336 N  N   . TRP B 1 142 ? 15.898 32.887 21.064  1.00 22.88 ? 142  TRP B N   1 
ATOM   2337 C  CA  . TRP B 1 142 ? 16.039 32.347 19.718  1.00 23.96 ? 142  TRP B CA  1 
ATOM   2338 C  C   . TRP B 1 142 ? 15.754 33.362 18.631  1.00 23.33 ? 142  TRP B C   1 
ATOM   2339 O  O   . TRP B 1 142 ? 14.895 34.245 18.772  1.00 26.73 ? 142  TRP B O   1 
ATOM   2340 C  CB  . TRP B 1 142 ? 15.047 31.213 19.512  1.00 25.18 ? 142  TRP B CB  1 
ATOM   2341 C  CG  . TRP B 1 142 ? 15.303 29.995 20.313  1.00 26.92 ? 142  TRP B CG  1 
ATOM   2342 C  CD1 . TRP B 1 142 ? 14.500 29.463 21.286  1.00 30.65 ? 142  TRP B CD1 1 
ATOM   2343 C  CD2 . TRP B 1 142 ? 16.407 29.124 20.174  1.00 26.82 ? 142  TRP B CD2 1 
ATOM   2344 N  NE1 . TRP B 1 142 ? 15.067 28.320 21.779  1.00 33.06 ? 142  TRP B NE1 1 
ATOM   2345 C  CE2 . TRP B 1 142 ? 16.247 28.092 21.117  1.00 28.78 ? 142  TRP B CE2 1 
ATOM   2346 C  CE3 . TRP B 1 142 ? 17.533 29.121 19.356  1.00 27.97 ? 142  TRP B CE3 1 
ATOM   2347 C  CZ2 . TRP B 1 142 ? 17.171 27.042 21.239  1.00 32.44 ? 142  TRP B CZ2 1 
ATOM   2348 C  CZ3 . TRP B 1 142 ? 18.448 28.083 19.475  1.00 33.07 ? 142  TRP B CZ3 1 
ATOM   2349 C  CH2 . TRP B 1 142 ? 18.264 27.068 20.413  1.00 29.43 ? 142  TRP B CH2 1 
ATOM   2350 N  N   . PHE B 1 143 ? 16.438 33.197 17.512  1.00 33.57 ? 143  PHE B N   1 
ATOM   2351 C  CA  . PHE B 1 143 ? 16.113 33.915 16.315  1.00 32.11 ? 143  PHE B CA  1 
ATOM   2352 C  C   . PHE B 1 143 ? 14.683 33.693 15.832  1.00 31.77 ? 143  PHE B C   1 
ATOM   2353 O  O   . PHE B 1 143 ? 14.134 32.620 15.977  1.00 30.49 ? 143  PHE B O   1 
ATOM   2354 C  CB  . PHE B 1 143 ? 17.067 33.529 15.191  1.00 32.05 ? 143  PHE B CB  1 
ATOM   2355 C  CG  . PHE B 1 143 ? 17.070 32.051 14.866  1.00 30.21 ? 143  PHE B CG  1 
ATOM   2356 C  CD1 . PHE B 1 143 ? 16.183 31.516 13.954  1.00 29.57 ? 143  PHE B CD1 1 
ATOM   2357 C  CD2 . PHE B 1 143 ? 17.994 31.217 15.458  1.00 30.05 ? 143  PHE B CD2 1 
ATOM   2358 C  CE1 . PHE B 1 143 ? 16.202 30.146 13.645  1.00 29.78 ? 143  PHE B CE1 1 
ATOM   2359 C  CE2 . PHE B 1 143 ? 18.025 29.868 15.141  1.00 29.21 ? 143  PHE B CE2 1 
ATOM   2360 C  CZ  . PHE B 1 143 ? 17.128 29.341 14.235  1.00 29.06 ? 143  PHE B CZ  1 
ATOM   2361 N  N   . GLU B 1 144 ? 14.121 34.724 15.189  1.00 34.24 ? 144  GLU B N   1 
ATOM   2362 C  CA  . GLU B 1 144 ? 12.855 34.581 14.476  1.00 34.05 ? 144  GLU B CA  1 
ATOM   2363 C  C   . GLU B 1 144 ? 13.081 33.853 13.150  1.00 33.51 ? 144  GLU B C   1 
ATOM   2364 O  O   . GLU B 1 144 ? 14.202 33.850 12.618  1.00 30.77 ? 144  GLU B O   1 
ATOM   2365 C  CB  . GLU B 1 144 ? 12.201 35.974 14.239  1.00 38.45 ? 144  GLU B CB  1 
ATOM   2366 C  CG  . GLU B 1 144 ? 11.783 36.675 15.527  1.00 46.74 ? 144  GLU B CG  1 
ATOM   2367 C  CD  . GLU B 1 144 ? 10.700 35.938 16.315  1.00 58.05 ? 144  GLU B CD  1 
ATOM   2368 O  OE1 . GLU B 1 144 ? 9.996  35.073 15.737  1.00 62.20 ? 144  GLU B OE1 1 
ATOM   2369 O  OE2 . GLU B 1 144 ? 10.556 36.233 17.528  1.00 69.17 ? 144  GLU B OE2 1 
ATOM   2370 N  N   . PRO B 1 145 ? 12.010 33.231 12.605  1.00 33.18 ? 145  PRO B N   1 
ATOM   2371 C  CA  . PRO B 1 145 ? 12.171 32.505 11.366  1.00 31.75 ? 145  PRO B CA  1 
ATOM   2372 C  C   . PRO B 1 145 ? 12.752 33.366 10.262  1.00 31.36 ? 145  PRO B C   1 
ATOM   2373 O  O   . PRO B 1 145 ? 12.451 34.554 10.176  1.00 34.25 ? 145  PRO B O   1 
ATOM   2374 C  CB  . PRO B 1 145 ? 10.751 32.020 11.052  1.00 34.56 ? 145  PRO B CB  1 
ATOM   2375 C  CG  . PRO B 1 145 ? 10.058 31.992 12.395  1.00 34.56 ? 145  PRO B CG  1 
ATOM   2376 C  CD  . PRO B 1 145 ? 10.625 33.151 13.127  1.00 34.11 ? 145  PRO B CD  1 
ATOM   2377 N  N   . PHE B 1 146 ? 13.646 32.795 9.462   1.00 31.38 ? 146  PHE B N   1 
ATOM   2378 C  CA  . PHE B 1 146 ? 14.348 33.562 8.440   1.00 30.91 ? 146  PHE B CA  1 
ATOM   2379 C  C   . PHE B 1 146 ? 14.612 32.726 7.217   1.00 29.82 ? 146  PHE B C   1 
ATOM   2380 O  O   . PHE B 1 146 ? 14.489 31.490 7.255   1.00 29.08 ? 146  PHE B O   1 
ATOM   2381 C  CB  . PHE B 1 146 ? 15.653 34.162 8.983   1.00 31.86 ? 146  PHE B CB  1 
ATOM   2382 C  CG  . PHE B 1 146 ? 16.716 33.139 9.277   1.00 29.75 ? 146  PHE B CG  1 
ATOM   2383 C  CD1 . PHE B 1 146 ? 16.702 32.450 10.470  1.00 31.82 ? 146  PHE B CD1 1 
ATOM   2384 C  CD2 . PHE B 1 146 ? 17.740 32.888 8.359   1.00 32.24 ? 146  PHE B CD2 1 
ATOM   2385 C  CE1 . PHE B 1 146 ? 17.688 31.473 10.757  1.00 30.70 ? 146  PHE B CE1 1 
ATOM   2386 C  CE2 . PHE B 1 146 ? 18.723 31.920 8.634   1.00 30.58 ? 146  PHE B CE2 1 
ATOM   2387 C  CZ  . PHE B 1 146 ? 18.688 31.238 9.854   1.00 28.97 ? 146  PHE B CZ  1 
ATOM   2388 N  N   . LYS B 1 147 ? 14.936 33.415 6.129   1.00 30.70 ? 147  LYS B N   1 
ATOM   2389 C  CA  . LYS B 1 147 ? 15.217 32.764 4.868   1.00 31.20 ? 147  LYS B CA  1 
ATOM   2390 C  C   . LYS B 1 147 ? 16.639 33.031 4.429   1.00 30.92 ? 147  LYS B C   1 
ATOM   2391 O  O   . LYS B 1 147 ? 17.158 34.118 4.635   1.00 33.93 ? 147  LYS B O   1 
ATOM   2392 C  CB  . LYS B 1 147 ? 14.249 33.254 3.765   1.00 35.87 ? 147  LYS B CB  1 
ATOM   2393 C  CG  . LYS B 1 147 ? 12.800 32.900 4.074   1.00 41.75 ? 147  LYS B CG  1 
ATOM   2394 C  CD  . LYS B 1 147 ? 11.826 33.413 3.021   1.00 48.94 ? 147  LYS B CD  1 
ATOM   2395 C  CE  . LYS B 1 147 ? 10.381 33.111 3.446   1.00 54.39 ? 147  LYS B CE  1 
ATOM   2396 N  NZ  . LYS B 1 147 ? 9.448  32.913 2.292   1.00 54.10 ? 147  LYS B NZ  1 
ATOM   2397 N  N   . VAL B 1 148 ? 17.243 32.031 3.793   1.00 30.47 ? 148  VAL B N   1 
ATOM   2398 C  CA  . VAL B 1 148 ? 18.502 32.212 3.093   1.00 30.96 ? 148  VAL B CA  1 
ATOM   2399 C  C   . VAL B 1 148 ? 18.312 31.767 1.660   1.00 31.07 ? 148  VAL B C   1 
ATOM   2400 O  O   . VAL B 1 148 ? 17.613 30.795 1.410   1.00 28.51 ? 148  VAL B O   1 
ATOM   2401 C  CB  . VAL B 1 148 ? 19.656 31.415 3.777   1.00 32.35 ? 148  VAL B CB  1 
ATOM   2402 C  CG1 . VAL B 1 148 ? 19.884 31.937 5.178   1.00 36.57 ? 148  VAL B CG1 1 
ATOM   2403 C  CG2 . VAL B 1 148 ? 19.353 29.923 3.800   1.00 31.24 ? 148  VAL B CG2 1 
ATOM   2404 N  N   . ASP B 1 149 ? 18.942 32.470 0.734   1.00 32.54 ? 149  ASP B N   1 
ATOM   2405 C  CA  . ASP B 1 149 ? 18.787 32.222 -0.684  1.00 34.71 ? 149  ASP B CA  1 
ATOM   2406 C  C   . ASP B 1 149 ? 20.119 31.887 -1.332  1.00 35.74 ? 149  ASP B C   1 
ATOM   2407 O  O   . ASP B 1 149 ? 21.146 32.438 -0.949  1.00 36.54 ? 149  ASP B O   1 
ATOM   2408 C  CB  . ASP B 1 149 ? 18.242 33.478 -1.355  1.00 41.27 ? 149  ASP B CB  1 
ATOM   2409 C  CG  . ASP B 1 149 ? 16.848 33.796 -0.908  1.00 50.20 ? 149  ASP B CG  1 
ATOM   2410 O  OD1 . ASP B 1 149 ? 15.972 32.959 -1.180  1.00 55.79 ? 149  ASP B OD1 1 
ATOM   2411 O  OD2 . ASP B 1 149 ? 16.628 34.856 -0.283  1.00 62.36 ? 149  ASP B OD2 1 
ATOM   2412 N  N   . TYR B 1 150 ? 20.068 31.018 -2.343  1.00 36.04 ? 150  TYR B N   1 
ATOM   2413 C  CA  . TYR B 1 150 ? 21.248 30.596 -3.107  1.00 36.56 ? 150  TYR B CA  1 
ATOM   2414 C  C   . TYR B 1 150 ? 20.872 30.498 -4.562  1.00 36.49 ? 150  TYR B C   1 
ATOM   2415 O  O   . TYR B 1 150 ? 19.727 30.182 -4.897  1.00 35.25 ? 150  TYR B O   1 
ATOM   2416 C  CB  . TYR B 1 150 ? 21.742 29.206 -2.649  1.00 34.69 ? 150  TYR B CB  1 
ATOM   2417 C  CG  . TYR B 1 150 ? 21.955 29.029 -1.169  1.00 32.63 ? 150  TYR B CG  1 
ATOM   2418 C  CD1 . TYR B 1 150 ? 20.922 28.647 -0.356  1.00 32.25 ? 150  TYR B CD1 1 
ATOM   2419 C  CD2 . TYR B 1 150 ? 23.216 29.184 -0.584  1.00 36.72 ? 150  TYR B CD2 1 
ATOM   2420 C  CE1 . TYR B 1 150 ? 21.109 28.472 1.009   1.00 31.85 ? 150  TYR B CE1 1 
ATOM   2421 C  CE2 . TYR B 1 150 ? 23.412 28.991 0.771   1.00 36.37 ? 150  TYR B CE2 1 
ATOM   2422 C  CZ  . TYR B 1 150 ? 22.351 28.645 1.566   1.00 32.75 ? 150  TYR B CZ  1 
ATOM   2423 O  OH  . TYR B 1 150 ? 22.505 28.442 2.909   1.00 36.00 ? 150  TYR B OH  1 
ATOM   2424 N  N   . LYS B 1 151 ? 21.831 30.778 -5.436  1.00 37.15 ? 151  LYS B N   1 
ATOM   2425 C  CA  . LYS B 1 151 ? 21.693 30.543 -6.863  1.00 40.80 ? 151  LYS B CA  1 
ATOM   2426 C  C   . LYS B 1 151 ? 22.755 29.528 -7.233  1.00 40.77 ? 151  LYS B C   1 
ATOM   2427 O  O   . LYS B 1 151 ? 23.891 29.613 -6.756  1.00 42.88 ? 151  LYS B O   1 
ATOM   2428 C  CB  . LYS B 1 151 ? 21.956 31.829 -7.620  1.00 46.27 ? 151  LYS B CB  1 
ATOM   2429 C  CG  . LYS B 1 151 ? 20.785 32.797 -7.687  1.00 55.34 ? 151  LYS B CG  1 
ATOM   2430 C  CD  . LYS B 1 151 ? 21.164 34.026 -8.520  1.00 65.48 ? 151  LYS B CD  1 
ATOM   2431 C  CE  . LYS B 1 151 ? 19.961 34.894 -8.871  1.00 70.74 ? 151  LYS B CE  1 
ATOM   2432 N  NZ  . LYS B 1 151 ? 19.521 35.733 -7.727  1.00 74.35 ? 151  LYS B NZ  1 
ATOM   2433 N  N   . PHE B 1 152 ? 22.407 28.555 -8.055  1.00 38.34 ? 152  PHE B N   1 
ATOM   2434 C  CA  . PHE B 1 152 ? 23.405 27.608 -8.519  1.00 39.18 ? 152  PHE B CA  1 
ATOM   2435 C  C   . PHE B 1 152 ? 23.022 27.035 -9.852  1.00 36.83 ? 152  PHE B C   1 
ATOM   2436 O  O   . PHE B 1 152 ? 21.868 27.144 -10.277 1.00 35.03 ? 152  PHE B O   1 
ATOM   2437 C  CB  . PHE B 1 152 ? 23.666 26.506 -7.468  1.00 38.47 ? 152  PHE B CB  1 
ATOM   2438 C  CG  . PHE B 1 152 ? 22.557 25.504 -7.306  1.00 35.82 ? 152  PHE B CG  1 
ATOM   2439 C  CD1 . PHE B 1 152 ? 21.401 25.821 -6.598  1.00 31.00 ? 152  PHE B CD1 1 
ATOM   2440 C  CD2 . PHE B 1 152 ? 22.684 24.218 -7.812  1.00 34.12 ? 152  PHE B CD2 1 
ATOM   2441 C  CE1 . PHE B 1 152 ? 20.412 24.882 -6.428  1.00 28.87 ? 152  PHE B CE1 1 
ATOM   2442 C  CE2 . PHE B 1 152 ? 21.682 23.285 -7.644  1.00 34.11 ? 152  PHE B CE2 1 
ATOM   2443 C  CZ  . PHE B 1 152 ? 20.551 23.616 -6.952  1.00 31.15 ? 152  PHE B CZ  1 
ATOM   2444 N  N   . LYS B 1 153 ? 24.014 26.456 -10.524 1.00 37.60 ? 153  LYS B N   1 
ATOM   2445 C  CA  . LYS B 1 153 ? 23.784 25.677 -11.720 1.00 39.14 ? 153  LYS B CA  1 
ATOM   2446 C  C   . LYS B 1 153 ? 23.768 24.182 -11.346 1.00 37.12 ? 153  LYS B C   1 
ATOM   2447 O  O   . LYS B 1 153 ? 24.710 23.647 -10.724 1.00 38.31 ? 153  LYS B O   1 
ATOM   2448 C  CB  . LYS B 1 153 ? 24.810 26.013 -12.821 1.00 43.05 ? 153  LYS B CB  1 
ATOM   2449 C  CG  . LYS B 1 153 ? 24.630 25.158 -14.092 1.00 52.98 ? 153  LYS B CG  1 
ATOM   2450 C  CD  . LYS B 1 153 ? 24.459 25.970 -15.396 1.00 60.77 ? 153  LYS B CD  1 
ATOM   2451 C  CE  . LYS B 1 153 ? 23.966 25.068 -16.538 1.00 63.40 ? 153  LYS B CE  1 
ATOM   2452 N  NZ  . LYS B 1 153 ? 23.407 25.825 -17.688 1.00 68.46 ? 153  LYS B NZ  1 
ATOM   2453 N  N   . TYR B 1 154 ? 22.664 23.526 -11.678 1.00 34.65 ? 154  TYR B N   1 
ATOM   2454 C  CA  . TYR B 1 154 ? 22.539 22.088 -11.492 1.00 33.19 ? 154  TYR B CA  1 
ATOM   2455 C  C   . TYR B 1 154 ? 23.020 21.397 -12.786 1.00 35.81 ? 154  TYR B C   1 
ATOM   2456 O  O   . TYR B 1 154 ? 22.492 21.637 -13.856 1.00 33.98 ? 154  TYR B O   1 
ATOM   2457 C  CB  . TYR B 1 154 ? 21.105 21.702 -11.159 1.00 30.46 ? 154  TYR B CB  1 
ATOM   2458 C  CG  . TYR B 1 154 ? 20.869 20.203 -11.203 1.00 32.05 ? 154  TYR B CG  1 
ATOM   2459 C  CD1 . TYR B 1 154 ? 21.567 19.355 -10.370 1.00 33.55 ? 154  TYR B CD1 1 
ATOM   2460 C  CD2 . TYR B 1 154 ? 19.936 19.648 -12.063 1.00 32.71 ? 154  TYR B CD2 1 
ATOM   2461 C  CE1 . TYR B 1 154 ? 21.368 18.003 -10.401 1.00 33.18 ? 154  TYR B CE1 1 
ATOM   2462 C  CE2 . TYR B 1 154 ? 19.723 18.278 -12.106 1.00 33.62 ? 154  TYR B CE2 1 
ATOM   2463 C  CZ  . TYR B 1 154 ? 20.455 17.456 -11.253 1.00 36.47 ? 154  TYR B CZ  1 
ATOM   2464 O  OH  . TYR B 1 154 ? 20.285 16.083 -11.261 1.00 37.01 ? 154  TYR B OH  1 
ATOM   2465 N  N   . THR B 1 155 ? 24.062 20.578 -12.673 1.00 40.03 ? 155  THR B N   1 
ATOM   2466 C  CA  . THR B 1 155 ? 24.674 19.954 -13.837 1.00 43.51 ? 155  THR B CA  1 
ATOM   2467 C  C   . THR B 1 155 ? 24.378 18.453 -13.936 1.00 45.50 ? 155  THR B C   1 
ATOM   2468 O  O   . THR B 1 155 ? 24.860 17.800 -14.842 1.00 48.13 ? 155  THR B O   1 
ATOM   2469 C  CB  . THR B 1 155 ? 26.201 20.192 -13.844 1.00 46.21 ? 155  THR B CB  1 
ATOM   2470 O  OG1 . THR B 1 155 ? 26.771 19.721 -12.613 1.00 47.46 ? 155  THR B OG1 1 
ATOM   2471 C  CG2 . THR B 1 155 ? 26.512 21.669 -14.013 1.00 46.97 ? 155  THR B CG2 1 
ATOM   2472 N  N   . GLY B 1 156 ? 23.568 17.913 -13.026 1.00 45.59 ? 156  GLY B N   1 
ATOM   2473 C  CA  . GLY B 1 156 ? 23.192 16.488 -13.059 1.00 47.76 ? 156  GLY B CA  1 
ATOM   2474 C  C   . GLY B 1 156 ? 23.640 15.791 -11.787 1.00 49.14 ? 156  GLY B C   1 
ATOM   2475 O  O   . GLY B 1 156 ? 24.300 16.405 -10.952 1.00 47.53 ? 156  GLY B O   1 
ATOM   2476 N  N   . THR B 1 157 ? 23.276 14.516 -11.630 1.00 52.56 ? 157  THR B N   1 
ATOM   2477 C  CA  . THR B 1 157 ? 23.706 13.716 -10.471 1.00 56.14 ? 157  THR B CA  1 
ATOM   2478 C  C   . THR B 1 157 ? 25.241 13.647 -10.383 1.00 61.61 ? 157  THR B C   1 
ATOM   2479 O  O   . THR B 1 157 ? 25.893 13.288 -11.373 1.00 60.83 ? 157  THR B O   1 
ATOM   2480 C  CB  . THR B 1 157 ? 23.144 12.277 -10.529 1.00 58.44 ? 157  THR B CB  1 
ATOM   2481 O  OG1 . THR B 1 157 ? 21.722 12.324 -10.675 1.00 58.43 ? 157  THR B OG1 1 
ATOM   2482 C  CG2 . THR B 1 157 ? 23.495 11.474 -9.260  1.00 59.76 ? 157  THR B CG2 1 
ATOM   2483 N  N   . PRO B 1 158 ? 25.821 14.004 -9.213  1.00 67.68 ? 158  PRO B N   1 
ATOM   2484 C  CA  . PRO B 1 158 ? 27.275 13.957 -9.000  1.00 76.65 ? 158  PRO B CA  1 
ATOM   2485 C  C   . PRO B 1 158 ? 27.909 12.606 -9.333  1.00 88.28 ? 158  PRO B C   1 
ATOM   2486 O  O   . PRO B 1 158 ? 27.317 11.551 -9.082  1.00 89.54 ? 158  PRO B O   1 
ATOM   2487 C  CB  . PRO B 1 158 ? 27.419 14.285 -7.510  1.00 75.94 ? 158  PRO B CB  1 
ATOM   2488 C  CG  . PRO B 1 158 ? 26.269 15.160 -7.231  1.00 68.00 ? 158  PRO B CG  1 
ATOM   2489 C  CD  . PRO B 1 158 ? 25.136 14.592 -8.045  1.00 64.47 ? 158  PRO B CD  1 
ATOM   2490 N  N   . LYS B 1 159 ? 29.134 12.674 -9.855  1.00 52.49 ? 159  LYS B N   1 
ATOM   2491 C  CA  . LYS B 1 159 ? 29.730 11.609 -10.666 1.00 55.82 ? 159  LYS B CA  1 
ATOM   2492 C  C   . LYS B 1 159 ? 31.088 11.175 -10.131 1.00 56.38 ? 159  LYS B C   1 
ATOM   2493 O  O   . LYS B 1 159 ? 31.589 10.121 -10.513 1.00 56.62 ? 159  LYS B O   1 
ATOM   2494 C  CB  . LYS B 1 159 ? 29.885 12.087 -12.122 1.00 57.43 ? 159  LYS B CB  1 
ATOM   2495 C  CG  . LYS B 1 159 ? 30.475 13.502 -12.269 1.00 61.44 ? 159  LYS B CG  1 
ATOM   2496 C  CD  . LYS B 1 159 ? 29.398 14.618 -12.210 1.00 63.27 ? 159  LYS B CD  1 
ATOM   2497 C  CE  . LYS B 1 159 ? 29.991 15.951 -11.723 1.00 65.50 ? 159  LYS B CE  1 
ATOM   2498 N  NZ  . LYS B 1 159 ? 28.981 16.969 -11.286 1.00 65.63 ? 159  LYS B NZ  1 
HETATM 2499 ZN ZN  . ZN  C 2 .   ? 18.083 21.863 31.528  0.10 19.42 ? 200  ZN  A ZN  1 
HETATM 2500 S  S   . SO4 D 3 .   ? 27.584 4.042  39.901  1.00 39.91 ? 300  SO4 A S   1 
HETATM 2501 O  O1  . SO4 D 3 .   ? 28.879 4.178  40.611  1.00 49.31 ? 300  SO4 A O1  1 
HETATM 2502 O  O2  . SO4 D 3 .   ? 27.183 5.334  39.429  1.00 44.38 ? 300  SO4 A O2  1 
HETATM 2503 O  O3  . SO4 D 3 .   ? 27.620 3.081  38.775  1.00 44.79 ? 300  SO4 A O3  1 
HETATM 2504 O  O4  . SO4 D 3 .   ? 26.652 3.482  40.880  1.00 47.13 ? 300  SO4 A O4  1 
HETATM 2505 ZN ZN  . ZN  E 2 .   ? 21.297 12.718 4.372   0.10 20.22 ? 200  ZN  B ZN  1 
HETATM 2506 S  S   . SO4 F 3 .   ? 33.252 32.554 13.866  1.00 38.03 ? 300  SO4 B S   1 
HETATM 2507 O  O1  . SO4 F 3 .   ? 34.484 32.933 14.591  1.00 41.20 ? 300  SO4 B O1  1 
HETATM 2508 O  O2  . SO4 F 3 .   ? 33.606 32.429 12.428  1.00 47.26 ? 300  SO4 B O2  1 
HETATM 2509 O  O3  . SO4 F 3 .   ? 32.678 31.238 14.212  1.00 35.44 ? 300  SO4 B O3  1 
HETATM 2510 O  O4  . SO4 F 3 .   ? 32.353 33.706 14.073  1.00 40.62 ? 300  SO4 B O4  1 
HETATM 2511 O  O   . HOH G 4 .   ? 23.190 15.565 27.270  1.00 20.04 ? 1001 HOH A O   1 
HETATM 2512 O  O   . HOH G 4 .   ? 16.664 2.254  21.028  1.00 23.12 ? 1002 HOH A O   1 
HETATM 2513 O  O   . HOH G 4 .   ? 25.032 17.522 27.715  1.00 20.32 ? 1003 HOH A O   1 
HETATM 2514 O  O   . HOH G 4 .   ? 33.075 9.576  17.076  1.00 20.18 ? 1004 HOH A O   1 
HETATM 2515 O  O   . HOH G 4 .   ? 28.868 13.166 28.232  1.00 21.76 ? 1005 HOH A O   1 
HETATM 2516 O  O   . HOH G 4 .   ? 25.725 6.076  19.143  1.00 20.79 ? 1006 HOH A O   1 
HETATM 2517 O  O   . HOH G 4 .   ? 14.259 8.966  20.233  1.00 24.11 ? 1007 HOH A O   1 
HETATM 2518 O  O   . HOH G 4 .   ? 28.723 13.366 36.077  1.00 29.62 ? 1008 HOH A O   1 
HETATM 2519 O  O   . HOH G 4 .   ? 26.386 19.454 25.172  1.00 20.59 ? 1009 HOH A O   1 
HETATM 2520 O  O   . HOH G 4 .   ? 27.744 10.184 35.968  1.00 20.45 ? 1010 HOH A O   1 
HETATM 2521 O  O   . HOH G 4 .   ? 29.402 2.304  11.654  1.00 25.22 ? 1011 HOH A O   1 
HETATM 2522 O  O   . HOH G 4 .   ? 26.775 18.560 18.667  1.00 32.03 ? 1012 HOH A O   1 
HETATM 2523 O  O   . HOH G 4 .   ? 9.089  16.070 40.576  1.00 23.88 ? 1013 HOH A O   1 
HETATM 2524 O  O   . HOH G 4 .   ? 24.837 16.800 17.703  1.00 25.16 ? 1014 HOH A O   1 
HETATM 2525 O  O   . HOH G 4 .   ? 32.481 2.333  17.753  1.00 21.31 ? 1015 HOH A O   1 
HETATM 2526 O  O   . HOH G 4 .   ? 20.057 -2.191 29.296  1.00 27.02 ? 1016 HOH A O   1 
HETATM 2527 O  O   . HOH G 4 .   ? 25.971 0.480  19.237  1.00 26.79 ? 1017 HOH A O   1 
HETATM 2528 O  O   . HOH G 4 .   ? 21.686 -2.475 21.771  1.00 30.03 ? 1018 HOH A O   1 
HETATM 2529 O  O   . HOH G 4 .   ? 32.807 7.240  13.794  1.00 26.40 ? 1019 HOH A O   1 
HETATM 2530 O  O   . HOH G 4 .   ? 31.756 11.554 12.099  1.00 28.17 ? 1020 HOH A O   1 
HETATM 2531 O  O   . HOH G 4 .   ? 14.077 17.779 13.563  1.00 30.09 ? 1021 HOH A O   1 
HETATM 2532 O  O   . HOH G 4 .   ? 15.631 15.920 53.581  1.00 33.96 ? 1022 HOH A O   1 
HETATM 2533 O  O   . HOH G 4 .   ? 12.831 22.397 49.565  1.00 29.89 ? 1023 HOH A O   1 
HETATM 2534 O  O   . HOH G 4 .   ? 16.811 27.569 41.387  1.00 34.98 ? 1024 HOH A O   1 
HETATM 2535 O  O   . HOH G 4 .   ? 18.272 -1.464 16.854  1.00 39.50 ? 1025 HOH A O   1 
HETATM 2536 O  O   . HOH G 4 .   ? 12.986 12.172 26.264  1.00 31.66 ? 1026 HOH A O   1 
HETATM 2537 O  O   . HOH G 4 .   ? 16.518 3.687  39.802  1.00 31.50 ? 1027 HOH A O   1 
HETATM 2538 O  O   . HOH G 4 .   ? 10.067 14.218 49.755  1.00 26.15 ? 1028 HOH A O   1 
HETATM 2539 O  O   . HOH G 4 .   ? 33.389 12.273 24.349  1.00 32.56 ? 1029 HOH A O   1 
HETATM 2540 O  O   . HOH G 4 .   ? 20.770 -2.098 24.199  1.00 33.99 ? 1030 HOH A O   1 
HETATM 2541 O  O   . HOH G 4 .   ? 36.171 7.679  23.363  1.00 35.43 ? 1031 HOH A O   1 
HETATM 2542 O  O   . HOH G 4 .   ? 22.860 4.937  46.585  1.00 33.32 ? 1032 HOH A O   1 
HETATM 2543 O  O   . HOH G 4 .   ? 13.501 5.643  26.574  1.00 38.12 ? 1033 HOH A O   1 
HETATM 2544 O  O   . HOH G 4 .   ? 27.655 10.330 43.317  1.00 33.58 ? 1034 HOH A O   1 
HETATM 2545 O  O   . HOH G 4 .   ? 16.222 -3.422 24.860  1.00 33.99 ? 1035 HOH A O   1 
HETATM 2546 O  O   . HOH G 4 .   ? 24.569 0.788  34.190  1.00 28.41 ? 1036 HOH A O   1 
HETATM 2547 O  O   . HOH G 4 .   ? 8.478  24.212 30.761  1.00 29.48 ? 1037 HOH A O   1 
HETATM 2548 O  O   . HOH G 4 .   ? 26.221 0.753  15.209  1.00 34.78 ? 1038 HOH A O   1 
HETATM 2549 O  O   . HOH G 4 .   ? 10.219 18.551 35.107  1.00 32.71 ? 1039 HOH A O   1 
HETATM 2550 O  O   . HOH G 4 .   ? 3.039  8.986  50.309  1.00 33.85 ? 1040 HOH A O   1 
HETATM 2551 O  O   . HOH G 4 .   ? 15.024 1.862  27.739  1.00 45.04 ? 1041 HOH A O   1 
HETATM 2552 O  O   . HOH G 4 .   ? 22.775 -0.666 3.674   1.00 36.72 ? 1042 HOH A O   1 
HETATM 2553 O  O   . HOH G 4 .   ? 32.429 4.468  19.961  1.00 31.57 ? 1043 HOH A O   1 
HETATM 2554 O  O   . HOH G 4 .   ? 5.396  23.547 34.319  1.00 34.65 ? 1044 HOH A O   1 
HETATM 2555 O  O   . HOH G 4 .   ? 27.104 30.180 26.177  1.00 38.30 ? 1045 HOH A O   1 
HETATM 2556 O  O   . HOH G 4 .   ? 27.171 10.709 45.719  1.00 35.16 ? 1046 HOH A O   1 
HETATM 2557 O  O   . HOH G 4 .   ? 30.665 4.233  5.528   1.00 33.79 ? 1047 HOH A O   1 
HETATM 2558 O  O   . HOH G 4 .   ? 24.259 21.930 29.712  1.00 34.78 ? 1048 HOH A O   1 
HETATM 2559 O  O   . HOH G 4 .   ? 16.373 28.909 38.193  1.00 44.47 ? 1049 HOH A O   1 
HETATM 2560 O  O   . HOH G 4 .   ? 0.707  14.840 49.500  1.00 25.31 ? 1050 HOH A O   1 
HETATM 2561 O  O   . HOH G 4 .   ? 14.356 14.771 21.466  1.00 35.20 ? 1051 HOH A O   1 
HETATM 2562 O  O   . HOH G 4 .   ? 22.474 -1.802 8.735   1.00 32.73 ? 1052 HOH A O   1 
HETATM 2563 O  O   . HOH G 4 .   ? 33.453 8.648  30.375  1.00 35.68 ? 1053 HOH A O   1 
HETATM 2564 O  O   . HOH G 4 .   ? 33.054 18.146 19.652  1.00 44.43 ? 1054 HOH A O   1 
HETATM 2565 O  O   . HOH G 4 .   ? 12.964 11.321 52.765  1.00 38.26 ? 1055 HOH A O   1 
HETATM 2566 O  O   . HOH G 4 .   ? 6.590  16.934 41.029  1.00 37.08 ? 1056 HOH A O   1 
HETATM 2567 O  O   . HOH G 4 .   ? 5.090  15.091 52.127  1.00 48.20 ? 1057 HOH A O   1 
HETATM 2568 O  O   . HOH G 4 .   ? 23.175 23.388 32.739  1.00 49.09 ? 1058 HOH A O   1 
HETATM 2569 O  O   . HOH G 4 .   ? 11.606 14.822 52.653  1.00 48.20 ? 1059 HOH A O   1 
HETATM 2570 O  O   . HOH G 4 .   ? 34.813 3.023  26.270  1.00 39.64 ? 1060 HOH A O   1 
HETATM 2571 O  O   . HOH G 4 .   ? 37.948 14.511 23.487  1.00 41.16 ? 1061 HOH A O   1 
HETATM 2572 O  O   . HOH G 4 .   ? 30.655 16.677 34.334  1.00 38.28 ? 1062 HOH A O   1 
HETATM 2573 O  O   . HOH G 4 .   ? 5.014  23.233 36.923  1.00 27.84 ? 1063 HOH A O   1 
HETATM 2574 O  O   . HOH G 4 .   ? 5.469  18.771 42.342  1.00 40.64 ? 1064 HOH A O   1 
HETATM 2575 O  O   . HOH G 4 .   ? 30.296 11.273 37.278  1.00 31.39 ? 1065 HOH A O   1 
HETATM 2576 O  O   . HOH G 4 .   ? 4.751  20.109 48.260  1.00 37.32 ? 1066 HOH A O   1 
HETATM 2577 O  O   . HOH G 4 .   ? 35.290 14.948 23.551  1.00 37.51 ? 1067 HOH A O   1 
HETATM 2578 O  O   . HOH G 4 .   ? 6.946  7.987  48.626  1.00 49.37 ? 1068 HOH A O   1 
HETATM 2579 O  O   . HOH G 4 .   ? 30.182 16.577 28.811  1.00 40.29 ? 1069 HOH A O   1 
HETATM 2580 O  O   . HOH G 4 .   ? 4.716  17.629 44.768  1.00 39.06 ? 1070 HOH A O   1 
HETATM 2581 O  O   . HOH G 4 .   ? 15.353 8.897  55.215  1.00 44.37 ? 1071 HOH A O   1 
HETATM 2582 O  O   . HOH G 4 .   ? 26.778 14.048 46.733  1.00 44.22 ? 1072 HOH A O   1 
HETATM 2583 O  O   . HOH G 4 .   ? 5.490  19.181 34.744  1.00 53.43 ? 1073 HOH A O   1 
HETATM 2584 O  O   . HOH G 4 .   ? 19.889 3.004  51.303  1.00 39.86 ? 1074 HOH A O   1 
HETATM 2585 O  O   . HOH G 4 .   ? 5.860  10.045 52.875  1.00 39.57 ? 1075 HOH A O   1 
HETATM 2586 O  O   . HOH G 4 .   ? 9.820  14.278 36.322  1.00 42.15 ? 1076 HOH A O   1 
HETATM 2587 O  O   . HOH G 4 .   ? 24.659 25.995 37.950  1.00 55.17 ? 1077 HOH A O   1 
HETATM 2588 O  O   . HOH G 4 .   ? 29.172 2.807  35.839  1.00 56.92 ? 1078 HOH A O   1 
HETATM 2589 O  O   . HOH G 4 .   ? 30.793 7.000  42.549  1.00 43.66 ? 1079 HOH A O   1 
HETATM 2590 O  O   . HOH G 4 .   ? 27.170 6.978  46.893  1.00 47.90 ? 1080 HOH A O   1 
HETATM 2591 O  O   . HOH G 4 .   ? 12.365 14.915 13.041  1.00 39.37 ? 1081 HOH A O   1 
HETATM 2592 O  O   . HOH G 4 .   ? 30.427 2.015  38.332  1.00 49.88 ? 1082 HOH A O   1 
HETATM 2593 O  O   . HOH G 4 .   ? 25.467 -0.732 6.075   1.00 38.24 ? 1083 HOH A O   1 
HETATM 2594 O  O   . HOH G 4 .   ? 30.535 3.049  9.512   1.00 37.04 ? 1084 HOH A O   1 
HETATM 2595 O  O   . HOH G 4 .   ? 24.352 2.525  18.666  1.00 31.56 ? 1085 HOH A O   1 
HETATM 2596 O  O   . HOH G 4 .   ? 32.988 8.799  39.503  1.00 46.36 ? 1086 HOH A O   1 
HETATM 2597 O  O   . HOH G 4 .   ? 24.184 -1.641 21.579  1.00 30.85 ? 1087 HOH A O   1 
HETATM 2598 O  O   . HOH G 4 .   ? 30.473 0.910  30.215  1.00 32.81 ? 1088 HOH A O   1 
HETATM 2599 O  O   . HOH G 4 .   ? 18.965 1.056  13.517  1.00 33.49 ? 1089 HOH A O   1 
HETATM 2600 O  O   . HOH G 4 .   ? 7.045  5.352  45.646  1.00 41.74 ? 1090 HOH A O   1 
HETATM 2601 O  O   . HOH G 4 .   ? 6.752  20.503 44.397  1.00 31.04 ? 1091 HOH A O   1 
HETATM 2602 O  O   . HOH G 4 .   ? 23.018 -0.969 25.349  1.00 31.45 ? 1092 HOH A O   1 
HETATM 2603 O  O   . HOH G 4 .   ? 35.268 15.778 17.355  1.00 35.21 ? 1093 HOH A O   1 
HETATM 2604 O  O   . HOH G 4 .   ? 6.501  8.899  39.323  1.00 36.78 ? 1094 HOH A O   1 
HETATM 2605 O  O   . HOH G 4 .   ? 13.723 13.734 23.965  1.00 32.93 ? 1095 HOH A O   1 
HETATM 2606 O  O   . HOH G 4 .   ? 12.050 13.948 10.921  1.00 45.31 ? 1096 HOH A O   1 
HETATM 2607 O  O   . HOH G 4 .   ? 9.561  16.328 37.845  1.00 34.38 ? 1097 HOH A O   1 
HETATM 2608 O  O   . HOH G 4 .   ? 21.723 0.866  46.458  1.00 45.12 ? 1098 HOH A O   1 
HETATM 2609 O  O   . HOH G 4 .   ? 27.844 4.507  -1.793  1.00 41.85 ? 1099 HOH A O   1 
HETATM 2610 O  O   . HOH G 4 .   ? 15.954 -5.145 22.690  1.00 36.44 ? 1100 HOH A O   1 
HETATM 2611 O  O   . HOH G 4 .   ? 35.921 11.299 24.003  1.00 37.10 ? 1101 HOH A O   1 
HETATM 2612 O  O   . HOH G 4 .   ? 28.876 15.457 32.940  1.00 38.35 ? 1102 HOH A O   1 
HETATM 2613 O  O   . HOH G 4 .   ? 9.048  25.351 33.348  1.00 38.90 ? 1103 HOH A O   1 
HETATM 2614 O  O   . HOH G 4 .   ? 18.686 6.594  12.298  1.00 39.68 ? 1104 HOH A O   1 
HETATM 2615 O  O   . HOH G 4 .   ? 28.082 13.376 44.268  1.00 34.43 ? 1105 HOH A O   1 
HETATM 2616 O  O   . HOH G 4 .   ? 9.098  12.215 53.947  1.00 46.52 ? 1106 HOH A O   1 
HETATM 2617 O  O   . HOH G 4 .   ? 11.655 24.933 34.228  1.00 38.48 ? 1107 HOH A O   1 
HETATM 2618 O  O   . HOH G 4 .   ? 6.145  11.475 43.170  1.00 45.90 ? 1108 HOH A O   1 
HETATM 2619 O  O   . HOH G 4 .   ? 30.243 9.526  42.263  1.00 44.79 ? 1109 HOH A O   1 
HETATM 2620 O  O   . HOH G 4 .   ? 17.729 2.085  10.985  1.00 40.02 ? 1110 HOH A O   1 
HETATM 2621 O  O   . HOH G 4 .   ? 24.623 6.302  48.244  1.00 42.75 ? 1111 HOH A O   1 
HETATM 2622 O  O   . HOH G 4 .   ? 29.613 18.573 35.675  1.00 50.28 ? 1112 HOH A O   1 
HETATM 2623 O  O   . HOH G 4 .   ? 16.550 9.310  52.805  1.00 38.96 ? 1113 HOH A O   1 
HETATM 2624 O  O   . HOH G 4 .   ? 9.013  28.910 39.222  1.00 41.38 ? 1114 HOH A O   1 
HETATM 2625 O  O   . HOH G 4 .   ? 40.364 12.796 20.806  1.00 37.02 ? 1115 HOH A O   1 
HETATM 2626 O  O   . HOH G 4 .   ? 10.233 27.515 36.132  1.00 40.33 ? 1116 HOH A O   1 
HETATM 2627 O  O   . HOH G 4 .   ? 7.195  19.215 51.145  1.00 43.67 ? 1117 HOH A O   1 
HETATM 2628 O  O   . HOH G 4 .   ? 13.937 3.244  17.468  1.00 40.82 ? 1118 HOH A O   1 
HETATM 2629 O  O   . HOH G 4 .   ? 25.895 0.267  32.006  1.00 39.76 ? 1119 HOH A O   1 
HETATM 2630 O  O   . HOH G 4 .   ? 6.726  29.758 26.714  1.00 53.69 ? 1120 HOH A O   1 
HETATM 2631 O  O   . HOH G 4 .   ? 15.499 1.608  15.464  1.00 45.36 ? 1121 HOH A O   1 
HETATM 2632 O  O   . HOH G 4 .   ? 37.979 14.885 18.787  1.00 38.72 ? 1122 HOH A O   1 
HETATM 2633 O  O   . HOH G 4 .   ? 31.745 2.815  31.520  1.00 43.32 ? 1123 HOH A O   1 
HETATM 2634 O  O   . HOH G 4 .   ? 23.093 18.747 47.178  1.00 38.50 ? 1124 HOH A O   1 
HETATM 2635 O  O   . HOH G 4 .   ? 13.025 26.000 43.812  1.00 41.95 ? 1125 HOH A O   1 
HETATM 2636 O  O   . HOH G 4 .   ? 14.860 0.404  49.419  1.00 53.07 ? 1126 HOH A O   1 
HETATM 2637 O  O   . HOH G 4 .   ? 13.200 3.163  26.861  1.00 49.35 ? 1127 HOH A O   1 
HETATM 2638 O  O   . HOH G 4 .   ? 12.031 18.378 31.558  1.00 40.85 ? 1128 HOH A O   1 
HETATM 2639 O  O   . HOH G 4 .   ? 32.354 13.887 26.126  1.00 49.40 ? 1129 HOH A O   1 
HETATM 2640 O  O   . HOH G 4 .   ? 26.122 7.372  -1.575  1.00 49.49 ? 1130 HOH A O   1 
HETATM 2641 O  O   . HOH G 4 .   ? 6.334  8.562  43.818  1.00 47.59 ? 1131 HOH A O   1 
HETATM 2642 O  O   . HOH G 4 .   ? 6.905  26.482 33.295  1.00 46.28 ? 1132 HOH A O   1 
HETATM 2643 O  O   . HOH G 4 .   ? 11.730 2.247  23.450  1.00 47.34 ? 1133 HOH A O   1 
HETATM 2644 O  O   . HOH G 4 .   ? 31.081 -3.816 -2.799  1.00 60.92 ? 1134 HOH A O   1 
HETATM 2645 O  O   . HOH G 4 .   ? 9.988  14.697 33.918  1.00 50.81 ? 1135 HOH A O   1 
HETATM 2646 O  O   . HOH G 4 .   ? 37.345 5.230  27.112  1.00 48.30 ? 1136 HOH A O   1 
HETATM 2647 O  O   . HOH G 4 .   ? 7.916  15.873 51.215  1.00 40.26 ? 1137 HOH A O   1 
HETATM 2648 O  O   . HOH G 4 .   ? 20.200 -1.601 8.539   1.00 67.82 ? 1138 HOH A O   1 
HETATM 2649 O  O   . HOH G 4 .   ? 4.425  18.346 31.436  1.00 57.45 ? 1139 HOH A O   1 
HETATM 2650 O  O   . HOH G 4 .   ? 17.011 1.694  41.196  1.00 50.00 ? 1140 HOH A O   1 
HETATM 2651 O  O   . HOH G 4 .   ? 14.419 1.542  19.575  1.00 32.50 ? 1141 HOH A O   1 
HETATM 2652 O  O   . HOH G 4 .   ? 31.672 17.800 24.156  1.00 30.96 ? 1142 HOH A O   1 
HETATM 2653 O  O   . HOH G 4 .   ? 21.794 -5.202 9.380   1.00 40.18 ? 1143 HOH A O   1 
HETATM 2654 O  O   . HOH G 4 .   ? 30.465 15.224 36.784  1.00 29.13 ? 1144 HOH A O   1 
HETATM 2655 O  O   . HOH G 4 .   ? 27.098 0.583  5.197   0.50 28.68 ? 1145 HOH A O   1 
HETATM 2656 O  O   . HOH G 4 .   ? 27.116 0.182  7.309   0.50 51.68 ? 1146 HOH A O   1 
HETATM 2657 O  O   . HOH G 4 .   ? 21.604 2.927  47.625  1.00 43.16 ? 1147 HOH A O   1 
HETATM 2658 O  O   . HOH H 4 .   ? 23.312 20.441 9.220   1.00 20.47 ? 1001 HOH B O   1 
HETATM 2659 O  O   . HOH H 4 .   ? 12.462 30.762 14.356  1.00 27.75 ? 1002 HOH B O   1 
HETATM 2660 O  O   . HOH H 4 .   ? 12.397 16.991 -14.533 1.00 27.94 ? 1003 HOH B O   1 
HETATM 2661 O  O   . HOH H 4 .   ? 27.570 17.674 11.548  1.00 23.64 ? 1004 HOH B O   1 
HETATM 2662 O  O   . HOH H 4 .   ? 24.284 19.657 18.912  1.00 29.28 ? 1005 HOH B O   1 
HETATM 2663 O  O   . HOH H 4 .   ? 12.211 23.711 14.857  1.00 23.80 ? 1006 HOH B O   1 
HETATM 2664 O  O   . HOH H 4 .   ? 21.792 30.110 17.131  1.00 25.34 ? 1007 HOH B O   1 
HETATM 2665 O  O   . HOH H 4 .   ? 25.668 19.179 8.889   1.00 22.33 ? 1008 HOH B O   1 
HETATM 2666 O  O   . HOH H 4 .   ? 32.066 7.304  10.996  1.00 31.69 ? 1009 HOH B O   1 
HETATM 2667 O  O   . HOH H 4 .   ? 11.373 14.995 -5.442  1.00 31.03 ? 1010 HOH B O   1 
HETATM 2668 O  O   . HOH H 4 .   ? 7.700  24.874 -15.589 1.00 24.83 ? 1011 HOH B O   1 
HETATM 2669 O  O   . HOH H 4 .   ? 11.641 16.851 0.304   1.00 34.50 ? 1012 HOH B O   1 
HETATM 2670 O  O   . HOH H 4 .   ? 26.287 27.202 0.733   1.00 27.50 ? 1013 HOH B O   1 
HETATM 2671 O  O   . HOH H 4 .   ? 27.962 24.590 8.665   1.00 27.82 ? 1014 HOH B O   1 
HETATM 2672 O  O   . HOH H 4 .   ? 13.839 29.474 -4.366  1.00 33.76 ? 1015 HOH B O   1 
HETATM 2673 O  O   . HOH H 4 .   ? 12.996 20.282 8.937   1.00 34.49 ? 1016 HOH B O   1 
HETATM 2674 O  O   . HOH H 4 .   ? 10.827 26.631 8.889   1.00 29.94 ? 1017 HOH B O   1 
HETATM 2675 O  O   . HOH H 4 .   ? 6.100  26.513 -14.047 1.00 38.41 ? 1018 HOH B O   1 
HETATM 2676 O  O   . HOH H 4 .   ? 10.134 6.563  -1.917  1.00 38.53 ? 1019 HOH B O   1 
HETATM 2677 O  O   . HOH H 4 .   ? 20.552 30.640 -10.684 1.00 39.01 ? 1020 HOH B O   1 
HETATM 2678 O  O   . HOH H 4 .   ? 18.424 17.429 -17.905 1.00 35.50 ? 1021 HOH B O   1 
HETATM 2679 O  O   . HOH H 4 .   ? 6.466  20.832 -4.284  1.00 34.59 ? 1022 HOH B O   1 
HETATM 2680 O  O   . HOH H 4 .   ? 19.234 33.050 17.943  1.00 35.61 ? 1023 HOH B O   1 
HETATM 2681 O  O   . HOH H 4 .   ? 31.251 26.810 13.229  1.00 37.65 ? 1024 HOH B O   1 
HETATM 2682 O  O   . HOH H 4 .   ? 28.135 24.729 0.468   1.00 36.63 ? 1025 HOH B O   1 
HETATM 2683 O  O   . HOH H 4 .   ? 33.624 24.206 20.580  1.00 30.96 ? 1026 HOH B O   1 
HETATM 2684 O  O   . HOH H 4 .   ? 13.183 32.578 22.178  1.00 34.69 ? 1027 HOH B O   1 
HETATM 2685 O  O   . HOH H 4 .   ? 8.801  25.463 1.330   1.00 34.89 ? 1028 HOH B O   1 
HETATM 2686 O  O   . HOH H 4 .   ? 25.393 35.670 13.685  1.00 34.28 ? 1029 HOH B O   1 
HETATM 2687 O  O   . HOH H 4 .   ? 27.096 14.721 7.156   1.00 32.01 ? 1030 HOH B O   1 
HETATM 2688 O  O   . HOH H 4 .   ? 17.996 37.445 24.418  1.00 34.78 ? 1031 HOH B O   1 
HETATM 2689 O  O   . HOH H 4 .   ? 26.674 26.438 -9.223  1.00 41.73 ? 1032 HOH B O   1 
HETATM 2690 O  O   . HOH H 4 .   ? 11.085 16.829 17.085  1.00 51.85 ? 1033 HOH B O   1 
HETATM 2691 O  O   . HOH H 4 .   ? 11.127 9.979  -8.802  1.00 49.74 ? 1034 HOH B O   1 
HETATM 2692 O  O   . HOH H 4 .   ? 28.053 26.582 25.499  1.00 28.95 ? 1035 HOH B O   1 
HETATM 2693 O  O   . HOH H 4 .   ? 31.757 36.393 16.908  1.00 39.07 ? 1036 HOH B O   1 
HETATM 2694 O  O   . HOH H 4 .   ? 32.308 30.566 21.392  1.00 42.82 ? 1037 HOH B O   1 
HETATM 2695 O  O   . HOH H 4 .   ? 17.115 31.325 -15.570 1.00 42.83 ? 1038 HOH B O   1 
HETATM 2696 O  O   . HOH H 4 .   ? 18.277 33.871 29.546  1.00 42.70 ? 1039 HOH B O   1 
HETATM 2697 O  O   . HOH H 4 .   ? 9.873  13.357 -5.817  1.00 53.91 ? 1040 HOH B O   1 
HETATM 2698 O  O   . HOH H 4 .   ? 8.350  22.216 12.797  1.00 41.62 ? 1041 HOH B O   1 
HETATM 2699 O  O   . HOH H 4 .   ? 35.208 29.924 24.124  1.00 54.66 ? 1042 HOH B O   1 
HETATM 2700 O  O   . HOH H 4 .   ? 20.202 9.987  -11.269 1.00 54.88 ? 1043 HOH B O   1 
HETATM 2701 O  O   . HOH H 4 .   ? 14.211 35.642 26.910  1.00 49.59 ? 1044 HOH B O   1 
HETATM 2702 O  O   . HOH H 4 .   ? 12.204 30.862 24.151  1.00 34.35 ? 1045 HOH B O   1 
HETATM 2703 O  O   . HOH H 4 .   ? 10.677 29.948 1.509   1.00 54.95 ? 1046 HOH B O   1 
HETATM 2704 O  O   . HOH H 4 .   ? 26.619 36.170 19.185  0.50 37.93 ? 1047 HOH B O   1 
HETATM 2705 O  O   . HOH H 4 .   ? 30.335 10.237 -5.990  1.00 74.14 ? 1048 HOH B O   1 
HETATM 2706 O  O   . HOH H 4 .   ? 7.085  22.846 3.530   1.00 55.18 ? 1049 HOH B O   1 
HETATM 2707 O  O   . HOH H 4 .   ? 33.080 15.142 -1.385  1.00 53.31 ? 1050 HOH B O   1 
HETATM 2708 O  O   . HOH H 4 .   ? 13.968 18.985 11.327  1.00 32.72 ? 1051 HOH B O   1 
HETATM 2709 O  O   . HOH H 4 .   ? 26.607 27.847 -6.709  1.00 38.76 ? 1052 HOH B O   1 
HETATM 2710 O  O   . HOH H 4 .   ? 26.268 14.146 4.153   1.00 41.74 ? 1053 HOH B O   1 
HETATM 2711 O  O   . HOH H 4 .   ? 27.881 17.500 7.207   1.00 47.21 ? 1054 HOH B O   1 
HETATM 2712 O  O   . HOH H 4 .   ? 29.444 29.284 20.343  1.00 24.71 ? 1055 HOH B O   1 
HETATM 2713 O  O   . HOH H 4 .   ? 20.171 15.369 -17.562 1.00 46.62 ? 1056 HOH B O   1 
HETATM 2714 O  O   . HOH H 4 .   ? 14.699 36.240 6.130   1.00 31.64 ? 1057 HOH B O   1 
HETATM 2715 O  O   . HOH H 4 .   ? 9.927  30.695 15.496  1.00 37.07 ? 1058 HOH B O   1 
HETATM 2716 O  O   . HOH H 4 .   ? 13.238 31.096 -19.062 1.00 38.10 ? 1059 HOH B O   1 
HETATM 2717 O  O   . HOH H 4 .   ? 9.729  17.160 2.200   1.00 33.52 ? 1060 HOH B O   1 
HETATM 2718 O  O   . HOH H 4 .   ? 15.471 37.068 15.091  1.00 39.78 ? 1061 HOH B O   1 
HETATM 2719 O  O   . HOH H 4 .   ? 15.497 8.038  1.576   1.00 37.53 ? 1062 HOH B O   1 
HETATM 2720 O  O   . HOH H 4 .   ? 13.350 26.810 23.453  1.00 30.74 ? 1063 HOH B O   1 
HETATM 2721 O  O   . HOH H 4 .   ? 16.770 24.177 -17.153 1.00 33.66 ? 1064 HOH B O   1 
HETATM 2722 O  O   . HOH H 4 .   ? 22.817 30.092 -12.133 1.00 42.21 ? 1065 HOH B O   1 
HETATM 2723 O  O   . HOH H 4 .   ? 24.061 32.553 31.628  1.00 39.84 ? 1066 HOH B O   1 
HETATM 2724 O  O   . HOH H 4 .   ? 16.542 3.233  -3.009  1.00 40.30 ? 1067 HOH B O   1 
HETATM 2725 O  O   . HOH H 4 .   ? 20.482 34.799 1.623   1.00 37.97 ? 1068 HOH B O   1 
HETATM 2726 O  O   . HOH H 4 .   ? 13.680 0.908  7.364   1.00 54.34 ? 1069 HOH B O   1 
HETATM 2727 O  O   . HOH H 4 .   ? 16.634 5.885  0.605   1.00 34.16 ? 1070 HOH B O   1 
HETATM 2728 O  O   . HOH H 4 .   ? 16.009 35.781 12.178  1.00 31.80 ? 1071 HOH B O   1 
HETATM 2729 O  O   . HOH H 4 .   ? 7.197  17.756 -8.597  1.00 42.62 ? 1072 HOH B O   1 
HETATM 2730 O  O   . HOH H 4 .   ? 12.484 14.145 -0.261  1.00 34.24 ? 1073 HOH B O   1 
HETATM 2731 O  O   . HOH H 4 .   ? 14.195 20.601 -17.291 1.00 45.35 ? 1074 HOH B O   1 
HETATM 2732 O  O   . HOH H 4 .   ? 12.126 15.116 4.158   1.00 48.64 ? 1075 HOH B O   1 
HETATM 2733 O  O   . HOH H 4 .   ? 12.259 19.912 25.393  1.00 35.97 ? 1076 HOH B O   1 
HETATM 2734 O  O   . HOH H 4 .   ? 21.732 13.508 -13.679 1.00 46.78 ? 1077 HOH B O   1 
HETATM 2735 O  O   . HOH H 4 .   ? 19.327 32.121 38.219  1.00 45.70 ? 1078 HOH B O   1 
HETATM 2736 O  O   . HOH H 4 .   ? 30.755 35.616 12.428  1.00 39.76 ? 1079 HOH B O   1 
HETATM 2737 O  O   . HOH H 4 .   ? 20.227 35.477 16.807  1.00 39.47 ? 1080 HOH B O   1 
HETATM 2738 O  O   . HOH H 4 .   ? 8.152  29.222 11.524  1.00 40.73 ? 1081 HOH B O   1 
HETATM 2739 O  O   . HOH H 4 .   ? 13.287 7.012  4.150   1.00 39.44 ? 1082 HOH B O   1 
HETATM 2740 O  O   . HOH H 4 .   ? 27.595 33.806 16.936  1.00 37.53 ? 1083 HOH B O   1 
HETATM 2741 O  O   . HOH H 4 .   ? 17.993 10.570 -13.975 1.00 42.01 ? 1084 HOH B O   1 
HETATM 2742 O  O   . HOH H 4 .   ? 13.603 31.664 -5.801  1.00 43.02 ? 1085 HOH B O   1 
HETATM 2743 O  O   . HOH H 4 .   ? 29.162 22.189 4.028   1.00 42.92 ? 1086 HOH B O   1 
HETATM 2744 O  O   . HOH H 4 .   ? 15.517 24.539 -19.805 1.00 41.24 ? 1087 HOH B O   1 
HETATM 2745 O  O   . HOH H 4 .   ? 11.241 31.704 19.758  1.00 48.17 ? 1088 HOH B O   1 
HETATM 2746 O  O   . HOH H 4 .   ? 22.566 29.867 -18.215 1.00 49.70 ? 1089 HOH B O   1 
HETATM 2747 O  O   . HOH H 4 .   ? 16.880 10.397 2.609   1.00 38.56 ? 1090 HOH B O   1 
HETATM 2748 O  O   . HOH H 4 .   ? 19.469 35.924 4.013   1.00 42.73 ? 1091 HOH B O   1 
HETATM 2749 O  O   . HOH H 4 .   ? 5.224  15.146 -18.070 1.00 37.07 ? 1092 HOH B O   1 
HETATM 2750 O  O   . HOH H 4 .   ? 23.280 6.281  -1.451  1.00 39.95 ? 1093 HOH B O   1 
HETATM 2751 O  O   . HOH H 4 .   ? 9.870  18.503 -3.045  1.00 45.33 ? 1094 HOH B O   1 
HETATM 2752 O  O   . HOH H 4 .   ? 13.326 0.905  -8.112  1.00 42.20 ? 1095 HOH B O   1 
HETATM 2753 O  O   . HOH H 4 .   ? 27.550 29.757 23.166  1.00 39.20 ? 1096 HOH B O   1 
HETATM 2754 O  O   . HOH H 4 .   ? 32.827 15.677 10.879  1.00 47.59 ? 1097 HOH B O   1 
HETATM 2755 O  O   . HOH H 4 .   ? 12.051 34.064 19.125  1.00 54.51 ? 1098 HOH B O   1 
HETATM 2756 O  O   . HOH H 4 .   ? 18.558 32.371 -11.562 1.00 51.13 ? 1099 HOH B O   1 
HETATM 2757 O  O   . HOH H 4 .   ? 12.128 4.979  1.500   1.00 49.29 ? 1100 HOH B O   1 
HETATM 2758 O  O   . HOH H 4 .   ? 17.434 20.959 -18.700 1.00 45.83 ? 1101 HOH B O   1 
HETATM 2759 O  O   . HOH H 4 .   ? 7.767  9.055  1.442   1.00 61.71 ? 1102 HOH B O   1 
HETATM 2760 O  O   . HOH H 4 .   ? 27.563 36.141 6.824   0.50 32.63 ? 1103 HOH B O   1 
HETATM 2761 O  O   . HOH H 4 .   ? 30.582 34.624 15.637  1.00 40.63 ? 1104 HOH B O   1 
HETATM 2762 O  O   . HOH H 4 .   ? 9.689  28.833 17.427  1.00 41.77 ? 1105 HOH B O   1 
HETATM 2763 O  O   . HOH H 4 .   ? 16.729 34.090 37.158  1.00 47.33 ? 1106 HOH B O   1 
HETATM 2764 O  O   . HOH H 4 .   ? 31.502 16.617 7.032   1.00 49.50 ? 1107 HOH B O   1 
HETATM 2765 O  O   . HOH H 4 .   ? 14.980 37.213 18.401  1.00 47.65 ? 1108 HOH B O   1 
HETATM 2766 O  O   . HOH H 4 .   ? 32.841 5.644  6.517   1.00 49.92 ? 1109 HOH B O   1 
HETATM 2767 O  O   . HOH H 4 .   ? 29.458 23.653 6.742   1.00 46.77 ? 1110 HOH B O   1 
HETATM 2768 O  O   . HOH H 4 .   ? 29.974 23.555 2.069   1.00 38.79 ? 1111 HOH B O   1 
