data_3LZR
# 
_entry.id   3LZR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3LZR         
RCSB  RCSB057927   
WWPDB D_1000057927 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O6C 'Structure of selenomethionyl rTp34 from Treponema pallidum'                                                        
unspecified 
PDB 2O6D 'Structure of native rTp34 from Treponema pallidum'                                                                 
unspecified 
PDB 2O6E 'Structure of native rTp34 from Treponema pallidum from zinc-soaked crystals'                                       
unspecified 
PDB 2O6F 'Structure of metal- free rTp34 from Treponema pallidum'                                                            
unspecified 
PDB 3LZO 'Crystal Structure Analysis of the COPPER-RECONSTITUTED P19 protein from Campylobacter jejuni at 1.65 A at pH 10.0' 
unspecified 
PDB 3LZP 
;Crystal Structure Analysis of the 'AS-ISOLATED' P19 protein from Campylobacter jejuni at 1.65 A at pH 9
;
unspecified 
PDB 3LZQ 'Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 1.41 A at pH 9'           
unspecified 
PDB 3LZL 'Crystal Structure Analysis of the as-isolated P19 protein from Campylobacter jejuni at 1.45 A at pH 9.0'           
unspecified 
PDB 3LZN 'Crystal Structure Analysis of the apo P19 protein from Campylobacter jejuni at 1.59 A at pH 9'                     
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3LZR 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doukov, T.I.'    1 
'Chan, A.C.K.'    2 
'Scofield, M.'    3 
'Ramin, A.B.'     4 
'Tom-Yew, S.A.L.' 5 
'Murphy, M.E.P.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            401 
_citation.page_first                590 
_citation.page_last                 604 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20600116 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.06.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chan, A.C.'      1 
primary 'Doukov, T.I.'    2 
primary 'Scofield, M.'    3 
primary 'Tom-Yew, S.A.'   4 
primary 'Ramin, A.B.'     5 
primary 'Mackichan, J.K.' 6 
primary 'Gaynor, E.C.'    7 
primary 'Murphy, M.E.'    8 
# 
_cell.entry_id           3LZR 
_cell.length_a           54.499 
_cell.length_b           73.797 
_cell.length_c           75.217 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3LZR 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'P19 protein'        17590.859 2  ? ? 'residues 22-179' ? 
2 non-polymer syn 'COPPER (II) ION'    63.546    2  ? ? ?                 ? 
3 non-polymer syn 'MANGANESE (II) ION' 54.938    2  ? ? ?                 ? 
4 non-polymer syn 'SULFATE ION'        96.063    2  ? ? ?                 ? 
5 water       nat water                18.015    56 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   GLU n 
1 4   VAL n 
1 5   PRO n 
1 6   ILE n 
1 7   GLY n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  GLU n 
1 12  LEU n 
1 13  ASN n 
1 14  GLY n 
1 15  MET n 
1 16  GLU n 
1 17  ILE n 
1 18  ALA n 
1 19  ALA n 
1 20  VAL n 
1 21  TYR n 
1 22  LEU n 
1 23  GLN n 
1 24  PRO n 
1 25  ILE n 
1 26  GLU n 
1 27  MET n 
1 28  GLU n 
1 29  PRO n 
1 30  ARG n 
1 31  GLY n 
1 32  ILE n 
1 33  ASP n 
1 34  LEU n 
1 35  ALA n 
1 36  ALA n 
1 37  SER n 
1 38  LEU n 
1 39  ALA n 
1 40  ASP n 
1 41  ILE n 
1 42  HIS n 
1 43  LEU n 
1 44  GLU n 
1 45  ALA n 
1 46  ASP n 
1 47  ILE n 
1 48  HIS n 
1 49  ALA n 
1 50  LEU n 
1 51  LYS n 
1 52  ASN n 
1 53  ASN n 
1 54  PRO n 
1 55  ASN n 
1 56  GLY n 
1 57  PHE n 
1 58  PRO n 
1 59  GLU n 
1 60  GLY n 
1 61  PHE n 
1 62  TRP n 
1 63  MET n 
1 64  PRO n 
1 65  TYR n 
1 66  LEU n 
1 67  THR n 
1 68  ILE n 
1 69  ALA n 
1 70  TYR n 
1 71  GLU n 
1 72  LEU n 
1 73  LYS n 
1 74  ASN n 
1 75  THR n 
1 76  ASP n 
1 77  THR n 
1 78  GLY n 
1 79  ALA n 
1 80  ILE n 
1 81  LYS n 
1 82  ARG n 
1 83  GLY n 
1 84  THR n 
1 85  LEU n 
1 86  MET n 
1 87  PRO n 
1 88  MET n 
1 89  VAL n 
1 90  ALA n 
1 91  ASP n 
1 92  ASP n 
1 93  GLY n 
1 94  PRO n 
1 95  HIS n 
1 96  TYR n 
1 97  GLY n 
1 98  ALA n 
1 99  ASN n 
1 100 ILE n 
1 101 ALA n 
1 102 MET n 
1 103 GLU n 
1 104 LYS n 
1 105 ASP n 
1 106 LYS n 
1 107 LYS n 
1 108 GLY n 
1 109 GLY n 
1 110 PHE n 
1 111 GLY n 
1 112 VAL n 
1 113 GLY n 
1 114 ASN n 
1 115 TYR n 
1 116 GLU n 
1 117 LEU n 
1 118 THR n 
1 119 PHE n 
1 120 TYR n 
1 121 ILE n 
1 122 SER n 
1 123 ASN n 
1 124 PRO n 
1 125 GLU n 
1 126 LYS n 
1 127 GLN n 
1 128 GLY n 
1 129 PHE n 
1 130 GLY n 
1 131 ARG n 
1 132 HIS n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 GLU n 
1 137 THR n 
1 138 GLY n 
1 139 VAL n 
1 140 GLY n 
1 141 LYS n 
1 142 TRP n 
1 143 PHE n 
1 144 GLU n 
1 145 PRO n 
1 146 PHE n 
1 147 LYS n 
1 148 VAL n 
1 149 ASP n 
1 150 TYR n 
1 151 LYS n 
1 152 PHE n 
1 153 LYS n 
1 154 TYR n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 PRO n 
1 159 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CJJ81176_1650, Gene Cj81176_1659' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    81-176 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Campylobacter jejuni' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     354242 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET19 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A1W1R1_CAMJJ 
_struct_ref.pdbx_db_accession          A1W1R1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIK
RGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LZR A 2 ? 159 ? A1W1R1 22 ? 179 ? 2 159 
2 1 3LZR B 2 ? 159 ? A1W1R1 22 ? 179 ? 2 159 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LZR GLY A 1 ? UNP A1W1R1 ? ? 'EXPRESSION TAG' 1 1 
2 3LZR GLY B 1 ? UNP A1W1R1 ? ? 'EXPRESSION TAG' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION'    ? 'Cu 2'           63.546  
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3LZR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pdbx_details    
;50% POLYETHYLENE GLYCOL (PEG) 250, 0.1 M CHES (2-(N-CYCLOHEXYLAMINO) ETHANE SULFONIC ACID) BUFFER PH 9.0, CRYO FROZEN WITHOUT ANY ADDITION, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-11-27 
_diffrn_detector.details                'Rh coated flat mirror, toroidal focusing mirror, Si 111 monochromator' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.893 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.893 
# 
_reflns.entry_id                     3LZR 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             19.26 
_reflns.d_resolution_high            2.73 
_reflns.number_obs                   7756 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.6 
_reflns.pdbx_Rmerge_I_obs            0.015 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        61.9 
_reflns.B_iso_Wilson_estimate        23.6 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.73 
_reflns_shell.d_res_low              2.88 
_reflns_shell.percent_possible_all   78.0 
_reflns_shell.Rmerge_I_obs           0.019 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    47.3 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      926 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3LZR 
_refine.ls_number_reflns_obs                     7400 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.26 
_refine.ls_d_res_high                            2.73 
_refine.ls_percent_reflns_obs                    91.84 
_refine.ls_R_factor_obs                          0.19699 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19460 
_refine.ls_R_factor_R_free                       0.24532 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  356 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.924 
_refine.correlation_coeff_Fo_to_Fc_free          0.869 
_refine.B_iso_mean                               36.236 
_refine.aniso_B[1][1]                            -0.64 
_refine.aniso_B[2][2]                            0.89 
_refine.aniso_B[3][3]                            -0.25 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'P6222 incomplete SeMAD model at 2.8 Angs resolution.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.412 
_refine.overall_SU_ML                            0.298 
_refine.overall_SU_B                             33.017 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3LZR 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.412 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2470 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               2540 
_refine_hist.d_res_high                       2.73 
_refine_hist.d_res_low                        19.26 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.005  0.022  ? 2565 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 1755 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    0.910  1.972  ? 3475 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      1.489  3.000  ? 4300 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 4.929  5.000  ? 318  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 36.550 25.294 ? 119  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 11.600 15.000 ? 422  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 10.864 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.057  0.200  ? 350  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.003  0.021  ? 2877 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 497  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.515  3.000  ? 1573 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.051  3.000  ? 647  'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.044  5.000  ? 2523 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.535  8.000  ? 992  'X-RAY DIFFRACTION' ? 
r_scangle_it           2.581  11.000 ? 951  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2056 0.52 5.00  'loose positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 2056 0.92 10.00 'loose thermal'    1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.73 
_refine_ls_shell.d_res_low                        2.803 
_refine_ls_shell.number_reflns_R_work             393 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.percent_reflns_obs               67.88 
_refine_ls_shell.R_factor_R_free                  0.445 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             17 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3LZR 
_struct.title                     
;Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 2.73 A at pH 9 and Manganese peak wavelength (1.893 A)
;
_struct.pdbx_descriptor           'P19 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LZR 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'copper binding, iron transport, iron uptake, P19 delition, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 123 ? GLY A 128 ? ASN A 123 GLY A 128 5 ? 6 
HELX_P HELX_P2 2 ALA B 35  ? ALA B 39  ? ALA B 35  ALA B 39  5 ? 5 
HELX_P HELX_P3 3 ASN B 123 ? GLY B 128 ? ASN B 123 GLY B 128 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B HIS 95  NE2 ? ? ? 1_555 F CU . CU ? ? B HIS 95  B CU 200 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc2  metalc ? ? A HIS 95  NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 95  A CU 200 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc3  metalc ? ? A HIS 42  NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 42  A CU 200 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc4  metalc ? ? A HIS 132 NE2 ? ? ? 1_555 F CU . CU ? ? A HIS 132 B CU 200 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc5  metalc ? ? B HIS 42  NE2 ? ? ? 1_555 F CU . CU ? ? B HIS 42  B CU 200 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc6  metalc ? ? B HIS 132 NE2 ? ? ? 1_555 C CU . CU ? ? B HIS 132 A CU 200 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc7  metalc ? ? A MET 88  SD  ? ? ? 1_555 C CU . CU ? ? A MET 88  A CU 200 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc8  metalc ? ? A ASP 92  OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 92  A MN 201 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc9  metalc ? ? B MET 88  SD  ? ? ? 1_555 F CU . CU ? ? B MET 88  B CU 200 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc10 metalc ? ? A GLU 44  OE1 ? ? ? 1_555 D MN . MN ? ? A GLU 44  A MN 201 1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc11 metalc ? ? A GLU 3   OE2 ? ? ? 1_555 D MN . MN ? ? A GLU 3   A MN 201 1_555 ? ? ? ? ? ? ? 2.672 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 28 A . ? GLU 28 A PRO 29 A ? PRO 29 A 1 6.46 
2 GLU 28 B . ? GLU 28 B PRO 29 B ? PRO 29 B 1 4.50 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 8 ? 
C ? 3 ? 
D ? 7 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 4   ? PRO A 5   ? VAL A 4   PRO A 5   
A 2 MET A 15  ? LEU A 22  ? MET A 15  LEU A 22  
A 3 ILE A 41  ? ALA A 49  ? ILE A 41  ALA A 49  
A 4 GLY A 93  ? ILE A 100 ? GLY A 93  ILE A 100 
A 5 ILE A 80  ? ALA A 90  ? ILE A 80  ALA A 90  
A 6 GLY B 130 ? HIS B 132 ? GLY B 130 HIS B 132 
A 7 MET A 27  ? GLU A 28  ? MET A 27  GLU A 28  
B 1 LYS A 10  ? LEU A 12  ? LYS A 10  LEU A 12  
B 2 MET A 15  ? LEU A 22  ? MET A 15  LEU A 22  
B 3 ILE A 41  ? ALA A 49  ? ILE A 41  ALA A 49  
B 4 GLY A 93  ? ILE A 100 ? GLY A 93  ILE A 100 
B 5 ILE A 80  ? ALA A 90  ? ILE A 80  ALA A 90  
B 6 THR A 67  ? ASN A 74  ? THR A 67  ASN A 74  
B 7 GLY A 113 ? SER A 122 ? GLY A 113 SER A 122 
B 8 PHE A 146 ? TYR A 154 ? PHE A 146 TYR A 154 
C 1 GLU B 3   ? PRO B 5   ? GLU B 3   PRO B 5   
C 2 MET B 15  ? LEU B 22  ? MET B 15  LEU B 22  
C 3 LYS B 10  ? LEU B 12  ? LYS B 10  LEU B 12  
D 1 GLU B 3   ? PRO B 5   ? GLU B 3   PRO B 5   
D 2 MET B 15  ? LEU B 22  ? MET B 15  LEU B 22  
D 3 ILE B 41  ? ALA B 49  ? ILE B 41  ALA B 49  
D 4 GLY B 93  ? ILE B 100 ? GLY B 93  ILE B 100 
D 5 MET B 86  ? ALA B 90  ? MET B 86  ALA B 90  
D 6 GLY A 130 ? HIS A 132 ? GLY A 130 HIS A 132 
D 7 MET B 27  ? GLU B 28  ? MET B 27  GLU B 28  
E 1 ILE B 80  ? THR B 84  ? ILE B 80  THR B 84  
E 2 THR B 67  ? ASN B 74  ? THR B 67  ASN B 74  
E 3 GLY B 113 ? SER B 122 ? GLY B 113 SER B 122 
E 4 PHE B 146 ? TYR B 154 ? PHE B 146 TYR B 154 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 4   ? N VAL A 4   O TYR A 21  ? O TYR A 21  
A 2 3 N GLU A 16  ? N GLU A 16  O HIS A 48  ? O HIS A 48  
A 3 4 N ALA A 45  ? N ALA A 45  O TYR A 96  ? O TYR A 96  
A 4 5 O HIS A 95  ? O HIS A 95  N MET A 88  ? N MET A 88  
A 5 6 N VAL A 89  ? N VAL A 89  O HIS B 132 ? O HIS B 132 
A 6 7 O ARG B 131 ? O ARG B 131 N GLU A 28  ? N GLU A 28  
B 1 2 N LYS A 10  ? N LYS A 10  O ILE A 17  ? O ILE A 17  
B 2 3 N GLU A 16  ? N GLU A 16  O HIS A 48  ? O HIS A 48  
B 3 4 N ALA A 45  ? N ALA A 45  O TYR A 96  ? O TYR A 96  
B 4 5 O HIS A 95  ? O HIS A 95  N MET A 88  ? N MET A 88  
B 5 6 O LEU A 85  ? O LEU A 85  N ILE A 68  ? N ILE A 68  
B 6 7 N LYS A 73  ? N LYS A 73  O GLU A 116 ? O GLU A 116 
B 7 8 N TYR A 115 ? N TYR A 115 O PHE A 152 ? O PHE A 152 
C 1 2 N VAL B 4   ? N VAL B 4   O TYR B 21  ? O TYR B 21  
C 2 3 O ILE B 17  ? O ILE B 17  N LYS B 10  ? N LYS B 10  
D 1 2 N VAL B 4   ? N VAL B 4   O TYR B 21  ? O TYR B 21  
D 2 3 N GLU B 16  ? N GLU B 16  O HIS B 48  ? O HIS B 48  
D 3 4 N ALA B 45  ? N ALA B 45  O TYR B 96  ? O TYR B 96  
D 4 5 O HIS B 95  ? O HIS B 95  N MET B 88  ? N MET B 88  
D 5 6 O VAL B 89  ? O VAL B 89  N HIS A 132 ? N HIS A 132 
D 6 7 N ARG A 131 ? N ARG A 131 O GLU B 28  ? O GLU B 28  
E 1 2 O GLY B 83  ? O GLY B 83  N TYR B 70  ? N TYR B 70  
E 2 3 N LYS B 73  ? N LYS B 73  O GLU B 116 ? O GLU B 116 
E 3 4 N TYR B 115 ? N TYR B 115 O PHE B 152 ? O PHE B 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A 200'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN A 201'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 300' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU B 200'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN B 201'  
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 42  ? HIS A 42  . ? 1_555 ? 
2  AC1 4 MET A 88  ? MET A 88  . ? 1_555 ? 
3  AC1 4 HIS A 95  ? HIS A 95  . ? 1_555 ? 
4  AC1 4 HIS B 132 ? HIS B 132 . ? 1_555 ? 
5  AC2 4 GLU A 3   ? GLU A 3   . ? 1_555 ? 
6  AC2 4 GLU A 44  ? GLU A 44  . ? 1_555 ? 
7  AC2 4 ASP A 92  ? ASP A 92  . ? 1_555 ? 
8  AC2 4 LYS A 106 ? LYS A 106 . ? 4_556 ? 
9  AC3 5 ASP A 8   ? ASP A 8   . ? 1_555 ? 
10 AC3 5 LYS A 10  ? LYS A 10  . ? 1_555 ? 
11 AC3 5 ASP A 149 ? ASP A 149 . ? 1_555 ? 
12 AC3 5 TYR A 150 ? TYR A 150 . ? 1_555 ? 
13 AC3 5 LYS A 151 ? LYS A 151 . ? 1_555 ? 
14 AC4 4 HIS A 132 ? HIS A 132 . ? 1_555 ? 
15 AC4 4 HIS B 42  ? HIS B 42  . ? 1_555 ? 
16 AC4 4 MET B 88  ? MET B 88  . ? 1_555 ? 
17 AC4 4 HIS B 95  ? HIS B 95  . ? 1_555 ? 
18 AC5 4 GLU B 3   ? GLU B 3   . ? 1_555 ? 
19 AC5 4 GLU B 44  ? GLU B 44  . ? 1_555 ? 
20 AC5 4 ASP B 46  ? ASP B 46  . ? 1_555 ? 
21 AC5 4 ASP B 92  ? ASP B 92  . ? 1_555 ? 
22 AC6 6 GLY B 7   ? GLY B 7   . ? 1_555 ? 
23 AC6 6 ASP B 8   ? ASP B 8   . ? 1_555 ? 
24 AC6 6 LYS B 10  ? LYS B 10  . ? 1_555 ? 
25 AC6 6 ASP B 149 ? ASP B 149 . ? 1_555 ? 
26 AC6 6 TYR B 150 ? TYR B 150 . ? 1_555 ? 
27 AC6 6 LYS B 151 ? LYS B 151 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3LZR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3LZR 
_atom_sites.fract_transf_matrix[1][1]   0.018349 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013551 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013295 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 2   ? 27.434 25.321 40.070  1.00 53.09 ? 2    GLY A N   1 
ATOM   2    C  CA  . GLY A 1 2   ? 26.943 24.571 41.263  1.00 53.07 ? 2    GLY A CA  1 
ATOM   3    C  C   . GLY A 1 2   ? 26.339 23.231 40.884  1.00 52.58 ? 2    GLY A C   1 
ATOM   4    O  O   . GLY A 1 2   ? 25.225 22.905 41.303  1.00 52.84 ? 2    GLY A O   1 
ATOM   5    N  N   . GLU A 1 3   ? 27.082 22.454 40.096  1.00 60.21 ? 3    GLU A N   1 
ATOM   6    C  CA  . GLU A 1 3   ? 26.625 21.145 39.626  1.00 58.32 ? 3    GLU A CA  1 
ATOM   7    C  C   . GLU A 1 3   ? 27.164 20.028 40.511  1.00 56.83 ? 3    GLU A C   1 
ATOM   8    O  O   . GLU A 1 3   ? 28.375 19.872 40.650  1.00 57.52 ? 3    GLU A O   1 
ATOM   9    C  CB  . GLU A 1 3   ? 27.062 20.909 38.180  1.00 58.21 ? 3    GLU A CB  1 
ATOM   10   C  CG  . GLU A 1 3   ? 26.360 21.810 37.175  1.00 60.54 ? 3    GLU A CG  1 
ATOM   11   C  CD  . GLU A 1 3   ? 26.706 21.487 35.726  1.00 63.97 ? 3    GLU A CD  1 
ATOM   12   O  OE1 . GLU A 1 3   ? 27.292 20.413 35.458  1.00 65.65 ? 3    GLU A OE1 1 
ATOM   13   O  OE2 . GLU A 1 3   ? 26.379 22.314 34.848  1.00 66.30 ? 3    GLU A OE2 1 
ATOM   14   N  N   . VAL A 1 4   ? 26.257 19.255 41.104  1.00 54.81 ? 4    VAL A N   1 
ATOM   15   C  CA  . VAL A 1 4   ? 26.625 18.123 41.948  1.00 53.31 ? 4    VAL A CA  1 
ATOM   16   C  C   . VAL A 1 4   ? 26.613 16.849 41.101  1.00 51.79 ? 4    VAL A C   1 
ATOM   17   O  O   . VAL A 1 4   ? 25.607 16.553 40.454  1.00 51.09 ? 4    VAL A O   1 
ATOM   18   C  CB  . VAL A 1 4   ? 25.644 17.963 43.125  1.00 53.17 ? 4    VAL A CB  1 
ATOM   19   C  CG1 . VAL A 1 4   ? 26.087 16.830 44.042  1.00 52.77 ? 4    VAL A CG1 1 
ATOM   20   C  CG2 . VAL A 1 4   ? 25.525 19.270 43.900  1.00 52.48 ? 4    VAL A CG2 1 
ATOM   21   N  N   . PRO A 1 5   ? 27.730 16.096 41.092  1.00 50.84 ? 5    PRO A N   1 
ATOM   22   C  CA  . PRO A 1 5   ? 27.798 14.887 40.270  1.00 49.69 ? 5    PRO A CA  1 
ATOM   23   C  C   . PRO A 1 5   ? 26.999 13.719 40.851  1.00 48.84 ? 5    PRO A C   1 
ATOM   24   O  O   . PRO A 1 5   ? 26.943 13.551 42.070  1.00 49.02 ? 5    PRO A O   1 
ATOM   25   C  CB  . PRO A 1 5   ? 29.295 14.563 40.248  1.00 50.41 ? 5    PRO A CB  1 
ATOM   26   C  CG  . PRO A 1 5   ? 29.826 15.134 41.499  1.00 51.29 ? 5    PRO A CG  1 
ATOM   27   C  CD  . PRO A 1 5   ? 28.995 16.345 41.808  1.00 51.44 ? 5    PRO A CD  1 
ATOM   28   N  N   . ILE A 1 6   ? 26.396 12.925 39.966  1.00 47.58 ? 6    ILE A N   1 
ATOM   29   C  CA  . ILE A 1 6   ? 25.582 11.770 40.345  1.00 46.54 ? 6    ILE A CA  1 
ATOM   30   C  C   . ILE A 1 6   ? 26.293 10.477 39.934  1.00 46.48 ? 6    ILE A C   1 
ATOM   31   O  O   . ILE A 1 6   ? 26.305 10.109 38.757  1.00 45.83 ? 6    ILE A O   1 
ATOM   32   C  CB  . ILE A 1 6   ? 24.178 11.840 39.685  1.00 45.86 ? 6    ILE A CB  1 
ATOM   33   C  CG1 . ILE A 1 6   ? 23.360 12.984 40.291  1.00 44.79 ? 6    ILE A CG1 1 
ATOM   34   C  CG2 . ILE A 1 6   ? 23.423 10.521 39.843  1.00 45.53 ? 6    ILE A CG2 1 
ATOM   35   C  CD1 . ILE A 1 6   ? 21.985 13.142 39.684  1.00 42.39 ? 6    ILE A CD1 1 
ATOM   36   N  N   . GLY A 1 7   ? 26.898 9.803  40.910  1.00 47.01 ? 7    GLY A N   1 
ATOM   37   C  CA  . GLY A 1 7   ? 27.574 8.529  40.674  1.00 47.45 ? 7    GLY A CA  1 
ATOM   38   C  C   . GLY A 1 7   ? 28.693 8.608  39.650  1.00 47.35 ? 7    GLY A C   1 
ATOM   39   O  O   . GLY A 1 7   ? 29.247 9.680  39.405  1.00 46.79 ? 7    GLY A O   1 
ATOM   40   N  N   . ASP A 1 8   ? 29.019 7.463  39.056  1.00 47.65 ? 8    ASP A N   1 
ATOM   41   C  CA  . ASP A 1 8   ? 30.053 7.377  38.028  1.00 47.87 ? 8    ASP A CA  1 
ATOM   42   C  C   . ASP A 1 8   ? 29.411 7.371  36.643  1.00 46.88 ? 8    ASP A C   1 
ATOM   43   O  O   . ASP A 1 8   ? 28.336 6.796  36.464  1.00 46.77 ? 8    ASP A O   1 
ATOM   44   C  CB  . ASP A 1 8   ? 30.881 6.099  38.199  1.00 49.13 ? 8    ASP A CB  1 
ATOM   45   C  CG  . ASP A 1 8   ? 31.456 5.947  39.598  1.00 51.27 ? 8    ASP A CG  1 
ATOM   46   O  OD1 . ASP A 1 8   ? 31.673 6.972  40.283  1.00 53.32 ? 8    ASP A OD1 1 
ATOM   47   O  OD2 . ASP A 1 8   ? 31.697 4.793  40.009  1.00 52.44 ? 8    ASP A OD2 1 
ATOM   48   N  N   . PRO A 1 9   ? 30.067 8.012  35.657  1.00 46.21 ? 9    PRO A N   1 
ATOM   49   C  CA  . PRO A 1 9   ? 29.562 8.016  34.288  1.00 45.13 ? 9    PRO A CA  1 
ATOM   50   C  C   . PRO A 1 9   ? 29.809 6.687  33.582  1.00 44.97 ? 9    PRO A C   1 
ATOM   51   O  O   . PRO A 1 9   ? 30.803 6.017  33.854  1.00 45.83 ? 9    PRO A O   1 
ATOM   52   C  CB  . PRO A 1 9   ? 30.368 9.134  33.625  1.00 45.12 ? 9    PRO A CB  1 
ATOM   53   C  CG  . PRO A 1 9   ? 31.635 9.161  34.367  1.00 46.08 ? 9    PRO A CG  1 
ATOM   54   C  CD  . PRO A 1 9   ? 31.299 8.812  35.783  1.00 46.56 ? 9    PRO A CD  1 
ATOM   55   N  N   . LYS A 1 10  ? 28.898 6.321  32.686  1.00 44.34 ? 10   LYS A N   1 
