data_3LZP
# 
_entry.id   3LZP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LZP         
RCSB  RCSB057925   
WWPDB D_1000057925 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O6C 'Structure of selenomethionyl rTp34 from Treponema pallidum' unspecified 
PDB 2O6D 'Structure of native rTp34 from Treponema pallidum' unspecified 
PDB 2O6E 'Structure of native rTp34 from Treponema pallidum from zinc-soaked crystals' unspecified 
PDB 2O6F 'Structure of metal- free rTp34 from Treponema pallidum' unspecified 
PDB 3LZO 'Crystal Structure Analysis of the copper-reconstituted P19 protein from Campylobacter jejuni at 1.65 A at pH 10.0' 
unspecified 
PDB 3LZQ 'Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 1.41 A at pH 9' unspecified 
PDB 3LZL 'Crystal Structure Analysis of the as-isolated P19 protein from Campylobacter jejuni at 1.45 A at pH 9.0' unspecified 
PDB 3LZN 'Crystal Structure Analysis of the apo P19 protein from Campylobacter jejuni at 1.59 A at pH 9' unspecified 
PDB 3LZR 
;Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 2.73 A at pH 9 and Manganese peak wavelength (1.893 A)
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3LZP 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doukov, T.I.'    1 
'Chan, A.C.K.'    2 
'Scofield, M.'    3 
'Ramin, A.B.'     4 
'Tom-Yew, S.A.L.' 5 
'Murphy, M.E.P.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            401 
_citation.page_first                590 
_citation.page_last                 604 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20600116 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.06.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chan, A.C.'      1 
primary 'Doukov, T.I.'    2 
primary 'Scofield, M.'    3 
primary 'Tom-Yew, S.A.'   4 
primary 'Ramin, A.B.'     5 
primary 'Mackichan, J.K.' 6 
primary 'Gaynor, E.C.'    7 
primary 'Murphy, M.E.'    8 
# 
_cell.entry_id           3LZP 
_cell.length_a           53.706 
_cell.length_b           72.533 
_cell.length_c           75.185 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LZP 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'P19 protein'     17590.859 2   ? ? 'residues 22-179' ? 
2 non-polymer syn 'COPPER (II) ION' 63.546    2   ? ? ?                 ? 
3 non-polymer syn 'SULFATE ION'     96.063    4   ? ? ?                 ? 
4 water       nat water             18.015    253 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   GLU n 
1 4   VAL n 
1 5   PRO n 
1 6   ILE n 
1 7   GLY n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  GLU n 
1 12  LEU n 
1 13  ASN n 
1 14  GLY n 
1 15  MET n 
1 16  GLU n 
1 17  ILE n 
1 18  ALA n 
1 19  ALA n 
1 20  VAL n 
1 21  TYR n 
1 22  LEU n 
1 23  GLN n 
1 24  PRO n 
1 25  ILE n 
1 26  GLU n 
1 27  MET n 
1 28  GLU n 
1 29  PRO n 
1 30  ARG n 
1 31  GLY n 
1 32  ILE n 
1 33  ASP n 
1 34  LEU n 
1 35  ALA n 
1 36  ALA n 
1 37  SER n 
1 38  LEU n 
1 39  ALA n 
1 40  ASP n 
1 41  ILE n 
1 42  HIS n 
1 43  LEU n 
1 44  GLU n 
1 45  ALA n 
1 46  ASP n 
1 47  ILE n 
1 48  HIS n 
1 49  ALA n 
1 50  LEU n 
1 51  LYS n 
1 52  ASN n 
1 53  ASN n 
1 54  PRO n 
1 55  ASN n 
1 56  GLY n 
1 57  PHE n 
1 58  PRO n 
1 59  GLU n 
1 60  GLY n 
1 61  PHE n 
1 62  TRP n 
1 63  MET n 
1 64  PRO n 
1 65  TYR n 
1 66  LEU n 
1 67  THR n 
1 68  ILE n 
1 69  ALA n 
1 70  TYR n 
1 71  GLU n 
1 72  LEU n 
1 73  LYS n 
1 74  ASN n 
1 75  THR n 
1 76  ASP n 
1 77  THR n 
1 78  GLY n 
1 79  ALA n 
1 80  ILE n 
1 81  LYS n 
1 82  ARG n 
1 83  GLY n 
1 84  THR n 
1 85  LEU n 
1 86  MET n 
1 87  PRO n 
1 88  MET n 
1 89  VAL n 
1 90  ALA n 
1 91  ASP n 
1 92  ASP n 
1 93  GLY n 
1 94  PRO n 
1 95  HIS n 
1 96  TYR n 
1 97  GLY n 
1 98  ALA n 
1 99  ASN n 
1 100 ILE n 
1 101 ALA n 
1 102 MET n 
1 103 GLU n 
1 104 LYS n 
1 105 ASP n 
1 106 LYS n 
1 107 LYS n 
1 108 GLY n 
1 109 GLY n 
1 110 PHE n 
1 111 GLY n 
1 112 VAL n 
1 113 GLY n 
1 114 ASN n 
1 115 TYR n 
1 116 GLU n 
1 117 LEU n 
1 118 THR n 
1 119 PHE n 
1 120 TYR n 
1 121 ILE n 
1 122 SER n 
1 123 ASN n 
1 124 PRO n 
1 125 GLU n 
1 126 LYS n 
1 127 GLN n 
1 128 GLY n 
1 129 PHE n 
1 130 GLY n 
1 131 ARG n 
1 132 HIS n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 GLU n 
1 137 THR n 
1 138 GLY n 
1 139 VAL n 
1 140 GLY n 
1 141 LYS n 
1 142 TRP n 
1 143 PHE n 
1 144 GLU n 
1 145 PRO n 
1 146 PHE n 
1 147 LYS n 
1 148 VAL n 
1 149 ASP n 
1 150 TYR n 
1 151 LYS n 
1 152 PHE n 
1 153 LYS n 
1 154 TYR n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 PRO n 
1 159 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CJJ81176_1650, Gene Cj81176_1659' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    81-176 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Campylobacter jejuni' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     354242 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET19 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A1W1R1_CAMJJ 
_struct_ref.pdbx_db_accession          A1W1R1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIK
RGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LZP A 2 ? 159 ? A1W1R1 22 ? 179 ? 2 159 
2 1 3LZP B 2 ? 159 ? A1W1R1 22 ? 179 ? 2 159 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LZP GLY A 1 ? UNP A1W1R1 ? ? 'EXPRESSION TAG' 1 1 
2 3LZP GLY B 1 ? UNP A1W1R1 ? ? 'EXPRESSION TAG' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'           63.546  
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'     ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3LZP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.08 
_exptl_crystal.density_percent_sol   40.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pdbx_details    
;50% POLYETHYLENE GLYCOL (PEG) 250, 0.1 M CHES (2-(N-CYCLOHEXYLAMINO) ETHANE SULFONIC ACID) BUFFER PH 9.0, CRYO FROZEN WITHOUT ANY ADDITION, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-08-01 
_diffrn_detector.details                '1m Rh coated cylindrical mirror; Si(111) double crystal, parallel monochromator' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) double crystal, paralel monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL1-5' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL1-5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.entry_id                     3LZP 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             19.00 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   35799 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.041 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.2 
_reflns.B_iso_Wilson_estimate        28.7 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.74 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.598 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        6.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5190 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3LZP 
_refine.ls_number_reflns_obs                     34228 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.80 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    99.35 
_refine.ls_R_factor_obs                          0.15926 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.15741 
_refine.ls_R_factor_R_free                       0.19505 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1729 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.957 
_refine.B_iso_mean                               23.526 
_refine.aniso_B[1][1]                            -0.45 
_refine.aniso_B[2][2]                            0.15 
_refine.aniso_B[3][3]                            0.30 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'P6222 incomplete SeMAD model at 2.8 A resolution.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.092 
_refine.pdbx_overall_ESU_R_Free                  0.094 
_refine.overall_SU_ML                            0.072 
_refine.overall_SU_B                             4.507 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3LZP 
_refine_analyze.Luzzati_coordinate_error_obs    0.092 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.094 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2474 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             253 
_refine_hist.number_atoms_total               2749 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        18.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.014  0.022  ? 2630 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 1801 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.494  1.976  ? 3575 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.849  3.000  ? 4421 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.754  5.000  ? 335  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 40.588 25.203 ? 123  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 13.408 15.000 ? 439  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 19.354 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.093  0.200  ? 359  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.007  0.021  ? 2954 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 513  'X-RAY DIFFRACTION' ? 
r_mcbond_it            1.911  3.000  ? 1598 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.568  3.000  ? 657  'X-RAY DIFFRACTION' ? 
r_mcangle_it           3.055  5.000  ? 2572 'X-RAY DIFFRACTION' ? 
r_scbond_it            4.690  8.000  ? 1032 'X-RAY DIFFRACTION' ? 
r_scangle_it           6.805  11.000 ? 993  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.650 
_refine_ls_shell.d_res_low                        1.690 
_refine_ls_shell.number_reflns_R_work             2385 
_refine_ls_shell.R_factor_R_work                  0.251 
_refine_ls_shell.percent_reflns_obs               96.19 
_refine_ls_shell.R_factor_R_free                  0.284 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             117 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LZP 
_struct.title                     
;Crystal Structure Analysis of the 'as-isolated' P19 protein from Campylobacter jejuni at 1.65 A at pH 9.0
;
_struct.pdbx_descriptor           'P19 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LZP 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'copper binding, iron transport, iron uptake, P19 delition, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 35  ? ALA A 39  ? ALA A 35  ALA A 39  5 ? 5 
HELX_P HELX_P2 2 ASN A 123 ? GLY A 128 ? ASN A 123 GLY A 128 5 ? 6 
HELX_P HELX_P3 3 ALA B 35  ? ALA B 39  ? ALA B 35  ALA B 39  5 ? 5 
HELX_P HELX_P4 4 ASN B 123 ? GLY B 128 ? ASN B 123 GLY B 128 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 42  NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 42  A CU 200 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc2 metalc ? ? B HIS 42  NE2 ? ? ? 1_555 F CU . CU ? ? B HIS 42  B CU 200 1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc3 metalc ? ? A HIS 95  NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 95  A CU 200 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc4 metalc ? ? B HIS 95  NE2 ? ? ? 1_555 F CU . CU ? ? B HIS 95  B CU 200 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc5 metalc ? ? A HIS 132 NE2 ? ? ? 1_555 F CU . CU ? ? A HIS 132 B CU 200 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc6 metalc ? ? B HIS 132 NE2 ? ? ? 1_555 C CU . CU ? ? B HIS 132 A CU 200 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc7 metalc ? ? B MET 88  SD  ? ? ? 1_555 F CU . CU ? ? B MET 88  B CU 200 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc8 metalc ? ? A MET 88  SD  ? ? ? 1_555 C CU . CU ? ? A MET 88  A CU 200 1_555 ? ? ? ? ? ? ? 2.323 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 28 A . ? GLU 28 A PRO 29 A ? PRO 29 A 1 -2.11 
2 GLU 28 B . ? GLU 28 B PRO 29 B ? PRO 29 B 1 0.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 8 ? 
C ? 7 ? 
D ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 4   ? LEU A 12  ? VAL A 4   LEU A 12  
A 2 MET A 15  ? LEU A 22  ? MET A 15  LEU A 22  
A 3 ILE A 41  ? ALA A 49  ? ILE A 41  ALA A 49  
A 4 GLY A 93  ? ILE A 100 ? GLY A 93  ILE A 100 
A 5 ILE A 80  ? ALA A 90  ? ILE A 80  ALA A 90  
A 6 GLY B 130 ? HIS B 132 ? GLY B 130 HIS B 132 
A 7 MET A 27  ? GLU A 28  ? MET A 27  GLU A 28  
B 1 VAL A 4   ? LEU A 12  ? VAL A 4   LEU A 12  
B 2 MET A 15  ? LEU A 22  ? MET A 15  LEU A 22  
B 3 ILE A 41  ? ALA A 49  ? ILE A 41  ALA A 49  
B 4 GLY A 93  ? ILE A 100 ? GLY A 93  ILE A 100 
B 5 ILE A 80  ? ALA A 90  ? ILE A 80  ALA A 90  
B 6 THR A 67  ? ASN A 74  ? THR A 67  ASN A 74  
B 7 GLY A 113 ? SER A 122 ? GLY A 113 SER A 122 
B 8 PHE A 146 ? TYR A 154 ? PHE A 146 TYR A 154 
C 1 VAL B 4   ? LEU B 12  ? VAL B 4   LEU B 12  
C 2 MET B 15  ? LEU B 22  ? MET B 15  LEU B 22  
C 3 ILE B 41  ? ALA B 49  ? ILE B 41  ALA B 49  
C 4 GLY B 93  ? ILE B 100 ? GLY B 93  ILE B 100 
C 5 ILE B 80  ? ALA B 90  ? ILE B 80  ALA B 90  
C 6 GLY A 130 ? HIS A 132 ? GLY A 130 HIS A 132 
C 7 MET B 27  ? GLU B 28  ? MET B 27  GLU B 28  
D 1 VAL B 4   ? LEU B 12  ? VAL B 4   LEU B 12  
D 2 MET B 15  ? LEU B 22  ? MET B 15  LEU B 22  
D 3 ILE B 41  ? ALA B 49  ? ILE B 41  ALA B 49  
D 4 GLY B 93  ? ILE B 100 ? GLY B 93  ILE B 100 
D 5 ILE B 80  ? ALA B 90  ? ILE B 80  ALA B 90  
D 6 THR B 67  ? ASN B 74  ? THR B 67  ASN B 74  
D 7 GLY B 113 ? SER B 122 ? GLY B 113 SER B 122 
D 8 PHE B 146 ? TYR B 154 ? PHE B 146 TYR B 154 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 4   ? N VAL A 4   O TYR A 21  ? O TYR A 21  
A 2 3 N GLU A 16  ? N GLU A 16  O HIS A 48  ? O HIS A 48  
A 3 4 N LEU A 43  ? N LEU A 43  O ALA A 98  ? O ALA A 98  
A 4 5 O GLY A 97  ? O GLY A 97  N MET A 86  ? N MET A 86  
A 5 6 N VAL A 89  ? N VAL A 89  O HIS B 132 ? O HIS B 132 
A 6 7 O ARG B 131 ? O ARG B 131 N GLU A 28  ? N GLU A 28  
B 1 2 N VAL A 4   ? N VAL A 4   O TYR A 21  ? O TYR A 21  
B 2 3 N GLU A 16  ? N GLU A 16  O HIS A 48  ? O HIS A 48  
B 3 4 N LEU A 43  ? N LEU A 43  O ALA A 98  ? O ALA A 98  
B 4 5 O GLY A 97  ? O GLY A 97  N MET A 86  ? N MET A 86  
B 5 6 O LYS A 81  ? O LYS A 81  N LEU A 72  ? N LEU A 72  
B 6 7 N LYS A 73  ? N LYS A 73  O GLU A 116 ? O GLU A 116 
B 7 8 N ILE A 121 ? N ILE A 121 O PHE A 146 ? O PHE A 146 
C 1 2 N VAL B 4   ? N VAL B 4   O TYR B 21  ? O TYR B 21  
C 2 3 N ALA B 18  ? N ALA B 18  O ASP B 46  ? O ASP B 46  
C 3 4 N ILE B 41  ? N ILE B 41  O ILE B 100 ? O ILE B 100 
C 4 5 O GLY B 97  ? O GLY B 97  N MET B 86  ? N MET B 86  
C 5 6 O VAL B 89  ? O VAL B 89  N HIS A 132 ? N HIS A 132 
C 6 7 N ARG A 131 ? N ARG A 131 O GLU B 28  ? O GLU B 28  
D 1 2 N VAL B 4   ? N VAL B 4   O TYR B 21  ? O TYR B 21  
D 2 3 N ALA B 18  ? N ALA B 18  O ASP B 46  ? O ASP B 46  
D 3 4 N ILE B 41  ? N ILE B 41  O ILE B 100 ? O ILE B 100 
D 4 5 O GLY B 97  ? O GLY B 97  N MET B 86  ? N MET B 86  
D 5 6 O LYS B 81  ? O LYS B 81  N LEU B 72  ? N LEU B 72  
D 6 7 N LYS B 73  ? N LYS B 73  O GLU B 116 ? O GLU B 116 
D 7 8 N TYR B 115 ? N TYR B 115 O PHE B 152 ? O PHE B 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A 200'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 300' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 301' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU B 200'  
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 B 300' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 42  ? HIS A 42   . ? 1_555 ? 
2  AC1 4 MET A 88  ? MET A 88   . ? 1_555 ? 
3  AC1 4 HIS A 95  ? HIS A 95   . ? 1_555 ? 
4  AC1 4 HIS B 132 ? HIS B 132  . ? 1_555 ? 
5  AC2 5 GLY A 7   ? GLY A 7    . ? 1_555 ? 
6  AC2 5 ASP A 8   ? ASP A 8    . ? 1_555 ? 
7  AC2 5 LYS A 10  ? LYS A 10   . ? 1_555 ? 
8  AC2 5 TYR A 150 ? TYR A 150  . ? 1_555 ? 
9  AC2 5 LYS A 151 ? LYS A 151  . ? 1_555 ? 
10 AC3 6 GLU A 11  ? GLU A 11   . ? 1_555 ? 
11 AC3 6 LEU A 50  ? LEU A 50   . ? 1_555 ? 
12 AC3 6 LYS A 51  ? LYS A 51   . ? 1_555 ? 
13 AC3 6 HOH I .   ? HOH A 1088 . ? 1_555 ? 
14 AC3 6 HOH I .   ? HOH A 1095 . ? 1_555 ? 
15 AC3 6 HOH I .   ? HOH A 1101 . ? 1_555 ? 
16 AC4 4 HIS A 132 ? HIS A 132  . ? 1_555 ? 
17 AC4 4 HIS B 42  ? HIS B 42   . ? 1_555 ? 
18 AC4 4 MET B 88  ? MET B 88   . ? 1_555 ? 
19 AC4 4 HIS B 95  ? HIS B 95   . ? 1_555 ? 
20 AC5 8 GLY B 7   ? GLY B 7    . ? 1_555 ? 
21 AC5 8 ASP B 8   ? ASP B 8    . ? 1_555 ? 
22 AC5 8 LYS B 10  ? LYS B 10   . ? 1_555 ? 
23 AC5 8 ASP B 149 ? ASP B 149  . ? 1_555 ? 
24 AC5 8 TYR B 150 ? TYR B 150  . ? 1_555 ? 
25 AC5 8 LYS B 151 ? LYS B 151  . ? 1_555 ? 
26 AC5 8 HOH J .   ? HOH B 1128 . ? 1_555 ? 
27 AC5 8 HOH J .   ? HOH B 1130 . ? 1_555 ? 
28 AC6 5 VAL B 133 ? VAL B 133  . ? 2_655 ? 
29 AC6 5 ASP B 134 ? ASP B 134  . ? 1_555 ? 
30 AC6 5 ASP B 134 ? ASP B 134  . ? 2_655 ? 
31 AC6 5 GLY B 138 ? GLY B 138  . ? 1_555 ? 
32 AC6 5 HOH J .   ? HOH B 1126 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3LZP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LZP 
_atom_sites.fract_transf_matrix[1][1]   0.018620 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013787 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013301 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? 29.389 9.380  -6.925  1.00 65.15  ? 1    GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? 29.135 10.844 -6.775  1.00 65.46  ? 1    GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? 30.138 11.559 -5.880  1.00 65.30  ? 1    GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? 31.191 11.007 -5.542  1.00 66.59  ? 1    GLY A O   1 
ATOM   5    N  N   . GLY A 1 2   ? 29.798 12.795 -5.499  1.00 63.51  ? 2    GLY A N   1 
ATOM   6    C  CA  . GLY A 1 2   ? 30.642 13.653 -4.642  1.00 59.99  ? 2    GLY A CA  1 
ATOM   7    C  C   . GLY A 1 2   ? 29.771 14.676 -3.918  1.00 55.81  ? 2    GLY A C   1 
ATOM   8    O  O   . GLY A 1 2   ? 28.546 14.597 -4.016  1.00 57.69  ? 2    GLY A O   1 
ATOM   9    N  N   . GLU A 1 3   ? 30.379 15.632 -3.205  1.00 68.56  ? 3    GLU A N   1 
ATOM   10   C  CA  . GLU A 1 3   ? 29.609 16.650 -2.470  1.00 60.53  ? 3    GLU A CA  1 
ATOM   11   C  C   . GLU A 1 3   ? 29.706 18.075 -3.054  1.00 53.13  ? 3    GLU A C   1 
ATOM   12   O  O   . GLU A 1 3   ? 30.729 18.746 -2.909  1.00 52.81  ? 3    GLU A O   1 
ATOM   13   C  CB  . GLU A 1 3   ? 30.025 16.660 -1.002  1.00 61.51  ? 3    GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 3   ? 28.967 17.262 -0.088  1.00 61.67  ? 3    GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 3   ? 29.234 16.980 1.383   1.00 66.86  ? 3    GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 3   ? 29.488 15.803 1.733   1.00 70.03  ? 3    GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 3   ? 29.183 17.938 2.189   1.00 64.64  ? 3    GLU A OE2 1 
ATOM   18   N  N   . VAL A 1 4   ? 28.618 18.544 -3.672  1.00 42.68  ? 4    VAL A N   1 
ATOM   19   C  CA  . VAL A 1 4   ? 28.629 19.792 -4.431  1.00 38.57  ? 4    VAL A CA  1 
ATOM   20   C  C   . VAL A 1 4   ? 28.047 20.941 -3.611  1.00 34.77  ? 4    VAL A C   1 
ATOM   21   O  O   . VAL A 1 4   ? 26.905 20.842 -3.138  1.00 30.59  ? 4    VAL A O   1 
ATOM   22   C  CB  . VAL A 1 4   ? 27.810 19.648 -5.734  1.00 39.20  ? 4    VAL A CB  1 
ATOM   23   C  CG1 . VAL A 1 4   ? 28.011 20.867 -6.637  1.00 37.81  ? 4    VAL A CG1 1 
ATOM   24   C  CG2 . VAL A 1 4   ? 28.158 18.349 -6.463  1.00 36.14  ? 4    VAL A CG2 1 
ATOM   25   N  N   . PRO A 1 5   ? 28.800 22.046 -3.445  1.00 32.49  ? 5    PRO A N   1 
ATOM   26   C  CA  . PRO A 1 5   ? 28.261 23.132 -2.628  1.00 32.85  ? 5    PRO A CA  1 
ATOM   27   C  C   . PRO A 1 5   ? 27.280 24.000 -3.435  1.00 31.90  ? 5    PRO A C   1 
ATOM   28   O  O   . PRO A 1 5   ? 27.390 24.120 -4.648  1.00 32.99  ? 5    PRO A O   1 
ATOM   29   C  CB  . PRO A 1 5   ? 29.512 23.921 -2.202  1.00 35.79  ? 5    PRO A CB  1 
ATOM   30   C  CG  . PRO A 1 5   ? 30.513 23.659 -3.250  1.00 37.29  ? 5    PRO A CG  1 
ATOM   31   C  CD  . PRO A 1 5   ? 30.119 22.389 -4.002  1.00 39.32  ? 5    PRO A CD  1 
ATOM   32   N  N   . ILE A 1 6   ? 26.298 24.558 -2.754  1.00 30.58  ? 6    ILE A N   1 
ATOM   33   C  CA  . ILE A 1 6   ? 25.279 25.363 -3.408  1.00 30.26  ? 6    ILE A CA  1 
ATOM   34   C  C   . ILE A 1 6   ? 25.456 26.782 -2.882  1.00 30.61  ? 6    ILE A C   1 
ATOM   35   O  O   . ILE A 1 6   ? 25.220 27.059 -1.676  1.00 32.64  ? 6    ILE A O   1 
ATOM   36   C  CB  . ILE A 1 6   ? 23.889 24.817 -3.086  1.00 26.01  ? 6    ILE A CB  1 
ATOM   37   C  CG1 . ILE A 1 6   ? 23.700 23.441 -3.738  1.00 28.44  ? 6    ILE A CG1 1 
ATOM   38   C  CG2 . ILE A 1 6   ? 22.820 25.775 -3.521  1.00 33.01  ? 6    ILE A CG2 1 
ATOM   39   C  CD1 . ILE A 1 6   ? 22.436 22.726 -3.332  1.00 27.70  ? 6    ILE A CD1 1 
ATOM   40   N  N   . GLY A 1 7   ? 25.889 27.667 -3.772  1.00 37.90  ? 7    GLY A N   1 
ATOM   41   C  CA  . GLY A 1 7   ? 26.216 29.037 -3.406  1.00 41.79  ? 7    GLY A CA  1 
ATOM   42   C  C   . GLY A 1 7   ? 27.228 29.102 -2.268  1.00 40.93  ? 7    GLY A C   1 
ATOM   43   O  O   . GLY A 1 7   ? 28.011 28.173 -2.077  1.00 39.35  ? 7    GLY A O   1 
ATOM   44   N  N   . ASP A 1 8   ? 27.182 30.201 -1.513  1.00 42.81  ? 8    ASP A N   1 
ATOM   45   C  CA  A ASP A 1 8   ? 28.117 30.449 -0.417  0.50 42.07  ? 8    ASP A CA  1 
ATOM   46   C  CA  B ASP A 1 8   ? 28.118 30.424 -0.412  0.50 43.17  ? 8    ASP A CA  1 
ATOM   47   C  C   . ASP A 1 8   ? 27.433 30.241 0.941   1.00 40.23  ? 8    ASP A C   1 
ATOM   48   O  O   . ASP A 1 8   ? 26.245 30.569 1.100   1.00 38.61  ? 8    ASP A O   1 
ATOM   49   C  CB  A ASP A 1 8   ? 28.667 31.879 -0.513  0.50 46.35  ? 8    ASP A CB  1 
ATOM   50   C  CB  B ASP A 1 8   ? 28.799 31.808 -0.503  0.50 48.27  ? 8    ASP A CB  1 
ATOM   51   C  CG  A ASP A 1 8   ? 29.560 32.088 -1.736  0.50 46.14  ? 8    ASP A CG  1 
ATOM   52   C  CG  B ASP A 1 8   ? 27.827 32.951 -0.814  0.50 52.99  ? 8    ASP A CG  1 
ATOM   53   O  OD1 A ASP A 1 8   ? 30.474 31.268 -1.934  0.50 43.47  ? 8    ASP A OD1 1 
ATOM   54   O  OD1 B ASP A 1 8   ? 26.603 32.780 -0.639  0.50 56.07  ? 8    ASP A OD1 1 
ATOM   55   O  OD2 A ASP A 1 8   ? 29.354 33.071 -2.483  0.50 48.73  ? 8    ASP A OD2 1 
ATOM   56   O  OD2 B ASP A 1 8   ? 28.301 34.034 -1.234  0.50 56.62  ? 8    ASP A OD2 1 
ATOM   57   N  N   . PRO A 1 9   ? 28.172 29.700 1.924   1.00 37.49  ? 9    PRO A N   1 
ATOM   58   C  CA  . PRO A 1 9   ? 27.586 29.601 3.256   1.00 35.42  ? 9    PRO A CA  1 
ATOM   59   C  C   . PRO A 1 9   ? 27.300 30.979 3.845   1.00 35.00  ? 9    PRO A C   1 
ATOM   60   O  O   . PRO A 1 9   ? 28.026 31.945 3.574   1.00 34.48  ? 9    PRO A O   1 
ATOM   61   C  CB  . PRO A 1 9   ? 28.667 28.885 4.074   1.00 35.58  ? 9    PRO A CB  1 
ATOM   62   C  CG  . PRO A 1 9   ? 29.948 29.205 3.354   1.00 42.85  ? 9    PRO A CG  1 
ATOM   63   C  CD  . PRO A 1 9   ? 29.574 29.236 1.911   1.00 39.79  ? 9    PRO A CD  1 
ATOM   64   N  N   . LYS A 1 10  ? 26.205 31.060 4.593   1.00 34.04  ? 10   LYS A N   1 
ATOM   65   C  CA  . LYS A 1 10  ? 25.815 32.269 5.306   1.00 33.64  ? 10   LYS A CA  1 
ATOM   66   C  C   . LYS A 1 10  ? 26.202 32.079 6.758   1.00 31.26  ? 10   LYS A C   1 
ATOM   67   O  O   . LYS A 1 10  ? 26.154 30.961 7.264   1.00 31.23  ? 10   LYS A O   1 
ATOM   68   C  CB  . LYS A 1 10  ? 24.306 32.477 5.219   1.00 34.74  ? 10   LYS A CB  1 
ATOM   69   C  CG  . LYS A 1 10  ? 23.806 33.162 3.975   1.00 45.71  ? 10   LYS A CG  1 
ATOM   70   C  CD  . LYS A 1 10  ? 23.828 32.272 2.745   1.00 51.67  ? 10   LYS A CD  1 
ATOM   71   C  CE  . LYS A 1 10  ? 23.167 32.970 1.560   1.00 57.10  ? 10   LYS A CE  1 
ATOM   72   N  NZ  . LYS A 1 10  ? 23.514 32.350 0.249   1.00 51.17  ? 10   LYS A NZ  1 
ATOM   73   N  N   . GLU A 1 11  ? 26.601 33.167 7.416   1.00 28.28  ? 11   GLU A N   1 
ATOM   74   C  CA  . GLU A 1 11  ? 26.651 33.225 8.850   1.00 25.98  ? 11   GLU A CA  1 
ATOM   75   C  C   . GLU A 1 11  ? 25.508 34.087 9.306   1.00 25.87  ? 11   GLU A C   1 
ATOM   76   O  O   . GLU A 1 11  ? 25.486 35.271 9.000   1.00 25.62  ? 11   GLU A O   1 
ATOM   77   C  CB  . GLU A 1 11  ? 28.006 33.738 9.346   1.00 29.76  ? 11   GLU A CB  1 
ATOM   78   C  CG  . GLU A 1 11  ? 29.133 32.746 9.023   1.00 38.29  ? 11   GLU A CG  1 
ATOM   79   C  CD  . GLU A 1 11  ? 30.485 33.054 9.675   1.00 46.47  ? 11   GLU A CD  1 
ATOM   80   O  OE1 . GLU A 1 11  ? 30.577 33.908 10.588  1.00 45.65  ? 11   GLU A OE1 1 
ATOM   81   O  OE2 . GLU A 1 11  ? 31.477 32.403 9.266   1.00 51.02  ? 11   GLU A OE2 1 
ATOM   82   N  N   . LEU A 1 12  ? 24.530 33.486 10.003  1.00 21.91  ? 12   LEU A N   1 
ATOM   83   C  CA  . LEU A 1 12  ? 23.327 34.194 10.395  1.00 22.68  ? 12   LEU A CA  1 
ATOM   84   C  C   . LEU A 1 12  ? 22.750 33.641 11.708  1.00 22.74  ? 12   LEU A C   1 
ATOM   85   O  O   . LEU A 1 12  ? 22.673 32.414 11.934  1.00 22.07  ? 12   LEU A O   1 
ATOM   86   C  CB  . LEU A 1 12  ? 22.270 34.158 9.262   1.00 23.79  ? 12   LEU A CB  1 
ATOM   87   C  CG  . LEU A 1 12  ? 22.623 34.696 7.865   1.00 32.96  ? 12   LEU A CG  1 
ATOM   88   C  CD1 . LEU A 1 12  ? 21.541 34.298 6.861   1.00 37.81  ? 12   LEU A CD1 1 
ATOM   89   C  CD2 . LEU A 1 12  ? 22.839 36.208 7.820   1.00 33.46  ? 12   LEU A CD2 1 
ATOM   90   N  N   . ASN A 1 13  ? 22.345 34.538 12.600  1.00 21.95  ? 13   ASN A N   1 
ATOM   91   C  CA  . ASN A 1 13  ? 21.613 34.112 13.785  1.00 21.45  ? 13   ASN A CA  1 
ATOM   92   C  C   . ASN A 1 13  ? 22.394 33.093 14.635  1.00 23.86  ? 13   ASN A C   1 
ATOM   93   O  O   . ASN A 1 13  ? 21.811 32.188 15.192  1.00 22.88  ? 13   ASN A O   1 
ATOM   94   C  CB  . ASN A 1 13  ? 20.253 33.547 13.356  1.00 23.19  ? 13   ASN A CB  1 
ATOM   95   C  CG  . ASN A 1 13  ? 19.285 34.618 12.989  1.00 28.95  ? 13   ASN A CG  1 
ATOM   96   O  OD1 . ASN A 1 13  ? 19.340 35.703 13.548  1.00 27.31  ? 13   ASN A OD1 1 
ATOM   97   N  ND2 . ASN A 1 13  ? 18.356 34.321 12.077  1.00 25.35  ? 13   ASN A ND2 1 
ATOM   98   N  N   . GLY A 1 14  ? 23.721 33.260 14.668  1.00 24.89  ? 14   GLY A N   1 
ATOM   99   C  CA  . GLY A 1 14  ? 24.598 32.469 15.510  1.00 25.60  ? 14   GLY A CA  1 
ATOM   100  C  C   . GLY A 1 14  ? 24.958 31.123 14.932  1.00 22.54  ? 14   GLY A C   1 
ATOM   101  O  O   . GLY A 1 14  ? 25.484 30.277 15.651  1.00 23.32  ? 14   GLY A O   1 
ATOM   102  N  N   . MET A 1 15  ? 24.705 30.959 13.637  1.00 21.22  ? 15   MET A N   1 
ATOM   103  C  CA  . MET A 1 15  ? 24.840 29.673 12.948  1.00 22.81  ? 15   MET A CA  1 
ATOM   104  C  C   . MET A 1 15  ? 25.549 29.868 11.596  1.00 21.61  ? 15   MET A C   1 
ATOM   105  O  O   . MET A 1 15  ? 25.402 30.881 10.965  1.00 24.16  ? 15   MET A O   1 
ATOM   106  C  CB  . MET A 1 15  ? 23.477 29.025 12.717  1.00 21.22  ? 15   MET A CB  1 
ATOM   107  C  CG  . MET A 1 15  ? 22.657 28.783 13.975  1.00 20.73  ? 15   MET A CG  1 
ATOM   108  S  SD  . MET A 1 15  ? 21.002 28.135 13.554  1.00 23.60  ? 15   MET A SD  1 
ATOM   109  C  CE  . MET A 1 15  ? 20.231 29.715 13.144  1.00 26.76  ? 15   MET A CE  1 
ATOM   110  N  N   . GLU A 1 16  ? 26.292 28.853 11.169  1.00 21.41  ? 16   GLU A N   1 
ATOM   111  C  CA  . GLU A 1 16  ? 26.775 28.747 9.806   1.00 24.22  ? 16   GLU A CA  1 
ATOM   112  C  C   . GLU A 1 16  ? 25.774 27.872 9.088   1.00 24.17  ? 16   GLU A C   1 
ATOM   113  O  O   . GLU A 1 16  ? 25.481 26.760 9.556   1.00 22.81  ? 16   GLU A O   1 
ATOM   114  C  CB  . GLU A 1 16  ? 28.142 28.064 9.752   1.00 27.38  ? 16   GLU A CB  1 
ATOM   115  C  CG  . GLU A 1 16  ? 28.711 27.994 8.321   1.00 33.13  ? 16   GLU A CG  1 
ATOM   116  C  CD  . GLU A 1 16  ? 29.900 27.042 8.189   1.00 55.17  ? 16   GLU A CD  1 
ATOM   117  O  OE1 . GLU A 1 16  ? 30.004 26.066 8.974   1.00 61.60  ? 16   GLU A OE1 1 
ATOM   118  O  OE2 . GLU A 1 16  ? 30.727 27.265 7.281   1.00 64.29  ? 16   GLU A OE2 1 
ATOM   119  N  N   . ILE A 1 17  ? 25.283 28.352 7.952   1.00 24.16  ? 17   ILE A N   1 
ATOM   120  C  CA  . ILE A 1 17  ? 24.226 27.692 7.210   1.00 24.50  ? 17   ILE A CA  1 
ATOM   121  C  C   . ILE A 1 17  ? 24.649 27.472 5.753   1.00 22.74  ? 17   ILE A C   1 
ATOM   122  O  O   . ILE A 1 17  ? 24.753 28.412 5.012   1.00 27.42  ? 17   ILE A O   1 
ATOM   123  C  CB  . ILE A 1 17  ? 22.986 28.551 7.205   1.00 25.83  ? 17   ILE A CB  1 
ATOM   124  C  CG1 . ILE A 1 17  ? 22.588 28.890 8.644   1.00 24.48  ? 17   ILE A CG1 1 
ATOM   125  C  CG2 . ILE A 1 17  ? 21.845 27.821 6.465   1.00 27.98  ? 17   ILE A CG2 1 
ATOM   126  C  CD1 . ILE A 1 17  ? 21.779 30.084 8.789   1.00 26.69  ? 17   ILE A CD1 1 
ATOM   127  N  N   . ALA A 1 18  ? 24.963 26.241 5.390   1.00 20.67  ? 18   ALA A N   1 
ATOM   128  C  CA  . ALA A 1 18  ? 25.440 25.937 4.036   1.00 24.08  ? 18   ALA A CA  1 
ATOM   129  C  C   . ALA A 1 18  ? 24.480 24.932 3.398   1.00 23.80  ? 18   ALA A C   1 
ATOM   130  O  O   . ALA A 1 18  ? 23.759 24.198 4.082   1.00 24.01  ? 18   ALA A O   1 
ATOM   131  C  CB  . ALA A 1 18  ? 26.883 25.367 4.099   1.00 25.42  ? 18   ALA A CB  1 
ATOM   132  N  N   . ALA A 1 19  ? 24.447 24.928 2.083   1.00 22.20  ? 19   ALA A N   1 
ATOM   133  C  CA  . ALA A 1 19  ? 23.682 23.945 1.324   1.00 25.79  ? 19   ALA A CA  1 
ATOM   134  C  C   . ALA A 1 19  ? 24.647 23.207 0.430   1.00 21.22  ? 19   ALA A C   1 
ATOM   135  O  O   . ALA A 1 19  ? 25.568 23.810 -0.126  1.00 25.23  ? 19   ALA A O   1 
ATOM   136  C  CB  . ALA A 1 19  ? 22.610 24.626 0.463   1.00 27.31  ? 19   ALA A CB  1 
ATOM   137  N  N   . VAL A 1 20  ? 24.426 21.897 0.313   1.00 23.71  ? 20   VAL A N   1 
ATOM   138  C  CA  . VAL A 1 20  ? 25.173 21.033 -0.563  1.00 25.58  ? 20   VAL A CA  1 
ATOM   139  C  C   . VAL A 1 20  ? 24.231 20.001 -1.160  1.00 24.61  ? 20   VAL A C   1 
ATOM   140  O  O   . VAL A 1 20  ? 23.112 19.804 -0.663  1.00 22.56  ? 20   VAL A O   1 
ATOM   141  C  CB  . VAL A 1 20  ? 26.288 20.329 0.201   1.00 29.55  ? 20   VAL A CB  1 
ATOM   142  C  CG1 . VAL A 1 20  ? 27.225 21.354 0.842   1.00 31.51  ? 20   VAL A CG1 1 
ATOM   143  C  CG2 . VAL A 1 20  ? 25.700 19.417 1.289   1.00 28.79  ? 20   VAL A CG2 1 
ATOM   144  N  N   . TYR A 1 21  ? 24.651 19.395 -2.269  1.00 26.01  ? 21   TYR A N   1 
ATOM   145  C  CA  . TYR A 1 21  ? 23.987 18.195 -2.744  1.00 25.74  ? 21   TYR A CA  1 
ATOM   146  C  C   . TYR A 1 21  ? 24.960 17.079 -3.079  1.00 27.18  ? 21   TYR A C   1 
ATOM   147  O  O   . TYR A 1 21  ? 26.138 17.318 -3.345  1.00 32.04  ? 21   TYR A O   1 
ATOM   148  C  CB  . TYR A 1 21  ? 23.032 18.465 -3.926  1.00 27.63  ? 21   TYR A CB  1 
ATOM   149  C  CG  . TYR A 1 21  ? 23.619 18.820 -5.266  1.00 32.56  ? 21   TYR A CG  1 
ATOM   150  C  CD1 . TYR A 1 21  ? 23.884 20.141 -5.601  1.00 34.06  ? 21   TYR A CD1 1 
ATOM   151  C  CD2 . TYR A 1 21  ? 23.837 17.852 -6.214  1.00 30.96  ? 21   TYR A CD2 1 
ATOM   152  C  CE1 . TYR A 1 21  ? 24.391 20.473 -6.831  1.00 39.39  ? 21   TYR A CE1 1 
ATOM   153  C  CE2 . TYR A 1 21  ? 24.342 18.172 -7.464  1.00 41.35  ? 21   TYR A CE2 1 
ATOM   154  C  CZ  . TYR A 1 21  ? 24.606 19.483 -7.763  1.00 40.97  ? 21   TYR A CZ  1 
ATOM   155  O  OH  . TYR A 1 21  ? 25.118 19.798 -8.985  1.00 38.17  ? 21   TYR A OH  1 
ATOM   156  N  N   . LEU A 1 22  ? 24.464 15.851 -3.002  1.00 30.46  ? 22   LEU A N   1 
ATOM   157  C  CA  . LEU A 1 22  ? 25.262 14.689 -3.385  1.00 31.77  ? 22   LEU A CA  1 
ATOM   158  C  C   . LEU A 1 22  ? 24.379 13.696 -4.109  1.00 28.99  ? 22   LEU A C   1 
ATOM   159  O  O   . LEU A 1 22  ? 23.228 14.001 -4.380  1.00 24.85  ? 22   LEU A O   1 
ATOM   160  C  CB  . LEU A 1 22  ? 25.950 14.065 -2.182  1.00 32.19  ? 22   LEU A CB  1 
ATOM   161  C  CG  . LEU A 1 22  ? 25.223 13.676 -0.900  1.00 33.53  ? 22   LEU A CG  1 
ATOM   162  C  CD1 . LEU A 1 22  ? 26.110 12.693 -0.134  1.00 36.77  ? 22   LEU A CD1 1 
ATOM   163  C  CD2 . LEU A 1 22  ? 24.936 14.899 -0.025  1.00 35.21  ? 22   LEU A CD2 1 
ATOM   164  N  N   . GLN A 1 23  ? 24.931 12.528 -4.436  1.00 27.62  ? 23   GLN A N   1 
ATOM   165  C  CA  . GLN A 1 23  ? 24.145 11.441 -4.998  1.00 29.69  ? 23   GLN A CA  1 
ATOM   166  C  C   . GLN A 1 23  ? 22.973 11.103 -4.088  1.00 24.76  ? 23   GLN A C   1 
ATOM   167  O  O   . GLN A 1 23  ? 23.064 11.338 -2.867  1.00 25.63  ? 23   GLN A O   1 
ATOM   168  C  CB  . GLN A 1 23  ? 25.014 10.182 -5.209  1.00 34.15  ? 23   GLN A CB  1 
ATOM   169  C  CG  . GLN A 1 23  ? 25.467 9.438  -3.946  1.00 35.18  ? 23   GLN A CG  1 
ATOM   170  C  CD  . GLN A 1 23  ? 26.784 9.941  -3.371  1.00 36.47  ? 23   GLN A CD  1 
ATOM   171  O  OE1 . GLN A 1 23  ? 27.231 11.067 -3.678  1.00 35.71  ? 23   GLN A OE1 1 
ATOM   172  N  NE2 . GLN A 1 23  ? 27.430 9.100  -2.542  1.00 41.30  ? 23   GLN A NE2 1 
ATOM   173  N  N   . PRO A 1 24  ? 21.899 10.509 -4.656  1.00 24.24  ? 24   PRO A N   1 
ATOM   174  C  CA  . PRO A 1 24  ? 20.836 10.057 -3.760  1.00 25.22  ? 24   PRO A CA  1 
ATOM   175  C  C   . PRO A 1 24  ? 21.340 9.009  -2.762  1.00 27.26  ? 24   PRO A C   1 
ATOM   176  O  O   . PRO A 1 24  ? 22.201 8.176  -3.096  1.00 29.40  ? 24   PRO A O   1 
ATOM   177  C  CB  . PRO A 1 24  ? 19.793 9.445  -4.684  1.00 28.80  ? 24   PRO A CB  1 
ATOM   178  C  CG  . PRO A 1 24  ? 20.148 9.942  -6.084  1.00 28.93  ? 24   PRO A CG  1 
ATOM   179  C  CD  . PRO A 1 24  ? 21.616 10.193 -6.069  1.00 26.58  ? 24   PRO A CD  1 
ATOM   180  N  N   . ILE A 1 25  ? 20.777 9.050  -1.558  1.00 25.85  ? 25   ILE A N   1 
ATOM   181  C  CA  . ILE A 1 25  ? 21.258 8.214  -0.459  1.00 25.90  ? 25   ILE A CA  1 
ATOM   182  C  C   . ILE A 1 25  ? 20.148 7.221  -0.098  1.00 27.42  ? 25   ILE A C   1 
ATOM   183  O  O   . ILE A 1 25  ? 18.961 7.505  -0.285  1.00 29.75  ? 25   ILE A O   1 
ATOM   184  C  CB  . ILE A 1 25  ? 21.672 9.129  0.718   1.00 27.89  ? 25   ILE A CB  1 
ATOM   185  C  CG1 . ILE A 1 25  ? 22.993 9.844  0.369   1.00 30.63  ? 25   ILE A CG1 1 
ATOM   186  C  CG2 . ILE A 1 25  ? 21.761 8.358  2.033   1.00 31.89  ? 25   ILE A CG2 1 
ATOM   187  C  CD1 . ILE A 1 25  ? 24.173 8.957  0.183   1.00 45.44  ? 25   ILE A CD1 1 
ATOM   188  N  N   . GLU A 1 26  ? 20.519 6.038  0.362   1.00 25.22  ? 26   GLU A N   1 
ATOM   189  C  CA  . GLU A 1 26  ? 19.535 5.095  0.871   1.00 25.68  ? 26   GLU A CA  1 
ATOM   190  C  C   . GLU A 1 26  ? 19.425 5.388  2.361   1.00 23.79  ? 26   GLU A C   1 
ATOM   191  O  O   . GLU A 1 26  ? 20.446 5.455  3.053   1.00 24.65  ? 26   GLU A O   1 
ATOM   192  C  CB  . GLU A 1 26  ? 19.993 3.660  0.631   1.00 28.15  ? 26   GLU A CB  1 
ATOM   193  C  CG  . GLU A 1 26  ? 18.915 2.703  0.259   1.00 39.66  ? 26   GLU A CG  1 
ATOM   194  C  CD  . GLU A 1 26  ? 18.288 3.031  -1.061  1.00 39.85  ? 26   GLU A CD  1 
ATOM   195  O  OE1 . GLU A 1 26  ? 18.885 2.674  -2.109  1.00 48.04  ? 26   GLU A OE1 1 
ATOM   196  O  OE2 . GLU A 1 26  ? 17.199 3.652  -1.048  1.00 51.50  ? 26   GLU A OE2 1 
ATOM   197  N  N   . MET A 1 27  ? 18.212 5.603  2.856   1.00 27.24  ? 27   MET A N   1 
ATOM   198  C  CA  . MET A 1 27  ? 18.021 6.006  4.245   1.00 25.82  ? 27   MET A CA  1 
ATOM   199  C  C   . MET A 1 27  ? 17.091 5.046  4.950   1.00 25.53  ? 27   MET A C   1 
ATOM   200  O  O   . MET A 1 27  ? 16.155 4.566  4.346   1.00 30.95  ? 27   MET A O   1 
ATOM   201  C  CB  . MET A 1 27  ? 17.385 7.403  4.326   1.00 26.43  ? 27   MET A CB  1 
ATOM   202  C  CG  . MET A 1 27  ? 17.417 8.070  5.723   1.00 30.66  ? 27   MET A CG  1 
ATOM   203  S  SD  . MET A 1 27  ? 16.316 9.501  5.905   1.00 36.81  ? 27   MET A SD  1 
ATOM   204  C  CE  . MET A 1 27  ? 14.745 8.670  6.212   1.00 32.43  ? 27   MET A CE  1 
ATOM   205  N  N   . GLU A 1 28  ? 17.361 4.802  6.228   1.00 24.56  ? 28   GLU A N   1 
ATOM   206  C  CA  . GLU A 1 28  ? 16.392 4.167  7.103   1.00 27.91  ? 28   GLU A CA  1 
ATOM   207  C  C   . GLU A 1 28  ? 15.895 5.151  8.156   1.00 27.22  ? 28   GLU A C   1 
ATOM   208  O  O   . GLU A 1 28  ? 16.580 6.104  8.473   1.00 26.02  ? 28   GLU A O   1 
ATOM   209  C  CB  . GLU A 1 28  ? 17.016 2.951  7.768   1.00 31.03  ? 28   GLU A CB  1 
ATOM   210  C  CG  . GLU A 1 28  ? 17.289 1.854  6.772   1.00 36.85  ? 28   GLU A CG  1 
ATOM   211  C  CD  . GLU A 1 28  ? 16.867 0.534  7.302   1.00 50.18  ? 28   GLU A CD  1 
ATOM   212  O  OE1 . GLU A 1 28  ? 15.673 0.221  7.161   1.00 51.43  ? 28   GLU A OE1 1 
ATOM   213  O  OE2 . GLU A 1 28  ? 17.720 -0.160 7.888   1.00 60.45  ? 28   GLU A OE2 1 
ATOM   214  N  N   . PRO A 1 29  ? 14.701 4.912  8.712   1.00 35.00  ? 29   PRO A N   1 
ATOM   215  C  CA  . PRO A 1 29  ? 13.800 3.826  8.385   1.00 36.76  ? 29   PRO A CA  1 
ATOM   216  C  C   . PRO A 1 29  ? 13.227 4.013  6.987   1.00 37.93  ? 29   PRO A C   1 
ATOM   217  O  O   . PRO A 1 29  ? 13.063 5.144  6.536   1.00 37.43  ? 29   PRO A O   1 
ATOM   218  C  CB  . PRO A 1 29  ? 12.698 3.958  9.435   1.00 41.85  ? 29   PRO A CB  1 
ATOM   219  C  CG  . PRO A 1 29  ? 12.685 5.376  9.779   1.00 42.54  ? 29   PRO A CG  1 
ATOM   220  C  CD  . PRO A 1 29  ? 14.058 5.919  9.572   1.00 38.69  ? 29   PRO A CD  1 
ATOM   221  N  N   . ARG A 1 30  ? 12.924 2.903  6.324   1.00 42.38  ? 30   ARG A N   1 
ATOM   222  C  CA  . ARG A 1 30  ? 12.445 2.925  4.959   1.00 44.53  ? 30   ARG A CA  1 
ATOM   223  C  C   . ARG A 1 30  ? 11.081 3.576  4.925   1.00 48.54  ? 30   ARG A C   1 
ATOM   224  O  O   . ARG A 1 30  ? 10.317 3.471  5.878   1.00 49.36  ? 30   ARG A O   1 
ATOM   225  C  CB  . ARG A 1 30  ? 12.348 1.499  4.405   1.00 49.70  ? 30   ARG A CB  1 
ATOM   226  C  CG  . ARG A 1 30  ? 13.669 0.770  4.369   1.00 52.68  ? 30   ARG A CG  1 
ATOM   227  C  CD  . ARG A 1 30  ? 13.520 -0.642 3.898   1.00 65.05  ? 30   ARG A CD  1 
ATOM   228  N  NE  . ARG A 1 30  ? 13.376 -0.712 2.449   1.00 73.19  ? 30   ARG A NE  1 
ATOM   229  C  CZ  . ARG A 1 30  ? 13.290 -1.847 1.762   1.00 80.42  ? 30   ARG A CZ  1 
ATOM   230  N  NH1 . ARG A 1 30  ? 13.319 -3.021 2.392   1.00 81.12  ? 30   ARG A NH1 1 
ATOM   231  N  NH2 . ARG A 1 30  ? 13.162 -1.812 0.436   1.00 88.11  ? 30   ARG A NH2 1 
ATOM   232  N  N   . GLY A 1 31  ? 10.802 4.290  3.843   1.00 49.78  ? 31   GLY A N   1 
ATOM   233  C  CA  . GLY A 1 31  ? 9.471  4.805  3.591   1.00 54.87  ? 31   GLY A CA  1 
ATOM   234  C  C   . GLY A 1 31  ? 9.170  6.222  4.029   1.00 56.51  ? 31   GLY A C   1 
ATOM   235  O  O   . GLY A 1 31  ? 8.132  6.753  3.642   1.00 61.36  ? 31   GLY A O   1 
ATOM   236  N  N   . ILE A 1 32  ? 10.024 6.832  4.851   1.00 55.41  ? 32   ILE A N   1 
ATOM   237  C  CA  . ILE A 1 32  ? 9.793  8.234  5.248   1.00 58.90  ? 32   ILE A CA  1 
ATOM   238  C  C   . ILE A 1 32  ? 10.474 9.232  4.307   1.00 56.26  ? 32   ILE A C   1 
ATOM   239  O  O   . ILE A 1 32  ? 10.194 10.426 4.389   1.00 62.10  ? 32   ILE A O   1 
ATOM   240  C  CB  . ILE A 1 32  ? 10.144 8.554  6.748   1.00 61.18  ? 32   ILE A CB  1 
ATOM   241  C  CG1 . ILE A 1 32  ? 11.536 8.059  7.143   1.00 61.80  ? 32   ILE A CG1 1 
ATOM   242  C  CG2 . ILE A 1 32  ? 9.090  7.967  7.690   1.00 67.63  ? 32   ILE A CG2 1 
ATOM   243  C  CD1 . ILE A 1 32  ? 12.102 8.772  8.380   1.00 65.14  ? 32   ILE A CD1 1 
ATOM   244  N  N   . ASP A 1 33  ? 11.359 8.754  3.429   1.00 50.86  ? 33   ASP A N   1 
ATOM   245  C  CA  . ASP A 1 33  ? 11.862 9.573  2.326   1.00 48.90  ? 33   ASP A CA  1 
ATOM   246  C  C   . ASP A 1 33  ? 11.916 8.837  0.998   1.00 45.46  ? 33   ASP A C   1 
ATOM   247  O  O   . ASP A 1 33  ? 11.944 7.610  0.944   1.00 45.03  ? 33   ASP A O   1 
ATOM   248  C  CB  . ASP A 1 33  ? 13.248 10.153 2.622   1.00 47.08  ? 33   ASP A CB  1 
ATOM   249  C  CG  . ASP A 1 33  ? 13.539 11.429 1.806   1.00 51.44  ? 33   ASP A CG  1 
ATOM   250  O  OD1 . ASP A 1 33  ? 12.589 12.124 1.356   1.00 50.44  ? 33   ASP A OD1 1 
ATOM   251  O  OD2 . ASP A 1 33  ? 14.715 11.750 1.617   1.00 42.43  ? 33   ASP A OD2 1 
ATOM   252  N  N   . LEU A 1 34  ? 11.942 9.624  -0.073  1.00 44.65  ? 34   LEU A N   1 
ATOM   253  C  CA  . LEU A 1 34  ? 12.076 9.127  -1.439  1.00 41.95  ? 34   LEU A CA  1 
ATOM   254  C  C   . LEU A 1 34  ? 13.242 8.143  -1.587  1.00 41.29  ? 34   LEU A C   1 
ATOM   255  O  O   . LEU A 1 34  ? 14.392 8.448  -1.255  1.00 38.83  ? 34   LEU A O   1 
ATOM   256  C  CB  . LEU A 1 34  ? 12.244 10.316 -2.406  1.00 43.69  ? 34   LEU A CB  1 
ATOM   257  C  CG  . LEU A 1 34  ? 12.153 10.088 -3.919  1.00 38.12  ? 34   LEU A CG  1 
ATOM   258  C  CD1 . LEU A 1 34  ? 10.805 9.519  -4.340  1.00 39.28  ? 34   LEU A CD1 1 
ATOM   259  C  CD2 . LEU A 1 34  ? 12.448 11.412 -4.637  1.00 37.29  ? 34   LEU A CD2 1 
ATOM   260  N  N   . ALA A 1 35  ? 12.922 6.957  -2.089  1.00 36.95  ? 35   ALA A N   1 
ATOM   261  C  CA  . ALA A 1 35  ? 13.911 5.915  -2.334  1.00 37.81  ? 35   ALA A CA  1 
ATOM   262  C  C   . ALA A 1 35  ? 14.988 6.408  -3.305  1.00 35.90  ? 35   ALA A C   1 
ATOM   263  O  O   . ALA A 1 35  ? 14.701 7.160  -4.244  1.00 32.21  ? 35   ALA A O   1 
ATOM   264  C  CB  . ALA A 1 35  ? 13.230 4.650  -2.874  1.00 40.56  ? 35   ALA A CB  1 
ATOM   265  N  N   . ALA A 1 36  ? 16.232 5.985  -3.062  1.00 33.97  ? 36   ALA A N   1 
ATOM   266  C  CA  . ALA A 1 36  ? 17.379 6.452  -3.845  1.00 31.78  ? 36   ALA A CA  1 
ATOM   267  C  C   . ALA A 1 36  ? 17.237 6.234  -5.351  1.00 32.55  ? 36   ALA A C   1 
ATOM   268  O  O   . ALA A 1 36  ? 17.683 7.058  -6.132  1.00 30.96  ? 36   ALA A O   1 
ATOM   269  C  CB  . ALA A 1 36  ? 18.667 5.807  -3.364  1.00 36.72  ? 36   ALA A CB  1 
ATOM   270  N  N   . SER A 1 37  ? 16.668 5.104  -5.744  1.00 35.12  ? 37   SER A N   1 
ATOM   271  C  CA  . SER A 1 37  ? 16.560 4.797  -7.171  1.00 36.36  ? 37   SER A CA  1 
ATOM   272  C  C   . SER A 1 37  ? 15.523 5.687  -7.853  1.00 36.04  ? 37   SER A C   1 
ATOM   273  O  O   . SER A 1 37  ? 15.513 5.784  -9.077  1.00 31.92  ? 37   SER A O   1 
ATOM   274  C  CB  . SER A 1 37  ? 16.232 3.324  -7.402  1.00 40.25  ? 37   SER A CB  1 
ATOM   275  O  OG  . SER A 1 37  ? 14.974 3.001  -6.845  1.00 46.28  ? 37   SER A OG  1 
ATOM   276  N  N   . LEU A 1 38  ? 14.674 6.348  -7.068  1.00 34.22  ? 38   LEU A N   1 
ATOM   277  C  CA  . LEU A 1 38  ? 13.659 7.252  -7.613  1.00 33.74  ? 38   LEU A CA  1 
ATOM   278  C  C   . LEU A 1 38  ? 14.107 8.708  -7.595  1.00 30.86  ? 38   LEU A C   1 
ATOM   279  O  O   . LEU A 1 38  ? 13.344 9.589  -8.012  1.00 30.15  ? 38   LEU A O   1 
ATOM   280  C  CB  . LEU A 1 38  ? 12.344 7.103  -6.838  1.00 33.93  ? 38   LEU A CB  1 
ATOM   281  C  CG  . LEU A 1 38  ? 11.531 5.817  -7.040  1.00 45.27  ? 38   LEU A CG  1 
ATOM   282  C  CD1 . LEU A 1 38  ? 12.425 4.612  -7.076  1.00 51.56  ? 38   LEU A CD1 1 
ATOM   283  C  CD2 . LEU A 1 38  ? 10.446 5.645  -5.973  1.00 43.91  ? 38   LEU A CD2 1 
ATOM   284  N  N   . ALA A 1 39  ? 15.336 8.960  -7.127  1.00 27.32  ? 39   ALA A N   1 
ATOM   285  C  CA  . ALA A 1 39  ? 15.845 10.331 -6.899  1.00 24.85  ? 39   ALA A CA  1 
ATOM   286  C  C   . ALA A 1 39  ? 17.081 10.594 -7.763  1.00 22.77  ? 39   ALA A C   1 
ATOM   287  O  O   . ALA A 1 39  ? 17.665 9.657  -8.288  1.00 26.23  ? 39   ALA A O   1 
ATOM   288  C  CB  . ALA A 1 39  ? 16.197 10.520 -5.432  1.00 22.33  ? 39   ALA A CB  1 
ATOM   289  N  N   . ASP A 1 40  ? 17.466 11.866 -7.863  1.00 22.93  ? 40   ASP A N   1 
ATOM   290  C  CA  . ASP A 1 40  ? 18.704 12.279 -8.543  1.00 25.71  ? 40   ASP A CA  1 
ATOM   291  C  C   . ASP A 1 40  ? 19.733 12.958 -7.665  1.00 24.07  ? 40   ASP A C   1 
ATOM   292  O  O   . ASP A 1 40  ? 20.911 12.957 -8.020  1.00 25.11  ? 40   ASP A O   1 
ATOM   293  C  CB  . ASP A 1 40  ? 18.401 13.189 -9.740  1.00 27.41  ? 40   ASP A CB  1 
ATOM   294  C  CG  . ASP A 1 40  ? 17.563 12.512 -10.774 1.00 34.04  ? 40   ASP A CG  1 
ATOM   295  O  OD1 . ASP A 1 40  ? 18.116 11.686 -11.535 1.00 34.13  ? 40   ASP A OD1 1 
ATOM   296  O  OD2 . ASP A 1 40  ? 16.347 12.790 -10.804 1.00 27.87  ? 40   ASP A OD2 1 
ATOM   297  N  N   . ILE A 1 41  ? 19.317 13.503 -6.521  1.00 22.06  ? 41   ILE A N   1 
ATOM   298  C  CA  . ILE A 1 41  ? 20.248 14.121 -5.587  1.00 20.50  ? 41   ILE A CA  1 
ATOM   299  C  C   . ILE A 1 41  ? 19.725 13.913 -4.211  1.00 19.57  ? 41   ILE A C   1 
ATOM   300  O  O   . ILE A 1 41  ? 18.552 13.591 -4.052  1.00 19.36  ? 41   ILE A O   1 
ATOM   301  C  CB  . ILE A 1 41  ? 20.394 15.660 -5.784  1.00 21.82  ? 41   ILE A CB  1 
ATOM   302  C  CG1 . ILE A 1 41  ? 19.057 16.376 -5.616  1.00 21.44  ? 41   ILE A CG1 1 
ATOM   303  C  CG2 . ILE A 1 41  ? 20.924 15.993 -7.162  1.00 25.13  ? 41   ILE A CG2 1 
ATOM   304  C  CD1 . ILE A 1 41  ? 19.154 17.943 -5.692  1.00 21.10  ? 41   ILE A CD1 1 
ATOM   305  N  N   . HIS A 1 42  ? 20.637 14.099 -3.256  1.00 21.36  ? 42   HIS A N   1 
ATOM   306  C  CA  . HIS A 1 42  ? 20.327 14.258 -1.843  1.00 21.51  ? 42   HIS A CA  1 
ATOM   307  C  C   . HIS A 1 42  ? 20.709 15.689 -1.519  1.00 23.67  ? 42   HIS A C   1 
ATOM   308  O  O   . HIS A 1 42  ? 21.879 16.092 -1.700  1.00 25.39  ? 42   HIS A O   1 
ATOM   309  C  CB  . HIS A 1 42  ? 21.131 13.293 -0.966  1.00 17.82  ? 42   HIS A CB  1 
ATOM   310  C  CG  . HIS A 1 42  ? 20.631 13.181 0.455   1.00 15.73  ? 42   HIS A CG  1 
ATOM   311  N  ND1 . HIS A 1 42  ? 19.422 12.599 0.770   1.00 16.52  ? 42   HIS A ND1 1 
ATOM   312  C  CD2 . HIS A 1 42  ? 21.221 13.486 1.636   1.00 23.12  ? 42   HIS A CD2 1 
ATOM   313  C  CE1 . HIS A 1 42  ? 19.281 12.564 2.089   1.00 18.52  ? 42   HIS A CE1 1 
ATOM   314  N  NE2 . HIS A 1 42  ? 20.340 13.130 2.629   1.00 13.71  ? 42   HIS A NE2 1 
ATOM   315  N  N   . LEU A 1 43  ? 19.716 16.467 -1.092  1.00 21.64  ? 43   LEU A N   1 
ATOM   316  C  CA  . LEU A 1 43  ? 19.921 17.866 -0.723  1.00 18.83  ? 43   LEU A CA  1 
ATOM   317  C  C   . LEU A 1 43  ? 20.130 17.927 0.785   1.00 19.15  ? 43   LEU A C   1 
ATOM   318  O  O   . LEU A 1 43  ? 19.382 17.291 1.539   1.00 20.29  ? 43   LEU A O   1 
ATOM   319  C  CB  . LEU A 1 43  ? 18.707 18.694 -1.142  1.00 19.22  ? 43   LEU A CB  1 
ATOM   320  C  CG  . LEU A 1 43  ? 18.661 20.179 -0.791  1.00 23.12  ? 43   LEU A CG  1 
ATOM   321  C  CD1 . LEU A 1 43  ? 19.822 20.932 -1.417  1.00 26.72  ? 43   LEU A CD1 1 
ATOM   322  C  CD2 . LEU A 1 43  ? 17.309 20.811 -1.239  1.00 23.53  ? 43   LEU A CD2 1 
ATOM   323  N  N   . GLU A 1 44  ? 21.117 18.689 1.204   1.00 19.25  ? 44   GLU A N   1 
ATOM   324  C  CA  . GLU A 1 44  ? 21.422 18.822 2.655   1.00 21.47  ? 44   GLU A CA  1 
ATOM   325  C  C   . GLU A 1 44  ? 21.563 20.273 3.040   1.00 21.66  ? 44   GLU A C   1 
ATOM   326  O  O   . GLU A 1 44  ? 22.118 21.064 2.280   1.00 25.28  ? 44   GLU A O   1 
ATOM   327  C  CB  . GLU A 1 44  ? 22.710 18.110 3.020   1.00 23.92  ? 44   GLU A CB  1 
ATOM   328  C  CG  . GLU A 1 44  ? 22.738 16.642 2.654   1.00 31.13  ? 44   GLU A CG  1 
ATOM   329  C  CD  . GLU A 1 44  ? 23.905 15.923 3.307   1.00 30.01  ? 44   GLU A CD  1 
ATOM   330  O  OE1 . GLU A 1 44  ? 24.783 16.633 3.818   1.00 30.31  ? 44   GLU A OE1 1 
ATOM   331  O  OE2 . GLU A 1 44  ? 23.923 14.659 3.294   1.00 31.95  ? 44   GLU A OE2 1 
ATOM   332  N  N   . ALA A 1 45  ? 21.088 20.590 4.237   1.00 22.93  ? 45   ALA A N   1 
ATOM   333  C  CA  . ALA A 1 45  ? 21.432 21.833 4.900   1.00 20.14  ? 45   ALA A CA  1 
ATOM   334  C  C   . ALA A 1 45  ? 22.414 21.448 5.975   1.00 20.95  ? 45   ALA A C   1 
ATOM   335  O  O   . ALA A 1 45  ? 22.137 20.559 6.772   1.00 21.12  ? 45   ALA A O   1 
ATOM   336  C  CB  . ALA A 1 45  ? 20.215 22.492 5.540   1.00 22.01  ? 45   ALA A CB  1 
ATOM   337  N  N   . ASP A 1 46  ? 23.525 22.169 6.013   1.00 19.79  ? 46   ASP A N   1 
ATOM   338  C  CA  . ASP A 1 46  ? 24.614 21.937 6.965   1.00 20.03  ? 46   ASP A CA  1 
ATOM   339  C  C   . ASP A 1 46  ? 24.604 23.132 7.875   1.00 18.70  ? 46   ASP A C   1 
ATOM   340  O  O   . ASP A 1 46  ? 24.939 24.251 7.452   1.00 20.90  ? 46   ASP A O   1 
ATOM   341  C  CB  . ASP A 1 46  ? 25.965 21.829 6.239   1.00 20.82  ? 46   ASP A CB  1 
ATOM   342  C  CG  . ASP A 1 46  ? 26.241 20.436 5.700   1.00 31.64  ? 46   ASP A CG  1 
ATOM   343  O  OD1 . ASP A 1 46  ? 25.678 19.441 6.206   1.00 35.60  ? 46   ASP A OD1 1 
ATOM   344  O  OD2 . ASP A 1 46  ? 27.050 20.353 4.748   1.00 42.87  ? 46   ASP A OD2 1 
ATOM   345  N  N   . ILE A 1 47  ? 24.171 22.920 9.119   1.00 18.44  ? 47   ILE A N   1 
ATOM   346  C  CA  . ILE A 1 47  ? 23.919 24.018 9.995   1.00 18.01  ? 47   ILE A CA  1 
ATOM   347  C  C   . ILE A 1 47  ? 24.569 23.736 11.356  1.00 20.34  ? 47   ILE A C   1 
ATOM   348  O  O   . ILE A 1 47  ? 24.183 22.796 12.017  1.00 18.81  ? 47   ILE A O   1 
ATOM   349  C  CB  . ILE A 1 47  ? 22.406 24.246 10.209  1.00 19.65  ? 47   ILE A CB  1 
ATOM   350  C  CG1 . ILE A 1 47  ? 21.685 24.354 8.881   1.00 22.53  ? 47   ILE A CG1 1 
ATOM   351  C  CG2 . ILE A 1 47  ? 22.168 25.495 11.147  1.00 20.22  ? 47   ILE A CG2 1 
ATOM   352  C  CD1 . ILE A 1 47  ? 20.173 24.702 8.972   1.00 24.76  ? 47   ILE A CD1 1 
ATOM   353  N  N   . HIS A 1 48  ? 25.518 24.590 11.738  1.00 18.39  ? 48   HIS A N   1 
ATOM   354  C  CA  . HIS A 1 48  ? 26.295 24.436 12.967  1.00 17.20  ? 48   HIS A CA  1 
ATOM   355  C  C   . HIS A 1 48  ? 26.455 25.759 13.693  1.00 17.67  ? 48   HIS A C   1 
ATOM   356  O  O   . HIS A 1 48  ? 26.358 26.836 13.094  1.00 20.69  ? 48   HIS A O   1 
ATOM   357  C  CB  . HIS A 1 48  ? 27.687 23.825 12.689  1.00 18.45  ? 48   HIS A CB  1 
ATOM   358  C  CG  . HIS A 1 48  ? 27.611 22.478 12.067  1.00 18.35  ? 48   HIS A CG  1 
ATOM   359  N  ND1 . HIS A 1 48  ? 27.409 22.310 10.714  1.00 19.24  ? 48   HIS A ND1 1 
ATOM   360  C  CD2 . HIS A 1 48  ? 27.605 21.239 12.615  1.00 18.17  ? 48   HIS A CD2 1 
ATOM   361  C  CE1 . HIS A 1 48  ? 27.310 21.010 10.457  1.00 21.81  ? 48   HIS A CE1 1 
ATOM   362  N  NE2 . HIS A 1 48  ? 27.420 20.343 11.595  1.00 20.90  ? 48   HIS A NE2 1 
ATOM   363  N  N   . ALA A 1 49  ? 26.620 25.687 15.014  1.00 19.59  ? 49   ALA A N   1 
ATOM   364  C  CA  . ALA A 1 49  ? 26.822 26.891 15.821  1.00 19.43  ? 49   ALA A CA  1 
ATOM   365  C  C   . ALA A 1 49  ? 28.135 27.598 15.514  1.00 18.02  ? 49   ALA A C   1 
ATOM   366  O  O   . ALA A 1 49  ? 29.183 26.969 15.355  1.00 17.86  ? 49   ALA A O   1 
ATOM   367  C  CB  . ALA A 1 49  ? 26.732 26.547 17.302  1.00 18.41  ? 49   ALA A CB  1 
ATOM   368  N  N   . LEU A 1 50  ? 28.051 28.920 15.435  1.00 19.36  ? 50   LEU A N   1 
ATOM   369  C  CA  . LEU A 1 50  ? 29.219 29.785 15.416  1.00 22.13  ? 50   LEU A CA  1 
ATOM   370  C  C   . LEU A 1 50  ? 29.761 29.908 16.825  1.00 20.55  ? 50   LEU A C   1 
ATOM   371  O  O   . LEU A 1 50  ? 29.123 29.489 17.781  1.00 19.99  ? 50   LEU A O   1 
ATOM   372  C  CB  . LEU A 1 50  ? 28.808 31.166 14.918  1.00 22.76  ? 50   LEU A CB  1 
ATOM   373  C  CG  . LEU A 1 50  ? 28.218 31.229 13.482  1.00 24.26  ? 50   LEU A CG  1 
ATOM   374  C  CD1 . LEU A 1 50  ? 27.754 32.635 13.153  1.00 24.53  ? 50   LEU A CD1 1 
ATOM   375  C  CD2 . LEU A 1 50  ? 29.156 30.672 12.392  1.00 24.71  ? 50   LEU A CD2 1 
ATOM   376  N  N   . LYS A 1 51  ? 30.968 30.431 16.917  1.00 24.51  ? 51   LYS A N   1 
ATOM   377  C  CA  A LYS A 1 51  ? 31.500 30.925 18.175  0.50 24.99  ? 51   LYS A CA  1 
ATOM   378  C  CA  B LYS A 1 51  ? 31.508 30.935 18.164  0.50 24.87  ? 51   LYS A CA  1 
ATOM   379  C  C   . LYS A 1 51  ? 30.518 31.933 18.771  1.00 24.59  ? 51   LYS A C   1 
ATOM   380  O  O   . LYS A 1 51  ? 29.816 32.660 18.037  1.00 24.51  ? 51   LYS A O   1 
ATOM   381  C  CB  A LYS A 1 51  ? 32.849 31.623 17.959  0.50 27.24  ? 51   LYS A CB  1 
ATOM   382  C  CB  B LYS A 1 51  ? 32.842 31.641 17.890  0.50 26.87  ? 51   LYS A CB  1 
ATOM   383  C  CG  A LYS A 1 51  ? 33.681 31.768 19.239  0.50 34.31  ? 51   LYS A CG  1 
ATOM   384  C  CG  B LYS A 1 51  ? 33.727 31.829 19.115  0.50 33.74  ? 51   LYS A CG  1 
ATOM   385  C  CD  A LYS A 1 51  ? 35.070 32.371 18.947  0.50 40.11  ? 51   LYS A CD  1 
ATOM   386  C  CD  B LYS A 1 51  ? 35.195 31.507 18.780  0.50 37.72  ? 51   LYS A CD  1 
ATOM   387  C  CE  A LYS A 1 51  ? 36.148 31.857 19.906  0.50 41.22  ? 51   LYS A CE  1 
ATOM   388  C  CE  B LYS A 1 51  ? 35.450 31.648 17.290  0.50 33.66  ? 51   LYS A CE  1 
ATOM   389  N  NZ  A LYS A 1 51  ? 35.985 32.392 21.279  0.50 40.62  ? 51   LYS A NZ  1 
ATOM   390  N  NZ  B LYS A 1 51  ? 36.551 30.780 16.781  0.50 41.54  ? 51   LYS A NZ  1 
ATOM   391  N  N   . ASN A 1 52  ? 30.473 31.995 20.098  1.00 24.30  ? 52   ASN A N   1 
ATOM   392  C  CA  . ASN A 1 52  ? 29.616 32.975 20.753  1.00 25.52  ? 52   ASN A CA  1 
ATOM   393  C  C   . ASN A 1 52  ? 28.151 32.874 20.342  1.00 25.38  ? 52   ASN A C   1 
ATOM   394  O  O   . ASN A 1 52  ? 27.440 33.891 20.235  1.00 26.07  ? 52   ASN A O   1 
ATOM   395  C  CB  . ASN A 1 52  ? 30.106 34.388 20.513  1.00 27.45  ? 52   ASN A CB  1 
ATOM   396  C  CG  . ASN A 1 52  ? 31.510 34.614 21.025  1.00 27.00  ? 52   ASN A CG  1 
ATOM   397  O  OD1 . ASN A 1 52  ? 31.807 34.314 22.178  1.00 32.73  ? 52   ASN A OD1 1 
ATOM   398  N  ND2 . ASN A 1 52  ? 32.378 35.176 20.172  1.00 29.63  ? 52   ASN A ND2 1 
ATOM   399  N  N   . ASN A 1 53  ? 27.680 31.648 20.199  1.00 24.37  ? 53   ASN A N   1 
ATOM   400  C  CA  . ASN A 1 53  ? 26.275 31.412 19.847  1.00 23.12  ? 53   ASN A CA  1 
ATOM   401  C  C   . ASN A 1 53  ? 25.414 31.893 21.016  1.00 22.37  ? 53   ASN A C   1 
ATOM   402  O  O   . ASN A 1 53  ? 25.745 31.591 22.144  1.00 22.87  ? 53   ASN A O   1 
ATOM   403  C  CB  . ASN A 1 53  ? 26.044 29.920 19.605  1.00 20.07  ? 53   ASN A CB  1 
ATOM   404  C  CG  . ASN A 1 53  ? 24.585 29.606 19.378  1.00 17.83  ? 53   ASN A CG  1 
ATOM   405  O  OD1 . ASN A 1 53  ? 23.836 29.393 20.330  1.00 19.66  ? 53   ASN A OD1 1 
ATOM   406  N  ND2 . ASN A 1 53  ? 24.163 29.632 18.116  1.00 18.31  ? 53   ASN A ND2 1 
ATOM   407  N  N   . PRO A 1 54  ? 24.377 32.734 20.759  1.00 23.20  ? 54   PRO A N   1 
ATOM   408  C  CA  . PRO A 1 54  ? 23.617 33.358 21.824  1.00 24.49  ? 54   PRO A CA  1 
ATOM   409  C  C   . PRO A 1 54  ? 22.615 32.456 22.543  1.00 24.19  ? 54   PRO A C   1 
ATOM   410  O  O   . PRO A 1 54  ? 22.041 32.863 23.561  1.00 24.56  ? 54   PRO A O   1 
ATOM   411  C  CB  . PRO A 1 54  ? 22.882 34.489 21.115  1.00 28.02  ? 54   PRO A CB  1 
ATOM   412  C  CG  . PRO A 1 54  ? 22.729 34.023 19.724  1.00 27.31  ? 54   PRO A CG  1 
ATOM   413  C  CD  . PRO A 1 54  ? 23.912 33.147 19.433  1.00 23.01  ? 54   PRO A CD  1 
ATOM   414  N  N   . ASN A 1 55  ? 22.419 31.247 22.014  1.00 23.32  ? 55   ASN A N   1 
ATOM   415  C  CA  . ASN A 1 55  ? 21.476 30.304 22.567  1.00 20.86  ? 55   ASN A CA  1 
ATOM   416  C  C   . ASN A 1 55  ? 22.154 29.130 23.288  1.00 18.55  ? 55   ASN A C   1 
ATOM   417  O  O   . ASN A 1 55  ? 21.513 28.142 23.578  1.00 21.14  ? 55   ASN A O   1 
ATOM   418  C  CB  . ASN A 1 55  ? 20.541 29.824 21.468  1.00 21.82  ? 55   ASN A CB  1 
ATOM   419  C  CG  . ASN A 1 55  ? 19.888 30.971 20.721  1.00 21.77  ? 55   ASN A CG  1 
ATOM   420  O  OD1 . ASN A 1 55  ? 20.203 31.187 19.557  1.00 25.39  ? 55   ASN A OD1 1 
ATOM   421  N  ND2 . ASN A 1 55  ? 19.052 31.776 21.411  1.00 21.42  ? 55   ASN A ND2 1 
ATOM   422  N  N   . GLY A 1 56  ? 23.442 29.250 23.588  1.00 18.26  ? 56   GLY A N   1 
ATOM   423  C  CA  . GLY A 1 56  ? 24.139 28.269 24.391  1.00 20.96  ? 56   GLY A CA  1 
ATOM   424  C  C   . GLY A 1 56  ? 24.797 27.119 23.702  1.00 19.98  ? 56   GLY A C   1 
ATOM   425  O  O   . GLY A 1 56  ? 25.356 26.248 24.388  1.00 20.43  ? 56   GLY A O   1 
ATOM   426  N  N   . PHE A 1 57  ? 24.709 27.059 22.366  1.00 19.55  ? 57   PHE A N   1 
ATOM   427  C  CA  . PHE A 1 57  ? 25.350 25.984 21.628  1.00 19.20  ? 57   PHE A CA  1 
ATOM   428  C  C   . PHE A 1 57  ? 26.830 26.245 21.448  1.00 19.80  ? 57   PHE A C   1 
ATOM   429  O  O   . PHE A 1 57  ? 27.219 27.319 20.948  1.00 21.47  ? 57   PHE A O   1 
ATOM   430  C  CB  . PHE A 1 57  ? 24.674 25.746 20.278  1.00 19.19  ? 57   PHE A CB  1 
ATOM   431  C  CG  . PHE A 1 57  ? 23.430 24.941 20.406  1.00 17.25  ? 57   PHE A CG  1 
ATOM   432  C  CD1 . PHE A 1 57  ? 23.458 23.586 20.311  1.00 17.82  ? 57   PHE A CD1 1 
ATOM   433  C  CD2 . PHE A 1 57  ? 22.238 25.572 20.710  1.00 22.68  ? 57   PHE A CD2 1 
ATOM   434  C  CE1 . PHE A 1 57  ? 22.294 22.825 20.514  1.00 21.25  ? 57   PHE A CE1 1 
ATOM   435  C  CE2 . PHE A 1 57  ? 21.068 24.824 20.885  1.00 24.80  ? 57   PHE A CE2 1 
ATOM   436  C  CZ  . PHE A 1 57  ? 21.117 23.455 20.808  1.00 21.82  ? 57   PHE A CZ  1 
ATOM   437  N  N   . PRO A 1 58  ? 27.669 25.281 21.872  1.00 19.06  ? 58   PRO A N   1 
ATOM   438  C  CA  . PRO A 1 58  ? 29.104 25.416 21.658  1.00 21.27  ? 58   PRO A CA  1 
ATOM   439  C  C   . PRO A 1 58  ? 29.474 25.456 20.176  1.00 18.05  ? 58   PRO A C   1 
ATOM   440  O  O   . PRO A 1 58  ? 28.780 24.900 19.318  1.00 18.73  ? 58   PRO A O   1 
ATOM   441  C  CB  . PRO A 1 58  ? 29.710 24.167 22.344  1.00 21.46  ? 58   PRO A CB  1 
ATOM   442  C  CG  . PRO A 1 58  ? 28.673 23.411 22.790  1.00 21.50  ? 58   PRO A CG  1 
ATOM   443  C  CD  . PRO A 1 58  ? 27.345 23.965 22.419  1.00 18.12  ? 58   PRO A CD  1 
ATOM   444  N  N   . GLU A 1 59  ? 30.585 26.131 19.892  1.00 21.42  ? 59   GLU A N   1 
ATOM   445  C  CA  . GLU A 1 59  ? 31.054 26.292 18.509  1.00 21.10  ? 59   GLU A CA  1 
ATOM   446  C  C   . GLU A 1 59  ? 31.201 24.942 17.838  1.00 19.09  ? 59   GLU A C   1 
ATOM   447  O  O   . GLU A 1 59  ? 31.765 24.017 18.428  1.00 21.08  ? 59   GLU A O   1 
ATOM   448  C  CB  . GLU A 1 59  ? 32.408 27.024 18.493  1.00 24.27  ? 59   GLU A CB  1 
ATOM   449  C  CG  . GLU A 1 59  ? 32.939 27.317 17.112  1.00 25.02  ? 59   GLU A CG  1 
ATOM   450  C  CD  . GLU A 1 59  ? 34.296 27.998 17.126  1.00 33.00  ? 59   GLU A CD  1 
ATOM   451  O  OE1 . GLU A 1 59  ? 34.938 28.163 18.198  1.00 37.25  ? 59   GLU A OE1 1 
ATOM   452  O  OE2 . GLU A 1 59  ? 34.707 28.366 16.036  1.00 34.27  ? 59   GLU A OE2 1 
ATOM   453  N  N   . GLY A 1 60  ? 30.669 24.830 16.621  1.00 17.84  ? 60   GLY A N   1 
ATOM   454  C  CA  . GLY A 1 60  ? 30.756 23.614 15.845  1.00 19.21  ? 60   GLY A CA  1 
ATOM   455  C  C   . GLY A 1 60  ? 29.650 22.602 16.052  1.00 18.91  ? 60   GLY A C   1 
ATOM   456  O  O   . GLY A 1 60  ? 29.501 21.697 15.244  1.00 20.59  ? 60   GLY A O   1 
ATOM   457  N  N   . PHE A 1 61  ? 28.881 22.714 17.127  1.00 19.39  ? 61   PHE A N   1 
ATOM   458  C  CA  . PHE A 1 61  ? 27.805 21.756 17.333  1.00 16.95  ? 61   PHE A CA  1 
ATOM   459  C  C   . PHE A 1 61  ? 26.759 21.868 16.241  1.00 16.77  ? 61   PHE A C   1 
ATOM   460  O  O   . PHE A 1 61  ? 26.447 22.953 15.775  1.00 16.82  ? 61   PHE A O   1 
ATOM   461  C  CB  . PHE A 1 61  ? 27.124 21.983 18.674  1.00 16.22  ? 61   PHE A CB  1 
ATOM   462  C  CG  . PHE A 1 61  ? 27.642 21.156 19.785  1.00 19.59  ? 61   PHE A CG  1 
ATOM   463  C  CD1 . PHE A 1 61  ? 28.979 20.751 19.850  1.00 23.15  ? 61   PHE A CD1 1 
ATOM   464  C  CD2 . PHE A 1 61  ? 26.801 20.851 20.854  1.00 18.59  ? 61   PHE A CD2 1 
ATOM   465  C  CE1 . PHE A 1 61  ? 29.425 19.972 20.923  1.00 24.78  ? 61   PHE A CE1 1 
ATOM   466  C  CE2 . PHE A 1 61  ? 27.247 20.132 21.914  1.00 18.23  ? 61   PHE A CE2 1 
ATOM   467  C  CZ  . PHE A 1 61  ? 28.569 19.680 21.963  1.00 21.10  ? 61   PHE A CZ  1 
ATOM   468  N  N   . TRP A 1 62  ? 26.203 20.723 15.876  1.00 18.61  ? 62   TRP A N   1 
ATOM   469  C  CA  . TRP A 1 62  ? 25.041 20.679 15.016  1.00 19.18  ? 62   TRP A CA  1 
ATOM   470  C  C   . TRP A 1 62  ? 23.874 21.356 15.726  1.00 17.52  ? 62   TRP A C   1 
ATOM   471  O  O   . TRP A 1 62  ? 23.715 21.185 16.957  1.00 20.17  ? 62   TRP A O   1 
ATOM   472  C  CB  . TRP A 1 62  ? 24.699 19.215 14.710  1.00 17.47  ? 62   TRP A CB  1 
ATOM   473  C  CG  . TRP A 1 62  ? 23.610 19.067 13.755  1.00 19.03  ? 62   TRP A CG  1 
ATOM   474  C  CD1 . TRP A 1 62  ? 23.551 19.578 12.522  1.00 19.75  ? 62   TRP A CD1 1 
ATOM   475  C  CD2 . TRP A 1 62  ? 22.412 18.313 13.945  1.00 17.37  ? 62   TRP A CD2 1 
ATOM   476  N  NE1 . TRP A 1 62  ? 22.377 19.227 11.901  1.00 20.08  ? 62   TRP A NE1 1 
ATOM   477  C  CE2 . TRP A 1 62  ? 21.652 18.446 12.765  1.00 14.52  ? 62   TRP A CE2 1 
ATOM   478  C  CE3 . TRP A 1 62  ? 21.910 17.552 14.983  1.00 16.88  ? 62   TRP A CE3 1 
ATOM   479  C  CZ2 . TRP A 1 62  ? 20.429 17.819 12.602  1.00 16.57  ? 62   TRP A CZ2 1 
ATOM   480  C  CZ3 . TRP A 1 62  ? 20.694 16.940 14.836  1.00 17.61  ? 62   TRP A CZ3 1 
ATOM   481  C  CH2 . TRP A 1 62  ? 19.947 17.098 13.654  1.00 18.42  ? 62   TRP A CH2 1 
ATOM   482  N  N   . MET A 1 63  ? 23.093 22.146 14.974  1.00 16.97  ? 63   MET A N   1 
ATOM   483  C  CA  . MET A 1 63  ? 21.890 22.774 15.499  1.00 17.81  ? 63   MET A CA  1 
ATOM   484  C  C   . MET A 1 63  ? 20.731 21.834 15.300  1.00 16.81  ? 63   MET A C   1 
ATOM   485  O  O   . MET A 1 63  ? 20.315 21.627 14.181  1.00 17.95  ? 63   MET A O   1 
ATOM   486  C  CB  . MET A 1 63  ? 21.601 24.126 14.838  1.00 18.99  ? 63   MET A CB  1 
ATOM   487  C  CG  . MET A 1 63  ? 22.707 25.173 14.962  1.00 21.27  ? 63   MET A CG  1 
ATOM   488  S  SD  . MET A 1 63  ? 23.078 25.635 16.652  1.00 24.38  ? 63   MET A SD  1 
ATOM   489  C  CE  . MET A 1 63  ? 21.553 26.448 17.071  1.00 18.81  ? 63   MET A CE  1 
ATOM   490  N  N   . PRO A 1 64  ? 20.203 21.268 16.395  1.00 15.85  ? 64   PRO A N   1 
ATOM   491  C  CA  . PRO A 1 64  ? 19.189 20.210 16.326  1.00 17.71  ? 64   PRO A CA  1 
ATOM   492  C  C   . PRO A 1 64  ? 17.773 20.801 16.450  1.00 17.77  ? 64   PRO A C   1 
ATOM   493  O  O   . PRO A 1 64  ? 17.609 21.974 16.860  1.00 19.88  ? 64   PRO A O   1 
ATOM   494  C  CB  . PRO A 1 64  ? 19.538 19.364 17.547  1.00 18.99  ? 64   PRO A CB  1 
ATOM   495  C  CG  . PRO A 1 64  ? 19.888 20.384 18.568  1.00 20.23  ? 64   PRO A CG  1 
ATOM   496  C  CD  . PRO A 1 64  ? 20.649 21.465 17.785  1.00 17.53  ? 64   PRO A CD  1 
ATOM   497  N  N   . TYR A 1 65  ? 16.767 20.002 16.087  1.00 17.17  ? 65   TYR A N   1 
ATOM   498  C  CA  . TYR A 1 65  ? 15.349 20.347 16.192  1.00 17.21  ? 65   TYR A CA  1 
ATOM   499  C  C   . TYR A 1 65  ? 14.899 21.587 15.417  1.00 19.75  ? 65   TYR A C   1 
ATOM   500  O  O   . TYR A 1 65  ? 13.850 22.153 15.702  1.00 21.90  ? 65   TYR A O   1 
ATOM   501  C  CB  . TYR A 1 65  ? 14.962 20.510 17.675  1.00 18.84  ? 65   TYR A CB  1 
ATOM   502  C  CG  . TYR A 1 65  ? 15.202 19.294 18.520  1.00 20.16  ? 65   TYR A CG  1 
ATOM   503  C  CD1 . TYR A 1 65  ? 16.400 19.096 19.160  1.00 20.06  ? 65   TYR A CD1 1 
ATOM   504  C  CD2 . TYR A 1 65  ? 14.208 18.345 18.703  1.00 28.48  ? 65   TYR A CD2 1 
ATOM   505  C  CE1 . TYR A 1 65  ? 16.604 17.988 19.998  1.00 20.72  ? 65   TYR A CE1 1 
ATOM   506  C  CE2 . TYR A 1 65  ? 14.423 17.227 19.494  1.00 24.06  ? 65   TYR A CE2 1 
ATOM   507  C  CZ  . TYR A 1 65  ? 15.640 17.074 20.153  1.00 19.62  ? 65   TYR A CZ  1 
ATOM   508  O  OH  . TYR A 1 65  ? 15.875 15.955 20.887  1.00 20.47  ? 65   TYR A OH  1 
ATOM   509  N  N   . LEU A 1 66  ? 15.628 21.939 14.361  1.00 19.29  ? 66   LEU A N   1 
ATOM   510  C  CA  . LEU A 1 66  ? 15.215 23.017 13.467  1.00 19.14  ? 66   LEU A CA  1 
ATOM   511  C  C   . LEU A 1 66  ? 14.195 22.468 12.494  1.00 21.05  ? 66   LEU A C   1 
ATOM   512  O  O   . LEU A 1 66  ? 14.214 21.288 12.130  1.00 22.51  ? 66   LEU A O   1 
ATOM   513  C  CB  . LEU A 1 66  ? 16.403 23.570 12.682  1.00 18.59  ? 66   LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 66  ? 17.568 24.195 13.462  1.00 19.05  ? 66   LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 66  ? 18.651 24.673 12.570  1.00 19.12  ? 66   LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 66  ? 17.077 25.414 14.258  1.00 20.59  ? 66   LEU A CD2 1 
ATOM   517  N  N   . THR A 1 67  ? 13.283 23.325 12.106  1.00 19.45  ? 67   THR A N   1 
ATOM   518  C  CA  . THR A 1 67  ? 12.343 23.024 11.050  1.00 23.58  ? 67   THR A CA  1 
ATOM   519  C  C   . THR A 1 67  ? 12.897 23.715 9.819   1.00 21.26  ? 67   THR A C   1 
ATOM   520  O  O   . THR A 1 67  ? 13.053 24.952 9.785   1.00 24.33  ? 67   THR A O   1 
ATOM   521  C  CB  . THR A 1 67  ? 10.940 23.548 11.401  1.00 24.56  ? 67   THR A CB  1 
ATOM   522  O  OG1 . THR A 1 67  ? 10.556 23.020 12.687  1.00 25.65  ? 67   THR A OG1 1 
ATOM   523  C  CG2 . THR A 1 67  ? 9.904  23.196 10.318  1.00 31.54  ? 67   THR A CG2 1 
ATOM   524  N  N   . ILE A 1 68  ? 13.173 22.931 8.790   1.00 24.91  ? 68   ILE A N   1 
ATOM   525  C  CA  . ILE A 1 68  ? 13.756 23.465 7.582   1.00 24.71  ? 68   ILE A CA  1 
ATOM   526  C  C   . ILE A 1 68  ? 12.904 23.110 6.365   1.00 24.91  ? 68   ILE A C   1 
ATOM   527  O  O   . ILE A 1 68  ? 12.853 21.968 5.948   1.00 25.71  ? 68   ILE A O   1 
ATOM   528  C  CB  . ILE A 1 68  ? 15.174 22.995 7.366   1.00 25.67  ? 68   ILE A CB  1 
ATOM   529  C  CG1 . ILE A 1 68  ? 16.030 23.340 8.600   1.00 27.75  ? 68   ILE A CG1 1 
ATOM   530  C  CG2 . ILE A 1 68  ? 15.748 23.655 6.170   1.00 26.00  ? 68   ILE A CG2 1 
ATOM   531  C  CD1 . ILE A 1 68  ? 17.468 22.983 8.467   1.00 40.15  ? 68   ILE A CD1 1 
ATOM   532  N  N   . ALA A 1 69  ? 12.208 24.098 5.844   1.00 22.43  ? 69   ALA A N   1 
ATOM   533  C  CA  . ALA A 1 69  ? 11.447 23.916 4.623   1.00 22.93  ? 69   ALA A CA  1 
ATOM   534  C  C   . ALA A 1 69  ? 12.325 24.392 3.514   1.00 23.58  ? 69   ALA A C   1 
ATOM   535  O  O   . ALA A 1 69  ? 13.132 25.292 3.721   1.00 26.15  ? 69   ALA A O   1 
ATOM   536  C  CB  . ALA A 1 69  ? 10.141 24.675 4.648   1.00 25.06  ? 69   ALA A CB  1 
ATOM   537  N  N   . TYR A 1 70  ? 12.157 23.806 2.336   1.00 24.80  ? 70   TYR A N   1 
ATOM   538  C  CA  . TYR A 1 70  ? 12.902 24.240 1.185   1.00 22.75  ? 70   TYR A CA  1 
ATOM   539  C  C   . TYR A 1 70  ? 11.954 24.489 0.031   1.00 22.75  ? 70   TYR A C   1 
ATOM   540  O  O   . TYR A 1 70  ? 10.865 23.922 -0.039  1.00 21.58  ? 70   TYR A O   1 
ATOM   541  C  CB  . TYR A 1 70  ? 14.005 23.244 0.747   1.00 22.95  ? 70   TYR A CB  1 
ATOM   542  C  CG  . TYR A 1 70  ? 13.480 21.951 0.168   1.00 21.40  ? 70   TYR A CG  1 
ATOM   543  C  CD1 . TYR A 1 70  ? 13.120 21.854 -1.177  1.00 22.35  ? 70   TYR A CD1 1 
ATOM   544  C  CD2 . TYR A 1 70  ? 13.296 20.828 0.971   1.00 22.71  ? 70   TYR A CD2 1 
ATOM   545  C  CE1 . TYR A 1 70  ? 12.622 20.677 -1.684  1.00 27.57  ? 70   TYR A CE1 1 
ATOM   546  C  CE2 . TYR A 1 70  ? 12.784 19.656 0.462   1.00 24.99  ? 70   TYR A CE2 1 
ATOM   547  C  CZ  . TYR A 1 70  ? 12.452 19.595 -0.881  1.00 23.54  ? 70   TYR A CZ  1 
ATOM   548  O  OH  . TYR A 1 70  ? 11.965 18.430 -1.387  1.00 30.62  ? 70   TYR A OH  1 
ATOM   549  N  N   . GLU A 1 71  ? 12.369 25.403 -0.831  1.00 22.45  ? 71   GLU A N   1 
ATOM   550  C  CA  . GLU A 1 71  ? 11.731 25.602 -2.105  1.00 22.05  ? 71   GLU A CA  1 
ATOM   551  C  C   . GLU A 1 71  ? 12.848 25.610 -3.102  1.00 23.32  ? 71   GLU A C   1 
ATOM   552  O  O   . GLU A 1 71  ? 13.806 26.360 -2.946  1.00 26.51  ? 71   GLU A O   1 
ATOM   553  C  CB  . GLU A 1 71  ? 10.979 26.928 -2.160  1.00 28.17  ? 71   GLU A CB  1 