HETATM 2769 O  O   . HOH H 4 .   ? 30.804 18.714 5.831   1.00 58.20 ? 1112 HOH B O   1 
HETATM 2770 O  O   . HOH H 4 .   ? 21.999 40.228 38.573  1.00 62.73 ? 1113 HOH B O   1 
HETATM 2771 O  O   . HOH H 4 .   ? 15.168 0.816  9.506   1.00 51.40 ? 1114 HOH B O   1 
HETATM 2772 O  O   . HOH H 4 .   ? 19.290 28.018 37.871  1.00 42.17 ? 1115 HOH B O   1 
HETATM 2773 O  O   . HOH H 4 .   ? 30.245 16.900 11.417  1.00 43.03 ? 1116 HOH B O   1 
HETATM 2774 O  O   . HOH H 4 .   ? 16.654 2.121  2.646   1.00 51.19 ? 1117 HOH B O   1 
HETATM 2775 O  O   . HOH H 4 .   ? 19.432 7.055  -7.672  1.00 48.68 ? 1118 HOH B O   1 
HETATM 2776 O  O   . HOH H 4 .   ? 7.839  22.482 -14.478 1.00 50.76 ? 1119 HOH B O   1 
HETATM 2777 O  O   . HOH H 4 .   ? 29.247 16.802 9.460   1.00 50.85 ? 1120 HOH B O   1 
HETATM 2778 O  O   . HOH H 4 .   ? 6.645  20.494 -8.562  1.00 46.44 ? 1121 HOH B O   1 
HETATM 2779 O  O   . HOH H 4 .   ? 16.018 10.519 -15.882 1.00 49.99 ? 1122 HOH B O   1 
HETATM 2780 O  O   . HOH H 4 .   ? 25.161 35.817 17.275  1.00 47.87 ? 1123 HOH B O   1 
HETATM 2781 O  O   . HOH H 4 .   ? 22.828 7.031  -4.957  1.00 49.02 ? 1124 HOH B O   1 
HETATM 2782 O  O   . HOH H 4 .   ? 7.849  17.237 -0.287  1.00 61.75 ? 1125 HOH B O   1 
HETATM 2783 O  O   . HOH H 4 .   ? 19.518 36.076 21.362  1.00 53.14 ? 1126 HOH B O   1 
HETATM 2784 O  O   . HOH H 4 .   ? 18.259 37.009 15.638  1.00 48.55 ? 1127 HOH B O   1 
HETATM 2785 O  O   . HOH H 4 .   ? 7.515  28.160 18.322  1.00 52.23 ? 1128 HOH B O   1 
HETATM 2786 O  O   . HOH H 4 .   ? 29.532 20.543 7.336   1.00 48.12 ? 1129 HOH B O   1 
HETATM 2787 O  O   . HOH H 4 .   ? 6.484  23.049 -11.324 1.00 31.24 ? 1130 HOH B O   1 
HETATM 2788 O  O   . HOH H 4 .   ? 34.135 33.897 10.988  1.00 49.06 ? 1131 HOH B O   1 
HETATM 2789 O  O   . HOH H 4 .   ? 28.711 18.488 4.009   1.00 45.01 ? 1132 HOH B O   1 
HETATM 2790 O  O   . HOH H 4 .   ? 10.684 31.302 -0.319  1.00 52.74 ? 1133 HOH B O   1 
HETATM 2791 O  O   . HOH H 4 .   ? 28.098 16.416 4.852   1.00 45.61 ? 1134 HOH B O   1 
HETATM 2792 O  O   . HOH H 4 .   ? 24.220 32.339 -4.069  1.00 45.10 ? 1135 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLY A 2   ? 0.6139 0.5856 0.6195 -0.0157 0.0189  0.0285  2    GLY A N   
2    C  CA  . GLY A 2   ? 0.5811 0.5510 0.5930 -0.0163 0.0073  0.0161  2    GLY A CA  
3    C  C   . GLY A 2   ? 0.5325 0.5342 0.5555 0.0024  0.0147  -0.0100 2    GLY A C   
4    O  O   . GLY A 2   ? 0.5492 0.5774 0.6146 -0.0035 0.0298  0.0080  2    GLY A O   
5    N  N   . GLU A 3   ? 0.5753 0.5941 0.8112 -0.0151 -0.0520 -0.0471 3    GLU A N   
6    C  CA  . GLU A 3   ? 0.4914 0.5287 0.6653 0.0215  -0.0462 -0.0161 3    GLU A CA  
7    C  C   . GLU A 3   ? 0.3561 0.4604 0.5833 -0.0048 -0.0490 -0.0335 3    GLU A C   
8    O  O   . GLU A 3   ? 0.3644 0.4592 0.6271 0.0213  -0.0872 0.0130  3    GLU A O   
9    C  CB  . GLU A 3   ? 0.5299 0.5193 0.6753 -0.0101 -0.0076 -0.0193 3    GLU A CB  
10   C  CG  . GLU A 3   ? 0.7013 0.5621 0.7757 0.0264  -0.0060 0.0232  3    GLU A CG  
11   C  CD  . GLU A 3   ? 0.8552 0.6481 0.8325 0.0079  0.1073  0.0506  3    GLU A CD  
12   O  OE1 . GLU A 3   ? 0.8260 0.6690 0.8975 -0.0303 0.1063  0.0967  3    GLU A OE1 
13   O  OE2 . GLU A 3   ? 1.0366 0.6640 1.0331 -0.0144 0.1285  0.1285  3    GLU A OE2 
14   N  N   . VAL A 4   ? 0.2799 0.3774 0.4474 0.0400  -0.0648 -0.0234 4    VAL A N   
15   C  CA  . VAL A 4   ? 0.2318 0.3734 0.3712 0.0174  -0.0636 -0.0459 4    VAL A CA  
16   C  C   . VAL A 4   ? 0.2289 0.3107 0.3669 0.0138  -0.0500 -0.0143 4    VAL A C   
17   O  O   . VAL A 4   ? 0.2694 0.3158 0.3169 0.0043  -0.0470 -0.0254 4    VAL A O   
18   C  CB  . VAL A 4   ? 0.2921 0.4136 0.3751 0.0577  -0.0382 -0.0502 4    VAL A CB  
19   C  CG1 . VAL A 4   ? 0.2946 0.4665 0.2635 0.0489  -0.0372 -0.0377 4    VAL A CG1 
20   C  CG2 . VAL A 4   ? 0.3284 0.4252 0.3639 0.0823  -0.0596 -0.0990 4    VAL A CG2 
21   N  N   . PRO A 5   ? 0.2471 0.3454 0.3734 0.0041  -0.0493 -0.0499 5    PRO A N   
22   C  CA  . PRO A 5   ? 0.2652 0.3053 0.3638 -0.0003 -0.0275 -0.0113 5    PRO A CA  
23   C  C   . PRO A 5   ? 0.2761 0.3419 0.3180 0.0110  -0.0283 0.0208  5    PRO A C   
24   O  O   . PRO A 5   ? 0.3212 0.3476 0.3150 -0.0002 -0.0417 0.0293  5    PRO A O   
25   C  CB  . PRO A 5   ? 0.2916 0.3239 0.4387 0.0199  -0.0520 -0.0279 5    PRO A CB  
26   C  CG  . PRO A 5   ? 0.3398 0.4267 0.4812 0.0496  -0.0875 -0.0746 5    PRO A CG  
27   C  CD  . PRO A 5   ? 0.2551 0.3985 0.4333 0.0236  -0.0796 -0.0512 5    PRO A CD  
28   N  N   . ILE A 6   ? 0.2618 0.3305 0.2761 -0.0010 -0.0103 0.0355  6    ILE A N   
29   C  CA  . ILE A 6   ? 0.2697 0.3229 0.2658 0.0021  -0.0197 0.0450  6    ILE A CA  
30   C  C   . ILE A 6   ? 0.2934 0.3280 0.3025 0.0033  -0.0063 0.0611  6    ILE A C   
31   O  O   . ILE A 6   ? 0.2748 0.2912 0.2921 0.0046  -0.0007 0.0397  6    ILE A O   
32   C  CB  . ILE A 6   ? 0.2414 0.2980 0.2623 -0.0035 0.0065  0.0650  6    ILE A CB  
33   C  CG1 . ILE A 6   ? 0.2440 0.3450 0.2741 -0.0150 0.0090  0.0260  6    ILE A CG1 
34   C  CG2 . ILE A 6   ? 0.2736 0.2781 0.2542 -0.0443 0.0107  0.0830  6    ILE A CG2 
35   C  CD1 . ILE A 6   ? 0.2082 0.3120 0.2833 -0.0285 -0.0055 -0.0018 6    ILE A CD1 
36   N  N   . GLY A 7   ? 0.3191 0.3567 0.3339 0.0089  -0.0502 0.0497  7    GLY A N   
37   C  CA  . GLY A 7   ? 0.3287 0.3333 0.3192 0.0218  -0.0491 0.0747  7    GLY A CA  
38   C  C   . GLY A 7   ? 0.3172 0.3316 0.3503 0.0046  -0.0393 0.0619  7    GLY A C   
39   O  O   . GLY A 7   ? 0.2824 0.3573 0.3934 0.0013  -0.0046 0.0220  7    GLY A O   
40   N  N   . ASP A 8   ? 0.3353 0.3630 0.4030 0.0091  -0.0289 0.0519  8    ASP A N   
41   C  CA  . ASP A 8   ? 0.3321 0.3526 0.4320 0.0308  -0.0337 0.0366  8    ASP A CA  
42   C  C   . ASP A 8   ? 0.2791 0.3186 0.4163 0.0241  -0.0172 0.0469  8    ASP A C   
43   O  O   . ASP A 8   ? 0.2852 0.3094 0.3883 0.0056  -0.0095 0.0396  8    ASP A O   
44   C  CB  . ASP A 8   ? 0.3459 0.3882 0.5029 0.0808  -0.0642 0.0429  8    ASP A CB  
45   C  CG  . ASP A 8   ? 0.5346 0.5408 0.5644 0.0845  -0.1424 -0.0101 8    ASP A CG  
46   O  OD1 . ASP A 8   ? 0.5415 0.5656 0.7345 0.0427  -0.2088 -0.0105 8    ASP A OD1 
47   O  OD2 . ASP A 8   ? 0.6499 0.5913 0.7059 0.0764  -0.1704 0.0541  8    ASP A OD2 
48   N  N   . PRO A 9   ? 0.2551 0.3265 0.4064 0.0031  -0.0083 0.0397  9    PRO A N   
49   C  CA  . PRO A 9   ? 0.2745 0.2892 0.3910 -0.0019 0.0087  0.0441  9    PRO A CA  
50   C  C   . PRO A 9   ? 0.2660 0.2638 0.3788 0.0103  -0.0075 0.0318  9    PRO A C   
51   O  O   . PRO A 9   ? 0.2952 0.2927 0.4352 0.0083  -0.0289 0.0362  9    PRO A O   
52   C  CB  . PRO A 9   ? 0.3069 0.3126 0.4424 -0.0296 0.0315  0.0391  9    PRO A CB  
53   C  CG  . PRO A 9   ? 0.2897 0.4202 0.5304 -0.0593 0.0323  0.0069  9    PRO A CG  
54   C  CD  . PRO A 9   ? 0.3017 0.3366 0.4803 -0.0234 -0.0088 0.0066  9    PRO A CD  
55   N  N   . LYS A 10  ? 0.2924 0.2496 0.3695 0.0133  0.0019  0.0496  10   LYS A N   
56   C  CA  . LYS A 10  ? 0.3020 0.2623 0.3814 0.0085  -0.0062 0.0379  10   LYS A CA  
57   C  C   . LYS A 10  ? 0.3119 0.2743 0.3757 0.0293  0.0183  0.0355  10   LYS A C   
58   O  O   . LYS A 10  ? 0.3728 0.2513 0.3515 0.0364  0.0120  0.0464  10   LYS A O   
59   C  CB  . LYS A 10  ? 0.3422 0.2767 0.4400 -0.0107 -0.0078 0.0737  10   LYS A CB  
60   C  CG  . LYS A 10  ? 0.4762 0.4386 0.4686 -0.0488 0.0357  0.0606  10   LYS A CG  
61   C  CD  . LYS A 10  ? 0.4862 0.4373 0.5763 -0.0048 -0.0007 0.0687  10   LYS A CD  
62   C  CE  . LYS A 10  ? 0.5085 0.5135 0.5164 0.0006  -0.0618 0.0830  10   LYS A CE  
63   N  NZ  . LYS A 10  ? 0.3238 0.4043 0.4644 -0.0054 -0.0155 0.1330  10   LYS A NZ  
64   N  N   . GLU A 11  ? 0.2892 0.1713 0.3005 0.0293  0.0169  0.0391  11   GLU A N   
65   C  CA  . GLU A 11  ? 0.2790 0.1640 0.3061 0.0409  0.0160  0.0404  11   GLU A CA  
66   C  C   . GLU A 11  ? 0.3132 0.2046 0.3407 0.0442  0.0026  0.0221  11   GLU A C   
67   O  O   . GLU A 11  ? 0.3234 0.1980 0.3459 0.0404  -0.0495 0.0476  11   GLU A O   
68   C  CB  . GLU A 11  ? 0.3021 0.2130 0.3279 0.0601  0.0205  0.0313  11   GLU A CB  
69   C  CG  . GLU A 11  ? 0.3293 0.3001 0.3324 -0.0127 0.0140  0.0107  11   GLU A CG  
70   C  CD  . GLU A 11  ? 0.3682 0.4090 0.4801 0.0477  0.0119  0.0270  11   GLU A CD  
71   O  OE1 . GLU A 11  ? 0.4127 0.4542 0.4975 0.0421  0.0040  -0.0028 11   GLU A OE1 
72   O  OE2 . GLU A 11  ? 0.4427 0.4418 0.5652 -0.0491 0.0564  0.0316  11   GLU A OE2 
73   N  N   . LEU A 12  ? 0.3167 0.1843 0.3410 0.0339  -0.0102 0.0250  12   LEU A N   
74   C  CA  . LEU A 12  ? 0.3205 0.2319 0.3277 0.0191  0.0131  0.0491  12   LEU A CA  
75   C  C   . LEU A 12  ? 0.2919 0.1723 0.2553 0.0204  0.0142  0.0404  12   LEU A C   
76   O  O   . LEU A 12  ? 0.2519 0.1354 0.2590 0.0093  0.0212  0.0267  12   LEU A O   
77   C  CB  . LEU A 12  ? 0.3461 0.2764 0.3074 -0.0049 0.0119  0.0348  12   LEU A CB  
78   C  CG  . LEU A 12  ? 0.2544 0.1997 0.3125 -0.0141 -0.0091 0.0235  12   LEU A CG  
79   C  CD1 . LEU A 12  ? 0.4565 0.2714 0.3522 -0.0174 0.0653  0.0454  12   LEU A CD1 
80   C  CD2 . LEU A 12  ? 0.3285 0.3329 0.5390 -0.0164 -0.0082 -0.1095 12   LEU A CD2 
81   N  N   . ASN A 13  ? 0.3068 0.1445 0.3126 0.0323  0.0470  0.0212  13   ASN A N   
82   C  CA  . ASN A 13  ? 0.3459 0.1458 0.2538 0.0314  0.0328  -0.0003 13   ASN A CA  
83   C  C   . ASN A 13  ? 0.3545 0.1880 0.2512 0.0206  0.0513  -0.0042 13   ASN A C   
84   O  O   . ASN A 13  ? 0.4673 0.2232 0.3091 0.0254  0.0421  0.0354  13   ASN A O   
85   C  CB  . ASN A 13  ? 0.3106 0.1731 0.2227 0.0025  -0.0085 -0.0004 13   ASN A CB  
86   C  CG  . ASN A 13  ? 0.2770 0.1982 0.2183 -0.0089 0.0010  0.0037  13   ASN A CG  
87   O  OD1 . ASN A 13  ? 0.3263 0.1472 0.2819 0.0012  0.0114  0.0046  13   ASN A OD1 
88   N  ND2 . ASN A 13  ? 0.2868 0.1921 0.2475 0.0071  0.0011  -0.0033 13   ASN A ND2 
89   N  N   . GLY A 14  ? 0.3844 0.1907 0.3228 -0.0049 0.0963  0.0055  14   GLY A N   
90   C  CA  . GLY A 14  ? 0.4216 0.1766 0.3356 0.0311  0.0988  0.0486  14   GLY A CA  
91   C  C   . GLY A 14  ? 0.3528 0.1570 0.2875 0.0173  0.1000  0.0355  14   GLY A C   
92   O  O   . GLY A 14  ? 0.3221 0.1747 0.3107 0.0123  0.1206  0.0406  14   GLY A O   
93   N  N   . MET A 15  ? 0.2855 0.1222 0.2733 0.0253  0.0774  0.0146  15   MET A N   
94   C  CA  . MET A 15  ? 0.2732 0.1802 0.2907 0.0178  0.0455  0.0025  15   MET A CA  
95   C  C   . MET A 15  ? 0.2507 0.1737 0.2851 -0.0008 0.0516  0.0336  15   MET A C   
96   O  O   . MET A 15  ? 0.2564 0.1978 0.2802 0.0056  0.0346  0.0396  15   MET A O   
97   C  CB  . MET A 15  ? 0.2550 0.1542 0.2435 0.0391  0.0299  0.0097  15   MET A CB  
98   C  CG  . MET A 15  ? 0.2959 0.1875 0.2393 0.0196  0.0431  0.0238  15   MET A CG  
99   S  SD  . MET A 15  ? 0.3082 0.2300 0.2725 0.0120  0.0264  0.0047  15   MET A SD  
100  C  CE  . MET A 15  ? 0.3743 0.2949 0.3544 -0.0630 -0.0087 0.0445  15   MET A CE  
101  N  N   . GLU A 16  ? 0.2317 0.1505 0.2587 0.0126  0.0505  0.0266  16   GLU A N   
102  C  CA  . GLU A 16  ? 0.2742 0.1858 0.2961 0.0105  0.0228  0.0089  16   GLU A CA  
103  C  C   . GLU A 16  ? 0.2512 0.1765 0.2821 0.0110  0.0318  0.0360  16   GLU A C   
104  O  O   . GLU A 16  ? 0.2529 0.2024 0.2828 0.0296  0.0373  0.0228  16   GLU A O   
105  C  CB  . GLU A 16  ? 0.2713 0.2336 0.3535 0.0232  0.0199  0.0182  16   GLU A CB  
106  C  CG  . GLU A 16  ? 0.2708 0.2781 0.3618 0.0019  -0.0036 0.0144  16   GLU A CG  
107  C  CD  . GLU A 16  ? 0.3693 0.3314 0.4706 -0.0395 0.0320  0.0271  16   GLU A CD  
108  O  OE1 . GLU A 16  ? 0.3778 0.3726 0.4977 0.0121  -0.0064 -0.0221 16   GLU A OE1 
109  O  OE2 . GLU A 16  ? 0.3774 0.4515 0.5212 0.0278  0.0078  0.0181  16   GLU A OE2 
110  N  N   . ILE A 17  ? 0.2498 0.1746 0.2820 0.0180  0.0175  0.0265  17   ILE A N   
111  C  CA  . ILE A 17  ? 0.2351 0.1812 0.2379 0.0107  0.0068  0.0122  17   ILE A CA  
112  C  C   . ILE A 17  ? 0.2043 0.1799 0.2438 0.0030  0.0036  0.0223  17   ILE A C   
113  O  O   . ILE A 17  ? 0.2450 0.2468 0.2843 0.0013  -0.0042 0.0370  17   ILE A O   
114  C  CB  . ILE A 17  ? 0.2541 0.1942 0.2428 -0.0060 0.0167  0.0222  17   ILE A CB  
115  C  CG1 . ILE A 17  ? 0.3251 0.2546 0.2544 -0.0164 0.0239  0.0043  17   ILE A CG1 
116  C  CG2 . ILE A 17  ? 0.2361 0.2692 0.3071 0.0029  0.0277  0.0318  17   ILE A CG2 
117  C  CD1 . ILE A 17  ? 0.3733 0.2879 0.2969 -0.0906 0.0654  -0.0042 17   ILE A CD1 
118  N  N   . ALA A 18  ? 0.2223 0.1942 0.2416 0.0063  0.0038  0.0077  18   ALA A N   
119  C  CA  . ALA A 18  ? 0.2273 0.2010 0.2561 0.0102  -0.0142 0.0136  18   ALA A CA  
120  C  C   . ALA A 18  ? 0.2190 0.2033 0.2329 0.0127  -0.0052 0.0220  18   ALA A C   
121  O  O   . ALA A 18  ? 0.2366 0.2221 0.2653 0.0194  -0.0182 0.0078  18   ALA A O   
122  C  CB  . ALA A 18  ? 0.2255 0.2382 0.3193 -0.0094 -0.0144 0.0119  18   ALA A CB  
123  N  N   . ALA A 19  ? 0.2281 0.2049 0.2326 0.0046  -0.0024 0.0124  19   ALA A N   
124  C  CA  . ALA A 19  ? 0.2430 0.2305 0.2766 0.0182  -0.0090 0.0174  19   ALA A CA  
125  C  C   . ALA A 19  ? 0.2333 0.2130 0.2678 -0.0099 -0.0192 0.0246  19   ALA A C   
126  O  O   . ALA A 19  ? 0.2301 0.2317 0.2599 0.0080  -0.0193 -0.0073 19   ALA A O   
127  C  CB  . ALA A 19  ? 0.2450 0.2634 0.2616 -0.0218 0.0001  0.0032  19   ALA A CB  
128  N  N   . VAL A 20  ? 0.2514 0.2600 0.2764 0.0274  0.0014  -0.0103 20   VAL A N   
129  C  CA  . VAL A 20  ? 0.2724 0.2756 0.3243 0.0067  -0.0099 -0.0227 20   VAL A CA  
130  C  C   . VAL A 20  ? 0.2413 0.2656 0.2835 0.0030  -0.0311 -0.0172 20   VAL A C   
131  O  O   . VAL A 20  ? 0.2417 0.2240 0.2240 0.0137  -0.0227 -0.0037 20   VAL A O   
132  C  CB  . VAL A 20  ? 0.2796 0.2914 0.3227 0.0093  0.0045  -0.0215 20   VAL A CB  
133  C  CG1 . VAL A 20  ? 0.2895 0.3416 0.3735 0.0070  0.0237  -0.0133 20   VAL A CG1 
134  C  CG2 . VAL A 20  ? 0.3250 0.3396 0.3826 0.0025  0.0059  0.0652  20   VAL A CG2 
135  N  N   . TYR A 21  ? 0.2699 0.2734 0.2630 0.0113  -0.0305 -0.0259 21   TYR A N   
136  C  CA  . TYR A 21  ? 0.2550 0.2686 0.2539 0.0072  -0.0291 -0.0071 21   TYR A CA  
137  C  C   . TYR A 21  ? 0.2815 0.2714 0.2940 0.0000  -0.0211 -0.0124 21   TYR A C   
138  O  O   . TYR A 21  ? 0.2712 0.3012 0.3280 -0.0058 -0.0298 -0.0219 21   TYR A O   
139  C  CB  . TYR A 21  ? 0.2740 0.2669 0.2767 0.0145  -0.0185 -0.0005 21   TYR A CB  
140  C  CG  . TYR A 21  ? 0.2952 0.2917 0.2710 -0.0064 -0.0332 -0.0213 21   TYR A CG  
141  C  CD1 . TYR A 21  ? 0.2876 0.3101 0.2933 0.0130  -0.0123 -0.0251 21   TYR A CD1 
142  C  CD2 . TYR A 21  ? 0.3274 0.3227 0.3030 0.0160  -0.0588 -0.0120 21   TYR A CD2 
143  C  CE1 . TYR A 21  ? 0.2693 0.3043 0.2642 -0.0038 -0.0158 -0.0115 21   TYR A CE1 
144  C  CE2 . TYR A 21  ? 0.3101 0.3289 0.3134 0.0106  -0.0420 -0.0058 21   TYR A CE2 
145  C  CZ  . TYR A 21  ? 0.3507 0.3612 0.2977 0.0253  -0.0406 -0.0054 21   TYR A CZ  
146  O  OH  . TYR A 21  ? 0.3377 0.4436 0.2953 -0.0230 -0.0339 -0.0112 21   TYR A OH  
147  N  N   . LEU A 22  ? 0.2422 0.2538 0.2823 -0.0104 -0.0231 -0.0094 22   LEU A N   
148  C  CA  . LEU A 22  ? 0.2803 0.2501 0.2852 -0.0163 -0.0003 -0.0247 22   LEU A CA  
149  C  C   . LEU A 22  ? 0.2447 0.2320 0.2399 -0.0068 -0.0269 -0.0201 22   LEU A C   
150  O  O   . LEU A 22  ? 0.2600 0.2422 0.2296 -0.0195 -0.0160 -0.0021 22   LEU A O   
151  C  CB  . LEU A 22  ? 0.3378 0.3064 0.3057 -0.0071 0.0184  -0.0167 22   LEU A CB  
152  C  CG  . LEU A 22  ? 0.2898 0.3137 0.3405 -0.0082 -0.0238 -0.0320 22   LEU A CG  
153  C  CD1 . LEU A 22  ? 0.4820 0.3207 0.3480 0.0046  -0.0045 -0.0152 22   LEU A CD1 
154  C  CD2 . LEU A 22  ? 0.4096 0.3445 0.3112 0.0090  0.0031  -0.0574 22   LEU A CD2 
155  N  N   . GLN A 23  ? 0.2863 0.2473 0.2689 0.0021  -0.0033 -0.0318 23   GLN A N   
156  C  CA  . GLN A 23  ? 0.2822 0.2523 0.2693 0.0036  -0.0073 -0.0313 23   GLN A CA  
157  C  C   . GLN A 23  ? 0.2742 0.2169 0.2444 0.0092  0.0035  -0.0267 23   GLN A C   
158  O  O   . GLN A 23  ? 0.2702 0.2387 0.2595 0.0197  0.0278  -0.0218 23   GLN A O   
159  C  CB  . GLN A 23  ? 0.2998 0.2533 0.3090 0.0075  0.0080  -0.0360 23   GLN A CB  
160  C  CG  . GLN A 23  ? 0.4150 0.2693 0.3541 -0.0104 0.0165  -0.0249 23   GLN A CG  
161  C  CD  . GLN A 23  ? 0.4637 0.4589 0.5205 0.0021  0.0661  0.0066  23   GLN A CD  
162  O  OE1 . GLN A 23  ? 0.4787 0.3777 0.4816 -0.0528 0.0108  -0.0287 23   GLN A OE1 
163  N  NE2 . GLN A 23  ? 0.6193 0.4693 0.4955 -0.0106 0.0289  0.0162  23   GLN A NE2 
164  N  N   . PRO A 24  ? 0.2776 0.2460 0.2411 0.0143  0.0018  -0.0231 24   PRO A N   
165  C  CA  . PRO A 24  ? 0.2923 0.2675 0.2652 0.0181  -0.0064 -0.0104 24   PRO A CA  
166  C  C   . PRO A 24  ? 0.2950 0.2480 0.2750 0.0200  0.0093  -0.0176 24   PRO A C   
167  O  O   . PRO A 24  ? 0.3261 0.2720 0.2853 0.0067  -0.0158 -0.0230 24   PRO A O   
168  C  CB  . PRO A 24  ? 0.2854 0.2560 0.2836 0.0289  -0.0050 -0.0198 24   PRO A CB  
169  C  CG  . PRO A 24  ? 0.2998 0.2923 0.2876 0.0175  0.0154  -0.0125 24   PRO A CG  
170  C  CD  . PRO A 24  ? 0.2822 0.2556 0.2726 0.0136  0.0259  -0.0030 24   PRO A CD  
171  N  N   . ILE A 25  ? 0.2917 0.2531 0.2692 0.0156  0.0065  0.0042  25   ILE A N   
172  C  CA  . ILE A 25  ? 0.3440 0.2718 0.3113 0.0222  0.0112  0.0148  25   ILE A CA  
173  C  C   . ILE A 25  ? 0.3497 0.3003 0.3165 0.0470  0.0195  0.0023  25   ILE A C   
174  O  O   . ILE A 25  ? 0.3664 0.3549 0.3354 0.0372  0.0036  0.0534  25   ILE A O   
175  C  CB  . ILE A 25  ? 0.3446 0.2880 0.3148 0.0173  -0.0004 -0.0098 25   ILE A CB  
176  C  CG1 . ILE A 25  ? 0.4233 0.3082 0.3790 0.0266  -0.0008 -0.0215 25   ILE A CG1 
177  C  CG2 . ILE A 25  ? 0.3132 0.3664 0.3813 0.0639  0.0427  0.0053  25   ILE A CG2 
178  C  CD1 . ILE A 25  ? 0.4191 0.3568 0.3142 0.0002  0.0091  0.0637  25   ILE A CD1 
179  N  N   . GLU A 26  ? 0.3160 0.3211 0.4185 0.0308  0.0591  0.0207  26   GLU A N   
180  C  CA  A GLU A 26  ? 0.3327 0.3075 0.4108 0.0642  0.0691  0.0107  26   GLU A CA  
181  C  CA  B GLU A 26  ? 0.3329 0.3037 0.4092 0.0630  0.0688  0.0113  26   GLU A CA  
182  C  C   . GLU A 26  ? 0.3118 0.2983 0.4168 0.0746  0.0631  0.0252  26   GLU A C   
183  O  O   . GLU A 26  ? 0.3170 0.2857 0.4168 0.0872  0.0969  0.0159  26   GLU A O   
184  C  CB  A GLU A 26  ? 0.4159 0.3443 0.4548 0.0637  0.0565  -0.0004 26   GLU A CB  
185  C  CB  B GLU A 26  ? 0.4142 0.3422 0.4478 0.0633  0.0566  -0.0033 26   GLU A CB  
186  C  CG  A GLU A 26  ? 0.5202 0.4329 0.4654 0.0692  0.0756  -0.0184 26   GLU A CG  
187  C  CG  B GLU A 26  ? 0.5236 0.3958 0.4478 0.0555  0.0766  -0.0037 26   GLU A CG  
188  C  CD  A GLU A 26  ? 0.6799 0.4284 0.5310 0.0987  0.0204  -0.0362 26   GLU A CD  
189  C  CD  B GLU A 26  ? 0.5340 0.4890 0.5000 0.1039  0.0769  0.0041  26   GLU A CD  
190  O  OE1 A GLU A 26  ? 0.7769 0.5009 0.5481 0.1100  0.0582  -0.0082 26   GLU A OE1 
191  O  OE1 B GLU A 26  ? 0.5962 0.5350 0.5814 0.0526  0.0400  -0.0331 26   GLU A OE1 
192  O  OE2 A GLU A 26  ? 0.7086 0.4945 0.5623 0.0862  0.0272  -0.0229 26   GLU A OE2 
193  O  OE2 B GLU A 26  ? 0.6376 0.4852 0.5090 0.1019  0.1677  0.0237  26   GLU A OE2 
194  N  N   . MET A 27  ? 0.3102 0.3556 0.4281 0.0825  0.0547  0.0088  27   MET A N   
195  C  CA  . MET A 27  ? 0.3221 0.3661 0.4222 0.0756  0.0668  0.0176  27   MET A CA  
196  C  C   . MET A 27  ? 0.3195 0.3464 0.4234 0.0920  0.0631  0.0150  27   MET A C   
197  O  O   . MET A 27  ? 0.3271 0.3802 0.4229 0.0794  0.0804  0.0157  27   MET A O   
198  C  CB  . MET A 27  ? 0.3433 0.3460 0.4201 0.0931  0.0624  0.0240  27   MET A CB  
199  C  CG  . MET A 27  ? 0.3924 0.3511 0.4317 0.0957  0.0882  0.0632  27   MET A CG  
200  S  SD  . MET A 27  ? 0.4728 0.3927 0.4418 0.0453  0.0672  0.0496  27   MET A SD  
201  C  CE  . MET A 27  ? 0.4929 0.4885 0.5956 0.0922  0.0030  0.1091  27   MET A CE  
202  N  N   . GLU A 28  ? 0.3217 0.3427 0.4245 0.0629  0.0453  0.0155  28   GLU A N   
203  C  CA  . GLU A 28  ? 0.3344 0.3439 0.4496 0.0877  0.0508  0.0227  28   GLU A CA  
204  C  C   . GLU A 28  ? 0.3355 0.3568 0.4112 0.0924  0.0577  0.0205  28   GLU A C   
205  O  O   . GLU A 28  ? 0.3268 0.3639 0.4180 0.0845  0.0797  -0.0010 28   GLU A O   
206  C  CB  . GLU A 28  ? 0.3616 0.3903 0.4880 0.0956  0.0574  0.0481  28   GLU A CB  
207  C  CG  . GLU A 28  ? 0.4751 0.4314 0.5357 0.0982  0.0855  0.0110  28   GLU A CG  
208  C  CD  . GLU A 28  ? 0.6670 0.4686 0.6131 0.1647  0.0543  0.0301  28   GLU A CD  
209  O  OE1 . GLU A 28  ? 0.6764 0.4624 0.5997 0.1270  0.0482  -0.0606 28   GLU A OE1 
210  O  OE2 . GLU A 28  ? 0.6618 0.5318 0.6208 0.1920  0.0901  -0.0311 28   GLU A OE2 
211  N  N   . PRO A 29  ? 0.3701 0.3574 0.4117 0.0824  0.0510  0.0134  29   PRO A N   
212  C  CA  . PRO A 29  ? 0.3613 0.4169 0.4402 0.0812  0.0456  0.0323  29   PRO A CA  
213  C  C   . PRO A 29  ? 0.3616 0.4401 0.4381 0.0731  0.0526  0.0434  29   PRO A C   
214  O  O   . PRO A 29  ? 0.3359 0.4131 0.3869 0.0845  0.0490  0.0250  29   PRO A O   
215  C  CB  . PRO A 29  ? 0.3868 0.4362 0.4715 0.0644  0.0075  0.0368  29   PRO A CB  
216  C  CG  . PRO A 29  ? 0.4247 0.4173 0.4115 0.0263  0.0343  -0.0024 29   PRO A CG  
217  C  CD  . PRO A 29  ? 0.3971 0.3531 0.4085 0.0763  0.0531  0.0121  29   PRO A CD  
218  N  N   . ARG A 30  ? 0.3778 0.4933 0.4959 0.1020  0.0442  0.0461  30   ARG A N   
219  C  CA  . ARG A 30  ? 0.3984 0.5976 0.5392 0.0982  0.0680  0.0430  30   ARG A CA  
220  C  C   . ARG A 30  ? 0.4001 0.6502 0.5477 0.0651  0.0638  0.0578  30   ARG A C   
221  O  O   . ARG A 30  ? 0.4014 0.6796 0.5540 0.0315  0.0416  0.0849  30   ARG A O   
222  C  CB  . ARG A 30  ? 0.4749 0.6760 0.5956 0.1562  0.0818  0.0341  30   ARG A CB  
223  C  CG  . ARG A 30  ? 0.5897 0.7465 0.7615 0.1057  0.0781  0.0212  30   ARG A CG  
224  C  CD  . ARG A 30  ? 0.6971 0.8743 0.7969 0.1564  0.0457  0.0294  30   ARG A CD  
225  N  NE  . ARG A 30  ? 0.8625 0.8799 0.9314 0.1221  0.0652  -0.0134 30   ARG A NE  
226  C  CZ  . ARG A 30  ? 0.9075 0.9308 0.9533 0.1550  0.0402  -0.0045 30   ARG A CZ  
227  N  NH1 . ARG A 30  ? 0.9505 0.9241 0.9501 0.1245  0.0480  0.0133  30   ARG A NH1 
228  N  NH2 . ARG A 30  ? 0.9633 0.8887 0.9665 0.1732  0.0386  -0.0234 30   ARG A NH2 
229  N  N   . GLY A 31  ? 0.4490 0.6995 0.5630 0.0475  0.0446  0.0739  31   GLY A N   
230  C  CA  . GLY A 31  ? 0.4414 0.7990 0.5678 -0.0010 0.0378  0.0977  31   GLY A CA  
231  C  C   . GLY A 31  ? 0.5071 0.7652 0.5456 -0.0627 -0.0004 0.0959  31   GLY A C   
232  O  O   . GLY A 31  ? 0.5508 0.8318 0.5487 -0.1222 -0.0514 0.1066  31   GLY A O   
233  N  N   . ILE A 32  ? 0.5169 0.6796 0.5317 -0.0405 -0.0104 0.0835  32   ILE A N   
234  C  CA  . ILE A 32  ? 0.5934 0.6448 0.5110 -0.0711 -0.0331 0.0697  32   ILE A CA  
235  C  C   . ILE A 32  ? 0.5768 0.5905 0.4676 -0.0803 -0.0159 0.0654  32   ILE A C   
236  O  O   . ILE A 32  ? 0.6639 0.6405 0.4581 -0.1064 -0.0547 0.0791  32   ILE A O   
237  C  CB  . ILE A 32  ? 0.6456 0.5957 0.5182 -0.0556 -0.0201 0.0764  32   ILE A CB  
238  C  CG1 . ILE A 32  ? 0.6459 0.6351 0.5333 -0.0567 -0.0433 0.0668  32   ILE A CG1 
239  C  CG2 . ILE A 32  ? 0.7785 0.6151 0.5016 -0.0466 -0.0541 0.0079  32   ILE A CG2 
240  C  CD1 . ILE A 32  ? 0.7602 0.7238 0.5923 -0.1548 -0.0380 0.0905  32   ILE A CD1 
241  N  N   . ASP A 33  ? 0.5054 0.4707 0.3723 -0.0242 -0.0145 0.0460  33   ASP A N   
242  C  CA  . ASP A 33  ? 0.4670 0.4326 0.3761 -0.0050 0.0127  0.0189  33   ASP A CA  
243  C  C   . ASP A 33  ? 0.4253 0.4807 0.3880 -0.0145 0.0221  0.0256  33   ASP A C   
244  O  O   . ASP A 33  ? 0.3791 0.4967 0.3405 0.0088  -0.0167 0.0095  33   ASP A O   
245  C  CB  . ASP A 33  ? 0.4481 0.4155 0.3440 0.0408  0.0065  0.0039  33   ASP A CB  
246  C  CG  . ASP A 33  ? 0.4666 0.3742 0.3915 0.0641  0.0188  0.0103  33   ASP A CG  
247  O  OD1 . ASP A 33  ? 0.4509 0.3551 0.3110 0.0341  -0.0416 -0.0042 33   ASP A OD1 
248  O  OD2 . ASP A 33  ? 0.4148 0.4737 0.4317 0.0408  -0.0287 0.0091  33   ASP A OD2 
249  N  N   . LEU A 34  ? 0.3144 0.3293 0.3332 0.0462  0.0050  -0.0282 34   LEU A N   
250  C  CA  . LEU A 34  ? 0.2939 0.2945 0.3030 0.0265  0.0037  -0.0171 34   LEU A CA  
251  C  C   . LEU A 34  ? 0.3193 0.2989 0.3070 0.0335  0.0023  -0.0234 34   LEU A C   
252  O  O   . LEU A 34  ? 0.3056 0.3125 0.3201 0.0311  0.0164  0.0023  34   LEU A O   
253  C  CB  . LEU A 34  ? 0.2949 0.2885 0.3239 0.0207  -0.0017 -0.0211 34   LEU A CB  
254  C  CG  . LEU A 34  ? 0.2910 0.2671 0.3003 0.0524  0.0145  0.0247  34   LEU A CG  
255  C  CD1 . LEU A 34  ? 0.2943 0.3705 0.3538 -0.0268 0.0050  0.0130  34   LEU A CD1 
256  C  CD2 . LEU A 34  ? 0.3004 0.2636 0.3240 0.0607  -0.0075 0.0036  34   LEU A CD2 
257  N  N   . ALA A 35  ? 0.3113 0.2870 0.3012 0.0450  -0.0045 0.0115  35   ALA A N   
258  C  CA  . ALA A 35  ? 0.3021 0.2855 0.2908 0.0444  0.0109  -0.0396 35   ALA A CA  
259  C  C   . ALA A 35  ? 0.3061 0.2516 0.2522 0.0554  0.0115  -0.0178 35   ALA A C   
260  O  O   . ALA A 35  ? 0.2862 0.2824 0.2650 0.0111  0.0210  -0.0143 35   ALA A O   
261  C  CB  . ALA A 35  ? 0.3315 0.2953 0.3396 0.0890  -0.0026 0.0178  35   ALA A CB  
262  N  N   . ALA A 36  ? 0.3428 0.2951 0.3177 0.0284  0.0071  -0.0078 36   ALA A N   
263  C  CA  . ALA A 36  ? 0.3315 0.2537 0.2717 0.0108  0.0021  -0.0021 36   ALA A CA  
264  C  C   . ALA A 36  ? 0.2786 0.2468 0.2608 0.0197  0.0187  -0.0323 36   ALA A C   
265  O  O   . ALA A 36  ? 0.3045 0.2794 0.2905 0.0106  0.0291  -0.0210 36   ALA A O   
266  C  CB  . ALA A 36  ? 0.3459 0.3242 0.3030 -0.0169 0.0274  0.0192  36   ALA A CB  
267  N  N   . SER A 37  ? 0.3241 0.2527 0.2632 0.0271  0.0264  -0.0436 37   SER A N   
268  C  CA  . SER A 37  ? 0.3727 0.3170 0.3012 0.0424  0.0406  -0.0240 37   SER A CA  
269  C  C   . SER A 37  ? 0.3331 0.3224 0.2836 0.0199  0.0316  -0.0493 37   SER A C   
270  O  O   . SER A 37  ? 0.3465 0.3511 0.2868 0.0187  0.0159  -0.0251 37   SER A O   
271  C  CB  . SER A 37  ? 0.4243 0.3183 0.3180 0.0583  0.0479  -0.0294 37   SER A CB  
272  O  OG  . SER A 37  ? 0.4145 0.3903 0.3944 0.0824  0.0374  0.0041  37   SER A OG  
273  N  N   . LEU A 38  ? 0.3059 0.2872 0.2751 0.0130  0.0106  -0.0126 38   LEU A N   
274  C  CA  . LEU A 38  ? 0.3143 0.3077 0.2731 0.0208  0.0135  -0.0232 38   LEU A CA  
275  C  C   . LEU A 38  ? 0.2920 0.2902 0.2652 0.0067  0.0112  -0.0015 38   LEU A C   
276  O  O   . LEU A 38  ? 0.2973 0.3051 0.2986 0.0308  0.0177  0.0019  38   LEU A O   
277  C  CB  . LEU A 38  ? 0.3184 0.2767 0.2909 0.0286  0.0079  -0.0287 38   LEU A CB  
278  C  CG  . LEU A 38  ? 0.3416 0.3151 0.3177 0.0796  -0.0012 -0.0228 38   LEU A CG  
279  C  CD1 . LEU A 38  ? 0.3272 0.3493 0.3209 0.0509  -0.0187 -0.0255 38   LEU A CD1 
280  C  CD2 . LEU A 38  ? 0.3053 0.4954 0.3757 0.0878  0.0373  -0.0389 38   LEU A CD2 
281  N  N   . ALA A 39  ? 0.2625 0.2750 0.2571 0.0455  0.0216  0.0062  39   ALA A N   
282  C  CA  . ALA A 39  ? 0.2509 0.2262 0.2413 0.0264  0.0213  -0.0315 39   ALA A CA  
283  C  C   . ALA A 39  ? 0.2538 0.2703 0.2197 0.0366  0.0100  -0.0386 39   ALA A C   
284  O  O   . ALA A 39  ? 0.2854 0.2839 0.2622 0.0245  0.0035  -0.0412 39   ALA A O   
285  C  CB  . ALA A 39  ? 0.2809 0.2549 0.2402 0.0420  0.0402  -0.0205 39   ALA A CB  
286  N  N   . ASP A 40  ? 0.2700 0.2743 0.2175 0.0335  -0.0088 -0.0141 40   ASP A N   
287  C  CA  . ASP A 40  ? 0.2489 0.3038 0.2430 0.0082  -0.0040 -0.0018 40   ASP A CA  
288  C  C   . ASP A 40  ? 0.2637 0.3106 0.2241 0.0256  -0.0038 -0.0076 40   ASP A C   
289  O  O   . ASP A 40  ? 0.2616 0.3039 0.1982 -0.0081 0.0029  -0.0049 40   ASP A O   
290  C  CB  . ASP A 40  ? 0.2954 0.3439 0.2567 0.0069  0.0165  0.0168  40   ASP A CB  
291  C  CG  . ASP A 40  ? 0.3011 0.4374 0.3109 0.0088  0.0426  -0.0277 40   ASP A CG  
292  O  OD1 . ASP A 40  ? 0.3665 0.4516 0.3302 -0.0311 0.0732  -0.0289 40   ASP A OD1 
293  O  OD2 . ASP A 40  ? 0.3149 0.3682 0.2768 0.0002  0.0462  0.0358  40   ASP A OD2 
294  N  N   . ILE A 41  ? 0.2370 0.3207 0.2219 0.0257  0.0112  -0.0109 41   ILE A N   
295  C  CA  . ILE A 41  ? 0.2199 0.2676 0.1761 0.0155  0.0094  0.0062  41   ILE A CA  
296  C  C   . ILE A 41  ? 0.2263 0.2492 0.1960 0.0262  0.0095  0.0024  41   ILE A C   
297  O  O   . ILE A 41  ? 0.2332 0.2630 0.2277 0.0036  0.0052  -0.0024 41   ILE A O   
298  C  CB  . ILE A 41  ? 0.2171 0.2892 0.1961 0.0385  0.0310  0.0128  41   ILE A CB  
299  C  CG1 . ILE A 41  ? 0.2580 0.3047 0.2591 0.0412  0.0174  0.0367  41   ILE A CG1 
300  C  CG2 . ILE A 41  ? 0.2734 0.3229 0.1994 0.0396  -0.0113 0.0208  41   ILE A CG2 
301  C  CD1 . ILE A 41  ? 0.2479 0.2790 0.2464 0.0397  0.0016  -0.0029 41   ILE A CD1 
302  N  N   . HIS A 42  ? 0.2053 0.2277 0.1896 0.0116  0.0072  -0.0093 42   HIS A N   
303  C  CA  . HIS A 42  ? 0.2301 0.2618 0.2062 0.0130  0.0124  0.0011  42   HIS A CA  
304  C  C   . HIS A 42  ? 0.2484 0.2745 0.2351 0.0127  0.0158  -0.0054 42   HIS A C   
305  O  O   . HIS A 42  ? 0.2306 0.2899 0.2769 0.0251  0.0066  -0.0113 42   HIS A O   
306  C  CB  . HIS A 42  ? 0.2478 0.2425 0.2166 0.0416  0.0194  -0.0101 42   HIS A CB  
307  C  CG  . HIS A 42  ? 0.2670 0.2750 0.2348 -0.0013 0.0022  -0.0151 42   HIS A CG  
308  N  ND1 . HIS A 42  ? 0.2813 0.2531 0.2367 0.0020  0.0010  -0.0104 42   HIS A ND1 
309  C  CD2 . HIS A 42  ? 0.2927 0.2717 0.2903 0.0431  0.0003  -0.0151 42   HIS A CD2 
310  C  CE1 . HIS A 42  ? 0.3198 0.3055 0.2706 0.0170  0.0411  0.0133  42   HIS A CE1 
311  N  NE2 . HIS A 42  ? 0.3188 0.3075 0.2556 0.0174  0.0170  -0.0013 42   HIS A NE2 
312  N  N   . LEU A 43  ? 0.2348 0.2748 0.2418 0.0318  0.0077  -0.0140 43   LEU A N   
313  C  CA  . LEU A 43  ? 0.2442 0.2657 0.2288 0.0414  0.0042  0.0194  43   LEU A CA  
314  C  C   . LEU A 43  ? 0.2449 0.2487 0.2338 0.0334  0.0149  0.0093  43   LEU A C   
315  O  O   . LEU A 43  ? 0.2583 0.2798 0.2528 0.0429  0.0182  -0.0060 43   LEU A O   
316  C  CB  . LEU A 43  ? 0.2460 0.2642 0.2348 0.0381  -0.0076 0.0034  43   LEU A CB  
317  C  CG  . LEU A 43  ? 0.2773 0.2503 0.2526 0.0664  0.0281  0.0323  43   LEU A CG  
318  C  CD1 . LEU A 43  ? 0.2365 0.2597 0.2939 0.0559  -0.0016 -0.0016 43   LEU A CD1 
319  C  CD2 . LEU A 43  ? 0.3129 0.2754 0.2646 0.0116  0.0021  0.0288  43   LEU A CD2 
320  N  N   . GLU A 44  ? 0.2357 0.2767 0.2354 0.0190  0.0135  0.0055  44   GLU A N   
321  C  CA  . GLU A 44  ? 0.2361 0.2463 0.2221 0.0330  0.0065  0.0247  44   GLU A CA  
322  C  C   . GLU A 44  ? 0.2681 0.2660 0.2440 0.0506  0.0189  0.0166  44   GLU A C   
323  O  O   . GLU A 44  ? 0.2689 0.2977 0.2496 0.0550  0.0175  0.0016  44   GLU A O   
324  C  CB  . GLU A 44  ? 0.2834 0.2759 0.2512 0.0245  -0.0036 0.0035  44   GLU A CB  
325  C  CG  . GLU A 44  ? 0.3799 0.3504 0.3188 0.0449  0.0115  0.0201  44   GLU A CG  
326  C  CD  . GLU A 44  ? 0.4572 0.4421 0.3961 -0.0350 0.0304  -0.0033 44   GLU A CD  
327  O  OE1 . GLU A 44  ? 0.4502 0.5485 0.5399 0.0210  -0.0515 0.0955  44   GLU A OE1 
328  O  OE2 . GLU A 44  ? 0.5520 0.5064 0.4471 0.0413  0.0500  0.0417  44   GLU A OE2 
329  N  N   . ALA A 45  ? 0.2323 0.2605 0.2453 0.0337  0.0024  0.0212  45   ALA A N   
330  C  CA  . ALA A 45  ? 0.2536 0.2519 0.2585 0.0419  0.0156  0.0366  45   ALA A CA  
331  C  C   . ALA A 45  ? 0.2513 0.2729 0.2733 0.0256  0.0256  0.0352  45   ALA A C   
332  O  O   . ALA A 45  ? 0.2709 0.2440 0.2818 0.0162  0.0098  0.0161  45   ALA A O   
333  C  CB  . ALA A 45  ? 0.2684 0.2468 0.3035 0.0327  0.0423  0.0392  45   ALA A CB  
334  N  N   . ASP A 46  ? 0.2421 0.2434 0.2132 0.0444  0.0220  0.0428  46   ASP A N   
335  C  CA  . ASP A 46  ? 0.2500 0.2534 0.2616 0.0360  0.0076  0.0312  46   ASP A CA  
336  C  C   . ASP A 46  ? 0.2297 0.2266 0.2396 0.0280  0.0021  0.0308  46   ASP A C   
337  O  O   . ASP A 46  ? 0.2421 0.2422 0.2276 0.0278  0.0165  0.0489  46   ASP A O   
338  C  CB  . ASP A 46  ? 0.2739 0.3064 0.2724 0.0011  0.0021  0.0142  46   ASP A CB  
339  C  CG  . ASP A 46  ? 0.4091 0.4222 0.3734 0.0710  -0.0274 -0.0340 46   ASP A CG  
340  O  OD1 . ASP A 46  ? 0.4689 0.3641 0.3530 0.0112  -0.0443 0.0126  46   ASP A OD1 
341  O  OD2 . ASP A 46  ? 0.4629 0.5461 0.3466 0.0153  -0.0678 -0.0616 46   ASP A OD2 
342  N  N   . ILE A 47  ? 0.2337 0.1702 0.2230 0.0041  0.0238  0.0263  47   ILE A N   
343  C  CA  . ILE A 47  ? 0.2557 0.2197 0.2606 0.0266  0.0352  0.0039  47   ILE A CA  
344  C  C   . ILE A 47  ? 0.2240 0.1841 0.2461 0.0168  0.0234  0.0243  47   ILE A C   
345  O  O   . ILE A 47  ? 0.2592 0.2305 0.2664 0.0249  0.0516  0.0359  47   ILE A O   
346  C  CB  . ILE A 47  ? 0.2233 0.1941 0.2595 0.0359  0.0385  0.0096  47   ILE A CB  
347  C  CG1 . ILE A 47  ? 0.2536 0.2269 0.2924 0.0180  0.0468  0.0355  47   ILE A CG1 
348  C  CG2 . ILE A 47  ? 0.2760 0.2003 0.2795 0.0529  0.0483  -0.0068 47   ILE A CG2 
349  C  CD1 . ILE A 47  ? 0.2782 0.2491 0.2703 -0.0082 0.0456  0.0130  47   ILE A CD1 
350  N  N   . HIS A 48  ? 0.2215 0.1874 0.2263 0.0282  0.0234  0.0245  48   HIS A N   
351  C  CA  . HIS A 48  ? 0.2418 0.1940 0.2277 0.0091  0.0213  0.0295  48   HIS A CA  
352  C  C   . HIS A 48  ? 0.2137 0.1886 0.2242 0.0321  0.0395  0.0483  48   HIS A C   
353  O  O   . HIS A 48  ? 0.2371 0.1904 0.2403 0.0438  0.0451  0.0615  48   HIS A O   
354  C  CB  . HIS A 48  ? 0.2197 0.2490 0.2295 -0.0073 0.0396  0.0297  48   HIS A CB  
355  C  CG  . HIS A 48  ? 0.3060 0.2829 0.2966 0.0288  0.0377  0.0145  48   HIS A CG  
356  N  ND1 . HIS A 48  ? 0.2581 0.2285 0.2285 0.0193  0.0152  -0.0188 48   HIS A ND1 
357  C  CD2 . HIS A 48  ? 0.2791 0.2385 0.2668 -0.0216 0.0470  0.0142  48   HIS A CD2 
358  C  CE1 . HIS A 48  ? 0.2503 0.2426 0.2366 0.0231  0.0380  0.0090  48   HIS A CE1 
359  N  NE2 . HIS A 48  ? 0.2638 0.2214 0.2566 -0.0113 0.0019  0.0039  48   HIS A NE2 
360  N  N   . ALA A 49  ? 0.2120 0.1794 0.2196 0.0188  0.0250  0.0453  49   ALA A N   
361  C  CA  . ALA A 49  ? 0.2264 0.1704 0.2573 -0.0010 0.0284  0.0214  49   ALA A CA  
362  C  C   . ALA A 49  ? 0.2268 0.1864 0.2299 0.0290  0.0335  0.0311  49   ALA A C   
363  O  O   . ALA A 49  ? 0.2444 0.2381 0.2586 0.0245  0.0331  0.0667  49   ALA A O   
364  C  CB  . ALA A 49  ? 0.2088 0.1614 0.1953 -0.0079 0.0375  0.0181  49   ALA A CB  
365  N  N   . LEU A 50  ? 0.2322 0.1911 0.2581 0.0489  0.0469  0.0632  50   LEU A N   
366  C  CA  . LEU A 50  ? 0.2537 0.2464 0.2946 0.0407  0.0646  0.0607  50   LEU A CA  
367  C  C   . LEU A 50  ? 0.2499 0.2411 0.2528 0.0518  0.0547  0.0496  50   LEU A C   
368  O  O   . LEU A 50  ? 0.2624 0.2333 0.2876 0.0392  0.0532  0.0518  50   LEU A O   
369  C  CB  . LEU A 50  ? 0.2749 0.2528 0.3315 0.0567  0.1042  0.0799  50   LEU A CB  
370  C  CG  . LEU A 50  ? 0.3510 0.3207 0.3212 0.1084  0.0869  0.0822  50   LEU A CG  
371  C  CD1 . LEU A 50  ? 0.4091 0.3000 0.4240 0.1458  0.0685  0.0869  50   LEU A CD1 
372  C  CD2 . LEU A 50  ? 0.2414 0.4260 0.3052 0.0842  0.0679  0.0240  50   LEU A CD2 
373  N  N   . LYS A 51  ? 0.2552 0.2895 0.2915 0.0429  0.0508  0.0458  51   LYS A N   
374  C  CA  . LYS A 51  ? 0.2405 0.2504 0.2560 0.0433  0.0545  0.0601  51   LYS A CA  
375  C  C   . LYS A 51  ? 0.2488 0.2566 0.2890 0.0549  0.0662  0.0629  51   LYS A C   
376  O  O   . LYS A 51  ? 0.2737 0.2249 0.3066 0.0607  0.0843  0.0633  51   LYS A O   
377  C  CB  . LYS A 51  ? 0.2534 0.3445 0.2581 0.0434  0.0670  0.0577  51   LYS A CB  
378  C  CG  . LYS A 51  ? 0.2750 0.3659 0.2544 0.0282  0.0712  0.0592  51   LYS A CG  
379  C  CD  . LYS A 51  ? 0.3274 0.4615 0.3713 0.0871  0.0590  0.0462  51   LYS A CD  
380  C  CE  . LYS A 51  ? 0.3560 0.5172 0.3742 0.0556  0.0346  0.0330  51   LYS A CE  
381  N  NZ  . LYS A 51  ? 0.3477 0.5063 0.4060 0.0381  0.0241  -0.0073 51   LYS A NZ  
382  N  N   . ASN A 52  ? 0.2654 0.2578 0.2872 0.0290  0.0654  0.0560  52   ASN A N   
383  C  CA  . ASN A 52  ? 0.2824 0.2279 0.3082 0.0473  0.0667  0.0584  52   ASN A CA  
384  C  C   . ASN A 52  ? 0.2801 0.2164 0.3477 0.0574  0.0650  0.0573  52   ASN A C   
385  O  O   . ASN A 52  ? 0.3130 0.2407 0.3846 0.0393  0.0768  0.0350  52   ASN A O   
386  C  CB  . ASN A 52  ? 0.2621 0.2312 0.2894 0.0776  0.0753  0.0596  52   ASN A CB  
387  C  CG  . ASN A 52  ? 0.3070 0.3347 0.3273 0.0536  0.0949  0.0834  52   ASN A CG  
388  O  OD1 . ASN A 52  ? 0.3145 0.2876 0.3393 0.0456  0.0861  0.0632  52   ASN A OD1 
389  N  ND2 . ASN A 52  ? 0.3498 0.4693 0.4366 0.0945  0.0549  0.0830  52   ASN A ND2 
390  N  N   . ASN A 53  ? 0.2536 0.2422 0.3190 0.0419  0.0549  0.0343  53   ASN A N   
391  C  CA  . ASN A 53  ? 0.2728 0.2165 0.3411 0.0316  0.0701  0.0320  53   ASN A CA  
392  C  C   . ASN A 53  ? 0.2358 0.1607 0.3127 0.0412  0.0740  0.0497  53   ASN A C   
393  O  O   . ASN A 53  ? 0.2760 0.2060 0.3392 0.0002  0.0653  0.0108  53   ASN A O   
394  C  CB  . ASN A 53  ? 0.2607 0.1852 0.3105 0.0082  0.0663  0.0239  53   ASN A CB  
395  C  CG  . ASN A 53  ? 0.2278 0.1186 0.2654 0.0380  0.0578  0.0224  53   ASN A CG  
396  O  OD1 . ASN A 53  ? 0.2664 0.1532 0.2945 0.0217  0.0560  0.0116  53   ASN A OD1 
397  N  ND2 . ASN A 53  ? 0.2604 0.1144 0.2763 0.0138  0.0849  0.0278  53   ASN A ND2 
398  N  N   . PRO A 54  ? 0.2917 0.1767 0.3572 0.0239  0.0788  0.0172  54   PRO A N   
399  C  CA  . PRO A 54  ? 0.3459 0.2055 0.3964 0.0169  0.0837  0.0081  54   PRO A CA  
400  C  C   . PRO A 54  ? 0.3142 0.2005 0.3879 0.0047  0.0895  -0.0172 54   PRO A C   
401  O  O   . PRO A 54  ? 0.3356 0.2413 0.4481 0.0179  0.0740  -0.0752 54   PRO A O   
402  C  CB  . PRO A 54  ? 0.3834 0.2316 0.4733 0.0046  0.1033  0.0328  54   PRO A CB  
403  C  CG  . PRO A 54  ? 0.3657 0.2191 0.4450 -0.0227 0.0799  0.0331  54   PRO A CG  
404  C  CD  . PRO A 54  ? 0.2955 0.1537 0.3821 0.0352  0.0920  0.0301  54   PRO A CD  
405  N  N   . ASN A 55  ? 0.2980 0.2027 0.3763 0.0079  0.0500  -0.0196 55   ASN A N   
406  C  CA  . ASN A 55  ? 0.2756 0.1521 0.3533 -0.0122 0.0721  -0.0181 55   ASN A CA  
407  C  C   . ASN A 55  ? 0.2600 0.1642 0.3366 -0.0129 0.0413  -0.0123 55   ASN A C   
408  O  O   . ASN A 55  ? 0.3005 0.1976 0.3875 -0.0019 0.0403  -0.0183 55   ASN A O   
409  C  CB  . ASN A 55  ? 0.2495 0.1729 0.3603 -0.0090 0.0640  -0.0254 55   ASN A CB  
410  C  CG  . ASN A 55  ? 0.2447 0.2015 0.3570 -0.0323 0.0911  -0.0134 55   ASN A CG  
411  O  OD1 . ASN A 55  ? 0.2874 0.2413 0.3642 -0.0175 0.1009  -0.0027 55   ASN A OD1 
412  N  ND2 . ASN A 55  ? 0.2850 0.1938 0.4174 0.0051  0.1144  -0.0634 55   ASN A ND2 
413  N  N   . GLY A 56  ? 0.2501 0.1477 0.3043 -0.0194 0.0406  0.0053  56   GLY A N   