ATOM   56   C  CA  . LYS A 1 10  ? 28.994 5.079  31.924  1.00 44.54 ? 10   LYS A CA  1 
ATOM   57   C  C   . LYS A 1 10  ? 29.377 5.384  30.485  1.00 43.54 ? 10   LYS A C   1 
ATOM   58   O  O   . LYS A 1 10  ? 29.059 6.454  29.968  1.00 43.32 ? 10   LYS A O   1 
ATOM   59   C  CB  . LYS A 1 10  ? 27.658 4.327  31.946  1.00 44.78 ? 10   LYS A CB  1 
ATOM   60   C  CG  . LYS A 1 10  ? 27.470 3.405  33.139  1.00 46.73 ? 10   LYS A CG  1 
ATOM   61   C  CD  . LYS A 1 10  ? 27.155 4.164  34.417  1.00 47.32 ? 10   LYS A CD  1 
ATOM   62   C  CE  . LYS A 1 10  ? 27.173 3.235  35.615  1.00 48.39 ? 10   LYS A CE  1 
ATOM   63   N  NZ  . LYS A 1 10  ? 28.520 2.631  35.830  1.00 47.33 ? 10   LYS A NZ  1 
ATOM   64   N  N   . GLU A 1 11  ? 30.056 4.438  29.843  1.00 43.21 ? 11   GLU A N   1 
ATOM   65   C  CA  . GLU A 1 11  ? 30.412 4.560  28.433  1.00 42.47 ? 11   GLU A CA  1 
ATOM   66   C  C   . GLU A 1 11  ? 29.911 3.347  27.659  1.00 41.51 ? 11   GLU A C   1 
ATOM   67   O  O   . GLU A 1 11  ? 30.466 2.254  27.778  1.00 41.92 ? 11   GLU A O   1 
ATOM   68   C  CB  . GLU A 1 11  ? 31.923 4.712  28.270  1.00 43.19 ? 11   GLU A CB  1 
ATOM   69   C  CG  . GLU A 1 11  ? 32.458 6.038  28.789  1.00 44.89 ? 11   GLU A CG  1 
ATOM   70   C  CD  . GLU A 1 11  ? 33.941 6.233  28.521  1.00 48.72 ? 11   GLU A CD  1 
ATOM   71   O  OE1 . GLU A 1 11  ? 34.536 5.415  27.783  1.00 50.63 ? 11   GLU A OE1 1 
ATOM   72   O  OE2 . GLU A 1 11  ? 34.512 7.213  29.052  1.00 51.00 ? 11   GLU A OE2 1 
ATOM   73   N  N   . LEU A 1 12  ? 28.856 3.551  26.872  1.00 40.11 ? 12   LEU A N   1 
ATOM   74   C  CA  . LEU A 1 12  ? 28.237 2.468  26.110  1.00 39.50 ? 12   LEU A CA  1 
ATOM   75   C  C   . LEU A 1 12  ? 27.532 2.966  24.854  1.00 38.38 ? 12   LEU A C   1 
ATOM   76   O  O   . LEU A 1 12  ? 27.109 4.121  24.782  1.00 37.89 ? 12   LEU A O   1 
ATOM   77   C  CB  . LEU A 1 12  ? 27.251 1.679  26.979  1.00 39.75 ? 12   LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 12  ? 26.049 2.361  27.634  1.00 38.44 ? 12   LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 12  ? 25.256 1.311  28.402  1.00 38.37 ? 12   LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 12  ? 26.450 3.501  28.551  1.00 38.09 ? 12   LEU A CD2 1 
ATOM   81   N  N   . ASN A 1 13  ? 27.412 2.071  23.875  1.00 37.89 ? 13   ASN A N   1 
ATOM   82   C  CA  . ASN A 1 13  ? 26.781 2.366  22.585  1.00 36.75 ? 13   ASN A CA  1 
ATOM   83   C  C   . ASN A 1 13  ? 27.366 3.599  21.873  1.00 35.99 ? 13   ASN A C   1 
ATOM   84   O  O   . ASN A 1 13  ? 26.650 4.337  21.191  1.00 35.36 ? 13   ASN A O   1 
ATOM   85   C  CB  . ASN A 1 13  ? 25.266 2.496  22.772  1.00 36.19 ? 13   ASN A CB  1 
ATOM   86   C  CG  . ASN A 1 13  ? 24.665 1.306  23.507  1.00 35.27 ? 13   ASN A CG  1 
ATOM   87   O  OD1 . ASN A 1 13  ? 23.884 1.470  24.443  1.00 34.67 ? 13   ASN A OD1 1 
ATOM   88   N  ND2 . ASN A 1 13  ? 25.036 0.104  23.091  1.00 32.12 ? 13   ASN A ND2 1 
ATOM   89   N  N   . GLY A 1 14  ? 28.674 3.800  22.029  1.00 35.97 ? 14   GLY A N   1 
ATOM   90   C  CA  . GLY A 1 14  ? 29.375 4.935  21.431  1.00 35.82 ? 14   GLY A CA  1 
ATOM   91   C  C   . GLY A 1 14  ? 29.046 6.278  22.060  1.00 35.42 ? 14   GLY A C   1 
ATOM   92   O  O   . GLY A 1 14  ? 29.221 7.321  21.429  1.00 35.80 ? 14   GLY A O   1 
ATOM   93   N  N   . MET A 1 15  ? 28.574 6.256  23.305  1.00 35.18 ? 15   MET A N   1 
ATOM   94   C  CA  . MET A 1 15  ? 28.187 7.475  24.018  1.00 34.29 ? 15   MET A CA  1 
ATOM   95   C  C   . MET A 1 15  ? 28.774 7.476  25.421  1.00 34.40 ? 15   MET A C   1 
ATOM   96   O  O   . MET A 1 15  ? 29.028 6.420  25.998  1.00 34.06 ? 15   MET A O   1 
ATOM   97   C  CB  . MET A 1 15  ? 26.662 7.575  24.129  1.00 33.57 ? 15   MET A CB  1 
ATOM   98   C  CG  . MET A 1 15  ? 25.915 7.549  22.806  1.00 33.21 ? 15   MET A CG  1 
ATOM   99   S  SD  . MET A 1 15  ? 24.132 7.775  23.013  1.00 31.75 ? 15   MET A SD  1 
ATOM   100  C  CE  . MET A 1 15  ? 23.678 6.227  23.787  1.00 31.48 ? 15   MET A CE  1 
ATOM   101  N  N   . GLU A 1 16  ? 28.989 8.671  25.957  1.00 34.76 ? 16   GLU A N   1 
ATOM   102  C  CA  . GLU A 1 16  ? 29.309 8.836  27.365  1.00 35.87 ? 16   GLU A CA  1 
ATOM   103  C  C   . GLU A 1 16  ? 28.068 9.382  28.047  1.00 35.42 ? 16   GLU A C   1 
ATOM   104  O  O   . GLU A 1 16  ? 27.579 10.449 27.686  1.00 35.16 ? 16   GLU A O   1 
ATOM   105  C  CB  . GLU A 1 16  ? 30.475 9.803  27.553  1.00 36.77 ? 16   GLU A CB  1 
ATOM   106  C  CG  . GLU A 1 16  ? 30.993 9.867  28.985  1.00 39.61 ? 16   GLU A CG  1 
ATOM   107  C  CD  . GLU A 1 16  ? 32.041 10.944 29.175  1.00 44.13 ? 16   GLU A CD  1 
ATOM   108  O  OE1 . GLU A 1 16  ? 31.746 12.125 28.880  1.00 43.88 ? 16   GLU A OE1 1 
ATOM   109  O  OE2 . GLU A 1 16  ? 33.157 10.609 29.628  1.00 48.36 ? 16   GLU A OE2 1 
ATOM   110  N  N   . ILE A 1 17  ? 27.561 8.647  29.029  1.00 35.74 ? 17   ILE A N   1 
ATOM   111  C  CA  . ILE A 1 17  ? 26.329 9.020  29.712  1.00 35.69 ? 17   ILE A CA  1 
ATOM   112  C  C   . ILE A 1 17  ? 26.634 9.373  31.165  1.00 35.37 ? 17   ILE A C   1 
ATOM   113  O  O   . ILE A 1 17  ? 26.892 8.493  31.987  1.00 35.10 ? 17   ILE A O   1 
ATOM   114  C  CB  . ILE A 1 17  ? 25.286 7.884  29.638  1.00 36.29 ? 17   ILE A CB  1 
ATOM   115  C  CG1 . ILE A 1 17  ? 25.174 7.360  28.201  1.00 36.34 ? 17   ILE A CG1 1 
ATOM   116  C  CG2 . ILE A 1 17  ? 23.933 8.373  30.142  1.00 35.22 ? 17   ILE A CG2 1 
ATOM   117  C  CD1 . ILE A 1 17  ? 24.204 6.222  28.043  1.00 39.08 ? 17   ILE A CD1 1 
ATOM   118  N  N   . ALA A 1 18  ? 26.622 10.671 31.462  1.00 35.08 ? 18   ALA A N   1 
ATOM   119  C  CA  . ALA A 1 18  ? 26.866 11.174 32.812  1.00 35.29 ? 18   ALA A CA  1 
ATOM   120  C  C   . ALA A 1 18  ? 25.604 11.833 33.366  1.00 34.94 ? 18   ALA A C   1 
ATOM   121  O  O   . ALA A 1 18  ? 24.741 12.278 32.607  1.00 34.77 ? 18   ALA A O   1 
ATOM   122  C  CB  . ALA A 1 18  ? 28.020 12.165 32.802  1.00 35.37 ? 18   ALA A CB  1 
ATOM   123  N  N   . ALA A 1 19  ? 25.502 11.883 34.691  1.00 34.79 ? 19   ALA A N   1 
ATOM   124  C  CA  . ALA A 1 19  ? 24.373 12.518 35.363  1.00 34.62 ? 19   ALA A CA  1 
ATOM   125  C  C   . ALA A 1 19  ? 24.872 13.583 36.336  1.00 34.96 ? 19   ALA A C   1 
ATOM   126  O  O   . ALA A 1 19  ? 25.903 13.405 36.989  1.00 35.42 ? 19   ALA A O   1 
ATOM   127  C  CB  . ALA A 1 19  ? 23.542 11.476 36.096  1.00 34.42 ? 19   ALA A CB  1 
ATOM   128  N  N   . VAL A 1 20  ? 24.145 14.694 36.411  1.00 35.02 ? 20   VAL A N   1 
ATOM   129  C  CA  . VAL A 1 20  ? 24.424 15.756 37.378  1.00 35.51 ? 20   VAL A CA  1 
ATOM   130  C  C   . VAL A 1 20  ? 23.114 16.339 37.883  1.00 35.74 ? 20   VAL A C   1 
ATOM   131  O  O   . VAL A 1 20  ? 22.044 16.011 37.371  1.00 35.53 ? 20   VAL A O   1 
ATOM   132  C  CB  . VAL A 1 20  ? 25.265 16.901 36.762  1.00 35.86 ? 20   VAL A CB  1 
ATOM   133  C  CG1 . VAL A 1 20  ? 26.668 16.420 36.422  1.00 35.43 ? 20   VAL A CG1 1 
ATOM   134  C  CG2 . VAL A 1 20  ? 24.575 17.475 35.532  1.00 34.78 ? 20   VAL A CG2 1 
ATOM   135  N  N   . TYR A 1 21  ? 23.199 17.191 38.899  1.00 36.75 ? 21   TYR A N   1 
ATOM   136  C  CA  . TYR A 1 21  ? 22.049 17.989 39.311  1.00 37.28 ? 21   TYR A CA  1 
ATOM   137  C  C   . TYR A 1 21  ? 22.486 19.340 39.869  1.00 38.10 ? 21   TYR A C   1 
ATOM   138  O  O   . TYR A 1 21  ? 23.582 19.476 40.411  1.00 38.22 ? 21   TYR A O   1 
ATOM   139  C  CB  . TYR A 1 21  ? 21.150 17.220 40.296  1.00 37.17 ? 21   TYR A CB  1 
ATOM   140  C  CG  . TYR A 1 21  ? 21.616 17.161 41.743  1.00 38.33 ? 21   TYR A CG  1 
ATOM   141  C  CD1 . TYR A 1 21  ? 21.372 18.218 42.620  1.00 39.37 ? 21   TYR A CD1 1 
ATOM   142  C  CD2 . TYR A 1 21  ? 22.255 16.028 42.248  1.00 39.50 ? 21   TYR A CD2 1 
ATOM   143  C  CE1 . TYR A 1 21  ? 21.780 18.164 43.951  1.00 39.83 ? 21   TYR A CE1 1 
ATOM   144  C  CE2 . TYR A 1 21  ? 22.665 15.963 43.581  1.00 39.37 ? 21   TYR A CE2 1 
ATOM   145  C  CZ  . TYR A 1 21  ? 22.424 17.036 44.424  1.00 39.64 ? 21   TYR A CZ  1 
ATOM   146  O  OH  . TYR A 1 21  ? 22.821 16.985 45.741  1.00 39.35 ? 21   TYR A OH  1 
ATOM   147  N  N   . LEU A 1 22  ? 21.618 20.333 39.713  1.00 39.07 ? 22   LEU A N   1 
ATOM   148  C  CA  . LEU A 1 22  ? 21.893 21.696 40.161  1.00 40.53 ? 22   LEU A CA  1 
ATOM   149  C  C   . LEU A 1 22  ? 20.595 22.363 40.623  1.00 41.17 ? 22   LEU A C   1 
ATOM   150  O  O   . LEU A 1 22  ? 19.540 21.726 40.638  1.00 41.16 ? 22   LEU A O   1 
ATOM   151  C  CB  . LEU A 1 22  ? 22.555 22.497 39.033  1.00 40.96 ? 22   LEU A CB  1 
ATOM   152  C  CG  . LEU A 1 22  ? 21.862 22.500 37.665  1.00 41.87 ? 22   LEU A CG  1 
ATOM   153  C  CD1 . LEU A 1 22  ? 22.294 23.706 36.842  1.00 43.12 ? 22   LEU A CD1 1 
ATOM   154  C  CD2 . LEU A 1 22  ? 22.136 21.208 36.902  1.00 42.04 ? 22   LEU A CD2 1 
ATOM   155  N  N   . GLN A 1 23  ? 20.674 23.633 41.013  1.00 42.31 ? 23   GLN A N   1 
ATOM   156  C  CA  . GLN A 1 23  ? 19.491 24.386 41.437  1.00 42.98 ? 23   GLN A CA  1 
ATOM   157  C  C   . GLN A 1 23  ? 18.396 24.370 40.364  1.00 42.66 ? 23   GLN A C   1 
ATOM   158  O  O   . GLN A 1 23  ? 18.702 24.266 39.175  1.00 42.62 ? 23   GLN A O   1 
ATOM   159  C  CB  . GLN A 1 23  ? 19.859 25.836 41.804  1.00 44.30 ? 23   GLN A CB  1 
ATOM   160  C  CG  . GLN A 1 23  ? 20.223 26.772 40.629  1.00 46.96 ? 23   GLN A CG  1 
ATOM   161  C  CD  . GLN A 1 23  ? 21.643 26.583 40.093  1.00 50.19 ? 23   GLN A CD  1 
ATOM   162  O  OE1 . GLN A 1 23  ? 22.407 25.742 40.575  1.00 51.95 ? 23   GLN A OE1 1 
ATOM   163  N  NE2 . GLN A 1 23  ? 21.998 27.376 39.086  1.00 52.39 ? 23   GLN A NE2 1 
ATOM   164  N  N   . PRO A 1 24  ? 17.117 24.475 40.779  1.00 42.83 ? 24   PRO A N   1 
ATOM   165  C  CA  . PRO A 1 24  ? 16.029 24.504 39.798  1.00 42.64 ? 24   PRO A CA  1 
ATOM   166  C  C   . PRO A 1 24  ? 16.182 25.649 38.803  1.00 43.10 ? 24   PRO A C   1 
ATOM   167  O  O   . PRO A 1 24  ? 16.706 26.705 39.155  1.00 43.78 ? 24   PRO A O   1 
ATOM   168  C  CB  . PRO A 1 24  ? 14.776 24.713 40.659  1.00 43.12 ? 24   PRO A CB  1 
ATOM   169  C  CG  . PRO A 1 24  ? 15.155 24.270 42.014  1.00 43.12 ? 24   PRO A CG  1 
ATOM   170  C  CD  . PRO A 1 24  ? 16.609 24.592 42.157  1.00 42.99 ? 24   PRO A CD  1 
ATOM   171  N  N   . ILE A 1 25  ? 15.721 25.432 37.575  1.00 43.24 ? 25   ILE A N   1 
ATOM   172  C  CA  . ILE A 1 25  ? 15.880 26.409 36.500  1.00 44.28 ? 25   ILE A CA  1 
ATOM   173  C  C   . ILE A 1 25  ? 14.542 26.736 35.840  1.00 45.12 ? 25   ILE A C   1 
ATOM   174  O  O   . ILE A 1 25  ? 13.648 25.892 35.792  1.00 44.24 ? 25   ILE A O   1 
ATOM   175  C  CB  . ILE A 1 25  ? 16.901 25.917 35.426  1.00 43.87 ? 25   ILE A CB  1 
ATOM   176  C  CG1 . ILE A 1 25  ? 16.388 24.673 34.677  1.00 43.36 ? 25   ILE A CG1 1 
ATOM   177  C  CG2 . ILE A 1 25  ? 18.253 25.639 36.072  1.00 42.13 ? 25   ILE A CG2 1 
ATOM   178  C  CD1 . ILE A 1 25  ? 15.581 24.979 33.412  1.00 41.35 ? 25   ILE A CD1 1 
ATOM   179  N  N   . GLU A 1 26  ? 14.421 27.971 35.352  1.00 46.99 ? 26   GLU A N   1 
ATOM   180  C  CA  A GLU A 1 26  ? 13.242 28.422 34.615  0.50 48.37 ? 26   GLU A CA  1 
ATOM   181  C  CA  B GLU A 1 26  ? 13.235 28.405 34.620  0.50 48.31 ? 26   GLU A CA  1 
ATOM   182  C  C   . GLU A 1 26  ? 13.415 28.077 33.139  1.00 48.87 ? 26   GLU A C   1 
ATOM   183  O  O   . GLU A 1 26  ? 14.423 28.444 32.535  1.00 49.10 ? 26   GLU A O   1 
ATOM   184  C  CB  A GLU A 1 26  ? 13.066 29.939 34.764  0.50 49.71 ? 26   GLU A CB  1 
ATOM   185  C  CB  B GLU A 1 26  ? 13.005 29.907 34.803  0.50 49.62 ? 26   GLU A CB  1 
ATOM   186  C  CG  A GLU A 1 26  ? 12.964 30.436 36.205  0.50 50.13 ? 26   GLU A CG  1 
ATOM   187  C  CG  B GLU A 1 26  ? 12.738 30.340 36.245  0.50 49.81 ? 26   GLU A CG  1 
ATOM   188  C  CD  A GLU A 1 26  ? 12.875 31.952 36.298  0.50 51.26 ? 26   GLU A CD  1 
ATOM   189  C  CD  B GLU A 1 26  ? 11.364 29.927 36.749  0.50 49.04 ? 26   GLU A CD  1 
ATOM   190  O  OE1 A GLU A 1 26  ? 12.779 32.615 35.243  0.50 50.93 ? 26   GLU A OE1 1 
ATOM   191  O  OE1 B GLU A 1 26  ? 10.839 28.886 36.296  0.50 47.48 ? 26   GLU A OE1 1 
ATOM   192  O  OE2 A GLU A 1 26  ? 12.902 32.481 37.429  0.50 51.36 ? 26   GLU A OE2 1 
ATOM   193  O  OE2 B GLU A 1 26  ? 10.812 30.647 37.608  0.50 48.66 ? 26   GLU A OE2 1 
ATOM   194  N  N   . MET A 1 27  ? 12.437 27.378 32.559  1.00 49.79 ? 27   MET A N   1 
ATOM   195  C  CA  . MET A 1 27  ? 12.517 26.942 31.161  1.00 50.68 ? 27   MET A CA  1 
ATOM   196  C  C   . MET A 1 27  ? 11.380 27.499 30.303  1.00 52.38 ? 27   MET A C   1 
ATOM   197  O  O   . MET A 1 27  ? 10.217 27.477 30.709  1.00 52.91 ? 27   MET A O   1 
ATOM   198  C  CB  . MET A 1 27  ? 12.501 25.409 31.078  1.00 49.93 ? 27   MET A CB  1 
ATOM   199  C  CG  . MET A 1 27  ? 12.990 24.847 29.738  1.00 50.43 ? 27   MET A CG  1 
ATOM   200  S  SD  . MET A 1 27  ? 12.539 23.122 29.434  1.00 49.48 ? 27   MET A SD  1 
ATOM   201  C  CE  . MET A 1 27  ? 10.808 23.284 29.015  1.00 51.75 ? 27   MET A CE  1 
ATOM   202  N  N   . GLU A 1 28  ? 11.735 28.005 29.122  1.00 53.73 ? 28   GLU A N   1 
ATOM   203  C  CA  . GLU A 1 28  ? 10.768 28.310 28.069  1.00 55.71 ? 28   GLU A CA  1 
ATOM   204  C  C   . GLU A 1 28  ? 10.935 27.268 26.964  1.00 55.87 ? 28   GLU A C   1 
ATOM   205  O  O   . GLU A 1 28  ? 12.063 26.937 26.608  1.00 55.28 ? 28   GLU A O   1 
ATOM   206  C  CB  . GLU A 1 28  ? 10.990 29.712 27.497  1.00 57.32 ? 28   GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 28  ? 10.442 30.841 28.366  1.00 59.16 ? 28   GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 28  ? 10.369 32.176 27.636  1.00 61.28 ? 28   GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 28  ? 10.038 32.190 26.430  1.00 62.00 ? 28   GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 28  ? 10.633 33.216 28.275  1.00 62.28 ? 28   GLU A OE2 1 
ATOM   211  N  N   . PRO A 1 29  ? 9.822  26.759 26.400  1.00 57.29 ? 29   PRO A N   1 
ATOM   212  C  CA  . PRO A 1 29  ? 8.432  27.162 26.612  1.00 59.13 ? 29   PRO A CA  1 
ATOM   213  C  C   . PRO A 1 29  ? 7.852  26.709 27.953  1.00 59.51 ? 29   PRO A C   1 
ATOM   214  O  O   . PRO A 1 29  ? 8.278  25.694 28.510  1.00 58.31 ? 29   PRO A O   1 
ATOM   215  C  CB  . PRO A 1 29  ? 7.697  26.475 25.459  1.00 59.40 ? 29   PRO A CB  1 
ATOM   216  C  CG  . PRO A 1 29  ? 8.476  25.245 25.216  1.00 57.80 ? 29   PRO A CG  1 
ATOM   217  C  CD  . PRO A 1 29  ? 9.914  25.604 25.488  1.00 56.68 ? 29   PRO A CD  1 
ATOM   218  N  N   . ARG A 1 30  ? 6.873  27.467 28.444  1.00 61.56 ? 30   ARG A N   1 
ATOM   219  C  CA  . ARG A 1 30  ? 6.241  27.195 29.731  1.00 62.05 ? 30   ARG A CA  1 
ATOM   220  C  C   . ARG A 1 30  ? 5.325  25.978 29.591  1.00 61.98 ? 30   ARG A C   1 
ATOM   221  O  O   . ARG A 1 30  ? 4.961  25.592 28.476  1.00 62.35 ? 30   ARG A O   1 
ATOM   222  C  CB  . ARG A 1 30  ? 5.405  28.392 30.213  1.00 63.93 ? 30   ARG A CB  1 
ATOM   223  C  CG  . ARG A 1 30  ? 6.023  29.790 30.052  1.00 66.50 ? 30   ARG A CG  1 
ATOM   224  C  CD  . ARG A 1 30  ? 7.166  30.074 31.025  1.00 68.07 ? 30   ARG A CD  1 
ATOM   225  N  NE  . ARG A 1 30  ? 7.238  31.504 31.339  1.00 71.57 ? 30   ARG A NE  1 
ATOM   226  C  CZ  . ARG A 1 30  ? 8.315  32.144 31.799  1.00 73.26 ? 30   ARG A CZ  1 
ATOM   227  N  NH1 . ARG A 1 30  ? 9.463  31.505 32.016  1.00 71.85 ? 30   ARG A NH1 1 
ATOM   228  N  NH2 . ARG A 1 30  ? 8.240  33.450 32.042  1.00 75.46 ? 30   ARG A NH2 1 
ATOM   229  N  N   . GLY A 1 31  ? 4.964  25.374 30.721  1.00 61.50 ? 31   GLY A N   1 
ATOM   230  C  CA  . GLY A 1 31  ? 3.960  24.309 30.745  1.00 61.39 ? 31   GLY A CA  1 
ATOM   231  C  C   . GLY A 1 31  ? 4.457  22.900 30.465  1.00 60.15 ? 31   GLY A C   1 
ATOM   232  O  O   . GLY A 1 31  ? 3.756  21.932 30.759  1.00 60.04 ? 31   GLY A O   1 
ATOM   233  N  N   . ILE A 1 32  ? 5.651  22.772 29.888  1.00 59.16 ? 32   ILE A N   1 
ATOM   234  C  CA  . ILE A 1 32  ? 6.242  21.458 29.638  1.00 58.09 ? 32   ILE A CA  1 
ATOM   235  C  C   . ILE A 1 32  ? 6.905  20.916 30.906  1.00 55.85 ? 32   ILE A C   1 
ATOM   236  O  O   . ILE A 1 32  ? 6.727  19.745 31.251  1.00 56.01 ? 32   ILE A O   1 
ATOM   237  C  CB  . ILE A 1 32  ? 7.281  21.502 28.489  1.00 58.42 ? 32   ILE A CB  1 
ATOM   238  C  CG1 . ILE A 1 32  ? 6.600  21.840 27.158  1.00 61.12 ? 32   ILE A CG1 1 
ATOM   239  C  CG2 . ILE A 1 32  ? 8.015  20.161 28.367  1.00 58.35 ? 32   ILE A CG2 1 
ATOM   240  C  CD1 . ILE A 1 32  ? 5.708  20.729 26.617  1.00 63.65 ? 32   ILE A CD1 1 
ATOM   241  N  N   . ASP A 1 33  ? 7.653  21.774 31.598  1.00 53.82 ? 33   ASP A N   1 
ATOM   242  C  CA  . ASP A 1 33  ? 8.445  21.371 32.764  1.00 51.31 ? 33   ASP A CA  1 
ATOM   243  C  C   . ASP A 1 33  ? 7.794  21.814 34.081  1.00 50.29 ? 33   ASP A C   1 
ATOM   244  O  O   . ASP A 1 33  ? 6.916  22.683 34.095  1.00 51.56 ? 33   ASP A O   1 
ATOM   245  C  CB  . ASP A 1 33  ? 9.856  21.967 32.646  1.00 50.69 ? 33   ASP A CB  1 
ATOM   246  C  CG  . ASP A 1 33  ? 10.875 21.278 33.547  1.00 49.66 ? 33   ASP A CG  1 
ATOM   247  O  OD1 . ASP A 1 33  ? 10.715 20.072 33.848  1.00 48.67 ? 33   ASP A OD1 1 
ATOM   248  O  OD2 . ASP A 1 33  ? 11.850 21.949 33.949  1.00 47.87 ? 33   ASP A OD2 1 
ATOM   249  N  N   . LEU A 1 34  ? 8.221  21.194 35.182  1.00 47.73 ? 34   LEU A N   1 
ATOM   250  C  CA  . LEU A 1 34  ? 7.832  21.628 36.522  1.00 46.21 ? 34   LEU A CA  1 
ATOM   251  C  C   . LEU A 1 34  ? 8.443  23.002 36.801  1.00 45.77 ? 34   LEU A C   1 
ATOM   252  O  O   . LEU A 1 34  ? 9.594  23.254 36.442  1.00 45.40 ? 34   LEU A O   1 
ATOM   253  C  CB  . LEU A 1 34  ? 8.304  20.615 37.573  1.00 44.80 ? 34   LEU A CB  1 
ATOM   254  C  CG  . LEU A 1 34  ? 7.863  20.844 39.025  1.00 43.86 ? 34   LEU A CG  1 
ATOM   255  C  CD1 . LEU A 1 34  ? 6.350  20.718 39.168  1.00 41.02 ? 34   LEU A CD1 1 
ATOM   256  C  CD2 . LEU A 1 34  ? 8.571  19.874 39.961  1.00 40.33 ? 34   LEU A CD2 1 
ATOM   257  N  N   . ALA A 1 35  ? 7.670  23.885 37.433  1.00 45.55 ? 35   ALA A N   1 
ATOM   258  C  CA  . ALA A 1 35  ? 8.128  25.247 37.723  1.00 45.20 ? 35   ALA A CA  1 
ATOM   259  C  C   . ALA A 1 35  ? 9.260  25.243 38.749  1.00 43.94 ? 35   ALA A C   1 
ATOM   260  O  O   . ALA A 1 35  ? 9.402  24.297 39.527  1.00 42.90 ? 35   ALA A O   1 
ATOM   261  C  CB  . ALA A 1 35  ? 6.969  26.111 38.207  1.00 45.83 ? 35   ALA A CB  1 
ATOM   262  N  N   . ALA A 1 36  ? 10.058 26.309 38.741  1.00 43.79 ? 36   ALA A N   1 
ATOM   263  C  CA  . ALA A 1 36  ? 11.260 26.392 39.576  1.00 42.99 ? 36   ALA A CA  1 
ATOM   264  C  C   . ALA A 1 36  ? 10.935 26.419 41.066  1.00 42.42 ? 36   ALA A C   1 
ATOM   265  O  O   . ALA A 1 36  ? 11.621 25.779 41.865  1.00 41.89 ? 36   ALA A O   1 
ATOM   266  C  CB  . ALA A 1 36  ? 12.088 27.616 39.194  1.00 43.76 ? 36   ALA A CB  1 
ATOM   267  N  N   . SER A 1 37  ? 9.891  27.161 41.432  1.00 42.61 ? 37   SER A N   1 
ATOM   268  C  CA  . SER A 1 37  ? 9.479  27.288 42.831  1.00 42.12 ? 37   SER A CA  1 
ATOM   269  C  C   . SER A 1 37  ? 8.920  25.983 43.406  1.00 40.96 ? 37   SER A C   1 
ATOM   270  O  O   . SER A 1 37  ? 9.028  25.739 44.607  1.00 41.17 ? 37   SER A O   1 
ATOM   271  C  CB  . SER A 1 37  ? 8.451  28.415 42.989  1.00 43.22 ? 37   SER A CB  1 
ATOM   272  O  OG  . SER A 1 37  ? 7.291  28.169 42.214  1.00 42.98 ? 37   SER A OG  1 
ATOM   273  N  N   . LEU A 1 38  ? 8.332  25.147 42.551  1.00 39.89 ? 38   LEU A N   1 
ATOM   274  C  CA  . LEU A 1 38  ? 7.784  23.856 42.979  1.00 38.82 ? 38   LEU A CA  1 
ATOM   275  C  C   . LEU A 1 38  ? 8.843  22.753 43.073  1.00 37.73 ? 38   LEU A C   1 
ATOM   276  O  O   . LEU A 1 38  ? 8.552  21.661 43.561  1.00 37.12 ? 38   LEU A O   1 
ATOM   277  C  CB  . LEU A 1 38  ? 6.665  23.412 42.028  1.00 38.99 ? 38   LEU A CB  1 
ATOM   278  C  CG  . LEU A 1 38  ? 5.415  24.297 42.017  1.00 38.48 ? 38   LEU A CG  1 
ATOM   279  C  CD1 . LEU A 1 38  ? 4.540  23.987 40.818  1.00 37.18 ? 38   LEU A CD1 1 
ATOM   280  C  CD2 . LEU A 1 38  ? 4.631  24.132 43.300  1.00 38.14 ? 38   LEU A CD2 1 
ATOM   281  N  N   . ALA A 1 39  ? 10.060 23.042 42.613  1.00 37.69 ? 39   ALA A N   1 
ATOM   282  C  CA  . ALA A 1 39  ? 11.140 22.054 42.556  1.00 36.80 ? 39   ALA A CA  1 
ATOM   283  C  C   . ALA A 1 39  ? 12.261 22.354 43.550  1.00 36.68 ? 39   ALA A C   1 
ATOM   284  O  O   . ALA A 1 39  ? 12.344 23.451 44.108  1.00 37.31 ? 39   ALA A O   1 
ATOM   285  C  CB  . ALA A 1 39  ? 11.705 21.984 41.144  1.00 36.32 ? 39   ALA A CB  1 
ATOM   286  N  N   . ASP A 1 40  ? 13.112 21.351 43.761  1.00 36.18 ? 40   ASP A N   1 
ATOM   287  C  CA  . ASP A 1 40  ? 14.298 21.459 44.616  1.00 36.14 ? 40   ASP A CA  1 
ATOM   288  C  C   . ASP A 1 40  ? 15.603 21.300 43.832  1.00 35.81 ? 40   ASP A C   1 
ATOM   289  O  O   . ASP A 1 40  ? 16.618 21.901 44.191  1.00 35.72 ? 40   ASP A O   1 
ATOM   290  C  CB  . ASP A 1 40  ? 14.240 20.403 45.717  1.00 35.93 ? 40   ASP A CB  1 
ATOM   291  C  CG  . ASP A 1 40  ? 13.165 20.692 46.738  1.00 36.82 ? 40   ASP A CG  1 
ATOM   292  O  OD1 . ASP A 1 40  ? 13.290 21.707 47.460  1.00 38.68 ? 40   ASP A OD1 1 
ATOM   293  O  OD2 . ASP A 1 40  ? 12.199 19.904 46.819  1.00 34.61 ? 40   ASP A OD2 1 
ATOM   294  N  N   . ILE A 1 41  ? 15.578 20.480 42.779  1.00 35.19 ? 41   ILE A N   1 
ATOM   295  C  CA  . ILE A 1 41  ? 16.742 20.283 41.912  1.00 34.46 ? 41   ILE A CA  1 
ATOM   296  C  C   . ILE A 1 41  ? 16.370 20.321 40.429  1.00 34.12 ? 41   ILE A C   1 
ATOM   297  O  O   . ILE A 1 41  ? 15.192 20.343 40.067  1.00 34.10 ? 41   ILE A O   1 
ATOM   298  C  CB  . ILE A 1 41  ? 17.466 18.940 42.216  1.00 34.08 ? 41   ILE A CB  1 
ATOM   299  C  CG1 . ILE A 1 41  ? 16.561 17.737 41.924  1.00 32.75 ? 41   ILE A CG1 1 
ATOM   300  C  CG2 . ILE A 1 41  ? 17.935 18.908 43.661  1.00 33.28 ? 41   ILE A CG2 1 
ATOM   301  C  CD1 . ILE A 1 41  ? 17.276 16.410 42.035  1.00 31.77 ? 41   ILE A CD1 1 
ATOM   302  N  N   . HIS A 1 42  ? 17.401 20.345 39.588  1.00 34.05 ? 42   HIS A N   1 
ATOM   303  C  CA  . HIS A 1 42  ? 17.262 20.174 38.144  1.00 33.86 ? 42   HIS A CA  1 
ATOM   304  C  C   . HIS A 1 42  ? 18.180 19.037 37.705  1.00 33.50 ? 42   HIS A C   1 