ATOM   554  C  CG  . GLU A 1 71  ? 10.250 27.167 -3.456  1.00 28.45  ? 71   GLU A CG  1 
ATOM   555  C  CD  . GLU A 1 71  ? 9.467  28.463 -3.386  1.00 41.40  ? 71   GLU A CD  1 
ATOM   556  O  OE1 . GLU A 1 71  ? 8.494  28.534 -2.610  1.00 47.15  ? 71   GLU A OE1 1 
ATOM   557  O  OE2 . GLU A 1 71  ? 9.866  29.415 -4.068  1.00 48.57  ? 71   GLU A OE2 1 
ATOM   558  N  N   . LEU A 1 72  ? 12.693 24.810 -4.133  1.00 25.92  ? 72   LEU A N   1 
ATOM   559  C  CA  . LEU A 1 72  ? 13.648 24.675 -5.208  1.00 24.01  ? 72   LEU A CA  1 
ATOM   560  C  C   . LEU A 1 72  ? 12.984 25.103 -6.518  1.00 25.38  ? 72   LEU A C   1 
ATOM   561  O  O   . LEU A 1 72  ? 12.000 24.527 -6.947  1.00 26.13  ? 72   LEU A O   1 
ATOM   562  C  CB  . LEU A 1 72  ? 14.102 23.224 -5.278  1.00 24.56  ? 72   LEU A CB  1 
ATOM   563  C  CG  . LEU A 1 72  ? 15.237 22.867 -6.236  1.00 32.81  ? 72   LEU A CG  1 
ATOM   564  C  CD1 . LEU A 1 72  ? 16.541 23.694 -5.948  1.00 26.60  ? 72   LEU A CD1 1 
ATOM   565  C  CD2 . LEU A 1 72  ? 15.471 21.353 -6.166  1.00 32.55  ? 72   LEU A CD2 1 
ATOM   566  N  N   . LYS A 1 73  ? 13.531 26.132 -7.124  1.00 21.89  ? 73   LYS A N   1 
ATOM   567  C  CA  . LYS A 1 73  ? 12.943 26.684 -8.312  1.00 23.62  ? 73   LYS A CA  1 
ATOM   568  C  C   . LYS A 1 73  ? 13.922 26.626 -9.493  1.00 24.26  ? 73   LYS A C   1 
ATOM   569  O  O   . LYS A 1 73  ? 15.060 27.091 -9.390  1.00 24.43  ? 73   LYS A O   1 
ATOM   570  C  CB  . LYS A 1 73  ? 12.471 28.141 -8.073  1.00 26.89  ? 73   LYS A CB  1 
ATOM   571  C  CG  . LYS A 1 73  ? 11.945 28.776 -9.367  1.00 37.74  ? 73   LYS A CG  1 
ATOM   572  C  CD  . LYS A 1 73  ? 11.258 30.130 -9.157  1.00 50.55  ? 73   LYS A CD  1 
ATOM   573  C  CE  . LYS A 1 73  ? 10.205 30.402 -10.245 1.00 52.00  ? 73   LYS A CE  1 
ATOM   574  N  NZ  . LYS A 1 73  ? 10.695 30.986 -11.538 1.00 58.38  ? 73   LYS A NZ  1 
ATOM   575  N  N   . ASN A 1 74  ? 13.478 26.092 -10.634 1.00 22.28  ? 74   ASN A N   1 
ATOM   576  C  CA  . ASN A 1 74  ? 14.278 26.174 -11.843 1.00 24.24  ? 74   ASN A CA  1 
ATOM   577  C  C   . ASN A 1 74  ? 13.882 27.483 -12.478 1.00 23.27  ? 74   ASN A C   1 
ATOM   578  O  O   . ASN A 1 74  ? 12.736 27.650 -12.868 1.00 26.19  ? 74   ASN A O   1 
ATOM   579  C  CB  . ASN A 1 74  ? 13.992 24.992 -12.784 1.00 24.49  ? 74   ASN A CB  1 
ATOM   580  C  CG  . ASN A 1 74  ? 14.816 25.035 -14.089 1.00 24.71  ? 74   ASN A CG  1 
ATOM   581  O  OD1 . ASN A 1 74  ? 14.986 26.089 -14.740 1.00 26.01  ? 74   ASN A OD1 1 
ATOM   582  N  ND2 . ASN A 1 74  ? 15.277 23.861 -14.510 1.00 26.70  ? 74   ASN A ND2 1 
ATOM   583  N  N   . THR A 1 75  ? 14.783 28.447 -12.536 1.00 25.56  ? 75   THR A N   1 
ATOM   584  C  CA  . THR A 1 75  ? 14.393 29.771 -13.054 1.00 26.74  ? 75   THR A CA  1 
ATOM   585  C  C   . THR A 1 75  ? 14.288 29.798 -14.582 1.00 28.21  ? 75   THR A C   1 
ATOM   586  O  O   . THR A 1 75  ? 13.645 30.655 -15.149 1.00 34.16  ? 75   THR A O   1 
ATOM   587  C  CB  . THR A 1 75  ? 15.305 30.881 -12.539 1.00 31.75  ? 75   THR A CB  1 
ATOM   588  O  OG1 . THR A 1 75  ? 16.663 30.574 -12.853 1.00 37.90  ? 75   THR A OG1 1 
ATOM   589  C  CG2 . THR A 1 75  ? 15.178 30.995 -11.042 1.00 34.35  ? 75   THR A CG2 1 
ATOM   590  N  N   . ASP A 1 76  ? 14.893 28.821 -15.234 1.00 27.78  ? 76   ASP A N   1 
ATOM   591  C  CA  . ASP A 1 76  ? 14.775 28.692 -16.687 1.00 29.52  ? 76   ASP A CA  1 
ATOM   592  C  C   . ASP A 1 76  ? 13.366 28.207 -17.053 1.00 27.97  ? 76   ASP A C   1 
ATOM   593  O  O   . ASP A 1 76  ? 12.727 28.768 -17.953 1.00 28.33  ? 76   ASP A O   1 
ATOM   594  C  CB  . ASP A 1 76  ? 15.775 27.663 -17.248 1.00 30.71  ? 76   ASP A CB  1 
ATOM   595  C  CG  . ASP A 1 76  ? 17.226 27.967 -16.908 1.00 37.23  ? 76   ASP A CG  1 
ATOM   596  O  OD1 . ASP A 1 76  ? 17.622 29.158 -16.893 1.00 37.53  ? 76   ASP A OD1 1 
ATOM   597  O  OD2 . ASP A 1 76  ? 17.978 26.987 -16.716 1.00 37.52  ? 76   ASP A OD2 1 
ATOM   598  N  N   . THR A 1 77  ? 12.920 27.133 -16.414 1.00 24.74  ? 77   THR A N   1 
ATOM   599  C  CA  . THR A 1 77  ? 11.646 26.504 -16.761 1.00 23.73  ? 77   THR A CA  1 
ATOM   600  C  C   . THR A 1 77  ? 10.440 26.972 -15.949 1.00 23.08  ? 77   THR A C   1 
ATOM   601  O  O   . THR A 1 77  ? 9.317  26.793 -16.382 1.00 23.99  ? 77   THR A O   1 
ATOM   602  C  CB  . THR A 1 77  ? 11.708 24.985 -16.566 1.00 22.75  ? 77   THR A CB  1 
ATOM   603  O  OG1 . THR A 1 77  ? 11.863 24.702 -15.169 1.00 21.77  ? 77   THR A OG1 1 
ATOM   604  C  CG2 . THR A 1 77  ? 12.881 24.391 -17.333 1.00 23.76  ? 77   THR A CG2 1 
ATOM   605  N  N   . GLY A 1 78  ? 10.673 27.482 -14.745 1.00 25.58  ? 78   GLY A N   1 
ATOM   606  C  CA  . GLY A 1 78  ? 9.611  27.883 -13.843 1.00 27.51  ? 78   GLY A CA  1 
ATOM   607  C  C   . GLY A 1 78  ? 9.208  26.810 -12.858 1.00 26.30  ? 78   GLY A C   1 
ATOM   608  O  O   . GLY A 1 78  ? 8.420  27.071 -11.939 1.00 25.60  ? 78   GLY A O   1 
ATOM   609  N  N   . ALA A 1 79  ? 9.759  25.603 -13.018 1.00 24.49  ? 79   ALA A N   1 
ATOM   610  C  CA  . ALA A 1 79  ? 9.374  24.498 -12.163 1.00 24.45  ? 79   ALA A CA  1 
ATOM   611  C  C   . ALA A 1 79  ? 9.693  24.799 -10.701 1.00 23.62  ? 79   ALA A C   1 
ATOM   612  O  O   . ALA A 1 79  ? 10.738 25.352 -10.393 1.00 24.67  ? 79   ALA A O   1 
ATOM   613  C  CB  . ALA A 1 79  ? 10.078 23.220 -12.620 1.00 26.84  ? 79   ALA A CB  1 
ATOM   614  N  N   . ILE A 1 80  ? 8.777  24.451 -9.815  1.00 22.21  ? 80   ILE A N   1 
ATOM   615  C  CA  . ILE A 1 80  ? 8.942  24.673 -8.382  1.00 21.98  ? 80   ILE A CA  1 
ATOM   616  C  C   . ILE A 1 80  ? 8.553  23.436 -7.611  1.00 24.12  ? 80   ILE A C   1 
ATOM   617  O  O   . ILE A 1 80  ? 7.528  22.819 -7.887  1.00 23.02  ? 80   ILE A O   1 
ATOM   618  C  CB  . ILE A 1 80  ? 7.964  25.739 -7.862  1.00 28.02  ? 80   ILE A CB  1 
ATOM   619  C  CG1 . ILE A 1 80  ? 8.104  27.051 -8.620  1.00 38.43  ? 80   ILE A CG1 1 
ATOM   620  C  CG2 . ILE A 1 80  ? 8.109  25.904 -6.335  1.00 30.48  ? 80   ILE A CG2 1 
ATOM   621  C  CD1 . ILE A 1 80  ? 7.062  28.094 -8.189  1.00 38.85  ? 80   ILE A CD1 1 
ATOM   622  N  N   . LYS A 1 81  ? 9.366  23.079 -6.625  1.00 22.92  ? 81   LYS A N   1 
ATOM   623  C  CA  . LYS A 1 81  ? 8.970  22.050 -5.673  1.00 26.50  ? 81   LYS A CA  1 
ATOM   624  C  C   . LYS A 1 81  ? 9.423  22.444 -4.305  1.00 23.19  ? 81   LYS A C   1 
ATOM   625  O  O   . LYS A 1 81  ? 10.369 23.216 -4.153  1.00 23.71  ? 81   LYS A O   1 
ATOM   626  C  CB  . LYS A 1 81  ? 9.499  20.663 -6.053  1.00 28.83  ? 81   LYS A CB  1 
ATOM   627  C  CG  . LYS A 1 81  ? 10.992 20.510 -6.144  1.00 32.50  ? 81   LYS A CG  1 
ATOM   628  C  CD  . LYS A 1 81  ? 11.387 19.011 -6.255  1.00 33.15  ? 81   LYS A CD  1 
ATOM   629  C  CE  . LYS A 1 81  ? 10.923 18.398 -7.568  1.00 30.53  ? 81   LYS A CE  1 
ATOM   630  N  NZ  . LYS A 1 81  ? 11.021 16.919 -7.616  1.00 27.61  ? 81   LYS A NZ  1 
ATOM   631  N  N   . ARG A 1 82  ? 8.690  21.950 -3.315  1.00 24.91  ? 82   ARG A N   1 
ATOM   632  C  CA  . ARG A 1 82  ? 8.908  22.308 -1.923  1.00 25.76  ? 82   ARG A CA  1 
ATOM   633  C  C   . ARG A 1 82  ? 8.877  21.077 -1.112  1.00 23.82  ? 82   ARG A C   1 
ATOM   634  O  O   . ARG A 1 82  ? 8.269  20.090 -1.492  1.00 24.17  ? 82   ARG A O   1 
ATOM   635  C  CB  . ARG A 1 82  ? 7.787  23.182 -1.395  1.00 27.90  ? 82   ARG A CB  1 
ATOM   636  C  CG  . ARG A 1 82  ? 7.635  24.472 -2.046  1.00 39.35  ? 82   ARG A CG  1 
ATOM   637  C  CD  . ARG A 1 82  ? 6.345  25.116 -1.591  1.00 42.10  ? 82   ARG A CD  1 
ATOM   638  N  NE  . ARG A 1 82  ? 6.323  26.415 -2.208  1.00 46.39  ? 82   ARG A NE  1 
ATOM   639  C  CZ  . ARG A 1 82  ? 5.630  26.730 -3.290  1.00 33.43  ? 82   ARG A CZ  1 
ATOM   640  N  NH1 . ARG A 1 82  ? 4.806  25.855 -3.856  1.00 35.62  ? 82   ARG A NH1 1 
ATOM   641  N  NH2 . ARG A 1 82  ? 5.741  27.957 -3.760  1.00 42.25  ? 82   ARG A NH2 1 
ATOM   642  N  N   . GLY A 1 83  ? 9.486  21.138 0.059   1.00 22.27  ? 83   GLY A N   1 
ATOM   643  C  CA  . GLY A 1 83  ? 9.426  20.031 0.984   1.00 24.45  ? 83   GLY A CA  1 
ATOM   644  C  C   . GLY A 1 83  ? 10.065 20.443 2.265   1.00 23.98  ? 83   GLY A C   1 
ATOM   645  O  O   . GLY A 1 83  ? 10.338 21.636 2.506   1.00 23.48  ? 83   GLY A O   1 
ATOM   646  N  N   . THR A 1 84  ? 10.316 19.458 3.103   1.00 25.47  ? 84   THR A N   1 
ATOM   647  C  CA  . THR A 1 84  ? 10.984 19.714 4.351   1.00 24.91  ? 84   THR A CA  1 
ATOM   648  C  C   . THR A 1 84  ? 12.189 18.794 4.406   1.00 26.11  ? 84   THR A C   1 
ATOM   649  O  O   . THR A 1 84  ? 12.109 17.622 4.045   1.00 30.26  ? 84   THR A O   1 
ATOM   650  C  CB  . THR A 1 84  ? 10.052 19.451 5.519   1.00 28.92  ? 84   THR A CB  1 
ATOM   651  O  OG1 . THR A 1 84  ? 9.695  18.074 5.519   1.00 42.65  ? 84   THR A OG1 1 
ATOM   652  C  CG2 . THR A 1 84  ? 8.798  20.301 5.421   1.00 30.27  ? 84   THR A CG2 1 
ATOM   653  N  N   . LEU A 1 85  ? 13.309 19.326 4.859   1.00 23.40  ? 85   LEU A N   1 
ATOM   654  C  CA  . LEU A 1 85  ? 14.510 18.529 5.058   1.00 24.56  ? 85   LEU A CA  1 
ATOM   655  C  C   . LEU A 1 85  ? 14.403 17.861 6.427   1.00 26.18  ? 85   LEU A C   1 
ATOM   656  O  O   . LEU A 1 85  ? 14.070 18.518 7.413   1.00 32.82  ? 85   LEU A O   1 
ATOM   657  C  CB  . LEU A 1 85  ? 15.755 19.419 4.931   1.00 23.97  ? 85   LEU A CB  1 
ATOM   658  C  CG  . LEU A 1 85  ? 16.026 20.083 3.574   1.00 27.00  ? 85   LEU A CG  1 
ATOM   659  C  CD1 . LEU A 1 85  ? 17.380 20.805 3.591   1.00 38.20  ? 85   LEU A CD1 1 
ATOM   660  C  CD2 . LEU A 1 85  ? 15.969 19.070 2.457   1.00 24.05  ? 85   LEU A CD2 1 
ATOM   661  N  N   . MET A 1 86  ? 14.748 16.574 6.506   1.00 19.44  ? 86   MET A N   1 
ATOM   662  C  CA  A MET A 1 86  ? 14.545 15.835 7.738   0.40 19.57  ? 86   MET A CA  1 
ATOM   663  C  CA  B MET A 1 86  ? 14.544 15.780 7.708   0.40 21.03  ? 86   MET A CA  1 
ATOM   664  C  CA  C MET A 1 86  ? 14.548 15.769 7.707   0.20 19.65  ? 86   MET A CA  1 
ATOM   665  C  C   . MET A 1 86  ? 15.877 15.593 8.455   1.00 16.42  ? 86   MET A C   1 
ATOM   666  O  O   . MET A 1 86  ? 16.938 15.468 7.806   1.00 18.08  ? 86   MET A O   1 
ATOM   667  C  CB  A MET A 1 86  ? 13.791 14.533 7.456   0.40 20.29  ? 86   MET A CB  1 
ATOM   668  C  CB  B MET A 1 86  ? 13.950 14.427 7.303   0.40 21.99  ? 86   MET A CB  1 
ATOM   669  C  CB  C MET A 1 86  ? 13.985 14.405 7.287   0.20 19.89  ? 86   MET A CB  1 
ATOM   670  C  CG  A MET A 1 86  ? 14.514 13.507 6.643   0.40 15.34  ? 86   MET A CG  1 
ATOM   671  C  CG  B MET A 1 86  ? 12.617 14.532 6.535   0.40 29.39  ? 86   MET A CG  1 
ATOM   672  C  CG  C MET A 1 86  ? 12.705 14.503 6.443   0.20 23.32  ? 86   MET A CG  1 
ATOM   673  S  SD  A MET A 1 86  ? 13.676 11.913 6.772   0.40 20.33  ? 86   MET A SD  1 
ATOM   674  S  SD  B MET A 1 86  ? 11.268 15.346 7.429   0.40 43.64  ? 86   MET A SD  1 
ATOM   675  S  SD  C MET A 1 86  ? 12.348 13.016 5.477   0.20 25.17  ? 86   MET A SD  1 
ATOM   676  C  CE  A MET A 1 86  ? 14.232 11.382 8.400   0.40 17.23  ? 86   MET A CE  1 
ATOM   677  C  CE  B MET A 1 86  ? 9.862  14.967 6.373   0.40 39.98  ? 86   MET A CE  1 
ATOM   678  C  CE  C MET A 1 86  ? 11.125 13.642 4.321   0.20 27.58  ? 86   MET A CE  1 
ATOM   679  N  N   . PRO A 1 87  ? 15.852 15.552 9.795   1.00 17.86  ? 87   PRO A N   1 
ATOM   680  C  CA  . PRO A 1 87  ? 17.112 15.311 10.475  1.00 16.77  ? 87   PRO A CA  1 
ATOM   681  C  C   . PRO A 1 87  ? 17.561 13.849 10.337  1.00 16.53  ? 87   PRO A C   1 
ATOM   682  O  O   . PRO A 1 87  ? 16.719 12.947 10.333  1.00 17.84  ? 87   PRO A O   1 
ATOM   683  C  CB  . PRO A 1 87  ? 16.770 15.613 11.924  1.00 17.67  ? 87   PRO A CB  1 
ATOM   684  C  CG  . PRO A 1 87  ? 15.363 15.376 12.019  1.00 21.15  ? 87   PRO A CG  1 
ATOM   685  C  CD  . PRO A 1 87  ? 14.744 15.684 10.756  1.00 19.73  ? 87   PRO A CD  1 
ATOM   686  N  N   . MET A 1 88  ? 18.858 13.632 10.180  1.00 15.24  ? 88   MET A N   1 
ATOM   687  C  CA  . MET A 1 88  ? 19.388 12.281 10.011  1.00 15.66  ? 88   MET A CA  1 
ATOM   688  C  C   . MET A 1 88  ? 20.915 12.341 10.179  1.00 16.63  ? 88   MET A C   1 
ATOM   689  O  O   . MET A 1 88  ? 21.481 13.411 10.251  1.00 17.18  ? 88   MET A O   1 
ATOM   690  C  CB  . MET A 1 88  ? 19.058 11.749 8.591   1.00 16.87  ? 88   MET A CB  1 
ATOM   691  C  CG  . MET A 1 88  ? 19.842 12.435 7.536   1.00 18.33  ? 88   MET A CG  1 
ATOM   692  S  SD  . MET A 1 88  ? 19.304 11.956 5.910   1.00 21.83  ? 88   MET A SD  1 
ATOM   693  C  CE  . MET A 1 88  ? 17.757 12.887 5.828   1.00 21.63  ? 88   MET A CE  1 
ATOM   694  N  N   . VAL A 1 89  ? 21.546 11.179 10.232  1.00 16.50  ? 89   VAL A N   1 
ATOM   695  C  CA  . VAL A 1 89  ? 22.977 11.056 10.448  1.00 18.75  ? 89   VAL A CA  1 
ATOM   696  C  C   . VAL A 1 89  ? 23.619 10.210 9.347   1.00 19.57  ? 89   VAL A C   1 
ATOM   697  O  O   . VAL A 1 89  ? 23.037 9.210  8.823   1.00 19.49  ? 89   VAL A O   1 
ATOM   698  C  CB  . VAL A 1 89  ? 23.324 10.518 11.862  1.00 17.32  ? 89   VAL A CB  1 
ATOM   699  C  CG1 . VAL A 1 89  ? 22.929 8.999  12.030  1.00 16.00  ? 89   VAL A CG1 1 
ATOM   700  C  CG2 . VAL A 1 89  ? 24.822 10.741 12.194  1.00 18.98  ? 89   VAL A CG2 1 
ATOM   701  N  N   . ALA A 1 90  ? 24.768 10.699 8.877   1.00 18.07  ? 90   ALA A N   1 
ATOM   702  C  CA  . ALA A 1 90  ? 25.612 9.966  7.970   1.00 18.66  ? 90   ALA A CA  1 
ATOM   703  C  C   . ALA A 1 90  ? 26.968 9.733  8.630   1.00 18.52  ? 90   ALA A C   1 
ATOM   704  O  O   . ALA A 1 90  ? 27.163 10.054 9.817   1.00 19.44  ? 90   ALA A O   1 
ATOM   705  C  CB  . ALA A 1 90  ? 25.732 10.706 6.581   1.00 19.82  ? 90   ALA A CB  1 
ATOM   706  N  N   . ASP A 1 91  ? 27.888 9.096  7.911   1.00 17.90  ? 91   ASP A N   1 
ATOM   707  C  CA  . ASP A 1 91  ? 29.142 8.709  8.529   1.00 19.78  ? 91   ASP A CA  1 
ATOM   708  C  C   . ASP A 1 91  ? 30.028 9.872  9.035   1.00 22.99  ? 91   ASP A C   1 
ATOM   709  O  O   . ASP A 1 91  ? 30.837 9.692  9.964   1.00 20.82  ? 91   ASP A O   1 
ATOM   710  C  CB  . ASP A 1 91  ? 29.925 7.727  7.644   1.00 23.42  ? 91   ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 91  ? 30.449 8.330  6.361   1.00 29.54  ? 91   ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 91  ? 30.009 9.419  5.923   1.00 27.86  ? 91   ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 91  ? 31.306 7.655  5.772   1.00 33.19  ? 91   ASP A OD2 1 
ATOM   714  N  N   . ASP A 1 92  ? 29.790 11.045 8.468   1.00 22.86  ? 92   ASP A N   1 
ATOM   715  C  CA  . ASP A 1 92  ? 30.429 12.301 8.861   1.00 25.29  ? 92   ASP A CA  1 
ATOM   716  C  C   . ASP A 1 92  ? 29.567 13.233 9.734   1.00 23.64  ? 92   ASP A C   1 
ATOM   717  O  O   . ASP A 1 92  ? 29.922 14.423 9.925   1.00 24.81  ? 92   ASP A O   1 
ATOM   718  C  CB  . ASP A 1 92  ? 30.936 13.026 7.601   1.00 25.43  ? 92   ASP A CB  1 
ATOM   719  C  CG  . ASP A 1 92  ? 29.803 13.557 6.695   1.00 36.09  ? 92   ASP A CG  1 
ATOM   720  O  OD1 . ASP A 1 92  ? 28.696 12.971 6.628   1.00 25.27  ? 92   ASP A OD1 1 
ATOM   721  O  OD2 . ASP A 1 92  ? 30.031 14.586 6.021   1.00 42.72  ? 92   ASP A OD2 1 
ATOM   722  N  N   . GLY A 1 93  ? 28.451 12.722 10.256  1.00 21.24  ? 93   GLY A N   1 
ATOM   723  C  CA  . GLY A 1 93  ? 27.675 13.428 11.265  1.00 20.16  ? 93   GLY A CA  1 
ATOM   724  C  C   . GLY A 1 93  ? 26.248 13.784 10.859  1.00 19.93  ? 93   GLY A C   1 
ATOM   725  O  O   . GLY A 1 93  ? 25.810 13.497 9.748   1.00 19.24  ? 93   GLY A O   1 
ATOM   726  N  N   . PRO A 1 94  ? 25.518 14.413 11.783  1.00 18.27  ? 94   PRO A N   1 
ATOM   727  C  CA  . PRO A 1 94  ? 24.110 14.748 11.530  1.00 18.73  ? 94   PRO A CA  1 
ATOM   728  C  C   . PRO A 1 94  ? 23.952 15.905 10.555  1.00 19.33  ? 94   PRO A C   1 
ATOM   729  O  O   . PRO A 1 94  ? 24.825 16.757 10.453  1.00 18.60  ? 94   PRO A O   1 
ATOM   730  C  CB  . PRO A 1 94  ? 23.577 15.161 12.898  1.00 18.35  ? 94   PRO A CB  1 
ATOM   731  C  CG  . PRO A 1 94  ? 24.863 15.609 13.676  1.00 18.95  ? 94   PRO A CG  1 
ATOM   732  C  CD  . PRO A 1 94  ? 25.957 14.751 13.155  1.00 17.51  ? 94   PRO A CD  1 
ATOM   733  N  N   . HIS A 1 95  ? 22.846 15.899 9.817   1.00 19.77  ? 95   HIS A N   1 
ATOM   734  C  CA  . HIS A 1 95  ? 22.492 16.982 8.917   1.00 18.30  ? 95   HIS A CA  1 
ATOM   735  C  C   . HIS A 1 95  ? 20.985 16.949 8.693   1.00 18.74  ? 95   HIS A C   1 
ATOM   736  O  O   . HIS A 1 95  ? 20.264 16.133 9.295   1.00 20.58  ? 95   HIS A O   1 
ATOM   737  C  CB  . HIS A 1 95  ? 23.268 16.885 7.601   1.00 19.02  ? 95   HIS A CB  1 
ATOM   738  C  CG  . HIS A 1 95  ? 22.963 15.645 6.813   1.00 20.39  ? 95   HIS A CG  1 
ATOM   739  N  ND1 . HIS A 1 95  ? 23.825 14.568 6.792   1.00 25.94  ? 95   HIS A ND1 1 
ATOM   740  C  CD2 . HIS A 1 95  ? 21.886 15.281 6.082   1.00 19.53  ? 95   HIS A CD2 1 
ATOM   741  C  CE1 . HIS A 1 95  ? 23.298 13.593 6.072   1.00 23.14  ? 95   HIS A CE1 1 
ATOM   742  N  NE2 . HIS A 1 95  ? 22.128 14.000 5.609   1.00 21.26  ? 95   HIS A NE2 1 
ATOM   743  N  N   . TYR A 1 96  ? 20.481 17.895 7.903   1.00 18.82  ? 96   TYR A N   1 
ATOM   744  C  CA  . TYR A 1 96  ? 19.101 17.896 7.512   1.00 17.42  ? 96   TYR A CA  1 
ATOM   745  C  C   . TYR A 1 96  ? 19.112 17.624 5.997   1.00 17.21  ? 96   TYR A C   1 
ATOM   746  O  O   . TYR A 1 96  ? 19.914 18.203 5.262   1.00 20.20  ? 96   TYR A O   1 
ATOM   747  C  CB  . TYR A 1 96  ? 18.403 19.249 7.781   1.00 20.84  ? 96   TYR A CB  1 
ATOM   748  C  CG  . TYR A 1 96  ? 18.291 19.622 9.235   1.00 18.15  ? 96   TYR A CG  1 
ATOM   749  C  CD1 . TYR A 1 96  ? 17.224 19.181 10.013  1.00 21.38  ? 96   TYR A CD1 1 
ATOM   750  C  CD2 . TYR A 1 96  ? 19.291 20.400 9.861   1.00 16.00  ? 96   TYR A CD2 1 
ATOM   751  C  CE1 . TYR A 1 96  ? 17.161 19.515 11.360  1.00 18.90  ? 96   TYR A CE1 1 
ATOM   752  C  CE2 . TYR A 1 96  ? 19.209 20.768 11.194  1.00 16.99  ? 96   TYR A CE2 1 
ATOM   753  C  CZ  . TYR A 1 96  ? 18.178 20.307 11.945  1.00 16.28  ? 96   TYR A CZ  1 
ATOM   754  O  OH  . TYR A 1 96  ? 18.082 20.619 13.290  1.00 18.08  ? 96   TYR A OH  1 
ATOM   755  N  N   . GLY A 1 97  ? 18.283 16.679 5.548   1.00 18.50  ? 97   GLY A N   1 
ATOM   756  C  CA  . GLY A 1 97  ? 18.386 16.229 4.138   1.00 15.53  ? 97   GLY A CA  1 
ATOM   757  C  C   . GLY A 1 97  ? 17.106 15.673 3.563   1.00 16.76  ? 97   GLY A C   1 
ATOM   758  O  O   . GLY A 1 97  ? 16.152 15.396 4.293   1.00 20.60  ? 97   GLY A O   1 
ATOM   759  N  N   . ALA A 1 98  ? 17.125 15.522 2.250   1.00 19.72  ? 98   ALA A N   1 
ATOM   760  C  CA  . ALA A 1 98  ? 16.044 14.901 1.497   1.00 19.11  ? 98   ALA A CA  1 
ATOM   761  C  C   . ALA A 1 98  ? 16.561 14.417 0.134   1.00 20.12  ? 98   ALA A C   1 
ATOM   762  O  O   . ALA A 1 98  ? 17.314 15.121 -0.526  1.00 21.61  ? 98   ALA A O   1 
ATOM   763  C  CB  . ALA A 1 98  ? 14.896 15.904 1.289   1.00 18.54  ? 98   ALA A CB  1 
ATOM   764  N  N   . ASN A 1 99  ? 16.136 13.224 -0.275  1.00 19.09  ? 99   ASN A N   1 
ATOM   765  C  CA  . ASN A 1 99  ? 16.303 12.794 -1.652  1.00 22.90  ? 99   ASN A CA  1 
ATOM   766  C  C   . ASN A 1 99  ? 15.309 13.532 -2.541  1.00 23.40  ? 99   ASN A C   1 
ATOM   767  O  O   . ASN A 1 99  ? 14.107 13.683 -2.194  1.00 26.48  ? 99   ASN A O   1 
ATOM   768  C  CB  . ASN A 1 99  ? 16.056 11.281 -1.742  1.00 23.55  ? 99   ASN A CB  1 
ATOM   769  C  CG  . ASN A 1 99  ? 17.296 10.450 -1.472  1.00 24.27  ? 99   ASN A CG  1 
ATOM   770  O  OD1 . ASN A 1 99  ? 18.407 10.961 -1.352  1.00 23.40  ? 99   ASN A OD1 1 
ATOM   771  N  ND2 . ASN A 1 99  ? 17.108 9.133  -1.420  1.00 25.02  ? 99   ASN A ND2 1 
ATOM   772  N  N   . ILE A 1 100 ? 15.769 13.960 -3.706  1.00 22.82  ? 100  ILE A N   1 
ATOM   773  C  CA  . ILE A 1 100 ? 14.953 14.764 -4.597  1.00 18.30  ? 100  ILE A CA  1 
ATOM   774  C  C   . ILE A 1 100 ? 15.106 14.273 -6.023  1.00 21.51  ? 100  ILE A C   1 
ATOM   775  O  O   . ILE A 1 100 ? 16.220 14.053 -6.479  1.00 22.33  ? 100  ILE A O   1 
ATOM   776  C  CB  . ILE A 1 100 ? 15.340 16.262 -4.492  1.00 20.27  ? 100  ILE A CB  1 
ATOM   777  C  CG1 . ILE A 1 100 ? 15.100 16.803 -3.054  1.00 20.83  ? 100  ILE A CG1 1 
ATOM   778  C  CG2 . ILE A 1 100 ? 14.523 17.118 -5.494  1.00 23.85  ? 100  ILE A CG2 1 
ATOM   779  C  CD1 . ILE A 1 100 ? 15.472 18.227 -2.878  1.00 24.71  ? 100  ILE A CD1 1 
ATOM   780  N  N   . ALA A 1 101 ? 13.976 14.070 -6.700  1.00 22.00  ? 101  ALA A N   1 
ATOM   781  C  CA  . ALA A 1 101 ? 13.964 13.712 -8.090  1.00 24.18  ? 101  ALA A CA  1 
ATOM   782  C  C   . ALA A 1 101 ? 14.131 14.983 -8.883  1.00 24.27  ? 101  ALA A C   1 
ATOM   783  O  O   . ALA A 1 101 ? 13.447 15.967 -8.622  1.00 23.91  ? 101  ALA A O   1 
ATOM   784  C  CB  . ALA A 1 101 ? 12.650 13.024 -8.452  1.00 27.84  ? 101  ALA A CB  1 
ATOM   785  N  N   . MET A 1 102 ? 15.009 14.947 -9.889  1.00 24.51  ? 102  MET A N   1 
ATOM   786  C  CA  . MET A 1 102 ? 15.307 16.106 -10.691 1.00 26.94  ? 102  MET A CA  1 
ATOM   787  C  C   . MET A 1 102 ? 14.963 15.668 -12.104 1.00 26.10  ? 102  MET A C   1 
ATOM   788  O  O   . MET A 1 102 ? 13.805 15.782 -12.505 1.00 27.40  ? 102  MET A O   1 
ATOM   789  C  CB  . MET A 1 102 ? 16.760 16.539 -10.506 1.00 28.29  ? 102  MET A CB  1 
ATOM   790  C  CG  . MET A 1 102 ? 17.085 17.003 -9.080  1.00 25.47  ? 102  MET A CG  1 
ATOM   791  S  SD  . MET A 1 102 ? 16.287 18.538 -8.595  1.00 26.90  ? 102  MET A SD  1 
ATOM   792  C  CE  . MET A 1 102 ? 17.311 19.709 -9.506  1.00 26.62  ? 102  MET A CE  1 
ATOM   793  N  N   . GLU A 1 103 ? 15.925 15.099 -12.826 1.00 27.41  ? 103  GLU A N   1 
ATOM   794  C  CA  . GLU A 1 103 ? 15.670 14.544 -14.166 1.00 29.86  ? 103  GLU A CA  1 
ATOM   795  C  C   . GLU A 1 103 ? 14.564 13.488 -14.134 1.00 28.45  ? 103  GLU A C   1 
ATOM   796  O  O   . GLU A 1 103 ? 13.759 13.376 -15.113 1.00 34.25  ? 103  GLU A O   1 
ATOM   797  C  CB  . GLU A 1 103 ? 16.949 13.942 -14.737 1.00 33.83  ? 103  GLU A CB  1 
ATOM   798  C  CG  . GLU A 1 103 ? 18.064 14.954 -15.001 1.00 41.95  ? 103  GLU A CG  1 
ATOM   799  C  CD  . GLU A 1 103 ? 19.120 14.993 -13.910 1.00 42.41  ? 103  GLU A CD  1 
ATOM   800  O  OE1 . GLU A 1 103 ? 18.764 15.025 -12.701 1.00 32.78  ? 103  GLU A OE1 1 
ATOM   801  O  OE2 . GLU A 1 103 ? 20.318 15.022 -14.271 1.00 49.48  ? 103  GLU A OE2 1 
ATOM   802  N  N   . LYS A 1 104 ? 14.475 12.766 -13.015 1.00 34.80  ? 104  LYS A N   1 
ATOM   803  C  CA  . LYS A 1 104 ? 13.474 11.712 -12.853 1.00 37.61  ? 104  LYS A CA  1 
ATOM   804  C  C   . LYS A 1 104 ? 12.071 12.209 -12.559 1.00 39.30  ? 104  LYS A C   1 
ATOM   805  O  O   . LYS A 1 104 ? 11.119 11.445 -12.715 1.00 41.54  ? 104  LYS A O   1 
ATOM   806  C  CB  . LYS A 1 104 ? 13.876 10.715 -11.779 1.00 37.08  ? 104  LYS A CB  1 
ATOM   807  C  CG  . LYS A 1 104 ? 15.058 9.835  -12.151 1.00 37.09  ? 104  LYS A CG  1 
ATOM   808  C  CD  . LYS A 1 104 ? 15.455 8.944  -10.973 1.00 41.89  ? 104  LYS A CD  1 
ATOM   809  C  CE  . LYS A 1 104 ? 16.605 8.035  -11.318 1.00 45.48  ? 104  LYS A CE  1 
ATOM   810  N  NZ  . LYS A 1 104 ? 17.947 8.674  -11.171 1.00 49.60  ? 104  LYS A NZ  1 
ATOM   811  N  N   . ASP A 1 105 ? 11.932 13.470 -12.147 1.00 36.45  ? 105  ASP A N   1 
ATOM   812  C  CA  . ASP A 1 105 ? 10.595 14.040 -11.967 1.00 38.17  ? 105  ASP A CA  1 
ATOM   813  C  C   . ASP A 1 105 ? 9.905  14.272 -13.307 1.00 39.18  ? 105  ASP A C   1 
ATOM   814  O  O   . ASP A 1 105 ? 10.344 15.103 -14.093 1.00 40.35  ? 105  ASP A O   1 
ATOM   815  C  CB  . ASP A 1 105 ? 10.687 15.352 -11.198 1.00 36.45  ? 105  ASP A CB  1 
ATOM   816  C  CG  . ASP A 1 105 ? 9.370  15.769 -10.625 1.00 42.44  ? 105  ASP A CG  1 
ATOM   817  O  OD1 . ASP A 1 105 ? 8.344  15.594 -11.310 1.00 42.13  ? 105  ASP A OD1 1 
ATOM   818  O  OD2 . ASP A 1 105 ? 9.367  16.273 -9.494  1.00 38.36  ? 105  ASP A OD2 1 
ATOM   819  N  N   . LYS A 1 106 ? 8.815  13.561 -13.587 1.00 42.33  ? 106  LYS A N   1 
ATOM   820  C  CA  . LYS A 1 106 ? 8.089  13.837 -14.820 1.00 42.56  ? 106  LYS A CA  1 
ATOM   821  C  C   . LYS A 1 106 ? 6.948  14.847 -14.651 1.00 40.78  ? 106  LYS A C   1 
ATOM   822  O  O   . LYS A 1 106 ? 6.269  15.190 -15.638 1.00 42.86  ? 106  LYS A O   1 
ATOM   823  C  CB  . LYS A 1 106 ? 7.602  12.544 -15.493 1.00 48.77  ? 106  LYS A CB  1 
ATOM   824  C  CG  . LYS A 1 106 ? 8.719  11.727 -16.156 1.00 52.34  ? 106  LYS A CG  1 
ATOM   825  C  CD  . LYS A 1 106 ? 9.364  12.440 -17.352 1.00 56.61  ? 106  LYS A CD  1 
ATOM   826  C  CE  . LYS A 1 106 ? 10.771 11.897 -17.623 1.00 57.45  ? 106  LYS A CE  1 
ATOM   827  N  NZ  . LYS A 1 106 ? 11.730 12.096 -16.502 1.00 62.11  ? 106  LYS A NZ  1 
ATOM   828  N  N   . LYS A 1 107 ? 6.751  15.375 -13.448 1.00 38.04  ? 107  LYS A N   1 
ATOM   829  C  CA  . LYS A 1 107 ? 5.645  16.361 -13.237 1.00 38.77  ? 107  LYS A CA  1 
ATOM   830  C  C   . LYS A 1 107 ? 6.133  17.816 -13.338 1.00 41.32  ? 107  LYS A C   1 
ATOM   831  O  O   . LYS A 1 107 ? 5.345  18.744 -13.136 1.00 44.84  ? 107  LYS A O   1 
ATOM   832  C  CB  . LYS A 1 107 ? 4.915  16.154 -11.906 1.00 41.60  ? 107  LYS A CB  1 
ATOM   833  C  CG  . LYS A 1 107 ? 4.721  14.667 -11.498 1.00 49.04  ? 107  LYS A CG  1 
ATOM   834  C  CD  . LYS A 1 107 ? 4.000  14.499 -10.181 1.00 45.87  ? 107  LYS A CD  1 
ATOM   835  C  CE  . LYS A 1 107 ? 4.940  14.644 -8.992  1.00 54.63  ? 107  LYS A CE  1 
ATOM   836  N  NZ  . LYS A 1 107 ? 5.982  13.575 -8.938  1.00 50.65  ? 107  LYS A NZ  1 
ATOM   837  N  N   . GLY A 1 108 ? 7.420  18.013 -13.652 1.00 43.84  ? 108  GLY A N   1 
ATOM   838  C  CA  . GLY A 1 108 ? 7.974  19.363 -13.956 1.00 45.32  ? 108  GLY A CA  1 
ATOM   839  C  C   . GLY A 1 108 ? 9.350  19.360 -14.650 1.00 40.16  ? 108  GLY A C   1 
ATOM   840  O  O   . GLY A 1 108 ? 9.900  18.325 -14.948 1.00 39.77  ? 108  GLY A O   1 
ATOM   841  N  N   . GLY A 1 109 ? 9.887  20.532 -14.962 1.00 43.28  ? 109  GLY A N   1 
ATOM   842  C  CA  . GLY A 1 109 ? 11.177 20.638 -15.679 1.00 36.77  ? 109  GLY A CA  1 
ATOM   843  C  C   . GLY A 1 109 ? 12.233 20.890 -14.632 1.00 33.84  ? 109  GLY A C   1 
ATOM   844  O  O   . GLY A 1 109 ? 12.581 22.023 -14.323 1.00 31.48  ? 109  GLY A O   1 
ATOM   845  N  N   . PHE A 1 110 ? 12.720 19.787 -14.081 1.00 22.24  ? 110  PHE A N   1 
ATOM   846  C  CA  . PHE A 1 110 ? 13.729 19.800 -13.049 1.00 23.95  ? 110  PHE A CA  1 
ATOM   847  C  C   . PHE A 1 110 ? 14.999 19.200 -13.594 1.00 26.82  ? 110  PHE A C   1 
ATOM   848  O  O   . PHE A 1 110 ? 15.679 18.458 -12.890 1.00 29.61  ? 110  PHE A O   1 
ATOM   849  C  CB  . PHE A 1 110 ? 13.220 19.009 -11.880 1.00 25.06  ? 110  PHE A CB  1 
ATOM   850  C  CG  . PHE A 1 110 ? 12.086 19.678 -11.158 1.00 28.47  ? 110  PHE A CG  1 
ATOM   851  C  CD1 . PHE A 1 110 ? 12.325 20.766 -10.336 1.00 30.70  ? 110  PHE A CD1 1 
ATOM   852  C  CD2 . PHE A 1 110 ? 10.779 19.210 -11.296 1.00 29.89  ? 110  PHE A CD2 1 
ATOM   853  C  CE1 . PHE A 1 110 ? 11.262 21.396 -9.666  1.00 27.22  ? 110  PHE A CE1 1 
ATOM   854  C  CE2 . PHE A 1 110 ? 9.727  19.834 -10.632 1.00 33.06  ? 110  PHE A CE2 1 
ATOM   855  C  CZ  . PHE A 1 110 ? 9.997  20.935 -9.801  1.00 24.80  ? 110  PHE A CZ  1 
ATOM   856  N  N   . GLY A 1 111 ? 15.322 19.541 -14.840 1.00 30.07  ? 111  GLY A N   1 
ATOM   857  C  CA  . GLY A 1 111 ? 16.524 19.046 -15.487 1.00 33.37  ? 111  GLY A CA  1 
ATOM   858  C  C   . GLY A 1 111 ? 17.707 19.965 -15.213 1.00 34.51  ? 111  GLY A C   1 
ATOM   859  O  O   . GLY A 1 111 ? 17.616 20.899 -14.407 1.00 31.84  ? 111  GLY A O   1 
ATOM   860  N  N   . VAL A 1 112 ? 18.811 19.709 -15.909 1.00 35.29  ? 112  VAL A N   1 
ATOM   861  C  CA  . VAL A 1 112 ? 19.989 20.547 -15.810 1.00 34.62  ? 112  VAL A CA  1 
ATOM   862  C  C   . VAL A 1 112 ? 19.604 22.003 -16.065 1.00 32.58  ? 112  VAL A C   1 
ATOM   863  O  O   . VAL A 1 112 ? 18.814 22.283 -16.966 1.00 30.65  ? 112  VAL A O   1 
ATOM   864  C  CB  . VAL A 1 112 ? 21.120 20.065 -16.791 1.00 37.99  ? 112  VAL A CB  1 
ATOM   865  C  CG1 . VAL A 1 112 ? 21.986 21.237 -17.261 1.00 42.05  ? 112  VAL A CG1 1 
ATOM   866  C  CG2 . VAL A 1 112 ? 21.983 18.969 -16.113 1.00 38.80  ? 112  VAL A CG2 1 
ATOM   867  N  N   . GLY A 1 113 ? 20.124 22.921 -15.247 1.00 29.99  ? 113  GLY A N   1 
ATOM   868  C  CA  . GLY A 1 113 ? 19.858 24.335 -15.453 1.00 30.60  ? 113  GLY A CA  1 
ATOM   869  C  C   . GLY A 1 113 ? 20.124 25.232 -14.272 1.00 30.24  ? 113  GLY A C   1 
ATOM   870  O  O   . GLY A 1 113 ? 20.772 24.836 -13.329 1.00 30.49  ? 113  GLY A O   1 
ATOM   871  N  N   . ASN A 1 114 ? 19.612 26.454 -14.335 1.00 30.27  ? 114  ASN A N   1 
ATOM   872  C  CA  . ASN A 1 114 ? 19.762 27.423 -13.235 1.00 29.40  ? 114  ASN A CA  1 
ATOM   873  C  C   . ASN A 1 114 ? 18.652 27.354 -12.187 1.00 28.17  ? 114  ASN A C   1 
ATOM   874  O  O   . ASN A 1 114 ? 17.450 27.349 -12.554 1.00 28.19  ? 114  ASN A O   1 
ATOM   875  C  CB  . ASN A 1 114 ? 19.766 28.825 -13.836 1.00 35.56  ? 114  ASN A CB  1 
ATOM   876  C  CG  . ASN A 1 114 ? 20.912 29.047 -14.800 1.00 36.78  ? 114  ASN A CG  1 
ATOM   877  O  OD1 . ASN A 1 114 ? 22.068 29.002 -14.398 1.00 34.42  ? 114  ASN A OD1 1 
ATOM   878  N  ND2 . ASN A 1 114 ? 20.594 29.309 -16.076 1.00 37.93  ? 114  ASN A ND2 1 
ATOM   879  N  N   . TYR A 1 115 ? 19.046 27.323 -10.905 1.00 26.62  ? 115  TYR A N   1 
ATOM   880  C  CA  . TYR A 1 115 ? 18.152 27.136 -9.777  1.00 27.63  ? 115  TYR A CA  1 
ATOM   881  C  C   . TYR A 1 115 ? 18.294 28.193 -8.711  1.00 26.34  ? 115  TYR A C   1 
ATOM   882  O  O   . TYR A 1 115 ? 19.371 28.713 -8.455  1.00 27.70  ? 115  TYR A O   1 
ATOM   883  C  CB  . TYR A 1 115 ? 18.364 25.755 -9.105  1.00 24.13  ? 115  TYR A CB  1 
ATOM   884  C  CG  . TYR A 1 115 ? 17.773 24.660 -9.946  1.00 25.89  ? 115  TYR A CG  1 
ATOM   885  C  CD1 . TYR A 1 115 ? 18.434 24.198 -11.061 1.00 23.75  ? 115  TYR A CD1 1 
ATOM   886  C  CD2 . TYR A 1 115 ? 16.525 24.119 -9.640  1.00 26.35  ? 115  TYR A CD2 1 
ATOM   887  C  CE1 . TYR A 1 115 ? 17.872 23.225 -11.893 1.00 30.43  ? 115  TYR A CE1 1 
ATOM   888  C  CE2 . TYR A 1 115 ? 15.954 23.148 -10.451 1.00 22.71  ? 115  TYR A CE2 1 
ATOM   889  C  CZ  . TYR A 1 115 ? 16.627 22.700 -11.556 1.00 21.02  ? 115  TYR A CZ  1 
ATOM   890  O  OH  . TYR A 1 115 ? 16.053 21.760 -12.339 1.00 23.81  ? 115  TYR A OH  1 
ATOM   891  N  N   . GLU A 1 116 ? 17.171 28.496 -8.101  1.00 24.32  ? 116  GLU A N   1 
ATOM   892  C  CA  . GLU A 1 116 ? 17.123 29.249 -6.869  1.00 28.21  ? 116  GLU A CA  1 
ATOM   893  C  C   . GLU A 1 116 ? 16.658 28.282 -5.781  1.00 25.43  ? 116  GLU A C   1 
ATOM   894  O  O   . GLU A 1 116 ? 15.674 27.581 -5.933  1.00 23.50  ? 116  GLU A O   1 
ATOM   895  C  CB  . GLU A 1 116 ? 16.160 30.441 -7.012  1.00 30.27  ? 116  GLU A CB  1 
ATOM   896  C  CG  . GLU A 1 116 ? 16.659 31.529 -7.947  1.00 40.03  ? 116  GLU A CG  1 
ATOM   897  C  CD  . GLU A 1 116 ? 15.705 32.734 -8.073  1.00 46.33  ? 116  GLU A CD  1 
ATOM   898  O  OE1 . GLU A 1 116 ? 14.563 32.683 -7.565  1.00 50.86  ? 116  GLU A OE1 1 
ATOM   899  O  OE2 . GLU A 1 116 ? 16.108 33.742 -8.693  1.00 54.33  ? 116  GLU A OE2 1 
ATOM   900  N  N   . LEU A 1 117 ? 17.397 28.212 -4.691  1.00 24.30  ? 117  LEU A N   1 
ATOM   901  C  CA  . LEU A 1 117 ? 17.024 27.425 -3.518  1.00 24.80  ? 117  LEU A CA  1 
ATOM   902  C  C   . LEU A 1 117 ? 16.833 28.348 -2.319  1.00 25.92  ? 117  LEU A C   1 
ATOM   903  O  O   . LEU A 1 117 ? 17.665 29.231 -2.076  1.00 27.23  ? 117  LEU A O   1 
ATOM   904  C  CB  . LEU A 1 117 ? 18.111 26.379 -3.201  1.00 22.13  ? 117  LEU A CB  1 
ATOM   905  C  CG  . LEU A 1 117 ? 18.061 25.591 -1.879  1.00 25.02  ? 117  LEU A CG  1 
ATOM   906  C  CD1 . LEU A 1 117 ? 16.865 24.650 -1.820  1.00 22.95  ? 117  LEU A CD1 1 
ATOM   907  C  CD2 . LEU A 1 117 ? 19.360 24.810 -1.701  1.00 26.61  ? 117  LEU A CD2 1 
ATOM   908  N  N   . THR A 1 118 ? 15.718 28.162 -1.605  1.00 22.62  ? 118  THR A N   1 
ATOM   909  C  CA  . THR A 1 118 ? 15.428 28.904 -0.394  1.00 23.42  ? 118  THR A CA  1 
ATOM   910  C  C   . THR A 1 118 ? 15.191 27.942 0.758   1.00 22.27  ? 118  THR A C   1 
ATOM   911  O  O   . THR A 1 118 ? 14.523 26.931 0.602   1.00 22.54  ? 118  THR A O   1 
ATOM   912  C  CB  . THR A 1 118 ? 14.162 29.805 -0.591  1.00 27.47  ? 118  THR A CB  1 
ATOM   913  O  OG1 . THR A 1 118 ? 14.276 30.575 -1.809  1.00 27.17  ? 118  THR A OG1 1 
ATOM   914  C  CG2 . THR A 1 118 ? 13.955 30.726 0.600   1.00 32.37  ? 118  THR A CG2 1 
ATOM   915  N  N   . PHE A 1 119 ? 15.785 28.229 1.911   1.00 20.68  ? 119  PHE A N   1 
ATOM   916  C  CA  . PHE A 1 119 ? 15.471 27.514 3.113   1.00 21.92  ? 119  PHE A CA  1 
ATOM   917  C  C   . PHE A 1 119 ? 14.678 28.478 3.971   1.00 22.99  ? 119  PHE A C   1 
ATOM   918  O  O   . PHE A 1 119 ? 15.014 29.670 4.055   1.00 24.62  ? 119  PHE A O   1 
ATOM   919  C  CB  . PHE A 1 119 ? 16.745 27.157 3.882   1.00 20.94  ? 119  PHE A CB  1 
ATOM   920  C  CG  . PHE A 1 119 ? 17.609 26.068 3.248   1.00 21.44  ? 119  PHE A CG  1 
ATOM   921  C  CD1 . PHE A 1 119 ? 17.078 25.056 2.455   1.00 24.32  ? 119  PHE A CD1 1 
ATOM   922  C  CD2 . PHE A 1 119 ? 18.960 26.050 3.491   1.00 23.82  ? 119  PHE A CD2 1 
ATOM   923  C  CE1 . PHE A 1 119 ? 17.918 24.059 1.913   1.00 26.67  ? 119  PHE A CE1 1 
ATOM   924  C  CE2 . PHE A 1 119 ? 19.786 25.063 2.964   1.00 21.69  ? 119  PHE A CE2 1 
ATOM   925  C  CZ  . PHE A 1 119 ? 19.266 24.077 2.184   1.00 25.25  ? 119  PHE A CZ  1 
ATOM   926  N  N   . TYR A 1 120 ? 13.620 27.962 4.583   1.00 22.33  ? 120  TYR A N   1 
ATOM   927  C  CA  A TYR A 1 120 ? 12.828 28.672 5.567   0.50 23.81  ? 120  TYR A CA  1 
ATOM   928  C  CA  B TYR A 1 120 ? 12.870 28.698 5.584   0.50 23.52  ? 120  TYR A CA  1 
ATOM   929  C  C   . TYR A 1 120 ? 13.082 27.970 6.892   1.00 24.83  ? 120  TYR A C   1 
ATOM   930  O  O   . TYR A 1 120 ? 12.698 26.809 7.049   1.00 25.48  ? 120  TYR A O   1 
ATOM   931  C  CB  A TYR A 1 120 ? 11.346 28.569 5.200   0.50 25.27  ? 120  TYR A CB  1 
ATOM   932  C  CB  B TYR A 1 120 ? 11.398 28.751 5.208   0.50 24.76  ? 120  TYR A CB  1 
ATOM   933  C  CG  A TYR A 1 120 ? 11.000 29.083 3.826   0.50 26.71  ? 120  TYR A CG  1 
ATOM   934  C  CG  B TYR A 1 120 ? 10.486 29.444 6.216   0.50 26.57  ? 120  TYR A CG  1 
ATOM   935  C  CD1 A TYR A 1 120 ? 10.437 30.331 3.660   0.50 32.96  ? 120  TYR A CD1 1 
ATOM   936  C  CD1 B TYR A 1 120 ? 10.764 30.722 6.688   0.50 27.34  ? 120  TYR A CD1 1 
ATOM   937  C  CD2 A TYR A 1 120 ? 11.211 28.309 2.693   0.50 31.51  ? 120  TYR A CD2 1 
ATOM   938  C  CD2 B TYR A 1 120 ? 9.315  28.838 6.629   0.50 35.83  ? 120  TYR A CD2 1 
ATOM   939  C  CE1 A TYR A 1 120 ? 10.110 30.798 2.409   0.50 31.25  ? 120  TYR A CE1 1 
ATOM   940  C  CE1 B TYR A 1 120 ? 9.909  31.355 7.565   0.50 30.50  ? 120  TYR A CE1 1 
ATOM   941  C  CE2 A TYR A 1 120 ? 10.882 28.783 1.450   0.50 18.68  ? 120  TYR A CE2 1 
ATOM   942  C  CE2 B TYR A 1 120 ? 8.459  29.459 7.508   0.50 38.43  ? 120  TYR A CE2 1 
ATOM   943  C  CZ  A TYR A 1 120 ? 10.351 30.030 1.315   0.50 21.83  ? 120  TYR A CZ  1 
ATOM   944  C  CZ  B TYR A 1 120 ? 8.759  30.710 7.976   0.50 37.38  ? 120  TYR A CZ  1 
ATOM   945  O  OH  A TYR A 1 120 ? 10.014 30.551 0.076   0.50 32.85  ? 120  TYR A OH  1 
ATOM   946  O  OH  B TYR A 1 120 ? 7.884  31.309 8.853   0.50 42.67  ? 120  TYR A OH  1 
ATOM   947  N  N   . ILE A 1 121 ? 13.744 28.647 7.822   1.00 22.24  ? 121  ILE A N   1 
ATOM   948  C  CA  . ILE A 1 121 ? 14.241 28.005 9.034   1.00 22.94  ? 121  ILE A CA  1 
ATOM   949  C  C   . ILE A 1 121 ? 13.519 28.549 10.239  1.00 23.89  ? 121  ILE A C   1 
ATOM   950  O  O   . ILE A 1 121 ? 13.469 29.752 10.403  1.00 27.04  ? 121  ILE A O   1 
ATOM   951  C  CB  . ILE A 1 121 ? 15.758 28.256 9.163   1.00 24.60  ? 121  ILE A CB  1 
ATOM   952  C  CG1 . ILE A 1 121 ? 16.459 27.705 7.912   1.00 23.39  ? 121  ILE A CG1 1 
ATOM   953  C  CG2 . ILE A 1 121 ? 16.338 27.668 10.507  1.00 20.98  ? 121  ILE A CG2 1 
ATOM   954  C  CD1 . ILE A 1 121 ? 17.951 27.922 7.806   1.00 22.77  ? 121  ILE A CD1 1 
ATOM   955  N  N   . SER A 1 122 ? 12.972 27.663 11.074  1.00 23.94  ? 122  SER A N   1 
ATOM   956  C  CA  . SER A 1 122 ? 12.369 28.064 12.325  1.00 23.30  ? 122  SER A CA  1 
ATOM   957  C  C   . SER A 1 122 ? 13.143 27.466 13.478  1.00 24.59  ? 122  SER A C   1 
ATOM   958  O  O   . SER A 1 122 ? 13.761 26.404 13.363  1.00 21.01  ? 122  SER A O   1 
ATOM   959  C  CB  . SER A 1 122 ? 10.898 27.626 12.379  1.00 27.51  ? 122  SER A CB  1 
ATOM   960  O  OG  . SER A 1 122 ? 10.164 28.211 11.308  1.00 32.11  ? 122  SER A OG  1 
ATOM   961  N  N   . ASN A 1 123 ? 13.106 28.150 14.609  1.00 22.12  ? 123  ASN A N   1 
ATOM   962  C  CA  . ASN A 1 123 ? 13.914 27.759 15.735  1.00 22.76  ? 123  ASN A CA  1 
ATOM   963  C  C   . ASN A 1 123 ? 13.432 26.454 16.415  1.00 23.50  ? 123  ASN A C   1 
ATOM   964  O  O   . ASN A 1 123 ? 12.307 25.967 16.151  1.00 22.67  ? 123  ASN A O   1 
ATOM   965  C  CB  . ASN A 1 123 ? 14.033 28.932 16.729  1.00 22.89  ? 123  ASN A CB  1 
ATOM   966  C  CG  . ASN A 1 123 ? 12.729 29.218 17.474  1.00 27.02  ? 123  ASN A CG  1 
ATOM   967  O  OD1 . ASN A 1 123 ? 12.129 28.324 18.047  1.00 27.35  ? 123  ASN A OD1 1 
ATOM   968  N  ND2 . ASN A 1 123 ? 12.327 30.483 17.517  1.00 24.87  ? 123  ASN A ND2 1 
ATOM   969  N  N   . PRO A 1 124 ? 14.264 25.899 17.319  1.00 22.40  ? 124  PRO A N   1 
ATOM   970  C  CA  . PRO A 1 124 ? 13.942 24.592 17.939  1.00 20.70  ? 124  PRO A CA  1 
ATOM   971  C  C   . PRO A 1 124 ? 12.703 24.574 18.820  1.00 20.54  ? 124  PRO A C   1 
ATOM   972  O  O   . PRO A 1 124 ? 12.147 23.514 19.058  1.00 21.56  ? 124  PRO A O   1 
ATOM   973  C  CB  . PRO A 1 124 ? 15.157 24.317 18.797  1.00 20.82  ? 124  PRO A CB  1 
ATOM   974  C  CG  . PRO A 1 124 ? 16.272 24.944 18.050  1.00 21.92  ? 124  PRO A CG  1 
ATOM   975  C  CD  . PRO A 1 124 ? 15.660 26.269 17.591  1.00 21.48  ? 124  PRO A CD  1 
ATOM   976  N  N   . GLU A 1 125 ? 12.296 25.737 19.308  1.00 23.48  ? 125  GLU A N   1 
ATOM   977  C  CA  . GLU A 1 125 ? 11.151 25.809 20.193  1.00 25.00  ? 125  GLU A CA  1 
ATOM   978  C  C   . GLU A 1 125 ? 9.871  25.407 19.467  1.00 28.09  ? 125  GLU A C   1 
ATOM   979  O  O   . GLU A 1 125 ? 8.940  24.901 20.111  1.00 32.79  ? 125  GLU A O   1 
ATOM   980  C  CB  . GLU A 1 125 ? 11.020 27.192 20.833  1.00 31.15  ? 125  GLU A CB  1 
ATOM   981  C  CG  . GLU A 1 125 ? 10.208 27.162 22.100  1.00 39.15  ? 125  GLU A CG  1 
ATOM   982  C  CD  . GLU A 1 125 ? 10.227 28.482 22.833  1.00 44.64  ? 125  GLU A CD  1 
ATOM   983  O  OE1 . GLU A 1 125 ? 11.277 28.861 23.412  1.00 45.46  ? 125  GLU A OE1 1 
ATOM   984  O  OE2 . GLU A 1 125 ? 9.175  29.116 22.820  1.00 49.14  ? 125  GLU A OE2 1 
ATOM   985  N  N   . LYS A 1 126 ? 9.832  25.601 18.146  1.00 26.39  ? 126  LYS A N   1 
ATOM   986  C  CA  . LYS A 1 126 ? 8.687  25.182 17.341  1.00 29.35  ? 126  LYS A CA  1 
ATOM   987  C  C   . LYS A 1 126 ? 8.423  23.681 17.528  1.00 28.32  ? 126  LYS A C   1 
ATOM   988  O  O   . LYS A 1 126 ? 7.271  23.243 17.486  1.00 31.94  ? 126  LYS A O   1 
ATOM   989  C  CB  . LYS A 1 126 ? 8.914  25.497 15.846  1.00 29.48  ? 126  LYS A CB  1 
ATOM   990  C  CG  . LYS A 1 126 ? 7.641  25.446 15.019  1.00 36.36  ? 126  LYS A CG  1 
ATOM   991  C  CD  . LYS A 1 126 ? 7.852  25.778 13.542  1.00 44.28  ? 126  LYS A CD  1 
ATOM   992  C  CE  . LYS A 1 126 ? 6.574  25.469 12.729  1.00 52.92  ? 126  LYS A CE  1 
ATOM   993  N  NZ  . LYS A 1 126 ? 6.582  26.074 11.370  1.00 56.23  ? 126  LYS A NZ  1 
ATOM   994  N  N   . GLN A 1 127 ? 9.481  22.909 17.750  1.00 25.72  ? 127  GLN A N   1 
ATOM   995  C  CA  . GLN A 1 127 ? 9.401  21.472 18.012  1.00 23.21  ? 127  GLN A CA  1 
ATOM   996  C  C   . GLN A 1 127 ? 9.399  21.111 19.523  1.00 26.59  ? 127  GLN A C   1 
ATOM   997  O  O   . GLN A 1 127 ? 9.420  19.942 19.887  1.00 30.04  ? 127  GLN A O   1 
ATOM   998  C  CB  . GLN A 1 127 ? 10.519 20.748 17.266  1.00 22.08  ? 127  GLN A CB  1 
ATOM   999  C  CG  . GLN A 1 127 ? 10.332 20.840 15.758  1.00 24.62  ? 127  GLN A CG  1 
ATOM   1000 C  CD  . GLN A 1 127 ? 11.354 20.037 14.942  1.00 26.84  ? 127  GLN A CD  1 
ATOM   1001 O  OE1 . GLN A 1 127 ? 11.933 19.039 15.413  1.00 30.57  ? 127  GLN A OE1 1 
ATOM   1002 N  NE2 . GLN A 1 127 ? 11.532 20.444 13.694  1.00 35.67  ? 127  GLN A NE2 1 
ATOM   1003 N  N   . GLY A 1 128 ? 9.327  22.113 20.393  1.00 27.87  ? 128  GLY A N   1 
ATOM   1004 C  CA  . GLY A 1 128 ? 9.207  21.877 21.844  1.00 27.96  ? 128  GLY A CA  1 
ATOM   1005 C  C   . GLY A 1 128 ? 10.524 21.713 22.620  1.00 23.89  ? 128  GLY A C   1 
ATOM   1006 O  O   . GLY A 1 128 ? 10.522 21.377 23.810  1.00 28.15  ? 128  GLY A O   1 
ATOM   1007 N  N   . PHE A 1 129 ? 11.637 21.944 21.936  1.00 21.80  ? 129  PHE A N   1 
ATOM   1008 C  CA  . PHE A 1 129 ? 12.949 21.975 22.539  1.00 20.32  ? 129  PHE A CA  1 
ATOM   1009 C  C   . PHE A 1 129 ? 13.011 23.187 23.446  1.00 21.98  ? 129  PHE A C   1 
ATOM   1010 O  O   . PHE A 1 129 ? 12.628 24.270 23.016  1.00 24.06  ? 129  PHE A O   1 
ATOM   1011 C  CB  . PHE A 1 129 ? 13.994 22.117 21.418  1.00 21.29  ? 129  PHE A CB  1 
ATOM   1012 C  CG  . PHE A 1 129 ? 15.419 22.069 21.900  1.00 16.20  ? 129  PHE A CG  1 
ATOM   1013 C  CD1 . PHE A 1 129 ? 16.092 20.853 22.043  1.00 15.89  ? 129  PHE A CD1 1 
ATOM   1014 C  CD2 . PHE A 1 129 ? 16.113 23.241 22.124  1.00 18.27  ? 129  PHE A CD2 1 
ATOM   1015 C  CE1 . PHE A 1 129 ? 17.382 20.827 22.455  1.00 20.36  ? 129  PHE A CE1 1 
ATOM   1016 C  CE2 . PHE A 1 129 ? 17.419 23.219 22.511  1.00 20.20  ? 129  PHE A CE2 1 
ATOM   1017 C  CZ  . PHE A 1 129 ? 18.076 22.021 22.679  1.00 20.26  ? 129  PHE A CZ  1 
ATOM   1018 N  N   . GLY A 1 130 ? 13.488 22.998 24.675  1.00 20.42  ? 130  GLY A N   1 
ATOM   1019 C  CA  . GLY A 1 130 ? 13.485 24.022 25.703  1.00 22.16  ? 130  GLY A CA  1 
ATOM   1020 C  C   . GLY A 1 130 ? 14.753 24.858 25.793  1.00 21.38  ? 130  GLY A C   1 
ATOM   1021 O  O   . GLY A 1 130 ? 15.776 24.558 25.149  1.00 21.00  ? 130  GLY A O   1 
ATOM   1022 N  N   . ARG A 1 131 ? 14.651 25.955 26.537  1.00 20.24  ? 131  ARG A N   1 
ATOM   1023 C  CA  . ARG A 1 131 ? 15.824 26.748 26.917  1.00 21.33  ? 131  ARG A CA  1 
ATOM   1024 C  C   . ARG A 1 131 ? 15.706 27.239 28.345  1.00 19.50  ? 131  ARG A C   1 
ATOM   1025 O  O   . ARG A 1 131 ? 14.621 27.653 28.817  1.00 20.51  ? 131  ARG A O   1 
ATOM   1026 C  CB  . ARG A 1 131 ? 16.126 27.908 25.957  1.00 27.11  ? 131  ARG A CB  1 
ATOM   1027 C  CG  . ARG A 1 131 ? 15.023 28.875 25.795  1.00 30.80  ? 131  ARG A CG  1 
ATOM   1028 C  CD  . ARG A 1 131 ? 15.424 30.120 25.009  1.00 29.15  ? 131  ARG A CD  1 
ATOM   1029 N  NE  . ARG A 1 131 ? 14.404 31.109 25.296  1.00 31.84  ? 131  ARG A NE  1 
ATOM   1030 C  CZ  . ARG A 1 131 ? 14.575 32.275 25.895  1.00 27.37  ? 131  ARG A CZ  1 
ATOM   1031 N  NH1 . ARG A 1 131 ? 15.769 32.732 26.263  1.00 31.03  ? 131  ARG A NH1 1 
ATOM   1032 N  NH2 . ARG A 1 131 ? 13.511 33.027 26.097  1.00 32.40  ? 131  ARG A NH2 1 
ATOM   1033 N  N   . HIS A 1 132 ? 16.836 27.205 29.047  1.00 21.14  ? 132  HIS A N   1 
ATOM   1034 C  CA  . HIS A 1 132 ? 16.909 27.822 30.351  1.00 21.07  ? 132  HIS A CA  1 
ATOM   1035 C  C   . HIS A 1 132 ? 16.840 29.337 30.169  1.00 23.22  ? 132  HIS A C   1 
ATOM   1036 O  O   . HIS A 1 132 ? 17.477 29.896 29.250  1.00 22.79  ? 132  HIS A O   1 
ATOM   1037 C  CB  . HIS A 1 132 ? 18.202 27.446 31.102  1.00 18.84  ? 132  HIS A CB  1 
ATOM   1038 C  CG  . HIS A 1 132 ? 18.312 25.991 31.463  1.00 18.99  ? 132  HIS A CG  1 
ATOM   1039 N  ND1 . HIS A 1 132 ? 19.108 25.546 32.494  1.00 20.31  ? 132  HIS A ND1 1 
ATOM   1040 C  CD2 . HIS A 1 132 ? 17.702 24.893 30.968  1.00 20.40  ? 132  HIS A CD2 1 
ATOM   1041 C  CE1 . HIS A 1 132 ? 19.029 24.228 32.579  1.00 19.29  ? 132  HIS A CE1 1 
ATOM   1042 N  NE2 . HIS A 1 132 ? 18.170 23.805 31.670  1.00 18.36  ? 132  HIS A NE2 1 
ATOM   1043 N  N   . VAL A 1 133 ? 16.072 29.981 31.051  1.00 23.12  ? 133  VAL A N   1 
ATOM   1044 C  CA  . VAL A 1 133 ? 15.964 31.446 31.074  1.00 24.49  ? 133  VAL A CA  1 
ATOM   1045 C  C   . VAL A 1 133 ? 16.271 32.100 32.427  1.00 26.26  ? 133  VAL A C   1 
ATOM   1046 O  O   . VAL A 1 133 ? 16.238 33.322 32.548  1.00 29.36  ? 133  VAL A O   1 
ATOM   1047 C  CB  . VAL A 1 133 ? 14.564 31.888 30.586  1.00 27.22  ? 133  VAL A CB  1 
ATOM   1048 C  CG1 . VAL A 1 133 ? 14.339 31.383 29.210  1.00 26.81  ? 133  VAL A CG1 1 
ATOM   1049 C  CG2 . VAL A 1 133 ? 13.460 31.388 31.531  1.00 27.97  ? 133  VAL A CG2 1 
ATOM   1050 N  N   . ASP A 1 134 ? 16.611 31.304 33.426  1.00 25.08  ? 134  ASP A N   1 
ATOM   1051 C  CA  . ASP A 1 134 ? 17.056 31.818 34.699  1.00 30.09  ? 134  ASP A CA  1 
ATOM   1052 C  C   . ASP A 1 134 ? 18.404 32.518 34.555  1.00 33.23  ? 134  ASP A C   1 
ATOM   1053 O  O   . ASP A 1 134 ? 19.166 32.257 33.625  1.00 27.74  ? 134  ASP A O   1 
ATOM   1054 C  CB  . ASP A 1 134 ? 17.126 30.706 35.739  1.00 28.88  ? 134  ASP A CB  1 
ATOM   1055 C  CG  . ASP A 1 134 ? 17.916 29.515 35.255  1.00 29.13  ? 134  ASP A CG  1 
ATOM   1056 O  OD1 . ASP A 1 134 ? 17.356 28.727 34.452  1.00 24.86  ? 134  ASP A OD1 1 
ATOM   1057 O  OD2 . ASP A 1 134 ? 19.090 29.386 35.657  1.00 27.87  ? 134  ASP A OD2 1 
ATOM   1058 N  N   . GLU A 1 135 ? 18.690 33.414 35.492  1.00 37.31  ? 135  GLU A N   1 
ATOM   1059 C  CA  . GLU A 1 135 ? 19.898 34.246 35.433  1.00 41.06  ? 135  GLU A CA  1 
ATOM   1060 C  C   . GLU A 1 135 ? 21.167 33.401 35.475  1.00 37.38  ? 135  GLU A C   1 
ATOM   1061 O  O   . GLU A 1 135 ? 22.165 33.708 34.807  1.00 36.53  ? 135  GLU A O   1 
ATOM   1062 C  CB  . GLU A 1 135 ? 19.868 35.280 36.581  1.00 46.58  ? 135  GLU A CB  1 
ATOM   1063 C  CG  . GLU A 1 135 ? 21.065 36.248 36.669  1.00 56.06  ? 135  GLU A CG  1 
ATOM   1064 C  CD  . GLU A 1 135 ? 21.214 36.879 38.052  1.00 69.71  ? 135  GLU A CD  1 
ATOM   1065 O  OE1 . GLU A 1 135 ? 20.327 37.658 38.459  1.00 76.72  ? 135  GLU A OE1 1 
ATOM   1066 O  OE2 . GLU A 1 135 ? 22.223 36.596 38.734  1.00 74.62  ? 135  GLU A OE2 1 
ATOM   1067 N  N   . GLU A 1 136 ? 21.111 32.305 36.219  1.00 34.16  ? 136  GLU A N   1 
ATOM   1068 C  CA  . GLU A 1 136 ? 22.307 31.568 36.547  1.00 34.96  ? 136  GLU A CA  1 
ATOM   1069 C  C   . GLU A 1 136 ? 22.729 30.698 35.372  1.00 30.11  ? 136  GLU A C   1 
ATOM   1070 O  O   . GLU A 1 136 ? 23.921 30.592 35.064  1.00 34.21  ? 136  GLU A O   1 
ATOM   1071 C  CB  . GLU A 1 136 ? 22.111 30.749 37.838  1.00 35.38  ? 136  GLU A CB  1 
ATOM   1072 C  CG  . GLU A 1 136 ? 21.418 31.522 38.990  1.00 48.56  ? 136  GLU A CG  1 
ATOM   1073 C  CD  . GLU A 1 136 ? 19.872 31.573 38.869  1.00 54.28  ? 136  GLU A CD  1 
ATOM   1074 O  OE1 . GLU A 1 136 ? 19.240 30.500 38.802  1.00 61.41  ? 136  GLU A OE1 1 
ATOM   1075 O  OE2 . GLU A 1 136 ? 19.287 32.681 38.843  1.00 59.82  ? 136  GLU A OE2 1 
ATOM   1076 N  N   . THR A 1 137 ? 21.768 30.111 34.672  1.00 26.00  ? 137  THR A N   1 
ATOM   1077 C  CA  . THR A 1 137 ? 22.109 29.187 33.576  1.00 24.60  ? 137  THR A CA  1 
ATOM   1078 C  C   . THR A 1 137 ? 21.451 29.487 32.239  1.00 23.16  ? 137  THR A C   1 
ATOM   1079 O  O   . THR A 1 137 ? 21.574 28.690 31.314  1.00 22.90  ? 137  THR A O   1 
ATOM   1080 C  CB  . THR A 1 137 ? 21.703 27.748 33.949  1.00 26.13  ? 137  THR A CB  1 
ATOM   1081 O  OG1 . THR A 1 137 ? 20.280 27.639 33.922  1.00 27.00  ? 137  THR A OG1 1 
ATOM   1082 C  CG2 . THR A 1 137 ? 22.220 27.376 35.322  1.00 27.30  ? 137  THR A CG2 1 
ATOM   1083 N  N   . GLY A 1 138 ? 20.804 30.653 32.134  1.00 23.53  ? 138  GLY A N   1 
ATOM   1084 C  CA  . GLY A 1 138 ? 19.919 30.964 31.033  1.00 25.59  ? 138  GLY A CA  1 
ATOM   1085 C  C   . GLY A 1 138 ? 20.689 31.391 29.797  1.00 23.93  ? 138  GLY A C   1 
ATOM   1086 O  O   . GLY A 1 138 ? 21.860 31.723 29.880  1.00 24.55  ? 138  GLY A O   1 
ATOM   1087 N  N   . VAL A 1 139 ? 19.999 31.396 28.660  1.00 23.05  ? 139  VAL A N   1 
ATOM   1088 C  CA  . VAL A 1 139 ? 20.584 31.772 27.366  1.00 23.40  ? 139  VAL A CA  1 
ATOM   1089 C  C   . VAL A 1 139 ? 19.649 32.772 26.723  1.00 23.79  ? 139  VAL A C   1 
ATOM   1090 O  O   . VAL A 1 139 ? 18.567 33.057 27.264  1.00 23.68  ? 139  VAL A O   1 
ATOM   1091 C  CB  . VAL A 1 139 ? 20.786 30.533 26.449  1.00 24.03  ? 139  VAL A CB  1 
ATOM   1092 C  CG1 . VAL A 1 139 ? 21.689 29.536 27.098  1.00 23.61  ? 139  VAL A CG1 1 
ATOM   1093 C  CG2 . VAL A 1 139 ? 19.440 29.887 26.100  1.00 25.63  ? 139  VAL A CG2 1 
ATOM   1094 N  N   . GLY A 1 140 ? 20.081 33.326 25.594  1.00 25.67  ? 140  GLY A N   1 
ATOM   1095 C  CA  . GLY A 1 140 ? 19.330 34.314 24.881  1.00 25.31  ? 140  GLY A CA  1 
ATOM   1096 C  C   . GLY A 1 140 ? 18.113 33.745 24.190  1.00 22.90  ? 140  GLY A C   1 
ATOM   1097 O  O   . GLY A 1 140 ? 17.989 32.537 24.006  1.00 22.42  ? 140  GLY A O   1 
ATOM   1098 N  N   . LYS A 1 141 ? 17.225 34.651 23.808  1.00 27.34  ? 141  LYS A N   1 
ATOM   1099 C  CA  . LYS A 1 141 ? 16.001 34.325 23.064  1.00 26.07  ? 141  LYS A CA  1 
ATOM   1100 C  C   . LYS A 1 141 ? 16.346 33.760 21.673  1.00 24.99  ? 141  LYS A C   1 
ATOM   1101 O  O   . LYS A 1 141 ? 17.323 34.145 21.075  1.00 24.61  ? 141  LYS A O   1 
ATOM   1102 C  CB  . LYS A 1 141 ? 15.164 35.599 22.935  1.00 31.30  ? 141  LYS A CB  1 
ATOM   1103 C  CG  . LYS A 1 141 ? 13.679 35.378 22.903  1.00 42.73  ? 141  LYS A CG  1 
ATOM   1104 C  CD  . LYS A 1 141 ? 12.916 36.669 22.706  1.00 49.08  ? 141  LYS A CD  1 
ATOM   1105 C  CE  . LYS A 1 141 ? 11.527 36.368 22.126  1.00 59.62  ? 141  LYS A CE  1 
ATOM   1106 N  NZ  . LYS A 1 141 ? 10.882 37.528 21.460  1.00 63.94  ? 141  LYS A NZ  1 
ATOM   1107 N  N   . TRP A 1 142 ? 15.534 32.838 21.186  1.00 24.84  ? 142  TRP A N   1 
ATOM   1108 C  CA  . TRP A 1 142 ? 15.692 32.316 19.830  1.00 24.79  ? 142  TRP A CA  1 
ATOM   1109 C  C   . TRP A 1 142 ? 15.399 33.343 18.743  1.00 23.68  ? 142  TRP A C   1 
ATOM   1110 O  O   . TRP A 1 142 ? 14.510 34.214 18.869  1.00 24.95  ? 142  TRP A O   1 
ATOM   1111 C  CB  . TRP A 1 142 ? 14.759 31.130 19.606  1.00 23.30  ? 142  TRP A CB  1 
ATOM   1112 C  CG  . TRP A 1 142 ? 15.134 29.886 20.337  1.00 26.95  ? 142  TRP A CG  1 
ATOM   1113 C  CD1 . TRP A 1 142 ? 14.445 29.291 21.335  1.00 31.52  ? 142  TRP A CD1 1 
ATOM   1114 C  CD2 . TRP A 1 142 ? 16.298 29.095 20.114  1.00 30.82  ? 142  TRP A CD2 1 
ATOM   1115 N  NE1 . TRP A 1 142 ? 15.100 28.166 21.750  1.00 31.99  ? 142  TRP A NE1 1 
ATOM   1116 C  CE2 . TRP A 1 142 ? 16.258 28.035 21.031  1.00 30.41  ? 142  TRP A CE2 1 
ATOM   1117 C  CE3 . TRP A 1 142 ? 17.375 29.188 19.229  1.00 25.37  ? 142  TRP A CE3 1 
ATOM   1118 C  CZ2 . TRP A 1 142 ? 17.243 27.034 21.068  1.00 32.15  ? 142  TRP A CZ2 1 
ATOM   1119 C  CZ3 . TRP A 1 142 ? 18.359 28.208 19.266  1.00 35.18  ? 142  TRP A CZ3 1 
ATOM   1120 C  CH2 . TRP A 1 142 ? 18.289 27.150 20.187  1.00 27.43  ? 142  TRP A CH2 1 
ATOM   1121 N  N   . PHE A 1 143 ? 16.121 33.179 17.630  1.00 26.54  ? 143  PHE A N   1 
ATOM   1122 C  CA  . PHE A 1 143 ? 15.829 33.903 16.396  1.00 26.85  ? 143  PHE A CA  1 
ATOM   1123 C  C   . PHE A 1 143 ? 14.419 33.644 15.902  1.00 26.97  ? 143  PHE A C   1 
ATOM   1124 O  O   . PHE A 1 143 ? 13.842 32.575 16.132  1.00 25.76  ? 143  PHE A O   1 
ATOM   1125 C  CB  . PHE A 1 143 ? 16.801 33.505 15.284  1.00 23.79  ? 143  PHE A CB  1 
ATOM   1126 C  CG  . PHE A 1 143 ? 16.799 32.029 14.989  1.00 23.68  ? 143  PHE A CG  1 
ATOM   1127 C  CD1 . PHE A 1 143 ? 15.896 31.483 14.105  1.00 26.89  ? 143  PHE A CD1 1 
ATOM   1128 C  CD2 . PHE A 1 143 ? 17.733 31.200 15.574  1.00 22.86  ? 143  PHE A CD2 1 
ATOM   1129 C  CE1 . PHE A 1 143 ? 15.919 30.117 13.817  1.00 28.08  ? 143  PHE A CE1 1 
ATOM   1130 C  CE2 . PHE A 1 143 ? 17.751 29.847 15.299  1.00 22.45  ? 143  PHE A CE2 1 
ATOM   1131 C  CZ  . PHE A 1 143 ? 16.845 29.310 14.428  1.00 24.20  ? 143  PHE A CZ  1 
ATOM   1132 N  N   . GLU A 1 144 ? 13.880 34.661 15.235  1.00 27.88  ? 144  GLU A N   1 
ATOM   1133 C  CA  . GLU A 1 144 ? 12.591 34.593 14.603  1.00 31.41  ? 144  GLU A CA  1 
ATOM   1134 C  C   . GLU A 1 144 ? 12.800 33.840 13.309  1.00 31.16  ? 144  GLU A C   1 
ATOM   1135 O  O   . GLU A 1 144 ? 13.928 33.809 12.799  1.00 30.64  ? 144  GLU A O   1 
ATOM   1136 C  CB  . GLU A 1 144 ? 12.059 36.000 14.322  1.00 34.28  ? 144  GLU A CB  1 
ATOM   1137 C  CG  . GLU A 1 144 ? 11.614 36.718 15.599  1.00 46.74  ? 144  GLU A CG  1 
ATOM   1138 C  CD  . GLU A 1 144 ? 10.334 36.135 16.201  1.00 59.59  ? 144  GLU A CD  1 
ATOM   1139 O  OE1 . GLU A 1 144 ? 9.331  35.980 15.464  1.00 63.92  ? 144  GLU A OE1 1 
ATOM   1140 O  OE2 . GLU A 1 144 ? 10.320 35.854 17.423  1.00 69.71  ? 144  GLU A OE2 1 
ATOM   1141 N  N   . PRO A 1 145 ? 11.721 33.261 12.751  1.00 30.12  ? 145  PRO A N   1 
ATOM   1142 C  CA  . PRO A 1 145 ? 11.894 32.496 11.539  1.00 27.42  ? 145  PRO A CA  1 
ATOM   1143 C  C   . PRO A 1 145 ? 12.433 33.338 10.368  1.00 26.44  ? 145  PRO A C   1 
ATOM   1144 O  O   . PRO A 1 145 ? 12.078 34.522 10.209  1.00 29.16  ? 145  PRO A O   1 
ATOM   1145 C  CB  . PRO A 1 145 ? 10.480 31.947 11.249  1.00 31.65  ? 145  PRO A CB  1 
ATOM   1146 C  CG  . PRO A 1 145 ? 9.686  32.191 12.445  1.00 36.56  ? 145  PRO A CG  1 
ATOM   1147 C  CD  . PRO A 1 145 ? 10.307 33.341 13.157  1.00 33.39  ? 145  PRO A CD  1 
ATOM   1148 N  N   . PHE A 1 146 ? 13.305 32.737 9.558   1.00 25.82  ? 146  PHE A N   1 
ATOM   1149 C  CA  . PHE A 1 146 ? 13.999 33.484 8.519   1.00 26.22  ? 146  PHE A CA  1 
ATOM   1150 C  C   . PHE A 1 146 ? 14.265 32.632 7.311   1.00 24.88  ? 146  PHE A C   1 
ATOM   1151 O  O   . PHE A 1 146 ? 14.156 31.407 7.377   1.00 25.98  ? 146  PHE A O   1 
ATOM   1152 C  CB  . PHE A 1 146 ? 15.314 34.082 9.061   1.00 23.12  ? 146  PHE A CB  1 
ATOM   1153 C  CG  . PHE A 1 146 ? 16.361 33.065 9.361   1.00 23.70  ? 146  PHE A CG  1 
ATOM   1154 C  CD1 . PHE A 1 146 ? 16.325 32.357 10.559  1.00 27.14  ? 146  PHE A CD1 1 
ATOM   1155 C  CD2 . PHE A 1 146 ? 17.419 32.846 8.480   1.00 26.33  ? 146  PHE A CD2 1 
ATOM   1156 C  CE1 . PHE A 1 146 ? 17.310 31.402 10.854  1.00 23.02  ? 146  PHE A CE1 1 
ATOM   1157 C  CE2 . PHE A 1 146 ? 18.397 31.894 8.756   1.00 25.48  ? 146  PHE A CE2 1 
ATOM   1158 C  CZ  . PHE A 1 146 ? 18.357 31.189 9.965   1.00 26.64  ? 146  PHE A CZ  1 
ATOM   1159 N  N   . LYS A 1 147 ? 14.561 33.303 6.200   1.00 27.49  ? 147  LYS A N   1 
ATOM   1160 C  CA  . LYS A 1 147 ? 14.887 32.667 4.952   1.00 27.07  ? 147  LYS A CA  1 
ATOM   1161 C  C   . LYS A 1 147 ? 16.326 32.960 4.536   1.00 27.22  ? 147  LYS A C   1 
ATOM   1162 O  O   . LYS A 1 147 ? 16.864 34.031 4.798   1.00 27.83  ? 147  LYS A O   1 
ATOM   1163 C  CB  . LYS A 1 147 ? 13.976 33.144 3.804   1.00 31.34  ? 147  LYS A CB  1 
ATOM   1164 C  CG  . LYS A 1 147 ? 12.520 32.791 3.964   1.00 37.20  ? 147  LYS A CG  1 
ATOM   1165 C  CD  . LYS A 1 147 ? 11.648 33.531 2.932   1.00 51.03  ? 147  LYS A CD  1 
ATOM   1166 C  CE  . LYS A 1 147 ? 10.260 33.866 3.498   1.00 63.96  ? 147  LYS A CE  1 
ATOM   1167 N  NZ  . LYS A 1 147 ? 9.285  34.295 2.451   1.00 63.46  ? 147  LYS A NZ  1 
ATOM   1168 N  N   . VAL A 1 148 ? 16.908 31.982 3.851   1.00 27.56  ? 148  VAL A N   1 
ATOM   1169 C  CA  A VAL A 1 148 ? 18.186 32.168 3.182   0.50 26.17  ? 148  VAL A CA  1 
ATOM   1170 C  CA  B VAL A 1 148 ? 18.213 32.096 3.218   0.50 26.99  ? 148  VAL A CA  1 
ATOM   1171 C  C   . VAL A 1 148 ? 18.044 31.636 1.772   1.00 26.83  ? 148  VAL A C   1 
ATOM   1172 O  O   . VAL A 1 148 ? 17.391 30.612 1.550   1.00 28.95  ? 148  VAL A O   1 
ATOM   1173 C  CB  A VAL A 1 148 ? 19.367 31.488 3.925   0.50 28.00  ? 148  VAL A CB  1 
ATOM   1174 C  CB  B VAL A 1 148 ? 19.237 31.179 3.931   0.50 29.02  ? 148  VAL A CB  1 
ATOM   1175 C  CG1 A VAL A 1 148 ? 19.635 32.182 5.265   0.50 27.52  ? 148  VAL A CG1 1 
ATOM   1176 C  CG1 B VAL A 1 148 ? 20.650 31.707 3.758   0.50 36.68  ? 148  VAL A CG1 1 
ATOM   1177 C  CG2 A VAL A 1 148 ? 19.115 30.001 4.116   0.50 29.71  ? 148  VAL A CG2 1 
ATOM   1178 C  CG2 B VAL A 1 148 ? 18.899 31.042 5.421   0.50 28.96  ? 148  VAL A CG2 1 
ATOM   1179 N  N   . ASP A 1 149 ? 18.643 32.357 0.819   1.00 31.69  ? 149  ASP A N   1 
ATOM   1180 C  CA  . ASP A 1 149 ? 18.556 32.038 -0.626  1.00 34.85  ? 149  ASP A CA  1 
ATOM   1181 C  C   . ASP A 1 149 ? 19.920 31.713 -1.214  1.00 34.16  ? 149  ASP A C   1 
ATOM   1182 O  O   . ASP A 1 149 ? 20.915 32.337 -0.835  1.00 34.26  ? 149  ASP A O   1 
ATOM   1183 C  CB  . ASP A 1 149 ? 18.023 33.238 -1.425  1.00 38.73  ? 149  ASP A CB  1 
ATOM   1184 C  CG  . ASP A 1 149 ? 16.630 33.620 -1.030  1.00 49.38  ? 149  ASP A CG  1 
ATOM   1185 O  OD1 . ASP A 1 149 ? 15.743 32.749 -1.104  1.00 60.81  ? 149  ASP A OD1 1 
ATOM   1186 O  OD2 . ASP A 1 149 ? 16.419 34.790 -0.646  1.00 62.72  ? 149  ASP A OD2 1 
ATOM   1187 N  N   . TYR A 1 150 ? 19.937 30.782 -2.177  1.00 32.38  ? 150  TYR A N   1 
ATOM   1188 C  CA  . TYR A 1 150 ? 21.163 30.379 -2.885  1.00 32.53  ? 150  TYR A CA  1 
ATOM   1189 C  C   . TYR A 1 150 ? 20.819 30.245 -4.357  1.00 31.65  ? 150  TYR A C   1 
ATOM   1190 O  O   . TYR A 1 150 ? 19.729 29.828 -4.700  1.00 33.29  ? 150  TYR A O   1 
ATOM   1191 C  CB  . TYR A 1 150 ? 21.673 29.006 -2.413  1.00 31.15  ? 150  TYR A CB  1 
ATOM   1192 C  CG  . TYR A 1 150 ? 21.872 28.863 -0.932  1.00 29.99  ? 150  TYR A CG  1 
ATOM   1193 C  CD1 . TYR A 1 150 ? 20.820 28.520 -0.126  1.00 27.58  ? 150  TYR A CD1 1 
ATOM   1194 C  CD2 . TYR A 1 150 ? 23.121 29.024 -0.343  1.00 32.31  ? 150  TYR A CD2 1 
ATOM   1195 C  CE1 . TYR A 1 150 ? 20.990 28.402 1.245   1.00 25.89  ? 150  TYR A CE1 1 
ATOM   1196 C  CE2 . TYR A 1 150 ? 23.297 28.873 1.024   1.00 37.05  ? 150  TYR A CE2 1 
ATOM   1197 C  CZ  . TYR A 1 150 ? 22.225 28.562 1.807   1.00 30.66  ? 150  TYR A CZ  1 
ATOM   1198 O  OH  . TYR A 1 150 ? 22.363 28.420 3.160   1.00 36.42  ? 150  TYR A OH  1 
ATOM   1199 N  N   . LYS A 1 151 ? 21.763 30.593 -5.221  1.00 33.47  ? 151  LYS A N   1 
ATOM   1200 C  CA  . LYS A 1 151 ? 21.607 30.360 -6.665  1.00 37.06  ? 151  LYS A CA  1 
ATOM   1201 C  C   . LYS A 1 151 ? 22.705 29.401 -7.086  1.00 37.83  ? 151  LYS A C   1 
ATOM   1202 O  O   . LYS A 1 151 ? 23.834 29.495 -6.620  1.00 39.36  ? 151  LYS A O   1 
ATOM   1203 C  CB  . LYS A 1 151 ? 21.718 31.662 -7.439  1.00 40.06  ? 151  LYS A CB  1 
ATOM   1204 C  CG  . LYS A 1 151 ? 20.577 32.632 -7.179  1.00 47.71  ? 151  LYS A CG  1 
ATOM   1205 C  CD  . LYS A 1 151 ? 20.567 33.763 -8.220  1.00 55.22  ? 151  LYS A CD  1 
ATOM   1206 C  CE  . LYS A 1 151 ? 19.589 34.873 -7.843  1.00 62.30  ? 151  LYS A CE  1 
ATOM   1207 N  NZ  . LYS A 1 151 ? 19.813 36.110 -8.629  1.00 70.96  ? 151  LYS A NZ  1 
ATOM   1208 N  N   . PHE A 1 152 ? 22.356 28.428 -7.914  1.00 36.41  ? 152  PHE A N   1 
ATOM   1209 C  CA  . PHE A 1 152 ? 23.338 27.464 -8.368  1.00 35.32  ? 152  PHE A CA  1 
ATOM   1210 C  C   . PHE A 1 152 ? 22.936 26.865 -9.701  1.00 34.89  ? 152  PHE A C   1 
ATOM   1211 O  O   . PHE A 1 152 ? 21.774 26.917 -10.107 1.00 34.42  ? 152  PHE A O   1 
ATOM   1212 C  CB  . PHE A 1 152 ? 23.590 26.380 -7.303  1.00 34.40  ? 152  PHE A CB  1 
ATOM   1213 C  CG  . PHE A 1 152 ? 22.481 25.381 -7.156  1.00 33.78  ? 152  PHE A CG  1 
ATOM   1214 C  CD1 . PHE A 1 152 ? 21.342 25.683 -6.417  1.00 34.01  ? 152  PHE A CD1 1 
ATOM   1215 C  CD2 . PHE A 1 152 ? 22.592 24.113 -7.718  1.00 34.76  ? 152  PHE A CD2 1 
ATOM   1216 C  CE1 . PHE A 1 152 ? 20.332 24.747 -6.267  1.00 29.77  ? 152  PHE A CE1 1 
ATOM   1217 C  CE2 . PHE A 1 152 ? 21.597 23.164 -7.556  1.00 34.12  ? 152  PHE A CE2 1 
ATOM   1218 C  CZ  . PHE A 1 152 ? 20.457 23.475 -6.828  1.00 30.11  ? 152  PHE A CZ  1 
ATOM   1219 N  N   . LYS A 1 153 ? 23.932 26.333 -10.394 1.00 36.48  ? 153  LYS A N   1 
ATOM   1220 C  CA  . LYS A 1 153 ? 23.698 25.628 -11.627 1.00 35.96  ? 153  LYS A CA  1 
ATOM   1221 C  C   . LYS A 1 153 ? 23.730 24.146 -11.327 1.00 34.05  ? 153  LYS A C   1 
ATOM   1222 O  O   . LYS A 1 153 ? 24.732 23.623 -10.828 1.00 35.00  ? 153  LYS A O   1 
ATOM   1223 C  CB  . LYS A 1 153 ? 24.734 26.003 -12.698 1.00 41.83  ? 153  LYS A CB  1 
ATOM   1224 C  CG  . LYS A 1 153 ? 24.830 27.506 -12.946 1.00 53.07  ? 153  LYS A CG  1 
ATOM   1225 C  CD  . LYS A 1 153 ? 26.046 28.153 -12.249 1.00 65.07  ? 153  LYS A CD  1 
ATOM   1226 C  CE  . LYS A 1 153 ? 25.871 29.663 -12.063 1.00 69.47  ? 153  LYS A CE  1 
ATOM   1227 N  NZ  . LYS A 1 153 ? 27.145 30.338 -11.662 1.00 81.22  ? 153  LYS A NZ  1 
ATOM   1228 N  N   . TYR A 1 154 ? 22.615 23.477 -11.604 1.00 30.43  ? 154  TYR A N   1 
ATOM   1229 C  CA  . TYR A 1 154 ? 22.540 22.027 -11.485 1.00 29.79  ? 154  TYR A CA  1 
ATOM   1230 C  C   . TYR A 1 154 ? 22.987 21.400 -12.814 1.00 33.88  ? 154  TYR A C   1 
ATOM   1231 O  O   . TYR A 1 154 ? 22.421 21.700 -13.848 1.00 31.69  ? 154  TYR A O   1 
ATOM   1232 C  CB  . TYR A 1 154 ? 21.104 21.604 -11.169 1.00 26.00  ? 154  TYR A CB  1 
ATOM   1233 C  CG  . TYR A 1 154 ? 20.902 20.106 -11.138 1.00 27.58  ? 154  TYR A CG  1 
ATOM   1234 C  CD1 . TYR A 1 154 ? 21.587 19.307 -10.219 1.00 21.25  ? 154  TYR A CD1 1 
ATOM   1235 C  CD2 . TYR A 1 154 ? 20.000 19.486 -11.995 1.00 28.77  ? 154  TYR A CD2 1 
ATOM   1236 C  CE1 . TYR A 1 154 ? 21.403 17.929 -10.197 1.00 23.96  ? 154  TYR A CE1 1 
ATOM   1237 C  CE2 . TYR A 1 154 ? 19.802 18.113 -11.959 1.00 28.25  ? 154  TYR A CE2 1 
ATOM   1238 C  CZ  . TYR A 1 154 ? 20.504 17.340 -11.038 1.00 30.26  ? 154  TYR A CZ  1 
ATOM   1239 O  OH  . TYR A 1 154 ? 20.333 15.978 -10.963 1.00 28.87  ? 154  TYR A OH  1 
ATOM   1240 N  N   . THR A 1 155 ? 24.000 20.536 -12.776 1.00 36.31  ? 155  THR A N   1 
ATOM   1241 C  CA  . THR A 1 155 ? 24.556 19.914 -13.975 1.00 40.68  ? 155  THR A CA  1 
ATOM   1242 C  C   . THR A 1 155 ? 24.356 18.385 -14.003 1.00 42.11  ? 155  THR A C   1 
ATOM   1243 O  O   . THR A 1 155 ? 24.992 17.683 -14.802 1.00 45.47  ? 155  THR A O   1 
ATOM   1244 C  CB  . THR A 1 155 ? 26.050 20.228 -14.108 1.00 43.90  ? 155  THR A CB  1 
ATOM   1245 O  OG1 . THR A 1 155 ? 26.723 19.806 -12.921 1.00 50.76  ? 155  THR A OG1 1 
ATOM   1246 C  CG2 . THR A 1 155 ? 26.272 21.713 -14.297 1.00 47.93  ? 155  THR A CG2 1 
ATOM   1247 N  N   . GLY A 1 156 ? 23.460 17.875 -13.163 1.00 38.76  ? 156  GLY A N   1 
ATOM   1248 C  CA  . GLY A 1 156 ? 23.121 16.436 -13.169 1.00 42.64  ? 156  GLY A CA  1 
ATOM   1249 C  C   . GLY A 1 156 ? 23.512 15.703 -11.895 1.00 43.19  ? 156  GLY A C   1 
ATOM   1250 O  O   . GLY A 1 156 ? 24.233 16.258 -11.057 1.00 41.02  ? 156  GLY A O   1 
ATOM   1251 N  N   . THR A 1 157 ? 23.027 14.467 -11.732 1.00 46.75  ? 157  THR A N   1 
ATOM   1252 C  CA  . THR A 1 157 ? 23.429 13.643 -10.588 1.00 52.80  ? 157  THR A CA  1 
ATOM   1253 C  C   . THR A 1 157 ? 24.947 13.536 -10.566 1.00 58.02  ? 157  THR A C   1 
ATOM   1254 O  O   . THR A 1 157 ? 25.579 13.371 -11.626 1.00 56.18  ? 157  THR A O   1 
ATOM   1255 C  CB  . THR A 1 157 ? 22.873 12.187 -10.614 1.00 56.79  ? 157  THR A CB  1 
ATOM   1256 O  OG1 . THR A 1 157 ? 21.450 12.187 -10.602 1.00 55.24  ? 157  THR A OG1 1 
ATOM   1257 C  CG2 . THR A 1 157 ? 23.346 11.391 -9.388  1.00 60.46  ? 157  THR A CG2 1 
ATOM   1258 N  N   . PRO A 1 158 ? 25.543 13.661 -9.368  1.00 65.12  ? 158  PRO A N   1 
ATOM   1259 C  CA  . PRO A 1 158 ? 26.937 13.286 -9.224  1.00 74.12  ? 158  PRO A CA  1 
ATOM   1260 C  C   . PRO A 1 158 ? 27.135 11.834 -9.662  1.00 83.05  ? 158  PRO A C   1 
ATOM   1261 O  O   . PRO A 1 158 ? 26.465 10.932 -9.153  1.00 84.31  ? 158  PRO A O   1 
ATOM   1262 C  CB  . PRO A 1 158 ? 27.192 13.475 -7.731  1.00 76.46  ? 158  PRO A CB  1 
ATOM   1263 C  CG  . PRO A 1 158 ? 26.255 14.550 -7.338  1.00 69.45  ? 158  PRO A CG  1 
ATOM   1264 C  CD  . PRO A 1 158 ? 25.021 14.311 -8.150  1.00 62.94  ? 158  PRO A CD  1 
ATOM   1265 N  N   . LYS A 1 159 ? 28.044 11.638 -10.616 1.00 52.35  ? 159  LYS A N   1 
ATOM   1266 C  CA  . LYS A 1 159 ? 28.202 10.369 -11.335 1.00 56.61  ? 159  LYS A CA  1 
ATOM   1267 C  C   . LYS A 1 159 ? 29.687 9.997  -11.460 1.00 58.67  ? 159  LYS A C   1 
ATOM   1268 O  O   . LYS A 1 159 ? 30.572 10.831 -11.231 1.00 59.70  ? 159  LYS A O   1 
ATOM   1269 C  CB  . LYS A 1 159 ? 27.563 10.481 -12.737 1.00 58.25  ? 159  LYS A CB  1 
ATOM   1270 C  CG  . LYS A 1 159 ? 28.117 11.640 -13.589 1.00 61.75  ? 159  LYS A CG  1 
ATOM   1271 C  CD  . LYS A 1 159 ? 27.288 11.887 -14.844 1.00 66.61  ? 159  LYS A CD  1 
ATOM   1272 C  CE  . LYS A 1 159 ? 27.889 13.011 -15.686 1.00 68.15  ? 159  LYS A CE  1 
ATOM   1273 N  NZ  . LYS A 1 159 ? 27.893 14.322 -14.973 1.00 67.42  ? 159  LYS A NZ  1 
ATOM   1274 N  N   . GLY B 1 2   ? 27.204 25.014 41.738  1.00 47.77  ? 2    GLY B N   1 
ATOM   1275 C  CA  . GLY B 1 2   ? 27.374 24.436 40.369  1.00 45.86  ? 2    GLY B CA  1 
ATOM   1276 C  C   . GLY B 1 2   ? 26.686 23.087 40.254  1.00 42.66  ? 2    GLY B C   1 
ATOM   1277 O  O   . GLY B 1 2   ? 25.579 22.910 40.752  1.00 45.78  ? 2    GLY B O   1 
ATOM   1278 N  N   . GLU B 1 3   ? 27.341 22.124 39.617  1.00 57.68  ? 3    GLU B N   1 
ATOM   1279 C  CA  . GLU B 1 3   ? 26.716 20.835 39.376  1.00 48.34  ? 3    GLU B CA  1 
ATOM   1280 C  C   . GLU B 1 3   ? 27.297 19.748 40.256  1.00 41.93  ? 3    GLU B C   1 
ATOM   1281 O  O   . GLU B 1 3   ? 28.506 19.679 40.473  1.00 44.02  ? 3    GLU B O   1 
ATOM   1282 C  CB  . GLU B 1 3   ? 26.867 20.451 37.916  1.00 45.66  ? 3    GLU B CB  1 
ATOM   1283 C  CG  . GLU B 1 3   ? 26.146 21.400 36.982  1.00 56.60  ? 3    GLU B CG  1 
ATOM   1284 C  CD  . GLU B 1 3   ? 26.820 21.473 35.634  1.00 68.51  ? 3    GLU B CD  1 
ATOM   1285 O  OE1 . GLU B 1 3   ? 27.168 20.398 35.095  1.00 68.94  ? 3    GLU B OE1 1 
ATOM   1286 O  OE2 . GLU B 1 3   ? 27.011 22.599 35.120  1.00 80.22  ? 3    GLU B OE2 1 
ATOM   1287 N  N   . VAL B 1 4   ? 26.420 18.889 40.755  1.00 32.61  ? 4    VAL B N   1 
ATOM   1288 C  CA  . VAL B 1 4   ? 26.821 17.787 41.614  1.00 32.74  ? 4    VAL B CA  1 
ATOM   1289 C  C   . VAL B 1 4   ? 26.801 16.506 40.778  1.00 27.62  ? 4    VAL B C   1 
ATOM   1290 O  O   . VAL B 1 4   ? 25.800 16.207 40.145  1.00 23.79  ? 4    VAL B O   1 
ATOM   1291 C  CB  . VAL B 1 4   ? 25.851 17.657 42.814  1.00 35.73  ? 4    VAL B CB  1 
ATOM   1292 C  CG1 . VAL B 1 4   ? 26.209 16.442 43.675  1.00 31.80  ? 4    VAL B CG1 1 
ATOM   1293 C  CG2 . VAL B 1 4   ? 25.858 18.933 43.642  1.00 36.48  ? 4    VAL B CG2 1 
ATOM   1294 N  N   . PRO B 1 5   ? 27.900 15.738 40.794  1.00 28.24  ? 5    PRO B N   1 
ATOM   1295 C  CA  . PRO B 1 5   ? 27.890 14.475 40.046  1.00 26.23  ? 5    PRO B CA  1 
ATOM   1296 C  C   . PRO B 1 5   ? 26.987 13.407 40.688  1.00 26.69  ? 5    PRO B C   1 