414  C  CA  . GLY A 56  ? 0.2633 0.1756 0.2784 -0.0155 0.0233  0.0052  56   GLY A CA  
415  C  C   . GLY A 56  ? 0.2371 0.1756 0.2542 0.0218  0.0220  0.0099  56   GLY A C   
416  O  O   . GLY A 56  ? 0.2839 0.2074 0.2731 -0.0088 0.0318  0.0151  56   GLY A O   
417  N  N   . PHE A 57  ? 0.2147 0.1434 0.2424 0.0019  0.0364  0.0105  57   PHE A N   
418  C  CA  . PHE A 57  ? 0.2303 0.1803 0.2640 0.0203  0.0244  -0.0024 57   PHE A CA  
419  C  C   . PHE A 57  ? 0.2482 0.2013 0.2728 0.0019  0.0287  0.0110  57   PHE A C   
420  O  O   . PHE A 57  ? 0.2748 0.2110 0.2906 0.0094  0.0201  0.0278  57   PHE A O   
421  C  CB  . PHE A 57  ? 0.2268 0.1470 0.2343 -0.0021 0.0231  0.0091  57   PHE A CB  
422  C  CG  . PHE A 57  ? 0.2317 0.1759 0.2132 0.0047  0.0419  0.0001  57   PHE A CG  
423  C  CD1 . PHE A 57  ? 0.2737 0.2599 0.2696 -0.0025 0.0421  0.0014  57   PHE A CD1 
424  C  CD2 . PHE A 57  ? 0.3027 0.2315 0.2995 0.0280  0.0282  0.0503  57   PHE A CD2 
425  C  CE1 . PHE A 57  ? 0.2801 0.2838 0.2816 0.0075  0.0115  -0.0152 57   PHE A CE1 
426  C  CE2 . PHE A 57  ? 0.3073 0.2738 0.3003 0.0120  0.0281  0.0496  57   PHE A CE2 
427  C  CZ  . PHE A 57  ? 0.2569 0.2549 0.2529 0.0158  0.0123  0.0121  57   PHE A CZ  
428  N  N   . PRO A 58  ? 0.2439 0.1869 0.2755 -0.0018 0.0182  0.0120  58   PRO A N   
429  C  CA  . PRO A 58  ? 0.2511 0.1832 0.2493 -0.0071 -0.0012 0.0164  58   PRO A CA  
430  C  C   . PRO A 58  ? 0.2313 0.1735 0.2460 -0.0051 0.0182  0.0285  58   PRO A C   
431  O  O   . PRO A 58  ? 0.2232 0.1663 0.2233 0.0126  0.0250  0.0167  58   PRO A O   
432  C  CB  . PRO A 58  ? 0.2658 0.1804 0.2292 -0.0244 -0.0017 0.0227  58   PRO A CB  
433  C  CG  . PRO A 58  ? 0.2789 0.2241 0.3223 -0.0310 -0.0215 0.0171  58   PRO A CG  
434  C  CD  . PRO A 58  ? 0.3007 0.2116 0.2809 -0.0259 0.0124  0.0254  58   PRO A CD  
435  N  N   . GLU A 59  ? 0.2511 0.2116 0.2502 0.0061  0.0075  0.0332  59   GLU A N   
436  C  CA  . GLU A 59  ? 0.2415 0.2307 0.2269 0.0195  0.0275  0.0407  59   GLU A CA  
437  C  C   . GLU A 59  ? 0.2565 0.2503 0.2456 -0.0070 0.0126  0.0252  59   GLU A C   
438  O  O   . GLU A 59  ? 0.2498 0.2266 0.2313 -0.0100 0.0029  0.0233  59   GLU A O   
439  C  CB  . GLU A 59  ? 0.2530 0.3002 0.2862 0.0298  0.0115  0.0485  59   GLU A CB  
440  C  CG  . GLU A 59  ? 0.3005 0.3696 0.2694 0.0485  -0.0042 0.0529  59   GLU A CG  
441  C  CD  . GLU A 59  ? 0.3217 0.5742 0.3240 0.0458  0.0081  0.0623  59   GLU A CD  
442  O  OE1 . GLU A 59  ? 0.2862 0.4618 0.3662 0.0117  0.0032  0.0483  59   GLU A OE1 
443  O  OE2 . GLU A 59  ? 0.3999 0.4859 0.3468 0.0992  -0.0221 0.0282  59   GLU A OE2 
444  N  N   . GLY A 60  ? 0.2334 0.2402 0.2491 0.0171  0.0230  0.0212  60   GLY A N   
445  C  CA  . GLY A 60  ? 0.2674 0.2461 0.2508 -0.0121 0.0018  0.0017  60   GLY A CA  
446  C  C   . GLY A 60  ? 0.2548 0.2286 0.2525 -0.0211 0.0118  0.0036  60   GLY A C   
447  O  O   . GLY A 60  ? 0.2683 0.2487 0.2818 -0.0082 0.0114  0.0064  60   GLY A O   
448  N  N   . PHE A 61  ? 0.2479 0.2253 0.2358 0.0100  0.0210  0.0147  61   PHE A N   
449  C  CA  . PHE A 61  ? 0.2471 0.2125 0.2582 0.0047  0.0124  0.0055  61   PHE A CA  
450  C  C   . PHE A 61  ? 0.2518 0.1965 0.2627 0.0122  0.0122  0.0185  61   PHE A C   
451  O  O   . PHE A 61  ? 0.2334 0.1848 0.2309 0.0097  0.0214  0.0288  61   PHE A O   
452  C  CB  . PHE A 61  ? 0.2796 0.2334 0.2681 0.0041  0.0042  0.0144  61   PHE A CB  
453  C  CG  . PHE A 61  ? 0.3047 0.2412 0.2879 -0.0054 0.0077  0.0159  61   PHE A CG  
454  C  CD1 . PHE A 61  ? 0.2926 0.2144 0.2794 -0.0217 0.0280  0.0145  61   PHE A CD1 
455  C  CD2 . PHE A 61  ? 0.3073 0.2025 0.3011 -0.0004 0.0060  0.0063  61   PHE A CD2 
456  C  CE1 . PHE A 61  ? 0.3252 0.2366 0.2915 -0.0247 0.0060  0.0463  61   PHE A CE1 
457  C  CE2 . PHE A 61  ? 0.3411 0.2664 0.2993 -0.0096 0.0074  0.0521  61   PHE A CE2 
458  C  CZ  . PHE A 61  ? 0.3416 0.2567 0.3148 0.0275  -0.0087 0.0231  61   PHE A CZ  
459  N  N   . TRP A 62  ? 0.2691 0.1714 0.2555 0.0097  0.0324  0.0107  62   TRP A N   
460  C  CA  . TRP A 62  ? 0.2413 0.1534 0.2422 0.0104  0.0148  0.0115  62   TRP A CA  
461  C  C   . TRP A 62  ? 0.2458 0.1628 0.2271 0.0058  0.0064  0.0084  62   TRP A C   
462  O  O   . TRP A 62  ? 0.2592 0.1909 0.2515 -0.0073 0.0110  0.0171  62   TRP A O   
463  C  CB  . TRP A 62  ? 0.2565 0.1774 0.2710 0.0272  0.0256  0.0154  62   TRP A CB  
464  C  CG  . TRP A 62  ? 0.2445 0.1604 0.2433 0.0233  0.0087  -0.0031 62   TRP A CG  
465  C  CD1 . TRP A 62  ? 0.2611 0.1996 0.2735 0.0165  0.0189  -0.0104 62   TRP A CD1 
466  C  CD2 . TRP A 62  ? 0.2351 0.1428 0.2365 -0.0032 0.0154  -0.0024 62   TRP A CD2 
467  N  NE1 . TRP A 62  ? 0.2295 0.2092 0.2195 0.0153  0.0195  -0.0043 62   TRP A NE1 
468  C  CE2 . TRP A 62  ? 0.2544 0.1468 0.2215 0.0195  0.0130  -0.0041 62   TRP A CE2 
469  C  CE3 . TRP A 62  ? 0.2563 0.1935 0.2174 -0.0027 0.0009  0.0171  62   TRP A CE3 
470  C  CZ2 . TRP A 62  ? 0.2579 0.2133 0.2818 -0.0029 0.0043  0.0001  62   TRP A CZ2 
471  C  CZ3 . TRP A 62  ? 0.2761 0.2062 0.2750 0.0437  -0.0097 0.0349  62   TRP A CZ3 
472  C  CH2 . TRP A 62  ? 0.2625 0.2190 0.2560 0.0424  0.0111  -0.0055 62   TRP A CH2 
473  N  N   . MET A 63  ? 0.2453 0.2079 0.2460 0.0231  0.0339  -0.0051 63   MET A N   
474  C  CA  . MET A 63  ? 0.2318 0.1881 0.2446 -0.0018 0.0291  0.0008  63   MET A CA  
475  C  C   . MET A 63  ? 0.2411 0.1743 0.2489 0.0124  0.0161  -0.0134 63   MET A C   
476  O  O   . MET A 63  ? 0.2447 0.1815 0.2476 0.0130  0.0232  0.0031  63   MET A O   
477  C  CB  . MET A 63  ? 0.2264 0.1673 0.2542 0.0248  0.0275  0.0003  63   MET A CB  
478  C  CG  . MET A 63  ? 0.2477 0.2542 0.2659 -0.0027 0.0575  0.0382  63   MET A CG  
479  S  SD  . MET A 63  ? 0.3098 0.2657 0.3140 0.0159  0.0519  0.0194  63   MET A SD  
480  C  CE  . MET A 63  ? 0.3660 0.2545 0.2886 -0.0172 0.0689  -0.0040 63   MET A CE  
481  N  N   . PRO A 64  ? 0.2636 0.2384 0.2216 -0.0170 0.0393  -0.0131 64   PRO A N   
482  C  CA  . PRO A 64  ? 0.2728 0.2284 0.2415 -0.0091 0.0311  -0.0092 64   PRO A CA  
483  C  C   . PRO A 64  ? 0.2737 0.2149 0.2294 0.0107  0.0340  -0.0267 64   PRO A C   
484  O  O   . PRO A 64  ? 0.2532 0.1852 0.2324 0.0011  0.0256  -0.0154 64   PRO A O   
485  C  CB  . PRO A 64  ? 0.2914 0.2319 0.2577 -0.0198 0.0283  0.0069  64   PRO A CB  
486  C  CG  . PRO A 64  ? 0.3019 0.2639 0.2311 -0.0267 0.0138  0.0213  64   PRO A CG  
487  C  CD  . PRO A 64  ? 0.2754 0.2646 0.2043 0.0028  0.0500  -0.0102 64   PRO A CD  
488  N  N   . TYR A 65  ? 0.2697 0.2119 0.2354 0.0116  0.0316  -0.0014 65   TYR A N   
489  C  CA  . TYR A 65  ? 0.2668 0.2255 0.2395 0.0312  0.0143  -0.0144 65   TYR A CA  
490  C  C   . TYR A 65  ? 0.2495 0.2413 0.2444 0.0130  0.0164  -0.0164 65   TYR A C   
491  O  O   . TYR A 65  ? 0.2698 0.2267 0.2660 0.0061  0.0124  -0.0127 65   TYR A O   
492  C  CB  . TYR A 65  ? 0.2908 0.2704 0.2583 0.0097  0.0201  -0.0021 65   TYR A CB  
493  C  CG  . TYR A 65  ? 0.3065 0.2266 0.2330 0.0277  0.0047  -0.0165 65   TYR A CG  
494  C  CD1 . TYR A 65  ? 0.2847 0.2975 0.3032 0.0273  0.0153  0.0316  65   TYR A CD1 
495  C  CD2 . TYR A 65  ? 0.3083 0.2535 0.2824 0.0321  0.0023  -0.0001 65   TYR A CD2 
496  C  CE1 . TYR A 65  ? 0.3242 0.3158 0.2922 0.0256  0.0270  0.0307  65   TYR A CE1 
497  C  CE2 . TYR A 65  ? 0.3118 0.2524 0.2641 0.0026  0.0196  0.0037  65   TYR A CE2 
498  C  CZ  . TYR A 65  ? 0.3242 0.2103 0.2457 0.0083  0.0099  0.0055  65   TYR A CZ  
499  O  OH  . TYR A 65  ? 0.3621 0.1976 0.2327 0.0556  0.0309  -0.0074 65   TYR A OH  
500  N  N   . LEU A 66  ? 0.2322 0.2016 0.2313 -0.0001 0.0045  -0.0003 66   LEU A N   
501  C  CA  . LEU A 66  ? 0.2171 0.1865 0.2343 -0.0016 0.0125  -0.0105 66   LEU A CA  
502  C  C   . LEU A 66  ? 0.2326 0.1939 0.2398 0.0095  0.0198  -0.0266 66   LEU A C   
503  O  O   . LEU A 66  ? 0.2566 0.2455 0.2850 0.0427  0.0372  -0.0262 66   LEU A O   
504  C  CB  . LEU A 66  ? 0.2261 0.1696 0.2179 0.0008  0.0163  -0.0164 66   LEU A CB  
505  C  CG  . LEU A 66  ? 0.2197 0.1983 0.2747 0.0007  0.0357  -0.0183 66   LEU A CG  
506  C  CD1 . LEU A 66  ? 0.2796 0.2093 0.2394 -0.0142 0.0088  0.0102  66   LEU A CD1 
507  C  CD2 . LEU A 66  ? 0.2595 0.2253 0.2559 0.0169  0.0126  -0.0451 66   LEU A CD2 
508  N  N   . THR A 67  ? 0.2286 0.1988 0.2690 0.0052  0.0192  -0.0061 67   THR A N   
509  C  CA  . THR A 67  ? 0.2768 0.2253 0.2714 0.0042  0.0350  0.0056  67   THR A CA  
510  C  C   . THR A 67  ? 0.2732 0.2632 0.2942 0.0035  0.0143  -0.0231 67   THR A C   
511  O  O   . THR A 67  ? 0.3054 0.2351 0.2921 0.0050  0.0243  0.0020  67   THR A O   
512  C  CB  . THR A 67  ? 0.3036 0.3274 0.3143 -0.0201 0.0182  -0.0033 67   THR A CB  
513  O  OG1 . THR A 67  ? 0.2660 0.3546 0.2963 -0.0041 0.0149  -0.0051 67   THR A OG1 
514  C  CG2 . THR A 67  ? 0.3028 0.4255 0.3394 0.0056  0.0174  -0.0087 67   THR A CG2 
515  N  N   . ILE A 68  ? 0.2707 0.2445 0.3012 0.0100  0.0360  -0.0152 68   ILE A N   
516  C  CA  . ILE A 68  ? 0.2579 0.2359 0.2735 0.0005  0.0357  -0.0197 68   ILE A CA  
517  C  C   . ILE A 68  ? 0.2576 0.2399 0.2874 0.0123  0.0410  -0.0234 68   ILE A C   
518  O  O   . ILE A 68  ? 0.2992 0.2704 0.3245 0.0099  0.0243  -0.0416 68   ILE A O   
519  C  CB  . ILE A 68  ? 0.2754 0.2172 0.3008 0.0077  0.0249  -0.0101 68   ILE A CB  
520  C  CG1 . ILE A 68  ? 0.3427 0.3078 0.3285 -0.0089 0.0151  0.0273  68   ILE A CG1 
521  C  CG2 . ILE A 68  ? 0.3050 0.2810 0.2905 0.0196  0.0296  -0.0095 68   ILE A CG2 
522  C  CD1 . ILE A 68  ? 0.3546 0.3693 0.4131 -0.0604 0.0165  -0.0077 68   ILE A CD1 
523  N  N   . ALA A 69  ? 0.2639 0.2533 0.2836 0.0096  0.0487  -0.0094 69   ALA A N   
524  C  CA  . ALA A 69  ? 0.2880 0.3039 0.2865 0.0204  0.0362  0.0105  69   ALA A CA  
525  C  C   . ALA A 69  ? 0.2668 0.2975 0.2782 0.0018  0.0218  -0.0141 69   ALA A C   
526  O  O   . ALA A 69  ? 0.2810 0.2667 0.2715 -0.0108 0.0244  -0.0077 69   ALA A O   
527  C  CB  . ALA A 69  ? 0.3229 0.3333 0.3147 -0.0235 0.0419  0.0083  69   ALA A CB  
528  N  N   . TYR A 70  ? 0.2689 0.3216 0.2975 0.0351  0.0238  -0.0143 70   TYR A N   
529  C  CA  . TYR A 70  ? 0.2842 0.2580 0.2950 0.0077  0.0320  0.0147  70   TYR A CA  
530  C  C   . TYR A 70  ? 0.2815 0.2899 0.2801 0.0076  0.0375  0.0007  70   TYR A C   
531  O  O   . TYR A 70  ? 0.2686 0.2711 0.2671 0.0213  0.0235  0.0033  70   TYR A O   
532  C  CB  . TYR A 70  ? 0.2719 0.2832 0.3015 0.0044  -0.0019 0.0180  70   TYR A CB  
533  C  CG  . TYR A 70  ? 0.3028 0.2907 0.2974 -0.0238 0.0238  0.0058  70   TYR A CG  
534  C  CD1 . TYR A 70  ? 0.3161 0.2630 0.2944 -0.0277 0.0470  -0.0072 70   TYR A CD1 
535  C  CD2 . TYR A 70  ? 0.2931 0.2917 0.3152 -0.0032 0.0297  0.0172  70   TYR A CD2 
536  C  CE1 . TYR A 70  ? 0.3201 0.3404 0.3435 -0.0341 0.0402  -0.0156 70   TYR A CE1 
537  C  CE2 . TYR A 70  ? 0.3430 0.3082 0.3187 -0.0197 0.0244  -0.0695 70   TYR A CE2 
538  C  CZ  . TYR A 70  ? 0.3003 0.3210 0.3402 -0.0355 0.0515  -0.0066 70   TYR A CZ  
539  O  OH  . TYR A 70  ? 0.3799 0.3814 0.4833 0.0062  0.0603  -0.0604 70   TYR A OH  
540  N  N   . GLU A 71  ? 0.3132 0.2868 0.3236 0.0088  0.0438  0.0104  71   GLU A N   
541  C  CA  A GLU A 71  ? 0.2974 0.2788 0.3016 -0.0072 0.0381  0.0096  71   GLU A CA  
542  C  CA  B GLU A 71  ? 0.2937 0.2737 0.2973 -0.0053 0.0391  0.0095  71   GLU A CA  
543  C  C   . GLU A 71  ? 0.2974 0.2688 0.2833 -0.0040 0.0369  0.0176  71   GLU A C   
544  O  O   . GLU A 71  ? 0.2998 0.3058 0.3055 -0.0177 0.0502  0.0072  71   GLU A O   
545  C  CB  A GLU A 71  ? 0.3406 0.2991 0.3409 -0.0238 0.0186  -0.0065 71   GLU A CB  
546  C  CB  B GLU A 71  ? 0.3254 0.2941 0.3259 -0.0225 0.0263  -0.0070 71   GLU A CB  
547  C  CG  A GLU A 71  ? 0.3428 0.3610 0.3857 -0.0501 0.0476  0.0054  71   GLU A CG  
548  C  CG  B GLU A 71  ? 0.3589 0.3379 0.3565 -0.0253 0.0430  0.0094  71   GLU A CG  
549  C  CD  A GLU A 71  ? 0.5270 0.3720 0.4814 -0.0618 0.0516  0.0001  71   GLU A CD  
550  C  CD  B GLU A 71  ? 0.5382 0.3641 0.4720 -0.0861 0.0477  0.0425  71   GLU A CD  
551  O  OE1 A GLU A 71  ? 0.5679 0.4798 0.4540 -0.1225 0.1410  0.0296  71   GLU A OE1 
552  O  OE1 B GLU A 71  ? 0.5270 0.4254 0.5931 -0.1287 0.0140  0.0567  71   GLU A OE1 
553  O  OE2 A GLU A 71  ? 0.6007 0.5261 0.5562 -0.1088 0.0456  0.0862  71   GLU A OE2 
554  O  OE2 B GLU A 71  ? 0.6389 0.5138 0.4806 0.0039  0.1036  0.1268  71   GLU A OE2 
555  N  N   . LEU A 72  ? 0.2700 0.2658 0.3199 -0.0129 0.0347  0.0056  72   LEU A N   
556  C  CA  . LEU A 72  ? 0.2943 0.2748 0.2626 0.0017  0.0320  0.0144  72   LEU A CA  
557  C  C   . LEU A 72  ? 0.3022 0.2830 0.2870 -0.0053 0.0467  0.0161  72   LEU A C   
558  O  O   . LEU A 72  ? 0.2913 0.3521 0.3127 -0.0213 0.0315  -0.0059 72   LEU A O   
559  C  CB  . LEU A 72  ? 0.3248 0.2903 0.3175 -0.0127 0.0522  0.0308  72   LEU A CB  
560  C  CG  . LEU A 72  ? 0.3516 0.3193 0.3358 0.0136  0.0061  0.0021  72   LEU A CG  
561  C  CD1 . LEU A 72  ? 0.3179 0.3130 0.2661 0.0056  0.0024  0.0030  72   LEU A CD1 
562  C  CD2 . LEU A 72  ? 0.4055 0.3219 0.4945 0.0300  -0.0253 -0.0159 72   LEU A CD2 
563  N  N   . LYS A 73  ? 0.2998 0.2861 0.2949 0.0001  0.0541  0.0258  73   LYS A N   
564  C  CA  . LYS A 73  ? 0.3104 0.2775 0.2810 -0.0010 0.0536  0.0210  73   LYS A CA  
565  C  C   . LYS A 73  ? 0.3240 0.2705 0.2824 0.0123  0.0526  0.0180  73   LYS A C   
566  O  O   . LYS A 73  ? 0.3176 0.2448 0.2973 -0.0103 0.0419  0.0380  73   LYS A O   
567  C  CB  . LYS A 73  ? 0.3501 0.2605 0.3048 -0.0039 0.0413  0.0361  73   LYS A CB  
568  C  CG  . LYS A 73  ? 0.4370 0.3468 0.3517 -0.0416 0.0433  0.0443  73   LYS A CG  
569  C  CD  . LYS A 73  ? 0.6384 0.3839 0.5213 0.0257  0.0836  0.0535  73   LYS A CD  
570  C  CE  . LYS A 73  ? 0.7528 0.5977 0.6545 -0.0462 0.0240  -0.0009 73   LYS A CE  
571  N  NZ  . LYS A 73  ? 0.8661 0.7224 0.7302 -0.0363 0.1021  0.0664  73   LYS A NZ  
572  N  N   . ASN A 74  ? 0.3199 0.3115 0.2638 -0.0011 0.0465  0.0398  74   ASN A N   
573  C  CA  . ASN A 74  ? 0.3286 0.2887 0.2719 0.0147  0.0433  0.0196  74   ASN A CA  
574  C  C   . ASN A 74  ? 0.3548 0.3056 0.2736 -0.0008 0.0524  0.0325  74   ASN A C   
575  O  O   . ASN A 74  ? 0.3886 0.3074 0.3010 -0.0144 0.0539  0.0714  74   ASN A O   
576  C  CB  . ASN A 74  ? 0.3415 0.3431 0.2617 0.0026  0.0615  0.0128  74   ASN A CB  
577  C  CG  . ASN A 74  ? 0.3775 0.3662 0.2814 0.0166  0.0183  0.0048  74   ASN A CG  
578  O  OD1 . ASN A 74  ? 0.4211 0.3463 0.2774 0.0314  0.0902  0.0086  74   ASN A OD1 
579  N  ND2 . ASN A 74  ? 0.3575 0.3263 0.2662 0.0157  0.0408  0.0371  74   ASN A ND2 
580  N  N   . THR A 75  ? 0.3781 0.2984 0.2755 0.0247  0.0540  0.0350  75   THR A N   
581  C  CA  . THR A 75  ? 0.4204 0.3155 0.2865 0.0213  0.0548  0.0441  75   THR A CA  
582  C  C   . THR A 75  ? 0.4669 0.3654 0.3034 0.0137  0.0429  0.0578  75   THR A C   
583  O  O   . THR A 75  ? 0.5479 0.3973 0.3797 0.0131  0.0382  0.0805  75   THR A O   
584  C  CB  . THR A 75  ? 0.4406 0.3485 0.3096 0.0378  0.0525  0.0369  75   THR A CB  
585  O  OG1 . THR A 75  ? 0.3975 0.3894 0.3810 0.0646  -0.0032 0.0400  75   THR A OG1 
586  C  CG2 . THR A 75  ? 0.5286 0.3699 0.3095 0.0724  0.0515  0.0995  75   THR A CG2 
587  N  N   . ASP A 76  ? 0.4244 0.3816 0.3181 0.0262  0.0688  0.0446  76   ASP A N   
588  C  CA  . ASP A 76  ? 0.4551 0.4138 0.3284 0.0262  0.0575  0.0611  76   ASP A CA  
589  C  C   . ASP A 76  ? 0.4738 0.4473 0.3708 0.0170  0.0639  0.0737  76   ASP A C   
590  O  O   . ASP A 76  ? 0.5171 0.4815 0.3911 -0.0066 0.0590  0.0847  76   ASP A O   
591  C  CB  . ASP A 76  ? 0.4596 0.4438 0.3207 0.0288  0.0617  0.0614  76   ASP A CB  
592  C  CG  . ASP A 76  ? 0.4622 0.5008 0.3763 0.0399  0.0452  0.0427  76   ASP A CG  
593  O  OD1 . ASP A 76  ? 0.5011 0.5037 0.3865 0.0714  0.0277  0.0552  76   ASP A OD1 
594  O  OD2 . ASP A 76  ? 0.5383 0.5277 0.4400 -0.0593 0.0500  0.0263  76   ASP A OD2 
595  N  N   . THR A 77  ? 0.4400 0.4424 0.3545 -0.0034 0.0673  0.0755  77   THR A N   
596  C  CA  . THR A 77  ? 0.4538 0.4321 0.3408 0.0011  0.0700  0.0671  77   THR A CA  
597  C  C   . THR A 77  ? 0.4376 0.4077 0.3523 -0.0278 0.0776  0.0667  77   THR A C   
598  O  O   . THR A 77  ? 0.4969 0.5061 0.3871 -0.0396 0.1202  0.0716  77   THR A O   
599  C  CB  . THR A 77  ? 0.4410 0.4304 0.3349 0.0024  0.0781  0.0479  77   THR A CB  
600  O  OG1 . THR A 77  ? 0.4095 0.4395 0.2923 0.0186  0.0737  0.0346  77   THR A OG1 
601  C  CG2 . THR A 77  ? 0.4606 0.4776 0.3134 0.0109  -0.0004 0.0720  77   THR A CG2 
602  N  N   . GLY A 78  ? 0.4300 0.3755 0.3551 -0.0225 0.0584  0.0568  78   GLY A N   
603  C  CA  . GLY A 78  ? 0.4405 0.3845 0.3608 -0.0421 0.0675  0.0549  78   GLY A CA  
604  C  C   . GLY A 78  ? 0.3920 0.3530 0.3225 -0.0705 0.0719  0.0512  78   GLY A C   
605  O  O   . GLY A 78  ? 0.4678 0.3679 0.3934 -0.0991 0.0629  0.0553  78   GLY A O   
606  N  N   . ALA A 79  ? 0.3591 0.3672 0.3123 -0.0295 0.0737  0.0267  79   ALA A N   
607  C  CA  . ALA A 79  ? 0.3190 0.3937 0.3087 -0.0407 0.0744  0.0180  79   ALA A CA  
608  C  C   . ALA A 79  ? 0.2999 0.3362 0.2827 -0.0286 0.0508  0.0368  79   ALA A C   
609  O  O   . ALA A 79  ? 0.3266 0.3211 0.2767 -0.0366 0.0750  0.0275  79   ALA A O   
610  C  CB  . ALA A 79  ? 0.3237 0.3858 0.3305 -0.0006 0.0692  0.0067  79   ALA A CB  
611  N  N   . ILE A 80  ? 0.3078 0.3445 0.2604 -0.0392 0.0457  0.0073  80   ILE A N   
612  C  CA  . ILE A 80  ? 0.3092 0.3383 0.2963 -0.0448 0.0600  0.0350  80   ILE A CA  
613  C  C   . ILE A 80  ? 0.2972 0.3861 0.3035 -0.0276 0.0510  0.0063  80   ILE A C   
614  O  O   . ILE A 80  ? 0.2770 0.4320 0.3162 -0.0479 0.0589  0.0003  80   ILE A O   
615  C  CB  . ILE A 80  ? 0.3549 0.3465 0.3588 -0.0405 0.0454  0.0117  80   ILE A CB  
616  C  CG1 . ILE A 80  ? 0.4419 0.4210 0.3626 -0.0224 0.0527  0.0306  80   ILE A CG1 
617  C  CG2 . ILE A 80  ? 0.4026 0.3212 0.3589 -0.0075 0.0373  0.0343  80   ILE A CG2 
618  C  CD1 . ILE A 80  ? 0.5740 0.4422 0.4649 -0.0385 0.0906  0.0094  80   ILE A CD1 
619  N  N   . LYS A 81  ? 0.2984 0.3430 0.3099 -0.0330 0.0382  0.0106  81   LYS A N   
620  C  CA  . LYS A 81  ? 0.3132 0.3564 0.3019 -0.0135 0.0610  0.0167  81   LYS A CA  
621  C  C   . LYS A 81  ? 0.2900 0.3413 0.2952 -0.0192 0.0426  -0.0051 81   LYS A C   
622  O  O   . LYS A 81  ? 0.2937 0.3123 0.2959 -0.0133 0.0292  -0.0162 81   LYS A O   
623  C  CB  . LYS A 81  ? 0.3479 0.3898 0.3246 0.0006  0.0540  -0.0266 81   LYS A CB  
624  C  CG  . LYS A 81  ? 0.3192 0.4287 0.4070 0.0060  0.0571  -0.0069 81   LYS A CG  
625  C  CD  . LYS A 81  ? 0.4753 0.4540 0.5305 0.0166  0.0703  0.0285  81   LYS A CD  
626  C  CE  . LYS A 81  ? 0.4927 0.4200 0.4929 0.0332  0.0440  0.0444  81   LYS A CE  
627  N  NZ  . LYS A 81  ? 0.3290 0.3610 0.3293 0.0469  0.0067  0.0026  81   LYS A NZ  
628  N  N   . ARG A 82  ? 0.2626 0.3879 0.2936 -0.0119 0.0461  -0.0021 82   ARG A N   
629  C  CA  . ARG A 82  ? 0.2614 0.3452 0.2856 -0.0293 0.0531  0.0033  82   ARG A CA  
630  C  C   . ARG A 82  ? 0.2650 0.3592 0.2627 0.0000  0.0330  -0.0223 82   ARG A C   
631  O  O   . ARG A 82  ? 0.2868 0.4352 0.3697 0.0260  0.0501  -0.0023 82   ARG A O   
632  C  CB  . ARG A 82  ? 0.3391 0.3758 0.3127 -0.0366 0.0380  -0.0103 82   ARG A CB  
633  C  CG  . ARG A 82  ? 0.4581 0.4259 0.4229 0.0257  0.0536  -0.0032 82   ARG A CG  
634  C  CD  . ARG A 82  ? 0.5612 0.5976 0.6092 -0.1482 0.0672  -0.0122 82   ARG A CD  
635  N  NE  . ARG A 82  ? 0.7565 0.6696 0.7252 -0.1069 0.0515  0.0383  82   ARG A NE  
636  C  CZ  . ARG A 82  ? 0.7862 0.7591 0.7401 -0.1485 0.0751  0.0242  82   ARG A CZ  
637  N  NH1 . ARG A 82  ? 0.7493 0.8601 0.8027 -0.1414 0.1038  0.0320  82   ARG A NH1 
638  N  NH2 . ARG A 82  ? 0.8353 0.7534 0.7584 -0.1492 0.0568  0.0307  82   ARG A NH2 
639  N  N   . GLY A 83  ? 0.2260 0.3213 0.2898 0.0004  0.0315  -0.0015 83   GLY A N   
640  C  CA  . GLY A 83  ? 0.2346 0.3171 0.2294 0.0150  0.0589  -0.0016 83   GLY A CA  
641  C  C   . GLY A 83  ? 0.2651 0.3331 0.2710 0.0240  0.0334  -0.0142 83   GLY A C   
642  O  O   . GLY A 83  ? 0.2882 0.3129 0.2634 0.0165  0.0292  -0.0177 83   GLY A O   
643  N  N   . THR A 84  ? 0.2621 0.2959 0.2461 0.0066  0.0318  -0.0043 84   THR A N   
644  C  CA  A THR A 84  ? 0.2677 0.3121 0.2913 0.0056  0.0348  -0.0138 84   THR A CA  
645  C  CA  B THR A 84  ? 0.2810 0.3224 0.2975 0.0021  0.0388  -0.0137 84   THR A CA  
646  C  C   . THR A 84  ? 0.2721 0.2595 0.2902 0.0035  0.0582  -0.0130 84   THR A C   
647  O  O   . THR A 84  ? 0.3171 0.3033 0.3618 0.0370  0.0584  -0.0175 84   THR A O   
648  C  CB  A THR A 84  ? 0.2915 0.3391 0.3075 0.0120  0.0201  -0.0072 84   THR A CB  
649  C  CB  B THR A 84  ? 0.3098 0.3621 0.3343 0.0213  0.0114  0.0024  84   THR A CB  
650  O  OG1 A THR A 84  ? 0.3068 0.4053 0.3627 0.0803  0.0095  0.0068  84   THR A OG1 
651  O  OG1 B THR A 84  ? 0.2874 0.4649 0.3884 -0.0056 0.0238  -0.0512 84   THR A OG1 
652  C  CG2 A THR A 84  ? 0.3110 0.3890 0.3355 -0.0203 -0.0462 -0.0350 84   THR A CG2 
653  C  CG2 B THR A 84  ? 0.3549 0.3541 0.3514 0.0165  0.0368  0.0234  84   THR A CG2 
654  N  N   . LEU A 85  ? 0.2761 0.2431 0.2804 0.0231  0.0402  -0.0217 85   LEU A N   
655  C  CA  . LEU A 85  ? 0.3238 0.2176 0.2664 0.0140  0.0306  0.0076  85   LEU A CA  
656  C  C   . LEU A 85  ? 0.3580 0.2367 0.2652 0.0259  0.0149  -0.0077 85   LEU A C   
657  O  O   . LEU A 85  ? 0.4485 0.2985 0.3418 -0.0081 -0.0088 -0.0046 85   LEU A O   
658  C  CB  . LEU A 85  ? 0.3170 0.2335 0.2802 -0.0017 0.0441  -0.0018 85   LEU A CB  
659  C  CG  . LEU A 85  ? 0.2900 0.2854 0.2952 0.0045  0.0169  0.0059  85   LEU A CG  
660  C  CD1 . LEU A 85  ? 0.3132 0.2888 0.3951 0.0104  0.0404  -0.0368 85   LEU A CD1 
661  C  CD2 . LEU A 85  ? 0.3002 0.2705 0.2971 0.0279  0.0505  -0.0292 85   LEU A CD2 
662  N  N   . MET A 86  ? 0.2846 0.2825 0.2503 -0.0173 0.0154  -0.0216 86   MET A N   
663  C  CA  . MET A 86  ? 0.2959 0.3116 0.2549 0.0006  0.0109  -0.0206 86   MET A CA  
664  C  C   . MET A 86  ? 0.2578 0.2105 0.2425 0.0209  0.0033  -0.0327 86   MET A C   
665  O  O   . MET A 86  ? 0.2538 0.2282 0.2340 0.0115  -0.0031 -0.0266 86   MET A O   
666  C  CB  . MET A 86  ? 0.2938 0.3618 0.2915 0.0403  -0.0007 0.0132  86   MET A CB  
667  C  CG  . MET A 86  ? 0.3764 0.5012 0.5202 0.0046  0.0227  0.0441  86   MET A CG  
668  S  SD  . MET A 86  ? 0.7017 0.7659 0.6848 -0.1050 -0.0667 -0.0001 86   MET A SD  
669  C  CE  . MET A 86  ? 0.7131 0.7896 0.7013 0.0142  0.0257  0.0112  86   MET A CE  
670  N  N   . PRO A 87  ? 0.2371 0.2238 0.2246 0.0118  0.0019  -0.0216 87   PRO A N   
671  C  CA  . PRO A 87  ? 0.2274 0.1789 0.1955 0.0152  0.0168  -0.0110 87   PRO A CA  
672  C  C   . PRO A 87  ? 0.2506 0.2102 0.2147 0.0259  0.0180  -0.0161 87   PRO A C   
673  O  O   . PRO A 87  ? 0.2501 0.2351 0.2449 0.0329  0.0100  -0.0195 87   PRO A O   
674  C  CB  . PRO A 87  ? 0.2768 0.2260 0.2304 0.0274  0.0110  -0.0202 87   PRO A CB  
675  C  CG  . PRO A 87  ? 0.2555 0.2201 0.2242 0.0480  0.0073  -0.0232 87   PRO A CG  
676  C  CD  . PRO A 87  ? 0.2726 0.2799 0.2174 0.0017  0.0030  -0.0381 87   PRO A CD  
677  N  N   . MET A 88  ? 0.2353 0.2044 0.2287 0.0365  0.0130  -0.0149 88   MET A N   
678  C  CA  . MET A 88  ? 0.2499 0.2044 0.2341 0.0282  0.0170  -0.0036 88   MET A CA  
679  C  C   . MET A 88  ? 0.2594 0.2065 0.2506 0.0270  0.0060  -0.0126 88   MET A C   
680  O  O   . MET A 88  ? 0.2401 0.1952 0.2413 0.0410  0.0179  -0.0040 88   MET A O   
681  C  CB  . MET A 88  ? 0.2761 0.2025 0.2613 0.0214  0.0012  -0.0181 88   MET A CB  
682  C  CG  . MET A 88  ? 0.2679 0.2401 0.2638 -0.0136 0.0075  -0.0332 88   MET A CG  
683  S  SD  . MET A 88  ? 0.3384 0.2990 0.2781 0.0158  0.0342  -0.0163 88   MET A SD  
684  C  CE  . MET A 88  ? 0.3677 0.2918 0.2003 -0.0032 0.0082  0.0218  88   MET A CE  
685  N  N   . VAL A 89  ? 0.2627 0.2013 0.2576 0.0360  0.0226  -0.0079 89   VAL A N   
686  C  CA  . VAL A 89  ? 0.2408 0.2013 0.2705 0.0491  0.0124  -0.0156 89   VAL A CA  
687  C  C   . VAL A 89  ? 0.3001 0.2411 0.2773 0.0205  0.0050  -0.0092 89   VAL A C   
688  O  O   . VAL A 89  ? 0.2622 0.1998 0.2414 0.0262  0.0138  -0.0039 89   VAL A O   
689  C  CB  . VAL A 89  ? 0.2604 0.2035 0.2677 0.0560  0.0173  -0.0139 89   VAL A CB  
690  C  CG1 . VAL A 89  ? 0.3194 0.2071 0.2914 0.0466  0.0162  0.0157  89   VAL A CG1 
691  C  CG2 . VAL A 89  ? 0.2496 0.1952 0.3168 0.0244  0.0770  -0.0188 89   VAL A CG2 
692  N  N   . ALA A 90  ? 0.2925 0.2607 0.3141 0.0238  0.0061  -0.0084 90   ALA A N   
693  C  CA  . ALA A 90  ? 0.3078 0.2415 0.2909 0.0030  0.0205  0.0018  90   ALA A CA  
694  C  C   . ALA A 90  ? 0.3141 0.1867 0.2590 -0.0082 0.0325  0.0001  90   ALA A C   
695  O  O   . ALA A 90  ? 0.2826 0.1878 0.2689 -0.0100 0.0136  0.0073  90   ALA A O   
696  C  CB  . ALA A 90  ? 0.3316 0.2660 0.3094 -0.0116 0.0358  0.0408  90   ALA A CB  
697  N  N   . ASP A 91  ? 0.3516 0.2429 0.2830 -0.0133 0.0140  -0.0092 91   ASP A N   
698  C  CA  . ASP A 91  ? 0.3429 0.2592 0.3025 -0.0183 0.0150  -0.0095 91   ASP A CA  
699  C  C   . ASP A 91  ? 0.3384 0.2928 0.3071 -0.0322 -0.0063 -0.0092 91   ASP A C   
700  O  O   . ASP A 91  ? 0.3339 0.3334 0.3169 -0.0266 0.0051  -0.0193 91   ASP A O   
701  C  CB  . ASP A 91  ? 0.4064 0.2670 0.3651 -0.0599 0.0119  -0.0214 91   ASP A CB  
702  C  CG  . ASP A 91  ? 0.4859 0.4620 0.4023 -0.0704 -0.0073 0.0023  91   ASP A CG  
703  O  OD1 . ASP A 91  ? 0.5627 0.4636 0.4288 0.0186  -0.0562 -0.0166 91   ASP A OD1 
704  O  OD2 . ASP A 91  ? 0.6813 0.5732 0.5553 -0.0955 -0.0072 -0.1209 91   ASP A OD2 
705  N  N   . ASP A 92  ? 0.2961 0.3092 0.3383 -0.0310 -0.0191 -0.0157 92   ASP A N   
706  C  CA  . ASP A 92  ? 0.3475 0.3327 0.3501 -0.0056 -0.0109 -0.0244 92   ASP A CA  
707  C  C   . ASP A 92  ? 0.3251 0.2991 0.3254 0.0021  -0.0206 0.0097  92   ASP A C   
708  O  O   . ASP A 92  ? 0.3430 0.3413 0.3474 0.0458  -0.0292 0.0188  92   ASP A O   
709  C  CB  . ASP A 92  ? 0.3858 0.3692 0.3867 0.0129  -0.0196 0.0205  92   ASP A CB  
710  C  CG  . ASP A 92  ? 0.4138 0.4497 0.4182 -0.0042 0.0312  -0.0193 92   ASP A CG  
711  O  OD1 . ASP A 92  ? 0.4362 0.4312 0.3743 0.0335  0.0640  0.0462  92   ASP A OD1 
712  O  OD2 . ASP A 92  ? 0.5260 0.5956 0.5660 0.0434  -0.0594 0.0323  92   ASP A OD2 
713  N  N   . GLY A 93  ? 0.2803 0.2207 0.2838 0.0054  0.0114  0.0063  93   GLY A N   
714  C  CA  . GLY A 93  ? 0.2723 0.2552 0.2836 0.0146  0.0179  0.0111  93   GLY A CA  
715  C  C   . GLY A 93  ? 0.2686 0.2107 0.2605 0.0333  0.0098  0.0177  93   GLY A C   
716  O  O   . GLY A 93  ? 0.2529 0.1916 0.2524 -0.0055 0.0224  0.0243  93   GLY A O   
717  N  N   . PRO A 94  ? 0.2629 0.2082 0.2439 0.0276  0.0134  0.0151  94   PRO A N   
718  C  CA  . PRO A 94  ? 0.2493 0.2164 0.2406 0.0252  0.0237  0.0217  94   PRO A CA  
719  C  C   . PRO A 94  ? 0.2535 0.2075 0.2923 0.0228  0.0330  0.0180  94   PRO A C   
720  O  O   . PRO A 94  ? 0.2560 0.2217 0.2812 0.0158  0.0077  0.0193  94   PRO A O   
721  C  CB  . PRO A 94  ? 0.2652 0.2164 0.2485 0.0219  -0.0119 0.0060  94   PRO A CB  
722  C  CG  . PRO A 94  ? 0.2630 0.2022 0.2209 0.0301  0.0175  0.0170  94   PRO A CG  
723  C  CD  . PRO A 94  ? 0.2829 0.2313 0.2687 0.0116  0.0320  0.0036  94   PRO A CD  
724  N  N   . HIS A 95  ? 0.2516 0.2556 0.2776 0.0178  0.0250  0.0206  95   HIS A N   
725  C  CA  . HIS A 95  ? 0.2505 0.2052 0.2621 0.0265  0.0169  0.0049  95   HIS A CA  
726  C  C   . HIS A 95  ? 0.2450 0.2162 0.2378 0.0244  0.0189  0.0018  95   HIS A C   
727  O  O   . HIS A 95  ? 0.2484 0.2190 0.2689 0.0243  0.0151  0.0108  95   HIS A O   
728  C  CB  . HIS A 95  ? 0.2957 0.2715 0.2865 0.0054  -0.0094 0.0022  95   HIS A CB  
729  C  CG  . HIS A 95  ? 0.3385 0.2505 0.2609 0.0337  0.0016  -0.0054 95   HIS A CG  
730  N  ND1 . HIS A 95  ? 0.5250 0.3286 0.4272 -0.0177 0.0146  -0.0749 95   HIS A ND1 
731  C  CD2 . HIS A 95  ? 0.3661 0.2995 0.3676 0.0117  0.0179  -0.0353 95   HIS A CD2 
732  C  CE1 . HIS A 95  ? 0.4193 0.2417 0.4126 0.0519  -0.0361 -0.0133 95   HIS A CE1 
733  N  NE2 . HIS A 95  ? 0.3822 0.3233 0.3467 0.0352  -0.0175 -0.0317 95   HIS A NE2 
734  N  N   . TYR A 96  ? 0.2258 0.1767 0.2318 0.0315  0.0141  -0.0045 96   TYR A N   
735  C  CA  . TYR A 96  ? 0.2178 0.1183 0.1689 0.0075  0.0311  -0.0012 96   TYR A CA  
736  C  C   . TYR A 96  ? 0.2408 0.1790 0.2120 0.0096  0.0204  -0.0055 96   TYR A C   
737  O  O   . TYR A 96  ? 0.2482 0.2550 0.2285 0.0129  0.0048  -0.0026 96   TYR A O   
738  C  CB  . TYR A 96  ? 0.2419 0.1358 0.1915 -0.0005 0.0337  -0.0080 96   TYR A CB  
739  C  CG  . TYR A 96  ? 0.2467 0.1533 0.2072 -0.0072 0.0307  -0.0113 96   TYR A CG  
740  C  CD1 . TYR A 96  ? 0.2723 0.1597 0.2169 -0.0225 0.0105  -0.0061 96   TYR A CD1 
741  C  CD2 . TYR A 96  ? 0.2408 0.1728 0.2000 0.0119  0.0451  -0.0096 96   TYR A CD2 
742  C  CE1 . TYR A 96  ? 0.2690 0.2009 0.1998 0.0329  0.0308  -0.0087 96   TYR A CE1 
743  C  CE2 . TYR A 96  ? 0.2661 0.1675 0.2013 -0.0116 0.0338  0.0208  96   TYR A CE2 
744  C  CZ  . TYR A 96  ? 0.2656 0.1971 0.1941 -0.0043 0.0413  0.0227  96   TYR A CZ  
745  O  OH  . TYR A 96  ? 0.2799 0.1587 0.1929 0.0064  0.0364  -0.0100 96   TYR A OH  
746  N  N   . GLY A 97  ? 0.2383 0.2070 0.2111 0.0103  0.0053  -0.0171 97   GLY A N   
747  C  CA  . GLY A 97  ? 0.2373 0.2176 0.2267 0.0193  0.0046  -0.0275 97   GLY A CA  
748  C  C   . GLY A 97  ? 0.2210 0.1940 0.2154 -0.0007 0.0093  -0.0195 97   GLY A C   
749  O  O   . GLY A 97  ? 0.2522 0.2125 0.2214 0.0034  0.0013  -0.0099 97   GLY A O   
750  N  N   . ALA A 98  ? 0.2463 0.2526 0.2320 -0.0135 0.0071  -0.0186 98   ALA A N   
751  C  CA  . ALA A 98  ? 0.2323 0.2183 0.2039 0.0172  0.0099  -0.0269 98   ALA A CA  
752  C  C   . ALA A 98  ? 0.2589 0.2270 0.2391 0.0042  -0.0002 -0.0271 98   ALA A C   
753  O  O   . ALA A 98  ? 0.2376 0.2520 0.2353 0.0157  0.0090  -0.0373 98   ALA A O   
754  C  CB  . ALA A 98  ? 0.2768 0.2706 0.2615 -0.0376 0.0228  -0.0436 98   ALA A CB  
755  N  N   . ASN A 99  ? 0.2558 0.2454 0.2315 0.0195  -0.0053 -0.0238 99   ASN A N   
756  C  CA  . ASN A 99  ? 0.2453 0.2362 0.2157 0.0221  0.0098  -0.0344 99   ASN A CA  
757  C  C   . ASN A 99  ? 0.2678 0.2425 0.2298 0.0119  0.0148  -0.0572 99   ASN A C   
758  O  O   . ASN A 99  ? 0.3072 0.3551 0.3069 -0.0136 -0.0130 -0.0486 99   ASN A O   
759  C  CB  . ASN A 99  ? 0.2373 0.2215 0.2154 0.0228  0.0197  -0.0431 99   ASN A CB  
760  C  CG  . ASN A 99  ? 0.2653 0.2480 0.2200 0.0063  -0.0027 -0.0165 99   ASN A CG  
761  O  OD1 . ASN A 99  ? 0.2608 0.2402 0.2512 0.0188  0.0163  -0.0022 99   ASN A OD1 
762  N  ND2 . ASN A 99  ? 0.2890 0.2963 0.3196 0.0287  0.0065  -0.0068 99   ASN A ND2 
763  N  N   . ILE A 100 ? 0.2542 0.2375 0.2375 -0.0034 0.0041  -0.0224 100  ILE A N   
764  C  CA  . ILE A 100 ? 0.2633 0.2490 0.2160 -0.0020 -0.0020 -0.0236 100  ILE A CA  
765  C  C   . ILE A 100 ? 0.2583 0.2732 0.2458 0.0090  0.0096  -0.0238 100  ILE A C   
766  O  O   . ILE A 100 ? 0.2516 0.2266 0.2615 0.0099  -0.0040 -0.0331 100  ILE A O   
767  C  CB  . ILE A 100 ? 0.2928 0.2540 0.2521 -0.0034 0.0330  -0.0066 100  ILE A CB  
768  C  CG1 . ILE A 100 ? 0.3352 0.2705 0.2639 -0.0066 0.0436  -0.0082 100  ILE A CG1 
769  C  CG2 . ILE A 100 ? 0.3101 0.2542 0.2505 0.0054  0.0248  0.0027  100  ILE A CG2 
770  C  CD1 . ILE A 100 ? 0.3882 0.3373 0.2479 0.0244  0.0182  -0.0877 100  ILE A CD1 
771  N  N   . ALA A 101 ? 0.2664 0.2740 0.2331 0.0151  0.0151  -0.0203 101  ALA A N   
772  C  CA  . ALA A 101 ? 0.2531 0.2444 0.2293 0.0136  0.0013  -0.0275 101  ALA A CA  
773  C  C   . ALA A 101 ? 0.2380 0.2216 0.1909 0.0054  0.0259  -0.0171 101  ALA A C   
774  O  O   . ALA A 101 ? 0.3260 0.3314 0.2424 -0.0018 0.0063  -0.0250 101  ALA A O   
775  C  CB  . ALA A 101 ? 0.2382 0.2765 0.2558 0.0201  0.0414  -0.0012 101  ALA A CB  
776  N  N   . MET A 102 ? 0.2612 0.2383 0.2322 0.0042  0.0038  -0.0096 102  MET A N   
777  C  CA  . MET A 102 ? 0.2815 0.2496 0.2334 0.0242  0.0173  -0.0089 102  MET A CA  
778  C  C   . MET A 102 ? 0.3018 0.2656 0.2379 0.0251  0.0293  -0.0205 102  MET A C   
779  O  O   . MET A 102 ? 0.3489 0.2990 0.2908 0.0115  0.0247  -0.0353 102  MET A O   
780  C  CB  . MET A 102 ? 0.2869 0.2359 0.2143 -0.0117 0.0123  -0.0003 102  MET A CB  
781  C  CG  . MET A 102 ? 0.2472 0.2103 0.2068 0.0418  0.0385  0.0205  102  MET A CG  
782  S  SD  . MET A 102 ? 0.3129 0.2946 0.2705 0.0236  0.0180  -0.0059 102  MET A SD  
783  C  CE  . MET A 102 ? 0.3570 0.3953 0.3072 0.0597  -0.0064 0.0119  102  MET A CE  
784  N  N   . GLU A 103 ? 0.3338 0.3251 0.2652 -0.0001 0.0200  -0.0215 103  GLU A N   
785  C  CA  . GLU A 103 ? 0.3646 0.3284 0.2939 0.0130  0.0287  -0.0264 103  GLU A CA  
786  C  C   . GLU A 103 ? 0.3876 0.3578 0.3221 0.0168  0.0429  -0.0202 103  GLU A C   
787  O  O   . GLU A 103 ? 0.4008 0.3483 0.3299 0.0011  0.0884  -0.0135 103  GLU A O   
788  C  CB  . GLU A 103 ? 0.4224 0.3781 0.2927 0.0081  0.0318  -0.0479 103  GLU A CB  
789  C  CG  . GLU A 103 ? 0.4335 0.4506 0.3407 0.0347  0.0377  -0.0516 103  GLU A CG  
790  C  CD  . GLU A 103 ? 0.4080 0.4086 0.3340 -0.0214 0.0098  -0.0140 103  GLU A CD  
791  O  OE1 . GLU A 103 ? 0.4015 0.3279 0.3305 0.0121  -0.0069 -0.0421 103  GLU A OE1 
792  O  OE2 . GLU A 103 ? 0.4077 0.5322 0.3439 0.0123  -0.0166 -0.0391 103  GLU A OE2 
793  N  N   . LYS A 104 ? 0.3633 0.3443 0.3019 0.0171  0.0121  -0.0094 104  LYS A N   
794  C  CA  . LYS A 104 ? 0.3860 0.3467 0.3429 0.0340  0.0229  -0.0113 104  LYS A CA  
795  C  C   . LYS A 104 ? 0.3601 0.3499 0.3305 0.0344  0.0315  -0.0013 104  LYS A C   
796  O  O   . LYS A 104 ? 0.3948 0.3735 0.3904 0.0264  0.0130  -0.0026 104  LYS A O   
797  C  CB  . LYS A 104 ? 0.4334 0.3819 0.3351 0.0424  -0.0142 0.0087  104  LYS A CB  
798  C  CG  . LYS A 104 ? 0.4816 0.4120 0.4026 0.0055  -0.0127 -0.0400 104  LYS A CG  
799  C  CD  . LYS A 104 ? 0.6068 0.4443 0.4540 0.0602  -0.0282 -0.0132 104  LYS A CD  
800  C  CE  . LYS A 104 ? 0.6333 0.5586 0.5332 0.0742  0.0225  -0.0034 104  LYS A CE  
801  N  NZ  . LYS A 104 ? 0.8003 0.5605 0.5594 0.1051  0.0279  -0.0745 104  LYS A NZ  
802  N  N   . ASP A 105 ? 0.3033 0.3318 0.2876 0.0144  0.0544  -0.0146 105  ASP A N   
803  C  CA  . ASP A 105 ? 0.3062 0.3449 0.2779 0.0124  0.0424  -0.0206 105  ASP A CA  
804  C  C   . ASP A 105 ? 0.2855 0.3501 0.2754 0.0056  0.0215  0.0002  105  ASP A C   
805  O  O   . ASP A 105 ? 0.3103 0.3653 0.2879 0.0111  0.0464  0.0129  105  ASP A O   
806  C  CB  . ASP A 105 ? 0.3135 0.3488 0.2924 0.0076  0.0666  0.0037  105  ASP A CB  
807  C  CG  . ASP A 105 ? 0.3684 0.4765 0.3769 -0.0273 0.0292  -0.0457 105  ASP A CG  
808  O  OD1 . ASP A 105 ? 0.4208 0.4675 0.3837 -0.0596 0.0827  -0.0367 105  ASP A OD1 
809  O  OD2 . ASP A 105 ? 0.3696 0.5410 0.3782 -0.0577 0.0719  -0.0168 105  ASP A OD2 
810  N  N   . LYS A 106 ? 0.2983 0.3226 0.3123 0.0226  0.0698  0.0590  106  LYS A N   
811  C  CA  . LYS A 106 ? 0.3148 0.3327 0.3264 0.0174  0.0777  0.0413  106  LYS A CA  
812  C  C   . LYS A 106 ? 0.3202 0.3245 0.3710 0.0219  0.0747  0.0390  106  LYS A C   
813  O  O   . LYS A 106 ? 0.3554 0.3301 0.3889 0.0097  0.1121  0.0350  106  LYS A O   
814  C  CB  . LYS A 106 ? 0.3449 0.3425 0.3688 0.0423  0.0779  0.0648  106  LYS A CB  
815  C  CG  . LYS A 106 ? 0.3689 0.3824 0.4198 0.0035  0.0391  0.0230  106  LYS A CG  
816  C  CD  . LYS A 106 ? 0.4191 0.4835 0.5751 0.0797  0.0296  0.0022  106  LYS A CD  
817  C  CE  . LYS A 106 ? 0.4642 0.5895 0.6109 0.0751  -0.0427 0.0183  106  LYS A CE  
818  N  NZ  . LYS A 106 ? 0.4836 0.6206 0.6820 0.0914  -0.0519 -0.0449 106  LYS A NZ  
819  N  N   . LYS A 107 ? 0.3074 0.3534 0.3903 0.0064  0.0349  0.0218  107  LYS A N   
820  C  CA  . LYS A 107 ? 0.3532 0.3729 0.4487 0.0074  0.0616  0.0258  107  LYS A CA  
821  C  C   . LYS A 107 ? 0.3707 0.3307 0.4165 0.0086  0.0694  0.0333  107  LYS A C   
822  O  O   . LYS A 107 ? 0.3785 0.3330 0.4225 0.0249  0.0648  0.0463  107  LYS A O   
823  C  CB  . LYS A 107 ? 0.3988 0.3847 0.4892 -0.0011 0.0517  -0.0116 107  LYS A CB  
824  C  CG  . LYS A 107 ? 0.3925 0.5637 0.6355 0.0333  0.0032  -0.0072 107  LYS A CG  
825  C  CD  . LYS A 107 ? 0.5738 0.6491 0.6905 0.0477  -0.0085 -0.0667 107  LYS A CD  
826  C  CE  . LYS A 107 ? 0.6452 0.7051 0.8889 -0.0181 -0.0038 -0.0333 107  LYS A CE  
827  N  NZ  . LYS A 107 ? 0.6804 0.7362 0.8946 0.0728  0.0053  -0.0114 107  LYS A NZ  
828  N  N   . GLY A 108 ? 0.3776 0.3472 0.3825 0.0147  0.0605  0.0305  108  GLY A N   
829  C  CA  . GLY A 108 ? 0.4000 0.3528 0.3414 0.0241  0.0705  0.0373  108  GLY A CA  
830  C  C   . GLY A 108 ? 0.4054 0.3153 0.3546 0.0069  0.0593  0.0347  108  GLY A C   
831  O  O   . GLY A 108 ? 0.3258 0.3179 0.3481 0.0041  0.0656  0.0168  108  GLY A O   
832  N  N   . GLY A 109 ? 0.4110 0.3295 0.3323 0.0122  0.0712  0.0426  109  GLY A N   
833  C  CA  . GLY A 109 ? 0.4052 0.3073 0.3508 -0.0019 0.0662  0.0470  109  GLY A CA  
834  C  C   . GLY A 109 ? 0.3647 0.3034 0.3135 0.0142  0.0490  0.0462  109  GLY A C   
835  O  O   . GLY A 109 ? 0.4005 0.2637 0.3092 0.0130  0.0662  0.0481  109  GLY A O   
836  N  N   . PHE A 110 ? 0.3304 0.2835 0.2718 0.0112  0.0274  0.0157  110  PHE A N   
837  C  CA  . PHE A 110 ? 0.3478 0.2855 0.2567 0.0299  0.0206  0.0250  110  PHE A CA  
838  C  C   . PHE A 110 ? 0.3425 0.2840 0.2559 0.0287  0.0255  0.0308  110  PHE A C   
839  O  O   . PHE A 110 ? 0.3830 0.3121 0.2928 0.0174  0.0051  0.0369  110  PHE A O   
840  C  CB  . PHE A 110 ? 0.3331 0.3138 0.2775 0.0264  0.0146  0.0279  110  PHE A CB  
841  C  CG  . PHE A 110 ? 0.3685 0.3430 0.2711 -0.0046 0.0203  0.0114  110  PHE A CG  
842  C  CD1 . PHE A 110 ? 0.4143 0.3533 0.3530 0.0211  -0.0061 0.0022  110  PHE A CD1 
843  C  CD2 . PHE A 110 ? 0.3604 0.3897 0.3370 0.0155  0.0023  0.0159  110  PHE A CD2 
844  C  CE1 . PHE A 110 ? 0.4225 0.3779 0.3461 -0.0095 0.0206  -0.0440 110  PHE A CE1 
845  C  CE2 . PHE A 110 ? 0.3459 0.3685 0.4096 -0.0146 0.0884  -0.0101 110  PHE A CE2 
846  C  CZ  . PHE A 110 ? 0.4151 0.3656 0.3628 -0.0003 0.0358  -0.0518 110  PHE A CZ  
847  N  N   . GLY A 111 ? 0.3862 0.3138 0.2819 0.0427  0.0040  0.0132  111  GLY A N   
848  C  CA  . GLY A 111 ? 0.4283 0.3429 0.3040 0.0013  -0.0036 0.0125  111  GLY A CA  
849  C  C   . GLY A 111 ? 0.4292 0.3502 0.2966 0.0032  0.0008  0.0210  111  GLY A C   
850  O  O   . GLY A 111 ? 0.4099 0.3376 0.2517 -0.0144 0.0141  0.0349  111  GLY A O   