ATOM   305  O  O   . HIS A 1 42  ? 19.400 19.181 37.728  1.00 34.00 ? 42   HIS A O   1 
ATOM   306  C  CB  . HIS A 1 42  ? 17.634 21.466 37.414  1.00 34.22 ? 42   HIS A CB  1 
ATOM   307  C  CG  . HIS A 1 42  ? 17.412 21.410 35.935  1.00 33.19 ? 42   HIS A CG  1 
ATOM   308  N  ND1 . HIS A 1 42  ? 16.155 21.417 35.371  1.00 34.08 ? 42   HIS A ND1 1 
ATOM   309  C  CD2 . HIS A 1 42  ? 18.286 21.355 34.904  1.00 33.91 ? 42   HIS A CD2 1 
ATOM   310  C  CE1 . HIS A 1 42  ? 16.263 21.363 34.056  1.00 34.42 ? 42   HIS A CE1 1 
ATOM   311  N  NE2 . HIS A 1 42  ? 17.547 21.324 33.746  1.00 35.46 ? 42   HIS A NE2 1 
ATOM   312  N  N   . LEU A 1 43  ? 17.592 17.904 37.329  1.00 33.27 ? 43   LEU A N   1 
ATOM   313  C  CA  . LEU A 1 43  ? 18.363 16.745 36.883  1.00 33.15 ? 43   LEU A CA  1 
ATOM   314  C  C   . LEU A 1 43  ? 18.796 16.941 35.434  1.00 33.12 ? 43   LEU A C   1 
ATOM   315  O  O   . LEU A 1 43  ? 18.025 17.448 34.621  1.00 32.83 ? 43   LEU A O   1 
ATOM   316  C  CB  . LEU A 1 43  ? 17.529 15.465 37.016  1.00 33.05 ? 43   LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 43  ? 18.258 14.132 36.806  1.00 33.56 ? 43   LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 43  ? 19.380 13.938 37.820  1.00 31.90 ? 43   LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 43  ? 17.269 12.980 36.877  1.00 33.38 ? 43   LEU A CD2 1 
ATOM   320  N  N   . GLU A 1 44  ? 20.028 16.547 35.118  1.00 33.52 ? 44   GLU A N   1 
ATOM   321  C  CA  . GLU A 1 44  ? 20.552 16.654 33.752  1.00 33.95 ? 44   GLU A CA  1 
ATOM   322  C  C   . GLU A 1 44  ? 21.243 15.369 33.318  1.00 33.70 ? 44   GLU A C   1 
ATOM   323  O  O   . GLU A 1 44  ? 21.987 14.765 34.088  1.00 33.48 ? 44   GLU A O   1 
ATOM   324  C  CB  . GLU A 1 44  ? 21.532 17.827 33.625  1.00 34.05 ? 44   GLU A CB  1 
ATOM   325  C  CG  . GLU A 1 44  ? 20.885 19.203 33.746  1.00 35.93 ? 44   GLU A CG  1 
ATOM   326  C  CD  . GLU A 1 44  ? 21.837 20.351 33.428  1.00 37.79 ? 44   GLU A CD  1 
ATOM   327  O  OE1 . GLU A 1 44  ? 23.009 20.092 33.083  1.00 39.33 ? 44   GLU A OE1 1 
ATOM   328  O  OE2 . GLU A 1 44  ? 21.410 21.521 33.525  1.00 39.08 ? 44   GLU A OE2 1 
ATOM   329  N  N   . ALA A 1 45  ? 20.982 14.960 32.078  1.00 34.32 ? 45   ALA A N   1 
ATOM   330  C  CA  . ALA A 1 45  ? 21.687 13.850 31.445  1.00 34.54 ? 45   ALA A CA  1 
ATOM   331  C  C   . ALA A 1 45  ? 22.609 14.404 30.357  1.00 35.06 ? 45   ALA A C   1 
ATOM   332  O  O   . ALA A 1 45  ? 22.141 14.922 29.337  1.00 35.23 ? 45   ALA A O   1 
ATOM   333  C  CB  . ALA A 1 45  ? 20.696 12.860 30.854  1.00 34.41 ? 45   ALA A CB  1 
ATOM   334  N  N   . ASP A 1 46  ? 23.916 14.314 30.594  1.00 35.54 ? 46   ASP A N   1 
ATOM   335  C  CA  . ASP A 1 46  ? 24.920 14.708 29.607  1.00 35.92 ? 46   ASP A CA  1 
ATOM   336  C  C   . ASP A 1 46  ? 25.307 13.491 28.781  1.00 34.90 ? 46   ASP A C   1 
ATOM   337  O  O   . ASP A 1 46  ? 25.985 12.589 29.276  1.00 34.89 ? 46   ASP A O   1 
ATOM   338  C  CB  . ASP A 1 46  ? 26.156 15.293 30.296  1.00 36.60 ? 46   ASP A CB  1 
ATOM   339  C  CG  . ASP A 1 46  ? 25.848 16.568 31.063  1.00 40.73 ? 46   ASP A CG  1 
ATOM   340  O  OD1 . ASP A 1 46  ? 25.105 17.426 30.533  1.00 45.91 ? 46   ASP A OD1 1 
ATOM   341  O  OD2 . ASP A 1 46  ? 26.355 16.717 32.197  1.00 46.65 ? 46   ASP A OD2 1 
ATOM   342  N  N   . ILE A 1 47  ? 24.861 13.467 27.526  1.00 34.26 ? 47   ILE A N   1 
ATOM   343  C  CA  . ILE A 1 47  ? 25.127 12.350 26.618  1.00 33.17 ? 47   ILE A CA  1 
ATOM   344  C  C   . ILE A 1 47  ? 25.840 12.869 25.370  1.00 32.60 ? 47   ILE A C   1 
ATOM   345  O  O   . ILE A 1 47  ? 25.229 13.524 24.524  1.00 32.24 ? 47   ILE A O   1 
ATOM   346  C  CB  . ILE A 1 47  ? 23.824 11.614 26.215  1.00 32.94 ? 47   ILE A CB  1 
ATOM   347  C  CG1 . ILE A 1 47  ? 22.971 11.304 27.451  1.00 33.20 ? 47   ILE A CG1 1 
ATOM   348  C  CG2 . ILE A 1 47  ? 24.156 10.331 25.477  1.00 31.40 ? 47   ILE A CG2 1 
ATOM   349  C  CD1 . ILE A 1 47  ? 21.654 10.630 27.136  1.00 34.53 ? 47   ILE A CD1 1 
ATOM   350  N  N   . HIS A 1 48  ? 27.137 12.584 25.273  1.00 32.12 ? 48   HIS A N   1 
ATOM   351  C  CA  . HIS A 1 48  ? 27.953 13.019 24.138  1.00 31.68 ? 48   HIS A CA  1 
ATOM   352  C  C   . HIS A 1 48  ? 28.631 11.831 23.467  1.00 31.39 ? 48   HIS A C   1 
ATOM   353  O  O   . HIS A 1 48  ? 28.886 10.809 24.101  1.00 30.82 ? 48   HIS A O   1 
ATOM   354  C  CB  . HIS A 1 48  ? 29.009 14.029 24.589  1.00 31.68 ? 48   HIS A CB  1 
ATOM   355  C  CG  . HIS A 1 48  ? 28.436 15.263 25.212  1.00 30.57 ? 48   HIS A CG  1 
ATOM   356  N  ND1 . HIS A 1 48  ? 28.210 15.376 26.567  1.00 30.08 ? 48   HIS A ND1 1 
ATOM   357  C  CD2 . HIS A 1 48  ? 28.046 16.438 24.666  1.00 30.05 ? 48   HIS A CD2 1 
ATOM   358  C  CE1 . HIS A 1 48  ? 27.702 16.567 26.828  1.00 30.77 ? 48   HIS A CE1 1 
ATOM   359  N  NE2 . HIS A 1 48  ? 27.593 17.232 25.692  1.00 29.02 ? 48   HIS A NE2 1 
ATOM   360  N  N   . ALA A 1 49  ? 28.921 11.981 22.179  1.00 31.98 ? 49   ALA A N   1 
ATOM   361  C  CA  . ALA A 1 49  ? 29.514 10.912 21.383  1.00 32.28 ? 49   ALA A CA  1 
ATOM   362  C  C   . ALA A 1 49  ? 30.968 10.687 21.766  1.00 32.72 ? 49   ALA A C   1 
ATOM   363  O  O   . ALA A 1 49  ? 31.688 11.635 22.087  1.00 33.45 ? 49   ALA A O   1 
ATOM   364  C  CB  . ALA A 1 49  ? 29.412 11.242 19.902  1.00 32.50 ? 49   ALA A CB  1 
ATOM   365  N  N   . LEU A 1 50  ? 31.392 9.427  21.720  1.00 32.82 ? 50   LEU A N   1 
ATOM   366  C  CA  . LEU A 1 50  ? 32.775 9.056  22.019  1.00 33.23 ? 50   LEU A CA  1 
ATOM   367  C  C   . LEU A 1 50  ? 33.619 9.048  20.739  1.00 33.37 ? 50   LEU A C   1 
ATOM   368  O  O   . LEU A 1 50  ? 33.150 9.437  19.667  1.00 32.90 ? 50   LEU A O   1 
ATOM   369  C  CB  . LEU A 1 50  ? 32.809 7.678  22.696  1.00 33.40 ? 50   LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 50  ? 32.303 7.638  24.140  1.00 33.63 ? 50   LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 50  ? 31.934 6.216  24.550  1.00 33.38 ? 50   LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 50  ? 33.345 8.230  25.085  1.00 33.07 ? 50   LEU A CD2 1 
ATOM   373  N  N   . LYS A 1 51  ? 34.874 8.624  20.864  1.00 33.94 ? 51   LYS A N   1 
ATOM   374  C  CA  . LYS A 1 51  ? 35.712 8.352  19.704  1.00 34.22 ? 51   LYS A CA  1 
ATOM   375  C  C   . LYS A 1 51  ? 35.089 7.224  18.876  1.00 33.98 ? 51   LYS A C   1 
ATOM   376  O  O   . LYS A 1 51  ? 34.502 6.294  19.430  1.00 33.72 ? 51   LYS A O   1 
ATOM   377  C  CB  . LYS A 1 51  ? 37.122 7.947  20.146  1.00 34.99 ? 51   LYS A CB  1 
ATOM   378  C  CG  . LYS A 1 51  ? 37.936 9.057  20.812  1.00 35.88 ? 51   LYS A CG  1 
ATOM   379  C  CD  . LYS A 1 51  ? 39.153 8.484  21.548  1.00 36.48 ? 51   LYS A CD  1 
ATOM   380  C  CE  . LYS A 1 51  ? 40.291 9.492  21.660  1.00 36.17 ? 51   LYS A CE  1 
ATOM   381  N  NZ  . LYS A 1 51  ? 39.895 10.731 22.370  1.00 34.01 ? 51   LYS A NZ  1 
ATOM   382  N  N   . ASN A 1 52  ? 35.207 7.325  17.554  1.00 34.43 ? 52   ASN A N   1 
ATOM   383  C  CA  . ASN A 1 52  ? 34.744 6.279  16.633  1.00 34.94 ? 52   ASN A CA  1 
ATOM   384  C  C   . ASN A 1 52  ? 33.308 5.808  16.898  1.00 34.30 ? 52   ASN A C   1 
ATOM   385  O  O   . ASN A 1 52  ? 33.031 4.605  16.943  1.00 34.13 ? 52   ASN A O   1 
ATOM   386  C  CB  . ASN A 1 52  ? 35.718 5.094  16.655  1.00 35.92 ? 52   ASN A CB  1 
ATOM   387  C  CG  . ASN A 1 52  ? 37.085 5.453  16.104  1.00 37.47 ? 52   ASN A CG  1 
ATOM   388  O  OD1 . ASN A 1 52  ? 37.221 5.778  14.925  1.00 41.04 ? 52   ASN A OD1 1 
ATOM   389  N  ND2 . ASN A 1 52  ? 38.106 5.391  16.954  1.00 37.90 ? 52   ASN A ND2 1 
ATOM   390  N  N   . ASN A 1 53  ? 32.404 6.770  17.075  1.00 33.83 ? 53   ASN A N   1 
ATOM   391  C  CA  . ASN A 1 53  ? 30.982 6.486  17.260  1.00 33.24 ? 53   ASN A CA  1 
ATOM   392  C  C   . ASN A 1 53  ? 30.461 5.710  16.053  1.00 33.55 ? 53   ASN A C   1 
ATOM   393  O  O   . ASN A 1 53  ? 30.669 6.132  14.914  1.00 33.66 ? 53   ASN A O   1 
ATOM   394  C  CB  . ASN A 1 53  ? 30.202 7.795  17.437  1.00 32.80 ? 53   ASN A CB  1 
ATOM   395  C  CG  . ASN A 1 53  ? 28.718 7.576  17.699  1.00 32.13 ? 53   ASN A CG  1 
ATOM   396  O  OD1 . ASN A 1 53  ? 27.916 7.508  16.767  1.00 32.17 ? 53   ASN A OD1 1 
ATOM   397  N  ND2 . ASN A 1 53  ? 28.345 7.499  18.970  1.00 27.90 ? 53   ASN A ND2 1 
ATOM   398  N  N   . PRO A 1 54  ? 29.792 4.567  16.295  1.00 33.90 ? 54   PRO A N   1 
ATOM   399  C  CA  . PRO A 1 54  ? 29.354 3.706  15.193  1.00 34.29 ? 54   PRO A CA  1 
ATOM   400  C  C   . PRO A 1 54  ? 28.231 4.305  14.347  1.00 34.15 ? 54   PRO A C   1 
ATOM   401  O  O   . PRO A 1 54  ? 28.036 3.882  13.209  1.00 34.43 ? 54   PRO A O   1 
ATOM   402  C  CB  . PRO A 1 54  ? 28.873 2.441  15.910  1.00 34.88 ? 54   PRO A CB  1 
ATOM   403  C  CG  . PRO A 1 54  ? 28.450 2.908  17.247  1.00 34.51 ? 54   PRO A CG  1 
ATOM   404  C  CD  . PRO A 1 54  ? 29.374 4.034  17.605  1.00 33.82 ? 54   PRO A CD  1 
ATOM   405  N  N   . ASN A 1 55  ? 27.512 5.278  14.905  1.00 34.03 ? 55   ASN A N   1 
ATOM   406  C  CA  . ASN A 1 55  ? 26.421 5.961  14.211  1.00 33.69 ? 55   ASN A CA  1 
ATOM   407  C  C   . ASN A 1 55  ? 26.848 7.301  13.602  1.00 33.24 ? 55   ASN A C   1 
ATOM   408  O  O   . ASN A 1 55  ? 26.003 8.139  13.268  1.00 33.34 ? 55   ASN A O   1 
ATOM   409  C  CB  . ASN A 1 55  ? 25.249 6.157  15.174  1.00 33.37 ? 55   ASN A CB  1 
ATOM   410  C  CG  . ASN A 1 55  ? 24.792 4.855  15.797  1.00 33.14 ? 55   ASN A CG  1 
ATOM   411  O  OD1 . ASN A 1 55  ? 25.053 4.588  16.970  1.00 32.57 ? 55   ASN A OD1 1 
ATOM   412  N  ND2 . ASN A 1 55  ? 24.126 4.024  15.003  1.00 33.65 ? 55   ASN A ND2 1 
ATOM   413  N  N   . GLY A 1 56  ? 28.159 7.499  13.469  1.00 32.72 ? 56   GLY A N   1 
ATOM   414  C  CA  . GLY A 1 56  ? 28.708 8.608  12.691  1.00 32.46 ? 56   GLY A CA  1 
ATOM   415  C  C   . GLY A 1 56  ? 28.806 9.956  13.382  1.00 31.78 ? 56   GLY A C   1 
ATOM   416  O  O   . GLY A 1 56  ? 29.185 10.939 12.753  1.00 32.21 ? 56   GLY A O   1 
ATOM   417  N  N   . PHE A 1 57  ? 28.482 10.016 14.669  1.00 31.22 ? 57   PHE A N   1 
ATOM   418  C  CA  . PHE A 1 57  ? 28.566 11.275 15.408  1.00 30.89 ? 57   PHE A CA  1 
ATOM   419  C  C   . PHE A 1 57  ? 30.011 11.618 15.792  1.00 31.06 ? 57   PHE A C   1 
ATOM   420  O  O   . PHE A 1 57  ? 30.745 10.754 16.272  1.00 30.16 ? 57   PHE A O   1 
ATOM   421  C  CB  . PHE A 1 57  ? 27.672 11.236 16.648  1.00 30.47 ? 57   PHE A CB  1 
ATOM   422  C  CG  . PHE A 1 57  ? 26.233 11.529 16.347  1.00 30.34 ? 57   PHE A CG  1 
ATOM   423  C  CD1 . PHE A 1 57  ? 25.367 10.517 15.966  1.00 29.69 ? 57   PHE A CD1 1 
ATOM   424  C  CD2 . PHE A 1 57  ? 25.752 12.828 16.417  1.00 29.76 ? 57   PHE A CD2 1 
ATOM   425  C  CE1 . PHE A 1 57  ? 24.045 10.797 15.675  1.00 30.03 ? 57   PHE A CE1 1 
ATOM   426  C  CE2 . PHE A 1 57  ? 24.432 13.112 16.128  1.00 29.07 ? 57   PHE A CE2 1 
ATOM   427  C  CZ  . PHE A 1 57  ? 23.577 12.096 15.758  1.00 30.09 ? 57   PHE A CZ  1 
ATOM   428  N  N   . PRO A 1 58  ? 30.427 12.883 15.566  1.00 32.08 ? 58   PRO A N   1 
ATOM   429  C  CA  . PRO A 1 58  ? 31.764 13.342 15.962  1.00 32.49 ? 58   PRO A CA  1 
ATOM   430  C  C   . PRO A 1 58  ? 32.020 13.271 17.471  1.00 32.63 ? 58   PRO A C   1 
ATOM   431  O  O   . PRO A 1 58  ? 31.079 13.337 18.265  1.00 32.12 ? 58   PRO A O   1 
ATOM   432  C  CB  . PRO A 1 58  ? 31.787 14.805 15.501  1.00 32.77 ? 58   PRO A CB  1 
ATOM   433  C  CG  . PRO A 1 58  ? 30.781 14.890 14.432  1.00 32.89 ? 58   PRO A CG  1 
ATOM   434  C  CD  . PRO A 1 58  ? 29.706 13.921 14.804  1.00 32.65 ? 58   PRO A CD  1 
ATOM   435  N  N   . GLU A 1 59  ? 33.291 13.144 17.849  1.00 33.28 ? 59   GLU A N   1 
ATOM   436  C  CA  . GLU A 1 59  ? 33.675 13.085 19.258  1.00 33.50 ? 59   GLU A CA  1 
ATOM   437  C  C   . GLU A 1 59  ? 33.237 14.358 19.974  1.00 32.94 ? 59   GLU A C   1 
ATOM   438  O  O   . GLU A 1 59  ? 33.509 15.461 19.504  1.00 33.32 ? 59   GLU A O   1 
ATOM   439  C  CB  . GLU A 1 59  ? 35.189 12.913 19.402  1.00 34.26 ? 59   GLU A CB  1 
ATOM   440  C  CG  . GLU A 1 59  ? 35.626 12.519 20.814  1.00 36.81 ? 59   GLU A CG  1 
ATOM   441  C  CD  . GLU A 1 59  ? 37.116 12.678 21.050  1.00 38.67 ? 59   GLU A CD  1 
ATOM   442  O  OE1 . GLU A 1 59  ? 37.863 12.937 20.080  1.00 41.80 ? 59   GLU A OE1 1 
ATOM   443  O  OE2 . GLU A 1 59  ? 37.539 12.549 22.219  1.00 40.24 ? 59   GLU A OE2 1 
ATOM   444  N  N   . GLY A 1 60  ? 32.540 14.195 21.096  1.00 32.25 ? 60   GLY A N   1 
ATOM   445  C  CA  . GLY A 1 60  ? 32.092 15.328 21.907  1.00 32.25 ? 60   GLY A CA  1 
ATOM   446  C  C   . GLY A 1 60  ? 30.782 15.974 21.479  1.00 32.02 ? 60   GLY A C   1 
ATOM   447  O  O   . GLY A 1 60  ? 30.258 16.829 22.196  1.00 32.43 ? 60   GLY A O   1 
ATOM   448  N  N   . PHE A 1 61  ? 30.252 15.582 20.320  1.00 31.46 ? 61   PHE A N   1 
ATOM   449  C  CA  . PHE A 1 61  ? 28.965 16.096 19.851  1.00 31.42 ? 61   PHE A CA  1 
ATOM   450  C  C   . PHE A 1 61  ? 27.836 15.579 20.729  1.00 30.88 ? 61   PHE A C   1 
ATOM   451  O  O   . PHE A 1 61  ? 27.807 14.402 21.091  1.00 30.46 ? 61   PHE A O   1 
ATOM   452  C  CB  . PHE A 1 61  ? 28.701 15.704 18.386  1.00 31.94 ? 61   PHE A CB  1 
ATOM   453  C  CG  . PHE A 1 61  ? 29.020 16.794 17.387  1.00 33.63 ? 61   PHE A CG  1 
ATOM   454  C  CD1 . PHE A 1 61  ? 30.185 17.550 17.496  1.00 33.31 ? 61   PHE A CD1 1 
ATOM   455  C  CD2 . PHE A 1 61  ? 28.159 17.048 16.324  1.00 34.83 ? 61   PHE A CD2 1 
ATOM   456  C  CE1 . PHE A 1 61  ? 30.479 18.549 16.575  1.00 33.70 ? 61   PHE A CE1 1 
ATOM   457  C  CE2 . PHE A 1 61  ? 28.446 18.045 15.396  1.00 36.23 ? 61   PHE A CE2 1 
ATOM   458  C  CZ  . PHE A 1 61  ? 29.608 18.796 15.522  1.00 35.56 ? 61   PHE A CZ  1 
ATOM   459  N  N   . TRP A 1 62  ? 26.912 16.472 21.071  1.00 30.85 ? 62   TRP A N   1 
ATOM   460  C  CA  . TRP A 1 62  ? 25.730 16.102 21.834  1.00 30.15 ? 62   TRP A CA  1 
ATOM   461  C  C   . TRP A 1 62  ? 24.928 15.088 21.031  1.00 29.76 ? 62   TRP A C   1 
ATOM   462  O  O   . TRP A 1 62  ? 24.750 15.253 19.826  1.00 30.50 ? 62   TRP A O   1 
ATOM   463  C  CB  . TRP A 1 62  ? 24.882 17.341 22.130  1.00 30.54 ? 62   TRP A CB  1 
ATOM   464  C  CG  . TRP A 1 62  ? 23.647 17.064 22.930  1.00 30.89 ? 62   TRP A CG  1 
ATOM   465  C  CD1 . TRP A 1 62  ? 23.584 16.485 24.162  1.00 32.02 ? 62   TRP A CD1 1 
ATOM   466  C  CD2 . TRP A 1 62  ? 22.296 17.372 22.562  1.00 31.38 ? 62   TRP A CD2 1 
ATOM   467  N  NE1 . TRP A 1 62  ? 22.278 16.403 24.581  1.00 32.01 ? 62   TRP A NE1 1 
ATOM   468  C  CE2 . TRP A 1 62  ? 21.468 16.942 23.618  1.00 30.90 ? 62   TRP A CE2 1 
ATOM   469  C  CE3 . TRP A 1 62  ? 21.706 17.968 21.440  1.00 32.39 ? 62   TRP A CE3 1 
ATOM   470  C  CZ2 . TRP A 1 62  ? 20.082 17.087 23.587  1.00 31.10 ? 62   TRP A CZ2 1 
ATOM   471  C  CZ3 . TRP A 1 62  ? 20.325 18.111 21.412  1.00 31.43 ? 62   TRP A CZ3 1 
ATOM   472  C  CH2 . TRP A 1 62  ? 19.531 17.671 22.480  1.00 30.44 ? 62   TRP A CH2 1 
ATOM   473  N  N   . MET A 1 63  ? 24.471 14.032 21.696  1.00 29.09 ? 63   MET A N   1 
ATOM   474  C  CA  . MET A 1 63  ? 23.650 13.013 21.060  1.00 28.93 ? 63   MET A CA  1 
ATOM   475  C  C   . MET A 1 63  ? 22.185 13.460 21.091  1.00 29.01 ? 63   MET A C   1 
ATOM   476  O  O   . MET A 1 63  ? 21.565 13.456 22.156  1.00 28.77 ? 63   MET A O   1 
ATOM   477  C  CB  . MET A 1 63  ? 23.814 11.684 21.793  1.00 28.96 ? 63   MET A CB  1 
ATOM   478  C  CG  . MET A 1 63  ? 25.248 11.159 21.815  1.00 30.72 ? 63   MET A CG  1 
ATOM   479  S  SD  . MET A 1 63  ? 25.886 10.658 20.202  1.00 31.48 ? 63   MET A SD  1 
ATOM   480  C  CE  . MET A 1 63  ? 24.620 9.506  19.660  1.00 28.58 ? 63   MET A CE  1 
ATOM   481  N  N   . PRO A 1 64  ? 21.623 13.854 19.928  1.00 29.01 ? 64   PRO A N   1 
ATOM   482  C  CA  . PRO A 1 64  ? 20.287 14.434 19.929  1.00 29.59 ? 64   PRO A CA  1 
ATOM   483  C  C   . PRO A 1 64  ? 19.174 13.426 19.610  1.00 29.71 ? 64   PRO A C   1 
ATOM   484  O  O   . PRO A 1 64  ? 19.452 12.288 19.227  1.00 29.21 ? 64   PRO A O   1 
ATOM   485  C  CB  . PRO A 1 64  ? 20.390 15.481 18.820  1.00 30.34 ? 64   PRO A CB  1 
ATOM   486  C  CG  . PRO A 1 64  ? 21.361 14.866 17.823  1.00 29.42 ? 64   PRO A CG  1 
ATOM   487  C  CD  . PRO A 1 64  ? 22.163 13.807 18.556  1.00 28.64 ? 64   PRO A CD  1 
ATOM   488  N  N   . TYR A 1 65  ? 17.927 13.866 19.787  1.00 30.11 ? 65   TYR A N   1 
ATOM   489  C  CA  . TYR A 1 65  ? 16.716 13.078 19.484  1.00 30.57 ? 65   TYR A CA  1 
ATOM   490  C  C   . TYR A 1 65  ? 16.551 11.776 20.293  1.00 30.27 ? 65   TYR A C   1 
ATOM   491  O  O   . TYR A 1 65  ? 15.720 10.937 19.947  1.00 30.62 ? 65   TYR A O   1 
ATOM   492  C  CB  . TYR A 1 65  ? 16.609 12.785 17.976  1.00 31.13 ? 65   TYR A CB  1 
ATOM   493  C  CG  . TYR A 1 65  ? 16.547 14.020 17.098  1.00 30.07 ? 65   TYR A CG  1 
ATOM   494  C  CD1 . TYR A 1 65  ? 15.328 14.588 16.735  1.00 30.35 ? 65   TYR A CD1 1 
ATOM   495  C  CD2 . TYR A 1 65  ? 17.708 14.610 16.623  1.00 29.65 ? 65   TYR A CD2 1 
ATOM   496  C  CE1 . TYR A 1 65  ? 15.275 15.719 15.923  1.00 31.01 ? 65   TYR A CE1 1 
ATOM   497  C  CE2 . TYR A 1 65  ? 17.667 15.737 15.816  1.00 30.74 ? 65   TYR A CE2 1 
ATOM   498  C  CZ  . TYR A 1 65  ? 16.453 16.289 15.467  1.00 30.72 ? 65   TYR A CZ  1 
ATOM   499  O  OH  . TYR A 1 65  ? 16.431 17.410 14.666  1.00 29.43 ? 65   TYR A OH  1 
ATOM   500  N  N   . LEU A 1 66  ? 17.310 11.620 21.377  1.00 29.87 ? 66   LEU A N   1 
ATOM   501  C  CA  . LEU A 1 66  ? 17.157 10.464 22.258  1.00 30.11 ? 66   LEU A CA  1 
ATOM   502  C  C   . LEU A 1 66  ? 15.912 10.628 23.123  1.00 30.98 ? 66   LEU A C   1 
ATOM   503  O  O   . LEU A 1 66  ? 15.575 11.741 23.530  1.00 30.97 ? 66   LEU A O   1 
ATOM   504  C  CB  . LEU A 1 66  ? 18.378 10.304 23.165  1.00 29.40 ? 66   LEU A CB  1 
ATOM   505  C  CG  . LEU A 1 66  ? 19.728 10.060 22.493  1.00 29.43 ? 66   LEU A CG  1 
ATOM   506  C  CD1 . LEU A 1 66  ? 20.811 9.925  23.552  1.00 28.70 ? 66   LEU A CD1 1 
ATOM   507  C  CD2 . LEU A 1 66  ? 19.693 8.826  21.598  1.00 28.23 ? 66   LEU A CD2 1 
ATOM   508  N  N   . THR A 1 67  ? 15.232 9.516  23.398  1.00 32.01 ? 67   THR A N   1 
ATOM   509  C  CA  . THR A 1 67  ? 14.072 9.513  24.286  1.00 32.97 ? 67   THR A CA  1 
ATOM   510  C  C   . THR A 1 67  ? 14.505 8.984  25.647  1.00 33.40 ? 67   THR A C   1 
ATOM   511  O  O   . THR A 1 67  ? 14.831 7.804  25.773  1.00 33.84 ? 67   THR A O   1 
ATOM   512  C  CB  . THR A 1 67  ? 12.933 8.636  23.728  1.00 33.71 ? 67   THR A CB  1 
ATOM   513  O  OG1 . THR A 1 67  ? 12.563 9.100  22.423  1.00 33.15 ? 67   THR A OG1 1 
ATOM   514  C  CG2 . THR A 1 67  ? 11.714 8.688  24.645  1.00 34.65 ? 67   THR A CG2 1 
ATOM   515  N  N   . ILE A 1 68  ? 14.511 9.860  26.655  1.00 33.84 ? 68   ILE A N   1 
ATOM   516  C  CA  . ILE A 1 68  ? 15.013 9.519  27.988  1.00 34.08 ? 68   ILE A CA  1 
ATOM   517  C  C   . ILE A 1 68  ? 13.916 9.582  29.051  1.00 34.78 ? 68   ILE A C   1 
ATOM   518  O  O   . ILE A 1 68  ? 13.310 10.631 29.267  1.00 34.93 ? 68   ILE A O   1 
ATOM   519  C  CB  . ILE A 1 68  ? 16.153 10.465 28.421  1.00 33.77 ? 68   ILE A CB  1 
ATOM   520  C  CG1 . ILE A 1 68  ? 17.273 10.478 27.383  1.00 34.29 ? 68   ILE A CG1 1 
ATOM   521  C  CG2 . ILE A 1 68  ? 16.721 10.039 29.770  1.00 34.11 ? 68   ILE A CG2 1 
ATOM   522  C  CD1 . ILE A 1 68  ? 18.414 11.393 27.753  1.00 35.53 ? 68   ILE A CD1 1 
ATOM   523  N  N   . ALA A 1 69  ? 13.666 8.446  29.700  1.00 35.78 ? 69   ALA A N   1 
ATOM   524  C  CA  . ALA A 1 69  ? 12.824 8.378  30.895  1.00 36.55 ? 69   ALA A CA  1 
ATOM   525  C  C   . ALA A 1 69  ? 13.720 8.055  32.085  1.00 36.67 ? 69   ALA A C   1 
ATOM   526  O  O   . ALA A 1 69  ? 14.738 7.382  31.926  1.00 36.57 ? 69   ALA A O   1 
ATOM   527  C  CB  . ALA A 1 69  ? 11.750 7.311  30.734  1.00 36.80 ? 69   ALA A CB  1 
ATOM   528  N  N   . TYR A 1 70  ? 13.355 8.536  33.272  1.00 37.10 ? 70   TYR A N   1 
ATOM   529  C  CA  . TYR A 1 70  ? 14.149 8.269  34.473  1.00 37.29 ? 70   TYR A CA  1 
ATOM   530  C  C   . TYR A 1 70  ? 13.330 7.609  35.583  1.00 38.50 ? 70   TYR A C   1 
ATOM   531  O  O   . TYR A 1 70  ? 12.093 7.618  35.558  1.00 39.26 ? 70   TYR A O   1 
ATOM   532  C  CB  . TYR A 1 70  ? 14.822 9.551  34.988  1.00 36.32 ? 70   TYR A CB  1 
ATOM   533  C  CG  . TYR A 1 70  ? 13.881 10.560 35.605  1.00 35.88 ? 70   TYR A CG  1 
ATOM   534  C  CD1 . TYR A 1 70  ? 13.467 10.437 36.928  1.00 35.35 ? 70   TYR A CD1 1 
ATOM   535  C  CD2 . TYR A 1 70  ? 13.418 11.648 34.872  1.00 35.71 ? 70   TYR A CD2 1 
ATOM   536  C  CE1 . TYR A 1 70  ? 12.606 11.360 37.499  1.00 36.03 ? 70   TYR A CE1 1 
ATOM   537  C  CE2 . TYR A 1 70  ? 12.556 12.578 35.437  1.00 35.64 ? 70   TYR A CE2 1 
ATOM   538  C  CZ  . TYR A 1 70  ? 12.156 12.428 36.750  1.00 35.82 ? 70   TYR A CZ  1 
ATOM   539  O  OH  . TYR A 1 70  ? 11.304 13.344 37.321  1.00 39.83 ? 70   TYR A OH  1 
ATOM   540  N  N   . GLU A 1 71  ? 14.046 7.030  36.546  1.00 38.80 ? 71   GLU A N   1 
ATOM   541  C  CA  . GLU A 1 71  ? 13.445 6.446  37.742  1.00 39.46 ? 71   GLU A CA  1 
ATOM   542  C  C   . GLU A 1 71  ? 14.347 6.767  38.932  1.00 38.94 ? 71   GLU A C   1 
ATOM   543  O  O   . GLU A 1 71  ? 15.494 6.329  38.977  1.00 38.96 ? 71   GLU A O   1 
ATOM   544  C  CB  . GLU A 1 71  ? 13.279 4.932  37.579  1.00 40.42 ? 71   GLU A CB  1 
ATOM   545  C  CG  . GLU A 1 71  ? 12.367 4.280  38.611  1.00 42.19 ? 71   GLU A CG  1 
ATOM   546  C  CD  . GLU A 1 71  ? 12.312 2.768  38.471  1.00 44.55 ? 71   GLU A CD  1 
ATOM   547  O  OE1 . GLU A 1 71  ? 13.362 2.115  38.652  1.00 47.01 ? 71   GLU A OE1 1 
ATOM   548  O  OE2 . GLU A 1 71  ? 11.219 2.231  38.190  1.00 44.60 ? 71   GLU A OE2 1 
ATOM   549  N  N   . LEU A 1 72  ? 13.827 7.544  39.879  1.00 38.73 ? 72   LEU A N   1 
ATOM   550  C  CA  . LEU A 1 72  ? 14.592 7.991  41.042  1.00 38.43 ? 72   LEU A CA  1 
ATOM   551  C  C   . LEU A 1 72  ? 14.104 7.262  42.292  1.00 39.19 ? 72   LEU A C   1 
ATOM   552  O  O   . LEU A 1 72  ? 12.989 7.494  42.760  1.00 38.81 ? 72   LEU A O   1 
ATOM   553  C  CB  . LEU A 1 72  ? 14.443 9.507  41.213  1.00 37.91 ? 72   LEU A CB  1 
ATOM   554  C  CG  . LEU A 1 72  ? 15.348 10.201 42.231  1.00 36.83 ? 72   LEU A CG  1 