ATOM   1297 O  O   . PRO B 1 5   ? 26.878 13.317 41.916  1.00 30.81  ? 5    PRO B O   1 
ATOM   1298 C  CB  . PRO B 1 5   ? 29.361 14.009 40.082  1.00 27.02  ? 5    PRO B CB  1 
ATOM   1299 C  CG  . PRO B 1 5   ? 30.096 14.989 40.874  1.00 33.37  ? 5    PRO B CG  1 
ATOM   1300 C  CD  . PRO B 1 5   ? 29.191 16.000 41.463  1.00 31.49  ? 5    PRO B CD  1 
ATOM   1301 N  N   . ILE B 1 6   ? 26.348 12.618 39.835  1.00 23.93  ? 6    ILE B N   1 
ATOM   1302 C  CA  . ILE B 1 6   ? 25.523 11.481 40.240  1.00 23.91  ? 6    ILE B CA  1 
ATOM   1303 C  C   . ILE B 1 6   ? 26.236 10.188 39.803  1.00 24.98  ? 6    ILE B C   1 
ATOM   1304 O  O   . ILE B 1 6   ? 26.215 9.824  38.631  1.00 24.11  ? 6    ILE B O   1 
ATOM   1305 C  CB  . ILE B 1 6   ? 24.147 11.550 39.649  1.00 23.15  ? 6    ILE B CB  1 
ATOM   1306 C  CG1 . ILE B 1 6   ? 23.358 12.717 40.242  1.00 26.49  ? 6    ILE B CG1 1 
ATOM   1307 C  CG2 . ILE B 1 6   ? 23.359 10.241 39.840  1.00 25.46  ? 6    ILE B CG2 1 
ATOM   1308 C  CD1 . ILE B 1 6   ? 21.974 12.835 39.737  1.00 22.89  ? 6    ILE B CD1 1 
ATOM   1309 N  N   . GLY B 1 7   ? 26.842 9.508  40.773  1.00 26.77  ? 7    GLY B N   1 
ATOM   1310 C  CA  . GLY B 1 7   ? 27.467 8.227  40.542  1.00 28.57  ? 7    GLY B CA  1 
ATOM   1311 C  C   . GLY B 1 7   ? 28.573 8.342  39.515  1.00 31.56  ? 7    GLY B C   1 
ATOM   1312 O  O   . GLY B 1 7   ? 29.216 9.402  39.385  1.00 30.56  ? 7    GLY B O   1 
ATOM   1313 N  N   . ASP B 1 8   ? 28.795 7.261  38.787  1.00 31.38  ? 8    ASP B N   1 
ATOM   1314 C  CA  . ASP B 1 8   ? 29.892 7.227  37.846  1.00 31.20  ? 8    ASP B CA  1 
ATOM   1315 C  C   . ASP B 1 8   ? 29.301 7.104  36.452  1.00 26.43  ? 8    ASP B C   1 
ATOM   1316 O  O   . ASP B 1 8   ? 28.288 6.448  36.233  1.00 28.35  ? 8    ASP B O   1 
ATOM   1317 C  CB  . ASP B 1 8   ? 30.854 6.094  38.170  1.00 35.43  ? 8    ASP B CB  1 
ATOM   1318 C  CG  . ASP B 1 8   ? 31.692 6.385  39.409  1.00 45.64  ? 8    ASP B CG  1 
ATOM   1319 O  OD1 . ASP B 1 8   ? 32.346 7.455  39.465  1.00 50.81  ? 8    ASP B OD1 1 
ATOM   1320 O  OD2 . ASP B 1 8   ? 31.692 5.545  40.330  1.00 60.43  ? 8    ASP B OD2 1 
ATOM   1321 N  N   . PRO B 1 9   ? 29.950 7.744  35.487  1.00 24.54  ? 9    PRO B N   1 
ATOM   1322 C  CA  . PRO B 1 9   ? 29.437 7.719  34.129  1.00 24.57  ? 9    PRO B CA  1 
ATOM   1323 C  C   . PRO B 1 9   ? 29.566 6.343  33.458  1.00 25.45  ? 9    PRO B C   1 
ATOM   1324 O  O   . PRO B 1 9   ? 30.413 5.551  33.843  1.00 28.68  ? 9    PRO B O   1 
ATOM   1325 C  CB  . PRO B 1 9   ? 30.317 8.745  33.427  1.00 28.38  ? 9    PRO B CB  1 
ATOM   1326 C  CG  . PRO B 1 9   ? 31.606 8.630  34.143  1.00 31.07  ? 9    PRO B CG  1 
ATOM   1327 C  CD  . PRO B 1 9   ? 31.230 8.470  35.575  1.00 25.40  ? 9    PRO B CD  1 
ATOM   1328 N  N   . LYS B 1 10  ? 28.737 6.096  32.449  1.00 22.69  ? 10   LYS B N   1 
ATOM   1329 C  CA  . LYS B 1 10  ? 28.753 4.845  31.691  1.00 23.92  ? 10   LYS B CA  1 
ATOM   1330 C  C   . LYS B 1 10  ? 29.071 5.146  30.234  1.00 24.37  ? 10   LYS B C   1 
ATOM   1331 O  O   . LYS B 1 10  ? 28.618 6.141  29.703  1.00 24.02  ? 10   LYS B O   1 
ATOM   1332 C  CB  . LYS B 1 10  ? 27.389 4.136  31.750  1.00 29.31  ? 10   LYS B CB  1 
ATOM   1333 C  CG  . LYS B 1 10  ? 26.820 3.942  33.153  1.00 35.82  ? 10   LYS B CG  1 
ATOM   1334 C  CD  . LYS B 1 10  ? 27.871 3.453  34.163  1.00 42.96  ? 10   LYS B CD  1 
ATOM   1335 C  CE  . LYS B 1 10  ? 27.253 3.048  35.483  1.00 48.69  ? 10   LYS B CE  1 
ATOM   1336 N  NZ  . LYS B 1 10  ? 27.120 4.169  36.460  1.00 48.12  ? 10   LYS B NZ  1 
ATOM   1337 N  N   . GLU B 1 11  ? 29.859 4.281  29.604  1.00 22.94  ? 11   GLU B N   1 
ATOM   1338 C  CA  . GLU B 1 11  ? 30.144 4.353  28.196  1.00 20.57  ? 11   GLU B CA  1 
ATOM   1339 C  C   . GLU B 1 11  ? 29.497 3.171  27.510  1.00 24.06  ? 11   GLU B C   1 
ATOM   1340 O  O   . GLU B 1 11  ? 29.833 1.997  27.770  1.00 22.45  ? 11   GLU B O   1 
ATOM   1341 C  CB  . GLU B 1 11  ? 31.650 4.332  27.961  1.00 20.21  ? 11   GLU B CB  1 
ATOM   1342 C  CG  . GLU B 1 11  ? 32.308 5.605  28.408  1.00 20.26  ? 11   GLU B CG  1 
ATOM   1343 C  CD  . GLU B 1 11  ? 33.793 5.672  28.157  1.00 36.44  ? 11   GLU B CD  1 
ATOM   1344 O  OE1 . GLU B 1 11  ? 34.328 4.745  27.520  1.00 52.34  ? 11   GLU B OE1 1 
ATOM   1345 O  OE2 . GLU B 1 11  ? 34.429 6.658  28.628  1.00 49.28  ? 11   GLU B OE2 1 
ATOM   1346 N  N   . LEU B 1 12  ? 28.534 3.462  26.645  1.00 22.48  ? 12   LEU B N   1 
ATOM   1347 C  CA  . LEU B 1 12  ? 27.841 2.419  25.918  1.00 24.41  ? 12   LEU B CA  1 
ATOM   1348 C  C   . LEU B 1 12  ? 27.228 2.947  24.651  1.00 19.87  ? 12   LEU B C   1 
ATOM   1349 O  O   . LEU B 1 12  ? 26.780 4.115  24.565  1.00 19.83  ? 12   LEU B O   1 
ATOM   1350 C  CB  . LEU B 1 12  ? 26.716 1.770  26.722  1.00 29.08  ? 12   LEU B CB  1 
ATOM   1351 C  CG  . LEU B 1 12  ? 25.959 2.468  27.837  1.00 35.33  ? 12   LEU B CG  1 
ATOM   1352 C  CD1 . LEU B 1 12  ? 25.655 3.896  27.478  1.00 42.56  ? 12   LEU B CD1 1 
ATOM   1353 C  CD2 . LEU B 1 12  ? 24.698 1.639  28.238  1.00 38.19  ? 12   LEU B CD2 1 
ATOM   1354 N  N   . ASN B 1 13  ? 27.159 2.056  23.695  1.00 17.97  ? 13   ASN B N   1 
ATOM   1355 C  CA  . ASN B 1 13  ? 26.513 2.319  22.434  1.00 21.19  ? 13   ASN B CA  1 
ATOM   1356 C  C   . ASN B 1 13  ? 27.049 3.603  21.788  1.00 22.30  ? 13   ASN B C   1 
ATOM   1357 O  O   . ASN B 1 13  ? 26.308 4.353  21.162  1.00 24.84  ? 13   ASN B O   1 
ATOM   1358 C  CB  . ASN B 1 13  ? 25.007 2.443  22.624  1.00 18.78  ? 13   ASN B CB  1 
ATOM   1359 C  CG  . ASN B 1 13  ? 24.419 1.236  23.244  1.00 18.80  ? 13   ASN B CG  1 
ATOM   1360 O  OD1 . ASN B 1 13  ? 24.868 0.127  22.999  1.00 15.12  ? 13   ASN B OD1 1 
ATOM   1361 N  ND2 . ASN B 1 13  ? 23.396 1.428  24.064  1.00 21.12  ? 13   ASN B ND2 1 
ATOM   1362 N  N   . GLY B 1 14  ? 28.331 3.810  21.919  1.00 22.75  ? 14   GLY B N   1 
ATOM   1363 C  CA  . GLY B 1 14  ? 28.990 4.951  21.276  1.00 24.97  ? 14   GLY B CA  1 
ATOM   1364 C  C   . GLY B 1 14  ? 28.779 6.273  21.990  1.00 22.75  ? 14   GLY B C   1 
ATOM   1365 O  O   . GLY B 1 14  ? 29.097 7.306  21.401  1.00 22.38  ? 14   GLY B O   1 
ATOM   1366 N  N   . MET B 1 15  ? 28.301 6.243  23.261  1.00 19.06  ? 15   MET B N   1 
ATOM   1367 C  CA  . MET B 1 15  ? 27.913 7.414  24.046  1.00 19.19  ? 15   MET B CA  1 
ATOM   1368 C  C   . MET B 1 15  ? 28.482 7.367  25.455  1.00 21.20  ? 15   MET B C   1 
ATOM   1369 O  O   . MET B 1 15  ? 28.599 6.278  26.009  1.00 19.72  ? 15   MET B O   1 
ATOM   1370 C  CB  . MET B 1 15  ? 26.394 7.504  24.193  1.00 16.87  ? 15   MET B CB  1 
ATOM   1371 C  CG  . MET B 1 15  ? 25.637 7.506  22.815  1.00 18.22  ? 15   MET B CG  1 
ATOM   1372 S  SD  . MET B 1 15  ? 23.868 7.695  23.033  1.00 19.33  ? 15   MET B SD  1 
ATOM   1373 C  CE  . MET B 1 15  ? 23.398 5.961  23.265  1.00 26.04  ? 15   MET B CE  1 
ATOM   1374 N  N   . GLU B 1 16  ? 28.872 8.543  25.949  1.00 17.78  ? 16   GLU B N   1 
ATOM   1375 C  CA  A GLU B 1 16  ? 29.177 8.753  27.348  0.50 19.20  ? 16   GLU B CA  1 
ATOM   1376 C  CA  B GLU B 1 16  ? 29.200 8.783  27.356  0.50 18.69  ? 16   GLU B CA  1 
ATOM   1377 C  C   . GLU B 1 16  ? 27.915 9.250  28.010  1.00 19.66  ? 16   GLU B C   1 
ATOM   1378 O  O   . GLU B 1 16  ? 27.337 10.273 27.595  1.00 19.75  ? 16   GLU B O   1 
ATOM   1379 C  CB  A GLU B 1 16  ? 30.316 9.747  27.480  0.50 20.45  ? 16   GLU B CB  1 
ATOM   1380 C  CB  B GLU B 1 16  ? 30.328 9.832  27.484  0.50 19.59  ? 16   GLU B CB  1 
ATOM   1381 C  CG  A GLU B 1 16  ? 30.477 10.331 28.840  0.50 24.25  ? 16   GLU B CG  1 
ATOM   1382 C  CG  B GLU B 1 16  ? 30.809 10.115 28.915  0.50 22.92  ? 16   GLU B CG  1 
ATOM   1383 C  CD  A GLU B 1 16  ? 31.493 11.403 28.789  0.50 27.35  ? 16   GLU B CD  1 
ATOM   1384 C  CD  B GLU B 1 16  ? 31.671 9.002  29.477  0.50 21.68  ? 16   GLU B CD  1 
ATOM   1385 O  OE1 A GLU B 1 16  ? 31.096 12.582 28.744  0.50 34.70  ? 16   GLU B OE1 1 
ATOM   1386 O  OE1 B GLU B 1 16  ? 32.894 8.939  29.199  0.50 19.15  ? 16   GLU B OE1 1 
ATOM   1387 O  OE2 A GLU B 1 16  ? 32.694 11.058 28.739  0.50 33.82  ? 16   GLU B OE2 1 
ATOM   1388 O  OE2 B GLU B 1 16  ? 31.108 8.172  30.216  0.50 28.79  ? 16   GLU B OE2 1 
ATOM   1389 N  N   . ILE B 1 17  ? 27.453 8.551  29.051  1.00 20.89  ? 17   ILE B N   1 
ATOM   1390 C  CA  . ILE B 1 17  ? 26.187 8.878  29.698  1.00 19.30  ? 17   ILE B CA  1 
ATOM   1391 C  C   . ILE B 1 17  ? 26.439 9.160  31.153  1.00 21.18  ? 17   ILE B C   1 
ATOM   1392 O  O   . ILE B 1 17  ? 26.775 8.255  31.938  1.00 19.35  ? 17   ILE B O   1 
ATOM   1393 C  CB  . ILE B 1 17  ? 25.164 7.760  29.554  1.00 20.41  ? 17   ILE B CB  1 
ATOM   1394 C  CG1 . ILE B 1 17  ? 25.095 7.335  28.100  1.00 20.47  ? 17   ILE B CG1 1 
ATOM   1395 C  CG2 . ILE B 1 17  ? 23.780 8.198  30.003  1.00 18.39  ? 17   ILE B CG2 1 
ATOM   1396 C  CD1 . ILE B 1 17  ? 24.043 6.290  27.844  1.00 24.47  ? 17   ILE B CD1 1 
ATOM   1397 N  N   . ALA B 1 18  ? 26.351 10.438 31.495  1.00 18.70  ? 18   ALA B N   1 
ATOM   1398 C  CA  . ALA B 1 18  ? 26.665 10.917 32.842  1.00 19.80  ? 18   ALA B CA  1 
ATOM   1399 C  C   . ALA B 1 18  ? 25.443 11.629 33.368  1.00 19.76  ? 18   ALA B C   1 
ATOM   1400 O  O   . ALA B 1 18  ? 24.591 12.074 32.603  1.00 21.38  ? 18   ALA B O   1 
ATOM   1401 C  CB  . ALA B 1 18  ? 27.874 11.841 32.819  1.00 18.75  ? 18   ALA B CB  1 
ATOM   1402 N  N   . ALA B 1 19  ? 25.315 11.687 34.673  1.00 20.62  ? 19   ALA B N   1 
ATOM   1403 C  CA  . ALA B 1 19  ? 24.205 12.385 35.308  1.00 20.93  ? 19   ALA B CA  1 
ATOM   1404 C  C   . ALA B 1 19  ? 24.761 13.393 36.283  1.00 19.63  ? 19   ALA B C   1 
ATOM   1405 O  O   . ALA B 1 19  ? 25.812 13.157 36.901  1.00 21.33  ? 19   ALA B O   1 
ATOM   1406 C  CB  . ALA B 1 19  ? 23.253 11.385 36.050  1.00 21.63  ? 19   ALA B CB  1 
ATOM   1407 N  N   . VAL B 1 20  ? 24.098 14.556 36.354  1.00 20.63  ? 20   VAL B N   1 
ATOM   1408 C  CA  . VAL B 1 20  ? 24.409 15.587 37.342  1.00 22.83  ? 20   VAL B CA  1 
ATOM   1409 C  C   . VAL B 1 20  ? 23.120 16.213 37.838  1.00 21.08  ? 20   VAL B C   1 
ATOM   1410 O  O   . VAL B 1 20  ? 22.091 16.072 37.214  1.00 21.07  ? 20   VAL B O   1 
ATOM   1411 C  CB  . VAL B 1 20  ? 25.248 16.744 36.755  1.00 21.00  ? 20   VAL B CB  1 
ATOM   1412 C  CG1 . VAL B 1 20  ? 26.615 16.250 36.240  1.00 24.25  ? 20   VAL B CG1 1 
ATOM   1413 C  CG2 . VAL B 1 20  ? 24.466 17.447 35.634  1.00 27.07  ? 20   VAL B CG2 1 
ATOM   1414 N  N   . TYR B 1 21  ? 23.181 16.869 38.993  1.00 22.87  ? 21   TYR B N   1 
ATOM   1415 C  CA  . TYR B 1 21  ? 22.114 17.756 39.377  1.00 21.72  ? 21   TYR B CA  1 
ATOM   1416 C  C   . TYR B 1 21  ? 22.632 19.089 39.870  1.00 23.39  ? 21   TYR B C   1 
ATOM   1417 O  O   . TYR B 1 21  ? 23.761 19.242 40.403  1.00 26.83  ? 21   TYR B O   1 
ATOM   1418 C  CB  . TYR B 1 21  ? 21.213 17.124 40.418  1.00 23.85  ? 21   TYR B CB  1 
ATOM   1419 C  CG  . TYR B 1 21  ? 21.761 16.998 41.816  1.00 24.48  ? 21   TYR B CG  1 
ATOM   1420 C  CD1 . TYR B 1 21  ? 21.549 17.998 42.739  1.00 26.59  ? 21   TYR B CD1 1 
ATOM   1421 C  CD2 . TYR B 1 21  ? 22.404 15.845 42.237  1.00 29.30  ? 21   TYR B CD2 1 
ATOM   1422 C  CE1 . TYR B 1 21  ? 21.993 17.885 44.032  1.00 27.08  ? 21   TYR B CE1 1 
ATOM   1423 C  CE2 . TYR B 1 21  ? 22.853 15.718 43.564  1.00 26.91  ? 21   TYR B CE2 1 
ATOM   1424 C  CZ  . TYR B 1 21  ? 22.652 16.736 44.439  1.00 28.76  ? 21   TYR B CZ  1 
ATOM   1425 O  OH  . TYR B 1 21  ? 23.081 16.634 45.764  1.00 33.46  ? 21   TYR B OH  1 
ATOM   1426 N  N   . LEU B 1 22  ? 21.733 20.036 39.791  1.00 19.65  ? 22   LEU B N   1 
ATOM   1427 C  CA  . LEU B 1 22  ? 21.995 21.361 40.206  1.00 22.17  ? 22   LEU B CA  1 
ATOM   1428 C  C   . LEU B 1 22  ? 20.728 21.957 40.741  1.00 21.84  ? 22   LEU B C   1 
ATOM   1429 O  O   . LEU B 1 22  ? 19.723 21.247 40.889  1.00 20.53  ? 22   LEU B O   1 
ATOM   1430 C  CB  . LEU B 1 22  ? 22.549 22.162 39.043  1.00 23.01  ? 22   LEU B CB  1 
ATOM   1431 C  CG  . LEU B 1 22  ? 21.695 22.349 37.784  1.00 23.97  ? 22   LEU B CG  1 
ATOM   1432 C  CD1 . LEU B 1 22  ? 21.873 23.724 37.170  1.00 32.56  ? 22   LEU B CD1 1 
ATOM   1433 C  CD2 . LEU B 1 22  ? 22.036 21.268 36.770  1.00 33.74  ? 22   LEU B CD2 1 
ATOM   1434 N  N   . GLN B 1 23  ? 20.787 23.248 41.066  1.00 22.84  ? 23   GLN B N   1 
ATOM   1435 C  CA  . GLN B 1 23  ? 19.607 23.926 41.575  1.00 25.09  ? 23   GLN B CA  1 
ATOM   1436 C  C   . GLN B 1 23  ? 18.520 23.962 40.488  1.00 21.33  ? 23   GLN B C   1 
ATOM   1437 O  O   . GLN B 1 23  ? 18.805 23.800 39.305  1.00 22.95  ? 23   GLN B O   1 
ATOM   1438 C  CB  . GLN B 1 23  ? 19.938 25.346 42.039  1.00 25.50  ? 23   GLN B CB  1 
ATOM   1439 C  CG  . GLN B 1 23  ? 20.150 26.346 40.899  1.00 33.30  ? 23   GLN B CG  1 
ATOM   1440 C  CD  . GLN B 1 23  ? 21.536 26.300 40.269  1.00 44.33  ? 23   GLN B CD  1 
ATOM   1441 O  OE1 . GLN B 1 23  ? 22.445 25.567 40.728  1.00 36.09  ? 23   GLN B OE1 1 
ATOM   1442 N  NE2 . GLN B 1 23  ? 21.716 27.107 39.211  1.00 42.68  ? 23   GLN B NE2 1 
ATOM   1443 N  N   . PRO B 1 24  ? 17.265 24.185 40.888  1.00 20.98  ? 24   PRO B N   1 
ATOM   1444 C  CA  . PRO B 1 24  ? 16.239 24.272 39.857  1.00 20.04  ? 24   PRO B CA  1 
ATOM   1445 C  C   . PRO B 1 24  ? 16.463 25.431 38.887  1.00 20.17  ? 24   PRO B C   1 
ATOM   1446 O  O   . PRO B 1 24  ? 17.067 26.444 39.237  1.00 21.15  ? 24   PRO B O   1 
ATOM   1447 C  CB  . PRO B 1 24  ? 14.960 24.501 40.643  1.00 23.32  ? 24   PRO B CB  1 
ATOM   1448 C  CG  . PRO B 1 24  ? 15.236 24.012 42.012  1.00 22.66  ? 24   PRO B CG  1 
ATOM   1449 C  CD  . PRO B 1 24  ? 16.684 24.249 42.245  1.00 23.04  ? 24   PRO B CD  1 
ATOM   1450 N  N   . ILE B 1 25  ? 15.959 25.266 37.670  1.00 21.86  ? 25   ILE B N   1 
ATOM   1451 C  CA  . ILE B 1 25  ? 16.129 26.230 36.629  1.00 19.89  ? 25   ILE B CA  1 
ATOM   1452 C  C   . ILE B 1 25  ? 14.739 26.639 36.150  1.00 23.37  ? 25   ILE B C   1 
ATOM   1453 O  O   . ILE B 1 25  ? 13.718 26.031 36.537  1.00 21.86  ? 25   ILE B O   1 
ATOM   1454 C  CB  . ILE B 1 25  ? 17.022 25.639 35.469  1.00 20.73  ? 25   ILE B CB  1 
ATOM   1455 C  CG1 . ILE B 1 25  ? 16.366 24.437 34.808  1.00 21.16  ? 25   ILE B CG1 1 
ATOM   1456 C  CG2 . ILE B 1 25  ? 18.408 25.275 36.030  1.00 24.67  ? 25   ILE B CG2 1 
ATOM   1457 C  CD1 . ILE B 1 25  ? 15.315 24.794 33.729  1.00 20.45  ? 25   ILE B CD1 1 
ATOM   1458 N  N   . GLU B 1 26  ? 14.685 27.692 35.353  1.00 23.05  ? 26   GLU B N   1 
ATOM   1459 C  CA  . GLU B 1 26  ? 13.412 28.120 34.764  1.00 22.07  ? 26   GLU B CA  1 
ATOM   1460 C  C   . GLU B 1 26  ? 13.497 27.856 33.278  1.00 24.19  ? 26   GLU B C   1 
ATOM   1461 O  O   . GLU B 1 26  ? 14.414 28.327 32.608  1.00 23.81  ? 26   GLU B O   1 
ATOM   1462 C  CB  . GLU B 1 26  ? 13.149 29.586 35.079  1.00 24.98  ? 26   GLU B CB  1 
ATOM   1463 C  CG  . GLU B 1 26  ? 12.854 29.836 36.574  1.00 32.97  ? 26   GLU B CG  1 
ATOM   1464 C  CD  . GLU B 1 26  ? 11.429 29.457 37.019  1.00 46.28  ? 26   GLU B CD  1 
ATOM   1465 O  OE1 . GLU B 1 26  ? 10.820 28.493 36.476  1.00 53.81  ? 26   GLU B OE1 1 
ATOM   1466 O  OE2 . GLU B 1 26  ? 10.906 30.131 37.930  1.00 53.05  ? 26   GLU B OE2 1 
ATOM   1467 N  N   . MET B 1 27  ? 12.569 27.058 32.773  1.00 26.31  ? 27   MET B N   1 
ATOM   1468 C  CA  . MET B 1 27  ? 12.603 26.699 31.353  1.00 23.85  ? 27   MET B CA  1 
ATOM   1469 C  C   . MET B 1 27  ? 11.450 27.343 30.551  1.00 25.67  ? 27   MET B C   1 
ATOM   1470 O  O   . MET B 1 27  ? 10.335 27.437 31.023  1.00 27.26  ? 27   MET B O   1 
ATOM   1471 C  CB  . MET B 1 27  ? 12.575 25.166 31.208  1.00 24.41  ? 27   MET B CB  1 
ATOM   1472 C  CG  . MET B 1 27  ? 12.924 24.678 29.797  1.00 26.88  ? 27   MET B CG  1 
ATOM   1473 S  SD  . MET B 1 27  ? 12.541 22.934 29.456  1.00 25.78  ? 27   MET B SD  1 
ATOM   1474 C  CE  . MET B 1 27  ? 10.809 23.013 28.943  1.00 25.98  ? 27   MET B CE  1 
ATOM   1475 N  N   . GLU B 1 28  ? 11.770 27.771 29.333  1.00 24.79  ? 28   GLU B N   1 
ATOM   1476 C  CA  . GLU B 1 28  ? 10.791 28.112 28.323  1.00 26.87  ? 28   GLU B CA  1 
ATOM   1477 C  C   . GLU B 1 28  ? 10.843 27.071 27.222  1.00 27.32  ? 28   GLU B C   1 
ATOM   1478 O  O   . GLU B 1 28  ? 11.912 26.575 26.900  1.00 25.39  ? 28   GLU B O   1 
ATOM   1479 C  CB  . GLU B 1 28  ? 11.084 29.480 27.726  1.00 32.15  ? 28   GLU B CB  1 
ATOM   1480 C  CG  . GLU B 1 28  ? 10.692 30.601 28.639  1.00 36.74  ? 28   GLU B CG  1 
ATOM   1481 C  CD  . GLU B 1 28  ? 10.641 31.946 27.958  1.00 50.63  ? 28   GLU B CD  1 
ATOM   1482 O  OE1 . GLU B 1 28  ? 10.472 32.010 26.716  1.00 56.32  ? 28   GLU B OE1 1 
ATOM   1483 O  OE2 . GLU B 1 28  ? 10.763 32.951 28.684  1.00 60.30  ? 28   GLU B OE2 1 
ATOM   1484 N  N   . PRO B 1 29  ? 9.688  26.717 26.648  1.00 28.88  ? 29   PRO B N   1 
ATOM   1485 C  CA  . PRO B 1 29  ? 8.362  27.230 26.965  1.00 32.39  ? 29   PRO B CA  1 
ATOM   1486 C  C   . PRO B 1 29  ? 7.851  26.789 28.316  1.00 29.40  ? 29   PRO B C   1 
ATOM   1487 O  O   . PRO B 1 29  ? 8.260  25.746 28.822  1.00 26.79  ? 29   PRO B O   1 
ATOM   1488 C  CB  . PRO B 1 29  ? 7.481  26.682 25.830  1.00 34.98  ? 29   PRO B CB  1 
ATOM   1489 C  CG  . PRO B 1 29  ? 8.196  25.533 25.289  1.00 36.03  ? 29   PRO B CG  1 
ATOM   1490 C  CD  . PRO B 1 29  ? 9.665  25.817 25.476  1.00 32.22  ? 29   PRO B CD  1 
ATOM   1491 N  N   . ARG B 1 30  ? 6.981  27.626 28.886  1.00 33.82  ? 30   ARG B N   1 
ATOM   1492 C  CA  A ARG B 1 30  ? 6.362  27.350 30.178  0.50 35.26  ? 30   ARG B CA  1 
ATOM   1493 C  CA  B ARG B 1 30  ? 6.356  27.360 30.179  0.50 35.08  ? 30   ARG B CA  1 
ATOM   1494 C  C   . ARG B 1 30  ? 5.343  26.222 30.075  1.00 35.54  ? 30   ARG B C   1 
ATOM   1495 O  O   . ARG B 1 30  ? 4.852  25.923 28.994  1.00 36.92  ? 30   ARG B O   1 
ATOM   1496 C  CB  A ARG B 1 30  ? 5.661  28.601 30.718  0.50 41.34  ? 30   ARG B CB  1 
ATOM   1497 C  CB  B ARG B 1 30  ? 5.627  28.609 30.695  0.50 41.00  ? 30   ARG B CB  1 
ATOM   1498 C  CG  A ARG B 1 30  ? 6.607  29.615 31.318  0.50 47.69  ? 30   ARG B CG  1 
ATOM   1499 C  CG  B ARG B 1 30  ? 6.501  29.846 30.864  0.50 46.80  ? 30   ARG B CG  1 
ATOM   1500 C  CD  A ARG B 1 30  ? 7.476  28.954 32.369  0.50 47.45  ? 30   ARG B CD  1 
ATOM   1501 C  CD  B ARG B 1 30  ? 7.839  29.486 31.485  0.50 43.03  ? 30   ARG B CD  1 
ATOM   1502 N  NE  A ARG B 1 30  ? 8.205  29.931 33.157  0.50 54.66  ? 30   ARG B NE  1 
ATOM   1503 N  NE  B ARG B 1 30  ? 8.544  30.656 31.995  0.50 54.49  ? 30   ARG B NE  1 
ATOM   1504 C  CZ  A ARG B 1 30  ? 8.557  29.754 34.424  0.50 52.54  ? 30   ARG B CZ  1 
ATOM   1505 C  CZ  B ARG B 1 30  ? 9.491  30.592 32.923  0.50 53.54  ? 30   ARG B CZ  1 
ATOM   1506 N  NH1 A ARG B 1 30  ? 8.242  28.628 35.056  0.50 42.71  ? 30   ARG B NH1 1 
ATOM   1507 N  NH1 B ARG B 1 30  ? 9.815  29.410 33.436  0.50 46.86  ? 30   ARG B NH1 1 
ATOM   1508 N  NH2 A ARG B 1 30  ? 9.226  30.708 35.053  0.50 57.86  ? 30   ARG B NH2 1 
ATOM   1509 N  NH2 B ARG B 1 30  ? 10.093 31.697 33.342  0.50 56.07  ? 30   ARG B NH2 1 
ATOM   1510 N  N   . GLY B 1 31  ? 5.024  25.609 31.216  1.00 36.15  ? 31   GLY B N   1 
ATOM   1511 C  CA  . GLY B 1 31  ? 3.967  24.589 31.277  1.00 39.00  ? 31   GLY B CA  1 
ATOM   1512 C  C   . GLY B 1 31  ? 4.364  23.169 30.908  1.00 37.52  ? 31   GLY B C   1 
ATOM   1513 O  O   . GLY B 1 31  ? 3.499  22.318 30.719  1.00 39.09  ? 31   GLY B O   1 
ATOM   1514 N  N   . ILE B 1 32  ? 5.664  22.909 30.838  1.00 33.45  ? 32   ILE B N   1 
ATOM   1515 C  CA  . ILE B 1 32  ? 6.187  21.606 30.425  1.00 33.06  ? 32   ILE B CA  1 
ATOM   1516 C  C   . ILE B 1 32  ? 7.056  21.041 31.536  1.00 31.66  ? 32   ILE B C   1 
ATOM   1517 O  O   . ILE B 1 32  ? 6.766  19.974 32.073  1.00 34.56  ? 32   ILE B O   1 
ATOM   1518 C  CB  . ILE B 1 32  ? 7.054  21.718 29.154  1.00 34.46  ? 32   ILE B CB  1 
ATOM   1519 C  CG1 . ILE B 1 32  ? 6.259  22.385 28.021  1.00 37.42  ? 32   ILE B CG1 1 
ATOM   1520 C  CG2 . ILE B 1 32  ? 7.565  20.333 28.745  1.00 37.28  ? 32   ILE B CG2 1 
ATOM   1521 C  CD1 . ILE B 1 32  ? 7.053  22.514 26.759  1.00 48.69  ? 32   ILE B CD1 1 
ATOM   1522 N  N   . ASP B 1 33  ? 8.143  21.740 31.839  1.00 27.43  ? 33   ASP B N   1 
ATOM   1523 C  CA  . ASP B 1 33  ? 9.014  21.403 32.977  1.00 26.82  ? 33   ASP B CA  1 
ATOM   1524 C  C   . ASP B 1 33  ? 8.345  21.839 34.296  1.00 26.71  ? 33   ASP B C   1 
ATOM   1525 O  O   . ASP B 1 33  ? 7.654  22.862 34.369  1.00 27.90  ? 33   ASP B O   1 
ATOM   1526 C  CB  . ASP B 1 33  ? 10.381 22.099 32.797  1.00 23.86  ? 33   ASP B CB  1 
ATOM   1527 C  CG  . ASP B 1 33  ? 11.481 21.595 33.794  1.00 34.57  ? 33   ASP B CG  1 
ATOM   1528 O  OD1 . ASP B 1 33  ? 11.574 20.372 34.055  1.00 25.99  ? 33   ASP B OD1 1 
ATOM   1529 O  OD2 . ASP B 1 33  ? 12.244 22.446 34.331  1.00 31.40  ? 33   ASP B OD2 1 
ATOM   1530 N  N   . LEU B 1 34  ? 8.556  21.072 35.353  1.00 27.27  ? 34   LEU B N   1 
ATOM   1531 C  CA  . LEU B 1 34  ? 8.112  21.469 36.686  1.00 24.99  ? 34   LEU B CA  1 
ATOM   1532 C  C   . LEU B 1 34  ? 8.655  22.879 37.005  1.00 24.54  ? 34   LEU B C   1 
ATOM   1533 O  O   . LEU B 1 34  ? 9.830  23.169 36.730  1.00 22.86  ? 34   LEU B O   1 
ATOM   1534 C  CB  . LEU B 1 34  ? 8.551  20.408 37.695  1.00 26.29  ? 34   LEU B CB  1 
ATOM   1535 C  CG  . LEU B 1 34  ? 8.178  20.639 39.164  1.00 24.44  ? 34   LEU B CG  1 
ATOM   1536 C  CD1 . LEU B 1 34  ? 6.689  20.409 39.314  1.00 26.31  ? 34   LEU B CD1 1 
ATOM   1537 C  CD2 . LEU B 1 34  ? 8.967  19.746 40.115  1.00 26.95  ? 34   LEU B CD2 1 
ATOM   1538 N  N   . ALA B 1 35  ? 7.817  23.768 37.532  1.00 24.54  ? 35   ALA B N   1 
ATOM   1539 C  CA  . ALA B 1 35  ? 8.254  25.148 37.814  1.00 23.45  ? 35   ALA B CA  1 
ATOM   1540 C  C   . ALA B 1 35  ? 9.329  25.134 38.914  1.00 20.30  ? 35   ALA B C   1 
ATOM   1541 O  O   . ALA B 1 35  ? 9.273  24.314 39.810  1.00 24.01  ? 35   ALA B O   1 
ATOM   1542 C  CB  . ALA B 1 35  ? 7.076  26.039 38.197  1.00 25.17  ? 35   ALA B CB  1 
ATOM   1543 N  N   . ALA B 1 36  ? 10.302 26.044 38.817  1.00 23.47  ? 36   ALA B N   1 
ATOM   1544 C  CA  . ALA B 1 36  ? 11.466 26.100 39.722  1.00 21.72  ? 36   ALA B CA  1 
ATOM   1545 C  C   . ALA B 1 36  ? 11.052 26.155 41.184  1.00 21.60  ? 36   ALA B C   1 
ATOM   1546 O  O   . ALA B 1 36  ? 11.663 25.508 42.049  1.00 23.20  ? 36   ALA B O   1 
ATOM   1547 C  CB  . ALA B 1 36  ? 12.348 27.320 39.384  1.00 25.23  ? 36   ALA B CB  1 
ATOM   1548 N  N   . SER B 1 37  ? 10.013 26.937 41.485  1.00 21.65  ? 37   SER B N   1 
ATOM   1549 C  CA  . SER B 1 37  ? 9.625  27.111 42.879  1.00 24.96  ? 37   SER B CA  1 
ATOM   1550 C  C   . SER B 1 37  ? 9.089  25.816 43.538  1.00 24.29  ? 37   SER B C   1 
ATOM   1551 O  O   . SER B 1 37  ? 9.104  25.687 44.779  1.00 26.51  ? 37   SER B O   1 
ATOM   1552 C  CB  . SER B 1 37  ? 8.650  28.288 43.021  1.00 26.35  ? 37   SER B CB  1 
ATOM   1553 O  OG  . SER B 1 37  ? 7.401  27.895 42.586  1.00 35.79  ? 37   SER B OG  1 
ATOM   1554 N  N   . LEU B 1 38  ? 8.649  24.862 42.726  1.00 24.09  ? 38   LEU B N   1 
ATOM   1555 C  CA  . LEU B 1 38  ? 8.115  23.576 43.184  1.00 23.74  ? 38   LEU B CA  1 
ATOM   1556 C  C   . LEU B 1 38  ? 9.154  22.488 43.244  1.00 24.44  ? 38   LEU B C   1 
ATOM   1557 O  O   . LEU B 1 38  ? 8.834  21.388 43.658  1.00 23.97  ? 38   LEU B O   1 
ATOM   1558 C  CB  . LEU B 1 38  ? 7.027  23.086 42.227  1.00 24.38  ? 38   LEU B CB  1 
ATOM   1559 C  CG  . LEU B 1 38  ? 5.834  24.025 42.089  1.00 30.52  ? 38   LEU B CG  1 
ATOM   1560 C  CD1 . LEU B 1 38  ? 4.914  23.484 41.029  1.00 24.02  ? 38   LEU B CD1 1 
ATOM   1561 C  CD2 . LEU B 1 38  ? 5.124  24.153 43.399  1.00 32.85  ? 38   LEU B CD2 1 
ATOM   1562 N  N   . ALA B 1 39  ? 10.377 22.796 42.805  1.00 22.30  ? 39   ALA B N   1 
ATOM   1563 C  CA  . ALA B 1 39  ? 11.419 21.806 42.586  1.00 20.88  ? 39   ALA B CA  1 
ATOM   1564 C  C   . ALA B 1 39  ? 12.513 22.022 43.589  1.00 21.95  ? 39   ALA B C   1 
ATOM   1565 O  O   . ALA B 1 39  ? 12.610 23.110 44.178  1.00 22.65  ? 39   ALA B O   1 
ATOM   1566 C  CB  . ALA B 1 39  ? 11.970 21.937 41.182  1.00 19.84  ? 39   ALA B CB  1 
ATOM   1567 N  N   . ASP B 1 40  ? 13.339 20.993 43.771  1.00 18.56  ? 40   ASP B N   1 
ATOM   1568 C  CA  . ASP B 1 40  ? 14.563 21.089 44.595  1.00 20.08  ? 40   ASP B CA  1 
ATOM   1569 C  C   . ASP B 1 40  ? 15.867 20.950 43.819  1.00 19.16  ? 40   ASP B C   1 
ATOM   1570 O  O   . ASP B 1 40  ? 16.894 21.495 44.251  1.00 21.96  ? 40   ASP B O   1 
ATOM   1571 C  CB  . ASP B 1 40  ? 14.509 20.051 45.682  1.00 21.16  ? 40   ASP B CB  1 
ATOM   1572 C  CG  . ASP B 1 40  ? 13.436 20.387 46.732  1.00 22.11  ? 40   ASP B CG  1 
ATOM   1573 O  OD1 . ASP B 1 40  ? 13.615 21.366 47.530  1.00 24.09  ? 40   ASP B OD1 1 
ATOM   1574 O  OD2 . ASP B 1 40  ? 12.390 19.702 46.679  1.00 25.84  ? 40   ASP B OD2 1 
ATOM   1575 N  N   . ILE B 1 41  ? 15.815 20.265 42.672  1.00 19.93  ? 41   ILE B N   1 
ATOM   1576 C  CA  . ILE B 1 41  ? 16.967 20.077 41.788  1.00 16.05  ? 41   ILE B CA  1 
ATOM   1577 C  C   . ILE B 1 41  ? 16.535 20.156 40.339  1.00 19.76  ? 41   ILE B C   1 
ATOM   1578 O  O   . ILE B 1 41  ? 15.339 20.016 40.029  1.00 20.87  ? 41   ILE B O   1 
ATOM   1579 C  CB  . ILE B 1 41  ? 17.688 18.751 41.997  1.00 16.04  ? 41   ILE B CB  1 
ATOM   1580 C  CG1 . ILE B 1 41  ? 16.801 17.551 41.697  1.00 19.16  ? 41   ILE B CG1 1 
ATOM   1581 C  CG2 . ILE B 1 41  ? 18.173 18.602 43.484  1.00 19.66  ? 41   ILE B CG2 1 
ATOM   1582 C  CD1 . ILE B 1 41  ? 17.519 16.201 41.780  1.00 21.04  ? 41   ILE B CD1 1 
ATOM   1583 N  N   . HIS B 1 42  ? 17.515 20.399 39.482  1.00 18.36  ? 42   HIS B N   1 
ATOM   1584 C  CA  . HIS B 1 42  ? 17.387 20.114 38.024  1.00 18.23  ? 42   HIS B CA  1 
ATOM   1585 C  C   . HIS B 1 42  ? 18.297 18.956 37.765  1.00 17.36  ? 42   HIS B C   1 
ATOM   1586 O  O   . HIS B 1 42  ? 19.502 19.013 38.051  1.00 21.79  ? 42   HIS B O   1 
ATOM   1587 C  CB  . HIS B 1 42  ? 17.802 21.313 37.211  1.00 19.06  ? 42   HIS B CB  1 
ATOM   1588 C  CG  . HIS B 1 42  ? 17.399 21.232 35.772  1.00 18.99  ? 42   HIS B CG  1 
ATOM   1589 N  ND1 . HIS B 1 42  ? 16.085 21.209 35.375  1.00 18.60  ? 42   HIS B ND1 1 
ATOM   1590 C  CD2 . HIS B 1 42  ? 18.136 21.206 34.635  1.00 20.25  ? 42   HIS B CD2 1 
ATOM   1591 C  CE1 . HIS B 1 42  ? 16.026 21.170 34.054  1.00 19.97  ? 42   HIS B CE1 1 
ATOM   1592 N  NE2 . HIS B 1 42  ? 17.255 21.165 33.585  1.00 21.37  ? 42   HIS B NE2 1 
ATOM   1593 N  N   . LEU B 1 43  ? 17.715 17.855 37.375  1.00 16.73  ? 43   LEU B N   1 
ATOM   1594 C  CA  . LEU B 1 43  ? 18.455 16.686 36.939  1.00 19.40  ? 43   LEU B CA  1 
ATOM   1595 C  C   . LEU B 1 43  ? 18.803 16.785 35.437  1.00 16.06  ? 43   LEU B C   1 
ATOM   1596 O  O   . LEU B 1 43  ? 17.914 17.049 34.600  1.00 18.18  ? 43   LEU B O   1 
ATOM   1597 C  CB  . LEU B 1 43  ? 17.613 15.446 37.190  1.00 17.77  ? 43   LEU B CB  1 
ATOM   1598 C  CG  . LEU B 1 43  ? 18.187 14.080 36.820  1.00 22.96  ? 43   LEU B CG  1 
ATOM   1599 C  CD1 . LEU B 1 43  ? 19.478 13.750 37.573  1.00 20.34  ? 43   LEU B CD1 1 
ATOM   1600 C  CD2 . LEU B 1 43  ? 17.120 13.014 37.015  1.00 21.09  ? 43   LEU B CD2 1 
ATOM   1601 N  N   . GLU B 1 44  ? 20.069 16.535 35.109  1.00 18.46  ? 44   GLU B N   1 
ATOM   1602 C  CA  . GLU B 1 44  ? 20.538 16.508 33.682  1.00 18.13  ? 44   GLU B CA  1 
ATOM   1603 C  C   . GLU B 1 44  ? 21.176 15.180 33.371  1.00 18.83  ? 44   GLU B C   1 
ATOM   1604 O  O   . GLU B 1 44  ? 21.988 14.641 34.160  1.00 21.47  ? 44   GLU B O   1 
ATOM   1605 C  CB  . GLU B 1 44  ? 21.571 17.627 33.398  1.00 17.53  ? 44   GLU B CB  1 
ATOM   1606 C  CG  . GLU B 1 44  ? 20.981 18.987 33.616  1.00 18.98  ? 44   GLU B CG  1 
ATOM   1607 C  CD  . GLU B 1 44  ? 21.893 20.142 33.359  1.00 23.32  ? 44   GLU B CD  1 
ATOM   1608 O  OE1 . GLU B 1 44  ? 23.087 19.897 33.052  1.00 29.56  ? 44   GLU B OE1 1 
ATOM   1609 O  OE2 . GLU B 1 44  ? 21.392 21.300 33.468  1.00 24.75  ? 44   GLU B OE2 1 
ATOM   1610 N  N   . ALA B 1 45  ? 20.833 14.657 32.187  1.00 18.95  ? 45   ALA B N   1 
ATOM   1611 C  CA  . ALA B 1 45  ? 21.573 13.582 31.584  1.00 17.85  ? 45   ALA B CA  1 
ATOM   1612 C  C   . ALA B 1 45  ? 22.485 14.234 30.521  1.00 17.22  ? 45   ALA B C   1 
ATOM   1613 O  O   . ALA B 1 45  ? 22.014 14.977 29.627  1.00 19.38  ? 45   ALA B O   1 
ATOM   1614 C  CB  . ALA B 1 45  ? 20.640 12.559 30.991  1.00 16.32  ? 45   ALA B CB  1 
ATOM   1615 N  N   . ASP B 1 46  ? 23.775 13.991 30.682  1.00 16.69  ? 46   ASP B N   1 
ATOM   1616 C  CA  . ASP B 1 46  ? 24.843 14.516 29.796  1.00 17.78  ? 46   ASP B CA  1 
ATOM   1617 C  C   . ASP B 1 46  ? 25.230 13.356 28.926  1.00 16.77  ? 46   ASP B C   1 
ATOM   1618 O  O   . ASP B 1 46  ? 25.907 12.419 29.387  1.00 18.65  ? 46   ASP B O   1 
ATOM   1619 C  CB  . ASP B 1 46  ? 26.058 14.981 30.607  1.00 22.39  ? 46   ASP B CB  1 
ATOM   1620 C  CG  . ASP B 1 46  ? 25.998 16.446 31.009  1.00 27.16  ? 46   ASP B CG  1 
ATOM   1621 O  OD1 . ASP B 1 46  ? 25.356 17.286 30.332  1.00 29.27  ? 46   ASP B OD1 1 
ATOM   1622 O  OD2 . ASP B 1 46  ? 26.622 16.758 32.060  1.00 37.12  ? 46   ASP B OD2 1 
ATOM   1623 N  N   . ILE B 1 47  ? 24.855 13.432 27.637  1.00 18.59  ? 47   ILE B N   1 
ATOM   1624 C  CA  . ILE B 1 47  ? 25.029 12.340 26.689  1.00 18.96  ? 47   ILE B CA  1 
ATOM   1625 C  C   . ILE B 1 47  ? 25.726 12.838 25.417  1.00 15.08  ? 47   ILE B C   1 
ATOM   1626 O  O   . ILE B 1 47  ? 25.189 13.666 24.683  1.00 19.20  ? 47   ILE B O   1 
ATOM   1627 C  CB  . ILE B 1 47  ? 23.646 11.702 26.318  1.00 18.25  ? 47   ILE B CB  1 
ATOM   1628 C  CG1 . ILE B 1 47  ? 22.896 11.327 27.590  1.00 18.42  ? 47   ILE B CG1 1 
ATOM   1629 C  CG2 . ILE B 1 47  ? 23.843 10.436 25.478  1.00 18.77  ? 47   ILE B CG2 1 
ATOM   1630 C  CD1 . ILE B 1 47  ? 21.540 10.601 27.364  1.00 20.17  ? 47   ILE B CD1 1 
ATOM   1631 N  N   . HIS B 1 48  ? 26.965 12.391 25.224  1.00 15.84  ? 48   HIS B N   1 
ATOM   1632 C  CA  . HIS B 1 48  ? 27.766 12.778 24.065  1.00 17.25  ? 48   HIS B CA  1 
ATOM   1633 C  C   . HIS B 1 48  ? 28.410 11.609 23.415  1.00 17.05  ? 48   HIS B C   1 
ATOM   1634 O  O   . HIS B 1 48  ? 28.668 10.607 24.051  1.00 19.54  ? 48   HIS B O   1 
ATOM   1635 C  CB  . HIS B 1 48  ? 28.841 13.808 24.471  1.00 19.62  ? 48   HIS B CB  1 
ATOM   1636 C  CG  . HIS B 1 48  ? 28.258 15.023 25.109  1.00 20.34  ? 48   HIS B CG  1 
ATOM   1637 N  ND1 . HIS B 1 48  ? 27.900 15.045 26.441  1.00 17.08  ? 48   HIS B ND1 1 
ATOM   1638 C  CD2 . HIS B 1 48  ? 27.878 16.212 24.586  1.00 19.77  ? 48   HIS B CD2 1 
ATOM   1639 C  CE1 . HIS B 1 48  ? 27.343 16.219 26.714  1.00 22.20  ? 48   HIS B CE1 1 
ATOM   1640 N  NE2 . HIS B 1 48  ? 27.311 16.939 25.603  1.00 19.98  ? 48   HIS B NE2 1 
ATOM   1641 N  N   . ALA B 1 49  ? 28.672 11.757 22.111  1.00 16.36  ? 49   ALA B N   1 
ATOM   1642 C  CA  . ALA B 1 49  ? 29.412 10.732 21.392  1.00 17.11  ? 49   ALA B CA  1 
ATOM   1643 C  C   . ALA B 1 49  ? 30.822 10.504 21.866  1.00 17.72  ? 49   ALA B C   1 
ATOM   1644 O  O   . ALA B 1 49  ? 31.553 11.435 22.177  1.00 18.77  ? 49   ALA B O   1 
ATOM   1645 C  CB  . ALA B 1 49  ? 29.405 11.029 19.892  1.00 16.76  ? 49   ALA B CB  1 
ATOM   1646 N  N   . LEU B 1 50  ? 31.188 9.228  21.953  1.00 19.40  ? 50   LEU B N   1 
ATOM   1647 C  CA  . LEU B 1 50  ? 32.545 8.799  22.160  1.00 22.92  ? 50   LEU B CA  1 
ATOM   1648 C  C   . LEU B 1 50  ? 33.301 8.856  20.848  1.00 20.50  ? 50   LEU B C   1 
ATOM   1649 O  O   . LEU B 1 50  ? 32.707 9.146  19.785  1.00 20.44  ? 50   LEU B O   1 
ATOM   1650 C  CB  . LEU B 1 50  ? 32.526 7.331  22.621  1.00 23.02  ? 50   LEU B CB  1 
ATOM   1651 C  CG  . LEU B 1 50  ? 31.721 7.100  23.881  1.00 25.69  ? 50   LEU B CG  1 
ATOM   1652 C  CD1 . LEU B 1 50  ? 31.511 5.594  24.121  1.00 25.65  ? 50   LEU B CD1 1 
ATOM   1653 C  CD2 . LEU B 1 50  ? 32.452 7.819  24.969  1.00 24.17  ? 50   LEU B CD2 1 
ATOM   1654 N  N   . LYS B 1 51  ? 34.594 8.521  20.904  1.00 20.11  ? 51   LYS B N   1 
ATOM   1655 C  CA  . LYS B 1 51  ? 35.362 8.287  19.686  1.00 20.68  ? 51   LYS B CA  1 
ATOM   1656 C  C   . LYS B 1 51  ? 34.749 7.100  18.920  1.00 21.32  ? 51   LYS B C   1 
ATOM   1657 O  O   . LYS B 1 51  ? 34.267 6.138  19.545  1.00 22.57  ? 51   LYS B O   1 
ATOM   1658 C  CB  . LYS B 1 51  ? 36.806 7.930  20.039  1.00 23.05  ? 51   LYS B CB  1 
ATOM   1659 C  CG  . LYS B 1 51  ? 37.605 9.072  20.664  1.00 26.74  ? 51   LYS B CG  1 
ATOM   1660 C  CD  . LYS B 1 51  ? 38.973 8.574  21.179  1.00 27.37  ? 51   LYS B CD  1 
ATOM   1661 C  CE  . LYS B 1 51  ? 39.936 9.697  21.504  1.00 34.07  ? 51   LYS B CE  1 
ATOM   1662 N  NZ  . LYS B 1 51  ? 39.393 10.544 22.588  1.00 33.59  ? 51   LYS B NZ  1 
ATOM   1663 N  N   . ASN B 1 52  ? 34.817 7.168  17.595  1.00 22.36  ? 52   ASN B N   1 
ATOM   1664 C  CA  . ASN B 1 52  ? 34.379 6.086  16.706  1.00 22.61  ? 52   ASN B CA  1 
ATOM   1665 C  C   . ASN B 1 52  ? 32.911 5.671  16.888  1.00 22.89  ? 52   ASN B C   1 
ATOM   1666 O  O   . ASN B 1 52  ? 32.556 4.503  16.731  1.00 24.05  ? 52   ASN B O   1 
ATOM   1667 C  CB  . ASN B 1 52  ? 35.346 4.916  16.821  1.00 20.15  ? 52   ASN B CB  1 
ATOM   1668 C  CG  . ASN B 1 52  ? 36.564 5.110  15.942  1.00 21.64  ? 52   ASN B CG  1 
ATOM   1669 O  OD1 . ASN B 1 52  ? 36.431 5.415  14.757  1.00 25.79  ? 52   ASN B OD1 1 
ATOM   1670 N  ND2 . ASN B 1 52  ? 37.745 4.960  16.505  1.00 27.47  ? 52   ASN B ND2 1 
ATOM   1671 N  N   . ASN B 1 53  ? 32.064 6.656  17.200  1.00 20.97  ? 53   ASN B N   1 
ATOM   1672 C  CA  . ASN B 1 53  ? 30.643 6.413  17.404  1.00 20.22  ? 53   ASN B CA  1 
ATOM   1673 C  C   . ASN B 1 53  ? 30.123 5.673  16.177  1.00 20.72  ? 53   ASN B C   1 
ATOM   1674 O  O   . ASN B 1 53  ? 30.411 6.052  15.046  1.00 21.81  ? 53   ASN B O   1 
ATOM   1675 C  CB  . ASN B 1 53  ? 29.908 7.749  17.626  1.00 20.96  ? 53   ASN B CB  1 
ATOM   1676 C  CG  . ASN B 1 53  ? 28.441 7.590  17.685  1.00 17.50  ? 53   ASN B CG  1 
ATOM   1677 O  OD1 . ASN B 1 53  ? 27.798 7.514  16.653  1.00 17.94  ? 53   ASN B OD1 1 
ATOM   1678 N  ND2 . ASN B 1 53  ? 27.874 7.508  18.888  1.00 18.78  ? 53   ASN B ND2 1 
ATOM   1679 N  N   . PRO B 1 54  ? 29.379 4.586  16.404  1.00 23.41  ? 54   PRO B N   1 
ATOM   1680 C  CA  . PRO B 1 54  ? 29.062 3.694  15.286  1.00 24.57  ? 54   PRO B CA  1 
ATOM   1681 C  C   . PRO B 1 54  ? 27.889 4.204  14.466  1.00 23.79  ? 54   PRO B C   1 
ATOM   1682 O  O   . PRO B 1 54  ? 27.589 3.640  13.401  1.00 27.19  ? 54   PRO B O   1 
ATOM   1683 C  CB  . PRO B 1 54  ? 28.672 2.387  15.990  1.00 27.63  ? 54   PRO B CB  1 
ATOM   1684 C  CG  . PRO B 1 54  ? 28.108 2.812  17.308  1.00 25.05  ? 54   PRO B CG  1 
ATOM   1685 C  CD  . PRO B 1 54  ? 28.970 4.004  17.699  1.00 25.19  ? 54   PRO B CD  1 
ATOM   1686 N  N   . ASN B 1 55  ? 27.225 5.265  14.951  1.00 20.02  ? 55   ASN B N   1 
ATOM   1687 C  CA  . ASN B 1 55  ? 26.113 5.881  14.211  1.00 20.43  ? 55   ASN B CA  1 
ATOM   1688 C  C   . ASN B 1 55  ? 26.504 7.206  13.546  1.00 21.64  ? 55   ASN B C   1 
ATOM   1689 O  O   . ASN B 1 55  ? 25.658 7.929  13.056  1.00 23.42  ? 55   ASN B O   1 
ATOM   1690 C  CB  . ASN B 1 55  ? 24.922 6.033  15.149  1.00 19.06  ? 55   ASN B CB  1 
ATOM   1691 C  CG  . ASN B 1 55  ? 24.529 4.704  15.794  1.00 19.46  ? 55   ASN B CG  1 
ATOM   1692 O  OD1 . ASN B 1 55  ? 24.685 4.502  17.005  1.00 28.03  ? 55   ASN B OD1 1 
ATOM   1693 N  ND2 . ASN B 1 55  ? 24.059 3.774  14.952  1.00 22.20  ? 55   ASN B ND2 1 
ATOM   1694 N  N   . GLY B 1 56  ? 27.804 7.472  13.457  1.00 20.85  ? 56   GLY B N   1 
ATOM   1695 C  CA  . GLY B 1 56  ? 28.326 8.602  12.711  1.00 20.38  ? 56   GLY B CA  1 
ATOM   1696 C  C   . GLY B 1 56  ? 28.456 9.908  13.470  1.00 19.82  ? 56   GLY B C   1 
ATOM   1697 O  O   . GLY B 1 56  ? 28.883 10.929 12.908  1.00 19.25  ? 56   GLY B O   1 
ATOM   1698 N  N   . PHE B 1 57  ? 28.105 9.931  14.744  1.00 16.39  ? 57   PHE B N   1 
ATOM   1699 C  CA  . PHE B 1 57  ? 28.232 11.206 15.449  1.00 17.72  ? 57   PHE B CA  1 
ATOM   1700 C  C   . PHE B 1 57  ? 29.661 11.542 15.820  1.00 18.99  ? 57   PHE B C   1 
ATOM   1701 O  O   . PHE B 1 57  ? 30.352 10.727 16.439  1.00 20.62  ? 57   PHE B O   1 
ATOM   1702 C  CB  . PHE B 1 57  ? 27.402 11.200 16.716  1.00 15.16  ? 57   PHE B CB  1 
ATOM   1703 C  CG  . PHE B 1 57  ? 25.968 11.486 16.454  1.00 17.46  ? 57   PHE B CG  1 
ATOM   1704 C  CD1 . PHE B 1 57  ? 25.116 10.485 16.053  1.00 19.18  ? 57   PHE B CD1 1 
ATOM   1705 C  CD2 . PHE B 1 57  ? 25.497 12.798 16.562  1.00 26.45  ? 57   PHE B CD2 1 
ATOM   1706 C  CE1 . PHE B 1 57  ? 23.761 10.804 15.779  1.00 22.89  ? 57   PHE B CE1 1 
ATOM   1707 C  CE2 . PHE B 1 57  ? 24.172 13.097 16.268  1.00 25.66  ? 57   PHE B CE2 1 
ATOM   1708 C  CZ  . PHE B 1 57  ? 23.342 12.098 15.874  1.00 20.07  ? 57   PHE B CZ  1 
ATOM   1709 N  N   . PRO B 1 58  ? 30.094 12.772 15.489  1.00 19.37  ? 58   PRO B N   1 
ATOM   1710 C  CA  . PRO B 1 58  ? 31.445 13.160 15.860  1.00 15.89  ? 58   PRO B CA  1 
ATOM   1711 C  C   . PRO B 1 58  ? 31.700 13.123 17.347  1.00 18.49  ? 58   PRO B C   1 
ATOM   1712 O  O   . PRO B 1 58  ? 30.827 13.468 18.157  1.00 16.88  ? 58   PRO B O   1 
ATOM   1713 C  CB  . PRO B 1 58  ? 31.499 14.619 15.414  1.00 19.09  ? 58   PRO B CB  1 
ATOM   1714 C  CG  . PRO B 1 58  ? 30.593 14.651 14.183  1.00 20.34  ? 58   PRO B CG  1 
ATOM   1715 C  CD  . PRO B 1 58  ? 29.438 13.833 14.704  1.00 19.53  ? 58   PRO B CD  1 
ATOM   1716 N  N   . GLU B 1 59  ? 32.916 12.745 17.701  1.00 19.91  ? 59   GLU B N   1 
ATOM   1717 C  CA  . GLU B 1 59  ? 33.309 12.735 19.097  1.00 18.99  ? 59   GLU B CA  1 
ATOM   1718 C  C   . GLU B 1 59  ? 32.927 14.042 19.783  1.00 18.79  ? 59   GLU B C   1 
ATOM   1719 O  O   . GLU B 1 59  ? 33.248 15.123 19.272  1.00 18.67  ? 59   GLU B O   1 
ATOM   1720 C  CB  . GLU B 1 59  ? 34.831 12.543 19.222  1.00 20.90  ? 59   GLU B CB  1 
ATOM   1721 C  CG  . GLU B 1 59  ? 35.212 12.330 20.660  1.00 21.52  ? 59   GLU B CG  1 
ATOM   1722 C  CD  . GLU B 1 59  ? 36.709 12.270 20.915  1.00 26.50  ? 59   GLU B CD  1 
ATOM   1723 O  OE1 . GLU B 1 59  ? 37.497 12.523 19.990  1.00 22.84  ? 59   GLU B OE1 1 
ATOM   1724 O  OE2 . GLU B 1 59  ? 37.095 11.975 22.082  1.00 26.54  ? 59   GLU B OE2 1 
ATOM   1725 N  N   . GLY B 1 60  ? 32.266 13.931 20.943  1.00 17.82  ? 60   GLY B N   1 
ATOM   1726 C  CA  . GLY B 1 60  ? 31.907 15.105 21.752  1.00 18.40  ? 60   GLY B CA  1 
ATOM   1727 C  C   . GLY B 1 60  ? 30.560 15.716 21.437  1.00 18.58  ? 60   GLY B C   1 
ATOM   1728 O  O   . GLY B 1 60  ? 30.024 16.489 22.248  1.00 18.50  ? 60   GLY B O   1 
ATOM   1729 N  N   . PHE B 1 61  ? 30.027 15.426 20.247  1.00 17.51  ? 61   PHE B N   1 
ATOM   1730 C  CA  . PHE B 1 61  ? 28.688 15.940 19.885  1.00 17.59  ? 61   PHE B CA  1 
ATOM   1731 C  C   . PHE B 1 61  ? 27.629 15.447 20.866  1.00 16.32  ? 61   PHE B C   1 
ATOM   1732 O  O   . PHE B 1 61  ? 27.640 14.286 21.290  1.00 17.06  ? 61   PHE B O   1 
ATOM   1733 C  CB  . PHE B 1 61  ? 28.255 15.541 18.466  1.00 17.72  ? 61   PHE B CB  1 
ATOM   1734 C  CG  . PHE B 1 61  ? 28.654 16.519 17.385  1.00 21.66  ? 61   PHE B CG  1 
ATOM   1735 C  CD1 . PHE B 1 61  ? 29.767 17.341 17.525  1.00 18.36  ? 61   PHE B CD1 1 
ATOM   1736 C  CD2 . PHE B 1 61  ? 27.887 16.630 16.222  1.00 20.23  ? 61   PHE B CD2 1 
ATOM   1737 C  CE1 . PHE B 1 61  ? 30.098 18.239 16.512  1.00 21.38  ? 61   PHE B CE1 1 
ATOM   1738 C  CE2 . PHE B 1 61  ? 28.220 17.514 15.201  1.00 18.62  ? 61   PHE B CE2 1 
ATOM   1739 C  CZ  . PHE B 1 61  ? 29.307 18.316 15.345  1.00 19.17  ? 61   PHE B CZ  1 
ATOM   1740 N  N   . TRP B 1 62  ? 26.687 16.332 21.161  1.00 17.37  ? 62   TRP B N   1 
ATOM   1741 C  CA  . TRP B 1 62  ? 25.495 15.971 21.900  1.00 18.59  ? 62   TRP B CA  1 
ATOM   1742 C  C   . TRP B 1 62  ? 24.691 14.968 21.081  1.00 17.44  ? 62   TRP B C   1 
ATOM   1743 O  O   . TRP B 1 62  ? 24.584 15.076 19.852  1.00 20.67  ? 62   TRP B O   1 
ATOM   1744 C  CB  . TRP B 1 62  ? 24.681 17.209 22.194  1.00 18.42  ? 62   TRP B CB  1 
ATOM   1745 C  CG  . TRP B 1 62  ? 23.447 16.932 23.022  1.00 15.79  ? 62   TRP B CG  1 
ATOM   1746 C  CD1 . TRP B 1 62  ? 23.413 16.402 24.278  1.00 21.65  ? 62   TRP B CD1 1 
ATOM   1747 C  CD2 . TRP B 1 62  ? 22.101 17.196 22.657  1.00 18.60  ? 62   TRP B CD2 1 
ATOM   1748 N  NE1 . TRP B 1 62  ? 22.121 16.307 24.711  1.00 17.37  ? 62   TRP B NE1 1 
ATOM   1749 C  CE2 . TRP B 1 62  ? 21.291 16.806 23.740  1.00 17.92  ? 62   TRP B CE2 1 
ATOM   1750 C  CE3 . TRP B 1 62  ? 21.505 17.765 21.546  1.00 17.58  ? 62   TRP B CE3 1 
ATOM   1751 C  CZ2 . TRP B 1 62  ? 19.910 16.928 23.720  1.00 20.49  ? 62   TRP B CZ2 1 
ATOM   1752 C  CZ3 . TRP B 1 62  ? 20.102 17.891 21.509  1.00 21.94  ? 62   TRP B CZ3 1 
ATOM   1753 C  CH2 . TRP B 1 62  ? 19.328 17.481 22.609  1.00 17.45  ? 62   TRP B CH2 1 
ATOM   1754 N  N   . MET B 1 63  ? 24.157 13.958 21.756  1.00 18.36  ? 63   MET B N   1 
ATOM   1755 C  CA  . MET B 1 63  ? 23.307 12.973 21.115  1.00 17.67  ? 63   MET B CA  1 
ATOM   1756 C  C   . MET B 1 63  ? 21.850 13.419 21.167  1.00 18.28  ? 63   MET B C   1 
ATOM   1757 O  O   . MET B 1 63  ? 21.217 13.407 22.244  1.00 19.40  ? 63   MET B O   1 
ATOM   1758 C  CB  . MET B 1 63  ? 23.473 11.608 21.786  1.00 17.78  ? 63   MET B CB  1 
ATOM   1759 C  CG  . MET B 1 63  ? 24.894 11.123 21.857  1.00 19.13  ? 63   MET B CG  1 
ATOM   1760 S  SD  . MET B 1 63  ? 25.577 10.751 20.240  1.00 22.91  ? 63   MET B SD  1 
ATOM   1761 C  CE  . MET B 1 63  ? 24.456 9.484  19.647  1.00 21.90  ? 63   MET B CE  1 
ATOM   1762 N  N   . PRO B 1 64  ? 21.284 13.784 20.008  1.00 19.36  ? 64   PRO B N   1 
ATOM   1763 C  CA  . PRO B 1 64  ? 19.947 14.390 19.964  1.00 18.88  ? 64   PRO B CA  1 
ATOM   1764 C  C   . PRO B 1 64  ? 18.850 13.376 19.649  1.00 17.97  ? 64   PRO B C   1 
ATOM   1765 O  O   . PRO B 1 64  ? 19.134 12.224 19.324  1.00 17.10  ? 64   PRO B O   1 
ATOM   1766 C  CB  . PRO B 1 64  ? 20.092 15.369 18.827  1.00 21.44  ? 64   PRO B CB  1 
ATOM   1767 C  CG  . PRO B 1 64  ? 20.884 14.548 17.812  1.00 20.61  ? 64   PRO B CG  1 
ATOM   1768 C  CD  . PRO B 1 64  ? 21.869 13.760 18.640  1.00 20.67  ? 64   PRO B CD  1 
ATOM   1769 N  N   . TYR B 1 65  ? 17.606 13.797 19.851  1.00 18.61  ? 65   TYR B N   1 
ATOM   1770 C  CA  . TYR B 1 65  ? 16.394 13.031 19.497  1.00 18.48  ? 65   TYR B CA  1 
ATOM   1771 C  C   . TYR B 1 65  ? 16.222 11.747 20.314  1.00 18.95  ? 65   TYR B C   1 
ATOM   1772 O  O   . TYR B 1 65  ? 15.492 10.860 19.888  1.00 18.13  ? 65   TYR B O   1 
ATOM   1773 C  CB  . TYR B 1 65  ? 16.306 12.756 17.983  1.00 22.16  ? 65   TYR B CB  1 
ATOM   1774 C  CG  . TYR B 1 65  ? 16.188 14.002 17.143  1.00 18.61  ? 65   TYR B CG  1 
ATOM   1775 C  CD1 . TYR B 1 65  ? 14.959 14.583 16.854  1.00 24.47  ? 65   TYR B CD1 1 
ATOM   1776 C  CD2 . TYR B 1 65  ? 17.306 14.592 16.620  1.00 20.00  ? 65   TYR B CD2 1 
ATOM   1777 C  CE1 . TYR B 1 65  ? 14.879 15.725 16.064  1.00 24.44  ? 65   TYR B CE1 1 
ATOM   1778 C  CE2 . TYR B 1 65  ? 17.241 15.714 15.885  1.00 21.35  ? 65   TYR B CE2 1 
ATOM   1779 C  CZ  . TYR B 1 65  ? 16.046 16.294 15.582  1.00 18.73  ? 65   TYR B CZ  1 
ATOM   1780 O  OH  . TYR B 1 65  ? 16.014 17.417 14.792  1.00 20.97  ? 65   TYR B OH  1 
ATOM   1781 N  N   . LEU B 1 66  ? 16.896 11.642 21.480  1.00 16.87  ? 66   LEU B N   1 
ATOM   1782 C  CA  . LEU B 1 66  ? 16.762 10.449 22.321  1.00 16.68  ? 66   LEU B CA  1 
ATOM   1783 C  C   . LEU B 1 66  ? 15.502 10.613 23.143  1.00 18.29  ? 66   LEU B C   1 
ATOM   1784 O  O   . LEU B 1 66  ? 15.105 11.724 23.430  1.00 20.21  ? 66   LEU B O   1 
ATOM   1785 C  CB  . LEU B 1 66  ? 17.940 10.295 23.259  1.00 19.56  ? 66   LEU B CB  1 
ATOM   1786 C  CG  . LEU B 1 66  ? 19.300 10.045 22.624  1.00 16.51  ? 66   LEU B CG  1 
ATOM   1787 C  CD1 . LEU B 1 66  ? 20.314 10.001 23.789  1.00 17.59  ? 66   LEU B CD1 1 
ATOM   1788 C  CD2 . LEU B 1 66  ? 19.321 8.757  21.837  1.00 15.84  ? 66   LEU B CD2 1 
ATOM   1789 N  N   . THR B 1 67  ? 14.825 9.515  23.404  1.00 17.97  ? 67   THR B N   1 
ATOM   1790 C  CA  . THR B 1 67  ? 13.682 9.485  24.335  1.00 21.18  ? 67   THR B CA  1 
ATOM   1791 C  C   . THR B 1 67  ? 14.225 8.924  25.625  1.00 20.76  ? 67   THR B C   1 
ATOM   1792 O  O   . THR B 1 67  ? 14.817 7.823  25.623  1.00 21.23  ? 67   THR B O   1 
ATOM   1793 C  CB  . THR B 1 67  ? 12.589 8.545  23.820  1.00 24.25  ? 67   THR B CB  1 
ATOM   1794 O  OG1 . THR B 1 67  ? 12.184 8.974  22.526  1.00 23.26  ? 67   THR B OG1 1 
ATOM   1795 C  CG2 . THR B 1 67  ? 11.357 8.543  24.748  1.00 25.50  ? 67   THR B CG2 1 
ATOM   1796 N  N   . ILE B 1 68  ? 14.071 9.680  26.706  1.00 20.48  ? 68   ILE B N   1 
ATOM   1797 C  CA  . ILE B 1 68  ? 14.678 9.303  27.977  1.00 20.47  ? 68   ILE B CA  1 
ATOM   1798 C  C   . ILE B 1 68  ? 13.717 9.445  29.139  1.00 22.65  ? 68   ILE B C   1 
ATOM   1799 O  O   . ILE B 1 68  ? 13.176 10.524 29.376  1.00 24.78  ? 68   ILE B O   1 
ATOM   1800 C  CB  . ILE B 1 68  ? 15.920 10.163 28.313  1.00 22.81  ? 68   ILE B CB  1 
ATOM   1801 C  CG1 . ILE B 1 68  ? 16.921 10.185 27.182  1.00 28.71  ? 68   ILE B CG1 1 
ATOM   1802 C  CG2 . ILE B 1 68  ? 16.579 9.692  29.580  1.00 19.59  ? 68   ILE B CG2 1 
ATOM   1803 C  CD1 . ILE B 1 68  ? 18.272 10.923 27.583  1.00 30.64  ? 68   ILE B CD1 1 
ATOM   1804 N  N   . ALA B 1 69  ? 13.512 8.345  29.853  1.00 20.93  ? 69   ALA B N   1 
ATOM   1805 C  CA  . ALA B 1 69  ? 12.751 8.334  31.101  1.00 21.46  ? 69   ALA B CA  1 
ATOM   1806 C  C   . ALA B 1 69  ? 13.729 8.127  32.226  1.00 24.16  ? 69   ALA B C   1 
ATOM   1807 O  O   . ALA B 1 69  ? 14.808 7.531  32.038  1.00 20.74  ? 69   ALA B O   1 
ATOM   1808 C  CB  . ALA B 1 69  ? 11.748 7.213  31.088  1.00 24.96  ? 69   ALA B CB  1 
ATOM   1809 N  N   . TYR B 1 70  ? 13.342 8.575  33.415  1.00 24.26  ? 70   TYR B N   1 
ATOM   1810 C  CA  . TYR B 1 70  ? 14.138 8.274  34.587  1.00 24.94  ? 70   TYR B CA  1 
ATOM   1811 C  C   . TYR B 1 70  ? 13.283 7.632  35.656  1.00 24.81  ? 70   TYR B C   1 
ATOM   1812 O  O   . TYR B 1 70  ? 12.042 7.791  35.714  1.00 23.46  ? 70   TYR B O   1 
ATOM   1813 C  CB  . TYR B 1 70  ? 14.828 9.520  35.130  1.00 24.33  ? 70   TYR B CB  1 
ATOM   1814 C  CG  . TYR B 1 70  ? 13.893 10.470 35.774  1.00 22.54  ? 70   TYR B CG  1 
ATOM   1815 C  CD1 . TYR B 1 70  ? 13.293 11.466 35.037  1.00 23.69  ? 70   TYR B CD1 1 
ATOM   1816 C  CD2 . TYR B 1 70  ? 13.549 10.334 37.132  1.00 20.28  ? 70   TYR B CD2 1 
ATOM   1817 C  CE1 . TYR B 1 70  ? 12.411 12.326 35.605  1.00 24.30  ? 70   TYR B CE1 1 
ATOM   1818 C  CE2 . TYR B 1 70  ? 12.668 11.185 37.725  1.00 23.61  ? 70   TYR B CE2 1 
ATOM   1819 C  CZ  . TYR B 1 70  ? 12.100 12.196 36.943  1.00 23.85  ? 70   TYR B CZ  1 
ATOM   1820 O  OH  . TYR B 1 70  ? 11.208 13.074 37.471  1.00 35.04  ? 70   TYR B OH  1 
ATOM   1821 N  N   . GLU B 1 71  ? 13.974 6.886  36.501  1.00 24.06  ? 71   GLU B N   1 
ATOM   1822 C  CA  . GLU B 1 71  ? 13.383 6.394  37.728  1.00 23.01  ? 71   GLU B CA  1 
ATOM   1823 C  C   . GLU B 1 71  ? 14.330 6.746  38.843  1.00 24.67  ? 71   GLU B C   1 
ATOM   1824 O  O   . GLU B 1 71  ? 15.498 6.425  38.747  1.00 22.59  ? 71   GLU B O   1 
ATOM   1825 C  CB  . GLU B 1 71  ? 13.172 4.898  37.660  1.00 25.96  ? 71   GLU B CB  1 
ATOM   1826 C  CG  . GLU B 1 71  ? 12.689 4.319  38.971  1.00 32.39  ? 71   GLU B CG  1 
ATOM   1827 C  CD  . GLU B 1 71  ? 12.668 2.806  38.991  1.00 50.58  ? 71   GLU B CD  1 
ATOM   1828 O  OE1 . GLU B 1 71  ? 11.826 2.228  38.279  1.00 51.58  ? 71   GLU B OE1 1 
ATOM   1829 O  OE2 . GLU B 1 71  ? 13.487 2.203  39.733  1.00 51.69  ? 71   GLU B OE2 1 
ATOM   1830 N  N   . LEU B 1 72  ? 13.795 7.337  39.901  1.00 23.25  ? 72   LEU B N   1 
ATOM   1831 C  CA  . LEU B 1 72  ? 14.589 7.755  41.058  1.00 21.58  ? 72   LEU B CA  1 
ATOM   1832 C  C   . LEU B 1 72  ? 14.062 7.081  42.310  1.00 24.15  ? 72   LEU B C   1 
ATOM   1833 O  O   . LEU B 1 72  ? 12.892 7.189  42.647  1.00 22.51  ? 72   LEU B O   1 
ATOM   1834 C  CB  . LEU B 1 72  ? 14.526 9.263  41.190  1.00 24.35  ? 72   LEU B CB  1 
ATOM   1835 C  CG  . LEU B 1 72  ? 15.350 9.934  42.272  1.00 28.60  ? 72   LEU B CG  1 
ATOM   1836 C  CD1 . LEU B 1 72  ? 16.827 9.639  42.049  1.00 22.34  ? 72   LEU B CD1 1 
ATOM   1837 C  CD2 . LEU B 1 72  ? 15.040 11.480 42.318  1.00 32.02  ? 72   LEU B CD2 1 
ATOM   1838 N  N   . LYS B 1 73  ? 14.942 6.387  43.000  1.00 23.11  ? 73   LYS B N   1 
ATOM   1839 C  CA  . LYS B 1 73  ? 14.542 5.596  44.128  1.00 23.10  ? 73   LYS B CA  1 
ATOM   1840 C  C   . LYS B 1 73  ? 15.371 5.999  45.314  1.00 21.06  ? 73   LYS B C   1 
ATOM   1841 O  O   . LYS B 1 73  ? 16.607 5.966  45.242  1.00 23.01  ? 73   LYS B O   1 
ATOM   1842 C  CB  . LYS B 1 73  ? 14.767 4.113  43.825  1.00 22.48  ? 73   LYS B CB  1 
ATOM   1843 C  CG  . LYS B 1 73  ? 14.524 3.211  45.009  1.00 28.08  ? 73   LYS B CG  1 
ATOM   1844 C  CD  . LYS B 1 73  ? 14.600 1.693  44.638  1.00 36.04  ? 73   LYS B CD  1 
ATOM   1845 C  CE  . LYS B 1 73  ? 13.727 0.853  45.560  1.00 46.89  ? 73   LYS B CE  1 
ATOM   1846 N  NZ  . LYS B 1 73  ? 13.783 -0.642 45.319  1.00 52.24  ? 73   LYS B NZ  1 
ATOM   1847 N  N   . ASN B 1 74  ? 14.693 6.325  46.408  1.00 22.97  ? 74   ASN B N   1 
ATOM   1848 C  CA  . ASN B 1 74  ? 15.341 6.554  47.685  1.00 22.09  ? 74   ASN B CA  1 
ATOM   1849 C  C   . ASN B 1 74  ? 15.465 5.209  48.346  1.00 22.21  ? 74   ASN B C   1 
ATOM   1850 O  O   . ASN B 1 74  ? 14.461 4.596  48.677  1.00 26.87  ? 74   ASN B O   1 
ATOM   1851 C  CB  . ASN B 1 74  ? 14.535 7.518  48.527  1.00 23.34  ? 74   ASN B CB  1 
ATOM   1852 C  CG  . ASN B 1 74  ? 15.190 7.787  49.898  1.00 21.19  ? 74   ASN B CG  1 
ATOM   1853 O  OD1 . ASN B 1 74  ? 15.765 6.888  50.516  1.00 26.71  ? 74   ASN B OD1 1 
ATOM   1854 N  ND2 . ASN B 1 74  ? 15.102 9.037  50.356  1.00 23.03  ? 74   ASN B ND2 1 
ATOM   1855 N  N   . THR B 1 75  ? 16.692 4.718  48.519  1.00 23.54  ? 75   THR B N   1 
ATOM   1856 C  CA  . THR B 1 75  ? 16.874 3.335  48.955  1.00 26.38  ? 75   THR B CA  1 
ATOM   1857 C  C   . THR B 1 75  ? 16.712 3.231  50.481  1.00 27.53  ? 75   THR B C   1 
ATOM   1858 O  O   . THR B 1 75  ? 16.526 2.151  51.004  1.00 32.64  ? 75   THR B O   1 
ATOM   1859 C  CB  . THR B 1 75  ? 18.216 2.707  48.466  1.00 27.36  ? 75   THR B CB  1 
ATOM   1860 O  OG1 . THR B 1 75  ? 19.321 3.485  48.929  1.00 32.11  ? 75   THR B OG1 1 
ATOM   1861 C  CG2 . THR B 1 75  ? 18.263 2.620  46.921  1.00 28.04  ? 75   THR B CG2 1 
ATOM   1862 N  N   . ASP B 1 76  ? 16.785 4.370  51.167  1.00 26.98  ? 76   ASP B N   1 
ATOM   1863 C  CA  . ASP B 1 76  ? 16.556 4.434  52.613  1.00 28.39  ? 76   ASP B CA  1 
ATOM   1864 C  C   . ASP B 1 76  ? 15.060 4.327  52.928  1.00 29.18  ? 76   ASP B C   1 
ATOM   1865 O  O   . ASP B 1 76  ? 14.651 3.576  53.816  1.00 33.88  ? 76   ASP B O   1 
ATOM   1866 C  CB  . ASP B 1 76  ? 17.062 5.745  53.202  1.00 30.48  ? 76   ASP B CB  1 
ATOM   1867 C  CG  . ASP B 1 76  ? 18.563 5.949  53.035  1.00 35.10  ? 76   ASP B CG  1 
ATOM   1868 O  OD1 . ASP B 1 76  ? 19.310 4.961  53.156  1.00 34.09  ? 76   ASP B OD1 1 
ATOM   1869 O  OD2 . ASP B 1 76  ? 18.974 7.118  52.820  1.00 37.55  ? 76   ASP B OD2 1 
ATOM   1870 N  N   . THR B 1 77  ? 14.251 5.099  52.208  1.00 28.60  ? 77   THR B N   1 
ATOM   1871 C  CA  . THR B 1 77  ? 12.810 5.157  52.438  1.00 29.42  ? 77   THR B CA  1 
ATOM   1872 C  C   . THR B 1 77  ? 12.029 4.163  51.595  1.00 29.53  ? 77   THR B C   1 
ATOM   1873 O  O   . THR B 1 77  ? 10.983 3.738  52.008  1.00 35.57  ? 77   THR B O   1 
ATOM   1874 C  CB  . THR B 1 77  ? 12.235 6.551  52.118  1.00 29.62  ? 77   THR B CB  1 
ATOM   1875 O  OG1 . THR B 1 77  ? 12.326 6.773  50.694  1.00 24.58  ? 77   THR B OG1 1 
ATOM   1876 C  CG2 . THR B 1 77  ? 12.981 7.651  52.879  1.00 31.62  ? 77   THR B CG2 1 
ATOM   1877 N  N   . GLY B 1 78  ? 12.488 3.850  50.383  1.00 30.02  ? 78   GLY B N   1 
ATOM   1878 C  CA  . GLY B 1 78  ? 11.739 2.999  49.472  1.00 32.06  ? 78   GLY B CA  1 
ATOM   1879 C  C   . GLY B 1 78  ? 10.904 3.787  48.470  1.00 32.70  ? 78   GLY B C   1 
ATOM   1880 O  O   . GLY B 1 78  ? 10.315 3.194  47.565  1.00 37.68  ? 78   GLY B O   1 
ATOM   1881 N  N   . ALA B 1 79  ? 10.901 5.123  48.588  1.00 31.56  ? 79   ALA B N   1 
ATOM   1882 C  CA  . ALA B 1 79  ? 10.137 5.991  47.678  1.00 30.73  ? 79   ALA B CA  1 
ATOM   1883 C  C   . ALA B 1 79  ? 10.725 5.934  46.295  1.00 27.67  ? 79   ALA B C   1 
ATOM   1884 O  O   . ALA B 1 79  ? 11.933 5.932  46.135  1.00 25.33  ? 79   ALA B O   1 
ATOM   1885 C  CB  . ALA B 1 79  ? 10.134 7.414  48.153  1.00 33.29  ? 79   ALA B CB  1 
ATOM   1886 N  N   . ILE B 1 80  ? 9.848  5.835  45.304  1.00 27.46  ? 80   ILE B N   1 
ATOM   1887 C  CA  . ILE B 1 80  ? 10.248 5.773  43.912  1.00 23.44  ? 80   ILE B CA  1 
ATOM   1888 C  C   . ILE B 1 80  ? 9.363  6.728  43.102  1.00 28.92  ? 80   ILE B C   1 
ATOM   1889 O  O   . ILE B 1 80  ? 8.135  6.758  43.288  1.00 26.84  ? 80   ILE B O   1 
ATOM   1890 C  CB  . ILE B 1 80  ? 10.067 4.336  43.368  1.00 30.00  ? 80   ILE B CB  1 
ATOM   1891 C  CG1 . ILE B 1 80  ? 10.991 3.327  44.073  1.00 32.05  ? 80   ILE B CG1 1 
ATOM   1892 C  CG2 . ILE B 1 80  ? 10.350 4.265  41.913  1.00 29.77  ? 80   ILE B CG2 1 
ATOM   1893 C  CD1 . ILE B 1 80  ? 10.630 1.876  43.780  1.00 40.62  ? 80   ILE B CD1 1 
ATOM   1894 N  N   . LYS B 1 81  ? 9.979  7.488  42.202  1.00 27.87  ? 81   LYS B N   1 
ATOM   1895 C  CA  . LYS B 1 81  ? 9.259  8.321  41.250  1.00 27.43  ? 81   LYS B CA  1 
ATOM   1896 C  C   . LYS B 1 81  ? 9.852  8.148  39.870  1.00 27.16  ? 81   LYS B C   1 
ATOM   1897 O  O   . LYS B 1 81  ? 11.004 7.772  39.734  1.00 25.97  ? 81   LYS B O   1 
ATOM   1898 C  CB  . LYS B 1 81  ? 9.272  9.781  41.674  1.00 26.83  ? 81   LYS B CB  1 
ATOM   1899 C  CG  . LYS B 1 81  ? 10.606 10.488 41.690  1.00 28.25  ? 81   LYS B CG  1 
ATOM   1900 C  CD  . LYS B 1 81  ? 10.538 11.775 42.545  1.00 41.45  ? 81   LYS B CD  1 
ATOM   1901 C  CE  . LYS B 1 81  ? 9.595  12.828 41.970  1.00 41.89  ? 81   LYS B CE  1 
ATOM   1902 N  NZ  . LYS B 1 81  ? 9.590  14.042 42.821  1.00 33.01  ? 81   LYS B NZ  1 
ATOM   1903 N  N   . ARG B 1 82  ? 9.022  8.362  38.860  1.00 26.38  ? 82   ARG B N   1 
ATOM   1904 C  CA  . ARG B 1 82  ? 9.405  8.241  37.480  1.00 25.81  ? 82   ARG B CA  1 
ATOM   1905 C  C   . ARG B 1 82  ? 8.993  9.485  36.729  1.00 24.24  ? 82   ARG B C   1 
ATOM   1906 O  O   . ARG B 1 82  ? 7.979  10.113 37.082  1.00 27.74  ? 82   ARG B O   1 
ATOM   1907 C  CB  . ARG B 1 82  ? 8.659  7.091  36.826  1.00 30.45  ? 82   ARG B CB  1 
ATOM   1908 C  CG  . ARG B 1 82  ? 8.806  5.733  37.468  1.00 40.27  ? 82   ARG B CG  1 
ATOM   1909 C  CD  . ARG B 1 82  ? 8.064  4.724  36.588  1.00 52.90  ? 82   ARG B CD  1 
ATOM   1910 N  NE  . ARG B 1 82  ? 8.297  3.333  36.955  1.00 66.63  ? 82   ARG B NE  1 
ATOM   1911 C  CZ  . ARG B 1 82  ? 9.402  2.636  36.682  1.00 73.00  ? 82   ARG B CZ  1 
ATOM   1912 N  NH1 . ARG B 1 82  ? 10.438 3.195  36.063  1.00 72.90  ? 82   ARG B NH1 1 
ATOM   1913 N  NH2 . ARG B 1 82  ? 9.481  1.363  37.056  1.00 79.29  ? 82   ARG B NH2 1 
ATOM   1914 N  N   . GLY B 1 83  ? 9.745  9.811  35.693  1.00 25.90  ? 83   GLY B N   1 
ATOM   1915 C  CA  . GLY B 1 83  ? 9.339  10.850 34.754  1.00 24.11  ? 83   GLY B CA  1 
ATOM   1916 C  C   . GLY B 1 83  ? 10.131 10.820 33.488  1.00 26.44  ? 83   GLY B C   1 
ATOM   1917 O  O   . GLY B 1 83  ? 10.788 9.819  33.171  1.00 25.29  ? 83   GLY B O   1 
ATOM   1918 N  N   . THR B 1 84  ? 10.063 11.924 32.756  1.00 22.50  ? 84   THR B N   1 
ATOM   1919 C  CA  . THR B 1 84  ? 10.747 12.025 31.453  1.00 24.74  ? 84   THR B CA  1 
ATOM   1920 C  C   . THR B 1 84  ? 11.723 13.197 31.523  1.00 23.61  ? 84   THR B C   1 
ATOM   1921 O  O   . THR B 1 84  ? 11.470 14.197 32.207  1.00 31.32  ? 84   THR B O   1 
ATOM   1922 C  CB  . THR B 1 84  ? 9.761  12.192 30.262  1.00 29.10  ? 84   THR B CB  1 
ATOM   1923 O  OG1 . THR B 1 84  ? 8.947  13.324 30.498  1.00 38.82  ? 84   THR B OG1 1 
ATOM   1924 C  CG2 . THR B 1 84  ? 8.859  10.934 30.066  1.00 30.99  ? 84   THR B CG2 1 
ATOM   1925 N  N   . LEU B 1 85  ? 12.907 13.024 30.960  1.00 19.05  ? 85   LEU B N   1 
ATOM   1926 C  CA  . LEU B 1 85  ? 13.797 14.156 30.743  1.00 20.36  ? 85   LEU B CA  1 
ATOM   1927 C  C   . LEU B 1 85  ? 13.507 14.767 29.385  1.00 22.07  ? 85   LEU B C   1 
ATOM   1928 O  O   . LEU B 1 85  ? 13.180 14.049 28.425  1.00 28.68  ? 85   LEU B O   1 
ATOM   1929 C  CB  . LEU B 1 85  ? 15.254 13.780 30.864  1.00 20.19  ? 85   LEU B CB  1 
ATOM   1930 C  CG  . LEU B 1 85  ? 15.661 13.116 32.178  1.00 23.24  ? 85   LEU B CG  1 
ATOM   1931 C  CD1 . LEU B 1 85  ? 17.142 12.719 32.118  1.00 25.03  ? 85   LEU B CD1 1 
ATOM   1932 C  CD2 . LEU B 1 85  ? 15.375 13.994 33.403  1.00 20.24  ? 85   LEU B CD2 1 
ATOM   1933 N  N   . MET B 1 86  ? 13.593 16.089 29.314  1.00 19.07  ? 86   MET B N   1 
ATOM   1934 C  CA  A MET B 1 86  ? 13.243 16.801 28.090  0.50 20.53  ? 86   MET B CA  1 
ATOM   1935 C  CA  B MET B 1 86  ? 13.230 16.849 28.120  0.50 20.33  ? 86   MET B CA  1 
ATOM   1936 C  C   . MET B 1 86  ? 14.480 17.474 27.501  1.00 19.16  ? 86   MET B C   1 
ATOM   1937 O  O   . MET B 1 86  ? 15.345 17.930 28.225  1.00 18.07  ? 86   MET B O   1 
ATOM   1938 C  CB  A MET B 1 86  ? 12.148 17.832 28.363  0.50 21.51  ? 86   MET B CB  1 
ATOM   1939 C  CB  B MET B 1 86  ? 12.265 17.970 28.518  0.50 20.82  ? 86   MET B CB  1 
ATOM   1940 C  CG  A MET B 1 86  ? 10.795 17.201 28.743  0.50 28.67  ? 86   MET B CG  1 
ATOM   1941 C  CG  B MET B 1 86  ? 10.967 17.456 29.162  0.50 26.75  ? 86   MET B CG  1 
ATOM   1942 S  SD  A MET B 1 86  ? 9.975  16.349 27.369  0.50 37.47  ? 86   MET B SD  1 
ATOM   1943 S  SD  B MET B 1 86  ? 10.213 18.643 30.275  0.50 35.83  ? 86   MET B SD  1 
ATOM   1944 C  CE  A MET B 1 86  ? 9.672  17.720 26.250  0.50 29.53  ? 86   MET B CE  1 
ATOM   1945 C  CE  B MET B 1 86  ? 11.405 18.621 31.656  0.50 18.36  ? 86   MET B CE  1 
ATOM   1946 N  N   . PRO B 1 87  ? 14.579 17.488 26.156  1.00 16.68  ? 87   PRO B N   1 
ATOM   1947 C  CA  . PRO B 1 87  ? 15.722 18.128 25.503  1.00 16.22  ? 87   PRO B CA  1 
ATOM   1948 C  C   . PRO B 1 87  ? 15.613 19.664 25.617  1.00 15.88  ? 87   PRO B C   1 
ATOM   1949 O  O   . PRO B 1 87  ? 14.548 20.227 25.387  1.00 18.58  ? 87   PRO B O   1 
ATOM   1950 C  CB  . PRO B 1 87  ? 15.593 17.670 24.046  1.00 16.07  ? 87   PRO B CB  1 
ATOM   1951 C  CG  . PRO B 1 87  ? 14.163 17.441 23.832  1.00 16.45  ? 87   PRO B CG  1 
ATOM   1952 C  CD  . PRO B 1 87  ? 13.583 17.014 25.181  1.00 20.55  ? 87   PRO B CD  1 
ATOM   1953 N  N   . MET B 1 88  ? 16.719 20.315 25.946  1.00 15.37  ? 88   MET B N   1 
ATOM   1954 C  CA  . MET B 1 88  ? 16.755 21.781 26.124  1.00 16.58  ? 88   MET B CA  1 
ATOM   1955 C  C   . MET B 1 88  ? 18.206 22.254 26.111  1.00 17.53  ? 88   MET B C   1 
ATOM   1956 O  O   . MET B 1 88  ? 19.115 21.464 26.110  1.00 16.38  ? 88   MET B O   1 
ATOM   1957 C  CB  . MET B 1 88  ? 16.111 22.182 27.458  1.00 20.25  ? 88   MET B CB  1 
ATOM   1958 C  CG  . MET B 1 88  ? 16.864 21.709 28.662  1.00 19.43  ? 88   MET B CG  1 
ATOM   1959 S  SD  . MET B 1 88  ? 16.012 21.936 30.223  1.00 21.53  ? 88   MET B SD  1 
ATOM   1960 C  CE  . MET B 1 88  ? 14.786 20.627 30.145  1.00 18.66  ? 88   MET B CE  1 
ATOM   1961 N  N   . VAL B 1 89  ? 18.397 23.575 26.057  1.00 17.06  ? 89   VAL B N   1 
ATOM   1962 C  CA  . VAL B 1 89  ? 19.720 24.155 26.062  1.00 18.11  ? 89   VAL B CA  1 
ATOM   1963 C  C   . VAL B 1 89  ? 19.865 25.139 27.225  1.00 19.34  ? 89   VAL B C   1 
ATOM   1964 O  O   . VAL B 1 89  ? 18.943 25.897 27.552  1.00 19.45  ? 89   VAL B O   1 
ATOM   1965 C  CB  . VAL B 1 89  ? 20.071 24.833 24.691  1.00 19.31  ? 89   VAL B CB  1 
ATOM   1966 C  CG1 . VAL B 1 89  ? 19.176 26.040 24.411  1.00 21.80  ? 89   VAL B CG1 1 
ATOM   1967 C  CG2 . VAL B 1 89  ? 21.576 25.223 24.630  1.00 18.82  ? 89   VAL B CG2 1 
ATOM   1968 N  N   . ALA B 1 90  ? 21.015 25.076 27.897  1.00 22.39  ? 90   ALA B N   1 
ATOM   1969 C  CA  . ALA B 1 90  ? 21.429 26.027 28.917  1.00 22.13  ? 90   ALA B CA  1 
ATOM   1970 C  C   . ALA B 1 90  ? 22.715 26.726 28.470  1.00 20.65  ? 90   ALA B C   1 
ATOM   1971 O  O   . ALA B 1 90  ? 23.216 26.488 27.366  1.00 20.42  ? 90   ALA B O   1 
ATOM   1972 C  CB  . ALA B 1 90  ? 21.669 25.298 30.254  1.00 23.85  ? 90   ALA B CB  1 
ATOM   1973 N  N   . ASP B 1 91  ? 23.295 27.536 29.341  1.00 21.88  ? 91   ASP B N   1 
ATOM   1974 C  CA  . ASP B 1 91  ? 24.522 28.254 28.986  1.00 23.15  ? 91   ASP B CA  1 
ATOM   1975 C  C   . ASP B 1 91  ? 25.669 27.314 28.727  1.00 22.32  ? 91   ASP B C   1 
ATOM   1976 O  O   . ASP B 1 91  ? 26.620 27.691 28.052  1.00 25.06  ? 91   ASP B O   1 
ATOM   1977 C  CB  . ASP B 1 91  ? 24.875 29.332 30.027  1.00 24.18  ? 91   ASP B CB  1 
ATOM   1978 C  CG  . ASP B 1 91  ? 25.159 28.789 31.424  1.00 31.76  ? 91   ASP B CG  1 
ATOM   1979 O  OD1 . ASP B 1 91  ? 25.000 27.599 31.718  1.00 33.92  ? 91   ASP B OD1 1 
ATOM   1980 O  OD2 . ASP B 1 91  ? 25.511 29.615 32.267  1.00 43.43  ? 91   ASP B OD2 1 
ATOM   1981 N  N   . ASP B 1 92  ? 25.587 26.079 29.233  1.00 21.73  ? 92   ASP B N   1 
ATOM   1982 C  CA  . ASP B 1 92  ? 26.631 25.091 28.944  1.00 24.11  ? 92   ASP B CA  1 
ATOM   1983 C  C   . ASP B 1 92  ? 26.256 24.066 27.906  1.00 21.27  ? 92   ASP B C   1 
ATOM   1984 O  O   . ASP B 1 92  ? 26.899 23.005 27.814  1.00 23.30  ? 92   ASP B O   1 
ATOM   1985 C  CB  . ASP B 1 92  ? 27.138 24.434 30.246  1.00 24.84  ? 92   ASP B CB  1 
ATOM   1986 C  CG  . ASP B 1 92  ? 26.069 23.741 31.020  1.00 27.95  ? 92   ASP B CG  1 
ATOM   1987 O  OD1 . ASP B 1 92  ? 24.878 23.819 30.660  1.00 30.38  ? 92   ASP B OD1 1 
ATOM   1988 O  OD2 . ASP B 1 92  ? 26.434 23.108 32.049  1.00 37.21  ? 92   ASP B OD2 1 
ATOM   1989 N  N   . GLY B 1 93  ? 25.243 24.401 27.092  1.00 18.83  ? 93   GLY B N   1 
ATOM   1990 C  CA  . GLY B 1 93  ? 24.882 23.607 25.933  1.00 19.11  ? 93   GLY B CA  1 
ATOM   1991 C  C   . GLY B 1 93  ? 23.655 22.738 26.129  1.00 17.54  ? 93   GLY B C   1 
ATOM   1992 O  O   . GLY B 1 93  ? 22.983 22.814 27.208  1.00 20.26  ? 93   GLY B O   1 
ATOM   1993 N  N   . PRO B 1 94  ? 23.346 21.924 25.104  1.00 17.99  ? 94   PRO B N   1 
ATOM   1994 C  CA  . PRO B 1 94  ? 22.168 21.080 25.143  1.00 17.32  ? 94   PRO B CA  1 
ATOM   1995 C  C   . PRO B 1 94  ? 22.347 19.908 26.095  1.00 18.17  ? 94   PRO B C   1 
ATOM   1996 O  O   . PRO B 1 94  ? 23.492 19.440 26.368  1.00 17.37  ? 94   PRO B O   1 
ATOM   1997 C  CB  . PRO B 1 94  ? 21.980 20.643 23.691  1.00 19.24  ? 94   PRO B CB  1 
ATOM   1998 C  CG  . PRO B 1 94  ? 23.426 20.617 23.154  1.00 16.90  ? 94   PRO B CG  1 
ATOM   1999 C  CD  . PRO B 1 94  ? 24.086 21.795 23.834  1.00 17.67  ? 94   PRO B CD  1 
ATOM   2000 N  N   . HIS B 1 95  ? 21.215 19.504 26.673  1.00 18.88  ? 95   HIS B N   1 
ATOM   2001 C  CA  . HIS B 1 95  ? 21.155 18.329 27.537  1.00 16.56  ? 95   HIS B CA  1 
ATOM   2002 C  C   . HIS B 1 95  ? 19.708 17.840 27.580  1.00 18.37  ? 95   HIS B C   1 
ATOM   2003 O  O   . HIS B 1 95  ? 18.809 18.434 26.946  1.00 18.03  ? 95   HIS B O   1 
ATOM   2004 C  CB  . HIS B 1 95  ? 21.682 18.637 28.958  1.00 17.87  ? 95   HIS B CB  1 
ATOM   2005 C  CG  . HIS B 1 95  ? 20.864 19.663 29.674  1.00 15.57  ? 95   HIS B CG  1 
ATOM   2006 N  ND1 . HIS B 1 95  ? 21.292 20.968 29.782  1.00 22.38  ? 95   HIS B ND1 1 
ATOM   2007 C  CD2 . HIS B 1 95  ? 19.617 19.631 30.193  1.00 18.41  ? 95   HIS B CD2 1 
ATOM   2008 C  CE1 . HIS B 1 95  ? 20.365 21.677 30.394  1.00 23.15  ? 95   HIS B CE1 1 
ATOM   2009 N  NE2 . HIS B 1 95  ? 19.336 20.893 30.641  1.00 18.85  ? 95   HIS B NE2 1 
ATOM   2010 N  N   . TYR B 1 96  ? 19.497 16.752 28.329  1.00 15.17  ? 96   TYR B N   1 
ATOM   2011 C  CA  . TYR B 1 96  ? 18.146 16.269 28.657  1.00 14.68  ? 96   TYR B CA  1 
ATOM   2012 C  C   . TYR B 1 96  ? 17.970 16.544 30.145  1.00 17.67  ? 96   TYR B C   1 
ATOM   2013 O  O   . TYR B 1 96  ? 18.851 16.168 30.930  1.00 17.55  ? 96   TYR B O   1 
ATOM   2014 C  CB  . TYR B 1 96  ? 18.051 14.758 28.333  1.00 14.79  ? 96   TYR B CB  1 
ATOM   2015 C  CG  . TYR B 1 96  ? 18.224 14.419 26.886  1.00 13.95  ? 96   TYR B CG  1 
ATOM   2016 C  CD1 . TYR B 1 96  ? 17.155 14.465 26.021  1.00 17.58  ? 96   TYR B CD1 1 
ATOM   2017 C  CD2 . TYR B 1 96  ? 19.469 14.067 26.364  1.00 13.63  ? 96   TYR B CD2 1 
ATOM   2018 C  CE1 . TYR B 1 96  ? 17.316 14.177 24.671  1.00 16.16  ? 96   TYR B CE1 1 
ATOM   2019 C  CE2 . TYR B 1 96  ? 19.640 13.786 25.003  1.00 16.78  ? 96   TYR B CE2 1 
ATOM   2020 C  CZ  . TYR B 1 96  ? 18.546 13.846 24.181  1.00 14.69  ? 96   TYR B CZ  1 
ATOM   2021 O  OH  . TYR B 1 96  ? 18.722 13.547 22.828  1.00 16.95  ? 96   TYR B OH  1 
ATOM   2022 N  N   . GLY B 1 97  ? 16.886 17.214 30.531  1.00 17.00  ? 97   GLY B N   1 
ATOM   2023 C  CA  . GLY B 1 97  ? 16.760 17.648 31.912  1.00 15.56  ? 97   GLY B CA  1 
ATOM   2024 C  C   . GLY B 1 97  ? 15.351 17.637 32.440  1.00 12.08  ? 97   GLY B C   1 
ATOM   2025 O  O   . GLY B 1 97  ? 14.385 17.541 31.673  1.00 18.63  ? 97   GLY B O   1 
ATOM   2026 N  N   . ALA B 1 98  ? 15.234 17.748 33.765  1.00 17.53  ? 98   ALA B N   1 
ATOM   2027 C  CA  . ALA B 1 98  ? 13.946 17.912 34.366  1.00 17.43  ? 98   ALA B CA  1 
ATOM   2028 C  C   . ALA B 1 98  ? 14.135 18.485 35.756  1.00 18.03  ? 98   ALA B C   1 
ATOM   2029 O  O   . ALA B 1 98  ? 14.962 18.020 36.516  1.00 16.90  ? 98   ALA B O   1 
ATOM   2030 C  CB  . ALA B 1 98  ? 13.216 16.545 34.464  1.00 19.63  ? 98   ALA B CB  1 
ATOM   2031 N  N   . ASN B 1 99  ? 13.366 19.526 36.064  1.00 17.96  ? 99   ASN B N   1 
ATOM   2032 C  CA  . ASN B 1 99  ? 13.190 19.939 37.459  1.00 17.96  ? 99   ASN B CA  1 
ATOM   2033 C  C   . ASN B 1 99  ? 12.497 18.845 38.253  1.00 20.16  ? 99   ASN B C   1 
ATOM   2034 O  O   . ASN B 1 99  ? 11.500 18.281 37.791  1.00 19.84  ? 99   ASN B O   1 
ATOM   2035 C  CB  . ASN B 1 99  ? 12.389 21.232 37.547  1.00 18.18  ? 99   ASN B CB  1 
ATOM   2036 C  CG  . ASN B 1 99  ? 13.238 22.481 37.382  1.00 15.77  ? 99   ASN B CG  1 
ATOM   2037 O  OD1 . ASN B 1 99  ? 14.486 22.428 37.317  1.00 18.37  ? 99   ASN B OD1 1 
ATOM   2038 N  ND2 . ASN B 1 99  ? 12.564 23.634 37.370  1.00 19.97  ? 99   ASN B ND2 1 
ATOM   2039 N  N   . ILE B 1 100 ? 12.979 18.595 39.481  1.00 21.13  ? 100  ILE B N   1 
ATOM   2040 C  CA  . ILE B 1 100 ? 12.420 17.543 40.310  1.00 19.69  ? 100  ILE B CA  1 
ATOM   2041 C  C   . ILE B 1 100 ? 12.221 18.019 41.744  1.00 21.41  ? 100  ILE B C   1 