851  N  N   . VAL A 112 ? 0.4620 0.3734 0.2590 0.0069  -0.0063 0.0224  112  VAL A N   
852  C  CA  . VAL A 112 ? 0.4740 0.3957 0.3102 0.0110  -0.0413 0.0303  112  VAL A CA  
853  C  C   . VAL A 112 ? 0.4436 0.3875 0.2852 0.0244  -0.0427 0.0329  112  VAL A C   
854  O  O   . VAL A 112 ? 0.4767 0.3875 0.2926 0.0545  -0.0187 0.0356  112  VAL A O   
855  C  CB  . VAL A 112 ? 0.5333 0.4271 0.3913 0.0010  -0.0602 0.0086  112  VAL A CB  
856  C  CG1 . VAL A 112 ? 0.5820 0.5548 0.5036 0.0280  -0.1254 0.0042  112  VAL A CG1 
857  C  CG2 . VAL A 112 ? 0.5404 0.4357 0.3662 -0.0132 -0.0471 0.0222  112  VAL A CG2 
858  N  N   . GLY A 113 ? 0.4220 0.3622 0.2984 0.0088  -0.0337 0.0447  113  GLY A N   
859  C  CA  . GLY A 113 ? 0.4314 0.3749 0.2910 0.0271  -0.0331 0.0421  113  GLY A CA  
860  C  C   . GLY A 113 ? 0.4104 0.3548 0.2681 0.0232  -0.0545 0.0397  113  GLY A C   
861  O  O   . GLY A 113 ? 0.4160 0.3574 0.3020 0.0012  -0.0500 0.0415  113  GLY A O   
862  N  N   . ASN A 114 ? 0.4222 0.3551 0.2798 0.0217  -0.0443 0.0497  114  ASN A N   
863  C  CA  . ASN A 114 ? 0.3816 0.3344 0.2983 0.0278  -0.0448 0.0421  114  ASN A CA  
864  C  C   . ASN A 114 ? 0.3681 0.2996 0.2649 0.0211  -0.0199 0.0455  114  ASN A C   
865  O  O   . ASN A 114 ? 0.3706 0.3087 0.2891 0.0094  -0.0004 0.0321  114  ASN A O   
866  C  CB  . ASN A 114 ? 0.4314 0.3550 0.3313 0.0399  -0.0282 0.0509  114  ASN A CB  
867  C  CG  . ASN A 114 ? 0.4954 0.3453 0.3581 0.0611  -0.0794 0.0839  114  ASN A CG  
868  O  OD1 . ASN A 114 ? 0.4582 0.6140 0.4294 0.0483  -0.0269 0.0308  114  ASN A OD1 
869  N  ND2 . ASN A 114 ? 0.6355 0.5197 0.3638 -0.0049 -0.0324 0.0881  114  ASN A ND2 
870  N  N   . TYR A 115 ? 0.3353 0.2667 0.2630 0.0280  -0.0118 0.0503  115  TYR A N   
871  C  CA  . TYR A 115 ? 0.3181 0.2763 0.2628 0.0098  -0.0075 0.0255  115  TYR A CA  
872  C  C   . TYR A 115 ? 0.3401 0.2742 0.2711 0.0217  -0.0084 0.0394  115  TYR A C   
873  O  O   . TYR A 115 ? 0.3181 0.3186 0.2726 0.0180  0.0065  0.0248  115  TYR A O   
874  C  CB  . TYR A 115 ? 0.3089 0.3070 0.2544 0.0068  -0.0146 0.0372  115  TYR A CB  
875  C  CG  . TYR A 115 ? 0.3064 0.2588 0.2681 0.0020  -0.0179 0.0191  115  TYR A CG  
876  C  CD1 . TYR A 115 ? 0.3004 0.3104 0.2386 0.0272  -0.0162 0.0238  115  TYR A CD1 
877  C  CD2 . TYR A 115 ? 0.3229 0.2667 0.2426 -0.0073 -0.0162 0.0127  115  TYR A CD2 
878  C  CE1 . TYR A 115 ? 0.3370 0.3096 0.2625 0.0183  0.0244  -0.0024 115  TYR A CE1 
879  C  CE2 . TYR A 115 ? 0.2911 0.2805 0.2718 -0.0151 -0.0090 -0.0064 115  TYR A CE2 
880  C  CZ  . TYR A 115 ? 0.3779 0.3111 0.2414 0.0368  -0.0243 0.0256  115  TYR A CZ  
881  O  OH  . TYR A 115 ? 0.3493 0.3450 0.2935 0.0095  0.0154  0.0080  115  TYR A OH  
882  N  N   . GLU A 116 ? 0.3318 0.2944 0.2905 -0.0006 0.0079  0.0273  116  GLU A N   
883  C  CA  . GLU A 116 ? 0.3311 0.2465 0.2809 0.0225  -0.0060 0.0231  116  GLU A CA  
884  C  C   . GLU A 116 ? 0.3208 0.2755 0.2685 0.0027  -0.0163 0.0198  116  GLU A C   
885  O  O   . GLU A 116 ? 0.3231 0.2963 0.2843 0.0353  0.0002  0.0214  116  GLU A O   
886  C  CB  . GLU A 116 ? 0.3409 0.2638 0.3079 0.0000  0.0098  0.0232  116  GLU A CB  
887  C  CG  . GLU A 116 ? 0.4160 0.3822 0.4194 0.0656  -0.0043 0.0451  116  GLU A CG  
888  C  CD  . GLU A 116 ? 0.5662 0.4146 0.5931 0.0039  0.0119  0.0401  116  GLU A CD  
889  O  OE1 . GLU A 116 ? 0.5657 0.4132 0.5194 -0.0063 0.0531  0.0010  116  GLU A OE1 
890  O  OE2 . GLU A 116 ? 0.7252 0.5293 0.7272 0.1201  0.0280  0.0905  116  GLU A OE2 
891  N  N   . LEU A 117 ? 0.2835 0.3728 0.2769 0.0164  0.0252  0.0194  117  LEU A N   
892  C  CA  . LEU A 117 ? 0.2544 0.3294 0.2436 0.0051  0.0309  0.0156  117  LEU A CA  
893  C  C   . LEU A 117 ? 0.2868 0.3241 0.2813 0.0016  0.0216  0.0051  117  LEU A C   
894  O  O   . LEU A 117 ? 0.3044 0.3360 0.2971 0.0405  0.0231  -0.0020 117  LEU A O   
895  C  CB  . LEU A 117 ? 0.2783 0.3138 0.2398 0.0041  -0.0069 0.0045  117  LEU A CB  
896  C  CG  . LEU A 117 ? 0.2625 0.2783 0.2396 -0.0269 0.0199  -0.0149 117  LEU A CG  
897  C  CD1 . LEU A 117 ? 0.2780 0.2583 0.2634 0.0180  -0.0315 0.0395  117  LEU A CD1 
898  C  CD2 . LEU A 117 ? 0.2775 0.2929 0.2739 -0.0461 0.0366  0.0140  117  LEU A CD2 
899  N  N   . THR A 118 ? 0.2727 0.2681 0.2481 0.0048  0.0246  0.0135  118  THR A N   
900  C  CA  . THR A 118 ? 0.2714 0.2836 0.2460 0.0028  0.0290  0.0148  118  THR A CA  
901  C  C   . THR A 118 ? 0.2331 0.2506 0.2421 0.0039  0.0292  0.0036  118  THR A C   
902  O  O   . THR A 118 ? 0.2640 0.2862 0.2784 0.0129  0.0326  -0.0025 118  THR A O   
903  C  CB  . THR A 118 ? 0.3422 0.2818 0.2832 -0.0009 0.0232  0.0292  118  THR A CB  
904  O  OG1 . THR A 118 ? 0.3621 0.3285 0.3051 0.0060  0.0461  0.0553  118  THR A OG1 
905  C  CG2 . THR A 118 ? 0.3383 0.2662 0.3208 -0.0354 0.0444  0.0273  118  THR A CG2 
906  N  N   . PHE A 119 ? 0.2368 0.2489 0.2451 0.0137  0.0317  -0.0093 119  PHE A N   
907  C  CA  . PHE A 119 ? 0.2379 0.2358 0.2648 0.0061  0.0239  0.0028  119  PHE A CA  
908  C  C   . PHE A 119 ? 0.2425 0.2402 0.2672 0.0057  0.0228  -0.0130 119  PHE A C   
909  O  O   . PHE A 119 ? 0.2735 0.2675 0.2739 0.0167  0.0174  -0.0158 119  PHE A O   
910  C  CB  . PHE A 119 ? 0.2391 0.2893 0.2720 0.0026  0.0387  -0.0107 119  PHE A CB  
911  C  CG  . PHE A 119 ? 0.2629 0.2529 0.2832 0.0069  0.0336  -0.0083 119  PHE A CG  
912  C  CD1 . PHE A 119 ? 0.2868 0.2809 0.2762 -0.0011 0.0473  0.0047  119  PHE A CD1 
913  C  CD2 . PHE A 119 ? 0.2668 0.2707 0.2770 -0.0038 -0.0039 0.0097  119  PHE A CD2 
914  C  CE1 . PHE A 119 ? 0.2944 0.3140 0.2823 0.0132  0.0241  0.0126  119  PHE A CE1 
915  C  CE2 . PHE A 119 ? 0.2521 0.2697 0.2294 -0.0124 -0.0060 0.0011  119  PHE A CE2 
916  C  CZ  . PHE A 119 ? 0.2978 0.2734 0.2295 -0.0145 -0.0111 -0.0067 119  PHE A CZ  
917  N  N   . TYR A 120 ? 0.2461 0.2538 0.2703 0.0238  0.0234  -0.0055 120  TYR A N   
918  C  CA  . TYR A 120 ? 0.2588 0.2734 0.2960 -0.0117 0.0464  -0.0163 120  TYR A CA  
919  C  C   . TYR A 120 ? 0.2418 0.2648 0.2840 0.0116  0.0259  -0.0110 120  TYR A C   
920  O  O   . TYR A 120 ? 0.2744 0.2624 0.2881 0.0136  0.0412  -0.0004 120  TYR A O   
921  C  CB  . TYR A 120 ? 0.2746 0.3141 0.2892 -0.0282 0.0239  -0.0172 120  TYR A CB  
922  C  CG  . TYR A 120 ? 0.3025 0.3875 0.3618 -0.0375 0.0535  0.0238  120  TYR A CG  
923  C  CD1 . TYR A 120 ? 0.4525 0.4103 0.4395 -0.0511 0.0651  0.0344  120  TYR A CD1 
924  C  CD2 . TYR A 120 ? 0.4285 0.4021 0.3934 -0.0239 0.0181  -0.0045 120  TYR A CD2 
925  C  CE1 . TYR A 120 ? 0.4953 0.4738 0.4688 -0.0537 0.0757  0.0747  120  TYR A CE1 
926  C  CE2 . TYR A 120 ? 0.4742 0.4924 0.3928 -0.0276 0.0797  0.0183  120  TYR A CE2 
927  C  CZ  . TYR A 120 ? 0.4758 0.4871 0.4607 -0.0851 0.0365  0.0375  120  TYR A CZ  
928  O  OH  . TYR A 120 ? 0.5741 0.5927 0.5576 -0.1325 0.0559  0.1375  120  TYR A OH  
929  N  N   . ILE A 121 ? 0.2779 0.2428 0.2969 -0.0067 0.0417  -0.0140 121  ILE A N   
930  C  CA  . ILE A 121 ? 0.2712 0.2471 0.2857 0.0183  0.0178  -0.0010 121  ILE A CA  
931  C  C   . ILE A 121 ? 0.2557 0.2360 0.2976 -0.0016 0.0221  -0.0208 121  ILE A C   
932  O  O   . ILE A 121 ? 0.2805 0.1718 0.2897 -0.0027 0.0421  0.0003  121  ILE A O   
933  C  CB  . ILE A 121 ? 0.2629 0.2454 0.2964 -0.0035 0.0239  0.0093  121  ILE A CB  
934  C  CG1 . ILE A 121 ? 0.3016 0.2470 0.3276 0.0079  0.0110  -0.0072 121  ILE A CG1 
935  C  CG2 . ILE A 121 ? 0.2677 0.1986 0.2913 -0.0070 0.0425  -0.0126 121  ILE A CG2 
936  C  CD1 . ILE A 121 ? 0.2676 0.2822 0.2750 -0.0120 0.0376  -0.0291 121  ILE A CD1 
937  N  N   . SER A 122 ? 0.2476 0.1948 0.2616 -0.0017 0.0211  -0.0073 122  SER A N   
938  C  CA  . SER A 122 ? 0.2399 0.2206 0.2571 0.0074  0.0026  -0.0143 122  SER A CA  
939  C  C   . SER A 122 ? 0.2331 0.2146 0.2824 -0.0169 0.0113  -0.0301 122  SER A C   
940  O  O   . SER A 122 ? 0.2620 0.2261 0.2802 0.0026  0.0195  -0.0339 122  SER A O   
941  C  CB  . SER A 122 ? 0.2723 0.3137 0.3062 -0.0640 0.0025  -0.0342 122  SER A CB  
942  O  OG  . SER A 122 ? 0.3699 0.4648 0.4296 -0.0441 0.0461  0.0036  122  SER A OG  
943  N  N   . ASN A 123 ? 0.2465 0.2426 0.2810 -0.0138 0.0079  -0.0125 123  ASN A N   
944  C  CA  . ASN A 123 ? 0.2543 0.2257 0.2746 -0.0063 0.0110  -0.0133 123  ASN A CA  
945  C  C   . ASN A 123 ? 0.2296 0.2361 0.2812 0.0030  0.0004  -0.0205 123  ASN A C   
946  O  O   . ASN A 123 ? 0.2087 0.2523 0.2540 0.0071  0.0007  -0.0273 123  ASN A O   
947  C  CB  . ASN A 123 ? 0.2694 0.1962 0.2797 0.0132  -0.0013 -0.0182 123  ASN A CB  
948  C  CG  . ASN A 123 ? 0.2985 0.2404 0.2701 -0.0276 0.0340  -0.0503 123  ASN A CG  
949  O  OD1 . ASN A 123 ? 0.3178 0.2452 0.3084 -0.0011 0.0112  -0.0430 123  ASN A OD1 
950  N  ND2 . ASN A 123 ? 0.3257 0.2144 0.2831 -0.0538 0.0731  -0.0020 123  ASN A ND2 
951  N  N   . PRO A 124 ? 0.2303 0.2245 0.2661 0.0069  -0.0015 -0.0263 124  PRO A N   
952  C  CA  . PRO A 124 ? 0.2381 0.2577 0.2591 0.0194  0.0143  -0.0120 124  PRO A CA  
953  C  C   . PRO A 124 ? 0.2612 0.2766 0.2726 0.0090  -0.0006 -0.0008 124  PRO A C   
954  O  O   . PRO A 124 ? 0.2206 0.3229 0.2991 0.0314  0.0156  -0.0195 124  PRO A O   
955  C  CB  . PRO A 124 ? 0.2570 0.2284 0.2972 0.0176  0.0064  0.0036  124  PRO A CB  
956  C  CG  . PRO A 124 ? 0.2293 0.2019 0.2649 0.0336  0.0254  -0.0306 124  PRO A CG  
957  C  CD  . PRO A 124 ? 0.2453 0.2183 0.2815 -0.0038 0.0181  -0.0362 124  PRO A CD  
958  N  N   . GLU A 125 ? 0.2830 0.2929 0.2697 -0.0124 0.0121  -0.0255 125  GLU A N   
959  C  CA  . GLU A 125 ? 0.2943 0.3294 0.3132 -0.0142 -0.0109 -0.0278 125  GLU A CA  
960  C  C   . GLU A 125 ? 0.3175 0.3969 0.3214 -0.0229 0.0037  -0.0327 125  GLU A C   
961  O  O   . GLU A 125 ? 0.2819 0.4818 0.3356 -0.0342 -0.0025 -0.0449 125  GLU A O   
962  C  CB  . GLU A 125 ? 0.3277 0.3144 0.2883 -0.0144 -0.0223 -0.0158 125  GLU A CB  
963  C  CG  . GLU A 125 ? 0.3624 0.4511 0.3940 0.0208  -0.0257 -0.0422 125  GLU A CG  
964  C  CD  . GLU A 125 ? 0.5733 0.4963 0.5812 0.0404  0.0252  -0.1244 125  GLU A CD  
965  O  OE1 . GLU A 125 ? 0.6950 0.5719 0.7665 -0.0699 0.1000  -0.2082 125  GLU A OE1 
966  O  OE2 . GLU A 125 ? 0.6244 0.6375 0.6518 0.0616  0.1106  0.0096  125  GLU A OE2 
967  N  N   . LYS A 126 ? 0.3592 0.3981 0.3505 -0.0574 0.0186  -0.0155 126  LYS A N   
968  C  CA  . LYS A 126 ? 0.3528 0.5201 0.4043 -0.0302 0.0033  -0.0256 126  LYS A CA  
969  C  C   . LYS A 126 ? 0.3146 0.5472 0.4009 -0.0048 -0.0026 -0.0164 126  LYS A C   
970  O  O   . LYS A 126 ? 0.2912 0.6744 0.4527 -0.0296 -0.0025 -0.0354 126  LYS A O   
971  C  CB  . LYS A 126 ? 0.3822 0.5321 0.4012 -0.0379 0.0372  -0.0073 126  LYS A CB  
972  C  CG  . LYS A 126 ? 0.3974 0.6792 0.5345 -0.0482 0.0424  -0.0227 126  LYS A CG  
973  C  CD  . LYS A 126 ? 0.5231 0.7136 0.5472 -0.0544 -0.0004 -0.0109 126  LYS A CD  
974  C  CE  . LYS A 126 ? 0.5678 0.8340 0.6466 -0.0545 0.0498  -0.0161 126  LYS A CE  
975  N  NZ  . LYS A 126 ? 0.6521 0.8982 0.6760 -0.0108 0.0246  -0.0644 126  LYS A NZ  
976  N  N   . GLN A 127 ? 0.2788 0.4385 0.2904 0.0147  0.0056  -0.0251 127  GLN A N   
977  C  CA  . GLN A 127 ? 0.2830 0.4849 0.3183 0.0734  -0.0010 -0.0129 127  GLN A CA  
978  C  C   . GLN A 127 ? 0.3425 0.5154 0.3450 0.0709  0.0148  0.0010  127  GLN A C   
979  O  O   . GLN A 127 ? 0.4168 0.5441 0.3735 0.1340  0.0450  0.0150  127  GLN A O   
980  C  CB  . GLN A 127 ? 0.3151 0.4007 0.3406 0.0810  0.0100  -0.0110 127  GLN A CB  
981  C  CG  . GLN A 127 ? 0.3076 0.4273 0.3287 0.0880  0.0357  -0.0264 127  GLN A CG  
982  C  CD  . GLN A 127 ? 0.3445 0.4626 0.4016 0.0474  -0.0194 0.0020  127  GLN A CD  
983  O  OE1 . GLN A 127 ? 0.3857 0.4026 0.3649 0.1201  0.0270  0.0015  127  GLN A OE1 
984  N  NE2 . GLN A 127 ? 0.3662 0.4692 0.3597 0.0119  -0.0079 -0.0541 127  GLN A NE2 
985  N  N   . GLY A 128 ? 0.2914 0.5457 0.3506 0.0236  -0.0228 -0.0174 128  GLY A N   
986  C  CA  . GLY A 128 ? 0.3316 0.5751 0.3588 0.0302  0.0091  -0.0135 128  GLY A CA  
987  C  C   . GLY A 128 ? 0.3157 0.4957 0.3593 0.0389  -0.0157 0.0104  128  GLY A C   
988  O  O   . GLY A 128 ? 0.3229 0.5715 0.2908 0.0487  -0.0191 -0.0245 128  GLY A O   
989  N  N   . PHE A 129 ? 0.2885 0.3699 0.3025 0.0464  -0.0009 -0.0104 129  PHE A N   
990  C  CA  . PHE A 129 ? 0.2606 0.2757 0.2806 0.0500  -0.0157 -0.0040 129  PHE A CA  
991  C  C   . PHE A 129 ? 0.2762 0.3219 0.2785 0.0390  0.0024  0.0010  129  PHE A C   
992  O  O   . PHE A 129 ? 0.3092 0.3025 0.3104 0.0244  0.0242  -0.0115 129  PHE A O   
993  C  CB  . PHE A 129 ? 0.2831 0.2868 0.2571 0.0378  0.0004  -0.0070 129  PHE A CB  
994  C  CG  . PHE A 129 ? 0.2529 0.2158 0.2036 0.0318  -0.0163 0.0190  129  PHE A CG  
995  C  CD1 . PHE A 129 ? 0.3145 0.2103 0.2661 0.0506  0.0092  -0.0276 129  PHE A CD1 
996  C  CD2 . PHE A 129 ? 0.2855 0.2508 0.2817 0.0415  -0.0008 -0.0280 129  PHE A CD2 
997  C  CE1 . PHE A 129 ? 0.2972 0.1819 0.3095 0.0512  0.0078  -0.0140 129  PHE A CE1 
998  C  CE2 . PHE A 129 ? 0.3028 0.2308 0.2981 0.0151  -0.0125 -0.0316 129  PHE A CE2 
999  C  CZ  . PHE A 129 ? 0.3041 0.2115 0.2697 0.0424  -0.0134 0.0051  129  PHE A CZ  
1000 N  N   . GLY A 130 ? 0.2671 0.3004 0.2782 0.0500  0.0005  -0.0202 130  GLY A N   
1001 C  CA  . GLY A 130 ? 0.2723 0.3040 0.2920 0.0217  -0.0061 -0.0357 130  GLY A CA  
1002 C  C   . GLY A 130 ? 0.2946 0.2689 0.2917 0.0136  0.0075  -0.0219 130  GLY A C   
1003 O  O   . GLY A 130 ? 0.2659 0.2363 0.2509 0.0173  0.0065  -0.0255 130  GLY A O   
1004 N  N   . ARG A 131 ? 0.2890 0.2528 0.2897 0.0153  -0.0073 -0.0222 131  ARG A N   
1005 C  CA  . ARG A 131 ? 0.2971 0.2390 0.2841 0.0031  0.0214  -0.0287 131  ARG A CA  
1006 C  C   . ARG A 131 ? 0.3038 0.1855 0.2648 0.0137  0.0157  -0.0157 131  ARG A C   
1007 O  O   . ARG A 131 ? 0.3110 0.2526 0.2807 0.0046  0.0078  -0.0348 131  ARG A O   
1008 C  CB  . ARG A 131 ? 0.3465 0.2895 0.3372 0.0087  0.0474  -0.0100 131  ARG A CB  
1009 C  CG  . ARG A 131 ? 0.4144 0.3239 0.3443 -0.0046 0.0155  -0.0117 131  ARG A CG  
1010 C  CD  . ARG A 131 ? 0.4419 0.3086 0.4162 0.0243  -0.0031 0.0123  131  ARG A CD  
1011 N  NE  . ARG A 131 ? 0.4415 0.3476 0.4597 0.0062  -0.0547 0.0098  131  ARG A NE  
1012 C  CZ  . ARG A 131 ? 0.4926 0.3436 0.4134 -0.0084 0.0277  0.0072  131  ARG A CZ  
1013 N  NH1 . ARG A 131 ? 0.4441 0.2583 0.3798 -0.0492 -0.0062 -0.0193 131  ARG A NH1 
1014 N  NH2 . ARG A 131 ? 0.5151 0.3965 0.4876 -0.0409 -0.0719 -0.0233 131  ARG A NH2 
1015 N  N   . HIS A 132 ? 0.2717 0.2088 0.2533 0.0166  -0.0053 -0.0299 132  HIS A N   
1016 C  CA  . HIS A 132 ? 0.3086 0.2049 0.2596 0.0375  0.0170  -0.0117 132  HIS A CA  
1017 C  C   . HIS A 132 ? 0.3506 0.1924 0.2779 0.0288  0.0031  -0.0198 132  HIS A C   
1018 O  O   . HIS A 132 ? 0.3276 0.1917 0.2539 0.0327  0.0187  -0.0076 132  HIS A O   
1019 C  CB  . HIS A 132 ? 0.3003 0.2139 0.2468 0.0229  -0.0014 -0.0032 132  HIS A CB  
1020 C  CG  . HIS A 132 ? 0.3152 0.2351 0.2647 0.0188  0.0010  0.0001  132  HIS A CG  
1021 N  ND1 . HIS A 132 ? 0.3417 0.2354 0.2646 -0.0083 0.0078  0.0168  132  HIS A ND1 
1022 C  CD2 . HIS A 132 ? 0.3990 0.2977 0.2636 0.0316  0.0295  0.0298  132  HIS A CD2 
1023 C  CE1 . HIS A 132 ? 0.3403 0.2333 0.2681 0.0293  0.0367  -0.0191 132  HIS A CE1 
1024 N  NE2 . HIS A 132 ? 0.3307 0.2607 0.3206 0.0382  0.0158  0.0058  132  HIS A NE2 
1025 N  N   . VAL A 133 ? 0.3269 0.1852 0.2364 0.0187  0.0137  -0.0103 133  VAL A N   
1026 C  CA  . VAL A 133 ? 0.3701 0.1917 0.2446 0.0396  0.0221  -0.0222 133  VAL A CA  
1027 C  C   . VAL A 133 ? 0.4251 0.2472 0.3056 0.0340  0.0542  -0.0397 133  VAL A C   
1028 O  O   . VAL A 133 ? 0.4543 0.2299 0.3299 0.0361  0.0883  -0.0534 133  VAL A O   
1029 C  CB  . VAL A 133 ? 0.4053 0.2143 0.2761 0.0160  0.0159  -0.0438 133  VAL A CB  
1030 C  CG1 . VAL A 133 ? 0.4205 0.2605 0.3022 0.0275  0.0526  -0.0321 133  VAL A CG1 
1031 C  CG2 . VAL A 133 ? 0.4045 0.2382 0.2968 -0.0089 -0.0209 -0.0365 133  VAL A CG2 
1032 N  N   . ASP A 134 ? 0.4049 0.2883 0.2689 0.0193  0.0374  -0.0569 134  ASP A N   
1033 C  CA  . ASP A 134 ? 0.4540 0.3106 0.3375 0.0385  0.0771  -0.0520 134  ASP A CA  
1034 C  C   . ASP A 134 ? 0.4753 0.3071 0.3240 0.0539  0.0750  -0.0352 134  ASP A C   
1035 O  O   . ASP A 134 ? 0.4272 0.2938 0.3325 0.0446  0.0894  -0.0370 134  ASP A O   
1036 C  CB  . ASP A 134 ? 0.4622 0.3655 0.3323 0.0229  0.0587  -0.0364 134  ASP A CB  
1037 C  CG  . ASP A 134 ? 0.5560 0.3538 0.4389 0.0274  0.0595  -0.0570 134  ASP A CG  
1038 O  OD1 . ASP A 134 ? 0.6426 0.3846 0.4273 0.0043  0.0537  -0.0545 134  ASP A OD1 
1039 O  OD2 . ASP A 134 ? 0.5899 0.5332 0.4660 0.0037  0.0905  -0.0578 134  ASP A OD2 
1040 N  N   . GLU A 135 ? 0.4757 0.3183 0.3581 -0.0373 0.0517  -0.0532 135  GLU A N   
1041 C  CA  . GLU A 135 ? 0.4918 0.3582 0.3890 -0.0183 0.0603  -0.0576 135  GLU A CA  
1042 C  C   . GLU A 135 ? 0.4489 0.3544 0.3615 0.0066  0.0815  -0.0627 135  GLU A C   
1043 O  O   . GLU A 135 ? 0.4442 0.4065 0.4106 -0.0004 0.0755  -0.0302 135  GLU A O   
1044 C  CB  . GLU A 135 ? 0.5880 0.3665 0.4400 -0.0275 0.1020  -0.0698 135  GLU A CB  
1045 C  CG  . GLU A 135 ? 0.6481 0.4330 0.4617 0.0234  0.1151  -0.0319 135  GLU A CG  
1046 C  CD  . GLU A 135 ? 0.8727 0.4906 0.5313 0.0815  0.1810  -0.0827 135  GLU A CD  
1047 O  OE1 . GLU A 135 ? 0.9440 0.5554 0.2800 0.0406  0.1112  0.0349  135  GLU A OE1 
1048 O  OE2 . GLU A 135 ? 0.8820 0.7857 0.6607 0.1296  0.2200  0.0002  135  GLU A OE2 
1049 N  N   . GLU A 136 ? 0.4372 0.3467 0.3593 -0.0080 0.0765  -0.0664 136  GLU A N   
1050 C  CA  . GLU A 136 ? 0.4336 0.3732 0.3965 -0.0100 0.0654  -0.0641 136  GLU A CA  
1051 C  C   . GLU A 136 ? 0.4053 0.3753 0.3828 -0.0148 0.0446  -0.0484 136  GLU A C   
1052 O  O   . GLU A 136 ? 0.3865 0.4291 0.3842 -0.0227 0.0718  -0.0812 136  GLU A O   
1053 C  CB  . GLU A 136 ? 0.4745 0.4205 0.3997 -0.0326 0.0699  -0.0424 136  GLU A CB  
1054 C  CG  . GLU A 136 ? 0.5517 0.5426 0.5723 -0.0954 0.0740  -0.0399 136  GLU A CG  
1055 C  CD  . GLU A 136 ? 0.7399 0.6430 0.6500 -0.1175 0.0686  0.0253  136  GLU A CD  
1056 O  OE1 . GLU A 136 ? 0.8519 0.7431 0.6724 -0.1028 -0.0098 -0.0179 136  GLU A OE1 
1057 O  OE2 . GLU A 136 ? 0.7132 0.6948 0.7325 -0.1337 0.1646  0.0118  136  GLU A OE2 
1058 N  N   . THR A 137 ? 0.3730 0.3199 0.3448 -0.0300 0.0425  -0.0457 137  THR A N   
1059 C  CA  . THR A 137 ? 0.3595 0.3215 0.3240 -0.0103 0.0427  -0.0298 137  THR A CA  
1060 C  C   . THR A 137 ? 0.3275 0.2698 0.3078 -0.0094 0.0129  -0.0328 137  THR A C   
1061 O  O   . THR A 137 ? 0.3529 0.2484 0.3207 0.0060  0.0153  -0.0372 137  THR A O   
1062 C  CB  . THR A 137 ? 0.4122 0.2993 0.3385 -0.0295 0.0765  -0.0313 137  THR A CB  
1063 O  OG1 . THR A 137 ? 0.4024 0.3365 0.3350 0.0204  -0.0116 -0.0453 137  THR A OG1 
1064 C  CG2 . THR A 137 ? 0.4733 0.3849 0.3361 -0.0307 0.0816  0.0288  137  THR A CG2 
1065 N  N   . GLY A 138 ? 0.2976 0.2473 0.2786 0.0060  0.0185  -0.0068 138  GLY A N   
1066 C  CA  . GLY A 138 ? 0.2726 0.2367 0.2942 0.0179  0.0233  -0.0186 138  GLY A CA  
1067 C  C   . GLY A 138 ? 0.2643 0.2221 0.3011 0.0063  0.0266  -0.0404 138  GLY A C   
1068 O  O   . GLY A 138 ? 0.3057 0.2704 0.3334 -0.0015 0.0170  -0.0272 138  GLY A O   
1069 N  N   . VAL A 139 ? 0.2454 0.1936 0.2790 0.0183  0.0188  -0.0326 139  VAL A N   
1070 C  CA  . VAL A 139 ? 0.2707 0.2322 0.3103 0.0328  0.0125  -0.0269 139  VAL A CA  
1071 C  C   . VAL A 139 ? 0.2835 0.2599 0.3371 0.0226  0.0007  -0.0012 139  VAL A C   
1072 O  O   . VAL A 139 ? 0.3167 0.2398 0.3357 -0.0193 -0.0425 -0.0105 139  VAL A O   
1073 C  CB  . VAL A 139 ? 0.2829 0.1932 0.3041 0.0054  0.0249  -0.0151 139  VAL A CB  
1074 C  CG1 . VAL A 139 ? 0.3162 0.2515 0.3499 -0.0340 0.0605  -0.0359 139  VAL A CG1 
1075 C  CG2 . VAL A 139 ? 0.2478 0.1466 0.2587 0.0557  0.0283  -0.0180 139  VAL A CG2 
1076 N  N   . GLY A 140 ? 0.2637 0.2722 0.3218 0.0453  -0.0005 -0.0223 140  GLY A N   
1077 C  CA  . GLY A 140 ? 0.2912 0.2433 0.3164 0.0497  -0.0089 -0.0440 140  GLY A CA  
1078 C  C   . GLY A 140 ? 0.2513 0.2219 0.2798 0.0326  -0.0124 -0.0217 140  GLY A C   
1079 O  O   . GLY A 140 ? 0.2606 0.2122 0.3176 0.0229  0.0049  -0.0367 140  GLY A O   
1080 N  N   . LYS A 141 ? 0.3083 0.2431 0.3216 0.0130  -0.0030 -0.0385 141  LYS A N   
1081 C  CA  . LYS A 141 ? 0.2943 0.2380 0.3535 0.0251  -0.0052 0.0138  141  LYS A CA  
1082 C  C   . LYS A 141 ? 0.2787 0.2321 0.3630 0.0199  0.0147  0.0071  141  LYS A C   
1083 O  O   . LYS A 141 ? 0.2736 0.2208 0.3358 0.0240  -0.0046 -0.0126 141  LYS A O   
1084 C  CB  . LYS A 141 ? 0.3374 0.2506 0.4003 -0.0202 0.0141  0.0121  141  LYS A CB  
1085 C  CG  . LYS A 141 ? 0.4681 0.3618 0.4014 -0.0299 -0.0225 0.0123  141  LYS A CG  
1086 C  CD  . LYS A 141 ? 0.5317 0.3729 0.4417 -0.1001 -0.0060 -0.0167 141  LYS A CD  
1087 C  CE  . LYS A 141 ? 0.6058 0.4199 0.4881 -0.1233 0.0091  -0.0509 141  LYS A CE  
1088 N  NZ  . LYS A 141 ? 0.5950 0.4172 0.4909 -0.1204 -0.0430 0.0151  141  LYS A NZ  
1089 N  N   . TRP A 142 ? 0.2693 0.2637 0.4021 0.0133  0.0239  0.0128  142  TRP A N   
1090 C  CA  . TRP A 142 ? 0.3273 0.3123 0.4296 0.0368  0.0341  0.0054  142  TRP A CA  
1091 C  C   . TRP A 142 ? 0.2908 0.2741 0.3729 0.0305  0.0281  -0.0207 142  TRP A C   
1092 O  O   . TRP A 142 ? 0.3143 0.2903 0.3755 -0.0141 0.0027  -0.0335 142  TRP A O   
1093 C  CB  . TRP A 142 ? 0.3667 0.3185 0.4546 0.0620  0.0821  0.0346  142  TRP A CB  
1094 C  CG  . TRP A 142 ? 0.4354 0.2942 0.4889 0.1138  0.0640  0.0224  142  TRP A CG  
1095 C  CD1 . TRP A 142 ? 0.4025 0.3755 0.4058 0.1313  0.1389  0.0119  142  TRP A CD1 
1096 C  CD2 . TRP A 142 ? 0.3883 0.3258 0.4428 0.1224  0.1255  -0.0276 142  TRP A CD2 
1097 N  NE1 . TRP A 142 ? 0.4431 0.3942 0.4403 0.0875  0.0681  0.0009  142  TRP A NE1 
1098 C  CE2 . TRP A 142 ? 0.4376 0.3231 0.4315 0.0825  0.1529  -0.0247 142  TRP A CE2 
1099 C  CE3 . TRP A 142 ? 0.4674 0.3501 0.4821 0.0846  0.1078  -0.0235 142  TRP A CE3 
1100 C  CZ2 . TRP A 142 ? 0.3815 0.3035 0.4545 0.0797  0.2082  -0.0252 142  TRP A CZ2 
1101 C  CZ3 . TRP A 142 ? 0.5597 0.3854 0.5473 0.0415  0.1365  0.0073  142  TRP A CZ3 
1102 C  CH2 . TRP A 142 ? 0.5793 0.4287 0.5034 0.0423  0.1314  0.0127  142  TRP A CH2 
1103 N  N   . PHE A 143 ? 0.2797 0.2026 0.3693 0.0157  0.0354  -0.0397 143  PHE A N   
1104 C  CA  . PHE A 143 ? 0.2871 0.2093 0.3156 0.0327  0.0207  -0.0404 143  PHE A CA  
1105 C  C   . PHE A 143 ? 0.2930 0.2395 0.3139 0.0133  0.0320  -0.0022 143  PHE A C   
1106 O  O   . PHE A 143 ? 0.2885 0.2772 0.3384 0.0205  0.0316  -0.0070 143  PHE A O   
1107 C  CB  . PHE A 143 ? 0.3174 0.2049 0.3600 0.0278  -0.0016 -0.0375 143  PHE A CB  
1108 C  CG  . PHE A 143 ? 0.3548 0.2422 0.3674 0.0083  0.0345  -0.0398 143  PHE A CG  
1109 C  CD1 . PHE A 143 ? 0.3340 0.1876 0.3207 0.0388  0.0045  -0.0400 143  PHE A CD1 
1110 C  CD2 . PHE A 143 ? 0.3256 0.1963 0.3428 0.0428  0.0361  -0.0706 143  PHE A CD2 
1111 C  CE1 . PHE A 143 ? 0.4316 0.2542 0.3702 0.0519  0.0266  -0.0588 143  PHE A CE1 
1112 C  CE2 . PHE A 143 ? 0.4375 0.1673 0.4007 0.0595  0.0545  -0.0609 143  PHE A CE2 
1113 C  CZ  . PHE A 143 ? 0.4574 0.2025 0.3291 0.0815  0.0323  -0.0194 143  PHE A CZ  
1114 N  N   . GLU A 144 ? 0.2698 0.1682 0.2867 0.0056  0.0189  -0.0453 144  GLU A N   
1115 C  CA  . GLU A 144 ? 0.2753 0.2433 0.3146 0.0110  0.0257  -0.0233 144  GLU A CA  
1116 C  C   . GLU A 144 ? 0.3276 0.2970 0.3363 0.0181  0.0503  -0.0137 144  GLU A C   
1117 O  O   . GLU A 144 ? 0.3102 0.2117 0.3375 0.0103  0.0432  -0.0308 144  GLU A O   
1118 C  CB  . GLU A 144 ? 0.3296 0.2955 0.3248 -0.0203 0.0032  -0.0329 144  GLU A CB  
1119 C  CG  . GLU A 144 ? 0.3853 0.3792 0.3773 -0.0499 0.0156  -0.0625 144  GLU A CG  
1120 C  CD  . GLU A 144 ? 0.4114 0.4279 0.4287 0.0051  -0.0097 -0.0569 144  GLU A CD  
1121 O  OE1 . GLU A 144 ? 0.4733 0.6648 0.5042 -0.1303 -0.0263 -0.0475 144  GLU A OE1 
1122 O  OE2 . GLU A 144 ? 0.3863 0.5676 0.4124 -0.0236 -0.0691 -0.0651 144  GLU A OE2 
1123 N  N   . PRO A 145 ? 0.3104 0.2339 0.3367 -0.0156 0.0297  -0.0416 145  PRO A N   
1124 C  CA  . PRO A 145 ? 0.2809 0.1881 0.3354 -0.0204 0.0154  -0.0203 145  PRO A CA  
1125 C  C   . PRO A 145 ? 0.2689 0.1307 0.2982 -0.0162 0.0469  -0.0279 145  PRO A C   
1126 O  O   . PRO A 145 ? 0.3397 0.1531 0.3478 -0.0233 0.0453  0.0083  145  PRO A O   
1127 C  CB  . PRO A 145 ? 0.2899 0.2416 0.3476 -0.0342 0.0415  -0.0259 145  PRO A CB  
1128 C  CG  . PRO A 145 ? 0.2975 0.2720 0.3542 -0.0333 0.0290  -0.0609 145  PRO A CG  
1129 C  CD  . PRO A 145 ? 0.3567 0.2642 0.3742 -0.0239 0.0352  -0.0651 145  PRO A CD  
1130 N  N   . PHE A 146 ? 0.2793 0.1651 0.2943 -0.0349 0.0552  -0.0082 146  PHE A N   
1131 C  CA  . PHE A 146 ? 0.2913 0.1926 0.3057 -0.0186 0.0393  0.0000  146  PHE A CA  
1132 C  C   . PHE A 146 ? 0.3079 0.1705 0.3218 -0.0117 0.0357  0.0008  146  PHE A C   
1133 O  O   . PHE A 146 ? 0.2873 0.2243 0.3411 0.0026  0.0394  -0.0131 146  PHE A O   
1134 C  CB  . PHE A 146 ? 0.3005 0.1726 0.3059 -0.0174 0.0428  -0.0017 146  PHE A CB  
1135 C  CG  . PHE A 146 ? 0.2906 0.2112 0.3306 -0.0286 0.0357  -0.0016 146  PHE A CG  
1136 C  CD1 . PHE A 146 ? 0.2505 0.1723 0.2913 -0.0090 0.0502  -0.0136 146  PHE A CD1 
1137 C  CD2 . PHE A 146 ? 0.2674 0.1713 0.2830 0.0124  -0.0099 0.0142  146  PHE A CD2 
1138 C  CE1 . PHE A 146 ? 0.3120 0.1837 0.2937 0.0070  0.0725  -0.0093 146  PHE A CE1 
1139 C  CE2 . PHE A 146 ? 0.3061 0.2284 0.3335 -0.0242 0.0096  0.0164  146  PHE A CE2 
1140 C  CZ  . PHE A 146 ? 0.3104 0.2568 0.3488 0.0138  0.0280  -0.0002 146  PHE A CZ  
1141 N  N   . LYS A 147 ? 0.3121 0.2327 0.3466 -0.0148 0.0415  -0.0061 147  LYS A N   
1142 C  CA  . LYS A 147 ? 0.3244 0.2697 0.3556 -0.0144 0.0283  -0.0007 147  LYS A CA  
1143 C  C   . LYS A 147 ? 0.3347 0.2549 0.3542 0.0050  0.0279  -0.0016 147  LYS A C   
1144 O  O   . LYS A 147 ? 0.3277 0.3044 0.3878 0.0233  0.0059  -0.0074 147  LYS A O   
1145 C  CB  . LYS A 147 ? 0.3644 0.2875 0.3889 -0.0133 0.0512  -0.0039 147  LYS A CB  
1146 C  CG  . LYS A 147 ? 0.4401 0.3010 0.4313 -0.0361 0.0596  0.0285  147  LYS A CG  
1147 C  CD  . LYS A 147 ? 0.5690 0.4481 0.5086 -0.0491 0.1210  0.0804  147  LYS A CD  
1148 C  CE  . LYS A 147 ? 0.7350 0.5109 0.6589 0.0259  0.0308  0.0937  147  LYS A CE  
1149 N  NZ  . LYS A 147 ? 0.8760 0.5747 0.6569 -0.0131 0.0359  -0.0096 147  LYS A NZ  
1150 N  N   . VAL A 148 ? 0.2941 0.2420 0.3159 -0.0034 0.0262  0.0063  148  VAL A N   
1151 C  CA  . VAL A 148 ? 0.2893 0.2556 0.3019 0.0166  0.0204  0.0102  148  VAL A CA  
1152 C  C   . VAL A 148 ? 0.2813 0.2260 0.3016 0.0110  0.0234  0.0050  148  VAL A C   
1153 O  O   . VAL A 148 ? 0.2777 0.2808 0.3045 0.0185  0.0418  0.0082  148  VAL A O   
1154 C  CB  . VAL A 148 ? 0.2943 0.2557 0.3047 0.0041  0.0421  0.0065  148  VAL A CB  
1155 C  CG1 . VAL A 148 ? 0.3448 0.3894 0.3489 -0.0061 0.0157  -0.0344 148  VAL A CG1 
1156 C  CG2 . VAL A 148 ? 0.3192 0.2608 0.3543 0.0015  0.0557  0.0109  148  VAL A CG2 
1157 N  N   . ASP A 149 ? 0.3001 0.2304 0.2979 0.0186  0.0332  0.0303  149  ASP A N   
1158 C  CA  . ASP A 149 ? 0.3337 0.3015 0.3163 0.0268  0.0290  0.0149  149  ASP A CA  
1159 C  C   . ASP A 149 ? 0.2982 0.2955 0.3201 0.0328  0.0178  0.0133  149  ASP A C   
1160 O  O   . ASP A 149 ? 0.3150 0.3095 0.3139 0.0178  0.0312  0.0133  149  ASP A O   
1161 C  CB  . ASP A 149 ? 0.4550 0.3488 0.3764 -0.0112 0.0608  0.0320  149  ASP A CB  
1162 C  CG  . ASP A 149 ? 0.5309 0.4307 0.5147 -0.0448 0.0377  0.0207  149  ASP A CG  
1163 O  OD1 . ASP A 149 ? 0.5182 0.5482 0.6777 -0.0334 0.0648  0.0639  149  ASP A OD1 
1164 O  OD2 . ASP A 149 ? 0.6585 0.5269 0.7358 0.0906  0.1770  -0.0541 149  ASP A OD2 
1165 N  N   . TYR A 150 ? 0.2560 0.2718 0.2967 0.0268  0.0327  0.0286  150  TYR A N   
1166 C  CA  . TYR A 150 ? 0.2934 0.2854 0.2981 0.0269  0.0260  0.0342  150  TYR A CA  
1167 C  C   . TYR A 150 ? 0.3181 0.3218 0.2898 0.0351  0.0187  0.0350  150  TYR A C   
1168 O  O   . TYR A 150 ? 0.3473 0.3835 0.3141 0.0196  0.0174  0.0549  150  TYR A O   
1169 C  CB  . TYR A 150 ? 0.2866 0.2742 0.2913 0.0225  0.0306  0.0343  150  TYR A CB  
1170 C  CG  . TYR A 150 ? 0.2279 0.1889 0.2527 0.0213  -0.0006 0.0023  150  TYR A CG  
1171 C  CD1 . TYR A 150 ? 0.2170 0.2336 0.2995 0.0031  0.0013  0.0159  150  TYR A CD1 
1172 C  CD2 . TYR A 150 ? 0.2152 0.2242 0.2138 0.0291  0.0073  -0.0011 150  TYR A CD2 
1173 C  CE1 . TYR A 150 ? 0.2576 0.2776 0.3004 0.0027  0.0132  0.0110  150  TYR A CE1 
1174 C  CE2 . TYR A 150 ? 0.2167 0.2620 0.2589 0.0315  0.0284  0.0068  150  TYR A CE2 
1175 C  CZ  . TYR A 150 ? 0.2605 0.2526 0.3026 0.0060  0.0106  -0.0082 150  TYR A CZ  
1176 O  OH  . TYR A 150 ? 0.3179 0.3370 0.3004 -0.0030 0.0049  0.0062  150  TYR A OH  
1177 N  N   . LYS A 151 ? 0.2861 0.3215 0.2988 0.0313  0.0100  0.0355  151  LYS A N   
1178 C  CA  . LYS A 151 ? 0.3407 0.3427 0.3151 0.0276  0.0061  0.0199  151  LYS A CA  
1179 C  C   . LYS A 151 ? 0.3222 0.3563 0.2964 0.0117  -0.0037 0.0195  151  LYS A C   
1180 O  O   . LYS A 151 ? 0.3046 0.3997 0.3128 0.0386  -0.0226 0.0006  151  LYS A O   
1181 C  CB  . LYS A 151 ? 0.3855 0.3892 0.3533 0.0509  -0.0039 0.0456  151  LYS A CB  
1182 C  CG  . LYS A 151 ? 0.5122 0.4294 0.4933 0.0165  0.0300  0.0080  151  LYS A CG  
1183 C  CD  . LYS A 151 ? 0.6887 0.5833 0.5660 0.0607  0.0283  0.0972  151  LYS A CD  
1184 C  CE  . LYS A 151 ? 0.7411 0.6011 0.6633 0.0465  0.0379  0.0497  151  LYS A CE  
1185 N  NZ  . LYS A 151 ? 0.7574 0.7245 0.6883 -0.0522 0.0960  0.0132  151  LYS A NZ  
1186 N  N   . PHE A 152 ? 0.2991 0.3475 0.3154 0.0007  0.0080  0.0287  152  PHE A N   
1187 C  CA  . PHE A 152 ? 0.2918 0.3599 0.3046 0.0290  0.0116  0.0138  152  PHE A CA  
1188 C  C   . PHE A 152 ? 0.3218 0.3871 0.2827 0.0156  -0.0062 0.0095  152  PHE A C   
1189 O  O   . PHE A 152 ? 0.3308 0.3410 0.2750 0.0085  -0.0107 0.0221  152  PHE A O   
1190 C  CB  . PHE A 152 ? 0.3062 0.3640 0.2921 0.0155  -0.0149 0.0076  152  PHE A CB  
1191 C  CG  . PHE A 152 ? 0.2742 0.3162 0.2463 -0.0143 -0.0123 0.0181  152  PHE A CG  
1192 C  CD1 . PHE A 152 ? 0.2988 0.3555 0.3464 -0.0401 -0.0079 0.0209  152  PHE A CD1 
1193 C  CD2 . PHE A 152 ? 0.3099 0.3870 0.3181 0.0273  -0.0329 -0.0029 152  PHE A CD2 
1194 C  CE1 . PHE A 152 ? 0.2919 0.2963 0.3010 -0.0230 -0.0302 -0.0106 152  PHE A CE1 
1195 C  CE2 . PHE A 152 ? 0.2912 0.3619 0.3101 -0.0070 -0.0067 0.0175  152  PHE A CE2 
1196 C  CZ  . PHE A 152 ? 0.2493 0.2950 0.2993 -0.0111 0.0118  0.0103  152  PHE A CZ  
1197 N  N   . LYS A 153 ? 0.3122 0.3880 0.2966 0.0100  -0.0037 0.0207  153  LYS A N   
1198 C  CA  . LYS A 153 ? 0.3154 0.4089 0.2880 0.0218  -0.0069 0.0209  153  LYS A CA  
1199 C  C   . LYS A 153 ? 0.3031 0.3883 0.3017 0.0212  0.0032  0.0042  153  LYS A C   
1200 O  O   . LYS A 153 ? 0.3152 0.4295 0.3294 -0.0106 0.0104  0.0017  153  LYS A O   
1201 C  CB  . LYS A 153 ? 0.3497 0.4854 0.3407 0.0083  -0.0289 0.0076  153  LYS A CB  
1202 C  CG  . LYS A 153 ? 0.5272 0.6358 0.4302 0.0549  -0.0070 -0.0505 153  LYS A CG  
1203 C  CD  . LYS A 153 ? 0.7124 0.7796 0.5215 0.0503  -0.0529 0.0270  153  LYS A CD  
1204 C  CE  . LYS A 153 ? 0.7160 0.8843 0.6460 0.0234  0.0037  -0.0068 153  LYS A CE  
1205 N  NZ  . LYS A 153 ? 0.7785 0.8972 0.7230 0.0340  -0.0031 -0.0478 153  LYS A NZ  
1206 N  N   . TYR A 154 ? 0.3145 0.3827 0.2876 0.0093  0.0241  0.0114  154  TYR A N   
1207 C  CA  . TYR A 154 ? 0.3032 0.3620 0.2616 0.0166  0.0121  0.0162  154  TYR A CA  
1208 C  C   . TYR A 154 ? 0.3513 0.4221 0.3187 -0.0038 -0.0252 0.0046  154  TYR A C   
1209 O  O   . TYR A 154 ? 0.3317 0.3816 0.3140 0.0035  -0.0173 0.0162  154  TYR A O   
1210 C  CB  . TYR A 154 ? 0.2953 0.3515 0.2617 0.0091  0.0213  0.0099  154  TYR A CB  
1211 C  CG  . TYR A 154 ? 0.2704 0.3013 0.2572 0.0040  0.0046  -0.0082 154  TYR A CG  
1212 C  CD1 . TYR A 154 ? 0.3299 0.3601 0.2564 0.0409  0.0024  0.0172  154  TYR A CD1 
1213 C  CD2 . TYR A 154 ? 0.3111 0.3365 0.2601 0.0177  -0.0059 -0.0035 154  TYR A CD2 
1214 C  CE1 . TYR A 154 ? 0.3235 0.3346 0.2644 0.0563  0.0033  -0.0115 154  TYR A CE1 
1215 C  CE2 . TYR A 154 ? 0.3083 0.3481 0.2580 0.0498  -0.0367 -0.0380 154  TYR A CE2 
1216 C  CZ  . TYR A 154 ? 0.3062 0.3611 0.3032 0.0268  0.0001  -0.0263 154  TYR A CZ  
1217 O  OH  . TYR A 154 ? 0.3220 0.3462 0.2787 0.0442  -0.0369 -0.0254 154  TYR A OH  
1218 N  N   . THR A 155 ? 0.3809 0.4235 0.3508 -0.0086 -0.0202 -0.0013 155  THR A N   
1219 C  CA  . THR A 155 ? 0.3988 0.4725 0.3558 0.0075  -0.0369 0.0005  155  THR A CA  
1220 C  C   . THR A 155 ? 0.4294 0.4923 0.3622 0.0126  -0.0263 -0.0423 155  THR A C   
1221 O  O   . THR A 155 ? 0.4620 0.5289 0.3506 -0.0137 -0.0344 -0.0386 155  THR A O   
1222 C  CB  . THR A 155 ? 0.3803 0.5129 0.3498 0.0014  -0.0236 -0.0031 155  THR A CB  
1223 O  OG1 . THR A 155 ? 0.3768 0.4484 0.3516 -0.0274 -0.0582 -0.0072 155  THR A OG1 
1224 C  CG2 . THR A 155 ? 0.4517 0.4872 0.4018 0.0110  -0.0365 0.0466  155  THR A CG2 
1225 N  N   . GLY A 156 ? 0.4410 0.4872 0.3721 0.0287  -0.0241 -0.0394 156  GLY A N   
1226 C  CA  . GLY A 156 ? 0.4600 0.5074 0.4090 0.0317  -0.0301 -0.0533 156  GLY A CA  
1227 C  C   . GLY A 156 ? 0.4922 0.4856 0.4192 0.0127  -0.0383 -0.0553 156  GLY A C   
1228 O  O   . GLY A 156 ? 0.4550 0.4139 0.4187 0.0000  -0.0828 -0.0326 156  GLY A O   
1229 N  N   . THR A 157 ? 0.5163 0.5154 0.4711 0.0153  -0.0416 -0.0610 157  THR A N   
1230 C  CA  . THR A 157 ? 0.5913 0.5366 0.4713 0.0323  -0.0582 -0.0624 157  THR A CA  
1231 C  C   . THR A 157 ? 0.6545 0.5540 0.5181 0.0132  -0.0632 -0.0635 157  THR A C   
1232 O  O   . THR A 157 ? 0.6595 0.5663 0.4693 -0.0080 -0.0710 -0.0483 157  THR A O   
1233 C  CB  . THR A 157 ? 0.6142 0.5413 0.4764 0.0524  -0.0694 -0.0902 157  THR A CB  
1234 O  OG1 . THR A 157 ? 0.5832 0.4774 0.4203 0.0056  -0.0769 -0.1150 157  THR A OG1 
1235 C  CG2 . THR A 157 ? 0.5915 0.6047 0.4665 0.0628  -0.0037 -0.1226 157  THR A CG2 
1236 N  N   . PRO A 158 ? 0.7328 0.5949 0.5315 0.0226  -0.0496 -0.0509 158  PRO A N   
1237 C  CA  . PRO A 158 ? 0.8098 0.6769 0.6154 -0.0183 -0.0504 -0.0565 158  PRO A CA  
1238 C  C   . PRO A 158 ? 0.9641 0.7161 0.7018 -0.0006 -0.0635 -0.0510 158  PRO A C   
1239 O  O   . PRO A 158 ? 0.9922 0.7474 0.7333 -0.0323 -0.0689 -0.0584 158  PRO A O   
1240 C  CB  . PRO A 158 ? 0.8008 0.6466 0.5960 -0.0373 -0.0492 -0.0522 158  PRO A CB  
1241 C  CG  . PRO A 158 ? 0.7306 0.6165 0.5438 -0.0186 -0.0396 -0.0338 158  PRO A CG  
1242 C  CD  . PRO A 158 ? 0.6942 0.5856 0.5445 0.0133  -0.0748 -0.0444 158  PRO A CD  
1243 N  N   . LYS A 159 ? 0.6398 0.6422 0.6580 0.0005  -0.0130 0.0065  159  LYS A N   
1244 C  CA  . LYS A 159 ? 0.6970 0.6841 0.6950 0.0120  -0.0102 -0.0035 159  LYS A CA  
1245 C  C   . LYS A 159 ? 0.7282 0.7245 0.7065 0.0087  -0.0047 -0.0276 159  LYS A C   
1246 O  O   . LYS A 159 ? 0.7623 0.7575 0.6947 0.0082  -0.0117 -0.0434 159  LYS A O   
1247 C  CB  . LYS A 159 ? 0.6928 0.6954 0.7182 0.0009  -0.0026 -0.0100 159  LYS A CB  
1248 C  CG  . LYS A 159 ? 0.7443 0.7571 0.7487 -0.0047 0.0194  0.0047  159  LYS A CG  
1249 C  CD  . LYS A 159 ? 0.7667 0.7771 0.7585 -0.0054 -0.0177 0.0001  159  LYS A CD  
1250 C  CE  . LYS A 159 ? 0.8093 0.7854 0.7910 -0.0214 -0.0021 0.0339  159  LYS A CE  
1251 N  NZ  . LYS A 159 ? 0.8852 0.7509 0.7129 -0.0283 0.0497  -0.0671 159  LYS A NZ  
1252 N  N   . GLY B 2   ? 0.5749 0.5665 0.6082 0.0043  -0.0148 0.0039  2    GLY B N   
1253 C  CA  . GLY B 2   ? 0.5525 0.5625 0.5700 0.0085  -0.0049 -0.0125 2    GLY B CA  
1254 C  C   . GLY B 2   ? 0.5158 0.5363 0.5459 -0.0004 -0.0144 -0.0104 2    GLY B C   
1255 O  O   . GLY B 2   ? 0.5321 0.6126 0.6097 -0.0032 -0.0080 -0.0077 2    GLY B O   
1256 N  N   . GLU B 3   ? 0.6125 0.8388 1.5214 -0.0100 -0.1203 -0.1188 3    GLU B N   
1257 C  CA  . GLU B 3   ? 0.5311 0.7371 1.2098 -0.0471 -0.1418 -0.0356 3    GLU B CA  
1258 C  C   . GLU B 3   ? 0.3891 0.6861 1.0699 -0.0357 -0.0453 -0.0824 3    GLU B C   
1259 O  O   . GLU B 3   ? 0.3544 0.6723 1.2036 -0.0231 -0.0323 -0.1081 3    GLU B O   
1260 C  CB  . GLU B 3   ? 0.6166 0.7171 1.2574 -0.0520 -0.2676 -0.0095 3    GLU B CB  
1261 C  CG  . GLU B 3   ? 0.7000 0.7491 1.1306 -0.0735 -0.3272 0.0495  3    GLU B CG  
1262 C  CD  . GLU B 3   ? 0.9549 0.9180 1.2153 -0.0712 -0.4729 0.0811  3    GLU B CD  
1263 O  OE1 . GLU B 3   ? 0.9763 0.7706 1.0507 -0.0644 -0.4830 0.0702  3    GLU B OE1 
1264 O  OE2 . GLU B 3   ? 1.1569 0.7886 1.1841 -0.0723 -0.6274 0.1270  3    GLU B OE2 
1265 N  N   . VAL B 4   ? 0.3207 0.6067 0.7865 -0.0543 0.0318  -0.0537 4    VAL B N   
1266 C  CA  . VAL B 4   ? 0.3070 0.6182 0.6890 -0.0466 0.0899  -0.0567 4    VAL B CA  
1267 C  C   . VAL B 4   ? 0.3126 0.5627 0.5623 -0.0192 0.0465  0.0144  4    VAL B C   
1268 O  O   . VAL B 4   ? 0.3082 0.5279 0.4202 -0.0057 -0.0004 0.0279  4    VAL B O   
1269 C  CB  . VAL B 4   ? 0.3585 0.6643 0.6239 -0.0770 0.1344  -0.0533 4    VAL B CB  
1270 C  CG1 . VAL B 4   ? 0.4302 0.7242 0.5123 -0.0371 0.2127  -0.0301 4    VAL B CG1 
1271 C  CG2 . VAL B 4   ? 0.4485 0.7373 0.6933 -0.0872 0.1954  -0.1101 4    VAL B CG2 
1272 N  N   . PRO B 5   ? 0.3061 0.5638 0.5939 -0.0253 0.0741  0.0024  5    PRO B N   
1273 C  CA  . PRO B 5   ? 0.3466 0.5308 0.5177 -0.0160 0.0569  0.0538  5    PRO B CA  
1274 C  C   . PRO B 5   ? 0.3775 0.5172 0.3869 0.0034  0.0923  0.0666  5    PRO B C   
1275 O  O   . PRO B 5   ? 0.4222 0.5446 0.3863 0.0225  0.1067  0.0759  5    PRO B O   
1276 C  CB  . PRO B 5   ? 0.3983 0.5499 0.6249 -0.0387 0.0713  0.0129  5    PRO B CB  
1277 C  CG  . PRO B 5   ? 0.4358 0.6124 0.7631 -0.0684 0.1454  -0.0576 5    PRO B CG  
1278 C  CD  . PRO B 5   ? 0.3394 0.5864 0.7660 -0.0733 0.1256  -0.0531 5    PRO B CD  
1279 N  N   . ILE B 6   ? 0.3600 0.5211 0.3146 0.0304  0.0486  0.0879  6    ILE B N   
1280 C  CA  . ILE B 6   ? 0.4354 0.5769 0.2759 0.0845  0.0566  0.1012  6    ILE B CA  
1281 C  C   . ILE B 6   ? 0.4946 0.5566 0.3413 0.0937  0.0629  0.1132  6    ILE B C   
1282 O  O   . ILE B 6   ? 0.4436 0.5528 0.3551 0.0829  0.0561  0.1118  6    ILE B O   
1283 C  CB  . ILE B 6   ? 0.3815 0.6056 0.2696 0.1083  0.0241  0.0950  6    ILE B CB  
1284 C  CG1 . ILE B 6   ? 0.3146 0.6548 0.2390 0.0809  0.0006  0.0939  6    ILE B CG1 
1285 C  CG2 . ILE B 6   ? 0.3702 0.6588 0.2966 0.1612  0.0279  0.0761  6    ILE B CG2 
1286 C  CD1 . ILE B 6   ? 0.3130 0.7051 0.2211 0.0420  0.0091  0.0537  6    ILE B CD1 
1287 N  N   . GLY B 7   ? 0.5917 0.5990 0.3600 0.0842  0.0993  0.1183  7    GLY B N   
1288 C  CA  . GLY B 7   ? 0.7267 0.6014 0.4225 0.0912  0.1192  0.1188  7    GLY B CA  