ATOM   555  C  CD1 . LEU A 1 72  ? 16.804 10.105 41.814  1.00 37.44 ? 72   LEU A CD1 1 
ATOM   556  C  CD2 . LEU A 1 72  ? 14.937 11.653 42.389  1.00 36.46 ? 72   LEU A CD2 1 
ATOM   557  N  N   . LYS A 1 73  ? 14.946 6.381  42.824  1.00 40.00 ? 73   LYS A N   1 
ATOM   558  C  CA  . LYS A 1 73  ? 14.597 5.579  43.989  1.00 41.26 ? 73   LYS A CA  1 
ATOM   559  C  C   . LYS A 1 73  ? 15.418 6.002  45.203  1.00 41.41 ? 73   LYS A C   1 
ATOM   560  O  O   . LYS A 1 73  ? 16.646 6.024  45.144  1.00 40.74 ? 73   LYS A O   1 
ATOM   561  C  CB  . LYS A 1 73  ? 14.836 4.098  43.689  1.00 42.33 ? 73   LYS A CB  1 
ATOM   562  C  CG  . LYS A 1 73  ? 14.456 3.157  44.823  1.00 45.49 ? 73   LYS A CG  1 
ATOM   563  C  CD  . LYS A 1 73  ? 14.378 1.711  44.347  1.00 49.59 ? 73   LYS A CD  1 
ATOM   564  C  CE  . LYS A 1 73  ? 13.975 0.771  45.479  1.00 51.60 ? 73   LYS A CE  1 
ATOM   565  N  NZ  . LYS A 1 73  ? 13.790 -0.635 45.010  1.00 53.82 ? 73   LYS A NZ  1 
ATOM   566  N  N   . ASN A 1 74  ? 14.731 6.347  46.292  1.00 41.93 ? 74   ASN A N   1 
ATOM   567  C  CA  . ASN A 1 74  ? 15.367 6.532  47.596  1.00 42.27 ? 74   ASN A CA  1 
ATOM   568  C  C   . ASN A 1 74  ? 15.498 5.162  48.264  1.00 43.35 ? 74   ASN A C   1 
ATOM   569  O  O   . ASN A 1 74  ? 14.491 4.536  48.591  1.00 44.06 ? 74   ASN A O   1 
ATOM   570  C  CB  . ASN A 1 74  ? 14.536 7.479  48.471  1.00 42.26 ? 74   ASN A CB  1 
ATOM   571  C  CG  . ASN A 1 74  ? 15.189 7.769  49.815  1.00 42.35 ? 74   ASN A CG  1 
ATOM   572  O  OD1 . ASN A 1 74  ? 15.629 6.859  50.513  1.00 43.37 ? 74   ASN A OD1 1 
ATOM   573  N  ND2 . ASN A 1 74  ? 15.232 9.042  50.191  1.00 41.98 ? 74   ASN A ND2 1 
ATOM   574  N  N   . THR A 1 75  ? 16.732 4.702  48.463  1.00 43.92 ? 75   THR A N   1 
ATOM   575  C  CA  . THR A 1 75  ? 16.976 3.359  49.005  1.00 45.02 ? 75   THR A CA  1 
ATOM   576  C  C   . THR A 1 75  ? 16.525 3.221  50.465  1.00 45.87 ? 75   THR A C   1 
ATOM   577  O  O   . THR A 1 75  ? 16.154 2.130  50.896  1.00 46.77 ? 75   THR A O   1 
ATOM   578  C  CB  . THR A 1 75  ? 18.471 2.937  48.884  1.00 45.30 ? 75   THR A CB  1 
ATOM   579  O  OG1 . THR A 1 75  ? 19.296 3.805  49.670  1.00 44.62 ? 75   THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 75  ? 18.933 2.979  47.435  1.00 44.17 ? 75   THR A CG2 1 
ATOM   581  N  N   . ASP A 1 76  ? 16.547 4.324  51.211  1.00 45.84 ? 76   ASP A N   1 
ATOM   582  C  CA  . ASP A 1 76  ? 16.161 4.313  52.623  1.00 47.13 ? 76   ASP A CA  1 
ATOM   583  C  C   . ASP A 1 76  ? 14.642 4.268  52.786  1.00 47.25 ? 76   ASP A C   1 
ATOM   584  O  O   . ASP A 1 76  ? 14.099 3.295  53.315  1.00 48.46 ? 76   ASP A O   1 
ATOM   585  C  CB  . ASP A 1 76  ? 16.725 5.541  53.354  1.00 47.15 ? 76   ASP A CB  1 
ATOM   586  C  CG  . ASP A 1 76  ? 18.246 5.609  53.312  1.00 49.13 ? 76   ASP A CG  1 
ATOM   587  O  OD1 . ASP A 1 76  ? 18.897 4.541  53.340  1.00 50.41 ? 76   ASP A OD1 1 
ATOM   588  O  OD2 . ASP A 1 76  ? 18.790 6.735  53.258  1.00 49.49 ? 76   ASP A OD2 1 
ATOM   589  N  N   . THR A 1 77  ? 13.962 5.318  52.323  1.00 45.96 ? 77   THR A N   1 
ATOM   590  C  CA  . THR A 1 77  ? 12.514 5.454  52.516  1.00 45.50 ? 77   THR A CA  1 
ATOM   591  C  C   . THR A 1 77  ? 11.704 4.552  51.582  1.00 45.30 ? 77   THR A C   1 
ATOM   592  O  O   . THR A 1 77  ? 10.533 4.278  51.849  1.00 46.00 ? 77   THR A O   1 
ATOM   593  C  CB  . THR A 1 77  ? 12.041 6.922  52.335  1.00 44.77 ? 77   THR A CB  1 
ATOM   594  O  OG1 . THR A 1 77  ? 12.298 7.360  50.994  1.00 44.59 ? 77   THR A OG1 1 
ATOM   595  C  CG2 . THR A 1 77  ? 12.751 7.848  53.318  1.00 44.13 ? 77   THR A CG2 1 
ATOM   596  N  N   . GLY A 1 78  ? 12.323 4.108  50.488  1.00 44.49 ? 78   GLY A N   1 
ATOM   597  C  CA  . GLY A 1 78  ? 11.671 3.216  49.523  1.00 44.10 ? 78   GLY A CA  1 
ATOM   598  C  C   . GLY A 1 78  ? 10.860 3.917  48.442  1.00 42.74 ? 78   GLY A C   1 
ATOM   599  O  O   . GLY A 1 78  ? 10.353 3.265  47.529  1.00 42.51 ? 78   GLY A O   1 
ATOM   600  N  N   . ALA A 1 79  ? 10.747 5.241  48.534  1.00 41.62 ? 79   ALA A N   1 
ATOM   601  C  CA  . ALA A 1 79  ? 9.937  6.020  47.601  1.00 40.99 ? 79   ALA A CA  1 
ATOM   602  C  C   . ALA A 1 79  ? 10.532 6.007  46.192  1.00 40.74 ? 79   ALA A C   1 
ATOM   603  O  O   . ALA A 1 79  ? 11.750 6.087  46.026  1.00 40.56 ? 79   ALA A O   1 
ATOM   604  C  CB  . ALA A 1 79  ? 9.792  7.451  48.100  1.00 40.19 ? 79   ALA A CB  1 
ATOM   605  N  N   . ILE A 1 80  ? 9.659  5.900  45.190  1.00 40.93 ? 80   ILE A N   1 
ATOM   606  C  CA  . ILE A 1 80  ? 10.056 5.863  43.783  1.00 40.75 ? 80   ILE A CA  1 
ATOM   607  C  C   . ILE A 1 80  ? 9.183  6.813  42.966  1.00 40.81 ? 80   ILE A C   1 
ATOM   608  O  O   . ILE A 1 80  ? 7.961  6.839  43.138  1.00 41.62 ? 80   ILE A O   1 
ATOM   609  C  CB  . ILE A 1 80  ? 9.906  4.440  43.188  1.00 41.35 ? 80   ILE A CB  1 
ATOM   610  C  CG1 . ILE A 1 80  ? 10.818 3.446  43.911  1.00 42.28 ? 80   ILE A CG1 1 
ATOM   611  C  CG2 . ILE A 1 80  ? 10.228 4.442  41.698  1.00 41.04 ? 80   ILE A CG2 1 
ATOM   612  C  CD1 . ILE A 1 80  ? 10.657 2.012  43.439  1.00 43.75 ? 80   ILE A CD1 1 
ATOM   613  N  N   . LYS A 1 81  ? 9.811  7.597  42.090  1.00 40.22 ? 81   LYS A N   1 
ATOM   614  C  CA  . LYS A 1 81  ? 9.081  8.441  41.140  1.00 40.29 ? 81   LYS A CA  1 
ATOM   615  C  C   . LYS A 1 81  ? 9.638  8.294  39.726  1.00 40.28 ? 81   LYS A C   1 
ATOM   616  O  O   . LYS A 1 81  ? 10.797 7.918  39.541  1.00 40.02 ? 81   LYS A O   1 
ATOM   617  C  CB  . LYS A 1 81  ? 9.100  9.912  41.571  1.00 39.73 ? 81   LYS A CB  1 
ATOM   618  C  CG  . LYS A 1 81  ? 10.484 10.547 41.670  1.00 39.19 ? 81   LYS A CG  1 
ATOM   619  C  CD  . LYS A 1 81  ? 10.422 12.069 41.528  1.00 38.56 ? 81   LYS A CD  1 
ATOM   620  C  CE  . LYS A 1 81  ? 9.703  12.730 42.694  1.00 37.58 ? 81   LYS A CE  1 
ATOM   621  N  NZ  . LYS A 1 81  ? 9.478  14.188 42.464  1.00 34.62 ? 81   LYS A NZ  1 
ATOM   622  N  N   . ARG A 1 82  ? 8.799  8.594  38.736  1.00 40.70 ? 82   ARG A N   1 
ATOM   623  C  CA  . ARG A 1 82  ? 9.177  8.499  37.330  1.00 40.79 ? 82   ARG A CA  1 
ATOM   624  C  C   . ARG A 1 82  ? 8.815  9.761  36.566  1.00 40.10 ? 82   ARG A C   1 
ATOM   625  O  O   . ARG A 1 82  ? 7.902  10.497 36.942  1.00 40.52 ? 82   ARG A O   1 
ATOM   626  C  CB  . ARG A 1 82  ? 8.495  7.299  36.675  1.00 42.21 ? 82   ARG A CB  1 
ATOM   627  C  CG  . ARG A 1 82  ? 8.985  5.969  37.202  1.00 45.38 ? 82   ARG A CG  1 
ATOM   628  C  CD  . ARG A 1 82  ? 8.218  4.796  36.617  1.00 49.38 ? 82   ARG A CD  1 
ATOM   629  N  NE  . ARG A 1 82  ? 8.548  3.565  37.331  1.00 52.82 ? 82   ARG A NE  1 
ATOM   630  C  CZ  . ARG A 1 82  ? 8.067  3.226  38.528  1.00 55.89 ? 82   ARG A CZ  1 
ATOM   631  N  NH1 . ARG A 1 82  ? 7.207  4.013  39.173  1.00 55.50 ? 82   ARG A NH1 1 
ATOM   632  N  NH2 . ARG A 1 82  ? 8.449  2.082  39.088  1.00 58.68 ? 82   ARG A NH2 1 
ATOM   633  N  N   . GLY A 1 83  ? 9.544  9.998  35.484  1.00 39.32 ? 83   GLY A N   1 
ATOM   634  C  CA  . GLY A 1 83  ? 9.295  11.137 34.614  1.00 38.76 ? 83   GLY A CA  1 
ATOM   635  C  C   . GLY A 1 83  ? 10.094 10.991 33.340  1.00 38.18 ? 83   GLY A C   1 
ATOM   636  O  O   . GLY A 1 83  ? 10.553 9.896  33.010  1.00 38.00 ? 83   GLY A O   1 
ATOM   637  N  N   . THR A 1 84  ? 10.258 12.098 32.623  1.00 37.91 ? 84   THR A N   1 
ATOM   638  C  CA  . THR A 1 84  ? 11.061 12.121 31.406  1.00 37.18 ? 84   THR A CA  1 
ATOM   639  C  C   . THR A 1 84  ? 11.988 13.331 31.405  1.00 36.82 ? 84   THR A C   1 
ATOM   640  O  O   . THR A 1 84  ? 11.670 14.371 31.983  1.00 37.09 ? 84   THR A O   1 
ATOM   641  C  CB  . THR A 1 84  ? 10.174 12.152 30.143  1.00 37.78 ? 84   THR A CB  1 
ATOM   642  O  OG1 . THR A 1 84  ? 9.285  13.272 30.204  1.00 37.38 ? 84   THR A OG1 1 
ATOM   643  C  CG2 . THR A 1 84  ? 9.359  10.867 30.020  1.00 37.52 ? 84   THR A CG2 1 
ATOM   644  N  N   . LEU A 1 85  ? 13.145 13.172 30.766  1.00 36.71 ? 85   LEU A N   1 
ATOM   645  C  CA  . LEU A 1 85  ? 14.092 14.262 30.574  1.00 36.06 ? 85   LEU A CA  1 
ATOM   646  C  C   . LEU A 1 85  ? 13.897 14.805 29.166  1.00 36.60 ? 85   LEU A C   1 
ATOM   647  O  O   . LEU A 1 85  ? 14.044 14.070 28.190  1.00 37.02 ? 85   LEU A O   1 
ATOM   648  C  CB  . LEU A 1 85  ? 15.531 13.770 30.762  1.00 35.15 ? 85   LEU A CB  1 
ATOM   649  C  CG  . LEU A 1 85  ? 15.851 13.105 32.103  1.00 33.61 ? 85   LEU A CG  1 
ATOM   650  C  CD1 . LEU A 1 85  ? 17.291 12.625 32.131  1.00 31.95 ? 85   LEU A CD1 1 
ATOM   651  C  CD2 . LEU A 1 85  ? 15.581 14.050 33.265  1.00 33.25 ? 85   LEU A CD2 1 
ATOM   652  N  N   . MET A 1 86  ? 13.550 16.086 29.069  1.00 37.26 ? 86   MET A N   1 
ATOM   653  C  CA  . MET A 1 86  ? 13.293 16.729 27.783  1.00 37.94 ? 86   MET A CA  1 
ATOM   654  C  C   . MET A 1 86  ? 14.534 17.479 27.296  1.00 36.63 ? 86   MET A C   1 
ATOM   655  O  O   . MET A 1 86  ? 15.278 18.039 28.101  1.00 36.28 ? 86   MET A O   1 
ATOM   656  C  CB  . MET A 1 86  ? 12.111 17.699 27.904  1.00 39.70 ? 86   MET A CB  1 
ATOM   657  C  CG  . MET A 1 86  ? 10.760 17.020 28.155  1.00 44.44 ? 86   MET A CG  1 
ATOM   658  S  SD  . MET A 1 86  ? 10.093 16.123 26.720  1.00 53.08 ? 86   MET A SD  1 
ATOM   659  C  CE  . MET A 1 86  ? 9.641  17.482 25.634  1.00 53.02 ? 86   MET A CE  1 
ATOM   660  N  N   . PRO A 1 87  ? 14.762 17.497 25.970  1.00 35.82 ? 87   PRO A N   1 
ATOM   661  C  CA  . PRO A 1 87  ? 15.910 18.215 25.422  1.00 34.51 ? 87   PRO A CA  1 
ATOM   662  C  C   . PRO A 1 87  ? 15.784 19.733 25.565  1.00 34.21 ? 87   PRO A C   1 
ATOM   663  O  O   . PRO A 1 87  ? 14.711 20.290 25.337  1.00 34.53 ? 87   PRO A O   1 
ATOM   664  C  CB  . PRO A 1 87  ? 15.900 17.810 23.945  1.00 34.76 ? 87   PRO A CB  1 
ATOM   665  C  CG  . PRO A 1 87  ? 14.500 17.452 23.655  1.00 34.96 ? 87   PRO A CG  1 
ATOM   666  C  CD  . PRO A 1 87  ? 13.968 16.846 24.911  1.00 36.27 ? 87   PRO A CD  1 
ATOM   667  N  N   . MET A 1 88  ? 16.880 20.385 25.945  1.00 33.30 ? 88   MET A N   1 
ATOM   668  C  CA  . MET A 1 88  ? 16.913 21.838 26.095  1.00 33.59 ? 88   MET A CA  1 
ATOM   669  C  C   . MET A 1 88  ? 18.352 22.343 26.053  1.00 33.26 ? 88   MET A C   1 
ATOM   670  O  O   . MET A 1 88  ? 19.290 21.553 26.119  1.00 32.55 ? 88   MET A O   1 
ATOM   671  C  CB  . MET A 1 88  ? 16.261 22.251 27.416  1.00 33.60 ? 88   MET A CB  1 
ATOM   672  C  CG  . MET A 1 88  ? 17.021 21.783 28.651  1.00 33.06 ? 88   MET A CG  1 
ATOM   673  S  SD  . MET A 1 88  ? 16.074 21.928 30.169  1.00 31.84 ? 88   MET A SD  1 
ATOM   674  C  CE  . MET A 1 88  ? 14.905 20.587 29.972  1.00 30.77 ? 88   MET A CE  1 
ATOM   675  N  N   . VAL A 1 89  ? 18.517 23.660 25.962  1.00 33.96 ? 89   VAL A N   1 
ATOM   676  C  CA  . VAL A 1 89  ? 19.842 24.272 25.921  1.00 34.05 ? 89   VAL A CA  1 
ATOM   677  C  C   . VAL A 1 89  ? 20.030 25.260 27.074  1.00 35.18 ? 89   VAL A C   1 
ATOM   678  O  O   . VAL A 1 89  ? 19.091 25.942 27.485  1.00 35.45 ? 89   VAL A O   1 
ATOM   679  C  CB  . VAL A 1 89  ? 20.103 24.969 24.561  1.00 34.60 ? 89   VAL A CB  1 
ATOM   680  C  CG1 . VAL A 1 89  ? 19.165 26.154 24.363  1.00 35.65 ? 89   VAL A CG1 1 
ATOM   681  C  CG2 . VAL A 1 89  ? 21.555 25.401 24.450  1.00 33.48 ? 89   VAL A CG2 1 
ATOM   682  N  N   . ALA A 1 90  ? 21.251 25.305 27.603  1.00 35.73 ? 90   ALA A N   1 
ATOM   683  C  CA  . ALA A 1 90  ? 21.634 26.247 28.654  1.00 36.60 ? 90   ALA A CA  1 
ATOM   684  C  C   . ALA A 1 90  ? 22.928 26.950 28.239  1.00 37.79 ? 90   ALA A C   1 
ATOM   685  O  O   . ALA A 1 90  ? 23.384 26.783 27.106  1.00 37.53 ? 90   ALA A O   1 
ATOM   686  C  CB  . ALA A 1 90  ? 21.813 25.516 29.975  1.00 35.90 ? 90   ALA A CB  1 
ATOM   687  N  N   . ASP A 1 91  ? 23.515 27.734 29.143  1.00 39.15 ? 91   ASP A N   1 
ATOM   688  C  CA  . ASP A 1 91  ? 24.762 28.453 28.840  1.00 40.90 ? 91   ASP A CA  1 
ATOM   689  C  C   . ASP A 1 91  ? 25.955 27.507 28.654  1.00 40.26 ? 91   ASP A C   1 
ATOM   690  O  O   . ASP A 1 91  ? 26.940 27.868 28.009  1.00 40.76 ? 91   ASP A O   1 
ATOM   691  C  CB  . ASP A 1 91  ? 25.070 29.526 29.901  1.00 42.41 ? 91   ASP A CB  1 
ATOM   692  C  CG  . ASP A 1 91  ? 25.411 28.942 31.267  1.00 43.94 ? 91   ASP A CG  1 
ATOM   693  O  OD1 . ASP A 1 91  ? 24.973 27.814 31.580  1.00 46.01 ? 91   ASP A OD1 1 
ATOM   694  O  OD2 . ASP A 1 91  ? 26.114 29.632 32.036  1.00 48.16 ? 91   ASP A OD2 1 
ATOM   695  N  N   . ASP A 1 92  ? 25.857 26.301 29.213  1.00 39.37 ? 92   ASP A N   1 
ATOM   696  C  CA  . ASP A 1 92  ? 26.844 25.247 28.964  1.00 38.91 ? 92   ASP A CA  1 
ATOM   697  C  C   . ASP A 1 92  ? 26.363 24.252 27.892  1.00 37.99 ? 92   ASP A C   1 
ATOM   698  O  O   . ASP A 1 92  ? 26.745 23.079 27.900  1.00 37.48 ? 92   ASP A O   1 
ATOM   699  C  CB  . ASP A 1 92  ? 27.233 24.534 30.274  1.00 38.53 ? 92   ASP A CB  1 
ATOM   700  C  CG  . ASP A 1 92  ? 26.065 23.800 30.934  1.00 39.68 ? 92   ASP A CG  1 
ATOM   701  O  OD1 . ASP A 1 92  ? 24.912 23.919 30.461  1.00 42.05 ? 92   ASP A OD1 1 
ATOM   702  O  OD2 . ASP A 1 92  ? 26.311 23.097 31.940  1.00 40.25 ? 92   ASP A OD2 1 
ATOM   703  N  N   . GLY A 1 93  ? 25.529 24.734 26.971  1.00 37.74 ? 93   GLY A N   1 
ATOM   704  C  CA  . GLY A 1 93  ? 25.098 23.945 25.822  1.00 36.66 ? 93   GLY A CA  1 
ATOM   705  C  C   . GLY A 1 93  ? 23.910 23.037 26.076  1.00 35.36 ? 93   GLY A C   1 
ATOM   706  O  O   . GLY A 1 93  ? 23.329 23.046 27.167  1.00 35.07 ? 93   GLY A O   1 
ATOM   707  N  N   . PRO A 1 94  ? 23.547 22.233 25.062  1.00 34.19 ? 94   PRO A N   1 
ATOM   708  C  CA  . PRO A 1 94  ? 22.356 21.401 25.120  1.00 33.52 ? 94   PRO A CA  1 
ATOM   709  C  C   . PRO A 1 94  ? 22.493 20.211 26.061  1.00 32.57 ? 94   PRO A C   1 
ATOM   710  O  O   . PRO A 1 94  ? 23.598 19.711 26.280  1.00 32.33 ? 94   PRO A O   1 
ATOM   711  C  CB  . PRO A 1 94  ? 22.199 20.923 23.675  1.00 33.62 ? 94   PRO A CB  1 
ATOM   712  C  CG  . PRO A 1 94  ? 23.577 20.896 23.145  1.00 33.65 ? 94   PRO A CG  1 
ATOM   713  C  CD  . PRO A 1 94  ? 24.299 22.027 23.810  1.00 34.07 ? 94   PRO A CD  1 
ATOM   714  N  N   . HIS A 1 95  ? 21.363 19.772 26.607  1.00 32.05 ? 95   HIS A N   1 
ATOM   715  C  CA  . HIS A 1 95  ? 21.310 18.575 27.441  1.00 31.40 ? 95   HIS A CA  1 
ATOM   716  C  C   . HIS A 1 95  ? 19.875 18.056 27.519  1.00 30.88 ? 95   HIS A C   1 
ATOM   717  O  O   . HIS A 1 95  ? 18.971 18.640 26.930  1.00 31.07 ? 95   HIS A O   1 
ATOM   718  C  CB  . HIS A 1 95  ? 21.859 18.868 28.847  1.00 31.33 ? 95   HIS A CB  1 
ATOM   719  C  CG  . HIS A 1 95  ? 21.108 19.934 29.584  1.00 31.65 ? 95   HIS A CG  1 
ATOM   720  N  ND1 . HIS A 1 95  ? 21.413 21.273 29.468  1.00 33.07 ? 95   HIS A ND1 1 
ATOM   721  C  CD2 . HIS A 1 95  ? 20.070 19.858 30.448  1.00 30.86 ? 95   HIS A CD2 1 
ATOM   722  C  CE1 . HIS A 1 95  ? 20.593 21.976 30.228  1.00 31.41 ? 95   HIS A CE1 1 
ATOM   723  N  NE2 . HIS A 1 95  ? 19.769 21.141 30.835  1.00 30.72 ? 95   HIS A NE2 1 
ATOM   724  N  N   . TYR A 1 96  ? 19.688 16.941 28.219  1.00 30.76 ? 96   TYR A N   1 
ATOM   725  C  CA  . TYR A 1 96  ? 18.362 16.436 28.566  1.00 30.89 ? 96   TYR A CA  1 
ATOM   726  C  C   . TYR A 1 96  ? 18.172 16.668 30.053  1.00 31.13 ? 96   TYR A C   1 
ATOM   727  O  O   . TYR A 1 96  ? 19.011 16.258 30.850  1.00 31.22 ? 96   TYR A O   1 
ATOM   728  C  CB  . TYR A 1 96  ? 18.246 14.940 28.257  1.00 30.69 ? 96   TYR A CB  1 
ATOM   729  C  CG  . TYR A 1 96  ? 18.365 14.603 26.789  1.00 29.58 ? 96   TYR A CG  1 
ATOM   730  C  CD1 . TYR A 1 96  ? 17.255 14.660 25.948  1.00 29.59 ? 96   TYR A CD1 1 
ATOM   731  C  CD2 . TYR A 1 96  ? 19.587 14.228 26.240  1.00 28.81 ? 96   TYR A CD2 1 
ATOM   732  C  CE1 . TYR A 1 96  ? 17.362 14.354 24.596  1.00 30.05 ? 96   TYR A CE1 1 
ATOM   733  C  CE2 . TYR A 1 96  ? 19.707 13.922 24.893  1.00 28.83 ? 96   TYR A CE2 1 
ATOM   734  C  CZ  . TYR A 1 96  ? 18.593 13.985 24.075  1.00 30.57 ? 96   TYR A CZ  1 
ATOM   735  O  OH  . TYR A 1 96  ? 18.713 13.679 22.738  1.00 30.37 ? 96   TYR A OH  1 
ATOM   736  N  N   . GLY A 1 97  ? 17.084 17.329 30.434  1.00 31.86 ? 97   GLY A N   1 
ATOM   737  C  CA  . GLY A 1 97  ? 16.851 17.637 31.841  1.00 32.25 ? 97   GLY A CA  1 
ATOM   738  C  C   . GLY A 1 97  ? 15.400 17.793 32.249  1.00 32.98 ? 97   GLY A C   1 
ATOM   739  O  O   . GLY A 1 97  ? 14.490 17.762 31.415  1.00 33.37 ? 97   GLY A O   1 
ATOM   740  N  N   . ALA A 1 98  ? 15.196 17.955 33.553  1.00 33.33 ? 98   ALA A N   1 
ATOM   741  C  CA  . ALA A 1 98  ? 13.866 18.150 34.121  1.00 33.94 ? 98   ALA A CA  1 
ATOM   742  C  C   . ALA A 1 98  ? 13.970 18.638 35.562  1.00 34.03 ? 98   ALA A C   1 
ATOM   743  O  O   . ALA A 1 98  ? 14.784 18.126 36.334  1.00 33.59 ? 98   ALA A O   1 
ATOM   744  C  CB  . ALA A 1 98  ? 13.069 16.851 34.065  1.00 33.65 ? 98   ALA A CB  1 
ATOM   745  N  N   . ASN A 1 99  ? 13.158 19.635 35.912  1.00 34.62 ? 99   ASN A N   1 
ATOM   746  C  CA  . ASN A 1 99  ? 12.992 20.041 37.304  1.00 34.54 ? 99   ASN A CA  1 
ATOM   747  C  C   . ASN A 1 99  ? 12.279 18.922 38.051  1.00 34.39 ? 99   ASN A C   1 
ATOM   748  O  O   . ASN A 1 99  ? 11.352 18.306 37.519  1.00 34.34 ? 99   ASN A O   1 
ATOM   749  C  CB  . ASN A 1 99  ? 12.193 21.346 37.420  1.00 35.32 ? 99   ASN A CB  1 
ATOM   750  C  CG  . ASN A 1 99  ? 13.018 22.582 37.081  1.00 35.23 ? 99   ASN A CG  1 
ATOM   751  O  OD1 . ASN A 1 99  ? 14.237 22.515 36.926  1.00 34.05 ? 99   ASN A OD1 1 
ATOM   752  N  ND2 . ASN A 1 99  ? 12.348 23.722 36.970  1.00 33.87 ? 99   ASN A ND2 1 
ATOM   753  N  N   . ILE A 1 100 ? 12.730 18.659 39.274  1.00 34.40 ? 100  ILE A N   1 
ATOM   754  C  CA  . ILE A 1 100 ? 12.201 17.571 40.089  1.00 34.39 ? 100  ILE A CA  1 
ATOM   755  C  C   . ILE A 1 100 ? 11.972 18.057 41.516  1.00 34.91 ? 100  ILE A C   1 
ATOM   756  O  O   . ILE A 1 100 ? 12.843 18.697 42.106  1.00 35.18 ? 100  ILE A O   1 
ATOM   757  C  CB  . ILE A 1 100 ? 13.172 16.369 40.120  1.00 33.99 ? 100  ILE A CB  1 
ATOM   758  C  CG1 . ILE A 1 100 ? 13.347 15.783 38.715  1.00 33.20 ? 100  ILE A CG1 1 
ATOM   759  C  CG2 . ILE A 1 100 ? 12.669 15.297 41.081  1.00 33.63 ? 100  ILE A CG2 1 
ATOM   760  C  CD1 . ILE A 1 100 ? 14.254 14.574 38.665  1.00 32.65 ? 100  ILE A CD1 1 
ATOM   761  N  N   . ALA A 1 101 ? 10.795 17.753 42.058  1.00 35.41 ? 101  ALA A N   1 
ATOM   762  C  CA  . ALA A 1 101 ? 10.481 18.049 43.451  1.00 35.39 ? 101  ALA A CA  1 
ATOM   763  C  C   . ALA A 1 101 ? 11.071 16.954 44.330  1.00 35.23 ? 101  ALA A C   1 
ATOM   764  O  O   . ALA A 1 101 ? 10.793 15.773 44.119  1.00 35.52 ? 101  ALA A O   1 
ATOM   765  C  CB  . ALA A 1 101 ? 8.978  18.131 43.648  1.00 35.72 ? 101  ALA A CB  1 
ATOM   766  N  N   . MET A 1 102 ? 11.892 17.349 45.301  1.00 35.44 ? 102  MET A N   1 
ATOM   767  C  CA  . MET A 1 102 ? 12.504 16.411 46.242  1.00 35.46 ? 102  MET A CA  1 
ATOM   768  C  C   . MET A 1 102 ? 11.905 16.606 47.637  1.00 36.36 ? 102  MET A C   1 
ATOM   769  O  O   . MET A 1 102 ? 11.012 15.858 48.027  1.00 36.56 ? 102  MET A O   1 
ATOM   770  C  CB  . MET A 1 102 ? 14.025 16.580 46.246  1.00 34.93 ? 102  MET A CB  1 
ATOM   771  C  CG  . MET A 1 102 ? 14.682 16.190 44.935  1.00 34.35 ? 102  MET A CG  1 
ATOM   772  S  SD  . MET A 1 102 ? 14.663 14.415 44.625  1.00 33.93 ? 102  MET A SD  1 
ATOM   773  C  CE  . MET A 1 102 ? 16.060 13.881 45.607  1.00 33.12 ? 102  MET A CE  1 
ATOM   774  N  N   . GLU A 1 103 ? 12.370 17.607 48.382  1.00 37.73 ? 103  GLU A N   1 
ATOM   775  C  CA  . GLU A 1 103 ? 11.760 17.932 49.673  1.00 39.46 ? 103  GLU A CA  1 
ATOM   776  C  C   . GLU A 1 103 ? 10.324 18.430 49.475  1.00 40.79 ? 103  GLU A C   1 
ATOM   777  O  O   . GLU A 1 103 ? 9.443  18.126 50.282  1.00 41.33 ? 103  GLU A O   1 
ATOM   778  C  CB  . GLU A 1 103 ? 12.572 18.989 50.436  1.00 39.76 ? 103  GLU A CB  1 
ATOM   779  C  CG  . GLU A 1 103 ? 13.932 18.518 50.952  1.00 40.12 ? 103  GLU A CG  1 
ATOM   780  C  CD  . GLU A 1 103 ? 15.093 18.946 50.064  1.00 41.06 ? 103  GLU A CD  1 
ATOM   781  O  OE1 . GLU A 1 103 ? 14.974 18.844 48.824  1.00 40.04 ? 103  GLU A OE1 1 
ATOM   782  O  OE2 . GLU A 1 103 ? 16.128 19.386 50.611  1.00 42.23 ? 103  GLU A OE2 1 
ATOM   783  N  N   . LYS A 1 104 ? 10.098 19.180 48.393  1.00 41.98 ? 104  LYS A N   1 
ATOM   784  C  CA  . LYS A 1 104 ? 8.781  19.755 48.089  1.00 43.34 ? 104  LYS A CA  1 
ATOM   785  C  C   . LYS A 1 104 ? 7.798  18.755 47.469  1.00 43.70 ? 104  LYS A C   1 
ATOM   786  O  O   . LYS A 1 104 ? 6.657  19.118 47.168  1.00 44.20 ? 104  LYS A O   1 
ATOM   787  C  CB  . LYS A 1 104 ? 8.918  20.975 47.167  1.00 43.62 ? 104  LYS A CB  1 
ATOM   788  C  CG  . LYS A 1 104 ? 9.774  22.093 47.738  1.00 46.04 ? 104  LYS A CG  1 
ATOM   789  C  CD  . LYS A 1 104 ? 9.423  23.455 47.146  1.00 50.69 ? 104  LYS A CD  1 
ATOM   790  C  CE  . LYS A 1 104 ? 8.242  24.105 47.876  1.00 53.36 ? 104  LYS A CE  1 
ATOM   791  N  NZ  . LYS A 1 104 ? 7.987  25.510 47.431  1.00 53.96 ? 104  LYS A NZ  1 
ATOM   792  N  N   . ASP A 1 105 ? 8.227  17.509 47.271  1.00 43.68 ? 105  ASP A N   1 
ATOM   793  C  CA  . ASP A 1 105 ? 7.314  16.464 46.818  1.00 44.26 ? 105  ASP A CA  1 
ATOM   794  C  C   . ASP A 1 105 ? 6.303  16.171 47.924  1.00 45.02 ? 105  ASP A C   1 
ATOM   795  O  O   . ASP A 1 105 ? 6.665  15.715 49.010  1.00 45.11 ? 105  ASP A O   1 
ATOM   796  C  CB  . ASP A 1 105 ? 8.071  15.193 46.430  1.00 43.86 ? 105  ASP A CB  1 
ATOM   797  C  CG  . ASP A 1 105 ? 7.230  14.252 45.591  1.00 44.40 ? 105  ASP A CG  1 
ATOM   798  O  OD1 . ASP A 1 105 ? 6.162  13.812 46.060  1.00 46.10 ? 105  ASP A OD1 1 
ATOM   799  O  OD2 . ASP A 1 105 ? 7.635  13.953 44.453  1.00 47.16 ? 105  ASP A OD2 1 
ATOM   800  N  N   . LYS A 1 106 ? 5.035  16.442 47.637  1.00 45.95 ? 106  LYS A N   1 
ATOM   801  C  CA  . LYS A 1 106 ? 3.971  16.324 48.634  1.00 47.08 ? 106  LYS A CA  1 
ATOM   802  C  C   . LYS A 1 106 ? 3.676  14.884 49.071  1.00 47.04 ? 106  LYS A C   1 
ATOM   803  O  O   . LYS A 1 106 ? 3.069  14.676 50.119  1.00 47.12 ? 106  LYS A O   1 
ATOM   804  C  CB  . LYS A 1 106 ? 2.691  17.000 48.125  1.00 47.97 ? 106  LYS A CB  1 
ATOM   805  C  CG  . LYS A 1 106 ? 2.055  16.327 46.914  1.00 49.98 ? 106  LYS A CG  1 