ATOM   2042 O  O   . ILE B 1 100 ? 13.142 18.584 42.373  1.00 19.18  ? 100  ILE B O   1 
ATOM   2043 C  CB  . ILE B 1 100 ? 13.313 16.241 40.229  1.00 20.42  ? 100  ILE B CB  1 
ATOM   2044 C  CG1 . ILE B 1 100 ? 13.392 15.745 38.752  1.00 21.69  ? 100  ILE B CG1 1 
ATOM   2045 C  CG2 . ILE B 1 100 ? 12.741 15.091 41.093  1.00 20.65  ? 100  ILE B CG2 1 
ATOM   2046 C  CD1 . ILE B 1 100 ? 14.389 14.621 38.492  1.00 28.99  ? 100  ILE B CD1 1 
ATOM   2047 N  N   . ALA B 1 101 ? 11.025 17.739 42.261  1.00 19.69  ? 101  ALA B N   1 
ATOM   2048 C  CA  . ALA B 1 101 ? 10.713 17.933 43.670  1.00 20.15  ? 101  ALA B CA  1 
ATOM   2049 C  C   . ALA B 1 101 ? 11.343 16.821 44.477  1.00 18.72  ? 101  ALA B C   1 
ATOM   2050 O  O   . ALA B 1 101 ? 11.115 15.660 44.190  1.00 21.00  ? 101  ALA B O   1 
ATOM   2051 C  CB  . ALA B 1 101 ? 9.185  17.937 43.860  1.00 17.92  ? 101  ALA B CB  1 
ATOM   2052 N  N   . MET B 1 102 ? 12.127 17.186 45.496  1.00 18.45  ? 102  MET B N   1 
ATOM   2053 C  CA  . MET B 1 102 ? 12.753 16.205 46.374  1.00 20.05  ? 102  MET B CA  1 
ATOM   2054 C  C   . MET B 1 102 ? 12.095 16.401 47.731  1.00 23.42  ? 102  MET B C   1 
ATOM   2055 O  O   . MET B 1 102 ? 11.022 15.811 47.979  1.00 24.20  ? 102  MET B O   1 
ATOM   2056 C  CB  . MET B 1 102 ? 14.281 16.338 46.384  1.00 21.62  ? 102  MET B CB  1 
ATOM   2057 C  CG  . MET B 1 102 ? 14.967 16.083 45.024  1.00 20.55  ? 102  MET B CG  1 
ATOM   2058 S  SD  . MET B 1 102 ? 14.811 14.371 44.473  1.00 23.08  ? 102  MET B SD  1 
ATOM   2059 C  CE  . MET B 1 102 ? 16.060 13.656 45.540  1.00 27.50  ? 102  MET B CE  1 
ATOM   2060 N  N   . GLU B 1 103 ? 12.683 17.250 48.585  1.00 24.93  ? 103  GLU B N   1 
ATOM   2061 C  CA  . GLU B 1 103 ? 12.062 17.649 49.855  1.00 25.08  ? 103  GLU B CA  1 
ATOM   2062 C  C   . GLU B 1 103 ? 10.644 18.163 49.678  1.00 25.37  ? 103  GLU B C   1 
ATOM   2063 O  O   . GLU B 1 103 ? 9.796  17.930 50.553  1.00 25.26  ? 103  GLU B O   1 
ATOM   2064 C  CB  . GLU B 1 103 ? 12.881 18.750 50.549  1.00 26.49  ? 103  GLU B CB  1 
ATOM   2065 C  CG  . GLU B 1 103 ? 14.252 18.298 51.029  1.00 33.55  ? 103  GLU B CG  1 
ATOM   2066 C  CD  . GLU B 1 103 ? 15.359 18.544 50.030  1.00 28.53  ? 103  GLU B CD  1 
ATOM   2067 O  OE1 . GLU B 1 103 ? 15.146 18.447 48.801  1.00 25.85  ? 103  GLU B OE1 1 
ATOM   2068 O  OE2 . GLU B 1 103 ? 16.484 18.846 50.465  1.00 36.32  ? 103  GLU B OE2 1 
ATOM   2069 N  N   . LYS B 1 104 ? 10.401 18.848 48.564  1.00 24.83  ? 104  LYS B N   1 
ATOM   2070 C  CA  . LYS B 1 104 ? 9.116  19.486 48.263  1.00 26.80  ? 104  LYS B CA  1 
ATOM   2071 C  C   . LYS B 1 104 ? 8.109  18.554 47.612  1.00 28.02  ? 104  LYS B C   1 
ATOM   2072 O  O   . LYS B 1 104 ? 6.955  18.966 47.394  1.00 28.49  ? 104  LYS B O   1 
ATOM   2073 C  CB  . LYS B 1 104 ? 9.297  20.685 47.315  1.00 28.05  ? 104  LYS B CB  1 
ATOM   2074 C  CG  . LYS B 1 104 ? 10.000 21.877 47.899  1.00 33.87  ? 104  LYS B CG  1 
ATOM   2075 C  CD  . LYS B 1 104 ? 10.267 22.907 46.820  1.00 37.55  ? 104  LYS B CD  1 
ATOM   2076 C  CE  . LYS B 1 104 ? 11.095 24.074 47.297  1.00 45.13  ? 104  LYS B CE  1 
ATOM   2077 N  NZ  . LYS B 1 104 ? 11.646 24.862 46.132  1.00 38.60  ? 104  LYS B NZ  1 
ATOM   2078 N  N   . ASP B 1 105 ? 8.491  17.300 47.337  1.00 22.38  ? 105  ASP B N   1 
ATOM   2079 C  CA  . ASP B 1 105 ? 7.504  16.360 46.847  1.00 23.67  ? 105  ASP B CA  1 
ATOM   2080 C  C   . ASP B 1 105 ? 6.448  16.078 47.922  1.00 25.19  ? 105  ASP B C   1 
ATOM   2081 O  O   . ASP B 1 105 ? 6.768  15.573 49.004  1.00 23.31  ? 105  ASP B O   1 
ATOM   2082 C  CB  . ASP B 1 105 ? 8.135  15.026 46.457  1.00 25.71  ? 105  ASP B CB  1 
ATOM   2083 C  CG  . ASP B 1 105 ? 7.209  14.196 45.582  1.00 33.08  ? 105  ASP B CG  1 
ATOM   2084 O  OD1 . ASP B 1 105 ? 6.056  13.974 46.013  1.00 31.85  ? 105  ASP B OD1 1 
ATOM   2085 O  OD2 . ASP B 1 105 ? 7.611  13.791 44.465  1.00 39.45  ? 105  ASP B OD2 1 
ATOM   2086 N  N   . LYS B 1 106 ? 5.179  16.322 47.586  1.00 26.31  ? 106  LYS B N   1 
ATOM   2087 C  CA  . LYS B 1 106 ? 4.106  16.161 48.532  1.00 25.69  ? 106  LYS B CA  1 
ATOM   2088 C  C   . LYS B 1 106 ? 3.895  14.725 49.010  1.00 25.17  ? 106  LYS B C   1 
ATOM   2089 O  O   . LYS B 1 106 ? 3.259  14.523 50.029  1.00 26.73  ? 106  LYS B O   1 
ATOM   2090 C  CB  . LYS B 1 106 ? 2.803  16.712 47.978  1.00 27.43  ? 106  LYS B CB  1 
ATOM   2091 C  CG  . LYS B 1 106 ? 2.277  15.940 46.787  1.00 25.57  ? 106  LYS B CG  1 
ATOM   2092 C  CD  . LYS B 1 106 ? 0.928  16.517 46.350  1.00 29.11  ? 106  LYS B CD  1 
ATOM   2093 C  CE  . LYS B 1 106 ? 0.400  15.844 45.090  1.00 34.25  ? 106  LYS B CE  1 
ATOM   2094 N  NZ  . LYS B 1 106 ? -0.984 16.311 44.734  1.00 33.84  ? 106  LYS B NZ  1 
ATOM   2095 N  N   . LYS B 1 107 ? 4.405  13.750 48.261  1.00 24.89  ? 107  LYS B N   1 
ATOM   2096 C  CA  . LYS B 1 107 ? 4.306  12.336 48.677  1.00 27.96  ? 107  LYS B CA  1 
ATOM   2097 C  C   . LYS B 1 107 ? 5.232  11.955 49.817  1.00 28.47  ? 107  LYS B C   1 
ATOM   2098 O  O   . LYS B 1 107 ? 5.002  10.958 50.486  1.00 28.55  ? 107  LYS B O   1 
ATOM   2099 C  CB  . LYS B 1 107 ? 4.594  11.418 47.502  1.00 30.17  ? 107  LYS B CB  1 
ATOM   2100 C  CG  . LYS B 1 107 ? 3.560  11.540 46.395  1.00 32.11  ? 107  LYS B CG  1 
ATOM   2101 C  CD  . LYS B 1 107 ? 3.882  10.609 45.222  1.00 41.27  ? 107  LYS B CD  1 
ATOM   2102 C  CE  . LYS B 1 107 ? 5.172  10.964 44.475  1.00 48.65  ? 107  LYS B CE  1 
ATOM   2103 N  NZ  . LYS B 1 107 ? 5.215  12.358 43.935  1.00 48.89  ? 107  LYS B NZ  1 
ATOM   2104 N  N   . GLY B 1 108 ? 6.271  12.750 50.034  1.00 27.20  ? 108  GLY B N   1 
ATOM   2105 C  CA  . GLY B 1 108 ? 7.261  12.478 51.070  1.00 25.95  ? 108  GLY B CA  1 
ATOM   2106 C  C   . GLY B 1 108 ? 8.241  11.400 50.599  1.00 27.92  ? 108  GLY B C   1 
ATOM   2107 O  O   . GLY B 1 108 ? 8.019  10.731 49.584  1.00 26.34  ? 108  GLY B O   1 
ATOM   2108 N  N   . GLY B 1 109 ? 9.329  11.242 51.341  1.00 23.85  ? 109  GLY B N   1 
ATOM   2109 C  CA  . GLY B 1 109 ? 10.229 10.128 51.131  1.00 24.62  ? 109  GLY B CA  1 
ATOM   2110 C  C   . GLY B 1 109 ? 11.372 10.415 50.172  1.00 24.69  ? 109  GLY B C   1 
ATOM   2111 O  O   . GLY B 1 109 ? 12.190 9.534  49.969  1.00 27.22  ? 109  GLY B O   1 
ATOM   2112 N  N   . PHE B 1 110 ? 11.426 11.630 49.610  1.00 22.85  ? 110  PHE B N   1 
ATOM   2113 C  CA  . PHE B 1 110 ? 12.440 12.039 48.637  1.00 23.19  ? 110  PHE B CA  1 
ATOM   2114 C  C   . PHE B 1 110 ? 13.341 13.128 49.222  1.00 25.73  ? 110  PHE B C   1 
ATOM   2115 O  O   . PHE B 1 110 ? 13.748 14.055 48.534  1.00 24.89  ? 110  PHE B O   1 
ATOM   2116 C  CB  . PHE B 1 110 ? 11.771 12.518 47.357  1.00 24.13  ? 110  PHE B CB  1 
ATOM   2117 C  CG  . PHE B 1 110 ? 11.013 11.447 46.651  1.00 24.80  ? 110  PHE B CG  1 
ATOM   2118 C  CD1 . PHE B 1 110 ? 11.686 10.453 45.953  1.00 28.94  ? 110  PHE B CD1 1 
ATOM   2119 C  CD2 . PHE B 1 110 ? 9.621  11.431 46.683  1.00 22.26  ? 110  PHE B CD2 1 
ATOM   2120 C  CE1 . PHE B 1 110 ? 10.978 9.438  45.314  1.00 25.63  ? 110  PHE B CE1 1 
ATOM   2121 C  CE2 . PHE B 1 110 ? 8.890  10.422 46.042  1.00 22.31  ? 110  PHE B CE2 1 
ATOM   2122 C  CZ  . PHE B 1 110 ? 9.563  9.427  45.363  1.00 25.79  ? 110  PHE B CZ  1 
ATOM   2123 N  N   . GLY B 1 111 ? 13.700 12.968 50.489  1.00 25.26  ? 111  GLY B N   1 
ATOM   2124 C  CA  . GLY B 1 111 ? 14.634 13.869 51.135  1.00 30.63  ? 111  GLY B CA  1 
ATOM   2125 C  C   . GLY B 1 111 ? 16.079 13.408 51.084  1.00 28.49  ? 111  GLY B C   1 
ATOM   2126 O  O   . GLY B 1 111 ? 16.438 12.494 50.338  1.00 27.10  ? 111  GLY B O   1 
ATOM   2127 N  N   . VAL B 1 112 ? 16.909 14.042 51.916  1.00 31.24  ? 112  VAL B N   1 
ATOM   2128 C  CA  . VAL B 1 112 ? 18.321 13.695 52.036  1.00 31.31  ? 112  VAL B CA  1 
ATOM   2129 C  C   . VAL B 1 112 ? 18.474 12.186 52.223  1.00 29.92  ? 112  VAL B C   1 
ATOM   2130 O  O   . VAL B 1 112 ? 17.757 11.586 53.008  1.00 32.45  ? 112  VAL B O   1 
ATOM   2131 C  CB  . VAL B 1 112 ? 18.968 14.455 53.242  1.00 34.45  ? 112  VAL B CB  1 
ATOM   2132 C  CG1 . VAL B 1 112 ? 20.394 13.991 53.469  1.00 44.29  ? 112  VAL B CG1 1 
ATOM   2133 C  CG2 . VAL B 1 112 ? 18.907 15.977 52.997  1.00 41.55  ? 112  VAL B CG2 1 
ATOM   2134 N  N   . GLY B 1 113 ? 19.390 11.557 51.497  1.00 30.21  ? 113  GLY B N   1 
ATOM   2135 C  CA  . GLY B 1 113 ? 19.515 10.112 51.577  1.00 28.34  ? 113  GLY B CA  1 
ATOM   2136 C  C   . GLY B 1 113 ? 20.291 9.478  50.452  1.00 27.52  ? 113  GLY B C   1 
ATOM   2137 O  O   . GLY B 1 113 ? 20.873 10.159 49.635  1.00 29.01  ? 113  GLY B O   1 
ATOM   2138 N  N   . ASN B 1 114 ? 20.302 8.152  50.457  1.00 27.95  ? 114  ASN B N   1 
ATOM   2139 C  CA  . ASN B 1 114 ? 20.921 7.360  49.423  1.00 25.57  ? 114  ASN B CA  1 
ATOM   2140 C  C   . ASN B 1 114 ? 19.903 7.045  48.350  1.00 23.09  ? 114  ASN B C   1 
ATOM   2141 O  O   . ASN B 1 114 ? 18.756 6.685  48.638  1.00 23.87  ? 114  ASN B O   1 
ATOM   2142 C  CB  . ASN B 1 114 ? 21.461 6.072  50.010  1.00 28.30  ? 114  ASN B CB  1 
ATOM   2143 C  CG  . ASN B 1 114 ? 22.514 6.315  51.064  1.00 30.96  ? 114  ASN B CG  1 
ATOM   2144 O  OD1 . ASN B 1 114 ? 23.625 6.773  50.768  1.00 32.34  ? 114  ASN B OD1 1 
ATOM   2145 N  ND2 . ASN B 1 114 ? 22.179 6.003  52.309  1.00 31.86  ? 114  ASN B ND2 1 
ATOM   2146 N  N   . TYR B 1 115 ? 20.343 7.207  47.112  1.00 19.75  ? 115  TYR B N   1 
ATOM   2147 C  CA  . TYR B 1 115 ? 19.496 7.071  45.920  1.00 19.29  ? 115  TYR B CA  1 
ATOM   2148 C  C   . TYR B 1 115 ? 20.089 6.166  44.871  1.00 22.31  ? 115  TYR B C   1 
ATOM   2149 O  O   . TYR B 1 115 ? 21.324 6.016  44.761  1.00 25.27  ? 115  TYR B O   1 
ATOM   2150 C  CB  . TYR B 1 115 ? 19.243 8.443  45.294  1.00 22.31  ? 115  TYR B CB  1 
ATOM   2151 C  CG  . TYR B 1 115 ? 18.232 9.233  46.045  1.00 20.77  ? 115  TYR B CG  1 
ATOM   2152 C  CD1 . TYR B 1 115 ? 18.573 9.916  47.202  1.00 22.21  ? 115  TYR B CD1 1 
ATOM   2153 C  CD2 . TYR B 1 115 ? 16.883 9.245  45.651  1.00 20.72  ? 115  TYR B CD2 1 
ATOM   2154 C  CE1 . TYR B 1 115 ? 17.604 10.618 47.933  1.00 19.42  ? 115  TYR B CE1 1 
ATOM   2155 C  CE2 . TYR B 1 115 ? 15.952 9.932  46.355  1.00 24.83  ? 115  TYR B CE2 1 
ATOM   2156 C  CZ  . TYR B 1 115 ? 16.298 10.620 47.509  1.00 21.25  ? 115  TYR B CZ  1 
ATOM   2157 O  OH  . TYR B 1 115 ? 15.341 11.309 48.234  1.00 24.27  ? 115  TYR B OH  1 
ATOM   2158 N  N   . GLU B 1 116 ? 19.171 5.618  44.079  1.00 22.13  ? 116  GLU B N   1 
ATOM   2159 C  CA  . GLU B 1 116 ? 19.448 4.900  42.852  1.00 22.97  ? 116  GLU B CA  1 
ATOM   2160 C  C   . GLU B 1 116 ? 18.697 5.633  41.742  1.00 22.33  ? 116  GLU B C   1 
ATOM   2161 O  O   . GLU B 1 116 ? 17.510 5.920  41.865  1.00 22.07  ? 116  GLU B O   1 
ATOM   2162 C  CB  . GLU B 1 116 ? 18.952 3.464  42.943  1.00 22.97  ? 116  GLU B CB  1 
ATOM   2163 C  CG  . GLU B 1 116 ? 19.954 2.532  43.642  1.00 34.55  ? 116  GLU B CG  1 
ATOM   2164 C  CD  . GLU B 1 116 ? 19.433 1.119  43.903  1.00 41.92  ? 116  GLU B CD  1 
ATOM   2165 O  OE1 . GLU B 1 116 ? 18.307 0.792  43.493  1.00 40.42  ? 116  GLU B OE1 1 
ATOM   2166 O  OE2 . GLU B 1 116 ? 20.159 0.337  44.563  1.00 53.85  ? 116  GLU B OE2 1 
ATOM   2167 N  N   . LEU B 1 117 ? 19.393 5.915  40.649  1.00 21.91  ? 117  LEU B N   1 
ATOM   2168 C  CA  . LEU B 1 117 ? 18.833 6.599  39.544  1.00 20.58  ? 117  LEU B CA  1 
ATOM   2169 C  C   . LEU B 1 117 ? 19.028 5.706  38.325  1.00 20.85  ? 117  LEU B C   1 
ATOM   2170 O  O   . LEU B 1 117 ? 20.149 5.219  38.066  1.00 19.63  ? 117  LEU B O   1 
ATOM   2171 C  CB  . LEU B 1 117 ? 19.535 7.942  39.310  1.00 20.52  ? 117  LEU B CB  1 
ATOM   2172 C  CG  . LEU B 1 117 ? 19.180 8.666  37.994  1.00 18.45  ? 117  LEU B CG  1 
ATOM   2173 C  CD1 . LEU B 1 117 ? 17.756 9.197  38.041  1.00 19.48  ? 117  LEU B CD1 1 
ATOM   2174 C  CD2 . LEU B 1 117 ? 20.151 9.847  37.739  1.00 18.30  ? 117  LEU B CD2 1 
ATOM   2175 N  N   . THR B 1 118 ? 17.937 5.502  37.596  1.00 20.81  ? 118  THR B N   1 
ATOM   2176 C  CA  . THR B 1 118 ? 17.987 4.760  36.339  1.00 22.49  ? 118  THR B CA  1 
ATOM   2177 C  C   . THR B 1 118 ? 17.479 5.612  35.194  1.00 20.52  ? 118  THR B C   1 
ATOM   2178 O  O   . THR B 1 118 ? 16.449 6.267  35.298  1.00 22.25  ? 118  THR B O   1 
ATOM   2179 C  CB  . THR B 1 118 ? 17.134 3.445  36.407  1.00 22.19  ? 118  THR B CB  1 
ATOM   2180 O  OG1 . THR B 1 118 ? 17.488 2.720  37.583  1.00 25.47  ? 118  THR B OG1 1 
ATOM   2181 C  CG2 . THR B 1 118 ? 17.323 2.583  35.118  1.00 28.09  ? 118  THR B CG2 1 
ATOM   2182 N  N   . PHE B 1 119 ? 18.196 5.575  34.075  1.00 19.74  ? 119  PHE B N   1 
ATOM   2183 C  CA  . PHE B 1 119 ? 17.707 6.116  32.804  1.00 18.62  ? 119  PHE B CA  1 
ATOM   2184 C  C   . PHE B 1 119 ? 17.304 4.987  31.877  1.00 19.78  ? 119  PHE B C   1 
ATOM   2185 O  O   . PHE B 1 119 ? 17.970 3.980  31.846  1.00 20.47  ? 119  PHE B O   1 
ATOM   2186 C  CB  . PHE B 1 119 ? 18.758 6.928  32.068  1.00 18.39  ? 119  PHE B CB  1 
ATOM   2187 C  CG  . PHE B 1 119 ? 19.220 8.201  32.765  1.00 23.41  ? 119  PHE B CG  1 
ATOM   2188 C  CD1 . PHE B 1 119 ? 18.358 8.969  33.577  1.00 22.27  ? 119  PHE B CD1 1 
ATOM   2189 C  CD2 . PHE B 1 119 ? 20.537 8.640  32.581  1.00 23.81  ? 119  PHE B CD2 1 
ATOM   2190 C  CE1 . PHE B 1 119 ? 18.816 10.134 34.177  1.00 21.12  ? 119  PHE B CE1 1 
ATOM   2191 C  CE2 . PHE B 1 119 ? 20.987 9.822  33.169  1.00 18.89  ? 119  PHE B CE2 1 
ATOM   2192 C  CZ  . PHE B 1 119 ? 20.117 10.564 33.980  1.00 23.06  ? 119  PHE B CZ  1 
ATOM   2193 N  N   . TYR B 1 120 ? 16.169 5.156  31.192  1.00 18.92  ? 120  TYR B N   1 
ATOM   2194 C  CA  . TYR B 1 120 ? 15.647 4.248  30.183  1.00 21.43  ? 120  TYR B CA  1 
ATOM   2195 C  C   . TYR B 1 120 ? 15.675 5.045  28.910  1.00 21.46  ? 120  TYR B C   1 
ATOM   2196 O  O   . TYR B 1 120 ? 15.040 6.091  28.829  1.00 23.64  ? 120  TYR B O   1 
ATOM   2197 C  CB  . TYR B 1 120 ? 14.197 3.852  30.506  1.00 22.86  ? 120  TYR B CB  1 
ATOM   2198 C  CG  . TYR B 1 120 ? 14.075 3.150  31.810  1.00 29.52  ? 120  TYR B CG  1 
ATOM   2199 C  CD1 . TYR B 1 120 ? 14.229 1.764  31.892  1.00 36.01  ? 120  TYR B CD1 1 
ATOM   2200 C  CD2 . TYR B 1 120 ? 13.769 3.855  32.971  1.00 35.75  ? 120  TYR B CD2 1 
ATOM   2201 C  CE1 . TYR B 1 120 ? 14.115 1.109  33.111  1.00 34.24  ? 120  TYR B CE1 1 
ATOM   2202 C  CE2 . TYR B 1 120 ? 13.636 3.206  34.193  1.00 35.51  ? 120  TYR B CE2 1 
ATOM   2203 C  CZ  . TYR B 1 120 ? 13.808 1.840  34.255  1.00 34.95  ? 120  TYR B CZ  1 
ATOM   2204 O  OH  . TYR B 1 120 ? 13.674 1.193  35.473  1.00 39.52  ? 120  TYR B OH  1 
ATOM   2205 N  N   . ILE B 1 121 ? 16.457 4.583  27.936  1.00 20.41  ? 121  ILE B N   1 
ATOM   2206 C  CA  . ILE B 1 121 ? 16.800 5.396  26.746  1.00 19.43  ? 121  ILE B CA  1 
ATOM   2207 C  C   . ILE B 1 121 ? 16.465 4.611  25.495  1.00 21.11  ? 121  ILE B C   1 
ATOM   2208 O  O   . ILE B 1 121 ? 16.837 3.439  25.374  1.00 20.04  ? 121  ILE B O   1 
ATOM   2209 C  CB  . ILE B 1 121 ? 18.330 5.764  26.746  1.00 17.97  ? 121  ILE B CB  1 
ATOM   2210 C  CG1 . ILE B 1 121 ? 18.683 6.543  28.036  1.00 24.19  ? 121  ILE B CG1 1 
ATOM   2211 C  CG2 . ILE B 1 121 ? 18.714 6.534  25.465  1.00 20.49  ? 121  ILE B CG2 1 
ATOM   2212 C  CD1 . ILE B 1 121 ? 20.184 6.794  28.252  1.00 20.86  ? 121  ILE B CD1 1 
ATOM   2213 N  N   . SER B 1 122 ? 15.736 5.256  24.589  1.00 20.18  ? 122  SER B N   1 
ATOM   2214 C  CA  . SER B 1 122 ? 15.480 4.723  23.230  1.00 21.01  ? 122  SER B CA  1 
ATOM   2215 C  C   . SER B 1 122 ? 16.117 5.596  22.159  1.00 21.19  ? 122  SER B C   1 
ATOM   2216 O  O   . SER B 1 122 ? 16.329 6.821  22.340  1.00 18.45  ? 122  SER B O   1 
ATOM   2217 C  CB  . SER B 1 122 ? 13.970 4.607  22.964  1.00 25.71  ? 122  SER B CB  1 
ATOM   2218 O  OG  . SER B 1 122 ? 13.339 3.958  24.029  1.00 33.79  ? 122  SER B OG  1 
ATOM   2219 N  N   . ASN B 1 123 ? 16.326 4.979  20.996  1.00 18.45  ? 123  ASN B N   1 
ATOM   2220 C  CA  . ASN B 1 123 ? 17.129 5.557  19.967  1.00 19.63  ? 123  ASN B CA  1 
ATOM   2221 C  C   . ASN B 1 123 ? 16.371 6.649  19.169  1.00 20.42  ? 123  ASN B C   1 
ATOM   2222 O  O   . ASN B 1 123 ? 15.150 6.761  19.280  1.00 19.39  ? 123  ASN B O   1 
ATOM   2223 C  CB  . ASN B 1 123 ? 17.753 4.472  19.092  1.00 19.42  ? 123  ASN B CB  1 
ATOM   2224 C  CG  . ASN B 1 123 ? 16.758 3.836  18.109  1.00 18.08  ? 123  ASN B CG  1 
ATOM   2225 O  OD1 . ASN B 1 123 ? 15.984 4.542  17.488  1.00 21.33  ? 123  ASN B OD1 1 
ATOM   2226 N  ND2 . ASN B 1 123 ? 16.813 2.515  17.948  1.00 17.11  ? 123  ASN B ND2 1 
ATOM   2227 N  N   . PRO B 1 124 ? 17.098 7.455  18.398  1.00 17.98  ? 124  PRO B N   1 
ATOM   2228 C  CA  . PRO B 1 124 ? 16.488 8.603  17.725  1.00 18.81  ? 124  PRO B CA  1 
ATOM   2229 C  C   . PRO B 1 124 ? 15.448 8.243  16.667  1.00 17.79  ? 124  PRO B C   1 
ATOM   2230 O  O   . PRO B 1 124 ? 14.623 9.071  16.321  1.00 22.39  ? 124  PRO B O   1 
ATOM   2231 C  CB  . PRO B 1 124 ? 17.704 9.289  17.067  1.00 19.30  ? 124  PRO B CB  1 
ATOM   2232 C  CG  . PRO B 1 124 ? 18.834 8.971  18.062  1.00 20.14  ? 124  PRO B CG  1 
ATOM   2233 C  CD  . PRO B 1 124 ? 18.578 7.523  18.294  1.00 18.98  ? 124  PRO B CD  1 
ATOM   2234 N  N   . GLU B 1 125 ? 15.478 7.011  16.170  1.00 19.15  ? 125  GLU B N   1 
ATOM   2235 C  CA  . GLU B 1 125 ? 14.566 6.611  15.097  1.00 23.85  ? 125  GLU B CA  1 
ATOM   2236 C  C   . GLU B 1 125 ? 13.135 6.588  15.603  1.00 26.37  ? 125  GLU B C   1 
ATOM   2237 O  O   . GLU B 1 125 ? 12.208 6.775  14.852  1.00 29.39  ? 125  GLU B O   1 
ATOM   2238 C  CB  . GLU B 1 125 ? 15.008 5.256  14.513  1.00 24.17  ? 125  GLU B CB  1 
ATOM   2239 C  CG  . GLU B 1 125 ? 14.346 4.863  13.245  1.00 37.31  ? 125  GLU B CG  1 
ATOM   2240 C  CD  . GLU B 1 125 ? 14.939 3.580  12.729  1.00 51.47  ? 125  GLU B CD  1 
ATOM   2241 O  OE1 . GLU B 1 125 ? 16.183 3.526  12.601  1.00 57.59  ? 125  GLU B OE1 1 
ATOM   2242 O  OE2 . GLU B 1 125 ? 14.173 2.633  12.484  1.00 58.63  ? 125  GLU B OE2 1 
ATOM   2243 N  N   . LYS B 1 126 ? 12.966 6.429  16.910  1.00 29.13  ? 126  LYS B N   1 
ATOM   2244 C  CA  . LYS B 1 126 ? 11.658 6.481  17.538  1.00 35.35  ? 126  LYS B CA  1 
ATOM   2245 C  C   . LYS B 1 126 ? 11.013 7.848  17.330  1.00 33.93  ? 126  LYS B C   1 
ATOM   2246 O  O   . LYS B 1 126 ? 9.776  7.949  17.259  1.00 39.60  ? 126  LYS B O   1 
ATOM   2247 C  CB  . LYS B 1 126 ? 11.800 6.173  19.034  1.00 35.34  ? 126  LYS B CB  1 
ATOM   2248 C  CG  . LYS B 1 126 ? 10.513 6.061  19.830  1.00 49.87  ? 126  LYS B CG  1 
ATOM   2249 C  CD  . LYS B 1 126 ? 10.814 5.541  21.241  1.00 54.27  ? 126  LYS B CD  1 
ATOM   2250 C  CE  . LYS B 1 126 ? 9.566  5.042  21.980  1.00 69.30  ? 126  LYS B CE  1 
ATOM   2251 N  NZ  . LYS B 1 126 ? 8.884  6.121  22.764  1.00 72.17  ? 126  LYS B NZ  1 
ATOM   2252 N  N   . GLN B 1 127 ? 11.833 8.893  17.249  1.00 25.89  ? 127  GLN B N   1 
ATOM   2253 C  CA  . GLN B 1 127 ? 11.314 10.239 16.995  1.00 28.79  ? 127  GLN B CA  1 
ATOM   2254 C  C   . GLN B 1 127 ? 11.457 10.625 15.521  1.00 31.61  ? 127  GLN B C   1 
ATOM   2255 O  O   . GLN B 1 127 ? 11.304 11.786 15.155  1.00 34.04  ? 127  GLN B O   1 
ATOM   2256 C  CB  . GLN B 1 127 ? 12.002 11.261 17.899  1.00 26.83  ? 127  GLN B CB  1 
ATOM   2257 C  CG  . GLN B 1 127 ? 11.688 11.082 19.398  1.00 30.99  ? 127  GLN B CG  1 
ATOM   2258 C  CD  . GLN B 1 127 ? 12.351 12.115 20.259  1.00 30.58  ? 127  GLN B CD  1 
ATOM   2259 O  OE1 . GLN B 1 127 ? 12.801 13.155 19.778  1.00 32.86  ? 127  GLN B OE1 1 
ATOM   2260 N  NE2 . GLN B 1 127 ? 12.425 11.839 21.564  1.00 33.33  ? 127  GLN B NE2 1 
ATOM   2261 N  N   . GLY B 1 128 ? 11.731 9.638  14.671  1.00 29.86  ? 128  GLY B N   1 
ATOM   2262 C  CA  . GLY B 1 128 ? 11.730 9.862  13.239  1.00 32.18  ? 128  GLY B CA  1 
ATOM   2263 C  C   . GLY B 1 128 ? 13.041 10.299 12.625  1.00 27.18  ? 128  GLY B C   1 
ATOM   2264 O  O   . GLY B 1 128 ? 13.109 10.538 11.419  1.00 29.63  ? 128  GLY B O   1 
ATOM   2265 N  N   . PHE B 1 129 ? 14.091 10.334 13.422  1.00 20.18  ? 129  PHE B N   1 
ATOM   2266 C  CA  . PHE B 1 129 ? 15.443 10.686 12.943  1.00 16.93  ? 129  PHE B CA  1 
ATOM   2267 C  C   . PHE B 1 129 ? 15.987 9.601  12.049  1.00 20.70  ? 129  PHE B C   1 
ATOM   2268 O  O   . PHE B 1 129 ? 15.901 8.438  12.406  1.00 21.81  ? 129  PHE B O   1 
ATOM   2269 C  CB  . PHE B 1 129 ? 16.305 10.838 14.187  1.00 18.16  ? 129  PHE B CB  1 
ATOM   2270 C  CG  . PHE B 1 129 ? 17.679 11.385 13.941  1.00 14.49  ? 129  PHE B CG  1 
ATOM   2271 C  CD1 . PHE B 1 129 ? 17.917 12.743 13.929  1.00 14.09  ? 129  PHE B CD1 1 
ATOM   2272 C  CD2 . PHE B 1 129 ? 18.728 10.538 13.807  1.00 16.11  ? 129  PHE B CD2 1 
ATOM   2273 C  CE1 . PHE B 1 129 ? 19.166 13.240 13.725  1.00 18.25  ? 129  PHE B CE1 1 
ATOM   2274 C  CE2 . PHE B 1 129 ? 19.996 11.021 13.628  1.00 17.75  ? 129  PHE B CE2 1 
ATOM   2275 C  CZ  . PHE B 1 129 ? 20.221 12.394 13.570  1.00 17.86  ? 129  PHE B CZ  1 
ATOM   2276 N  N   . GLY B 1 130 ? 16.503 9.953  10.867  1.00 19.79  ? 130  GLY B N   1 
ATOM   2277 C  CA  . GLY B 1 130 ? 16.995 8.950  9.946   1.00 18.74  ? 130  GLY B CA  1 
ATOM   2278 C  C   . GLY B 1 130 ? 18.488 8.655  10.004  1.00 19.69  ? 130  GLY B C   1 
ATOM   2279 O  O   . GLY B 1 130 ? 19.275 9.321  10.690  1.00 17.62  ? 130  GLY B O   1 
ATOM   2280 N  N   . ARG B 1 131 ? 18.889 7.654  9.240   1.00 20.23  ? 131  ARG B N   1 
ATOM   2281 C  CA  . ARG B 1 131 ? 20.320 7.367  9.069   1.00 22.00  ? 131  ARG B CA  1 
ATOM   2282 C  C   . ARG B 1 131 ? 20.600 6.896  7.640   1.00 18.93  ? 131  ARG B C   1 
ATOM   2283 O  O   . ARG B 1 131 ? 19.783 6.158  7.057   1.00 20.08  ? 131  ARG B O   1 
ATOM   2284 C  CB  . ARG B 1 131 ? 20.828 6.365  10.102  1.00 21.78  ? 131  ARG B CB  1 
ATOM   2285 C  CG  . ARG B 1 131 ? 20.276 5.003  9.984   1.00 22.76  ? 131  ARG B CG  1 
ATOM   2286 C  CD  . ARG B 1 131 ? 20.806 4.060  11.044  1.00 28.47  ? 131  ARG B CD  1 
ATOM   2287 N  NE  . ARG B 1 131 ? 20.063 2.823  10.875  1.00 28.17  ? 131  ARG B NE  1 
ATOM   2288 C  CZ  . ARG B 1 131 ? 20.496 1.710  10.294  1.00 27.84  ? 131  ARG B CZ  1 
ATOM   2289 N  NH1 . ARG B 1 131 ? 21.758 1.541  9.884   1.00 29.75  ? 131  ARG B NH1 1 
ATOM   2290 N  NH2 . ARG B 1 131 ? 19.653 0.700  10.193  1.00 32.68  ? 131  ARG B NH2 1 
ATOM   2291 N  N   . HIS B 1 132 ? 21.738 7.303  7.085   1.00 18.09  ? 132  HIS B N   1 
ATOM   2292 C  CA  . HIS B 1 132 ? 22.186 6.798  5.775   1.00 19.60  ? 132  HIS B CA  1 
ATOM   2293 C  C   . HIS B 1 132 ? 22.630 5.345  5.970   1.00 20.76  ? 132  HIS B C   1 
ATOM   2294 O  O   . HIS B 1 132 ? 23.206 4.994  7.035   1.00 20.02  ? 132  HIS B O   1 
ATOM   2295 C  CB  . HIS B 1 132 ? 23.374 7.606  5.287   1.00 18.30  ? 132  HIS B CB  1 
ATOM   2296 C  CG  . HIS B 1 132 ? 23.042 9.013  4.894   1.00 17.60  ? 132  HIS B CG  1 
ATOM   2297 N  ND1 . HIS B 1 132 ? 23.797 9.723  3.977   1.00 21.52  ? 132  HIS B ND1 1 
ATOM   2298 C  CD2 . HIS B 1 132 ? 22.002 9.802  5.232   1.00 18.58  ? 132  HIS B CD2 1 
ATOM   2299 C  CE1 . HIS B 1 132 ? 23.235 10.910 3.801   1.00 21.28  ? 132  HIS B CE1 1 
ATOM   2300 N  NE2 . HIS B 1 132 ? 22.156 10.988 4.577   1.00 15.72  ? 132  HIS B NE2 1 
ATOM   2301 N  N   . VAL B 1 133 ? 22.336 4.514  4.986   1.00 20.88  ? 133  VAL B N   1 
ATOM   2302 C  CA  . VAL B 1 133 ? 22.743 3.109  5.002   1.00 19.84  ? 133  VAL B CA  1 
ATOM   2303 C  C   . VAL B 1 133 ? 23.413 2.686  3.697   1.00 21.00  ? 133  VAL B C   1 
ATOM   2304 O  O   . VAL B 1 133 ? 23.656 1.490  3.487   1.00 22.94  ? 133  VAL B O   1 
ATOM   2305 C  CB  . VAL B 1 133 ? 21.545 2.174  5.325   1.00 20.34  ? 133  VAL B CB  1 
ATOM   2306 C  CG1 . VAL B 1 133 ? 20.996 2.471  6.740   1.00 20.30  ? 133  VAL B CG1 1 
ATOM   2307 C  CG2 . VAL B 1 133 ? 20.434 2.247  4.282   1.00 23.13  ? 133  VAL B CG2 1 
ATOM   2308 N  N   . ASP B 1 134 ? 23.737 3.653  2.850   1.00 25.19  ? 134  ASP B N   1 
ATOM   2309 C  CA  . ASP B 1 134 ? 24.437 3.347  1.568   1.00 26.02  ? 134  ASP B CA  1 
ATOM   2310 C  C   . ASP B 1 134 ? 25.882 3.003  1.905   1.00 26.85  ? 134  ASP B C   1 
ATOM   2311 O  O   . ASP B 1 134 ? 26.349 3.333  2.979   1.00 21.74  ? 134  ASP B O   1 
ATOM   2312 C  CB  . ASP B 1 134 ? 24.390 4.545  0.631   1.00 28.06  ? 134  ASP B CB  1 
ATOM   2313 C  CG  . ASP B 1 134 ? 24.916 5.803  1.280   1.00 37.51  ? 134  ASP B CG  1 
ATOM   2314 O  OD1 . ASP B 1 134 ? 24.269 6.268  2.259   1.00 42.09  ? 134  ASP B OD1 1 
ATOM   2315 O  OD2 . ASP B 1 134 ? 25.985 6.291  0.862   1.00 34.23  ? 134  ASP B OD2 1 
ATOM   2316 N  N   . GLU B 1 135 ? 26.595 2.385  0.966   1.00 27.73  ? 135  GLU B N   1 
ATOM   2317 C  CA  . GLU B 1 135 ? 27.954 1.928  1.224   1.00 30.41  ? 135  GLU B CA  1 
ATOM   2318 C  C   . GLU B 1 135 ? 28.919 3.078  1.575   1.00 28.80  ? 135  GLU B C   1 
ATOM   2319 O  O   . GLU B 1 135 ? 29.713 2.983  2.522   1.00 30.93  ? 135  GLU B O   1 
ATOM   2320 C  CB  . GLU B 1 135 ? 28.461 1.212  -0.004  1.00 33.34  ? 135  GLU B CB  1 
ATOM   2321 C  CG  . GLU B 1 135 ? 29.661 0.388  0.266   1.00 36.32  ? 135  GLU B CG  1 
ATOM   2322 C  CD  . GLU B 1 135 ? 29.868 -0.645 -0.790  1.00 34.19  ? 135  GLU B CD  1 
ATOM   2323 O  OE1 . GLU B 1 135 ? 28.926 -1.434 -1.066  1.00 41.82  ? 135  GLU B OE1 1 
ATOM   2324 O  OE2 . GLU B 1 135 ? 30.974 -0.656 -1.356  1.00 53.84  ? 135  GLU B OE2 1 
ATOM   2325 N  N   . GLU B 1 136 ? 28.752 4.191  0.883   1.00 26.27  ? 136  GLU B N   1 
ATOM   2326 C  CA  A GLU B 1 136 ? 29.703 5.292  0.883   0.50 30.12  ? 136  GLU B CA  1 
ATOM   2327 C  CA  B GLU B 1 136 ? 29.759 5.262  0.932   0.50 30.12  ? 136  GLU B CA  1 
ATOM   2328 C  C   . GLU B 1 136 ? 29.610 6.116  2.175   1.00 29.77  ? 136  GLU B C   1 
ATOM   2329 O  O   . GLU B 1 136 ? 30.626 6.445  2.793   1.00 30.53  ? 136  GLU B O   1 
ATOM   2330 C  CB  A GLU B 1 136 ? 29.437 6.178  -0.351  0.50 32.52  ? 136  GLU B CB  1 
ATOM   2331 C  CB  B GLU B 1 136 ? 29.774 6.151  -0.327  0.50 32.27  ? 136  GLU B CB  1 
ATOM   2332 C  CG  A GLU B 1 136 ? 29.736 5.532  -1.733  0.50 37.87  ? 136  GLU B CG  1 
ATOM   2333 C  CG  B GLU B 1 136 ? 30.912 7.215  -0.295  0.50 38.82  ? 136  GLU B CG  1 
ATOM   2334 C  CD  A GLU B 1 136 ? 28.714 4.475  -2.223  0.50 43.33  ? 136  GLU B CD  1 
ATOM   2335 C  CD  B GLU B 1 136 ? 30.982 8.117  -1.531  0.50 41.62  ? 136  GLU B CD  1 
ATOM   2336 O  OE1 A GLU B 1 136 ? 27.621 4.322  -1.626  0.50 35.15  ? 136  GLU B OE1 1 
ATOM   2337 O  OE1 B GLU B 1 136 ? 30.275 7.868  -2.530  0.50 46.00  ? 136  GLU B OE1 1 
ATOM   2338 O  OE2 A GLU B 1 136 ? 29.025 3.779  -3.226  0.50 43.43  ? 136  GLU B OE2 1 
ATOM   2339 O  OE2 B GLU B 1 136 ? 31.769 9.086  -1.502  0.50 44.72  ? 136  GLU B OE2 1 
ATOM   2340 N  N   . THR B 1 137 ? 28.370 6.435  2.573   1.00 27.75  ? 137  THR B N   1 
ATOM   2341 C  CA  . THR B 1 137 ? 28.141 7.348  3.711   1.00 29.54  ? 137  THR B CA  1 
ATOM   2342 C  C   . THR B 1 137 ? 27.327 6.754  4.862   1.00 24.71  ? 137  THR B C   1 
ATOM   2343 O  O   . THR B 1 137 ? 26.992 7.457  5.838   1.00 25.45  ? 137  THR B O   1 
ATOM   2344 C  CB  . THR B 1 137 ? 27.434 8.628  3.242   1.00 30.20  ? 137  THR B CB  1 
ATOM   2345 O  OG1 . THR B 1 137 ? 26.065 8.340  2.926   1.00 29.65  ? 137  THR B OG1 1 
ATOM   2346 C  CG2 . THR B 1 137 ? 28.131 9.237  2.043   1.00 30.90  ? 137  THR B CG2 1 
ATOM   2347 N  N   . GLY B 1 138 ? 27.011 5.467  4.769   1.00 21.56  ? 138  GLY B N   1 
ATOM   2348 C  CA  . GLY B 1 138 ? 26.123 4.832  5.700   1.00 20.04  ? 138  GLY B CA  1 
ATOM   2349 C  C   . GLY B 1 138 ? 26.748 4.500  7.028   1.00 19.97  ? 138  GLY B C   1 
ATOM   2350 O  O   . GLY B 1 138 ? 27.984 4.433  7.160   1.00 22.89  ? 138  GLY B O   1 
ATOM   2351 N  N   . VAL B 1 139 ? 25.887 4.265  8.016   1.00 19.27  ? 139  VAL B N   1 
ATOM   2352 C  CA  . VAL B 1 139 ? 26.297 3.917  9.361   1.00 20.50  ? 139  VAL B CA  1 
ATOM   2353 C  C   . VAL B 1 139 ? 25.493 2.713  9.822   1.00 22.61  ? 139  VAL B C   1 
ATOM   2354 O  O   . VAL B 1 139 ? 24.483 2.365  9.188   1.00 26.32  ? 139  VAL B O   1 
ATOM   2355 C  CB  . VAL B 1 139 ? 26.114 5.110  10.347  1.00 21.61  ? 139  VAL B CB  1 
ATOM   2356 C  CG1 . VAL B 1 139 ? 26.927 6.301  9.890   1.00 22.87  ? 139  VAL B CG1 1 
ATOM   2357 C  CG2 . VAL B 1 139 ? 24.662 5.494  10.491  1.00 18.33  ? 139  VAL B CG2 1 
ATOM   2358 N  N   . GLY B 1 140 ? 25.934 2.110  10.914  1.00 20.80  ? 140  GLY B N   1 
ATOM   2359 C  CA  . GLY B 1 140 ? 25.309 0.934  11.501  1.00 23.51  ? 140  GLY B CA  1 
ATOM   2360 C  C   . GLY B 1 140 ? 23.997 1.230  12.179  1.00 20.87  ? 140  GLY B C   1 
ATOM   2361 O  O   . GLY B 1 140 ? 23.575 2.393  12.322  1.00 24.54  ? 140  GLY B O   1 
ATOM   2362 N  N   . LYS B 1 141 ? 23.343 0.151  12.555  1.00 21.40  ? 141  LYS B N   1 
ATOM   2363 C  CA  . LYS B 1 141 ? 22.104 0.178  13.289  1.00 21.92  ? 141  LYS B CA  1 
ATOM   2364 C  C   . LYS B 1 141 ? 22.194 0.871  14.646  1.00 21.94  ? 141  LYS B C   1 
ATOM   2365 O  O   . LYS B 1 141 ? 23.230 0.876  15.278  1.00 20.95  ? 141  LYS B O   1 
ATOM   2366 C  CB  . LYS B 1 141 ? 21.648 -1.270 13.549  1.00 22.95  ? 141  LYS B CB  1 
ATOM   2367 C  CG  . LYS B 1 141 ? 20.929 -1.943 12.495  1.00 29.71  ? 141  LYS B CG  1 
ATOM   2368 C  CD  . LYS B 1 141 ? 20.472 -3.326 12.993  1.00 35.04  ? 141  LYS B CD  1 
ATOM   2369 C  CE  . LYS B 1 141 ? 19.677 -4.067 11.959  1.00 39.36  ? 141  LYS B CE  1 
ATOM   2370 N  NZ  . LYS B 1 141 ? 19.389 -5.470 12.432  1.00 34.78  ? 141  LYS B NZ  1 
ATOM   2371 N  N   . TRP B 1 142 ? 21.061 1.412  15.079  1.00 25.24  ? 142  TRP B N   1 
ATOM   2372 C  CA  . TRP B 1 142 ? 20.865 1.967  16.419  1.00 26.65  ? 142  TRP B CA  1 
ATOM   2373 C  C   . TRP B 1 142 ? 20.702 0.941  17.529  1.00 24.72  ? 142  TRP B C   1 
ATOM   2374 O  O   . TRP B 1 142 ? 20.142 -0.128 17.315  1.00 27.09  ? 142  TRP B O   1 
ATOM   2375 C  CB  . TRP B 1 142 ? 19.558 2.794  16.367  1.00 27.77  ? 142  TRP B CB  1 
ATOM   2376 C  CG  . TRP B 1 142 ? 19.603 4.009  15.531  1.00 33.43  ? 142  TRP B CG  1 
ATOM   2377 C  CD1 . TRP B 1 142 ? 18.950 4.251  14.368  1.00 35.75  ? 142  TRP B CD1 1 
ATOM   2378 C  CD2 . TRP B 1 142 ? 20.345 5.158  15.831  1.00 29.81  ? 142  TRP B CD2 1 
ATOM   2379 N  NE1 . TRP B 1 142 ? 19.249 5.518  13.918  1.00 39.65  ? 142  TRP B NE1 1 
ATOM   2380 C  CE2 . TRP B 1 142 ? 20.115 6.089  14.813  1.00 31.77  ? 142  TRP B CE2 1 
ATOM   2381 C  CE3 . TRP B 1 142 ? 21.203 5.493  16.886  1.00 28.93  ? 142  TRP B CE3 1 
ATOM   2382 C  CZ2 . TRP B 1 142 ? 20.712 7.340  14.815  1.00 36.97  ? 142  TRP B CZ2 1 
ATOM   2383 C  CZ3 . TRP B 1 142 ? 21.773 6.735  16.886  1.00 37.03  ? 142  TRP B CZ3 1 
ATOM   2384 C  CH2 . TRP B 1 142 ? 21.544 7.625  15.868  1.00 24.37  ? 142  TRP B CH2 1 
ATOM   2385 N  N   . PHE B 1 143 ? 21.219 1.233  18.728  1.00 23.05  ? 143  PHE B N   1 
ATOM   2386 C  CA  . PHE B 1 143 ? 20.939 0.475  19.902  1.00 22.18  ? 143  PHE B CA  1 
ATOM   2387 C  C   . PHE B 1 143 ? 19.466 0.217  20.169  1.00 22.94  ? 143  PHE B C   1 
ATOM   2388 O  O   . PHE B 1 143 ? 18.599 1.048  19.877  1.00 22.16  ? 143  PHE B O   1 
ATOM   2389 C  CB  . PHE B 1 143 ? 21.571 1.119  21.166  1.00 22.49  ? 143  PHE B CB  1 
ATOM   2390 C  CG  . PHE B 1 143 ? 21.070 2.510  21.446  1.00 26.79  ? 143  PHE B CG  1 
ATOM   2391 C  CD1 . PHE B 1 143 ? 19.888 2.717  22.151  1.00 24.66  ? 143  PHE B CD1 1 
ATOM   2392 C  CD2 . PHE B 1 143 ? 21.736 3.595  20.944  1.00 29.64  ? 143  PHE B CD2 1 
ATOM   2393 C  CE1 . PHE B 1 143 ? 19.428 4.011  22.385  1.00 29.21  ? 143  PHE B CE1 1 
ATOM   2394 C  CE2 . PHE B 1 143 ? 21.260 4.876  21.164  1.00 31.55  ? 143  PHE B CE2 1 
ATOM   2395 C  CZ  . PHE B 1 143 ? 20.134 5.063  21.891  1.00 24.49  ? 143  PHE B CZ  1 
ATOM   2396 N  N   . GLU B 1 144 ? 19.206 -0.971 20.711  1.00 20.61  ? 144  GLU B N   1 
ATOM   2397 C  CA  . GLU B 1 144 ? 17.896 -1.298 21.317  1.00 22.64  ? 144  GLU B CA  1 
ATOM   2398 C  C   . GLU B 1 144 ? 17.704 -0.509 22.604  1.00 19.70  ? 144  GLU B C   1 
ATOM   2399 O  O   . GLU B 1 144 ? 18.701 -0.115 23.237  1.00 19.71  ? 144  GLU B O   1 
ATOM   2400 C  CB  . GLU B 1 144 ? 17.836 -2.801 21.657  1.00 26.09  ? 144  GLU B CB  1 
ATOM   2401 C  CG  . GLU B 1 144 ? 17.721 -3.667 20.496  1.00 35.15  ? 144  GLU B CG  1 
ATOM   2402 C  CD  . GLU B 1 144 ? 16.311 -3.686 19.966  1.00 28.54  ? 144  GLU B CD  1 
ATOM   2403 O  OE1 . GLU B 1 144 ? 15.429 -4.244 20.670  1.00 36.98  ? 144  GLU B OE1 1 
ATOM   2404 O  OE2 . GLU B 1 144 ? 16.113 -3.108 18.878  1.00 35.42  ? 144  GLU B OE2 1 
ATOM   2405 N  N   . PRO B 1 145 ? 16.452 -0.293 23.028  1.00 19.81  ? 145  PRO B N   1 
ATOM   2406 C  CA  . PRO B 1 145 ? 16.267 0.424  24.289  1.00 21.03  ? 145  PRO B CA  1 
ATOM   2407 C  C   . PRO B 1 145 ? 17.055 -0.204 25.409  1.00 18.44  ? 145  PRO B C   1 
ATOM   2408 O  O   . PRO B 1 145 ? 17.192 -1.452 25.488  1.00 19.90  ? 145  PRO B O   1 
ATOM   2409 C  CB  . PRO B 1 145 ? 14.758 0.308  24.538  1.00 23.71  ? 145  PRO B CB  1 
ATOM   2410 C  CG  . PRO B 1 145 ? 14.202 0.117  23.144  1.00 26.34  ? 145  PRO B CG  1 
ATOM   2411 C  CD  . PRO B 1 145 ? 15.166 -0.727 22.463  1.00 25.13  ? 145  PRO B CD  1 
ATOM   2412 N  N   . PHE B 1 146 ? 17.630 0.635  26.263  1.00 18.74  ? 146  PHE B N   1 
ATOM   2413 C  CA  . PHE B 1 146 ? 18.455 0.164  27.349  1.00 21.07  ? 146  PHE B CA  1 
ATOM   2414 C  C   . PHE B 1 146 ? 18.290 0.984  28.611  1.00 18.94  ? 146  PHE B C   1 
ATOM   2415 O  O   . PHE B 1 146 ? 17.701 2.069  28.617  1.00 17.84  ? 146  PHE B O   1 
ATOM   2416 C  CB  . PHE B 1 146 ? 19.925 0.129  26.949  1.00 19.65  ? 146  PHE B CB  1 
ATOM   2417 C  CG  . PHE B 1 146 ? 20.520 1.491  26.713  1.00 20.59  ? 146  PHE B CG  1 
ATOM   2418 C  CD1 . PHE B 1 146 ? 20.358 2.141  25.475  1.00 17.37  ? 146  PHE B CD1 1 
ATOM   2419 C  CD2 . PHE B 1 146 ? 21.291 2.094  27.693  1.00 21.56  ? 146  PHE B CD2 1 
ATOM   2420 C  CE1 . PHE B 1 146 ? 20.929 3.419  25.248  1.00 18.11  ? 146  PHE B CE1 1 
ATOM   2421 C  CE2 . PHE B 1 146 ? 21.848 3.345  27.460  1.00 21.64  ? 146  PHE B CE2 1 
ATOM   2422 C  CZ  . PHE B 1 146 ? 21.653 3.992  26.239  1.00 19.10  ? 146  PHE B CZ  1 
ATOM   2423 N  N   . LYS B 1 147 ? 18.836 0.451  29.681  1.00 21.14  ? 147  LYS B N   1 
ATOM   2424 C  CA  . LYS B 1 147 ? 18.880 1.189  30.894  1.00 23.74  ? 147  LYS B CA  1 
ATOM   2425 C  C   . LYS B 1 147 ? 20.301 1.315  31.380  1.00 24.19  ? 147  LYS B C   1 
ATOM   2426 O  O   . LYS B 1 147 ? 21.170 0.503  31.041  1.00 25.26  ? 147  LYS B O   1 
ATOM   2427 C  CB  . LYS B 1 147 ? 18.000 0.553  31.982  1.00 27.26  ? 147  LYS B CB  1 
ATOM   2428 C  CG  . LYS B 1 147 ? 18.444 -0.805 32.450  1.00 31.38  ? 147  LYS B CG  1 
ATOM   2429 C  CD  . LYS B 1 147 ? 17.375 -1.437 33.365  1.00 43.14  ? 147  LYS B CD  1 
ATOM   2430 C  CE  . LYS B 1 147 ? 17.900 -2.686 34.059  1.00 52.23  ? 147  LYS B CE  1 
ATOM   2431 N  NZ  . LYS B 1 147 ? 19.076 -2.350 34.913  1.00 60.10  ? 147  LYS B NZ  1 
ATOM   2432 N  N   . VAL B 1 148 ? 20.502 2.360  32.160  1.00 21.01  ? 148  VAL B N   1 
ATOM   2433 C  CA  . VAL B 1 148 ? 21.746 2.604  32.848  1.00 20.15  ? 148  VAL B CA  1 
ATOM   2434 C  C   . VAL B 1 148 ? 21.396 3.070  34.250  1.00 22.46  ? 148  VAL B C   1 
ATOM   2435 O  O   . VAL B 1 148 ? 20.424 3.806  34.445  1.00 22.08  ? 148  VAL B O   1 
ATOM   2436 C  CB  . VAL B 1 148 ? 22.648 3.621  32.112  1.00 23.50  ? 148  VAL B CB  1 
ATOM   2437 C  CG1 . VAL B 1 148 ? 23.198 3.026  30.841  1.00 30.87  ? 148  VAL B CG1 1 
ATOM   2438 C  CG2 . VAL B 1 148 ? 21.897 4.913  31.803  1.00 20.07  ? 148  VAL B CG2 1 
ATOM   2439 N  N   . ASP B 1 149 ? 22.232 2.676  35.192  1.00 21.91  ? 149  ASP B N   1 
ATOM   2440 C  CA  . ASP B 1 149 ? 21.966 2.863  36.614  1.00 22.73  ? 149  ASP B CA  1 
ATOM   2441 C  C   . ASP B 1 149 ? 23.104 3.591  37.319  1.00 22.37  ? 149  ASP B C   1 
ATOM   2442 O  O   . ASP B 1 149 ? 24.277 3.347  37.021  1.00 23.10  ? 149  ASP B O   1 
ATOM   2443 C  CB  . ASP B 1 149 ? 21.787 1.480  37.240  1.00 28.54  ? 149  ASP B CB  1 
ATOM   2444 C  CG  . ASP B 1 149 ? 20.489 0.812  36.838  1.00 38.73  ? 149  ASP B CG  1 
ATOM   2445 O  OD1 . ASP B 1 149 ? 19.442 1.133  37.451  1.00 46.20  ? 149  ASP B OD1 1 
ATOM   2446 O  OD2 . ASP B 1 149 ? 20.512 -0.061 35.943  1.00 42.15  ? 149  ASP B OD2 1 
ATOM   2447 N  N   . TYR B 1 150 ? 22.750 4.426  38.305  1.00 21.73  ? 150  TYR B N   1 
ATOM   2448 C  CA  . TYR B 1 150 ? 23.694 5.203  39.093  1.00 20.66  ? 150  TYR B CA  1 
ATOM   2449 C  C   . TYR B 1 150 ? 23.322 5.142  40.561  1.00 22.70  ? 150  TYR B C   1 
ATOM   2450 O  O   . TYR B 1 150 ? 22.146 5.052  40.876  1.00 24.79  ? 150  TYR B O   1 
ATOM   2451 C  CB  . TYR B 1 150 ? 23.649 6.696  38.696  1.00 20.46  ? 150  TYR B CB  1 
ATOM   2452 C  CG  . TYR B 1 150 ? 23.817 6.940  37.223  1.00 18.23  ? 150  TYR B CG  1 
ATOM   2453 C  CD1 . TYR B 1 150 ? 22.735 6.916  36.387  1.00 22.22  ? 150  TYR B CD1 1 
ATOM   2454 C  CD2 . TYR B 1 150 ? 25.083 7.173  36.675  1.00 18.95  ? 150  TYR B CD2 1 
ATOM   2455 C  CE1 . TYR B 1 150 ? 22.898 7.094  35.042  1.00 18.34  ? 150  TYR B CE1 1 
ATOM   2456 C  CE2 . TYR B 1 150 ? 25.256 7.375  35.355  1.00 19.13  ? 150  TYR B CE2 1 
ATOM   2457 C  CZ  . TYR B 1 150 ? 24.156 7.363  34.529  1.00 20.71  ? 150  TYR B CZ  1 
ATOM   2458 O  OH  . TYR B 1 150 ? 24.374 7.530  33.180  1.00 22.39  ? 150  TYR B OH  1 
ATOM   2459 N  N   . LYS B 1 151 ? 24.313 5.242  41.431  1.00 25.19  ? 151  LYS B N   1 
ATOM   2460 C  CA  . LYS B 1 151 ? 24.046 5.414  42.848  1.00 28.80  ? 151  LYS B CA  1 
ATOM   2461 C  C   . LYS B 1 151 ? 24.669 6.721  43.302  1.00 26.12  ? 151  LYS B C   1 
ATOM   2462 O  O   . LYS B 1 151 ? 25.792 7.059  42.888  1.00 28.18  ? 151  LYS B O   1 
ATOM   2463 C  CB  . LYS B 1 151 ? 24.588 4.227  43.661  1.00 33.21  ? 151  LYS B CB  1 
ATOM   2464 C  CG  . LYS B 1 151 ? 24.160 2.891  43.063  1.00 43.14  ? 151  LYS B CG  1 
ATOM   2465 C  CD  . LYS B 1 151 ? 24.107 1.735  44.052  1.00 51.69  ? 151  LYS B CD  1 
ATOM   2466 C  CE  . LYS B 1 151 ? 23.889 0.393  43.326  1.00 56.02  ? 151  LYS B CE  1 
ATOM   2467 N  NZ  . LYS B 1 151 ? 23.035 0.510  42.078  1.00 54.90  ? 151  LYS B NZ  1 
ATOM   2468 N  N   . PHE B 1 152 ? 23.960 7.447  44.156  1.00 24.24  ? 152  PHE B N   1 
ATOM   2469 C  CA  . PHE B 1 152 ? 24.511 8.672  44.726  1.00 26.92  ? 152  PHE B CA  1 
ATOM   2470 C  C   . PHE B 1 152 ? 23.893 9.030  46.062  1.00 27.60  ? 152  PHE B C   1 
ATOM   2471 O  O   . PHE B 1 152 ? 22.843 8.477  46.467  1.00 24.41  ? 152  PHE B O   1 
ATOM   2472 C  CB  . PHE B 1 152 ? 24.372 9.853  43.745  1.00 27.38  ? 152  PHE B CB  1 
ATOM   2473 C  CG  . PHE B 1 152 ? 22.954 10.349 43.556  1.00 26.36  ? 152  PHE B CG  1 
ATOM   2474 C  CD1 . PHE B 1 152 ? 22.040 9.591  42.867  1.00 25.09  ? 152  PHE B CD1 1 
ATOM   2475 C  CD2 . PHE B 1 152 ? 22.549 11.583 44.053  1.00 28.73  ? 152  PHE B CD2 1 
ATOM   2476 C  CE1 . PHE B 1 152 ? 20.737 10.037 42.678  1.00 25.68  ? 152  PHE B CE1 1 
ATOM   2477 C  CE2 . PHE B 1 152 ? 21.247 12.045 43.844  1.00 29.84  ? 152  PHE B CE2 1 
ATOM   2478 C  CZ  . PHE B 1 152 ? 20.342 11.264 43.130  1.00 20.68  ? 152  PHE B CZ  1 
ATOM   2479 N  N   . LYS B 1 153 ? 24.534 9.987  46.718  1.00 27.40  ? 153  LYS B N   1 
ATOM   2480 C  CA  . LYS B 1 153 ? 24.034 10.545 47.973  1.00 27.52  ? 153  LYS B CA  1 
ATOM   2481 C  C   . LYS B 1 153 ? 23.462 11.914 47.693  1.00 28.68  ? 153  LYS B C   1 
ATOM   2482 O  O   . LYS B 1 153 ? 24.169 12.796 47.196  1.00 32.86  ? 153  LYS B O   1 
ATOM   2483 C  CB  . LYS B 1 153 ? 25.150 10.656 49.023  1.00 33.76  ? 153  LYS B CB  1 
ATOM   2484 C  CG  . LYS B 1 153 ? 25.774 9.340  49.398  1.00 41.48  ? 153  LYS B CG  1 
ATOM   2485 C  CD  . LYS B 1 153 ? 26.808 9.515  50.530  1.00 51.00  ? 153  LYS B CD  1 
ATOM   2486 C  CE  . LYS B 1 153 ? 26.461 8.654  51.738  1.00 56.72  ? 153  LYS B CE  1 
ATOM   2487 N  NZ  . LYS B 1 153 ? 26.454 7.194  51.444  1.00 59.23  ? 153  LYS B NZ  1 
ATOM   2488 N  N   . TYR B 1 154 ? 22.180 12.093 47.966  1.00 25.81  ? 154  TYR B N   1 
ATOM   2489 C  CA  . TYR B 1 154 ? 21.547 13.425 47.857  1.00 24.91  ? 154  TYR B CA  1 
ATOM   2490 C  C   . TYR B 1 154 ? 21.654 14.104 49.210  1.00 29.40  ? 154  TYR B C   1 
ATOM   2491 O  O   . TYR B 1 154 ? 21.138 13.610 50.224  1.00 30.38  ? 154  TYR B O   1 
ATOM   2492 C  CB  . TYR B 1 154 ? 20.092 13.296 47.434  1.00 23.47  ? 154  TYR B CB  1 
ATOM   2493 C  CG  . TYR B 1 154 ? 19.322 14.609 47.386  1.00 21.17  ? 154  TYR B CG  1 
ATOM   2494 C  CD1 . TYR B 1 154 ? 19.751 15.662 46.610  1.00 21.65  ? 154  TYR B CD1 1 
ATOM   2495 C  CD2 . TYR B 1 154 ? 18.171 14.804 48.160  1.00 21.95  ? 154  TYR B CD2 1 
ATOM   2496 C  CE1 . TYR B 1 154 ? 19.064 16.868 46.572  1.00 22.82  ? 154  TYR B CE1 1 
ATOM   2497 C  CE2 . TYR B 1 154 ? 17.482 15.995 48.114  1.00 21.81  ? 154  TYR B CE2 1 
ATOM   2498 C  CZ  . TYR B 1 154 ? 17.920 17.026 47.300  1.00 25.71  ? 154  TYR B CZ  1 
ATOM   2499 O  OH  . TYR B 1 154 ? 17.197 18.214 47.249  1.00 25.55  ? 154  TYR B OH  1 
ATOM   2500 N  N   . THR B 1 155 ? 22.347 15.235 49.236  1.00 33.21  ? 155  THR B N   1 
ATOM   2501 C  CA  . THR B 1 155 ? 22.625 15.913 50.487  1.00 35.38  ? 155  THR B CA  1 
ATOM   2502 C  C   . THR B 1 155 ? 21.736 17.131 50.699  1.00 36.24  ? 155  THR B C   1 
ATOM   2503 O  O   . THR B 1 155 ? 21.935 17.880 51.648  1.00 37.51  ? 155  THR B O   1 
ATOM   2504 C  CB  . THR B 1 155 ? 24.110 16.312 50.546  1.00 39.68  ? 155  THR B CB  1 
ATOM   2505 O  OG1 . THR B 1 155 ? 24.462 17.045 49.359  1.00 36.82  ? 155  THR B OG1 1 
ATOM   2506 C  CG2 . THR B 1 155 ? 24.985 15.052 50.640  1.00 40.75  ? 155  THR B CG2 1 
ATOM   2507 N  N   . GLY B 1 156 ? 20.762 17.335 49.815  1.00 36.82  ? 156  GLY B N   1 
ATOM   2508 C  CA  . GLY B 1 156 ? 19.820 18.426 49.959  1.00 40.54  ? 156  GLY B CA  1 
ATOM   2509 C  C   . GLY B 1 156 ? 19.886 19.432 48.828  1.00 41.80  ? 156  GLY B C   1 
ATOM   2510 O  O   . GLY B 1 156 ? 20.868 19.496 48.066  1.00 40.65  ? 156  GLY B O   1 
ATOM   2511 N  N   . THR B 1 157 ? 18.831 20.232 48.731  1.00 45.25  ? 157  THR B N   1 
ATOM   2512 C  CA  . THR B 1 157 ? 18.684 21.151 47.616  1.00 48.43  ? 157  THR B CA  1 
ATOM   2513 C  C   . THR B 1 157 ? 19.784 22.210 47.668  1.00 53.82  ? 157  THR B C   1 
ATOM   2514 O  O   . THR B 1 157 ? 19.990 22.823 48.723  1.00 52.62  ? 157  THR B O   1 
ATOM   2515 C  CB  . THR B 1 157 ? 17.296 21.832 47.610  1.00 51.13  ? 157  THR B CB  1 
ATOM   2516 O  OG1 . THR B 1 157 ? 17.237 22.761 46.521  1.00 43.55  ? 157  THR B OG1 1 
ATOM   2517 C  CG2 . THR B 1 157 ? 17.020 22.542 48.941  1.00 53.20  ? 157  THR B CG2 1 
ATOM   2518 N  N   . PRO B 1 158 ? 20.515 22.398 46.545  1.00 58.81  ? 158  PRO B N   1 
ATOM   2519 C  CA  . PRO B 1 158 ? 21.596 23.390 46.502  1.00 65.34  ? 158  PRO B CA  1 
ATOM   2520 C  C   . PRO B 1 158 ? 21.169 24.816 46.081  1.00 72.70  ? 158  PRO B C   1 
ATOM   2521 O  O   . PRO B 1 158 ? 22.032 25.645 45.785  1.00 74.79  ? 158  PRO B O   1 
ATOM   2522 C  CB  . PRO B 1 158 ? 22.574 22.784 45.483  1.00 65.61  ? 158  PRO B CB  1 
ATOM   2523 C  CG  . PRO B 1 158 ? 21.719 21.988 44.558  1.00 59.36  ? 158  PRO B CG  1 
ATOM   2524 C  CD  . PRO B 1 158 ? 20.519 21.532 45.347  1.00 58.03  ? 158  PRO B CD  1 
ATOM   2525 N  N   . LYS B 1 159 ? 19.862 25.100 46.085  1.00 53.51  ? 159  LYS B N   1 
ATOM   2526 C  CA  . LYS B 1 159 ? 19.321 26.385 45.571  1.00 58.01  ? 159  LYS B CA  1 
ATOM   2527 C  C   . LYS B 1 159 ? 19.623 27.574 46.496  1.00 59.82  ? 159  LYS B C   1 
ATOM   2528 O  O   . LYS B 1 159 ? 19.478 28.739 46.104  1.00 60.98  ? 159  LYS B O   1 
ATOM   2529 C  CB  . LYS B 1 159 ? 17.796 26.264 45.341  1.00 58.45  ? 159  LYS B CB  1 
ATOM   2530 C  CG  . LYS B 1 159 ? 17.070 27.478 44.694  1.00 61.90  ? 159  LYS B CG  1 
ATOM   2531 C  CD  . LYS B 1 159 ? 17.780 28.078 43.456  1.00 64.86  ? 159  LYS B CD  1 
ATOM   2532 C  CE  . LYS B 1 159 ? 16.858 28.161 42.213  1.00 67.87  ? 159  LYS B CE  1 
ATOM   2533 N  NZ  . LYS B 1 159 ? 15.545 28.830 42.481  1.00 71.35  ? 159  LYS B NZ  1 
HETATM 2534 CU CU  . CU  C 2 .   ? 20.966 12.750 4.494   1.00 21.41  ? 200  CU  A CU  1 
HETATM 2535 S  S   . SO4 D 3 .   ? 24.558 32.350 -3.404  1.00 106.75 ? 300  SO4 A S   1 
HETATM 2536 O  O1  . SO4 D 3 .   ? 25.916 32.877 -3.531  1.00 109.54 ? 300  SO4 A O1  1 
HETATM 2537 O  O2  . SO4 D 3 .   ? 23.583 33.431 -3.540  1.00 106.75 ? 300  SO4 A O2  1 
HETATM 2538 O  O3  . SO4 D 3 .   ? 24.329 31.360 -4.449  1.00 107.65 ? 300  SO4 A O3  1 
HETATM 2539 O  O4  . SO4 D 3 .   ? 24.402 31.716 -2.099  1.00 107.11 ? 300  SO4 A O4  1 
HETATM 2540 S  S   . SO4 E 3 .   ? 32.944 32.448 13.948  1.00 44.21  ? 301  SO4 A S   1 
HETATM 2541 O  O1  . SO4 E 3 .   ? 33.280 32.502 12.500  1.00 52.27  ? 301  SO4 A O1  1 
HETATM 2542 O  O2  . SO4 E 3 .   ? 31.972 33.518 14.218  1.00 37.97  ? 301  SO4 A O2  1 
HETATM 2543 O  O3  . SO4 E 3 .   ? 32.407 31.110 14.309  1.00 36.77  ? 301  SO4 A O3  1 
HETATM 2544 O  O4  . SO4 E 3 .   ? 34.178 32.757 14.702  1.00 37.74  ? 301  SO4 A O4  1 
HETATM 2545 CU CU  . CU  F 2 .   ? 17.733 21.723 31.688  1.00 20.32  ? 200  CU  B CU  1 
HETATM 2546 S  S   . SO4 G 3 .   ? 27.399 3.853  39.865  1.00 56.58  ? 300  SO4 B S   1 
HETATM 2547 O  O1  . SO4 G 3 .   ? 28.305 3.422  40.934  1.00 63.75  ? 300  SO4 B O1  1 
HETATM 2548 O  O2  . SO4 G 3 .   ? 28.185 3.996  38.639  1.00 66.82  ? 300  SO4 B O2  1 
HETATM 2549 O  O3  . SO4 G 3 .   ? 26.345 2.847  39.658  1.00 64.59  ? 300  SO4 B O3  1 
HETATM 2550 O  O4  . SO4 G 3 .   ? 26.874 5.154  40.237  1.00 38.37  ? 300  SO4 B O4  1 
HETATM 2551 S  S   . SO4 H 3 .   ? 27.644 0.666  5.842   0.50 40.32  ? 301  SO4 B S   1 
HETATM 2552 O  O1  . SO4 H 3 .   ? 27.089 1.787  5.102   0.50 46.03  ? 301  SO4 B O1  1 
HETATM 2553 O  O2  . SO4 H 3 .   ? 27.451 -0.548 5.042   0.50 34.00  ? 301  SO4 B O2  1 
HETATM 2554 O  O3  . SO4 H 3 .   ? 29.046 0.924  6.107   0.50 27.21  ? 301  SO4 B O3  1 
HETATM 2555 O  O4  . SO4 H 3 .   ? 26.946 0.516  7.130   0.50 40.28  ? 301  SO4 B O4  1 
HETATM 2556 O  O   . HOH I 4 .   ? 7.675  24.690 -15.599 1.00 21.97  ? 1001 HOH A O   1 
HETATM 2557 O  O   . HOH I 4 .   ? 25.329 19.151 9.029   1.00 22.24  ? 1002 HOH A O   1 
HETATM 2558 O  O   . HOH I 4 .   ? 11.781 23.671 14.943  1.00 21.40  ? 1003 HOH A O   1 
HETATM 2559 O  O   . HOH I 4 .   ? 21.411 30.065 17.260  1.00 22.52  ? 1004 HOH A O   1 
HETATM 2560 O  O   . HOH I 4 .   ? 22.977 20.382 9.387   1.00 18.87  ? 1005 HOH A O   1 
HETATM 2561 O  O   . HOH I 4 .   ? 27.141 17.618 11.695  1.00 20.57  ? 1006 HOH A O   1 
HETATM 2562 O  O   . HOH I 4 .   ? 26.713 14.612 7.375   1.00 25.81  ? 1007 HOH A O   1 
HETATM 2563 O  O   . HOH I 4 .   ? 29.260 29.063 20.543  1.00 22.59  ? 1008 HOH A O   1 
HETATM 2564 O  O   . HOH I 4 .   ? 26.085 27.056 1.007   1.00 31.12  ? 1009 HOH A O   1 
HETATM 2565 O  O   . HOH I 4 .   ? 5.910  26.279 -14.015 1.00 28.14  ? 1010 HOH A O   1 
HETATM 2566 O  O   . HOH I 4 .   ? 23.826 19.463 18.976  1.00 23.79  ? 1011 HOH A O   1 
HETATM 2567 O  O   . HOH I 4 .   ? 30.833 26.689 13.319  1.00 35.89  ? 1012 HOH A O   1 
HETATM 2568 O  O   . HOH I 4 .   ? 27.597 26.369 25.762  1.00 27.50  ? 1013 HOH A O   1 
HETATM 2569 O  O   . HOH I 4 .   ? 27.544 24.388 8.832   1.00 21.54  ? 1014 HOH A O   1 
HETATM 2570 O  O   . HOH I 4 .   ? 12.403 16.971 -14.529 1.00 25.25  ? 1015 HOH A O   1 
HETATM 2571 O  O   . HOH I 4 .   ? 11.305 14.872 -5.466  1.00 25.95  ? 1016 HOH A O   1 
HETATM 2572 O  O   . HOH I 4 .   ? 12.170 30.794 14.368  1.00 30.32  ? 1017 HOH A O   1 
HETATM 2573 O  O   . HOH I 4 .   ? 12.882 32.413 22.385  1.00 30.13  ? 1018 HOH A O   1 
HETATM 2574 O  O   . HOH I 4 .   ? 13.577 29.266 -4.283  1.00 27.35  ? 1019 HOH A O   1 
HETATM 2575 O  O   . HOH I 4 .   ? 16.612 24.233 -17.065 1.00 30.76  ? 1020 HOH A O   1 
HETATM 2576 O  O   . HOH I 4 .   ? 13.154 26.837 23.648  1.00 30.59  ? 1021 HOH A O   1 
HETATM 2577 O  O   . HOH I 4 .   ? 10.487 26.608 9.080   1.00 29.93  ? 1022 HOH A O   1 
HETATM 2578 O  O   . HOH I 4 .   ? 15.634 35.848 12.136  1.00 24.61  ? 1023 HOH A O   1 
HETATM 2579 O  O   . HOH I 4 .   ? 17.839 37.339 24.559  1.00 29.40  ? 1024 HOH A O   1 
HETATM 2580 O  O   . HOH I 4 .   ? 31.534 7.230  10.985  1.00 31.15  ? 1025 HOH A O   1 
HETATM 2581 O  O   . HOH I 4 .   ? 29.574 16.828 10.864  1.00 40.59  ? 1026 HOH A O   1 
HETATM 2582 O  O   . HOH I 4 .   ? 19.007 28.310 38.414  1.00 29.39  ? 1027 HOH A O   1 
HETATM 2583 O  O   . HOH I 4 .   ? 31.485 36.131 17.021  1.00 38.86  ? 1028 HOH A O   1 
HETATM 2584 O  O   . HOH I 4 .   ? 33.252 23.963 20.620  1.00 38.47  ? 1029 HOH A O   1 
HETATM 2585 O  O   . HOH I 4 .   ? 13.310 20.151 9.288   1.00 34.47  ? 1030 HOH A O   1 
HETATM 2586 O  O   . HOH I 4 .   ? 9.494  30.790 15.514  1.00 44.46  ? 1031 HOH A O   1 
HETATM 2587 O  O   . HOH I 4 .   ? 22.706 29.994 -11.952 1.00 37.06  ? 1032 HOH A O   1 
HETATM 2588 O  O   . HOH I 4 .   ? 9.175  17.000 2.470   1.00 38.08  ? 1033 HOH A O   1 
HETATM 2589 O  O   . HOH I 4 .   ? 27.295 33.848 17.283  1.00 41.53  ? 1034 HOH A O   1 
HETATM 2590 O  O   . HOH I 4 .   ? 6.364  20.515 -4.220  1.00 36.43  ? 1035 HOH A O   1 
HETATM 2591 O  O   . HOH I 4 .   ? 7.120  17.425 -8.794  1.00 42.00  ? 1036 HOH A O   1 
HETATM 2592 O  O   . HOH I 4 .   ? 25.238 35.519 13.591  1.00 36.84  ? 1037 HOH A O   1 
HETATM 2593 O  O   . HOH I 4 .   ? 14.260 20.511 -17.481 1.00 41.41  ? 1038 HOH A O   1 
HETATM 2594 O  O   . HOH I 4 .   ? 13.054 18.900 11.469  1.00 32.32  ? 1039 HOH A O   1 
HETATM 2595 O  O   . HOH I 4 .   ? 20.248 34.773 1.707   1.00 36.46  ? 1040 HOH A O   1 
HETATM 2596 O  O   . HOH I 4 .   ? 7.911  22.187 13.030  1.00 40.30  ? 1041 HOH A O   1 
HETATM 2597 O  O   . HOH I 4 .   ? 27.899 15.732 4.492   1.00 44.41  ? 1042 HOH A O   1 
HETATM 2598 O  O   . HOH I 4 .   ? 18.320 17.376 -17.909 1.00 42.84  ? 1043 HOH A O   1 
HETATM 2599 O  O   . HOH I 4 .   ? 23.206 5.759  -2.056  1.00 38.27  ? 1044 HOH A O   1 
HETATM 2600 O  O   . HOH I 4 .   ? 9.471  28.838 17.618  1.00 39.91  ? 1045 HOH A O   1 
HETATM 2601 O  O   . HOH I 4 .   ? 27.161 29.629 23.553  1.00 36.72  ? 1046 HOH A O   1 
HETATM 2602 O  O   . HOH I 4 .   ? 5.229  15.102 -18.153 1.00 35.71  ? 1047 HOH A O   1 
HETATM 2603 O  O   . HOH I 4 .   ? 11.748 19.912 25.718  1.00 29.97  ? 1048 HOH A O   1 
HETATM 2604 O  O   . HOH I 4 .   ? 26.136 13.675 4.152   1.00 33.50  ? 1049 HOH A O   1 
HETATM 2605 O  O   . HOH I 4 .   ? 12.218 14.068 -0.195  1.00 35.89  ? 1050 HOH A O   1 
HETATM 2606 O  O   . HOH I 4 .   ? 14.299 36.158 6.178   1.00 38.43  ? 1051 HOH A O   1 
HETATM 2607 O  O   . HOH I 4 .   ? 11.153 9.700  -9.300  1.00 42.04  ? 1052 HOH A O   1 
HETATM 2608 O  O   . HOH I 4 .   ? 15.431 36.959 14.700  1.00 37.26  ? 1053 HOH A O   1 
HETATM 2609 O  O   . HOH I 4 .   ? 20.365 30.564 -10.458 1.00 38.27  ? 1054 HOH A O   1 
HETATM 2610 O  O   . HOH I 4 .   ? 8.945  25.422 1.268   1.00 36.45  ? 1055 HOH A O   1 
HETATM 2611 O  O   . HOH I 4 .   ? 9.985  6.397  -2.404  1.00 37.93  ? 1056 HOH A O   1 
HETATM 2612 O  O   . HOH I 4 .   ? 19.245 6.893  -8.272  1.00 41.73  ? 1057 HOH A O   1 
HETATM 2613 O  O   . HOH I 4 .   ? 11.968 33.705 19.330  1.00 52.92  ? 1058 HOH A O   1 
HETATM 2614 O  O   . HOH I 4 .   ? 16.945 31.468 -15.631 1.00 30.66  ? 1059 HOH A O   1 
HETATM 2615 O  O   . HOH I 4 .   ? 27.309 17.237 7.396   1.00 42.91  ? 1060 HOH A O   1 
HETATM 2616 O  O   . HOH I 4 .   ? 32.084 30.326 21.687  1.00 41.20  ? 1061 HOH A O   1 
HETATM 2617 O  O   . HOH I 4 .   ? 23.137 7.037  -5.568  1.00 37.45  ? 1062 HOH A O   1 
HETATM 2618 O  O   . HOH I 4 .   ? 17.937 10.402 -13.979 1.00 46.02  ? 1063 HOH A O   1 
HETATM 2619 O  O   . HOH I 4 .   ? 19.858 35.349 17.023  1.00 37.34  ? 1064 HOH A O   1 
HETATM 2620 O  O   . HOH I 4 .   ? 11.897 30.915 24.284  1.00 39.30  ? 1065 HOH A O   1 
HETATM 2621 O  O   . HOH I 4 .   ? 39.145 32.992 14.931  1.00 50.53  ? 1066 HOH A O   1 
HETATM 2622 O  O   . HOH I 4 .   ? 6.449  20.372 -8.599  1.00 35.56  ? 1067 HOH A O   1 
HETATM 2623 O  O   . HOH I 4 .   ? 5.523  20.611 -10.924 1.00 37.37  ? 1068 HOH A O   1 
HETATM 2624 O  O   . HOH I 4 .   ? 6.438  22.989 -11.317 1.00 26.28  ? 1069 HOH A O   1 
HETATM 2625 O  O   . HOH I 4 .   ? 26.359 36.033 19.225  0.50 26.72  ? 1070 HOH A O   1 
HETATM 2626 O  O   . HOH I 4 .   ? 11.414 16.499 0.275   1.00 39.09  ? 1071 HOH A O   1 
HETATM 2627 O  O   . HOH I 4 .   ? 26.801 27.484 -6.475  1.00 41.31  ? 1072 HOH A O   1 
HETATM 2628 O  O   . HOH I 4 .   ? 6.522  21.165 15.055  1.00 48.17  ? 1073 HOH A O   1 
HETATM 2629 O  O   . HOH I 4 .   ? 18.904 33.081 18.067  1.00 38.35  ? 1074 HOH A O   1 
HETATM 2630 O  O   . HOH I 4 .   ? 19.088 35.714 3.980   1.00 43.97  ? 1075 HOH A O   1 
HETATM 2631 O  O   . HOH I 4 .   ? 26.447 26.619 -8.941  1.00 38.24  ? 1076 HOH A O   1 
HETATM 2632 O  O   . HOH I 4 .   ? 27.551 17.970 4.615   1.00 53.07  ? 1077 HOH A O   1 
HETATM 2633 O  O   . HOH I 4 .   ? 31.509 16.544 6.673   1.00 43.14  ? 1078 HOH A O   1 
HETATM 2634 O  O   . HOH I 4 .   ? 24.032 33.003 28.565  1.00 48.36  ? 1079 HOH A O   1 
HETATM 2635 O  O   . HOH I 4 .   ? 24.099 32.357 31.923  1.00 35.12  ? 1080 HOH A O   1 
HETATM 2636 O  O   . HOH I 4 .   ? 7.901  22.335 -14.652 1.00 34.66  ? 1081 HOH A O   1 
HETATM 2637 O  O   . HOH I 4 .   ? 13.444 30.964 -19.211 1.00 29.91  ? 1082 HOH A O   1 
HETATM 2638 O  O   . HOH I 4 .   ? 13.487 17.783 13.850  1.00 32.80  ? 1083 HOH A O   1 
HETATM 2639 O  O   . HOH I 4 .   ? 17.354 34.109 29.463  1.00 54.66  ? 1084 HOH A O   1 
HETATM 2640 O  O   . HOH I 4 .   ? 18.369 32.634 -10.800 1.00 55.34  ? 1085 HOH A O   1 
HETATM 2641 O  O   . HOH I 4 .   ? 15.992 10.508 -15.826 1.00 47.44  ? 1086 HOH A O   1 
HETATM 2642 O  O   . HOH I 4 .   ? 16.522 34.030 37.460  1.00 42.28  ? 1087 HOH A O   1 
HETATM 2643 O  O   . HOH I 4 .   ? 30.425 35.296 12.551  1.00 29.96  ? 1088 HOH A O   1 
HETATM 2644 O  O   . HOH I 4 .   ? 7.893  11.471 -11.683 1.00 48.69  ? 1089 HOH A O   1 
HETATM 2645 O  O   . HOH I 4 .   ? 28.068 11.707 4.275   1.00 38.79  ? 1090 HOH A O   1 
HETATM 2646 O  O   . HOH I 4 .   ? 16.407 10.312 2.253   1.00 42.23  ? 1091 HOH A O   1 
HETATM 2647 O  O   . HOH I 4 .   ? 12.965 6.551  3.921   1.00 34.00  ? 1092 HOH A O   1 
HETATM 2648 O  O   . HOH I 4 .   ? 27.236 35.657 6.452   0.50 26.48  ? 1093 HOH A O   1 
HETATM 2649 O  O   . HOH I 4 .   ? 25.108 18.603 -11.102 1.00 50.31  ? 1094 HOH A O   1 
HETATM 2650 O  O   . HOH I 4 .   ? 34.291 33.275 10.168  1.00 49.05  ? 1095 HOH A O   1 
HETATM 2651 O  O   . HOH I 4 .   ? 26.143 22.707 -8.825  1.00 39.20  ? 1096 HOH A O   1 
HETATM 2652 O  O   . HOH I 4 .   ? 7.728  17.367 0.319   1.00 54.73  ? 1097 HOH A O   1 
HETATM 2653 O  O   . HOH I 4 .   ? 17.200 20.904 -18.761 1.00 38.09  ? 1098 HOH A O   1 
HETATM 2654 O  O   . HOH I 4 .   ? 17.331 37.494 -0.853  1.00 41.92  ? 1099 HOH A O   1 
HETATM 2655 O  O   . HOH I 4 .   ? 22.744 29.809 -18.053 1.00 40.72  ? 1100 HOH A O   1 
HETATM 2656 O  O   . HOH I 4 .   ? 30.256 34.552 15.766  1.00 42.65  ? 1101 HOH A O   1 
HETATM 2657 O  O   . HOH I 4 .   ? 17.786 36.568 -2.912  1.00 37.48  ? 1102 HOH A O   1 
HETATM 2658 O  O   . HOH I 4 .   ? 6.862  22.818 3.608   1.00 50.01  ? 1103 HOH A O   1 
HETATM 2659 O  O   . HOH I 4 .   ? 14.072 35.259 27.296  1.00 49.02  ? 1104 HOH A O   1 
HETATM 2660 O  O   . HOH I 4 .   ? 7.620  29.097 11.539  1.00 44.20  ? 1105 HOH A O   1 
HETATM 2661 O  O   . HOH I 4 .   ? 32.685 14.639 -1.394  1.00 45.71  ? 1106 HOH A O   1 
HETATM 2662 O  O   . HOH I 4 .   ? 16.363 2.302  2.495   1.00 42.13  ? 1107 HOH A O   1 
HETATM 2663 O  O   . HOH I 4 .   ? 13.245 1.302  -8.370  1.00 41.32  ? 1108 HOH A O   1 
HETATM 2664 O  O   . HOH I 4 .   ? 15.366 29.809 -20.648 1.00 43.33  ? 1109 HOH A O   1 
HETATM 2665 O  O   . HOH I 4 .   ? 8.608  16.673 -15.301 1.00 44.89  ? 1110 HOH A O   1 
HETATM 2666 O  O   . HOH I 4 .   ? 15.100 37.581 18.488  1.00 50.18  ? 1111 HOH A O   1 
HETATM 2667 O  O   . HOH I 4 .   ? 13.735 31.947 -5.433  1.00 41.77  ? 1112 HOH A O   1 
HETATM 2668 O  O   . HOH I 4 .   ? 7.109  17.930 -16.240 1.00 42.48  ? 1113 HOH A O   1 
HETATM 2669 O  O   . HOH I 4 .   ? 17.431 36.857 19.040  1.00 54.27  ? 1114 HOH A O   1 
HETATM 2670 O  O   . HOH I 4 .   ? 19.021 36.235 21.533  1.00 45.32  ? 1115 HOH A O   1 
HETATM 2671 O  O   . HOH I 4 .   ? 9.373  28.279 -6.254  1.00 73.80  ? 1116 HOH A O   1 
HETATM 2672 O  O   . HOH J 4 .   ? 13.792 14.599 21.561  1.00 34.68  ? 1001 HOH B O   1 
HETATM 2673 O  O   . HOH J 4 .   ? 8.027  6.609  50.822  1.00 49.95  ? 1002 HOH B O   1 
HETATM 2674 O  O   . HOH J 4 .   ? 20.779 -1.756 8.511   1.00 43.32  ? 1003 HOH B O   1 
HETATM 2675 O  O   . HOH J 4 .   ? 21.594 -4.754 9.274   1.00 41.62  ? 1004 HOH B O   1 
HETATM 2676 O  O   . HOH J 4 .   ? 33.153 4.061  30.810  1.00 34.71  ? 1005 HOH B O   1 
HETATM 2677 O  O   . HOH J 4 .   ? 25.474 0.186  32.172  1.00 26.80  ? 1006 HOH B O   1 
HETATM 2678 O  O   . HOH J 4 .   ? 24.668 17.431 27.779  1.00 19.43  ? 1007 HOH B O   1 
HETATM 2679 O  O   . HOH J 4 .   ? 22.838 15.429 27.199  1.00 19.06  ? 1008 HOH B O   1 
HETATM 2680 O  O   . HOH J 4 .   ? 26.024 19.315 25.265  1.00 19.17  ? 1009 HOH B O   1 
HETATM 2681 O  O   . HOH J 4 .   ? 32.756 9.513  17.160  1.00 19.82  ? 1010 HOH B O   1 
HETATM 2682 O  O   . HOH J 4 .   ? 25.338 6.072  19.038  1.00 19.65  ? 1011 HOH B O   1 
HETATM 2683 O  O   . HOH J 4 .   ? 28.497 13.057 28.274  1.00 22.16  ? 1012 HOH B O   1 
HETATM 2684 O  O   . HOH J 4 .   ? 28.963 2.354  11.671  1.00 22.55  ? 1013 HOH B O   1 
HETATM 2685 O  O   . HOH J 4 .   ? 27.454 10.059 35.974  1.00 22.39  ? 1014 HOH B O   1 
HETATM 2686 O  O   . HOH J 4 .   ? 0.604  14.733 49.708  1.00 20.23  ? 1015 HOH B O   1 
HETATM 2687 O  O   . HOH J 4 .   ? 9.041  16.043 40.884  1.00 28.30  ? 1016 HOH B O   1 
HETATM 2688 O  O   . HOH J 4 .   ? 4.929  23.237 37.488  1.00 26.41  ? 1017 HOH B O   1 
HETATM 2689 O  O   . HOH J 4 .   ? 26.364 18.450 18.634  1.00 24.67  ? 1018 HOH B O   1 
HETATM 2690 O  O   . HOH J 4 .   ? 32.127 2.347  17.944  1.00 21.10  ? 1019 HOH B O   1 
HETATM 2691 O  O   . HOH J 4 .   ? 24.039 21.697 29.557  1.00 26.28  ? 1020 HOH B O   1 
HETATM 2692 O  O   . HOH J 4 .   ? 31.249 17.555 24.241  1.00 28.13  ? 1021 HOH B O   1 
HETATM 2693 O  O   . HOH J 4 .   ? 16.163 2.073  21.077  1.00 23.95  ? 1022 HOH B O   1 
HETATM 2694 O  O   . HOH J 4 .   ? 24.448 16.747 17.651  1.00 21.94  ? 1023 HOH B O   1 
HETATM 2695 O  O   . HOH J 4 .   ? 23.050 23.369 32.842  1.00 34.93  ? 1024 HOH B O   1 
HETATM 2696 O  O   . HOH J 4 .   ? 32.506 7.391  13.815  1.00 29.27  ? 1025 HOH B O   1 
HETATM 2697 O  O   . HOH J 4 .   ? 13.813 8.844  20.490  1.00 25.62  ? 1026 HOH B O   1 
HETATM 2698 O  O   . HOH J 4 .   ? 31.404 11.487 12.100  1.00 22.97  ? 1027 HOH B O   1 
HETATM 2699 O  O   . HOH J 4 .   ? 30.148 4.172  5.540   1.00 33.22  ? 1028 HOH B O   1 
HETATM 2700 O  O   . HOH J 4 .   ? 30.134 0.939  30.302  1.00 27.16  ? 1029 HOH B O   1 
HETATM 2701 O  O   . HOH J 4 .   ? 15.274 -5.211 23.127  1.00 37.76  ? 1030 HOH B O   1 
HETATM 2702 O  O   . HOH J 4 .   ? 12.934 12.293 26.376  1.00 32.00  ? 1031 HOH B O   1 
HETATM 2703 O  O   . HOH J 4 .   ? 18.578 1.103  13.815  1.00 32.55  ? 1032 HOH B O   1 
HETATM 2704 O  O   . HOH J 4 .   ? 10.053 18.656 35.280  1.00 26.95  ? 1033 HOH B O   1 
HETATM 2705 O  O   . HOH J 4 .   ? 28.473 13.192 36.303  1.00 31.71  ? 1034 HOH B O   1 
HETATM 2706 O  O   . HOH J 4 .   ? 16.384 3.564  40.056  1.00 27.86  ? 1035 HOH B O   1 
HETATM 2707 O  O   . HOH J 4 .   ? 33.152 12.392 24.233  1.00 35.01  ? 1036 HOH B O   1 
HETATM 2708 O  O   . HOH J 4 .   ? 9.895  14.151 49.792  1.00 28.05  ? 1037 HOH B O   1 
HETATM 2709 O  O   . HOH J 4 .   ? 5.703  9.597  52.912  1.00 32.14  ? 1038 HOH B O   1 
HETATM 2710 O  O   . HOH J 4 .   ? 8.284  24.463 31.218  1.00 29.78  ? 1039 HOH B O   1 
HETATM 2711 O  O   . HOH J 4 .   ? 23.893 2.517  19.060  1.00 27.06  ? 1040 HOH B O   1 
HETATM 2712 O  O   . HOH J 4 .   ? 40.081 12.929 20.741  1.00 33.33  ? 1041 HOH B O   1 
HETATM 2713 O  O   . HOH J 4 .   ? 32.179 4.521  20.059  1.00 28.74  ? 1042 HOH B O   1 
HETATM 2714 O  O   . HOH J 4 .   ? 28.684 15.237 32.842  1.00 31.37  ? 1043 HOH B O   1 
HETATM 2715 O  O   . HOH J 4 .   ? 36.085 7.763  23.611  1.00 35.99  ? 1044 HOH B O   1 
HETATM 2716 O  O   . HOH J 4 .   ? 17.341 6.293  11.885  1.00 38.33  ? 1045 HOH B O   1 
HETATM 2717 O  O   . HOH J 4 .   ? 29.866 11.168 37.334  1.00 30.51  ? 1046 HOH B O   1 
HETATM 2718 O  O   . HOH J 4 .   ? 27.132 10.692 45.667  1.00 27.96  ? 1047 HOH B O   1 
HETATM 2719 O  O   . HOH J 4 .   ? 11.377 25.004 34.458  1.00 33.33  ? 1048 HOH B O   1 
HETATM 2720 O  O   . HOH J 4 .   ? 12.903 11.330 52.871  1.00 41.18  ? 1049 HOH B O   1 
HETATM 2721 O  O   . HOH J 4 .   ? 3.121  9.007  50.512  1.00 33.10  ? 1050 HOH B O   1 
HETATM 2722 O  O   . HOH J 4 .   ? 24.251 0.575  34.447  1.00 28.01  ? 1051 HOH B O   1 
HETATM 2723 O  O   . HOH J 4 .   ? 6.580  20.463 44.654  1.00 26.82  ? 1052 HOH B O   1 
HETATM 2724 O  O   . HOH J 4 .   ? 13.457 13.546 24.198  1.00 33.87  ? 1053 HOH B O   1 
HETATM 2725 O  O   . HOH J 4 .   ? 31.138 1.008  3.669   1.00 34.73  ? 1054 HOH B O   1 
HETATM 2726 O  O   . HOH J 4 .   ? 9.454  16.506 38.179  1.00 29.74  ? 1055 HOH B O   1 
HETATM 2727 O  O   . HOH J 4 .   ? 17.230 1.850  11.090  1.00 38.42  ? 1056 HOH B O   1 
HETATM 2728 O  O   . HOH J 4 .   ? 12.917 22.356 49.861  1.00 32.30  ? 1057 HOH B O   1 
HETATM 2729 O  O   . HOH J 4 .   ? 5.248  23.869 34.905  1.00 34.31  ? 1058 HOH B O   1 
HETATM 2730 O  O   . HOH J 4 .   ? 30.467 16.604 34.336  1.00 30.47  ? 1059 HOH B O   1 
HETATM 2731 O  O   . HOH J 4 .   ? 17.601 -1.407 17.214  1.00 40.20  ? 1060 HOH B O   1 
HETATM 2732 O  O   . HOH J 4 .   ? 15.539 -3.376 25.051  1.00 32.77  ? 1061 HOH B O   1 
HETATM 2733 O  O   . HOH J 4 .   ? 21.118 -2.580 22.036  1.00 26.47  ? 1062 HOH B O   1 
HETATM 2734 O  O   . HOH J 4 .   ? 29.854 16.447 29.072  1.00 32.58  ? 1063 HOH B O   1 
HETATM 2735 O  O   . HOH J 4 .   ? 30.149 15.170 36.705  1.00 29.40  ? 1064 HOH B O   1 
HETATM 2736 O  O   . HOH J 4 .   ? 29.808 3.013  9.294   1.00 41.21  ? 1065 HOH B O   1 
HETATM 2737 O  O   . HOH J 4 .   ? 26.714 30.161 26.651  1.00 35.53  ? 1066 HOH B O   1 
HETATM 2738 O  O   . HOH J 4 .   ? 12.941 5.337  26.563  1.00 38.15  ? 1067 HOH B O   1 
HETATM 2739 O  O   . HOH J 4 .   ? 34.938 14.920 23.542  1.00 41.92  ? 1068 HOH B O   1 
HETATM 2740 O  O   . HOH J 4 .   ? 15.621 15.958 53.824  1.00 31.22  ? 1069 HOH B O   1 
HETATM 2741 O  O   . HOH J 4 .   ? 24.613 6.044  48.295  1.00 45.06  ? 1070 HOH B O   1 
HETATM 2742 O  O   . HOH J 4 .   ? 16.682 1.218  41.554  1.00 39.47  ? 1071 HOH B O   1 
HETATM 2743 O  O   . HOH J 4 .   ? 6.284  26.218 34.074  1.00 52.40  ? 1072 HOH B O   1 
HETATM 2744 O  O   . HOH J 4 .   ? 4.529  17.755 45.014  1.00 30.89  ? 1073 HOH B O   1 
HETATM 2745 O  O   . HOH J 4 .   ? 8.877  25.586 33.645  1.00 41.01  ? 1074 HOH B O   1 
HETATM 2746 O  O   . HOH J 4 .   ? 31.797 13.509 26.249  1.00 45.48  ? 1075 HOH B O   1 
HETATM 2747 O  O   . HOH J 4 .   ? 5.542  18.924 42.615  1.00 33.41  ? 1076 HOH B O   1 
HETATM 2748 O  O   . HOH J 4 .   ? 5.056  15.198 52.283  1.00 39.11  ? 1077 HOH B O   1 
HETATM 2749 O  O   . HOH J 4 .   ? 25.820 0.776  15.754  1.00 34.65  ? 1078 HOH B O   1 
HETATM 2750 O  O   . HOH J 4 .   ? 25.846 6.582  -1.663  1.00 37.07  ? 1079 HOH B O   1 
HETATM 2751 O  O   . HOH J 4 .   ? 7.093  18.785 51.231  1.00 43.17  ? 1080 HOH B O   1 
HETATM 2752 O  O   . HOH J 4 .   ? 27.414 18.881 33.195  1.00 35.48  ? 1081 HOH B O   1 
HETATM 2753 O  O   . HOH J 4 .   ? 27.685 13.268 44.380  1.00 37.29  ? 1082 HOH B O   1 
HETATM 2754 O  O   . HOH J 4 .   ? 13.959 -1.501 18.814  1.00 46.80  ? 1083 HOH B O   1 
HETATM 2755 O  O   . HOH J 4 .   ? 6.567  16.942 41.197  1.00 35.16  ? 1084 HOH B O   1 
HETATM 2756 O  O   . HOH J 4 .   ? 27.613 10.207 43.228  1.00 40.51  ? 1085 HOH B O   1 
HETATM 2757 O  O   . HOH J 4 .   ? 6.156  29.885 27.444  1.00 35.58  ? 1086 HOH B O   1 
HETATM 2758 O  O   . HOH J 4 .   ? 24.407 26.266 38.382  1.00 51.15  ? 1087 HOH B O   1 
HETATM 2759 O  O   . HOH J 4 .   ? 37.570 14.617 23.498  1.00 43.12  ? 1088 HOH B O   1 
HETATM 2760 O  O   . HOH J 4 .   ? 31.636 2.778  32.001  1.00 41.45  ? 1089 HOH B O   1 
HETATM 2761 O  O   . HOH J 4 .   ? 35.525 11.084 23.988  1.00 41.48  ? 1090 HOH B O   1 
HETATM 2762 O  O   . HOH J 4 .   ? 13.156 26.390 43.914  1.00 45.10  ? 1091 HOH B O   1 
HETATM 2763 O  O   . HOH J 4 .   ? 22.280 -1.354 34.516  1.00 43.15  ? 1092 HOH B O   1 
HETATM 2764 O  O   . HOH J 4 .   ? 22.787 4.814  46.737  1.00 38.89  ? 1093 HOH B O   1 
HETATM 2765 O  O   . HOH J 4 .   ? 23.593 -1.724 21.806  1.00 30.10  ? 1094 HOH B O   1 
HETATM 2766 O  O   . HOH J 4 .   ? 34.888 15.900 17.304  1.00 32.50  ? 1095 HOH B O   1 
HETATM 2767 O  O   . HOH J 4 .   ? 34.431 2.517  29.168  1.00 24.65  ? 1096 HOH B O   1 
HETATM 2768 O  O   . HOH J 4 .   ? 14.495 -0.574 28.455  1.00 57.96  ? 1097 HOH B O   1 
HETATM 2769 O  O   . HOH J 4 .   ? 6.458  7.183  46.658  1.00 48.99  ? 1098 HOH B O   1 
HETATM 2770 O  O   . HOH J 4 .   ? 7.000  5.109  45.787  1.00 37.59  ? 1099 HOH B O   1 
HETATM 2771 O  O   . HOH J 4 .   ? 26.400 14.038 46.591  1.00 47.79  ? 1100 HOH B O   1 
HETATM 2772 O  O   . HOH J 4 .   ? 19.505 2.785  51.631  1.00 48.51  ? 1101 HOH B O   1 
HETATM 2773 O  O   . HOH J 4 .   ? 6.209  8.772  39.344  1.00 43.85  ? 1102 HOH B O   1 
HETATM 2774 O  O   . HOH J 4 .   ? 14.030 1.124  19.555  1.00 37.35  ? 1103 HOH B O   1 
HETATM 2775 O  O   . HOH J 4 .   ? 12.282 15.506 53.345  1.00 45.77  ? 1104 HOH B O   1 
HETATM 2776 O  O   . HOH J 4 .   ? 8.540  14.068 34.144  1.00 54.77  ? 1105 HOH B O   1 
HETATM 2777 O  O   . HOH J 4 .   ? 8.661  29.005 39.697  1.00 36.15  ? 1106 HOH B O   1 
HETATM 2778 O  O   . HOH J 4 .   ? 6.805  16.985 38.091  1.00 58.55  ? 1107 HOH B O   1 
HETATM 2779 O  O   . HOH J 4 .   ? 15.385 10.109 52.882  1.00 50.25  ? 1108 HOH B O   1 
HETATM 2780 O  O   . HOH J 4 .   ? 28.292 12.744 48.556  1.00 47.36  ? 1109 HOH B O   1 
HETATM 2781 O  O   . HOH J 4 .   ? 25.537 0.460  19.173  1.00 20.63  ? 1110 HOH B O   1 
HETATM 2782 O  O   . HOH J 4 .   ? 32.842 17.966 19.439  1.00 43.27  ? 1111 HOH B O   1 
HETATM 2783 O  O   . HOH J 4 .   ? 4.692  20.022 48.432  1.00 34.07  ? 1112 HOH B O   1 
HETATM 2784 O  O   . HOH J 4 .   ? 12.871 1.231  27.486  1.00 61.77  ? 1113 HOH B O   1 
HETATM 2785 O  O   . HOH J 4 .   ? 7.948  15.920 51.435  1.00 45.27  ? 1114 HOH B O   1 