1289 C  C   . GLY B 7   ? 0.6756 0.5510 0.4408 0.0520  0.1418  0.1124  7    GLY B C   
1290 O  O   . GLY B 7   ? 0.5982 0.4681 0.4458 0.0080  0.1081  0.0653  7    GLY B O   
1291 N  N   . ASP B 8   ? 0.7573 0.5487 0.4574 0.0497  0.1731  0.1172  8    ASP B N   
1292 C  CA  . ASP B 8   ? 0.7783 0.5497 0.4993 -0.0081 0.1853  0.0923  8    ASP B CA  
1293 C  C   . ASP B 8   ? 0.7618 0.5459 0.4922 -0.0259 0.1765  0.0848  8    ASP B C   
1294 O  O   . ASP B 8   ? 0.7933 0.5743 0.5065 -0.0038 0.1668  0.0756  8    ASP B O   
1295 C  CB  . ASP B 8   ? 0.9185 0.5468 0.5430 -0.0279 0.2430  0.0956  8    ASP B CB  
1296 C  CG  . ASP B 8   ? 1.0478 0.5974 0.5854 -0.0681 0.2944  0.1012  8    ASP B CG  
1297 O  OD1 . ASP B 8   ? 0.9700 0.7408 0.6208 -0.0973 0.3426  0.0568  8    ASP B OD1 
1298 O  OD2 . ASP B 8   ? 1.2560 0.7109 0.6382 -0.0503 0.3484  0.2069  8    ASP B OD2 
1299 N  N   . PRO B 9   ? 0.7356 0.5639 0.5082 -0.0727 0.1387  0.0746  9    PRO B N   
1300 C  CA  . PRO B 9   ? 0.7791 0.6077 0.4973 -0.1093 0.1446  0.0723  9    PRO B CA  
1301 C  C   . PRO B 9   ? 0.9009 0.6137 0.5416 -0.1363 0.2055  0.0586  9    PRO B C   
1302 O  O   . PRO B 9   ? 0.9521 0.5664 0.5192 -0.1295 0.2364  0.0278  9    PRO B O   
1303 C  CB  . PRO B 9   ? 0.7872 0.6127 0.5150 -0.1690 0.0621  0.0831  9    PRO B CB  
1304 C  CG  . PRO B 9   ? 0.7844 0.6141 0.6039 -0.1792 0.0533  0.1072  9    PRO B CG  
1305 C  CD  . PRO B 9   ? 0.7041 0.5709 0.5486 -0.1210 0.1349  0.0629  9    PRO B CD  
1306 N  N   . LYS B 10  ? 0.6375 0.3692 0.4574 0.0278  0.0719  0.1477  10   LYS B N   
1307 C  CA  . LYS B 10  ? 0.6627 0.3931 0.4725 0.0293  0.0651  0.1234  10   LYS B CA  
1308 C  C   . LYS B 10  ? 0.6038 0.3658 0.4807 0.0246  0.0680  0.0986  10   LYS B C   
1309 O  O   . LYS B 10  ? 0.6287 0.3635 0.4225 0.0573  0.0657  0.0631  10   LYS B O   
1310 C  CB  . LYS B 10  ? 0.6857 0.4141 0.4970 0.0598  0.0324  0.1363  10   LYS B CB  
1311 C  CG  . LYS B 10  ? 0.7629 0.5133 0.5379 0.0559  0.0263  0.1015  10   LYS B CG  
1312 C  CD  . LYS B 10  ? 0.8810 0.5832 0.6477 0.0303  0.0161  0.1894  10   LYS B CD  
1313 C  CE  . LYS B 10  ? 0.9322 0.6610 0.6556 0.0605  -0.0002 0.1206  10   LYS B CE  
1314 N  NZ  . LYS B 10  ? 0.9018 0.5691 0.6138 -0.0030 0.0156  0.1513  10   LYS B NZ  
1315 N  N   . GLU B 11  ? 0.5668 0.3244 0.4707 0.0107  0.0607  0.1219  11   GLU B N   
1316 C  CA  . GLU B 11  ? 0.4954 0.2615 0.4560 0.0167  0.0706  0.1123  11   GLU B CA  
1317 C  C   . GLU B 11  ? 0.4983 0.1889 0.4515 0.0195  0.0444  0.1003  11   GLU B C   
1318 O  O   . GLU B 11  ? 0.5266 0.1646 0.4943 0.0392  0.0204  0.0955  11   GLU B O   
1319 C  CB  . GLU B 11  ? 0.5253 0.1964 0.5078 0.0113  0.0626  0.0981  11   GLU B CB  
1320 C  CG  . GLU B 11  ? 0.5552 0.4180 0.5766 0.0494  0.1149  0.0647  11   GLU B CG  
1321 C  CD  . GLU B 11  ? 0.5966 0.5164 0.6764 -0.0184 0.0908  0.0570  11   GLU B CD  
1322 O  OE1 . GLU B 11  ? 0.6741 0.5148 0.6480 -0.1716 0.0934  0.0923  11   GLU B OE1 
1323 O  OE2 . GLU B 11  ? 0.6741 0.6831 0.6189 0.0078  0.2064  0.0611  11   GLU B OE2 
1324 N  N   . LEU B 12  ? 0.4557 0.1907 0.4121 0.0523  0.0202  0.0861  12   LEU B N   
1325 C  CA  . LEU B 12  ? 0.4383 0.1923 0.4139 0.0492  0.0021  0.0739  12   LEU B CA  
1326 C  C   . LEU B 12  ? 0.3619 0.1745 0.3685 0.0739  -0.0132 0.0643  12   LEU B C   
1327 O  O   . LEU B 12  ? 0.3227 0.1663 0.3383 0.0580  0.0149  0.0610  12   LEU B O   
1328 C  CB  . LEU B 12  ? 0.5121 0.2003 0.3831 0.0763  -0.0130 0.0869  12   LEU B CB  
1329 C  CG  . LEU B 12  ? 0.6090 0.3286 0.4355 0.0479  -0.0190 0.1090  12   LEU B CG  
1330 C  CD1 . LEU B 12  ? 0.6198 0.3875 0.4447 0.0162  -0.0371 0.1273  12   LEU B CD1 
1331 C  CD2 . LEU B 12  ? 0.6868 0.2782 0.5164 0.0662  -0.0636 0.1675  12   LEU B CD2 
1332 N  N   . ASN B 13  ? 0.3645 0.1708 0.3898 0.0691  -0.0103 0.0461  13   ASN B N   
1333 C  CA  . ASN B 13  ? 0.3770 0.1898 0.3861 0.0743  -0.0024 0.0211  13   ASN B CA  
1334 C  C   . ASN B 13  ? 0.3612 0.2076 0.3564 0.0560  -0.0027 0.0215  13   ASN B C   
1335 O  O   . ASN B 13  ? 0.3474 0.2338 0.3552 0.0423  -0.0065 0.0127  13   ASN B O   
1336 C  CB  . ASN B 13  ? 0.3604 0.2676 0.3900 0.0798  -0.0038 0.0128  13   ASN B CB  
1337 C  CG  . ASN B 13  ? 0.3830 0.2648 0.4018 0.1026  0.0033  -0.0226 13   ASN B CG  
1338 O  OD1 . ASN B 13  ? 0.4820 0.2713 0.5323 0.0828  -0.0759 -0.0557 13   ASN B OD1 
1339 N  ND2 . ASN B 13  ? 0.3882 0.2922 0.3924 0.0566  -0.0256 0.0175  13   ASN B ND2 
1340 N  N   . GLY B 14  ? 0.3764 0.2050 0.3960 0.0441  0.0085  0.0309  14   GLY B N   
1341 C  CA  . GLY B 14  ? 0.3821 0.2086 0.3806 0.0512  0.0090  0.0109  14   GLY B CA  
1342 C  C   . GLY B 14  ? 0.3637 0.1725 0.3520 0.0210  0.0205  0.0441  14   GLY B C   
1343 O  O   . GLY B 14  ? 0.3407 0.2478 0.3525 0.0615  -0.0006 0.0331  14   GLY B O   
1344 N  N   . MET B 15  ? 0.3361 0.1868 0.3282 0.0443  0.0191  0.0534  15   MET B N   
1345 C  CA  . MET B 15  ? 0.3249 0.2087 0.3059 0.0443  0.0199  0.0566  15   MET B CA  
1346 C  C   . MET B 15  ? 0.3290 0.1864 0.3063 0.0418  0.0460  0.0760  15   MET B C   
1347 O  O   . MET B 15  ? 0.3953 0.2089 0.3095 0.0502  0.0414  0.0467  15   MET B O   
1348 C  CB  . MET B 15  ? 0.3208 0.1475 0.2840 0.0338  0.0338  0.0559  15   MET B CB  
1349 C  CG  . MET B 15  ? 0.3421 0.1945 0.3121 0.0406  0.0323  0.0671  15   MET B CG  
1350 S  SD  . MET B 15  ? 0.3680 0.2587 0.3272 0.0432  0.0295  0.0094  15   MET B SD  
1351 C  CE  . MET B 15  ? 0.3608 0.2801 0.3857 0.0633  0.0596  0.0969  15   MET B CE  
1352 N  N   . GLU B 16  ? 0.3803 0.1768 0.3372 0.0273  0.0502  0.0653  16   GLU B N   
1353 C  CA  . GLU B 16  ? 0.4023 0.2176 0.3402 0.0193  0.0602  0.0764  16   GLU B CA  
1354 C  C   . GLU B 16  ? 0.3804 0.2544 0.3125 0.0253  0.0469  0.0877  16   GLU B C   
1355 O  O   . GLU B 16  ? 0.4089 0.1939 0.3147 0.0323  0.0148  0.0579  16   GLU B O   
1356 C  CB  . GLU B 16  ? 0.4100 0.2378 0.4063 0.0023  0.0369  0.0367  16   GLU B CB  
1357 C  CG  . GLU B 16  ? 0.4781 0.3674 0.4439 0.0166  0.0867  0.0513  16   GLU B CG  
1358 C  CD  . GLU B 16  ? 0.5604 0.6346 0.7046 0.1233  0.0216  -0.0278 16   GLU B CD  
1359 O  OE1 . GLU B 16  ? 0.6010 0.7388 0.7448 0.2097  -0.0088 -0.0007 16   GLU B OE1 
1360 O  OE2 . GLU B 16  ? 0.7270 0.7678 0.7620 0.0790  0.0906  -0.0526 16   GLU B OE2 
1361 N  N   . ILE B 17  ? 0.4087 0.1888 0.3350 0.0303  0.0505  0.1063  17   ILE B N   
1362 C  CA  . ILE B 17  ? 0.4144 0.2744 0.2997 0.0393  0.0578  0.0816  17   ILE B CA  
1363 C  C   . ILE B 17  ? 0.4456 0.3038 0.3006 0.0596  0.0704  0.0941  17   ILE B C   
1364 O  O   . ILE B 17  ? 0.5108 0.2816 0.3577 0.0407  0.0838  0.1009  17   ILE B O   
1365 C  CB  . ILE B 17  ? 0.4292 0.2931 0.3147 0.0695  0.0429  0.0946  17   ILE B CB  
1366 C  CG1 . ILE B 17  ? 0.4226 0.2943 0.3104 0.0685  0.0213  0.0504  17   ILE B CG1 
1367 C  CG2 . ILE B 17  ? 0.4621 0.3278 0.3670 0.0565  0.0248  0.0591  17   ILE B CG2 
1368 C  CD1 . ILE B 17  ? 0.4773 0.3030 0.3737 0.0876  0.0481  -0.0052 17   ILE B CD1 
1369 N  N   . ALA B 18  ? 0.3782 0.2660 0.2438 0.0247  0.0533  0.0673  18   ALA B N   
1370 C  CA  . ALA B 18  ? 0.3884 0.2965 0.2566 0.0384  0.0817  0.0882  18   ALA B CA  
1371 C  C   . ALA B 18  ? 0.3634 0.3240 0.2334 0.0493  0.0443  0.0978  18   ALA B C   
1372 O  O   . ALA B 18  ? 0.3947 0.3359 0.2559 0.0486  0.0650  0.0686  18   ALA B O   
1373 C  CB  . ALA B 18  ? 0.3482 0.3439 0.3156 0.0188  0.0395  0.0421  18   ALA B CB  
1374 N  N   . ALA B 19  ? 0.4044 0.3640 0.2528 0.0475  0.0656  0.0867  19   ALA B N   
1375 C  CA  . ALA B 19  ? 0.3846 0.3799 0.2664 0.0717  0.0398  0.0742  19   ALA B CA  
1376 C  C   . ALA B 19  ? 0.3564 0.3946 0.2224 0.0647  0.0393  0.0792  19   ALA B C   
1377 O  O   . ALA B 19  ? 0.3723 0.4028 0.2667 0.0363  0.0455  0.0897  19   ALA B O   
1378 C  CB  . ALA B 19  ? 0.4085 0.4171 0.2803 0.0971  0.0062  0.0804  19   ALA B CB  
1379 N  N   . VAL B 20  ? 0.3401 0.4167 0.2439 0.0549  0.0304  0.0609  20   VAL B N   
1380 C  CA  . VAL B 20  ? 0.3792 0.4579 0.2810 0.0647  0.0282  0.0333  20   VAL B CA  
1381 C  C   . VAL B 20  ? 0.3656 0.4422 0.2623 0.0752  0.0406  0.0280  20   VAL B C   
1382 O  O   . VAL B 20  ? 0.3636 0.4197 0.2090 0.0559  0.0377  0.0056  20   VAL B O   
1383 C  CB  . VAL B 20  ? 0.4107 0.4781 0.2967 0.0661  0.0083  0.0445  20   VAL B CB  
1384 C  CG1 . VAL B 20  ? 0.4298 0.5406 0.4172 0.0385  -0.0462 0.0701  20   VAL B CG1 
1385 C  CG2 . VAL B 20  ? 0.3489 0.4555 0.2845 0.0869  -0.0058 0.0644  20   VAL B CG2 
1386 N  N   . TYR B 21  ? 0.3539 0.5013 0.2568 0.0852  0.0505  0.0111  21   TYR B N   
1387 C  CA  . TYR B 21  ? 0.3561 0.5001 0.2513 0.0841  0.0488  -0.0010 21   TYR B CA  
1388 C  C   . TYR B 21  ? 0.3678 0.5358 0.2801 0.0990  0.0267  -0.0118 21   TYR B C   
1389 O  O   . TYR B 21  ? 0.3718 0.5890 0.3153 0.0812  0.0347  -0.0250 21   TYR B O   
1390 C  CB  . TYR B 21  ? 0.3545 0.5246 0.2448 0.0954  0.0446  -0.0057 21   TYR B CB  
1391 C  CG  . TYR B 21  ? 0.3299 0.5891 0.2635 0.1062  0.0168  0.0127  21   TYR B CG  
1392 C  CD1 . TYR B 21  ? 0.3677 0.6373 0.3192 0.1747  0.0020  -0.0048 21   TYR B CD1 
1393 C  CD2 . TYR B 21  ? 0.4051 0.6440 0.3053 0.0810  0.0807  0.0346  21   TYR B CD2 
1394 C  CE1 . TYR B 21  ? 0.3724 0.7550 0.3568 0.1147  0.0504  -0.0164 21   TYR B CE1 
1395 C  CE2 . TYR B 21  ? 0.4875 0.7148 0.3832 0.0992  0.1576  0.0330  21   TYR B CE2 
1396 C  CZ  . TYR B 21  ? 0.4290 0.7428 0.3134 0.0927  0.0190  -0.0178 21   TYR B CZ  
1397 O  OH  . TYR B 21  ? 0.5696 0.8024 0.3571 0.0921  0.0733  0.0346  21   TYR B OH  
1398 N  N   . LEU B 22  ? 0.3626 0.5325 0.3232 0.1015  0.0048  -0.0151 22   LEU B N   
1399 C  CA  . LEU B 22  ? 0.3981 0.5446 0.3098 0.1094  0.0064  -0.0424 22   LEU B CA  
1400 C  C   . LEU B 22  ? 0.3596 0.5368 0.2801 0.1233  0.0148  -0.0394 22   LEU B C   
1401 O  O   . LEU B 22  ? 0.3280 0.5130 0.2433 0.1030  -0.0100 -0.0603 22   LEU B O   
1402 C  CB  . LEU B 22  ? 0.4320 0.5222 0.3497 0.0980  -0.0870 -0.0503 22   LEU B CB  
1403 C  CG  . LEU B 22  ? 0.5509 0.5285 0.3484 0.1130  0.0082  -0.0393 22   LEU B CG  
1404 C  CD1 . LEU B 22  ? 0.5867 0.5965 0.5158 0.1095  0.0700  0.0256  22   LEU B CD1 
1405 C  CD2 . LEU B 22  ? 0.6711 0.5701 0.5230 0.0784  -0.1098 0.0175  22   LEU B CD2 
1406 N  N   . GLN B 23  ? 0.3291 0.5312 0.2929 0.1280  0.0018  -0.0463 23   GLN B N   
1407 C  CA  . GLN B 23  ? 0.3822 0.5423 0.2742 0.1414  -0.0155 -0.0871 23   GLN B CA  
1408 C  C   . GLN B 23  ? 0.3564 0.4341 0.2369 0.1395  -0.0255 -0.1025 23   GLN B C   
1409 O  O   . GLN B 23  ? 0.3589 0.3957 0.2265 0.1235  -0.0354 -0.0523 23   GLN B O   
1410 C  CB  . GLN B 23  ? 0.4182 0.6191 0.3663 0.1591  -0.0380 -0.1286 23   GLN B CB  
1411 C  CG  . GLN B 23  ? 0.5974 0.6590 0.4650 0.1813  -0.0818 -0.0801 23   GLN B CG  
1412 C  CD  . GLN B 23  ? 0.6507 0.7308 0.5406 0.1507  -0.1343 -0.0750 23   GLN B CD  
1413 O  OE1 . GLN B 23  ? 0.5167 0.6878 0.5212 0.2325  -0.1173 -0.0732 23   GLN B OE1 
1414 N  NE2 . GLN B 23  ? 0.6486 0.6906 0.5323 0.1848  -0.1108 -0.0570 23   GLN B NE2 
1415 N  N   . PRO B 24  ? 0.3247 0.4106 0.2187 0.0957  -0.0033 0.0461  24   PRO B N   
1416 C  CA  . PRO B 24  ? 0.2909 0.4377 0.2741 0.0906  -0.0199 0.0063  24   PRO B CA  
1417 C  C   . PRO B 24  ? 0.3331 0.4460 0.2771 0.0723  -0.0131 0.0051  24   PRO B C   
1418 O  O   . PRO B 24  ? 0.3981 0.5033 0.3258 0.1202  0.0251  -0.0004 24   PRO B O   
1419 C  CB  . PRO B 24  ? 0.3729 0.4688 0.2536 0.0828  -0.0156 -0.0265 24   PRO B CB  
1420 C  CG  . PRO B 24  ? 0.3978 0.4588 0.2725 0.0878  -0.0316 0.0114  24   PRO B CG  
1421 C  CD  . PRO B 24  ? 0.3867 0.4686 0.2577 0.1310  -0.0305 0.0524  24   PRO B CD  
1422 N  N   . ILE B 25  ? 0.3115 0.4574 0.2983 0.0453  -0.0278 0.0053  25   ILE B N   
1423 C  CA  . ILE B 25  ? 0.3296 0.4255 0.3188 0.0494  -0.0222 0.0270  25   ILE B CA  
1424 C  C   . ILE B 25  ? 0.3530 0.4273 0.3274 0.0361  -0.0332 -0.0066 25   ILE B C   
1425 O  O   . ILE B 25  ? 0.3285 0.4298 0.3244 0.0385  -0.0426 0.0021  25   ILE B O   
1426 C  CB  . ILE B 25  ? 0.3463 0.4736 0.3293 -0.0201 -0.0675 0.0256  25   ILE B CB  
1427 C  CG1 . ILE B 25  ? 0.3489 0.4513 0.3362 0.0175  -0.0564 0.0961  25   ILE B CG1 
1428 C  CG2 . ILE B 25  ? 0.3428 0.4665 0.3567 -0.0110 -0.0882 0.0492  25   ILE B CG2 
1429 C  CD1 . ILE B 25  ? 0.3533 0.4862 0.3184 0.0314  -0.0222 0.0741  25   ILE B CD1 
1430 N  N   . GLU B 26  ? 0.3647 0.4313 0.3158 0.0581  -0.0250 -0.0071 26   GLU B N   
1431 C  CA  . GLU B 26  ? 0.3790 0.4000 0.2954 0.0403  -0.0335 -0.0192 26   GLU B CA  
1432 C  C   . GLU B 26  ? 0.3310 0.3010 0.2760 0.0243  -0.0468 -0.0329 26   GLU B C   
1433 O  O   . GLU B 26  ? 0.3253 0.3216 0.2575 0.0129  -0.0375 -0.0151 26   GLU B O   
1434 C  CB  . GLU B 26  ? 0.4309 0.4262 0.2901 0.0667  -0.0360 -0.0325 26   GLU B CB  
1435 C  CG  . GLU B 26  ? 0.5223 0.4695 0.3084 0.0071  -0.0335 -0.0586 26   GLU B CG  
1436 C  CD  . GLU B 26  ? 0.5686 0.5291 0.3649 0.0515  -0.0892 -0.0484 26   GLU B CD  
1437 O  OE1 . GLU B 26  ? 0.6230 0.5096 0.3950 -0.0320 -0.0463 -0.0144 26   GLU B OE1 
1438 O  OE2 . GLU B 26  ? 0.6130 0.6379 0.5331 -0.0710 -0.0917 -0.0326 26   GLU B OE2 
1439 N  N   . MET B 27  ? 0.3447 0.3571 0.2988 0.0077  -0.0473 -0.0413 27   MET B N   
1440 C  CA  . MET B 27  ? 0.3667 0.3602 0.2750 0.0023  -0.0421 -0.0342 27   MET B CA  
1441 C  C   . MET B 27  ? 0.3385 0.3939 0.2845 -0.0315 -0.0311 -0.0741 27   MET B C   
1442 O  O   . MET B 27  ? 0.3805 0.4919 0.3009 -0.0556 -0.0605 -0.0790 27   MET B O   
1443 C  CB  . MET B 27  ? 0.3413 0.3521 0.2567 0.0396  -0.0386 -0.0405 27   MET B CB  
1444 C  CG  . MET B 27  ? 0.4507 0.4286 0.3472 0.0265  -0.0436 -0.0524 27   MET B CG  
1445 S  SD  . MET B 27  ? 0.4263 0.4690 0.3854 0.0104  -0.0178 -0.0344 27   MET B SD  
1446 C  CE  . MET B 27  ? 0.4580 0.4514 0.3624 -0.0543 -0.0292 -0.0455 27   MET B CE  
1447 N  N   . GLU B 28  ? 0.3491 0.3840 0.2595 -0.0413 -0.0195 -0.0623 28   GLU B N   
1448 C  CA  . GLU B 28  ? 0.4110 0.4018 0.3497 -0.0708 -0.0079 -0.0565 28   GLU B CA  
1449 C  C   . GLU B 28  ? 0.4288 0.4193 0.3477 -0.0613 0.0198  -0.0684 28   GLU B C   
1450 O  O   . GLU B 28  ? 0.4157 0.3680 0.3403 -0.0589 0.0181  -0.0575 28   GLU B O   
1451 C  CB  . GLU B 28  ? 0.4518 0.4515 0.3900 -0.0719 -0.0108 -0.0312 28   GLU B CB  
1452 C  CG  . GLU B 28  ? 0.5400 0.4937 0.4469 -0.0674 -0.0039 -0.0708 28   GLU B CG  
1453 C  CD  . GLU B 28  ? 0.7637 0.5551 0.5647 -0.0511 -0.0169 -0.0071 28   GLU B CD  
1454 O  OE1 . GLU B 28  ? 0.8890 0.6891 0.5689 -0.0887 -0.0161 -0.0111 28   GLU B OE1 
1455 O  OE2 . GLU B 28  ? 0.8303 0.5983 0.5991 -0.1375 -0.0540 -0.0778 28   GLU B OE2 
1456 N  N   . PRO B 29  ? 0.4714 0.4668 0.4212 -0.0873 0.0411  -0.0758 29   PRO B N   
1457 C  CA  . PRO B 29  ? 0.4588 0.4860 0.4125 -0.0885 0.0310  -0.0673 29   PRO B CA  
1458 C  C   . PRO B 29  ? 0.4242 0.5108 0.4033 -0.0670 0.0425  -0.0563 29   PRO B C   
1459 O  O   . PRO B 29  ? 0.4393 0.5514 0.4257 -0.0618 0.0589  -0.0376 29   PRO B O   
1460 C  CB  . PRO B 29  ? 0.4870 0.5198 0.4300 -0.0994 0.0624  -0.0673 29   PRO B CB  
1461 C  CG  . PRO B 29  ? 0.5337 0.5445 0.5259 -0.0596 0.1248  -0.0645 29   PRO B CG  
1462 C  CD  . PRO B 29  ? 0.5366 0.4820 0.4475 -0.0852 0.0629  -0.0914 29   PRO B CD  
1463 N  N   . ARG B 30  ? 0.4423 0.5261 0.4442 -0.0973 -0.0113 -0.0551 30   ARG B N   
1464 C  CA  . ARG B 30  ? 0.4813 0.5897 0.4946 -0.0906 -0.0342 -0.0499 30   ARG B CA  
1465 C  C   . ARG B 30  ? 0.4533 0.6369 0.5537 -0.1072 -0.0277 -0.0329 30   ARG B C   
1466 O  O   . ARG B 30  ? 0.4563 0.6348 0.5701 -0.1183 -0.0111 -0.0181 30   ARG B O   
1467 C  CB  . ARG B 30  ? 0.5647 0.6266 0.5344 -0.1261 -0.0777 -0.0589 30   ARG B CB  
1468 C  CG  . ARG B 30  ? 0.6300 0.6995 0.5903 -0.0755 -0.0553 -0.0750 30   ARG B CG  
1469 C  CD  . ARG B 30  ? 0.8400 0.7373 0.7456 -0.1270 -0.0690 -0.0437 30   ARG B CD  
1470 N  NE  . ARG B 30  ? 0.9454 0.8422 0.7745 -0.1382 -0.0900 -0.0870 30   ARG B NE  
1471 C  CZ  . ARG B 30  ? 1.0415 0.8606 0.8018 -0.1569 -0.1158 -0.0910 30   ARG B CZ  
1472 N  NH1 . ARG B 30  ? 1.1153 0.8943 0.7891 -0.1403 -0.0840 -0.0686 30   ARG B NH1 
1473 N  NH2 . ARG B 30  ? 1.0575 0.8905 0.7902 -0.1771 -0.2098 -0.0735 30   ARG B NH2 
1474 N  N   . GLY B 31  ? 0.4619 0.6834 0.5832 -0.0935 -0.0297 -0.0149 31   GLY B N   
1475 C  CA  . GLY B 31  ? 0.4828 0.7773 0.6823 -0.0790 -0.0368 0.0104  31   GLY B CA  
1476 C  C   . GLY B 31  ? 0.4943 0.7805 0.7141 -0.0342 -0.0008 0.0184  31   GLY B C   
1477 O  O   . GLY B 31  ? 0.4795 0.8703 0.8083 -0.0238 -0.0346 0.0257  31   GLY B O   
1478 N  N   . ILE B 32  ? 0.4851 0.7350 0.6474 -0.0226 0.0328  0.0077  32   ILE B N   
1479 C  CA  . ILE B 32  ? 0.5182 0.7299 0.6575 0.0164  0.0704  0.0164  32   ILE B CA  
1480 C  C   . ILE B 32  ? 0.4805 0.7135 0.6227 0.0416  0.0613  0.0150  32   ILE B C   
1481 O  O   . ILE B 32  ? 0.5185 0.7320 0.6404 0.0601  0.0976  0.0381  32   ILE B O   
1482 C  CB  . ILE B 32  ? 0.5868 0.6984 0.6162 0.0208  0.0807  -0.0015 32   ILE B CB  
1483 C  CG1 . ILE B 32  ? 0.6685 0.7248 0.6485 0.0089  0.0940  0.0148  32   ILE B CG1 
1484 C  CG2 . ILE B 32  ? 0.6852 0.7077 0.6652 0.0521  0.0919  -0.0097 32   ILE B CG2 
1485 C  CD1 . ILE B 32  ? 0.7343 0.6895 0.6132 -0.0203 0.1007  -0.0002 32   ILE B CD1 
1486 N  N   . ASP B 33  ? 0.4412 0.6458 0.5595 0.0168  0.0267  0.0059  33   ASP B N   
1487 C  CA  . ASP B 33  ? 0.4334 0.6330 0.5353 0.0363  -0.0022 0.0035  33   ASP B CA  
1488 C  C   . ASP B 33  ? 0.3902 0.6315 0.5284 0.0123  -0.0367 -0.0123 33   ASP B C   
1489 O  O   . ASP B 33  ? 0.3622 0.6342 0.4545 -0.0277 -0.0723 -0.0106 33   ASP B O   
1490 C  CB  . ASP B 33  ? 0.4486 0.5813 0.4563 0.0286  0.0026  -0.0019 33   ASP B CB  
1491 C  CG  . ASP B 33  ? 0.4177 0.5868 0.4824 0.0177  0.0169  -0.0177 33   ASP B CG  
1492 O  OD1 . ASP B 33  ? 0.4345 0.5558 0.5866 0.0529  0.0621  -0.0309 33   ASP B OD1 
1493 O  OD2 . ASP B 33  ? 0.3795 0.4946 0.3235 0.0443  0.0060  0.0036  33   ASP B OD2 
1494 N  N   . LEU B 34  ? 0.3738 0.4796 0.3460 0.0459  -0.0524 -0.0132 34   LEU B N   
1495 C  CA  . LEU B 34  ? 0.3741 0.4911 0.3278 0.0397  -0.0640 -0.0132 34   LEU B CA  
1496 C  C   . LEU B 34  ? 0.3621 0.5045 0.3377 0.0338  -0.0504 -0.0116 34   LEU B C   
1497 O  O   . LEU B 34  ? 0.3604 0.4681 0.3308 0.0123  -0.0723 0.0021  34   LEU B O   
1498 C  CB  . LEU B 34  ? 0.3286 0.5008 0.3217 0.0459  -0.0435 -0.0085 34   LEU B CB  
1499 C  CG  . LEU B 34  ? 0.3645 0.5072 0.3000 0.0482  -0.0612 -0.0112 34   LEU B CG  
1500 C  CD1 . LEU B 34  ? 0.4086 0.5461 0.2790 0.0074  -0.0606 0.0139  34   LEU B CD1 
1501 C  CD2 . LEU B 34  ? 0.3466 0.5219 0.3020 0.0464  -0.0970 0.0241  34   LEU B CD2 
1502 N  N   . ALA B 35  ? 0.3768 0.5196 0.3460 0.0385  -0.0502 -0.0339 35   ALA B N   
1503 C  CA  . ALA B 35  ? 0.3813 0.5283 0.3670 0.0527  -0.0518 -0.0222 35   ALA B CA  
1504 C  C   . ALA B 35  ? 0.3604 0.5020 0.3386 0.0618  -0.0555 -0.0188 35   ALA B C   
1505 O  O   . ALA B 35  ? 0.3308 0.4636 0.3228 0.0533  -0.0634 -0.0216 35   ALA B O   
1506 C  CB  . ALA B 35  ? 0.4275 0.5243 0.3866 0.0327  -0.0408 -0.0406 35   ALA B CB  
1507 N  N   . ALA B 36  ? 0.3533 0.4628 0.3409 0.0571  -0.0719 -0.0084 36   ALA B N   
1508 C  CA  . ALA B 36  ? 0.3497 0.4624 0.3348 0.0759  -0.0551 -0.0191 36   ALA B CA  
1509 C  C   . ALA B 36  ? 0.3803 0.5047 0.3447 0.0761  -0.0599 -0.0434 36   ALA B C   
1510 O  O   . ALA B 36  ? 0.3797 0.5147 0.3113 0.0615  -0.0513 -0.0441 36   ALA B O   
1511 C  CB  . ALA B 36  ? 0.3363 0.4679 0.3493 0.0681  -0.0804 -0.0238 36   ALA B CB  
1512 N  N   . SER B 37  ? 0.4128 0.5242 0.3689 0.0656  -0.0718 -0.0474 37   SER B N   
1513 C  CA  . SER B 37  ? 0.4541 0.5772 0.3804 0.0562  -0.0715 -0.0603 37   SER B CA  
1514 C  C   . SER B 37  ? 0.4479 0.5820 0.3522 0.0582  -0.0630 -0.0631 37   SER B C   
1515 O  O   . SER B 37  ? 0.4808 0.5945 0.3618 0.0188  -0.0760 -0.0441 37   SER B O   
1516 C  CB  . SER B 37  ? 0.4895 0.5724 0.4236 0.0678  -0.0583 -0.0673 37   SER B CB  
1517 O  OG  . SER B 37  ? 0.4591 0.5472 0.5305 -0.0204 -0.1010 0.0348  37   SER B OG  
1518 N  N   . LEU B 38  ? 0.3854 0.5481 0.3057 0.0538  -0.0651 -0.0417 38   LEU B N   
1519 C  CA  . LEU B 38  ? 0.4009 0.5722 0.2945 0.0545  -0.0751 -0.0445 38   LEU B CA  
1520 C  C   . LEU B 38  ? 0.3637 0.5370 0.2486 0.0798  -0.0589 -0.0447 38   LEU B C   
1521 O  O   . LEU B 38  ? 0.3967 0.5825 0.3167 0.0878  -0.0636 -0.0408 38   LEU B O   
1522 C  CB  . LEU B 38  ? 0.4251 0.5996 0.3185 0.0493  -0.0725 -0.0618 38   LEU B CB  
1523 C  CG  . LEU B 38  ? 0.4904 0.6071 0.4088 0.0507  -0.0789 -0.0402 38   LEU B CG  
1524 C  CD1 . LEU B 38  ? 0.5167 0.7428 0.5009 0.0021  -0.0534 -0.0159 38   LEU B CD1 
1525 C  CD2 . LEU B 38  ? 0.5291 0.6603 0.4028 -0.0448 -0.0937 -0.0490 38   LEU B CD2 
1526 N  N   . ALA B 39  ? 0.3542 0.4944 0.2213 0.0794  -0.0567 -0.0330 39   ALA B N   
1527 C  CA  . ALA B 39  ? 0.3401 0.4822 0.2203 0.0765  -0.0490 -0.0130 39   ALA B CA  
1528 C  C   . ALA B 39  ? 0.3550 0.4829 0.1962 0.0758  -0.0298 -0.0169 39   ALA B C   
1529 O  O   . ALA B 39  ? 0.3689 0.5095 0.2257 0.0900  -0.0281 -0.0197 39   ALA B O   
1530 C  CB  . ALA B 39  ? 0.3348 0.4183 0.1736 0.0823  -0.0145 0.0017  39   ALA B CB  
1531 N  N   . ASP B 40  ? 0.3362 0.4722 0.1963 0.0835  -0.0196 -0.0226 40   ASP B N   
1532 C  CA  . ASP B 40  ? 0.3573 0.4962 0.1944 0.0644  -0.0183 -0.0078 40   ASP B CA  
1533 C  C   . ASP B 40  ? 0.3278 0.4693 0.1950 0.0535  -0.0062 0.0148  40   ASP B C   
1534 O  O   . ASP B 40  ? 0.3307 0.4510 0.1871 0.0893  0.0117  0.0019  40   ASP B O   
1535 C  CB  . ASP B 40  ? 0.3758 0.5343 0.1892 0.0733  -0.0310 0.0093  40   ASP B CB  
1536 C  CG  . ASP B 40  ? 0.4288 0.5889 0.2207 0.0580  -0.0475 -0.0312 40   ASP B CG  
1537 O  OD1 . ASP B 40  ? 0.4214 0.5990 0.2799 0.0698  -0.0497 -0.0353 40   ASP B OD1 
1538 O  OD2 . ASP B 40  ? 0.4539 0.5925 0.2609 0.0955  -0.0067 -0.0236 40   ASP B OD2 
1539 N  N   . ILE B 41  ? 0.2989 0.4478 0.2050 0.0793  -0.0193 -0.0063 41   ILE B N   
1540 C  CA  . ILE B 41  ? 0.3282 0.4465 0.1940 0.0586  0.0011  0.0114  41   ILE B CA  
1541 C  C   . ILE B 41  ? 0.2820 0.4036 0.1790 0.0646  -0.0113 0.0183  41   ILE B C   
1542 O  O   . ILE B 41  ? 0.3057 0.4214 0.2355 0.0459  -0.0119 0.0127  41   ILE B O   
1543 C  CB  . ILE B 41  ? 0.3636 0.4578 0.2126 0.0555  -0.0031 0.0188  41   ILE B CB  
1544 C  CG1 . ILE B 41  ? 0.3221 0.4429 0.1714 0.0571  -0.0087 0.0132  41   ILE B CG1 
1545 C  CG2 . ILE B 41  ? 0.3831 0.5442 0.2140 0.0634  0.0299  0.0047  41   ILE B CG2 
1546 C  CD1 . ILE B 41  ? 0.3842 0.4595 0.1900 0.0239  -0.0237 0.0385  41   ILE B CD1 
1547 N  N   . HIS B 42  ? 0.2808 0.3833 0.1614 0.0404  -0.0077 0.0121  42   HIS B N   
1548 C  CA  . HIS B 42  ? 0.2703 0.3819 0.1804 0.0591  0.0024  0.0056  42   HIS B CA  
1549 C  C   . HIS B 42  ? 0.3316 0.4131 0.2546 0.0401  -0.0047 0.0041  42   HIS B C   
1550 O  O   . HIS B 42  ? 0.3322 0.4287 0.3194 0.0198  0.0176  0.0072  42   HIS B O   
1551 C  CB  . HIS B 42  ? 0.2771 0.3602 0.2025 0.0708  0.0180  -0.0022 42   HIS B CB  
1552 C  CG  . HIS B 42  ? 0.2546 0.3595 0.1740 0.0573  -0.0225 0.0050  42   HIS B CG  
1553 N  ND1 . HIS B 42  ? 0.3046 0.4156 0.2126 0.0233  -0.0181 0.0207  42   HIS B ND1 
1554 C  CD2 . HIS B 42  ? 0.2965 0.3554 0.2646 0.0260  -0.0307 0.0041  42   HIS B CD2 
1555 C  CE1 . HIS B 42  ? 0.3744 0.4716 0.2780 -0.0011 0.0342  -0.0425 42   HIS B CE1 
1556 N  NE2 . HIS B 42  ? 0.2974 0.3783 0.1938 0.0576  -0.0360 0.0095  42   HIS B NE2 
1557 N  N   . LEU B 43  ? 0.2983 0.3733 0.2053 0.0403  0.0047  0.0133  43   LEU B N   
1558 C  CA  . LEU B 43  ? 0.3154 0.3757 0.2252 0.0264  -0.0096 0.0259  43   LEU B CA  
1559 C  C   . LEU B 43  ? 0.3089 0.3457 0.2021 0.0295  0.0046  0.0344  43   LEU B C   
1560 O  O   . LEU B 43  ? 0.2896 0.3801 0.2051 0.0133  -0.0217 0.0238  43   LEU B O   
1561 C  CB  . LEU B 43  ? 0.3138 0.3272 0.1875 0.0371  0.0053  0.0653  43   LEU B CB  
1562 C  CG  . LEU B 43  ? 0.3743 0.3616 0.2332 0.0368  -0.0169 0.0397  43   LEU B CG  
1563 C  CD1 . LEU B 43  ? 0.3575 0.4309 0.2217 0.0648  -0.0094 0.0690  43   LEU B CD1 
1564 C  CD2 . LEU B 43  ? 0.3825 0.3798 0.3490 0.0660  -0.0325 0.0276  43   LEU B CD2 
1565 N  N   . GLU B 44  ? 0.3062 0.3660 0.2178 0.0309  0.0165  0.0290  44   GLU B N   
1566 C  CA  . GLU B 44  ? 0.2963 0.3245 0.2270 0.0366  -0.0111 0.0294  44   GLU B CA  
1567 C  C   . GLU B 44  ? 0.2804 0.3234 0.2195 0.0125  -0.0031 0.0562  44   GLU B C   
1568 O  O   . GLU B 44  ? 0.3262 0.3278 0.1941 0.0097  -0.0065 0.0605  44   GLU B O   
1569 C  CB  . GLU B 44  ? 0.2881 0.3755 0.2599 0.0361  -0.0085 0.0060  44   GLU B CB  
1570 C  CG  . GLU B 44  ? 0.3240 0.3704 0.2570 0.0378  -0.0031 0.0040  44   GLU B CG  
1571 C  CD  . GLU B 44  ? 0.3619 0.4220 0.3726 0.0469  -0.0405 -0.0045 44   GLU B CD  
1572 O  OE1 . GLU B 44  ? 0.3844 0.4497 0.2911 0.0599  -0.0165 -0.0319 44   GLU B OE1 
1573 O  OE2 . GLU B 44  ? 0.3680 0.4458 0.3371 0.0302  -0.0283 0.0257  44   GLU B OE2 
1574 N  N   . ALA B 45  ? 0.2726 0.3091 0.2400 0.0227  0.0085  0.0144  45   ALA B N   
1575 C  CA  . ALA B 45  ? 0.2714 0.2867 0.2497 0.0181  -0.0076 0.0398  45   ALA B CA  
1576 C  C   . ALA B 45  ? 0.2791 0.2929 0.2262 0.0220  -0.0007 0.0365  45   ALA B C   
1577 O  O   . ALA B 45  ? 0.2798 0.3016 0.2527 0.0053  -0.0034 0.0237  45   ALA B O   
1578 C  CB  . ALA B 45  ? 0.2837 0.2964 0.2231 0.0547  -0.0117 0.0201  45   ALA B CB  
1579 N  N   . ASP B 46  ? 0.2893 0.2862 0.2247 0.0164  -0.0027 0.0410  46   ASP B N   
1580 C  CA  . ASP B 46  ? 0.2762 0.2708 0.2443 0.0156  0.0031  0.0427  46   ASP B CA  
1581 C  C   . ASP B 46  ? 0.2580 0.2438 0.2219 -0.0013 -0.0029 0.0525  46   ASP B C   
1582 O  O   . ASP B 46  ? 0.3021 0.2500 0.2440 0.0167  0.0101  0.0476  46   ASP B O   
1583 C  CB  . ASP B 46  ? 0.2683 0.3102 0.2700 0.0077  0.0129  0.0448  46   ASP B CB  
1584 C  CG  . ASP B 46  ? 0.3647 0.3851 0.3647 0.0043  0.0383  0.0118  46   ASP B CG  
1585 O  OD1 . ASP B 46  ? 0.3295 0.3554 0.3799 0.0501  0.0373  0.0014  46   ASP B OD1 
1586 O  OD2 . ASP B 46  ? 0.4370 0.5248 0.3806 0.0239  0.0746  0.0114  46   ASP B OD2 
1587 N  N   . ILE B 47  ? 0.2834 0.2518 0.2369 0.0197  0.0125  0.0472  47   ILE B N   
1588 C  CA  . ILE B 47  ? 0.2838 0.2273 0.2568 0.0004  -0.0094 0.0200  47   ILE B CA  
1589 C  C   . ILE B 47  ? 0.2905 0.2201 0.2604 0.0068  -0.0025 0.0443  47   ILE B C   
1590 O  O   . ILE B 47  ? 0.2989 0.2279 0.2531 -0.0041 -0.0451 0.0509  47   ILE B O   
1591 C  CB  . ILE B 47  ? 0.2760 0.2111 0.2733 0.0315  -0.0177 0.0191  47   ILE B CB  
1592 C  CG1 . ILE B 47  ? 0.2968 0.2799 0.2511 0.0301  0.0015  0.0217  47   ILE B CG1 
1593 C  CG2 . ILE B 47  ? 0.2667 0.2277 0.2105 0.0116  -0.0198 0.0127  47   ILE B CG2 
1594 C  CD1 . ILE B 47  ? 0.2911 0.3092 0.2871 0.0660  0.0380  -0.0149 47   ILE B CD1 
1595 N  N   . HIS B 48  ? 0.2560 0.1831 0.2476 0.0207  -0.0055 0.0276  48   HIS B N   
1596 C  CA  . HIS B 48  ? 0.2416 0.1966 0.2335 0.0096  -0.0026 0.0301  48   HIS B CA  
1597 C  C   . HIS B 48  ? 0.2520 0.1822 0.2493 0.0195  0.0011  0.0486  48   HIS B C   
1598 O  O   . HIS B 48  ? 0.2805 0.1921 0.2744 0.0303  0.0020  0.0427  48   HIS B O   
1599 C  CB  . HIS B 48  ? 0.2319 0.1906 0.2551 0.0173  -0.0072 0.0105  48   HIS B CB  
1600 C  CG  . HIS B 48  ? 0.2327 0.2031 0.2240 0.0006  0.0006  0.0038  48   HIS B CG  
1601 N  ND1 . HIS B 48  ? 0.2750 0.2493 0.2455 0.0247  -0.0170 -0.0073 48   HIS B ND1 
1602 C  CD2 . HIS B 48  ? 0.2576 0.2736 0.2703 0.0344  0.0052  0.0281  48   HIS B CD2 
1603 C  CE1 . HIS B 48  ? 0.2859 0.2703 0.3003 -0.0039 -0.0299 -0.0020 48   HIS B CE1 
1604 N  NE2 . HIS B 48  ? 0.2729 0.2422 0.2883 0.0228  -0.0013 0.0044  48   HIS B NE2 
1605 N  N   . ALA B 49  ? 0.2751 0.1811 0.2703 0.0123  -0.0052 0.0130  49   ALA B N   
1606 C  CA  . ALA B 49  ? 0.2876 0.1684 0.2775 0.0003  -0.0044 0.0274  49   ALA B CA  
1607 C  C   . ALA B 49  ? 0.2721 0.1830 0.2719 0.0203  -0.0097 0.0527  49   ALA B C   
1608 O  O   . ALA B 49  ? 0.2730 0.1978 0.3057 0.0033  0.0019  0.0300  49   ALA B O   
1609 C  CB  . ALA B 49  ? 0.2685 0.2122 0.2621 0.0285  -0.0201 0.0359  49   ALA B CB  
1610 N  N   . LEU B 50  ? 0.2945 0.1756 0.2975 0.0091  -0.0294 0.0325  50   LEU B N   
1611 C  CA  . LEU B 50  ? 0.3089 0.1823 0.3424 -0.0101 -0.0214 0.0338  50   LEU B CA  
1612 C  C   . LEU B 50  ? 0.3008 0.1752 0.3340 0.0206  -0.0059 0.0164  50   LEU B C   
1613 O  O   . LEU B 50  ? 0.3379 0.2103 0.3638 -0.0042 -0.0205 0.0242  50   LEU B O   
1614 C  CB  . LEU B 50  ? 0.3258 0.2455 0.3735 -0.0021 -0.0284 0.0672  50   LEU B CB  
1615 C  CG  . LEU B 50  ? 0.3726 0.2887 0.3729 0.0056  -0.0208 0.0666  50   LEU B CG  
1616 C  CD1 . LEU B 50  ? 0.4564 0.2860 0.4579 -0.0229 -0.0538 0.1040  50   LEU B CD1 
1617 C  CD2 . LEU B 50  ? 0.4263 0.2912 0.3597 -0.0315 0.0319  0.0620  50   LEU B CD2 
1618 N  N   . LYS B 51  ? 0.3148 0.2034 0.3779 -0.0100 -0.0023 0.0131  51   LYS B N   
1619 C  CA  A LYS B 51  ? 0.3393 0.2392 0.3913 -0.0151 -0.0084 0.0142  51   LYS B CA  
1620 C  CA  B LYS B 51  ? 0.3455 0.2392 0.3966 -0.0114 -0.0097 0.0119  51   LYS B CA  
1621 C  C   . LYS B 51  ? 0.3487 0.2130 0.3970 -0.0208 -0.0160 0.0085  51   LYS B C   
1622 O  O   . LYS B 51  ? 0.3810 0.2343 0.4136 -0.0113 -0.0379 0.0037  51   LYS B O   
1623 C  CB  A LYS B 51  ? 0.3568 0.2569 0.4255 -0.0308 -0.0024 -0.0024 51   LYS B CB  
1624 C  CB  B LYS B 51  ? 0.3672 0.2675 0.4346 -0.0268 -0.0027 -0.0085 51   LYS B CB  
1625 C  CG  A LYS B 51  ? 0.3779 0.3140 0.4719 -0.0271 -0.0269 -0.0198 51   LYS B CG  
1626 C  CG  B LYS B 51  ? 0.4044 0.2822 0.4788 0.0006  -0.0009 0.0070  51   LYS B CG  
1627 C  CD  A LYS B 51  ? 0.4121 0.3013 0.4970 -0.0412 -0.0155 -0.0242 51   LYS B CD  
1628 C  CD  B LYS B 51  ? 0.4484 0.4293 0.5683 -0.0767 -0.0175 -0.0020 51   LYS B CD  
1629 C  CE  A LYS B 51  ? 0.4288 0.2225 0.4729 -0.0364 -0.0230 0.0658  51   LYS B CE  
1630 C  CE  B LYS B 51  ? 0.5184 0.4594 0.6044 -0.0301 0.0056  -0.0090 51   LYS B CE  
1631 N  NZ  A LYS B 51  ? 0.3718 0.3115 0.5073 0.0190  -0.0501 0.0133  51   LYS B NZ  
1632 N  NZ  B LYS B 51  ? 0.5078 0.4469 0.6030 -0.0565 0.0460  0.0796  51   LYS B NZ  
1633 N  N   . ASN B 52  ? 0.3522 0.2290 0.4114 -0.0141 -0.0247 -0.0020 52   ASN B N   
1634 C  CA  . ASN B 52  ? 0.3436 0.1687 0.4078 -0.0036 -0.0507 0.0049  52   ASN B CA  
1635 C  C   . ASN B 52  ? 0.3403 0.1795 0.3914 0.0052  -0.0367 -0.0007 52   ASN B C   
1636 O  O   . ASN B 52  ? 0.3881 0.1878 0.4408 0.0005  -0.0385 0.0199  52   ASN B O   
1637 C  CB  . ASN B 52  ? 0.3734 0.1642 0.4103 -0.0073 -0.0459 -0.0076 52   ASN B CB  
1638 C  CG  . ASN B 52  ? 0.3568 0.1735 0.4681 0.0161  -0.0173 -0.0128 52   ASN B CG  
1639 O  OD1 . ASN B 52  ? 0.4795 0.3346 0.4947 0.0190  -0.0812 -0.0016 52   ASN B OD1 
1640 N  ND2 . ASN B 52  ? 0.3912 0.1721 0.4736 0.0104  -0.0079 -0.0081 52   ASN B ND2 
1641 N  N   . ASN B 53  ? 0.3281 0.1667 0.3487 0.0002  -0.0227 -0.0037 53   ASN B N   
1642 C  CA  . ASN B 53  ? 0.2889 0.1430 0.3441 0.0400  -0.0189 0.0044  53   ASN B CA  
1643 C  C   . ASN B 53  ? 0.3475 0.2161 0.3474 0.0520  -0.0317 0.0016  53   ASN B C   
1644 O  O   . ASN B 53  ? 0.3714 0.1946 0.3413 0.0099  -0.0332 0.0014  53   ASN B O   
1645 C  CB  . ASN B 53  ? 0.3039 0.1551 0.3109 0.0191  -0.0105 -0.0154 53   ASN B CB  
1646 C  CG  . ASN B 53  ? 0.2951 0.1591 0.2914 0.0211  -0.0209 -0.0067 53   ASN B CG  
1647 O  OD1 . ASN B 53  ? 0.3005 0.1573 0.2910 0.0379  -0.0135 -0.0202 53   ASN B OD1 
1648 N  ND2 . ASN B 53  ? 0.2955 0.1926 0.2804 0.0553  -0.0268 0.0112  53   ASN B ND2 
1649 N  N   . PRO B 54  ? 0.3466 0.1820 0.3819 0.0412  -0.0326 0.0064  54   PRO B N   
1650 C  CA  . PRO B 54  ? 0.3485 0.1952 0.3586 0.0488  -0.0298 -0.0095 54   PRO B CA  
1651 C  C   . PRO B 54  ? 0.3645 0.1982 0.3569 0.0439  -0.0270 -0.0313 54   PRO B C   
1652 O  O   . PRO B 54  ? 0.3577 0.1987 0.3598 0.0454  -0.0131 -0.0228 54   PRO B O   
1653 C  CB  . PRO B 54  ? 0.3977 0.1709 0.4013 0.0366  -0.0222 0.0277  54   PRO B CB  
1654 C  CG  . PRO B 54  ? 0.4155 0.2220 0.4268 0.0639  -0.0481 -0.0001 54   PRO B CG  
1655 C  CD  . PRO B 54  ? 0.3903 0.2117 0.3826 0.0165  -0.0167 0.0111  54   PRO B CD  
1656 N  N   . ASN B 55  ? 0.3474 0.1856 0.3453 0.0237  0.0056  -0.0152 55   ASN B N   
1657 C  CA  . ASN B 55  ? 0.2994 0.1859 0.3128 0.0493  -0.0024 -0.0108 55   ASN B CA  
1658 C  C   . ASN B 55  ? 0.3005 0.1985 0.3015 0.0336  -0.0335 -0.0224 55   ASN B C   
1659 O  O   . ASN B 55  ? 0.3047 0.2481 0.3224 0.0121  -0.0379 0.0342  55   ASN B O   
1660 C  CB  . ASN B 55  ? 0.3044 0.1988 0.3171 0.0417  -0.0124 -0.0047 55   ASN B CB  
1661 C  CG  . ASN B 55  ? 0.3466 0.2383 0.3290 0.0956  -0.0404 -0.0416 55   ASN B CG  
1662 O  OD1 . ASN B 55  ? 0.3665 0.2634 0.3519 0.0908  -0.0100 0.0166  55   ASN B OD1 
1663 N  ND2 . ASN B 55  ? 0.3318 0.2681 0.3279 0.1095  -0.0169 -0.0345 55   ASN B ND2 
1664 N  N   . GLY B 56  ? 0.3102 0.1897 0.3051 0.0269  -0.0169 -0.0051 56   GLY B N   
1665 C  CA  . GLY B 56  ? 0.3026 0.2275 0.3040 0.0335  -0.0263 -0.0030 56   GLY B CA  
1666 C  C   . GLY B 56  ? 0.2906 0.1788 0.2669 0.0266  -0.0328 0.0000  56   GLY B C   
1667 O  O   . GLY B 56  ? 0.3014 0.2182 0.2733 0.0400  -0.0198 0.0058  56   GLY B O   
1668 N  N   . PHE B 57  ? 0.2625 0.1723 0.2557 0.0260  -0.0234 -0.0010 57   PHE B N   
1669 C  CA  . PHE B 57  ? 0.2646 0.1681 0.2682 0.0224  -0.0373 -0.0016 57   PHE B CA  
1670 C  C   . PHE B 57  ? 0.2800 0.1966 0.3059 0.0178  -0.0145 -0.0088 57   PHE B C   
1671 O  O   . PHE B 57  ? 0.3304 0.2267 0.3533 0.0025  -0.0195 0.0157  57   PHE B O   
1672 C  CB  . PHE B 57  ? 0.2738 0.1716 0.2780 0.0347  -0.0179 0.0124  57   PHE B CB  
1673 C  CG  . PHE B 57  ? 0.2659 0.2206 0.2190 0.0176  -0.0339 -0.0060 57   PHE B CG  
1674 C  CD1 . PHE B 57  ? 0.3186 0.3018 0.3615 0.0245  -0.0243 -0.0468 57   PHE B CD1 
1675 C  CD2 . PHE B 57  ? 0.2911 0.2177 0.2532 0.0197  -0.0266 0.0167  57   PHE B CD2 
1676 C  CE1 . PHE B 57  ? 0.3161 0.3195 0.2854 0.0281  -0.0135 0.0030  57   PHE B CE1 
1677 C  CE2 . PHE B 57  ? 0.3215 0.3123 0.3069 0.0006  -0.0703 0.0295  57   PHE B CE2 
1678 C  CZ  . PHE B 57  ? 0.3445 0.3365 0.2336 -0.0138 -0.0197 -0.0169 57   PHE B CZ  
1679 N  N   . PRO B 58  ? 0.2889 0.2016 0.3243 0.0164  -0.0183 -0.0006 58   PRO B N   
1680 C  CA  . PRO B 58  ? 0.3047 0.2068 0.3447 0.0190  -0.0143 -0.0012 58   PRO B CA  
1681 C  C   . PRO B 58  ? 0.2611 0.1656 0.3139 0.0260  -0.0243 -0.0038 58   PRO B C   
1682 O  O   . PRO B 58  ? 0.2525 0.2072 0.2873 0.0089  -0.0248 0.0243  58   PRO B O   
1683 C  CB  . PRO B 58  ? 0.3357 0.2553 0.3482 0.0603  -0.0193 0.0180  58   PRO B CB  
1684 C  CG  . PRO B 58  ? 0.3583 0.2810 0.4101 0.0062  -0.0459 0.0508  58   PRO B CG  
1685 C  CD  . PRO B 58  ? 0.3133 0.2143 0.3396 0.0205  -0.0494 0.0278  58   PRO B CD  
1686 N  N   . GLU B 59  ? 0.2720 0.1649 0.3185 0.0030  -0.0116 -0.0048 59   GLU B N   
1687 C  CA  . GLU B 59  ? 0.2762 0.1896 0.3153 0.0169  -0.0111 0.0093  59   GLU B CA  
1688 C  C   . GLU B 59  ? 0.2490 0.2031 0.2854 -0.0054 -0.0043 0.0026  59   GLU B C   
1689 O  O   . GLU B 59  ? 0.2542 0.2374 0.3324 -0.0058 -0.0039 0.0168  59   GLU B O   
1690 C  CB  . GLU B 59  ? 0.2943 0.2164 0.3797 0.0027  -0.0132 -0.0197 59   GLU B CB  
1691 C  CG  . GLU B 59  ? 0.3424 0.2753 0.4094 -0.0214 0.0005  0.0048  59   GLU B CG  
1692 C  CD  . GLU B 59  ? 0.4377 0.4051 0.5649 -0.0922 -0.0039 0.0413  59   GLU B CD  
1693 O  OE1 . GLU B 59  ? 0.4114 0.4746 0.6452 -0.1163 -0.0497 0.0326  59   GLU B OE1 
1694 O  OE2 . GLU B 59  ? 0.4423 0.5435 0.6004 -0.1390 0.0904  0.0588  59   GLU B OE2 
1695 N  N   . GLY B 60  ? 0.2585 0.2376 0.3004 0.0020  -0.0129 0.0123  60   GLY B N   
1696 C  CA  . GLY B 60  ? 0.2767 0.2306 0.3185 -0.0065 -0.0055 0.0248  60   GLY B CA  
1697 C  C   . GLY B 60  ? 0.2371 0.2134 0.2743 -0.0016 -0.0080 0.0012  60   GLY B C   
1698 O  O   . GLY B 60  ? 0.2569 0.2398 0.2781 0.0271  0.0044  0.0168  60   GLY B O   
1699 N  N   . PHE B 61  ? 0.2473 0.2161 0.2901 0.0038  -0.0034 -0.0010 61   PHE B N   
1700 C  CA  . PHE B 61  ? 0.2517 0.2013 0.2754 0.0090  -0.0197 0.0176  61   PHE B CA  
1701 C  C   . PHE B 61  ? 0.2238 0.1876 0.2407 0.0135  -0.0011 -0.0004 61   PHE B C   
1702 O  O   . PHE B 61  ? 0.2587 0.2148 0.2551 0.0152  -0.0012 0.0306  61   PHE B O   
1703 C  CB  . PHE B 61  ? 0.2563 0.1928 0.2721 0.0091  -0.0117 -0.0150 61   PHE B CB  
1704 C  CG  . PHE B 61  ? 0.2565 0.2207 0.2616 0.0193  -0.0248 0.0218  61   PHE B CG  
1705 C  CD1 . PHE B 61  ? 0.2973 0.3471 0.3863 0.0393  -0.0222 0.0379  61   PHE B CD1 
1706 C  CD2 . PHE B 61  ? 0.2500 0.2340 0.2648 0.0143  -0.0265 -0.0130 61   PHE B CD2 
1707 C  CE1 . PHE B 61  ? 0.3462 0.3601 0.3767 0.0255  0.0065  0.0315  61   PHE B CE1 
1708 C  CE2 . PHE B 61  ? 0.2865 0.2331 0.2848 0.0156  -0.0002 0.0236  61   PHE B CE2 
1709 C  CZ  . PHE B 61  ? 0.3094 0.2642 0.3456 0.0242  -0.0422 0.0461  61   PHE B CZ  
1710 N  N   . TRP B 62  ? 0.2263 0.1787 0.2479 0.0018  -0.0053 0.0071  62   TRP B N   
1711 C  CA  . TRP B 62  ? 0.2326 0.1628 0.2261 0.0096  -0.0094 0.0137  62   TRP B CA  
1712 C  C   . TRP B 62  ? 0.2496 0.1870 0.2353 0.0282  -0.0181 0.0127  62   TRP B C   
1713 O  O   . TRP B 62  ? 0.2703 0.2310 0.2643 0.0129  -0.0195 0.0310  62   TRP B O   
1714 C  CB  . TRP B 62  ? 0.2413 0.1670 0.2457 0.0030  -0.0226 0.0139  62   TRP B CB  
1715 C  CG  . TRP B 62  ? 0.2332 0.1404 0.2305 0.0335  -0.0273 0.0078  62   TRP B CG  
1716 C  CD1 . TRP B 62  ? 0.2545 0.2026 0.2325 0.0164  -0.0083 -0.0088 62   TRP B CD1 
1717 C  CD2 . TRP B 62  ? 0.2158 0.2073 0.2215 0.0153  -0.0222 0.0080  62   TRP B CD2 
1718 N  NE1 . TRP B 62  ? 0.2342 0.2004 0.2390 0.0287  -0.0024 0.0085  62   TRP B NE1 
1719 C  CE2 . TRP B 62  ? 0.2340 0.2205 0.1886 0.0225  -0.0084 0.0172  62   TRP B CE2 
1720 C  CE3 . TRP B 62  ? 0.2478 0.2460 0.2335 0.0323  -0.0129 0.0030  62   TRP B CE3 
1721 C  CZ2 . TRP B 62  ? 0.2472 0.2533 0.1956 0.0203  -0.0355 0.0052  62   TRP B CZ2 
1722 C  CZ3 . TRP B 62  ? 0.2669 0.2292 0.2136 0.0184  -0.0058 -0.0105 62   TRP B CZ3 
1723 C  CH2 . TRP B 62  ? 0.2602 0.2861 0.2558 0.0035  -0.0030 0.0370  62   TRP B CH2 
1724 N  N   . MET B 63  ? 0.2416 0.1975 0.2088 0.0171  -0.0212 0.0146  63   MET B N   
1725 C  CA  . MET B 63  ? 0.2393 0.2276 0.2260 0.0192  -0.0278 0.0064  63   MET B CA  