ATOM   806  C  CD  . LYS A 1 106 ? 0.959  17.183 46.295  1.00 52.20 ? 106  LYS A CD  1 
ATOM   807  C  CE  . LYS A 1 106 ? 0.524  16.618 44.949  1.00 53.23 ? 106  LYS A CE  1 
ATOM   808  N  NZ  . LYS A 1 106 ? -0.805 17.131 44.512  1.00 55.60 ? 106  LYS A NZ  1 
ATOM   809  N  N   . LYS A 1 107 ? 4.102  13.902 48.275  1.00 46.91 ? 107  LYS A N   1 
ATOM   810  C  CA  . LYS A 1 107 ? 3.930  12.486 48.626  1.00 47.23 ? 107  LYS A CA  1 
ATOM   811  C  C   . LYS A 1 107 ? 4.856  12.093 49.773  1.00 46.46 ? 107  LYS A C   1 
ATOM   812  O  O   . LYS A 1 107 ? 4.499  11.255 50.598  1.00 46.79 ? 107  LYS A O   1 
ATOM   813  C  CB  . LYS A 1 107 ? 4.190  11.575 47.420  1.00 47.27 ? 107  LYS A CB  1 
ATOM   814  C  CG  . LYS A 1 107 ? 3.360  11.919 46.191  1.00 49.72 ? 107  LYS A CG  1 
ATOM   815  C  CD  . LYS A 1 107 ? 3.437  10.846 45.107  1.00 52.80 ? 107  LYS A CD  1 
ATOM   816  C  CE  . LYS A 1 107 ? 2.736  9.553  45.517  1.00 54.65 ? 107  LYS A CE  1 
ATOM   817  N  NZ  . LYS A 1 107 ? 2.204  8.803  44.341  1.00 54.88 ? 107  LYS A NZ  1 
ATOM   818  N  N   . GLY A 1 108 ? 6.044  12.698 49.809  1.00 45.62 ? 108  GLY A N   1 
ATOM   819  C  CA  . GLY A 1 108 ? 7.002  12.498 50.899  1.00 45.35 ? 108  GLY A CA  1 
ATOM   820  C  C   . GLY A 1 108 ? 8.048  11.439 50.599  1.00 44.91 ? 108  GLY A C   1 
ATOM   821  O  O   . GLY A 1 108 ? 7.960  10.733 49.592  1.00 45.16 ? 108  GLY A O   1 
ATOM   822  N  N   . GLY A 1 109 ? 9.046  11.341 51.475  1.00 44.35 ? 109  GLY A N   1 
ATOM   823  C  CA  . GLY A 1 109 ? 10.099 10.330 51.360  1.00 44.11 ? 109  GLY A CA  1 
ATOM   824  C  C   . GLY A 1 109 ? 11.148 10.619 50.298  1.00 43.36 ? 109  GLY A C   1 
ATOM   825  O  O   . GLY A 1 109 ? 11.918 9.728  49.926  1.00 43.01 ? 109  GLY A O   1 
ATOM   826  N  N   . PHE A 1 110 ? 11.184 11.861 49.813  1.00 42.88 ? 110  PHE A N   1 
ATOM   827  C  CA  . PHE A 1 110 ? 12.139 12.276 48.784  1.00 42.29 ? 110  PHE A CA  1 
ATOM   828  C  C   . PHE A 1 110 ? 13.092 13.361 49.303  1.00 41.92 ? 110  PHE A C   1 
ATOM   829  O  O   . PHE A 1 110 ? 13.571 14.198 48.536  1.00 41.42 ? 110  PHE A O   1 
ATOM   830  C  CB  . PHE A 1 110 ? 11.396 12.768 47.536  1.00 42.29 ? 110  PHE A CB  1 
ATOM   831  C  CG  . PHE A 1 110 ? 10.729 11.672 46.751  1.00 42.84 ? 110  PHE A CG  1 
ATOM   832  C  CD1 . PHE A 1 110 ? 11.489 10.750 46.042  1.00 41.99 ? 110  PHE A CD1 1 
ATOM   833  C  CD2 . PHE A 1 110 ? 9.343  11.573 46.709  1.00 44.23 ? 110  PHE A CD2 1 
ATOM   834  C  CE1 . PHE A 1 110 ? 10.880 9.740  45.315  1.00 43.23 ? 110  PHE A CE1 1 
ATOM   835  C  CE2 . PHE A 1 110 ? 8.725  10.566 45.982  1.00 45.10 ? 110  PHE A CE2 1 
ATOM   836  C  CZ  . PHE A 1 110 ? 9.495  9.649  45.282  1.00 45.15 ? 110  PHE A CZ  1 
ATOM   837  N  N   . GLY A 1 111 ? 13.379 13.329 50.602  1.00 41.90 ? 111  GLY A N   1 
ATOM   838  C  CA  . GLY A 1 111 ? 14.310 14.271 51.212  1.00 41.44 ? 111  GLY A CA  1 
ATOM   839  C  C   . GLY A 1 111 ? 15.740 13.767 51.155  1.00 41.37 ? 111  GLY A C   1 
ATOM   840  O  O   . GLY A 1 111 ? 16.059 12.847 50.393  1.00 40.64 ? 111  GLY A O   1 
ATOM   841  N  N   . VAL A 1 112 ? 16.599 14.374 51.973  1.00 41.61 ? 112  VAL A N   1 
ATOM   842  C  CA  . VAL A 1 112 ? 18.015 14.010 52.048  1.00 41.41 ? 112  VAL A CA  1 
ATOM   843  C  C   . VAL A 1 112 ? 18.170 12.513 52.315  1.00 41.05 ? 112  VAL A C   1 
ATOM   844  O  O   . VAL A 1 112 ? 17.497 11.962 53.185  1.00 41.70 ? 112  VAL A O   1 
ATOM   845  C  CB  . VAL A 1 112 ? 18.742 14.807 53.164  1.00 42.25 ? 112  VAL A CB  1 
ATOM   846  C  CG1 . VAL A 1 112 ? 20.189 14.339 53.320  1.00 42.89 ? 112  VAL A CG1 1 
ATOM   847  C  CG2 . VAL A 1 112 ? 18.686 16.306 52.876  1.00 42.27 ? 112  VAL A CG2 1 
ATOM   848  N  N   . GLY A 1 113 ? 19.042 11.856 51.556  1.00 40.18 ? 113  GLY A N   1 
ATOM   849  C  CA  . GLY A 1 113 ? 19.265 10.423 51.727  1.00 40.18 ? 113  GLY A CA  1 
ATOM   850  C  C   . GLY A 1 113 ? 20.036 9.779  50.592  1.00 39.67 ? 113  GLY A C   1 
ATOM   851  O  O   . GLY A 1 113 ? 20.575 10.466 49.723  1.00 38.93 ? 113  GLY A O   1 
ATOM   852  N  N   . ASN A 1 114 ? 20.086 8.450  50.616  1.00 40.00 ? 114  ASN A N   1 
ATOM   853  C  CA  . ASN A 1 114 ? 20.773 7.663  49.597  1.00 39.91 ? 114  ASN A CA  1 
ATOM   854  C  C   . ASN A 1 114 ? 19.810 7.319  48.469  1.00 39.43 ? 114  ASN A C   1 
ATOM   855  O  O   . ASN A 1 114 ? 18.657 6.977  48.729  1.00 39.65 ? 114  ASN A O   1 
ATOM   856  C  CB  . ASN A 1 114 ? 21.336 6.383  50.215  1.00 40.90 ? 114  ASN A CB  1 
ATOM   857  C  CG  . ASN A 1 114 ? 22.417 6.659  51.247  1.00 41.91 ? 114  ASN A CG  1 
ATOM   858  O  OD1 . ASN A 1 114 ? 23.411 7.325  50.958  1.00 42.85 ? 114  ASN A OD1 1 
ATOM   859  N  ND2 . ASN A 1 114 ? 22.227 6.144  52.457  1.00 42.53 ? 114  ASN A ND2 1 
ATOM   860  N  N   . TYR A 1 115 ? 20.283 7.409  47.226  1.00 39.03 ? 115  TYR A N   1 
ATOM   861  C  CA  . TYR A 1 115 ? 19.423 7.247  46.051  1.00 38.58 ? 115  TYR A CA  1 
ATOM   862  C  C   . TYR A 1 115 ? 19.999 6.344  44.964  1.00 38.86 ? 115  TYR A C   1 
ATOM   863  O  O   . TYR A 1 115 ? 21.213 6.143  44.877  1.00 39.00 ? 115  TYR A O   1 
ATOM   864  C  CB  . TYR A 1 115 ? 19.123 8.613  45.430  1.00 37.85 ? 115  TYR A CB  1 
ATOM   865  C  CG  . TYR A 1 115 ? 18.066 9.389  46.164  1.00 37.70 ? 115  TYR A CG  1 
ATOM   866  C  CD1 . TYR A 1 115 ? 18.379 10.099 47.314  1.00 38.17 ? 115  TYR A CD1 1 
ATOM   867  C  CD2 . TYR A 1 115 ? 16.749 9.412  45.710  1.00 37.36 ? 115  TYR A CD2 1 
ATOM   868  C  CE1 . TYR A 1 115 ? 17.413 10.816 47.999  1.00 39.57 ? 115  TYR A CE1 1 
ATOM   869  C  CE2 . TYR A 1 115 ? 15.771 10.126 46.386  1.00 37.20 ? 115  TYR A CE2 1 
ATOM   870  C  CZ  . TYR A 1 115 ? 16.112 10.825 47.531  1.00 38.64 ? 115  TYR A CZ  1 
ATOM   871  O  OH  . TYR A 1 115 ? 15.161 11.535 48.214  1.00 36.76 ? 115  TYR A OH  1 
ATOM   872  N  N   . GLU A 1 116 ? 19.096 5.814  44.140  1.00 38.90 ? 116  GLU A N   1 
ATOM   873  C  CA  . GLU A 1 116 ? 19.442 5.116  42.905  1.00 38.93 ? 116  GLU A CA  1 
ATOM   874  C  C   . GLU A 1 116 ? 18.719 5.781  41.739  1.00 37.67 ? 116  GLU A C   1 
ATOM   875  O  O   . GLU A 1 116 ? 17.498 5.918  41.761  1.00 37.41 ? 116  GLU A O   1 
ATOM   876  C  CB  . GLU A 1 116 ? 19.032 3.645  42.971  1.00 40.03 ? 116  GLU A CB  1 
ATOM   877  C  CG  . GLU A 1 116 ? 19.911 2.782  43.858  1.00 43.20 ? 116  GLU A CG  1 
ATOM   878  C  CD  . GLU A 1 116 ? 19.406 1.354  43.970  1.00 46.62 ? 116  GLU A CD  1 
ATOM   879  O  OE1 . GLU A 1 116 ? 18.686 0.902  43.052  1.00 48.76 ? 116  GLU A OE1 1 
ATOM   880  O  OE2 . GLU A 1 116 ? 19.731 0.684  44.977  1.00 49.15 ? 116  GLU A OE2 1 
ATOM   881  N  N   . LEU A 1 117 ? 19.481 6.190  40.729  1.00 37.20 ? 117  LEU A N   1 
ATOM   882  C  CA  . LEU A 1 117 ? 18.931 6.810  39.530  1.00 36.69 ? 117  LEU A CA  1 
ATOM   883  C  C   . LEU A 1 117 ? 19.118 5.878  38.336  1.00 37.04 ? 117  LEU A C   1 
ATOM   884  O  O   . LEU A 1 117 ? 20.226 5.394  38.092  1.00 37.16 ? 117  LEU A O   1 
ATOM   885  C  CB  . LEU A 1 117 ? 19.628 8.146  39.261  1.00 36.08 ? 117  LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 117 ? 19.297 8.859  37.946  1.00 35.08 ? 117  LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 117 ? 17.809 9.168  37.864  1.00 33.94 ? 117  LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 117 ? 20.125 10.129 37.805  1.00 34.40 ? 117  LEU A CD2 1 
ATOM   889  N  N   . THR A 1 118 ? 18.033 5.635  37.600  1.00 36.83 ? 118  THR A N   1 
ATOM   890  C  CA  . THR A 1 118 ? 18.079 4.830  36.382  1.00 36.78 ? 118  THR A CA  1 
ATOM   891  C  C   . THR A 1 118 ? 17.559 5.643  35.205  1.00 36.17 ? 118  THR A C   1 
ATOM   892  O  O   . THR A 1 118 ? 16.486 6.232  35.294  1.00 35.72 ? 118  THR A O   1 
ATOM   893  C  CB  . THR A 1 118 ? 17.216 3.560  36.502  1.00 37.39 ? 118  THR A CB  1 
ATOM   894  O  OG1 . THR A 1 118 ? 17.507 2.885  37.732  1.00 38.67 ? 118  THR A OG1 1 
ATOM   895  C  CG2 . THR A 1 118 ? 17.485 2.622  35.337  1.00 37.61 ? 118  THR A CG2 1 
ATOM   896  N  N   . PHE A 1 119 ? 18.330 5.684  34.118  1.00 36.15 ? 119  PHE A N   1 
ATOM   897  C  CA  . PHE A 1 119 ? 17.869 6.260  32.854  1.00 35.97 ? 119  PHE A CA  1 
ATOM   898  C  C   . PHE A 1 119 ? 17.378 5.147  31.945  1.00 36.55 ? 119  PHE A C   1 
ATOM   899  O  O   . PHE A 1 119 ? 17.904 4.041  31.985  1.00 37.01 ? 119  PHE A O   1 
ATOM   900  C  CB  . PHE A 1 119 ? 18.994 7.013  32.133  1.00 35.59 ? 119  PHE A CB  1 
ATOM   901  C  CG  . PHE A 1 119 ? 19.462 8.265  32.834  1.00 35.02 ? 119  PHE A CG  1 
ATOM   902  C  CD1 . PHE A 1 119 ? 18.565 9.121  33.466  1.00 34.99 ? 119  PHE A CD1 1 
ATOM   903  C  CD2 . PHE A 1 119 ? 20.805 8.612  32.812  1.00 34.58 ? 119  PHE A CD2 1 
ATOM   904  C  CE1 . PHE A 1 119 ? 19.009 10.279 34.093  1.00 34.52 ? 119  PHE A CE1 1 
ATOM   905  C  CE2 . PHE A 1 119 ? 21.252 9.768  33.433  1.00 34.80 ? 119  PHE A CE2 1 
ATOM   906  C  CZ  . PHE A 1 119 ? 20.353 10.602 34.074  1.00 33.94 ? 119  PHE A CZ  1 
ATOM   907  N  N   . TYR A 1 120 ? 16.372 5.447  31.127  1.00 37.21 ? 120  TYR A N   1 
ATOM   908  C  CA  . TYR A 1 120 ? 15.878 4.518  30.108  1.00 38.29 ? 120  TYR A CA  1 
ATOM   909  C  C   . TYR A 1 120 ? 15.937 5.201  28.743  1.00 37.59 ? 120  TYR A C   1 
ATOM   910  O  O   . TYR A 1 120 ? 15.123 6.075  28.443  1.00 37.56 ? 120  TYR A O   1 
ATOM   911  C  CB  . TYR A 1 120 ? 14.450 4.072  30.425  1.00 39.06 ? 120  TYR A CB  1 
ATOM   912  C  CG  . TYR A 1 120 ? 14.334 3.267  31.700  1.00 41.14 ? 120  TYR A CG  1 
ATOM   913  C  CD1 . TYR A 1 120 ? 14.652 1.911  31.724  1.00 43.11 ? 120  TYR A CD1 1 
ATOM   914  C  CD2 . TYR A 1 120 ? 13.907 3.861  32.884  1.00 43.02 ? 120  TYR A CD2 1 
ATOM   915  C  CE1 . TYR A 1 120 ? 14.546 1.168  32.895  1.00 44.61 ? 120  TYR A CE1 1 
ATOM   916  C  CE2 . TYR A 1 120 ? 13.798 3.128  34.059  1.00 44.54 ? 120  TYR A CE2 1 
ATOM   917  C  CZ  . TYR A 1 120 ? 14.118 1.784  34.061  1.00 46.14 ? 120  TYR A CZ  1 
ATOM   918  O  OH  . TYR A 1 120 ? 14.007 1.065  35.232  1.00 48.83 ? 120  TYR A OH  1 
ATOM   919  N  N   . ILE A 1 121 ? 16.901 4.787  27.921  1.00 36.88 ? 121  ILE A N   1 
ATOM   920  C  CA  . ILE A 1 121 ? 17.231 5.494  26.688  1.00 35.85 ? 121  ILE A CA  1 
ATOM   921  C  C   . ILE A 1 121 ? 16.883 4.667  25.451  1.00 36.00 ? 121  ILE A C   1 
ATOM   922  O  O   . ILE A 1 121 ? 17.200 3.480  25.378  1.00 35.85 ? 121  ILE A O   1 
ATOM   923  C  CB  . ILE A 1 121 ? 18.731 5.865  26.655  1.00 34.93 ? 121  ILE A CB  1 
ATOM   924  C  CG1 . ILE A 1 121 ? 19.131 6.585  27.947  1.00 34.26 ? 121  ILE A CG1 1 
ATOM   925  C  CG2 . ILE A 1 121 ? 19.036 6.739  25.453  1.00 35.01 ? 121  ILE A CG2 1 
ATOM   926  C  CD1 . ILE A 1 121 ? 20.575 7.034  27.990  1.00 34.71 ? 121  ILE A CD1 1 
ATOM   927  N  N   . SER A 1 122 ? 16.219 5.310  24.492  1.00 36.13 ? 122  SER A N   1 
ATOM   928  C  CA  . SER A 1 122 ? 15.908 4.714  23.193  1.00 36.39 ? 122  SER A CA  1 
ATOM   929  C  C   . SER A 1 122 ? 16.548 5.555  22.092  1.00 35.85 ? 122  SER A C   1 
ATOM   930  O  O   . SER A 1 122 ? 16.736 6.762  22.259  1.00 35.34 ? 122  SER A O   1 
ATOM   931  C  CB  . SER A 1 122 ? 14.397 4.651  22.983  1.00 36.96 ? 122  SER A CB  1 
ATOM   932  O  OG  . SER A 1 122 ? 13.782 3.860  23.982  1.00 38.48 ? 122  SER A OG  1 
ATOM   933  N  N   . ASN A 1 123 ? 16.867 4.914  20.968  1.00 35.72 ? 123  ASN A N   1 
ATOM   934  C  CA  . ASN A 1 123 ? 17.619 5.567  19.894  1.00 34.89 ? 123  ASN A CA  1 
ATOM   935  C  C   . ASN A 1 123 ? 16.826 6.669  19.175  1.00 35.03 ? 123  ASN A C   1 
ATOM   936  O  O   . ASN A 1 123 ? 15.619 6.787  19.369  1.00 35.44 ? 123  ASN A O   1 
ATOM   937  C  CB  . ASN A 1 123 ? 18.164 4.524  18.901  1.00 35.42 ? 123  ASN A CB  1 
ATOM   938  C  CG  . ASN A 1 123 ? 17.084 3.889  18.043  1.00 35.05 ? 123  ASN A CG  1 
ATOM   939  O  OD1 . ASN A 1 123 ? 16.160 4.555  17.584  1.00 34.62 ? 123  ASN A OD1 1 
ATOM   940  N  ND2 . ASN A 1 123 ? 17.213 2.590  17.806  1.00 33.48 ? 123  ASN A ND2 1 
ATOM   941  N  N   . PRO A 1 124 ? 17.509 7.488  18.356  1.00 35.10 ? 124  PRO A N   1 
ATOM   942  C  CA  . PRO A 1 124 ? 16.845 8.589  17.661  1.00 36.01 ? 124  PRO A CA  1 
ATOM   943  C  C   . PRO A 1 124 ? 15.772 8.227  16.623  1.00 37.95 ? 124  PRO A C   1 
ATOM   944  O  O   . PRO A 1 124 ? 14.938 9.077  16.315  1.00 38.44 ? 124  PRO A O   1 
ATOM   945  C  CB  . PRO A 1 124 ? 18.012 9.305  16.974  1.00 35.44 ? 124  PRO A CB  1 
ATOM   946  C  CG  . PRO A 1 124 ? 19.155 9.038  17.843  1.00 34.77 ? 124  PRO A CG  1 
ATOM   947  C  CD  . PRO A 1 124 ? 18.974 7.615  18.252  1.00 34.48 ? 124  PRO A CD  1 
ATOM   948  N  N   . GLU A 1 125 ? 15.786 7.005  16.086  1.00 39.50 ? 125  GLU A N   1 
ATOM   949  C  CA  . GLU A 1 125 ? 14.798 6.603  15.066  1.00 41.45 ? 125  GLU A CA  1 
ATOM   950  C  C   . GLU A 1 125 ? 13.365 6.611  15.593  1.00 42.32 ? 125  GLU A C   1 
ATOM   951  O  O   . GLU A 1 125 ? 12.419 6.773  14.823  1.00 43.52 ? 125  GLU A O   1 
ATOM   952  C  CB  . GLU A 1 125 ? 15.113 5.223  14.479  1.00 42.27 ? 125  GLU A CB  1 
ATOM   953  C  CG  . GLU A 1 125 ? 16.251 5.226  13.470  1.00 45.11 ? 125  GLU A CG  1 
ATOM   954  C  CD  . GLU A 1 125 ? 16.464 3.874  12.807  1.00 49.20 ? 125  GLU A CD  1 
ATOM   955  O  OE1 . GLU A 1 125 ? 15.626 2.966  13.002  1.00 52.22 ? 125  GLU A OE1 1 
ATOM   956  O  OE2 . GLU A 1 125 ? 17.472 3.723  12.083  1.00 50.76 ? 125  GLU A OE2 1 
ATOM   957  N  N   . LYS A 1 126 ? 13.213 6.433  16.903  1.00 42.06 ? 126  LYS A N   1 
ATOM   958  C  CA  . LYS A 1 126 ? 11.910 6.525  17.556  1.00 42.70 ? 126  LYS A CA  1 
ATOM   959  C  C   . LYS A 1 126 ? 11.263 7.900  17.330  1.00 42.45 ? 126  LYS A C   1 
ATOM   960  O  O   . LYS A 1 126 ? 10.034 8.011  17.316  1.00 43.00 ? 126  LYS A O   1 
ATOM   961  C  CB  . LYS A 1 126 ? 12.057 6.236  19.056  1.00 42.47 ? 126  LYS A CB  1 
ATOM   962  C  CG  . LYS A 1 126 ? 10.777 5.802  19.754  1.00 45.17 ? 126  LYS A CG  1 
ATOM   963  C  CD  . LYS A 1 126 ? 11.082 5.152  21.103  1.00 46.39 ? 126  LYS A CD  1 
ATOM   964  C  CE  . LYS A 1 126 ? 9.810  4.769  21.856  1.00 49.15 ? 126  LYS A CE  1 
ATOM   965  N  NZ  . LYS A 1 126 ? 9.028  5.962  22.299  1.00 49.25 ? 126  LYS A NZ  1 
ATOM   966  N  N   . GLN A 1 127 ? 12.094 8.932  17.145  1.00 41.18 ? 127  GLN A N   1 
ATOM   967  C  CA  . GLN A 1 127 ? 11.626 10.302 16.893  1.00 41.13 ? 127  GLN A CA  1 
ATOM   968  C  C   . GLN A 1 127 ? 11.797 10.765 15.432  1.00 41.53 ? 127  GLN A C   1 
ATOM   969  O  O   . GLN A 1 127 ? 11.778 11.964 15.154  1.00 42.09 ? 127  GLN A O   1 
ATOM   970  C  CB  . GLN A 1 127 ? 12.340 11.279 17.839  1.00 40.03 ? 127  GLN A CB  1 
ATOM   971  C  CG  . GLN A 1 127 ? 11.936 11.130 19.302  1.00 40.03 ? 127  GLN A CG  1 
ATOM   972  C  CD  . GLN A 1 127 ? 12.521 12.207 20.210  1.00 38.69 ? 127  GLN A CD  1 
ATOM   973  O  OE1 . GLN A 1 127 ? 12.797 13.327 19.780  1.00 38.42 ? 127  GLN A OE1 1 
ATOM   974  N  NE2 . GLN A 1 127 ? 12.696 11.870 21.479  1.00 40.49 ? 127  GLN A NE2 1 
ATOM   975  N  N   . GLY A 1 128 ? 11.951 9.823  14.503  1.00 41.52 ? 128  GLY A N   1 
ATOM   976  C  CA  . GLY A 1 128 ? 12.040 10.145 13.069  1.00 41.62 ? 128  GLY A CA  1 
ATOM   977  C  C   . GLY A 1 128 ? 13.403 10.603 12.562  1.00 40.00 ? 128  GLY A C   1 
ATOM   978  O  O   . GLY A 1 128 ? 13.495 11.225 11.504  1.00 40.54 ? 128  GLY A O   1 
ATOM   979  N  N   . PHE A 1 129 ? 14.458 10.285 13.307  1.00 38.02 ? 129  PHE A N   1 
ATOM   980  C  CA  . PHE A 1 129 ? 15.825 10.639 12.932  1.00 36.43 ? 129  PHE A CA  1 
ATOM   981  C  C   . PHE A 1 129 ? 16.405 9.532  12.062  1.00 36.66 ? 129  PHE A C   1 
ATOM   982  O  O   . PHE A 1 129 ? 16.559 8.397  12.517  1.00 36.89 ? 129  PHE A O   1 
ATOM   983  C  CB  . PHE A 1 129 ? 16.680 10.817 14.187  1.00 34.91 ? 129  PHE A CB  1 
ATOM   984  C  CG  . PHE A 1 129 ? 18.042 11.394 13.925  1.00 32.09 ? 129  PHE A CG  1 
ATOM   985  C  CD1 . PHE A 1 129 ? 18.238 12.767 13.908  1.00 31.63 ? 129  PHE A CD1 1 
ATOM   986  C  CD2 . PHE A 1 129 ? 19.132 10.565 13.714  1.00 30.90 ? 129  PHE A CD2 1 
ATOM   987  C  CE1 . PHE A 1 129 ? 19.497 13.308 13.673  1.00 29.26 ? 129  PHE A CE1 1 
ATOM   988  C  CE2 . PHE A 1 129 ? 20.392 11.096 13.480  1.00 30.68 ? 129  PHE A CE2 1 
ATOM   989  C  CZ  . PHE A 1 129 ? 20.575 12.471 13.459  1.00 29.50 ? 129  PHE A CZ  1 
ATOM   990  N  N   . GLY A 1 130 ? 16.730 9.865  10.816  1.00 36.78 ? 130  GLY A N   1 
ATOM   991  C  CA  . GLY A 1 130 ? 17.230 8.881  9.858   1.00 36.91 ? 130  GLY A CA  1 
ATOM   992  C  C   . GLY A 1 130 ? 18.734 8.669  9.905   1.00 35.88 ? 130  GLY A C   1 
ATOM   993  O  O   . GLY A 1 130 ? 19.453 9.356  10.632  1.00 35.02 ? 130  GLY A O   1 
ATOM   994  N  N   . ARG A 1 131 ? 19.207 7.701  9.126   1.00 35.89 ? 131  ARG A N   1 
ATOM   995  C  CA  . ARG A 1 131 ? 20.637 7.451  8.982   1.00 35.26 ? 131  ARG A CA  1 
ATOM   996  C  C   . ARG A 1 131 ? 20.950 6.941  7.580   1.00 35.73 ? 131  ARG A C   1 
ATOM   997  O  O   . ARG A 1 131 ? 20.150 6.222  6.979   1.00 36.38 ? 131  ARG A O   1 
ATOM   998  C  CB  . ARG A 1 131 ? 21.124 6.449  10.039  1.00 34.73 ? 131  ARG A CB  1 
ATOM   999  C  CG  . ARG A 1 131 ? 20.712 5.006  9.787   1.00 35.42 ? 131  ARG A CG  1 
ATOM   1000 C  CD  . ARG A 1 131 ? 20.975 4.120  10.990  1.00 34.60 ? 131  ARG A CD  1 
ATOM   1001 N  NE  . ARG A 1 131 ? 20.523 2.747  10.748  1.00 36.31 ? 131  ARG A NE  1 
ATOM   1002 C  CZ  . ARG A 1 131 ? 21.230 1.802  10.128  1.00 35.66 ? 131  ARG A CZ  1 
ATOM   1003 N  NH1 . ARG A 1 131 ? 22.455 2.049  9.668   1.00 35.42 ? 131  ARG A NH1 1 
ATOM   1004 N  NH2 . ARG A 1 131 ? 20.706 0.592  9.966   1.00 37.04 ? 131  ARG A NH2 1 
ATOM   1005 N  N   . HIS A 1 132 ? 22.112 7.322  7.060   1.00 35.62 ? 132  HIS A N   1 
ATOM   1006 C  CA  . HIS A 1 132 ? 22.583 6.806  5.777   1.00 36.41 ? 132  HIS A CA  1 
ATOM   1007 C  C   . HIS A 1 132 ? 22.997 5.347  5.958   1.00 36.83 ? 132  HIS A C   1 
ATOM   1008 O  O   . HIS A 1 132 ? 23.566 4.990  6.992   1.00 36.40 ? 132  HIS A O   1 
ATOM   1009 C  CB  . HIS A 1 132 ? 23.773 7.624  5.268   1.00 35.99 ? 132  HIS A CB  1 
ATOM   1010 C  CG  . HIS A 1 132 ? 23.417 9.008  4.822   1.00 35.32 ? 132  HIS A CG  1 
ATOM   1011 N  ND1 . HIS A 1 132 ? 24.157 9.696  3.886   1.00 34.39 ? 132  HIS A ND1 1 
ATOM   1012 C  CD2 . HIS A 1 132 ? 22.398 9.827  5.172   1.00 36.11 ? 132  HIS A CD2 1 
ATOM   1013 C  CE1 . HIS A 1 132 ? 23.615 10.884 3.686   1.00 34.57 ? 132  HIS A CE1 1 
ATOM   1014 N  NE2 . HIS A 1 132 ? 22.544 10.988 4.452   1.00 34.27 ? 132  HIS A NE2 1 
ATOM   1015 N  N   . VAL A 1 133 ? 22.695 4.510  4.968   1.00 38.10 ? 133  VAL A N   1 
ATOM   1016 C  CA  . VAL A 1 133 ? 23.129 3.106  4.973   1.00 38.80 ? 133  VAL A CA  1 
ATOM   1017 C  C   . VAL A 1 133 ? 23.869 2.719  3.686   1.00 40.14 ? 133  VAL A C   1 
ATOM   1018 O  O   . VAL A 1 133 ? 24.133 1.538  3.451   1.00 40.55 ? 133  VAL A O   1 
ATOM   1019 C  CB  . VAL A 1 133 ? 21.930 2.138  5.191   1.00 39.36 ? 133  VAL A CB  1 
ATOM   1020 C  CG1 . VAL A 1 133 ? 21.236 2.441  6.508   1.00 37.92 ? 133  VAL A CG1 1 
ATOM   1021 C  CG2 . VAL A 1 133 ? 20.945 2.220  4.033   1.00 39.17 ? 133  VAL A CG2 1 
ATOM   1022 N  N   . ASP A 1 134 ? 24.216 3.711  2.867   1.00 41.28 ? 134  ASP A N   1 
ATOM   1023 C  CA  . ASP A 1 134 ? 24.888 3.457  1.594   1.00 42.93 ? 134  ASP A CA  1 
ATOM   1024 C  C   . ASP A 1 134 ? 26.347 3.077  1.828   1.00 43.66 ? 134  ASP A C   1 
ATOM   1025 O  O   . ASP A 1 134 ? 26.863 3.224  2.934   1.00 42.96 ? 134  ASP A O   1 
ATOM   1026 C  CB  . ASP A 1 134 ? 24.782 4.667  0.655   1.00 43.11 ? 134  ASP A CB  1 
ATOM   1027 C  CG  . ASP A 1 134 ? 25.528 5.887  1.171   1.00 43.49 ? 134  ASP A CG  1 
ATOM   1028 O  OD1 . ASP A 1 134 ? 25.466 6.162  2.388   1.00 43.61 ? 134  ASP A OD1 1 
ATOM   1029 O  OD2 . ASP A 1 134 ? 26.169 6.580  0.352   1.00 45.85 ? 134  ASP A OD2 1 
ATOM   1030 N  N   . GLU A 1 135 ? 27.004 2.584  0.783   1.00 45.81 ? 135  GLU A N   1 
ATOM   1031 C  CA  . GLU A 1 135 ? 28.364 2.065  0.911   1.00 46.72 ? 135  GLU A CA  1 
ATOM   1032 C  C   . GLU A 1 135 ? 29.371 3.149  1.288   1.00 46.16 ? 135  GLU A C   1 
ATOM   1033 O  O   . GLU A 1 135 ? 30.229 2.925  2.145   1.00 45.74 ? 135  GLU A O   1 
ATOM   1034 C  CB  . GLU A 1 135 ? 28.805 1.370  -0.383  1.00 48.03 ? 135  GLU A CB  1 
ATOM   1035 C  CG  . GLU A 1 135 ? 30.120 0.590  -0.240  1.00 50.52 ? 135  GLU A CG  1 
ATOM   1036 C  CD  . GLU A 1 135 ? 30.234 -0.603 -1.182  1.00 54.55 ? 135  GLU A CD  1 
ATOM   1037 O  OE1 . GLU A 1 135 ? 29.197 -1.216 -1.526  1.00 56.17 ? 135  GLU A OE1 1 
ATOM   1038 O  OE2 . GLU A 1 135 ? 31.376 -0.940 -1.564  1.00 57.40 ? 135  GLU A OE2 1 
ATOM   1039 N  N   . GLU A 1 136 ? 29.254 4.318  0.657   1.00 46.26 ? 136  GLU A N   1 
ATOM   1040 C  CA  . GLU A 1 136 ? 30.222 5.398  0.847   1.00 46.11 ? 136  GLU A CA  1 
ATOM   1041 C  C   . GLU A 1 136 ? 30.068 6.095  2.205   1.00 44.56 ? 136  GLU A C   1 
ATOM   1042 O  O   . GLU A 1 136 ? 31.009 6.107  3.005   1.00 44.27 ? 136  GLU A O   1 
ATOM   1043 C  CB  . GLU A 1 136 ? 30.127 6.420  -0.297  1.00 47.12 ? 136  GLU A CB  1 
ATOM   1044 C  CG  . GLU A 1 136 ? 31.300 7.416  -0.350  1.00 50.13 ? 136  GLU A CG  1 
ATOM   1045 C  CD  . GLU A 1 136 ? 31.280 8.326  -1.582  1.00 54.42 ? 136  GLU A CD  1 
ATOM   1046 O  OE1 . GLU A 1 136 ? 30.982 7.836  -2.695  1.00 57.44 ? 136  GLU A OE1 1 
ATOM   1047 O  OE2 . GLU A 1 136 ? 31.578 9.534  -1.437  1.00 54.31 ? 136  GLU A OE2 1 
ATOM   1048 N  N   . THR A 1 137 ? 28.885 6.653  2.463   1.00 43.59 ? 137  THR A N   1 
ATOM   1049 C  CA  . THR A 1 137 ? 28.654 7.506  3.640   1.00 42.18 ? 137  THR A CA  1 
ATOM   1050 C  C   . THR A 1 137 ? 27.819 6.864  4.758   1.00 40.64 ? 137  THR A C   1 
ATOM   1051 O  O   . THR A 1 137 ? 27.488 7.531  5.738   1.00 39.80 ? 137  THR A O   1 
ATOM   1052 C  CB  . THR A 1 137 ? 27.960 8.835  3.229   1.00 42.96 ? 137  THR A CB  1 
ATOM   1053 O  OG1 . THR A 1 137 ? 26.655 8.565  2.696   1.00 42.83 ? 137  THR A OG1 1 
ATOM   1054 C  CG2 . THR A 1 137 ? 28.794 9.584  2.192   1.00 43.69 ? 137  THR A CG2 1 
ATOM   1055 N  N   . GLY A 1 138 ? 27.491 5.582  4.627   1.00 39.93 ? 138  GLY A N   1 
ATOM   1056 C  CA  . GLY A 1 138 ? 26.577 4.929  5.566   1.00 39.23 ? 138  GLY A CA  1 