HETATM 2786 O  O   . HOH J 4 .   ? 9.678  14.388 36.504  1.00 51.92  ? 1115 HOH B O   1 
HETATM 2787 O  O   . HOH J 4 .   ? 6.829  8.066  48.770  1.00 44.99  ? 1116 HOH B O   1 
HETATM 2788 O  O   . HOH J 4 .   ? 6.116  12.177 40.627  1.00 43.31  ? 1117 HOH B O   1 
HETATM 2789 O  O   . HOH J 4 .   ? 42.396 11.857 19.714  1.00 39.07  ? 1118 HOH B O   1 
HETATM 2790 O  O   . HOH J 4 .   ? 20.292 -2.410 24.483  1.00 38.15  ? 1119 HOH B O   1 
HETATM 2791 O  O   . HOH J 4 .   ? 10.885 10.880 54.818  1.00 53.22  ? 1120 HOH B O   1 
HETATM 2792 O  O   . HOH J 4 .   ? 15.283 8.573  55.438  1.00 57.20  ? 1121 HOH B O   1 
HETATM 2793 O  O   . HOH J 4 .   ? 22.536 -0.901 25.235  1.00 26.89  ? 1122 HOH B O   1 
HETATM 2794 O  O   . HOH J 4 .   ? 13.312 2.962  17.729  1.00 39.91  ? 1123 HOH B O   1 
HETATM 2795 O  O   . HOH J 4 .   ? 10.185 4.739  33.888  1.00 51.38  ? 1124 HOH B O   1 
HETATM 2796 O  O   . HOH J 4 .   ? 25.441 20.977 33.192  1.00 30.92  ? 1125 HOH B O   1 
HETATM 2797 O  O   . HOH J 4 .   ? 31.248 1.609  6.731   1.00 42.99  ? 1126 HOH B O   1 
HETATM 2798 O  O   . HOH J 4 .   ? 25.610 0.453  36.895  1.00 45.10  ? 1127 HOH B O   1 
HETATM 2799 O  O   . HOH J 4 .   ? 24.130 1.314  39.435  1.00 54.04  ? 1128 HOH B O   1 
HETATM 2800 O  O   . HOH J 4 .   ? 6.676  12.475 33.081  1.00 47.01  ? 1129 HOH B O   1 
HETATM 2801 O  O   . HOH J 4 .   ? 29.911 1.938  38.143  1.00 53.49  ? 1130 HOH B O   1 
HETATM 2802 O  O   . HOH J 4 .   ? 19.101 -6.937 10.599  1.00 55.29  ? 1131 HOH B O   1 
HETATM 2803 O  O   . HOH J 4 .   ? 32.495 6.258  31.184  1.00 38.58  ? 1132 HOH B O   1 
HETATM 2804 O  O   . HOH J 4 .   ? 17.619 -0.871 36.950  1.00 43.68  ? 1133 HOH B O   1 
HETATM 2805 O  O   . HOH J 4 .   ? 34.628 11.234 28.335  1.00 42.33  ? 1134 HOH B O   1 
HETATM 2806 O  O   . HOH J 4 .   ? 21.651 2.061  46.623  1.00 64.70  ? 1135 HOH B O   1 
HETATM 2807 O  O   . HOH J 4 .   ? 13.981 12.631 10.453  1.00 48.75  ? 1136 HOH B O   1 
HETATM 2808 O  O   . HOH J 4 .   ? 10.883 -0.401 46.465  1.00 60.06  ? 1137 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
9    N N   . GLU A 3   ? 0.8008 1.0174 0.7866 0.0948  -0.0988 -0.1256 3    GLU A N   
10   C CA  . GLU A 3   ? 0.7087 0.8953 0.6955 0.0671  -0.0766 -0.0907 3    GLU A CA  
11   C C   . GLU A 3   ? 0.5701 0.8351 0.6132 0.0384  -0.0526 -0.0753 3    GLU A C   
12   O O   . GLU A 3   ? 0.5404 0.8535 0.6125 0.0374  -0.0523 -0.0941 3    GLU A O   
13   C CB  . GLU A 3   ? 0.7588 0.8753 0.7030 0.0914  -0.0949 -0.0977 3    GLU A CB  
14   C CG  . GLU A 3   ? 0.7887 0.8439 0.7105 0.0652  -0.0743 -0.0640 3    GLU A CG  
15   C CD  . GLU A 3   ? 0.9101 0.8678 0.7623 0.0913  -0.0927 -0.0697 3    GLU A CD  
16   O OE1 . GLU A 3   ? 1.0092 0.8744 0.7770 0.1232  -0.1153 -0.0865 3    GLU A OE1 
17   O OE2 . GLU A 3   ? 0.8754 0.8364 0.7442 0.0834  -0.0859 -0.0576 3    GLU A OE2 
18   N N   . VAL A 4   ? 0.4354 0.7043 0.4819 0.0162  -0.0323 -0.0471 4    VAL A N   
19   C CA  . VAL A 4   ? 0.3651 0.6731 0.4272 -0.0034 -0.0122 -0.0302 4    VAL A CA  
20   C C   . VAL A 4   ? 0.3350 0.6012 0.3847 -0.0125 -0.0030 -0.0047 4    VAL A C   
21   O O   . VAL A 4   ? 0.2964 0.5310 0.3346 -0.0090 -0.0048 0.0064  4    VAL A O   
22   C CB  . VAL A 4   ? 0.3665 0.6995 0.4231 -0.0047 -0.0053 -0.0210 4    VAL A CB  
23   C CG1 . VAL A 4   ? 0.3522 0.6957 0.3886 -0.0188 0.0135  -0.0044 4    VAL A CG1 
24   C CG2 . VAL A 4   ? 0.3119 0.6803 0.3807 0.0060  -0.0165 -0.0467 4    VAL A CG2 
25   N N   . PRO A 5   ? 0.3043 0.5739 0.3561 -0.0284 0.0098  -0.0022 5    PRO A N   
26   C CA  . PRO A 5   ? 0.3302 0.5523 0.3657 -0.0334 0.0156  0.0204  5    PRO A CA  
27   C C   . PRO A 5   ? 0.3404 0.5352 0.3362 -0.0315 0.0237  0.0468  5    PRO A C   
28   O O   . PRO A 5   ? 0.3598 0.5635 0.3300 -0.0352 0.0326  0.0503  5    PRO A O   
29   C CB  . PRO A 5   ? 0.3591 0.5933 0.4073 -0.0546 0.0288  0.0045  5    PRO A CB  
30   C CG  . PRO A 5   ? 0.3542 0.6472 0.4155 -0.0721 0.0417  -0.0222 5    PRO A CG  
31   C CD  . PRO A 5   ? 0.3693 0.6880 0.4364 -0.0493 0.0247  -0.0266 5    PRO A CD  
32   N N   . ILE A 6   ? 0.3391 0.4999 0.3227 -0.0191 0.0167  0.0602  6    ILE A N   
33   C CA  . ILE A 6   ? 0.3589 0.4934 0.2973 0.0015  0.0119  0.0745  6    ILE A CA  
34   C C   . ILE A 6   ? 0.4000 0.4670 0.2958 -0.0031 0.0186  0.0926  6    ILE A C   
35   O O   . ILE A 6   ? 0.4214 0.4788 0.3398 -0.0021 0.0130  0.0916  6    ILE A O   
36   C CB  . ILE A 6   ? 0.2858 0.4533 0.2489 0.0238  -0.0044 0.0583  6    ILE A CB  
37   C CG1 . ILE A 6   ? 0.2887 0.5104 0.2814 0.0214  -0.0053 0.0375  6    ILE A CG1 
38   C CG2 . ILE A 6   ? 0.3938 0.5458 0.3145 0.0604  -0.0198 0.0590  6    ILE A CG2 
39   C CD1 . ILE A 6   ? 0.2567 0.5172 0.2782 0.0233  -0.0088 0.0082  6    ILE A CD1 
40   N N   . GLY A 7   ? 0.5360 0.5449 0.3591 -0.0120 0.0338  0.1082  7    GLY A N   
41   C CA  . GLY A 7   ? 0.6359 0.5556 0.3960 -0.0267 0.0482  0.1246  7    GLY A CA  
42   C C   . GLY A 7   ? 0.5975 0.5413 0.4162 -0.0642 0.0642  0.1111  7    GLY A C   
43   O O   . GLY A 7   ? 0.5298 0.5488 0.4164 -0.0808 0.0680  0.0877  7    GLY A O   
44   N N   . ASP A 8   ? 0.6534 0.5324 0.4406 -0.0691 0.0685  0.1208  8    ASP A N   
45   C CA  A ASP A 8   ? 0.6203 0.5205 0.4574 -0.1013 0.0829  0.1030  8    ASP A CA  
46   C CA  B ASP A 8   ? 0.6332 0.5351 0.4718 -0.1011 0.0826  0.1026  8    ASP A CA  
47   C C   . ASP A 8   ? 0.5714 0.4957 0.4612 -0.0716 0.0556  0.1013  8    ASP A C   
48   O O   . ASP A 8   ? 0.5695 0.4634 0.4340 -0.0372 0.0350  0.1154  8    ASP A O   
49   C CB  A ASP A 8   ? 0.7335 0.5363 0.4912 -0.1401 0.1157  0.1100  8    ASP A CB  
50   C CB  B ASP A 8   ? 0.7520 0.5644 0.5176 -0.1445 0.1180  0.1064  8    ASP A CB  
51   C CG  A ASP A 8   ? 0.7608 0.5347 0.4576 -0.1907 0.1577  0.1029  8    ASP A CG  
52   C CG  B ASP A 8   ? 0.8951 0.5745 0.5434 -0.1169 0.1094  0.1402  8    ASP A CG  
53   O OD1 A ASP A 8   ? 0.6695 0.5446 0.4375 -0.2174 0.1707  0.0691  8    ASP A OD1 
54   O OD1 B ASP A 8   ? 0.9317 0.6159 0.5828 -0.0589 0.0704  0.1510  8    ASP A OD1 
55   O OD2 A ASP A 8   ? 0.8803 0.5235 0.4474 -0.2025 0.1775  0.1273  8    ASP A OD2 
56   O OD2 B ASP A 8   ? 1.0140 0.5791 0.5580 -0.1536 0.1426  0.1493  8    ASP A OD2 
57   N N   . PRO A 9   ? 0.4958 0.4762 0.4525 -0.0813 0.0538  0.0775  9    PRO A N   
58   C CA  . PRO A 9   ? 0.4590 0.4422 0.4443 -0.0590 0.0337  0.0774  9    PRO A CA  
59   C C   . PRO A 9   ? 0.4841 0.4068 0.4387 -0.0610 0.0374  0.0894  9    PRO A C   
60   O O   . PRO A 9   ? 0.5028 0.3830 0.4243 -0.0913 0.0610  0.0885  9    PRO A O   
61   C CB  . PRO A 9   ? 0.4268 0.4619 0.4631 -0.0632 0.0299  0.0463  9    PRO A CB  
62   C CG  . PRO A 9   ? 0.5058 0.5716 0.5507 -0.0974 0.0542  0.0215  9    PRO A CG  
63   C CD  . PRO A 9   ? 0.4895 0.5321 0.4901 -0.1075 0.0675  0.0421  9    PRO A CD  
64   N N   . LYS A 10  ? 0.4730 0.3887 0.4314 -0.0330 0.0173  0.0961  10   LYS A N   
65   C CA  . LYS A 10  ? 0.4925 0.3580 0.4275 -0.0250 0.0129  0.1028  10   LYS A CA  
66   C C   . LYS A 10  ? 0.4349 0.3316 0.4213 -0.0296 0.0093  0.0875  10   LYS A C   
67   O O   . LYS A 10  ? 0.4097 0.3487 0.4280 -0.0231 0.0013  0.0770  10   LYS A O   
68   C CB  . LYS A 10  ? 0.5163 0.3748 0.4289 0.0149  -0.0109 0.1065  10   LYS A CB  
69   C CG  . LYS A 10  ? 0.7021 0.4996 0.5350 0.0394  -0.0183 0.1191  10   LYS A CG  
70   C CD  . LYS A 10  ? 0.7692 0.5972 0.5967 0.0390  -0.0146 0.1202  10   LYS A CD  
71   C CE  . LYS A 10  ? 0.8933 0.6519 0.6242 0.0783  -0.0300 0.1298  10   LYS A CE  
72   N NZ  . LYS A 10  ? 0.8248 0.5890 0.5304 0.0697  -0.0190 0.1362  10   LYS A NZ  
73   N N   . GLU A 11  ? 0.4109 0.2727 0.3906 -0.0400 0.0157  0.0851  11   GLU A N   
74   C CA  . GLU A 11  ? 0.3629 0.2446 0.3794 -0.0330 0.0063  0.0722  11   GLU A CA  
75   C C   . GLU A 11  ? 0.3809 0.2273 0.3746 -0.0100 -0.0078 0.0819  11   GLU A C   
76   O O   . GLU A 11  ? 0.4148 0.1959 0.3625 -0.0111 -0.0040 0.0907  11   GLU A O   
77   C CB  . GLU A 11  ? 0.3991 0.2911 0.4405 -0.0599 0.0221  0.0486  11   GLU A CB  
78   C CG  . GLU A 11  ? 0.4741 0.4298 0.5507 -0.0707 0.0276  0.0211  11   GLU A CG  
79   C CD  . GLU A 11  ? 0.5462 0.5517 0.6674 -0.0883 0.0367  -0.0250 11   GLU A CD  
80   O OE1 . GLU A 11  ? 0.5365 0.5298 0.6682 -0.0921 0.0381  -0.0347 11   GLU A OE1 
81   O OE2 . GLU A 11  ? 0.5722 0.6424 0.7238 -0.0956 0.0405  -0.0608 11   GLU A OE2 
82   N N   . LEU A 12  ? 0.3116 0.1944 0.3262 0.0093  -0.0226 0.0754  12   LEU A N   
83   C CA  . LEU A 12  ? 0.3266 0.2041 0.3309 0.0350  -0.0390 0.0704  12   LEU A CA  
84   C C   . LEU A 12  ? 0.3015 0.2234 0.3390 0.0348  -0.0419 0.0525  12   LEU A C   
85   O O   . LEU A 12  ? 0.2816 0.2298 0.3272 0.0209  -0.0331 0.0460  12   LEU A O   
86   C CB  . LEU A 12  ? 0.3478 0.2322 0.3238 0.0615  -0.0521 0.0682  12   LEU A CB  
87   C CG  . LEU A 12  ? 0.5068 0.3260 0.4194 0.0684  -0.0507 0.0875  12   LEU A CG  
88   C CD1 . LEU A 12  ? 0.5637 0.4140 0.4585 0.1026  -0.0688 0.0760  12   LEU A CD1 
89   C CD2 . LEU A 12  ? 0.5711 0.2871 0.4129 0.0794  -0.0546 0.0997  12   LEU A CD2 
90   N N   . ASN A 13  ? 0.2915 0.2081 0.3341 0.0477  -0.0519 0.0434  13   ASN A N   
91   C CA  . ASN A 13  ? 0.2647 0.2223 0.3279 0.0443  -0.0509 0.0223  13   ASN A CA  
92   C C   . ASN A 13  ? 0.2996 0.2470 0.3596 0.0226  -0.0372 0.0252  13   ASN A C   
93   O O   . ASN A 13  ? 0.2885 0.2466 0.3340 0.0079  -0.0259 0.0127  13   ASN A O   
94   C CB  . ASN A 13  ? 0.2651 0.2811 0.3348 0.0476  -0.0511 -0.0037 13   ASN A CB  
95   C CG  . ASN A 13  ? 0.3306 0.3689 0.4003 0.0874  -0.0766 -0.0251 13   ASN A CG  
96   O OD1 . ASN A 13  ? 0.3208 0.3316 0.3849 0.1078  -0.0916 -0.0249 13   ASN A OD1 
97   N ND2 . ASN A 13  ? 0.2671 0.3567 0.3394 0.1050  -0.0856 -0.0506 13   ASN A ND2 
98   N N   . GLY A 14  ? 0.3906 0.2001 0.3548 0.0294  -0.0405 0.0377  14   GLY A N   
99   C CA  . GLY A 14  ? 0.3764 0.2280 0.3680 0.0225  -0.0305 0.0282  14   GLY A CA  
100  C C   . GLY A 14  ? 0.3336 0.2031 0.3196 0.0199  -0.0247 0.0322  14   GLY A C   
101  O O   . GLY A 14  ? 0.3376 0.2243 0.3241 0.0292  -0.0262 0.0223  14   GLY A O   
102  N N   . MET A 15  ? 0.3276 0.1821 0.2963 0.0134  -0.0220 0.0445  15   MET A N   
103  C CA  . MET A 15  ? 0.3438 0.2148 0.3079 0.0122  -0.0181 0.0479  15   MET A CA  
104  C C   . MET A 15  ? 0.3364 0.1979 0.2867 -0.0058 -0.0083 0.0524  15   MET A C   
105  O O   . MET A 15  ? 0.3940 0.2108 0.3129 -0.0150 -0.0052 0.0614  15   MET A O   
106  C CB  . MET A 15  ? 0.3239 0.1995 0.2827 0.0202  -0.0212 0.0504  15   MET A CB  
107  C CG  . MET A 15  ? 0.3136 0.1975 0.2765 0.0226  -0.0184 0.0378  15   MET A CG  
108  S SD  . MET A 15  ? 0.3367 0.2516 0.3083 0.0166  -0.0111 0.0162  15   MET A SD  
109  C CE  . MET A 15  ? 0.3659 0.2945 0.3565 0.0445  -0.0389 0.0028  15   MET A CE  
110  N N   . GLU A 16  ? 0.3204 0.2127 0.2802 -0.0096 -0.0039 0.0434  16   GLU A N   
111  C CA  . GLU A 16  ? 0.3600 0.2535 0.3065 -0.0292 0.0080  0.0444  16   GLU A CA  
112  C C   . GLU A 16  ? 0.3644 0.2549 0.2990 -0.0145 -0.0004 0.0598  16   GLU A C   
113  O O   . GLU A 16  ? 0.3375 0.2454 0.2835 -0.0005 -0.0068 0.0556  16   GLU A O   
114  C CB  . GLU A 16  ? 0.3708 0.3215 0.3478 -0.0366 0.0133  0.0113  16   GLU A CB  
115  C CG  . GLU A 16  ? 0.4433 0.4059 0.4093 -0.0667 0.0328  0.0041  16   GLU A CG  
116  C CD  . GLU A 16  ? 0.6820 0.7240 0.6899 -0.0638 0.0302  -0.0408 16   GLU A CD  
117  O OE1 . GLU A 16  ? 0.7512 0.8147 0.7744 -0.0226 0.0028  -0.0539 16   GLU A OE1 
118  O OE2 . GLU A 16  ? 0.7846 0.8595 0.7984 -0.1015 0.0552  -0.0678 16   GLU A OE2 
119  N N   . ILE A 17  ? 0.3869 0.2449 0.2859 -0.0177 0.0003  0.0735  17   ILE A N   
120  C CA  . ILE A 17  ? 0.3904 0.2567 0.2837 0.0007  -0.0107 0.0780  17   ILE A CA  
121  C C   . ILE A 17  ? 0.3809 0.2393 0.2438 -0.0102 -0.0032 0.0834  17   ILE A C   
122  O O   . ILE A 17  ? 0.4806 0.2790 0.2823 -0.0171 0.0005  0.0946  17   ILE A O   
123  C CB  . ILE A 17  ? 0.4248 0.2617 0.2947 0.0268  -0.0300 0.0784  17   ILE A CB  
124  C CG1 . ILE A 17  ? 0.3930 0.2430 0.2938 0.0325  -0.0341 0.0684  17   ILE A CG1 
125  C CG2 . ILE A 17  ? 0.4366 0.3094 0.3168 0.0494  -0.0433 0.0637  17   ILE A CG2 
126  C CD1 . ILE A 17  ? 0.4404 0.2567 0.3169 0.0579  -0.0552 0.0629  17   ILE A CD1 
127  N N   . ALA A 18  ? 0.3292 0.2346 0.2213 -0.0134 0.0004  0.0747  18   ALA A N   
128  C CA  . ALA A 18  ? 0.3775 0.2890 0.2485 -0.0262 0.0092  0.0748  18   ALA A CA  
129  C C   . ALA A 18  ? 0.3600 0.2999 0.2443 -0.0048 -0.0030 0.0717  18   ALA A C   
130  O O   . ALA A 18  ? 0.3438 0.3072 0.2612 0.0065  -0.0086 0.0621  18   ALA A O   
131  C CB  . ALA A 18  ? 0.3670 0.3273 0.2713 -0.0489 0.0234  0.0519  18   ALA A CB  
132  N N   . ALA A 19  ? 0.3535 0.2858 0.2038 -0.0045 -0.0026 0.0755  19   ALA A N   
133  C CA  . ALA A 19  ? 0.3794 0.3515 0.2486 0.0134  -0.0125 0.0646  19   ALA A CA  
134  C C   . ALA A 19  ? 0.3099 0.3119 0.1844 -0.0055 -0.0001 0.0595  19   ALA A C   
135  O O   . ALA A 19  ? 0.3812 0.3604 0.2170 -0.0303 0.0157  0.0642  19   ALA A O   
136  C CB  . ALA A 19  ? 0.4257 0.3677 0.2440 0.0467  -0.0337 0.0648  19   ALA A CB  
137  N N   . VAL A 20  ? 0.3107 0.3610 0.2291 0.0010  -0.0035 0.0438  20   VAL A N   
138  C CA  . VAL A 20  ? 0.3169 0.4061 0.2488 -0.0081 0.0015  0.0316  20   VAL A CA  
139  C C   . VAL A 20  ? 0.2864 0.4076 0.2408 0.0078  -0.0062 0.0183  20   VAL A C   
140  O O   . VAL A 20  ? 0.2551 0.3767 0.2251 0.0182  -0.0098 0.0098  20   VAL A O   
141  C CB  . VAL A 20  ? 0.3489 0.4606 0.3132 -0.0146 0.0025  0.0142  20   VAL A CB  
142  C CG1 . VAL A 20  ? 0.3794 0.4810 0.3367 -0.0318 0.0118  0.0123  20   VAL A CG1 
143  C CG2 . VAL A 20  ? 0.3433 0.4321 0.3183 0.0012  -0.0058 0.0106  20   VAL A CG2 
144  N N   . TYR A 21  ? 0.2912 0.4471 0.2497 0.0050  -0.0050 0.0085  21   TYR A N   
145  C CA  . TYR A 21  ? 0.2648 0.4579 0.2552 0.0151  -0.0093 -0.0115 21   TYR A CA  
146  C C   . TYR A 21  ? 0.2654 0.4886 0.2785 0.0092  -0.0088 -0.0281 21   TYR A C   
147  O O   . TYR A 21  ? 0.3220 0.5632 0.3320 -0.0013 -0.0061 -0.0322 21   TYR A O   
148  C CB  . TYR A 21  ? 0.2861 0.5017 0.2619 0.0348  -0.0188 -0.0185 21   TYR A CB  
149  C CG  . TYR A 21  ? 0.3627 0.5802 0.2943 0.0348  -0.0192 -0.0110 21   TYR A CG  
150  C CD1 . TYR A 21  ? 0.4303 0.5834 0.2803 0.0327  -0.0172 0.0127  21   TYR A CD1 
151  C CD2 . TYR A 21  ? 0.3169 0.5864 0.2728 0.0342  -0.0187 -0.0292 21   TYR A CD2 
152  C CE1 . TYR A 21  ? 0.5284 0.6586 0.3097 0.0235  -0.0090 0.0194  21   TYR A CE1 
153  C CE2 . TYR A 21  ? 0.4654 0.7344 0.3712 0.0296  -0.0148 -0.0248 21   TYR A CE2 
154  C CZ  . TYR A 21  ? 0.5169 0.7109 0.3289 0.0219  -0.0076 0.0000  21   TYR A CZ  
155  O OH  . TYR A 21  ? 0.5147 0.6845 0.2509 0.0077  0.0048  0.0043  21   TYR A OH  
156  N N   . LEU A 22  ? 0.3811 0.4817 0.2943 0.0572  -0.0105 0.0410  22   LEU A N   
157  C CA  . LEU A 22  ? 0.3841 0.5078 0.3153 0.0675  0.0051  0.0424  22   LEU A CA  
158  C C   . LEU A 22  ? 0.3612 0.4788 0.2612 0.0872  0.0074  0.0170  22   LEU A C   
159  O O   . LEU A 22  ? 0.3232 0.4252 0.1955 0.0908  -0.0025 0.0023  22   LEU A O   
160  C CB  . LEU A 22  ? 0.3748 0.5044 0.3437 0.0543  -0.0024 0.0452  22   LEU A CB  
161  C CG  . LEU A 22  ? 0.3992 0.5083 0.3662 0.0433  -0.0211 0.0277  22   LEU A CG  
162  C CD1 . LEU A 22  ? 0.4272 0.5443 0.4254 0.0387  -0.0231 0.0307  22   LEU A CD1 
163  C CD2 . LEU A 22  ? 0.4307 0.5162 0.3907 0.0277  -0.0379 0.0341  22   LEU A CD2 
164  N N   . GLN A 23  ? 0.3390 0.4666 0.2437 0.1008  0.0179  0.0125  23   GLN A N   
165  C CA  . GLN A 23  ? 0.3804 0.4928 0.2546 0.1174  0.0128  -0.0127 23   GLN A CA  
166  C C   . GLN A 23  ? 0.3212 0.4196 0.1999 0.1026  -0.0089 -0.0319 23   GLN A C   
167  O O   . GLN A 23  ? 0.3225 0.4232 0.2280 0.0835  -0.0155 -0.0264 23   GLN A O   
168  C CB  . GLN A 23  ? 0.4332 0.5516 0.3127 0.1337  0.0236  -0.0149 23   GLN A CB  
169  C CG  . GLN A 23  ? 0.4322 0.5549 0.3495 0.1193  0.0152  -0.0156 23   GLN A CG  
170  C CD  . GLN A 23  ? 0.4243 0.5743 0.3870 0.1095  0.0251  0.0111  23   GLN A CD  
171  O OE1 . GLN A 23  ? 0.4057 0.5715 0.3792 0.1044  0.0347  0.0327  23   GLN A OE1 
172  N NE2 . GLN A 23  ? 0.4747 0.6286 0.4660 0.1060  0.0201  0.0113  23   GLN A NE2 
173  N N   . PRO A 24  ? 0.3283 0.4113 0.1814 0.1116  -0.0209 -0.0530 24   PRO A N   
174  C CA  . PRO A 24  ? 0.3374 0.4151 0.2057 0.0960  -0.0385 -0.0666 24   PRO A CA  
175  C C   . PRO A 24  ? 0.3556 0.4321 0.2479 0.0858  -0.0399 -0.0672 24   PRO A C   
176  O O   . PRO A 24  ? 0.3852 0.4579 0.2737 0.0974  -0.0339 -0.0675 24   PRO A O   
177  C CB  . PRO A 24  ? 0.3960 0.4587 0.2393 0.1071  -0.0538 -0.0860 24   PRO A CB  
178  C CG  . PRO A 24  ? 0.4138 0.4683 0.2169 0.1303  -0.0451 -0.0835 24   PRO A CG  
179  C CD  . PRO A 24  ? 0.3773 0.4450 0.1875 0.1355  -0.0209 -0.0637 24   PRO A CD  
180  N N   . ILE A 25  ? 0.3308 0.4081 0.2432 0.0671  -0.0472 -0.0673 25   ILE A N   
181  C CA  . ILE A 25  ? 0.3272 0.3988 0.2582 0.0557  -0.0491 -0.0651 25   ILE A CA  
182  C C   . ILE A 25  ? 0.3482 0.4103 0.2833 0.0462  -0.0619 -0.0780 25   ILE A C   
183  O O   . ILE A 25  ? 0.3753 0.4436 0.3114 0.0429  -0.0683 -0.0840 25   ILE A O   
184  C CB  . ILE A 25  ? 0.3472 0.4210 0.2914 0.0425  -0.0465 -0.0505 25   ILE A CB  
185  C CG1 . ILE A 25  ? 0.3764 0.4597 0.3276 0.0476  -0.0379 -0.0340 25   ILE A CG1 
186  C CG2 . ILE A 25  ? 0.3984 0.4596 0.3536 0.0292  -0.0521 -0.0500 25   ILE A CG2 
187  C CD1 . ILE A 25  ? 0.5573 0.6465 0.5225 0.0554  -0.0324 -0.0294 25   ILE A CD1 
188  N N   . GLU A 26  ? 0.3233 0.3711 0.2636 0.0420  -0.0670 -0.0809 26   GLU A N   
189  C CA  . GLU A 26  ? 0.3298 0.3670 0.2787 0.0276  -0.0793 -0.0879 26   GLU A CA  
190  C C   . GLU A 26  ? 0.3003 0.3403 0.2632 0.0109  -0.0733 -0.0764 26   GLU A C   
191  O O   . GLU A 26  ? 0.3141 0.3462 0.2764 0.0104  -0.0689 -0.0681 26   GLU A O   
192  C CB  . GLU A 26  ? 0.3729 0.3840 0.3128 0.0320  -0.0902 -0.0964 26   GLU A CB  
193  C CG  . GLU A 26  ? 0.5243 0.5189 0.4634 0.0242  -0.1103 -0.1079 26   GLU A CG  
194  C CD  . GLU A 26  ? 0.5315 0.5277 0.4549 0.0370  -0.1195 -0.1189 26   GLU A CD  
195  O OE1 . GLU A 26  ? 0.6529 0.6284 0.5439 0.0595  -0.1233 -0.1288 26   GLU A OE1 
196  O OE2 . GLU A 26  ? 0.6663 0.6831 0.6071 0.0272  -0.1228 -0.1174 26   GLU A OE2 
197  N N   . MET A 27  ? 0.3365 0.3874 0.3110 -0.0002 -0.0729 -0.0748 27   MET A N   
198  C CA  . MET A 27  ? 0.3177 0.3683 0.2947 -0.0103 -0.0635 -0.0635 27   MET A CA  
199  C C   . MET A 27  ? 0.3094 0.3587 0.3018 -0.0265 -0.0650 -0.0603 27   MET A C   
200  O O   . MET A 27  ? 0.3678 0.4295 0.3787 -0.0319 -0.0732 -0.0651 27   MET A O   
201  C CB  . MET A 27  ? 0.3205 0.3890 0.2945 -0.0040 -0.0547 -0.0601 27   MET A CB  
202  C CG  . MET A 27  ? 0.3825 0.4401 0.3424 -0.0061 -0.0448 -0.0495 27   MET A CG  
203  S SD  . MET A 27  ? 0.4569 0.5318 0.4099 0.0052  -0.0349 -0.0474 27   MET A SD  
204  C CE  . MET A 27  ? 0.3804 0.4853 0.3665 -0.0035 -0.0267 -0.0446 27   MET A CE  
205  N N   . GLU A 28  ? 0.3054 0.3380 0.2895 -0.0347 -0.0584 -0.0503 28   GLU A N   
206  C CA  . GLU A 28  ? 0.3429 0.3779 0.3395 -0.0501 -0.0524 -0.0409 28   GLU A CA  
207  C C   . GLU A 28  ? 0.3354 0.3787 0.3202 -0.0457 -0.0331 -0.0299 28   GLU A C   
208  O O   . GLU A 28  ? 0.3333 0.3633 0.2919 -0.0340 -0.0304 -0.0300 28   GLU A O   
209  C CB  . GLU A 28  ? 0.3969 0.3979 0.3839 -0.0611 -0.0595 -0.0370 28   GLU A CB  
210  C CG  . GLU A 28  ? 0.4725 0.4604 0.4672 -0.0632 -0.0793 -0.0483 28   GLU A CG  
211  C CD  . GLU A 28  ? 0.6460 0.6125 0.6480 -0.0826 -0.0875 -0.0417 28   GLU A CD  
212  O OE1 . GLU A 28  ? 0.6463 0.6314 0.6761 -0.0974 -0.0894 -0.0366 28   GLU A OE1 
213  O OE2 . GLU A 28  ? 0.7942 0.7260 0.7767 -0.0838 -0.0931 -0.0397 28   GLU A OE2 
214  N N   . PRO A 29  ? 0.3746 0.3149 0.6401 -0.1436 0.1421  -0.1019 29   PRO A N   
215  C CA  . PRO A 29  ? 0.3622 0.3506 0.6837 -0.1604 0.1223  -0.0818 29   PRO A CA  
216  C C   . PRO A 29  ? 0.3746 0.3535 0.7131 -0.1486 0.0959  -0.0819 29   PRO A C   
217  O O   . PRO A 29  ? 0.3731 0.3441 0.7049 -0.1197 0.1059  -0.0928 29   PRO A O   
218  C CB  . PRO A 29  ? 0.3808 0.4635 0.7458 -0.1529 0.1472  -0.0601 29   PRO A CB  
219  C CG  . PRO A 29  ? 0.4118 0.4722 0.7321 -0.1029 0.1770  -0.0847 29   PRO A CG  
220  C CD  . PRO A 29  ? 0.4222 0.3755 0.6722 -0.1114 0.1681  -0.1105 29   PRO A CD  
221  N N   . ARG A 30  ? 0.4324 0.3963 0.7813 -0.1725 0.0538  -0.0692 30   ARG A N   
222  C CA  . ARG A 30  ? 0.4670 0.4081 0.8165 -0.1659 0.0195  -0.0698 30   ARG A CA  
223  C C   . ARG A 30  ? 0.4658 0.4937 0.8847 -0.1631 0.0276  -0.0428 30   ARG A C   
224  O O   . ARG A 30  ? 0.4294 0.5466 0.8992 -0.1736 0.0436  -0.0104 30   ARG A O   
225  C CB  . ARG A 30  ? 0.5657 0.4394 0.8831 -0.1939 -0.0436 -0.0622 30   ARG A CB  
226  C CG  . ARG A 30  ? 0.6600 0.4476 0.8937 -0.1736 -0.0522 -0.0883 30   ARG A CG  
227  C CD  . ARG A 30  ? 0.8734 0.5541 1.0440 -0.1883 -0.1265 -0.0875 30   ARG A CD  
228  N NE  . ARG A 30  ? 1.0208 0.6308 1.1292 -0.1593 -0.1689 -0.1064 30   ARG A NE  
229  C CZ  . ARG A 30  ? 1.1908 0.6634 1.2012 -0.1558 -0.2482 -0.1173 30   ARG A CZ  
230  N NH1 . ARG A 30  ? 1.2433 0.6269 1.2117 -0.1856 -0.2999 -0.1072 30   ARG A NH1 
231  N NH2 . ARG A 30  ? 1.3325 0.7414 1.2736 -0.1219 -0.2845 -0.1382 30   ARG A NH2 
232  N N   . GLY A 31  ? 0.4834 0.5031 0.9048 -0.1416 0.0201  -0.0498 31   GLY A N   
233  C CA  . GLY A 31  ? 0.4968 0.6035 0.9844 -0.1342 0.0211  -0.0170 31   GLY A CA  
234  C C   . GLY A 31  ? 0.5008 0.6483 0.9980 -0.0778 0.0690  -0.0248 31   GLY A C   
235  O O   . GLY A 31  ? 0.5228 0.7412 1.0671 -0.0549 0.0717  0.0013  31   GLY A O   
236  N N   . ILE A 32  ? 0.5223 0.6177 0.9652 -0.0525 0.0999  -0.0569 32   ILE A N   
237  C CA  . ILE A 32  ? 0.5818 0.6621 0.9940 0.0089  0.1281  -0.0729 32   ILE A CA  
238  C C   . ILE A 32  ? 0.5968 0.5775 0.9630 0.0177  0.1070  -0.0961 32   ILE A C   
239  O O   . ILE A 32  ? 0.6966 0.6350 1.0279 0.0664  0.1111  -0.1071 32   ILE A O   
240  C CB  . ILE A 32  ? 0.6363 0.6966 0.9916 0.0376  0.1606  -0.0912 32   ILE A CB  
241  C CG1 . ILE A 32  ? 0.6850 0.6695 0.9936 -0.0098 0.1520  -0.1097 32   ILE A CG1 
242  C CG2 . ILE A 32  ? 0.6514 0.8568 1.0613 0.0549  0.1895  -0.0538 32   ILE A CG2 
243  C CD1 . ILE A 32  ? 0.7789 0.6943 1.0018 0.0149  0.1689  -0.1345 32   ILE A CD1 
244  N N   . ASP A 33  ? 0.5433 0.4885 0.9007 -0.0227 0.0806  -0.0985 33   ASP A N   
245  C CA  . ASP A 33  ? 0.5409 0.4398 0.8772 -0.0214 0.0559  -0.0996 33   ASP A CA  
246  C C   . ASP A 33  ? 0.4804 0.4076 0.8391 -0.0412 0.0305  -0.0896 33   ASP A C   
247  O O   . ASP A 33  ? 0.4695 0.4104 0.8306 -0.0601 0.0221  -0.0898 33   ASP A O   
248  C CB  . ASP A 33  ? 0.5634 0.3914 0.8338 -0.0384 0.0454  -0.1028 33   ASP A CB  
249  C CG  . ASP A 33  ? 0.6426 0.4220 0.8897 -0.0371 0.0124  -0.0893 33   ASP A CG  
250  O OD1 . ASP A 33  ? 0.6255 0.3983 0.8925 -0.0065 0.0062  -0.0907 33   ASP A OD1 
251  O OD2 . ASP A 33  ? 0.5475 0.3052 0.7595 -0.0692 -0.0115 -0.0671 33   ASP A OD2 
252  N N   . LEU A 34  ? 0.4715 0.3927 0.8320 -0.0334 0.0111  -0.0813 34   LEU A N   
253  C CA  . LEU A 34  ? 0.4294 0.3734 0.7908 -0.0405 -0.0148 -0.0737 34   LEU A CA  
254  C C   . LEU A 34  ? 0.4410 0.3784 0.7491 -0.0446 -0.0195 -0.0797 34   LEU A C   
255  O O   . LEU A 34  ? 0.4206 0.3581 0.6964 -0.0469 -0.0110 -0.0702 34   LEU A O   
256  C CB  . LEU A 34  ? 0.4497 0.3959 0.8142 -0.0336 -0.0330 -0.0565 34   LEU A CB  
257  C CG  . LEU A 34  ? 0.3651 0.3494 0.7338 -0.0314 -0.0589 -0.0450 34   LEU A CG  
258  C CD1 . LEU A 34  ? 0.3607 0.3627 0.7692 -0.0337 -0.0709 -0.0467 34   LEU A CD1 
259  C CD2 . LEU A 34  ? 0.3483 0.3428 0.7255 -0.0327 -0.0773 -0.0171 34   LEU A CD2 
260  N N   . ALA A 35  ? 0.5227 0.4938 0.3872 -0.0702 -0.1259 0.0158  35   ALA A N   
261  C CA  . ALA A 35  ? 0.5606 0.4785 0.3974 -0.0595 -0.1476 0.0130  35   ALA A CA  
262  C C   . ALA A 35  ? 0.5380 0.4555 0.3704 -0.0216 -0.1402 0.0004  35   ALA A C   
263  O O   . ALA A 35  ? 0.4811 0.4220 0.3208 -0.0066 -0.1297 -0.0048 35   ALA A O   
264  C CB  . ALA A 35  ? 0.6120 0.4946 0.4343 -0.0725 -0.1795 0.0115  35   ALA A CB  
265  N N   . ALA A 36  ? 0.5262 0.4189 0.3455 -0.0075 -0.1466 -0.0044 36   ALA A N   
266  C CA  . ALA A 36  ? 0.4945 0.3997 0.3132 0.0241  -0.1354 -0.0171 36   ALA A CA  
267  C C   . ALA A 36  ? 0.5087 0.4131 0.3151 0.0451  -0.1424 -0.0306 36   ALA A C   
268  O O   . ALA A 36  ? 0.4792 0.4107 0.2861 0.0616  -0.1233 -0.0349 36   ALA A O   
269  C CB  . ALA A 36  ? 0.5673 0.4496 0.3782 0.0375  -0.1475 -0.0260 36   ALA A CB  
270  N N   . SER A 37  ? 0.5579 0.4276 0.3488 0.0430  -0.1718 -0.0367 37   SER A N   
271  C CA  . SER A 37  ? 0.5810 0.4452 0.3551 0.0657  -0.1826 -0.0524 37   SER A CA  
272  C C   . SER A 37  ? 0.5659 0.4564 0.3469 0.0603  -0.1695 -0.0458 37   SER A C   
273  O O   . SER A 37  ? 0.5187 0.4114 0.2825 0.0801  -0.1713 -0.0564 37   SER A O   
274  C CB  . SER A 37  ? 0.6543 0.4666 0.4082 0.0662  -0.2238 -0.0623 37   SER A CB  
275  O OG  . SER A 37  ? 0.7328 0.5314 0.4942 0.0312  -0.2369 -0.0467 37   SER A OG  
276  N N   . LEU A 38  ? 0.5282 0.4395 0.3322 0.0358  -0.1578 -0.0307 38   LEU A N   
277  C CA  . LEU A 38  ? 0.5099 0.4469 0.3249 0.0338  -0.1498 -0.0277 38   LEU A CA  
278  C C   . LEU A 38  ? 0.4618 0.4274 0.2832 0.0421  -0.1222 -0.0217 38   LEU A C   
279  O O   . LEU A 38  ? 0.4455 0.4268 0.2730 0.0437  -0.1187 -0.0199 38   LEU A O   
280  C CB  . LEU A 38  ? 0.4992 0.4501 0.3396 0.0044  -0.1565 -0.0203 38   LEU A CB  
281  C CG  . LEU A 38  ? 0.6528 0.5779 0.4890 -0.0116 -0.1872 -0.0234 38   LEU A CG  
282  C CD1 . LEU A 38  ? 0.7585 0.6338 0.5666 -0.0047 -0.2086 -0.0282 38   LEU A CD1 
283  C CD2 . LEU A 38  ? 0.6185 0.5680 0.4817 -0.0499 -0.1873 -0.0130 38   LEU A CD2 
284  N N   . ALA A 39  ? 0.4164 0.3856 0.2360 0.0474  -0.1067 -0.0195 39   ALA A N   
285  C CA  . ALA A 39  ? 0.3750 0.3669 0.2021 0.0491  -0.0829 -0.0111 39   ALA A CA  
286  C C   . ALA A 39  ? 0.3538 0.3503 0.1609 0.0660  -0.0710 -0.0152 39   ALA A C   
287  O O   . ALA A 39  ? 0.4053 0.3933 0.1978 0.0792  -0.0792 -0.0279 39   ALA A O   
288  C CB  . ALA A 39  ? 0.3337 0.3335 0.1812 0.0351  -0.0736 -0.0038 39   ALA A CB  
289  N N   . ASP A 40  ? 0.3511 0.3624 0.1576 0.0644  -0.0531 -0.0055 40   ASP A N   
290  C CA  . ASP A 40  ? 0.3868 0.4128 0.1772 0.0716  -0.0365 -0.0057 40   ASP A CA  
291  C C   . ASP A 40  ? 0.3536 0.3973 0.1634 0.0630  -0.0196 0.0014  40   ASP A C   
292  O O   . ASP A 40  ? 0.3608 0.4261 0.1671 0.0672  -0.0065 -0.0031 40   ASP A O   
293  C CB  . ASP A 40  ? 0.4195 0.4420 0.1797 0.0729  -0.0326 0.0020  40   ASP A CB  
294  C CG  . ASP A 40  ? 0.5170 0.5229 0.2532 0.0846  -0.0501 -0.0074 40   ASP A CG  
295  O OD1 . ASP A 40  ? 0.5234 0.5336 0.2397 0.0981  -0.0510 -0.0209 40   ASP A OD1 
296  O OD2 . ASP A 40  ? 0.4427 0.4337 0.1823 0.0822  -0.0648 -0.0042 40   ASP A OD2 
297  N N   . ILE A 41  ? 0.3223 0.3617 0.1539 0.0515  -0.0202 0.0100  41   ILE A N   
298  C CA  . ILE A 41  ? 0.2923 0.3437 0.1426 0.0438  -0.0083 0.0157  41   ILE A CA  
299  C C   . ILE A 41  ? 0.2765 0.3202 0.1469 0.0365  -0.0156 0.0164  41   ILE A C   
300  O O   . ILE A 41  ? 0.2762 0.3119 0.1473 0.0335  -0.0259 0.0153  41   ILE A O   
301  C CB  . ILE A 41  ? 0.3105 0.3628 0.1555 0.0346  0.0010  0.0303  41   ILE A CB  
302  C CG1 . ILE A 41  ? 0.3119 0.3466 0.1559 0.0333  -0.0105 0.0353  41   ILE A CG1 
303  C CG2 . ILE A 41  ? 0.3595 0.4191 0.1760 0.0346  0.0103  0.0346  41   ILE A CG2 
304  C CD1 . ILE A 41  ? 0.3148 0.3365 0.1503 0.0262  -0.0104 0.0487  41   ILE A CD1 
305  N N   . HIS A 42  ? 0.2918 0.3420 0.1777 0.0325  -0.0098 0.0175  42   HIS A N   
306  C CA  . HIS A 42  ? 0.2907 0.3357 0.1907 0.0236  -0.0129 0.0206  42   HIS A CA  
307  C C   . HIS A 42  ? 0.3132 0.3642 0.2217 0.0192  -0.0041 0.0286  42   HIS A C   
308  O O   . HIS A 42  ? 0.3303 0.3906 0.2436 0.0185  0.0037  0.0307  42   HIS A O   
309  C CB  . HIS A 42  ? 0.2446 0.2826 0.1499 0.0240  -0.0196 0.0146  42   HIS A CB  
310  C CG  . HIS A 42  ? 0.2205 0.2484 0.1287 0.0121  -0.0251 0.0185  42   HIS A CG  
311  N ND1 . HIS A 42  ? 0.2353 0.2565 0.1357 0.0013  -0.0323 0.0203  42   HIS A ND1 
312  C CD2 . HIS A 42  ? 0.3127 0.3380 0.2278 0.0078  -0.0247 0.0202  42   HIS A CD2 
313  C CE1 . HIS A 42  ? 0.2622 0.2798 0.1616 -0.0108 -0.0335 0.0239  42   HIS A CE1 
314  N NE2 . HIS A 42  ? 0.1989 0.2162 0.1055 -0.0052 -0.0297 0.0236  42   HIS A NE2 
315  N N   . LEU A 43  ? 0.2878 0.3355 0.1989 0.0166  -0.0073 0.0313  43   LEU A N   
316  C CA  . LEU A 43  ? 0.2518 0.2955 0.1679 0.0147  -0.0063 0.0370  43   LEU A CA  
317  C C   . LEU A 43  ? 0.2507 0.2965 0.1802 0.0112  -0.0070 0.0337  43   LEU A C   
318  O O   . LEU A 43  ? 0.2626 0.3143 0.1939 0.0090  -0.0093 0.0281  43   LEU A O   
319  C CB  . LEU A 43  ? 0.2609 0.2980 0.1711 0.0202  -0.0152 0.0361  43   LEU A CB  
320  C CG  . LEU A 43  ? 0.3150 0.3376 0.2259 0.0225  -0.0232 0.0388  43   LEU A CG  
321  C CD1 . LEU A 43  ? 0.3702 0.3762 0.2688 0.0134  -0.0208 0.0530  43   LEU A CD1 
322  C CD2 . LEU A 43  ? 0.3238 0.3400 0.2301 0.0344  -0.0384 0.0317  43   LEU A CD2 
323  N N   . GLU A 44  ? 0.2512 0.2926 0.1876 0.0083  -0.0057 0.0377  44   GLU A N   
324  C CA  . GLU A 44  ? 0.2768 0.3164 0.2223 0.0065  -0.0086 0.0339  44   GLU A CA  
325  C C   . GLU A 44  ? 0.2818 0.3100 0.2311 0.0072  -0.0148 0.0359  44   GLU A C   
326  O O   . GLU A 44  ? 0.3313 0.3502 0.2789 0.0027  -0.0159 0.0447  44   GLU A O   
327  C CB  . GLU A 44  ? 0.3046 0.3464 0.2578 0.0039  -0.0072 0.0330  44   GLU A CB  
328  C CG  . GLU A 44  ? 0.3972 0.4412 0.3443 0.0064  -0.0080 0.0285  44   GLU A CG  
329  C CD  . GLU A 44  ? 0.3814 0.4226 0.3360 0.0086  -0.0143 0.0228  44   GLU A CD  
330  O OE1 . GLU A 44  ? 0.3792 0.4241 0.3482 0.0073  -0.0144 0.0230  44   GLU A OE1 
331  O OE2 . GLU A 44  ? 0.4122 0.4439 0.3579 0.0124  -0.0229 0.0171  44   GLU A OE2 
332  N N   . ALA A 45  ? 0.2974 0.3252 0.2484 0.0113  -0.0201 0.0277  45   ALA A N   
333  C CA  . ALA A 45  ? 0.2661 0.2784 0.2205 0.0143  -0.0305 0.0259  45   ALA A CA  
334  C C   . ALA A 45  ? 0.2747 0.2862 0.2348 0.0097  -0.0304 0.0245  45   ALA A C   
335  O O   . ALA A 45  ? 0.2761 0.2962 0.2300 0.0093  -0.0271 0.0192  45   ALA A O   
336  C CB  . ALA A 45  ? 0.2895 0.3058 0.2410 0.0274  -0.0388 0.0118  45   ALA A CB  
337  N N   . ASP A 46  ? 0.2946 0.2428 0.2145 0.0037  -0.0119 0.0313  46   ASP A N   
338  C CA  . ASP A 46  ? 0.2930 0.2392 0.2286 0.0028  -0.0048 0.0297  46   ASP A CA  
339  C C   . ASP A 46  ? 0.2765 0.2153 0.2186 0.0045  -0.0079 0.0379  46   ASP A C   
340  O O   . ASP A 46  ? 0.3108 0.2414 0.2417 0.0023  -0.0076 0.0463  46   ASP A O   
341  C CB  . ASP A 46  ? 0.3032 0.2539 0.2337 -0.0012 0.0054  0.0277  46   ASP A CB  
342  C CG  . ASP A 46  ? 0.4381 0.3953 0.3686 -0.0001 0.0098  0.0151  46   ASP A CG  
343  O OD1 . ASP A 46  ? 0.4876 0.4401 0.4248 0.0027  0.0058  0.0085  46   ASP A OD1 
344  O OD2 . ASP A 46  ? 0.5803 0.5462 0.5023 -0.0031 0.0179  0.0112  46   ASP A OD2 
345  N N   . ILE A 47  ? 0.2680 0.2074 0.2251 0.0071  -0.0112 0.0355  47   ILE A N   
346  C CA  . ILE A 47  ? 0.2627 0.1962 0.2252 0.0099  -0.0151 0.0404  47   ILE A CA  
347  C C   . ILE A 47  ? 0.2869 0.2210 0.2648 0.0084  -0.0121 0.0380  47   ILE A C   
348  O O   . ILE A 47  ? 0.2639 0.2022 0.2484 0.0083  -0.0130 0.0330  47   ILE A O   
349  C CB  . ILE A 47  ? 0.2811 0.2201 0.2454 0.0158  -0.0238 0.0383  47   ILE A CB  
350  C CG1 . ILE A 47  ? 0.3215 0.2635 0.2710 0.0186  -0.0294 0.0397  47   ILE A CG1 
351  C CG2 . ILE A 47  ? 0.2887 0.2205 0.2588 0.0212  -0.0279 0.0411  47   ILE A CG2 
352  C CD1 . ILE A 47  ? 0.3443 0.2983 0.2980 0.0271  -0.0400 0.0363  47   ILE A CD1 
353  N N   . HIS A 48  ? 0.2631 0.1918 0.2436 0.0060  -0.0093 0.0420  48   HIS A N   
354  C CA  . HIS A 48  ? 0.2428 0.1743 0.2365 0.0046  -0.0076 0.0398  48   HIS A CA  
355  C C   . HIS A 48  ? 0.2509 0.1741 0.2462 0.0029  -0.0093 0.0431  48   HIS A C   
356  O O   . HIS A 48  ? 0.2968 0.2079 0.2814 0.0017  -0.0103 0.0483  48   HIS A O   
357  C CB  . HIS A 48  ? 0.2538 0.1939 0.2532 0.0021  -0.0014 0.0372  48   HIS A CB  
358  C CG  . HIS A 48  ? 0.2518 0.1959 0.2493 0.0054  -0.0001 0.0316  48   HIS A CG  
359  N ND1 . HIS A 48  ? 0.2664 0.2121 0.2523 0.0043  0.0027  0.0307  48   HIS A ND1 
360  C CD2 . HIS A 48  ? 0.2485 0.1911 0.2508 0.0094  -0.0022 0.0267  48   HIS A CD2 
361  C CE1 . HIS A 48  ? 0.2988 0.2451 0.2845 0.0076  0.0029  0.0235  48   HIS A CE1 
362  N NE2 . HIS A 48  ? 0.2857 0.2276 0.2807 0.0108  -0.0003 0.0216  48   HIS A NE2 
363  N N   . ALA A 49  ? 0.2707 0.1971 0.2762 0.0029  -0.0108 0.0401  49   ALA A N   
364  C CA  . ALA A 49  ? 0.2709 0.1894 0.2780 0.0007  -0.0124 0.0407  49   ALA A CA  
365  C C   . ALA A 49  ? 0.2541 0.1697 0.2607 -0.0079 -0.0080 0.0433  49   ALA A C   
366  O O   . ALA A 49  ? 0.2449 0.1747 0.2589 -0.0115 -0.0036 0.0416  49   ALA A O   
367  C CB  . ALA A 49  ? 0.2529 0.1781 0.2685 0.0013  -0.0146 0.0360  49   ALA A CB  
368  N N   . LEU A 50  ? 0.2802 0.1775 0.2778 -0.0113 -0.0094 0.0466  50   LEU A N   
369  C CA  . LEU A 50  ? 0.3177 0.2094 0.3135 -0.0238 -0.0053 0.0484  50   LEU A CA  
370  C C   . LEU A 50  ? 0.2905 0.1907 0.2995 -0.0268 -0.0068 0.0419  50   LEU A C   
371  O O   . LEU A 50  ? 0.2797 0.1850 0.2946 -0.0190 -0.0111 0.0376  50   LEU A O   
372  C CB  . LEU A 50  ? 0.3428 0.2024 0.3193 -0.0265 -0.0081 0.0546  50   LEU A CB  
373  C CG  . LEU A 50  ? 0.3724 0.2192 0.3300 -0.0234 -0.0091 0.0629  50   LEU A CG  
374  C CD1 . LEU A 50  ? 0.3961 0.2042 0.3317 -0.0230 -0.0153 0.0700  50   LEU A CD1 
375  C CD2 . LEU A 50  ? 0.3744 0.2363 0.3281 -0.0342 0.0000  0.0659  50   LEU A CD2 
376  N N   . LYS A 51  ? 0.3377 0.2428 0.3504 -0.0399 -0.0028 0.0410  51   LYS A N   
377  C CA  A LYS A 51  ? 0.3400 0.2486 0.3609 -0.0456 -0.0053 0.0349  51   LYS A CA  
378  C CA  B LYS A 51  ? 0.3385 0.2470 0.3593 -0.0458 -0.0053 0.0349  51   LYS A CA  
379  C C   . LYS A 51  ? 0.3479 0.2284 0.3579 -0.0415 -0.0108 0.0335  51   LYS A C   
380  O O   . LYS A 51  ? 0.3611 0.2146 0.3556 -0.0387 -0.0122 0.0386  51   LYS A O   
381  C CB  A LYS A 51  ? 0.3655 0.2805 0.3890 -0.0642 0.0001  0.0339  51   LYS A CB  
382  C CB  B LYS A 51  ? 0.3613 0.2754 0.3840 -0.0644 0.0003  0.0343  51   LYS A CB  
383  C CG  A LYS A 51  ? 0.4443 0.3771 0.4822 -0.0706 -0.0027 0.0253  51   LYS A CG  
384  C CG  B LYS A 51  ? 0.4376 0.3695 0.4745 -0.0719 -0.0019 0.0259  51   LYS A CG  
385  C CD  A LYS A 51  ? 0.5109 0.4584 0.5547 -0.0916 0.0035  0.0226  51   LYS A CD  
386  C CD  B LYS A 51  ? 0.4710 0.4379 0.5240 -0.0837 0.0039  0.0220  51   LYS A CD  
387  C CE  A LYS A 51  ? 0.5039 0.4911 0.5709 -0.0936 0.0005  0.0130  51   LYS A CE  
388  C CE  B LYS A 51  ? 0.4236 0.3880 0.4673 -0.0927 0.0133  0.0279  51   LYS A CE  
389  N NZ  A LYS A 51  ? 0.4993 0.4784 0.5655 -0.0948 -0.0070 0.0071  51   LYS A NZ  
390  N NZ  B LYS A 51  ? 0.5027 0.5102 0.5654 -0.0945 0.0197  0.0223  51   LYS A NZ  
391  N N   . ASN A 52  ? 0.3398 0.2265 0.3567 -0.0400 -0.0146 0.0259  52   ASN A N   
392  C CA  . ASN A 52  ? 0.3659 0.2293 0.3742 -0.0353 -0.0190 0.0210  52   ASN A CA  
393  C C   . ASN A 52  ? 0.3695 0.2230 0.3717 -0.0195 -0.0220 0.0223  52   ASN A C   
394  O O   . ASN A 52  ? 0.3905 0.2176 0.3824 -0.0133 -0.0259 0.0206  52   ASN A O   
395  C CB  . ASN A 52  ? 0.4045 0.2376 0.4007 -0.0472 -0.0187 0.0215  52   ASN A CB  
396  C CG  . ASN A 52  ? 0.3917 0.2386 0.3956 -0.0655 -0.0159 0.0174  52   ASN A CG  
397  O OD1 . ASN A 52  ? 0.4539 0.3210 0.4685 -0.0659 -0.0184 0.0093  52   ASN A OD1 
398  N ND2 . ASN A 52  ? 0.4303 0.2677 0.4276 -0.0821 -0.0109 0.0227  52   ASN A ND2 
399  N N   . ASN A 53  ? 0.3472 0.2223 0.3563 -0.0125 -0.0212 0.0238  53   ASN A N   
400  C CA  . ASN A 53  ? 0.3323 0.2070 0.3389 0.0006  -0.0239 0.0232  53   ASN A CA  
401  C C   . ASN A 53  ? 0.3217 0.1976 0.3307 0.0075  -0.0269 0.0124  53   ASN A C   
402  O O   . ASN A 53  ? 0.3219 0.2112 0.3358 0.0024  -0.0257 0.0069  53   ASN A O   
403  C CB  . ASN A 53  ? 0.2841 0.1816 0.2969 0.0024  -0.0219 0.0255  53   ASN A CB  
404  C CG  . ASN A 53  ? 0.2535 0.1576 0.2662 0.0126  -0.0243 0.0226  53   ASN A CG  
405  O OD1 . ASN A 53  ? 0.2708 0.1877 0.2881 0.0153  -0.0247 0.0151  53   ASN A OD1 
406  N ND2 . ASN A 53  ? 0.2637 0.1615 0.2704 0.0174  -0.0258 0.0277  53   ASN A ND2 
407  N N   . PRO A 54  ? 0.3385 0.1999 0.3429 0.0196  -0.0314 0.0084  54   PRO A N   
408  C CA  . PRO A 54  ? 0.3534 0.2163 0.3608 0.0276  -0.0336 -0.0048 54   PRO A CA  
409  C C   . PRO A 54  ? 0.3349 0.2317 0.3523 0.0319  -0.0312 -0.0131 54   PRO A C   
410  O O   . PRO A 54  ? 0.3356 0.2412 0.3562 0.0363  -0.0309 -0.0262 54   PRO A O   
411  C CB  . PRO A 54  ? 0.4098 0.2454 0.4093 0.0422  -0.0406 -0.0060 54   PRO A CB  
412  C CG  . PRO A 54  ? 0.4030 0.2370 0.3977 0.0445  -0.0423 0.0061  54   PRO A CG  
413  C CD  . PRO A 54  ? 0.3453 0.1884 0.3404 0.0276  -0.0355 0.0157  54   PRO A CD  
414  N N   . ASN A 55  ? 0.3168 0.2317 0.3374 0.0289  -0.0289 -0.0065 55   ASN A N   
415  C CA  . ASN A 55  ? 0.2737 0.2183 0.3006 0.0284  -0.0259 -0.0125 55   ASN A CA  
416  C C   . ASN A 55  ? 0.2416 0.1971 0.2660 0.0146  -0.0217 -0.0079 55   ASN A C   
417  O O   . ASN A 55  ? 0.2683 0.2421 0.2928 0.0099  -0.0189 -0.0091 55   ASN A O   
418  C CB  . ASN A 55  ? 0.2813 0.2362 0.3116 0.0352  -0.0278 -0.0103 55   ASN A CB  
419  C CG  . ASN A 55  ? 0.2849 0.2269 0.3153 0.0517  -0.0349 -0.0135 55   ASN A CG  
420  O OD1 . ASN A 55  ? 0.3396 0.2626 0.3623 0.0544  -0.0388 -0.0035 55   ASN A OD1 
421  N ND2 . ASN A 55  ? 0.2758 0.2253 0.3126 0.0633  -0.0372 -0.0275 55   ASN A ND2 
422  N N   . GLY A 56  ? 0.2431 0.1866 0.2640 0.0077  -0.0222 -0.0030 56   GLY A N   
423  C CA  . GLY A 56  ? 0.2756 0.2274 0.2931 -0.0018 -0.0212 0.0006  56   GLY A CA  
424  C C   . GLY A 56  ? 0.2640 0.2143 0.2809 -0.0047 -0.0215 0.0109  56   GLY A C   
425  O O   . GLY A 56  ? 0.2699 0.2237 0.2824 -0.0099 -0.0229 0.0143  56   GLY A O   
426  N N   . PHE A 57  ? 0.2596 0.2040 0.2791 -0.0003 -0.0210 0.0154  57   PHE A N   
427  C CA  . PHE A 57  ? 0.2557 0.1988 0.2748 -0.0017 -0.0207 0.0225  57   PHE A CA  
428  C C   . PHE A 57  ? 0.2629 0.2028 0.2863 -0.0038 -0.0212 0.0256  57   PHE A C   
429  O O   . PHE A 57  ? 0.2859 0.2187 0.3108 -0.0047 -0.0201 0.0256  57   PHE A O   
430  C CB  . PHE A 57  ? 0.2563 0.1979 0.2748 0.0023  -0.0196 0.0246  57   PHE A CB  
431  C CG  . PHE A 57  ? 0.2293 0.1806 0.2455 0.0011  -0.0191 0.0216  57   PHE A CG  
432  C CD1 . PHE A 57  ? 0.2384 0.1889 0.2496 -0.0035 -0.0185 0.0244  57   PHE A CD1 
433  C CD2 . PHE A 57  ? 0.2936 0.2554 0.3126 0.0042  -0.0192 0.0144  57   PHE A CD2 
434  C CE1 . PHE A 57  ? 0.2804 0.2394 0.2876 -0.0092 -0.0172 0.0212  57   PHE A CE1 
435  C CE2 . PHE A 57  ? 0.3151 0.2930 0.3340 0.0001  -0.0176 0.0098  57   PHE A CE2 
436  C CZ  . PHE A 57  ? 0.2804 0.2562 0.2924 -0.0086 -0.0162 0.0138  57   PHE A CZ  
437  N N   . PRO A 58  ? 0.2515 0.1966 0.2761 -0.0049 -0.0233 0.0278  58   PRO A N   
438  C CA  . PRO A 58  ? 0.2747 0.2255 0.3077 -0.0059 -0.0238 0.0285  58   PRO A CA  
439  C C   . PRO A 58  ? 0.2328 0.1834 0.2694 -0.0049 -0.0191 0.0304  58   PRO A C   
440  O O   . PRO A 58  ? 0.2446 0.1905 0.2763 -0.0015 -0.0172 0.0323  58   PRO A O   
441  C CB  . PRO A 58  ? 0.2754 0.2314 0.3082 -0.0025 -0.0293 0.0300  58   PRO A CB  
442  C CG  . PRO A 58  ? 0.2826 0.2303 0.3037 -0.0026 -0.0305 0.0321  58   PRO A CG  
443  C CD  . PRO A 58  ? 0.2420 0.1867 0.2595 -0.0048 -0.0258 0.0301  58   PRO A CD  
444  N N   . GLU A 59  ? 0.2707 0.2284 0.3146 -0.0101 -0.0168 0.0293  59   GLU A N   
445  C CA  . GLU A 59  ? 0.2656 0.2257 0.3104 -0.0127 -0.0106 0.0309  59   GLU A CA  
446  C C   . GLU A 59  ? 0.2367 0.2045 0.2841 -0.0050 -0.0097 0.0302  59   GLU A C   
447  O O   . GLU A 59  ? 0.2562 0.2334 0.3110 0.0009  -0.0138 0.0276  59   GLU A O   
448  C CB  . GLU A 59  ? 0.2980 0.2718 0.3523 -0.0226 -0.0075 0.0282  59   GLU A CB  
449  C CG  . GLU A 59  ? 0.3067 0.2848 0.3591 -0.0297 0.0007  0.0297  59   GLU A CG  
450  C CD  . GLU A 59  ? 0.3981 0.3948 0.4607 -0.0434 0.0054  0.0257  59   GLU A CD  
451  O OE1 . GLU A 59  ? 0.4435 0.4536 0.5179 -0.0461 0.0010  0.0207  59   GLU A OE1 
452  O OE2 . GLU A 59  ? 0.4149 0.4146 0.4726 -0.0531 0.0135  0.0274  59   GLU A OE2 
453  N N   . GLY A 60  ? 0.2457 0.1899 0.2422 -0.0011 -0.0056 0.0328  60   GLY A N   
454  C CA  . GLY A 60  ? 0.2622 0.2062 0.2615 -0.0013 -0.0003 0.0350  60   GLY A CA  
455  C C   . GLY A 60  ? 0.2563 0.2058 0.2565 0.0002  0.0007  0.0329  60   GLY A C   
456  O O   . GLY A 60  ? 0.2785 0.2254 0.2782 -0.0003 0.0053  0.0333  60   GLY A O   
457  N N   . PHE A 61  ? 0.2595 0.2163 0.2606 0.0016  -0.0026 0.0303  61   PHE A N   
458  C CA  . PHE A 61  ? 0.2266 0.1891 0.2284 0.0026  -0.0015 0.0282  61   PHE A CA  
459  C C   . PHE A 61  ? 0.2282 0.1857 0.2231 0.0040  -0.0023 0.0247  61   PHE A C   
460  O O   . PHE A 61  ? 0.2323 0.1846 0.2221 0.0056  -0.0060 0.0229  61   PHE A O   
461  C CB  . PHE A 61  ? 0.2140 0.1850 0.2172 0.0036  -0.0050 0.0256  61   PHE A CB  
462  C CG  . PHE A 61  ? 0.2514 0.2313 0.2614 0.0015  -0.0034 0.0291  61   PHE A CG  
463  C CD1 . PHE A 61  ? 0.2942 0.2749 0.3105 -0.0005 -0.0007 0.0354  61   PHE A CD1 
464  C CD2 . PHE A 61  ? 0.2356 0.2241 0.2465 0.0016  -0.0049 0.0267  61   PHE A CD2 
465  C CE1 . PHE A 61  ? 0.3092 0.2994 0.3328 -0.0023 0.0000  0.0400  61   PHE A CE1 
466  C CE2 . PHE A 61  ? 0.2264 0.2233 0.2428 -0.0007 -0.0041 0.0305  61   PHE A CE2 
467  C CZ  . PHE A 61  ? 0.2602 0.2583 0.2832 -0.0026 -0.0019 0.0377  61   PHE A CZ  
468  N N   . TRP A 62  ? 0.2508 0.2103 0.2457 0.0030  0.0011  0.0242  62   TRP A N   
469  C CA  . TRP A 62  ? 0.2606 0.2189 0.2492 0.0032  -0.0002 0.0211  62   TRP A CA  
470  C C   . TRP A 62  ? 0.2372 0.2023 0.2260 0.0066  -0.0057 0.0175  62   TRP A C   
471  O O   . TRP A 62  ? 0.2666 0.2393 0.2602 0.0074  -0.0062 0.0166  62   TRP A O   
472  C CB  . TRP A 62  ? 0.2382 0.1983 0.2270 0.0003  0.0052  0.0209  62   TRP A CB  
473  C CG  . TRP A 62  ? 0.2606 0.2200 0.2423 -0.0011 0.0040  0.0182  62   TRP A CG  
474  C CD1 . TRP A 62  ? 0.2746 0.2270 0.2488 -0.0026 0.0027  0.0182  62   TRP A CD1 
475  C CD2 . TRP A 62  ? 0.2373 0.2042 0.2184 -0.0021 0.0040  0.0155  62   TRP A CD2 
476  N NE1 . TRP A 62  ? 0.2794 0.2351 0.2483 -0.0047 0.0012  0.0160  62   TRP A NE1 
477  C CE2 . TRP A 62  ? 0.2045 0.1693 0.1777 -0.0044 0.0021  0.0141  62   TRP A CE2 
478  C CE3 . TRP A 62  ? 0.2266 0.2020 0.2125 -0.0018 0.0051  0.0143  62   TRP A CE3 
479  C CZ2 . TRP A 62  ? 0.2290 0.2008 0.1997 -0.0067 0.0013  0.0117  62   TRP A CZ2 
480  C CZ3 . TRP A 62  ? 0.2347 0.2162 0.2181 -0.0037 0.0048  0.0115  62   TRP A CZ3 
481  C CH2 . TRP A 62  ? 0.2479 0.2280 0.2239 -0.0061 0.0027  0.0101  62   TRP A CH2 
482  N N   . MET A 63  ? 0.2326 0.1952 0.2167 0.0084  -0.0097 0.0159  63   MET A N   
483  C CA  . MET A 63  ? 0.2407 0.2097 0.2262 0.0123  -0.0142 0.0128  63   MET A CA  
484  C C   . MET A 63  ? 0.2253 0.2024 0.2109 0.0112  -0.0138 0.0111  63   MET A C   
485  O O   . MET A 63  ? 0.2420 0.2173 0.2228 0.0093  -0.0143 0.0118  63   MET A O   
486  C CB  . MET A 63  ? 0.2588 0.2217 0.2411 0.0156  -0.0188 0.0130  63   MET A CB  
487  C CG  . MET A 63  ? 0.2911 0.2447 0.2722 0.0162  -0.0193 0.0144  63   MET A CG  
488  S SD  . MET A 63  ? 0.3277 0.2849 0.3136 0.0173  -0.0191 0.0119  63   MET A SD  
489  C CE  . MET A 63  ? 0.2550 0.2166 0.2431 0.0230  -0.0225 0.0078  63   MET A CE  
490  N N   . PRO A 64  ? 0.2085 0.1948 0.1987 0.0116  -0.0128 0.0089  64   PRO A N   
491  C CA  . PRO A 64  ? 0.2292 0.2237 0.2196 0.0095  -0.0115 0.0072  64   PRO A CA  
492  C C   . PRO A 64  ? 0.2264 0.2295 0.2191 0.0131  -0.0160 0.0045  64   PRO A C   
493  O O   . PRO A 64  ? 0.2523 0.2551 0.2478 0.0179  -0.0192 0.0035  64   PRO A O   
494  C CB  . PRO A 64  ? 0.2424 0.2418 0.2372 0.0080  -0.0079 0.0070  64   PRO A CB  
495  C CG  . PRO A 64  ? 0.2569 0.2568 0.2548 0.0111  -0.0103 0.0062  64   PRO A CG  
496  C CD  . PRO A 64  ? 0.2271 0.2167 0.2220 0.0126  -0.0123 0.0081  64   PRO A CD  
497  N N   . TYR A 65  ? 0.2165 0.2273 0.2085 0.0107  -0.0159 0.0034  65   TYR A N   
498  C CA  . TYR A 65  ? 0.2121 0.2339 0.2079 0.0136  -0.0197 0.0014  65   TYR A CA  
499  C C   . TYR A 65  ? 0.2445 0.2650 0.2408 0.0180  -0.0252 0.0032  65   TYR A C   
500  O O   . TYR A 65  ? 0.2669 0.2960 0.2692 0.0225  -0.0283 0.0021  65   TYR A O   
501  C CB  . TYR A 65  ? 0.2279 0.2573 0.2304 0.0167  -0.0190 -0.0019 65   TYR A CB  
502  C CG  . TYR A 65  ? 0.2435 0.2763 0.2462 0.0125  -0.0144 -0.0030 65   TYR A CG  
503  C CD1 . TYR A 65  ? 0.2444 0.2710 0.2467 0.0112  -0.0115 -0.0016 65   TYR A CD1 
504  C CD2 . TYR A 65  ? 0.3451 0.3880 0.3489 0.0097  -0.0131 -0.0050 65   TYR A CD2 
505  C CE1 . TYR A 65  ? 0.2512 0.2815 0.2546 0.0076  -0.0076 -0.0015 65   TYR A CE1 
506  C CE2 . TYR A 65  ? 0.2883 0.3336 0.2921 0.0058  -0.0088 -0.0056 65   TYR A CE2 
507  C CZ  . TYR A 65  ? 0.2343 0.2729 0.2381 0.0051  -0.0061 -0.0035 65   TYR A CZ  
508  O OH  . TYR A 65  ? 0.2442 0.2850 0.2486 0.0015  -0.0021 -0.0027 65   TYR A OH  
509  N N   . LEU A 66  ? 0.2442 0.2542 0.2343 0.0165  -0.0261 0.0064  66   LEU A N   
510  C CA  . LEU A 66  ? 0.2431 0.2513 0.2326 0.0199  -0.0316 0.0093  66   LEU A CA  
511  C C   . LEU A 66  ? 0.2653 0.2821 0.2521 0.0161  -0.0344 0.0110  66   LEU A C   
512  O O   . LEU A 66  ? 0.2852 0.3034 0.2665 0.0091  -0.0313 0.0102  66   LEU A O   
513  C CB  . LEU A 66  ? 0.2433 0.2370 0.2260 0.0186  -0.0314 0.0123  66   LEU A CB  
514  C CG  . LEU A 66  ? 0.2517 0.2361 0.2357 0.0210  -0.0291 0.0115  66   LEU A CG  
515  C CD1 . LEU A 66  ? 0.2592 0.2307 0.2365 0.0190  -0.0290 0.0146  66   LEU A CD1 
516  C CD2 . LEU A 66  ? 0.2685 0.2544 0.2591 0.0283  -0.0318 0.0100  66   LEU A CD2 
517  N N   . THR A 67  ? 0.2416 0.2645 0.2326 0.0205  -0.0401 0.0135  67   THR A N   
518  C CA  . THR A 67  ? 0.2919 0.3236 0.2802 0.0167  -0.0444 0.0166  67   THR A CA  
519  C C   . THR A 67  ? 0.2686 0.2898 0.2491 0.0153  -0.0478 0.0216  67   THR A C   
520  O O   . THR A 67  ? 0.3082 0.3238 0.2922 0.0218  -0.0509 0.0243  67   THR A O   
521  C CB  . THR A 67  ? 0.2954 0.3425 0.2953 0.0228  -0.0491 0.0175  67   THR A CB  
522  O OG1 . THR A 67  ? 0.3042 0.3592 0.3111 0.0245  -0.0451 0.0123  67   THR A OG1 
523  C CG2 . THR A 67  ? 0.3804 0.4396 0.3782 0.0180  -0.0544 0.0216  67   THR A CG2 
524  N N   . ILE A 68  ? 0.3839 0.2812 0.2813 -0.0458 -0.0926 0.0515  68   ILE A N   
525  C CA  . ILE A 68  ? 0.3627 0.3030 0.2729 -0.0585 -0.0995 0.0632  68   ILE A CA  
526  C C   . ILE A 68  ? 0.3529 0.3039 0.2896 -0.0348 -0.0868 0.0534  68   ILE A C   
527  O O   . ILE A 68  ? 0.3481 0.3248 0.3037 -0.0166 -0.0761 0.0481  68   ILE A O   
528  C CB  . ILE A 68  ? 0.3341 0.3697 0.2713 -0.0649 -0.1077 0.0828  68   ILE A CB  
529  C CG1 . ILE A 68  ? 0.3629 0.4167 0.2746 -0.0998 -0.1260 0.0993  68   ILE A CG1 
530  C CG2 . ILE A 68  ? 0.3199 0.4030 0.2647 -0.0870 -0.1136 0.0950  68   ILE A CG2 
531  C CD1 . ILE A 68  ? 0.4621 0.6561 0.4071 -0.1047 -0.1363 0.1296  68   ILE A CD1 
532  N N   . ALA A 69  ? 0.3391 0.2563 0.2566 -0.0352 -0.0873 0.0530  69   ALA A N   
533  C CA  . ALA A 69  ? 0.3286 0.2728 0.2697 -0.0202 -0.0810 0.0501  69   ALA A CA  
534  C C   . ALA A 69  ? 0.3302 0.2950 0.2707 -0.0382 -0.0896 0.0601  69   ALA A C   
535  O O   . ALA A 69  ? 0.3823 0.3245 0.2866 -0.0658 -0.1007 0.0698  69   ALA A O   
536  C CB  . ALA A 69  ? 0.3704 0.2890 0.2926 0.0043  -0.0751 0.0506  69   ALA A CB  
537  N N   . TYR A 70  ? 0.3251 0.3264 0.2906 -0.0325 -0.0843 0.0586  70   TYR A N   
538  C CA  . TYR A 70  ? 0.2930 0.3146 0.2566 -0.0486 -0.0893 0.0674  70   TYR A CA  
539  C C   . TYR A 70  ? 0.2960 0.3108 0.2574 -0.0420 -0.0894 0.0661  70   TYR A C   
540  O O   . TYR A 70  ? 0.2727 0.3007 0.2463 -0.0297 -0.0843 0.0610  70   TYR A O   
541  C CB  . TYR A 70  ? 0.2691 0.3481 0.2545 -0.0447 -0.0795 0.0731  70   TYR A CB  
542  C CG  . TYR A 70  ? 0.2556 0.3221 0.2354 -0.0241 -0.0617 0.0640  70   TYR A CG  
543  C CD1 . TYR A 70  ? 0.2740 0.3327 0.2424 -0.0320 -0.0576 0.0628  70   TYR A CD1 
544  C CD2 . TYR A 70  ? 0.2869 0.3278 0.2482 -0.0056 -0.0492 0.0564  70   TYR A CD2 
545  C CE1 . TYR A 70  ? 0.3652 0.3871 0.2950 -0.0299 -0.0418 0.0553  70   TYR A CE1 
546  C CE2 . TYR A 70  ? 0.3479 0.3404 0.2610 -0.0020 -0.0320 0.0476  70   TYR A CE2 
547  C CZ  . TYR A 70  ? 0.3400 0.3213 0.2332 -0.0185 -0.0285 0.0475  70   TYR A CZ  
548  O OH  . TYR A 70  ? 0.4792 0.3902 0.2937 -0.0302 -0.0115 0.0399  70   TYR A OH  
549  N N   . GLU A 71  ? 0.3053 0.3050 0.2424 -0.0575 -0.0976 0.0736  71   GLU A N   
550  C CA  . GLU A 71  ? 0.3014 0.3023 0.2342 -0.0536 -0.0999 0.0758  71   GLU A CA  
551  C C   . GLU A 71  ? 0.3126 0.3311 0.2421 -0.0803 -0.0995 0.0800  71   GLU A C   
552  O O   . GLU A 71  ? 0.3649 0.3749 0.2675 -0.1076 -0.1060 0.0867  71   GLU A O   
553  C CB  . GLU A 71  ? 0.4158 0.3579 0.2966 -0.0344 -0.1077 0.0834  71   GLU A CB  
554  C CG  . GLU A 71  ? 0.4163 0.3721 0.2923 -0.0227 -0.1130 0.0909  71   GLU A CG  
555  C CD  . GLU A 71  ? 0.6249 0.5157 0.4324 0.0202  -0.1156 0.1035  71   GLU A CD  
556  O OE1 . GLU A 71  ? 0.6905 0.5986 0.5022 0.0658  -0.1082 0.1098  71   GLU A OE1 
557  O OE2 . GLU A 71  ? 0.7654 0.5794 0.5006 0.0119  -0.1217 0.1085  71   GLU A OE2 
558  N N   . LEU A 72  ? 0.3334 0.3747 0.2767 -0.0798 -0.0914 0.0779  72   LEU A N   
559  C CA  . LEU A 72  ? 0.3049 0.3650 0.2421 -0.0963 -0.0842 0.0825  72   LEU A CA  
560  C C   . LEU A 72  ? 0.3392 0.3723 0.2526 -0.1071 -0.0921 0.0837  72   LEU A C   
561  O O   . LEU A 72  ? 0.3494 0.3811 0.2622 -0.1032 -0.0923 0.0815  72   LEU A O   
562  C CB  . LEU A 72  ? 0.3030 0.3837 0.2464 -0.0775 -0.0602 0.0804  72   LEU A CB  
563  C CG  . LEU A 72  ? 0.4009 0.5120 0.3337 -0.0742 -0.0408 0.0893  72   LEU A CG  
564  C CD1 . LEU A 72  ? 0.2869 0.4796 0.2441 -0.0912 -0.0465 0.1051  72   LEU A CD1 
565  C CD2 . LEU A 72  ? 0.4156 0.5044 0.3166 -0.0345 -0.0096 0.0883  72   LEU A CD2 
566  N N   . LYS A 73  ? 0.2940 0.2830 0.2545 -0.0346 -0.0703 0.0666  73   LYS A N   
567  C CA  . LYS A 73  ? 0.3232 0.3010 0.2731 -0.0381 -0.0769 0.0720  73   LYS A CA  
568  C C   . LYS A 73  ? 0.3245 0.3292 0.2679 -0.0505 -0.0736 0.0823  73   LYS A C   
569  O O   . LYS A 73  ? 0.3218 0.3451 0.2614 -0.0673 -0.0743 0.0915  73   LYS A O   
570  C CB  . LYS A 73  ? 0.3840 0.3214 0.3161 -0.0410 -0.0930 0.0759  73   LYS A CB  
571  C CG  . LYS A 73  ? 0.5341 0.4532 0.4463 -0.0427 -0.1019 0.0823  73   LYS A CG  
572  C CD  . LYS A 73  ? 0.7247 0.5901 0.6056 -0.0348 -0.1221 0.0825  73   LYS A CD  
573  C CE  . LYS A 73  ? 0.7523 0.6060 0.6173 -0.0201 -0.1292 0.0807  73   LYS A CE  
574  N NZ  . LYS A 73  ? 0.8486 0.6829 0.6867 -0.0383 -0.1356 0.0963  73   LYS A NZ  
575  N N   . ASN A 74  ? 0.2972 0.3110 0.2381 -0.0439 -0.0709 0.0811  74   ASN A N   
576  C CA  . ASN A 74  ? 0.3150 0.3586 0.2473 -0.0534 -0.0691 0.0914  74   ASN A CA  
577  C C   . ASN A 74  ? 0.3190 0.3321 0.2330 -0.0684 -0.0811 0.1034  74   ASN A C   
578  O O   . ASN A 74  ? 0.3668 0.3529 0.2754 -0.0570 -0.0867 0.0986  74   ASN A O   
579  C CB  . ASN A 74  ? 0.3124 0.3737 0.2442 -0.0362 -0.0630 0.0834  74   ASN A CB  
580  C CG  . ASN A 74  ? 0.3046 0.4073 0.2269 -0.0408 -0.0609 0.0930  74   ASN A CG  
581  O OD1 . ASN A 74  ? 0.3239 0.4277 0.2365 -0.0606 -0.0662 0.1078  74   ASN A OD1 
582  N ND2 . ASN A 74  ? 0.3210 0.4541 0.2391 -0.0209 -0.0549 0.0843  74   ASN A ND2 
583  N N   . THR A 75  ? 0.3527 0.3666 0.2515 -0.0947 -0.0874 0.1188  75   THR A N   
584  C CA  . THR A 75  ? 0.3957 0.3586 0.2616 -0.1104 -0.1037 0.1313  75   THR A CA  
585  C C   . THR A 75  ? 0.4142 0.3904 0.2670 -0.1143 -0.1033 0.1406  75   THR A C   
586  O O   . THR A 75  ? 0.5155 0.4436 0.3388 -0.1161 -0.1166 0.1468  75   THR A O   
587  C CB  . THR A 75  ? 0.4747 0.4157 0.3160 -0.1449 -0.1155 0.1466  75   THR A CB  
588  O OG1 . THR A 75  ? 0.5257 0.5373 0.3768 -0.1700 -0.1055 0.1578  75   THR A OG1 
589  C CG2 . THR A 75  ? 0.5136 0.4287 0.3626 -0.1358 -0.1194 0.1355  75   THR A CG2 
590  N N   . ASP A 76  ? 0.3815 0.4217 0.2523 -0.1100 -0.0893 0.1396  76   ASP A N   
591  C CA  . ASP A 76  ? 0.3999 0.4606 0.2610 -0.1083 -0.0876 0.1459  76   ASP A CA  
592  C C   . ASP A 76  ? 0.3880 0.4205 0.2543 -0.0786 -0.0889 0.1304  76   ASP A C   
593  O O   . ASP A 76  ? 0.4073 0.4151 0.2540 -0.0774 -0.0968 0.1357  76   ASP A O   
594  C CB  . ASP A 76  ? 0.3832 0.5246 0.2588 -0.1020 -0.0738 0.1446  76   ASP A CB  
595  C CG  . ASP A 76  ? 0.4469 0.6450 0.3225 -0.1289 -0.0704 0.1576  76   ASP A CG  
596  O OD1 . ASP A 76  ? 0.4632 0.6449 0.3176 -0.1674 -0.0799 0.1772  76   ASP A OD1 
597  O OD2 . ASP A 76  ? 0.4246 0.6850 0.3158 -0.1112 -0.0598 0.1481  76   ASP A OD2 
598  N N   . THR A 77  ? 0.3371 0.3769 0.2260 -0.0571 -0.0816 0.1124  77   THR A N   
599  C CA  . THR A 77  ? 0.3266 0.3540 0.2211 -0.0362 -0.0823 0.0981  77   THR A CA  
600  C C   . THR A 77  ? 0.3297 0.3212 0.2259 -0.0277 -0.0902 0.0895  77   THR A C   
601  O O   . THR A 77  ? 0.3419 0.3310 0.2383 -0.0148 -0.0936 0.0807  77   THR A O   
602  C CB  . THR A 77  ? 0.3025 0.3516 0.2099 -0.0219 -0.0733 0.0838  77   THR A CB  
603  O OG1 . THR A 77  ? 0.2895 0.3297 0.2079 -0.0220 -0.0704 0.0777  77   THR A OG1 
604  C CG2 . THR A 77  ? 0.3034 0.3949 0.2044 -0.0182 -0.0670 0.0874  77   THR A CG2 
605  N N   . GLY A 78  ? 0.3669 0.3402 0.2648 -0.0328 -0.0931 0.0902  78   GLY A N   
606  C CA  . GLY A 78  ? 0.3988 0.3490 0.2975 -0.0195 -0.1007 0.0803  78   GLY A CA  
607  C C   . GLY A 78  ? 0.3684 0.3393 0.2913 -0.0128 -0.0917 0.0670  78   GLY A C   
608  O O   . GLY A 78  ? 0.3599 0.3261 0.2867 -0.0028 -0.0961 0.0590  78   GLY A O   
609  N N   . ALA A 79  ? 0.3350 0.3273 0.2680 -0.0169 -0.0809 0.0647  79   ALA A N   
610  C CA  . ALA A 79  ? 0.3285 0.3277 0.2726 -0.0145 -0.0749 0.0542  79   ALA A CA  
611  C C   . ALA A 79  ? 0.3180 0.3098 0.2696 -0.0154 -0.0738 0.0536  79   ALA A C   
612  O O   . ALA A 79  ? 0.3335 0.3207 0.2830 -0.0205 -0.0739 0.0608  79   ALA A O   
613  C CB  . ALA A 79  ? 0.3588 0.3646 0.2961 -0.0140 -0.0682 0.0517  79   ALA A CB  
614  N N   . ILE A 80  ? 0.2958 0.2925 0.2554 -0.0126 -0.0734 0.0454  80   ILE A N   
615  C CA  . ILE A 80  ? 0.2917 0.2849 0.2582 -0.0106 -0.0725 0.0435  80   ILE A CA  
616  C C   . ILE A 80  ? 0.3149 0.3164 0.2848 -0.0160 -0.0657 0.0375  80   ILE A C   
617  O O   . ILE A 80  ? 0.2967 0.3122 0.2656 -0.0223 -0.0661 0.0332  80   ILE A O   
618  C CB  . ILE A 80  ? 0.3673 0.3631 0.3340 0.0018  -0.0821 0.0392  80   ILE A CB  
619  C CG1 . ILE A 80  ? 0.5137 0.4840 0.4622 0.0082  -0.0944 0.0448  80   ILE A CG1 
620  C CG2 . ILE A 80  ? 0.3965 0.3919 0.3695 0.0065  -0.0815 0.0359  80   ILE A CG2 
621  C CD1 . ILE A 80  ? 0.5252 0.4899 0.4607 0.0312  -0.1085 0.0372  80   ILE A CD1 
622  N N   . LYS A 81  ? 0.3028 0.2952 0.2728 -0.0162 -0.0608 0.0379  81   LYS A N   
623  C CA  . LYS A 81  ? 0.3498 0.3411 0.3157 -0.0225 -0.0565 0.0341  81   LYS A CA  
624  C C   . LYS A 81  ? 0.3054 0.2967 0.2790 -0.0164 -0.0545 0.0338  81   LYS A C   
625  O O   . LYS A 81  ? 0.3123 0.2982 0.2901 -0.0097 -0.0558 0.0364  81   LYS A O   
626  C CB  . LYS A 81  ? 0.3958 0.3619 0.3376 -0.0270 -0.0540 0.0332  81   LYS A CB  
627  C CG  . LYS A 81  ? 0.4487 0.4045 0.3814 -0.0138 -0.0514 0.0340  81   LYS A CG  
628  C CD  . LYS A 81  ? 0.4807 0.4026 0.3762 -0.0087 -0.0527 0.0293  81   LYS A CD  
629  C CE  . LYS A 81  ? 0.4587 0.3668 0.3344 -0.0120 -0.0583 0.0270  81   LYS A CE  
630  N NZ  . LYS A 81  ? 0.4555 0.3120 0.2815 -0.0090 -0.0653 0.0213  81   LYS A NZ  
631  N N   . ARG A 82  ? 0.3237 0.3250 0.2977 -0.0220 -0.0522 0.0314  82   ARG A N   
632  C CA  . ARG A 82  ? 0.3301 0.3367 0.3116 -0.0145 -0.0507 0.0301  82   ARG A CA  
633  C C   . ARG A 82  ? 0.3143 0.3101 0.2806 -0.0253 -0.0452 0.0309  82   ARG A C   
634  O O   . ARG A 82  ? 0.3269 0.3154 0.2759 -0.0428 -0.0452 0.0325  82   ARG A O   
635  C CB  . ARG A 82  ? 0.3414 0.3828 0.3359 -0.0062 -0.0556 0.0260  82   ARG A CB  
636  C CG  . ARG A 82  ? 0.4857 0.5264 0.4829 0.0086  -0.0654 0.0240  82   ARG A CG  
637  C CD  . ARG A 82  ? 0.5058 0.5866 0.5071 0.0244  -0.0721 0.0166  82   ARG A CD  
638  N NE  . ARG A 82  ? 0.5705 0.6311 0.5609 0.0441  -0.0856 0.0141  82   ARG A NE  
639  C CZ  . ARG A 82  ? 0.4054 0.4751 0.3897 0.0498  -0.0917 0.0123  82   ARG A CZ  
640  N NH1 . ARG A 82  ? 0.4170 0.5262 0.4102 0.0364  -0.0852 0.0115  82   ARG A NH1 
641  N NH2 . ARG A 82  ? 0.5355 0.5705 0.4990 0.0682  -0.1066 0.0113  82   ARG A NH2 
642  N N   . GLY A 83  ? 0.2960 0.2866 0.2633 -0.0170 -0.0424 0.0303  83   GLY A N   
643  C CA  . GLY A 83  ? 0.3357 0.3109 0.2824 -0.0264 -0.0384 0.0322  83   GLY A CA  
644  C C   . GLY A 83  ? 0.3258 0.3046 0.2806 -0.0117 -0.0359 0.0302  83   GLY A C   
645  O O   . GLY A 83  ? 0.3066 0.3024 0.2831 0.0026  -0.0388 0.0270  83   GLY A O   
646  N N   . THR A 84  ? 0.3605 0.3159 0.2913 -0.0156 -0.0327 0.0322  84   THR A N   
647  C CA  . THR A 84  ? 0.3511 0.3087 0.2864 -0.0004 -0.0301 0.0299  84   THR A CA  
648  C C   . THR A 84  ? 0.3908 0.3062 0.2948 0.0105  -0.0294 0.0284  84   THR A C   
649  O O   . THR A 84  ? 0.4701 0.3446 0.3350 0.0023  -0.0317 0.0307  84   THR A O   
650  C CB  . THR A 84  ? 0.3960 0.3742 0.3285 -0.0110 -0.0273 0.0332  84   THR A CB  
651  O OG1 . THR A 84  ? 0.5946 0.5385 0.4872 -0.0341 -0.0270 0.0404  84   THR A OG1 
652  C CG2 . THR A 84  ? 0.3857 0.4193 0.3449 -0.0150 -0.0292 0.0322  84   THR A CG2 
653  N N   . LEU A 85  ? 0.3495 0.2742 0.2652 0.0305  -0.0285 0.0236  85   LEU A N   
654  C CA  . LEU A 85  ? 0.3822 0.2822 0.2686 0.0492  -0.0283 0.0195  85   LEU A CA  
655  C C   . LEU A 85  ? 0.4178 0.2962 0.2806 0.0527  -0.0264 0.0204  85   LEU A C   
656  O O   . LEU A 85  ? 0.4852 0.3899 0.3717 0.0515  -0.0238 0.0208  85   LEU A O   
657  C CB  . LEU A 85  ? 0.3551 0.2900 0.2656 0.0646  -0.0283 0.0144  85   LEU A CB  
658  C CG  . LEU A 85  ? 0.3802 0.3376 0.3080 0.0582  -0.0305 0.0160  85   LEU A CG  
659  C CD1 . LEU A 85  ? 0.5039 0.5008 0.4468 0.0660  -0.0312 0.0134  85   LEU A CD1 
660  C CD2 . LEU A 85  ? 0.3606 0.2941 0.2588 0.0609  -0.0319 0.0157  85   LEU A CD2 
661  N N   . MET A 86  ? 0.2916 0.2548 0.1922 0.0736  -0.0243 -0.0085 86   MET A N   
662  C CA  A MET A 86  ? 0.2804 0.2612 0.2017 0.0651  -0.0236 -0.0054 86   MET A CA  
663  C CA  B MET A 86  ? 0.2989 0.2796 0.2205 0.0649  -0.0239 -0.0055 86   MET A CA  
664  C CA  C MET A 86  ? 0.2813 0.2621 0.2030 0.0649  -0.0240 -0.0055 86   MET A CA  
665  C C   . MET A 86  ? 0.2430 0.2180 0.1629 0.0581  -0.0165 -0.0038 86   MET A C   
666  O O   . MET A 86  ? 0.2717 0.2334 0.1818 0.0581  -0.0144 -0.0052 86   MET A O   
667  C CB  A MET A 86  ? 0.2803 0.2707 0.2197 0.0606  -0.0355 -0.0048 86   MET A CB  
668  C CB  B MET A 86  ? 0.3036 0.2908 0.2409 0.0606  -0.0362 -0.0055 86   MET A CB  
669  C CB  C MET A 86  ? 0.2773 0.2640 0.2143 0.0606  -0.0363 -0.0056 86   MET A CB  
670  C CG  A MET A 86  ? 0.2247 0.2000 0.1579 0.0596  -0.0433 -0.0089 86   MET A CG  
671  C CG  B MET A 86  ? 0.3935 0.3857 0.3373 0.0668  -0.0474 -0.0071 86   MET A CG  
672  C CG  C MET A 86  ? 0.3181 0.3080 0.2599 0.0671  -0.0477 -0.0076 86   MET A CG  
673  S SD  A MET A 86  ? 0.2756 0.2600 0.2366 0.0507  -0.0622 -0.0062 86   MET A SD  
674  S SD  B MET A 86  ? 0.5585 0.5787 0.5209 0.0698  -0.0430 -0.0021 86   MET A SD  
675  S SD  C MET A 86  ? 0.3415 0.3226 0.2922 0.0655  -0.0693 -0.0110 86   MET A SD  
676  C CE  A MET A 86  ? 0.2265 0.2245 0.2036 0.0370  -0.0538 0.0022  86   MET A CE  
677  C CE  B MET A 86  ? 0.5046 0.5302 0.4840 0.0738  -0.0617 -0.0034 86   MET A CE  
678  C CE  C MET A 86  ? 0.3755 0.3513 0.3210 0.0775  -0.0818 -0.0157 86   MET A CE  
679  N N   . PRO A 87  ? 0.2546 0.2403 0.1835 0.0534  -0.0126 -0.0006 87   PRO A N   
680  C CA  . PRO A 87  ? 0.2439 0.2214 0.1716 0.0472  -0.0089 0.0001  87   PRO A CA  
681  C C   . PRO A 87  ? 0.2373 0.2151 0.1753 0.0394  -0.0145 0.0002  87   PRO A C   
682  O O   . PRO A 87  ? 0.2462 0.2345 0.1971 0.0357  -0.0220 0.0025  87   PRO A O   
683  C CB  . PRO A 87  ? 0.2512 0.2389 0.1811 0.0473  -0.0054 0.0029  87   PRO A CB  
684  C CG  . PRO A 87  ? 0.2844 0.2938 0.2251 0.0497  -0.0064 0.0062  87   PRO A CG  
685  C CD  . PRO A 87  ? 0.2678 0.2746 0.2072 0.0551  -0.0110 0.0030  87   PRO A CD  
686  N N   . MET A 88  ? 0.2261 0.1923 0.1607 0.0374  -0.0127 -0.0017 88   MET A N   
687  C CA  . MET A 88  ? 0.2297 0.1933 0.1717 0.0330  -0.0198 -0.0039 88   MET A CA  
688  C C   . MET A 88  ? 0.2452 0.2004 0.1863 0.0318  -0.0148 -0.0053 88   MET A C   
689  O O   . MET A 88  ? 0.2549 0.2062 0.1915 0.0334  -0.0071 -0.0032 88   MET A O   
690  C CB  . MET A 88  ? 0.2487 0.2075 0.1846 0.0402  -0.0273 -0.0091 88   MET A CB  
691  C CG  . MET A 88  ? 0.2753 0.2262 0.1948 0.0497  -0.0191 -0.0116 88   MET A CG  
692  S SD  . MET A 88  ? 0.3277 0.2706 0.2308 0.0627  -0.0283 -0.0184 88   MET A SD  
693  C CE  . MET A 88  ? 0.3239 0.2711 0.2266 0.0636  -0.0309 -0.0155 88   MET A CE  
694  N N   . VAL A 89  ? 0.2422 0.1945 0.1902 0.0290  -0.0214 -0.0084 89   VAL A N   
695  C CA  . VAL A 89  ? 0.2706 0.2183 0.2232 0.0281  -0.0183 -0.0099 89   VAL A CA  
696  C C   . VAL A 89  ? 0.2826 0.2284 0.2326 0.0366  -0.0213 -0.0166 89   VAL A C   
697  O O   . VAL A 89  ? 0.2838 0.2258 0.2306 0.0402  -0.0333 -0.0219 89   VAL A O   
698  C CB  . VAL A 89  ? 0.2502 0.1951 0.2127 0.0186  -0.0240 -0.0081 89   VAL A CB  
699  C CG1 . VAL A 89  ? 0.2319 0.1749 0.2009 0.0140  -0.0382 -0.0098 89   VAL A CG1 
700  C CG2 . VAL A 89  ? 0.2704 0.2104 0.2403 0.0177  -0.0209 -0.0090 89   VAL A CG2 
701  N N   . ALA A 90  ? 0.2623 0.2112 0.2128 0.0417  -0.0109 -0.0157 90   ALA A N   
702  C CA  . ALA A 90  ? 0.2697 0.2213 0.2178 0.0529  -0.0103 -0.0217 90   ALA A CA  
703  C C   . ALA A 90  ? 0.2605 0.2161 0.2269 0.0493  -0.0083 -0.0212 90   ALA A C   
704  O O   . ALA A 90  ? 0.2694 0.2213 0.2479 0.0376  -0.0105 -0.0171 90   ALA A O   
705  C CB  . ALA A 90  ? 0.2875 0.2456 0.2196 0.0657  0.0026  -0.0188 90   ALA A CB  
706  N N   . ASP A 91  ? 0.2500 0.2124 0.2175 0.0611  -0.0061 -0.0266 91   ASP A N   
707  C CA  . ASP A 91  ? 0.2652 0.2326 0.2535 0.0589  -0.0069 -0.0277 91   ASP A CA  
708  C C   . ASP A 91  ? 0.2961 0.2727 0.3047 0.0500  0.0046  -0.0159 91   ASP A C   
709  O O   . ASP A 91  ? 0.2625 0.2374 0.2911 0.0429  -0.0009 -0.0159 91   ASP A O   
710  C CB  . ASP A 91  ? 0.3096 0.2849 0.2952 0.0770  -0.0076 -0.0374 91   ASP A CB  
711  C CG  . ASP A 91  ? 0.3831 0.3783 0.3610 0.0922  0.0120  -0.0323 91   ASP A CG  
712  O OD1 . ASP A 91  ? 0.3634 0.3623 0.3328 0.0894  0.0239  -0.0218 91   ASP A OD1 
713  O OD2 . ASP A 91  ? 0.4250 0.4322 0.4037 0.1087  0.0150  -0.0388 91   ASP A OD2 
714  N N   . ASP A 92  ? 0.2943 0.2766 0.2973 0.0498  0.0171  -0.0059 92   ASP A N   
715  C CA  . ASP A 92  ? 0.3177 0.3040 0.3391 0.0401  0.0243  0.0071  92   ASP A CA  
716  C C   . ASP A 92  ? 0.3047 0.2737 0.3196 0.0292  0.0175  0.0104  92   ASP A C   
717  O O   . ASP A 92  ? 0.3167 0.2836 0.3421 0.0227  0.0202  0.0209  92   ASP A O   
718  C CB  . ASP A 92  ? 0.3130 0.3180 0.3352 0.0476  0.0423  0.0191  92   ASP A CB  
719  C CG  . ASP A 92  ? 0.4596 0.4591 0.4524 0.0535  0.0471  0.0209  92   ASP A CG  
720  O OD1 . ASP A 92  ? 0.3337 0.3212 0.3050 0.0577  0.0381  0.0098  92   ASP A OD1 
721  O OD2 . ASP A 92  ? 0.5408 0.5480 0.5340 0.0534  0.0590  0.0351  92   ASP A OD2 
722  N N   . GLY A 93  ? 0.2835 0.2409 0.2824 0.0279  0.0080  0.0024  93   GLY A N   
723  C CA  . GLY A 93  ? 0.2763 0.2208 0.2686 0.0209  0.0016  0.0037  93   GLY A CA  
724  C C   . GLY A 93  ? 0.2807 0.2236 0.2528 0.0246  0.0029  0.0030  93   GLY A C   
725  O O   . GLY A 93  ? 0.2733 0.2222 0.2354 0.0318  0.0070  0.0014  93   GLY A O   
726  N N   . PRO A 94  ? 0.2646 0.1993 0.2301 0.0215  -0.0016 0.0035  94   PRO A N   
727  C CA  . PRO A 94  ? 0.2750 0.2114 0.2252 0.0257  -0.0011 0.0026  94   PRO A CA  
728  C C   . PRO A 94  ? 0.2858 0.2203 0.2283 0.0305  0.0048  0.0072  94   PRO A C   
729  O O   . PRO A 94  ? 0.2760 0.2053 0.2253 0.0283  0.0071  0.0135  94   PRO A O   
730  C CB  . PRO A 94  ? 0.2737 0.2044 0.2191 0.0240  -0.0063 0.0021  94   PRO A CB  
731  C CG  . PRO A 94  ? 0.2823 0.2006 0.2369 0.0198  -0.0107 0.0035  94   PRO A CG  
732  C CD  . PRO A 94  ? 0.2570 0.1808 0.2274 0.0163  -0.0089 0.0037  94   PRO A CD  
733  N N   . HIS A 95  ? 0.2571 0.2555 0.2383 0.0307  -0.0045 0.0256  95   HIS A N   
734  C CA  . HIS A 95  ? 0.2334 0.2430 0.2186 0.0329  -0.0005 0.0294  95   HIS A CA  
735  C C   . HIS A 95  ? 0.2380 0.2524 0.2216 0.0289  -0.0038 0.0298  95   HIS A C   
736  O O   . HIS A 95  ? 0.2630 0.2754 0.2435 0.0221  -0.0078 0.0280  95   HIS A O   
737  C CB  . HIS A 95  ? 0.2434 0.2564 0.2228 0.0384  0.0015  0.0282  95   HIS A CB  
738  C CG  . HIS A 95  ? 0.2665 0.2739 0.2342 0.0406  -0.0040 0.0231  95   HIS A CG  
739  N ND1 . HIS A 95  ? 0.3415 0.3418 0.3022 0.0459  -0.0082 0.0161  95   HIS A ND1 
740  C CD2 . HIS A 95  ? 0.2584 0.2643 0.2193 0.0389  -0.0080 0.0230  95   HIS A CD2 
741  C CE1 . HIS A 95  ? 0.3127 0.3049 0.2614 0.0475  -0.0154 0.0122  95   HIS A CE1 
742  N NE2 . HIS A 95  ? 0.2875 0.2836 0.2366 0.0425  -0.0148 0.0169  95   HIS A NE2 
743  N N   . TYR A 96  ? 0.2361 0.2575 0.2211 0.0320  -0.0029 0.0322  96   TYR A N   
744  C CA  . TYR A 96  ? 0.2163 0.2453 0.2003 0.0306  -0.0067 0.0307  96   TYR A CA  
745  C C   . TYR A 96  ? 0.2179 0.2437 0.1920 0.0341  -0.0079 0.0308  96   TYR A C   
746  O O   . TYR A 96  ? 0.2578 0.2812 0.2284 0.0381  -0.0050 0.0338  96   TYR A O   
747  C CB  . TYR A 96  ? 0.2540 0.2921 0.2455 0.0344  -0.0081 0.0311  96   TYR A CB  
748  C CG  . TYR A 96  ? 0.2145 0.2593 0.2156 0.0330  -0.0075 0.0296  96   TYR A CG  
749  C CD1 . TYR A 96  ? 0.2486 0.3093 0.2542 0.0275  -0.0091 0.0251  96   TYR A CD1 
750  C CD2 . TYR A 96  ? 0.1884 0.2257 0.1937 0.0358  -0.0052 0.0326  96   TYR A CD2 
751  C CE1 . TYR A 96  ? 0.2116 0.2812 0.2250 0.0262  -0.0080 0.0233  96   TYR A CE1 
752  C CE2 . TYR A 96  ? 0.1963 0.2392 0.2098 0.0358  -0.0052 0.0307  96   TYR A CE2 
753  C CZ  . TYR A 96  ? 0.1808 0.2398 0.1980 0.0315  -0.0063 0.0259  96   TYR A CZ  
754  O OH  . TYR A 96  ? 0.1983 0.2662 0.2225 0.0311  -0.0058 0.0234  96   TYR A OH  