1726 C  C   . MET B 63  ? 0.2187 0.1809 0.2079 0.0282  -0.0287 0.0193  63   MET B C   
1727 O  O   . MET B 63  ? 0.2596 0.2073 0.1997 0.0278  -0.0206 0.0154  63   MET B O   
1728 C  CB  . MET B 63  ? 0.2970 0.2307 0.2526 0.0188  -0.0033 0.0165  63   MET B CB  
1729 C  CG  . MET B 63  ? 0.3025 0.2788 0.2621 0.0242  -0.0047 0.0342  63   MET B CG  
1730 S  SD  . MET B 63  ? 0.3608 0.3282 0.3388 0.0177  -0.0242 0.0000  63   MET B SD  
1731 C  CE  . MET B 63  ? 0.3816 0.2888 0.2904 0.1319  -0.0134 -0.0267 63   MET B CE  
1732 N  N   . PRO B 64  ? 0.2538 0.2386 0.2331 0.0097  -0.0168 0.0160  64   PRO B N   
1733 C  CA  . PRO B 64  ? 0.2491 0.2409 0.2140 0.0251  -0.0150 0.0059  64   PRO B CA  
1734 C  C   . PRO B 64  ? 0.2424 0.2453 0.2100 0.0282  -0.0049 0.0088  64   PRO B C   
1735 O  O   . PRO B 64  ? 0.2751 0.2580 0.2553 0.0370  -0.0195 -0.0004 64   PRO B O   
1736 C  CB  . PRO B 64  ? 0.2519 0.2450 0.2750 0.0280  -0.0433 0.0165  64   PRO B CB  
1737 C  CG  . PRO B 64  ? 0.2848 0.2491 0.2771 0.0201  -0.0200 0.0263  64   PRO B CG  
1738 C  CD  . PRO B 64  ? 0.2814 0.2326 0.2418 0.0026  -0.0276 0.0244  64   PRO B CD  
1739 N  N   . TYR B 65  ? 0.2503 0.2532 0.2092 0.0211  -0.0031 0.0271  65   TYR B N   
1740 C  CA  . TYR B 65  ? 0.2399 0.2534 0.1939 0.0245  0.0011  0.0020  65   TYR B CA  
1741 C  C   . TYR B 65  ? 0.2572 0.2792 0.2306 0.0486  -0.0035 0.0160  65   TYR B C   
1742 O  O   . TYR B 65  ? 0.2648 0.2940 0.2712 0.0605  -0.0002 0.0015  65   TYR B O   
1743 C  CB  . TYR B 65  ? 0.2511 0.2759 0.2025 0.0228  0.0121  0.0104  65   TYR B CB  
1744 C  CG  . TYR B 65  ? 0.2837 0.2823 0.2288 0.0320  -0.0070 0.0010  65   TYR B CG  
1745 C  CD1 . TYR B 65  ? 0.2658 0.3771 0.3547 -0.0039 -0.0365 -0.0029 65   TYR B CD1 
1746 C  CD2 . TYR B 65  ? 0.2529 0.2652 0.2650 0.0073  -0.0334 0.0039  65   TYR B CD2 
1747 C  CE1 . TYR B 65  ? 0.3587 0.3696 0.3268 -0.0714 -0.0828 -0.0090 65   TYR B CE1 
1748 C  CE2 . TYR B 65  ? 0.2983 0.3224 0.2626 0.0005  -0.0043 0.0058  65   TYR B CE2 
1749 C  CZ  . TYR B 65  ? 0.3055 0.2654 0.2420 0.0151  -0.0011 0.0035  65   TYR B CZ  
1750 O  OH  . TYR B 65  ? 0.3736 0.3079 0.2556 0.0410  -0.0284 0.0079  65   TYR B OH  
1751 N  N   . LEU B 66  ? 0.2441 0.2513 0.2250 0.0376  0.0008  0.0095  66   LEU B N   
1752 C  CA  . LEU B 66  ? 0.2587 0.2872 0.2468 0.0525  -0.0108 0.0024  66   LEU B CA  
1753 C  C   . LEU B 66  ? 0.2593 0.3185 0.2444 0.0603  -0.0184 0.0019  66   LEU B C   
1754 O  O   . LEU B 66  ? 0.2829 0.3100 0.2893 0.0415  -0.0367 0.0076  66   LEU B O   
1755 C  CB  . LEU B 66  ? 0.2604 0.2393 0.2497 0.0493  -0.0003 0.0284  66   LEU B CB  
1756 C  CG  . LEU B 66  ? 0.2585 0.2364 0.2388 0.0507  -0.0193 0.0289  66   LEU B CG  
1757 C  CD1 . LEU B 66  ? 0.2661 0.2035 0.2320 0.0459  -0.0229 0.0320  66   LEU B CD1 
1758 C  CD2 . LEU B 66  ? 0.2719 0.2702 0.2823 0.0539  -0.0173 -0.0278 66   LEU B CD2 
1759 N  N   . THR B 67  ? 0.2819 0.2857 0.2519 0.0664  -0.0232 0.0162  67   THR B N   
1760 C  CA  . THR B 67  ? 0.2770 0.3508 0.2680 0.0622  -0.0330 0.0058  67   THR B CA  
1761 C  C   . THR B 67  ? 0.3022 0.3224 0.2604 0.0707  -0.0403 0.0162  67   THR B C   
1762 O  O   . THR B 67  ? 0.3350 0.3462 0.3214 0.0984  -0.0406 0.0118  67   THR B O   
1763 C  CB  . THR B 67  ? 0.2777 0.3841 0.2826 0.0702  -0.0480 -0.0044 67   THR B CB  
1764 O  OG1 . THR B 67  ? 0.2635 0.3741 0.2984 0.0630  -0.0066 -0.0042 67   THR B OG1 
1765 C  CG2 . THR B 67  ? 0.2945 0.3823 0.3110 0.0605  -0.0810 -0.0113 67   THR B CG2 
1766 N  N   . ILE B 68  ? 0.3250 0.3092 0.2762 0.0765  -0.0377 0.0299  68   ILE B N   
1767 C  CA  . ILE B 68  ? 0.3330 0.3424 0.2315 0.0729  -0.0574 0.0223  68   ILE B CA  
1768 C  C   . ILE B 68  ? 0.3011 0.3542 0.2518 0.0630  -0.0459 0.0123  68   ILE B C   
1769 O  O   . ILE B 68  ? 0.3161 0.3981 0.2817 0.0841  -0.0703 -0.0013 68   ILE B O   
1770 C  CB  . ILE B 68  ? 0.3392 0.3645 0.2453 0.0524  -0.0546 0.0289  68   ILE B CB  
1771 C  CG1 . ILE B 68  ? 0.3550 0.3586 0.2566 0.0511  -0.0551 0.0171  68   ILE B CG1 
1772 C  CG2 . ILE B 68  ? 0.3663 0.2977 0.2736 0.0636  -0.0409 0.0413  68   ILE B CG2 
1773 C  CD1 . ILE B 68  ? 0.3375 0.3621 0.3176 0.0619  -0.0752 0.0616  68   ILE B CD1 
1774 N  N   . ALA B 69  ? 0.3239 0.3416 0.2349 0.0806  -0.0326 0.0323  69   ALA B N   
1775 C  CA  . ALA B 69  ? 0.3367 0.3437 0.2427 0.0806  -0.0436 0.0324  69   ALA B CA  
1776 C  C   . ALA B 69  ? 0.3783 0.3923 0.2828 0.0725  -0.0301 0.0359  69   ALA B C   
1777 O  O   . ALA B 69  ? 0.3679 0.3949 0.2680 0.0482  -0.0046 0.0207  69   ALA B O   
1778 C  CB  . ALA B 69  ? 0.3383 0.4165 0.3049 0.0862  -0.0532 0.0329  69   ALA B CB  
1779 N  N   . TYR B 70  ? 0.2729 0.3347 0.2847 0.0146  -0.0293 0.0124  70   TYR B N   
1780 C  CA  . TYR B 70  ? 0.2435 0.3419 0.2458 0.0081  -0.0397 0.0306  70   TYR B CA  
1781 C  C   . TYR B 70  ? 0.2457 0.3178 0.2653 0.0034  -0.0438 0.0160  70   TYR B C   
1782 O  O   . TYR B 70  ? 0.2432 0.3180 0.2462 0.0022  -0.0470 0.0415  70   TYR B O   
1783 C  CB  . TYR B 70  ? 0.2639 0.3580 0.2523 0.0155  -0.0585 0.0437  70   TYR B CB  
1784 C  CG  . TYR B 70  ? 0.2029 0.3928 0.2746 0.0351  -0.0553 0.0276  70   TYR B CG  
1785 C  CD1 . TYR B 70  ? 0.3101 0.3898 0.2531 0.0022  -0.0534 0.0620  70   TYR B CD1 
1786 C  CD2 . TYR B 70  ? 0.2998 0.4142 0.3261 0.0177  -0.0390 0.0356  70   TYR B CD2 
1787 C  CE1 . TYR B 70  ? 0.3664 0.3937 0.3216 0.0353  -0.0496 0.0060  70   TYR B CE1 
1788 C  CE2 . TYR B 70  ? 0.3081 0.3940 0.3343 0.0460  -0.0267 0.0102  70   TYR B CE2 
1789 C  CZ  . TYR B 70  ? 0.3534 0.4166 0.3305 0.0548  -0.0135 0.0212  70   TYR B CZ  
1790 O  OH  . TYR B 70  ? 0.3843 0.4180 0.3581 0.0288  -0.0141 0.0288  70   TYR B OH  
1791 N  N   . GLU B 71  ? 0.2800 0.3073 0.2359 -0.0238 -0.0606 0.0080  71   GLU B N   
1792 C  CA  . GLU B 71  ? 0.2557 0.3262 0.2714 -0.0159 -0.0525 0.0419  71   GLU B CA  
1793 C  C   . GLU B 71  ? 0.2779 0.3161 0.2581 -0.0297 -0.0456 0.0272  71   GLU B C   
1794 O  O   . GLU B 71  ? 0.3170 0.3958 0.2763 -0.0383 -0.0546 0.0366  71   GLU B O   
1795 C  CB  . GLU B 71  ? 0.3499 0.3468 0.3208 0.0086  -0.0424 0.0262  71   GLU B CB  
1796 C  CG  . GLU B 71  ? 0.3996 0.3781 0.3419 -0.0370 -0.0650 0.0193  71   GLU B CG  
1797 C  CD  . GLU B 71  ? 0.5826 0.5019 0.5425 0.0956  -0.0926 0.0446  71   GLU B CD  
1798 O  OE1 . GLU B 71  ? 0.5485 0.5741 0.6141 0.0837  -0.0996 -0.0061 71   GLU B OE1 
1799 O  OE2 . GLU B 71  ? 0.8181 0.5634 0.6248 0.0047  -0.0749 0.0630  71   GLU B OE2 
1800 N  N   . LEU B 72  ? 0.2494 0.3176 0.2905 -0.0573 -0.0494 0.0340  72   LEU B N   
1801 C  CA  . LEU B 72  ? 0.2562 0.3518 0.2687 -0.0379 -0.0528 0.0331  72   LEU B CA  
1802 C  C   . LEU B 72  ? 0.2594 0.3408 0.2986 -0.0313 -0.0516 0.0357  72   LEU B C   
1803 O  O   . LEU B 72  ? 0.2564 0.3431 0.2768 -0.0529 -0.0228 0.0392  72   LEU B O   
1804 C  CB  . LEU B 72  ? 0.2725 0.3537 0.2473 -0.0136 -0.0639 0.0485  72   LEU B CB  
1805 C  CG  . LEU B 72  ? 0.3033 0.4641 0.3249 0.0123  -0.0148 0.0562  72   LEU B CG  
1806 C  CD1 . LEU B 72  ? 0.3021 0.4858 0.2976 -0.0155 -0.0359 0.0183  72   LEU B CD1 
1807 C  CD2 . LEU B 72  ? 0.4176 0.4266 0.4013 0.0145  0.0050  0.0446  72   LEU B CD2 
1808 N  N   . LYS B 73  ? 0.2632 0.3503 0.2554 -0.0449 -0.0482 0.0537  73   LYS B N   
1809 C  CA  A LYS B 73  ? 0.2810 0.3351 0.2730 -0.0521 -0.0651 0.0502  73   LYS B CA  
1810 C  CA  B LYS B 73  ? 0.2637 0.3265 0.2651 -0.0523 -0.0669 0.0475  73   LYS B CA  
1811 C  C   . LYS B 73  ? 0.2737 0.3351 0.2714 -0.0658 -0.0665 0.0594  73   LYS B C   
1812 O  O   . LYS B 73  ? 0.2708 0.3986 0.2559 -0.0599 -0.0661 0.0497  73   LYS B O   
1813 C  CB  A LYS B 73  ? 0.3619 0.3498 0.3272 -0.0654 -0.0580 0.0414  73   LYS B CB  
1814 C  CB  B LYS B 73  ? 0.3076 0.3416 0.3080 -0.0523 -0.0488 0.0378  73   LYS B CB  
1815 C  CG  A LYS B 73  ? 0.3557 0.3933 0.3981 -0.0723 -0.0693 -0.0004 73   LYS B CG  
1816 C  CG  B LYS B 73  ? 0.3117 0.3426 0.3369 -0.0740 -0.0904 0.0393  73   LYS B CG  
1817 C  CD  A LYS B 73  ? 0.5136 0.4639 0.4856 -0.0253 -0.0983 0.0579  73   LYS B CD  
1818 C  CD  B LYS B 73  ? 0.4771 0.3780 0.4432 -0.0125 -0.0623 0.0522  73   LYS B CD  
1819 C  CE  A LYS B 73  ? 0.5839 0.4945 0.5035 -0.0368 -0.1239 0.0239  73   LYS B CE  
1820 C  CE  B LYS B 73  ? 0.5533 0.4438 0.4017 -0.0489 -0.0667 0.0526  73   LYS B CE  
1821 N  NZ  A LYS B 73  ? 0.5885 0.5208 0.5348 0.0082  -0.0903 0.0344  73   LYS B NZ  
1822 N  NZ  B LYS B 73  ? 0.5189 0.4252 0.3245 -0.0096 -0.0910 0.0554  73   LYS B NZ  
1823 N  N   . ASN B 74  ? 0.2529 0.3369 0.2526 -0.0750 -0.0639 0.0546  74   ASN B N   
1824 C  CA  . ASN B 74  ? 0.2747 0.3960 0.2862 -0.0762 -0.0598 0.0365  74   ASN B CA  
1825 C  C   . ASN B 74  ? 0.3073 0.3885 0.2491 -0.1009 -0.0683 0.0652  74   ASN B C   
1826 O  O   . ASN B 74  ? 0.3132 0.3880 0.3083 -0.0833 -0.0774 0.0505  74   ASN B O   
1827 C  CB  . ASN B 74  ? 0.2554 0.3550 0.2437 -0.0791 -0.0537 0.0649  74   ASN B CB  
1828 C  CG  . ASN B 74  ? 0.2644 0.4365 0.2781 -0.0536 -0.0308 0.0515  74   ASN B CG  
1829 O  OD1 . ASN B 74  ? 0.3213 0.4381 0.2610 -0.0421 -0.0609 0.0693  74   ASN B OD1 
1830 N  ND2 . ASN B 74  ? 0.2675 0.4364 0.2005 -0.0302 -0.0594 0.0580  74   ASN B ND2 
1831 N  N   . THR B 75  ? 0.3098 0.3858 0.2811 -0.1136 -0.0796 0.0522  75   THR B N   
1832 C  CA  . THR B 75  ? 0.4053 0.4262 0.3138 -0.1125 -0.0698 0.1005  75   THR B CA  
1833 C  C   . THR B 75  ? 0.4038 0.4303 0.3311 -0.1233 -0.0853 0.0977  75   THR B C   
1834 O  O   . THR B 75  ? 0.4303 0.4445 0.3739 -0.1219 -0.1005 0.1156  75   THR B O   
1835 C  CB  . THR B 75  ? 0.4735 0.4234 0.3189 -0.1499 -0.0721 0.0903  75   THR B CB  
1836 O  OG1 . THR B 75  ? 0.4020 0.5296 0.4075 -0.2395 -0.0488 0.0719  75   THR B OG1 
1837 C  CG2 . THR B 75  ? 0.6027 0.5298 0.3569 -0.1342 -0.0627 0.0677  75   THR B CG2 
1838 N  N   . ASP B 76  ? 0.3574 0.4617 0.3148 -0.1337 -0.0738 0.0893  76   ASP B N   
1839 C  CA  . ASP B 76  ? 0.3733 0.4720 0.3169 -0.1132 -0.0947 0.1069  76   ASP B CA  
1840 C  C   . ASP B 76  ? 0.3631 0.4086 0.3232 -0.0947 -0.0875 0.1168  76   ASP B C   
1841 O  O   . ASP B 76  ? 0.3418 0.4242 0.3390 -0.1142 -0.1375 0.1021  76   ASP B O   
1842 C  CB  . ASP B 76  ? 0.3620 0.5413 0.2910 -0.0996 -0.0831 0.0820  76   ASP B CB  
1843 C  CG  . ASP B 76  ? 0.3938 0.6291 0.2951 -0.1201 -0.0866 0.0909  76   ASP B CG  
1844 O  OD1 . ASP B 76  ? 0.4315 0.6672 0.3308 -0.2034 -0.0353 0.1403  76   ASP B OD1 
1845 O  OD2 . ASP B 76  ? 0.3678 0.7308 0.2441 -0.0278 -0.0574 0.0503  76   ASP B OD2 
1846 N  N   . THR B 77  ? 0.3148 0.3683 0.2699 -0.0678 -0.0840 0.1150  77   THR B N   
1847 C  CA  . THR B 77  ? 0.2999 0.3223 0.2600 -0.0444 -0.0743 0.0965  77   THR B CA  
1848 C  C   . THR B 77  ? 0.3035 0.2984 0.3103 -0.0456 -0.0765 0.0808  77   THR B C   
1849 O  O   . THR B 77  ? 0.2980 0.3131 0.3019 -0.0278 -0.0756 0.0698  77   THR B O   
1850 C  CB  . THR B 77  ? 0.2788 0.3136 0.2654 -0.0377 -0.0691 0.0650  77   THR B CB  
1851 O  OG1 . THR B 77  ? 0.2711 0.3446 0.2567 -0.0376 -0.0399 0.0439  77   THR B OG1 
1852 C  CG2 . THR B 77  ? 0.2873 0.4154 0.2429 -0.0210 -0.0615 0.0387  77   THR B CG2 
1853 N  N   . GLY B 78  ? 0.3345 0.3239 0.3204 -0.0400 -0.0766 0.0789  78   GLY B N   
1854 C  CA  . GLY B 78  ? 0.3451 0.3281 0.3568 -0.0299 -0.0680 0.0634  78   GLY B CA  
1855 C  C   . GLY B 78  ? 0.3256 0.3564 0.3119 -0.0142 -0.0751 0.0569  78   GLY B C   
1856 O  O   . GLY B 78  ? 0.2991 0.3501 0.3308 -0.0459 -0.0648 0.0366  78   GLY B O   
1857 N  N   . ALA B 79  ? 0.2975 0.3098 0.2807 -0.0388 -0.0739 0.0507  79   ALA B N   
1858 C  CA  . ALA B 79  ? 0.2802 0.3018 0.2715 -0.0303 -0.0915 0.0513  79   ALA B CA  
1859 C  C   . ALA B 79  ? 0.2692 0.2808 0.2726 -0.0391 -0.0640 0.0535  79   ALA B C   
1860 O  O   . ALA B 79  ? 0.2804 0.3382 0.2854 -0.0634 -0.0666 0.0405  79   ALA B O   
1861 C  CB  . ALA B 79  ? 0.3157 0.3073 0.2803 -0.0061 -0.0719 0.0091  79   ALA B CB  
1862 N  N   . ILE B 80  ? 0.2665 0.3058 0.2805 -0.0342 -0.0585 0.0400  80   ILE B N   
1863 C  CA  . ILE B 80  ? 0.2567 0.3192 0.2551 -0.0288 -0.0833 0.0402  80   ILE B CA  
1864 C  C   . ILE B 80  ? 0.2595 0.3349 0.3024 -0.0378 -0.0413 0.0413  80   ILE B C   
1865 O  O   . ILE B 80  ? 0.2876 0.3540 0.3043 -0.0468 -0.0488 0.0300  80   ILE B O   
1866 C  CB  . ILE B 80  ? 0.3026 0.3425 0.3147 0.0060  -0.0881 0.0150  80   ILE B CB  
1867 C  CG1 . ILE B 80  ? 0.3629 0.4188 0.3888 -0.0381 -0.0617 0.0207  80   ILE B CG1 
1868 C  CG2 . ILE B 80  ? 0.3485 0.4925 0.3182 0.0599  -0.1098 0.0127  80   ILE B CG2 
1869 C  CD1 . ILE B 80  ? 0.4241 0.5357 0.5542 0.0439  -0.0802 0.0517  80   ILE B CD1 
1870 N  N   . LYS B 81  ? 0.2705 0.3324 0.2838 -0.0405 -0.0378 0.0436  81   LYS B N   
1871 C  CA  . LYS B 81  ? 0.3041 0.3575 0.3275 -0.0352 -0.0552 0.0528  81   LYS B CA  
1872 C  C   . LYS B 81  ? 0.2544 0.3471 0.3002 -0.0091 -0.0419 0.0596  81   LYS B C   
1873 O  O   . LYS B 81  ? 0.3046 0.3834 0.3118 -0.0455 -0.0067 0.0336  81   LYS B O   
1874 C  CB  . LYS B 81  ? 0.3861 0.3963 0.3516 -0.0112 -0.0678 0.0624  81   LYS B CB  
1875 C  CG  . LYS B 81  ? 0.3605 0.4350 0.3812 -0.0513 -0.0349 0.0400  81   LYS B CG  
1876 C  CD  . LYS B 81  ? 0.5271 0.4592 0.4476 -0.0087 -0.0673 0.0421  81   LYS B CD  
1877 C  CE  . LYS B 81  ? 0.4819 0.4306 0.3872 -0.0311 -0.1067 0.0915  81   LYS B CE  
1878 N  NZ  . LYS B 81  ? 0.4087 0.3862 0.3392 -0.0039 -0.1083 0.0451  81   LYS B NZ  
1879 N  N   . ARG B 82  ? 0.2638 0.3662 0.3094 -0.0207 -0.0216 0.0644  82   ARG B N   
1880 C  CA  . ARG B 82  ? 0.2523 0.3739 0.3098 0.0053  -0.0458 0.0540  82   ARG B CA  
1881 C  C   . ARG B 82  ? 0.2300 0.3626 0.2894 -0.0167 -0.0050 0.0477  82   ARG B C   
1882 O  O   . ARG B 82  ? 0.3062 0.3515 0.2862 -0.0315 -0.0208 0.0649  82   ARG B O   
1883 C  CB  . ARG B 82  ? 0.3111 0.4032 0.3253 0.0152  -0.0041 0.0391  82   ARG B CB  
1884 C  CG  . ARG B 82  ? 0.4139 0.4936 0.4478 0.0224  -0.0291 0.0853  82   ARG B CG  
1885 C  CD  . ARG B 82  ? 0.4707 0.5491 0.4718 0.0985  -0.0452 0.0569  82   ARG B CD  
1886 N  NE  . ARG B 82  ? 0.5782 0.6249 0.4211 0.0875  -0.1089 0.0818  82   ARG B NE  
1887 C  CZ  . ARG B 82  ? 0.3875 0.5598 0.4530 0.0925  -0.0890 0.0611  82   ARG B CZ  
1888 N  NH1 . ARG B 82  ? 0.4355 0.5351 0.3556 0.0731  -0.0465 0.0683  82   ARG B NH1 
1889 N  NH2 . ARG B 82  ? 0.4233 0.5585 0.4172 0.0701  -0.1226 0.0284  82   ARG B NH2 
1890 N  N   . GLY B 83  ? 0.2402 0.3437 0.2794 -0.0014 -0.0250 0.0570  83   GLY B N   
1891 C  CA  . GLY B 83  ? 0.2464 0.3648 0.2830 -0.0155 -0.0346 0.0684  83   GLY B CA  
1892 C  C   . GLY B 83  ? 0.2470 0.3870 0.2598 0.0116  -0.0102 0.0591  83   GLY B C   
1893 O  O   . GLY B 83  ? 0.2721 0.3814 0.3104 0.0278  -0.0043 0.0494  83   GLY B O   
1894 N  N   . THR B 84  ? 0.2789 0.3610 0.2937 0.0383  0.0045  0.0608  84   THR B N   
1895 C  CA  . THR B 84  ? 0.2514 0.3751 0.2849 0.0424  -0.0174 0.0681  84   THR B CA  
1896 C  C   . THR B 84  ? 0.2864 0.3812 0.2909 0.0529  -0.0308 0.0519  84   THR B C   
1897 O  O   . THR B 84  ? 0.3570 0.3986 0.3340 0.0457  -0.0741 0.0435  84   THR B O   
1898 C  CB  . THR B 84  ? 0.3045 0.4499 0.3119 0.0451  -0.0052 0.0666  84   THR B CB  
1899 O  OG1 . THR B 84  ? 0.4665 0.5628 0.4539 -0.0603 0.0160  0.1109  84   THR B OG1 
1900 C  CG2 . THR B 84  ? 0.2819 0.5017 0.3219 0.0475  0.0272  0.1193  84   THR B CG2 
1901 N  N   . LEU B 85  ? 0.3442 0.3897 0.2293 0.0786  -0.0201 -0.0121 85   LEU B N   
1902 C  CA  . LEU B 85  ? 0.3334 0.4067 0.2439 0.0748  -0.0056 0.0039  85   LEU B CA  
1903 C  C   . LEU B 85  ? 0.3326 0.4040 0.2556 0.0791  -0.0157 0.0098  85   LEU B C   
1904 O  O   . LEU B 85  ? 0.4212 0.4378 0.3013 0.1068  0.0065  0.0087  85   LEU B O   
1905 C  CB  . LEU B 85  ? 0.3626 0.4206 0.2663 0.0519  -0.0311 0.0015  85   LEU B CB  
1906 C  CG  . LEU B 85  ? 0.3655 0.3764 0.2929 0.0128  -0.0058 -0.0122 85   LEU B CG  
1907 C  CD1 . LEU B 85  ? 0.3284 0.4402 0.3891 0.0295  -0.0379 -0.0616 85   LEU B CD1 
1908 C  CD2 . LEU B 85  ? 0.3341 0.4076 0.2476 0.0856  -0.0330 0.0205  85   LEU B CD2 
1909 N  N   . MET B 86  ? 0.2598 0.3794 0.2174 0.0475  -0.0350 -0.0121 86   MET B N   
1910 C  CA  . MET B 86  ? 0.2476 0.3716 0.2598 0.0373  0.0042  0.0025  86   MET B CA  
1911 C  C   . MET B 86  ? 0.2552 0.2827 0.2045 0.0474  -0.0125 -0.0108 86   MET B C   
1912 O  O   . MET B 86  ? 0.2369 0.3043 0.2206 0.0493  0.0116  0.0056  86   MET B O   
1913 C  CB  . MET B 86  ? 0.2816 0.3909 0.2962 0.0244  -0.0175 -0.0068 86   MET B CB  
1914 C  CG  . MET B 86  ? 0.2704 0.4237 0.2412 0.0071  -0.0245 -0.0011 86   MET B CG  
1915 S  SD  . MET B 86  ? 0.3699 0.4614 0.3544 -0.0033 -0.0039 -0.0075 86   MET B SD  
1916 C  CE  . MET B 86  ? 0.4186 0.5663 0.3677 -0.0102 -0.0318 0.0290  86   MET B CE  
1917 N  N   . PRO B 87  ? 0.2343 0.2746 0.2000 0.0468  0.0006  -0.0094 87   PRO B N   
1918 C  CA  . PRO B 87  ? 0.2492 0.2649 0.2075 0.0386  -0.0096 -0.0008 87   PRO B CA  
1919 C  C   . PRO B 87  ? 0.2347 0.2759 0.1997 0.0378  -0.0137 -0.0162 87   PRO B C   
1920 O  O   . PRO B 87  ? 0.2274 0.3036 0.2074 0.0399  0.0058  -0.0103 87   PRO B O   
1921 C  CB  . PRO B 87  ? 0.2653 0.2603 0.2088 0.0493  0.0048  -0.0048 87   PRO B CB  
1922 C  CG  . PRO B 87  ? 0.2412 0.2666 0.1705 0.0376  -0.0049 -0.0275 87   PRO B CG  
1923 C  CD  . PRO B 87  ? 0.2477 0.3032 0.1991 0.0487  -0.0020 -0.0017 87   PRO B CD  
1924 N  N   . MET B 88  ? 0.2330 0.2801 0.2064 0.0284  -0.0067 -0.0053 88   MET B N   
1925 C  CA  . MET B 88  ? 0.2313 0.2957 0.2360 0.0365  -0.0147 -0.0078 88   MET B CA  
1926 C  C   . MET B 88  ? 0.2395 0.2985 0.2378 0.0156  -0.0140 0.0120  88   MET B C   
1927 O  O   . MET B 88  ? 0.2364 0.2706 0.2221 0.0122  -0.0010 -0.0087 88   MET B O   
1928 C  CB  . MET B 88  ? 0.2532 0.3230 0.2423 0.0160  -0.0060 -0.0087 88   MET B CB  
1929 C  CG  . MET B 88  ? 0.2711 0.3435 0.2422 -0.0030 -0.0424 0.0291  88   MET B CG  
1930 S  SD  . MET B 88  ? 0.3150 0.3983 0.2590 0.0216  -0.0129 -0.0032 88   MET B SD  
1931 C  CE  . MET B 88  ? 0.3774 0.3573 0.2715 0.0981  0.0115  -0.0120 88   MET B CE  
1932 N  N   . VAL B 89  ? 0.2211 0.2586 0.1868 0.0230  -0.0111 -0.0173 89   VAL B N   
1933 C  CA  . VAL B 89  ? 0.2230 0.2859 0.2213 0.0127  -0.0025 -0.0117 89   VAL B CA  
1934 C  C   . VAL B 89  ? 0.2415 0.3086 0.2356 0.0317  -0.0213 -0.0138 89   VAL B C   
1935 O  O   . VAL B 89  ? 0.2190 0.3247 0.2394 0.0378  -0.0327 -0.0231 89   VAL B O   
1936 C  CB  . VAL B 89  ? 0.2363 0.2466 0.2228 0.0095  -0.0054 -0.0139 89   VAL B CB  
1937 C  CG1 . VAL B 89  ? 0.2624 0.2399 0.2033 -0.0139 0.0040  0.0032  89   VAL B CG1 
1938 C  CG2 . VAL B 89  ? 0.2028 0.2300 0.2067 0.0051  -0.0120 0.0004  89   VAL B CG2 
1939 N  N   . ALA B 90  ? 0.2536 0.3239 0.2354 0.0147  0.0031  -0.0263 90   ALA B N   
1940 C  CA  . ALA B 90  ? 0.2262 0.3294 0.2523 0.0146  0.0111  -0.0159 90   ALA B CA  
1941 C  C   . ALA B 90  ? 0.2328 0.2831 0.2376 0.0119  -0.0013 -0.0016 90   ALA B C   
1942 O  O   . ALA B 90  ? 0.2294 0.2879 0.2370 0.0363  0.0115  0.0119  90   ALA B O   
1943 C  CB  . ALA B 90  ? 0.2862 0.3621 0.2634 0.0128  0.0187  -0.0015 90   ALA B CB  
1944 N  N   . ASP B 91  ? 0.2219 0.3168 0.2368 0.0135  0.0126  -0.0139 91   ASP B N   
1945 C  CA  . ASP B 91  ? 0.2214 0.3414 0.2598 0.0334  -0.0060 -0.0184 91   ASP B CA  
1946 C  C   . ASP B 91  ? 0.2158 0.3645 0.2517 0.0368  -0.0101 -0.0076 91   ASP B C   
1947 O  O   . ASP B 91  ? 0.2185 0.3739 0.2426 0.0161  -0.0123 -0.0364 91   ASP B O   
1948 C  CB  . ASP B 91  ? 0.2769 0.3856 0.2966 0.0533  0.0196  -0.0435 91   ASP B CB  
1949 C  CG  . ASP B 91  ? 0.3257 0.4807 0.3620 0.0976  0.0491  0.0096  91   ASP B CG  
1950 O  OD1 . ASP B 91  ? 0.2928 0.4496 0.3162 0.0302  0.0284  0.0210  91   ASP B OD1 
1951 O  OD2 . ASP B 91  ? 0.3600 0.5336 0.3992 0.0532  0.0993  -0.0528 91   ASP B OD2 
1952 N  N   . ASP B 92  ? 0.2232 0.3512 0.2619 0.0263  -0.0175 -0.0078 92   ASP B N   
1953 C  CA  . ASP B 92  ? 0.2446 0.4084 0.2977 0.0019  -0.0089 -0.0153 92   ASP B CA  
1954 C  C   . ASP B 92  ? 0.2449 0.3839 0.3212 0.0016  0.0043  -0.0117 92   ASP B C   
1955 O  O   . ASP B 92  ? 0.2751 0.3739 0.3314 -0.0343 0.0217  -0.0058 92   ASP B O   
1956 C  CB  . ASP B 92  ? 0.2876 0.4437 0.3200 -0.0158 0.0220  0.0002  92   ASP B CB  
1957 C  CG  . ASP B 92  ? 0.3218 0.5237 0.3351 0.0188  0.0065  -0.0097 92   ASP B CG  
1958 O  OD1 . ASP B 92  ? 0.3420 0.5001 0.3410 0.0004  -0.0400 0.0245  92   ASP B OD1 
1959 O  OD2 . ASP B 92  ? 0.5280 0.6283 0.5205 -0.0907 0.0298  0.0713  92   ASP B OD2 
1960 N  N   . GLY B 93  ? 0.2636 0.3614 0.2881 0.0127  -0.0028 -0.0141 93   GLY B N   
1961 C  CA  . GLY B 93  ? 0.2503 0.3115 0.2738 0.0016  -0.0114 -0.0050 93   GLY B CA  
1962 C  C   . GLY B 93  ? 0.2344 0.2480 0.2219 -0.0124 -0.0093 0.0124  93   GLY B C   
1963 O  O   . GLY B 93  ? 0.2442 0.2628 0.2129 0.0288  -0.0096 0.0126  93   GLY B O   
1964 N  N   . PRO B 94  ? 0.2283 0.2689 0.2260 0.0003  -0.0141 0.0160  94   PRO B N   
1965 C  CA  . PRO B 94  ? 0.2228 0.2636 0.2330 0.0105  -0.0176 0.0003  94   PRO B CA  
1966 C  C   . PRO B 94  ? 0.2179 0.2891 0.2286 0.0010  -0.0301 0.0123  94   PRO B C   
1967 O  O   . PRO B 94  ? 0.2410 0.2528 0.2517 0.0126  -0.0299 0.0198  94   PRO B O   
1968 C  CB  . PRO B 94  ? 0.2472 0.2950 0.2179 0.0177  -0.0278 0.0064  94   PRO B CB  
1969 C  CG  . PRO B 94  ? 0.2586 0.2275 0.2387 0.0103  -0.0108 -0.0022 94   PRO B CG  
1970 C  CD  . PRO B 94  ? 0.2396 0.2630 0.2580 0.0077  -0.0203 0.0129  94   PRO B CD  
1971 N  N   . HIS B 95  ? 0.2387 0.2755 0.2083 0.0179  -0.0253 0.0146  95   HIS B N   
1972 C  CA  . HIS B 95  ? 0.2313 0.2487 0.2058 0.0165  -0.0152 0.0196  95   HIS B CA  
1973 C  C   . HIS B 95  ? 0.2442 0.2899 0.2206 0.0182  -0.0102 0.0171  95   HIS B C   
1974 O  O   . HIS B 95  ? 0.2454 0.2821 0.2517 0.0357  -0.0180 0.0115  95   HIS B O   
1975 C  CB  . HIS B 95  ? 0.2581 0.2831 0.2438 0.0173  -0.0184 -0.0010 95   HIS B CB  
1976 C  CG  . HIS B 95  ? 0.2740 0.3611 0.2370 0.0092  0.0101  -0.0570 95   HIS B CG  
1977 N  ND1 . HIS B 95  ? 0.3741 0.3980 0.3470 0.0022  -0.0082 -0.0175 95   HIS B ND1 
1978 C  CD2 . HIS B 95  ? 0.2669 0.3453 0.2529 0.0167  -0.0249 0.0049  95   HIS B CD2 
1979 C  CE1 . HIS B 95  ? 0.2836 0.3059 0.2766 0.0460  0.0287  -0.0163 95   HIS B CE1 
1980 N  NE2 . HIS B 95  ? 0.3248 0.4145 0.3075 0.0108  0.0060  -0.0141 95   HIS B NE2 
1981 N  N   . TYR B 96  ? 0.2367 0.2603 0.2107 0.0234  -0.0079 0.0142  96   TYR B N   
1982 C  CA  . TYR B 96  ? 0.2224 0.2126 0.1579 0.0297  -0.0275 0.0139  96   TYR B CA  
1983 C  C   . TYR B 96  ? 0.2415 0.2558 0.1791 0.0406  -0.0028 -0.0016 96   TYR B C   
1984 O  O   . TYR B 96  ? 0.2925 0.3127 0.2029 0.0113  -0.0158 -0.0033 96   TYR B O   
1985 C  CB  . TYR B 96  ? 0.2358 0.2599 0.1643 0.0588  -0.0237 -0.0012 96   TYR B CB  
1986 C  CG  . TYR B 96  ? 0.2572 0.2337 0.1414 0.0455  0.0129  -0.0075 96   TYR B CG  
1987 C  CD1 . TYR B 96  ? 0.2200 0.2131 0.1577 0.0418  -0.0234 0.0041  96   TYR B CD1 
1988 C  CD2 . TYR B 96  ? 0.2645 0.2846 0.1814 0.0333  -0.0091 0.0237  96   TYR B CD2 
1989 C  CE1 . TYR B 96  ? 0.2553 0.2492 0.1583 0.0207  -0.0275 0.0197  96   TYR B CE1 
1990 C  CE2 . TYR B 96  ? 0.2716 0.2175 0.1822 0.0304  -0.0315 0.0001  96   TYR B CE2 
1991 C  CZ  . TYR B 96  ? 0.2733 0.2677 0.1671 0.0331  -0.0274 0.0097  96   TYR B CZ  
1992 O  OH  . TYR B 96  ? 0.2514 0.2621 0.1728 0.0374  -0.0127 0.0073  96   TYR B OH  
1993 N  N   . GLY B 97  ? 0.2397 0.3178 0.1700 0.0293  -0.0033 -0.0030 97   GLY B N   
1994 C  CA  . GLY B 97  ? 0.2713 0.3272 0.2010 0.0355  -0.0156 -0.0137 97   GLY B CA  
1995 C  C   . GLY B 97  ? 0.2464 0.3139 0.2105 0.0460  -0.0037 -0.0029 97   GLY B C   
1996 O  O   . GLY B 97  ? 0.2614 0.3438 0.2395 0.0273  0.0037  -0.0115 97   GLY B O   
1997 N  N   . ALA B 98  ? 0.2509 0.3385 0.2164 0.0340  -0.0132 -0.0093 98   ALA B N   
1998 C  CA  . ALA B 98  ? 0.2655 0.3432 0.2208 0.0441  -0.0179 -0.0168 98   ALA B CA  
1999 C  C   . ALA B 98  ? 0.2556 0.3675 0.2104 0.0322  -0.0324 0.0020  98   ALA B C   
2000 O  O   . ALA B 98  ? 0.2855 0.3620 0.2254 0.0180  -0.0151 -0.0049 98   ALA B O   
2001 C  CB  . ALA B 98  ? 0.2389 0.3641 0.2197 0.0532  -0.0132 -0.0338 98   ALA B CB  
2002 N  N   . ASN B 99  ? 0.2682 0.3343 0.2002 0.0427  -0.0118 -0.0075 99   ASN B N   
2003 C  CA  . ASN B 99  ? 0.2720 0.3771 0.2278 0.0301  -0.0018 -0.0056 99   ASN B CA  
2004 C  C   . ASN B 99  ? 0.2950 0.3839 0.2414 0.0329  -0.0062 -0.0001 99   ASN B C   
2005 O  O   . ASN B 99  ? 0.2981 0.4493 0.2580 0.0514  -0.0317 -0.0103 99   ASN B O   
2006 C  CB  . ASN B 99  ? 0.3031 0.3815 0.2565 0.0422  0.0046  -0.0068 99   ASN B CB  
2007 C  CG  . ASN B 99  ? 0.2940 0.3992 0.2202 0.0092  -0.0079 0.0127  99   ASN B CG  
2008 O  OD1 . ASN B 99  ? 0.2555 0.3802 0.2637 0.0380  -0.0206 0.0029  99   ASN B OD1 
2009 N  ND2 . ASN B 99  ? 0.3233 0.4100 0.2670 0.0186  -0.0250 0.0250  99   ASN B ND2 
2010 N  N   . ILE B 100 ? 0.2960 0.3711 0.2278 0.0384  -0.0170 -0.0135 100  ILE B N   
2011 C  CA  . ILE B 100 ? 0.3137 0.3845 0.2042 0.0560  -0.0258 -0.0156 100  ILE B CA  
2012 C  C   . ILE B 100 ? 0.3159 0.3671 0.2230 0.0429  -0.0182 -0.0130 100  ILE B C   
2013 O  O   . ILE B 100 ? 0.3221 0.3854 0.2247 0.0225  -0.0102 0.0122  100  ILE B O   
2014 C  CB  . ILE B 100 ? 0.3561 0.3956 0.2223 0.0502  -0.0102 0.0049  100  ILE B CB  
2015 C  CG1 . ILE B 100 ? 0.3907 0.3982 0.1974 0.0429  -0.0631 0.0084  100  ILE B CG1 
2016 C  CG2 . ILE B 100 ? 0.3729 0.3608 0.2795 0.0543  -0.0435 0.0158  100  ILE B CG2 
2017 C  CD1 . ILE B 100 ? 0.4271 0.4416 0.2252 0.0497  -0.0378 -0.0247 100  ILE B CD1 
2018 N  N   . ALA B 101 ? 0.3176 0.4065 0.2160 0.0395  -0.0322 0.0180  101  ALA B N   
2019 C  CA  . ALA B 101 ? 0.3183 0.4163 0.2526 0.0454  -0.0213 -0.0199 101  ALA B CA  
2020 C  C   . ALA B 101 ? 0.3481 0.4218 0.2426 0.0514  -0.0372 -0.0173 101  ALA B C   
2021 O  O   . ALA B 101 ? 0.3530 0.4422 0.2456 0.0649  -0.0258 -0.0242 101  ALA B O   
2022 C  CB  . ALA B 101 ? 0.3524 0.4409 0.2310 0.0202  -0.0667 -0.0176 101  ALA B CB  
2023 N  N   . MET B 102 ? 0.3571 0.4137 0.2290 0.0524  -0.0411 0.0016  102  MET B N   
2024 C  CA  . MET B 102 ? 0.3858 0.3853 0.2407 0.0591  -0.0367 -0.0013 102  MET B CA  
2025 C  C   . MET B 102 ? 0.4078 0.4051 0.2417 0.0579  -0.0275 -0.0014 102  MET B C   
2026 O  O   . MET B 102 ? 0.3920 0.3968 0.2568 0.0579  -0.0422 -0.0012 102  MET B O   
2027 C  CB  . MET B 102 ? 0.3724 0.3560 0.1777 0.0690  -0.0160 0.0047  102  MET B CB  
2028 C  CG  . MET B 102 ? 0.3773 0.3919 0.1956 0.0525  -0.0869 0.0379  102  MET B CG  
2029 S  SD  . MET B 102 ? 0.4270 0.4101 0.2393 0.0371  -0.0365 0.0171  102  MET B SD  
2030 C  CE  . MET B 102 ? 0.4886 0.4711 0.2854 -0.0087 -0.0414 0.0368  102  MET B CE  
2031 N  N   . GLU B 103 ? 0.4275 0.4530 0.2410 0.0385  -0.0153 -0.0009 103  GLU B N   
2032 C  CA  . GLU B 103 ? 0.4722 0.4706 0.2823 0.0415  -0.0297 -0.0106 103  GLU B CA  
2033 C  C   . GLU B 103 ? 0.4749 0.4937 0.2923 0.0375  -0.0196 -0.0182 103  GLU B C   
2034 O  O   . GLU B 103 ? 0.4826 0.5279 0.2476 0.0274  -0.0234 -0.0248 103  GLU B O   
2035 C  CB  . GLU B 103 ? 0.5172 0.4851 0.2657 0.0278  0.0185  -0.0074 103  GLU B CB  
2036 C  CG  . GLU B 103 ? 0.5455 0.5019 0.3698 0.0023  0.0068  -0.0245 103  GLU B CG  
2037 C  CD  . GLU B 103 ? 0.5505 0.5820 0.3445 0.0622  0.0078  -0.0117 103  GLU B CD  
2038 O  OE1 . GLU B 103 ? 0.4638 0.4777 0.3339 0.0644  0.0107  -0.0220 103  GLU B OE1 
2039 O  OE2 . GLU B 103 ? 0.5989 0.6742 0.4204 0.0158  0.0720  -0.0639 103  GLU B OE2 
2040 N  N   . LYS B 104 ? 0.4711 0.4668 0.3036 0.0266  -0.0355 -0.0132 104  LYS B N   
2041 C  CA  . LYS B 104 ? 0.4620 0.4990 0.3078 0.0343  -0.0297 -0.0027 104  LYS B CA  
2042 C  C   . LYS B 104 ? 0.4501 0.5005 0.3170 0.0358  -0.0565 -0.0151 104  LYS B C   
2043 O  O   . LYS B 104 ? 0.4379 0.5130 0.3964 0.0267  -0.0372 -0.0087 104  LYS B O   
2044 C  CB  . LYS B 104 ? 0.4424 0.4831 0.3230 0.0182  -0.0585 0.0042  104  LYS B CB  
2045 C  CG  . LYS B 104 ? 0.4581 0.5273 0.3235 0.0263  -0.0265 -0.0194 104  LYS B CG  
2046 C  CD  . LYS B 104 ? 0.4971 0.5113 0.3502 0.0391  -0.0203 -0.0021 104  LYS B CD  
2047 C  CE  . LYS B 104 ? 0.5671 0.5219 0.4509 0.0713  0.0134  -0.0037 104  LYS B CE  
2048 N  NZ  . LYS B 104 ? 0.6189 0.6303 0.5664 0.0806  -0.0556 -0.0759 104  LYS B NZ  
2049 N  N   . ASP B 105 ? 0.4140 0.4906 0.2885 0.0536  -0.0721 0.0011  105  ASP B N   
2050 C  CA  . ASP B 105 ? 0.4213 0.4933 0.3157 0.0499  -0.0497 -0.0006 105  ASP B CA  
2051 C  C   . ASP B 105 ? 0.4527 0.5251 0.3382 0.0436  -0.0702 0.0045  105  ASP B C   
2052 O  O   . ASP B 105 ? 0.4386 0.5337 0.3691 0.0121  -0.1109 0.0414  105  ASP B O   
2053 C  CB  . ASP B 105 ? 0.3554 0.5104 0.3050 0.0683  -0.0967 -0.0080 105  ASP B CB  
2054 C  CG  . ASP B 105 ? 0.4129 0.5677 0.3279 0.0720  -0.0591 -0.0493 105  ASP B CG  
2055 O  OD1 . ASP B 105 ? 0.4038 0.5929 0.3311 0.0668  -0.0754 -0.0422 105  ASP B OD1 
2056 O  OD2 . ASP B 105 ? 0.4386 0.6139 0.3182 0.0955  -0.1185 -0.0424 105  ASP B OD2 
2057 N  N   . LYS B 106 ? 0.4957 0.4562 0.4108 -0.0886 -0.0847 0.0556  106  LYS B N   
2058 C  CA  . LYS B 106 ? 0.5379 0.5127 0.4239 -0.0944 -0.0828 0.0553  106  LYS B CA  
2059 C  C   . LYS B 106 ? 0.4920 0.5438 0.4203 -0.0937 -0.0814 0.0658  106  LYS B C   
2060 O  O   . LYS B 106 ? 0.4437 0.5800 0.4227 -0.0732 -0.0647 0.0882  106  LYS B O   
2061 C  CB  . LYS B 106 ? 0.6254 0.5581 0.4430 -0.1192 -0.1023 0.0307  106  LYS B CB  
2062 C  CG  . LYS B 106 ? 0.7420 0.6118 0.5927 -0.0537 -0.1053 0.0259  106  LYS B CG  
2063 C  CD  . LYS B 106 ? 0.7867 0.7118 0.6091 -0.0591 -0.0751 0.0052  106  LYS B CD  
2064 C  CE  . LYS B 106 ? 0.8655 0.7330 0.6513 -0.0074 -0.0850 0.0150  106  LYS B CE  
2065 N  NZ  . LYS B 106 ? 0.9224 0.7633 0.6487 -0.0238 -0.0630 0.0073  106  LYS B NZ  
2066 N  N   . LYS B 107 ? 0.4705 0.5266 0.4250 -0.0987 -0.0808 0.0567  107  LYS B N   
2067 C  CA  . LYS B 107 ? 0.4761 0.5504 0.4528 -0.0950 -0.0942 0.0633  107  LYS B CA  
2068 C  C   . LYS B 107 ? 0.4422 0.5341 0.4664 -0.0828 -0.0856 0.0653  107  LYS B C   
2069 O  O   . LYS B 107 ? 0.4235 0.5874 0.5025 -0.0733 -0.0756 0.0606  107  LYS B O   
2070 C  CB  . LYS B 107 ? 0.4538 0.5681 0.4466 -0.1132 -0.0771 0.0699  107  LYS B CB  
2071 C  CG  . LYS B 107 ? 0.5692 0.6063 0.5471 -0.1541 -0.0897 0.0748  107  LYS B CG  
2072 C  CD  . LYS B 107 ? 0.5648 0.6988 0.5515 -0.1274 -0.0856 0.1082  107  LYS B CD  
2073 C  CE  . LYS B 107 ? 0.6586 0.7687 0.5997 -0.1373 -0.0985 0.0225  107  LYS B CE  
2074 N  NZ  . LYS B 107 ? 0.6787 0.8678 0.5646 -0.0779 -0.1162 0.0400  107  LYS B NZ  
2075 N  N   . GLY B 108 ? 0.4328 0.5188 0.4508 -0.0758 -0.0862 0.0666  108  GLY B N   
2076 C  CA  . GLY B 108 ? 0.4281 0.5156 0.4316 -0.0558 -0.0876 0.0610  108  GLY B CA  
2077 C  C   . GLY B 108 ? 0.4087 0.4876 0.4099 -0.0558 -0.0945 0.0662  108  GLY B C   
2078 O  O   . GLY B 108 ? 0.4457 0.5562 0.4849 -0.0124 -0.1170 0.0461  108  GLY B O   
2079 N  N   . GLY B 109 ? 0.3853 0.4985 0.3993 -0.0538 -0.0897 0.0477  109  GLY B N   
2080 C  CA  . GLY B 109 ? 0.3538 0.4517 0.3149 -0.0211 -0.0913 0.0749  109  GLY B CA  
2081 C  C   . GLY B 109 ? 0.3345 0.3809 0.2870 -0.0365 -0.0662 0.0329  109  GLY B C   
2082 O  O   . GLY B 109 ? 0.2807 0.3645 0.2847 -0.0314 -0.0527 0.0292  109  GLY B O   
2083 N  N   . PHE B 110 ? 0.3231 0.3501 0.2685 -0.0357 -0.0979 0.0317  110  PHE B N   
2084 C  CA  . PHE B 110 ? 0.3061 0.3655 0.2559 -0.0242 -0.0807 0.0308  110  PHE B CA  
2085 C  C   . PHE B 110 ? 0.3280 0.4202 0.2793 -0.0169 -0.0727 0.0266  110  PHE B C   
2086 O  O   . PHE B 110 ? 0.3647 0.4475 0.3005 0.0204  -0.0412 0.0318  110  PHE B O   
2087 C  CB  . PHE B 110 ? 0.3280 0.3628 0.2892 -0.0060 -0.0534 0.0408  110  PHE B CB  
2088 C  CG  . PHE B 110 ? 0.3362 0.4078 0.3103 -0.0100 -0.0506 0.0589  110  PHE B CG  
2089 C  CD1 . PHE B 110 ? 0.3609 0.4163 0.2922 -0.0220 0.0021  0.0653  110  PHE B CD1 
2090 C  CD2 . PHE B 110 ? 0.3734 0.4583 0.3740 -0.0381 -0.0601 0.0407  110  PHE B CD2 
2091 C  CE1 . PHE B 110 ? 0.3712 0.3704 0.3873 0.0330  -0.0267 0.0635  110  PHE B CE1 
2092 C  CE2 . PHE B 110 ? 0.3954 0.5128 0.4021 -0.0149 -0.0637 0.0290  110  PHE B CE2 
2093 C  CZ  . PHE B 110 ? 0.3704 0.4190 0.4097 0.0181  -0.0357 0.0678  110  PHE B CZ  
2094 N  N   . GLY B 111 ? 0.3521 0.4571 0.3014 -0.0184 -0.0458 0.0243  111  GLY B N   
2095 C  CA  . GLY B 111 ? 0.3883 0.4923 0.3184 -0.0122 -0.0460 0.0089  111  GLY B CA  
2096 C  C   . GLY B 111 ? 0.3724 0.5491 0.3349 -0.0150 -0.0440 0.0106  111  GLY B C   
2097 O  O   . GLY B 111 ? 0.3591 0.5028 0.3293 -0.0578 -0.0297 0.0203  111  GLY B O   
2098 N  N   . VAL B 112 ? 0.3897 0.5786 0.3158 -0.0047 -0.0311 0.0109  112  VAL B N   
2099 C  CA  . VAL B 112 ? 0.3685 0.5980 0.3115 -0.0083 -0.0275 0.0215  112  VAL B CA  
2100 C  C   . VAL B 112 ? 0.3393 0.5799 0.3022 -0.0369 -0.0348 0.0246  112  VAL B C   
2101 O  O   . VAL B 112 ? 0.3695 0.5598 0.2788 -0.0371 -0.0372 0.0090  112  VAL B O   
2102 C  CB  . VAL B 112 ? 0.3831 0.6787 0.3800 0.0083  -0.0186 -0.0131 112  VAL B CB  
2103 C  CG1 . VAL B 112 ? 0.4461 0.7433 0.4836 -0.0249 0.0648  0.0192  112  VAL B CG1 
2104 C  CG2 . VAL B 112 ? 0.4740 0.7005 0.4155 0.0600  -0.0040 0.0008  112  VAL B CG2 
2105 N  N   . GLY B 113 ? 0.3663 0.5750 0.2793 -0.0537 -0.0165 0.0262  113  GLY B N   
2106 C  CA  . GLY B 113 ? 0.3720 0.5706 0.2960 -0.0657 -0.0390 0.0400  113  GLY B CA  
2107 C  C   . GLY B 113 ? 0.3364 0.5526 0.2929 -0.0833 -0.0318 0.0426  113  GLY B C   
2108 O  O   . GLY B 113 ? 0.3195 0.5628 0.2817 -0.0729 -0.0266 0.0561  113  GLY B O   
2109 N  N   . ASN B 114 ? 0.3308 0.5085 0.2449 -0.1085 -0.0287 0.0823  114  ASN B N   
2110 C  CA  . ASN B 114 ? 0.3183 0.5109 0.3027 -0.1335 -0.0257 0.0505  114  ASN B CA  
2111 C  C   . ASN B 114 ? 0.3165 0.4670 0.2861 -0.1212 -0.0344 0.0447  114  ASN B C   
2112 O  O   . ASN B 114 ? 0.3001 0.4727 0.2833 -0.0931 -0.0391 0.0497  114  ASN B O   
2113 C  CB  . ASN B 114 ? 0.3603 0.5354 0.3250 -0.1715 -0.0355 0.0671  114  ASN B CB  
2114 C  CG  . ASN B 114 ? 0.3729 0.6424 0.3166 -0.1665 -0.0266 0.0479  114  ASN B CG  
2115 O  OD1 . ASN B 114 ? 0.3469 0.6624 0.3251 -0.2137 -0.0452 0.0261  114  ASN B OD1 
2116 N  ND2 . ASN B 114 ? 0.4605 0.5977 0.3568 -0.1760 -0.0535 0.1212  114  ASN B ND2 
2117 N  N   . TYR B 115 ? 0.3090 0.4623 0.2808 -0.1051 -0.0382 0.0570  115  TYR B N   
2118 C  CA  . TYR B 115 ? 0.3004 0.4365 0.2888 -0.0890 -0.0326 0.0413  115  TYR B CA  
2119 C  C   . TYR B 115 ? 0.3233 0.4174 0.2964 -0.1101 -0.0368 0.0372  115  TYR B C   
2120 O  O   . TYR B 115 ? 0.3086 0.4426 0.2815 -0.1203 -0.0067 0.0175  115  TYR B O   
2121 C  CB  . TYR B 115 ? 0.2732 0.4381 0.3003 -0.0550 -0.0212 0.0516  115  TYR B CB  
2122 C  CG  . TYR B 115 ? 0.2448 0.4082 0.2507 -0.0200 -0.0675 0.0575  115  TYR B CG  
2123 C  CD1 . TYR B 115 ? 0.2979 0.4305 0.2643 -0.0378 -0.0418 0.0687  115  TYR B CD1 
2124 C  CD2 . TYR B 115 ? 0.2807 0.3872 0.2376 -0.0575 -0.0336 0.0720  115  TYR B CD2 
2125 C  CE1 . TYR B 115 ? 0.2685 0.4590 0.2631 -0.0235 -0.0512 0.0334  115  TYR B CE1 
2126 C  CE2 . TYR B 115 ? 0.2837 0.3712 0.2612 -0.0626 -0.0163 0.0747  115  TYR B CE2 
2127 C  CZ  . TYR B 115 ? 0.3039 0.3926 0.2401 -0.0253 -0.0421 0.0587  115  TYR B CZ  
2128 O  OH  . TYR B 115 ? 0.3376 0.4658 0.2584 -0.0440 -0.0372 0.0311  115  TYR B OH  
2129 N  N   . GLU B 116 ? 0.3176 0.3938 0.3200 -0.0951 -0.0416 0.0239  116  GLU B N   
2130 C  CA  . GLU B 116 ? 0.3382 0.4052 0.2992 -0.0984 -0.0619 0.0381  116  GLU B CA  
2131 C  C   . GLU B 116 ? 0.2745 0.3678 0.2765 -0.0709 -0.0647 0.0350  116  GLU B C   
2132 O  O   . GLU B 116 ? 0.3110 0.3602 0.2581 -0.0721 -0.0697 0.0476  116  GLU B O   
2133 C  CB  . GLU B 116 ? 0.3928 0.3701 0.3587 -0.0901 -0.0618 0.0319  116  GLU B CB  
2134 C  CG  . GLU B 116 ? 0.5307 0.4973 0.4016 -0.1261 -0.0721 0.0667  116  GLU B CG  
2135 C  CD  . GLU B 116 ? 0.6510 0.5123 0.5181 -0.0675 -0.0731 0.0851  116  GLU B CD  
2136 O  OE1 . GLU B 116 ? 0.6211 0.5593 0.5027 -0.0016 -0.1091 0.0624  116  GLU B OE1 
2137 O  OE2 . GLU B 116 ? 0.7633 0.5924 0.5436 -0.1273 -0.0771 0.1217  116  GLU B OE2 
2138 N  N   . LEU B 117 ? 0.2870 0.3806 0.2804 -0.0833 -0.0543 0.0316  117  LEU B N   
2139 C  CA  . LEU B 117 ? 0.2812 0.3886 0.3087 -0.0686 -0.0508 0.0382  117  LEU B CA  
2140 C  C   . LEU B 117 ? 0.3235 0.3570 0.3009 -0.0766 -0.0343 0.0392  117  LEU B C   
2141 O  O   . LEU B 117 ? 0.3127 0.4134 0.3130 -0.0885 -0.0535 0.0236  117  LEU B O   
2142 C  CB  . LEU B 117 ? 0.2617 0.4081 0.3028 -0.0531 -0.0583 0.0292  117  LEU B CB  
2143 C  CG  . LEU B 117 ? 0.2349 0.4002 0.2754 -0.0446 -0.0358 0.0160  117  LEU B CG  
2144 C  CD1 . LEU B 117 ? 0.2659 0.3206 0.2832 -0.0562 -0.0374 0.0525  117  LEU B CD1 
2145 C  CD2 . LEU B 117 ? 0.2375 0.4089 0.3230 0.0077  -0.0241 0.0255  117  LEU B CD2 
2146 N  N   . THR B 118 ? 0.2905 0.3532 0.3102 -0.0557 -0.0527 0.0265  118  THR B N   
2147 C  CA  . THR B 118 ? 0.3374 0.3579 0.3066 -0.0374 -0.0465 0.0446  118  THR B CA  
2148 C  C   . THR B 118 ? 0.2771 0.3235 0.2797 -0.0291 -0.0506 0.0325  118  THR B C   
2149 O  O   . THR B 118 ? 0.2847 0.3366 0.2735 -0.0421 -0.0572 0.0047  118  THR B O   
2150 C  CB  . THR B 118 ? 0.4172 0.3780 0.3348 0.0057  -0.0355 0.0538  118  THR B CB  
2151 O  OG1 . THR B 118 ? 0.3872 0.3995 0.3204 -0.0125 -0.0697 0.0813  118  THR B OG1 
2152 C  CG2 . THR B 118 ? 0.3776 0.3795 0.3246 0.0224  -0.0821 0.0341  118  THR B CG2 
2153 N  N   . PHE B 119 ? 0.2364 0.2831 0.2633 -0.0170 -0.0552 0.0269  119  PHE B N   
2154 C  CA  . PHE B 119 ? 0.2808 0.3072 0.2999 -0.0282 -0.0379 0.0281  119  PHE B CA  
2155 C  C   . PHE B 119 ? 0.3174 0.3369 0.2960 -0.0187 -0.0403 0.0128  119  PHE B C   
2156 O  O   . PHE B 119 ? 0.3664 0.3549 0.3346 -0.0379 -0.0120 0.0287  119  PHE B O   
2157 C  CB  . PHE B 119 ? 0.2886 0.3601 0.2642 -0.0249 -0.0452 0.0373  119  PHE B CB  
2158 C  CG  . PHE B 119 ? 0.3107 0.3590 0.2969 -0.0346 -0.0641 0.0136  119  PHE B CG  
2159 C  CD1 . PHE B 119 ? 0.3322 0.3680 0.3274 -0.0343 -0.0328 0.0098  119  PHE B CD1 
2160 C  CD2 . PHE B 119 ? 0.3110 0.3660 0.2803 -0.0226 -0.0156 0.0229  119  PHE B CD2 
2161 C  CE1 . PHE B 119 ? 0.3467 0.4697 0.2733 0.0004  -0.0540 0.0031  119  PHE B CE1 
2162 C  CE2 . PHE B 119 ? 0.2393 0.3864 0.3013 -0.0424 0.0012  0.0292  119  PHE B CE2 
2163 C  CZ  . PHE B 119 ? 0.3251 0.4759 0.3277 -0.0208 -0.0201 -0.0157 119  PHE B CZ  