ATOM   1057 C  C   . GLY A 1 138 ? 27.167 4.624  6.929   1.00 38.01 ? 138  GLY A C   1 
ATOM   1058 O  O   . GLY A 1 138 ? 28.377 4.446  7.065   1.00 37.77 ? 138  GLY A O   1 
ATOM   1059 N  N   . VAL A 1 139 ? 26.297 4.566  7.937   1.00 37.56 ? 139  VAL A N   1 
ATOM   1060 C  CA  . VAL A 1 139 ? 26.685 4.213  9.305   1.00 36.97 ? 139  VAL A CA  1 
ATOM   1061 C  C   . VAL A 1 139 ? 25.975 2.932  9.741   1.00 37.78 ? 139  VAL A C   1 
ATOM   1062 O  O   . VAL A 1 139 ? 25.084 2.438  9.049   1.00 38.49 ? 139  VAL A O   1 
ATOM   1063 C  CB  . VAL A 1 139 ? 26.359 5.344  10.311  1.00 36.12 ? 139  VAL A CB  1 
ATOM   1064 C  CG1 . VAL A 1 139 ? 26.938 6.664  9.835   1.00 35.14 ? 139  VAL A CG1 1 
ATOM   1065 C  CG2 . VAL A 1 139 ? 24.862 5.466  10.528  1.00 35.32 ? 139  VAL A CG2 1 
ATOM   1066 N  N   . GLY A 1 140 ? 26.371 2.406  10.895  1.00 38.08 ? 140  GLY A N   1 
ATOM   1067 C  CA  . GLY A 1 140 ? 25.827 1.150  11.407  1.00 39.08 ? 140  GLY A CA  1 
ATOM   1068 C  C   . GLY A 1 140 ? 24.487 1.286  12.107  1.00 39.58 ? 140  GLY A C   1 
ATOM   1069 O  O   . GLY A 1 140 ? 23.941 2.387  12.226  1.00 39.23 ? 140  GLY A O   1 
ATOM   1070 N  N   . LYS A 1 141 ? 23.968 0.152  12.576  1.00 40.62 ? 141  LYS A N   1 
ATOM   1071 C  CA  . LYS A 1 141 ? 22.685 0.103  13.281  1.00 41.01 ? 141  LYS A CA  1 
ATOM   1072 C  C   . LYS A 1 141 ? 22.710 0.879  14.593  1.00 40.41 ? 141  LYS A C   1 
ATOM   1073 O  O   . LYS A 1 141 ? 23.742 0.975  15.266  1.00 39.86 ? 141  LYS A O   1 
ATOM   1074 C  CB  . LYS A 1 141 ? 22.284 -1.343 13.594  1.00 42.17 ? 141  LYS A CB  1 
ATOM   1075 C  CG  . LYS A 1 141 ? 21.602 -2.094 12.460  1.00 44.87 ? 141  LYS A CG  1 
ATOM   1076 C  CD  . LYS A 1 141 ? 21.210 -3.500 12.914  1.00 46.66 ? 141  LYS A CD  1 
ATOM   1077 C  CE  . LYS A 1 141 ? 20.277 -4.184 11.929  1.00 48.45 ? 141  LYS A CE  1 
ATOM   1078 N  NZ  . LYS A 1 141 ? 19.891 -5.544 12.396  1.00 50.50 ? 141  LYS A NZ  1 
ATOM   1079 N  N   . TRP A 1 142 ? 21.550 1.416  14.953  1.00 40.48 ? 142  TRP A N   1 
ATOM   1080 C  CA  . TRP A 1 142 ? 21.362 2.042  16.250  1.00 39.62 ? 142  TRP A CA  1 
ATOM   1081 C  C   . TRP A 1 142 ? 21.309 0.987  17.347  1.00 39.67 ? 142  TRP A C   1 
ATOM   1082 O  O   . TRP A 1 142 ? 21.130 -0.204 17.083  1.00 40.22 ? 142  TRP A O   1 
ATOM   1083 C  CB  . TRP A 1 142 ? 20.066 2.850  16.272  1.00 39.97 ? 142  TRP A CB  1 
ATOM   1084 C  CG  . TRP A 1 142 ? 20.166 4.149  15.568  1.00 39.64 ? 142  TRP A CG  1 
ATOM   1085 C  CD1 . TRP A 1 142 ? 19.565 4.494  14.399  1.00 40.75 ? 142  TRP A CD1 1 
ATOM   1086 C  CD2 . TRP A 1 142 ? 20.913 5.286  15.991  1.00 37.69 ? 142  TRP A CD2 1 
ATOM   1087 N  NE1 . TRP A 1 142 ? 19.889 5.787  14.064  1.00 40.69 ? 142  TRP A NE1 1 
ATOM   1088 C  CE2 . TRP A 1 142 ? 20.720 6.295  15.026  1.00 37.74 ? 142  TRP A CE2 1 
ATOM   1089 C  CE3 . TRP A 1 142 ? 21.727 5.552  17.095  1.00 38.90 ? 142  TRP A CE3 1 
ATOM   1090 C  CZ2 . TRP A 1 142 ? 21.313 7.549  15.132  1.00 37.62 ? 142  TRP A CZ2 1 
ATOM   1091 C  CZ3 . TRP A 1 142 ? 22.317 6.797  17.199  1.00 39.07 ? 142  TRP A CZ3 1 
ATOM   1092 C  CH2 . TRP A 1 142 ? 22.106 7.780  16.225  1.00 38.21 ? 142  TRP A CH2 1 
ATOM   1093 N  N   . PHE A 1 143 ? 21.459 1.450  18.580  1.00 39.01 ? 143  PHE A N   1 
ATOM   1094 C  CA  . PHE A 1 143 ? 21.367 0.588  19.754  1.00 39.06 ? 143  PHE A CA  1 
ATOM   1095 C  C   . PHE A 1 143 ? 19.910 0.273  20.078  1.00 39.61 ? 143  PHE A C   1 
ATOM   1096 O  O   . PHE A 1 143 ? 19.012 1.062  19.779  1.00 39.17 ? 143  PHE A O   1 
ATOM   1097 C  CB  . PHE A 1 143 ? 22.051 1.242  20.967  1.00 38.22 ? 143  PHE A CB  1 
ATOM   1098 C  CG  . PHE A 1 143 ? 21.617 2.663  21.224  1.00 37.07 ? 143  PHE A CG  1 
ATOM   1099 C  CD1 . PHE A 1 143 ? 20.496 2.936  21.995  1.00 36.55 ? 143  PHE A CD1 1 
ATOM   1100 C  CD2 . PHE A 1 143 ? 22.335 3.728  20.691  1.00 36.23 ? 143  PHE A CD2 1 
ATOM   1101 C  CE1 . PHE A 1 143 ? 20.094 4.243  22.227  1.00 35.80 ? 143  PHE A CE1 1 
ATOM   1102 C  CE2 . PHE A 1 143 ? 21.938 5.039  20.917  1.00 35.01 ? 143  PHE A CE2 1 
ATOM   1103 C  CZ  . PHE A 1 143 ? 20.820 5.297  21.687  1.00 35.85 ? 143  PHE A CZ  1 
ATOM   1104 N  N   . GLU A 1 144 ? 19.686 -0.893 20.680  1.00 40.74 ? 144  GLU A N   1 
ATOM   1105 C  CA  . GLU A 1 144 ? 18.382 -1.240 21.237  1.00 41.90 ? 144  GLU A CA  1 
ATOM   1106 C  C   . GLU A 1 144 ? 18.170 -0.462 22.532  1.00 41.40 ? 144  GLU A C   1 
ATOM   1107 O  O   . GLU A 1 144 ? 19.141 -0.061 23.174  1.00 41.25 ? 144  GLU A O   1 
ATOM   1108 C  CB  . GLU A 1 144 ? 18.298 -2.742 21.524  1.00 43.31 ? 144  GLU A CB  1 
ATOM   1109 C  CG  . GLU A 1 144 ? 18.180 -3.609 20.280  1.00 45.92 ? 144  GLU A CG  1 
ATOM   1110 C  CD  . GLU A 1 144 ? 16.803 -3.535 19.643  1.00 48.97 ? 144  GLU A CD  1 
ATOM   1111 O  OE1 . GLU A 1 144 ? 15.829 -3.999 20.277  1.00 50.17 ? 144  GLU A OE1 1 
ATOM   1112 O  OE2 . GLU A 1 144 ? 16.699 -3.016 18.509  1.00 49.39 ? 144  GLU A OE2 1 
ATOM   1113 N  N   . PRO A 1 145 ? 16.903 -0.250 22.929  1.00 41.40 ? 145  PRO A N   1 
ATOM   1114 C  CA  . PRO A 1 145 ? 16.616 0.405  24.204  1.00 40.97 ? 145  PRO A CA  1 
ATOM   1115 C  C   . PRO A 1 145 ? 17.414 -0.205 25.355  1.00 41.03 ? 145  PRO A C   1 
ATOM   1116 O  O   . PRO A 1 145 ? 17.470 -1.428 25.476  1.00 42.11 ? 145  PRO A O   1 
ATOM   1117 C  CB  . PRO A 1 145 ? 15.121 0.147  24.400  1.00 41.73 ? 145  PRO A CB  1 
ATOM   1118 C  CG  . PRO A 1 145 ? 14.579 0.004  23.032  1.00 42.00 ? 145  PRO A CG  1 
ATOM   1119 C  CD  . PRO A 1 145 ? 15.671 -0.581 22.189  1.00 42.20 ? 145  PRO A CD  1 
ATOM   1120 N  N   . PHE A 1 146 ? 18.031 0.640  26.179  1.00 40.29 ? 146  PHE A N   1 
ATOM   1121 C  CA  . PHE A 1 146 ? 18.858 0.173  27.297  1.00 39.98 ? 146  PHE A CA  1 
ATOM   1122 C  C   . PHE A 1 146 ? 18.641 1.020  28.546  1.00 39.40 ? 146  PHE A C   1 
ATOM   1123 O  O   . PHE A 1 146 ? 17.819 1.938  28.545  1.00 38.95 ? 146  PHE A O   1 
ATOM   1124 C  CB  . PHE A 1 146 ? 20.341 0.181  26.903  1.00 39.67 ? 146  PHE A CB  1 
ATOM   1125 C  CG  . PHE A 1 146 ? 20.938 1.560  26.776  1.00 37.46 ? 146  PHE A CG  1 
ATOM   1126 C  CD1 . PHE A 1 146 ? 20.826 2.271  25.588  1.00 35.52 ? 146  PHE A CD1 1 
ATOM   1127 C  CD2 . PHE A 1 146 ? 21.626 2.138  27.838  1.00 36.86 ? 146  PHE A CD2 1 
ATOM   1128 C  CE1 . PHE A 1 146 ? 21.380 3.535  25.462  1.00 33.85 ? 146  PHE A CE1 1 
ATOM   1129 C  CE2 . PHE A 1 146 ? 22.182 3.405  27.718  1.00 35.54 ? 146  PHE A CE2 1 
ATOM   1130 C  CZ  . PHE A 1 146 ? 22.057 4.103  26.526  1.00 34.71 ? 146  PHE A CZ  1 
ATOM   1131 N  N   . LYS A 1 147 ? 19.375 0.695  29.608  1.00 39.72 ? 147  LYS A N   1 
ATOM   1132 C  CA  . LYS A 1 147 ? 19.342 1.477  30.839  1.00 40.02 ? 147  LYS A CA  1 
ATOM   1133 C  C   . LYS A 1 147 ? 20.714 1.554  31.500  1.00 40.05 ? 147  LYS A C   1 
ATOM   1134 O  O   . LYS A 1 147 ? 21.543 0.659  31.336  1.00 40.72 ? 147  LYS A O   1 
ATOM   1135 C  CB  . LYS A 1 147 ? 18.324 0.889  31.825  1.00 40.99 ? 147  LYS A CB  1 
ATOM   1136 C  CG  . LYS A 1 147 ? 18.664 -0.503 32.351  1.00 43.15 ? 147  LYS A CG  1 
ATOM   1137 C  CD  . LYS A 1 147 ? 17.737 -0.906 33.487  1.00 45.38 ? 147  LYS A CD  1 
ATOM   1138 C  CE  . LYS A 1 147 ? 18.184 -2.206 34.133  1.00 47.13 ? 147  LYS A CE  1 
ATOM   1139 N  NZ  . LYS A 1 147 ? 18.143 -3.345 33.175  1.00 47.31 ? 147  LYS A NZ  1 
ATOM   1140 N  N   . VAL A 1 148 ? 20.938 2.632  32.250  1.00 39.62 ? 148  VAL A N   1 
ATOM   1141 C  CA  . VAL A 1 148 ? 22.154 2.806  33.043  1.00 39.39 ? 148  VAL A CA  1 
ATOM   1142 C  C   . VAL A 1 148 ? 21.771 3.159  34.480  1.00 40.02 ? 148  VAL A C   1 
ATOM   1143 O  O   . VAL A 1 148 ? 20.899 3.997  34.706  1.00 39.55 ? 148  VAL A O   1 
ATOM   1144 C  CB  . VAL A 1 148 ? 23.090 3.896  32.453  1.00 38.60 ? 148  VAL A CB  1 
ATOM   1145 C  CG1 . VAL A 1 148 ? 23.759 3.391  31.184  1.00 37.58 ? 148  VAL A CG1 1 
ATOM   1146 C  CG2 . VAL A 1 148 ? 22.329 5.191  32.183  1.00 36.54 ? 148  VAL A CG2 1 
ATOM   1147 N  N   . ASP A 1 149 ? 22.414 2.501  35.443  1.00 41.40 ? 149  ASP A N   1 
ATOM   1148 C  CA  . ASP A 1 149 ? 22.130 2.710  36.861  1.00 42.25 ? 149  ASP A CA  1 
ATOM   1149 C  C   . ASP A 1 149 ? 23.185 3.618  37.484  1.00 41.98 ? 149  ASP A C   1 
ATOM   1150 O  O   . ASP A 1 149 ? 24.371 3.510  37.162  1.00 42.49 ? 149  ASP A O   1 
ATOM   1151 C  CB  . ASP A 1 149 ? 22.113 1.372  37.608  1.00 43.76 ? 149  ASP A CB  1 
ATOM   1152 C  CG  . ASP A 1 149 ? 21.097 0.388  37.040  1.00 46.41 ? 149  ASP A CG  1 
ATOM   1153 O  OD1 . ASP A 1 149 ? 20.295 0.773  36.163  1.00 49.99 ? 149  ASP A OD1 1 
ATOM   1154 O  OD2 . ASP A 1 149 ? 21.102 -0.782 37.478  1.00 51.07 ? 149  ASP A OD2 1 
ATOM   1155 N  N   . TYR A 1 150 ? 22.747 4.510  38.368  1.00 41.56 ? 150  TYR A N   1 
ATOM   1156 C  CA  . TYR A 1 150 ? 23.653 5.347  39.151  1.00 41.91 ? 150  TYR A CA  1 
ATOM   1157 C  C   . TYR A 1 150 ? 23.320 5.219  40.632  1.00 42.62 ? 150  TYR A C   1 
ATOM   1158 O  O   . TYR A 1 150 ? 22.218 4.802  40.994  1.00 43.13 ? 150  TYR A O   1 
ATOM   1159 C  CB  . TYR A 1 150 ? 23.544 6.816  38.739  1.00 41.31 ? 150  TYR A CB  1 
ATOM   1160 C  CG  . TYR A 1 150 ? 23.819 7.087  37.279  1.00 40.93 ? 150  TYR A CG  1 
ATOM   1161 C  CD1 . TYR A 1 150 ? 22.804 6.994  36.334  1.00 40.01 ? 150  TYR A CD1 1 
ATOM   1162 C  CD2 . TYR A 1 150 ? 25.088 7.457  36.846  1.00 42.57 ? 150  TYR A CD2 1 
ATOM   1163 C  CE1 . TYR A 1 150 ? 23.044 7.247  34.995  1.00 39.55 ? 150  TYR A CE1 1 
ATOM   1164 C  CE2 . TYR A 1 150 ? 25.341 7.714  35.504  1.00 42.70 ? 150  TYR A CE2 1 
ATOM   1165 C  CZ  . TYR A 1 150 ? 24.313 7.606  34.584  1.00 42.11 ? 150  TYR A CZ  1 
ATOM   1166 O  OH  . TYR A 1 150 ? 24.553 7.856  33.251  1.00 44.33 ? 150  TYR A OH  1 
ATOM   1167 N  N   . LYS A 1 151 ? 24.285 5.568  41.478  1.00 43.00 ? 151  LYS A N   1 
ATOM   1168 C  CA  . LYS A 1 151 ? 24.075 5.660  42.920  1.00 43.69 ? 151  LYS A CA  1 
ATOM   1169 C  C   . LYS A 1 151 ? 24.686 6.966  43.416  1.00 43.31 ? 151  LYS A C   1 
ATOM   1170 O  O   . LYS A 1 151 ? 25.840 7.271  43.109  1.00 43.18 ? 151  LYS A O   1 
ATOM   1171 C  CB  . LYS A 1 151 ? 24.707 4.471  43.648  1.00 44.86 ? 151  LYS A CB  1 
ATOM   1172 C  CG  . LYS A 1 151 ? 23.912 3.174  43.552  1.00 46.80 ? 151  LYS A CG  1 
ATOM   1173 C  CD  . LYS A 1 151 ? 24.569 2.058  44.367  1.00 50.08 ? 151  LYS A CD  1 
ATOM   1174 C  CE  . LYS A 1 151 ? 23.719 0.791  44.390  1.00 51.58 ? 151  LYS A CE  1 
ATOM   1175 N  NZ  . LYS A 1 151 ? 23.474 0.249  43.022  1.00 51.36 ? 151  LYS A NZ  1 
ATOM   1176 N  N   . PHE A 1 152 ? 23.905 7.739  44.166  1.00 43.18 ? 152  PHE A N   1 
ATOM   1177 C  CA  . PHE A 1 152 ? 24.390 8.997  44.728  1.00 42.99 ? 152  PHE A CA  1 
ATOM   1178 C  C   . PHE A 1 152 ? 23.730 9.316  46.063  1.00 43.59 ? 152  PHE A C   1 
ATOM   1179 O  O   . PHE A 1 152 ? 22.787 8.643  46.483  1.00 43.28 ? 152  PHE A O   1 
ATOM   1180 C  CB  . PHE A 1 152 ? 24.189 10.149 43.734  1.00 42.09 ? 152  PHE A CB  1 
ATOM   1181 C  CG  . PHE A 1 152 ? 22.763 10.633 43.623  1.00 39.75 ? 152  PHE A CG  1 
ATOM   1182 C  CD1 . PHE A 1 152 ? 21.807 9.881  42.958  1.00 36.55 ? 152  PHE A CD1 1 
ATOM   1183 C  CD2 . PHE A 1 152 ? 22.386 11.858 44.165  1.00 38.81 ? 152  PHE A CD2 1 
ATOM   1184 C  CE1 . PHE A 1 152 ? 20.502 10.333 42.848  1.00 35.53 ? 152  PHE A CE1 1 
ATOM   1185 C  CE2 . PHE A 1 152 ? 21.081 12.315 44.057  1.00 35.34 ? 152  PHE A CE2 1 
ATOM   1186 C  CZ  . PHE A 1 152 ? 20.140 11.553 43.398  1.00 34.91 ? 152  PHE A CZ  1 
ATOM   1187 N  N   . LYS A 1 153 ? 24.253 10.341 46.725  1.00 44.75 ? 153  LYS A N   1 
ATOM   1188 C  CA  . LYS A 1 153 ? 23.738 10.792 48.009  1.00 46.14 ? 153  LYS A CA  1 
ATOM   1189 C  C   . LYS A 1 153 ? 23.215 12.217 47.858  1.00 45.73 ? 153  LYS A C   1 
ATOM   1190 O  O   . LYS A 1 153 ? 23.985 13.149 47.617  1.00 45.79 ? 153  LYS A O   1 
ATOM   1191 C  CB  . LYS A 1 153 ? 24.840 10.726 49.074  1.00 47.46 ? 153  LYS A CB  1 
ATOM   1192 C  CG  . LYS A 1 153 ? 24.367 11.065 50.482  1.00 50.45 ? 153  LYS A CG  1 
ATOM   1193 C  CD  . LYS A 1 153 ? 25.445 10.800 51.520  1.00 55.02 ? 153  LYS A CD  1 
ATOM   1194 C  CE  . LYS A 1 153 ? 25.075 11.402 52.873  1.00 57.16 ? 153  LYS A CE  1 
ATOM   1195 N  NZ  . LYS A 1 153 ? 23.717 10.984 53.333  1.00 57.88 ? 153  LYS A NZ  1 
ATOM   1196 N  N   . TYR A 1 154 ? 21.902 12.379 47.982  1.00 45.86 ? 154  TYR A N   1 
ATOM   1197 C  CA  . TYR A 1 154 ? 21.283 13.697 47.893  1.00 45.96 ? 154  TYR A CA  1 
ATOM   1198 C  C   . TYR A 1 154 ? 21.479 14.448 49.207  1.00 47.70 ? 154  TYR A C   1 
ATOM   1199 O  O   . TYR A 1 154 ? 20.913 14.069 50.232  1.00 48.18 ? 154  TYR A O   1 
ATOM   1200 C  CB  . TYR A 1 154 ? 19.794 13.572 47.565  1.00 44.85 ? 154  TYR A CB  1 
ATOM   1201 C  CG  . TYR A 1 154 ? 19.087 14.902 47.481  1.00 41.94 ? 154  TYR A CG  1 
ATOM   1202 C  CD1 . TYR A 1 154 ? 19.473 15.856 46.547  1.00 39.10 ? 154  TYR A CD1 1 
ATOM   1203 C  CD2 . TYR A 1 154 ? 18.038 15.212 48.337  1.00 39.29 ? 154  TYR A CD2 1 
ATOM   1204 C  CE1 . TYR A 1 154 ? 18.836 17.078 46.468  1.00 36.79 ? 154  TYR A CE1 1 
ATOM   1205 C  CE2 . TYR A 1 154 ? 17.392 16.433 48.260  1.00 37.91 ? 154  TYR A CE2 1 
ATOM   1206 C  CZ  . TYR A 1 154 ? 17.796 17.360 47.325  1.00 35.78 ? 154  TYR A CZ  1 
ATOM   1207 O  OH  . TYR A 1 154 ? 17.157 18.571 47.248  1.00 37.54 ? 154  TYR A OH  1 
ATOM   1208 N  N   . THR A 1 155 ? 22.282 15.509 49.169  1.00 49.47 ? 155  THR A N   1 
ATOM   1209 C  CA  . THR A 1 155 ? 22.645 16.257 50.375  1.00 51.43 ? 155  THR A CA  1 
ATOM   1210 C  C   . THR A 1 155 ? 21.728 17.454 50.647  1.00 53.02 ? 155  THR A C   1 
ATOM   1211 O  O   . THR A 1 155 ? 21.880 18.128 51.665  1.00 53.51 ? 155  THR A O   1 
ATOM   1212 C  CB  . THR A 1 155 ? 24.108 16.747 50.299  1.00 51.73 ? 155  THR A CB  1 
ATOM   1213 O  OG1 . THR A 1 155 ? 24.305 17.483 49.087  1.00 50.95 ? 155  THR A OG1 1 
ATOM   1214 C  CG2 . THR A 1 155 ? 25.070 15.568 50.330  1.00 51.07 ? 155  THR A CG2 1 
ATOM   1215 N  N   . GLY A 1 156 ? 20.782 17.712 49.744  1.00 54.69 ? 156  GLY A N   1 
ATOM   1216 C  CA  . GLY A 1 156 ? 19.821 18.805 49.908  1.00 56.70 ? 156  GLY A CA  1 
ATOM   1217 C  C   . GLY A 1 156 ? 19.833 19.783 48.747  1.00 58.46 ? 156  GLY A C   1 
ATOM   1218 O  O   . GLY A 1 156 ? 20.753 19.773 47.927  1.00 58.52 ? 156  GLY A O   1 
ATOM   1219 N  N   . THR A 1 157 ? 18.807 20.632 48.689  1.00 60.95 ? 157  THR A N   1 
ATOM   1220 C  CA  . THR A 1 157 ? 18.649 21.608 47.603  1.00 62.79 ? 157  THR A CA  1 
ATOM   1221 C  C   . THR A 1 157 ? 19.768 22.662 47.625  1.00 65.29 ? 157  THR A C   1 
ATOM   1222 O  O   . THR A 1 157 ? 20.070 23.212 48.688  1.00 65.85 ? 157  THR A O   1 
ATOM   1223 C  CB  . THR A 1 157 ? 17.263 22.315 47.655  1.00 62.96 ? 157  THR A CB  1 
ATOM   1224 O  OG1 . THR A 1 157 ? 17.185 23.307 46.622  1.00 62.84 ? 157  THR A OG1 1 
ATOM   1225 C  CG2 . THR A 1 157 ? 17.018 22.972 49.016  1.00 62.75 ? 157  THR A CG2 1 
ATOM   1226 N  N   . PRO A 1 158 ? 20.390 22.940 46.454  1.00 67.28 ? 158  PRO A N   1 
ATOM   1227 C  CA  . PRO A 1 158 ? 21.514 23.881 46.402  1.00 69.65 ? 158  PRO A CA  1 
ATOM   1228 C  C   . PRO A 1 158 ? 21.156 25.337 46.040  1.00 72.08 ? 158  PRO A C   1 
ATOM   1229 O  O   . PRO A 1 158 ? 22.062 26.162 45.889  1.00 73.07 ? 158  PRO A O   1 
ATOM   1230 C  CB  . PRO A 1 158 ? 22.409 23.269 45.317  1.00 69.33 ? 158  PRO A CB  1 
ATOM   1231 C  CG  . PRO A 1 158 ? 21.457 22.567 44.387  1.00 67.46 ? 158  PRO A CG  1 
ATOM   1232 C  CD  . PRO A 1 158 ? 20.171 22.300 45.141  1.00 66.39 ? 158  PRO A CD  1 
ATOM   1233 N  N   . LYS A 1 159 ? 19.865 25.652 45.918  1.00 63.76 ? 159  LYS A N   1 
ATOM   1234 C  CA  . LYS A 1 159 ? 19.429 26.988 45.471  1.00 65.16 ? 159  LYS A CA  1 
ATOM   1235 C  C   . LYS A 1 159 ? 19.670 28.081 46.518  1.00 65.40 ? 159  LYS A C   1 
ATOM   1236 O  O   . LYS A 1 159 ? 19.416 27.891 47.708  1.00 65.84 ? 159  LYS A O   1 
ATOM   1237 C  CB  . LYS A 1 159 ? 17.950 26.970 45.049  1.00 65.66 ? 159  LYS A CB  1 
ATOM   1238 C  CG  . LYS A 1 159 ? 16.947 26.746 46.182  1.00 68.18 ? 159  LYS A CG  1 
ATOM   1239 C  CD  . LYS A 1 159 ? 15.558 26.411 45.645  1.00 70.57 ? 159  LYS A CD  1 
ATOM   1240 C  CE  . LYS A 1 159 ? 14.610 25.991 46.762  1.00 71.81 ? 159  LYS A CE  1 
ATOM   1241 N  NZ  . LYS A 1 159 ? 13.310 25.478 46.237  1.00 73.00 ? 159  LYS A NZ  1 
ATOM   1242 N  N   . GLY B 1 2   ? 30.551 11.647 -4.455  1.00 51.85 ? 2    GLY B N   1 
ATOM   1243 C  CA  . GLY B 1 2   ? 30.739 13.078 -4.841  1.00 51.96 ? 2    GLY B CA  1 
ATOM   1244 C  C   . GLY B 1 2   ? 29.863 14.018 -4.030  1.00 51.78 ? 2    GLY B C   1 
ATOM   1245 O  O   . GLY B 1 2   ? 28.843 13.600 -3.473  1.00 51.81 ? 2    GLY B O   1 
ATOM   1246 N  N   . GLU B 1 3   ? 30.266 15.288 -3.968  1.00 67.06 ? 3    GLU B N   1 
ATOM   1247 C  CA  . GLU B 1 3   ? 29.531 16.318 -3.225  1.00 65.12 ? 3    GLU B CA  1 
ATOM   1248 C  C   . GLU B 1 3   ? 29.729 17.694 -3.875  1.00 63.94 ? 3    GLU B C   1 
ATOM   1249 O  O   . GLU B 1 3   ? 30.817 18.265 -3.806  1.00 64.84 ? 3    GLU B O   1 
ATOM   1250 C  CB  . GLU B 1 3   ? 29.992 16.347 -1.759  1.00 65.22 ? 3    GLU B CB  1 
ATOM   1251 C  CG  . GLU B 1 3   ? 28.907 16.780 -0.776  1.00 65.93 ? 3    GLU B CG  1 
ATOM   1252 C  CD  . GLU B 1 3   ? 29.438 17.070 0.620   1.00 68.61 ? 3    GLU B CD  1 
ATOM   1253 O  OE1 . GLU B 1 3   ? 29.977 18.177 0.837   1.00 71.03 ? 3    GLU B OE1 1 
ATOM   1254 O  OE2 . GLU B 1 3   ? 29.297 16.199 1.507   1.00 70.33 ? 3    GLU B OE2 1 
ATOM   1255 N  N   . VAL B 1 4   ? 28.679 18.215 -4.510  1.00 61.87 ? 4    VAL B N   1 
ATOM   1256 C  CA  . VAL B 1 4   ? 28.748 19.501 -5.210  1.00 61.05 ? 4    VAL B CA  1 
ATOM   1257 C  C   . VAL B 1 4   ? 28.149 20.621 -4.350  1.00 59.16 ? 4    VAL B C   1 
ATOM   1258 O  O   . VAL B 1 4   ? 27.000 20.521 -3.923  1.00 58.17 ? 4    VAL B O   1 
ATOM   1259 C  CB  . VAL B 1 4   ? 27.998 19.443 -6.558  1.00 61.07 ? 4    VAL B CB  1 
ATOM   1260 C  CG1 . VAL B 1 4   ? 28.137 20.762 -7.309  1.00 61.85 ? 4    VAL B CG1 1 
ATOM   1261 C  CG2 . VAL B 1 4   ? 28.517 18.293 -7.406  1.00 61.74 ? 4    VAL B CG2 1 
ATOM   1262 N  N   . PRO B 1 5   ? 28.922 21.697 -4.101  1.00 58.64 ? 5    PRO B N   1 
ATOM   1263 C  CA  . PRO B 1 5   ? 28.442 22.783 -3.243  1.00 57.14 ? 5    PRO B CA  1 
ATOM   1264 C  C   . PRO B 1 5   ? 27.422 23.689 -3.936  1.00 56.16 ? 5    PRO B C   1 
ATOM   1265 O  O   . PRO B 1 5   ? 27.460 23.845 -5.158  1.00 56.59 ? 5    PRO B O   1 
ATOM   1266 C  CB  . PRO B 1 5   ? 29.720 23.562 -2.928  1.00 58.15 ? 5    PRO B CB  1 
ATOM   1267 C  CG  . PRO B 1 5   ? 30.577 23.362 -4.123  1.00 59.66 ? 5    PRO B CG  1 
ATOM   1268 C  CD  . PRO B 1 5   ? 30.266 21.982 -4.641  1.00 60.01 ? 5    PRO B CD  1 
ATOM   1269 N  N   . ILE B 1 6   ? 26.526 24.280 -3.147  1.00 54.49 ? 6    ILE B N   1 
ATOM   1270 C  CA  . ILE B 1 6   ? 25.492 25.176 -3.661  1.00 53.58 ? 6    ILE B CA  1 
ATOM   1271 C  C   . ILE B 1 6   ? 25.687 26.584 -3.101  1.00 53.70 ? 6    ILE B C   1 
ATOM   1272 O  O   . ILE B 1 6   ? 25.374 26.844 -1.939  1.00 53.02 ? 6    ILE B O   1 
ATOM   1273 C  CB  . ILE B 1 6   ? 24.077 24.667 -3.296  1.00 52.48 ? 6    ILE B CB  1 
ATOM   1274 C  CG1 . ILE B 1 6   ? 23.802 23.323 -3.978  1.00 51.44 ? 6    ILE B CG1 1 
ATOM   1275 C  CG2 . ILE B 1 6   ? 23.013 25.687 -3.692  1.00 51.08 ? 6    ILE B CG2 1 
ATOM   1276 C  CD1 . ILE B 1 6   ? 22.444 22.736 -3.649  1.00 49.86 ? 6    ILE B CD1 1 
ATOM   1277 N  N   . GLY B 1 7   ? 26.219 27.481 -3.929  1.00 54.57 ? 7    GLY B N   1 
ATOM   1278 C  CA  . GLY B 1 7   ? 26.362 28.891 -3.567  1.00 55.14 ? 7    GLY B CA  1 
ATOM   1279 C  C   . GLY B 1 7   ? 27.313 29.153 -2.412  1.00 55.43 ? 7    GLY B C   1 
ATOM   1280 O  O   . GLY B 1 7   ? 28.163 28.321 -2.094  1.00 55.33 ? 7    GLY B O   1 
ATOM   1281 N  N   . ASP B 1 8   ? 27.162 30.322 -1.789  1.00 55.98 ? 8    ASP B N   1 
ATOM   1282 C  CA  . ASP B 1 8   ? 27.981 30.724 -0.643  1.00 56.33 ? 8    ASP B CA  1 
ATOM   1283 C  C   . ASP B 1 8   ? 27.279 30.364 0.665   1.00 54.71 ? 8    ASP B C   1 
ATOM   1284 O  O   . ASP B 1 8   ? 26.060 30.504 0.765   1.00 53.98 ? 8    ASP B O   1 
ATOM   1285 C  CB  . ASP B 1 8   ? 28.236 32.238 -0.664  1.00 57.97 ? 8    ASP B CB  1 
ATOM   1286 C  CG  . ASP B 1 8   ? 29.046 32.691 -1.872  1.00 60.92 ? 8    ASP B CG  1 
ATOM   1287 O  OD1 . ASP B 1 8   ? 29.865 31.901 -2.392  1.00 62.52 ? 8    ASP B OD1 1 
ATOM   1288 O  OD2 . ASP B 1 8   ? 28.868 33.854 -2.294  1.00 63.65 ? 8    ASP B OD2 1 
ATOM   1289 N  N   . PRO B 1 9   ? 28.045 29.914 1.679   1.00 54.11 ? 9    PRO B N   1 
ATOM   1290 C  CA  . PRO B 1 9   ? 27.466 29.662 2.999   1.00 52.58 ? 9    PRO B CA  1 
ATOM   1291 C  C   . PRO B 1 9   ? 27.229 30.962 3.778   1.00 52.36 ? 9    PRO B C   1 
ATOM   1292 O  O   . PRO B 1 9   ? 28.144 31.782 3.903   1.00 52.90 ? 9    PRO B O   1 
ATOM   1293 C  CB  . PRO B 1 9   ? 28.527 28.802 3.687   1.00 52.34 ? 9    PRO B CB  1 
ATOM   1294 C  CG  . PRO B 1 9   ? 29.806 29.228 3.071   1.00 54.40 ? 9    PRO B CG  1 
ATOM   1295 C  CD  . PRO B 1 9   ? 29.488 29.607 1.646   1.00 54.90 ? 9    PRO B CD  1 
ATOM   1296 N  N   . LYS B 1 10  ? 26.011 31.138 4.292   1.00 51.23 ? 10   LYS B N   1 
ATOM   1297 C  CA  . LYS B 1 10  ? 25.624 32.360 5.004   1.00 50.92 ? 10   LYS B CA  1 
ATOM   1298 C  C   . LYS B 1 10  ? 25.987 32.275 6.483   1.00 49.53 ? 10   LYS B C   1 
ATOM   1299 O  O   . LYS B 1 10  ? 26.055 31.185 7.051   1.00 48.52 ? 10   LYS B O   1 
ATOM   1300 C  CB  . LYS B 1 10  ? 24.116 32.612 4.876   1.00 50.79 ? 10   LYS B CB  1 
ATOM   1301 C  CG  . LYS B 1 10  ? 23.568 32.624 3.449   1.00 53.08 ? 10   LYS B CG  1 
ATOM   1302 C  CD  . LYS B 1 10  ? 24.177 33.736 2.597   1.00 56.13 ? 10   LYS B CD  1 
ATOM   1303 C  CE  . LYS B 1 10  ? 23.471 33.858 1.245   1.00 56.90 ? 10   LYS B CE  1 
ATOM   1304 N  NZ  . LYS B 1 10  ? 23.453 32.571 0.488   1.00 54.93 ? 10   LYS B NZ  1 
ATOM   1305 N  N   . GLU B 1 11  ? 26.217 33.434 7.096   1.00 49.40 ? 11   GLU B N   1 
ATOM   1306 C  CA  . GLU B 1 11  ? 26.406 33.537 8.541   1.00 48.51 ? 11   GLU B CA  1 
ATOM   1307 C  C   . GLU B 1 11  ? 25.316 34.430 9.133   1.00 47.43 ? 11   GLU B C   1 