755  N N   . GLY A 97  ? 0.2362 0.2622 0.2044 0.0311  -0.0125 0.0277  97   GLY A N   
756  C CA  . GLY A 97  ? 0.2038 0.2251 0.1610 0.0354  -0.0144 0.0268  97   GLY A CA  
757  C C   . GLY A 97  ? 0.2199 0.2441 0.1728 0.0326  -0.0206 0.0241  97   GLY A C   
758  O O   . GLY A 97  ? 0.2644 0.2962 0.2221 0.0252  -0.0236 0.0225  97   GLY A O   
759  N N   . ALA A 98  ? 0.2617 0.2824 0.2050 0.0380  -0.0223 0.0234  98   ALA A N   
760  C CA  . ALA A 98  ? 0.2557 0.2771 0.1930 0.0365  -0.0290 0.0205  98   ALA A CA  
761  C C   . ALA A 98  ? 0.2758 0.2889 0.1995 0.0438  -0.0307 0.0189  98   ALA A C   
762  O O   . ALA A 98  ? 0.2953 0.3100 0.2157 0.0498  -0.0256 0.0214  98   ALA A O   
763  C CB  . ALA A 98  ? 0.2421 0.2763 0.1859 0.0380  -0.0305 0.0203  98   ALA A CB  
764  N N   . ASN A 99  ? 0.2687 0.2735 0.1831 0.0421  -0.0387 0.0149  99   ASN A N   
765  C CA  . ASN A 99  ? 0.3231 0.3224 0.2243 0.0502  -0.0421 0.0120  99   ASN A CA  
766  C C   . ASN A 99  ? 0.3270 0.3337 0.2281 0.0521  -0.0430 0.0134  99   ASN A C   
767  O O   . ASN A 99  ? 0.3612 0.3750 0.2696 0.0463  -0.0467 0.0129  99   ASN A O   
768  C CB  . ASN A 99  ? 0.3404 0.3242 0.2301 0.0479  -0.0537 0.0068  99   ASN A CB  
769  C CG  . ASN A 99  ? 0.3563 0.3277 0.2379 0.0537  -0.0566 0.0022  99   ASN A CG  
770  O OD1 . ASN A 99  ? 0.3413 0.3204 0.2272 0.0601  -0.0484 0.0020  99   ASN A OD1 
771  N ND2 . ASN A 99  ? 0.3771 0.3282 0.2452 0.0517  -0.0701 -0.0023 99   ASN A ND2 
772  N N   . ILE A 100 ? 0.3228 0.3297 0.2146 0.0602  -0.0404 0.0142  100  ILE A N   
773  C CA  . ILE A 100 ? 0.2658 0.2753 0.1539 0.0631  -0.0424 0.0159  100  ILE A CA  
774  C C   . ILE A 100 ? 0.3134 0.3182 0.1854 0.0702  -0.0455 0.0133  100  ILE A C   
775  O O   . ILE A 100 ? 0.3261 0.3321 0.1899 0.0748  -0.0411 0.0126  100  ILE A O   
776  C CB  . ILE A 100 ? 0.2891 0.3014 0.1795 0.0636  -0.0365 0.0224  100  ILE A CB  
777  C CG1 . ILE A 100 ? 0.2891 0.3067 0.1957 0.0586  -0.0348 0.0235  100  ILE A CG1 
778  C CG2 . ILE A 100 ? 0.3385 0.3474 0.2200 0.0678  -0.0417 0.0239  100  ILE A CG2 
779  C CD1 . ILE A 100 ? 0.3388 0.3543 0.2457 0.0595  -0.0322 0.0293  100  ILE A CD1 
780  N N   . ALA A 101 ? 0.3219 0.3243 0.1897 0.0715  -0.0533 0.0106  101  ALA A N   
781  C CA  . ALA A 101 ? 0.3565 0.3539 0.2083 0.0789  -0.0572 0.0081  101  ALA A CA  
782  C C   . ALA A 101 ? 0.3601 0.3586 0.2034 0.0820  -0.0532 0.0138  101  ALA A C   
783  O O   . ALA A 101 ? 0.3539 0.3522 0.2024 0.0803  -0.0550 0.0168  101  ALA A O   
784  C CB  . ALA A 101 ? 0.4043 0.3980 0.2552 0.0781  -0.0682 0.0032  101  ALA A CB  
785  N N   . MET A 102 ? 0.3678 0.3676 0.1957 0.0867  -0.0494 0.0146  102  MET A N   
786  C CA  . MET A 102 ? 0.4032 0.4024 0.2179 0.0861  -0.0459 0.0218  102  MET A CA  
787  C C   . MET A 102 ? 0.3996 0.3953 0.1965 0.0930  -0.0512 0.0183  102  MET A C   
788  O O   . MET A 102 ? 0.4198 0.4065 0.2145 0.0956  -0.0601 0.0167  102  MET A O   
789  C CB  . MET A 102 ? 0.4176 0.4274 0.2298 0.0816  -0.0349 0.0268  102  MET A CB  
790  C CG  . MET A 102 ? 0.3755 0.3868 0.2052 0.0752  -0.0306 0.0301  102  MET A CG  
791  S SD  . MET A 102 ? 0.3971 0.3955 0.2294 0.0705  -0.0354 0.0379  102  MET A SD  
792  C CE  . MET A 102 ? 0.4019 0.3977 0.2118 0.0631  -0.0308 0.0493  102  MET A CE  
793  N N   . GLU A 103 ? 0.4169 0.4221 0.2022 0.0973  -0.0467 0.0154  103  GLU A N   
794  C CA  . GLU A 103 ? 0.4543 0.4580 0.2221 0.1056  -0.0520 0.0104  103  GLU A CA  
795  C C   . GLU A 103 ? 0.4385 0.4307 0.2115 0.1110  -0.0641 0.0022  103  GLU A C   
796  O O   . GLU A 103 ? 0.5184 0.5026 0.2801 0.1160  -0.0720 0.0000  103  GLU A O   
797  C CB  . GLU A 103 ? 0.5018 0.5237 0.2596 0.1114  -0.0456 0.0051  103  GLU A CB  
798  C CG  . GLU A 103 ? 0.6018 0.6411 0.3510 0.1033  -0.0334 0.0134  103  GLU A CG  
799  C CD  . GLU A 103 ? 0.5975 0.6516 0.3619 0.0987  -0.0247 0.0135  103  GLU A CD  
800  O OE1 . GLU A 103 ? 0.4734 0.5165 0.2556 0.0953  -0.0266 0.0148  103  GLU A OE1 
801  O OE2 . GLU A 103 ? 0.6807 0.7602 0.4389 0.0981  -0.0157 0.0120  103  GLU A OE2 
802  N N   . LYS A 104 ? 0.4896 0.6006 0.2319 0.1605  -0.1267 -0.0063 104  LYS A N   
803  C CA  . LYS A 104 ? 0.5153 0.5908 0.3230 0.1526  -0.1138 0.0368  104  LYS A CA  
804  C C   . LYS A 104 ? 0.5271 0.6164 0.3496 0.1410  -0.0904 0.0885  104  LYS A C   
805  O O   . LYS A 104 ? 0.5440 0.6232 0.4108 0.1175  -0.0766 0.1073  104  LYS A O   
806  C CB  . LYS A 104 ? 0.5303 0.5482 0.3301 0.1958  -0.1039 0.0662  104  LYS A CB  
807  C CG  . LYS A 104 ? 0.5360 0.5295 0.3437 0.2113  -0.1293 0.0143  104  LYS A CG  
808  C CD  . LYS A 104 ? 0.6181 0.5585 0.4150 0.2700  -0.1151 0.0660  104  LYS A CD  
809  C CE  . LYS A 104 ? 0.6690 0.5791 0.4799 0.2969  -0.1428 0.0135  104  LYS A CE  
810  N NZ  . LYS A 104 ? 0.7339 0.7110 0.4394 0.3340  -0.1606 -0.0497 104  LYS A NZ  
811  N N   . ASP A 105 ? 0.4920 0.6105 0.2824 0.1548  -0.0827 0.1000  105  ASP A N   
812  C CA  . ASP A 105 ? 0.4985 0.6436 0.3083 0.1456  -0.0698 0.1351  105  ASP A CA  
813  C C   . ASP A 105 ? 0.4863 0.6751 0.3270 0.1121  -0.0750 0.1304  105  ASP A C   
814  O O   . ASP A 105 ? 0.4914 0.7100 0.3315 0.1051  -0.0865 0.1183  105  ASP A O   
815  C CB  . ASP A 105 ? 0.4704 0.6447 0.2697 0.1699  -0.0582 0.1361  105  ASP A CB  
816  C CG  . ASP A 105 ? 0.5245 0.7362 0.3515 0.1683  -0.0520 0.1626  105  ASP A CG  
817  O OD1 . ASP A 105 ? 0.5151 0.7353 0.3503 0.1480  -0.0568 0.1757  105  ASP A OD1 
818  O OD2 . ASP A 105 ? 0.4505 0.7111 0.2960 0.1847  -0.0409 0.1597  105  ASP A OD2 
819  N N   . LYS A 106 ? 0.5090 0.7229 0.3764 0.0882  -0.0612 0.1399  106  LYS A N   
820  C CA  . LYS A 106 ? 0.4692 0.7778 0.3701 0.0608  -0.0552 0.1346  106  LYS A CA  
821  C C   . LYS A 106 ? 0.4393 0.7882 0.3217 0.0781  -0.0476 0.1665  106  LYS A C   
822  O O   . LYS A 106 ? 0.4251 0.8738 0.3292 0.0672  -0.0389 0.1736  106  LYS A O   
823  C CB  . LYS A 106 ? 0.5122 0.8738 0.4669 0.0187  -0.0309 0.1029  106  LYS A CB  
824  C CG  . LYS A 106 ? 0.5344 0.9046 0.5494 -0.0053 -0.0448 0.0540  106  LYS A CG  
825  C CD  . LYS A 106 ? 0.5397 1.0245 0.5867 -0.0265 -0.0733 0.0316  106  LYS A CD  
826  C CE  . LYS A 106 ? 0.5467 1.0169 0.6193 -0.0394 -0.1087 -0.0252 106  LYS A CE  
827  N NZ  . LYS A 106 ? 0.6823 1.0107 0.6669 0.0089  -0.1269 -0.0152 106  LYS A NZ  
828  N N   . LYS A 107 ? 0.4298 0.7306 0.2849 0.1063  -0.0516 0.1819  107  LYS A N   
829  C CA  . LYS A 107 ? 0.4247 0.7703 0.2778 0.1249  -0.0517 0.1980  107  LYS A CA  
830  C C   . LYS A 107 ? 0.4539 0.7829 0.3329 0.1550  -0.0592 0.2127  107  LYS A C   
831  O O   . LYS A 107 ? 0.4837 0.8372 0.3827 0.1784  -0.0608 0.2241  107  LYS A O   
832  C CB  . LYS A 107 ? 0.4662 0.8138 0.3005 0.1263  -0.0551 0.1920  107  LYS A CB  
833  C CG  . LYS A 107 ? 0.5768 0.9027 0.3836 0.0937  -0.0443 0.1869  107  LYS A CG  
834  C CD  . LYS A 107 ? 0.5345 0.8879 0.3203 0.0842  -0.0548 0.1881  107  LYS A CD  
835  C CE  . LYS A 107 ? 0.6385 0.9853 0.4517 0.1022  -0.0656 0.2025  107  LYS A CE  
836  N NZ  . LYS A 107 ? 0.6140 0.8873 0.4230 0.1036  -0.0543 0.2241  107  LYS A NZ  
837  N N   . GLY A 108 ? 0.4994 0.7867 0.3796 0.1525  -0.0622 0.2053  108  GLY A N   
838  C CA  . GLY A 108 ? 0.5193 0.7820 0.4206 0.1688  -0.0597 0.2170  108  GLY A CA  
839  C C   . GLY A 108 ? 0.4688 0.7104 0.3465 0.1472  -0.0674 0.1989  108  GLY A C   
840  O O   . GLY A 108 ? 0.4667 0.7217 0.3224 0.1235  -0.0806 0.1724  108  GLY A O   
841  N N   . GLY A 109 ? 0.5153 0.7278 0.4013 0.1511  -0.0604 0.2082  109  GLY A N   
842  C CA  . GLY A 109 ? 0.4475 0.6545 0.2948 0.1199  -0.0725 0.1827  109  GLY A CA  
843  C C   . GLY A 109 ? 0.4423 0.5935 0.2498 0.1311  -0.0473 0.1215  109  GLY A C   
844  O O   . GLY A 109 ? 0.4217 0.5332 0.2410 0.1390  -0.0152 0.1101  109  GLY A O   
845  N N   . PHE A 110 ? 0.3344 0.3195 0.1912 0.0065  -0.0820 0.0400  110  PHE A N   
846  C CA  . PHE A 110 ? 0.3511 0.3429 0.2157 0.0137  -0.0759 0.0381  110  PHE A CA  
847  C C   . PHE A 110 ? 0.3964 0.3864 0.2359 0.0367  -0.0741 0.0347  110  PHE A C   
848  O O   . PHE A 110 ? 0.4421 0.4199 0.2630 0.0490  -0.0755 0.0290  110  PHE A O   
849  C CB  . PHE A 110 ? 0.3767 0.3452 0.2301 0.0030  -0.0816 0.0341  110  PHE A CB  
850  C CG  . PHE A 110 ? 0.4038 0.3918 0.2860 -0.0159 -0.0815 0.0372  110  PHE A CG  
851  C CD1 . PHE A 110 ? 0.4125 0.4258 0.3278 -0.0149 -0.0738 0.0396  110  PHE A CD1 
852  C CD2 . PHE A 110 ? 0.4264 0.4107 0.2984 -0.0343 -0.0901 0.0375  110  PHE A CD2 
853  C CE1 . PHE A 110 ? 0.3548 0.3879 0.2912 -0.0248 -0.0746 0.0410  110  PHE A CE1 
854  C CE2 . PHE A 110 ? 0.4465 0.4643 0.3452 -0.0470 -0.0896 0.0396  110  PHE A CE2 
855  C CZ  . PHE A 110 ? 0.3236 0.3646 0.2539 -0.0384 -0.0817 0.0407  110  PHE A CZ  
856  N N   . GLY A 111 ? 0.4332 0.4391 0.2702 0.0451  -0.0715 0.0378  111  GLY A N   
857  C CA  . GLY A 111 ? 0.4782 0.4976 0.2920 0.0707  -0.0691 0.0347  111  GLY A CA  
858  C C   . GLY A 111 ? 0.4642 0.5402 0.3067 0.0719  -0.0571 0.0397  111  GLY A C   
859  O O   . GLY A 111 ? 0.4152 0.5054 0.2889 0.0526  -0.0524 0.0448  111  GLY A O   
860  N N   . VAL A 112 ? 0.4675 0.5783 0.2951 0.0937  -0.0531 0.0384  112  VAL A N   
861  C CA  . VAL A 112 ? 0.4287 0.6065 0.2799 0.0897  -0.0422 0.0446  112  VAL A CA  
862  C C   . VAL A 112 ? 0.3904 0.5778 0.2694 0.0562  -0.0377 0.0571  112  VAL A C   
863  O O   . VAL A 112 ? 0.3757 0.5393 0.2493 0.0497  -0.0407 0.0605  112  VAL A O   
864  C CB  . VAL A 112 ? 0.4622 0.6899 0.2911 0.1190  -0.0386 0.0422  112  VAL A CB  
865  C CG1 . VAL A 112 ? 0.4808 0.7827 0.3343 0.0988  -0.0275 0.0544  112  VAL A CG1 
866  C CG2 . VAL A 112 ? 0.4770 0.7163 0.2808 0.1555  -0.0414 0.0302  112  VAL A CG2 
867  N N   . GLY A 113 ? 0.3411 0.5555 0.2427 0.0358  -0.0325 0.0634  113  GLY A N   
868  C CA  . GLY A 113 ? 0.3467 0.5569 0.2589 0.0052  -0.0313 0.0752  113  GLY A CA  
869  C C   . GLY A 113 ? 0.3364 0.5487 0.2638 -0.0174 -0.0304 0.0801  113  GLY A C   
870  O O   . GLY A 113 ? 0.3287 0.5643 0.2652 -0.0118 -0.0281 0.0757  113  GLY A O   
871  N N   . ASN A 114 ? 0.3482 0.5302 0.2717 -0.0408 -0.0339 0.0887  114  ASN A N   
872  C CA  . ASN A 114 ? 0.3407 0.5088 0.2675 -0.0626 -0.0361 0.0935  114  ASN A CA  
873  C C   . ASN A 114 ? 0.3373 0.4600 0.2727 -0.0532 -0.0418 0.0861  114  ASN A C   
874  O O   . ASN A 114 ? 0.3505 0.4392 0.2813 -0.0435 -0.0470 0.0830  114  ASN A O   
875  C CB  . ASN A 114 ? 0.4348 0.5790 0.3371 -0.0905 -0.0404 0.1065  114  ASN A CB  
876  C CG  . ASN A 114 ? 0.4365 0.6327 0.3282 -0.1092 -0.0346 0.1167  114  ASN A CG  
877  O OD1 . ASN A 114 ? 0.3852 0.6378 0.2848 -0.1224 -0.0293 0.1202  114  ASN A OD1 
878  N ND2 . ASN A 114 ? 0.4614 0.6451 0.3344 -0.1110 -0.0358 0.1219  114  ASN A ND2 
879  N N   . TYR A 115 ? 0.3115 0.4408 0.2588 -0.0564 -0.0409 0.0834  115  TYR A N   
880  C CA  . TYR A 115 ? 0.3311 0.4301 0.2882 -0.0472 -0.0448 0.0761  115  TYR A CA  
881  C C   . TYR A 115 ? 0.3227 0.4019 0.2759 -0.0627 -0.0484 0.0801  115  TYR A C   
882  O O   . TYR A 115 ? 0.3350 0.4335 0.2839 -0.0819 -0.0469 0.0866  115  TYR A O   
883  C CB  . TYR A 115 ? 0.2767 0.3932 0.2466 -0.0297 -0.0415 0.0660  115  TYR A CB  
884  C CG  . TYR A 115 ? 0.3040 0.4134 0.2662 -0.0127 -0.0428 0.0601  115  TYR A CG  
885  C CD1 . TYR A 115 ? 0.2726 0.4058 0.2238 -0.0042 -0.0400 0.0608  115  TYR A CD1 
886  C CD2 . TYR A 115 ? 0.3195 0.4002 0.2814 -0.0074 -0.0480 0.0545  115  TYR A CD2 
887  C CE1 . TYR A 115 ? 0.3678 0.4846 0.3035 0.0110  -0.0435 0.0556  115  TYR A CE1 
888  C CE2 . TYR A 115 ? 0.2822 0.3509 0.2297 0.0016  -0.0516 0.0504  115  TYR A CE2 
889  C CZ  . TYR A 115 ? 0.2618 0.3425 0.1943 0.0117  -0.0500 0.0505  115  TYR A CZ  
890  O OH  . TYR A 115 ? 0.3110 0.3710 0.2224 0.0204  -0.0556 0.0463  115  TYR A OH  
891  N N   . GLU A 116 ? 0.3095 0.3530 0.2613 -0.0540 -0.0542 0.0761  116  GLU A N   
892  C CA  . GLU A 116 ? 0.3684 0.3882 0.3153 -0.0592 -0.0587 0.0763  116  GLU A CA  
893  C C   . GLU A 116 ? 0.3217 0.3523 0.2921 -0.0442 -0.0560 0.0665  116  GLU A C   
894  O O   . GLU A 116 ? 0.2941 0.3262 0.2725 -0.0307 -0.0563 0.0607  116  GLU A O   
895  C CB  . GLU A 116 ? 0.4208 0.3908 0.3384 -0.0551 -0.0691 0.0787  116  GLU A CB  
896  C CG  . GLU A 116 ? 0.5660 0.5082 0.4465 -0.0746 -0.0748 0.0897  116  GLU A CG  
897  C CD  . GLU A 116 ? 0.6817 0.5601 0.5184 -0.0641 -0.0884 0.0908  116  GLU A CD  
898  O OE1 . GLU A 116 ? 0.7406 0.6102 0.5816 -0.0368 -0.0922 0.0821  116  GLU A OE1 
899  O OE2 . GLU A 116 ? 0.8114 0.6492 0.6036 -0.0828 -0.0962 0.1004  116  GLU A OE2 
900  N N   . LEU A 117 ? 0.3015 0.3414 0.2803 -0.0498 -0.0539 0.0653  117  LEU A N   
901  C CA  . LEU A 117 ? 0.3012 0.3447 0.2962 -0.0385 -0.0522 0.0571  117  LEU A CA  
902  C C   . LEU A 117 ? 0.3255 0.3446 0.3146 -0.0409 -0.0571 0.0574  117  LEU A C   
903  O O   . LEU A 117 ? 0.3500 0.3589 0.3257 -0.0563 -0.0600 0.0633  117  LEU A O   
904  C CB  . LEU A 117 ? 0.2535 0.3281 0.2593 -0.0365 -0.0461 0.0534  117  LEU A CB  
905  C CG  . LEU A 117 ? 0.2874 0.3608 0.3024 -0.0280 -0.0451 0.0458  117  LEU A CG  
906  C CD1 . LEU A 117 ? 0.2664 0.3254 0.2802 -0.0186 -0.0467 0.0400  117  LEU A CD1 
907  C CD2 . LEU A 117 ? 0.2969 0.4006 0.3132 -0.0222 -0.0409 0.0425  117  LEU A CD2 
908  N N   . THR A 118 ? 0.2846 0.2955 0.2792 -0.0271 -0.0591 0.0515  118  THR A N   
909  C CA  . THR A 118 ? 0.3040 0.2943 0.2916 -0.0224 -0.0638 0.0499  118  THR A CA  
910  C C   . THR A 118 ? 0.2767 0.2848 0.2843 -0.0164 -0.0594 0.0430  118  THR A C   
911  O O   . THR A 118 ? 0.2705 0.2967 0.2889 -0.0123 -0.0565 0.0392  118  THR A O   
912  C CB  . THR A 118 ? 0.3693 0.3372 0.3370 -0.0057 -0.0721 0.0490  118  THR A CB  
913  O OG1 . THR A 118 ? 0.3815 0.3264 0.3243 -0.0102 -0.0771 0.0551  118  THR A OG1 
914  C CG2 . THR A 118 ? 0.4474 0.3863 0.3962 0.0042  -0.0792 0.0470  118  THR A CG2 
915  N N   . PHE A 119 ? 0.2594 0.2592 0.2669 -0.0194 -0.0599 0.0422  119  PHE A N   
916  C CA  . PHE A 119 ? 0.2674 0.2772 0.2880 -0.0131 -0.0571 0.0362  119  PHE A CA  
917  C C   . PHE A 119 ? 0.2905 0.2828 0.2999 -0.0009 -0.0630 0.0346  119  PHE A C   
918  O O   . PHE A 119 ? 0.3295 0.2898 0.3159 -0.0014 -0.0702 0.0380  119  PHE A O   
919  C CB  . PHE A 119 ? 0.2513 0.2661 0.2781 -0.0208 -0.0540 0.0352  119  PHE A CB  
920  C CG  . PHE A 119 ? 0.2482 0.2852 0.2809 -0.0233 -0.0488 0.0341  119  PHE A CG  
921  C CD1 . PHE A 119 ? 0.2834 0.3256 0.3149 -0.0183 -0.0471 0.0318  119  PHE A CD1 
922  C CD2 . PHE A 119 ? 0.2721 0.3260 0.3068 -0.0288 -0.0470 0.0348  119  PHE A CD2 
923  C CE1 . PHE A 119 ? 0.3108 0.3654 0.3369 -0.0139 -0.0445 0.0293  119  PHE A CE1 
924  C CE2 . PHE A 119 ? 0.2364 0.3162 0.2714 -0.0225 -0.0433 0.0320  119  PHE A CE2 
925  C CZ  . PHE A 119 ? 0.2853 0.3607 0.3133 -0.0127 -0.0425 0.0288  119  PHE A CZ  
926  N N   . TYR A 120 ? 0.2723 0.2847 0.2913 0.0094  -0.0614 0.0299  120  TYR A N   
927  C CA  A TYR A 120 ? 0.2950 0.3044 0.3050 0.0267  -0.0658 0.0266  120  TYR A CA  
928  C CA  B TYR A 120 ? 0.2920 0.3000 0.3015 0.0265  -0.0659 0.0267  120  TYR A CA  
929  C C   . TYR A 120 ? 0.3002 0.3196 0.3234 0.0226  -0.0611 0.0232  120  TYR A C   
930  O O   . TYR A 120 ? 0.2952 0.3407 0.3322 0.0149  -0.0558 0.0216  120  TYR A O   
931  C CB  A TYR A 120 ? 0.3010 0.3451 0.3137 0.0410  -0.0668 0.0242  120  TYR A CB  
932  C CB  B TYR A 120 ? 0.2976 0.3362 0.3070 0.0428  -0.0678 0.0243  120  TYR A CB  
933  C CG  A TYR A 120 ? 0.3254 0.3635 0.3257 0.0467  -0.0712 0.0267  120  TYR A CG  
934  C CG  B TYR A 120 ? 0.3206 0.3700 0.3188 0.0683  -0.0724 0.0196  120  TYR A CG  
935  C CD1 A TYR A 120 ? 0.4211 0.4388 0.3924 0.0712  -0.0808 0.0255  120  TYR A CD1 
936  C CD1 B TYR A 120 ? 0.3566 0.3595 0.3226 0.0862  -0.0818 0.0185  120  TYR A CD1 
937  C CD2 A TYR A 120 ? 0.3792 0.4275 0.3904 0.0308  -0.0672 0.0297  120  TYR A CD2 
938  C CD2 B TYR A 120 ? 0.4135 0.5206 0.4270 0.0744  -0.0689 0.0164  120  TYR A CD2 
939  C CE1 A TYR A 120 ? 0.4080 0.4160 0.3633 0.0780  -0.0858 0.0275  120  TYR A CE1 
940  C CE1 B TYR A 120 ? 0.3996 0.4108 0.3484 0.1168  -0.0873 0.0128  120  TYR A CE1 
941  C CE2 A TYR A 120 ? 0.2225 0.2653 0.2219 0.0363  -0.0713 0.0320  120  TYR A CE2 
942  C CE2 B TYR A 120 ? 0.4422 0.5724 0.4455 0.1020  -0.0726 0.0115  120  TYR A CE2 
943  C CZ  A TYR A 120 ? 0.2782 0.3007 0.2505 0.0589  -0.0803 0.0311  120  TYR A CZ  
944  C CZ  B TYR A 120 ? 0.4561 0.5373 0.4269 0.1269  -0.0818 0.0089  120  TYR A CZ  
945  O OH  A TYR A 120 ? 0.4275 0.4385 0.3818 0.0666  -0.0856 0.0331  120  TYR A OH  
946  O OH  B TYR A 120 ? 0.5208 0.6249 0.4755 0.1611  -0.0865 0.0028  120  TYR A OH  
947  N N   . ILE A 121 ? 0.2795 0.2727 0.2925 0.0252  -0.0645 0.0227  121  ILE A N   
948  C CA  . ILE A 121 ? 0.2834 0.2808 0.3072 0.0202  -0.0603 0.0197  121  ILE A CA  
949  C C   . ILE A 121 ? 0.2983 0.2951 0.3141 0.0378  -0.0634 0.0159  121  ILE A C   
950  O O   . ILE A 121 ? 0.3563 0.3232 0.3478 0.0513  -0.0719 0.0159  121  ILE A O   
951  C CB  . ILE A 121 ? 0.3128 0.2888 0.3330 0.0068  -0.0614 0.0221  121  ILE A CB  
952  C CG1 . ILE A 121 ? 0.2908 0.2794 0.3182 -0.0060 -0.0579 0.0254  121  ILE A CG1 
953  C CG2 . ILE A 121 ? 0.2632 0.2420 0.2919 0.0054  -0.0583 0.0181  121  ILE A CG2 
954  C CD1 . ILE A 121 ? 0.2833 0.2725 0.3091 -0.0204 -0.0583 0.0286  121  ILE A CD1 
955  N N   . SER A 122 ? 0.2849 0.3106 0.3141 0.0374  -0.0578 0.0129  122  SER A N   
956  C CA  . SER A 122 ? 0.2760 0.3096 0.2994 0.0541  -0.0593 0.0091  122  SER A CA  
957  C C   . SER A 122 ? 0.2939 0.3171 0.3233 0.0447  -0.0557 0.0074  122  SER A C   
958  O O   . SER A 122 ? 0.2454 0.2687 0.2841 0.0273  -0.0509 0.0080  122  SER A O   
959  C CB  . SER A 122 ? 0.3082 0.3974 0.3397 0.0609  -0.0560 0.0079  122  SER A CB  
960  O OG  . SER A 122 ? 0.3639 0.4673 0.3889 0.0738  -0.0602 0.0086  122  SER A OG  
961  N N   . ASN A 123 ? 0.2705 0.2811 0.2888 0.0597  -0.0593 0.0043  123  ASN A N   
962  C CA  . ASN A 123 ? 0.2825 0.2786 0.3036 0.0532  -0.0574 0.0023  123  ASN A CA  
963  C C   . ASN A 123 ? 0.2779 0.3043 0.3106 0.0436  -0.0495 0.0011  123  ASN A C   
964  O O   . ASN A 123 ? 0.2529 0.3180 0.2904 0.0406  -0.0461 0.0024  123  ASN A O   
965  C CB  . ASN A 123 ? 0.3012 0.2676 0.3010 0.0718  -0.0653 -0.0003 123  ASN A CB  
966  C CG  . ASN A 123 ? 0.3463 0.3413 0.3389 0.0971  -0.0655 -0.0041 123  ASN A CG  
967  O OD1 . ASN A 123 ? 0.3317 0.3679 0.3396 0.0927  -0.0577 -0.0049 123  ASN A OD1 
968  N ND2 . ASN A 123 ? 0.3371 0.3082 0.2994 0.1243  -0.0758 -0.0065 123  ASN A ND2 
969  N N   . PRO A 124 ? 0.2698 0.2787 0.3023 0.0369  -0.0478 -0.0009 124  PRO A N   
970  C CA  . PRO A 124 ? 0.2445 0.2661 0.2760 0.0241  -0.0424 -0.0013 124  PRO A CA  
971  C C   . PRO A 124 ? 0.2309 0.2884 0.2611 0.0283  -0.0397 -0.0012 124  PRO A C   
972  O O   . PRO A 124 ? 0.2397 0.3149 0.2646 0.0100  -0.0361 0.0009  124  PRO A O   
973  C CB  . PRO A 124 ? 0.2577 0.2488 0.2843 0.0243  -0.0433 -0.0048 124  PRO A CB  
974  C CG  . PRO A 124 ? 0.2761 0.2502 0.3065 0.0257  -0.0471 -0.0044 124  PRO A CG  
975  C CD  . PRO A 124 ? 0.2700 0.2467 0.2994 0.0356  -0.0514 -0.0021 124  PRO A CD  
976  N N   . GLU A 125 ? 0.2780 0.2608 0.3529 0.0541  -0.0164 0.0035  125  GLU A N   
977  C CA  . GLU A 125 ? 0.2856 0.3028 0.3612 0.0840  -0.0068 -0.0132 125  GLU A CA  
978  C C   . GLU A 125 ? 0.2886 0.3897 0.3889 0.0957  -0.0023 0.0016  125  GLU A C   
979  O O   . GLU A 125 ? 0.3151 0.5102 0.4203 0.0949  0.0063  -0.0004 125  GLU A O   
980  C CB  . GLU A 125 ? 0.3994 0.3454 0.4386 0.1250  -0.0146 -0.0368 125  GLU A CB  
981  C CG  . GLU A 125 ? 0.4815 0.4922 0.5138 0.1590  0.0012  -0.0679 125  GLU A CG  
982  C CD  . GLU A 125 ? 0.6064 0.5149 0.5746 0.2107  -0.0098 -0.1064 125  GLU A CD  
983  O OE1 . GLU A 125 ? 0.6677 0.4733 0.5859 0.1736  -0.0219 -0.1141 125  GLU A OE1 
984  O OE2 . GLU A 125 ? 0.6583 0.5920 0.6167 0.2916  -0.0100 -0.1292 125  GLU A OE2 
985  N N   . LYS A 126 ? 0.2669 0.3573 0.3782 0.0925  -0.0107 0.0225  126  LYS A N   
986  C CA  . LYS A 126 ? 0.2688 0.4471 0.3991 0.0894  -0.0098 0.0444  126  LYS A CA  
987  C C   . LYS A 126 ? 0.2469 0.4710 0.3579 0.0351  -0.0087 0.0528  126  LYS A C   
988  O O   . LYS A 126 ? 0.2586 0.5856 0.3691 0.0145  -0.0100 0.0721  126  LYS A O   
989  C CB  . LYS A 126 ? 0.2771 0.4296 0.4132 0.0768  -0.0217 0.0680  126  LYS A CB  
990  C CG  . LYS A 126 ? 0.3260 0.5731 0.4822 0.0804  -0.0250 0.0957  126  LYS A CG  
991  C CD  . LYS A 126 ? 0.4320 0.6600 0.5905 0.0590  -0.0393 0.1226  126  LYS A CD  
992  C CE  . LYS A 126 ? 0.4975 0.8402 0.6729 0.0461  -0.0427 0.1559  126  LYS A CE  
993  N NZ  . LYS A 126 ? 0.5396 0.8755 0.7211 0.0338  -0.0614 0.1880  126  LYS A NZ  
994  N N   . GLN A 127 ? 0.2492 0.3965 0.3314 0.0105  -0.0142 0.0422  127  GLN A N   
995  C CA  . GLN A 127 ? 0.2435 0.3658 0.2724 -0.0361 -0.0308 0.0483  127  GLN A CA  
996  C C   . GLN A 127 ? 0.2895 0.4203 0.3005 -0.0535 -0.0356 0.0439  127  GLN A C   
997  O O   . GLN A 127 ? 0.3710 0.4508 0.3195 -0.0992 -0.0625 0.0547  127  GLN A O   
998  C CB  . GLN A 127 ? 0.2734 0.3003 0.2652 -0.0311 -0.0426 0.0355  127  GLN A CB  
999  C CG  . GLN A 127 ? 0.3015 0.3408 0.2928 -0.0340 -0.0409 0.0418  127  GLN A CG  
1000 C CD  . GLN A 127 ? 0.3688 0.3405 0.3104 -0.0164 -0.0505 0.0181  127  GLN A CD  
1001 O OE1 . GLN A 127 ? 0.4646 0.3511 0.3458 -0.0011 -0.0702 -0.0007 127  GLN A OE1 
1002 N NE2 . GLN A 127 ? 0.4614 0.4749 0.4188 -0.0124 -0.0410 0.0180  127  GLN A NE2 
1003 N N   . GLY A 128 ? 0.2760 0.4579 0.3248 -0.0207 -0.0166 0.0286  128  GLY A N   
1004 C CA  . GLY A 128 ? 0.2689 0.4913 0.3019 -0.0418 -0.0174 0.0233  128  GLY A CA  
1005 C C   . GLY A 128 ? 0.2516 0.3857 0.2704 -0.0425 -0.0241 0.0107  128  GLY A C   
1006 O O   . GLY A 128 ? 0.3041 0.4630 0.3024 -0.0719 -0.0305 0.0119  128  GLY A O   
1007 N N   . PHE A 129 ? 0.2463 0.3062 0.2758 -0.0159 -0.0243 0.0039  129  PHE A N   
1008 C CA  . PHE A 129 ? 0.2419 0.2615 0.2687 -0.0106 -0.0288 -0.0028 129  PHE A CA  
1009 C C   . PHE A 129 ? 0.2542 0.2904 0.2903 -0.0048 -0.0135 -0.0195 129  PHE A C   
1010 O O   . PHE A 129 ? 0.2804 0.3091 0.3244 0.0204  -0.0039 -0.0302 129  PHE A O   
1011 C CB  . PHE A 129 ? 0.2563 0.2561 0.2965 0.0138  -0.0292 -0.0029 129  PHE A CB  
1012 C CG  . PHE A 129 ? 0.1881 0.1974 0.2299 0.0202  -0.0355 -0.0023 129  PHE A CG  
1013 C CD1 . PHE A 129 ? 0.1981 0.1895 0.2161 0.0423  -0.0564 -0.0008 129  PHE A CD1 
1014 C CD2 . PHE A 129 ? 0.2026 0.2356 0.2560 0.0051  -0.0285 0.0000  129  PHE A CD2 
1015 C CE1 . PHE A 129 ? 0.2353 0.2746 0.2635 0.0596  -0.0624 0.0035  129  PHE A CE1 
1016 C CE2 . PHE A 129 ? 0.2101 0.2916 0.2656 -0.0019 -0.0358 0.0099  129  PHE A CE2 
1017 C CZ  . PHE A 129 ? 0.2023 0.3105 0.2569 0.0311  -0.0489 0.0120  129  PHE A CZ  
1018 N N   . GLY A 130 ? 0.2176 0.2472 0.3109 0.0226  -0.0054 -0.0404 130  GLY A N   
1019 C CA  . GLY A 130 ? 0.2446 0.2687 0.3288 0.0230  0.0054  -0.0248 130  GLY A CA  
1020 C C   . GLY A 130 ? 0.2372 0.2618 0.3132 0.0283  0.0090  -0.0270 130  GLY A C   
1021 O O   . GLY A 130 ? 0.2259 0.2674 0.3046 0.0316  0.0047  -0.0400 130  GLY A O   
1022 N N   . ARG A 131 ? 0.2292 0.2438 0.2960 0.0289  0.0152  -0.0174 131  ARG A N   
1023 C CA  . ARG A 131 ? 0.2496 0.2558 0.3047 0.0269  0.0147  -0.0159 131  ARG A CA  
1024 C C   . ARG A 131 ? 0.2363 0.2229 0.2816 0.0283  0.0185  -0.0147 131  ARG A C   
1025 O O   . ARG A 131 ? 0.2482 0.2357 0.2951 0.0348  0.0228  -0.0168 131  ARG A O   
1026 C CB  . ARG A 131 ? 0.3220 0.3365 0.3714 0.0196  0.0097  -0.0069 131  ARG A CB  
1027 C CG  . ARG A 131 ? 0.3736 0.3711 0.4255 0.0248  0.0053  0.0014  131  ARG A CG  
1028 C CD  . ARG A 131 ? 0.3583 0.3468 0.4024 0.0113  -0.0109 0.0199  131  ARG A CD  
1029 N NE  . ARG A 131 ? 0.4025 0.3540 0.4532 0.0267  -0.0220 0.0220  131  ARG A NE  
1030 C CZ  . ARG A 131 ? 0.3646 0.2667 0.4085 0.0308  -0.0383 0.0221  131  ARG A CZ  
1031 N NH1 . ARG A 131 ? 0.4241 0.3052 0.4495 0.0120  -0.0461 0.0275  131  ARG A NH1 
1032 N NH2 . ARG A 131 ? 0.4328 0.3074 0.4908 0.0555  -0.0506 0.0140  131  ARG A NH2 
1033 N N   . HIS A 132 ? 0.2621 0.2429 0.2982 0.0234  0.0168  -0.0150 132  HIS A N   
1034 C CA  . HIS A 132 ? 0.2696 0.2388 0.2920 0.0214  0.0196  -0.0171 132  HIS A CA  
1035 C C   . HIS A 132 ? 0.3074 0.2536 0.3211 0.0239  0.0147  -0.0210 132  HIS A C   
1036 O O   . HIS A 132 ? 0.3051 0.2444 0.3162 0.0150  0.0055  -0.0119 132  HIS A O   
1037 C CB  . HIS A 132 ? 0.2432 0.2149 0.2576 0.0129  0.0159  -0.0140 132  HIS A CB  
1038 C CG  . HIS A 132 ? 0.2393 0.2178 0.2642 0.0121  0.0099  -0.0076 132  HIS A CG  
1039 N ND1 . HIS A 132 ? 0.2570 0.2377 0.2768 0.0051  0.0029  0.0000  132  HIS A ND1 
1040 C CD2 . HIS A 132 ? 0.2530 0.2289 0.2931 0.0152  0.0033  -0.0055 132  HIS A CD2 
1041 C CE1 . HIS A 132 ? 0.2419 0.2151 0.2757 0.0054  -0.0115 0.0090  132  HIS A CE1 
1042 N NE2 . HIS A 132 ? 0.2285 0.1951 0.2739 0.0107  -0.0122 0.0043  132  HIS A NE2 
1043 N N   . VAL A 133 ? 0.3097 0.2489 0.3198 0.0348  0.0169  -0.0353 133  VAL A N   
1044 C CA  . VAL A 133 ? 0.3416 0.2423 0.3463 0.0436  0.0033  -0.0464 133  VAL A CA  
1045 C C   . VAL A 133 ? 0.3735 0.2622 0.3618 0.0459  0.0017  -0.0687 133  VAL A C   
1046 O O   . VAL A 133 ? 0.4291 0.2736 0.4127 0.0551  -0.0159 -0.0842 133  VAL A O   
1047 C CB  . VAL A 133 ? 0.3697 0.2709 0.3935 0.0675  -0.0005 -0.0555 133  VAL A CB  
1048 C CG1 . VAL A 133 ? 0.3564 0.2696 0.3924 0.0606  -0.0017 -0.0334 133  VAL A CG1 
1049 C CG2 . VAL A 133 ? 0.3591 0.3123 0.3913 0.0830  0.0161  -0.0761 133  VAL A CG2 
1050 N N   . ASP A 134 ? 0.3499 0.2742 0.3288 0.0357  0.0149  -0.0697 134  ASP A N   
1051 C CA  . ASP A 134 ? 0.4193 0.3451 0.3787 0.0313  0.0142  -0.0892 134  ASP A CA  
1052 C C   . ASP A 134 ? 0.4791 0.3615 0.4219 0.0125  -0.0014 -0.0805 134  ASP A C   
1053 O O   . ASP A 134 ? 0.4107 0.2867 0.3566 -0.0020 -0.0065 -0.0549 134  ASP A O   
1054 C CB  . ASP A 134 ? 0.3874 0.3697 0.3400 0.0169  0.0282  -0.0816 134  ASP A CB  
1055 C CG  . ASP A 134 ? 0.3877 0.3725 0.3466 0.0008  0.0267  -0.0487 134  ASP A CG  
1056 O OD1 . ASP A 134 ? 0.3259 0.3160 0.3024 0.0053  0.0284  -0.0364 134  ASP A OD1 
1057 O OD2 . ASP A 134 ? 0.3758 0.3586 0.3242 -0.0136 0.0214  -0.0391 134  ASP A OD2 
1058 N N   . GLU A 135 ? 0.4998 0.4842 0.4333 0.0956  -0.0370 -0.1445 135  GLU A N   
1059 C CA  . GLU A 135 ? 0.5970 0.4731 0.4898 0.0666  -0.0658 -0.1464 135  GLU A CA  
1060 C C   . GLU A 135 ? 0.5234 0.4371 0.4597 0.0118  -0.0641 -0.1163 135  GLU A C   
1061 O O   . GLU A 135 ? 0.5181 0.4092 0.4605 -0.0234 -0.0797 -0.0928 135  GLU A O   
1062 C CB  . GLU A 135 ? 0.7281 0.5178 0.5237 0.0947  -0.0898 -0.1802 135  GLU A CB  
1063 C CG  . GLU A 135 ? 0.9170 0.5718 0.6412 0.0435  -0.1381 -0.1763 135  GLU A CG  
1064 C CD  . GLU A 135 ? 1.1553 0.7219 0.7713 0.0559  -0.1663 -0.2085 135  GLU A CD  
1065 O OE1 . GLU A 135 ? 1.3055 0.7879 0.8216 0.1333  -0.1759 -0.2508 135  GLU A OE1 
1066 O OE2 . GLU A 135 ? 1.2101 0.7940 0.8309 -0.0037 -0.1802 -0.1914 135  GLU A OE2 
1067 N N   . GLU A 136 ? 0.4494 0.4353 0.4131 0.0085  -0.0460 -0.1099 136  GLU A N   
1068 C CA  . GLU A 136 ? 0.4417 0.4596 0.4267 -0.0229 -0.0468 -0.0849 136  GLU A CA  
1069 C C   . GLU A 136 ? 0.3603 0.4026 0.3809 -0.0218 -0.0357 -0.0590 136  GLU A C   
1070 O O   . GLU A 136 ? 0.3986 0.4697 0.4315 -0.0330 -0.0395 -0.0330 136  GLU A O   
1071 C CB  . GLU A 136 ? 0.4318 0.4979 0.4145 -0.0229 -0.0378 -0.0862 136  GLU A CB  
1072 C CG  . GLU A 136 ? 0.6174 0.6757 0.5516 -0.0029 -0.0422 -0.1173 136  GLU A CG  
1073 C CD  . GLU A 136 ? 0.6750 0.7788 0.6084 0.0387  -0.0251 -0.1311 136  GLU A CD  
1074 O OE1 . GLU A 136 ? 0.7270 0.9084 0.6976 0.0266  -0.0110 -0.1081 136  GLU A OE1 
1075 O OE2 . GLU A 136 ? 0.7748 0.8379 0.6601 0.0835  -0.0311 -0.1599 136  GLU A OE2 
1076 N N   . THR A 137 ? 0.3073 0.3459 0.3346 -0.0056 -0.0251 -0.0627 137  THR A N   
1077 C CA  . THR A 137 ? 0.2918 0.3226 0.3202 0.0050  -0.0201 -0.0455 137  THR A CA  
1078 C C   . THR A 137 ? 0.2810 0.2878 0.3108 0.0137  -0.0196 -0.0495 137  THR A C   
1079 O O   . THR A 137 ? 0.2916 0.2763 0.3019 0.0278  -0.0185 -0.0411 137  THR A O   
1080 C CB  . THR A 137 ? 0.3257 0.3397 0.3272 0.0043  -0.0221 -0.0386 137  THR A CB  
1081 O OG1 . THR A 137 ? 0.3355 0.3548 0.3355 -0.0135 -0.0262 -0.0431 137  THR A OG1 
1082 C CG2 . THR A 137 ? 0.3333 0.3727 0.3312 -0.0043 -0.0235 -0.0319 137  THR A CG2 
1083 N N   . GLY A 138 ? 0.2860 0.2850 0.3229 0.0137  -0.0238 -0.0633 138  GLY A N   
1084 C CA  . GLY A 138 ? 0.3152 0.3021 0.3547 0.0242  -0.0245 -0.0664 138  GLY A CA  
1085 C C   . GLY A 138 ? 0.2998 0.2688 0.3406 0.0241  -0.0275 -0.0521 138  GLY A C   
1086 O O   . GLY A 138 ? 0.3023 0.2842 0.3460 0.0113  -0.0314 -0.0359 138  GLY A O   
1087 N N   . VAL A 139 ? 0.2923 0.2516 0.3317 0.0329  -0.0278 -0.0512 139  VAL A N   
1088 C CA  . VAL A 139 ? 0.2984 0.2544 0.3360 0.0345  -0.0293 -0.0343 139  VAL A CA  
1089 C C   . VAL A 139 ? 0.3119 0.2424 0.3496 0.0393  -0.0398 -0.0390 139  VAL A C   
1090 O O   . VAL A 139 ? 0.3107 0.2402 0.3487 0.0537  -0.0423 -0.0555 139  VAL A O   
1091 C CB  . VAL A 139 ? 0.3151 0.2713 0.3263 0.0531  -0.0213 -0.0287 139  VAL A CB  
1092 C CG1 . VAL A 139 ? 0.3133 0.2787 0.3049 0.0686  -0.0142 -0.0249 139  VAL A CG1 
1093 C CG2 . VAL A 139 ? 0.3532 0.2773 0.3433 0.0481  -0.0302 -0.0404 139  VAL A CG2 
1094 N N   . GLY A 140 ? 0.3386 0.2639 0.3728 0.0336  -0.0457 -0.0197 140  GLY A N   
1095 C CA  . GLY A 140 ? 0.3486 0.2388 0.3740 0.0406  -0.0599 -0.0184 140  GLY A CA  
1096 C C   . GLY A 140 ? 0.3089 0.2213 0.3398 0.0594  -0.0542 -0.0264 140  GLY A C   
1097 O O   . GLY A 140 ? 0.2970 0.2310 0.3236 0.0552  -0.0457 -0.0288 140  GLY A O   
1098 N N   . LYS A 141 ? 0.4732 0.1726 0.3929 0.0601  -0.0826 -0.0014 141  LYS A N   
1099 C CA  . LYS A 141 ? 0.4235 0.2023 0.3644 0.0784  -0.0528 -0.0069 141  LYS A CA  
1100 C C   . LYS A 141 ? 0.3664 0.2139 0.3693 0.0685  -0.0496 -0.0071 141  LYS A C   
1101 O O   . LYS A 141 ? 0.3532 0.2039 0.3778 0.0570  -0.0567 -0.0028 141  LYS A O   
1102 C CB  . LYS A 141 ? 0.5127 0.2750 0.4014 0.1217  -0.0439 -0.0044 141  LYS A CB  
1103 C CG  . LYS A 141 ? 0.6182 0.4825 0.5225 0.1546  -0.0172 -0.0174 141  LYS A CG  
1104 C CD  . LYS A 141 ? 0.7236 0.5740 0.5670 0.2301  -0.0206 -0.0249 141  LYS A CD  
1105 C CE  . LYS A 141 ? 0.7787 0.8003 0.6862 0.2653  -0.0023 -0.0418 141  LYS A CE  
1106 N NZ  . LYS A 141 ? 0.8555 0.8652 0.7083 0.3561  -0.0241 -0.0557 141  LYS A NZ  
1107 N N   . TRP A 142 ? 0.3420 0.2429 0.3586 0.0640  -0.0380 -0.0113 142  TRP A N   
1108 C CA  . TRP A 142 ? 0.3201 0.2569 0.3646 0.0607  -0.0355 -0.0094 142  TRP A CA  
1109 C C   . TRP A 142 ? 0.2996 0.2512 0.3487 0.0761  -0.0268 -0.0027 142  TRP A C   
1110 O O   . TRP A 142 ? 0.3226 0.2773 0.3481 0.1029  -0.0264 -0.0033 142  TRP A O   
1111 C CB  . TRP A 142 ? 0.3021 0.2609 0.3221 0.0383  -0.0359 -0.0091 142  TRP A CB  
1112 C CG  . TRP A 142 ? 0.3937 0.2804 0.3498 0.0153  -0.0573 -0.0171 142  TRP A CG  
1113 C CD1 . TRP A 142 ? 0.4846 0.3399 0.3728 -0.0257 -0.0611 -0.0197 142  TRP A CD1 
1114 C CD2 . TRP A 142 ? 0.4729 0.2968 0.4010 0.0375  -0.0829 -0.0284 142  TRP A CD2 
1115 N NE1 . TRP A 142 ? 0.5643 0.2965 0.3545 -0.0360 -0.0969 -0.0302 142  TRP A NE1 
1116 C CE2 . TRP A 142 ? 0.5396 0.2569 0.3587 0.0171  -0.1142 -0.0386 142  TRP A CE2 
1117 C CE3 . TRP A 142 ? 0.3781 0.2328 0.3530 0.0761  -0.0817 -0.0353 142  TRP A CE3 
1118 C CZ2 . TRP A 142 ? 0.6207 0.2386 0.3620 0.0551  -0.1574 -0.0586 142  TRP A CZ2 
1119 C CZ3 . TRP A 142 ? 0.5319 0.3403 0.4642 0.1164  -0.1121 -0.0566 142  TRP A CZ3 
1120 C CH2 . TRP A 142 ? 0.5164 0.1975 0.3281 0.1163  -0.1557 -0.0697 142  TRP A CH2 
1121 N N   . PHE A 143 ? 0.3315 0.2842 0.3925 0.0668  -0.0222 -0.0010 143  PHE A N   
1122 C CA  . PHE A 143 ? 0.3512 0.2844 0.3846 0.0695  -0.0176 0.0039  143  PHE A CA  
1123 C C   . PHE A 143 ? 0.3456 0.3060 0.3731 0.0881  -0.0250 0.0050  143  PHE A C   
1124 O O   . PHE A 143 ? 0.3086 0.3152 0.3547 0.0754  -0.0270 0.0064  143  PHE A O   
1125 C CB  . PHE A 143 ? 0.3084 0.2472 0.3482 0.0501  -0.0015 0.0031  143  PHE A CB  
1126 C CG  . PHE A 143 ? 0.2973 0.2551 0.3474 0.0613  -0.0010 -0.0009 143  PHE A CG  
1127 C CD1 . PHE A 143 ? 0.3599 0.2901 0.3716 0.0619  -0.0070 0.0071  143  PHE A CD1 
1128 C CD2 . PHE A 143 ? 0.2720 0.2528 0.3435 0.0750  -0.0055 -0.0138 143  PHE A CD2 
1129 C CE1 . PHE A 143 ? 0.3998 0.2982 0.3686 0.0660  -0.0167 0.0073  143  PHE A CE1 
1130 C CE2 . PHE A 143 ? 0.2940 0.2399 0.3189 0.0974  -0.0179 -0.0204 143  PHE A CE2 
1131 C CZ  . PHE A 143 ? 0.3555 0.2472 0.3166 0.0879  -0.0230 -0.0074 143  PHE A CZ  
1132 N N   . GLU A 144 ? 0.3849 0.3072 0.3670 0.1128  -0.0374 0.0035  144  GLU A N   
1133 C CA  . GLU A 144 ? 0.4150 0.3802 0.3982 0.1397  -0.0553 0.0005  144  GLU A CA  
1134 C C   . GLU A 144 ? 0.4280 0.3592 0.3965 0.1089  -0.0547 0.0107  144  GLU A C   
1135 O O   . GLU A 144 ? 0.4517 0.3189 0.3932 0.0842  -0.0362 0.0139  144  GLU A O   
1136 C CB  . GLU A 144 ? 0.4993 0.3978 0.4052 0.1975  -0.0839 -0.0117 144  GLU A CB  
1137 C CG  . GLU A 144 ? 0.6518 0.5773 0.5468 0.2516  -0.0882 -0.0250 144  GLU A CG  
1138 C CD  . GLU A 144 ? 0.7216 0.8342 0.7084 0.2803  -0.0812 -0.0368 144  GLU A CD  
1139 O OE1 . GLU A 144 ? 0.7344 0.9400 0.7541 0.3050  -0.1017 -0.0449 144  GLU A OE1 
1140 O OE2 . GLU A 144 ? 0.8187 0.9912 0.8385 0.2707  -0.0565 -0.0388 144  GLU A OE2 
1141 N N   . PRO A 145 ? 0.4460 0.3405 0.3577 0.0758  -0.0453 -0.0220 145  PRO A N   
1142 C CA  . PRO A 145 ? 0.3929 0.3236 0.3254 0.0468  -0.0461 -0.0272 145  PRO A CA  
1143 C C   . PRO A 145 ? 0.3998 0.2960 0.3085 0.0764  -0.0638 -0.0104 145  PRO A C   
1144 O O   . PRO A 145 ? 0.4652 0.3269 0.3159 0.1351  -0.0687 -0.0003 145  PRO A O   
1145 C CB  . PRO A 145 ? 0.3844 0.4732 0.3449 0.0226  -0.0345 -0.0610 145  PRO A CB  
1146 C CG  . PRO A 145 ? 0.4273 0.5691 0.3927 0.0348  -0.0245 -0.0739 145  PRO A CG  
1147 C CD  . PRO A 145 ? 0.4410 0.4569 0.3708 0.0988  -0.0375 -0.0428 145  PRO A CD  
1148 N N   . PHE A 146 ? 0.3965 0.2706 0.3138 0.0445  -0.0641 -0.0061 146  PHE A N   
1149 C CA  . PHE A 146 ? 0.4293 0.2549 0.3117 0.0522  -0.0737 0.0060  146  PHE A CA  
1150 C C   . PHE A 146 ? 0.3931 0.2523 0.2999 0.0291  -0.0735 0.0029  146  PHE A C   
1151 O O   . PHE A 146 ? 0.3955 0.2733 0.3181 0.0014  -0.0575 -0.0072 146  PHE A O   
1152 C CB  . PHE A 146 ? 0.4258 0.1836 0.2688 0.0208  -0.0689 0.0112  146  PHE A CB  
1153 C CG  . PHE A 146 ? 0.3977 0.2192 0.2833 0.0010  -0.0670 0.0105  146  PHE A CG  
1154 C CD1 . PHE A 146 ? 0.4305 0.2714 0.3292 0.0174  -0.0611 0.0114  146  PHE A CD1 
1155 C CD2 . PHE A 146 ? 0.4162 0.2792 0.3049 -0.0155 -0.0668 0.0108  146  PHE A CD2 
1156 C CE1 . PHE A 146 ? 0.3647 0.2534 0.2563 0.0447  -0.0540 0.0187  146  PHE A CE1 
1157 C CE2 . PHE A 146 ? 0.3720 0.3198 0.2763 0.0091  -0.0620 0.0146  146  PHE A CE2 
1158 C CZ  . PHE A 146 ? 0.3873 0.3435 0.2814 0.0520  -0.0554 0.0214  146  PHE A CZ  
1159 N N   . LYS A 147 ? 0.4484 0.2763 0.3196 0.0388  -0.0812 0.0107  147  LYS A N   
1160 C CA  . LYS A 147 ? 0.4321 0.2804 0.3159 0.0178  -0.0811 0.0090  147  LYS A CA  
1161 C C   . LYS A 147 ? 0.4585 0.2577 0.3180 -0.0092 -0.0757 0.0160  147  LYS A C   
1162 O O   . LYS A 147 ? 0.5071 0.2439 0.3063 -0.0264 -0.0704 0.0166  147  LYS A O   
1163 C CB  . LYS A 147 ? 0.4813 0.3717 0.3376 0.0541  -0.0943 0.0083  147  LYS A CB  
1164 C CG  . LYS A 147 ? 0.4915 0.5387 0.3830 0.0721  -0.1006 -0.0119 147  LYS A CG  
1165 C CD  . LYS A 147 ? 0.6486 0.7936 0.4965 0.1513  -0.1202 -0.0088 147  LYS A CD  
1166 C CE  . LYS A 147 ? 0.7456 1.0813 0.6033 0.2236  -0.1296 -0.0227 147  LYS A CE  
1167 N NZ  . LYS A 147 ? 0.6853 1.2185 0.5074 0.3200  -0.1512 -0.0263 147  LYS A NZ  
1168 N N   . VAL A 148 ? 0.4458 0.2733 0.3280 -0.0224 -0.0679 0.0150  148  VAL A N   
1169 C CA  A VAL A 148 ? 0.4284 0.2690 0.2969 -0.0449 -0.0621 0.0155  148  VAL A CA  
1170 C CA  B VAL A 148 ? 0.4368 0.2809 0.3077 -0.0437 -0.0616 0.0156  148  VAL A CA  
1171 C C   . VAL A 148 ? 0.4437 0.2705 0.3052 -0.0468 -0.0590 0.0164  148  VAL A C   
1172 O O   . VAL A 148 ? 0.4713 0.2922 0.3363 -0.0414 -0.0500 0.0130  148  VAL A O   
1173 C CB  A VAL A 148 ? 0.4136 0.3459 0.3045 -0.0299 -0.0518 0.0152  148  VAL A CB  
1174 C CB  B VAL A 148 ? 0.4290 0.3530 0.3207 -0.0185 -0.0495 0.0176  148  VAL A CB  
1175 C CG1 A VAL A 148 ? 0.3920 0.3686 0.2849 -0.0460 -0.0572 0.0079  148  VAL A CG1 
1176 C CG1 B VAL A 148 ? 0.4860 0.5284 0.3792 -0.0489 -0.0468 0.0059  148  VAL A CG1 
1177 C CG2 A VAL A 148 ? 0.4523 0.3503 0.3262 0.0238  -0.0326 0.0253  148  VAL A CG2 
1178 C CG2 B VAL A 148 ? 0.4244 0.3524 0.3234 0.0042  -0.0507 0.0198  148  VAL A CG2 
1179 N N   . ASP A 149 ? 0.3127 0.4729 0.4184 -0.1007 -0.0735 0.0779  149  ASP A N   
1180 C CA  . ASP A 149 ? 0.3403 0.5328 0.4508 -0.0921 -0.0851 0.0819  149  ASP A CA  
1181 C C   . ASP A 149 ? 0.3302 0.5461 0.4216 -0.1170 -0.0824 0.1004  149  ASP A C   
1182 O O   . ASP A 149 ? 0.3437 0.5527 0.4051 -0.1451 -0.0803 0.1096  149  ASP A O   
1183 C CB  . ASP A 149 ? 0.4228 0.5623 0.4865 -0.0663 -0.1131 0.0865  149  ASP A CB  
1184 C CG  . ASP A 149 ? 0.5449 0.6981 0.6330 -0.0174 -0.1258 0.0537  149  ASP A CG  
1185 O OD1 . ASP A 149 ? 0.6341 0.8832 0.7929 -0.0094 -0.1168 0.0193  149  ASP A OD1 
1186 O OD2 . ASP A 149 ? 0.7616 0.8338 0.7875 0.0107  -0.1430 0.0551  149  ASP A OD2 
1187 N N   . TYR A 150 ? 0.2889 0.5459 0.3954 -0.1104 -0.0811 0.0982  150  TYR A N   
1188 C CA  . TYR A 150 ? 0.2783 0.5837 0.3740 -0.1243 -0.0781 0.1047  150  TYR A CA  
1189 C C   . TYR A 150 ? 0.2698 0.5757 0.3569 -0.1244 -0.0851 0.1108  150  TYR A C   
1190 O O   . TYR A 150 ? 0.2879 0.5852 0.3916 -0.1047 -0.0898 0.1039  150  TYR A O   
1191 C CB  . TYR A 150 ? 0.2492 0.5872 0.3471 -0.0982 -0.0695 0.0914  150  TYR A CB  
1192 C CG  . TYR A 150 ? 0.2478 0.5597 0.3319 -0.0862 -0.0669 0.0820  150  TYR A CG  
1193 C CD1 . TYR A 150 ? 0.2455 0.4872 0.3151 -0.0850 -0.0559 0.0736  150  TYR A CD1 
1194 C CD2 . TYR A 150 ? 0.2597 0.6284 0.3394 -0.0803 -0.0743 0.0730  150  TYR A CD2 
1195 C CE1 . TYR A 150 ? 0.2516 0.4442 0.2879 -0.0796 -0.0521 0.0653  150  TYR A CE1 
1196 C CE2 . TYR A 150 ? 0.3402 0.6732 0.3943 -0.0627 -0.0778 0.0637  150  TYR A CE2 
1197 C CZ  . TYR A 150 ? 0.3046 0.5314 0.3289 -0.0627 -0.0663 0.0641  150  TYR A CZ  
1198 O OH  . TYR A 150 ? 0.4131 0.5786 0.3920 -0.0518 -0.0676 0.0553  150  TYR A OH  
1199 N N   . LYS A 151 ? 0.2961 0.6224 0.3531 -0.1550 -0.0832 0.1169  151  LYS A N   
1200 C CA  . LYS A 151 ? 0.3510 0.6700 0.3871 -0.1595 -0.0876 0.1230  151  LYS A CA  
1201 C C   . LYS A 151 ? 0.3236 0.7353 0.3783 -0.1628 -0.0718 0.1115  151  LYS A C   
1202 O O   . LYS A 151 ? 0.3138 0.8038 0.3777 -0.1787 -0.0618 0.0950  151  LYS A O   
1203 C CB  . LYS A 151 ? 0.4488 0.6795 0.3937 -0.1988 -0.0963 0.1343  151  LYS A CB  
1204 C CG  . LYS A 151 ? 0.5998 0.7181 0.4946 -0.1665 -0.1235 0.1404  151  LYS A CG  
1205 C CD  . LYS A 151 ? 0.7952 0.7642 0.5386 -0.1878 -0.1412 0.1520  151  LYS A CD  
1206 C CE  . LYS A 151 ? 0.9603 0.7928 0.6139 -0.1350 -0.1761 0.1524  151  LYS A CE  
1207 N NZ  . LYS A 151 ? 1.2137 0.8335 0.6490 -0.1615 -0.1917 0.1646  151  LYS A NZ  
1208 N N   . PHE A 152 ? 0.3032 0.7183 0.3617 -0.1406 -0.0714 0.1130  152  PHE A N   
1209 C CA  . PHE A 152 ? 0.2635 0.7548 0.3235 -0.1257 -0.0600 0.0985  152  PHE A CA  
1210 C C   . PHE A 152 ? 0.2744 0.7391 0.3121 -0.1255 -0.0586 0.1076  152  PHE A C   
1211 O O   . PHE A 152 ? 0.2932 0.6915 0.3230 -0.1270 -0.0689 0.1209  152  PHE A O   
1212 C CB  . PHE A 152 ? 0.2482 0.7527 0.3060 -0.0687 -0.0602 0.0829  152  PHE A CB  
1213 C CG  . PHE A 152 ? 0.2855 0.6931 0.3045 -0.0460 -0.0577 0.0891  152  PHE A CG  
1214 C CD1 . PHE A 152 ? 0.3043 0.6547 0.3331 -0.0626 -0.0569 0.0922  152  PHE A CD1 
1215 C CD2 . PHE A 152 ? 0.3299 0.7040 0.2866 -0.0149 -0.0517 0.0839  152  PHE A CD2 
1216 C CE1 . PHE A 152 ? 0.2887 0.5702 0.2720 -0.0671 -0.0441 0.0835  152  PHE A CE1 
1217 C CE2 . PHE A 152 ? 0.3815 0.6478 0.2669 -0.0174 -0.0405 0.0835  152  PHE A CE2 
1218 C CZ  . PHE A 152 ? 0.3381 0.5669 0.2390 -0.0531 -0.0335 0.0800  152  PHE A CZ  
1219 N N   . LYS A 153 ? 0.3288 0.5821 0.4750 -0.1324 -0.0768 0.0804  153  LYS A N   
1220 C CA  . LYS A 153 ? 0.3550 0.5722 0.4389 -0.1105 -0.0486 0.1051  153  LYS A CA  
1221 C C   . LYS A 153 ? 0.3187 0.5791 0.3958 -0.0700 -0.0511 0.0985  153  LYS A C   
1222 O O   . LYS A 153 ? 0.2870 0.6283 0.4145 -0.0585 -0.0459 0.0919  153  LYS A O   
1223 C CB  . LYS A 153 ? 0.4237 0.6449 0.5205 -0.1333 0.0048  0.1286  153  LYS A CB  
1224 C CG  . LYS A 153 ? 0.5858 0.7418 0.6885 -0.1778 0.0266  0.1387  153  LYS A CG  
1225 C CD  . LYS A 153 ? 0.6636 0.9045 0.9039 -0.2308 0.0409  0.1141  153  LYS A CD  
1226 C CE  . LYS A 153 ? 0.7423 0.9023 0.9947 -0.2793 0.0489  0.1092  153  LYS A CE  
1227 N NZ  . LYS A 153 ? 0.8139 1.0520 1.2198 -0.3436 0.0764  0.0769  153  LYS A NZ  
1228 N N   . TYR A 154 ? 0.3102 0.5151 0.3306 -0.0456 -0.0592 0.0948  154  TYR A N   
1229 C CA  . TYR A 154 ? 0.3048 0.5179 0.3090 -0.0114 -0.0470 0.0889  154  TYR A CA  
1230 C C   . TYR A 154 ? 0.3731 0.5768 0.3374 0.0026  -0.0184 0.1009  154  TYR A C   
1231 O O   . TYR A 154 ? 0.3809 0.5304 0.2929 0.0025  -0.0224 0.1017  154  TYR A O   
1232 C CB  . TYR A 154 ? 0.2807 0.4385 0.2685 -0.0027 -0.0597 0.0682  154  TYR A CB  
1233 C CG  . TYR A 154 ? 0.3126 0.4504 0.2848 0.0237  -0.0332 0.0588  154  TYR A CG  
1234 C CD1 . TYR A 154 ? 0.2286 0.3831 0.1957 0.0523  -0.0106 0.0686  154  TYR A CD1 
1235 C CD2 . TYR A 154 ? 0.3467 0.4407 0.3054 0.0252  -0.0324 0.0347  154  TYR A CD2 
1236 C CE1 . TYR A 154 ? 0.2877 0.3961 0.2265 0.0794  0.0257  0.0643  154  TYR A CE1 
1237 C CE2 . TYR A 154 ? 0.3534 0.4139 0.3060 0.0412  -0.0003 0.0196  154  TYR A CE2 
1238 C CZ  . TYR A 154 ? 0.3847 0.4421 0.3226 0.0671  0.0356  0.0395  154  TYR A CZ  
1239 O OH  . TYR A 154 ? 0.3938 0.3917 0.3111 0.0866  0.0796  0.0301  154  TYR A OH  
1240 N N   . THR A 155 ? 0.3830 0.6360 0.3604 0.0253  0.0080  0.1081  155  THR A N   
1241 C CA  . THR A 155 ? 0.4549 0.7000 0.3907 0.0448  0.0430  0.1196  155  THR A CA  
1242 C C   . THR A 155 ? 0.4956 0.7116 0.3926 0.0845  0.0568  0.1077  155  THR A C   
1243 O O   . THR A 155 ? 0.5497 0.7652 0.4126 0.1107  0.0887  0.1146  155  THR A O   
1244 C CB  . THR A 155 ? 0.4471 0.7778 0.4429 0.0394  0.0763  0.1366  155  THR A CB  
1245 O OG1 . THR A 155 ? 0.4837 0.8982 0.5466 0.0587  0.0628  0.1255  155  THR A OG1 
1246 C CG2 . THR A 155 ? 0.4843 0.8187 0.5181 -0.0085 0.0819  0.1468  155  THR A CG2 
1247 N N   . GLY A 156 ? 0.4651 0.6436 0.3638 0.0886  0.0431  0.0897  156  GLY A N   
1248 C CA  . GLY A 156 ? 0.5453 0.6664 0.4082 0.1178  0.0686  0.0752  156  GLY A CA  
1249 C C   . GLY A 156 ? 0.5516 0.6739 0.4154 0.1524  0.0893  0.0859  156  GLY A C   
1250 O O   . GLY A 156 ? 0.4923 0.6819 0.3845 0.1631  0.0737  0.1000  156  GLY A O   
1251 N N   . THR A 157 ? 0.6370 0.6757 0.4635 0.1741  0.1248  0.0753  157  THR A N   
1252 C CA  . THR A 157 ? 0.7372 0.7430 0.5257 0.2256  0.1571  0.0935  157  THR A CA  
1253 C C   . THR A 157 ? 0.7772 0.8685 0.5586 0.2768  0.1525  0.1154  157  THR A C   
1254 O O   . THR A 157 ? 0.7408 0.8669 0.5266 0.2802  0.1604  0.1158  157  THR A O   
1255 C CB  . THR A 157 ? 0.8474 0.7256 0.5847 0.2451  0.2168  0.0831  157  THR A CB  
1256 O OG1 . THR A 157 ? 0.8367 0.6489 0.6131 0.1937  0.2278  0.0508  157  THR A OG1 
1257 C CG2 . THR A 157 ? 0.9381 0.7569 0.6021 0.3151  0.2582  0.1131  157  THR A CG2 
1258 N N   . PRO A 158 ? 0.8563 0.9883 0.6293 0.3222  0.1377  0.1286  158  PRO A N   
1259 C CA  . PRO A 158 ? 0.9424 1.1581 0.7156 0.3886  0.1328  0.1387  158  PRO A CA  
1260 C C   . PRO A 158 ? 1.1098 1.2389 0.8065 0.4430  0.1872  0.1493  158  PRO A C   
1261 O O   . PRO A 158 ? 1.1992 1.1917 0.8125 0.4699  0.2293  0.1570  158  PRO A O   
1262 C CB  . PRO A 158 ? 0.9754 1.2107 0.7191 0.4424  0.1026  0.1415  158  PRO A CB  
1263 C CG  . PRO A 158 ? 0.8806 1.1032 0.6547 0.3779  0.0765  0.1304  158  PRO A CG  
1264 C CD  . PRO A 158 ? 0.8338 0.9551 0.6025 0.3182  0.1144  0.1276  158  PRO A CD  
1278 N N   . GLU B 3   ? 0.5449 0.6921 0.9545 0.0679  -0.2525 -0.1680 3    GLU B N   
1279 C CA  . GLU B 3   ? 0.4634 0.6254 0.7478 0.0591  -0.1935 -0.1371 3    GLU B CA  
1280 C C   . GLU B 3   ? 0.3833 0.5836 0.6259 0.0793  -0.1798 -0.1455 3    GLU B C   
1281 O O   . GLU B 3   ? 0.3896 0.5857 0.6971 0.0803  -0.1905 -0.1515 3    GLU B O   
1282 C CB  . GLU B 3   ? 0.4524 0.5674 0.7149 0.0128  -0.1411 -0.0743 3    GLU B CB  
1283 C CG  . GLU B 3   ? 0.6040 0.6706 0.8759 -0.0070 -0.1565 -0.0538 3    GLU B CG  
1284 C CD  . GLU B 3   ? 0.7678 0.7876 1.0473 -0.0489 -0.1162 0.0085  3    GLU B CD  
1285 O OE1 . GLU B 3   ? 0.7918 0.8181 1.0091 -0.0603 -0.0605 0.0342  3    GLU B OE1 
1286 O OE2 . GLU B 3   ? 0.9059 0.8857 1.2561 -0.0689 -0.1411 0.0326  3    GLU B OE2 
1287 N N   . VAL B 4   ? 0.2863 0.5223 0.4304 0.0937  -0.1586 -0.1420 4    VAL B N   
1288 C CA  . VAL B 4   ? 0.2956 0.5619 0.3863 0.1111  -0.1493 -0.1366 4    VAL B CA  
1289 C C   . VAL B 4   ? 0.2509 0.4944 0.3040 0.0770  -0.0986 -0.0828 4    VAL B C   
1290 O O   . VAL B 4   ? 0.2175 0.4542 0.2319 0.0602  -0.0718 -0.0592 4    VAL B O   
1291 C CB  . VAL B 4   ? 0.3392 0.6693 0.3489 0.1500  -0.1571 -0.1586 4    VAL B CB  
1292 C CG1 . VAL B 4   ? 0.3050 0.6588 0.2441 0.1634  -0.1470 -0.1335 4    VAL B CG1 
1293 C CG2 . VAL B 4   ? 0.3268 0.6865 0.3724 0.1956  -0.2151 -0.2291 4    VAL B CG2 
1294 N N   . PRO B 5   ? 0.2550 0.4867 0.3312 0.0716  -0.0944 -0.0720 5    PRO B N   
1295 C CA  . PRO B 5   ? 0.2438 0.4574 0.2953 0.0474  -0.0572 -0.0337 5    PRO B CA  
1296 C C   . PRO B 5   ? 0.2660 0.5031 0.2450 0.0545  -0.0507 -0.0066 5    PRO B C   
1297 O O   . PRO B 5   ? 0.3197 0.5912 0.2595 0.0805  -0.0710 -0.0105 5    PRO B O   
1298 C CB  . PRO B 5   ? 0.2356 0.4393 0.3516 0.0472  -0.0652 -0.0425 5    PRO B CB  
1299 C CG  . PRO B 5   ? 0.2931 0.5062 0.4685 0.0700  -0.1077 -0.0810 5    PRO B CG  
1300 C CD  . PRO B 5   ? 0.2737 0.5064 0.4162 0.0911  -0.1321 -0.1029 5    PRO B CD  
1301 N N   . ILE B 6   ? 0.2419 0.4610 0.2062 0.0328  -0.0242 0.0226  6    ILE B N   
1302 C CA  . ILE B 6   ? 0.2477 0.4821 0.1785 0.0300  -0.0173 0.0595  6    ILE B CA  
1303 C C   . ILE B 6   ? 0.2610 0.4652 0.2230 0.0190  -0.0213 0.0772  6    ILE B C   
1304 O O   . ILE B 6   ? 0.2526 0.4270 0.2364 0.0058  -0.0095 0.0735  6    ILE B O   
1305 C CB  . ILE B 6   ? 0.2413 0.4770 0.1614 0.0182  0.0004  0.0708  6    ILE B CB  
1306 C CG1 . ILE B 6   ? 0.2763 0.5525 0.1776 0.0340  -0.0013 0.0472  6    ILE B CG1 
1307 C CG2 . ILE B 6   ? 0.2659 0.5111 0.1902 0.0073  0.0075  0.1159  6    ILE B CG2 
1308 C CD1 . ILE B 6   ? 0.2267 0.5080 0.1349 0.0251  0.0104  0.0510  6    ILE B CD1 
1309 N N   . GLY B 7   ? 0.2816 0.4935 0.2419 0.0299  -0.0447 0.0920  7    GLY B N   
1310 C CA  . GLY B 7   ? 0.2996 0.4834 0.3024 0.0232  -0.0622 0.1064  7    GLY B CA  
1311 C C   . GLY B 7   ? 0.3247 0.4864 0.3880 0.0209  -0.0570 0.0640  7    GLY B C   
1312 O O   . GLY B 7   ? 0.3039 0.4732 0.3840 0.0252  -0.0479 0.0325  7    GLY B O   
1313 N N   . ASP B 8   ? 0.3151 0.4553 0.4219 0.0155  -0.0630 0.0621  8    ASP B N   
1314 C CA  . ASP B 8   ? 0.2947 0.4307 0.4598 0.0181  -0.0509 0.0186  8    ASP B CA  
1315 C C   . ASP B 8   ? 0.2437 0.3696 0.3910 0.0127  -0.0222 0.0077  8    ASP B C   
1316 O O   . ASP B 8   ? 0.2792 0.3885 0.4094 0.0104  -0.0350 0.0268  8    ASP B O   
1317 C CB  . ASP B 8   ? 0.3276 0.4534 0.5650 0.0283  -0.0905 0.0056  8    ASP B CB  
1318 C CG  . ASP B 8   ? 0.4502 0.5796 0.7041 0.0403  -0.1246 0.0036  8    ASP B CG  
1319 O OD1 . ASP B 8   ? 0.5033 0.6498 0.7772 0.0443  -0.1100 -0.0245 8    ASP B OD1 
1320 O OD2 . ASP B 8   ? 0.6449 0.7561 0.8951 0.0469  -0.1720 0.0324  8    ASP B OD2 
1321 N N   . PRO B 9   ? 0.2140 0.3504 0.3680 0.0123  0.0154  -0.0215 9    PRO B N   
1322 C CA  . PRO B 9   ? 0.2328 0.3584 0.3423 0.0140  0.0417  -0.0325 9    PRO B CA  
1323 C C   . PRO B 9   ? 0.2352 0.3541 0.3776 0.0323  0.0214  -0.0631 9    PRO B C   
1324 O O   . PRO B 9   ? 0.2474 0.3767 0.4656 0.0412  -0.0020 -0.0836 9    PRO B O   
1325 C CB  . PRO B 9   ? 0.2729 0.4204 0.3847 0.0077  0.0918  -0.0452 9    PRO B CB  
1326 C CG  . PRO B 9   ? 0.2664 0.4409 0.4729 0.0096  0.0850  -0.0639 9    PRO B CG  
1327 C CD  . PRO B 9   ? 0.1982 0.3588 0.4079 0.0111  0.0349  -0.0435 9    PRO B CD  
1328 N N   . LYS B 10  ? 0.3190 0.3130 0.2299 -0.0847 -0.0354 0.0707  10   LYS B N   
1329 C CA  . LYS B 10  ? 0.3390 0.3142 0.2556 -0.0825 -0.0518 0.0725  10   LYS B CA  
1330 C C   . LYS B 10  ? 0.3236 0.3205 0.2817 -0.0485 -0.0357 0.0612  10   LYS B C   
1331 O O   . LYS B 10  ? 0.3184 0.3284 0.2656 -0.0341 -0.0160 0.0541  10   LYS B O   
1332 C CB  . LYS B 10  ? 0.4135 0.4062 0.2937 -0.1174 -0.0418 0.0651  10   LYS B CB  
1333 C CG  . LYS B 10  ? 0.5277 0.4988 0.3343 -0.1833 -0.0377 0.0625  10   LYS B CG  
1334 C CD  . LYS B 10  ? 0.6809 0.5348 0.4166 -0.2036 -0.0844 0.0908  10   LYS B CD  
1335 C CE  . LYS B 10  ? 0.8199 0.6040 0.4259 -0.2940 -0.0825 0.0918  10   LYS B CE  
1336 N NZ  . LYS B 10  ? 0.7986 0.6249 0.4048 -0.3159 -0.0531 0.0806  10   LYS B NZ  
1337 N N   . GLU B 11  ? 0.2986 0.2834 0.2893 -0.0386 -0.0511 0.0524  11   GLU B N   
1338 C CA  . GLU B 11  ? 0.2556 0.2559 0.2699 -0.0269 -0.0286 0.0344  11   GLU B CA  
1339 C C   . GLU B 11  ? 0.3011 0.2976 0.3153 -0.0238 -0.0400 0.0376  11   GLU B C   
1340 O O   . GLU B 11  ? 0.2836 0.2574 0.3116 -0.0219 -0.0758 0.0344  11   GLU B O   
1341 C CB  . GLU B 11  ? 0.2237 0.2453 0.2989 -0.0254 -0.0270 -0.0043 11   GLU B CB  
1342 C CG  . GLU B 11  ? 0.2241 0.2535 0.2920 -0.0395 -0.0031 -0.0143 11   GLU B CG  
1343 C CD  . GLU B 11  ? 0.3864 0.4685 0.5294 -0.0510 0.0102  -0.0775 11   GLU B CD  
1344 O OE1 . GLU B 11  ? 0.5506 0.6735 0.7644 -0.0423 0.0006  -0.1235 11   GLU B OE1 
1345 O OE2 . GLU B 11  ? 0.5464 0.6403 0.6857 -0.0704 0.0307  -0.0925 11   GLU B OE2 
1346 N N   . LEU B 12  ? 0.2880 0.2906 0.2753 -0.0196 -0.0214 0.0405  12   LEU B N   
1347 C CA  . LEU B 12  ? 0.3113 0.3172 0.2987 -0.0187 -0.0278 0.0409  12   LEU B CA  
1348 C C   . LEU B 12  ? 0.2662 0.2629 0.2256 -0.0047 -0.0140 0.0335  12   LEU B C   
1349 O O   . LEU B 12  ? 0.2858 0.2628 0.2048 0.0088  -0.0149 0.0291  12   LEU B O   
1350 C CB  . LEU B 12  ? 0.3739 0.3931 0.3376 -0.0410 -0.0384 0.0474  12   LEU B CB  
1351 C CG  . LEU B 12  ? 0.4483 0.4996 0.3941 -0.0607 -0.0296 0.0397  12   LEU B CG  
1352 C CD1 . LEU B 12  ? 0.5278 0.6040 0.4851 -0.0260 -0.0213 0.0228  12   LEU B CD1 
1353 C CD2 . LEU B 12  ? 0.4822 0.5672 0.4015 -0.1075 -0.0212 0.0207  12   LEU B CD2 
1354 N N   . ASN B 13  ? 0.2410 0.2335 0.2081 -0.0048 -0.0135 0.0298  13   ASN B N   
1355 C CA  . ASN B 13  ? 0.3060 0.2690 0.2299 0.0061  -0.0115 0.0238  13   ASN B CA  
1356 C C   . ASN B 13  ? 0.3717 0.2581 0.2174 -0.0006 -0.0001 0.0188  13   ASN B C   
1357 O O   . ASN B 13  ? 0.4536 0.2714 0.2186 0.0172  -0.0229 0.0162  13   ASN B O   
1358 C CB  . ASN B 13  ? 0.2653 0.2613 0.1868 0.0269  -0.0330 0.0130  13   ASN B CB  
1359 C CG  . ASN B 13  ? 0.2325 0.2881 0.1936 0.0051  -0.0320 0.0109  13   ASN B CG  
1360 O OD1 . ASN B 13  ? 0.1887 0.2288 0.1568 -0.0107 -0.0306 0.0237  13   ASN B OD1 
1361 N ND2 . ASN B 13  ? 0.2355 0.3543 0.2124 -0.0035 -0.0332 -0.0150 13   ASN B ND2 
1362 N N   . GLY B 14  ? 0.2891 0.2564 0.3188 -0.0288 0.1171  0.0173  14   GLY B N   
1363 C CA  . GLY B 14  ? 0.3198 0.2714 0.3574 -0.0250 0.1252  0.0126  14   GLY B CA  
1364 C C   . GLY B 14  ? 0.2863 0.2520 0.3260 -0.0185 0.1147  0.0076  14   GLY B C   
1365 O O   . GLY B 14  ? 0.2943 0.2340 0.3221 -0.0173 0.1244  0.0027  14   GLY B O   
1366 N N   . MET B 15  ? 0.2261 0.2238 0.2740 -0.0159 0.0981  0.0081  15   MET B N   
1367 C CA  . MET B 15  ? 0.2229 0.2365 0.2697 -0.0097 0.0869  0.0034  15   MET B CA  
1368 C C   . MET B 15  ? 0.2314 0.2686 0.3055 -0.0096 0.0761  0.0031  15   MET B C   
1369 O O   . MET B 15  ? 0.2094 0.2524 0.2873 -0.0110 0.0711  0.0078  15   MET B O   
1370 C CB  . MET B 15  ? 0.1946 0.2292 0.2170 -0.0057 0.0755  -0.0001 15   MET B CB  
1371 C CG  . MET B 15  ? 0.2272 0.2466 0.2183 0.0000  0.0794  -0.0040 15   MET B CG  
1372 S SD  . MET B 15  ? 0.2317 0.2962 0.2064 0.0087  0.0625  -0.0193 15   MET B SD  
1373 C CE  . MET B 15  ? 0.3054 0.3952 0.2884 -0.0161 0.0697  -0.0218 15   MET B CE  
1374 N N   . GLU B 16  ? 0.1830 0.2248 0.2677 -0.0072 0.0739  -0.0030 16   GLU B N   
1375 C CA  A GLU B 16  ? 0.1860 0.2531 0.2901 -0.0056 0.0601  -0.0055 16   GLU B CA  
1376 C CA  B GLU B 16  ? 0.1794 0.2466 0.2841 -0.0056 0.0601  -0.0058 16   GLU B CA  
1377 C C   . GLU B 16  ? 0.1950 0.2754 0.2766 -0.0031 0.0493  -0.0051 16   GLU B C   
1378 O O   . GLU B 16  ? 0.2054 0.2770 0.2681 0.0020  0.0518  -0.0090 16   GLU B O   
1379 C CB  A GLU B 16  ? 0.1928 0.2613 0.3229 -0.0087 0.0669  -0.0172 16   GLU B CB  
1380 C CB  B GLU B 16  ? 0.1820 0.2501 0.3120 -0.0090 0.0673  -0.0178 16   GLU B CB  
1381 C CG  A GLU B 16  ? 0.2280 0.3215 0.3717 -0.0073 0.0527  -0.0226 16   GLU B CG  
1382 C CG  B GLU B 16  ? 0.2061 0.3045 0.3600 -0.0070 0.0517  -0.0242 16   GLU B CG  
1383 C CD  A GLU B 16  ? 0.2599 0.3537 0.4253 -0.0161 0.0652  -0.0389 16   GLU B CD  
1384 C CD  B GLU B 16  ? 0.1750 0.2929 0.3556 0.0009  0.0393  -0.0260 16   GLU B CD  
1385 O OE1 A GLU B 16  ? 0.3678 0.4417 0.5086 -0.0200 0.0730  -0.0417 16   GLU B OE1 
1386 O OE1 B GLU B 16  ? 0.1258 0.2578 0.3439 0.0012  0.0449  -0.0404 16   GLU B OE1 
1387 O OE2 A GLU B 16  ? 0.3225 0.4351 0.5274 -0.0194 0.0691  -0.0520 16   GLU B OE2 
1388 O OE2 B GLU B 16  ? 0.2726 0.3890 0.4320 0.0079  0.0245  -0.0156 16   GLU B OE2 
1389 N N   . ILE B 17  ? 0.2066 0.3033 0.2838 -0.0054 0.0381  -0.0022 17   ILE B N   
1390 C CA  . ILE B 17  ? 0.1863 0.3014 0.2454 -0.0071 0.0314  -0.0065 17   ILE B CA  
1391 C C   . ILE B 17  ? 0.2051 0.3303 0.2692 -0.0079 0.0201  -0.0071 17   ILE B C   
1392 O O   . ILE B 17  ? 0.1866 0.3045 0.2439 -0.0107 0.0144  -0.0026 17   ILE B O   
1393 C CB  . ILE B 17  ? 0.2051 0.3261 0.2439 -0.0171 0.0353  -0.0079 17   ILE B CB  
1394 C CG1 . ILE B 17  ? 0.2113 0.3206 0.2457 -0.0166 0.0455  -0.0071 17   ILE B CG1 
1395 C CG2 . ILE B 17  ? 0.1727 0.3247 0.2011 -0.0203 0.0319  -0.0212 17   ILE B CG2 
1396 C CD1 . ILE B 17  ? 0.2648 0.3846 0.2804 -0.0304 0.0522  -0.0137 17   ILE B CD1 
1397 N N   . ALA B 18  ? 0.1696 0.3030 0.2379 -0.0034 0.0169  -0.0127 18   ALA B N   
1398 C CA  . ALA B 18  ? 0.1785 0.3213 0.2522 -0.0045 0.0065  -0.0149 18   ALA B CA  
1399 C C   . ALA B 18  ? 0.1785 0.3363 0.2359 -0.0045 0.0041  -0.0214 18   ALA B C   
1400 O O   . ALA B 18  ? 0.2006 0.3634 0.2483 0.0023  0.0083  -0.0270 18   ALA B O   
1401 C CB  . ALA B 18  ? 0.1584 0.2981 0.2557 -0.0025 0.0082  -0.0198 18   ALA B CB  
1402 N N   . ALA B 19  ? 0.1887 0.3541 0.2404 -0.0097 -0.0038 -0.0229 19   ALA B N   
1403 C CA  . ALA B 19  ? 0.1907 0.3737 0.2306 -0.0107 -0.0050 -0.0322 19   ALA B CA  
1404 C C   . ALA B 19  ? 0.1737 0.3542 0.2177 -0.0094 -0.0115 -0.0334 19   ALA B C   
1405 O O   . ALA B 19  ? 0.1950 0.3678 0.2473 -0.0120 -0.0189 -0.0291 19   ALA B O   
1406 C CB  . ALA B 19  ? 0.2035 0.3950 0.2231 -0.0261 -0.0023 -0.0371 19   ALA B CB  
1407 N N   . VAL B 20  ? 0.1864 0.3736 0.2237 -0.0023 -0.0098 -0.0415 20   VAL B N   
1408 C CA  . VAL B 20  ? 0.2162 0.3999 0.2513 -0.0035 -0.0134 -0.0448 20   VAL B CA  
1409 C C   . VAL B 20  ? 0.1935 0.3936 0.2138 0.0009  -0.0130 -0.0555 20   VAL B C   
1410 O O   . VAL B 20  ? 0.1887 0.4063 0.2052 0.0095  -0.0107 -0.0638 20   VAL B O   
1411 C CB  . VAL B 20  ? 0.2002 0.3605 0.2371 0.0021  -0.0060 -0.0461 20   VAL B CB  
1412 C CG1 . VAL B 20  ? 0.2361 0.3889 0.2964 -0.0045 -0.0032 -0.0428 20   VAL B CG1 
1413 C CG2 . VAL B 20  ? 0.2907 0.4338 0.3040 0.0198  0.0016  -0.0497 20   VAL B CG2 
1414 N N   . TYR B 21  ? 0.2185 0.4177 0.2327 -0.0044 -0.0161 -0.0586 21   TYR B N   
1415 C CA  . TYR B 21  ? 0.2039 0.4154 0.2057 0.0039  -0.0142 -0.0710 21   TYR B CA  
1416 C C   . TYR B 21  ? 0.2364 0.4249 0.2273 0.0073  -0.0127 -0.0716 21   TYR B C   
1417 O O   . TYR B 21  ? 0.2827 0.4570 0.2797 -0.0048 -0.0144 -0.0662 21   TYR B O   
1418 C CB  . TYR B 21  ? 0.2241 0.4602 0.2217 -0.0110 -0.0139 -0.0800 21   TYR B CB  
1419 C CG  . TYR B 21  ? 0.2408 0.4621 0.2272 -0.0284 -0.0179 -0.0749 21   TYR B CG  
1420 C CD1 . TYR B 21  ? 0.2712 0.4911 0.2480 -0.0292 -0.0177 -0.0815 21   TYR B CD1 
1421 C CD2 . TYR B 21  ? 0.3102 0.5148 0.2880 -0.0414 -0.0227 -0.0649 21   TYR B CD2 
1422 C CE1 . TYR B 21  ? 0.2876 0.4923 0.2488 -0.0444 -0.0228 -0.0782 21   TYR B CE1 
1423 C CE2 . TYR B 21  ? 0.2937 0.4786 0.2499 -0.0522 -0.0301 -0.0617 21   TYR B CE2 
1424 C CZ  . TYR B 21  ? 0.3189 0.5055 0.2683 -0.0546 -0.0303 -0.0684 21   TYR B CZ  
1425 O OH  . TYR B 21  ? 0.3945 0.5592 0.3176 -0.0646 -0.0390 -0.0661 21   TYR B OH  
1426 N N   . LEU B 22  ? 0.2102 0.2861 0.2501 0.0259  -0.0258 -0.0355 22   LEU B N   
1427 C CA  . LEU B 22  ? 0.2236 0.3240 0.2948 0.0040  -0.0208 -0.0311 22   LEU B CA  
1428 C C   . LEU B 22  ? 0.2296 0.3004 0.2996 -0.0081 -0.0233 -0.0378 22   LEU B C   
1429 O O   . LEU B 22  ? 0.2222 0.2774 0.2802 -0.0051 -0.0258 -0.0373 22   LEU B O   
1430 C CB  . LEU B 22  ? 0.2177 0.3505 0.3059 0.0017  -0.0141 -0.0152 22   LEU B CB  
1431 C CG  . LEU B 22  ? 0.2394 0.3537 0.3175 0.0094  -0.0086 -0.0142 22   LEU B CG  
1432 C CD1 . LEU B 22  ? 0.3336 0.4661 0.4372 -0.0097 -0.0054 0.0037  22   LEU B CD1 
1433 C CD2 . LEU B 22  ? 0.3701 0.4940 0.4177 0.0481  -0.0070 -0.0138 22   LEU B CD2 
1434 N N   . GLN B 23  ? 0.2420 0.3062 0.3194 -0.0200 -0.0278 -0.0396 23   GLN B N   
1435 C CA  . GLN B 23  ? 0.2847 0.3238 0.3446 -0.0138 -0.0306 -0.0472 23   GLN B CA  
1436 C C   . GLN B 23  ? 0.2396 0.2746 0.2962 -0.0099 -0.0214 -0.0412 23   GLN B C   
1437 O O   . GLN B 23  ? 0.2560 0.2947 0.3212 -0.0137 -0.0165 -0.0350 23   GLN B O   
1438 C CB  . GLN B 23  ? 0.3060 0.3103 0.3524 -0.0192 -0.0489 -0.0551 23   GLN B CB  
1439 C CG  . GLN B 23  ? 0.4094 0.3929 0.4629 -0.0366 -0.0544 -0.0444 23   GLN B CG  
1440 C CD  . GLN B 23  ? 0.5239 0.5458 0.6147 -0.0632 -0.0571 -0.0216 23   GLN B CD  
1441 O OE1 . GLN B 23  ? 0.4003 0.4631 0.5078 -0.0656 -0.0560 -0.0172 23   GLN B OE1 
1442 N NE2 . GLN B 23  ? 0.4988 0.5199 0.6030 -0.0800 -0.0601 -0.0009 23   GLN B NE2 
1443 N N   . PRO B 24  ? 0.2389 0.2773 0.2808 0.0033  -0.0193 -0.0401 24   PRO B N   
1444 C CA  . PRO B 24  ? 0.2254 0.2691 0.2669 0.0051  -0.0127 -0.0315 24   PRO B CA  
1445 C C   . PRO B 24  ? 0.2382 0.2537 0.2743 0.0044  -0.0113 -0.0357 24   PRO B C   
1446 O O   . PRO B 24  ? 0.2652 0.2486 0.2897 0.0027  -0.0217 -0.0426 24   PRO B O   
1447 C CB  . PRO B 24  ? 0.2613 0.3365 0.2880 0.0259  -0.0098 -0.0225 24   PRO B CB  
1448 C CG  . PRO B 24  ? 0.2467 0.3424 0.2717 0.0331  -0.0133 -0.0212 24   PRO B CG  
1449 C CD  . PRO B 24  ? 0.2648 0.3209 0.2896 0.0235  -0.0214 -0.0407 24   PRO B CD  
1450 N N   . ILE B 25  ? 0.2557 0.2777 0.2971 0.0035  -0.0043 -0.0288 25   ILE B N   
1451 C CA  . ILE B 25  ? 0.2371 0.2416 0.2766 0.0032  -0.0007 -0.0262 25   ILE B CA  
1452 C C   . ILE B 25  ? 0.2850 0.2942 0.3085 0.0193  0.0055  -0.0238 25   ILE B C   
1453 O O   . ILE B 25  ? 0.2555 0.2970 0.2782 0.0256  0.0064  -0.0177 25   ILE B O   
1454 C CB  . ILE B 25  ? 0.2360 0.2585 0.2930 -0.0014 0.0042  -0.0179 25   ILE B CB  
1455 C CG1 . ILE B 25  ? 0.2420 0.2713 0.2906 0.0083  0.0024  -0.0202 25   ILE B CG1 
1456 C CG2 . ILE B 25  ? 0.2757 0.3141 0.3475 -0.0103 -0.0002 -0.0145 25   ILE B CG2 
1457 C CD1 . ILE B 25  ? 0.2360 0.2648 0.2761 0.0168  0.0063  -0.0173 25   ILE B CD1 
1458 N N   . GLU B 26  ? 0.2924 0.2781 0.3052 0.0244  0.0080  -0.0217 26   GLU B N   
1459 C CA  . GLU B 26  ? 0.2826 0.2778 0.2778 0.0445  0.0158  -0.0186 26   GLU B CA  
1460 C C   . GLU B 26  ? 0.3003 0.3076 0.3110 0.0395  0.0236  -0.0113 26   GLU B C   
1461 O O   . GLU B 26  ? 0.2970 0.2911 0.3162 0.0321  0.0253  -0.0044 26   GLU B O   
1462 C CB  . GLU B 26  ? 0.3503 0.2958 0.3028 0.0665  0.0087  -0.0249 26   GLU B CB  
1463 C CG  . GLU B 26  ? 0.4675 0.4013 0.3838 0.0921  -0.0021 -0.0365 26   GLU B CG  
1464 C CD  . GLU B 26  ? 0.6162 0.6214 0.5205 0.1264  0.0106  -0.0273 26   GLU B CD  
1465 O OE1 . GLU B 26  ? 0.6767 0.7483 0.6195 0.1099  0.0217  -0.0091 26   GLU B OE1 
1466 O OE2 . GLU B 26  ? 0.7220 0.7201 0.5736 0.1727  0.0049  -0.0342 26   GLU B OE2 
1467 N N   . MET B 27  ? 0.2722 0.4048 0.3223 0.0031  0.0640  -0.0455 27   MET B N   
1468 C CA  . MET B 27  ? 0.2488 0.3440 0.3131 0.0347  0.0476  -0.0147 27   MET B CA  
1469 C C   . MET B 27  ? 0.2684 0.3288 0.3778 0.0517  0.0531  -0.0152 27   MET B C   
1470 O O   . MET B 27  ? 0.2808 0.3431 0.4115 0.0561  0.0673  -0.0255 27   MET B O   
1471 C CB  . MET B 27  ? 0.2581 0.3600 0.3092 0.0501  0.0350  0.0113  27   MET B CB  
1472 C CG  . MET B 27  ? 0.3004 0.3758 0.3448 0.0752  0.0256  0.0199  27   MET B CG  
1473 S SD  . MET B 27  ? 0.3050 0.3324 0.3420 0.0890  0.0193  0.0203  27   MET B SD  
1474 C CE  . MET B 27  ? 0.3120 0.3242 0.3510 0.0648  0.0073  0.0103  27   MET B CE  
1475 N N   . GLU B 28  ? 0.2504 0.3092 0.3822 0.0602  0.0415  0.0103  28   GLU B N   
1476 C CA  . GLU B 28  ? 0.2553 0.3274 0.4379 0.0710  0.0388  0.0412  28   GLU B CA  
1477 C C   . GLU B 28  ? 0.2608 0.3722 0.4048 0.0694  0.0179  0.0557  28   GLU B C   
1478 O O   . GLU B 28  ? 0.2465 0.3683 0.3497 0.0734  0.0107  0.0471  28   GLU B O   
1479 C CB  . GLU B 28  ? 0.2979 0.3700 0.5534 0.0706  0.0400  0.0725  28   GLU B CB  
1480 C CG  . GLU B 28  ? 0.3590 0.3642 0.6724 0.0743  0.0710  0.0453  28   GLU B CG  
1481 C CD  . GLU B 28  ? 0.5042 0.4880 0.9313 0.0798  0.0755  0.0924  28   GLU B CD  
1482 O OE1 . GLU B 28  ? 0.5335 0.5936 1.0128 0.0829  0.0539  0.1688  28   GLU B OE1 
1483 O OE2 . GLU B 28  ? 0.6414 0.5373 1.1123 0.0755  0.1018  0.0533  28   GLU B OE2 
1484 N N   . PRO B 29  ? 0.2668 0.4088 0.4216 0.0606  0.0117  0.0743  29   PRO B N   
1485 C CA  . PRO B 29  ? 0.2864 0.4443 0.4998 0.0633  0.0236  0.1021  29   PRO B CA  
1486 C C   . PRO B 29  ? 0.2658 0.3901 0.4608 0.0677  0.0368  0.0734  29   PRO B C   
1487 O O   . PRO B 29  ? 0.2598 0.3597 0.3981 0.0573  0.0261  0.0482  29   PRO B O   
1488 C CB  . PRO B 29  ? 0.2949 0.5316 0.5026 0.0355  0.0037  0.1398  29   PRO B CB  
1489 C CG  . PRO B 29  ? 0.3424 0.5625 0.4641 0.0161  -0.0131 0.0957  29   PRO B CG  
1490 C CD  . PRO B 29  ? 0.3101 0.4950 0.4188 0.0419  -0.0057 0.0709  29   PRO B CD  
1491 N N   . ARG B 30  ? 0.2969 0.4332 0.5546 0.0867  0.0635  0.0842  30   ARG B N   
1492 C CA  A ARG B 30  ? 0.3150 0.4628 0.5618 0.0912  0.0810  0.0600  30   ARG B CA  
1493 C CA  B ARG B 30  ? 0.3125 0.4604 0.5600 0.0915  0.0813  0.0601  30   ARG B CA  
1494 C C   . ARG B 30  ? 0.3072 0.5107 0.5324 0.0696  0.0567  0.0979  30   ARG B C   
1495 O O   . ARG B 30  ? 0.3127 0.5479 0.5423 0.0510  0.0352  0.1398  30   ARG B O   
1496 C CB  A ARG B 30  ? 0.3646 0.5151 0.6910 0.1273  0.1280  0.0518  30   ARG B CB  
1497 C CB  B ARG B 30  ? 0.3591 0.5110 0.6876 0.1279  0.1281  0.0538  30   ARG B CB  
1498 C CG  A ARG B 30  ? 0.4675 0.5433 0.8009 0.1322  0.1560  -0.0127 30   ARG B CG  
1499 C CG  B ARG B 30  ? 0.4478 0.5195 0.8109 0.1395  0.1549  0.0094  30   ARG B CG  
1500 C CD  A ARG B 30  ? 0.4920 0.5770 0.7339 0.0979  0.1463  -0.0659 30   ARG B CD  
1501 C CD  B ARG B 30  ? 0.4386 0.4812 0.7149 0.1046  0.1395  -0.0445 30   ARG B CD  
1502 N NE  A ARG B 30  ? 0.6009 0.6403 0.8355 0.0840  0.1759  -0.1372 30   ARG B NE  
1503 N NE  B ARG B 30  ? 0.6005 0.5754 0.8942 0.0968  0.1668  -0.1012 30   ARG B NE  
1504 C CZ  A ARG B 30  ? 0.5781 0.6658 0.7522 0.0512  0.1883  -0.1939 30   ARG B CZ  
1505 C CZ  B ARG B 30  ? 0.6112 0.5886 0.8341 0.0570  0.1666  -0.1568 30   ARG B CZ  
1506 N NH1 A ARG B 30  ? 0.4334 0.6217 0.5675 0.0372  0.1718  -0.1709 30   ARG B NH1 
1507 N NH1 B ARG B 30  ? 0.5253 0.5781 0.6769 0.0342  0.1432  -0.1464 30   ARG B NH1 
1508 N NH2 A ARG B 30  ? 0.6645 0.7112 0.8225 0.0223  0.2145  -0.2683 30   ARG B NH2 
1509 N NH2 B ARG B 30  ? 0.6623 0.5735 0.8946 0.0336  0.1892  -0.2150 30   ARG B NH2 
1510 N N   . GLY B 31  ? 0.3122 0.5460 0.5150 0.0608  0.0570  0.0879  31   GLY B N   
1511 C CA  . GLY B 31  ? 0.3310 0.6251 0.5255 0.0321  0.0298  0.1354  31   GLY B CA  
1512 C C   . GLY B 31  ? 0.3462 0.5892 0.4899 -0.0103 -0.0131 0.1400  31   GLY B C   
1513 O O   . GLY B 31  ? 0.3592 0.6296 0.4961 -0.0488 -0.0427 0.1791  31   GLY B O   
1514 N N   . ILE B 32  ? 0.3291 0.4970 0.4447 -0.0037 -0.0139 0.1023  32   ILE B N   
1515 C CA  . ILE B 32  ? 0.3590 0.4527 0.4442 -0.0268 -0.0400 0.0961  32   ILE B CA  
1516 C C   . ILE B 32  ? 0.3396 0.4263 0.4369 -0.0190 -0.0384 0.1023  32   ILE B C   
1517 O O   . ILE B 32  ? 0.3697 0.4554 0.4879 -0.0434 -0.0605 0.1390  32   ILE B O   
1518 C CB  . ILE B 32  ? 0.4063 0.4418 0.4611 -0.0160 -0.0356 0.0579  32   ILE B CB  
1519 C CG1 . ILE B 32  ? 0.4254 0.5155 0.4808 -0.0321 -0.0390 0.0711  32   ILE B CG1 
1520 C CG2 . ILE B 32  ? 0.4813 0.4247 0.5102 -0.0296 -0.0485 0.0332  32   ILE B CG2 
1521 C CD1 . ILE B 32  ? 0.5806 0.6624 0.6067 -0.0307 -0.0372 0.0411  32   ILE B CD1 
1522 N N   . ASP B 33  ? 0.3082 0.4291 0.3047 0.0361  -0.0483 -0.0325 33   ASP B N   
1523 C CA  . ASP B 33  ? 0.3094 0.4109 0.2985 0.0393  -0.0405 -0.0414 33   ASP B CA  
1524 C C   . ASP B 33  ? 0.3017 0.3997 0.3136 0.0314  -0.0291 -0.0323 33   ASP B C   
1525 O O   . ASP B 33  ? 0.3045 0.4166 0.3388 0.0299  -0.0189 -0.0199 33   ASP B O   
1526 C CB  . ASP B 33  ? 0.2706 0.3838 0.2521 0.0504  -0.0300 -0.0428 33   ASP B CB  
1527 C CG  . ASP B 33  ? 0.4151 0.5128 0.3853 0.0537  -0.0257 -0.0505 33   ASP B CG  
1528 O OD1 . ASP B 33  ? 0.3178 0.3953 0.2742 0.0547  -0.0342 -0.0599 33   ASP B OD1 
1529 O OD2 . ASP B 33  ? 0.3702 0.4754 0.3474 0.0536  -0.0156 -0.0451 33   ASP B OD2 
1530 N N   . LEU B 34  ? 0.3164 0.3971 0.3224 0.0282  -0.0294 -0.0374 34   LEU B N   
1531 C CA  . LEU B 34  ? 0.2832 0.3637 0.3025 0.0238  -0.0163 -0.0306 34   LEU B CA  
1532 C C   . LEU B 34  ? 0.2752 0.3603 0.2967 0.0287  0.0002  -0.0312 34   LEU B C   
1533 O O   . LEU B 34  ? 0.2581 0.3426 0.2678 0.0327  0.0001  -0.0374 34   LEU B O   
1534 C CB  . LEU B 34  ? 0.3080 0.3739 0.3169 0.0203  -0.0204 -0.0350 34   LEU B CB  
1535 C CG  . LEU B 34  ? 0.2811 0.3506 0.2966 0.0162  -0.0074 -0.0283 34   LEU B CG  
1536 C CD1 . LEU B 34  ? 0.2932 0.3746 0.3317 0.0107  -0.0083 -0.0121 34   LEU B CD1 
1537 C CD2 . LEU B 34  ? 0.3199 0.3807 0.3232 0.0133  -0.0110 -0.0312 34   LEU B CD2 