2164 N  N   . TYR B 120 ? 0.2929 0.3265 0.2731 -0.0031 -0.0576 0.0123  120  TYR B N   
2165 C  CA  . TYR B 120 ? 0.3172 0.3459 0.3038 0.0230  -0.0523 0.0127  120  TYR B CA  
2166 C  C   . TYR B 120 ? 0.3098 0.3531 0.3057 0.0056  -0.0347 0.0170  120  TYR B C   
2167 O  O   . TYR B 120 ? 0.3221 0.3466 0.3123 0.0232  -0.0491 0.0272  120  TYR B O   
2168 C  CB  . TYR B 120 ? 0.3219 0.3758 0.2837 0.0163  -0.0376 0.0377  120  TYR B CB  
2169 C  CG  . TYR B 120 ? 0.4131 0.4554 0.4075 0.0969  -0.0280 0.0137  120  TYR B CG  
2170 C  CD1 . TYR B 120 ? 0.5386 0.4684 0.4509 0.0772  -0.0425 0.0286  120  TYR B CD1 
2171 C  CD2 . TYR B 120 ? 0.4573 0.6129 0.4797 0.0364  -0.0182 0.0023  120  TYR B CD2 
2172 C  CE1 . TYR B 120 ? 0.6539 0.6156 0.4523 0.1005  -0.0017 -0.0372 120  TYR B CE1 
2173 C  CE2 . TYR B 120 ? 0.5527 0.6513 0.5389 0.0818  0.0024  -0.0617 120  TYR B CE2 
2174 C  CZ  . TYR B 120 ? 0.6145 0.6506 0.6011 0.0731  -0.0323 -0.0513 120  TYR B CZ  
2175 O  OH  . TYR B 120 ? 0.6200 0.6617 0.6364 0.1819  -0.0942 -0.0704 120  TYR B OH  
2176 N  N   . ILE B 121 ? 0.2949 0.3146 0.2857 0.0253  -0.0435 0.0165  121  ILE B N   
2177 C  CA  . ILE B 121 ? 0.3130 0.3404 0.2801 0.0260  -0.0486 -0.0042 121  ILE B CA  
2178 C  C   . ILE B 121 ? 0.2774 0.3039 0.2623 0.0385  -0.0578 0.0091  121  ILE B C   
2179 O  O   . ILE B 121 ? 0.3299 0.3214 0.2839 0.0620  -0.0598 -0.0139 121  ILE B O   
2180 C  CB  . ILE B 121 ? 0.3289 0.3415 0.2731 -0.0037 -0.0651 -0.0187 121  ILE B CB  
2181 C  CG1 . ILE B 121 ? 0.2988 0.3729 0.3010 -0.0168 -0.0618 -0.0050 121  ILE B CG1 
2182 C  CG2 . ILE B 121 ? 0.2951 0.2822 0.2641 0.0214  -0.0627 -0.0068 121  ILE B CG2 
2183 C  CD1 . ILE B 121 ? 0.2956 0.3443 0.2899 -0.0299 -0.0198 -0.0150 121  ILE B CD1 
2184 N  N   . SER B 122 ? 0.2789 0.2879 0.2834 0.0433  -0.0351 0.0069  122  SER B N   
2185 C  CA  . SER B 122 ? 0.3079 0.2961 0.2837 0.0520  -0.0367 0.0169  122  SER B CA  
2186 C  C   . SER B 122 ? 0.3142 0.3192 0.3005 0.0483  -0.0257 0.0105  122  SER B C   
2187 O  O   . SER B 122 ? 0.3195 0.3385 0.2792 0.0657  -0.0220 0.0102  122  SER B O   
2188 C  CB  . SER B 122 ? 0.3028 0.3380 0.3205 0.0830  -0.0078 0.0243  122  SER B CB  
2189 O  OG  . SER B 122 ? 0.3691 0.4694 0.3359 0.0796  -0.0286 0.0292  122  SER B OG  
2190 N  N   . ASN B 123 ? 0.3284 0.3081 0.2679 0.0491  -0.0354 0.0205  123  ASN B N   
2191 C  CA  . ASN B 123 ? 0.3153 0.2790 0.2865 0.0691  -0.0374 0.0046  123  ASN B CA  
2192 C  C   . ASN B 123 ? 0.3014 0.2871 0.2723 0.0614  -0.0165 -0.0016 123  ASN B C   
2193 O  O   . ASN B 123 ? 0.2749 0.2666 0.2827 0.0731  -0.0158 -0.0178 123  ASN B O   
2194 C  CB  . ASN B 123 ? 0.3506 0.2761 0.2804 0.0896  -0.0405 -0.0057 123  ASN B CB  
2195 C  CG  . ASN B 123 ? 0.3528 0.2732 0.2753 0.0948  -0.0191 0.0130  123  ASN B CG  
2196 O  OD1 . ASN B 123 ? 0.3668 0.2528 0.2914 0.0903  -0.0047 -0.0263 123  ASN B OD1 
2197 N  ND2 . ASN B 123 ? 0.3547 0.2667 0.2993 0.1158  -0.0529 -0.0316 123  ASN B ND2 
2198 N  N   . PRO B 124 ? 0.2800 0.2594 0.2558 0.0531  -0.0404 0.0158  124  PRO B N   
2199 C  CA  . PRO B 124 ? 0.2809 0.2484 0.2655 0.0382  -0.0341 0.0041  124  PRO B CA  
2200 C  C   . PRO B 124 ? 0.2855 0.2603 0.2333 0.0675  -0.0259 0.0256  124  PRO B C   
2201 O  O   . PRO B 124 ? 0.2745 0.3063 0.2292 0.0502  -0.0152 0.0174  124  PRO B O   
2202 C  CB  . PRO B 124 ? 0.2954 0.2466 0.2824 0.0569  -0.0353 0.0219  124  PRO B CB  
2203 C  CG  . PRO B 124 ? 0.3115 0.2662 0.2356 0.0503  -0.0226 0.0092  124  PRO B CG  
2204 C  CD  . PRO B 124 ? 0.2934 0.2730 0.2965 0.0532  -0.0554 0.0065  124  PRO B CD  
2205 N  N   . GLU B 125 ? 0.2907 0.2839 0.2841 0.0599  0.0085  -0.0110 125  GLU B N   
2206 C  CA  . GLU B 125 ? 0.2960 0.2983 0.3010 0.0888  0.0220  -0.0075 125  GLU B CA  
2207 C  C   . GLU B 125 ? 0.2980 0.3431 0.2840 0.1084  0.0059  -0.0088 125  GLU B C   
2208 O  O   . GLU B 125 ? 0.3332 0.4472 0.3502 0.0865  0.0314  -0.0181 125  GLU B O   
2209 C  CB  . GLU B 125 ? 0.3595 0.3302 0.3559 0.0976  0.0265  -0.0217 125  GLU B CB  
2210 C  CG  . GLU B 125 ? 0.4162 0.4183 0.4034 0.0983  0.0643  -0.0669 125  GLU B CG  
2211 C  CD  . GLU B 125 ? 0.6445 0.5139 0.5086 0.1500  0.0299  -0.1644 125  GLU B CD  
2212 O  OE1 . GLU B 125 ? 0.6795 0.6993 0.6706 0.0990  -0.0060 -0.1520 125  GLU B OE1 
2213 O  OE2 . GLU B 125 ? 0.6373 0.6209 0.6244 0.1690  -0.0279 -0.1211 125  GLU B OE2 
2214 N  N   . LYS B 126 ? 0.3133 0.3479 0.2903 0.0945  0.0017  -0.0079 126  LYS B N   
2215 C  CA  . LYS B 126 ? 0.3192 0.4312 0.3054 0.1073  -0.0209 0.0050  126  LYS B CA  
2216 C  C   . LYS B 126 ? 0.3143 0.4621 0.3064 0.0634  -0.0162 -0.0006 126  LYS B C   
2217 O  O   . LYS B 126 ? 0.3086 0.5762 0.3743 0.0428  0.0008  -0.0089 126  LYS B O   
2218 C  CB  . LYS B 126 ? 0.3289 0.4435 0.3035 0.1215  -0.0289 0.0020  126  LYS B CB  
2219 C  CG  . LYS B 126 ? 0.3891 0.6037 0.3583 0.1176  -0.0566 -0.0163 126  LYS B CG  
2220 C  CD  . LYS B 126 ? 0.4559 0.6145 0.4190 0.1539  -0.0659 0.0821  126  LYS B CD  
2221 C  CE  . LYS B 126 ? 0.4827 0.8065 0.4263 0.1476  -0.0815 0.0248  126  LYS B CE  
2222 N  NZ  . LYS B 126 ? 0.5920 0.8178 0.5122 0.1648  -0.1039 0.1009  126  LYS B NZ  
2223 N  N   . GLN B 127 ? 0.2959 0.4061 0.2684 0.0522  -0.0042 0.0017  127  GLN B N   
2224 C  CA  . GLN B 127 ? 0.3143 0.4025 0.2645 0.0058  0.0071  -0.0072 127  GLN B CA  
2225 C  C   . GLN B 127 ? 0.3087 0.4134 0.2761 -0.0075 0.0073  -0.0070 127  GLN B C   
2226 O  O   . GLN B 127 ? 0.4147 0.4498 0.2878 -0.0453 0.0064  0.0096  127  GLN B O   
2227 C  CB  . GLN B 127 ? 0.2880 0.3420 0.2786 0.0226  -0.0045 0.0217  127  GLN B CB  
2228 C  CG  . GLN B 127 ? 0.3211 0.3677 0.2792 0.0374  0.0219  -0.0237 127  GLN B CG  
2229 C  CD  . GLN B 127 ? 0.3038 0.3725 0.2442 0.0200  0.0120  -0.0334 127  GLN B CD  
2230 O  OE1 . GLN B 127 ? 0.4084 0.3867 0.2964 0.0296  0.0362  0.0266  127  GLN B OE1 
2231 N  NE2 . GLN B 127 ? 0.3618 0.3795 0.2764 0.0446  0.0650  -0.0048 127  GLN B NE2 
2232 N  N   . GLY B 128 ? 0.2834 0.4105 0.2868 0.0056  0.0171  -0.0148 128  GLY B N   
2233 C  CA  . GLY B 128 ? 0.3020 0.4293 0.2798 -0.0006 0.0167  -0.0113 128  GLY B CA  
2234 C  C   . GLY B 128 ? 0.3000 0.3593 0.2782 0.0169  0.0202  0.0033  128  GLY B C   
2235 O  O   . GLY B 128 ? 0.2943 0.4229 0.2685 -0.0091 0.0295  -0.0133 128  GLY B O   
2236 N  N   . PHE B 129 ? 0.2884 0.2946 0.3068 0.0166  0.0001  -0.0153 129  PHE B N   
2237 C  CA  . PHE B 129 ? 0.2739 0.2775 0.2877 0.0271  0.0139  0.0049  129  PHE B CA  
2238 C  C   . PHE B 129 ? 0.2853 0.2693 0.2658 0.0347  0.0150  0.0067  129  PHE B C   
2239 O  O   . PHE B 129 ? 0.2918 0.2740 0.2898 0.0441  0.0068  0.0274  129  PHE B O   
2240 C  CB  . PHE B 129 ? 0.2868 0.2638 0.2697 0.0368  0.0182  0.0003  129  PHE B CB  
2241 C  CG  . PHE B 129 ? 0.2495 0.2264 0.1849 0.0217  0.0256  0.0200  129  PHE B CG  
2242 C  CD1 . PHE B 129 ? 0.2594 0.2056 0.2435 0.0215  -0.0090 0.0095  129  PHE B CD1 
2243 C  CD2 . PHE B 129 ? 0.2446 0.2262 0.2475 0.0148  0.0306  0.0021  129  PHE B CD2 
2244 C  CE1 . PHE B 129 ? 0.2523 0.2142 0.2429 0.0367  0.0005  0.0215  129  PHE B CE1 
2245 C  CE2 . PHE B 129 ? 0.2539 0.2191 0.2422 0.0420  0.0038  0.0181  129  PHE B CE2 
2246 C  CZ  . PHE B 129 ? 0.2160 0.2135 0.2358 0.0578  0.0459  -0.0187 129  PHE B CZ  
2247 N  N   . GLY B 130 ? 0.2573 0.2895 0.2952 0.0367  0.0044  -0.0114 130  GLY B N   
2248 C  CA  . GLY B 130 ? 0.2750 0.2653 0.3200 0.0202  0.0055  0.0004  130  GLY B CA  
2249 C  C   . GLY B 130 ? 0.2572 0.2318 0.3035 0.0330  0.0213  0.0044  130  GLY B C   
2250 O  O   . GLY B 130 ? 0.2579 0.2023 0.2818 0.0365  0.0251  0.0016  130  GLY B O   
2251 N  N   . ARG B 131 ? 0.3406 0.2319 0.3218 -0.0104 0.0127  -0.0241 131  ARG B N   
2252 C  CA  . ARG B 131 ? 0.3419 0.2177 0.3206 0.0050  0.0059  -0.0194 131  ARG B CA  
2253 C  C   . ARG B 131 ? 0.3249 0.2026 0.3134 0.0135  -0.0051 -0.0285 131  ARG B C   
2254 O  O   . ARG B 131 ? 0.3253 0.2350 0.3155 -0.0061 0.0269  -0.0139 131  ARG B O   
2255 C  CB  . ARG B 131 ? 0.4022 0.2878 0.3617 0.0329  -0.0174 -0.0173 131  ARG B CB  
2256 C  CG  . ARG B 131 ? 0.4191 0.2801 0.3508 0.0359  0.0608  0.0007  131  ARG B CG  
2257 C  CD  . ARG B 131 ? 0.4188 0.2533 0.3759 -0.0422 -0.0146 -0.0016 131  ARG B CD  
2258 N  NE  . ARG B 131 ? 0.4447 0.3425 0.4007 0.0142  -0.0170 0.0310  131  ARG B NE  
2259 C  CZ  . ARG B 131 ? 0.4360 0.3694 0.3617 0.0332  -0.0162 -0.0138 131  ARG B CZ  
2260 N  NH1 . ARG B 131 ? 0.3760 0.3027 0.3776 0.0938  -0.0277 -0.0054 131  ARG B NH1 
2261 N  NH2 . ARG B 131 ? 0.4507 0.4270 0.4346 0.0389  0.0098  -0.0014 131  ARG B NH2 
2262 N  N   . HIS B 132 ? 0.3011 0.1803 0.2643 0.0573  0.0139  0.0010  132  HIS B N   
2263 C  CA  . HIS B 132 ? 0.3330 0.1906 0.2809 0.0285  -0.0025 -0.0125 132  HIS B CA  
2264 C  C   . HIS B 132 ? 0.3531 0.2136 0.2856 0.0288  0.0162  -0.0039 132  HIS B C   
2265 O  O   . HIS B 132 ? 0.3389 0.2190 0.3006 0.0341  0.0145  -0.0053 132  HIS B O   
2266 C  CB  . HIS B 132 ? 0.3755 0.2217 0.2715 0.0386  -0.0202 0.0178  132  HIS B CB  
2267 C  CG  . HIS B 132 ? 0.3426 0.2081 0.2418 0.0249  0.0406  -0.0109 132  HIS B CG  
2268 N  ND1 . HIS B 132 ? 0.3693 0.2235 0.2779 -0.0054 0.0138  0.0566  132  HIS B ND1 
2269 C  CD2 . HIS B 132 ? 0.3826 0.1952 0.2823 -0.0096 0.0002  0.0440  132  HIS B CD2 
2270 C  CE1 . HIS B 132 ? 0.4250 0.2045 0.2798 0.0487  0.0005  0.0386  132  HIS B CE1 
2271 N  NE2 . HIS B 132 ? 0.4145 0.1525 0.3218 -0.0186 0.0005  0.0233  132  HIS B NE2 
2272 N  N   . VAL B 133 ? 0.3814 0.2540 0.2959 0.0124  0.0309  -0.0367 133  VAL B N   
2273 C  CA  . VAL B 133 ? 0.4093 0.2667 0.3050 0.0521  0.0285  -0.0247 133  VAL B CA  
2274 C  C   . VAL B 133 ? 0.4600 0.2751 0.3186 0.0615  -0.0005 -0.0447 133  VAL B C   
2275 O  O   . VAL B 133 ? 0.5283 0.2827 0.3456 0.0570  -0.0167 -0.0890 133  VAL B O   
2276 C  CB  . VAL B 133 ? 0.4041 0.3219 0.3393 0.0501  0.0242  -0.0156 133  VAL B CB  
2277 C  CG1 . VAL B 133 ? 0.3855 0.3342 0.3320 0.0661  0.0274  -0.0346 133  VAL B CG1 
2278 C  CG2 . VAL B 133 ? 0.4282 0.3623 0.2665 0.0927  0.0549  -0.0217 133  VAL B CG2 
2279 N  N   . ASP B 134 ? 0.4914 0.3573 0.3342 0.0508  0.0226  -0.0355 134  ASP B N   
2280 C  CA  . ASP B 134 ? 0.5241 0.3819 0.3262 0.0519  0.0019  -0.0462 134  ASP B CA  
2281 C  C   . ASP B 134 ? 0.5559 0.3793 0.3387 0.0282  -0.0071 -0.0678 134  ASP B C   
2282 O  O   . ASP B 134 ? 0.4731 0.3287 0.3196 0.0158  -0.0505 -0.0438 134  ASP B O   
2283 C  CB  . ASP B 134 ? 0.5552 0.4353 0.3607 0.0430  0.0019  -0.0196 134  ASP B CB  
2284 C  CG  . ASP B 134 ? 0.5612 0.3986 0.2922 0.0257  -0.0187 -0.0150 134  ASP B CG  
2285 O  OD1 . ASP B 134 ? 0.5095 0.3609 0.3616 0.0345  -0.0044 -0.0558 134  ASP B OD1 
2286 O  OD2 . ASP B 134 ? 0.5382 0.4226 0.3786 0.0557  0.0308  -0.0054 134  ASP B OD2 
2287 N  N   . GLU B 135 ? 0.6365 0.4309 0.3529 0.0400  -0.0303 -0.0928 135  GLU B N   
2288 C  CA  . GLU B 135 ? 0.6763 0.4625 0.4066 0.0079  -0.0543 -0.0819 135  GLU B CA  
2289 C  C   . GLU B 135 ? 0.6415 0.4776 0.3864 -0.0153 -0.0660 -0.0597 135  GLU B C   
2290 O  O   . GLU B 135 ? 0.6344 0.4732 0.3873 -0.0318 -0.0712 -0.0247 135  GLU B O   
2291 C  CB  . GLU B 135 ? 0.7936 0.5249 0.4529 0.0044  -0.0800 -0.1293 135  GLU B CB  
2292 C  CG  . GLU B 135 ? 0.9167 0.5844 0.6090 -0.0555 -0.0931 -0.1053 135  GLU B CG  
2293 C  CD  . GLU B 135 ? 1.0691 0.7013 0.6616 -0.0811 -0.1348 -0.1779 135  GLU B CD  
2294 O  OE1 . GLU B 135 ? 1.2394 0.8158 0.6338 -0.0110 -0.1103 -0.2285 135  GLU B OE1 
2295 O  OE2 . GLU B 135 ? 1.1586 0.7892 0.8091 -0.1103 -0.1857 -0.1396 135  GLU B OE2 
2296 N  N   . GLU B 136 ? 0.6396 0.4899 0.3650 -0.0222 -0.0712 -0.0729 136  GLU B N   
2297 C  CA  . GLU B 136 ? 0.6466 0.5305 0.3852 -0.0252 -0.0882 -0.0422 136  GLU B CA  
2298 C  C   . GLU B 136 ? 0.5585 0.4895 0.3437 -0.0231 -0.0844 -0.0062 136  GLU B C   
2299 O  O   . GLU B 136 ? 0.5453 0.5256 0.3832 -0.0415 -0.1010 -0.0154 136  GLU B O   
2300 C  CB  . GLU B 136 ? 0.7367 0.5851 0.4071 -0.0139 -0.0740 -0.0068 136  GLU B CB  
2301 C  CG  . GLU B 136 ? 0.8168 0.8189 0.5670 -0.0103 -0.1450 0.0362  136  GLU B CG  
2302 C  CD  . GLU B 136 ? 0.9921 0.9276 0.6167 -0.0078 -0.2225 -0.0442 136  GLU B CD  
2303 O  OE1 . GLU B 136 ? 1.1553 1.0469 0.7916 0.0082  -0.0905 -0.0040 136  GLU B OE1 
2304 O  OE2 . GLU B 136 ? 1.1357 1.1355 0.8352 -0.0133 -0.1884 0.0608  136  GLU B OE2 
2305 N  N   . THR B 137 ? 0.4953 0.4064 0.3260 0.0066  -0.0529 0.0092  137  THR B N   
2306 C  CA  . THR B 137 ? 0.4493 0.3636 0.3142 0.0101  -0.0672 0.0216  137  THR B CA  
2307 C  C   . THR B 137 ? 0.4155 0.3095 0.2958 0.0160  -0.0272 0.0049  137  THR B C   
2308 O  O   . THR B 137 ? 0.4161 0.3018 0.3086 0.0104  -0.0291 0.0278  137  THR B O   
2309 C  CB  . THR B 137 ? 0.4748 0.3662 0.3141 0.0288  -0.0435 0.0480  137  THR B CB  
2310 O  OG1 . THR B 137 ? 0.4814 0.3599 0.3220 0.0060  -0.0435 0.0419  137  THR B OG1 
2311 C  CG2 . THR B 137 ? 0.5468 0.4517 0.3049 0.0621  -0.0852 0.0522  137  THR B CG2 
2312 N  N   . GLY B 138 ? 0.4300 0.2807 0.2704 -0.0009 -0.0353 -0.0017 138  GLY B N   
2313 C  CA  . GLY B 138 ? 0.3860 0.2192 0.2846 0.0319  -0.0213 -0.0319 138  GLY B CA  
2314 C  C   . GLY B 138 ? 0.3655 0.2137 0.2981 0.0125  -0.0258 -0.0074 138  GLY B C   
2315 O  O   . GLY B 138 ? 0.3755 0.2683 0.3225 -0.0259 -0.0401 0.0139  138  GLY B O   
2316 N  N   . VAL B 139 ? 0.3415 0.2038 0.2882 0.0296  -0.0169 -0.0163 139  VAL B N   
2317 C  CA  . VAL B 139 ? 0.3561 0.2489 0.2985 0.0102  -0.0076 -0.0017 139  VAL B CA  
2318 C  C   . VAL B 139 ? 0.3944 0.2472 0.3282 0.0134  -0.0137 -0.0130 139  VAL B C   
2319 O  O   . VAL B 139 ? 0.3942 0.2439 0.3422 0.0489  -0.0296 -0.0104 139  VAL B O   
2320 C  CB  . VAL B 139 ? 0.3428 0.2448 0.3124 0.0278  -0.0011 0.0100  139  VAL B CB  
2321 C  CG1 . VAL B 139 ? 0.4026 0.2841 0.3201 0.0597  -0.0191 0.0016  139  VAL B CG1 
2322 C  CG2 . VAL B 139 ? 0.3888 0.2047 0.2844 0.0055  0.0034  -0.0583 139  VAL B CG2 
2323 N  N   . GLY B 140 ? 0.3724 0.2501 0.3270 0.0184  -0.0064 -0.0077 140  GLY B N   
2324 C  CA  . GLY B 140 ? 0.4109 0.2133 0.3264 0.0244  -0.0194 -0.0197 140  GLY B CA  
2325 C  C   . GLY B 140 ? 0.3760 0.2172 0.3324 0.0450  -0.0213 -0.0067 140  GLY B C   
2326 O  O   . GLY B 140 ? 0.3733 0.2156 0.3151 0.0181  -0.0170 -0.0272 140  GLY B O   
2327 N  N   . LYS B 141 ? 0.4049 0.1796 0.3322 0.0398  -0.0344 0.0023  141  LYS B N   
2328 C  CA  . LYS B 141 ? 0.4034 0.2433 0.3262 0.0780  -0.0322 -0.0092 141  LYS B CA  
2329 C  C   . LYS B 141 ? 0.3572 0.2433 0.2955 0.0660  -0.0368 -0.0055 141  LYS B C   
2330 O  O   . LYS B 141 ? 0.3702 0.2375 0.3222 0.0606  -0.0470 -0.0036 141  LYS B O   
2331 C  CB  . LYS B 141 ? 0.4641 0.2955 0.4353 0.0997  -0.0424 0.0137  141  LYS B CB  
2332 C  CG  . LYS B 141 ? 0.6219 0.3888 0.4936 0.1002  -0.0254 0.0286  141  LYS B CG  
2333 C  CD  . LYS B 141 ? 0.6891 0.5076 0.6676 0.2015  -0.0463 0.0199  141  LYS B CD  
2334 C  CE  . LYS B 141 ? 0.7217 0.5592 0.7109 0.1655  -0.0231 0.0210  141  LYS B CE  
2335 N  NZ  . LYS B 141 ? 0.7568 0.7387 0.8303 0.2443  -0.0309 0.0344  141  LYS B NZ  
2336 N  N   . TRP B 142 ? 0.3456 0.2500 0.2734 0.0506  -0.0312 -0.0123 142  TRP B N   
2337 C  CA  . TRP B 142 ? 0.3420 0.2935 0.2747 0.0734  -0.0467 -0.0045 142  TRP B CA  
2338 C  C   . TRP B 142 ? 0.3366 0.2852 0.2645 0.0793  -0.0321 0.0096  142  TRP B C   
2339 O  O   . TRP B 142 ? 0.3964 0.3049 0.3142 0.1236  -0.0074 -0.0093 142  TRP B O   
2340 C  CB  . TRP B 142 ? 0.3915 0.2779 0.2872 0.0560  -0.0700 -0.0293 142  TRP B CB  
2341 C  CG  . TRP B 142 ? 0.4331 0.3001 0.2893 0.0577  -0.0397 -0.0504 142  TRP B CG  
2342 C  CD1 . TRP B 142 ? 0.4366 0.3228 0.4052 0.0315  -0.0271 -0.0138 142  TRP B CD1 
2343 C  CD2 . TRP B 142 ? 0.4293 0.2748 0.3149 0.0298  -0.0692 -0.0410 142  TRP B CD2 
2344 N  NE1 . TRP B 142 ? 0.5005 0.3247 0.4306 0.0183  -0.0421 -0.0191 142  TRP B NE1 
2345 C  CE2 . TRP B 142 ? 0.4680 0.2888 0.3366 0.0359  -0.0472 -0.0252 142  TRP B CE2 
2346 C  CE3 . TRP B 142 ? 0.4286 0.2864 0.3476 0.0632  -0.0446 -0.0384 142  TRP B CE3 
2347 C  CZ2 . TRP B 142 ? 0.4997 0.3201 0.4126 0.0540  -0.0381 -0.1039 142  TRP B CZ2 
2348 C  CZ3 . TRP B 142 ? 0.4646 0.3458 0.4461 0.0610  -0.1205 -0.0190 142  TRP B CZ3 
2349 C  CH2 . TRP B 142 ? 0.4181 0.3130 0.3869 0.0725  -0.0911 -0.0414 142  TRP B CH2 
2350 N  N   . PHE B 143 ? 0.7142 0.2810 0.2802 -0.0243 0.0028  -0.0181 143  PHE B N   
2351 C  CA  . PHE B 143 ? 0.7058 0.2569 0.2571 -0.0431 0.0022  -0.0072 143  PHE B CA  
2352 C  C   . PHE B 143 ? 0.6835 0.2400 0.2834 -0.0123 0.0266  -0.0051 143  PHE B C   
2353 O  O   . PHE B 143 ? 0.6401 0.2394 0.2788 0.0006  0.0346  -0.0190 143  PHE B O   
2354 C  CB  . PHE B 143 ? 0.6614 0.2795 0.2768 -0.0690 0.0018  -0.0049 143  PHE B CB  
2355 C  CG  . PHE B 143 ? 0.6158 0.2822 0.2495 -0.0445 0.0209  0.0067  143  PHE B CG  
2356 C  CD1 . PHE B 143 ? 0.5787 0.2876 0.2570 -0.0159 0.0068  -0.0055 143  PHE B CD1 
2357 C  CD2 . PHE B 143 ? 0.5892 0.3268 0.2258 -0.0403 0.0090  0.0172  143  PHE B CD2 
2358 C  CE1 . PHE B 143 ? 0.5342 0.3172 0.2800 -0.0361 0.0170  0.0399  143  PHE B CE1 
2359 C  CE2 . PHE B 143 ? 0.5581 0.3197 0.2318 -0.0200 0.0247  0.0161  143  PHE B CE2 
2360 C  CZ  . PHE B 143 ? 0.5575 0.2913 0.2549 -0.0094 0.0501  0.0000  143  PHE B CZ  
2361 N  N   . GLU B 144 ? 0.7374 0.2544 0.3091 0.0116  0.0089  -0.0048 144  GLU B N   
2362 C  CA  . GLU B 144 ? 0.7168 0.2523 0.3246 0.0339  0.0115  -0.0112 144  GLU B CA  
2363 C  C   . GLU B 144 ? 0.6541 0.2769 0.3422 0.0275  -0.0043 -0.0003 144  GLU B C   
2364 O  O   . GLU B 144 ? 0.6326 0.2543 0.2820 -0.0098 -0.0054 -0.0044 144  GLU B O   
2365 C  CB  . GLU B 144 ? 0.7999 0.2845 0.3766 0.0725  -0.0072 -0.0042 144  GLU B CB  
2366 C  CG  . GLU B 144 ? 0.9748 0.3421 0.4591 0.1374  0.0158  -0.0138 144  GLU B CG  
2367 C  CD  . GLU B 144 ? 0.9664 0.5533 0.6860 0.0996  0.0981  -0.0238 144  GLU B CD  
2368 O  OE1 . GLU B 144 ? 0.9925 0.6498 0.7208 0.1228  0.1021  -0.1406 144  GLU B OE1 
2369 O  OE2 . GLU B 144 ? 1.1783 0.7136 0.7362 0.1289  0.0965  -0.0910 144  GLU B OE2 
2370 N  N   . PRO B 145 ? 0.6243 0.2750 0.3613 0.0352  0.0080  -0.0104 145  PRO B N   
2371 C  CA  . PRO B 145 ? 0.5554 0.3015 0.3493 0.0317  0.0046  -0.0129 145  PRO B CA  
2372 C  C   . PRO B 145 ? 0.5828 0.2958 0.3126 0.0231  -0.0161 -0.0037 145  PRO B C   
2373 O  O   . PRO B 145 ? 0.6584 0.3094 0.3332 0.0581  -0.0090 0.0097  145  PRO B O   
2374 C  CB  . PRO B 145 ? 0.5516 0.3762 0.3851 0.0483  0.0031  -0.0238 145  PRO B CB  
2375 C  CG  . PRO B 145 ? 0.5631 0.3566 0.3933 0.0449  0.0288  -0.0447 145  PRO B CG  
2376 C  CD  . PRO B 145 ? 0.6225 0.2963 0.3773 0.0734  0.0186  -0.0407 145  PRO B CD  
2377 N  N   . PHE B 146 ? 0.5637 0.3022 0.3262 0.0172  -0.0258 0.0038  146  PHE B N   
2378 C  CA  . PHE B 146 ? 0.5809 0.2939 0.2994 -0.0105 -0.0468 0.0001  146  PHE B CA  
2379 C  C   . PHE B 146 ? 0.5251 0.3181 0.2898 -0.0196 -0.0515 0.0002  146  PHE B C   
2380 O  O   . PHE B 146 ? 0.4740 0.3291 0.3016 -0.0111 -0.0320 0.0025  146  PHE B O   
2381 C  CB  . PHE B 146 ? 0.6227 0.3051 0.2827 -0.0388 -0.0483 0.0124  146  PHE B CB  
2382 C  CG  . PHE B 146 ? 0.5666 0.3007 0.2630 -0.0700 -0.0557 0.0043  146  PHE B CG  
2383 C  CD1 . PHE B 146 ? 0.5750 0.3567 0.2773 -0.0215 -0.0383 0.0169  146  PHE B CD1 
2384 C  CD2 . PHE B 146 ? 0.5556 0.4081 0.2611 -0.0787 -0.0460 0.0694  146  PHE B CD2 
2385 C  CE1 . PHE B 146 ? 0.5251 0.3510 0.2900 -0.0484 -0.0200 0.0420  146  PHE B CE1 
2386 C  CE2 . PHE B 146 ? 0.5383 0.3884 0.2351 -0.0684 -0.0350 0.0247  146  PHE B CE2 
2387 C  CZ  . PHE B 146 ? 0.5108 0.3525 0.2372 -0.0748 -0.0288 0.0196  146  PHE B CZ  
2388 N  N   . LYS B 147 ? 0.5577 0.3194 0.2891 -0.0320 -0.0731 0.0079  147  LYS B N   
2389 C  CA  . LYS B 147 ? 0.5390 0.3445 0.3017 -0.0298 -0.0794 0.0136  147  LYS B CA  
2390 C  C   . LYS B 147 ? 0.5423 0.3667 0.2656 -0.0873 -0.0960 0.0202  147  LYS B C   
2391 O  O   . LYS B 147 ? 0.6292 0.3521 0.3076 -0.0826 -0.0718 0.0299  147  LYS B O   
2392 C  CB  . LYS B 147 ? 0.5838 0.4274 0.3517 -0.0045 -0.1232 0.0068  147  LYS B CB  
2393 C  CG  . LYS B 147 ? 0.6113 0.4875 0.4873 0.0013  -0.0867 0.0244  147  LYS B CG  
2394 C  CD  . LYS B 147 ? 0.7464 0.6041 0.5090 0.0464  -0.1495 0.0062  147  LYS B CD  
2395 C  CE  . LYS B 147 ? 0.7578 0.7236 0.5851 0.0773  -0.1124 0.0060  147  LYS B CE  
2396 N  NZ  . LYS B 147 ? 0.7315 0.7064 0.6177 0.0839  -0.1574 0.0977  147  LYS B NZ  
2397 N  N   . VAL B 148 ? 0.4856 0.3848 0.2870 -0.0875 -0.0901 0.0463  148  VAL B N   
2398 C  CA  . VAL B 148 ? 0.5063 0.4077 0.2622 -0.1270 -0.0809 0.0182  148  VAL B CA  
2399 C  C   . VAL B 148 ? 0.4778 0.4299 0.2728 -0.1056 -0.1037 0.0385  148  VAL B C   
2400 O  O   . VAL B 148 ? 0.4472 0.3884 0.2476 -0.0789 -0.0794 0.0222  148  VAL B O   
2401 C  CB  . VAL B 148 ? 0.4967 0.4529 0.2794 -0.1243 -0.0751 0.0249  148  VAL B CB  
2402 C  CG1 . VAL B 148 ? 0.5364 0.5440 0.3089 -0.0867 -0.0738 -0.0028 148  VAL B CG1 
2403 C  CG2 . VAL B 148 ? 0.4275 0.4604 0.2988 -0.1227 0.0038  0.0290  148  VAL B CG2 
2404 N  N   . ASP B 149 ? 0.5149 0.4303 0.2911 -0.1573 -0.0914 0.0404  149  ASP B N   
2405 C  CA  . ASP B 149 ? 0.5578 0.4772 0.2835 -0.1616 -0.0913 0.0392  149  ASP B CA  
2406 C  C   . ASP B 149 ? 0.5384 0.5117 0.3079 -0.1721 -0.1088 0.0408  149  ASP B C   
2407 O  O   . ASP B 149 ? 0.5420 0.5079 0.3384 -0.1994 -0.0888 0.0212  149  ASP B O   
2408 C  CB  . ASP B 149 ? 0.6699 0.5378 0.3601 -0.1269 -0.1369 0.0430  149  ASP B CB  
2409 C  CG  . ASP B 149 ? 0.7457 0.6682 0.4934 -0.0823 -0.0738 0.0454  149  ASP B CG  
2410 O  OD1 . ASP B 149 ? 0.7349 0.7430 0.6419 -0.0894 -0.1192 0.0686  149  ASP B OD1 
2411 O  OD2 . ASP B 149 ? 0.9597 0.6888 0.7205 -0.0359 -0.0845 -0.0136 149  ASP B OD2 
2412 N  N   . TYR B 150 ? 0.5003 0.5678 0.3010 -0.1622 -0.0875 0.0273  150  TYR B N   
2413 C  CA  . TYR B 150 ? 0.4937 0.6007 0.2944 -0.2002 -0.0775 0.0369  150  TYR B CA  
2414 C  C   . TYR B 150 ? 0.4982 0.5806 0.3073 -0.2114 -0.0791 0.0263  150  TYR B C   
2415 O  O   . TYR B 150 ? 0.4488 0.6134 0.2769 -0.2130 -0.0476 0.0142  150  TYR B O   
2416 C  CB  . TYR B 150 ? 0.4153 0.6059 0.2967 -0.1858 -0.0564 0.0137  150  TYR B CB  
2417 C  CG  . TYR B 150 ? 0.4127 0.5473 0.2795 -0.1445 -0.0711 -0.0071 150  TYR B CG  
2418 C  CD1 . TYR B 150 ? 0.4234 0.5171 0.2848 -0.1274 -0.0692 -0.0256 150  TYR B CD1 
2419 C  CD2 . TYR B 150 ? 0.4247 0.6680 0.3021 -0.1738 -0.0473 -0.0674 150  TYR B CD2 
2420 C  CE1 . TYR B 150 ? 0.3834 0.5456 0.2810 -0.1230 -0.0220 0.0191  150  TYR B CE1 
2421 C  CE2 . TYR B 150 ? 0.4245 0.6068 0.3503 -0.1938 -0.0518 0.0162  150  TYR B CE2 
2422 C  CZ  . TYR B 150 ? 0.4401 0.5441 0.2601 -0.1196 -0.0509 -0.0026 150  TYR B CZ  
2423 O  OH  . TYR B 150 ? 0.4698 0.6177 0.2802 -0.1004 -0.0947 0.0367  150  TYR B OH  
2424 N  N   . LYS B 151 ? 0.5212 0.6100 0.2802 -0.2692 -0.0890 0.0422  151  LYS B N   
2425 C  CA  . LYS B 151 ? 0.5565 0.6819 0.3117 -0.2557 -0.1225 0.0374  151  LYS B CA  
2426 C  C   . LYS B 151 ? 0.5158 0.7315 0.3015 -0.2650 -0.0990 0.0187  151  LYS B C   
2427 O  O   . LYS B 151 ? 0.4976 0.8075 0.3241 -0.2585 -0.1287 0.0048  151  LYS B O   
2428 C  CB  . LYS B 151 ? 0.6940 0.7213 0.3426 -0.3043 -0.1074 0.0620  151  LYS B CB  
2429 C  CG  . LYS B 151 ? 0.8138 0.7722 0.5166 -0.2388 -0.1184 0.0391  151  LYS B CG  
2430 C  CD  . LYS B 151 ? 1.0621 0.8713 0.5545 -0.3110 -0.1127 0.0913  151  LYS B CD  
2431 C  CE  . LYS B 151 ? 1.1529 0.8842 0.6504 -0.2545 -0.1476 0.0681  151  LYS B CE  
2432 N  NZ  . LYS B 151 ? 1.2358 0.9408 0.6480 -0.2536 -0.1162 0.0670  151  LYS B NZ  
2433 N  N   . PHE B 152 ? 0.4475 0.7118 0.2972 -0.2351 -0.0958 0.0337  152  PHE B N   
2434 C  CA  . PHE B 152 ? 0.4544 0.7489 0.2851 -0.2306 -0.0811 0.0276  152  PHE B CA  
2435 C  C   . PHE B 152 ? 0.4287 0.7282 0.2423 -0.2176 -0.0636 0.0451  152  PHE B C   
2436 O  O   . PHE B 152 ? 0.4112 0.6899 0.2297 -0.1667 -0.0496 0.0139  152  PHE B O   
2437 C  CB  . PHE B 152 ? 0.4122 0.7757 0.2735 -0.1814 -0.0790 0.0186  152  PHE B CB  
2438 C  CG  . PHE B 152 ? 0.4074 0.7036 0.2500 -0.1231 0.0041  0.0221  152  PHE B CG  
2439 C  CD1 . PHE B 152 ? 0.3115 0.6246 0.2418 -0.1029 -0.0492 0.0799  152  PHE B CD1 
2440 C  CD2 . PHE B 152 ? 0.3207 0.7089 0.2666 -0.1211 -0.0558 0.0204  152  PHE B CD2 
2441 C  CE1 . PHE B 152 ? 0.3441 0.5454 0.2074 -0.0922 -0.0746 0.0282  152  PHE B CE1 
2442 C  CE2 . PHE B 152 ? 0.3967 0.6461 0.2532 -0.1165 -0.0339 0.0476  152  PHE B CE2 
2443 C  CZ  . PHE B 152 ? 0.3631 0.5672 0.2533 -0.1065 -0.0737 0.0130  152  PHE B CZ  
2444 N  N   . LYS B 153 ? 0.3951 0.7645 0.2689 -0.2338 -0.0546 0.0495  153  LYS B N   
2445 C  CA  . LYS B 153 ? 0.4264 0.7940 0.2665 -0.2095 -0.0559 0.0360  153  LYS B CA  
2446 C  C   . LYS B 153 ? 0.3841 0.7749 0.2513 -0.1632 -0.0584 0.0107  153  LYS B C   
2447 O  O   . LYS B 153 ? 0.3461 0.8127 0.2966 -0.1270 -0.0756 0.0024  153  LYS B O   
2448 C  CB  . LYS B 153 ? 0.4632 0.8907 0.2818 -0.2437 -0.0400 0.0339  153  LYS B CB  
2449 C  CG  . LYS B 153 ? 0.6492 0.9812 0.3824 -0.2254 -0.0533 -0.0255 153  LYS B CG  
2450 C  CD  . LYS B 153 ? 0.7667 1.0709 0.4713 -0.2489 -0.0606 0.0588  153  LYS B CD  
2451 C  CE  . LYS B 153 ? 0.7667 1.1361 0.5059 -0.2605 -0.0704 0.0241  153  LYS B CE  
2452 N  NZ  . LYS B 153 ? 0.8948 1.1125 0.5935 -0.2462 -0.0818 0.0823  153  LYS B NZ  
2453 N  N   . TYR B 154 ? 0.3614 0.7095 0.2454 -0.1374 -0.0391 0.0055  154  TYR B N   
2454 C  CA  . TYR B 154 ? 0.3477 0.6900 0.2233 -0.1236 -0.0278 0.0157  154  TYR B CA  
2455 C  C   . TYR B 154 ? 0.3942 0.7303 0.2361 -0.1372 -0.0399 -0.0012 154  TYR B C   
2456 O  O   . TYR B 154 ? 0.3682 0.6707 0.2520 -0.1273 -0.0680 0.0271  154  TYR B O   
2457 C  CB  . TYR B 154 ? 0.3293 0.6154 0.2124 -0.1196 -0.0542 0.0280  154  TYR B CB  
2458 C  CG  . TYR B 154 ? 0.3376 0.6046 0.2752 -0.0713 -0.0107 -0.0077 154  TYR B CG  
2459 C  CD1 . TYR B 154 ? 0.3926 0.6322 0.2496 -0.0377 -0.0208 0.0213  154  TYR B CD1 
2460 C  CD2 . TYR B 154 ? 0.3979 0.6173 0.2274 -0.0431 -0.0207 -0.0211 154  TYR B CD2 
2461 C  CE1 . TYR B 154 ? 0.3949 0.6256 0.2401 -0.0216 0.0433  -0.0028 154  TYR B CE1 
2462 C  CE2 . TYR B 154 ? 0.3939 0.6171 0.2661 -0.0882 0.0271  0.0347  154  TYR B CE2 
2463 C  CZ  . TYR B 154 ? 0.4737 0.6357 0.2763 -0.0389 0.0189  0.0195  154  TYR B CZ  
2464 O  OH  . TYR B 154 ? 0.5204 0.6196 0.2663 -0.0408 0.0706  0.0027  154  TYR B OH  
2465 N  N   . THR B 155 ? 0.4327 0.8070 0.2812 -0.0891 -0.0236 0.0080  155  THR B N   
2466 C  CA  . THR B 155 ? 0.4654 0.8888 0.2988 -0.0874 0.0037  0.0002  155  THR B CA  
2467 C  C   . THR B 155 ? 0.5238 0.8826 0.3222 -0.0527 0.0289  -0.0054 155  THR B C   
2468 O  O   . THR B 155 ? 0.5394 0.9356 0.3536 -0.0382 0.0606  -0.0165 155  THR B O   
2469 C  CB  . THR B 155 ? 0.4703 0.9827 0.3025 -0.0933 0.0099  -0.0142 155  THR B CB  
2470 O  OG1 . THR B 155 ? 0.4129 1.0376 0.3527 -0.0611 0.0129  -0.0114 155  THR B OG1 
2471 C  CG2 . THR B 155 ? 0.4334 0.9972 0.3540 -0.1161 -0.0200 0.0097  155  THR B CG2 
2472 N  N   . GLY B 156 ? 0.5389 0.8443 0.3487 -0.0348 0.0303  0.0118  156  GLY B N   
2473 C  CA  . GLY B 156 ? 0.6109 0.8411 0.3626 -0.0089 0.0532  -0.0088 156  GLY B CA  
2474 C  C   . GLY B 156 ? 0.6420 0.8683 0.3567 0.0432  0.0679  -0.0162 156  GLY B C   
2475 O  O   . GLY B 156 ? 0.5615 0.8743 0.3701 0.0701  0.0793  -0.0298 156  GLY B O   
2476 N  N   . THR B 157 ? 0.7406 0.8643 0.3919 0.0656  0.0908  -0.0301 157  THR B N   
2477 C  CA  . THR B 157 ? 0.8445 0.9029 0.3854 0.1102  0.1152  -0.0276 157  THR B CA  
2478 C  C   . THR B 157 ? 0.8747 1.0409 0.4250 0.1682  0.1230  -0.0148 157  THR B C   
2479 O  O   . THR B 157 ? 0.8541 1.0684 0.3888 0.1886  0.1435  -0.0353 157  THR B O   
2480 C  CB  . THR B 157 ? 0.9410 0.8806 0.3988 0.1200  0.1366  -0.0475 157  THR B CB  
2481 O  OG1 . THR B 157 ? 0.9394 0.7700 0.5104 0.1335  0.1238  -0.1294 157  THR B OG1 
2482 C  CG2 . THR B 157 ? 1.0103 0.8651 0.3951 0.1525  0.1746  -0.0437 157  THR B CG2 
2483 N  N   . PRO B 158 ? 0.9589 1.1347 0.4778 0.1841  0.0887  -0.0168 158  PRO B N   
2484 C  CA  . PRO B 158 ? 1.0074 1.3338 0.5710 0.2303  0.0805  -0.0081 158  PRO B CA  
2485 C  C   . PRO B 158 ? 1.2264 1.4382 0.6895 0.3216  0.0959  -0.0176 158  PRO B C   
2486 O  O   . PRO B 158 ? 1.2923 1.4090 0.7006 0.3362  0.1260  -0.0038 158  PRO B O   
2487 C  CB  . PRO B 158 ? 0.9952 1.3175 0.5725 0.2594  0.0698  -0.0024 158  PRO B CB  
2488 C  CG  . PRO B 158 ? 0.9147 1.1852 0.4837 0.1697  0.0818  -0.0015 158  PRO B CG  
2489 C  CD  . PRO B 158 ? 0.9083 1.0823 0.4587 0.1700  0.0931  0.0050  158  PRO B CD  
2490 N  N   . LYS B 159 ? 0.6488 0.6748 0.6709 0.0037  0.0214  0.0025  159  LYS B N   
2491 C  CA  . LYS B 159 ? 0.7140 0.6976 0.7092 0.0177  0.0118  -0.0113 159  LYS B CA  
2492 C  C   . LYS B 159 ? 0.7037 0.7127 0.7255 0.0248  0.0061  -0.0145 159  LYS B C   
2493 O  O   . LYS B 159 ? 0.6881 0.7293 0.7338 0.0438  0.0394  -0.0174 159  LYS B O   
2494 C  CB  . LYS B 159 ? 0.7388 0.7245 0.7188 0.0072  0.0100  0.0034  159  LYS B CB  
2495 C  CG  . LYS B 159 ? 0.8005 0.7532 0.7806 -0.0215 0.0148  0.0031  159  LYS B CG  
2496 C  CD  . LYS B 159 ? 0.7910 0.8054 0.8075 -0.0006 0.0101  -0.0017 159  LYS B CD  
2497 C  CE  . LYS B 159 ? 0.8178 0.8070 0.8636 -0.0013 0.0101  -0.0055 159  LYS B CE  
2498 N  NZ  . LYS B 159 ? 0.7126 0.8700 0.9108 0.0120  0.0280  0.0425  159  LYS B NZ  
2499 ZN ZN  . ZN  C .   ? 0.2975 0.2170 0.2234 -0.0043 0.0341  -0.0641 200  ZN  A ZN  
2500 S  S   . SO4 D .   ? 0.4873 0.5249 0.5040 -0.0035 -0.0029 -0.0045 300  SO4 A S   
2501 O  O1  . SO4 D .   ? 0.4873 0.7015 0.6844 -0.0364 -0.0302 -0.0220 300  SO4 A O1  
2502 O  O2  . SO4 D .   ? 0.5152 0.4814 0.6895 0.0323  -0.0009 0.0515  300  SO4 A O2  
2503 O  O3  . SO4 D .   ? 0.6213 0.5858 0.4946 0.0399  -0.0515 -0.0466 300  SO4 A O3  
2504 O  O4  . SO4 D .   ? 0.5301 0.6980 0.5626 -0.0136 0.0849  0.0231  300  SO4 A O4  
2505 ZN ZN  . ZN  E .   ? 0.2988 0.2852 0.1840 0.0470  -0.0059 -0.0432 200  ZN  B ZN  
2506 S  S   . SO4 F .   ? 0.4860 0.5056 0.4534 -0.0081 0.0042  0.0293  300  SO4 B S   
2507 O  O1  . SO4 F .   ? 0.4706 0.5790 0.5157 -0.0667 -0.0298 0.0583  300  SO4 B O1  
2508 O  O2  . SO4 F .   ? 0.6300 0.6765 0.4889 0.0236  0.0698  -0.0466 300  SO4 B O2  
2509 O  O3  . SO4 F .   ? 0.4128 0.4342 0.4994 -0.0594 0.0277  0.0273  300  SO4 B O3  
2510 O  O4  . SO4 F .   ? 0.5321 0.4929 0.5183 0.0253  0.0479  0.0106  300  SO4 B O4  
2511 O  O   . HOH G .   ? 0.2712 0.2204 0.2697 0.0353  0.0080  -0.0238 1001 HOH A O   
2512 O  O   . HOH G .   ? 0.2922 0.2584 0.3276 -0.0047 0.0206  -0.0515 1002 HOH A O   
2513 O  O   . HOH G .   ? 0.2723 0.2028 0.2969 0.0203  -0.0043 0.0268  1003 HOH A O   
2514 O  O   . HOH G .   ? 0.2501 0.2180 0.2984 0.0256  0.0134  0.0320  1004 HOH A O   
2515 O  O   . HOH G .   ? 0.2705 0.2599 0.2962 -0.0009 0.0006  0.0051  1005 HOH A O   
2516 O  O   . HOH G .   ? 0.2706 0.2116 0.3076 -0.0329 0.0181  -0.0025 1006 HOH A O   
2517 O  O   . HOH G .   ? 0.2787 0.2798 0.3575 -0.0041 -0.0116 -0.0259 1007 HOH A O   
2518 O  O   . HOH G .   ? 0.2963 0.4029 0.4259 0.0009  0.0063  -0.0748 1008 HOH A O   
2519 O  O   . HOH G .   ? 0.3205 0.1926 0.2690 -0.0284 -0.0069 0.0150  1009 HOH A O   
2520 O  O   . HOH G .   ? 0.2347 0.2628 0.2793 0.0077  -0.0154 0.0230  1010 HOH A O   
2521 O  O   . HOH G .   ? 0.4236 0.2134 0.3210 0.0247  0.0091  -0.0035 1011 HOH A O   
2522 O  O   . HOH G .   ? 0.4706 0.2920 0.4543 -0.0006 0.0040  -0.0754 1012 HOH A O   
2523 O  O   . HOH G .   ? 0.3129 0.2747 0.3194 -0.0174 0.0477  -0.0175 1013 HOH A O   
2524 O  O   . HOH G .   ? 0.3596 0.2720 0.3243 0.0014  -0.0338 0.0126  1014 HOH A O   
2525 O  O   . HOH G .   ? 0.3040 0.2091 0.2965 0.0112  0.0208  0.0178  1015 HOH A O   
2526 O  O   . HOH G .   ? 0.4136 0.2230 0.3898 0.0294  0.0227  0.0021  1016 HOH A O   
2527 O  O   . HOH G .   ? 0.3341 0.2523 0.4313 0.0062  -0.0163 -0.0278 1017 HOH A O   
2528 O  O   . HOH G .   ? 0.4251 0.2933 0.4223 0.0419  -0.0072 -0.0038 1018 HOH A O   
2529 O  O   . HOH G .   ? 0.3335 0.3224 0.3470 0.0040  0.0334  0.0342  1019 HOH A O   
2530 O  O   . HOH G .   ? 0.3189 0.3576 0.3937 0.0016  0.0712  0.0021  1020 HOH A O   
2531 O  O   . HOH G .   ? 0.4186 0.4106 0.3138 0.1355  -0.0213 -0.0303 1021 HOH A O   
2532 O  O   . HOH G .   ? 0.4788 0.5278 0.2836 0.0466  -0.0666 -0.0536 1022 HOH A O   
2533 O  O   . HOH G .   ? 0.4506 0.4142 0.2708 -0.0267 0.0514  -0.0401 1023 HOH A O   
2534 O  O   . HOH G .   ? 0.4924 0.3977 0.4387 -0.0683 0.0599  -0.0172 1024 HOH A O   
2535 O  O   . HOH G .   ? 0.4995 0.4791 0.5220 -0.0674 -0.0655 -0.0475 1025 HOH A O   
2536 O  O   . HOH G .   ? 0.4466 0.3480 0.4082 0.1004  -0.0032 -0.0429 1026 HOH A O   
2537 O  O   . HOH G .   ? 0.4324 0.3497 0.4148 0.0058  0.0639  0.0432  1027 HOH A O   
2538 O  O   . HOH G .   ? 0.3652 0.2916 0.3369 -0.0035 0.0718  0.0094  1028 HOH A O   
2539 O  O   . HOH G .   ? 0.3926 0.4750 0.3693 0.0824  -0.0120 -0.0268 1029 HOH A O   
2540 O  O   . HOH G .   ? 0.4285 0.4462 0.4166 0.0555  -0.0747 -0.0826 1030 HOH A O   
2541 O  O   . HOH G .   ? 0.4240 0.5722 0.3500 0.0021  0.0847  0.0757  1031 HOH A O   
2542 O  O   . HOH G .   ? 0.4713 0.4236 0.3711 0.0977  0.0110  0.0767  1032 HOH A O   
2543 O  O   . HOH G .   ? 0.4778 0.4262 0.5444 0.0232  0.0030  0.0266  1033 HOH A O   
2544 O  O   . HOH G .   ? 0.3509 0.5661 0.3587 -0.0393 -0.0663 0.0137  1034 HOH A O   
2545 O  O   . HOH G .   ? 0.4826 0.2936 0.5150 -0.1197 0.0223  -0.0271 1035 HOH A O   
2546 O  O   . HOH G .   ? 0.3460 0.3365 0.3967 0.0171  -0.0051 0.0177  1036 HOH A O   
2547 O  O   . HOH G .   ? 0.3849 0.3651 0.3699 0.0604  0.0254  0.0113  1037 HOH A O   
2548 O  O   . HOH G .   ? 0.4005 0.2618 0.6592 0.0334  -0.0678 -0.0402 1038 HOH A O   
2549 O  O   . HOH G .   ? 0.3838 0.4526 0.4063 0.0401  -0.0004 -0.0485 1039 HOH A O   
2550 O  O   . HOH G .   ? 0.4569 0.3891 0.4398 0.0412  0.0084  0.0279  1040 HOH A O   
2551 O  O   . HOH G .   ? 0.4760 0.5651 0.6701 -0.1203 -0.0111 -0.0889 1041 HOH A O   
2552 O  O   . HOH G .   ? 0.5289 0.3590 0.5073 0.0314  0.0838  -0.0419 1042 HOH A O   
2553 O  O   . HOH G .   ? 0.4344 0.3397 0.4254 0.0815  0.0783  0.0841  1043 HOH A O   
2554 O  O   . HOH G .   ? 0.3763 0.5042 0.4357 0.0446  -0.0231 0.0508  1044 HOH A O   
2555 O  O   . HOH G .   ? 0.5850 0.3486 0.5216 -0.0512 -0.0305 0.0255  1045 HOH A O   
2556 O  O   . HOH G .   ? 0.3716 0.5528 0.4113 -0.0494 -0.1055 -0.0223 1046 HOH A O   
2557 O  O   . HOH G .   ? 0.4318 0.4122 0.4396 0.0633  0.0557  0.0250  1047 HOH A O   
2558 O  O   . HOH G .   ? 0.4653 0.4007 0.4553 -0.0049 -0.0456 0.0386  1048 HOH A O   
2559 O  O   . HOH G .   ? 0.7590 0.4293 0.5012 -0.0350 -0.0079 -0.0573 1049 HOH A O   
2560 O  O   . HOH G .   ? 0.2888 0.3427 0.3301 -0.0098 0.0152  0.0094  1050 HOH A O   
2561 O  O   . HOH G .   ? 0.5083 0.4338 0.3950 -0.0938 0.0489  0.0257  1051 HOH A O   
2562 O  O   . HOH G .   ? 0.4765 0.4001 0.3669 0.0468  0.0314  0.0036  1052 HOH A O   
2563 O  O   . HOH G .   ? 0.4046 0.4200 0.5310 -0.0692 -0.0116 -0.0495 1053 HOH A O   
2564 O  O   . HOH G .   ? 0.5154 0.5478 0.6249 -0.0375 0.0284  0.0290  1054 HOH A O   
2565 O  O   . HOH G .   ? 0.5860 0.5038 0.3637 -0.0589 0.1007  0.0844  1055 HOH A O   
2566 O  O   . HOH G .   ? 0.3666 0.5345 0.5075 -0.0251 0.0156  0.0019  1056 HOH A O   
2567 O  O   . HOH G .   ? 0.5215 0.6078 0.7021 -0.0964 0.1647  -0.0817 1057 HOH A O   
2568 O  O   . HOH G .   ? 0.7491 0.5564 0.5596 -0.0193 -0.0332 0.2032  1058 HOH A O   
2569 O  O   . HOH G .   ? 0.5311 0.5541 0.7459 0.1877  0.1558  -0.0095 1059 HOH A O   
2570 O  O   . HOH G .   ? 0.5263 0.3161 0.6637 0.0713  -0.0269 -0.0731 1060 HOH A O   
2571 O  O   . HOH G .   ? 0.5568 0.5460 0.4609 0.0566  -0.0309 -0.0939 1061 HOH A O   
2572 O  O   . HOH G .   ? 0.4326 0.5156 0.5061 -0.0622 -0.0938 -0.0548 1062 HOH A O   
2573 O  O   . HOH G .   ? 0.3128 0.3751 0.3699 0.0559  -0.0232 -0.0083 1063 HOH A O   
2574 O  O   . HOH G .   ? 0.4441 0.5931 0.5069 0.0382  0.1323  -0.0334 1064 HOH A O   
2575 O  O   . HOH G .   ? 0.3196 0.3774 0.4955 -0.0144 0.0174  -0.0205 1065 HOH A O   
2576 O  O   . HOH G .   ? 0.4699 0.4912 0.4569 0.0988  0.1179  -0.0226 1066 HOH A O   
2577 O  O   . HOH G .   ? 0.4528 0.5091 0.4631 0.0750  -0.0598 -0.0370 1067 HOH A O   
2578 O  O   . HOH G .   ? 0.3944 0.7374 0.7439 0.1032  0.0601  -0.0385 1068 HOH A O   
2579 O  O   . HOH G .   ? 0.5830 0.4824 0.4654 0.0102  -0.0563 0.0948  1069 HOH A O   
2580 O  O   . HOH G .   ? 0.5252 0.5797 0.3790 0.0417  -0.0047 0.1039  1070 HOH A O   
2581 O  O   . HOH G .   ? 0.6848 0.6059 0.3949 0.0458  0.0010  0.0104  1071 HOH A O   
2582 O  O   . HOH G .   ? 0.5912 0.5716 0.5171 -0.0150 0.0068  -0.0110 1072 HOH A O   
2583 O  O   . HOH G .   ? 0.5956 0.6574 0.7769 -0.1166 -0.1378 -0.0242 1073 HOH A O   
2584 O  O   . HOH G .   ? 0.5416 0.4706 0.5019 0.0537  0.0007  0.0721  1074 HOH A O   
2585 O  O   . HOH G .   ? 0.4817 0.5158 0.5056 0.1366  0.0390  0.0514  1075 HOH A O   
2586 O  O   . HOH G .   ? 0.5248 0.5707 0.5060 0.0741  0.0521  -0.0617 1076 HOH A O   
2587 O  O   . HOH G .   ? 0.6773 0.7299 0.6887 -0.0950 -0.0257 0.0205  1077 HOH A O   
2588 O  O   . HOH G .   ? 0.8547 0.5018 0.8059 0.1561  0.1236  -0.0347 1078 HOH A O   
2589 O  O   . HOH G .   ? 0.4980 0.6145 0.5464 -0.1023 -0.0246 -0.0815 1079 HOH A O   
2590 O  O   . HOH G .   ? 0.5813 0.6797 0.5588 0.0936  -0.0048 0.0408  1080 HOH A O   
2591 O  O   . HOH G .   ? 0.4820 0.5540 0.4595 0.0181  0.0282  0.0925  1081 HOH A O   
2592 O  O   . HOH G .   ? 0.7736 0.6293 0.4921 0.0898  -0.0049 -0.0378 1082 HOH A O   
2593 O  O   . HOH G .   ? 0.6500 0.3754 0.4275 0.0411  0.0872  -0.0484 1083 HOH A O   
2594 O  O   . HOH G .   ? 0.5370 0.4883 0.3817 0.0240  0.0175  0.0173  1084 HOH A O   
2595 O  O   . HOH G .   ? 0.3893 0.2629 0.5470 -0.0181 0.0501  0.0432  1085 HOH A O   
2596 O  O   . HOH G .   ? 0.5194 0.7368 0.5050 0.0486  -0.0871 0.1141  1086 HOH A O   
2597 O  O   . HOH G .   ? 0.3923 0.2538 0.5260 0.0264  -0.0591 -0.1032 1087 HOH A O   
2598 O  O   . HOH G .   ? 0.4769 0.4141 0.3554 0.0610  -0.0339 0.0153  1088 HOH A O   
2599 O  O   . HOH G .   ? 0.2806 0.4112 0.5807 0.0511  -0.0068 0.0605  1089 HOH A O   
2600 O  O   . HOH G .   ? 0.3826 0.7136 0.4896 -0.0834 0.0888  0.1040  1090 HOH A O   