ATOM   1308 O  O   . GLU B 1 11  ? 25.428 35.658 9.121   1.00 48.49 ? 11   GLU B O   1 
ATOM   1309 C  CB  . GLU B 1 11  ? 27.798 34.084 8.872   1.00 49.72 ? 11   GLU B CB  1 
ATOM   1310 C  CG  . GLU B 1 11  ? 28.939 33.182 8.397   1.00 52.00 ? 11   GLU B CG  1 
ATOM   1311 C  CD  . GLU B 1 11  ? 30.262 33.451 9.106   1.00 55.43 ? 11   GLU B CD  1 
ATOM   1312 O  OE1 . GLU B 1 11  ? 30.452 34.565 9.649   1.00 57.83 ? 11   GLU B OE1 1 
ATOM   1313 O  OE2 . GLU B 1 11  ? 31.115 32.538 9.116   1.00 55.68 ? 11   GLU B OE2 1 
ATOM   1314 N  N   . LEU B 1 12  ? 24.255 33.800 9.631   1.00 45.39 ? 12   LEU B N   1 
ATOM   1315 C  CA  . LEU B 1 12  ? 23.099 34.511 10.177  1.00 44.71 ? 12   LEU B CA  1 
ATOM   1316 C  C   . LEU B 1 12  ? 22.640 33.877 11.487  1.00 42.58 ? 12   LEU B C   1 
ATOM   1317 O  O   . LEU B 1 12  ? 22.680 32.658 11.635  1.00 41.06 ? 12   LEU B O   1 
ATOM   1318 C  CB  . LEU B 1 12  ? 21.942 34.487 9.171   1.00 44.87 ? 12   LEU B CB  1 
ATOM   1319 C  CG  . LEU B 1 12  ? 22.172 35.195 7.834   1.00 45.72 ? 12   LEU B CG  1 
ATOM   1320 C  CD1 . LEU B 1 12  ? 21.132 34.764 6.814   1.00 47.69 ? 12   LEU B CD1 1 
ATOM   1321 C  CD2 . LEU B 1 12  ? 22.161 36.709 8.011   1.00 47.28 ? 12   LEU B CD2 1 
ATOM   1322 N  N   . ASN B 1 13  ? 22.209 34.715 12.428  1.00 42.27 ? 13   ASN B N   1 
ATOM   1323 C  CA  . ASN B 1 13  ? 21.602 34.261 13.684  1.00 41.14 ? 13   ASN B CA  1 
ATOM   1324 C  C   . ASN B 1 13  ? 22.472 33.268 14.463  1.00 40.02 ? 13   ASN B C   1 
ATOM   1325 O  O   . ASN B 1 13  ? 21.978 32.260 14.972  1.00 39.20 ? 13   ASN B O   1 
ATOM   1326 C  CB  . ASN B 1 13  ? 20.214 33.659 13.414  1.00 40.38 ? 13   ASN B CB  1 
ATOM   1327 C  CG  . ASN B 1 13  ? 19.277 34.635 12.717  1.00 40.34 ? 13   ASN B CG  1 
ATOM   1328 O  OD1 . ASN B 1 13  ? 19.096 35.767 13.166  1.00 38.12 ? 13   ASN B OD1 1 
ATOM   1329 N  ND2 . ASN B 1 13  ? 18.669 34.195 11.619  1.00 37.17 ? 13   ASN B ND2 1 
ATOM   1330 N  N   . GLY B 1 14  ? 23.766 33.565 14.551  1.00 40.05 ? 14   GLY B N   1 
ATOM   1331 C  CA  . GLY B 1 14  ? 24.717 32.716 15.272  1.00 39.28 ? 14   GLY B CA  1 
ATOM   1332 C  C   . GLY B 1 14  ? 24.886 31.322 14.690  1.00 38.14 ? 14   GLY B C   1 
ATOM   1333 O  O   . GLY B 1 14  ? 25.197 30.381 15.420  1.00 37.11 ? 14   GLY B O   1 
ATOM   1334 N  N   . MET B 1 15  ? 24.685 31.194 13.377  1.00 38.31 ? 15   MET B N   1 
ATOM   1335 C  CA  . MET B 1 15  ? 24.770 29.908 12.679  1.00 37.85 ? 15   MET B CA  1 
ATOM   1336 C  C   . MET B 1 15  ? 25.438 30.049 11.310  1.00 38.54 ? 15   MET B C   1 
ATOM   1337 O  O   . MET B 1 15  ? 25.249 31.048 10.620  1.00 38.68 ? 15   MET B O   1 
ATOM   1338 C  CB  . MET B 1 15  ? 23.371 29.316 12.477  1.00 37.20 ? 15   MET B CB  1 
ATOM   1339 C  CG  . MET B 1 15  ? 22.603 29.037 13.758  1.00 37.21 ? 15   MET B CG  1 
ATOM   1340 S  SD  . MET B 1 15  ? 20.963 28.349 13.454  1.00 35.70 ? 15   MET B SD  1 
ATOM   1341 C  CE  . MET B 1 15  ? 20.158 29.728 12.643  1.00 34.10 ? 15   MET B CE  1 
ATOM   1342 N  N   . GLU B 1 16  ? 26.217 29.038 10.928  1.00 39.55 ? 16   GLU B N   1 
ATOM   1343 C  CA  . GLU B 1 16  ? 26.754 28.929 9.576   1.00 40.79 ? 16   GLU B CA  1 
ATOM   1344 C  C   . GLU B 1 16  ? 25.832 28.014 8.777   1.00 40.39 ? 16   GLU B C   1 
ATOM   1345 O  O   . GLU B 1 16  ? 25.733 26.823 9.068   1.00 39.96 ? 16   GLU B O   1 
ATOM   1346 C  CB  . GLU B 1 16  ? 28.168 28.343 9.590   1.00 41.56 ? 16   GLU B CB  1 
ATOM   1347 C  CG  . GLU B 1 16  ? 28.850 28.340 8.215   1.00 44.33 ? 16   GLU B CG  1 
ATOM   1348 C  CD  . GLU B 1 16  ? 30.085 27.458 8.158   1.00 47.34 ? 16   GLU B CD  1 
ATOM   1349 O  OE1 . GLU B 1 16  ? 30.164 26.476 8.930   1.00 49.07 ? 16   GLU B OE1 1 
ATOM   1350 O  OE2 . GLU B 1 16  ? 30.973 27.741 7.326   1.00 48.38 ? 16   GLU B OE2 1 
ATOM   1351 N  N   . ILE B 1 17  ? 25.167 28.578 7.773   1.00 40.81 ? 17   ILE B N   1 
ATOM   1352 C  CA  . ILE B 1 17  ? 24.198 27.843 6.966   1.00 40.72 ? 17   ILE B CA  1 
ATOM   1353 C  C   . ILE B 1 17  ? 24.757 27.619 5.563   1.00 41.19 ? 17   ILE B C   1 
ATOM   1354 O  O   . ILE B 1 17  ? 25.001 28.577 4.828   1.00 41.97 ? 17   ILE B O   1 
ATOM   1355 C  CB  . ILE B 1 17  ? 22.858 28.608 6.861   1.00 40.88 ? 17   ILE B CB  1 
ATOM   1356 C  CG1 . ILE B 1 17  ? 22.426 29.133 8.236   1.00 40.61 ? 17   ILE B CG1 1 
ATOM   1357 C  CG2 . ILE B 1 17  ? 21.782 27.709 6.263   1.00 39.11 ? 17   ILE B CG2 1 
ATOM   1358 C  CD1 . ILE B 1 17  ? 21.193 29.999 8.193   1.00 41.93 ? 17   ILE B CD1 1 
ATOM   1359 N  N   . ALA B 1 18  ? 24.958 26.354 5.201   1.00 40.67 ? 18   ALA B N   1 
ATOM   1360 C  CA  . ALA B 1 18  ? 25.491 25.990 3.890   1.00 40.98 ? 18   ALA B CA  1 
ATOM   1361 C  C   . ALA B 1 18  ? 24.599 24.954 3.211   1.00 40.74 ? 18   ALA B C   1 
ATOM   1362 O  O   . ALA B 1 18  ? 23.761 24.318 3.856   1.00 40.41 ? 18   ALA B O   1 
ATOM   1363 C  CB  . ALA B 1 18  ? 26.906 25.458 4.029   1.00 41.07 ? 18   ALA B CB  1 
ATOM   1364 N  N   . ALA B 1 19  ? 24.789 24.793 1.905   1.00 40.89 ? 19   ALA B N   1 
ATOM   1365 C  CA  . ALA B 1 19  ? 23.996 23.859 1.120   1.00 40.39 ? 19   ALA B CA  1 
ATOM   1366 C  C   . ALA B 1 19  ? 24.875 23.086 0.140   1.00 40.99 ? 19   ALA B C   1 
ATOM   1367 O  O   . ALA B 1 19  ? 25.735 23.665 -0.528  1.00 41.74 ? 19   ALA B O   1 
ATOM   1368 C  CB  . ALA B 1 19  ? 22.903 24.605 0.375   1.00 40.50 ? 19   ALA B CB  1 
ATOM   1369 N  N   . VAL B 1 20  ? 24.658 21.774 0.075   1.00 40.83 ? 20   VAL B N   1 
ATOM   1370 C  CA  . VAL B 1 20  ? 25.332 20.903 -0.890  1.00 41.57 ? 20   VAL B CA  1 
ATOM   1371 C  C   . VAL B 1 20  ? 24.352 19.833 -1.370  1.00 41.36 ? 20   VAL B C   1 
ATOM   1372 O  O   . VAL B 1 20  ? 23.300 19.642 -0.757  1.00 40.61 ? 20   VAL B O   1 
ATOM   1373 C  CB  . VAL B 1 20  ? 26.562 20.205 -0.266  1.00 41.86 ? 20   VAL B CB  1 
ATOM   1374 C  CG1 . VAL B 1 20  ? 27.580 21.231 0.214   1.00 42.44 ? 20   VAL B CG1 1 
ATOM   1375 C  CG2 . VAL B 1 20  ? 26.139 19.298 0.877   1.00 41.04 ? 20   VAL B CG2 1 
ATOM   1376 N  N   . TYR B 1 21  ? 24.688 19.150 -2.463  1.00 41.97 ? 21   TYR B N   1 
ATOM   1377 C  CA  . TYR B 1 21  ? 23.894 18.005 -2.921  1.00 42.20 ? 21   TYR B CA  1 
ATOM   1378 C  C   . TYR B 1 21  ? 24.776 16.846 -3.387  1.00 43.26 ? 21   TYR B C   1 
ATOM   1379 O  O   . TYR B 1 21  ? 25.851 17.062 -3.941  1.00 43.95 ? 21   TYR B O   1 
ATOM   1380 C  CB  . TYR B 1 21  ? 22.891 18.416 -4.012  1.00 42.24 ? 21   TYR B CB  1 
ATOM   1381 C  CG  . TYR B 1 21  ? 23.479 18.721 -5.378  1.00 43.36 ? 21   TYR B CG  1 
ATOM   1382 C  CD1 . TYR B 1 21  ? 23.928 20.000 -5.697  1.00 44.80 ? 21   TYR B CD1 1 
ATOM   1383 C  CD2 . TYR B 1 21  ? 23.558 17.737 -6.361  1.00 43.75 ? 21   TYR B CD2 1 
ATOM   1384 C  CE1 . TYR B 1 21  ? 24.456 20.287 -6.955  1.00 44.67 ? 21   TYR B CE1 1 
ATOM   1385 C  CE2 . TYR B 1 21  ? 24.087 18.016 -7.619  1.00 44.63 ? 21   TYR B CE2 1 
ATOM   1386 C  CZ  . TYR B 1 21  ? 24.533 19.291 -7.908  1.00 44.09 ? 21   TYR B CZ  1 
ATOM   1387 O  OH  . TYR B 1 21  ? 25.057 19.571 -9.147  1.00 45.44 ? 21   TYR B OH  1 
ATOM   1388 N  N   . LEU B 1 22  ? 24.309 15.622 -3.145  1.00 43.89 ? 22   LEU B N   1 
ATOM   1389 C  CA  . LEU B 1 22  ? 25.048 14.411 -3.503  1.00 45.18 ? 22   LEU B CA  1 
ATOM   1390 C  C   . LEU B 1 22  ? 24.190 13.490 -4.363  1.00 45.67 ? 22   LEU B C   1 
ATOM   1391 O  O   . LEU B 1 22  ? 23.068 13.832 -4.732  1.00 44.74 ? 22   LEU B O   1 
ATOM   1392 C  CB  . LEU B 1 22  ? 25.486 13.644 -2.248  1.00 45.50 ? 22   LEU B CB  1 
ATOM   1393 C  CG  . LEU B 1 22  ? 25.840 14.419 -0.979  1.00 45.05 ? 22   LEU B CG  1 
ATOM   1394 C  CD1 . LEU B 1 22  ? 24.591 14.802 -0.211  1.00 44.85 ? 22   LEU B CD1 1 
ATOM   1395 C  CD2 . LEU B 1 22  ? 26.754 13.586 -0.095  1.00 46.34 ? 22   LEU B CD2 1 
ATOM   1396 N  N   . GLN B 1 23  ? 24.739 12.319 -4.677  1.00 47.28 ? 23   GLN B N   1 
ATOM   1397 C  CA  . GLN B 1 23  ? 23.980 11.241 -5.305  1.00 48.00 ? 23   GLN B CA  1 
ATOM   1398 C  C   . GLN B 1 23  ? 22.879 10.781 -4.349  1.00 47.15 ? 23   GLN B C   1 
ATOM   1399 O  O   . GLN B 1 23  ? 22.988 10.996 -3.141  1.00 46.02 ? 23   GLN B O   1 
ATOM   1400 C  CB  . GLN B 1 23  ? 24.902 10.064 -5.694  1.00 49.78 ? 23   GLN B CB  1 
ATOM   1401 C  CG  . GLN B 1 23  ? 25.502 9.233  -4.528  1.00 51.81 ? 23   GLN B CG  1 
ATOM   1402 C  CD  . GLN B 1 23  ? 26.719 9.878  -3.854  1.00 54.47 ? 23   GLN B CD  1 
ATOM   1403 O  OE1 . GLN B 1 23  ? 27.037 11.047 -4.087  1.00 53.92 ? 23   GLN B OE1 1 
ATOM   1404 N  NE2 . GLN B 1 23  ? 27.398 9.109  -3.004  1.00 56.39 ? 23   GLN B NE2 1 
ATOM   1405 N  N   . PRO B 1 24  ? 21.812 10.157 -4.881  1.00 47.77 ? 24   PRO B N   1 
ATOM   1406 C  CA  . PRO B 1 24  ? 20.736 9.682  -4.010  1.00 47.71 ? 24   PRO B CA  1 
ATOM   1407 C  C   . PRO B 1 24  ? 21.253 8.729  -2.933  1.00 48.56 ? 24   PRO B C   1 
ATOM   1408 O  O   . PRO B 1 24  ? 22.007 7.801  -3.239  1.00 49.68 ? 24   PRO B O   1 
ATOM   1409 C  CB  . PRO B 1 24  ? 19.794 8.951  -4.975  1.00 48.10 ? 24   PRO B CB  1 
ATOM   1410 C  CG  . PRO B 1 24  ? 20.088 9.514  -6.303  1.00 48.06 ? 24   PRO B CG  1 
ATOM   1411 C  CD  . PRO B 1 24  ? 21.543 9.851  -6.297  1.00 48.31 ? 24   PRO B CD  1 
ATOM   1412 N  N   . ILE B 1 25  ? 20.853 8.971  -1.687  1.00 48.25 ? 25   ILE B N   1 
ATOM   1413 C  CA  . ILE B 1 25  ? 21.344 8.208  -0.545  1.00 49.09 ? 25   ILE B CA  1 
ATOM   1414 C  C   . ILE B 1 25  ? 20.289 7.228  -0.053  1.00 50.27 ? 25   ILE B C   1 
ATOM   1415 O  O   . ILE B 1 25  ? 19.168 7.627  0.269   1.00 49.57 ? 25   ILE B O   1 
ATOM   1416 C  CB  . ILE B 1 25  ? 21.719 9.135  0.629   1.00 48.08 ? 25   ILE B CB  1 
ATOM   1417 C  CG1 . ILE B 1 25  ? 22.808 10.131 0.208   1.00 47.29 ? 25   ILE B CG1 1 
ATOM   1418 C  CG2 . ILE B 1 25  ? 22.172 8.314  1.829   1.00 48.71 ? 25   ILE B CG2 1 
ATOM   1419 C  CD1 . ILE B 1 25  ? 24.117 9.487  -0.217  1.00 46.22 ? 25   ILE B CD1 1 
ATOM   1420 N  N   . GLU B 1 26  ? 20.657 5.949  0.009   1.00 52.37 ? 26   GLU B N   1 
ATOM   1421 C  CA  . GLU B 1 26  ? 19.784 4.933  0.583   1.00 54.04 ? 26   GLU B CA  1 
ATOM   1422 C  C   . GLU B 1 26  ? 19.713 5.186  2.089   1.00 54.04 ? 26   GLU B C   1 
ATOM   1423 O  O   . GLU B 1 26  ? 20.737 5.168  2.775   1.00 54.02 ? 26   GLU B O   1 
ATOM   1424 C  CB  . GLU B 1 26  ? 20.304 3.522  0.281   1.00 55.79 ? 26   GLU B CB  1 
ATOM   1425 C  CG  . GLU B 1 26  ? 19.205 2.469  0.191   1.00 58.38 ? 26   GLU B CG  1 
ATOM   1426 C  CD  . GLU B 1 26  ? 18.354 2.617  -1.063  1.00 60.59 ? 26   GLU B CD  1 
ATOM   1427 O  OE1 . GLU B 1 26  ? 18.873 2.356  -2.170  1.00 62.92 ? 26   GLU B OE1 1 
ATOM   1428 O  OE2 . GLU B 1 26  ? 17.166 2.989  -0.941  1.00 61.36 ? 26   GLU B OE2 1 
ATOM   1429 N  N   . MET B 1 27  ? 18.504 5.436  2.589   1.00 54.31 ? 27   MET B N   1 
ATOM   1430 C  CA  . MET B 1 27  ? 18.306 5.900  3.960   1.00 54.42 ? 27   MET B CA  1 
ATOM   1431 C  C   . MET B 1 27  ? 17.409 4.950  4.753   1.00 55.27 ? 27   MET B C   1 
ATOM   1432 O  O   . MET B 1 27  ? 16.573 4.249  4.179   1.00 55.67 ? 27   MET B O   1 
ATOM   1433 C  CB  . MET B 1 27  ? 17.686 7.300  3.939   1.00 53.59 ? 27   MET B CB  1 
ATOM   1434 C  CG  . MET B 1 27  ? 18.240 8.236  4.997   1.00 54.95 ? 27   MET B CG  1 
ATOM   1435 S  SD  . MET B 1 27  ? 17.137 9.617  5.344   1.00 60.83 ? 27   MET B SD  1 
ATOM   1436 C  CE  . MET B 1 27  ? 15.871 8.794  6.311   1.00 58.57 ? 27   MET B CE  1 
ATOM   1437 N  N   . GLU B 1 28  ? 17.599 4.929  6.071   1.00 55.85 ? 28   GLU B N   1 
ATOM   1438 C  CA  . GLU B 1 28  ? 16.739 4.167  6.979   1.00 57.33 ? 28   GLU B CA  1 
ATOM   1439 C  C   . GLU B 1 28  ? 16.347 5.011  8.195   1.00 57.25 ? 28   GLU B C   1 
ATOM   1440 O  O   . GLU B 1 28  ? 17.120 5.863  8.629   1.00 56.32 ? 28   GLU B O   1 
ATOM   1441 C  CB  . GLU B 1 28  ? 17.426 2.875  7.426   1.00 58.53 ? 28   GLU B CB  1 
ATOM   1442 C  CG  . GLU B 1 28  ? 17.458 1.800  6.348   1.00 60.24 ? 28   GLU B CG  1 
ATOM   1443 C  CD  . GLU B 1 28  ? 17.488 0.393  6.917   1.00 63.10 ? 28   GLU B CD  1 
ATOM   1444 O  OE1 . GLU B 1 28  ? 18.302 0.131  7.828   1.00 64.21 ? 28   GLU B OE1 1 
ATOM   1445 O  OE2 . GLU B 1 28  ? 16.698 -0.454 6.446   1.00 64.53 ? 28   GLU B OE2 1 
ATOM   1446 N  N   . PRO B 1 29  ? 15.148 4.772  8.760   1.00 58.88 ? 29   PRO B N   1 
ATOM   1447 C  CA  . PRO B 1 29  ? 14.185 3.723  8.406   1.00 60.81 ? 29   PRO B CA  1 
ATOM   1448 C  C   . PRO B 1 29  ? 13.470 3.982  7.079   1.00 61.22 ? 29   PRO B C   1 
ATOM   1449 O  O   . PRO B 1 29  ? 13.405 5.123  6.617   1.00 60.25 ? 29   PRO B O   1 
ATOM   1450 C  CB  . PRO B 1 29  ? 13.191 3.759  9.570   1.00 61.11 ? 29   PRO B CB  1 
ATOM   1451 C  CG  . PRO B 1 29  ? 13.216 5.166  10.034  1.00 59.83 ? 29   PRO B CG  1 
ATOM   1452 C  CD  . PRO B 1 29  ? 14.620 5.663  9.810   1.00 58.53 ? 29   PRO B CD  1 
ATOM   1453 N  N   . ARG B 1 30  ? 12.948 2.918  6.476   1.00 63.15 ? 30   ARG B N   1 
ATOM   1454 C  CA  . ARG B 1 30  ? 12.318 3.008  5.159   1.00 63.95 ? 30   ARG B CA  1 
ATOM   1455 C  C   . ARG B 1 30  ? 10.904 3.575  5.253   1.00 63.72 ? 30   ARG B C   1 
ATOM   1456 O  O   . ARG B 1 30  ? 10.227 3.413  6.271   1.00 64.39 ? 30   ARG B O   1 
ATOM   1457 C  CB  . ARG B 1 30  ? 12.315 1.636  4.481   1.00 65.93 ? 30   ARG B CB  1 
ATOM   1458 C  CG  . ARG B 1 30  ? 13.719 1.173  4.083   1.00 68.55 ? 30   ARG B CG  1 
ATOM   1459 C  CD  . ARG B 1 30  ? 13.945 -0.318 4.306   1.00 72.73 ? 30   ARG B CD  1 
ATOM   1460 N  NE  . ARG B 1 30  ? 13.561 -1.131 3.154   1.00 76.09 ? 30   ARG B NE  1 
ATOM   1461 C  CZ  . ARG B 1 30  ? 13.732 -2.451 3.074   1.00 79.50 ? 30   ARG B CZ  1 
ATOM   1462 N  NH1 . ARG B 1 30  ? 14.273 -3.129 4.083   1.00 81.01 ? 30   ARG B NH1 1 
ATOM   1463 N  NH2 . ARG B 1 30  ? 13.357 -3.101 1.979   1.00 80.80 ? 30   ARG B NH2 1 
ATOM   1464 N  N   . GLY B 1 31  ? 10.478 4.251  4.187   1.00 62.99 ? 31   GLY B N   1 
ATOM   1465 C  CA  . GLY B 1 31  ? 9.166  4.901  4.133   1.00 62.96 ? 31   GLY B CA  1 
ATOM   1466 C  C   . GLY B 1 31  ? 9.207  6.380  4.481   1.00 61.48 ? 31   GLY B C   1 
ATOM   1467 O  O   . GLY B 1 31  ? 8.380  7.158  4.001   1.00 61.25 ? 31   GLY B O   1 
ATOM   1468 N  N   . ILE B 1 32  ? 10.176 6.766  5.309   1.00 60.45 ? 32   ILE B N   1 
ATOM   1469 C  CA  . ILE B 1 32  ? 10.284 8.132  5.822   1.00 58.99 ? 32   ILE B CA  1 
ATOM   1470 C  C   . ILE B 1 32  ? 10.716 9.136  4.744   1.00 56.89 ? 32   ILE B C   1 
ATOM   1471 O  O   . ILE B 1 32  ? 10.335 10.307 4.797   1.00 56.37 ? 32   ILE B O   1 
ATOM   1472 C  CB  . ILE B 1 32  ? 11.268 8.187  7.032   1.00 59.07 ? 32   ILE B CB  1 
ATOM   1473 C  CG1 . ILE B 1 32  ? 11.050 9.452  7.869   1.00 59.74 ? 32   ILE B CG1 1 
ATOM   1474 C  CG2 . ILE B 1 32  ? 12.717 8.082  6.566   1.00 57.76 ? 32   ILE B CG2 1 
ATOM   1475 C  CD1 . ILE B 1 32  ? 11.845 9.460  9.169   1.00 59.81 ? 32   ILE B CD1 1 
ATOM   1476 N  N   . ASP B 1 33  ? 11.495 8.668  3.769   1.00 55.53 ? 33   ASP B N   1 
ATOM   1477 C  CA  . ASP B 1 33  ? 12.056 9.522  2.719   1.00 53.70 ? 33   ASP B CA  1 
ATOM   1478 C  C   . ASP B 1 33  ? 11.814 8.900  1.342   1.00 53.09 ? 33   ASP B C   1 
ATOM   1479 O  O   . ASP B 1 33  ? 11.559 7.699  1.236   1.00 54.03 ? 33   ASP B O   1 
ATOM   1480 C  CB  . ASP B 1 33  ? 13.561 9.697  2.964   1.00 53.18 ? 33   ASP B CB  1 
ATOM   1481 C  CG  . ASP B 1 33  ? 14.185 10.778 2.097   1.00 52.06 ? 33   ASP B CG  1 
ATOM   1482 O  OD1 . ASP B 1 33  ? 13.552 11.838 1.904   1.00 51.06 ? 33   ASP B OD1 1 
ATOM   1483 O  OD2 . ASP B 1 33  ? 15.321 10.564 1.619   1.00 50.27 ? 33   ASP B OD2 1 
ATOM   1484 N  N   . LEU B 1 34  ? 11.885 9.722  0.295   1.00 51.09 ? 34   LEU B N   1 
ATOM   1485 C  CA  . LEU B 1 34  ? 11.792 9.239  -1.085  1.00 50.51 ? 34   LEU B CA  1 
ATOM   1486 C  C   . LEU B 1 34  ? 12.909 8.234  -1.363  1.00 50.10 ? 34   LEU B C   1 
ATOM   1487 O  O   . LEU B 1 34  ? 14.058 8.454  -0.973  1.00 49.82 ? 34   LEU B O   1 
ATOM   1488 C  CB  . LEU B 1 34  ? 11.882 10.408 -2.078  1.00 49.78 ? 34   LEU B CB  1 
ATOM   1489 C  CG  . LEU B 1 34  ? 11.668 10.093 -3.566  1.00 49.31 ? 34   LEU B CG  1 
ATOM   1490 C  CD1 . LEU B 1 34  ? 10.239 9.637  -3.835  1.00 48.90 ? 34   LEU B CD1 1 
ATOM   1491 C  CD2 . LEU B 1 34  ? 12.008 11.301 -4.425  1.00 46.73 ? 34   LEU B CD2 1 
ATOM   1492 N  N   . ALA B 1 35  ? 12.565 7.135  -2.033  1.00 49.79 ? 35   ALA B N   1 
ATOM   1493 C  CA  . ALA B 1 35  ? 13.519 6.057  -2.298  1.00 49.55 ? 35   ALA B CA  1 
ATOM   1494 C  C   . ALA B 1 35  ? 14.665 6.543  -3.177  1.00 48.51 ? 35   ALA B C   1 
ATOM   1495 O  O   . ALA B 1 35  ? 14.491 7.447  -3.997  1.00 47.65 ? 35   ALA B O   1 
ATOM   1496 C  CB  . ALA B 1 35  ? 12.821 4.871  -2.945  1.00 50.46 ? 35   ALA B CB  1 
ATOM   1497 N  N   . ALA B 1 36  ? 15.836 5.938  -2.992  1.00 48.35 ? 36   ALA B N   1 
ATOM   1498 C  CA  . ALA B 1 36  ? 17.040 6.319  -3.730  1.00 47.43 ? 36   ALA B CA  1 
ATOM   1499 C  C   . ALA B 1 36  ? 16.923 6.005  -5.224  1.00 47.29 ? 36   ALA B C   1 
ATOM   1500 O  O   . ALA B 1 36  ? 17.497 6.708  -6.057  1.00 47.08 ? 36   ALA B O   1 
ATOM   1501 C  CB  . ALA B 1 36  ? 18.263 5.628  -3.134  1.00 47.74 ? 36   ALA B CB  1 
ATOM   1502 N  N   . SER B 1 37  ? 16.178 4.952  -5.554  1.00 47.59 ? 37   SER B N   1 
ATOM   1503 C  CA  . SER B 1 37  ? 15.962 4.561  -6.948  1.00 48.00 ? 37   SER B CA  1 
ATOM   1504 C  C   . SER B 1 37  ? 15.049 5.535  -7.700  1.00 46.47 ? 37   SER B C   1 
ATOM   1505 O  O   . SER B 1 37  ? 15.136 5.643  -8.924  1.00 46.72 ? 37   SER B O   1 
ATOM   1506 C  CB  . SER B 1 37  ? 15.384 3.143  -7.019  1.00 49.41 ? 37   SER B CB  1 
ATOM   1507 O  OG  . SER B 1 37  ? 14.228 3.022  -6.207  1.00 50.35 ? 37   SER B OG  1 
ATOM   1508 N  N   . LEU B 1 38  ? 14.185 6.237  -6.966  1.00 44.97 ? 38   LEU B N   1 
ATOM   1509 C  CA  . LEU B 1 38  ? 13.247 7.201  -7.552  1.00 43.78 ? 38   LEU B CA  1 
ATOM   1510 C  C   . LEU B 1 38  ? 13.765 8.645  -7.542  1.00 42.11 ? 38   LEU B C   1 
ATOM   1511 O  O   . LEU B 1 38  ? 13.054 9.555  -7.972  1.00 41.16 ? 38   LEU B O   1 
ATOM   1512 C  CB  . LEU B 1 38  ? 11.908 7.146  -6.808  1.00 43.95 ? 38   LEU B CB  1 
ATOM   1513 C  CG  . LEU B 1 38  ? 11.171 5.803  -6.779  1.00 45.80 ? 38   LEU B CG  1 
ATOM   1514 C  CD1 . LEU B 1 38  ? 9.949  5.895  -5.876  1.00 45.29 ? 38   LEU B CD1 1 
ATOM   1515 C  CD2 . LEU B 1 38  ? 10.769 5.362  -8.182  1.00 47.03 ? 38   LEU B CD2 1 
ATOM   1516 N  N   . ALA B 1 39  ? 14.992 8.852  -7.061  1.00 41.63 ? 39   ALA B N   1 
ATOM   1517 C  CA  . ALA B 1 39  ? 15.570 10.195 -6.931  1.00 40.45 ? 39   ALA B CA  1 
ATOM   1518 C  C   . ALA B 1 39  ? 16.797 10.388 -7.824  1.00 40.51 ? 39   ALA B C   1 
ATOM   1519 O  O   . ALA B 1 39  ? 17.354 9.423  -8.349  1.00 41.47 ? 39   ALA B O   1 
ATOM   1520 C  CB  . ALA B 1 39  ? 15.933 10.466 -5.481  1.00 39.81 ? 39   ALA B CB  1 
ATOM   1521 N  N   . ASP B 1 40  ? 17.200 11.647 -7.991  1.00 39.76 ? 40   ASP B N   1 
ATOM   1522 C  CA  . ASP B 1 40  ? 18.382 12.008 -8.782  1.00 39.94 ? 40   ASP B CA  1 
ATOM   1523 C  C   . ASP B 1 40  ? 19.471 12.693 -7.958  1.00 39.16 ? 40   ASP B C   1 
ATOM   1524 O  O   . ASP B 1 40  ? 20.649 12.576 -8.283  1.00 40.06 ? 40   ASP B O   1 
ATOM   1525 C  CB  . ASP B 1 40  ? 17.986 12.914 -9.948  1.00 40.08 ? 40   ASP B CB  1 
ATOM   1526 C  CG  . ASP B 1 40  ? 17.106 12.208 -10.959 1.00 41.69 ? 40   ASP B CG  1 
ATOM   1527 O  OD1 . ASP B 1 40  ? 17.510 11.136 -11.457 1.00 46.06 ? 40   ASP B OD1 1 
ATOM   1528 O  OD2 . ASP B 1 40  ? 16.010 12.725 -11.257 1.00 42.15 ? 40   ASP B OD2 1 
ATOM   1529 N  N   . ILE B 1 41  ? 19.084 13.426 -6.915  1.00 38.01 ? 41   ILE B N   1 
ATOM   1530 C  CA  . ILE B 1 41  ? 20.053 14.029 -5.998  1.00 37.29 ? 41   ILE B CA  1 
ATOM   1531 C  C   . ILE B 1 41  ? 19.623 13.873 -4.544  1.00 36.42 ? 41   ILE B C   1 
ATOM   1532 O  O   . ILE B 1 41  ? 18.491 13.487 -4.255  1.00 36.27 ? 41   ILE B O   1 
ATOM   1533 C  CB  . ILE B 1 41  ? 20.285 15.538 -6.293  1.00 36.89 ? 41   ILE B CB  1 
ATOM   1534 C  CG1 . ILE B 1 41  ? 19.023 16.363 -6.009  1.00 35.35 ? 41   ILE B CG1 1 
ATOM   1535 C  CG2 . ILE B 1 41  ? 20.743 15.735 -7.729  1.00 36.92 ? 41   ILE B CG2 1 
ATOM   1536 C  CD1 . ILE B 1 41  ? 19.210 17.849 -6.218  1.00 35.16 ? 41   ILE B CD1 1 
ATOM   1537 N  N   . HIS B 1 42  ? 20.549 14.176 -3.641  1.00 35.98 ? 42   HIS B N   1 
ATOM   1538 C  CA  . HIS B 1 42  ? 20.265 14.239 -2.219  1.00 35.38 ? 42   HIS B CA  1 
ATOM   1539 C  C   . HIS B 1 42  ? 20.650 15.624 -1.722  1.00 34.78 ? 42   HIS B C   1 
ATOM   1540 O  O   . HIS B 1 42  ? 21.824 15.893 -1.491  1.00 34.93 ? 42   HIS B O   1 
ATOM   1541 C  CB  . HIS B 1 42  ? 21.051 13.167 -1.471  1.00 35.87 ? 42   HIS B CB  1 
ATOM   1542 C  CG  . HIS B 1 42  ? 20.746 13.108 -0.008  1.00 35.93 ? 42   HIS B CG  1 
ATOM   1543 N  ND1 . HIS B 1 42  ? 19.588 12.548 0.488   1.00 36.69 ? 42   HIS B ND1 1 
ATOM   1544 C  CD2 . HIS B 1 42  ? 21.447 13.535 1.068   1.00 37.09 ? 42   HIS B CD2 1 
ATOM   1545 C  CE1 . HIS B 1 42  ? 19.590 12.631 1.806   1.00 37.26 ? 42   HIS B CE1 1 
ATOM   1546 N  NE2 . HIS B 1 42  ? 20.707 13.227 2.183   1.00 38.92 ? 42   HIS B NE2 1 
ATOM   1547 N  N   . LEU B 1 43  ? 19.660 16.502 -1.578  1.00 34.54 ? 43   LEU B N   1 
ATOM   1548 C  CA  . LEU B 1 43  ? 19.896 17.868 -1.108  1.00 34.57 ? 43   LEU B CA  1 
ATOM   1549 C  C   . LEU B 1 43  ? 20.250 17.847 0.376   1.00 34.76 ? 43   LEU B C   1 
ATOM   1550 O  O   . LEU B 1 43  ? 19.711 17.045 1.136   1.00 34.77 ? 43   LEU B O   1 
ATOM   1551 C  CB  . LEU B 1 43  ? 18.663 18.746 -1.356  1.00 34.22 ? 43   LEU B CB  1 
ATOM   1552 C  CG  . LEU B 1 43  ? 18.739 20.215 -0.925  1.00 33.85 ? 43   LEU B CG  1 
ATOM   1553 C  CD1 . LEU B 1 43  ? 19.906 20.931 -1.582  1.00 32.52 ? 43   LEU B CD1 1 
ATOM   1554 C  CD2 . LEU B 1 43  ? 17.432 20.918 -1.246  1.00 33.52 ? 43   LEU B CD2 1 
ATOM   1555 N  N   . GLU B 1 44  ? 21.160 18.731 0.777   1.00 35.28 ? 44   GLU B N   1 
ATOM   1556 C  CA  . GLU B 1 44  ? 21.694 18.729 2.136   1.00 35.54 ? 44   GLU B CA  1 
ATOM   1557 C  C   . GLU B 1 44  ? 21.829 20.151 2.677   1.00 35.09 ? 44   GLU B C   1 