1538 N N   . ALA B 35  ? 0.2683 0.3577 0.3063 0.0291  0.0138  -0.0236 35   ALA B N   
1539 C CA  . ALA B 35  ? 0.2557 0.3398 0.2955 0.0334  0.0274  -0.0262 35   ALA B CA  
1540 C C   . ALA B 35  ? 0.2287 0.2968 0.2455 0.0302  0.0299  -0.0385 35   ALA B C   
1541 O O   . ALA B 35  ? 0.2806 0.3452 0.2864 0.0266  0.0292  -0.0411 35   ALA B O   
1542 C CB  . ALA B 35  ? 0.2697 0.3562 0.3301 0.0385  0.0433  -0.0173 35   ALA B CB  
1543 N N   . ALA B 36  ? 0.2725 0.3341 0.2849 0.0297  0.0309  -0.0424 36   ALA B N   
1544 C CA  . ALA B 36  ? 0.2613 0.3111 0.2527 0.0231  0.0287  -0.0508 36   ALA B CA  
1545 C C   . ALA B 36  ? 0.2700 0.3053 0.2453 0.0201  0.0381  -0.0592 36   ALA B C   
1546 O O   . ALA B 36  ? 0.2968 0.3313 0.2533 0.0136  0.0339  -0.0630 36   ALA B O   
1547 C CB  . ALA B 36  ? 0.3059 0.3504 0.3021 0.0201  0.0269  -0.0493 36   ALA B CB  
1548 N N   . SER B 37  ? 0.2711 0.2978 0.2535 0.0266  0.0522  -0.0605 37   SER B N   
1549 C CA  . SER B 37  ? 0.3242 0.3385 0.2857 0.0277  0.0644  -0.0700 37   SER B CA  
1550 C C   . SER B 37  ? 0.3107 0.3438 0.2683 0.0267  0.0647  -0.0630 37   SER B C   
1551 O O   . SER B 37  ? 0.3472 0.3782 0.2816 0.0251  0.0713  -0.0689 37   SER B O   
1552 C CB  . SER B 37  ? 0.3439 0.3436 0.3136 0.0401  0.0826  -0.0728 37   SER B CB  
1553 O OG  . SER B 37  ? 0.4472 0.4694 0.4433 0.0490  0.0901  -0.0570 37   SER B OG  
1554 N N   . LEU B 38  ? 0.2950 0.3462 0.2740 0.0265  0.0559  -0.0499 38   LEU B N   
1555 C CA  . LEU B 38  ? 0.2836 0.3508 0.2674 0.0231  0.0515  -0.0390 38   LEU B CA  
1556 C C   . LEU B 38  ? 0.2960 0.3627 0.2699 0.0148  0.0356  -0.0400 38   LEU B C   
1557 O O   . LEU B 38  ? 0.2849 0.3611 0.2647 0.0107  0.0297  -0.0300 38   LEU B O   
1558 C CB  . LEU B 38  ? 0.2771 0.3587 0.2905 0.0246  0.0459  -0.0236 38   LEU B CB  
1559 C CG  . LEU B 38  ? 0.3452 0.4358 0.3784 0.0342  0.0619  -0.0145 38   LEU B CG  
1560 C CD1 . LEU B 38  ? 0.2473 0.3552 0.3099 0.0310  0.0506  0.0032  38   LEU B CD1 
1561 C CD2 . LEU B 38  ? 0.3732 0.4733 0.4015 0.0408  0.0804  -0.0094 38   LEU B CD2 
1562 N N   . ALA B 39  ? 0.2754 0.3330 0.2388 0.0130  0.0287  -0.0485 39   ALA B N   
1563 C CA  . ALA B 39  ? 0.2585 0.3175 0.2174 0.0099  0.0151  -0.0471 39   ALA B CA  
1564 C C   . ALA B 39  ? 0.2788 0.3371 0.2179 0.0028  0.0151  -0.0504 39   ALA B C   
1565 O O   . ALA B 39  ? 0.2949 0.3454 0.2201 -0.0005 0.0227  -0.0582 39   ALA B O   
1566 C CB  . ALA B 39  ? 0.2434 0.3019 0.2084 0.0158  0.0079  -0.0490 39   ALA B CB  
1567 N N   . ASP B 40  ? 0.2343 0.2987 0.1722 0.0003  0.0055  -0.0441 40   ASP B N   
1568 C CA  . ASP B 40  ? 0.2566 0.3269 0.1795 -0.0081 0.0018  -0.0418 40   ASP B CA  
1569 C C   . ASP B 40  ? 0.2410 0.3175 0.1691 -0.0047 -0.0063 -0.0366 40   ASP B C   
1570 O O   . ASP B 40  ? 0.2773 0.3605 0.1967 -0.0134 -0.0100 -0.0330 40   ASP B O   
1571 C CB  . ASP B 40  ? 0.2673 0.3484 0.1880 -0.0139 -0.0005 -0.0318 40   ASP B CB  
1572 C CG  . ASP B 40  ? 0.2819 0.3664 0.1916 -0.0176 0.0102  -0.0340 40   ASP B CG  
1573 O OD1 . ASP B 40  ? 0.3167 0.3975 0.2011 -0.0234 0.0164  -0.0436 40   ASP B OD1 
1574 O OD2 . ASP B 40  ? 0.3221 0.4117 0.2481 -0.0137 0.0121  -0.0260 40   ASP B OD2 
1575 N N   . ILE B 41  ? 0.2470 0.3224 0.1876 0.0079  -0.0096 -0.0355 41   ILE B N   
1576 C CA  . ILE B 41  ? 0.1931 0.2784 0.1380 0.0177  -0.0137 -0.0298 41   ILE B CA  
1577 C C   . ILE B 41  ? 0.2398 0.3215 0.1894 0.0310  -0.0130 -0.0362 41   ILE B C   
1578 O O   . ILE B 41  ? 0.2569 0.3269 0.2091 0.0316  -0.0128 -0.0434 41   ILE B O   
1579 C CB  . ILE B 41  ? 0.1902 0.2799 0.1392 0.0243  -0.0188 -0.0204 41   ILE B CB  
1580 C CG1 . ILE B 41  ? 0.2342 0.3053 0.1884 0.0318  -0.0228 -0.0256 41   ILE B CG1 
1581 C CG2 . ILE B 41  ? 0.2335 0.3343 0.1791 0.0093  -0.0210 -0.0093 41   ILE B CG2 
1582 C CD1 . ILE B 41  ? 0.2570 0.3244 0.2180 0.0419  -0.0281 -0.0172 41   ILE B CD1 
1583 N N   . HIS B 42  ? 0.2029 0.3059 0.1886 -0.0042 0.0126  -0.0721 42   HIS B N   
1584 C CA  . HIS B 42  ? 0.2008 0.2897 0.2020 0.0093  0.0089  -0.0567 42   HIS B CA  
1585 C C   . HIS B 42  ? 0.1994 0.2838 0.1763 0.0170  -0.0007 -0.0381 42   HIS B C   
1586 O O   . HIS B 42  ? 0.2529 0.3493 0.2255 0.0198  -0.0097 -0.0362 42   HIS B O   
1587 C CB  . HIS B 42  ? 0.2011 0.2877 0.2353 0.0153  0.0106  -0.0584 42   HIS B CB  
1588 C CG  . HIS B 42  ? 0.2011 0.2756 0.2448 0.0300  0.0081  -0.0439 42   HIS B CG  
1589 N ND1 . HIS B 42  ? 0.1917 0.2691 0.2456 0.0365  0.0092  -0.0470 42   HIS B ND1 
1590 C CD2 . HIS B 42  ? 0.2202 0.2853 0.2638 0.0393  0.0045  -0.0292 42   HIS B CD2 
1591 C CE1 . HIS B 42  ? 0.2094 0.2840 0.2655 0.0517  0.0033  -0.0333 42   HIS B CE1 
1592 N NE2 . HIS B 42  ? 0.2340 0.2971 0.2808 0.0523  0.0020  -0.0211 42   HIS B NE2 
1593 N N   . LEU B 43  ? 0.2004 0.2710 0.1642 0.0193  0.0033  -0.0288 43   LEU B N   
1594 C CA  . LEU B 43  ? 0.2427 0.3028 0.1915 0.0276  -0.0003 -0.0112 43   LEU B CA  
1595 C C   . LEU B 43  ? 0.1918 0.2533 0.1649 0.0343  -0.0045 -0.0063 43   LEU B C   
1596 O O   . LEU B 43  ? 0.2125 0.2772 0.2008 0.0344  -0.0011 -0.0121 43   LEU B O   
1597 C CB  . LEU B 43  ? 0.2362 0.2757 0.1632 0.0230  0.0153  -0.0079 43   LEU B CB  
1598 C CG  . LEU B 43  ? 0.3132 0.3323 0.2268 0.0307  0.0207  0.0095  43   LEU B CG  
1599 C CD1 . LEU B 43  ? 0.2888 0.3056 0.1783 0.0449  0.0084  0.0280  43   LEU B CD1 
1600 C CD2 . LEU B 43  ? 0.3028 0.2962 0.2022 0.0207  0.0472  0.0053  43   LEU B CD2 
1601 N N   . GLU B 44  ? 0.2211 0.2839 0.1964 0.0408  -0.0121 0.0026  44   GLU B N   
1602 C CA  . GLU B 44  ? 0.2118 0.2729 0.2042 0.0441  -0.0124 0.0068  44   GLU B CA  
1603 C C   . GLU B 44  ? 0.2245 0.2779 0.2129 0.0480  -0.0106 0.0163  44   GLU B C   
1604 O O   . GLU B 44  ? 0.2609 0.3140 0.2407 0.0552  -0.0159 0.0232  44   GLU B O   
1605 C CB  . GLU B 44  ? 0.1964 0.2634 0.2061 0.0443  -0.0156 0.0020  44   GLU B CB  
1606 C CG  . GLU B 44  ? 0.2119 0.2783 0.2309 0.0413  -0.0107 -0.0068 44   GLU B CG  
1607 C CD  . GLU B 44  ? 0.2615 0.3249 0.2996 0.0381  -0.0034 -0.0147 44   GLU B CD  
1608 O OE1 . GLU B 44  ? 0.3363 0.4044 0.3824 0.0366  -0.0042 -0.0172 44   GLU B OE1 
1609 O OE2 . GLU B 44  ? 0.2789 0.3335 0.3280 0.0367  0.0066  -0.0208 44   GLU B OE2 
1610 N N   . ALA B 45  ? 0.2244 0.2749 0.2205 0.0451  -0.0030 0.0158  45   ALA B N   
1611 C CA  . ALA B 45  ? 0.2102 0.2541 0.2138 0.0462  0.0027  0.0204  45   ALA B CA  
1612 C C   . ALA B 45  ? 0.1946 0.2458 0.2137 0.0450  -0.0007 0.0178  45   ALA B C   
1613 O O   . ALA B 45  ? 0.2213 0.2767 0.2383 0.0419  0.0003  0.0148  45   ALA B O   
1614 C CB  . ALA B 45  ? 0.1919 0.2318 0.1965 0.0384  0.0190  0.0140  45   ALA B CB  
1615 N N   . ASP B 46  ? 0.1830 0.2354 0.2156 0.0493  -0.0042 0.0189  46   ASP B N   
1616 C CA  . ASP B 46  ? 0.1892 0.2459 0.2404 0.0448  -0.0021 0.0116  46   ASP B CA  
1617 C C   . ASP B 46  ? 0.1733 0.2260 0.2377 0.0413  0.0082  0.0104  46   ASP B C   
1618 O O   . ASP B 46  ? 0.1924 0.2443 0.2717 0.0498  0.0074  0.0130  46   ASP B O   
1619 C CB  . ASP B 46  ? 0.2365 0.3085 0.3056 0.0501  -0.0117 0.0035  46   ASP B CB  
1620 C CG  . ASP B 46  ? 0.2954 0.3727 0.3640 0.0450  -0.0124 -0.0058 46   ASP B CG  
1621 O OD1 . ASP B 46  ? 0.3306 0.3919 0.3894 0.0388  -0.0026 -0.0036 46   ASP B OD1 
1622 O OD2 . ASP B 46  ? 0.4104 0.5105 0.4893 0.0489  -0.0223 -0.0164 46   ASP B OD2 
1623 N N   . ILE B 47  ? 0.1853 0.3033 0.2176 0.0180  0.0314  0.0506  47   ILE B N   
1624 C CA  . ILE B 47  ? 0.1985 0.2894 0.2325 0.0189  0.0386  0.0626  47   ILE B CA  
1625 C C   . ILE B 47  ? 0.1576 0.2267 0.1885 0.0163  0.0315  0.0571  47   ILE B C   
1626 O O   . ILE B 47  ? 0.2149 0.2688 0.2456 0.0125  0.0235  0.0440  47   ILE B O   
1627 C CB  . ILE B 47  ? 0.1918 0.2659 0.2356 0.0160  0.0447  0.0584  47   ILE B CB  
1628 C CG1 . ILE B 47  ? 0.1855 0.2822 0.2320 0.0163  0.0532  0.0632  47   ILE B CG1 
1629 C CG2 . ILE B 47  ? 0.2028 0.2550 0.2552 0.0173  0.0543  0.0687  47   ILE B CG2 
1630 C CD1 . ILE B 47  ? 0.2075 0.2909 0.2678 0.0120  0.0627  0.0581  47   ILE B CD1 
1631 N N   . HIS B 48  ? 0.1678 0.2384 0.1957 0.0191  0.0343  0.0676  48   HIS B N   
1632 C CA  . HIS B 48  ? 0.1921 0.2467 0.2164 0.0157  0.0300  0.0638  48   HIS B CA  
1633 C C   . HIS B 48  ? 0.1913 0.2369 0.2195 0.0184  0.0369  0.0739  48   HIS B C   
1634 O O   . HIS B 48  ? 0.2180 0.2726 0.2515 0.0244  0.0443  0.0863  48   HIS B O   
1635 C CB  . HIS B 48  ? 0.2178 0.2893 0.2381 0.0140  0.0246  0.0585  48   HIS B CB  
1636 C CG  . HIS B 48  ? 0.2225 0.3047 0.2455 0.0112  0.0176  0.0450  48   HIS B CG  
1637 N ND1 . HIS B 48  ? 0.1702 0.2822 0.1963 0.0150  0.0181  0.0430  48   HIS B ND1 
1638 C CD2 . HIS B 48  ? 0.2196 0.2869 0.2446 0.0056  0.0100  0.0328  48   HIS B CD2 
1639 C CE1 . HIS B 48  ? 0.2311 0.3483 0.2637 0.0111  0.0106  0.0266  48   HIS B CE1 
1640 N NE2 . HIS B 48  ? 0.2128 0.3005 0.2456 0.0058  0.0055  0.0210  48   HIS B NE2 
1641 N N   . ALA B 49  ? 0.1889 0.2174 0.2151 0.0143  0.0344  0.0685  49   ALA B N   
1642 C CA  . ALA B 49  ? 0.1976 0.2218 0.2303 0.0161  0.0399  0.0736  49   ALA B CA  
1643 C C   . ALA B 49  ? 0.2001 0.2407 0.2324 0.0195  0.0416  0.0804  49   ALA B C   
1644 O O   . ALA B 49  ? 0.2121 0.2646 0.2365 0.0170  0.0371  0.0763  49   ALA B O   
1645 C CB  . ALA B 49  ? 0.1995 0.2093 0.2280 0.0111  0.0366  0.0649  49   ALA B CB  
1646 N N   . LEU B 50  ? 0.2168 0.2589 0.2611 0.0259  0.0484  0.0896  50   LEU B N   
1647 C CA  . LEU B 50  ? 0.2558 0.3121 0.3027 0.0312  0.0493  0.0946  50   LEU B CA  
1648 C C   . LEU B 50  ? 0.2265 0.2773 0.2749 0.0250  0.0480  0.0845  50   LEU B C   
1649 O O   . LEU B 50  ? 0.2313 0.2678 0.2773 0.0180  0.0468  0.0761  50   LEU B O   
1650 C CB  . LEU B 50  ? 0.2523 0.3070 0.3154 0.0413  0.0574  0.1091  50   LEU B CB  
1651 C CG  . LEU B 50  ? 0.2849 0.3450 0.3462 0.0472  0.0618  0.1228  50   LEU B CG  
1652 C CD1 . LEU B 50  ? 0.2814 0.3306 0.3625 0.0555  0.0728  0.1393  50   LEU B CD1 
1653 C CD2 . LEU B 50  ? 0.2608 0.3500 0.3072 0.0526  0.0563  0.1256  50   LEU B CD2 
1654 N N   . LYS B 51  ? 0.2154 0.2807 0.2678 0.0287  0.0483  0.0848  51   LYS B N   
1655 C CA  . LYS B 51  ? 0.2211 0.2854 0.2790 0.0236  0.0489  0.0751  51   LYS B CA  
1656 C C   . LYS B 51  ? 0.2273 0.2785 0.3042 0.0257  0.0538  0.0742  51   LYS B C   
1657 O O   . LYS B 51  ? 0.2399 0.2857 0.3319 0.0341  0.0586  0.0842  51   LYS B O   
1658 C CB  . LYS B 51  ? 0.2423 0.3273 0.3062 0.0294  0.0485  0.0743  51   LYS B CB  
1659 C CG  . LYS B 51  ? 0.2868 0.3910 0.3380 0.0264  0.0446  0.0686  51   LYS B CG  
1660 C CD  . LYS B 51  ? 0.2834 0.4134 0.3430 0.0358  0.0436  0.0665  51   LYS B CD  
1661 C CE  . LYS B 51  ? 0.3628 0.5156 0.4158 0.0303  0.0411  0.0531  51   LYS B CE  
1662 N NZ  . LYS B 51  ? 0.3567 0.5184 0.4011 0.0320  0.0383  0.0551  51   LYS B NZ  
1663 N N   . ASN B 52  ? 0.2409 0.2898 0.3187 0.0183  0.0535  0.0618  52   ASN B N   
1664 C CA  . ASN B 52  ? 0.2380 0.2825 0.3383 0.0196  0.0578  0.0540  52   ASN B CA  
1665 C C   . ASN B 52  ? 0.2431 0.2728 0.3538 0.0221  0.0612  0.0559  52   ASN B C   
1666 O O   . ASN B 52  ? 0.2497 0.2753 0.3888 0.0263  0.0677  0.0531  52   ASN B O   
1667 C CB  . ASN B 52  ? 0.1955 0.2492 0.3208 0.0270  0.0613  0.0541  52   ASN B CB  
1668 C CG  . ASN B 52  ? 0.2093 0.2804 0.3325 0.0214  0.0591  0.0411  52   ASN B CG  
1669 O OD1 . ASN B 52  ? 0.2621 0.3376 0.3802 0.0131  0.0586  0.0285  52   ASN B OD1 
1670 N ND2 . ASN B 52  ? 0.2777 0.3620 0.4040 0.0263  0.0577  0.0435  52   ASN B ND2 
1671 N N   . ASN B 53  ? 0.2280 0.2502 0.3186 0.0188  0.0573  0.0583  53   ASN B N   
1672 C CA  . ASN B 53  ? 0.2194 0.2304 0.3182 0.0201  0.0601  0.0572  53   ASN B CA  
1673 C C   . ASN B 53  ? 0.2187 0.2302 0.3380 0.0191  0.0631  0.0408  53   ASN B C   
1674 O O   . ASN B 53  ? 0.2327 0.2526 0.3433 0.0154  0.0588  0.0296  53   ASN B O   
1675 C CB  . ASN B 53  ? 0.2387 0.2448 0.3128 0.0161  0.0528  0.0568  53   ASN B CB  
1676 C CG  . ASN B 53  ? 0.1949 0.1928 0.2770 0.0169  0.0544  0.0509  53   ASN B CG  
1677 O OD1 . ASN B 53  ? 0.1993 0.1961 0.2861 0.0159  0.0529  0.0372  53   ASN B OD1 
1678 N ND2 . ASN B 53  ? 0.2110 0.2067 0.2956 0.0190  0.0578  0.0597  53   ASN B ND2 
1679 N N   . PRO B 54  ? 0.2451 0.2503 0.3939 0.0225  0.0718  0.0387  54   PRO B N   
1680 C CA  . PRO B 54  ? 0.2480 0.2592 0.4263 0.0223  0.0762  0.0190  54   PRO B CA  
1681 C C   . PRO B 54  ? 0.2389 0.2540 0.4108 0.0201  0.0718  0.0015  54   PRO B C   
1682 O O   . PRO B 54  ? 0.2706 0.2986 0.4638 0.0204  0.0735  -0.0192 54   PRO B O   
1683 C CB  . PRO B 54  ? 0.2779 0.2779 0.4940 0.0264  0.0891  0.0244  54   PRO B CB  
1684 C CG  . PRO B 54  ? 0.2545 0.2428 0.4542 0.0272  0.0909  0.0433  54   PRO B CG  
1685 C CD  . PRO B 54  ? 0.2671 0.2621 0.4278 0.0267  0.0800  0.0545  54   PRO B CD  
1686 N N   . ASN B 55  ? 0.2028 0.2102 0.3477 0.0189  0.0656  0.0079  55   ASN B N   
1687 C CA  . ASN B 55  ? 0.2099 0.2212 0.3452 0.0191  0.0590  -0.0076 55   ASN B CA  
1688 C C   . ASN B 55  ? 0.2366 0.2511 0.3346 0.0179  0.0471  -0.0047 55   ASN B C   
1689 O O   . ASN B 55  ? 0.2636 0.2788 0.3472 0.0201  0.0396  -0.0122 55   ASN B O   
1690 C CB  . ASN B 55  ? 0.1950 0.1957 0.3335 0.0195  0.0611  -0.0061 55   ASN B CB  
1691 C CG  . ASN B 55  ? 0.1892 0.1845 0.3656 0.0195  0.0759  -0.0061 55   ASN B CG  
1692 O OD1 . ASN B 55  ? 0.3007 0.2865 0.4778 0.0193  0.0822  0.0124  55   ASN B OD1 
1693 N ND2 . ASN B 55  ? 0.2100 0.2134 0.4199 0.0201  0.0824  -0.0273 55   ASN B ND2 
1694 N N   . GLY B 56  ? 0.2300 0.2473 0.3149 0.0148  0.0462  0.0054  56   GLY B N   
1695 C CA  . GLY B 56  ? 0.2334 0.2534 0.2873 0.0118  0.0386  0.0091  56   GLY B CA  
1696 C C   . GLY B 56  ? 0.2397 0.2450 0.2683 0.0089  0.0330  0.0235  56   GLY B C   
1697 O O   . GLY B 56  ? 0.2412 0.2440 0.2462 0.0056  0.0283  0.0287  56   GLY B O   
1698 N N   . PHE B 57  ? 0.1970 0.1938 0.2316 0.0099  0.0342  0.0299  57   PHE B N   
1699 C CA  . PHE B 57  ? 0.2232 0.2111 0.2387 0.0071  0.0285  0.0390  57   PHE B CA  
1700 C C   . PHE B 57  ? 0.2400 0.2325 0.2491 0.0022  0.0306  0.0477  57   PHE B C   
1701 O O   . PHE B 57  ? 0.2534 0.2546 0.2754 0.0037  0.0362  0.0513  57   PHE B O   
1702 C CB  . PHE B 57  ? 0.1893 0.1738 0.2127 0.0095  0.0287  0.0405  57   PHE B CB  
1703 C CG  . PHE B 57  ? 0.2202 0.1990 0.2439 0.0127  0.0236  0.0302  57   PHE B CG  
1704 C CD1 . PHE B 57  ? 0.2347 0.2173 0.2767 0.0160  0.0280  0.0189  57   PHE B CD1 
1705 C CD2 . PHE B 57  ? 0.3420 0.3123 0.3504 0.0126  0.0141  0.0297  57   PHE B CD2 
1706 C CE1 . PHE B 57  ? 0.2819 0.2628 0.3248 0.0198  0.0223  0.0056  57   PHE B CE1 
1707 C CE2 . PHE B 57  ? 0.3331 0.2997 0.3419 0.0174  0.0076  0.0184  57   PHE B CE2 
1708 C CZ  . PHE B 57  ? 0.2548 0.2281 0.2795 0.0210  0.0115  0.0061  57   PHE B CZ  
1709 N N   . PRO B 58  ? 0.2529 0.2394 0.2437 -0.0029 0.0265  0.0511  58   PRO B N   
1710 C CA  . PRO B 58  ? 0.2074 0.2005 0.1957 -0.0087 0.0295  0.0555  58   PRO B CA  
1711 C C   . PRO B 58  ? 0.2345 0.2360 0.2319 -0.0064 0.0303  0.0579  58   PRO B C   
1712 O O   . PRO B 58  ? 0.2146 0.2129 0.2135 -0.0036 0.0268  0.0577  58   PRO B O   
1713 C CB  . PRO B 58  ? 0.2579 0.2378 0.2294 -0.0148 0.0259  0.0586  58   PRO B CB  
1714 C CG  . PRO B 58  ? 0.2804 0.2518 0.2406 -0.0114 0.0220  0.0578  58   PRO B CG  
1715 C CD  . PRO B 58  ? 0.2648 0.2384 0.2386 -0.0033 0.0198  0.0512  58   PRO B CD  
1716 N N   . GLU B 59  ? 0.2457 0.2620 0.2488 -0.0072 0.0344  0.0588  59   GLU B N   
1717 C CA  . GLU B 59  ? 0.2267 0.2582 0.2363 -0.0030 0.0346  0.0609  59   GLU B CA  
1718 C C   . GLU B 59  ? 0.2262 0.2564 0.2312 -0.0062 0.0299  0.0575  59   GLU B C   
1719 O O   . GLU B 59  ? 0.2294 0.2511 0.2286 -0.0143 0.0287  0.0538  59   GLU B O   
1720 C CB  . GLU B 59  ? 0.2434 0.2933 0.2571 -0.0040 0.0378  0.0587  59   GLU B CB  
1721 C CG  . GLU B 59  ? 0.2419 0.3137 0.2620 0.0042  0.0372  0.0610  59   GLU B CG  
1722 C CD  . GLU B 59  ? 0.2955 0.3907 0.3205 0.0051  0.0387  0.0554  59   GLU B CD  
1723 O OE1 . GLU B 59  ? 0.2500 0.3435 0.2742 -0.0033 0.0410  0.0484  59   GLU B OE1 
1724 O OE2 . GLU B 59  ? 0.2868 0.4054 0.3162 0.0151  0.0375  0.0576  59   GLU B OE2 
1725 N N   . GLY B 60  ? 0.2092 0.2488 0.2189 -0.0002 0.0281  0.0587  60   GLY B N   
1726 C CA  . GLY B 60  ? 0.2142 0.2598 0.2250 -0.0024 0.0232  0.0516  60   GLY B CA  
1727 C C   . GLY B 60  ? 0.2239 0.2499 0.2320 -0.0038 0.0179  0.0483  60   GLY B C   
1728 O O   . GLY B 60  ? 0.2188 0.2520 0.2320 -0.0037 0.0134  0.0410  60   GLY B O   
1729 N N   . PHE B 61  ? 0.2213 0.1865 0.2572 0.0195  0.0107  0.0490  61   PHE B N   
1730 C CA  . PHE B 61  ? 0.2298 0.1807 0.2578 0.0197  0.0052  0.0418  61   PHE B CA  
1731 C C   . PHE B 61  ? 0.2144 0.1665 0.2392 0.0219  0.0018  0.0321  61   PHE B C   
1732 O O   . PHE B 61  ? 0.2233 0.1808 0.2440 0.0250  0.0063  0.0312  61   PHE B O   
1733 C CB  . PHE B 61  ? 0.2405 0.1785 0.2540 0.0235  0.0099  0.0452  61   PHE B CB  
1734 C CG  . PHE B 61  ? 0.2927 0.2229 0.3071 0.0219  0.0104  0.0518  61   PHE B CG  
1735 C CD1 . PHE B 61  ? 0.2438 0.1816 0.2720 0.0169  0.0102  0.0586  61   PHE B CD1 
1736 C CD2 . PHE B 61  ? 0.2842 0.1990 0.2853 0.0250  0.0105  0.0515  61   PHE B CD2 
1737 C CE1 . PHE B 61  ? 0.2846 0.2143 0.3132 0.0151  0.0112  0.0653  61   PHE B CE1 
1738 C CE2 . PHE B 61  ? 0.2671 0.1731 0.2671 0.0246  0.0117  0.0576  61   PHE B CE2 
1739 C CZ  . PHE B 61  ? 0.2671 0.1803 0.2809 0.0197  0.0125  0.0646  61   PHE B CZ  
1740 N N   . TRP B 62  ? 0.2293 0.1756 0.2548 0.0210  -0.0055 0.0258  62   TRP B N   
1741 C CA  . TRP B 62  ? 0.2455 0.1929 0.2679 0.0242  -0.0082 0.0182  62   TRP B CA  
1742 C C   . TRP B 62  ? 0.2359 0.1789 0.2477 0.0264  -0.0046 0.0186  62   TRP B C   
1743 O O   . TRP B 62  ? 0.2823 0.2159 0.2870 0.0262  -0.0036 0.0221  62   TRP B O   
1744 C CB  . TRP B 62  ? 0.2452 0.1863 0.2683 0.0247  -0.0159 0.0133  62   TRP B CB  
1745 C CG  . TRP B 62  ? 0.2111 0.1561 0.2327 0.0294  -0.0182 0.0070  62   TRP B CG  
1746 C CD1 . TRP B 62  ? 0.2814 0.2349 0.3061 0.0320  -0.0175 0.0036  62   TRP B CD1 
1747 C CD2 . TRP B 62  ? 0.2491 0.1911 0.2665 0.0325  -0.0209 0.0048  62   TRP B CD2 
1748 N NE1 . TRP B 62  ? 0.2269 0.1831 0.2500 0.0367  -0.0191 0.0000  62   TRP B NE1 
1749 C CE2 . TRP B 62  ? 0.2369 0.1873 0.2563 0.0369  -0.0214 0.0009  62   TRP B CE2 
1750 C CE3 . TRP B 62  ? 0.2406 0.1744 0.2529 0.0328  -0.0231 0.0062  62   TRP B CE3 
1751 C CZ2 . TRP B 62  ? 0.2687 0.2223 0.2872 0.0411  -0.0237 -0.0004 62   TRP B CZ2 
1752 C CZ3 . TRP B 62  ? 0.2956 0.2319 0.3060 0.0370  -0.0261 0.0040  62   TRP B CZ3 
1753 C CH2 . TRP B 62  ? 0.2337 0.1810 0.2481 0.0409  -0.0263 0.0011  62   TRP B CH2 
1754 N N   . MET B 63  ? 0.2463 0.1949 0.2561 0.0282  -0.0028 0.0153  63   MET B N   
1755 C CA  . MET B 63  ? 0.2428 0.1862 0.2421 0.0285  -0.0012 0.0153  63   MET B CA  
1756 C C   . MET B 63  ? 0.2496 0.1938 0.2509 0.0287  -0.0075 0.0113  63   MET B C   
1757 O O   . MET B 63  ? 0.2587 0.2120 0.2664 0.0305  -0.0092 0.0075  63   MET B O   
1758 C CB  . MET B 63  ? 0.2441 0.1921 0.2393 0.0296  0.0039  0.0149  63   MET B CB  
1759 C CG  . MET B 63  ? 0.2612 0.2112 0.2545 0.0312  0.0107  0.0195  63   MET B CG  
1760 S SD  . MET B 63  ? 0.3185 0.2548 0.2969 0.0324  0.0160  0.0275  63   MET B SD  
1761 C CE  . MET B 63  ? 0.3171 0.2390 0.2760 0.0320  0.0158  0.0256  63   MET B CE  
1762 N N   . PRO B 64  ? 0.2682 0.2036 0.2635 0.0280  -0.0105 0.0127  64   PRO B N   
1763 C CA  . PRO B 64  ? 0.2602 0.1984 0.2584 0.0291  -0.0168 0.0101  64   PRO B CA  
1764 C C   . PRO B 64  ? 0.2496 0.1897 0.2434 0.0268  -0.0186 0.0103  64   PRO B C   
1765 O O   . PRO B 64  ? 0.2434 0.1778 0.2282 0.0240  -0.0155 0.0121  64   PRO B O   
1766 C CB  . PRO B 64  ? 0.2980 0.2251 0.2915 0.0296  -0.0190 0.0121  64   PRO B CB  
1767 C CG  . PRO B 64  ? 0.2947 0.2112 0.2770 0.0279  -0.0142 0.0167  64   PRO B CG  
1768 C CD  . PRO B 64  ? 0.2926 0.2151 0.2775 0.0274  -0.0083 0.0176  64   PRO B CD  
1769 N N   . TYR B 65  ? 0.2527 0.2014 0.2528 0.0281  -0.0237 0.0090  65   TYR B N   
1770 C CA  . TYR B 65  ? 0.2498 0.2032 0.2489 0.0246  -0.0276 0.0104  65   TYR B CA  
1771 C C   . TYR B 65  ? 0.2527 0.2134 0.2537 0.0212  -0.0246 0.0106  65   TYR B C   
1772 O O   . TYR B 65  ? 0.2439 0.2040 0.2409 0.0157  -0.0276 0.0125  65   TYR B O   
1773 C CB  . TYR B 65  ? 0.3059 0.2445 0.2915 0.0212  -0.0309 0.0127  65   TYR B CB  
1774 C CG  . TYR B 65  ? 0.2636 0.1961 0.2473 0.0250  -0.0343 0.0129  65   TYR B CG  
1775 C CD1 . TYR B 65  ? 0.3337 0.2740 0.3219 0.0267  -0.0409 0.0132  65   TYR B CD1 
1776 C CD2 . TYR B 65  ? 0.2876 0.2073 0.2650 0.0272  -0.0307 0.0136  65   TYR B CD2 
1777 C CE1 . TYR B 65  ? 0.3372 0.2700 0.3213 0.0311  -0.0435 0.0133  65   TYR B CE1 
1778 C CE2 . TYR B 65  ? 0.3079 0.2206 0.2827 0.0305  -0.0331 0.0140  65   TYR B CE2 
1779 C CZ  . TYR B 65  ? 0.2724 0.1900 0.2491 0.0329  -0.0394 0.0134  65   TYR B CZ  
1780 O OH  . TYR B 65  ? 0.3056 0.2138 0.2771 0.0371  -0.0413 0.0139  65   TYR B OH  
1781 N N   . LEU B 66  ? 0.2228 0.1891 0.2289 0.0242  -0.0192 0.0086  66   LEU B N   
1782 C CA  . LEU B 66  ? 0.2180 0.1904 0.2251 0.0221  -0.0154 0.0087  66   LEU B CA  
1783 C C   . LEU B 66  ? 0.2282 0.2183 0.2484 0.0240  -0.0177 0.0094  66   LEU B C   
1784 O O   . LEU B 66  ? 0.2476 0.2448 0.2753 0.0299  -0.0201 0.0086  66   LEU B O   
1785 C CB  . LEU B 66  ? 0.2545 0.2268 0.2616 0.0257  -0.0089 0.0067  66   LEU B CB  
1786 C CG  . LEU B 66  ? 0.2238 0.1831 0.2202 0.0251  -0.0049 0.0078  66   LEU B CG  
1787 C CD1 . LEU B 66  ? 0.2341 0.1994 0.2349 0.0292  0.0002  0.0061  66   LEU B CD1 
1788 C CD2 . LEU B 66  ? 0.2247 0.1716 0.2054 0.0207  -0.0030 0.0104  66   LEU B CD2 
1789 N N   . THR B 67  ? 0.2218 0.2176 0.2433 0.0191  -0.0172 0.0116  67   THR B N   
1790 C CA  . THR B 67  ? 0.2510 0.2667 0.2868 0.0212  -0.0174 0.0140  67   THR B CA  
1791 C C   . THR B 67  ? 0.2444 0.2632 0.2812 0.0251  -0.0100 0.0122  67   THR B C   
1792 O O   . THR B 67  ? 0.2567 0.2660 0.2839 0.0204  -0.0062 0.0118  67   THR B O   
1793 C CB  . THR B 67  ? 0.2876 0.3085 0.3252 0.0116  -0.0219 0.0190  67   THR B CB  
1794 O OG1 . THR B 67  ? 0.2782 0.2934 0.3119 0.0078  -0.0296 0.0202  67   THR B OG1 
1795 C CG2 . THR B 67  ? 0.2894 0.3348 0.3447 0.0139  -0.0216 0.0237  67   THR B CG2 
1796 N N   . ILE B 68  ? 0.2209 0.2979 0.2593 0.0135  0.0196  -0.0057 68   ILE B N   
1797 C CA  . ILE B 68  ? 0.2207 0.3038 0.2530 0.0201  0.0234  -0.0035 68   ILE B CA  
1798 C C   . ILE B 68  ? 0.2546 0.3149 0.2910 0.0153  0.0272  -0.0029 68   ILE B C   
1799 O O   . ILE B 68  ? 0.2828 0.3371 0.3214 0.0074  0.0262  -0.0034 68   ILE B O   
1800 C CB  . ILE B 68  ? 0.2393 0.3603 0.2670 0.0107  0.0210  0.0021  68   ILE B CB  
1801 C CG1 . ILE B 68  ? 0.2988 0.4673 0.3246 0.0119  0.0176  0.0055  68   ILE B CG1 
1802 C CG2 . ILE B 68  ? 0.1969 0.3289 0.2185 0.0190  0.0245  0.0047  68   ILE B CG2 
1803 C CD1 . ILE B 68  ? 0.3063 0.5322 0.3257 -0.0052 0.0131  0.0173  68   ILE B CD1 
1804 N N   . ALA B 69  ? 0.2396 0.2856 0.2698 0.0225  0.0297  -0.0016 69   ALA B N   
1805 C CA  . ALA B 69  ? 0.2478 0.2869 0.2806 0.0177  0.0343  0.0016  69   ALA B CA  
1806 C C   . ALA B 69  ? 0.2833 0.3287 0.3058 0.0240  0.0364  0.0034  69   ALA B C   
1807 O O   . ALA B 69  ? 0.2413 0.2939 0.2525 0.0359  0.0339  0.0031  69   ALA B O   
1808 C CB  . ALA B 69  ? 0.3002 0.3197 0.3283 0.0113  0.0321  0.0063  69   ALA B CB  
1809 N N   . TYR B 70  ? 0.2834 0.3310 0.3072 0.0203  0.0410  0.0052  70   TYR B N   
1810 C CA  . TYR B 70  ? 0.2942 0.3459 0.3075 0.0246  0.0428  0.0080  70   TYR B CA  
1811 C C   . TYR B 70  ? 0.2963 0.3394 0.3069 0.0215  0.0470  0.0131  70   TYR B C   
1812 O O   . TYR B 70  ? 0.2739 0.3236 0.2935 0.0149  0.0501  0.0154  70   TYR B O   
1813 C CB  . TYR B 70  ? 0.2844 0.3478 0.2920 0.0197  0.0414  0.0068  70   TYR B CB  
1814 C CG  . TYR B 70  ? 0.2676 0.3185 0.2702 0.0186  0.0431  0.0037  70   TYR B CG  
1815 C CD1 . TYR B 70  ? 0.2873 0.3262 0.2866 0.0181  0.0386  -0.0009 70   TYR B CD1 
1816 C CD2 . TYR B 70  ? 0.2411 0.2922 0.2372 0.0232  0.0487  0.0051  70   TYR B CD2 
1817 C CE1 . TYR B 70  ? 0.3042 0.3298 0.2892 0.0286  0.0387  -0.0058 70   TYR B CE1 
1818 C CE2 . TYR B 70  ? 0.2886 0.3344 0.2741 0.0317  0.0506  0.0008  70   TYR B CE2 
1819 C CZ  . TYR B 70  ? 0.2989 0.3307 0.2766 0.0377  0.0452  -0.0055 70   TYR B CZ  
1820 O OH  . TYR B 70  ? 0.4498 0.4738 0.4074 0.0571  0.0452  -0.0120 70   TYR B OH  
1821 N N   . GLU B 71  ? 0.2936 0.3304 0.2901 0.0266  0.0464  0.0167  71   GLU B N   
1822 C CA  . GLU B 71  ? 0.2837 0.3168 0.2736 0.0202  0.0496  0.0237  71   GLU B CA  
1823 C C   . GLU B 71  ? 0.3037 0.3470 0.2865 0.0267  0.0521  0.0232  71   GLU B C   
1824 O O   . GLU B 71  ? 0.2801 0.3247 0.2536 0.0371  0.0481  0.0225  71   GLU B O   
1825 C CB  . GLU B 71  ? 0.3403 0.3387 0.3073 0.0154  0.0412  0.0312  71   GLU B CB  
1826 C CG  . GLU B 71  ? 0.4270 0.4221 0.3815 0.0027  0.0419  0.0422  71   GLU B CG  
1827 C CD  . GLU B 71  ? 0.6892 0.6298 0.6029 -0.0051 0.0270  0.0514  71   GLU B CD  
1828 O OE1 . GLU B 71  ? 0.7136 0.6309 0.6150 -0.0240 0.0176  0.0579  71   GLU B OE1 
1829 O OE2 . GLU B 71  ? 0.7202 0.6361 0.6075 0.0067  0.0222  0.0528  71   GLU B OE2 
1830 N N   . LEU B 72  ? 0.2813 0.3366 0.2653 0.0231  0.0582  0.0242  72   LEU B N   
1831 C CA  . LEU B 72  ? 0.2621 0.3229 0.2347 0.0265  0.0595  0.0238  72   LEU B CA  
1832 C C   . LEU B 72  ? 0.2965 0.3596 0.2613 0.0231  0.0640  0.0315  72   LEU B C   
1833 O O   . LEU B 72  ? 0.2686 0.3478 0.2386 0.0188  0.0698  0.0346  72   LEU B O   
1834 C CB  . LEU B 72  ? 0.2987 0.3606 0.2655 0.0275  0.0591  0.0162  72   LEU B CB  
1835 C CG  . LEU B 72  ? 0.3610 0.4189 0.3065 0.0261  0.0558  0.0153  72   LEU B CG  
1836 C CD1 . LEU B 72  ? 0.2774 0.3491 0.2220 0.0200  0.0492  0.0202  72   LEU B CD1 
1837 C CD2 . LEU B 72  ? 0.4209 0.4544 0.3410 0.0280  0.0494  0.0064  72   LEU B CD2 
1838 N N   . LYS B 73  ? 0.2907 0.3455 0.2418 0.0259  0.0610  0.0361  73   LYS B N   
1839 C CA  . LYS B 73  ? 0.2960 0.3470 0.2345 0.0193  0.0625  0.0457  73   LYS B CA  
1840 C C   . LYS B 73  ? 0.2706 0.3303 0.1990 0.0249  0.0644  0.0449  73   LYS B C   
1841 O O   . LYS B 73  ? 0.2973 0.3570 0.2199 0.0335  0.0591  0.0432  73   LYS B O   
1842 C CB  . LYS B 73  ? 0.3077 0.3217 0.2245 0.0182  0.0519  0.0536  73   LYS B CB  
1843 C CG  . LYS B 73  ? 0.3918 0.3903 0.2847 0.0072  0.0486  0.0662  73   LYS B CG  
1844 C CD  . LYS B 73  ? 0.5271 0.4634 0.3787 0.0040  0.0310  0.0747  73   LYS B CD  
1845 C CE  . LYS B 73  ? 0.6790 0.5980 0.5045 -0.0258 0.0245  0.0931  73   LYS B CE  
1846 N NZ  . LYS B 73  ? 0.7950 0.6298 0.5598 -0.0339 0.0003  0.1034  73   LYS B NZ  
1847 N N   . ASN B 74  ? 0.2911 0.3660 0.2157 0.0208  0.0713  0.0473  74   ASN B N   
1848 C CA  . ASN B 74  ? 0.2837 0.3624 0.1931 0.0238  0.0723  0.0481  74   ASN B CA  
1849 C C   . ASN B 74  ? 0.2939 0.3602 0.1895 0.0179  0.0688  0.0607  74   ASN B C   
1850 O O   . ASN B 74  ? 0.3526 0.4234 0.2446 0.0044  0.0709  0.0709  74   ASN B O   
1851 C CB  . ASN B 74  ? 0.2955 0.3926 0.1986 0.0282  0.0804  0.0433  74   ASN B CB  
1852 C CG  . ASN B 74  ? 0.2760 0.3717 0.1573 0.0308  0.0802  0.0434  74   ASN B CG  
1853 O OD1 . ASN B 74  ? 0.3487 0.4414 0.2245 0.0253  0.0778  0.0526  74   ASN B OD1 
1854 N ND2 . ASN B 74  ? 0.3079 0.3977 0.1691 0.0409  0.0802  0.0325  74   ASN B ND2 
1855 N N   . THR B 75  ? 0.3195 0.3723 0.2024 0.0269  0.0614  0.0621  75   THR B N   
1856 C CA  . THR B 75  ? 0.3741 0.3968 0.2314 0.0270  0.0530  0.0732  75   THR B CA  
1857 C C   . THR B 75  ? 0.3903 0.4215 0.2342 0.0181  0.0565  0.0814  75   THR B C   
1858 O O   . THR B 75  ? 0.4728 0.4764 0.2907 0.0098  0.0490  0.0936  75   THR B O   
1859 C CB  . THR B 75  ? 0.3969 0.4040 0.2384 0.0512  0.0421  0.0711  75   THR B CB  
1860 O OG1 . THR B 75  ? 0.4412 0.4872 0.2915 0.0602  0.0445  0.0674  75   THR B OG1 
1861 C CG2 . THR B 75  ? 0.4061 0.4045 0.2549 0.0615  0.0381  0.0641  75   THR B CG2 
1862 N N   . ASP B 76  ? 0.3698 0.4317 0.2236 0.0193  0.0654  0.0747  76   ASP B N   
1863 C CA  . ASP B 76  ? 0.3876 0.4628 0.2280 0.0134  0.0704  0.0804  76   ASP B CA  
1864 C C   . ASP B 76  ? 0.3885 0.4874 0.2325 -0.0008 0.0787  0.0881  76   ASP B C   
1865 O O   . ASP B 76  ? 0.4515 0.5556 0.2800 -0.0152 0.0782  0.1024  76   ASP B O   
1866 C CB  . ASP B 76  ? 0.4097 0.5005 0.2476 0.0209  0.0740  0.0695  76   ASP B CB  
1867 C CG  . ASP B 76  ? 0.4703 0.5587 0.3045 0.0265  0.0646  0.0670  76   ASP B CG  
1868 O OD1 . ASP B 76  ? 0.4614 0.5449 0.2887 0.0325  0.0581  0.0750  76   ASP B OD1 
1869 O OD2 . ASP B 76  ? 0.5005 0.5932 0.3327 0.0245  0.0619  0.0584  76   ASP B OD2 
1870 N N   . THR B 77  ? 0.3678 0.4886 0.2302 0.0027  0.0856  0.0802  77   THR B N   
1871 C CA  . THR B 77  ? 0.3604 0.5277 0.2298 -0.0054 0.0948  0.0876  77   THR B CA  
1872 C C   . THR B 77  ? 0.3594 0.5267 0.2358 -0.0295 0.0890  0.1022  77   THR B C   
1873 O O   . THR B 77  ? 0.4220 0.6321 0.2974 -0.0498 0.0920  0.1184  77   THR B O   
1874 C CB  . THR B 77  ? 0.3509 0.5453 0.2291 0.0176  0.1037  0.0714  77   THR B CB  
1875 O OG1 . THR B 77  ? 0.2888 0.4617 0.1833 0.0197  0.0988  0.0638  77   THR B OG1 
1876 C CG2 . THR B 77  ? 0.3900 0.5657 0.2457 0.0386  0.1037  0.0562  77   THR B CG2 
1877 N N   . GLY B 78  ? 0.3625 0.5240 0.2538 -0.1689 0.1008  0.0953  78   GLY B N   
1878 C CA  . GLY B 78  ? 0.3898 0.5309 0.2972 -0.1771 0.0895  0.1012  78   GLY B CA  
1879 C C   . GLY B 78  ? 0.3991 0.5454 0.2979 -0.1547 0.1020  0.0721  78   GLY B C   
1880 O O   . GLY B 78  ? 0.4708 0.5882 0.3724 -0.1651 0.0876  0.0762  78   GLY B O   
1881 N N   . ALA B 79  ? 0.3822 0.5514 0.2655 -0.1261 0.1221  0.0444  79   ALA B N   
1882 C CA  . ALA B 79  ? 0.3677 0.5474 0.2523 -0.1027 0.1337  0.0209  79   ALA B CA  
1883 C C   . ALA B 79  ? 0.3500 0.4604 0.2408 -0.0922 0.1276  0.0069  79   ALA B C   
1884 O O   . ALA B 79  ? 0.3361 0.4013 0.2251 -0.0812 0.1253  0.0054  79   ALA B O   
1885 C CB  . ALA B 79  ? 0.4032 0.5983 0.2630 -0.0704 0.1488  -0.0065 79   ALA B CB  
1886 N N   . ILE B 80  ? 0.3442 0.4573 0.2416 -0.0969 0.1243  0.0051  80   ILE B N   
1887 C CA  . ILE B 80  ? 0.3155 0.3695 0.2056 -0.0861 0.1196  -0.0097 80   ILE B CA  
1888 C C   . ILE B 80  ? 0.3671 0.4583 0.2730 -0.0793 0.1257  -0.0197 80   ILE B C   
1889 O O   . ILE B 80  ? 0.3167 0.4655 0.2375 -0.0955 0.1255  -0.0021 80   ILE B O   
1890 C CB  . ILE B 80  ? 0.4291 0.4180 0.2928 -0.1100 0.0958  0.0019  80   ILE B CB  
1891 C CG1 . ILE B 80  ? 0.4738 0.4158 0.3279 -0.1116 0.0875  0.0149  80   ILE B CG1 
1892 C CG2 . ILE B 80  ? 0.4577 0.3823 0.2909 -0.0932 0.0929  -0.0186 80   ILE B CG2 
1893 C CD1 . ILE B 80  ? 0.6197 0.4828 0.4408 -0.1391 0.0520  0.0288  80   ILE B CD1 
1894 N N   . LYS B 81  ? 0.3587 0.4307 0.2695 -0.0567 0.1299  -0.0371 81   LYS B N   
1895 C CA  . LYS B 81  ? 0.3362 0.4379 0.2681 -0.0539 0.1308  -0.0421 81   LYS B CA  
1896 C C   . LYS B 81  ? 0.3512 0.4127 0.2682 -0.0483 0.1250  -0.0496 81   LYS B C   
1897 O O   . LYS B 81  ? 0.3548 0.3789 0.2529 -0.0296 0.1278  -0.0521 81   LYS B O   
1898 C CB  . LYS B 81  ? 0.3084 0.4449 0.2658 -0.0287 0.1383  -0.0526 81   LYS B CB  
1899 C CG  . LYS B 81  ? 0.3362 0.4432 0.2940 -0.0105 0.1298  -0.0590 81   LYS B CG  
1900 C CD  . LYS B 81  ? 0.5036 0.6117 0.4594 0.0081  0.1238  -0.0714 81   LYS B CD  
1901 C CE  . LYS B 81  ? 0.4908 0.6252 0.4753 0.0232  0.1237  -0.0789 81   LYS B CE  
1902 N NZ  . LYS B 81  ? 0.3962 0.5001 0.3577 0.0515  0.1133  -0.0981 81   LYS B NZ  
1903 N N   . ARG B 82  ? 0.3337 0.4115 0.2571 -0.0633 0.1183  -0.0470 82   ARG B N   
1904 C CA  . ARG B 82  ? 0.3446 0.3933 0.2427 -0.0593 0.1131  -0.0545 82   ARG B CA  
1905 C C   . ARG B 82  ? 0.2880 0.3978 0.2352 -0.0602 0.1120  -0.0486 82   ARG B C   
1906 O O   . ARG B 82  ? 0.3011 0.4614 0.2912 -0.0716 0.1121  -0.0369 82   ARG B O   
1907 C CB  . ARG B 82  ? 0.4420 0.4327 0.2821 -0.0926 0.0923  -0.0525 82   ARG B CB  
1908 C CG  . ARG B 82  ? 0.6089 0.5234 0.3976 -0.1022 0.0791  -0.0528 82   ARG B CG  
1909 C CD  . ARG B 82  ? 0.8208 0.6528 0.5361 -0.1409 0.0424  -0.0504 82   ARG B CD  
1910 N NE  . ARG B 82  ? 1.0529 0.7770 0.7016 -0.1488 0.0171  -0.0536 82   ARG B NE  
1911 C CZ  . ARG B 82  ? 1.1874 0.8154 0.7706 -0.1044 0.0243  -0.0819 82   ARG B CZ  
1912 N NH1 . ARG B 82  ? 1.1812 0.8274 0.7613 -0.0478 0.0601  -0.1027 82   ARG B NH1 
1913 N NH2 . ARG B 82  ? 1.3224 0.8423 0.8477 -0.1139 -0.0058 -0.0817 82   ARG B NH2 
1914 N N   . GLY B 83  ? 0.3088 0.4227 0.2524 -0.0451 0.1118  -0.0507 83   GLY B N   
1915 C CA  . GLY B 83  ? 0.2514 0.4233 0.2413 -0.0546 0.1035  -0.0388 83   GLY B CA  
1916 C C   . GLY B 83  ? 0.2862 0.4659 0.2523 -0.0421 0.1032  -0.0364 83   GLY B C   
1917 O O   . GLY B 83  ? 0.3130 0.4400 0.2076 -0.0223 0.1127  -0.0492 83   GLY B O   
1918 N N   . THR B 84  ? 0.2499 0.3436 0.2613 -0.0263 0.0117  -0.0630 84   THR B N   
1919 C CA  . THR B 84  ? 0.2810 0.3669 0.2919 -0.0257 0.0072  -0.0588 84   THR B CA  
1920 C C   . THR B 84  ? 0.2640 0.3465 0.2866 -0.0153 0.0056  -0.0608 84   THR B C   
1921 O O   . THR B 84  ? 0.3552 0.4451 0.3895 -0.0095 0.0069  -0.0641 84   THR B O   
1922 C CB  . THR B 84  ? 0.3289 0.4278 0.3487 -0.0313 0.0034  -0.0530 84   THR B CB  
1923 O OG1 . THR B 84  ? 0.4372 0.5570 0.4806 -0.0253 0.0038  -0.0527 84   THR B OG1 
1924 C CG2 . THR B 84  ? 0.3577 0.4577 0.3618 -0.0456 0.0031  -0.0495 84   THR B CG2 
1925 N N   . LEU B 85  ? 0.2128 0.2813 0.2295 -0.0131 0.0040  -0.0586 85   LEU B N   
1926 C CA  . LEU B 85  ? 0.2258 0.2926 0.2549 -0.0054 0.0015  -0.0588 85   LEU B CA  
1927 C C   . LEU B 85  ? 0.2435 0.3134 0.2816 -0.0045 -0.0007 -0.0555 85   LEU B C   
1928 O O   . LEU B 85  ? 0.3319 0.3969 0.3608 -0.0103 -0.0011 -0.0513 85   LEU B O   
1929 C CB  . LEU B 85  ? 0.2300 0.2841 0.2531 -0.0027 0.0012  -0.0564 85   LEU B CB  
1930 C CG  . LEU B 85  ? 0.2734 0.3232 0.2863 -0.0037 0.0021  -0.0582 85   LEU B CG  
1931 C CD1 . LEU B 85  ? 0.2996 0.3406 0.3108 -0.0002 0.0014  -0.0522 85   LEU B CD1 
1932 C CD2 . LEU B 85  ? 0.2322 0.2871 0.2496 -0.0028 0.0004  -0.0641 85   LEU B CD2 
1933 N N   . MET B 86  ? 0.1989 0.2740 0.2515 0.0018  -0.0023 -0.0571 86   MET B N   
1934 C CA  A MET B 86  ? 0.2134 0.2916 0.2748 0.0036  -0.0047 -0.0542 86   MET B CA  
1935 C CA  B MET B 86  ? 0.2105 0.2892 0.2725 0.0038  -0.0047 -0.0543 86   MET B CA  
1936 C C   . MET B 86  ? 0.1990 0.2657 0.2634 0.0084  -0.0059 -0.0535 86   MET B C   
1937 O O   . MET B 86  ? 0.1855 0.2487 0.2521 0.0116  -0.0060 -0.0558 86   MET B O   
1938 C CB  A MET B 86  ? 0.2158 0.3097 0.2916 0.0080  -0.0040 -0.0554 86   MET B CB  
1939 C CB  B MET B 86  ? 0.2073 0.3002 0.2835 0.0091  -0.0037 -0.0563 86   MET B CB  
1940 C CG  A MET B 86  ? 0.3004 0.4103 0.3783 0.0030  -0.0024 -0.0535 86   MET B CG  
1941 C CG  B MET B 86  ? 0.2764 0.3848 0.3549 0.0056  -0.0009 -0.0556 86   MET B CG  
1942 S SD  A MET B 86  ? 0.4111 0.5270 0.4855 -0.0075 -0.0079 -0.0456 86   MET B SD  
1943 S SD  B MET B 86  ? 0.3846 0.5023 0.4745 0.0149  0.0057  -0.0587 86   MET B SD  
1944 C CE  A MET B 86  ? 0.3025 0.4255 0.3937 -0.0005 -0.0119 -0.0416 86   MET B CE  
1945 C CE  B MET B 86  ? 0.1754 0.2731 0.2491 0.0152  0.0076  -0.0662 86   MET B CE  
1946 N N   . PRO B 87  ? 0.1705 0.2300 0.2331 0.0076  -0.0072 -0.0495 87   PRO B N   
1947 C CA  . PRO B 87  ? 0.1674 0.2156 0.2333 0.0121  -0.0071 -0.0482 87   PRO B CA  
1948 C C   . PRO B 87  ? 0.1568 0.2107 0.2357 0.0181  -0.0089 -0.0517 87   PRO B C   
1949 O O   . PRO B 87  ? 0.1862 0.2490 0.2707 0.0198  -0.0100 -0.0521 87   PRO B O   
1950 C CB  . PRO B 87  ? 0.1730 0.2087 0.2288 0.0087  -0.0071 -0.0433 87   PRO B CB  
1951 C CG  . PRO B 87  ? 0.1748 0.2211 0.2290 0.0031  -0.0105 -0.0423 87   PRO B CG  
1952 C CD  . PRO B 87  ? 0.2209 0.2818 0.2779 0.0014  -0.0094 -0.0454 87   PRO B CD  
1953 N N   . MET B 88  ? 0.1510 0.1992 0.2336 0.0210  -0.0090 -0.0530 88   MET B N   
1954 C CA  . MET B 88  ? 0.1644 0.2121 0.2533 0.0255  -0.0099 -0.0566 88   MET B CA  
1955 C C   . MET B 88  ? 0.1786 0.2177 0.2697 0.0252  -0.0111 -0.0554 88   MET B C   
1956 O O   . MET B 88  ? 0.1645 0.2019 0.2557 0.0230  -0.0108 -0.0511 88   MET B O   
1957 C CB  . MET B 88  ? 0.2095 0.2630 0.2969 0.0265  -0.0087 -0.0614 88   MET B CB  
1958 C CG  . MET B 88  ? 0.2018 0.2529 0.2833 0.0224  -0.0099 -0.0626 88   MET B CG  
1959 S SD  . MET B 88  ? 0.2308 0.2828 0.3041 0.0224  -0.0068 -0.0681 88   MET B SD  
1960 C CE  . MET B 88  ? 0.1894 0.2553 0.2642 0.0209  -0.0039 -0.0664 88   MET B CE  
1961 N N   . VAL B 89  ? 0.1737 0.2075 0.2667 0.0276  -0.0120 -0.0582 89   VAL B N   
1962 C CA  . VAL B 89  ? 0.1884 0.2156 0.2840 0.0254  -0.0140 -0.0566 89   VAL B CA  
1963 C C   . VAL B 89  ? 0.2077 0.2302 0.2966 0.0228  -0.0164 -0.0611 89   VAL B C   
1964 O O   . VAL B 89  ? 0.2130 0.2311 0.2948 0.0263  -0.0139 -0.0662 89   VAL B O   
1965 C CB  . VAL B 89  ? 0.2055 0.2237 0.3044 0.0283  -0.0126 -0.0549 89   VAL B CB  
1966 C CG1 . VAL B 89  ? 0.2401 0.2530 0.3351 0.0331  -0.0117 -0.0599 89   VAL B CG1 
1967 C CG2 . VAL B 89  ? 0.1986 0.2130 0.3035 0.0248  -0.0141 -0.0509 89   VAL B CG2 
1968 N N   . ALA B 90  ? 0.2462 0.2687 0.3359 0.0163  -0.0209 -0.0582 90   ALA B N   
1969 C CA  . ALA B 90  ? 0.2495 0.2628 0.3285 0.0100  -0.0250 -0.0610 90   ALA B CA  
1970 C C   . ALA B 90  ? 0.2300 0.2398 0.3148 0.0046  -0.0292 -0.0565 90   ALA B C   
1971 O O   . ALA B 90  ? 0.2210 0.2356 0.3191 0.0076  -0.0272 -0.0516 90   ALA B O   
1972 C CB  . ALA B 90  ? 0.2718 0.2890 0.3451 0.0037  -0.0294 -0.0599 90   ALA B CB  
1973 N N   . ASP B 91  ? 0.2523 0.2529 0.3260 -0.0044 -0.0350 -0.0573 91   ASP B N   
1974 C CA  . ASP B 91  ? 0.2672 0.2659 0.3464 -0.0121 -0.0400 -0.0522 91   ASP B CA  
1975 C C   . ASP B 91  ? 0.2426 0.2609 0.3445 -0.0145 -0.0434 -0.0406 91   ASP B C   
1976 O O   . ASP B 91  ? 0.2718 0.2939 0.3862 -0.0174 -0.0445 -0.0343 91   ASP B O   
1977 C CB  . ASP B 91  ? 0.2933 0.2747 0.3506 -0.0244 -0.0465 -0.0549 91   ASP B CB  
1978 C CG  . ASP B 91  ? 0.3913 0.3751 0.4403 -0.0340 -0.0545 -0.0523 91   ASP B CG  
1979 O OD1 . ASP B 91  ? 0.4103 0.4090 0.4694 -0.0303 -0.0545 -0.0495 91   ASP B OD1 
1980 O OD2 . ASP B 91  ? 0.5519 0.5186 0.5795 -0.0464 -0.0609 -0.0536 91   ASP B OD2 
1981 N N   . ASP B 92  ? 0.2291 0.2597 0.3368 -0.0126 -0.0439 -0.0370 92   ASP B N   
1982 C CA  . ASP B 92  ? 0.2460 0.2945 0.3753 -0.0118 -0.0445 -0.0245 92   ASP B CA  
1983 C C   . ASP B 92  ? 0.2065 0.2579 0.3438 -0.0002 -0.0342 -0.0225 92   ASP B C   
1984 O O   . ASP B 92  ? 0.2244 0.2868 0.3741 0.0028  -0.0318 -0.0126 92   ASP B O   
1985 C CB  . ASP B 92  ? 0.2517 0.3106 0.3814 -0.0190 -0.0530 -0.0185 92   ASP B CB  
1986 C CG  . ASP B 92  ? 0.2980 0.3519 0.4120 -0.0161 -0.0512 -0.0260 92   ASP B CG  
1987 O OD1 . ASP B 92  ? 0.3353 0.3797 0.4390 -0.0094 -0.0440 -0.0356 92   ASP B OD1 
1988 O OD2 . ASP B 92  ? 0.4136 0.4740 0.5260 -0.0212 -0.0575 -0.0214 92   ASP B OD2 
1989 N N   . GLY B 93  ? 0.1823 0.2222 0.3108 0.0059  -0.0281 -0.0309 93   GLY B N   
1990 C CA  . GLY B 93  ? 0.1859 0.2230 0.3170 0.0143  -0.0194 -0.0291 93   GLY B CA  
1991 C C   . GLY B 93  ? 0.1701 0.2062 0.2900 0.0177  -0.0166 -0.0342 93   GLY B C   
1992 O O   . GLY B 93  ? 0.2068 0.2450 0.3181 0.0148  -0.0204 -0.0402 93   GLY B O   
1993 N N   . PRO B 94  ? 0.1785 0.2090 0.2959 0.0226  -0.0097 -0.0318 94   PRO B N   
1994 C CA  . PRO B 94  ? 0.1743 0.2034 0.2802 0.0236  -0.0076 -0.0355 94   PRO B CA  
1995 C C   . PRO B 94  ? 0.1838 0.2195 0.2870 0.0221  -0.0076 -0.0323 94   PRO B C   
1996 O O   . PRO B 94  ? 0.1695 0.2095 0.2808 0.0226  -0.0069 -0.0240 94   PRO B O   
1997 C CB  . PRO B 94  ? 0.2049 0.2212 0.3048 0.0267  -0.0013 -0.0325 94   PRO B CB  
1998 C CG  . PRO B 94  ? 0.1734 0.1856 0.2831 0.0292  0.0034  -0.0236 94   PRO B CG  
1999 C CD  . PRO B 94  ? 0.1755 0.1977 0.2981 0.0263  -0.0031 -0.0248 94   PRO B CD  
2000 N N   . HIS B 95  ? 0.1953 0.2333 0.2886 0.0204  -0.0085 -0.0382 95   HIS B N   
2001 C CA  . HIS B 95  ? 0.1672 0.2084 0.2535 0.0188  -0.0078 -0.0367 95   HIS B CA  
2002 C C   . HIS B 95  ? 0.1940 0.2350 0.2687 0.0169  -0.0063 -0.0423 95   HIS B C   
2003 O O   . HIS B 95  ? 0.1896 0.2306 0.2646 0.0173  -0.0066 -0.0460 95   HIS B O   
2004 C CB  . HIS B 95  ? 0.1801 0.2289 0.2697 0.0153  -0.0141 -0.0374 95   HIS B CB  
2005 C CG  . HIS B 95  ? 0.1524 0.2013 0.2375 0.0128  -0.0178 -0.0463 95   HIS B CG  
2006 N ND1 . HIS B 95  ? 0.2384 0.2846 0.3272 0.0111  -0.0219 -0.0481 95   HIS B ND1 
2007 C CD2 . HIS B 95  ? 0.1913 0.2404 0.2675 0.0125  -0.0162 -0.0532 95   HIS B CD2 
2008 C CE1 . HIS B 95  ? 0.2526 0.2946 0.3323 0.0106  -0.0218 -0.0558 95   HIS B CE1 
2009 N NE2 . HIS B 95  ? 0.1989 0.2442 0.2731 0.0121  -0.0180 -0.0586 95   HIS B NE2 
2010 N N   . TYR B 96  ? 0.1563 0.1983 0.2217 0.0147  -0.0049 -0.0420 96   TYR B N   
2011 C CA  . TYR B 96  ? 0.1523 0.1972 0.2079 0.0112  -0.0041 -0.0471 96   TYR B CA  
2012 C C   . TYR B 96  ? 0.1882 0.2394 0.2435 0.0097  -0.0069 -0.0521 96   TYR B C   
2013 O O   . TYR B 96  ? 0.1878 0.2376 0.2412 0.0091  -0.0087 -0.0496 96   TYR B O   
2014 C CB  . TYR B 96  ? 0.1621 0.1979 0.2017 0.0086  0.0009  -0.0430 96   TYR B CB  
2015 C CG  . TYR B 96  ? 0.1584 0.1806 0.1910 0.0090  0.0050  -0.0378 96   TYR B CG  
2016 C CD1 . TYR B 96  ? 0.2072 0.2271 0.2334 0.0045  0.0040  -0.0391 96   TYR B CD1 
2017 C CD2 . TYR B 96  ? 0.1586 0.1691 0.1902 0.0138  0.0101  -0.0303 96   TYR B CD2 
2018 C CE1 . TYR B 96  ? 0.1990 0.2013 0.2137 0.0033  0.0072  -0.0343 96   TYR B CE1 
2019 C CE2 . TYR B 96  ? 0.2080 0.2003 0.2291 0.0145  0.0159  -0.0255 96   TYR B CE2 
2020 C CZ  . TYR B 96  ? 0.1871 0.1735 0.1975 0.0084  0.0139  -0.0282 96   TYR B CZ  
2021 O OH  . TYR B 96  ? 0.2288 0.1918 0.2232 0.0075  0.0192  -0.0233 96   TYR B OH  
2022 N N   . GLY B 97  ? 0.2169 0.2499 0.1789 0.0072  0.0003  -0.0352 97   GLY B N   
2023 C CA  . GLY B 97  ? 0.1886 0.2389 0.1634 0.0054  -0.0007 -0.0340 97   GLY B CA  
2024 C C   . GLY B 97  ? 0.1392 0.2001 0.1195 0.0004  -0.0048 -0.0373 97   GLY B C   
2025 O O   . GLY B 97  ? 0.2234 0.2832 0.2012 -0.0022 -0.0091 -0.0403 97   GLY B O   
2026 N N   . ALA B 98  ? 0.2021 0.2737 0.1900 -0.0010 -0.0036 -0.0358 98   ALA B N   
2027 C CA  . ALA B 98  ? 0.1952 0.2770 0.1900 -0.0039 -0.0052 -0.0373 98   ALA B CA  
2028 C C   . ALA B 98  ? 0.1996 0.2885 0.1970 -0.0033 -0.0023 -0.0359 98   ALA B C   
2029 O O   . ALA B 98  ? 0.1862 0.2741 0.1815 -0.0040 -0.0004 -0.0330 98   ALA B O   
2030 C CB  . ALA B 98  ? 0.2231 0.3032 0.2195 -0.0096 -0.0053 -0.0368 98   ALA B CB  
2031 N N   . ASN B 99  ? 0.1957 0.2905 0.1961 -0.0019 -0.0014 -0.0373 99   ASN B N   
2032 C CA  . ASN B 99  ? 0.1953 0.2927 0.1942 -0.0023 0.0026  -0.0366 99   ASN B CA  
2033 C C   . ASN B 99  ? 0.2203 0.3215 0.2239 -0.0050 0.0047  -0.0340 99   ASN B C   
2034 O O   . ASN B 99  ? 0.2117 0.3177 0.2243 -0.0065 0.0036  -0.0332 99   ASN B O   
2035 C CB  . ASN B 99  ? 0.1973 0.2963 0.1969 0.0010  0.0063  -0.0376 99   ASN B CB  
2036 C CG  . ASN B 99  ? 0.1722 0.2638 0.1630 0.0028  0.0075  -0.0402 99   ASN B CG  
2037 O OD1 . ASN B 99  ? 0.2081 0.2957 0.1938 0.0007  0.0046  -0.0407 99   ASN B OD1 
2038 N ND2 . ASN B 99  ? 0.2264 0.3162 0.2161 0.0069  0.0129  -0.0408 99   ASN B ND2 
2039 N N   . ILE B 100 ? 0.2351 0.3349 0.2328 -0.0061 0.0073  -0.0323 100  ILE B N   
2040 C CA  . ILE B 100 ? 0.2149 0.3170 0.2161 -0.0077 0.0107  -0.0293 100  ILE B CA  
2041 C C   . ILE B 100 ? 0.2400 0.3404 0.2330 -0.0069 0.0159  -0.0282 100  ILE B C   
2042 O O   . ILE B 100 ? 0.2174 0.3134 0.1976 -0.0079 0.0147  -0.0289 100  ILE B O   
2043 C CB  . ILE B 100 ? 0.2255 0.3247 0.2256 -0.0093 0.0098  -0.0262 100  ILE B CB  
2044 C CG1 . ILE B 100 ? 0.2420 0.3367 0.2452 -0.0101 0.0067  -0.0279 100  ILE B CG1 
2045 C CG2 . ILE B 100 ? 0.2269 0.3270 0.2304 -0.0106 0.0148  -0.0227 100  ILE B CG2 
2046 C CD1 . ILE B 100 ? 0.3382 0.4253 0.3377 -0.0098 0.0087  -0.0242 100  ILE B CD1 
2047 N N   . ALA B 101 ? 0.2150 0.3182 0.2148 -0.0059 0.0216  -0.0260 101  ALA B N   
2048 C CA  . ALA B 101 ? 0.2256 0.3241 0.2159 -0.0043 0.0288  -0.0241 101  ALA B CA  
2049 C C   . ALA B 101 ? 0.2096 0.3071 0.1946 -0.0061 0.0288  -0.0209 101  ALA B C   
2050 O O   . ALA B 101 ? 0.2335 0.3350 0.2294 -0.0071 0.0291  -0.0183 101  ALA B O   
2051 C CB  . ALA B 101 ? 0.1915 0.2945 0.1946 -0.0013 0.0365  -0.0206 101  ALA B CB  
2052 N N   . MET B 102 ? 0.2141 0.3057 0.1811 -0.0069 0.0286  -0.0206 102  MET B N   
2053 C CA  . MET B 102 ? 0.2361 0.3285 0.1969 -0.0076 0.0285  -0.0156 102  MET B CA  
2054 C C   . MET B 102 ? 0.2860 0.3705 0.2332 -0.0057 0.0365  -0.0143 102  MET B C   
2055 O O   . MET B 102 ? 0.2925 0.3774 0.2495 -0.0026 0.0446  -0.0115 102  MET B O   
2056 C CB  . MET B 102 ? 0.2579 0.3530 0.2102 -0.0108 0.0200  -0.0141 102  MET B CB  
2057 C CG  . MET B 102 ? 0.2381 0.3389 0.2037 -0.0109 0.0147  -0.0140 102  MET B CG  
2058 S SD  . MET B 102 ? 0.2646 0.3676 0.2445 -0.0084 0.0189  -0.0089 102  MET B SD  
2059 C CE  . MET B 102 ? 0.3212 0.4296 0.2940 -0.0074 0.0181  0.0010  102  MET B CE  
2060 N N   . GLU B 103 ? 0.3159 0.3913 0.2397 -0.0082 0.0347  -0.0161 103  GLU B N   
2061 C CA  . GLU B 103 ? 0.3293 0.3908 0.2329 -0.0063 0.0436  -0.0159 103  GLU B CA  
2062 C C   . GLU B 103 ? 0.3321 0.3880 0.2438 -0.0008 0.0552  -0.0169 103  GLU B C   
2063 O O   . GLU B 103 ? 0.3346 0.3832 0.2417 0.0036  0.0662  -0.0132 103  GLU B O   
2064 C CB  . GLU B 103 ? 0.3616 0.4098 0.2350 -0.0123 0.0390  -0.0201 103  GLU B CB  
2065 C CG  . GLU B 103 ? 0.4517 0.5074 0.3153 -0.0184 0.0273  -0.0163 103  GLU B CG  
2066 C CD  . GLU B 103 ? 0.3803 0.4481 0.2555 -0.0233 0.0156  -0.0170 103  GLU B CD  
2067 O OE1 . GLU B 103 ? 0.3364 0.4116 0.2340 -0.0202 0.0158  -0.0184 103  GLU B OE1 
2068 O OE2 . GLU B 103 ? 0.4825 0.5528 0.3444 -0.0308 0.0056  -0.0153 103  GLU B OE2 
2069 N N   . LYS B 104 ? 0.3195 0.3796 0.2441 -0.0004 0.0532  -0.0202 104  LYS B N   
2070 C CA  . LYS B 104 ? 0.3416 0.4000 0.2766 0.0053  0.0634  -0.0191 104  LYS B CA  
2071 C C   . LYS B 104 ? 0.3411 0.4161 0.3071 0.0077  0.0651  -0.0137 104  LYS B C   
2072 O O   . LYS B 104 ? 0.3413 0.4199 0.3210 0.0126  0.0732  -0.0098 104  LYS B O   
2073 C CB  . LYS B 104 ? 0.3580 0.4146 0.2931 0.0051  0.0606  -0.0237 104  LYS B CB  
2074 C CG  . LYS B 104 ? 0.4485 0.4851 0.3531 0.0021  0.0619  -0.0294 104  LYS B CG  
2075 C CD  . LYS B 104 ? 0.4939 0.5304 0.4024 0.0018  0.0588  -0.0335 104  LYS B CD  
2076 C CE  . LYS B 104 ? 0.6069 0.6226 0.4852 -0.0036 0.0589  -0.0400 104  LYS B CE  
2077 N NZ  . LYS B 104 ? 0.5209 0.5395 0.4059 -0.0051 0.0533  -0.0438 104  LYS B NZ  
2078 N N   . ASP B 105 ? 0.2628 0.3475 0.2398 0.0041  0.0585  -0.0124 105  ASP B N   
2079 C CA  . ASP B 105 ? 0.2664 0.3635 0.2693 0.0039  0.0604  -0.0078 105  ASP B CA  
2080 C C   . ASP B 105 ? 0.2856 0.3798 0.2917 0.0086  0.0737  -0.0011 105  ASP B C   
2081 O O   . ASP B 105 ? 0.2694 0.3549 0.2611 0.0099  0.0784  0.0005  105  ASP B O   
2082 C CB  . ASP B 105 ? 0.2886 0.3904 0.2977 -0.0008 0.0537  -0.0077 105  ASP B CB  
2083 C CG  . ASP B 105 ? 0.3701 0.4826 0.4039 -0.0044 0.0525  -0.0055 105  ASP B CG  
2084 O OD1 . ASP B 105 ? 0.3485 0.4658 0.3958 -0.0030 0.0603  0.0000  105  ASP B OD1 
2085 O OD2 . ASP B 105 ? 0.4483 0.5635 0.4871 -0.0092 0.0440  -0.0086 105  ASP B OD2 
2086 N N   . LYS B 106 ? 0.2897 0.3930 0.3169 0.0114  0.0797  0.0040  106  LYS B N   
2087 C CA  . LYS B 106 ? 0.2802 0.3817 0.3140 0.0171  0.0942  0.0122  106  LYS B CA  
2088 C C   . LYS B 106 ? 0.2691 0.3741 0.3129 0.0145  0.0968  0.0163  106  LYS B C   
2089 O O   . LYS B 106 ? 0.2911 0.3903 0.3340 0.0199  0.1099  0.0228  106  LYS B O   
2090 C CB  . LYS B 106 ? 0.2889 0.4042 0.3488 0.0208  0.0996  0.0197  106  LYS B CB  
2091 C CG  . LYS B 106 ? 0.2476 0.3851 0.3386 0.0131  0.0890  0.0221  106  LYS B CG  
2092 C CD  . LYS B 106 ? 0.2772 0.4325 0.3963 0.0169  0.0941  0.0327  106  LYS B CD  
2093 C CE  . LYS B 106 ? 0.3250 0.5033 0.4728 0.0069  0.0805  0.0349  106  LYS B CE  
2094 N NZ  . LYS B 106 ? 0.3016 0.5026 0.4814 0.0100  0.0846  0.0485  106  LYS B NZ  
2095 N N   . LYS B 107 ? 0.2604 0.3725 0.3125 0.0069  0.0861  0.0131  107  LYS B N   
2096 C CA  . LYS B 107 ? 0.2970 0.4091 0.3562 0.0042  0.0897  0.0166  107  LYS B CA  
2097 C C   . LYS B 107 ? 0.3165 0.4147 0.3504 0.0079  0.0938  0.0163  107  LYS B C   
2098 O O   . LYS B 107 ? 0.3173 0.4129 0.3543 0.0089  0.1015  0.0213  107  LYS B O   
2099 C CB  . LYS B 107 ? 0.3187 0.4374 0.3901 -0.0049 0.0790  0.0131  107  LYS B CB  
2100 C CG  . LYS B 107 ? 0.3296 0.4636 0.4267 -0.0109 0.0734  0.0146  107  LYS B CG  
2101 C CD  . LYS B 107 ? 0.4437 0.5784 0.5457 -0.0215 0.0628  0.0099  107  LYS B CD  
2102 C CE  . LYS B 107 ? 0.5461 0.6730 0.6291 -0.0218 0.0533  0.0019  107  LYS B CE  
2103 N NZ  . LYS B 107 ? 0.5480 0.6806 0.6288 -0.0183 0.0477  -0.0005 107  LYS B NZ  
2104 N N   . GLY B 108 ? 0.3113 0.4014 0.3207 0.0093  0.0884  0.0113  108  GLY B N   
2105 C CA  . GLY B 108 ? 0.3072 0.3872 0.2916 0.0113  0.0891  0.0120  108  GLY B CA  
2106 C C   . GLY B 108 ? 0.3294 0.4142 0.3170 0.0075  0.0816  0.0121  108  GLY B C   
2107 O O   . GLY B 108 ? 0.3007 0.3922 0.3076 0.0032  0.0785  0.0112  108  GLY B O   
2108 N N   . GLY B 109 ? 0.2860 0.3665 0.2534 0.0089  0.0790  0.0139  109  GLY B N   
2109 C CA  . GLY B 109 ? 0.2935 0.3779 0.2638 0.0081  0.0760  0.0177  109  GLY B CA  
2110 C C   . GLY B 109 ? 0.2927 0.3825 0.2627 0.0046  0.0642  0.0147  109  GLY B C   
2111 O O   . GLY B 109 ? 0.3232 0.4154 0.2954 0.0053  0.0633  0.0193  109  GLY B O   
2112 N N   . PHE B 110 ? 0.2701 0.3607 0.2373 0.0019  0.0571  0.0080  110  PHE B N   
2113 C CA  . PHE B 110 ? 0.2726 0.3677 0.2407 -0.0010 0.0467  0.0051  110  PHE B CA  
2114 C C   . PHE B 110 ? 0.3115 0.4059 0.2600 -0.0027 0.0395  0.0039  110  PHE B C   
2115 O O   . PHE B 110 ? 0.3010 0.3962 0.2484 -0.0057 0.0325  -0.0010 110  PHE B O   
2116 C CB  . PHE B 110 ? 0.2794 0.3760 0.2615 -0.0035 0.0442  -0.0012 110  PHE B CB  
2117 C CG  . PHE B 110 ? 0.2819 0.3791 0.2813 -0.0051 0.0481  -0.0005 110  PHE B CG  
2118 C CD1 . PHE B 110 ? 0.3338 0.4289 0.3368 -0.0064 0.0472  0.0012  110  PHE B CD1 
2119 C CD2 . PHE B 110 ? 0.2450 0.3439 0.2567 -0.0059 0.0535  -0.0008 110  PHE B CD2 
2120 C CE1 . PHE B 110 ? 0.2893 0.3804 0.3038 -0.0100 0.0512  0.0008  110  PHE B CE1 
2121 C CE2 . PHE B 110 ? 0.2400 0.3398 0.2676 -0.0103 0.0557  -0.0001 110  PHE B CE2 
2122 C CZ  . PHE B 110 ? 0.2861 0.3804 0.3132 -0.0132 0.0543  -0.0002 110  PHE B CZ  
2123 N N   . GLY B 111 ? 0.3120 0.4041 0.2436 -0.0017 0.0407  0.0088  111  GLY B N   
2124 C CA  . GLY B 111 ? 0.3875 0.4785 0.2977 -0.0060 0.0321  0.0084  111  GLY B CA  
2125 C C   . GLY B 111 ? 0.3554 0.4594 0.2675 -0.0078 0.0230  0.0163  111  GLY B C   
2126 O O   . GLY B 111 ? 0.3291 0.4411 0.2594 -0.0046 0.0242  0.0214  111  GLY B O   
2127 N N   . VAL B 112 ? 0.3966 0.5019 0.2884 -0.0132 0.0142  0.0183  112  VAL B N   
2128 C CA  . VAL B 112 ? 0.3911 0.5129 0.2855 -0.0156 0.0042  0.0287  112  VAL B CA  
2129 C C   . VAL B 112 ? 0.3663 0.4968 0.2735 -0.0075 0.0111  0.0407  112  VAL B C   
2130 O O   . VAL B 112 ? 0.4031 0.5267 0.3032 -0.0030 0.0198  0.0424  112  VAL B O   
2131 C CB  . VAL B 112 ? 0.4406 0.5615 0.3067 -0.0241 -0.0062 0.0302  112  VAL B CB  
2132 C CG1 . VAL B 112 ? 0.5558 0.6990 0.4279 -0.0266 -0.0173 0.0444  112  VAL B CG1 
2133 C CG2 . VAL B 112 ? 0.5395 0.6481 0.3911 -0.0330 -0.0117 0.0181  112  VAL B CG2 
2134 N N   . GLY B 113 ? 0.4193 0.4896 0.2387 -0.0245 0.0204  0.0014  113  GLY B N   
2135 C CA  . GLY B 113 ? 0.3734 0.4783 0.2251 -0.0198 0.0188  0.0124  113  GLY B CA  
2136 C C   . GLY B 113 ? 0.3486 0.4709 0.2259 -0.0209 0.0133  0.0178  113  GLY B C   
2137 O O   . GLY B 113 ? 0.3697 0.4874 0.2449 -0.0297 0.0100  0.0133  113  GLY B O   
2138 N N   . ASN B 114 ? 0.3435 0.4811 0.2373 -0.0120 0.0125  0.0275  114  ASN B N   
2139 C CA  . ASN B 114 ? 0.3034 0.4524 0.2154 -0.0059 0.0085  0.0331  114  ASN B CA  
2140 C C   . ASN B 114 ? 0.2731 0.4056 0.1984 -0.0009 0.0144  0.0333  114  ASN B C   
2141 O O   . ASN B 114 ? 0.2865 0.4106 0.2096 0.0001  0.0207  0.0349  114  ASN B O   
2142 C CB  . ASN B 114 ? 0.3361 0.4958 0.2433 0.0052  0.0045  0.0436  114  ASN B CB  
2143 C CG  . ASN B 114 ? 0.3644 0.5517 0.2601 0.0023  -0.0024 0.0445  114  ASN B CG  
2144 O OD1 . ASN B 114 ? 0.3692 0.5892 0.2702 -0.0029 -0.0089 0.0424  114  ASN B OD1 
2145 N ND2 . ASN B 114 ? 0.3838 0.5642 0.2625 0.0032  -0.0013 0.0479  114  ASN B ND2 
2146 N N   . TYR B 115 ? 0.2258 0.3603 0.1641 -0.0005 0.0121  0.0315  115  TYR B N   
2147 C CA  . TYR B 115 ? 0.2200 0.3417 0.1709 0.0024  0.0164  0.0306  115  TYR B CA  
2148 C C   . TYR B 115 ? 0.2542 0.3777 0.2155 0.0089  0.0133  0.0358  115  TYR B C   
2149 O O   . TYR B 115 ? 0.2851 0.4273 0.2477 0.0130  0.0076  0.0377  115  TYR B O   
2150 C CB  . TYR B 115 ? 0.2627 0.3736 0.2111 -0.0019 0.0179  0.0213  115  TYR B CB  
2151 C CG  . TYR B 115 ? 0.2524 0.3518 0.1847 0.0010  0.0234  0.0158  115  TYR B CG  
2152 C CD1 . TYR B 115 ? 0.2807 0.3735 0.1895 -0.0039 0.0225  0.0119  115  TYR B CD1 
2153 C CD2 . TYR B 115 ? 0.2493 0.3503 0.1875 0.0105  0.0299  0.0146  115  TYR B CD2 
2154 C CE1 . TYR B 115 ? 0.2565 0.3365 0.1447 0.0042  0.0287  0.0064  115  TYR B CE1 
2155 C CE2 . TYR B 115 ? 0.3070 0.4072 0.2292 0.0200  0.0356  0.0096  115  TYR B CE2 
2156 C CZ  . TYR B 115 ? 0.2751 0.3614 0.1708 0.0188  0.0355  0.0053  115  TYR B CZ  
2157 O OH  . TYR B 115 ? 0.3215 0.4048 0.1956 0.0333  0.0422  -0.0001 115  TYR B OH  
2158 N N   . GLU B 116 ? 0.2551 0.3639 0.2216 0.0097  0.0172  0.0376  116  GLU B N   
2159 C CA  . GLU B 116 ? 0.2670 0.3670 0.2387 0.0150  0.0158  0.0405  116  GLU B CA  
2160 C C   . GLU B 116 ? 0.2549 0.3529 0.2406 0.0099  0.0187  0.0346  116  GLU B C   
2161 O O   . GLU B 116 ? 0.2507 0.3498 0.2379 0.0057  0.0232  0.0325  116  GLU B O   
2162 C CB  . GLU B 116 ? 0.2819 0.3562 0.2346 0.0164  0.0175  0.0486  116  GLU B CB  
2163 C CG  . GLU B 116 ? 0.4394 0.5043 0.3689 0.0310  0.0132  0.0559  116  GLU B CG  
2164 C CD  . GLU B 116 ? 0.5605 0.5799 0.4520 0.0304  0.0149  0.0645  116  GLU B CD  
2165 O OE1 . GLU B 116 ? 0.5500 0.5506 0.4349 0.0125  0.0194  0.0648  116  GLU B OE1 
2166 O OE2 . GLU B 116 ? 0.7272 0.7293 0.5894 0.0467  0.0114  0.0712  116  GLU B OE2 
2167 N N   . LEU B 117 ? 0.2458 0.3462 0.2403 0.0120  0.0160  0.0322  117  LEU B N   
2168 C CA  . LEU B 117 ? 0.2278 0.3229 0.2313 0.0090  0.0177  0.0273  117  LEU B CA  
2169 C C   . LEU B 117 ? 0.2322 0.3194 0.2404 0.0126  0.0168  0.0306  117  LEU B C   
2170 O O   . LEU B 117 ? 0.2154 0.3082 0.2220 0.0199  0.0138  0.0331  117  LEU B O   
2171 C CB  . LEU B 117 ? 0.2274 0.3244 0.2276 0.0036  0.0153  0.0206  117  LEU B CB  
2172 C CG  . LEU B 117 ? 0.2051 0.2887 0.2070 0.0023  0.0160  0.0161  117  LEU B CG  
2173 C CD1 . LEU B 117 ? 0.2233 0.2965 0.2201 0.0094  0.0200  0.0131  117  LEU B CD1 
2174 C CD2 . LEU B 117 ? 0.2105 0.2875 0.1971 -0.0098 0.0129  0.0109  117  LEU B CD2 
2175 N N   . THR B 118 ? 0.2333 0.3122 0.2450 0.0088  0.0196  0.0304  118  THR B N   
2176 C CA  . THR B 118 ? 0.2591 0.3246 0.2706 0.0093  0.0190  0.0324  118  THR B CA  
2177 C C   . THR B 118 ? 0.2287 0.2984 0.2524 0.0070  0.0193  0.0273  118  THR B C   
2178 O O   . THR B 118 ? 0.2459 0.3256 0.2737 0.0055  0.0213  0.0246  118  THR B O   
2179 C CB  . THR B 118 ? 0.2679 0.3135 0.2616 0.0010  0.0210  0.0382  118  THR B CB  
2180 O OG1 . THR B 118 ? 0.3201 0.3536 0.2940 0.0036  0.0208  0.0434  118  THR B OG1 
2181 C CG2 . THR B 118 ? 0.3555 0.3746 0.3371 0.0015  0.0201  0.0399  118  THR B CG2 
2182 N N   . PHE B 119 ? 0.2197 0.2837 0.2465 0.0097  0.0175  0.0263  119  PHE B N   
2183 C CA  . PHE B 119 ? 0.2041 0.2656 0.2376 0.0075  0.0174  0.0230  119  PHE B CA  
2184 C C   . PHE B 119 ? 0.2249 0.2728 0.2536 0.0042  0.0177  0.0261  119  PHE B C   
2185 O O   . PHE B 119 ? 0.2433 0.2753 0.2591 0.0084  0.0175  0.0296  119  PHE B O   
2186 C CB  . PHE B 119 ? 0.2002 0.2627 0.2357 0.0080  0.0155  0.0193  119  PHE B CB  
2187 C CG  . PHE B 119 ? 0.2653 0.3305 0.2934 0.0036  0.0145  0.0153  119  PHE B CG  
2188 C CD1 . PHE B 119 ? 0.2565 0.3142 0.2754 0.0057  0.0158  0.0127  119  PHE B CD1 
2189 C CD2 . PHE B 119 ? 0.2681 0.3441 0.2925 -0.0040 0.0125  0.0137  119  PHE B CD2 
2190 C CE1 . PHE B 119 ? 0.2527 0.2982 0.2516 0.0002  0.0149  0.0083  119  PHE B CE1 
2191 C CE2 . PHE B 119 ? 0.2131 0.2845 0.2201 -0.0163 0.0111  0.0097  119  PHE B CE2 
2192 C CZ  . PHE B 119 ? 0.2790 0.3274 0.2696 -0.0140 0.0122  0.0069  119  PHE B CZ  
2193 N N   . TYR B 120 ? 0.2105 0.2643 0.2438 -0.0021 0.0182  0.0250  120  TYR B N   
2194 C CA  . TYR B 120 ? 0.2490 0.2909 0.2743 -0.0115 0.0179  0.0270  120  TYR B CA  
2195 C C   . TYR B 120 ? 0.2447 0.2905 0.2802 -0.0073 0.0162  0.0231  120  TYR B C   
2196 O O   . TYR B 120 ? 0.2633 0.3270 0.3077 -0.0027 0.0157  0.0203  120  TYR B O   
2197 C CB  . TYR B 120 ? 0.2616 0.3228 0.2842 -0.0272 0.0192  0.0293  120  TYR B CB  
2198 C CG  . TYR B 120 ? 0.3522 0.4086 0.3606 -0.0350 0.0213  0.0334  120  TYR B CG  
2199 C CD1 . TYR B 120 ? 0.4586 0.4756 0.4339 -0.0477 0.0215  0.0384  120  TYR B CD1 
2200 C CD2 . TYR B 120 ? 0.4183 0.5020 0.4377 -0.0295 0.0232  0.0324  120  TYR B CD2 
2201 C CE1 . TYR B 120 ? 0.4473 0.4521 0.4016 -0.0558 0.0233  0.0429  120  TYR B CE1 
2202 C CE2 . TYR B 120 ? 0.4215 0.5014 0.4263 -0.0380 0.0253  0.0365  120  TYR B CE2 
2203 C CZ  . TYR B 120 ? 0.4380 0.4789 0.4108 -0.0520 0.0252  0.0421  120  TYR B CZ  
2204 O OH  . TYR B 120 ? 0.5069 0.5367 0.4578 -0.0615 0.0271  0.0468  120  TYR B OH  
2205 N N   . ILE B 121 ? 0.2400 0.2662 0.2691 -0.0055 0.0155  0.0230  121  ILE B N   
2206 C CA  . ILE B 121 ? 0.2250 0.2519 0.2611 -0.0018 0.0141  0.0194  121  ILE B CA  
2207 C C   . ILE B 121 ? 0.2542 0.2664 0.2814 -0.0081 0.0135  0.0201  121  ILE B C   
2208 O O   . ILE B 121 ? 0.2549 0.2428 0.2634 -0.0089 0.0145  0.0223  121  ILE B O   
2209 C CB  . ILE B 121 ? 0.2060 0.2337 0.2429 0.0053  0.0145  0.0179  121  ILE B CB  
2210 C CG1 . ILE B 121 ? 0.2795 0.3201 0.3195 0.0061  0.0144  0.0171  121  ILE B CG1 
2211 C CG2 . ILE B 121 ? 0.2380 0.2641 0.2761 0.0035  0.0136  0.0147  121  ILE B CG2 
2212 C CD1 . ILE B 121 ? 0.2323 0.2881 0.2721 0.0072  0.0142  0.0163  121  ILE B CD1 
2213 N N   . SER B 122 ? 0.2368 0.2591 0.2706 -0.0107 0.0115  0.0182  122  SER B N   
2214 C CA  . SER B 122 ? 0.2540 0.2645 0.2796 -0.0178 0.0101  0.0180  122  SER B CA  
2215 C C   . SER B 122 ? 0.2564 0.2628 0.2858 -0.0107 0.0092  0.0149  122  SER B C   
2216 O O   . SER B 122 ? 0.2179 0.2305 0.2524 -0.0041 0.0086  0.0130  122  SER B O   
2217 C CB  . SER B 122 ? 0.3051 0.3392 0.3324 -0.0302 0.0077  0.0192  122  SER B CB  
2218 O OG  . SER B 122 ? 0.4052 0.4504 0.4280 -0.0415 0.0090  0.0221  122  SER B OG  
2219 N N   . ASN B 123 ? 0.2305 0.2206 0.2497 -0.0145 0.0091  0.0144  123  ASN B N   
2220 C CA  . ASN B 123 ? 0.2474 0.2321 0.2663 -0.0100 0.0094  0.0120  123  ASN B CA  
2221 C C   . ASN B 123 ? 0.2543 0.2454 0.2759 -0.0107 0.0058  0.0108  123  ASN B C   
2222 O O   . ASN B 123 ? 0.2349 0.2416 0.2600 -0.0117 0.0029  0.0120  123  ASN B O   
2223 C CB  . ASN B 123 ? 0.2573 0.2207 0.2599 -0.0089 0.0116  0.0115  123  ASN B CB  
2224 C CG  . ASN B 123 ? 0.2499 0.1984 0.2387 -0.0209 0.0091  0.0117  123  ASN B CG  
2225 O OD1 . ASN B 123 ? 0.2833 0.2463 0.2805 -0.0261 0.0055  0.0112  123  ASN B OD1 
2226 N ND2 . ASN B 123 ? 0.2576 0.1737 0.2185 -0.0245 0.0106  0.0123  123  ASN B ND2 
2227 N N   . PRO B 124 ? 0.2281 0.2104 0.2444 -0.0093 0.0060  0.0089  124  PRO B N   
2228 C CA  . PRO B 124 ? 0.2435 0.2199 0.2512 -0.0060 0.0024  0.0084  124  PRO B CA  
2229 C C   . PRO B 124 ? 0.2289 0.2115 0.2356 -0.0070 -0.0013 0.0093  124  PRO B C   
2230 O O   . PRO B 124 ? 0.2878 0.2747 0.2879 0.0019  -0.0054 0.0098  124  PRO B O   
2231 C CB  . PRO B 124 ? 0.2593 0.2196 0.2541 -0.0118 0.0043  0.0066  124  PRO B CB  
2232 C CG  . PRO B 124 ? 0.2631 0.2363 0.2658 -0.0152 0.0085  0.0062  124  PRO B CG  
2233 C CD  . PRO B 124 ? 0.2419 0.2234 0.2556 -0.0104 0.0098  0.0076  124  PRO B CD  
2234 N N   . GLU B 125 ? 0.2997 0.2218 0.2058 -0.0172 -0.0310 0.0128  125  GLU B N   
2235 C CA  . GLU B 125 ? 0.3677 0.2972 0.2412 -0.0516 -0.0261 0.0086  125  GLU B CA  
2236 C C   . GLU B 125 ? 0.3789 0.3798 0.2430 -0.0947 -0.0309 0.0175  125  GLU B C   
2237 O O   . GLU B 125 ? 0.3889 0.4693 0.2583 -0.1183 -0.0323 0.0202  125  GLU B O   
2238 C CB  . GLU B 125 ? 0.4362 0.2504 0.2318 -0.0622 -0.0210 -0.0018 125  GLU B CB  
2239 C CG  . GLU B 125 ? 0.6249 0.4258 0.3666 -0.1069 -0.0153 -0.0107 125  GLU B CG  
2240 C CD  . GLU B 125 ? 0.8931 0.5351 0.5271 -0.1064 -0.0021 -0.0262 125  GLU B CD  
2241 O OE1 . GLU B 125 ? 0.9765 0.5805 0.6311 -0.0371 0.0117  -0.0344 125  GLU B OE1 
2242 O OE2 . GLU B 125 ? 1.0505 0.6070 0.5702 -0.1754 -0.0037 -0.0306 125  GLU B OE2 
2243 N N   . LYS B 126 ? 0.4188 0.4148 0.2731 -0.1038 -0.0334 0.0237  126  LYS B N   
2244 C CA  . LYS B 126 ? 0.4648 0.5590 0.3191 -0.1434 -0.0295 0.0303  126  LYS B CA  
2245 C C   . LYS B 126 ? 0.3798 0.6048 0.3045 -0.0962 -0.0210 0.0339  126  LYS B C   
2246 O O   . LYS B 126 ? 0.3983 0.7621 0.3440 -0.1143 -0.0167 0.0400  126  LYS B O   
2247 C CB  . LYS B 126 ? 0.4920 0.5387 0.3117 -0.1562 -0.0295 0.0350  126  LYS B CB  
2248 C CG  . LYS B 126 ? 0.6463 0.7955 0.4530 -0.2088 -0.0173 0.0393  126  LYS B CG  
2249 C CD  . LYS B 126 ? 0.7550 0.8131 0.4936 -0.2345 -0.0192 0.0448  126  LYS B CD  
2250 C CE  . LYS B 126 ? 0.9336 1.0731 0.6261 -0.3183 -0.0029 0.0482  126  LYS B CE  
2251 N NZ  . LYS B 126 ? 0.8998 1.1876 0.6545 -0.2850 0.0239  0.0437  126  LYS B NZ  
2252 N N   . GLN B 127 ? 0.2840 0.4666 0.2331 -0.0360 -0.0180 0.0316  127  GLN B N   
2253 C CA  . GLN B 127 ? 0.2918 0.5366 0.2654 0.0213  -0.0087 0.0364  127  GLN B CA  
2254 C C   . GLN B 127 ? 0.3277 0.5695 0.3038 0.0391  -0.0165 0.0404  127  GLN B C   
2255 O O   . GLN B 127 ? 0.3623 0.6014 0.3296 0.0940  -0.0124 0.0475  127  GLN B O   
2256 C CB  . GLN B 127 ? 0.3009 0.4656 0.2528 0.0598  0.0020  0.0313  127  GLN B CB  
2257 C CG  . GLN B 127 ? 0.3564 0.5296 0.2913 0.0467  0.0124  0.0278  127  GLN B CG  
2258 C CD  . GLN B 127 ? 0.3980 0.4776 0.2863 0.0718  0.0221  0.0204  127  GLN B CD  
2259 O OE1 . GLN B 127 ? 0.4595 0.4711 0.3176 0.1026  0.0263  0.0183  127  GLN B OE1 
2260 N NE2 . GLN B 127 ? 0.4500 0.5080 0.3083 0.0464  0.0254  0.0166  127  GLN B NE2 
2261 N N   . GLY B 128 ? 0.3169 0.5365 0.2811 -0.0071 -0.0260 0.0360  128  GLY B N   
2262 C CA  . GLY B 128 ? 0.3484 0.5726 0.3016 -0.0044 -0.0327 0.0393  128  GLY B CA  
2263 C C   . GLY B 128 ? 0.3244 0.4470 0.2610 0.0109  -0.0245 0.0309  128  GLY B C   
2264 O O   . GLY B 128 ? 0.3664 0.4797 0.2796 0.0086  -0.0264 0.0331  128  GLY B O   
2265 N N   . PHE B 129 ? 0.2528 0.3155 0.1983 0.0167  -0.0161 0.0219  129  PHE B N   
2266 C CA  . PHE B 129 ? 0.2305 0.2399 0.1728 0.0183  -0.0056 0.0129  129  PHE B CA  
2267 C C   . PHE B 129 ? 0.2875 0.2773 0.2216 0.0009  0.0020  0.0000  129  PHE B C   
2268 O O   . PHE B 129 ? 0.3123 0.2802 0.2359 -0.0080 -0.0008 -0.0052 129  PHE B O   
2269 C CB  . PHE B 129 ? 0.2446 0.2389 0.2063 0.0215  -0.0059 0.0097  129  PHE B CB  
2270 C CG  . PHE B 129 ? 0.1984 0.1854 0.1667 0.0108  0.0030  0.0030  129  PHE B CG  
2271 C CD1 . PHE B 129 ? 0.2202 0.1693 0.1457 -0.0023 0.0089  0.0060  129  PHE B CD1 
2272 C CD2 . PHE B 129 ? 0.1961 0.2147 0.2011 0.0132  0.0072  -0.0058 129  PHE B CD2 
2273 C CE1 . PHE B 129 ? 0.2708 0.2299 0.1925 -0.0381 0.0179  -0.0002 129  PHE B CE1 
2274 C CE2 . PHE B 129 ? 0.1939 0.2589 0.2217 -0.0024 0.0170  -0.0114 129  PHE B CE2 
2275 C CZ  . PHE B 129 ? 0.2160 0.2594 0.2030 -0.0417 0.0220  -0.0089 129  PHE B CZ  
2276 N N   . GLY B 130 ? 0.2466 0.2306 0.2744 0.0093  -0.0215 -0.0296 130  GLY B N   
2277 C CA  . GLY B 130 ? 0.2462 0.2149 0.2507 0.0127  -0.0264 -0.0220 130  GLY B CA  
2278 C C   . GLY B 130 ? 0.2640 0.2301 0.2541 0.0113  -0.0176 -0.0175 130  GLY B C   
2279 O O   . GLY B 130 ? 0.2312 0.2088 0.2292 0.0079  -0.0087 -0.0213 130  GLY B O   
2280 N N   . ARG B 131 ? 0.2808 0.2339 0.2538 0.0139  -0.0202 -0.0126 131  ARG B N   
2281 C CA  . ARG B 131 ? 0.3084 0.2570 0.2704 0.0144  -0.0118 -0.0088 131  ARG B CA  
2282 C C   . ARG B 131 ? 0.2851 0.2101 0.2239 0.0201  -0.0136 -0.0060 131  ARG B C   
2283 O O   . ARG B 131 ? 0.3035 0.2226 0.2367 0.0221  -0.0231 -0.0090 131  ARG B O   
2284 C CB  . ARG B 131 ? 0.2972 0.2634 0.2667 0.0115  -0.0087 -0.0058 131  ARG B CB  
2285 C CG  . ARG B 131 ? 0.3116 0.2712 0.2818 0.0117  -0.0118 -0.0019 131  ARG B CG  
2286 C CD  . ARG B 131 ? 0.3770 0.3506 0.3540 0.0123  -0.0059 0.0072  131  ARG B CD  
2287 N NE  . ARG B 131 ? 0.3745 0.3360 0.3599 0.0111  -0.0049 0.0106  131  ARG B NE  
2288 C CZ  . ARG B 131 ? 0.3752 0.3204 0.3622 0.0135  -0.0013 0.0133  131  ARG B CZ  
2289 N NH1 . ARG B 131 ? 0.4038 0.3440 0.3825 0.0185  0.0018  0.0156  131  ARG B NH1 
2290 N NH2 . ARG B 131 ? 0.4344 0.3691 0.4379 0.0102  0.0014  0.0120  131  ARG B NH2 
2291 N N   . HIS B 132 ? 0.2818 0.1958 0.2094 0.0223  -0.0032 -0.0032 132  HIS B N   
2292 C CA  . HIS B 132 ? 0.3164 0.2099 0.2181 0.0277  -0.0009 -0.0014 132  HIS B CA  
2293 C C   . HIS B 132 ? 0.3279 0.2254 0.2352 0.0254  -0.0006 -0.0042 132  HIS B C   
2294 O O   . HIS B 132 ? 0.3065 0.2202 0.2336 0.0221  0.0032  -0.0022 132  HIS B O   
2295 C CB  . HIS B 132 ? 0.3065 0.1880 0.2009 0.0291  0.0157  0.0026  132  HIS B CB  
2296 C CG  . HIS B 132 ? 0.3036 0.1723 0.1928 0.0332  0.0209  0.0089  132  HIS B CG  
2297 N ND1 . HIS B 132 ? 0.3660 0.2125 0.2389 0.0376  0.0382  0.0170  132  HIS B ND1 
2298 C CD2 . HIS B 132 ? 0.3115 0.1836 0.2108 0.0350  0.0133  0.0101  132  HIS B CD2 
2299 C CE1 . HIS B 132 ? 0.3666 0.2016 0.2402 0.0428  0.0414  0.0252  132  HIS B CE1 
2300 N NE2 . HIS B 132 ? 0.2846 0.1361 0.1763 0.0413  0.0255  0.0199  132  HIS B NE2 
2301 N N   . VAL B 133 ? 0.3390 0.2239 0.2305 0.0285  -0.0051 -0.0092 133  VAL B N   
2302 C CA  . VAL B 133 ? 0.3231 0.2063 0.2244 0.0268  -0.0018 -0.0133 133  VAL B CA  
2303 C C   . VAL B 133 ? 0.3510 0.2173 0.2293 0.0309  0.0048  -0.0199 133  VAL B C   
2304 O O   . VAL B 133 ? 0.3742 0.2357 0.2616 0.0301  0.0082  -0.0272 133  VAL B O   
2305 C CB  . VAL B 133 ? 0.3218 0.2095 0.2412 0.0232  -0.0113 -0.0197 133  VAL B CB  
2306 C CG1 . VAL B 133 ? 0.3082 0.2133 0.2499 0.0190  -0.0128 -0.0118 133  VAL B CG1 
2307 C CG2 . VAL B 133 ? 0.3631 0.2471 0.2684 0.0255  -0.0248 -0.0328 133  VAL B CG2 