2601 O  O   . HOH G .   ? 0.3621 0.3715 0.4455 0.0274  0.0690  0.0213  1091 HOH A O   
2602 O  O   . HOH G .   ? 0.3732 0.4150 0.4067 0.0188  -0.0017 -0.0460 1092 HOH A O   
2603 O  O   . HOH G .   ? 0.4974 0.4653 0.3748 -0.0392 0.0757  0.0312  1093 HOH A O   
2604 O  O   . HOH G .   ? 0.3207 0.5854 0.4911 0.0422  0.0794  -0.0172 1094 HOH A O   
2605 O  O   . HOH G .   ? 0.4321 0.3910 0.4278 0.0374  0.0448  -0.0497 1095 HOH A O   
2606 O  O   . HOH G .   ? 0.5362 0.6777 0.5075 0.0791  -0.0335 0.0893  1096 HOH A O   
2607 O  O   . HOH G .   ? 0.4480 0.4489 0.4092 -0.0421 -0.0094 -0.0067 1097 HOH A O   
2608 O  O   . HOH G .   ? 0.6047 0.6419 0.4677 0.1244  0.0422  -0.0200 1098 HOH A O   
2609 O  O   . HOH G .   ? 0.6261 0.4954 0.4685 0.0643  0.0431  -0.1186 1099 HOH A O   
2610 O  O   . HOH G .   ? 0.4945 0.3601 0.5298 -0.0864 0.0486  -0.0428 1100 HOH A O   
2611 O  O   . HOH G .   ? 0.4719 0.5754 0.3622 0.0551  -0.0314 0.0395  1101 HOH A O   
2612 O  O   . HOH G .   ? 0.4808 0.3861 0.5903 0.0188  -0.1208 -0.0436 1102 HOH A O   
2613 O  O   . HOH G .   ? 0.4636 0.4483 0.5658 0.0685  0.0032  -0.0498 1103 HOH A O   
2614 O  O   . HOH G .   ? 0.5666 0.5164 0.4244 0.0139  0.0131  -0.1008 1104 HOH A O   
2615 O  O   . HOH G .   ? 0.3965 0.5077 0.4036 -0.0076 -0.0493 -0.0097 1105 HOH A O   
2616 O  O   . HOH G .   ? 0.6129 0.4958 0.6586 0.0002  0.0947  -0.1039 1106 HOH A O   
2617 O  O   . HOH G .   ? 0.4671 0.6231 0.3717 0.0436  -0.0481 0.0536  1107 HOH A O   
2618 O  O   . HOH G .   ? 0.5239 0.6311 0.5888 -0.0769 -0.1382 0.0740  1108 HOH A O   
2619 O  O   . HOH G .   ? 0.3387 0.8069 0.5562 -0.1093 -0.0116 -0.1777 1109 HOH A O   
2620 O  O   . HOH G .   ? 0.4826 0.5314 0.5064 0.0650  -0.1027 -0.1145 1110 HOH A O   
2621 O  O   . HOH G .   ? 0.5351 0.5548 0.5343 0.0301  -0.0051 0.0915  1111 HOH A O   
2622 O  O   . HOH G .   ? 0.6349 0.6179 0.6576 -0.1748 0.0911  0.0296  1112 HOH A O   
2623 O  O   . HOH G .   ? 0.5879 0.5116 0.3808 -0.0564 0.0830  0.0247  1113 HOH A O   
2624 O  O   . HOH G .   ? 0.6052 0.4500 0.5171 0.1233  -0.0321 -0.0230 1114 HOH A O   
2625 O  O   . HOH G .   ? 0.4407 0.5453 0.4204 0.0193  0.0138  -0.0357 1115 HOH A O   
2626 O  O   . HOH G .   ? 0.5877 0.5354 0.4092 0.0292  -0.0370 0.0936  1116 HOH A O   
2627 O  O   . HOH G .   ? 0.5637 0.5762 0.5192 -0.0370 0.0829  0.0350  1117 HOH A O   
2628 O  O   . HOH G .   ? 0.4252 0.5708 0.5549 -0.0121 -0.0773 0.0360  1118 HOH A O   
2629 O  O   . HOH G .   ? 0.5334 0.4244 0.5529 -0.0032 0.0066  0.0110  1119 HOH A O   
2630 O  O   . HOH G .   ? 0.6651 0.6649 0.7097 0.3063  0.0779  -0.0030 1120 HOH A O   
2631 O  O   . HOH G .   ? 0.6762 0.4162 0.6311 -0.0808 -0.0021 -0.0931 1121 HOH A O   
2632 O  O   . HOH G .   ? 0.5137 0.4598 0.4973 -0.0360 0.0015  0.0151  1122 HOH A O   
2633 O  O   . HOH G .   ? 0.6683 0.3833 0.5941 0.0628  -0.0622 0.0425  1123 HOH A O   
2634 O  O   . HOH G .   ? 0.4729 0.5601 0.4296 -0.0739 -0.0323 -0.0271 1124 HOH A O   
2635 O  O   . HOH G .   ? 0.5619 0.5155 0.5165 0.1395  -0.0537 -0.1843 1125 HOH A O   
2636 O  O   . HOH G .   ? 0.8545 0.4933 0.6686 -0.0717 0.0641  0.1333  1126 HOH A O   
2637 O  O   . HOH G .   ? 0.5064 0.7064 0.6621 -0.0457 -0.0659 -0.1079 1127 HOH A O   
2638 O  O   . HOH G .   ? 0.5064 0.5699 0.4757 0.0111  0.0207  -0.0322 1128 HOH A O   
2639 O  O   . HOH G .   ? 0.5507 0.6357 0.6904 0.0574  -0.1455 0.0430  1129 HOH A O   
2640 O  O   . HOH G .   ? 0.7563 0.7290 0.3949 0.0362  0.0619  0.0410  1130 HOH A O   
2641 O  O   . HOH G .   ? 0.4616 0.5750 0.7714 0.0377  0.1162  0.0282  1131 HOH A O   
2642 O  O   . HOH G .   ? 0.5135 0.5934 0.6515 0.0595  0.0204  -0.0814 1132 HOH A O   
2643 O  O   . HOH G .   ? 0.4514 0.5423 0.8051 0.0108  0.0265  -0.0326 1133 HOH A O   
2644 O  O   . HOH G .   ? 0.8408 0.7273 0.7464 -0.0039 0.1533  0.1893  1134 HOH A O   
2645 O  O   . HOH G .   ? 0.6364 0.6105 0.6834 0.1043  0.0402  -0.0435 1135 HOH A O   
2646 O  O   . HOH G .   ? 0.5243 0.6579 0.6530 -0.0993 -0.0213 -0.0438 1136 HOH A O   
2647 O  O   . HOH G .   ? 0.5938 0.4367 0.4988 0.0160  0.1181  0.0294  1137 HOH A O   
2648 O  O   . HOH G .   ? 1.0564 0.6240 0.8964 -0.0927 -0.0092 -0.0917 1138 HOH A O   
2649 O  O   . HOH G .   ? 0.6441 0.7646 0.7741 0.0888  0.1586  0.1892  1139 HOH A O   
2650 O  O   . HOH G .   ? 0.7824 0.6639 0.4532 -0.0470 0.0091  -0.1287 1140 HOH A O   
2651 O  O   . HOH G .   ? 0.3348 0.4353 0.4648 -0.0686 0.0072  0.0499  1141 HOH A O   
2652 O  O   . HOH G .   ? 0.4161 0.4253 0.3346 -0.0423 -0.0303 -0.0285 1142 HOH A O   
2653 O  O   . HOH G .   ? 0.5272 0.5471 0.4522 0.0135  -0.1124 0.0464  1143 HOH A O   
2654 O  O   . HOH G .   ? 0.3015 0.4252 0.3799 0.0060  -0.0539 -0.0165 1144 HOH A O   
2655 O  O   . HOH G .   ? 0.4680 0.3070 0.3146 0.1014  -0.0282 0.0828  1145 HOH A O   
2656 O  O   . HOH G .   ? 0.8013 0.5567 0.6053 0.1086  0.0288  -0.0303 1146 HOH A O   
2657 O  O   . HOH G .   ? 0.4858 0.5964 0.5577 0.0257  0.0128  0.0672  1147 HOH A O   
2658 O  O   . HOH H .   ? 0.2579 0.2387 0.2809 0.0083  0.0125  -0.0056 1001 HOH B O   
2659 O  O   . HOH H .   ? 0.3980 0.3542 0.3022 0.0918  -0.0272 -0.0182 1002 HOH B O   
2660 O  O   . HOH H .   ? 0.3599 0.4372 0.2645 0.0114  -0.0500 0.0223  1003 HOH B O   
2661 O  O   . HOH H .   ? 0.3074 0.2654 0.3253 0.0182  -0.0241 0.0388  1004 HOH B O   
2662 O  O   . HOH H .   ? 0.3762 0.3782 0.3578 0.0227  -0.0264 0.0805  1005 HOH B O   
2663 O  O   . HOH H .   ? 0.2502 0.3406 0.3134 0.0616  -0.0104 -0.0065 1006 HOH B O   
2664 O  O   . HOH H .   ? 0.3576 0.2842 0.3209 0.0626  -0.0022 0.0089  1007 HOH B O   
2665 O  O   . HOH H .   ? 0.3060 0.2353 0.3071 0.0253  -0.0330 0.0133  1008 HOH B O   
2666 O  O   . HOH H .   ? 0.4177 0.3797 0.4066 0.0927  -0.0710 -0.0912 1009 HOH B O   
2667 O  O   . HOH H .   ? 0.4503 0.4216 0.3070 0.0386  -0.1018 0.0224  1010 HOH B O   
2668 O  O   . HOH H .   ? 0.2855 0.3929 0.2648 -0.0482 -0.0459 0.0712  1011 HOH B O   
2669 O  O   . HOH H .   ? 0.4963 0.3190 0.4955 0.0365  0.0418  0.0000  1012 HOH B O   
2670 O  O   . HOH H .   ? 0.3387 0.4171 0.2889 -0.0257 0.0278  0.0483  1013 HOH B O   
2671 O  O   . HOH H .   ? 0.3484 0.3504 0.3580 0.0126  0.0198  0.0260  1014 HOH B O   
2672 O  O   . HOH H .   ? 0.4834 0.4208 0.3786 -0.0338 -0.0482 0.0927  1015 HOH B O   
2673 O  O   . HOH H .   ? 0.5841 0.3575 0.3688 0.0595  0.0795  -0.0088 1016 HOH B O   
2674 O  O   . HOH H .   ? 0.3899 0.3444 0.4030 0.1019  -0.0217 0.0074  1017 HOH B O   
2675 O  O   . HOH H .   ? 0.4269 0.5728 0.4596 -0.0152 0.0135  -0.0145 1018 HOH B O   
2676 O  O   . HOH H .   ? 0.4779 0.5424 0.4435 0.0320  -0.0835 -0.0458 1019 HOH B O   
2677 O  O   . HOH H .   ? 0.5208 0.6020 0.3592 -0.1695 0.0324  0.0605  1020 HOH B O   
2678 O  O   . HOH H .   ? 0.3984 0.6417 0.3086 -0.0065 0.0137  -0.0451 1021 HOH B O   
2679 O  O   . HOH H .   ? 0.4037 0.5594 0.3508 -0.2265 -0.0505 -0.0196 1022 HOH B O   
2680 O  O   . HOH H .   ? 0.4724 0.4367 0.4439 0.1316  -0.1144 0.0090  1023 HOH B O   
2681 O  O   . HOH H .   ? 0.4386 0.5186 0.4733 0.0436  0.0920  0.0465  1024 HOH B O   
2682 O  O   . HOH H .   ? 0.4054 0.5553 0.4308 -0.0753 0.0244  -0.0034 1025 HOH B O   
2683 O  O   . HOH H .   ? 0.4044 0.3098 0.4622 0.0271  -0.0869 -0.0584 1026 HOH B O   
2684 O  O   . HOH H .   ? 0.4817 0.4014 0.4347 0.1003  -0.0302 0.0044  1027 HOH B O   
2685 O  O   . HOH H .   ? 0.4059 0.5404 0.3793 0.0858  -0.0648 -0.0419 1028 HOH B O   
2686 O  O   . HOH H .   ? 0.5035 0.2525 0.5464 -0.0342 -0.0829 0.0294  1029 HOH B O   
2687 O  O   . HOH H .   ? 0.4144 0.4031 0.3988 0.0090  -0.0495 0.0469  1030 HOH B O   
2688 O  O   . HOH H .   ? 0.5536 0.3396 0.4283 0.0931  -0.0983 -0.0377 1031 HOH B O   
2689 O  O   . HOH H .   ? 0.3745 0.7326 0.4782 -0.0448 -0.0389 0.0133  1032 HOH B O   
2690 O  O   . HOH H .   ? 0.6763 0.6477 0.6460 0.0074  -0.0216 -0.0908 1033 HOH B O   
2691 O  O   . HOH H .   ? 0.5335 0.7756 0.5807 0.0165  -0.1733 0.0588  1034 HOH B O   
2692 O  O   . HOH H .   ? 0.3857 0.3377 0.3766 0.0391  -0.0124 -0.0131 1035 HOH B O   
2693 O  O   . HOH H .   ? 0.5322 0.4359 0.5162 -0.0861 0.0415  -0.0144 1036 HOH B O   
2694 O  O   . HOH H .   ? 0.5230 0.5703 0.5336 0.1739  -0.1283 0.1120  1037 HOH B O   
2695 O  O   . HOH H .   ? 0.5258 0.5998 0.5016 -0.1902 -0.0261 0.1075  1038 HOH B O   
2696 O  O   . HOH H .   ? 0.6346 0.5928 0.3950 0.0380  0.1008  -0.0709 1039 HOH B O   
2697 O  O   . HOH H .   ? 0.6568 0.8364 0.5550 0.0764  0.0542  0.1062  1040 HOH B O   
2698 O  O   . HOH H .   ? 0.4263 0.7070 0.4479 0.0419  -0.1045 -0.0044 1041 HOH B O   
2699 O  O   . HOH H .   ? 0.5819 0.6941 0.8007 0.0472  -0.1971 0.0016  1042 HOH B O   
2700 O  O   . HOH H .   ? 0.5915 0.8153 0.6782 0.0933  0.1069  -0.2691 1043 HOH B O   
2701 O  O   . HOH H .   ? 0.7094 0.5285 0.6461 -0.1542 0.0711  -0.1876 1044 HOH B O   
2702 O  O   . HOH H .   ? 0.4184 0.4454 0.4413 0.0092  -0.0222 -0.0003 1045 HOH B O   
2703 O  O   . HOH H .   ? 0.6479 0.8815 0.5584 -0.0322 -0.2367 0.1886  1046 HOH B O   
2704 O  O   . HOH H .   ? 0.5948 0.3341 0.5121 0.0669  -0.0818 0.0373  1047 HOH B O   
2705 O  O   . HOH H .   ? 0.6173 0.9081 1.2916 0.0389  -0.1999 -0.1287 1048 HOH B O   
2706 O  O   . HOH H .   ? 0.5078 0.7892 0.7996 0.0412  -0.0391 0.0010  1049 HOH B O   
2707 O  O   . HOH H .   ? 0.5470 0.7803 0.6981 0.0279  -0.2282 0.0335  1050 HOH B O   
2708 O  O   . HOH H .   ? 0.4869 0.3414 0.4149 0.0992  -0.0030 0.0090  1051 HOH B O   
2709 O  O   . HOH H .   ? 0.4464 0.6684 0.3579 -0.1233 0.0469  -0.0126 1052 HOH B O   
2710 O  O   . HOH H .   ? 0.4994 0.4946 0.5918 0.0991  0.0713  0.0318  1053 HOH B O   
2711 O  O   . HOH H .   ? 0.6377 0.7931 0.3630 -0.0147 0.0861  0.0643  1054 HOH B O   
2712 O  O   . HOH H .   ? 0.3584 0.2400 0.3405 -0.0014 -0.0261 0.0025  1055 HOH B O   
2713 O  O   . HOH H .   ? 0.4796 0.8175 0.4741 0.0714  0.0702  -0.0059 1056 HOH B O   
2714 O  O   . HOH H .   ? 0.4752 0.3625 0.3641 0.0190  -0.0298 0.0195  1057 HOH B O   
2715 O  O   . HOH H .   ? 0.4159 0.5477 0.4448 0.1199  -0.0921 0.0542  1058 HOH B O   
2716 O  O   . HOH H .   ? 0.4953 0.5463 0.4058 -0.1093 -0.1447 0.0750  1059 HOH B O   
2717 O  O   . HOH H .   ? 0.4497 0.3882 0.4358 -0.0061 -0.0464 0.0701  1060 HOH B O   
2718 O  O   . HOH H .   ? 0.6004 0.3434 0.5676 0.1127  -0.1247 0.0410  1061 HOH B O   
2719 O  O   . HOH H .   ? 0.4726 0.4519 0.5012 0.0661  -0.0477 0.0345  1062 HOH B O   
2720 O  O   . HOH H .   ? 0.4858 0.3361 0.3460 0.0486  -0.0088 0.0396  1063 HOH B O   
2721 O  O   . HOH H .   ? 0.3606 0.6335 0.2845 -0.0322 0.0099  0.0310  1064 HOH B O   
2722 O  O   . HOH H .   ? 0.3761 0.7119 0.5156 -0.1260 -0.0889 0.0739  1065 HOH B O   
2723 O  O   . HOH H .   ? 0.6192 0.4977 0.3968 -0.0129 -0.0822 -0.0725 1066 HOH B O   
2724 O  O   . HOH H .   ? 0.6134 0.4583 0.4594 0.0766  -0.1416 -0.0049 1067 HOH B O   
2725 O  O   . HOH H .   ? 0.5044 0.4383 0.4996 0.0100  -0.0168 0.0598  1068 HOH B O   
2726 O  O   . HOH H .   ? 0.7567 0.6396 0.6682 -0.0081 -0.0880 0.0499  1069 HOH B O   
2727 O  O   . HOH H .   ? 0.4443 0.4743 0.3792 0.0507  -0.0676 -0.0092 1070 HOH B O   
2728 O  O   . HOH H .   ? 0.4137 0.3836 0.4107 0.0757  -0.0851 0.0081  1071 HOH B O   
2729 O  O   . HOH H .   ? 0.4894 0.6236 0.5062 0.0852  -0.0231 0.1100  1072 HOH B O   
2730 O  O   . HOH H .   ? 0.4351 0.4827 0.3829 -0.0342 0.0010  -0.0388 1073 HOH B O   
2731 O  O   . HOH H .   ? 0.6807 0.6619 0.3803 0.0231  0.0395  0.1272  1074 HOH B O   
2732 O  O   . HOH H .   ? 0.6294 0.6816 0.5371 0.0222  -0.0201 -0.0343 1075 HOH B O   
2733 O  O   . HOH H .   ? 0.3876 0.5173 0.4618 0.0228  0.0736  0.0366  1076 HOH B O   
2734 O  O   . HOH H .   ? 0.6510 0.7036 0.4227 -0.0429 0.0848  -0.1041 1077 HOH B O   
2735 O  O   . HOH H .   ? 0.6731 0.6388 0.4245 -0.0187 0.0241  -0.1260 1078 HOH B O   
2736 O  O   . HOH H .   ? 0.5971 0.2804 0.6331 0.0501  -0.0112 0.0418  1079 HOH B O   
2737 O  O   . HOH H .   ? 0.5869 0.4026 0.5098 0.0386  -0.0657 -0.0191 1080 HOH B O   
2738 O  O   . HOH H .   ? 0.4263 0.5585 0.5627 0.1315  -0.0368 -0.0476 1081 HOH B O   
2739 O  O   . HOH H .   ? 0.4763 0.5110 0.5110 0.0113  -0.0645 0.0376  1082 HOH B O   
2740 O  O   . HOH H .   ? 0.5472 0.4043 0.4742 -0.0359 -0.0735 -0.0464 1083 HOH B O   
2741 O  O   . HOH H .   ? 0.6205 0.5884 0.3870 0.0702  0.0521  -0.0882 1084 HOH B O   
2742 O  O   . HOH H .   ? 0.5427 0.6254 0.4663 0.0187  0.1290  0.1257  1085 HOH B O   
2743 O  O   . HOH H .   ? 0.5468 0.4817 0.6023 -0.0451 0.1076  0.0054  1086 HOH B O   
2744 O  O   . HOH H .   ? 0.4377 0.7934 0.3357 -0.0437 -0.0062 0.0121  1087 HOH B O   
2745 O  O   . HOH H .   ? 0.6528 0.6668 0.5104 0.1732  0.0682  -0.1199 1088 HOH B O   
2746 O  O   . HOH H .   ? 0.5874 0.7744 0.5265 -0.0922 0.1601  0.0423  1089 HOH B O   
2747 O  O   . HOH H .   ? 0.4521 0.5200 0.4929 -0.0030 0.0262  -0.0640 1090 HOH B O   
2748 O  O   . HOH H .   ? 0.6227 0.4584 0.5423 0.0020  -0.0307 0.0102  1091 HOH B O   
2749 O  O   . HOH H .   ? 0.4389 0.5977 0.3716 -0.0119 -0.0404 0.0092  1092 HOH B O   
2750 O  O   . HOH H .   ? 0.5043 0.5458 0.4676 0.1392  -0.0563 -0.0562 1093 HOH B O   
2751 O  O   . HOH H .   ? 0.6600 0.5785 0.4838 0.0069  0.0611  0.0442  1094 HOH B O   
2752 O  O   . HOH H .   ? 0.6186 0.4706 0.5141 -0.0354 -0.1126 -0.0180 1095 HOH B O   
2753 O  O   . HOH H .   ? 0.4940 0.4184 0.5767 0.0602  -0.0009 -0.0145 1096 HOH B O   
2754 O  O   . HOH H .   ? 0.5524 0.6164 0.6393 -0.0494 0.0137  0.0210  1097 HOH B O   
2755 O  O   . HOH H .   ? 0.5010 0.6751 0.8950 0.1222  0.1942  -0.1645 1098 HOH B O   
2756 O  O   . HOH H .   ? 0.6127 0.7077 0.6223 -0.1829 -0.2293 0.1439  1099 HOH B O   
2757 O  O   . HOH H .   ? 0.6144 0.7243 0.5341 -0.1436 -0.1830 0.0192  1100 HOH B O   
2758 O  O   . HOH H .   ? 0.5650 0.7457 0.4305 0.1067  -0.1155 -0.1495 1101 HOH B O   
2759 O  O   . HOH H .   ? 0.8260 0.7578 0.7608 -0.0190 -0.0968 -0.0773 1102 HOH B O   
2760 O  O   . HOH H .   ? 0.5472 0.3713 0.3210 0.0205  -0.0484 -0.0212 1103 HOH B O   
2761 O  O   . HOH H .   ? 0.6446 0.3821 0.5170 -0.0223 -0.0988 0.0186  1104 HOH B O   
2762 O  O   . HOH H .   ? 0.5099 0.5955 0.4815 0.1177  -0.0899 0.0910  1105 HOH B O   
2763 O  O   . HOH H .   ? 0.6905 0.6250 0.4828 -0.0446 0.0522  -0.1188 1106 HOH B O   
2764 O  O   . HOH H .   ? 0.5288 0.7123 0.6394 0.1157  -0.1236 -0.0654 1107 HOH B O   
2765 O  O   . HOH H .   ? 0.7665 0.4651 0.5788 0.1258  0.0497  0.0617  1108 HOH B O   
2766 O  O   . HOH H .   ? 0.7239 0.5397 0.6328 0.1475  0.1561  -0.1226 1109 HOH B O   
2767 O  O   . HOH H .   ? 0.4766 0.7826 0.5178 -0.0228 -0.0965 0.0673  1110 HOH B O   
2768 O  O   . HOH H .   ? 0.4135 0.6119 0.4485 0.0351  -0.0064 0.0091  1111 HOH B O   
2769 O  O   . HOH H .   ? 0.6088 0.8846 0.7177 0.1384  -0.0680 0.1899  1112 HOH B O   
2770 O  O   . HOH H .   ? 0.8901 0.5595 0.9338 -0.1229 -0.2531 -0.0111 1113 HOH B O   
2771 O  O   . HOH H .   ? 0.7372 0.6369 0.5788 -0.1850 -0.1179 0.0906  1114 HOH B O   
2772 O  O   . HOH H .   ? 0.5890 0.5499 0.4632 0.0223  0.0014  0.0419  1115 HOH B O   
2773 O  O   . HOH H .   ? 0.5612 0.5280 0.5454 -0.0115 -0.0198 -0.0023 1116 HOH B O   
2774 O  O   . HOH H .   ? 0.7637 0.6127 0.5683 -0.1076 -0.0961 -0.1004 1117 HOH B O   
2775 O  O   . HOH H .   ? 0.5326 0.5892 0.7277 0.0601  0.1070  -0.1380 1118 HOH B O   
2776 O  O   . HOH H .   ? 0.4202 0.7398 0.7685 -0.1404 -0.3332 0.0920  1119 HOH B O   
2777 O  O   . HOH H .   ? 0.7129 0.5221 0.6971 -0.0259 0.0390  -0.0012 1120 HOH B O   
2778 O  O   . HOH H .   ? 0.4658 0.4834 0.8152 0.0517  -0.0233 -0.0697 1121 HOH B O   
2779 O  O   . HOH H .   ? 0.8525 0.5937 0.4531 -0.0412 -0.0873 -0.0683 1122 HOH B O   
2780 O  O   . HOH H .   ? 0.8000 0.3729 0.6457 -0.0967 -0.0076 -0.0075 1123 HOH B O   
2781 O  O   . HOH H .   ? 0.6183 0.7097 0.5344 0.2212  -0.0134 -0.0797 1124 HOH B O   
2782 O  O   . HOH H .   ? 0.7226 0.6506 0.9727 -0.1806 -0.2897 -0.0466 1125 HOH B O   
2783 O  O   . HOH H .   ? 0.6851 0.7242 0.6095 -0.0026 0.1586  -0.2174 1126 HOH B O   
2784 O  O   . HOH H .   ? 0.7330 0.4226 0.6891 0.0294  -0.0215 -0.0585 1127 HOH B O   
2785 O  O   . HOH H .   ? 0.6141 0.5961 0.7741 0.1965  0.1258  -0.0155 1128 HOH B O   
2786 O  O   . HOH H .   ? 0.6220 0.7638 0.4424 -0.0628 -0.0111 0.1471  1129 HOH B O   
2787 O  O   . HOH H .   ? 0.3930 0.3663 0.4276 -0.0744 -0.0192 0.0015  1130 HOH B O   
2788 O  O   . HOH H .   ? 0.5481 0.5386 0.7771 0.0187  -0.0342 0.1137  1131 HOH B O   
2789 O  O   . HOH H .   ? 0.5299 0.5798 0.6002 0.0678  -0.0803 -0.0368 1132 HOH B O   
2790 O  O   . HOH H .   ? 0.5754 0.7420 0.6864 -0.0252 -0.2365 -0.1560 1133 HOH B O   
2791 O  O   . HOH H .   ? 0.4479 0.7124 0.5724 -0.0236 -0.1846 -0.0573 1134 HOH B O   
2792 O  O   . HOH H .   ? 0.4185 0.7191 0.5760 -0.1759 0.1131  0.1218  1135 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  MET 27  27  27  MET MET A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  TRP 62  62  62  TRP TRP A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 TRP 142 142 142 TRP TRP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
B 1 1   GLY 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  MET 15  15  15  MET MET B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  ILE 17  17  17  ILE ILE B . n 
B 1 18  ALA 18  18  18  ALA ALA B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  TYR 21  21  21  TYR TYR B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  MET 27  27  27  MET MET B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  ILE 41  41  41  ILE ILE B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ASN 52  52  52  ASN ASN B . n 
B 1 53  ASN 53  53  53  ASN ASN B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  GLY 60  60  60  GLY GLY B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  TRP 62  62  62  TRP TRP B . n 
B 1 63  MET 63  63  63  MET MET B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  TYR 65  65  65  TYR TYR B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  THR 67  67  67  THR THR B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  LYS 73  73  73  LYS LYS B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  ASP 76  76  76  ASP ASP B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  MET 86  86  86  MET MET B . n 
B 1 87  PRO 87  87  87  PRO PRO B . n 
B 1 88  MET 88  88  88  MET MET B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ASN 99  99  99  ASN ASN B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 MET 102 102 102 MET MET B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 GLY 113 113 113 GLY GLY B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 TYR 120 120 120 TYR TYR B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ASN 123 123 123 ASN ASN B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 GLN 127 127 127 GLN GLN B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 GLY 130 130 130 GLY GLY B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 HIS 132 132 132 HIS HIS B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 THR 137 137 137 THR THR B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 TRP 142 142 142 TRP TRP B . n 
B 1 143 PHE 143 143 143 PHE PHE B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 TYR 150 150 150 TYR TYR B . n 
B 1 151 LYS 151 151 151 LYS LYS B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 TYR 154 154 154 TYR TYR B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3330  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  13950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SD  ? B MET 88  ? B MET 88  ? 1_555 ZN ? E ZN . ? B ZN 200 ? 1_555 NE2 ? B HIS 95  ? B HIS 95  ? 1_555 112.8 ? 
2  SD  ? B MET 88  ? B MET 88  ? 1_555 ZN ? E ZN . ? B ZN 200 ? 1_555 NE2 ? B HIS 42  ? B HIS 42  ? 1_555 116.5 ? 
3  NE2 ? B HIS 95  ? B HIS 95  ? 1_555 ZN ? E ZN . ? B ZN 200 ? 1_555 NE2 ? B HIS 42  ? B HIS 42  ? 1_555 85.2  ? 
4  SD  ? B MET 88  ? B MET 88  ? 1_555 ZN ? E ZN . ? B ZN 200 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 105.5 ? 
5  NE2 ? B HIS 95  ? B HIS 95  ? 1_555 ZN ? E ZN . ? B ZN 200 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 93.4  ? 
6  NE2 ? B HIS 42  ? B HIS 42  ? 1_555 ZN ? E ZN . ? B ZN 200 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 134.9 ? 
7  NE2 ? A HIS 95  ? A HIS 95  ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 103.5 ? 
8  NE2 ? A HIS 95  ? A HIS 95  ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 116.6 ? 
9  NE2 ? B HIS 132 ? B HIS 132 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 98.2  ? 
10 NE2 ? A HIS 95  ? A HIS 95  ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 42  ? A HIS 42  ? 1_555 93.0  ? 
11 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 42  ? A HIS 42  ? 1_555 130.3 ? 
12 SD  ? A MET 88  ? A MET 88  ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 42  ? A HIS 42  ? 1_555 115.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 28.0800 11.5680 37.6620 0.0627 0.1171 0.1537 -0.0064 -0.0050 0.0449  4.6541 13.3192 4.9085  
-3.7069 0.6347  6.7971  -0.0436 -0.3905 0.1779  0.1122  0.2994  -0.6493 0.0677  0.0674  -0.2558 
'X-RAY DIFFRACTION' 2  ? refined 24.5130 13.2970 32.4320 0.0771 0.0499 0.1022 0.0019  -0.0033 0.0116  1.1867 2.4439  2.0962  
-0.8655 -1.0326 1.0370  0.0592  -0.1343 0.0685  -0.0752 0.0095  -0.2557 -0.0178 0.0195  -0.0687 
'X-RAY DIFFRACTION' 3  ? refined 9.5500  26.5350 30.4540 0.1523 0.2191 0.2529 0.0834  0.0659  0.0143  0.1701 3.9263  15.3195 
1.3804  2.4256  -4.7045 0.0417  -0.1936 0.2167  -0.1163 0.1374  0.1741  0.0843  -0.9380 -0.1791 
'X-RAY DIFFRACTION' 4  ? refined 24.0130 14.7580 26.4240 0.0918 0.0535 0.0969 0.0171  0.0154  0.0194  1.9220 0.3491  2.9076  
-0.5147 -2.1027 0.7591  -0.1090 -0.2209 -0.1266 0.0072  -0.0078 0.0330  -0.0165 0.1873  0.1168  
'X-RAY DIFFRACTION' 5  ? refined 13.6370 8.5200  36.4620 0.0507 0.0394 0.0641 -0.0072 0.0359  0.0010  0.7963 0.5978  6.8008  
-0.1364 -0.4430 -0.1246 -0.0225 -0.0782 -0.0819 0.0642  0.0020  0.0768  0.1526  -0.3622 0.0205  
'X-RAY DIFFRACTION' 6  ? refined 16.5530 19.8140 34.5000 0.1043 0.0846 0.0943 0.0120  0.0035  -0.0175 0.7394 0.7796  3.9669  
-0.0355 -1.4430 -0.8537 0.0098  -0.0129 0.0310  0.0132  -0.0577 -0.0502 -0.0796 -0.0560 0.0479  
'X-RAY DIFFRACTION' 7  ? refined 12.5860 10.8120 47.9210 0.1437 0.0872 0.0743 0.0037  0.0065  0.0258  3.0206 4.4420  1.8512  
-2.3176 -2.1233 0.3521  -0.0682 0.0662  -0.2978 0.3258  -0.0225 0.3290  0.0353  -0.0722 0.0907  
'X-RAY DIFFRACTION' 8  ? refined 17.8380 6.5350  18.4700 0.0626 0.0394 0.0881 0.0002  0.0111  -0.0186 1.2275 0.7582  8.1431  
0.0536  -1.6523 -0.4479 -0.0636 0.0674  -0.0734 -0.0707 -0.0271 0.0518  0.2418  -0.4954 0.0907  
'X-RAY DIFFRACTION' 9  ? refined 24.1230 2.4170  11.6870 0.0594 0.0303 0.1140 0.0300  0.0096  -0.0225 1.3390 3.8719  14.8257 
2.1694  -3.5725 -4.3100 0.0167  0.1511  0.0972  -0.0598 0.2170  0.1159  0.0676  -0.2359 -0.2337 
'X-RAY DIFFRACTION' 10 ? refined 21.4930 8.3740  39.8550 0.0868 0.1085 0.1101 0.0060  0.0155  0.0167  0.7425 1.6859  5.3932  
-0.0361 0.2003  1.9437  -0.1089 -0.2388 -0.1028 0.1258  -0.0047 0.0141  0.1556  0.1358  0.1137  
'X-RAY DIFFRACTION' 11 ? refined 20.2672 10.7325 30.6507 0.0764 0.0541 0.1120 -0.0021 -0.0106 -0.0013 0.4998 0.4662  1.6184  
-0.1551 -0.6029 0.1060  0.0110  -0.0639 -0.0372 0.0099  -0.0341 0.0247  -0.0072 -0.0113 0.0232  
'X-RAY DIFFRACTION' 12 ? refined 28.3600 24.2500 -1.7420 0.2348 0.3675 0.3482 -0.0177 0.0276  0.0649  9.3631 28.1424 14.5059 
14.6040 0.7503  12.1711 0.7578  0.3473  -0.6982 0.1329  0.1864  -2.1095 -0.8846 -0.2966 -0.9442 
'X-RAY DIFFRACTION' 13 ? refined 24.7770 26.5310 4.9890  0.2423 0.1427 0.1400 0.0483  0.0501  0.0889  3.0619 3.5319  7.2764  
0.3511  1.5770  5.1894  0.0563  0.5146  0.3420  -0.2802 0.0055  -0.1625 -0.3899 0.1319  -0.0618 
'X-RAY DIFFRACTION' 14 ? refined 16.2370 5.7530  3.0700  0.1750 0.2441 0.1424 -0.0223 -0.0371 -0.0550 0.8660 9.2312  8.7682  
0.2617  0.3880  -5.8527 0.2048  0.2228  -0.0162 -0.0382 -0.1335 0.5092  0.4525  -0.5096 -0.0713 
'X-RAY DIFFRACTION' 15 ? refined 22.3210 21.7380 10.5560 0.0884 0.0703 0.0641 0.0297  -0.0057 0.0318  1.2972 1.1459  1.8451  
0.1712  0.8103  0.8293  0.0276  0.2033  0.1554  -0.0990 -0.0021 -0.0951 -0.1908 -0.0565 -0.0256 
'X-RAY DIFFRACTION' 16 ? refined 11.4490 24.9100 -6.9100 0.0456 0.0962 0.0795 -0.0274 -0.0547 0.0444  1.7648 0.8334  11.9811 
-0.9347 2.0010  -1.6219 -0.1208 -0.0357 0.0915  -0.0232 0.1039  0.1361  -0.2537 0.1545  0.0169  
'X-RAY DIFFRACTION' 17 ? refined 19.2640 14.4150 1.5410  0.0917 0.1755 0.0558 0.0243  -0.0011 -0.0012 0.0566 1.1293  3.1550  
-0.0269 0.5423  0.0074  -0.0238 0.0734  0.0084  -0.0860 -0.0274 -0.0496 -0.1642 -0.0286 0.0512  
'X-RAY DIFFRACTION' 18 ? refined 13.9850 24.0460 -3.8710 0.0427 0.1383 0.0797 -0.0279 -0.0453 0.0362  0.3158 0.8943  6.4614  
-0.1656 1.1304  0.2390  -0.0707 0.0922  0.0706  -0.0649 0.0723  0.0619  -0.1472 0.1220  -0.0017 
'X-RAY DIFFRACTION' 19 ? refined 11.4790 23.8490 19.4780 0.0602 0.1027 0.0571 0.0543  0.0149  0.0053  5.3903 2.0132  14.0551 
1.1403  3.0476  2.0207  0.0058  0.0513  0.3709  -0.1459 -0.2031 0.0661  -0.2677 -0.9740 0.1973  
'X-RAY DIFFRACTION' 20 ? refined 18.0200 31.5440 28.4440 0.1551 0.0211 0.0882 0.0294  -0.0092 -0.0264 6.8506 5.5536  12.3465 
-0.6685 0.7806  -2.1929 -0.0406 -0.3173 0.1251  0.4005  -0.1019 0.0751  -0.3902 -0.1387 0.1425  
'X-RAY DIFFRACTION' 21 ? refined 19.5380 27.4890 -1.0840 0.2805 0.4013 0.1597 -0.1157 -0.0633 0.0236  0.6404 2.5980  12.0563 
-0.0738 -1.4344 2.2344  -0.3205 0.2064  0.0760  0.0291  0.0912  0.2747  -0.6050 0.8099  0.2293  
'X-RAY DIFFRACTION' 22 ? refined 19.0042 22.8249 5.4091  0.1376 0.1340 0.1402 0.0192  0.0067  0.0100  0.8109 0.0737  1.6071  
0.1318  1.0250  -0.1337 -0.0305 0.1423  0.0412  -0.0003 0.0546  -0.0418 -0.0929 0.0568  -0.0241 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 3    A 10   ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 11   A 25   ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 26   A 33   ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 34   A 63   ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 64   A 85   ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 86   A 105  ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  A 106  A 116  ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  A 117  A 134  ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  A 135  A 144  ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 A 145  A 158  ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 A 1001 A 1147 ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 B 3    B 9    ? . . . . ? 
'X-RAY DIFFRACTION' 13 13 B 10   B 23   ? . . . . ? 
'X-RAY DIFFRACTION' 14 14 B 24   B 33   ? . . . . ? 
'X-RAY DIFFRACTION' 15 15 B 34   B 69   ? . . . . ? 
'X-RAY DIFFRACTION' 16 16 B 70   B 84   ? . . . . ? 
'X-RAY DIFFRACTION' 17 17 B 85   B 105  ? . . . . ? 
'X-RAY DIFFRACTION' 18 18 B 106  B 124  ? . . . . ? 
'X-RAY DIFFRACTION' 19 19 B 125  B 130  ? . . . . ? 
'X-RAY DIFFRACTION' 20 20 B 131  B 142  ? . . . . ? 
'X-RAY DIFFRACTION' 21 21 B 143  B 158  ? . . . . ? 
'X-RAY DIFFRACTION' 22 22 B 1001 B 1135 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice 'data collection' . ? 1 
REFMAC  refinement        . ? 2 
XDS     'data reduction'  . ? 3 
XSCALE  'data scaling'    . ? 4 
REFMAC  phasing           . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 26  ? B O A HOH 1116 ? ? 2.12 
2 1 O2  B SO4 300 ? ? O B HOH 1131 ? ? 2.12 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     1052 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     1084 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_655 
_pdbx_validate_symm_contact.dist              2.02 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE B ARG 131 ? ? CZ B ARG 131 ? ? NH1 B ARG 131 ? ? 123.91 120.30 3.61  0.50 N 
2 1 NE B ARG 131 ? ? CZ B ARG 131 ? ? NH2 B ARG 131 ? ? 117.13 120.30 -3.17 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 32  ? ? -106.75 -67.91 
2 1 MET A 102 ? ? -115.48 -91.46 
3 1 MET B 102 ? ? -115.56 -90.46 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 1 ? A GLY 1 
2 1 Y 1 B GLY 1 ? B GLY 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   200  200  ZN  ZN  A . 
D 3 SO4 1   300  300  SO4 SO4 A . 
E 2 ZN  1   200  200  ZN  ZN  B . 
F 3 SO4 1   300  300  SO4 SO4 B . 
G 4 HOH 1   1001 1001 HOH HOH A . 
G 4 HOH 2   1002 1002 HOH HOH A . 
G 4 HOH 3   1003 1003 HOH HOH A . 
G 4 HOH 4   1004 1004 HOH HOH A . 
G 4 HOH 5   1005 1005 HOH HOH A . 
G 4 HOH 6   1006 1006 HOH HOH A . 
G 4 HOH 7   1007 1007 HOH HOH A . 
G 4 HOH 8   1008 1008 HOH HOH A . 
G 4 HOH 9   1009 1009 HOH HOH A . 
G 4 HOH 10  1010 1010 HOH HOH A . 
G 4 HOH 11  1011 1011 HOH HOH A . 
G 4 HOH 12  1012 1012 HOH HOH A . 
G 4 HOH 13  1013 1013 HOH HOH A . 
G 4 HOH 14  1014 1014 HOH HOH A . 
G 4 HOH 15  1015 1015 HOH HOH A . 
G 4 HOH 16  1016 1016 HOH HOH A . 
G 4 HOH 17  1017 1017 HOH HOH A . 
G 4 HOH 18  1018 1018 HOH HOH A . 
G 4 HOH 19  1019 1019 HOH HOH A . 
G 4 HOH 20  1020 1020 HOH HOH A . 
G 4 HOH 21  1021 1021 HOH HOH A . 
G 4 HOH 22  1022 1022 HOH HOH A . 
G 4 HOH 23  1023 1023 HOH HOH A . 
G 4 HOH 24  1024 1024 HOH HOH A . 
G 4 HOH 25  1025 1025 HOH HOH A . 
G 4 HOH 26  1026 1026 HOH HOH A . 
G 4 HOH 27  1027 1027 HOH HOH A . 
G 4 HOH 28  1028 1028 HOH HOH A . 
G 4 HOH 29  1029 1029 HOH HOH A . 
G 4 HOH 30  1030 1030 HOH HOH A . 
G 4 HOH 31  1031 1031 HOH HOH A . 
G 4 HOH 32  1032 1032 HOH HOH A . 
G 4 HOH 33  1033 1033 HOH HOH A . 
G 4 HOH 34  1034 1034 HOH HOH A . 
G 4 HOH 35  1035 1035 HOH HOH A . 
G 4 HOH 36  1036 1036 HOH HOH A . 
G 4 HOH 37  1037 1037 HOH HOH A . 
G 4 HOH 38  1038 1038 HOH HOH A . 
G 4 HOH 39  1039 1039 HOH HOH A . 
G 4 HOH 40  1040 1040 HOH HOH A . 
G 4 HOH 41  1041 1041 HOH HOH A . 
G 4 HOH 42  1042 1042 HOH HOH A . 
G 4 HOH 43  1043 1043 HOH HOH A . 
G 4 HOH 44  1044 1044 HOH HOH A . 
G 4 HOH 45  1045 1045 HOH HOH A . 
G 4 HOH 46  1046 1046 HOH HOH A . 
G 4 HOH 47  1047 1047 HOH HOH A . 
G 4 HOH 48  1048 1048 HOH HOH A . 
G 4 HOH 49  1049 1049 HOH HOH A . 
G 4 HOH 50  1050 1050 HOH HOH A . 
G 4 HOH 51  1051 1051 HOH HOH A . 
G 4 HOH 52  1052 1052 HOH HOH A . 
G 4 HOH 53  1053 1053 HOH HOH A . 
G 4 HOH 54  1054 1054 HOH HOH A . 
G 4 HOH 55  1055 1055 HOH HOH A . 
G 4 HOH 56  1056 1056 HOH HOH A . 
G 4 HOH 57  1057 1057 HOH HOH A . 
G 4 HOH 58  1058 1058 HOH HOH A . 
G 4 HOH 59  1059 1059 HOH HOH A . 
G 4 HOH 60  1060 1060 HOH HOH A . 
G 4 HOH 61  1061 1061 HOH HOH A . 
G 4 HOH 62  1062 1062 HOH HOH A . 
G 4 HOH 63  1063 1063 HOH HOH A . 
G 4 HOH 64  1064 1064 HOH HOH A . 
G 4 HOH 65  1065 1065 HOH HOH A . 
G 4 HOH 66  1066 1066 HOH HOH A . 
G 4 HOH 67  1067 1067 HOH HOH A . 
G 4 HOH 68  1068 1068 HOH HOH A . 
G 4 HOH 69  1069 1069 HOH HOH A . 
G 4 HOH 70  1070 1070 HOH HOH A . 
G 4 HOH 71  1071 1071 HOH HOH A . 
G 4 HOH 72  1072 1072 HOH HOH A . 
G 4 HOH 73  1073 1073 HOH HOH A . 
G 4 HOH 74  1074 1074 HOH HOH A . 
G 4 HOH 75  1075 1075 HOH HOH A . 
G 4 HOH 76  1076 1076 HOH HOH A . 
G 4 HOH 77  1077 1077 HOH HOH A . 
G 4 HOH 78  1078 1078 HOH HOH A . 
G 4 HOH 79  1079 1079 HOH HOH A . 
G 4 HOH 80  1080 1080 HOH HOH A . 
G 4 HOH 81  1081 1081 HOH HOH A . 
G 4 HOH 82  1082 1082 HOH HOH A . 
G 4 HOH 83  1083 1083 HOH HOH A . 
G 4 HOH 84  1084 1084 HOH HOH A . 
G 4 HOH 85  1085 1085 HOH HOH A . 
G 4 HOH 86  1086 1086 HOH HOH A . 
G 4 HOH 87  1087 1087 HOH HOH A . 
G 4 HOH 88  1088 1088 HOH HOH A . 
G 4 HOH 89  1089 1089 HOH HOH A . 
G 4 HOH 90  1090 1090 HOH HOH A . 
G 4 HOH 91  1091 1091 HOH HOH A . 
G 4 HOH 92  1092 1092 HOH HOH A . 
G 4 HOH 93  1093 1093 HOH HOH A . 
G 4 HOH 94  1094 1094 HOH HOH A . 
G 4 HOH 95  1095 1095 HOH HOH A . 
G 4 HOH 96  1096 1096 HOH HOH A . 
G 4 HOH 97  1097 1097 HOH HOH A . 
G 4 HOH 98  1098 1098 HOH HOH A . 
G 4 HOH 99  1099 1099 HOH HOH A . 
G 4 HOH 100 1100 1100 HOH HOH A . 
G 4 HOH 101 1101 1101 HOH HOH A . 
G 4 HOH 102 1102 1102 HOH HOH A . 
G 4 HOH 103 1103 1103 HOH HOH A . 
G 4 HOH 104 1104 1104 HOH HOH A . 
G 4 HOH 105 1105 1105 HOH HOH A . 
G 4 HOH 106 1106 1106 HOH HOH A . 
G 4 HOH 107 1107 1107 HOH HOH A . 
G 4 HOH 108 1108 1108 HOH HOH A . 
G 4 HOH 109 1109 1109 HOH HOH A . 
G 4 HOH 110 1110 1110 HOH HOH A . 
G 4 HOH 111 1111 1111 HOH HOH A . 
G 4 HOH 112 1112 1112 HOH HOH A . 
G 4 HOH 113 1113 1113 HOH HOH A . 
G 4 HOH 114 1114 1114 HOH HOH A . 
G 4 HOH 115 1115 1115 HOH HOH A . 
G 4 HOH 116 1116 1116 HOH HOH A . 
G 4 HOH 117 1117 1117 HOH HOH A . 
G 4 HOH 118 1118 1118 HOH HOH A . 
G 4 HOH 119 1119 1119 HOH HOH A . 
G 4 HOH 120 1120 1120 HOH HOH A . 
G 4 HOH 121 1121 1121 HOH HOH A . 
G 4 HOH 122 1122 1122 HOH HOH A . 
G 4 HOH 123 1123 1123 HOH HOH A . 
G 4 HOH 124 1124 1124 HOH HOH A . 
G 4 HOH 125 1125 1125 HOH HOH A . 
G 4 HOH 126 1126 1126 HOH HOH A . 
G 4 HOH 127 1127 1127 HOH HOH A . 
G 4 HOH 128 1128 1128 HOH HOH A . 
G 4 HOH 129 1129 1129 HOH HOH A . 
G 4 HOH 130 1130 1130 HOH HOH A . 
G 4 HOH 131 1131 1131 HOH HOH A . 
G 4 HOH 132 1132 1132 HOH HOH A . 
G 4 HOH 133 1133 1133 HOH HOH A . 
G 4 HOH 134 1134 1134 HOH HOH A . 
G 4 HOH 135 1135 1135 HOH HOH A . 
G 4 HOH 136 1136 1136 HOH HOH A . 
G 4 HOH 137 1137 1137 HOH HOH A . 
G 4 HOH 138 1138 1138 HOH HOH A . 
G 4 HOH 139 1139 1139 HOH HOH A . 
G 4 HOH 140 1140 1140 HOH HOH A . 
G 4 HOH 141 1141 1141 HOH HOH A . 
G 4 HOH 142 1142 1142 HOH HOH A . 
G 4 HOH 143 1143 1143 HOH HOH A . 
G 4 HOH 144 1144 1144 HOH HOH A . 
G 4 HOH 145 1145 1145 HOH HOH A . 
G 4 HOH 146 1146 1146 HOH HOH A . 
G 4 HOH 147 1147 1147 HOH HOH A . 
H 4 HOH 1   1001 1001 HOH HOH B . 
H 4 HOH 2   1002 1002 HOH HOH B . 
H 4 HOH 3   1003 1003 HOH HOH B . 
H 4 HOH 4   1004 1004 HOH HOH B . 
H 4 HOH 5   1005 1005 HOH HOH B . 
H 4 HOH 6   1006 1006 HOH HOH B . 
H 4 HOH 7   1007 1007 HOH HOH B . 
H 4 HOH 8   1008 1008 HOH HOH B . 
H 4 HOH 9   1009 1009 HOH HOH B . 
H 4 HOH 10  1010 1010 HOH HOH B . 
H 4 HOH 11  1011 1011 HOH HOH B . 
H 4 HOH 12  1012 1012 HOH HOH B . 
H 4 HOH 13  1013 1013 HOH HOH B . 
H 4 HOH 14  1014 1014 HOH HOH B . 
H 4 HOH 15  1015 1015 HOH HOH B . 
H 4 HOH 16  1016 1016 HOH HOH B . 
H 4 HOH 17  1017 1017 HOH HOH B . 
H 4 HOH 18  1018 1018 HOH HOH B . 
H 4 HOH 19  1019 1019 HOH HOH B . 
H 4 HOH 20  1020 1020 HOH HOH B . 
H 4 HOH 21  1021 1021 HOH HOH B . 
H 4 HOH 22  1022 1022 HOH HOH B . 
H 4 HOH 23  1023 1023 HOH HOH B . 
H 4 HOH 24  1024 1024 HOH HOH B . 
H 4 HOH 25  1025 1025 HOH HOH B . 
H 4 HOH 26  1026 1026 HOH HOH B . 
H 4 HOH 27  1027 1027 HOH HOH B . 
H 4 HOH 28  1028 1028 HOH HOH B . 
H 4 HOH 29  1029 1029 HOH HOH B . 
H 4 HOH 30  1030 1030 HOH HOH B . 
H 4 HOH 31  1031 1031 HOH HOH B . 
H 4 HOH 32  1032 1032 HOH HOH B . 
H 4 HOH 33  1033 1033 HOH HOH B . 
H 4 HOH 34  1034 1034 HOH HOH B . 
H 4 HOH 35  1035 1035 HOH HOH B . 
H 4 HOH 36  1036 1036 HOH HOH B . 
H 4 HOH 37  1037 1037 HOH HOH B . 
H 4 HOH 38  1038 1038 HOH HOH B . 
H 4 HOH 39  1039 1039 HOH HOH B . 
H 4 HOH 40  1040 1040 HOH HOH B . 
H 4 HOH 41  1041 1041 HOH HOH B . 
H 4 HOH 42  1042 1042 HOH HOH B . 
H 4 HOH 43  1043 1043 HOH HOH B . 
H 4 HOH 44  1044 1044 HOH HOH B . 
H 4 HOH 45  1045 1045 HOH HOH B . 
H 4 HOH 46  1046 1046 HOH HOH B . 
H 4 HOH 47  1047 1047 HOH HOH B . 
H 4 HOH 48  1048 1048 HOH HOH B . 
H 4 HOH 49  1049 1049 HOH HOH B . 
H 4 HOH 50  1050 1050 HOH HOH B . 
H 4 HOH 51  1051 1051 HOH HOH B . 
H 4 HOH 52  1052 1052 HOH HOH B . 
H 4 HOH 53  1053 1053 HOH HOH B . 
H 4 HOH 54  1054 1054 HOH HOH B . 
H 4 HOH 55  1055 1055 HOH HOH B . 
H 4 HOH 56  1056 1056 HOH HOH B . 
H 4 HOH 57  1057 1057 HOH HOH B . 
H 4 HOH 58  1058 1058 HOH HOH B . 
H 4 HOH 59  1059 1059 HOH HOH B . 
H 4 HOH 60  1060 1060 HOH HOH B . 
H 4 HOH 61  1061 1061 HOH HOH B . 
H 4 HOH 62  1062 1062 HOH HOH B . 
H 4 HOH 63  1063 1063 HOH HOH B . 
H 4 HOH 64  1064 1064 HOH HOH B . 
H 4 HOH 65  1065 1065 HOH HOH B . 
H 4 HOH 66  1066 1066 HOH HOH B . 
H 4 HOH 67  1067 1067 HOH HOH B . 
H 4 HOH 68  1068 1068 HOH HOH B . 
H 4 HOH 69  1069 1069 HOH HOH B . 
H 4 HOH 70  1070 1070 HOH HOH B . 
H 4 HOH 71  1071 1071 HOH HOH B . 
H 4 HOH 72  1072 1072 HOH HOH B . 
H 4 HOH 73  1073 1073 HOH HOH B . 
H 4 HOH 74  1074 1074 HOH HOH B . 
H 4 HOH 75  1075 1075 HOH HOH B . 
H 4 HOH 76  1076 1076 HOH HOH B . 
H 4 HOH 77  1077 1077 HOH HOH B . 
H 4 HOH 78  1078 1078 HOH HOH B . 
H 4 HOH 79  1079 1079 HOH HOH B . 
H 4 HOH 80  1080 1080 HOH HOH B . 
H 4 HOH 81  1081 1081 HOH HOH B . 
H 4 HOH 82  1082 1082 HOH HOH B . 
H 4 HOH 83  1083 1083 HOH HOH B . 
H 4 HOH 84  1084 1084 HOH HOH B . 
H 4 HOH 85  1085 1085 HOH HOH B . 
H 4 HOH 86  1086 1086 HOH HOH B . 
H 4 HOH 87  1087 1087 HOH HOH B . 
H 4 HOH 88  1088 1088 HOH HOH B . 
H 4 HOH 89  1089 1089 HOH HOH B . 
H 4 HOH 90  1090 1090 HOH HOH B . 
H 4 HOH 91  1091 1091 HOH HOH B . 
H 4 HOH 92  1092 1092 HOH HOH B . 
H 4 HOH 93  1093 1093 HOH HOH B . 
H 4 HOH 94  1094 1094 HOH HOH B . 
H 4 HOH 95  1095 1095 HOH HOH B . 
H 4 HOH 96  1096 1096 HOH HOH B . 
H 4 HOH 97  1097 1097 HOH HOH B . 
H 4 HOH 98  1098 1098 HOH HOH B . 
H 4 HOH 99  1099 1099 HOH HOH B . 
H 4 HOH 100 1100 1100 HOH HOH B . 
H 4 HOH 101 1101 1101 HOH HOH B . 
H 4 HOH 102 1102 1102 HOH HOH B . 
H 4 HOH 103 1103 1103 HOH HOH B . 
H 4 HOH 104 1104 1104 HOH HOH B . 
H 4 HOH 105 1105 1105 HOH HOH B . 
H 4 HOH 106 1106 1106 HOH HOH B . 
H 4 HOH 107 1107 1107 HOH HOH B . 
H 4 HOH 108 1108 1108 HOH HOH B . 
H 4 HOH 109 1109 1109 HOH HOH B . 
H 4 HOH 110 1110 1110 HOH HOH B . 
H 4 HOH 111 1111 1111 HOH HOH B . 
H 4 HOH 112 1112 1112 HOH HOH B . 
H 4 HOH 113 1113 1113 HOH HOH B . 
H 4 HOH 114 1114 1114 HOH HOH B . 
H 4 HOH 115 1115 1115 HOH HOH B . 
H 4 HOH 116 1116 1116 HOH HOH B . 
H 4 HOH 117 1117 1117 HOH HOH B . 
H 4 HOH 118 1118 1118 HOH HOH B . 
H 4 HOH 119 1119 1119 HOH HOH B . 
H 4 HOH 120 1120 1120 HOH HOH B . 
H 4 HOH 121 1121 1121 HOH HOH B . 
H 4 HOH 122 1122 1122 HOH HOH B . 
H 4 HOH 123 1123 1123 HOH HOH B . 
H 4 HOH 124 1124 1124 HOH HOH B . 
H 4 HOH 125 1125 1125 HOH HOH B . 
H 4 HOH 126 1126 1126 HOH HOH B . 
H 4 HOH 127 1127 1127 HOH HOH B . 
H 4 HOH 128 1128 1128 HOH HOH B . 
H 4 HOH 129 1129 1129 HOH HOH B . 
H 4 HOH 130 1130 1130 HOH HOH B . 
H 4 HOH 131 1131 1131 HOH HOH B . 
H 4 HOH 132 1132 1132 HOH HOH B . 
H 4 HOH 133 1133 1133 HOH HOH B . 
H 4 HOH 134 1134 1134 HOH HOH B . 
H 4 HOH 135 1135 1135 HOH HOH B . 
#