2308 N N   . ASP B 134 ? 0.4170 0.2731 0.2669 0.0357  0.0097  -0.0168 134  ASP B N   
2309 C CA  . ASP B 134 ? 0.4422 0.2828 0.2633 0.0405  0.0199  -0.0222 134  ASP B CA  
2310 C C   . ASP B 134 ? 0.4465 0.2867 0.2867 0.0376  0.0378  -0.0204 134  ASP B C   
2311 O O   . ASP B 134 ? 0.3683 0.2215 0.2361 0.0341  0.0406  -0.0138 134  ASP B O   
2312 C CB  . ASP B 134 ? 0.4849 0.3129 0.2680 0.0484  0.0241  -0.0138 134  ASP B CB  
2313 C CG  . ASP B 134 ? 0.6001 0.4272 0.3978 0.0461  0.0360  -0.0002 134  ASP B CG  
2314 O OD1 . ASP B 134 ? 0.6460 0.4858 0.4674 0.0426  0.0263  0.0022  134  ASP B OD1 
2315 O OD2 . ASP B 134 ? 0.5647 0.3800 0.3556 0.0466  0.0568  0.0050  134  ASP B OD2 
2316 N N   . GLU B 135 ? 0.4662 0.2950 0.2923 0.0399  0.0495  -0.0285 135  GLU B N   
2317 C CA  . GLU B 135 ? 0.4914 0.3219 0.3419 0.0385  0.0661  -0.0292 135  GLU B CA  
2318 C C   . GLU B 135 ? 0.4661 0.3010 0.3269 0.0368  0.0801  -0.0203 135  GLU B C   
2319 O O   . GLU B 135 ? 0.4752 0.3272 0.3727 0.0347  0.0833  -0.0191 135  GLU B O   
2320 C CB  . GLU B 135 ? 0.5402 0.3562 0.3704 0.0413  0.0785  -0.0420 135  GLU B CB  
2321 C CG  . GLU B 135 ? 0.5656 0.3845 0.4298 0.0408  0.0928  -0.0463 135  GLU B CG  
2322 C CD  . GLU B 135 ? 0.5466 0.3529 0.3996 0.0427  0.1020  -0.0641 135  GLU B CD  
2323 O OE1 . GLU B 135 ? 0.6456 0.4490 0.4941 0.0420  0.0900  -0.0766 135  GLU B OE1 
2324 O OE2 . GLU B 135 ? 0.7975 0.5980 0.6499 0.0440  0.1227  -0.0686 135  GLU B OE2 
2325 N N   . GLU B 136 ? 0.4482 0.2700 0.2798 0.0387  0.0873  -0.0141 136  GLU B N   
2326 C CA  A GLU B 136 ? 0.4948 0.3131 0.3364 0.0362  0.1081  -0.0082 136  GLU B CA  
2327 C CA  B GLU B 136 ? 0.4936 0.3130 0.3376 0.0359  0.1083  -0.0087 136  GLU B CA  
2328 C C   . GLU B 136 ? 0.4720 0.3097 0.3492 0.0306  0.1015  -0.0055 136  GLU B C   
2329 O O   . GLU B 136 ? 0.4646 0.3173 0.3781 0.0256  0.1125  -0.0104 136  GLU B O   
2330 C CB  A GLU B 136 ? 0.5493 0.3418 0.3443 0.0424  0.1206  0.0016  136  GLU B CB  
2331 C CB  B GLU B 136 ? 0.5438 0.3369 0.3454 0.0411  0.1260  0.0004  136  GLU B CB  
2332 C CG  A GLU B 136 ? 0.6367 0.4125 0.3894 0.0488  0.1325  -0.0028 136  GLU B CG  
2333 C CG  B GLU B 136 ? 0.6213 0.4081 0.4456 0.0362  0.1550  0.0050  136  GLU B CG  
2334 C CD  A GLU B 136 ? 0.7139 0.4931 0.4390 0.0539  0.1098  -0.0141 136  GLU B CD  
2335 C CD  B GLU B 136 ? 0.6812 0.4368 0.4631 0.0427  0.1791  0.0200  136  GLU B CD  
2336 O OE1 A GLU B 136 ? 0.6035 0.3942 0.3378 0.0534  0.0852  -0.0154 136  GLU B OE1 
2337 O OE1 B GLU B 136 ? 0.7597 0.5013 0.4867 0.0534  0.1725  0.0262  136  GLU B OE1 
2338 O OE2 A GLU B 136 ? 0.7270 0.4985 0.4244 0.0576  0.1185  -0.0249 136  GLU B OE2 
2339 O OE2 B GLU B 136 ? 0.7161 0.4623 0.5208 0.0378  0.2059  0.0252  136  GLU B OE2 
2340 N N   . THR B 137 ? 0.4134 0.2918 0.3491 0.0369  0.0350  0.0569  137  THR B N   
2341 C CA  . THR B 137 ? 0.4459 0.3018 0.3746 0.0363  0.0703  0.0546  137  THR B CA  
2342 C C   . THR B 137 ? 0.3654 0.2539 0.3194 0.0427  0.0497  0.0694  137  THR B C   
2343 O O   . THR B 137 ? 0.3805 0.2539 0.3322 0.0454  0.0757  0.0721  137  THR B O   
2344 C CB  . THR B 137 ? 0.4827 0.2858 0.3789 0.0581  0.1136  0.0807  137  THR B CB  
2345 O OG1 . THR B 137 ? 0.4614 0.2946 0.3704 0.0898  0.0953  0.1235  137  THR B OG1 
2346 C CG2 . THR B 137 ? 0.5187 0.2760 0.3795 0.0533  0.1381  0.0691  137  THR B CG2 
2347 N N   . GLY B 138 ? 0.3074 0.2331 0.2784 0.0428  0.0062  0.0778  138  GLY B N   
2348 C CA  . GLY B 138 ? 0.2748 0.2254 0.2611 0.0452  -0.0121 0.0935  138  GLY B CA  
2349 C C   . GLY B 138 ? 0.2718 0.2254 0.2612 0.0353  -0.0152 0.0670  138  GLY B C   
2350 O O   . GLY B 138 ? 0.3117 0.2654 0.2924 0.0266  -0.0133 0.0321  138  GLY B O   
2351 N N   . VAL B 139 ? 0.2553 0.2206 0.2560 0.0381  -0.0204 0.0818  139  VAL B N   
2352 C CA  . VAL B 139 ? 0.2690 0.2379 0.2718 0.0338  -0.0236 0.0612  139  VAL B CA  
2353 C C   . VAL B 139 ? 0.2944 0.2720 0.2924 0.0317  -0.0533 0.0761  139  VAL B C   
2354 O O   . VAL B 139 ? 0.3371 0.3270 0.3357 0.0284  -0.0654 0.1025  139  VAL B O   
2355 C CB  . VAL B 139 ? 0.2819 0.2423 0.2967 0.0359  0.0120  0.0604  139  VAL B CB  
2356 C CG1 . VAL B 139 ? 0.3103 0.2461 0.3124 0.0295  0.0494  0.0417  139  VAL B CG1 
2357 C CG2 . VAL B 139 ? 0.2352 0.2008 0.2604 0.0480  0.0182  0.0987  139  VAL B CG2 
2358 N N   . GLY B 140 ? 0.2765 0.2496 0.2640 0.0326  -0.0616 0.0571  140  GLY B N   
2359 C CA  . GLY B 140 ? 0.3217 0.2839 0.2877 0.0285  -0.0837 0.0657  140  GLY B CA  
2360 C C   . GLY B 140 ? 0.2764 0.2530 0.2635 0.0222  -0.0766 0.0905  140  GLY B C   
2361 O O   . GLY B 140 ? 0.3069 0.3009 0.3243 0.0284  -0.0540 0.1026  140  GLY B O   
2362 N N   . LYS B 141 ? 0.2957 0.2604 0.2568 0.0097  -0.0939 0.0975  141  LYS B N   
2363 C CA  . LYS B 141 ? 0.2917 0.2756 0.2655 -0.0013 -0.0910 0.1163  141  LYS B CA  
2364 C C   . LYS B 141 ? 0.2833 0.2691 0.2812 0.0111  -0.0746 0.1105  141  LYS B C   
2365 O O   . LYS B 141 ? 0.2795 0.2459 0.2705 0.0238  -0.0705 0.0864  141  LYS B O   
2366 C CB  . LYS B 141 ? 0.3322 0.2847 0.2550 -0.0240 -0.1087 0.1149  141  LYS B CB  
2367 C CG  . LYS B 141 ? 0.4213 0.3853 0.3222 -0.0505 -0.1203 0.1268  141  LYS B CG  
2368 C CD  . LYS B 141 ? 0.5268 0.4423 0.3620 -0.0804 -0.1284 0.1211  141  LYS B CD  
2369 C CE  . LYS B 141 ? 0.5866 0.5165 0.3923 -0.1189 -0.1361 0.1288  141  LYS B CE  
2370 N NZ  . LYS B 141 ? 0.5819 0.4384 0.3012 -0.1534 -0.1368 0.1183  141  LYS B NZ  
2371 N N   . TRP B 142 ? 0.3055 0.3236 0.3296 0.0081  -0.0659 0.1320  142  TRP B N   
2372 C CA  . TRP B 142 ? 0.3154 0.3363 0.3607 0.0163  -0.0520 0.1316  142  TRP B CA  
2373 C C   . TRP B 142 ? 0.3072 0.3039 0.3278 0.0057  -0.0640 0.1227  142  TRP B C   
2374 O O   . TRP B 142 ? 0.3529 0.3378 0.3386 -0.0159 -0.0795 0.1266  142  TRP B O   
2375 C CB  . TRP B 142 ? 0.3045 0.3733 0.3774 0.0205  -0.0410 0.1616  142  TRP B CB  
2376 C CG  . TRP B 142 ? 0.3680 0.4480 0.4540 0.0417  -0.0202 0.1741  142  TRP B CG  
2377 C CD1 . TRP B 142 ? 0.3864 0.5013 0.4706 0.0491  -0.0208 0.1945  142  TRP B CD1 
2378 C CD2 . TRP B 142 ? 0.3299 0.3801 0.4225 0.0582  0.0087  0.1654  142  TRP B CD2 
2379 N NE1 . TRP B 142 ? 0.4420 0.5390 0.5253 0.0755  0.0076  0.2015  142  TRP B NE1 
2380 C CE2 . TRP B 142 ? 0.3564 0.4084 0.4420 0.0767  0.0278  0.1825  142  TRP B CE2 
2381 C CE3 . TRP B 142 ? 0.3262 0.3486 0.4244 0.0574  0.0233  0.1420  142  TRP B CE3 
2382 C CZ2 . TRP B 142 ? 0.4401 0.4500 0.5143 0.0904  0.0646  0.1771  142  TRP B CZ2 
2383 C CZ3 . TRP B 142 ? 0.4385 0.4346 0.5339 0.0659  0.0583  0.1346  142  TRP B CZ3 
2384 C CH2 . TRP B 142 ? 0.2882 0.2702 0.3672 0.0798  0.0799  0.1515  142  TRP B CH2 
2385 N N   . PHE B 143 ? 0.2872 0.2709 0.3177 0.0192  -0.0541 0.1083  143  PHE B N   
2386 C CA  . PHE B 143 ? 0.2907 0.2516 0.3002 0.0150  -0.0604 0.1033  143  PHE B CA  
2387 C C   . PHE B 143 ? 0.2926 0.2745 0.3045 -0.0083 -0.0647 0.1258  143  PHE B C   
2388 O O   . PHE B 143 ? 0.2531 0.2867 0.3019 -0.0096 -0.0574 0.1473  143  PHE B O   
2389 C CB  . PHE B 143 ? 0.2860 0.2487 0.3198 0.0351  -0.0454 0.0875  143  PHE B CB  
2390 C CG  . PHE B 143 ? 0.3118 0.3093 0.3967 0.0388  -0.0240 0.1028  143  PHE B CG  
2391 C CD1 . PHE B 143 ? 0.2724 0.2885 0.3758 0.0331  -0.0219 0.1244  143  PHE B CD1 
2392 C CD2 . PHE B 143 ? 0.3387 0.3448 0.4425 0.0472  -0.0037 0.0961  143  PHE B CD2 
2393 C CE1 . PHE B 143 ? 0.3103 0.3509 0.4486 0.0438  -0.0002 0.1407  143  PHE B CE1 
2394 C CE2 . PHE B 143 ? 0.3499 0.3678 0.4808 0.0532  0.0216  0.1117  143  PHE B CE2 
2395 C CZ  . PHE B 143 ? 0.2500 0.2838 0.3967 0.0549  0.0226  0.1346  143  PHE B CZ  
2396 N N   . GLU B 144 ? 0.2262 0.2941 0.2626 0.0216  -0.0044 -0.0633 144  GLU B N   
2397 C CA  . GLU B 144 ? 0.2595 0.2940 0.3064 0.0201  -0.0068 -0.0528 144  GLU B CA  
2398 C C   . GLU B 144 ? 0.2372 0.2452 0.2661 0.0135  0.0008  -0.0276 144  GLU B C   
2399 O O   . GLU B 144 ? 0.2436 0.2436 0.2617 0.0113  0.0039  -0.0208 144  GLU B O   
2400 C CB  . GLU B 144 ? 0.2997 0.3116 0.3798 0.0219  -0.0238 -0.0651 144  GLU B CB  
2401 C CG  . GLU B 144 ? 0.4002 0.4317 0.5037 0.0328  -0.0385 -0.0975 144  GLU B CG  
2402 C CD  . GLU B 144 ? 0.3104 0.3530 0.4209 0.0252  -0.0369 -0.0985 144  GLU B CD  
2403 O OE1 . GLU B 144 ? 0.4221 0.4375 0.5454 0.0076  -0.0427 -0.0854 144  GLU B OE1 
2404 O OE2 . GLU B 144 ? 0.3865 0.4726 0.4866 0.0339  -0.0302 -0.1101 144  GLU B OE2 
2405 N N   . PRO B 145 ? 0.2390 0.2466 0.2667 0.0124  0.0026  -0.0192 145  PRO B N   
2406 C CA  . PRO B 145 ? 0.2618 0.2621 0.2751 0.0125  0.0070  -0.0043 145  PRO B CA  
2407 C C   . PRO B 145 ? 0.2305 0.2174 0.2527 0.0048  0.0065  0.0061  145  PRO B C   
2408 O O   . PRO B 145 ? 0.2459 0.2212 0.2888 -0.0030 -0.0019 0.0069  145  PRO B O   
2409 C CB  . PRO B 145 ? 0.2825 0.3139 0.3044 0.0121  0.0072  -0.0055 145  PRO B CB  
2410 C CG  . PRO B 145 ? 0.3092 0.3542 0.3374 0.0171  0.0035  -0.0209 145  PRO B CG  
2411 C CD  . PRO B 145 ? 0.2943 0.3238 0.3368 0.0119  -0.0003 -0.0284 145  PRO B CD  
2412 N N   . PHE B 146 ? 0.2421 0.2231 0.2468 0.0087  0.0102  0.0127  146  PHE B N   
2413 C CA  . PHE B 146 ? 0.2723 0.2467 0.2812 0.0054  0.0092  0.0218  146  PHE B CA  
2414 C C   . PHE B 146 ? 0.2453 0.2341 0.2401 0.0097  0.0131  0.0288  146  PHE B C   
2415 O O   . PHE B 146 ? 0.2336 0.2300 0.2141 0.0201  0.0129  0.0209  146  PHE B O   
2416 C CB  . PHE B 146 ? 0.2570 0.2242 0.2653 0.0086  0.0071  0.0112  146  PHE B CB  
2417 C CG  . PHE B 146 ? 0.2759 0.2446 0.2615 0.0056  0.0121  0.0079  146  PHE B CG  
2418 C CD1 . PHE B 146 ? 0.2399 0.2086 0.2113 0.0000  0.0123  0.0047  146  PHE B CD1 
2419 C CD2 . PHE B 146 ? 0.2918 0.2594 0.2676 0.0045  0.0131  0.0099  146  PHE B CD2 
2420 C CE1 . PHE B 146 ? 0.2633 0.2187 0.2061 -0.0131 0.0104  0.0102  146  PHE B CE1 
2421 C CE2 . PHE B 146 ? 0.3036 0.2613 0.2572 -0.0066 0.0121  0.0086  146  PHE B CE2 
2422 C CZ  . PHE B 146 ? 0.2814 0.2273 0.2168 -0.0183 0.0093  0.0118  146  PHE B CZ  
2423 N N   . LYS B 147 ? 0.2711 0.2634 0.2686 0.0065  0.0119  0.0403  147  LYS B N   
2424 C CA  . LYS B 147 ? 0.2999 0.3167 0.2855 0.0135  0.0147  0.0418  147  LYS B CA  
2425 C C   . LYS B 147 ? 0.3108 0.3160 0.2921 0.0179  0.0129  0.0385  147  LYS B C   
2426 O O   . LYS B 147 ? 0.3273 0.3153 0.3171 0.0166  0.0079  0.0386  147  LYS B O   
2427 C CB  . LYS B 147 ? 0.3289 0.3897 0.3171 0.0029  0.0163  0.0612  147  LYS B CB  
2428 C CG  . LYS B 147 ? 0.3864 0.4271 0.3786 -0.0137 0.0083  0.0876  147  LYS B CG  
2429 C CD  . LYS B 147 ? 0.5204 0.6091 0.5093 -0.0395 0.0088  0.1168  147  LYS B CD  
2430 C CE  . LYS B 147 ? 0.6499 0.7037 0.6308 -0.0585 -0.0070 0.1523  147  LYS B CE  
2431 N NZ  . LYS B 147 ? 0.7537 0.8075 0.7221 -0.0367 -0.0089 0.1497  147  LYS B NZ  
2432 N N   . VAL B 148 ? 0.2694 0.2897 0.2390 0.0270  0.0133  0.0289  148  VAL B N   
2433 C CA  . VAL B 148 ? 0.2584 0.2825 0.2246 0.0303  0.0117  0.0227  148  VAL B CA  
2434 C C   . VAL B 148 ? 0.2763 0.3414 0.2358 0.0420  0.0108  0.0203  148  VAL B C   
2435 O O   . VAL B 148 ? 0.2667 0.3512 0.2209 0.0524  0.0084  0.0092  148  VAL B O   
2436 C CB  . VAL B 148 ? 0.3116 0.3114 0.2698 0.0231  0.0094  0.0059  148  VAL B CB  
2437 C CG1 . VAL B 148 ? 0.4053 0.3964 0.3710 0.0118  0.0117  0.0058  148  VAL B CG1 
2438 C CG2 . VAL B 148 ? 0.2824 0.2561 0.2240 0.0260  0.0012  -0.0032 148  VAL B CG2 
2439 N N   . ASP B 149 ? 0.2259 0.3986 0.2079 -0.0352 0.0428  -0.0056 149  ASP B N   
2440 C CA  . ASP B 149 ? 0.2409 0.4078 0.2148 -0.0306 0.0413  -0.0061 149  ASP B CA  
2441 C C   . ASP B 149 ? 0.2390 0.3903 0.2204 -0.0069 0.0236  0.0094  149  ASP B C   
2442 O O   . ASP B 149 ? 0.2521 0.3870 0.2383 0.0029  0.0214  0.0166  149  ASP B O   
2443 C CB  . ASP B 149 ? 0.3468 0.4625 0.2748 -0.0497 0.0733  -0.0100 149  ASP B CB  
2444 C CG  . ASP B 149 ? 0.4696 0.6115 0.3903 -0.0891 0.1040  -0.0434 149  ASP B CG  
2445 O OD1 . ASP B 149 ? 0.5485 0.7285 0.4782 -0.1038 0.1089  -0.0699 149  ASP B OD1 
2446 O OD2 . ASP B 149 ? 0.5208 0.6513 0.4293 -0.1102 0.1279  -0.0507 149  ASP B OD2 
2447 N N   . TYR B 150 ? 0.2247 0.3905 0.2104 -0.0013 0.0144  0.0068  150  TYR B N   
2448 C CA  . TYR B 150 ? 0.2078 0.3748 0.2021 0.0126  0.0020  0.0111  150  TYR B CA  
2449 C C   . TYR B 150 ? 0.2442 0.4019 0.2163 0.0122  0.0013  0.0106  150  TYR B C   
2450 O O   . TYR B 150 ? 0.2738 0.4315 0.2364 -0.0029 0.0119  0.0022  150  TYR B O   
2451 C CB  . TYR B 150 ? 0.1947 0.3763 0.2061 0.0152  -0.0004 0.0063  150  TYR B CB  
2452 C CG  . TYR B 150 ? 0.1720 0.3402 0.1803 0.0166  0.0043  0.0068  150  TYR B CG  
2453 C CD1 . TYR B 150 ? 0.2232 0.4005 0.2205 0.0225  0.0016  0.0060  150  TYR B CD1 
2454 C CD2 . TYR B 150 ? 0.1851 0.3361 0.1987 0.0113  0.0128  0.0008  150  TYR B CD2 
2455 C CE1 . TYR B 150 ? 0.1878 0.3433 0.1656 0.0278  0.0039  0.0079  150  TYR B CE1 
2456 C CE2 . TYR B 150 ? 0.2038 0.3233 0.1995 0.0076  0.0232  0.0001  150  TYR B CE2 
2457 C CZ  . TYR B 150 ? 0.2346 0.3479 0.2044 0.0187  0.0173  0.0081  150  TYR B CZ  
2458 O OH  . TYR B 150 ? 0.2808 0.3525 0.2171 0.0182  0.0262  0.0087  150  TYR B OH  
2459 N N   . LYS B 151 ? 0.2779 0.4362 0.2430 0.0279  -0.0107 0.0124  151  LYS B N   
2460 C CA  . LYS B 151 ? 0.3366 0.4840 0.2734 0.0283  -0.0139 0.0117  151  LYS B CA  
2461 C C   . LYS B 151 ? 0.2761 0.4694 0.2468 0.0272  -0.0235 0.0002  151  LYS B C   
2462 O O   . LYS B 151 ? 0.2805 0.5094 0.2808 0.0341  -0.0299 -0.0118 151  LYS B O   
2463 C CB  . LYS B 151 ? 0.4310 0.5287 0.3019 0.0542  -0.0185 0.0214  151  LYS B CB  
2464 C CG  . LYS B 151 ? 0.5940 0.6268 0.4181 0.0510  0.0054  0.0299  151  LYS B CG  
2465 C CD  . LYS B 151 ? 0.7727 0.7042 0.4870 0.0693  0.0212  0.0408  151  LYS B CD  
2466 C CE  . LYS B 151 ? 0.8721 0.7257 0.5306 0.0639  0.0572  0.0461  151  LYS B CE  
2467 N NZ  . LYS B 151 ? 0.8206 0.7218 0.5435 0.0170  0.0775  0.0296  151  LYS B NZ  
2468 N N   . PHE B 152 ? 0.2540 0.4468 0.2202 0.0124  -0.0175 -0.0034 152  PHE B N   
2469 C CA  . PHE B 152 ? 0.2692 0.4965 0.2569 0.0036  -0.0166 -0.0178 152  PHE B CA  
2470 C C   . PHE B 152 ? 0.2888 0.5054 0.2542 -0.0096 -0.0126 -0.0196 152  PHE B C   
2471 O O   . PHE B 152 ? 0.2707 0.4493 0.2073 -0.0170 -0.0056 -0.0129 152  PHE B O   
2472 C CB  . PHE B 152 ? 0.2659 0.4943 0.2798 -0.0074 0.0029  -0.0241 152  PHE B CB  
2473 C CG  . PHE B 152 ? 0.2621 0.4683 0.2709 -0.0084 0.0139  -0.0169 152  PHE B CG  
2474 C CD1 . PHE B 152 ? 0.2472 0.4504 0.2555 0.0000  0.0085  -0.0108 152  PHE B CD1 
2475 C CD2 . PHE B 152 ? 0.2960 0.4931 0.3022 -0.0162 0.0318  -0.0232 152  PHE B CD2 
2476 C CE1 . PHE B 152 ? 0.2494 0.4620 0.2642 0.0064  0.0132  -0.0170 152  PHE B CE1 
2477 C CE2 . PHE B 152 ? 0.3135 0.5015 0.3185 -0.0039 0.0379  -0.0216 152  PHE B CE2 
2478 C CZ  . PHE B 152 ? 0.1884 0.3949 0.2025 0.0108  0.0246  -0.0214 152  PHE B CZ  
2479 N N   . LYS B 153 ? 0.2502 0.4454 0.3455 0.0406  0.0438  0.0891  153  LYS B N   
2480 C CA  . LYS B 153 ? 0.2746 0.4494 0.3215 0.0334  0.0068  0.0697  153  LYS B CA  
2481 C C   . LYS B 153 ? 0.2802 0.4617 0.3476 0.0160  0.0171  0.0601  153  LYS B C   
2482 O O   . LYS B 153 ? 0.3001 0.5037 0.4445 0.0070  0.0186  0.0617  153  LYS B O   
2483 C CB  . LYS B 153 ? 0.3408 0.5147 0.4272 0.0426  -0.0540 0.0579  153  LYS B CB  
2484 C CG  . LYS B 153 ? 0.4550 0.6039 0.5170 0.0673  -0.0855 0.0612  153  LYS B CG  
2485 C CD  . LYS B 153 ? 0.5733 0.6973 0.6672 0.0813  -0.1719 0.0426  153  LYS B CD  
2486 C CE  . LYS B 153 ? 0.7452 0.7483 0.6615 0.0919  -0.2201 0.0363  153  LYS B CE  
2487 N NZ  . LYS B 153 ? 0.8075 0.7797 0.6631 0.1121  -0.2115 0.0481  153  LYS B NZ  
2488 N N   . TYR B 154 ? 0.2724 0.4307 0.2774 0.0100  0.0276  0.0462  154  TYR B N   
2489 C CA  . TYR B 154 ? 0.2552 0.4122 0.2790 0.0007  0.0251  0.0290  154  TYR B CA  
2490 C C   . TYR B 154 ? 0.3252 0.4651 0.3265 -0.0048 -0.0040 0.0083  154  TYR B C   
2491 O O   . TYR B 154 ? 0.3753 0.4783 0.3007 -0.0067 -0.0002 -0.0065 154  TYR B O   
2492 C CB  . TYR B 154 ? 0.2482 0.3945 0.2490 0.0018  0.0465  0.0142  154  TYR B CB  
2493 C CG  . TYR B 154 ? 0.2125 0.3522 0.2396 0.0007  0.0337  -0.0123 154  TYR B CG  
2494 C CD1 . TYR B 154 ? 0.2171 0.3385 0.2669 -0.0005 0.0157  -0.0049 154  TYR B CD1 
2495 C CD2 . TYR B 154 ? 0.2222 0.3636 0.2483 -0.0005 0.0443  -0.0497 154  TYR B CD2 
2496 C CE1 . TYR B 154 ? 0.2353 0.3351 0.2964 0.0029  -0.0063 -0.0308 154  TYR B CE1 
2497 C CE2 . TYR B 154 ? 0.2090 0.3462 0.2732 0.0051  0.0285  -0.0796 154  TYR B CE2 
2498 C CZ  . TYR B 154 ? 0.2621 0.3757 0.3390 0.0100  -0.0046 -0.0688 154  TYR B CZ  
2499 O OH  . TYR B 154 ? 0.2579 0.3520 0.3610 0.0204  -0.0305 -0.1011 154  TYR B OH  
2500 N N   . THR B 155 ? 0.3544 0.5021 0.4050 -0.0113 -0.0300 0.0067  155  THR B N   
2501 C CA  . THR B 155 ? 0.4018 0.5184 0.4239 -0.0160 -0.0683 -0.0098 155  THR B CA  
2502 C C   . THR B 155 ? 0.4258 0.5217 0.4293 -0.0214 -0.0648 -0.0333 155  THR B C   
2503 O O   . THR B 155 ? 0.4653 0.5233 0.4364 -0.0262 -0.0945 -0.0471 155  THR B O   
2504 C CB  . THR B 155 ? 0.4222 0.5600 0.5252 -0.0204 -0.1107 -0.0009 155  THR B CB  
2505 O OG1 . THR B 155 ? 0.3475 0.5195 0.5318 -0.0331 -0.0872 0.0081  155  THR B OG1 
2506 C CG2 . THR B 155 ? 0.4221 0.5743 0.5517 -0.0066 -0.1275 0.0105  155  THR B CG2 
2507 N N   . GLY B 156 ? 0.4222 0.5320 0.4445 -0.0172 -0.0369 -0.0405 156  GLY B N   
2508 C CA  . GLY B 156 ? 0.4760 0.5674 0.4969 -0.0141 -0.0391 -0.0704 156  GLY B CA  
2509 C C   . GLY B 156 ? 0.4835 0.5651 0.5395 -0.0131 -0.0570 -0.0655 156  GLY B C   
2510 O O   . GLY B 156 ? 0.4632 0.5433 0.5377 -0.0241 -0.0602 -0.0384 156  GLY B O   
2511 N N   . THR B 157 ? 0.5321 0.5938 0.5933 -0.0008 -0.0660 -0.0966 157  THR B N   
2512 C CA  . THR B 157 ? 0.5871 0.6037 0.6492 0.0046  -0.0935 -0.0967 157  THR B CA  
2513 C C   . THR B 157 ? 0.6736 0.6557 0.7154 -0.0154 -0.1145 -0.0815 157  THR B C   
2514 O O   . THR B 157 ? 0.6605 0.6431 0.6954 -0.0199 -0.1290 -0.0944 157  THR B O   
2515 C CB  . THR B 157 ? 0.6192 0.6177 0.7054 0.0299  -0.1149 -0.1429 157  THR B CB  
2516 O OG1 . THR B 157 ? 0.5594 0.4797 0.6156 0.0378  -0.1586 -0.1421 157  THR B OG1 
2517 C CG2 . THR B 157 ? 0.6431 0.6478 0.7302 0.0318  -0.1113 -0.1754 157  THR B CG2 
2518 N N   . PRO B 158 ? 0.7565 0.6964 0.7814 -0.0320 -0.1105 -0.0557 158  PRO B N   
2519 C CA  . PRO B 158 ? 0.8529 0.7583 0.8714 -0.0611 -0.1183 -0.0448 158  PRO B CA  
2520 C C   . PRO B 158 ? 1.0001 0.8077 0.9543 -0.0610 -0.1532 -0.0613 158  PRO B C   
2521 O O   . PRO B 158 ? 1.0518 0.8069 0.9827 -0.0925 -0.1521 -0.0509 158  PRO B O   
2522 C CB  . PRO B 158 ? 0.8550 0.7523 0.8853 -0.0853 -0.0750 -0.0147 158  PRO B CB  
2523 C CG  . PRO B 158 ? 0.8018 0.6660 0.7873 -0.0644 -0.0631 -0.0098 158  PRO B CG  
2524 C CD  . PRO B 158 ? 0.7598 0.6777 0.7672 -0.0316 -0.0854 -0.0341 158  PRO B CD  
2556 O O   . HOH I .   ? 0.2866 0.2985 0.2496 0.0006  -0.0203 0.0157  1001 HOH A O   
2557 O O   . HOH I .   ? 0.2887 0.2779 0.2784 -0.0017 -0.0002 0.0016  1002 HOH A O   
2558 O O   . HOH I .   ? 0.2665 0.2813 0.2650 0.0025  -0.0007 0.0017  1003 HOH A O   
2559 O O   . HOH I .   ? 0.2997 0.2699 0.2859 0.0034  -0.0023 0.0049  1004 HOH A O   
2560 O O   . HOH I .   ? 0.2460 0.2345 0.2361 -0.0022 -0.0003 0.0032  1005 HOH A O   
2561 O O   . HOH I .   ? 0.2683 0.2532 0.2599 -0.0027 -0.0012 0.0002  1006 HOH A O   
2562 O O   . HOH I .   ? 0.3350 0.3237 0.3219 0.0025  -0.0049 -0.0053 1007 HOH A O   
2563 O O   . HOH I .   ? 0.3039 0.2642 0.2899 -0.0083 -0.0008 0.0101  1008 HOH A O   
2564 O O   . HOH I .   ? 0.4010 0.4022 0.3790 -0.0063 -0.0003 0.0153  1009 HOH A O   
2565 O O   . HOH I .   ? 0.3634 0.3734 0.3321 0.0032  -0.0222 0.0170  1010 HOH A O   
2566 O O   . HOH I .   ? 0.3098 0.2900 0.3040 -0.0094 -0.0002 0.0033  1011 HOH A O   
2567 O O   . HOH I .   ? 0.4651 0.4452 0.4534 -0.0092 0.0016  0.0125  1012 HOH A O   
2568 O O   . HOH I .   ? 0.3642 0.3279 0.3527 -0.0091 0.0012  0.0051  1013 HOH A O   
2569 O O   . HOH I .   ? 0.2804 0.2697 0.2681 -0.0045 0.0019  0.0088  1014 HOH A O   
2570 O O   . HOH I .   ? 0.3301 0.3422 0.2870 0.0032  -0.0161 0.0004  1015 HOH A O   
2571 O O   . HOH I .   ? 0.3370 0.3379 0.3108 -0.0008 -0.0164 0.0005  1016 HOH A O   
2572 O O   . HOH I .   ? 0.3876 0.3846 0.3798 0.0182  -0.0052 -0.0013 1017 HOH A O   
2573 O O   . HOH I .   ? 0.3852 0.3854 0.3743 0.0240  -0.0030 -0.0099 1018 HOH A O   
2574 O O   . HOH I .   ? 0.3565 0.3502 0.3323 0.0038  -0.0125 0.0154  1019 HOH A O   
2575 O O   . HOH I .   ? 0.3967 0.4240 0.3479 -0.0040 -0.0104 0.0145  1020 HOH A O   
2576 O O   . HOH I .   ? 0.3829 0.4005 0.3786 0.0074  0.0028  -0.0046 1021 HOH A O   
2577 O O   . HOH I .   ? 0.3777 0.3862 0.3733 0.0101  -0.0047 0.0032  1022 HOH A O   
2578 O O   . HOH I .   ? 0.3311 0.2935 0.3101 0.0192  -0.0149 0.0039  1023 HOH A O   
2579 O O   . HOH I .   ? 0.3963 0.3514 0.3692 0.0265  -0.0125 -0.0099 1024 HOH A O   
2580 O O   . HOH I .   ? 0.4105 0.3782 0.3947 0.0103  -0.0208 -0.0177 1025 HOH A O   
2581 O O   . HOH I .   ? 0.5207 0.5091 0.5123 -0.0004 -0.0012 -0.0016 1026 HOH A O   
2582 O O   . HOH I .   ? 0.3766 0.3849 0.3550 -0.0005 0.0057  -0.0111 1027 HOH A O   
2583 O O   . HOH I .   ? 0.5217 0.4618 0.4928 -0.0146 -0.0127 0.0224  1028 HOH A O   
2584 O O   . HOH I .   ? 0.4990 0.4700 0.4925 -0.0119 0.0016  0.0091  1029 HOH A O   
2585 O O   . HOH I .   ? 0.4369 0.4414 0.4313 -0.0025 -0.0040 0.0040  1030 HOH A O   
2586 O O   . HOH I .   ? 0.5605 0.5725 0.5561 0.0229  -0.0049 -0.0048 1031 HOH A O   
2587 O O   . HOH I .   ? 0.4768 0.4993 0.4321 -0.0150 -0.0082 0.0278  1032 HOH A O   
2588 O O   . HOH I .   ? 0.4823 0.4927 0.4719 -0.0049 -0.0118 0.0051  1033 HOH A O   
2589 O O   . HOH I .   ? 0.5506 0.4995 0.5277 -0.0047 -0.0079 0.0136  1034 HOH A O   
2590 O O   . HOH I .   ? 0.4611 0.4765 0.4466 0.0013  -0.0145 0.0079  1035 HOH A O   
2591 O O   . HOH I .   ? 0.5371 0.5471 0.5114 -0.0009 -0.0187 0.0057  1036 HOH A O   
2592 O O   . HOH I .   ? 0.4930 0.4404 0.4663 -0.0023 -0.0121 0.0158  1037 HOH A O   
2593 O O   . HOH I .   ? 0.5329 0.5561 0.4841 0.0009  -0.0129 0.0064  1038 HOH A O   
2594 O O   . HOH I .   ? 0.4084 0.4153 0.4041 -0.0058 -0.0042 0.0041  1039 HOH A O   
2595 O O   . HOH I .   ? 0.4825 0.4504 0.4524 -0.0021 -0.0154 0.0220  1040 HOH A O   
2596 O O   . HOH I .   ? 0.4989 0.5311 0.5009 0.0010  -0.0028 0.0030  1041 HOH A O   
2597 O O   . HOH I .   ? 0.5678 0.5668 0.5527 0.0052  -0.0023 -0.0056 1042 HOH A O   
2598 O O   . HOH I .   ? 0.5493 0.5830 0.4952 0.0069  -0.0096 -0.0037 1043 HOH A O   
2599 O O   . HOH I .   ? 0.5061 0.4803 0.4675 0.0169  -0.0272 -0.0247 1044 HOH A O   
2600 O O   . HOH I .   ? 0.4986 0.5206 0.4968 0.0180  -0.0015 -0.0049 1045 HOH A O   
2601 O O   . HOH I .   ? 0.4843 0.4419 0.4688 -0.0052 -0.0011 0.0063  1046 HOH A O   
2602 O O   . HOH I .   ? 0.4649 0.4743 0.4175 -0.0015 -0.0287 0.0034  1047 HOH A O   
2603 O O   . HOH I .   ? 0.3669 0.4057 0.3660 -0.0147 0.0022  0.0030  1048 HOH A O   
2604 O O   . HOH I .   ? 0.4325 0.4252 0.4152 0.0060  -0.0064 -0.0083 1049 HOH A O   
2605 O O   . HOH I .   ? 0.4618 0.4593 0.4423 -0.0041 -0.0151 0.0009  1050 HOH A O   
2606 O O   . HOH I .   ? 0.5067 0.4702 0.4832 0.0167  -0.0192 0.0101  1051 HOH A O   
2607 O O   . HOH I .   ? 0.5499 0.5389 0.5083 0.0004  -0.0280 -0.0073 1052 HOH A O   
2608 O O   . HOH I .   ? 0.4931 0.4518 0.4706 0.0238  -0.0163 0.0001  1053 HOH A O   
2609 O O   . HOH I .   ? 0.4955 0.5043 0.4541 -0.0113 -0.0110 0.0266  1054 HOH A O   
2610 O O   . HOH I .   ? 0.4618 0.4705 0.4524 0.0078  -0.0093 0.0073  1055 HOH A O   
2611 O O   . HOH I .   ? 0.4999 0.4764 0.4646 -0.0119 -0.0361 -0.0028 1056 HOH A O   
2612 O O   . HOH I .   ? 0.5498 0.5338 0.5018 0.0162  -0.0270 -0.0233 1057 HOH A O   
2613 O O   . HOH I .   ? 0.6758 0.6704 0.6642 0.0280  -0.0068 -0.0088 1058 HOH A O   
2614 O O   . HOH I .   ? 0.4017 0.4120 0.3511 -0.0132 -0.0179 0.0311  1059 HOH A O   
2615 O O   . HOH I .   ? 0.5496 0.5426 0.5379 0.0011  -0.0011 -0.0017 1060 HOH A O   
2616 O O   . HOH I .   ? 0.5424 0.4967 0.5262 -0.0125 -0.0024 0.0135  1061 HOH A O   
2617 O O   . HOH I .   ? 0.4924 0.4801 0.4503 0.0206  -0.0229 -0.0260 1062 HOH A O   
2618 O O   . HOH I .   ? 0.5984 0.6049 0.5450 0.0157  -0.0198 -0.0190 1063 HOH A O   
2619 O O   . HOH I .   ? 0.4959 0.4496 0.4733 0.0125  -0.0112 0.0038  1064 HOH A O   
2620 O O   . HOH I .   ? 0.4952 0.5106 0.4871 0.0216  0.0001  -0.0111 1065 HOH A O   
2621 O O   . HOH I .   ? 0.6538 0.6314 0.6344 -0.0290 -0.0052 0.0314  1066 HOH A O   
2622 O O   . HOH I .   ? 0.4534 0.4665 0.4311 0.0012  -0.0171 0.0087  1067 HOH A O   
2623 O O   . HOH I .   ? 0.4770 0.4912 0.4515 0.0011  -0.0194 0.0098  1068 HOH A O   
2624 O O   . HOH I .   ? 0.3374 0.3499 0.3110 0.0026  -0.0184 0.0119  1069 HOH A O   
2625 O O   . HOH I .   ? 0.3685 0.3058 0.3407 -0.0006 -0.0122 0.0113  1070 HOH A O   
2626 O O   . HOH I .   ? 0.4992 0.5022 0.4836 -0.0029 -0.0119 0.0032  1071 HOH A O   
2627 O O   . HOH I .   ? 0.5257 0.5513 0.4926 -0.0108 -0.0006 0.0202  1072 HOH A O   
2628 O O   . HOH I .   ? 0.5933 0.6388 0.5978 -0.0025 -0.0023 0.0034  1073 HOH A O   
2629 O O   . HOH I .   ? 0.5027 0.4690 0.4855 0.0120  -0.0065 0.0014  1074 HOH A O   
2630 O O   . HOH I .   ? 0.5796 0.5402 0.5507 0.0028  -0.0173 0.0189  1075 HOH A O   
2631 O O   . HOH I .   ? 0.4849 0.5194 0.4484 -0.0100 -0.0002 0.0188  1076 HOH A O   
2632 O O   . HOH I .   ? 0.6767 0.6772 0.6625 0.0025  0.0000  -0.0014 1077 HOH A O   
2633 O O   . HOH I .   ? 0.5490 0.5523 0.5379 0.0047  0.0001  -0.0045 1078 HOH A O   
2634 O O   . HOH I .   ? 0.6359 0.5888 0.6125 0.0049  -0.0041 -0.0021 1079 HOH A O   
2635 O O   . HOH I .   ? 0.4673 0.4243 0.4427 0.0038  -0.0025 -0.0048 1080 HOH A O   
2636 O O   . HOH I .   ? 0.4466 0.4593 0.4110 0.0008  -0.0188 0.0118  1081 HOH A O   
2637 O O   . HOH I .   ? 0.3932 0.4048 0.3382 -0.0119 -0.0227 0.0314  1082 HOH A O   
2638 O O   . HOH I .   ? 0.4143 0.4214 0.4105 -0.0096 -0.0044 0.0044  1083 HOH A O   
2639 O O   . HOH I .   ? 0.7063 0.6863 0.6842 0.0218  -0.0034 -0.0137 1084 HOH A O   
2640 O O   . HOH I .   ? 0.7159 0.7141 0.6725 -0.0111 -0.0168 0.0300  1085 HOH A O   
2641 O O   . HOH I .   ? 0.6179 0.6238 0.5607 0.0138  -0.0222 -0.0174 1086 HOH A O   
2642 O O   . HOH I .   ? 0.5441 0.5471 0.5151 0.0248  0.0007  -0.0240 1087 HOH A O   
2643 O O   . HOH I .   ? 0.4042 0.3575 0.3766 -0.0149 -0.0110 0.0246  1088 HOH A O   
2644 O O   . HOH I .   ? 0.6312 0.6284 0.5904 -0.0022 -0.0283 -0.0021 1089 HOH A O   
2645 O O   . HOH I .   ? 0.5002 0.4918 0.4817 0.0102  -0.0091 -0.0131 1090 HOH A O   
2646 O O   . HOH I .   ? 0.5486 0.5307 0.5251 -0.0036 -0.0194 -0.0049 1091 HOH A O   
2647 O O   . HOH I .   ? 0.4485 0.4219 0.4212 -0.0152 -0.0318 -0.0012 1092 HOH A O   
2648 O O   . HOH I .   ? 0.3585 0.3201 0.3273 -0.0132 -0.0132 0.0271  1093 HOH A O   
2649 O O   . HOH I .   ? 0.6368 0.6768 0.5978 0.0071  -0.0004 -0.0029 1094 HOH A O   
2650 O O   . HOH I .   ? 0.6365 0.6140 0.6128 -0.0225 -0.0057 0.0290  1095 HOH A O   
2651 O O   . HOH I .   ? 0.4955 0.5325 0.4613 -0.0015 0.0015  0.0081  1096 HOH A O   
2652 O O   . HOH I .   ? 0.6925 0.7059 0.6811 -0.0039 -0.0134 0.0059  1097 HOH A O   
2653 O O   . HOH I .   ? 0.4887 0.5234 0.4350 0.0003  -0.0096 0.0062  1098 HOH A O   
2654 O O   . HOH I .   ? 0.5569 0.5150 0.5207 0.0012  -0.0249 0.0250  1099 HOH A O   
2655 O O   . HOH I .   ? 0.5200 0.5649 0.4622 -0.0209 -0.0092 0.0318  1100 HOH A O   
2656 O O   . HOH I .   ? 0.5654 0.5145 0.5403 -0.0120 -0.0093 0.0200  1101 HOH A O   
2657 O O   . HOH I .   ? 0.4984 0.4641 0.4612 -0.0026 -0.0231 0.0272  1102 HOH A O   
2658 O O   . HOH I .   ? 0.6276 0.6486 0.6237 0.0047  -0.0087 0.0060  1103 HOH A O   
2659 O O   . HOH I .   ? 0.6306 0.6211 0.6108 0.0319  -0.0055 -0.0175 1104 HOH A O   
2660 O O   . HOH I .   ? 0.5537 0.5733 0.5523 0.0197  -0.0059 -0.0012 1105 HOH A O   
2661 O O   . HOH I .   ? 0.5749 0.6078 0.5538 0.0162  0.0006  -0.0138 1106 HOH A O   
2662 O O   . HOH I .   ? 0.5646 0.5119 0.5239 -0.0076 -0.0449 -0.0116 1107 HOH A O   
2663 O O   . HOH I .   ? 0.5610 0.5098 0.4990 0.0040  -0.0525 -0.0217 1108 HOH A O   
2664 O O   . HOH I .   ? 0.5606 0.5842 0.5013 -0.0146 -0.0191 0.0306  1109 HOH A O   
2665 O O   . HOH I .   ? 0.5792 0.5892 0.5372 0.0009  -0.0212 0.0030  1110 HOH A O   
2666 O O   . HOH I .   ? 0.6567 0.6165 0.6333 0.0294  -0.0158 -0.0060 1111 HOH A O   
2667 O O   . HOH I .   ? 0.5430 0.5298 0.5140 0.0029  -0.0170 0.0198  1112 HOH A O   
2668 O O   . HOH I .   ? 0.5477 0.5599 0.5064 0.0000  -0.0223 0.0061  1113 HOH A O   
2669 O O   . HOH I .   ? 0.7104 0.6651 0.6863 0.0224  -0.0138 -0.0027 1114 HOH A O   
2670 O O   . HOH I .   ? 0.5977 0.5510 0.5733 0.0191  -0.0114 -0.0032 1115 HOH A O   
2671 O O   . HOH I .   ? 0.9416 0.9424 0.9197 0.0069  -0.0157 0.0141  1116 HOH A O   
2672 O O   . HOH J .   ? 0.4246 0.4562 0.4368 0.0061  -0.0098 0.0064  1001 HOH B O   
2673 O O   . HOH J .   ? 0.6340 0.6623 0.6012 0.0035  0.0277  0.0188  1002 HOH B O   
2674 O O   . HOH J .   ? 0.5670 0.5463 0.5326 -0.0076 -0.0025 -0.0107 1003 HOH B O   
2675 O O   . HOH J .   ? 0.5518 0.5151 0.5144 -0.0109 0.0040  -0.0124 1004 HOH B O   
2676 O O   . HOH J .   ? 0.4231 0.4619 0.4336 0.0159  -0.0088 0.0191  1005 HOH B O   
2677 O O   . HOH J .   ? 0.3397 0.3465 0.3319 0.0098  0.0001  0.0222  1006 HOH B O   
2678 O O   . HOH J .   ? 0.2342 0.2536 0.2504 -0.0030 -0.0043 0.0011  1007 HOH B O   
2679 O O   . HOH J .   ? 0.2303 0.2501 0.2438 -0.0010 -0.0059 0.0038  1008 HOH B O   
2680 O O   . HOH J .   ? 0.2326 0.2449 0.2508 -0.0030 0.0000  0.0016  1009 HOH B O   
2681 O O   . HOH J .   ? 0.2438 0.2523 0.2567 0.0073  0.0033  0.0130  1010 HOH B O   
2682 O O   . HOH J .   ? 0.2476 0.2505 0.2484 0.0027  -0.0038 0.0095  1011 HOH B O   
2683 O O   . HOH J .   ? 0.2646 0.2942 0.2828 -0.0014 -0.0081 0.0045  1012 HOH B O   
2684 O O   . HOH J .   ? 0.2976 0.2786 0.2803 0.0090  0.0053  0.0088  1013 HOH B O   
2685 O O   . HOH J .   ? 0.2672 0.3110 0.2724 0.0031  -0.0133 0.0065  1014 HOH B O   
2686 O O   . HOH J .   ? 0.2393 0.2913 0.2377 0.0056  0.0353  0.0047  1015 HOH B O   
2687 O O   . HOH J .   ? 0.3439 0.3825 0.3488 0.0017  0.0078  0.0006  1016 HOH B O   
2688 O O   . HOH J .   ? 0.3159 0.3544 0.3328 0.0167  0.0150  -0.0005 1017 HOH B O   
2689 O O   . HOH J .   ? 0.3084 0.3095 0.3191 0.0043  0.0040  0.0096  1018 HOH B O   
2690 O O   . HOH J .   ? 0.2682 0.2643 0.2690 0.0123  0.0045  0.0156  1019 HOH B O   
2691 O O   . HOH J .   ? 0.3231 0.3361 0.3393 -0.0056 0.0005  -0.0048 1020 HOH B O   
2692 O O   . HOH J .   ? 0.3400 0.3614 0.3671 -0.0055 0.0001  0.0018  1021 HOH B O   
2693 O O   . HOH J .   ? 0.2994 0.3084 0.3021 -0.0121 -0.0054 0.0008  1022 HOH B O   
2694 O O   . HOH J .   ? 0.2748 0.2781 0.2807 0.0068  0.0004  0.0107  1023 HOH B O   
2695 O O   . HOH J .   ? 0.4336 0.4468 0.4467 -0.0079 0.0017  -0.0109 1024 HOH B O   
2696 O O   . HOH J .   ? 0.3710 0.3682 0.3728 0.0107  0.0064  0.0140  1025 HOH B O   
2697 O O   . HOH J .   ? 0.3108 0.3416 0.3211 -0.0033 -0.0120 0.0024  1026 HOH B O   
2698 O O   . HOH J .   ? 0.2925 0.2875 0.2926 0.0103  0.0081  0.0145  1027 HOH B O   
2699 O O   . HOH J .   ? 0.4409 0.4146 0.4067 0.0154  0.0102  0.0089  1028 HOH B O   
2700 O O   . HOH J .   ? 0.3385 0.3555 0.3378 0.0160  -0.0029 0.0229  1029 HOH B O   
2701 O O   . HOH J .   ? 0.4863 0.4663 0.4820 -0.0234 0.0097  -0.0005 1030 HOH B O   
2702 O O   . HOH J .   ? 0.3883 0.4226 0.4047 -0.0008 -0.0080 0.0045  1031 HOH B O   
2703 O O   . HOH J .   ? 0.4173 0.4155 0.4038 -0.0087 -0.0069 -0.0042 1032 HOH B O   
2704 O O   . HOH J .   ? 0.3250 0.3600 0.3389 0.0049  0.0032  0.0005  1033 HOH B O   
2705 O O   . HOH J .   ? 0.3817 0.4312 0.3919 -0.0015 -0.0147 -0.0005 1034 HOH B O   
2706 O O   . HOH J .   ? 0.3510 0.3691 0.3382 0.0005  0.0056  0.0181  1035 HOH B O   
2707 O O   . HOH J .   ? 0.4243 0.4549 0.4508 0.0005  -0.0038 0.0072  1036 HOH B O   
2708 O O   . HOH J .   ? 0.3523 0.3892 0.3239 0.0049  0.0151  0.0015  1037 HOH B O   
2709 O O   . HOH J .   ? 0.4069 0.4417 0.3724 0.0054  0.0324  0.0137  1038 HOH B O   
2710 O O   . HOH J .   ? 0.3628 0.3895 0.3791 0.0194  0.0089  0.0036  1039 HOH B O   
2711 O O   . HOH J .   ? 0.3458 0.3410 0.3413 0.0000  -0.0022 0.0080  1040 HOH B O   
2712 O O   . HOH J .   ? 0.3919 0.4359 0.4383 0.0008  0.0052  0.0084  1041 HOH B O   
2713 O O   . HOH J .   ? 0.3589 0.3661 0.3669 0.0104  0.0009  0.0152  1042 HOH B O   
2714 O O   . HOH J .   ? 0.3778 0.4184 0.3957 -0.0050 -0.0111 -0.0022 1043 HOH B O   
2715 O O   . HOH J .   ? 0.4353 0.4703 0.4617 0.0094  -0.0028 0.0137  1044 HOH B O   
2716 O O   . HOH J .   ? 0.4845 0.4998 0.4717 0.0002  -0.0132 -0.0007 1045 HOH B O   
2717 O O   . HOH J .   ? 0.3649 0.4216 0.3727 0.0028  -0.0170 0.0030  1046 HOH B O   
2718 O O   . HOH J .   ? 0.3387 0.4059 0.3177 0.0092  -0.0192 0.0026  1047 HOH B O   
2719 O O   . HOH J .   ? 0.4141 0.4291 0.4231 0.0111  0.0107  -0.0033 1048 HOH B O   
2720 O O   . HOH J .   ? 0.5254 0.5634 0.4756 0.0097  0.0122  0.0070  1049 HOH B O   
2721 O O   . HOH J .   ? 0.4105 0.4506 0.3962 -0.0001 0.0355  0.0137  1050 HOH B O   
2722 O O   . HOH J .   ? 0.3549 0.3648 0.3444 0.0095  0.0002  0.0228  1051 HOH B O   
2723 O O   . HOH J .   ? 0.3287 0.3643 0.3259 0.0079  0.0178  -0.0054 1052 HOH B O   
2724 O O   . HOH J .   ? 0.4130 0.4458 0.4279 0.0023  -0.0090 0.0052  1053 HOH B O   
2725 O O   . HOH J .   ? 0.4681 0.4291 0.4224 0.0167  0.0151  0.0055  1054 HOH B O   
2726 O O   . HOH J .   ? 0.3604 0.3987 0.3708 0.0020  0.0048  0.0009  1055 HOH B O   
2727 O O   . HOH J .   ? 0.4908 0.4964 0.4725 -0.0083 -0.0111 -0.0081 1056 HOH B O   
2728 O O   . HOH J .   ? 0.4108 0.4384 0.3780 0.0018  0.0116  -0.0204 1057 HOH B O   
2729 O O   . HOH J .   ? 0.4155 0.4531 0.4349 0.0196  0.0128  0.0017  1058 HOH B O   
2730 O O   . HOH J .   ? 0.3623 0.4117 0.3834 -0.0083 -0.0127 -0.0074 1059 HOH B O   
2731 O O   . HOH J .   ? 0.5146 0.5068 0.5059 -0.0148 -0.0022 -0.0040 1060 HOH B O   
2732 O O   . HOH J .   ? 0.4194 0.4077 0.4180 -0.0189 0.0073  0.0037  1061 HOH B O   
2733 O O   . HOH J .   ? 0.3443 0.3257 0.3355 -0.0068 0.0046  0.0074  1062 HOH B O   
2734 O O   . HOH J .   ? 0.3937 0.4264 0.4176 -0.0062 -0.0068 -0.0013 1063 HOH B O   
2735 O O   . HOH J .   ? 0.3485 0.4048 0.3636 -0.0053 -0.0160 -0.0062 1064 HOH B O   
2736 O O   . HOH J .   ? 0.5367 0.5148 0.5141 0.0116  0.0075  0.0090  1065 HOH B O   
2737 O O   . HOH J .   ? 0.4520 0.4271 0.4709 -0.0121 0.0241  -0.0109 1066 HOH B O   
2738 O O   . HOH J .   ? 0.4699 0.4960 0.4835 -0.0112 -0.0051 0.0035  1067 HOH B O   
2739 O O   . HOH J .   ? 0.5084 0.5414 0.5426 -0.0034 -0.0005 0.0043  1068 HOH B O   
2740 O O   . HOH J .   ? 0.3987 0.4433 0.3440 0.0071  0.0036  -0.0088 1069 HOH B O   
2741 O O   . HOH J .   ? 0.5664 0.6208 0.5248 0.0204  -0.0107 0.0183  1070 HOH B O   
2742 O O   . HOH J .   ? 0.5032 0.5141 0.4821 0.0035  0.0105  0.0239  1071 HOH B O   
2743 O O   . HOH J .   ? 0.6499 0.6755 0.6652 0.0231  0.0158  0.0014  1072 HOH B O   
2744 O O   . HOH J .   ? 0.3756 0.4200 0.3782 0.0065  0.0201  -0.0006 1073 HOH B O   
2745 O O   . HOH J .   ? 0.5088 0.5283 0.5211 0.0174  0.0128  -0.0002 1074 HOH B O   
2746 O O   . HOH J .   ? 0.5567 0.5891 0.5820 -0.0017 -0.0059 0.0046  1075 HOH B O   
2747 O O   . HOH J .   ? 0.4068 0.4490 0.4137 0.0072  0.0159  -0.0015 1076 HOH B O   
2748 O O   . HOH J .   ? 0.4917 0.5311 0.4633 0.0077  0.0290  0.0017  1077 HOH B O   
2749 O O   . HOH J .   ? 0.4482 0.4323 0.4358 0.0026  0.0016  0.0072  1078 HOH B O   
2750 O O   . HOH J .   ? 0.5006 0.4778 0.4299 0.0238  0.0037  0.0053  1079 HOH B O   
2751 O O   . HOH J .   ? 0.5448 0.5797 0.5156 0.0080  0.0230  -0.0070 1080 HOH B O   
2752 O O   . HOH J .   ? 0.4321 0.4655 0.4502 -0.0093 -0.0074 -0.0083 1081 HOH B O   
2753 O O   . HOH J .   ? 0.4536 0.5213 0.4417 0.0024  -0.0201 -0.0051 1082 HOH B O   
2754 O O   . HOH J .   ? 0.5913 0.5952 0.5914 -0.0224 -0.0033 -0.0076 1083 HOH B O   
2755 O O   . HOH J .   ? 0.4278 0.4710 0.4371 0.0039  0.0117  0.0005  1084 HOH B O   
2756 O O   . HOH J .   ? 0.4964 0.5589 0.4837 0.0081  -0.0182 0.0044  1085 HOH B O   
2757 O O   . HOH J .   ? 0.4418 0.4561 0.4541 0.0416  0.0190  0.0127  1086 HOH B O   
2758 O O   . HOH J .   ? 0.6399 0.6566 0.6469 -0.0172 0.0025  -0.0274 1087 HOH B O   
2759 O O   . HOH J .   ? 0.5176 0.5606 0.5601 -0.0038 0.0002  0.0039  1088 HOH B O   
2760 O O   . HOH J .   ? 0.5127 0.5454 0.5165 0.0170  -0.0076 0.0215  1089 HOH B O   
2761 O O   . HOH J .   ? 0.5026 0.5399 0.5335 0.0029  -0.0033 0.0089  1090 HOH B O   
2762 O O   . HOH J .   ? 0.5719 0.5828 0.5587 0.0015  0.0150  -0.0213 1091 HOH B O   
2763 O O   . HOH J .   ? 0.5515 0.5504 0.5375 0.0069  0.0058  0.0243  1092 HOH B O   
2764 O O   . HOH J .   ? 0.4913 0.5325 0.4536 0.0179  -0.0049 0.0215  1093 HOH B O   
2765 O O   . HOH J .   ? 0.3897 0.3727 0.3809 -0.0011 0.0038  0.0105  1094 HOH B O   
2766 O O   . HOH J .   ? 0.3988 0.4104 0.4253 0.0005  0.0100  0.0100  1095 HOH B O   
2767 O O   . HOH J .   ? 0.2970 0.3314 0.3079 0.0197  -0.0058 0.0221  1096 HOH B O   
2768 O O   . HOH J .   ? 0.7318 0.7346 0.7357 -0.0156 0.0049  0.0073  1097 HOH B O   
2769 O O   . HOH J .   ? 0.6123 0.6463 0.6027 -0.0033 0.0242  0.0143  1098 HOH B O   
2770 O O   . HOH J .   ? 0.4695 0.4983 0.4603 -0.0055 0.0249  0.0169  1099 HOH B O   
2771 O O   . HOH J .   ? 0.5895 0.6574 0.5688 0.0024  -0.0194 -0.0079 1100 HOH B O   
2772 O O   . HOH J .   ? 0.6246 0.6563 0.5622 0.0245  0.0071  0.0308  1101 HOH B O   
2773 O O   . HOH J .   ? 0.5355 0.5795 0.5510 -0.0080 0.0117  0.0074  1102 HOH B O   
2774 O O   . HOH J .   ? 0.4673 0.4806 0.4711 -0.0172 -0.0067 -0.0042 1103 HOH B O   
2775 O O   . HOH J .   ? 0.5831 0.6218 0.5342 0.0076  0.0120  -0.0043 1104 HOH B O   
2776 O O   . HOH J .   ? 0.6723 0.7166 0.6920 -0.0003 0.0007  0.0034  1105 HOH B O   
2777 O O   . HOH J .   ? 0.4569 0.4605 0.4558 0.0159  0.0245  -0.0116 1106 HOH B O   
2778 O O   . HOH J .   ? 0.7213 0.7660 0.7373 0.0040  0.0077  0.0014  1107 HOH B O   
2779 O O   . HOH J .   ? 0.6409 0.6815 0.5866 0.0121  0.0069  0.0094  1108 HOH B O   
2780 O O   . HOH J .   ? 0.5815 0.6637 0.5539 0.0076  -0.0244 -0.0062 1109 HOH B O   
2781 O O   . HOH J .   ? 0.2677 0.2555 0.2603 0.0022  0.0013  0.0099  1110 HOH B O   
2782 O O   . HOH J .   ? 0.5357 0.5462 0.5619 -0.0025 0.0079  0.0067  1111 HOH B O   
2783 O O   . HOH J .   ? 0.4228 0.4606 0.4110 0.0097  0.0255  -0.0056 1112 HOH B O   
2784 O O   . HOH J .   ? 0.7743 0.7884 0.7842 -0.0170 0.0010  0.0040  1113 HOH B O   
2785 O O   . HOH J .   ? 0.5716 0.6085 0.5399 0.0068  0.0209  -0.0015 1114 HOH B O   
2786 O O   . HOH J .   ? 0.6397 0.6795 0.6533 -0.0003 0.0024  0.0029  1115 HOH B O   
2787 O O   . HOH J .   ? 0.5648 0.5985 0.5459 0.0001  0.0254  0.0143  1116 HOH B O   
2788 O O   . HOH J .   ? 0.5288 0.5750 0.5417 -0.0025 0.0115  0.0051  1117 HOH B O   
2789 O O   . HOH J .   ? 0.4603 0.5111 0.5130 0.0038  0.0082  0.0106  1118 HOH B O   
2790 O O   . HOH J .   ? 0.4905 0.4751 0.4837 -0.0072 0.0051  0.0097  1119 HOH B O   
2791 O O   . HOH J .   ? 0.6810 0.7169 0.6240 0.0115  0.0196  0.0095  1120 HOH B O   
2792 O O   . HOH J .   ? 0.7342 0.7743 0.6645 0.0178  0.0105  0.0149  1121 HOH B O   
2793 O O   . HOH J .   ? 0.3455 0.3360 0.3400 -0.0013 0.0026  0.0130  1122 HOH B O   
2794 O O   . HOH J .   ? 0.4965 0.5193 0.5006 -0.0143 -0.0112 -0.0054 1123 HOH B O   
2795 O O   . HOH J .   ? 0.6366 0.6655 0.6500 -0.0128 0.0046  0.0077  1124 HOH B O   
2796 O O   . HOH J .   ? 0.3782 0.4026 0.3940 -0.0096 -0.0036 -0.0102 1125 HOH B O   
2797 O O   . HOH J .   ? 0.5656 0.5341 0.5335 0.0149  0.0127  0.0083  1126 HOH B O   
2798 O O   . HOH J .   ? 0.5708 0.5874 0.5554 0.0152  -0.0010 0.0262  1127 HOH B O   
2799 O O   . HOH J .   ? 0.6841 0.7048 0.6641 0.0146  -0.0011 0.0258  1128 HOH B O   
2800 O O   . HOH J .   ? 0.5694 0.6212 0.5953 -0.0029 0.0005  0.0035  1129 HOH B O   
2801 O O   . HOH J .   ? 0.6681 0.7077 0.6564 0.0224  -0.0091 0.0259  1130 HOH B O   
2802 O O   . HOH J .   ? 0.7250 0.6851 0.6906 -0.0211 0.0057  -0.0184 1131 HOH B O   
2803 O O   . HOH J .   ? 0.4698 0.5125 0.4833 0.0110  -0.0109 0.0147  1132 HOH B O   
2804 O O   . HOH J .   ? 0.5577 0.5578 0.5441 -0.0004 0.0105  0.0224  1133 HOH B O   
2805 O O   . HOH J .   ? 0.5101 0.5585 0.5394 0.0018  -0.0095 0.0062  1134 HOH B O   
2806 O O   . HOH J .   ? 0.8241 0.8524 0.7818 0.0202  0.0022  0.0291  1135 HOH B O   
2807 O O   . HOH J .   ? 0.6098 0.6449 0.5975 0.0154  -0.0177 0.0062  1136 HOH B O   
2808 O O   . HOH J .   ? 0.7690 0.7734 0.7396 -0.0004 0.0297  0.0294  1137 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  MET 27  27  27  MET MET A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  TRP 62  62  62  TRP TRP A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 TRP 142 142 142 TRP TRP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
B 1 1   GLY 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  MET 15  15  15  MET MET B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  ILE 17  17  17  ILE ILE B . n 
B 1 18  ALA 18  18  18  ALA ALA B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  TYR 21  21  21  TYR TYR B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  MET 27  27  27  MET MET B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  ILE 41  41  41  ILE ILE B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ASN 52  52  52  ASN ASN B . n 
B 1 53  ASN 53  53  53  ASN ASN B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  GLY 60  60  60  GLY GLY B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  TRP 62  62  62  TRP TRP B . n 
B 1 63  MET 63  63  63  MET MET B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  TYR 65  65  65  TYR TYR B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  THR 67  67  67  THR THR B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  LYS 73  73  73  LYS LYS B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  ASP 76  76  76  ASP ASP B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  MET 86  86  86  MET MET B . n 
B 1 87  PRO 87  87  87  PRO PRO B . n 
B 1 88  MET 88  88  88  MET MET B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ASN 99  99  99  ASN ASN B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 MET 102 102 102 MET MET B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 GLY 113 113 113 GLY GLY B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 TYR 120 120 120 TYR TYR B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ASN 123 123 123 ASN ASN B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 GLN 127 127 127 GLN GLN B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 GLY 130 130 130 GLY GLY B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 HIS 132 132 132 HIS HIS B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 THR 137 137 137 THR THR B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 TRP 142 142 142 TRP TRP B . n 
B 1 143 PHE 143 143 143 PHE PHE B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 TYR 150 150 150 TYR TYR B . n 
B 1 151 LYS 151 151 151 LYS LYS B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 TYR 154 154 154 TYR TYR B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3360  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  14040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 42  ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 NE2 ? A HIS 95  ? A HIS 95  ? 1_555 124.8 ? 
2  NE2 ? A HIS 42  ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 111.6 ? 
3  NE2 ? A HIS 95  ? A HIS 95  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 99.7  ? 
4  NE2 ? A HIS 42  ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 114.1 ? 
5  NE2 ? A HIS 95  ? A HIS 95  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 106.5 ? 
6  NE2 ? B HIS 132 ? B HIS 132 ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 95.4  ? 
7  NE2 ? B HIS 42  ? B HIS 42  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 NE2 ? B HIS 95  ? B HIS 95  ? 1_555 122.6 ? 
8  NE2 ? B HIS 42  ? B HIS 42  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 108.9 ? 
9  NE2 ? B HIS 95  ? B HIS 95  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 103.1 ? 
10 NE2 ? B HIS 42  ? B HIS 42  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 SD  ? B MET 88  ? B MET 88  ? 1_555 116.7 ? 
11 NE2 ? B HIS 95  ? B HIS 95  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 SD  ? B MET 88  ? B MET 88  ? 1_555 107.2 ? 
12 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 SD  ? B MET 88  ? B MET 88  ? 1_555 93.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 26.4280 28.2290 2.5430   0.1649 0.1810 0.1537 -0.0320 0.0161  0.0819  2.3955  6.3490   14.3706 
-1.1104 -0.3732  9.7390   0.0688  0.5498  0.2922  -0.5266 0.1845  -0.2963 -0.9252 0.2220  -0.2533 
'X-RAY DIFFRACTION' 2  ? refined 24.7980 25.3810 4.9730   0.2111 0.1421 0.1162 -0.0089 -0.0013 0.0701  2.8501  7.7728   14.1902 
-0.8564 -0.1761  11.0066  -0.0341 0.4642  0.1938  -0.5273 0.1121  -0.0886 -0.8829 0.1823  -0.0780 
'X-RAY DIFFRACTION' 3  ? refined 20.8360 8.0740  0.1940   0.1940 0.2629 0.1319 0.0463  -0.0533 -0.0664 1.8951  5.7496   4.3039  
-1.7329 1.9392   -1.6127  0.3100  0.3882  -0.2635 -0.3203 -0.3587 -0.0573 0.2222  -0.0015 0.0487  
'X-RAY DIFFRACTION' 4  ? refined 12.2630 5.5090  3.9030   0.2195 0.1775 0.5764 -0.1040 0.0560  -0.0895 7.8193  5.0746   19.1688 
-2.7505 8.9490   -10.1346 0.3823  -0.3402 -0.0967 -0.1450 0.2257  1.2222  0.0553  -1.2184 -0.6080 
'X-RAY DIFFRACTION' 5  ? refined 18.3390 12.6370 -3.2160  0.2024 0.2311 0.0800 0.0274  -0.0346 0.0119  3.3519  3.7526   5.7030  
0.2573  3.5920   1.7877   0.3296  0.2828  -0.1422 -0.2953 -0.1359 0.0287  0.2805  0.0192  -0.1937 
'X-RAY DIFFRACTION' 6  ? refined 26.9320 27.8290 17.5060  0.1163 0.0308 0.1296 -0.0010 -0.0154 0.0365  2.2483  1.9098   4.1030  
0.5992  0.5468   1.2076   -0.0114 0.0370  0.2029  -0.1428 -0.0255 -0.0816 -0.3091 0.0656  0.0369  
'X-RAY DIFFRACTION' 7  ? refined 20.8370 21.1900 15.9400  0.0988 0.0798 0.0871 0.0102  -0.0114 0.0107  0.7936  0.7687   0.8593  
0.6264  -0.4223  -0.2758  -0.0838 -0.0146 0.0610  -0.1151 -0.0153 0.0050  -0.0688 -0.1581 0.0991  
'X-RAY DIFFRACTION' 8  ? refined 12.9480 23.8730 0.4020   0.1778 0.2182 0.1513 -0.0472 -0.0850 0.0675  -0.2334 4.3231   23.2417 
1.8813  -2.1866  -4.2969  -0.2566 0.2473  0.0956  0.0465  -0.0597 -0.0728 -0.5538 0.6536  0.3163  
'X-RAY DIFFRACTION' 9  ? refined 11.2000 24.6400 -7.1720  0.2155 0.1994 0.1833 -0.0157 -0.0654 0.0500  1.8012  0.4856   9.7173  
-0.7634 2.5602   0.3659   -0.1620 0.2109  0.1676  -0.1388 -0.0326 0.0515  -0.1763 0.0625  0.1946  
'X-RAY DIFFRACTION' 10 ? refined 22.7080 12.8340 9.4630   0.1552 0.1039 0.0937 0.0362  -0.0052 -0.0058 2.3707  3.0864   2.2957  
-1.4510 2.1891   -0.7149  0.2332  0.2075  -0.0776 -0.1968 -0.1302 -0.1227 -0.0279 -0.0395 -0.1030 
'X-RAY DIFFRACTION' 11 ? refined 17.5480 15.7740 -1.2680  0.1981 0.2149 0.1141 0.0534  -0.0231 0.0239  1.1809  0.8391   3.3620  
0.1365  1.9355   0.8721   0.1288  0.2346  -0.0116 -0.2524 -0.0867 0.0498  0.0905  0.0069  -0.0421 
'X-RAY DIFFRACTION' 12 ? refined 9.7860  14.1250 -13.2240 0.3484 0.5346 0.1908 0.1114  -0.0731 0.1331  19.2838 -10.4724 8.7269  
3.8315  -4.0633  7.8893   -0.4575 0.3380  -0.8282 0.5829  0.7926  0.3765  0.4837  -0.6148 -0.3350 
'X-RAY DIFFRACTION' 13 ? refined 15.6590 26.0120 -1.4120  0.1427 0.1837 0.1581 -0.0211 -0.0517 0.0431  0.5402  0.6549   8.8146  
-0.3433 1.8305   -0.0110  -0.0620 0.2059  0.1369  -0.1316 -0.0113 0.0042  -0.2467 0.1350  0.0733  
'X-RAY DIFFRACTION' 14 ? refined 11.0070 23.6480 19.1840  0.0886 0.1634 0.1725 0.0350  -0.0086 0.0127  9.7785  2.4944   28.7701 
3.9952  8.6670   -2.9599  0.0735  -0.2600 0.5596  0.1637  0.1072  0.1538  -0.1540 -1.2511 -0.1807 
'X-RAY DIFFRACTION' 15 ? refined 16.0760 28.8670 29.4220  0.1487 0.1077 0.1758 0.0294  0.0170  -0.0185 9.9282  1.4749   9.1366  
2.4353  5.4798   0.3595   -0.1120 -0.0995 0.3304  0.1789  -0.0438 0.2081  -0.4921 -0.1199 0.1558  
'X-RAY DIFFRACTION' 16 ? refined 20.8830 32.0330 33.0070  0.1718 0.1450 0.1902 0.0121  -0.0369 -0.0800 6.4710  3.9373   24.7558 
-1.2368 7.0005   -6.6634  -0.2075 -0.5016 0.5132  0.3012  -0.2725 -0.0574 -1.0492 -0.1109 0.4800  
'X-RAY DIFFRACTION' 17 ? refined 14.9790 32.8700 18.5470  0.1788 0.1517 0.2318 0.0731  -0.0253 -0.0030 -2.0375 12.0438  29.7027 
1.7193  7.1029   2.4414   0.0462  0.0792  0.1833  0.1558  -0.0106 -0.1247 -0.3506 -0.8867 -0.0356 
'X-RAY DIFFRACTION' 18 ? refined 14.3060 32.6380 7.3240   0.2763 0.1333 0.1826 0.0287  -0.0735 0.0034  3.4312  3.9565   45.8747 
-0.3691 -11.3970 5.0761   -0.1742 0.4072  0.0297  -0.1210 -0.1386 0.2486  -0.8347 -1.2591 0.3128  
'X-RAY DIFFRACTION' 19 ? refined 21.0030 29.6620 -4.4810  0.1134 0.4421 0.2080 -0.1187 -0.0805 0.1077  -1.0312 7.3629   27.1498 
1.5002  -0.1571  9.7074   -0.2454 0.4065  0.3113  -0.2744 0.0900  0.2267  -0.6908 0.9274  0.1554  
'X-RAY DIFFRACTION' 20 ? refined 23.9550 19.3800 -11.3140 0.1668 0.4325 0.1514 0.0645  0.0055  0.0970  7.9314  16.0845  11.7721 
-7.5143 -4.5437  5.3848   -0.5148 0.0219  0.2410  -0.4359 0.0098  -0.6560 0.5360  1.6371  0.5049  
'X-RAY DIFFRACTION' 21 ? refined 18.1543 24.0922 4.6456   0.1482 0.1415 0.1350 0.0013  -0.0025 0.0069  0.2633  0.1051   0.4963  
0.0433  0.3119   -0.0203  -0.0030 0.0496  0.0189  -0.0283 -0.0043 0.0159  -0.0308 -0.0220 0.0073  
'X-RAY DIFFRACTION' 22 ? refined 27.9410 12.9020 38.8330  0.0290 0.2142 0.0681 0.0197  -0.0172 0.0031  14.5294 12.9764  3.3018  
-3.7862 6.5876   2.3450   -0.3884 -0.8144 0.3073  0.2436  0.5303  -1.2517 0.0529  -0.0976 -0.1419 
'X-RAY DIFFRACTION' 23 ? refined 28.0850 3.5670  28.2750  0.0987 0.1060 0.0672 -0.0376 -0.0352 0.0535  2.6658  14.4255  17.3390 
6.5305  6.3235   14.7013  0.5656  -0.1959 -0.3803 0.3443  -0.2872 -0.5170 0.3355  -0.4993 -0.2784 
'X-RAY DIFFRACTION' 24 ? refined 25.8760 11.3290 31.8860  0.0260 0.1675 0.0887 -0.0005 0.0140  -0.0179 0.4408  4.5546   7.1807  
-0.1650 -1.6086  4.2804   0.0722  -0.2259 0.0308  -0.0505 -0.1281 -0.3989 -0.0395 -0.2912 0.0558  
'X-RAY DIFFRACTION' 25 ? refined 17.3640 25.2370 38.5540  0.1020 0.1167 0.1512 -0.0067 -0.0124 -0.0345 5.8771  3.1665   13.3376 
-4.7030 6.0474   -5.3590  -0.1112 -0.1225 0.3139  0.1887  0.0455  -0.2974 -0.5456 -0.0334 0.0657  
'X-RAY DIFFRACTION' 26 ? refined 8.6260  26.6440 29.7030  0.0545 0.1413 0.2143 0.0692  0.0490  0.0272  25.5256 2.9332   14.7927 
6.1184  -1.5364  -8.8641  0.3202  -0.1326 1.2171  0.2252  0.2786  0.6842  -0.1429 -0.5880 -0.5988 
'X-RAY DIFFRACTION' 27 ? refined 10.8500 22.5440 40.4520  0.1201 0.1805 0.1001 0.0199  0.0128  -0.0471 4.8442  2.7217   3.6306  
-0.2233 0.8661   -3.1026  0.2162  -0.1124 0.0503  0.1946  -0.0046 0.2815  -0.0279 -0.0535 -0.2116 
'X-RAY DIFFRACTION' 28 ? refined 20.4350 17.1190 34.2030  0.0618 0.1271 0.0548 0.0424  -0.0137 0.0017  6.1860  4.5408   4.5144  
0.0813  -3.9357  3.6248   0.0208  -0.3684 0.1614  0.2649  -0.0790 -0.0991 0.1371  0.0906  0.0582  
'X-RAY DIFFRACTION' 29 ? refined 30.2620 9.8140  19.1790  0.0466 0.0585 0.0870 0.0131  0.0431  0.0670  4.5300  1.0828   1.5715  
-0.5911 -0.5607  1.7595   -0.1559 -0.1427 -0.3583 -0.0187 0.0041  0.0558  -0.0194 0.2069  0.1518  
'X-RAY DIFFRACTION' 30 ? refined 21.1870 14.0350 20.4380  0.0824 0.0215 0.0818 0.0286  -0.0116 0.0114  0.1656  1.2226   1.9532  
-0.7137 0.0953   -0.8699  -0.0752 -0.0428 0.1398  -0.1880 -0.0171 0.0048  -0.0216 -0.0549 0.0923  
'X-RAY DIFFRACTION' 31 ? refined 14.5820 6.6910  41.8280  0.1174 0.1716 0.0807 0.0253  0.0599  0.0316  1.7149  0.9671   11.1800 
-0.2220 3.1579   -1.6151  0.0704  -0.3197 -0.1642 0.1929  0.0160  0.1631  0.3483  -0.0683 -0.0864 
'X-RAY DIFFRACTION' 32 ? refined 9.8970  6.8020  41.2440  0.2108 0.2437 0.1019 -0.0660 0.1206  -0.0374 7.9891  5.9286   11.6306 
0.1942  5.5082   -9.3120  0.2265  -0.3330 -0.3806 -0.2722 0.0895  0.2079  1.0937  -0.7824 -0.3160 
'X-RAY DIFFRACTION' 33 ? refined 18.6390 19.8700 27.9790  0.0370 0.0841 0.1184 0.0180  -0.0110 -0.0526 -0.1401 2.2229   2.3042  
0.4821  -0.6426  -1.2798  0.0012  -0.1434 0.1309  0.0621  -0.0912 -0.0821 -0.0157 -0.0810 0.0899  
'X-RAY DIFFRACTION' 34 ? refined 10.5170 15.7490 45.7330  0.1188 0.2158 0.1057 -0.0045 0.0381  -0.0152 0.8524  2.1501   1.8557  
0.0190  -1.0822  -1.3412  -0.0343 -0.1540 -0.1088 0.2784  0.0440  0.2503  -0.0810 -0.0476 -0.0097 
'X-RAY DIFFRACTION' 35 ? refined 17.9120 6.3460  34.7470  0.0356 0.1072 0.0635 0.0087  0.0181  0.0239  0.6736  0.9018   9.3819  
0.1899  0.0287   -0.1336  -0.0082 -0.2360 -0.0518 0.1053  0.0013  0.0300  0.1126  0.0044  0.0069  
'X-RAY DIFFRACTION' 36 ? refined 13.6830 8.6180  16.1000  0.0633 0.1198 0.0053 -0.0225 -0.0249 0.0216  4.4835  8.4816   27.7973 
3.5086  -1.3073  -0.9123  0.0738  0.1121  -0.1291 0.0257  0.0931  -0.0589 0.7669  -1.5416 -0.1669 
'X-RAY DIFFRACTION' 37 ? refined 23.9500 4.9290  4.7010   0.1777 0.0555 0.0629 0.0296  0.0126  -0.0050 5.7279  3.8563   2.0270  
-1.0627 -1.9167  1.4488   0.1205  0.2013  -0.0828 -0.6132 -0.0964 -0.0864 -0.0256 -0.0306 -0.0241 
'X-RAY DIFFRACTION' 38 ? refined 22.7540 2.9440  13.3600  0.1351 0.1421 0.1730 0.0318  -0.0405 0.1162  0.4849  -0.3758  10.8752 
-0.8662 -3.4832  2.0789   0.3886  0.2500  0.3488  -0.1390 0.4223  0.2097  0.1222  -0.5286 -0.8109 
'X-RAY DIFFRACTION' 39 ? refined 18.5720 0.2820  27.2770  0.0821 0.0555 0.0891 0.0063  0.0096  0.0204  9.0317  1.2177   11.1377 
-0.0790 5.5281   2.9000   0.0991  -0.1589 -0.5319 0.0604  0.0450  0.0523  0.0971  -0.2659 -0.1442 
'X-RAY DIFFRACTION' 40 ? refined 23.2600 5.8690  40.6510  0.0800 0.2530 0.0661 0.0120  -0.0022 0.0077  2.4103  6.9366   13.7427 
-0.1386 -6.4153  7.9679   -0.0847 -0.2097 0.0040  0.3792  -0.0546 -0.1096 0.5469  -0.0305 0.1393  
'X-RAY DIFFRACTION' 41 ? refined 21.6250 16.4160 48.2530  0.1058 0.2478 0.1790 -0.0162 -0.0182 -0.0010 -0.5638 21.4158  7.0568  
1.1399  1.6699   5.4652   -0.2630 -0.5033 0.6544  0.5513  -0.2586 -0.8078 -0.3019 0.3144  0.5216  
'X-RAY DIFFRACTION' 42 ? refined 19.9780 10.1939 31.5319  0.0972 0.1221 0.1046 -0.0017 -0.0072 0.0069  0.3684  0.3237   0.5089  
-0.1048 -0.2639  0.0360   -0.0068 -0.0561 0.0000  0.0265  -0.0006 0.0060  0.0243  0.0004  0.0074  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 3    A 13   ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 14   A 21   ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 22   A 28   ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 29   A 34   ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 35   A 45   ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 46   A 59   ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  A 60   A 67   ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  A 68   A 72   ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  A 73   A 85   ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 A 86   A 94   ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 A 95   A 103  ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 A 104  A 109  ? . . . . ? 
'X-RAY DIFFRACTION' 13 13 A 110  A 124  ? . . . . ? 
'X-RAY DIFFRACTION' 14 14 A 125  A 129  ? . . . . ? 
'X-RAY DIFFRACTION' 15 15 A 130  A 134  ? . . . . ? 
'X-RAY DIFFRACTION' 16 16 A 135  A 140  ? . . . . ? 
'X-RAY DIFFRACTION' 17 17 A 141  A 144  ? . . . . ? 
'X-RAY DIFFRACTION' 18 18 A 145  A 148  ? . . . . ? 
'X-RAY DIFFRACTION' 19 19 A 149  A 152  ? . . . . ? 
'X-RAY DIFFRACTION' 20 20 A 153  A 158  ? . . . . ? 
'X-RAY DIFFRACTION' 21 21 A 1001 A 1116 ? . . . . ? 
'X-RAY DIFFRACTION' 22 22 B 3    B 9    ? . . . . ? 
'X-RAY DIFFRACTION' 23 23 B 10   B 13   ? . . . . ? 
'X-RAY DIFFRACTION' 24 24 B 14   B 21   ? . . . . ? 
'X-RAY DIFFRACTION' 25 25 B 22   B 26   ? . . . . ? 
'X-RAY DIFFRACTION' 26 26 B 27   B 32   ? . . . . ? 
'X-RAY DIFFRACTION' 27 27 B 33   B 41   ? . . . . ? 
'X-RAY DIFFRACTION' 28 28 B 42   B 46   ? . . . . ? 
'X-RAY DIFFRACTION' 29 29 B 47   B 60   ? . . . . ? 
'X-RAY DIFFRACTION' 30 30 B 61   B 67   ? . . . . ? 
'X-RAY DIFFRACTION' 31 31 B 68   B 77   ? . . . . ? 
'X-RAY DIFFRACTION' 32 32 B 78   B 83   ? . . . . ? 
'X-RAY DIFFRACTION' 33 33 B 84   B 96   ? . . . . ? 
'X-RAY DIFFRACTION' 34 34 B 97   B 112  ? . . . . ? 
'X-RAY DIFFRACTION' 35 35 B 113  B 124  ? . . . . ? 
'X-RAY DIFFRACTION' 36 36 B 125  B 129  ? . . . . ? 
'X-RAY DIFFRACTION' 37 37 B 130  B 136  ? . . . . ? 
'X-RAY DIFFRACTION' 38 38 B 137  B 143  ? . . . . ? 
'X-RAY DIFFRACTION' 39 39 B 144  B 148  ? . . . . ? 
'X-RAY DIFFRACTION' 40 40 B 149  B 152  ? . . . . ? 
'X-RAY DIFFRACTION' 41 41 B 153  B 158  ? . . . . ? 
'X-RAY DIFFRACTION' 42 42 B 1001 B 1137 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice 'data collection' . ? 1 
REFMAC  refinement        . ? 2 
XDS     'data reduction'  . ? 3 
XSCALE  'data scaling'    . ? 4 
REFMAC  phasing           . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 B GLU 16   ? A O B HOH 1134 ? ? 1.98 
2 1 O   A GLY 108  ? ? O A HOH 1110 ? ? 2.13 
3 1 O   A HOH 1110 ? ? O A HOH 1113 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 102 ? ? -121.74 -89.77 
2 1 ILE B 32  ? ? -121.61 -62.99 
3 1 MET B 102 ? ? -113.14 -91.60 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLY 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLY 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION' CU  
3 'SULFATE ION'     SO4 
4 water             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CU  1   200  200  CU  CU  A . 
D 3 SO4 1   300  300  SO4 SO4 A . 
E 3 SO4 1   301  301  SO4 SO4 A . 
F 2 CU  1   200  200  CU  CU  B . 
G 3 SO4 1   300  300  SO4 SO4 B . 
H 3 SO4 1   301  301  SO4 SO4 B . 
I 4 HOH 1   1001 1001 HOH HOH A . 
I 4 HOH 2   1002 1002 HOH HOH A . 
I 4 HOH 3   1003 1003 HOH HOH A . 
I 4 HOH 4   1004 1004 HOH HOH A . 
I 4 HOH 5   1005 1005 HOH HOH A . 
I 4 HOH 6   1006 1006 HOH HOH A . 
I 4 HOH 7   1007 1007 HOH HOH A . 
I 4 HOH 8   1008 1008 HOH HOH A . 
I 4 HOH 9   1009 1009 HOH HOH A . 
I 4 HOH 10  1010 1010 HOH HOH A . 
I 4 HOH 11  1011 1011 HOH HOH A . 
I 4 HOH 12  1012 1012 HOH HOH A . 
I 4 HOH 13  1013 1013 HOH HOH A . 
I 4 HOH 14  1014 1014 HOH HOH A . 
I 4 HOH 15  1015 1015 HOH HOH A . 
I 4 HOH 16  1016 1016 HOH HOH A . 
I 4 HOH 17  1017 1017 HOH HOH A . 
I 4 HOH 18  1018 1018 HOH HOH A . 
I 4 HOH 19  1019 1019 HOH HOH A . 
I 4 HOH 20  1020 1020 HOH HOH A . 
I 4 HOH 21  1021 1021 HOH HOH A . 
I 4 HOH 22  1022 1022 HOH HOH A . 
I 4 HOH 23  1023 1023 HOH HOH A . 
I 4 HOH 24  1024 1024 HOH HOH A . 
I 4 HOH 25  1025 1025 HOH HOH A . 
I 4 HOH 26  1026 1026 HOH HOH A . 
I 4 HOH 27  1027 1027 HOH HOH A . 
I 4 HOH 28  1028 1028 HOH HOH A . 
I 4 HOH 29  1029 1029 HOH HOH A . 
I 4 HOH 30  1030 1030 HOH HOH A . 
I 4 HOH 31  1031 1031 HOH HOH A . 
I 4 HOH 32  1032 1032 HOH HOH A . 
I 4 HOH 33  1033 1033 HOH HOH A . 
I 4 HOH 34  1034 1034 HOH HOH A . 
I 4 HOH 35  1035 1035 HOH HOH A . 
I 4 HOH 36  1036 1036 HOH HOH A . 
I 4 HOH 37  1037 1037 HOH HOH A . 
I 4 HOH 38  1038 1038 HOH HOH A . 
I 4 HOH 39  1039 1039 HOH HOH A . 
I 4 HOH 40  1040 1040 HOH HOH A . 
I 4 HOH 41  1041 1041 HOH HOH A . 
I 4 HOH 42  1042 1042 HOH HOH A . 
I 4 HOH 43  1043 1043 HOH HOH A . 
I 4 HOH 44  1044 1044 HOH HOH A . 
I 4 HOH 45  1045 1045 HOH HOH A . 
I 4 HOH 46  1046 1046 HOH HOH A . 
I 4 HOH 47  1047 1047 HOH HOH A . 
I 4 HOH 48  1048 1048 HOH HOH A . 
I 4 HOH 49  1049 1049 HOH HOH A . 
I 4 HOH 50  1050 1050 HOH HOH A . 
I 4 HOH 51  1051 1051 HOH HOH A . 
I 4 HOH 52  1052 1052 HOH HOH A . 
I 4 HOH 53  1053 1053 HOH HOH A . 
I 4 HOH 54  1054 1054 HOH HOH A . 
I 4 HOH 55  1055 1055 HOH HOH A . 
I 4 HOH 56  1056 1056 HOH HOH A . 
I 4 HOH 57  1057 1057 HOH HOH A . 
I 4 HOH 58  1058 1058 HOH HOH A . 
I 4 HOH 59  1059 1059 HOH HOH A . 
I 4 HOH 60  1060 1060 HOH HOH A . 
I 4 HOH 61  1061 1061 HOH HOH A . 
I 4 HOH 62  1062 1062 HOH HOH A . 
I 4 HOH 63  1063 1063 HOH HOH A . 
I 4 HOH 64  1064 1064 HOH HOH A . 
I 4 HOH 65  1065 1065 HOH HOH A . 
I 4 HOH 66  1066 1066 HOH HOH A . 
I 4 HOH 67  1067 1067 HOH HOH A . 
I 4 HOH 68  1068 1068 HOH HOH A . 
I 4 HOH 69  1069 1069 HOH HOH A . 
I 4 HOH 70  1070 1070 HOH HOH A . 
I 4 HOH 71  1071 1071 HOH HOH A . 
I 4 HOH 72  1072 1072 HOH HOH A . 
I 4 HOH 73  1073 1073 HOH HOH A . 
I 4 HOH 74  1074 1074 HOH HOH A . 
I 4 HOH 75  1075 1075 HOH HOH A . 
I 4 HOH 76  1076 1076 HOH HOH A . 
I 4 HOH 77  1077 1077 HOH HOH A . 
I 4 HOH 78  1078 1078 HOH HOH A . 
I 4 HOH 79  1079 1079 HOH HOH A . 
I 4 HOH 80  1080 1080 HOH HOH A . 
I 4 HOH 81  1081 1081 HOH HOH A . 
I 4 HOH 82  1082 1082 HOH HOH A . 
I 4 HOH 83  1083 1083 HOH HOH A . 
I 4 HOH 84  1084 1084 HOH HOH A . 
I 4 HOH 85  1085 1085 HOH HOH A . 
I 4 HOH 86  1086 1086 HOH HOH A . 
I 4 HOH 87  1087 1087 HOH HOH A . 
I 4 HOH 88  1088 1088 HOH HOH A . 
I 4 HOH 89  1089 1089 HOH HOH A . 
I 4 HOH 90  1090 1090 HOH HOH A . 
I 4 HOH 91  1091 1091 HOH HOH A . 
I 4 HOH 92  1092 1092 HOH HOH A . 
I 4 HOH 93  1093 1093 HOH HOH A . 
I 4 HOH 94  1094 1094 HOH HOH A . 
I 4 HOH 95  1095 1095 HOH HOH A . 
I 4 HOH 96  1096 1096 HOH HOH A . 
I 4 HOH 97  1097 1097 HOH HOH A . 
I 4 HOH 98  1098 1098 HOH HOH A . 
I 4 HOH 99  1099 1099 HOH HOH A . 
I 4 HOH 100 1100 1100 HOH HOH A . 
I 4 HOH 101 1101 1101 HOH HOH A . 
I 4 HOH 102 1102 1102 HOH HOH A . 
I 4 HOH 103 1103 1103 HOH HOH A . 
I 4 HOH 104 1104 1104 HOH HOH A . 
I 4 HOH 105 1105 1105 HOH HOH A . 
I 4 HOH 106 1106 1106 HOH HOH A . 
I 4 HOH 107 1107 1107 HOH HOH A . 
I 4 HOH 108 1108 1108 HOH HOH A . 
I 4 HOH 109 1109 1109 HOH HOH A . 
I 4 HOH 110 1110 1110 HOH HOH A . 
I 4 HOH 111 1111 1111 HOH HOH A . 
I 4 HOH 112 1112 1112 HOH HOH A . 
I 4 HOH 113 1113 1113 HOH HOH A . 
I 4 HOH 114 1114 1114 HOH HOH A . 
I 4 HOH 115 1115 1115 HOH HOH A . 
I 4 HOH 116 1116 1116 HOH HOH A . 
J 4 HOH 1   1001 1001 HOH HOH B . 
J 4 HOH 2   1002 1002 HOH HOH B . 
J 4 HOH 3   1003 1003 HOH HOH B . 
J 4 HOH 4   1004 1004 HOH HOH B . 
J 4 HOH 5   1005 1005 HOH HOH B . 
J 4 HOH 6   1006 1006 HOH HOH B . 
J 4 HOH 7   1007 1007 HOH HOH B . 
J 4 HOH 8   1008 1008 HOH HOH B . 
J 4 HOH 9   1009 1009 HOH HOH B . 
J 4 HOH 10  1010 1010 HOH HOH B . 
J 4 HOH 11  1011 1011 HOH HOH B . 
J 4 HOH 12  1012 1012 HOH HOH B . 
J 4 HOH 13  1013 1013 HOH HOH B . 
J 4 HOH 14  1014 1014 HOH HOH B . 
J 4 HOH 15  1015 1015 HOH HOH B . 
J 4 HOH 16  1016 1016 HOH HOH B . 
J 4 HOH 17  1017 1017 HOH HOH B . 
J 4 HOH 18  1018 1018 HOH HOH B . 
J 4 HOH 19  1019 1019 HOH HOH B . 
J 4 HOH 20  1020 1020 HOH HOH B . 
J 4 HOH 21  1021 1021 HOH HOH B . 
J 4 HOH 22  1022 1022 HOH HOH B . 
J 4 HOH 23  1023 1023 HOH HOH B . 
J 4 HOH 24  1024 1024 HOH HOH B . 
J 4 HOH 25  1025 1025 HOH HOH B . 
J 4 HOH 26  1026 1026 HOH HOH B . 
J 4 HOH 27  1027 1027 HOH HOH B . 
J 4 HOH 28  1028 1028 HOH HOH B . 
J 4 HOH 29  1029 1029 HOH HOH B . 
J 4 HOH 30  1030 1030 HOH HOH B . 
J 4 HOH 31  1031 1031 HOH HOH B . 
J 4 HOH 32  1032 1032 HOH HOH B . 
J 4 HOH 33  1033 1033 HOH HOH B . 
J 4 HOH 34  1034 1034 HOH HOH B . 
J 4 HOH 35  1035 1035 HOH HOH B . 
J 4 HOH 36  1036 1036 HOH HOH B . 
J 4 HOH 37  1037 1037 HOH HOH B . 
J 4 HOH 38  1038 1038 HOH HOH B . 
J 4 HOH 39  1039 1039 HOH HOH B . 
J 4 HOH 40  1040 1040 HOH HOH B . 
J 4 HOH 41  1041 1041 HOH HOH B . 
J 4 HOH 42  1042 1042 HOH HOH B . 
J 4 HOH 43  1043 1043 HOH HOH B . 
J 4 HOH 44  1044 1044 HOH HOH B . 
J 4 HOH 45  1045 1045 HOH HOH B . 
J 4 HOH 46  1046 1046 HOH HOH B . 
J 4 HOH 47  1047 1047 HOH HOH B . 
J 4 HOH 48  1048 1048 HOH HOH B . 
J 4 HOH 49  1049 1049 HOH HOH B . 
J 4 HOH 50  1050 1050 HOH HOH B . 
J 4 HOH 51  1051 1051 HOH HOH B . 
J 4 HOH 52  1052 1052 HOH HOH B . 
J 4 HOH 53  1053 1053 HOH HOH B . 
J 4 HOH 54  1054 1054 HOH HOH B . 
J 4 HOH 55  1055 1055 HOH HOH B . 
J 4 HOH 56  1056 1056 HOH HOH B . 
J 4 HOH 57  1057 1057 HOH HOH B . 
J 4 HOH 58  1058 1058 HOH HOH B . 
J 4 HOH 59  1059 1059 HOH HOH B . 
J 4 HOH 60  1060 1060 HOH HOH B . 
J 4 HOH 61  1061 1061 HOH HOH B . 
J 4 HOH 62  1062 1062 HOH HOH B . 
J 4 HOH 63  1063 1063 HOH HOH B . 
J 4 HOH 64  1064 1064 HOH HOH B . 
J 4 HOH 65  1065 1065 HOH HOH B . 
J 4 HOH 66  1066 1066 HOH HOH B . 
J 4 HOH 67  1067 1067 HOH HOH B . 
J 4 HOH 68  1068 1068 HOH HOH B . 
J 4 HOH 69  1069 1069 HOH HOH B . 
J 4 HOH 70  1070 1070 HOH HOH B . 
J 4 HOH 71  1071 1071 HOH HOH B . 
J 4 HOH 72  1072 1072 HOH HOH B . 
J 4 HOH 73  1073 1073 HOH HOH B . 
J 4 HOH 74  1074 1074 HOH HOH B . 
J 4 HOH 75  1075 1075 HOH HOH B . 
J 4 HOH 76  1076 1076 HOH HOH B . 
J 4 HOH 77  1077 1077 HOH HOH B . 
J 4 HOH 78  1078 1078 HOH HOH B . 
J 4 HOH 79  1079 1079 HOH HOH B . 
J 4 HOH 80  1080 1080 HOH HOH B . 
J 4 HOH 81  1081 1081 HOH HOH B . 
J 4 HOH 82  1082 1082 HOH HOH B . 
J 4 HOH 83  1083 1083 HOH HOH B . 
J 4 HOH 84  1084 1084 HOH HOH B . 
J 4 HOH 85  1085 1085 HOH HOH B . 
J 4 HOH 86  1086 1086 HOH HOH B . 
J 4 HOH 87  1087 1087 HOH HOH B . 
J 4 HOH 88  1088 1088 HOH HOH B . 
J 4 HOH 89  1089 1089 HOH HOH B . 
J 4 HOH 90  1090 1090 HOH HOH B . 
J 4 HOH 91  1091 1091 HOH HOH B . 
J 4 HOH 92  1092 1092 HOH HOH B . 
J 4 HOH 93  1093 1093 HOH HOH B . 
J 4 HOH 94  1094 1094 HOH HOH B . 
J 4 HOH 95  1095 1095 HOH HOH B . 
J 4 HOH 96  1096 1096 HOH HOH B . 
J 4 HOH 97  1097 1097 HOH HOH B . 
J 4 HOH 98  1098 1098 HOH HOH B . 
J 4 HOH 99  1099 1099 HOH HOH B . 
J 4 HOH 100 1100 1100 HOH HOH B . 
J 4 HOH 101 1101 1101 HOH HOH B . 
J 4 HOH 102 1102 1102 HOH HOH B . 
J 4 HOH 103 1103 1103 HOH HOH B . 
J 4 HOH 104 1104 1104 HOH HOH B . 
J 4 HOH 105 1105 1105 HOH HOH B . 
J 4 HOH 106 1106 1106 HOH HOH B . 
J 4 HOH 107 1107 1107 HOH HOH B . 
J 4 HOH 108 1108 1108 HOH HOH B . 
J 4 HOH 109 1109 1109 HOH HOH B . 
J 4 HOH 110 1110 1110 HOH HOH B . 
J 4 HOH 111 1111 1111 HOH HOH B . 
J 4 HOH 112 1112 1112 HOH HOH B . 
J 4 HOH 113 1113 1113 HOH HOH B . 
J 4 HOH 114 1114 1114 HOH HOH B . 
J 4 HOH 115 1115 1115 HOH HOH B . 
J 4 HOH 116 1116 1116 HOH HOH B . 
J 4 HOH 117 1117 1117 HOH HOH B . 
J 4 HOH 118 1118 1118 HOH HOH B . 
J 4 HOH 119 1119 1119 HOH HOH B . 
J 4 HOH 120 1120 1120 HOH HOH B . 
J 4 HOH 121 1121 1121 HOH HOH B . 
J 4 HOH 122 1122 1122 HOH HOH B . 
J 4 HOH 123 1123 1123 HOH HOH B . 
J 4 HOH 124 1124 1124 HOH HOH B . 
J 4 HOH 125 1125 1125 HOH HOH B . 
J 4 HOH 126 1126 1126 HOH HOH B . 
J 4 HOH 127 1127 1127 HOH HOH B . 
J 4 HOH 128 1128 1128 HOH HOH B . 
J 4 HOH 129 1129 1129 HOH HOH B . 
J 4 HOH 130 1130 1130 HOH HOH B . 
J 4 HOH 131 1131 1131 HOH HOH B . 
J 4 HOH 132 1132 1132 HOH HOH B . 
J 4 HOH 133 1133 1133 HOH HOH B . 
J 4 HOH 134 1134 1134 HOH HOH B . 
J 4 HOH 135 1135 1135 HOH HOH B . 
J 4 HOH 136 1136 1136 HOH HOH B . 
J 4 HOH 137 1137 1137 HOH HOH B . 
#