ATOM   1558 O  O   . GLU B 1 44  ? 22.202 21.067 1.949   1.00 35.03 ? 44   GLU B O   1 
ATOM   1559 C  CB  . GLU B 1 44  ? 23.057 18.027 2.158   1.00 36.32 ? 44   GLU B CB  1 
ATOM   1560 C  CG  . GLU B 1 44  ? 23.234 17.058 3.307   1.00 38.13 ? 44   GLU B CG  1 
ATOM   1561 C  CD  . GLU B 1 44  ? 24.501 16.227 3.195   1.00 42.17 ? 44   GLU B CD  1 
ATOM   1562 O  OE1 . GLU B 1 44  ? 24.392 15.006 2.935   1.00 42.73 ? 44   GLU B OE1 1 
ATOM   1563 O  OE2 . GLU B 1 44  ? 25.603 16.795 3.368   1.00 45.49 ? 44   GLU B OE2 1 
ATOM   1564 N  N   . ALA B 1 45  ? 21.513 20.317 3.958   1.00 35.28 ? 45   ALA B N   1 
ATOM   1565 C  CA  . ALA B 1 45  ? 21.659 21.590 4.653   1.00 35.53 ? 45   ALA B CA  1 
ATOM   1566 C  C   . ALA B 1 45  ? 22.565 21.394 5.863   1.00 35.75 ? 45   ALA B C   1 
ATOM   1567 O  O   . ALA B 1 45  ? 22.187 20.711 6.815   1.00 35.08 ? 45   ALA B O   1 
ATOM   1568 C  CB  . ALA B 1 45  ? 20.306 22.105 5.089   1.00 35.32 ? 45   ALA B CB  1 
ATOM   1569 N  N   . ASP B 1 46  ? 23.758 21.985 5.812   1.00 36.52 ? 46   ASP B N   1 
ATOM   1570 C  CA  . ASP B 1 46  ? 24.730 21.897 6.906   1.00 36.81 ? 46   ASP B CA  1 
ATOM   1571 C  C   . ASP B 1 46  ? 24.656 23.155 7.778   1.00 35.65 ? 46   ASP B C   1 
ATOM   1572 O  O   . ASP B 1 46  ? 25.108 24.227 7.375   1.00 35.01 ? 46   ASP B O   1 
ATOM   1573 C  CB  . ASP B 1 46  ? 26.151 21.701 6.351   1.00 37.98 ? 46   ASP B CB  1 
ATOM   1574 C  CG  . ASP B 1 46  ? 26.364 20.317 5.726   1.00 40.89 ? 46   ASP B CG  1 
ATOM   1575 O  OD1 . ASP B 1 46  ? 25.902 19.308 6.307   1.00 43.16 ? 46   ASP B OD1 1 
ATOM   1576 O  OD2 . ASP B 1 46  ? 27.013 20.234 4.658   1.00 44.00 ? 46   ASP B OD2 1 
ATOM   1577 N  N   . ILE B 1 47  ? 24.080 23.011 8.972   1.00 35.09 ? 47   ILE B N   1 
ATOM   1578 C  CA  . ILE B 1 47  ? 23.850 24.138 9.883   1.00 34.82 ? 47   ILE B CA  1 
ATOM   1579 C  C   . ILE B 1 47  ? 24.516 23.894 11.239  1.00 33.73 ? 47   ILE B C   1 
ATOM   1580 O  O   . ILE B 1 47  ? 24.060 23.055 12.015  1.00 33.45 ? 47   ILE B O   1 
ATOM   1581 C  CB  . ILE B 1 47  ? 22.336 24.383 10.117  1.00 34.77 ? 47   ILE B CB  1 
ATOM   1582 C  CG1 . ILE B 1 47  ? 21.603 24.587 8.789   1.00 35.28 ? 47   ILE B CG1 1 
ATOM   1583 C  CG2 . ILE B 1 47  ? 22.120 25.593 11.022  1.00 34.96 ? 47   ILE B CG2 1 
ATOM   1584 C  CD1 . ILE B 1 47  ? 20.097 24.682 8.936   1.00 35.96 ? 47   ILE B CD1 1 
ATOM   1585 N  N   . HIS B 1 48  ? 25.587 24.637 11.517  1.00 33.13 ? 48   HIS B N   1 
ATOM   1586 C  CA  . HIS B 1 48  ? 26.309 24.533 12.788  1.00 32.05 ? 48   HIS B CA  1 
ATOM   1587 C  C   . HIS B 1 48  ? 26.433 25.892 13.466  1.00 31.99 ? 48   HIS B C   1 
ATOM   1588 O  O   . HIS B 1 48  ? 26.303 26.927 12.823  1.00 32.25 ? 48   HIS B O   1 
ATOM   1589 C  CB  . HIS B 1 48  ? 27.700 23.951 12.558  1.00 31.87 ? 48   HIS B CB  1 
ATOM   1590 C  CG  . HIS B 1 48  ? 27.685 22.615 11.890  1.00 30.92 ? 48   HIS B CG  1 
ATOM   1591 N  ND1 . HIS B 1 48  ? 27.584 22.470 10.524  1.00 30.37 ? 48   HIS B ND1 1 
ATOM   1592 C  CD2 . HIS B 1 48  ? 27.750 21.362 12.400  1.00 29.31 ? 48   HIS B CD2 1 
ATOM   1593 C  CE1 . HIS B 1 48  ? 27.589 21.184 10.220  1.00 31.36 ? 48   HIS B CE1 1 
ATOM   1594 N  NE2 . HIS B 1 48  ? 27.689 20.490 11.340  1.00 29.32 ? 48   HIS B NE2 1 
ATOM   1595 N  N   . ALA B 1 49  ? 26.697 25.872 14.768  1.00 32.12 ? 49   ALA B N   1 
ATOM   1596 C  CA  . ALA B 1 49  ? 26.819 27.092 15.563  1.00 32.51 ? 49   ALA B CA  1 
ATOM   1597 C  C   . ALA B 1 49  ? 28.129 27.829 15.286  1.00 33.30 ? 49   ALA B C   1 
ATOM   1598 O  O   . ALA B 1 49  ? 29.182 27.209 15.144  1.00 33.00 ? 49   ALA B O   1 
ATOM   1599 C  CB  . ALA B 1 49  ? 26.714 26.756 17.044  1.00 32.24 ? 49   ALA B CB  1 
ATOM   1600 N  N   . LEU B 1 50  ? 28.053 29.155 15.213  1.00 34.61 ? 50   LEU B N   1 
ATOM   1601 C  CA  . LEU B 1 50  ? 29.238 29.999 15.070  1.00 35.99 ? 50   LEU B CA  1 
ATOM   1602 C  C   . LEU B 1 50  ? 29.829 30.305 16.441  1.00 36.78 ? 50   LEU B C   1 
ATOM   1603 O  O   . LEU B 1 50  ? 29.276 29.914 17.475  1.00 35.84 ? 50   LEU B O   1 
ATOM   1604 C  CB  . LEU B 1 50  ? 28.882 31.318 14.377  1.00 36.74 ? 50   LEU B CB  1 
ATOM   1605 C  CG  . LEU B 1 50  ? 28.296 31.250 12.966  1.00 36.76 ? 50   LEU B CG  1 
ATOM   1606 C  CD1 . LEU B 1 50  ? 27.641 32.581 12.605  1.00 35.55 ? 50   LEU B CD1 1 
ATOM   1607 C  CD2 . LEU B 1 50  ? 29.362 30.880 11.948  1.00 35.70 ? 50   LEU B CD2 1 
ATOM   1608 N  N   . LYS B 1 51  ? 30.961 31.006 16.433  1.00 38.75 ? 51   LYS B N   1 
ATOM   1609 C  CA  . LYS B 1 51  ? 31.590 31.508 17.653  1.00 39.77 ? 51   LYS B CA  1 
ATOM   1610 C  C   . LYS B 1 51  ? 30.634 32.466 18.368  1.00 39.89 ? 51   LYS B C   1 
ATOM   1611 O  O   . LYS B 1 51  ? 29.923 33.239 17.719  1.00 40.01 ? 51   LYS B O   1 
ATOM   1612 C  CB  . LYS B 1 51  ? 32.901 32.227 17.301  1.00 41.33 ? 51   LYS B CB  1 
ATOM   1613 C  CG  . LYS B 1 51  ? 33.786 32.602 18.486  1.00 43.63 ? 51   LYS B CG  1 
ATOM   1614 C  CD  . LYS B 1 51  ? 35.116 33.197 18.005  1.00 47.66 ? 51   LYS B CD  1 
ATOM   1615 C  CE  . LYS B 1 51  ? 35.923 33.832 19.146  1.00 49.58 ? 51   LYS B CE  1 
ATOM   1616 N  NZ  . LYS B 1 51  ? 36.301 32.859 20.218  1.00 47.83 ? 51   LYS B NZ  1 
ATOM   1617 N  N   . ASN B 1 52  ? 30.610 32.390 19.698  1.00 39.80 ? 52   ASN B N   1 
ATOM   1618 C  CA  . ASN B 1 52  ? 29.765 33.253 20.534  1.00 40.18 ? 52   ASN B CA  1 
ATOM   1619 C  C   . ASN B 1 52  ? 28.273 33.150 20.201  1.00 39.31 ? 52   ASN B C   1 
ATOM   1620 O  O   . ASN B 1 52  ? 27.587 34.167 20.082  1.00 40.05 ? 52   ASN B O   1 
ATOM   1621 C  CB  . ASN B 1 52  ? 30.223 34.725 20.450  1.00 41.62 ? 52   ASN B CB  1 
ATOM   1622 C  CG  . ASN B 1 52  ? 31.658 34.929 20.921  1.00 43.23 ? 52   ASN B CG  1 
ATOM   1623 O  OD1 . ASN B 1 52  ? 32.083 34.363 21.931  1.00 43.65 ? 52   ASN B OD1 1 
ATOM   1624 N  ND2 . ASN B 1 52  ? 32.406 35.756 20.194  1.00 45.65 ? 52   ASN B ND2 1 
ATOM   1625 N  N   . ASN B 1 53  ? 27.775 31.923 20.059  1.00 38.12 ? 53   ASN B N   1 
ATOM   1626 C  CA  . ASN B 1 53  ? 26.354 31.693 19.766  1.00 37.37 ? 53   ASN B CA  1 
ATOM   1627 C  C   . ASN B 1 53  ? 25.466 32.209 20.903  1.00 37.31 ? 53   ASN B C   1 
ATOM   1628 O  O   . ASN B 1 53  ? 25.684 31.855 22.062  1.00 37.58 ? 53   ASN B O   1 
ATOM   1629 C  CB  . ASN B 1 53  ? 26.092 30.202 19.533  1.00 36.65 ? 53   ASN B CB  1 
ATOM   1630 C  CG  . ASN B 1 53  ? 24.650 29.906 19.153  1.00 36.25 ? 53   ASN B CG  1 
ATOM   1631 O  OD1 . ASN B 1 53  ? 23.788 29.755 20.019  1.00 38.04 ? 53   ASN B OD1 1 
ATOM   1632 N  ND2 . ASN B 1 53  ? 24.386 29.805 17.856  1.00 34.82 ? 53   ASN B ND2 1 
ATOM   1633 N  N   . PRO B 1 54  ? 24.457 33.039 20.576  1.00 37.29 ? 54   PRO B N   1 
ATOM   1634 C  CA  . PRO B 1 54  ? 23.633 33.664 21.611  1.00 37.59 ? 54   PRO B CA  1 
ATOM   1635 C  C   . PRO B 1 54  ? 22.661 32.719 22.332  1.00 36.96 ? 54   PRO B C   1 
ATOM   1636 O  O   . PRO B 1 54  ? 22.076 33.110 23.342  1.00 37.33 ? 54   PRO B O   1 
ATOM   1637 C  CB  . PRO B 1 54  ? 22.854 34.727 20.832  1.00 38.53 ? 54   PRO B CB  1 
ATOM   1638 C  CG  . PRO B 1 54  ? 22.730 34.168 19.469  1.00 37.44 ? 54   PRO B CG  1 
ATOM   1639 C  CD  . PRO B 1 54  ? 24.005 33.417 19.222  1.00 37.52 ? 54   PRO B CD  1 
ATOM   1640 N  N   . ASN B 1 55  ? 22.490 31.502 21.817  1.00 35.93 ? 55   ASN B N   1 
ATOM   1641 C  CA  . ASN B 1 55  ? 21.583 30.519 22.412  1.00 35.62 ? 55   ASN B CA  1 
ATOM   1642 C  C   . ASN B 1 55  ? 22.311 29.342 23.083  1.00 35.06 ? 55   ASN B C   1 
ATOM   1643 O  O   . ASN B 1 55  ? 21.733 28.266 23.261  1.00 34.75 ? 55   ASN B O   1 
ATOM   1644 C  CB  . ASN B 1 55  ? 20.617 30.008 21.344  1.00 35.50 ? 55   ASN B CB  1 
ATOM   1645 C  CG  . ASN B 1 55  ? 19.940 31.134 20.593  1.00 36.22 ? 55   ASN B CG  1 
ATOM   1646 O  OD1 . ASN B 1 55  ? 20.123 31.289 19.386  1.00 38.32 ? 55   ASN B OD1 1 
ATOM   1647 N  ND2 . ASN B 1 55  ? 19.168 31.942 21.310  1.00 36.18 ? 55   ASN B ND2 1 
ATOM   1648 N  N   . GLY B 1 56  ? 23.577 29.550 23.445  1.00 34.73 ? 56   GLY B N   1 
ATOM   1649 C  CA  . GLY B 1 56  ? 24.316 28.607 24.286  1.00 33.87 ? 56   GLY B CA  1 
ATOM   1650 C  C   . GLY B 1 56  ? 25.024 27.453 23.595  1.00 32.88 ? 56   GLY B C   1 
ATOM   1651 O  O   . GLY B 1 56  ? 25.718 26.674 24.251  1.00 32.30 ? 56   GLY B O   1 
ATOM   1652 N  N   . PHE B 1 57  ? 24.868 27.335 22.281  1.00 32.35 ? 57   PHE B N   1 
ATOM   1653 C  CA  . PHE B 1 57  ? 25.489 26.235 21.542  1.00 31.72 ? 57   PHE B CA  1 
ATOM   1654 C  C   . PHE B 1 57  ? 26.985 26.471 21.306  1.00 31.88 ? 57   PHE B C   1 
ATOM   1655 O  O   . PHE B 1 57  ? 27.370 27.519 20.788  1.00 32.62 ? 57   PHE B O   1 
ATOM   1656 C  CB  . PHE B 1 57  ? 24.769 25.999 20.214  1.00 31.44 ? 57   PHE B CB  1 
ATOM   1657 C  CG  . PHE B 1 57  ? 23.547 25.149 20.346  1.00 29.92 ? 57   PHE B CG  1 
ATOM   1658 C  CD1 . PHE B 1 57  ? 22.321 25.715 20.644  1.00 30.36 ? 57   PHE B CD1 1 
ATOM   1659 C  CD2 . PHE B 1 57  ? 23.631 23.774 20.199  1.00 29.39 ? 57   PHE B CD2 1 
ATOM   1660 C  CE1 . PHE B 1 57  ? 21.192 24.925 20.778  1.00 31.48 ? 57   PHE B CE1 1 
ATOM   1661 C  CE2 . PHE B 1 57  ? 22.511 22.980 20.333  1.00 30.30 ? 57   PHE B CE2 1 
ATOM   1662 C  CZ  . PHE B 1 57  ? 21.286 23.556 20.621  1.00 30.62 ? 57   PHE B CZ  1 
ATOM   1663 N  N   . PRO B 1 58  ? 27.833 25.498 21.694  1.00 31.59 ? 58   PRO B N   1 
ATOM   1664 C  CA  . PRO B 1 58  ? 29.274 25.581 21.451  1.00 32.19 ? 58   PRO B CA  1 
ATOM   1665 C  C   . PRO B 1 58  ? 29.627 25.760 19.978  1.00 32.60 ? 58   PRO B C   1 
ATOM   1666 O  O   . PRO B 1 58  ? 28.889 25.304 19.105  1.00 32.53 ? 58   PRO B O   1 
ATOM   1667 C  CB  . PRO B 1 58  ? 29.792 24.224 21.939  1.00 31.86 ? 58   PRO B CB  1 
ATOM   1668 C  CG  . PRO B 1 58  ? 28.805 23.767 22.907  1.00 31.65 ? 58   PRO B CG  1 
ATOM   1669 C  CD  . PRO B 1 58  ? 27.485 24.298 22.474  1.00 31.57 ? 58   PRO B CD  1 
ATOM   1670 N  N   . GLU B 1 59  ? 30.753 26.413 19.711  1.00 33.51 ? 59   GLU B N   1 
ATOM   1671 C  CA  . GLU B 1 59  ? 31.225 26.588 18.342  1.00 34.07 ? 59   GLU B CA  1 
ATOM   1672 C  C   . GLU B 1 59  ? 31.433 25.225 17.680  1.00 33.69 ? 59   GLU B C   1 
ATOM   1673 O  O   . GLU B 1 59  ? 32.100 24.352 18.239  1.00 33.84 ? 59   GLU B O   1 
ATOM   1674 C  CB  . GLU B 1 59  ? 32.526 27.390 18.320  1.00 34.98 ? 59   GLU B CB  1 
ATOM   1675 C  CG  . GLU B 1 59  ? 32.910 27.881 16.936  1.00 38.26 ? 59   GLU B CG  1 
ATOM   1676 C  CD  . GLU B 1 59  ? 34.182 28.710 16.923  1.00 42.15 ? 59   GLU B CD  1 
ATOM   1677 O  OE1 . GLU B 1 59  ? 34.813 28.881 17.992  1.00 40.61 ? 59   GLU B OE1 1 
ATOM   1678 O  OE2 . GLU B 1 59  ? 34.546 29.195 15.831  1.00 44.74 ? 59   GLU B OE2 1 
ATOM   1679 N  N   . GLY B 1 60  ? 30.836 25.042 16.505  1.00 33.45 ? 60   GLY B N   1 
ATOM   1680 C  CA  . GLY B 1 60  ? 30.965 23.798 15.752  1.00 33.37 ? 60   GLY B CA  1 
ATOM   1681 C  C   . GLY B 1 60  ? 29.787 22.854 15.868  1.00 32.85 ? 60   GLY B C   1 
ATOM   1682 O  O   . GLY B 1 60  ? 29.521 22.092 14.942  1.00 32.91 ? 60   GLY B O   1 
ATOM   1683 N  N   . PHE B 1 61  ? 29.093 22.888 17.005  1.00 32.82 ? 61   PHE B N   1 
ATOM   1684 C  CA  . PHE B 1 61  ? 27.942 22.010 17.248  1.00 32.18 ? 61   PHE B CA  1 
ATOM   1685 C  C   . PHE B 1 61  ? 26.860 22.151 16.178  1.00 31.65 ? 61   PHE B C   1 
ATOM   1686 O  O   . PHE B 1 61  ? 26.491 23.259 15.794  1.00 31.61 ? 61   PHE B O   1 
ATOM   1687 C  CB  . PHE B 1 61  ? 27.318 22.298 18.622  1.00 32.27 ? 61   PHE B CB  1 
ATOM   1688 C  CG  . PHE B 1 61  ? 27.843 21.431 19.735  1.00 33.13 ? 61   PHE B CG  1 
ATOM   1689 C  CD1 . PHE B 1 61  ? 29.186 21.092 19.812  1.00 34.81 ? 61   PHE B CD1 1 
ATOM   1690 C  CD2 . PHE B 1 61  ? 26.986 20.981 20.731  1.00 34.37 ? 61   PHE B CD2 1 
ATOM   1691 C  CE1 . PHE B 1 61  ? 29.660 20.303 20.849  1.00 35.85 ? 61   PHE B CE1 1 
ATOM   1692 C  CE2 . PHE B 1 61  ? 27.454 20.193 21.771  1.00 35.26 ? 61   PHE B CE2 1 
ATOM   1693 C  CZ  . PHE B 1 61  ? 28.792 19.853 21.830  1.00 35.64 ? 61   PHE B CZ  1 
ATOM   1694 N  N   . TRP B 1 62  ? 26.363 21.012 15.709  1.00 31.52 ? 62   TRP B N   1 
ATOM   1695 C  CA  . TRP B 1 62  ? 25.207 20.961 14.826  1.00 31.23 ? 62   TRP B CA  1 
ATOM   1696 C  C   . TRP B 1 62  ? 23.997 21.527 15.560  1.00 30.79 ? 62   TRP B C   1 
ATOM   1697 O  O   . TRP B 1 62  ? 23.775 21.200 16.724  1.00 30.83 ? 62   TRP B O   1 
ATOM   1698 C  CB  . TRP B 1 62  ? 24.949 19.508 14.428  1.00 31.40 ? 62   TRP B CB  1 
ATOM   1699 C  CG  . TRP B 1 62  ? 23.790 19.298 13.520  1.00 32.38 ? 62   TRP B CG  1 
ATOM   1700 C  CD1 . TRP B 1 62  ? 23.616 19.830 12.278  1.00 34.54 ? 62   TRP B CD1 1 
ATOM   1701 C  CD2 . TRP B 1 62  ? 22.650 18.467 13.766  1.00 33.50 ? 62   TRP B CD2 1 
ATOM   1702 N  NE1 . TRP B 1 62  ? 22.427 19.396 11.738  1.00 35.02 ? 62   TRP B NE1 1 
ATOM   1703 C  CE2 . TRP B 1 62  ? 21.816 18.555 12.631  1.00 34.02 ? 62   TRP B CE2 1 
ATOM   1704 C  CE3 . TRP B 1 62  ? 22.248 17.662 14.839  1.00 33.32 ? 62   TRP B CE3 1 
ATOM   1705 C  CZ2 . TRP B 1 62  ? 20.605 17.870 12.537  1.00 34.58 ? 62   TRP B CZ2 1 
ATOM   1706 C  CZ3 . TRP B 1 62  ? 21.046 16.983 14.745  1.00 34.17 ? 62   TRP B CZ3 1 
ATOM   1707 C  CH2 . TRP B 1 62  ? 20.238 17.091 13.600  1.00 35.13 ? 62   TRP B CH2 1 
ATOM   1708 N  N   . MET B 1 63  ? 23.234 22.388 14.888  1.00 30.53 ? 63   MET B N   1 
ATOM   1709 C  CA  . MET B 1 63  ? 22.031 22.985 15.475  1.00 30.51 ? 63   MET B CA  1 
ATOM   1710 C  C   . MET B 1 63  ? 20.849 22.037 15.294  1.00 29.73 ? 63   MET B C   1 
ATOM   1711 O  O   . MET B 1 63  ? 20.374 21.858 14.174  1.00 28.93 ? 63   MET B O   1 
ATOM   1712 C  CB  . MET B 1 63  ? 21.719 24.330 14.819  1.00 31.14 ? 63   MET B CB  1 
ATOM   1713 C  CG  . MET B 1 63  ? 22.820 25.368 14.968  1.00 33.67 ? 63   MET B CG  1 
ATOM   1714 S  SD  . MET B 1 63  ? 23.145 25.869 16.670  1.00 38.39 ? 63   MET B SD  1 
ATOM   1715 C  CE  . MET B 1 63  ? 21.575 26.600 17.141  1.00 37.36 ? 63   MET B CE  1 
ATOM   1716 N  N   . PRO B 1 64  ? 20.358 21.439 16.397  1.00 29.85 ? 64   PRO B N   1 
ATOM   1717 C  CA  . PRO B 1 64  ? 19.365 20.382 16.306  1.00 30.25 ? 64   PRO B CA  1 
ATOM   1718 C  C   . PRO B 1 64  ? 17.925 20.885 16.384  1.00 30.48 ? 64   PRO B C   1 
ATOM   1719 O  O   . PRO B 1 64  ? 17.684 22.033 16.771  1.00 30.42 ? 64   PRO B O   1 
ATOM   1720 C  CB  . PRO B 1 64  ? 19.679 19.543 17.538  1.00 30.70 ? 64   PRO B CB  1 
ATOM   1721 C  CG  . PRO B 1 64  ? 20.058 20.568 18.565  1.00 30.64 ? 64   PRO B CG  1 
ATOM   1722 C  CD  . PRO B 1 64  ? 20.669 21.737 17.809  1.00 29.82 ? 64   PRO B CD  1 
ATOM   1723 N  N   . TYR B 1 65  ? 16.991 20.009 16.014  1.00 30.84 ? 65   TYR B N   1 
ATOM   1724 C  CA  . TYR B 1 65  ? 15.546 20.261 16.099  1.00 31.40 ? 65   TYR B CA  1 
ATOM   1725 C  C   . TYR B 1 65  ? 15.043 21.448 15.259  1.00 31.75 ? 65   TYR B C   1 
ATOM   1726 O  O   . TYR B 1 65  ? 13.967 21.985 15.530  1.00 32.34 ? 65   TYR B O   1 
ATOM   1727 C  CB  . TYR B 1 65  ? 15.105 20.426 17.564  1.00 31.61 ? 65   TYR B CB  1 
ATOM   1728 C  CG  . TYR B 1 65  ? 15.378 19.224 18.443  1.00 31.18 ? 65   TYR B CG  1 
ATOM   1729 C  CD1 . TYR B 1 65  ? 14.459 18.185 18.546  1.00 30.18 ? 65   TYR B CD1 1 
ATOM   1730 C  CD2 . TYR B 1 65  ? 16.551 19.134 19.185  1.00 31.79 ? 65   TYR B CD2 1 
ATOM   1731 C  CE1 . TYR B 1 65  ? 14.709 17.083 19.358  1.00 31.05 ? 65   TYR B CE1 1 
ATOM   1732 C  CE2 . TYR B 1 65  ? 16.810 18.040 19.997  1.00 29.58 ? 65   TYR B CE2 1 
ATOM   1733 C  CZ  . TYR B 1 65  ? 15.889 17.019 20.080  1.00 30.18 ? 65   TYR B CZ  1 
ATOM   1734 O  OH  . TYR B 1 65  ? 16.150 15.937 20.889  1.00 30.49 ? 65   TYR B OH  1 
ATOM   1735 N  N   . LEU B 1 66  ? 15.800 21.840 14.233  1.00 31.76 ? 66   LEU B N   1 
ATOM   1736 C  CA  . LEU B 1 66  ? 15.365 22.906 13.325  1.00 32.22 ? 66   LEU B CA  1 
ATOM   1737 C  C   . LEU B 1 66  ? 14.340 22.369 12.330  1.00 32.85 ? 66   LEU B C   1 
ATOM   1738 O  O   . LEU B 1 66  ? 14.442 21.228 11.873  1.00 32.70 ? 66   LEU B O   1 
ATOM   1739 C  CB  . LEU B 1 66  ? 16.546 23.500 12.548  1.00 31.87 ? 66   LEU B CB  1 
ATOM   1740 C  CG  . LEU B 1 66  ? 17.575 24.339 13.307  1.00 31.04 ? 66   LEU B CG  1 
ATOM   1741 C  CD1 . LEU B 1 66  ? 18.804 24.580 12.435  1.00 30.96 ? 66   LEU B CD1 1 
ATOM   1742 C  CD2 . LEU B 1 66  ? 16.968 25.653 13.757  1.00 28.31 ? 66   LEU B CD2 1 
ATOM   1743 N  N   . THR B 1 67  ? 13.354 23.201 12.005  1.00 33.88 ? 67   THR B N   1 
ATOM   1744 C  CA  . THR B 1 67  ? 12.403 22.909 10.941  1.00 34.63 ? 67   THR B CA  1 
ATOM   1745 C  C   . THR B 1 67  ? 12.889 23.617 9.683   1.00 34.70 ? 67   THR B C   1 
ATOM   1746 O  O   . THR B 1 67  ? 12.941 24.847 9.647   1.00 34.73 ? 67   THR B O   1 
ATOM   1747 C  CB  . THR B 1 67  ? 10.997 23.405 11.307  1.00 35.46 ? 67   THR B CB  1 
ATOM   1748 O  OG1 . THR B 1 67  ? 10.597 22.821 12.553  1.00 36.54 ? 67   THR B OG1 1 
ATOM   1749 C  CG2 . THR B 1 67  ? 9.991  23.038 10.221  1.00 36.43 ? 67   THR B CG2 1 
ATOM   1750 N  N   . ILE B 1 68  ? 13.267 22.839 8.668   1.00 34.88 ? 68   ILE B N   1 
ATOM   1751 C  CA  . ILE B 1 68  ? 13.812 23.388 7.423   1.00 35.40 ? 68   ILE B CA  1 
ATOM   1752 C  C   . ILE B 1 68  ? 12.946 22.989 6.226   1.00 36.20 ? 68   ILE B C   1 
ATOM   1753 O  O   . ILE B 1 68  ? 12.896 21.815 5.852   1.00 36.56 ? 68   ILE B O   1 
ATOM   1754 C  CB  . ILE B 1 68  ? 15.258 22.907 7.173   1.00 34.76 ? 68   ILE B CB  1 
ATOM   1755 C  CG1 . ILE B 1 68  ? 16.164 23.288 8.342   1.00 35.03 ? 68   ILE B CG1 1 
ATOM   1756 C  CG2 . ILE B 1 68  ? 15.809 23.510 5.893   1.00 34.46 ? 68   ILE B CG2 1 
ATOM   1757 C  CD1 . ILE B 1 68  ? 17.583 22.793 8.185   1.00 35.41 ? 68   ILE B CD1 1 
ATOM   1758 N  N   . ALA B 1 69  ? 12.263 23.972 5.641   1.00 36.68 ? 69   ALA B N   1 
ATOM   1759 C  CA  . ALA B 1 69  ? 11.483 23.773 4.422   1.00 37.13 ? 69   ALA B CA  1 
ATOM   1760 C  C   . ALA B 1 69  ? 12.226 24.409 3.251   1.00 37.18 ? 69   ALA B C   1 
ATOM   1761 O  O   . ALA B 1 69  ? 12.734 25.524 3.370   1.00 37.34 ? 69   ALA B O   1 
ATOM   1762 C  CB  . ALA B 1 69  ? 10.098 24.385 4.571   1.00 37.49 ? 69   ALA B CB  1 
ATOM   1763 N  N   . TYR B 1 70  ? 12.291 23.695 2.129   1.00 37.54 ? 70   TYR B N   1 
ATOM   1764 C  CA  . TYR B 1 70  ? 13.014 24.170 0.946   1.00 37.80 ? 70   TYR B CA  1 
ATOM   1765 C  C   . TYR B 1 70  ? 12.072 24.497 -0.210  1.00 39.03 ? 70   TYR B C   1 
ATOM   1766 O  O   . TYR B 1 70  ? 10.956 23.980 -0.285  1.00 39.73 ? 70   TYR B O   1 
ATOM   1767 C  CB  . TYR B 1 70  ? 14.062 23.144 0.493   1.00 37.29 ? 70   TYR B CB  1 
ATOM   1768 C  CG  . TYR B 1 70  ? 13.501 21.841 -0.050  1.00 37.23 ? 70   TYR B CG  1 
ATOM   1769 C  CD1 . TYR B 1 70  ? 13.133 21.716 -1.389  1.00 36.89 ? 70   TYR B CD1 1 
ATOM   1770 C  CD2 . TYR B 1 70  ? 13.357 20.728 0.773   1.00 37.57 ? 70   TYR B CD2 1 
ATOM   1771 C  CE1 . TYR B 1 70  ? 12.623 20.522 -1.887  1.00 36.34 ? 70   TYR B CE1 1 
ATOM   1772 C  CE2 . TYR B 1 70  ? 12.850 19.532 0.283   1.00 38.32 ? 70   TYR B CE2 1 
ATOM   1773 C  CZ  . TYR B 1 70  ? 12.486 19.436 -1.045  1.00 37.61 ? 70   TYR B CZ  1 
ATOM   1774 O  OH  . TYR B 1 70  ? 11.984 18.249 -1.520  1.00 39.97 ? 70   TYR B OH  1 
ATOM   1775 N  N   . GLU B 1 71  ? 12.535 25.368 -1.103  1.00 39.75 ? 71   GLU B N   1 
ATOM   1776 C  CA  . GLU B 1 71  ? 11.836 25.668 -2.346  1.00 40.58 ? 71   GLU B CA  1 
ATOM   1777 C  C   . GLU B 1 71  ? 12.856 25.683 -3.483  1.00 40.89 ? 71   GLU B C   1 
ATOM   1778 O  O   . GLU B 1 71  ? 13.583 26.663 -3.670  1.00 41.38 ? 71   GLU B O   1 
ATOM   1779 C  CB  . GLU B 1 71  ? 11.108 27.013 -2.250  1.00 41.44 ? 71   GLU B CB  1 
ATOM   1780 C  CG  . GLU B 1 71  ? 10.251 27.348 -3.471  1.00 43.42 ? 71   GLU B CG  1 
ATOM   1781 C  CD  . GLU B 1 71  ? 9.772  28.790 -3.481  1.00 46.89 ? 71   GLU B CD  1 
ATOM   1782 O  OE1 . GLU B 1 71  ? 8.911  29.144 -2.645  1.00 45.99 ? 71   GLU B OE1 1 
ATOM   1783 O  OE2 . GLU B 1 71  ? 10.253 29.565 -4.337  1.00 49.58 ? 71   GLU B OE2 1 
ATOM   1784 N  N   . LEU B 1 72  ? 12.917 24.578 -4.222  1.00 40.67 ? 72   LEU B N   1 
ATOM   1785 C  CA  . LEU B 1 72  ? 13.819 24.452 -5.361  1.00 40.80 ? 72   LEU B CA  1 
ATOM   1786 C  C   . LEU B 1 72  ? 13.091 24.909 -6.626  1.00 41.57 ? 72   LEU B C   1 
ATOM   1787 O  O   . LEU B 1 72  ? 12.112 24.289 -7.046  1.00 41.67 ? 72   LEU B O   1 
ATOM   1788 C  CB  . LEU B 1 72  ? 14.295 23.003 -5.502  1.00 40.34 ? 72   LEU B CB  1 
ATOM   1789 C  CG  . LEU B 1 72  ? 15.449 22.724 -6.466  1.00 40.09 ? 72   LEU B CG  1 
ATOM   1790 C  CD1 . LEU B 1 72  ? 16.680 23.537 -6.107  1.00 39.92 ? 72   LEU B CD1 1 
ATOM   1791 C  CD2 . LEU B 1 72  ? 15.776 21.243 -6.458  1.00 40.09 ? 72   LEU B CD2 1 
ATOM   1792 N  N   A LYS B 1 73  ? 13.555 26.015 -7.205  0.50 42.12 ? 73   LYS B N   1 
ATOM   1793 N  N   B LYS B 1 73  ? 13.591 25.987 -7.226  0.50 42.11 ? 73   LYS B N   1 
ATOM   1794 C  CA  A LYS B 1 73  ? 12.971 26.575 -8.422  0.50 42.62 ? 73   LYS B CA  1 
ATOM   1795 C  CA  B LYS B 1 73  ? 12.989 26.587 -8.409  0.50 42.61 ? 73   LYS B CA  1 
ATOM   1796 C  C   A LYS B 1 73  ? 14.034 26.669 -9.502  0.50 42.94 ? 73   LYS B C   1 
ATOM   1797 C  C   B LYS B 1 73  ? 14.035 26.692 -9.508  0.50 42.96 ? 73   LYS B C   1 
ATOM   1798 O  O   A LYS B 1 73  ? 15.169 27.057 -9.227  0.50 42.88 ? 73   LYS B O   1 
ATOM   1799 O  O   B LYS B 1 73  ? 15.161 27.113 -9.251  0.50 42.92 ? 73   LYS B O   1 
ATOM   1800 C  CB  A LYS B 1 73  ? 12.402 27.971 -8.154  0.50 43.17 ? 73   LYS B CB  1 
ATOM   1801 C  CB  B LYS B 1 73  ? 12.468 27.981 -8.062  0.50 43.12 ? 73   LYS B CB  1 
ATOM   1802 C  CG  A LYS B 1 73  ? 11.916 28.691 -9.409  0.50 44.30 ? 73   LYS B CG  1 
ATOM   1803 C  CG  B LYS B 1 73  ? 11.881 28.746 -9.232  0.50 44.22 ? 73   LYS B CG  1 
ATOM   1804 C  CD  A LYS B 1 73  ? 11.546 30.143 -9.126  0.50 45.27 ? 73   LYS B CD  1 
ATOM   1805 C  CD  B LYS B 1 73  ? 11.459 30.147 -8.813  0.50 45.11 ? 73   LYS B CD  1 
ATOM   1806 C  CE  A LYS B 1 73  ? 11.056 30.858 -10.384 0.50 45.76 ? 73   LYS B CE  1 
ATOM   1807 C  CE  B LYS B 1 73  ? 10.684 30.126 -7.504  0.50 44.24 ? 73   LYS B CE  1 
ATOM   1808 N  NZ  A LYS B 1 73  ? 9.734  30.353 -10.847 0.50 44.67 ? 73   LYS B NZ  1 
ATOM   1809 N  NZ  B LYS B 1 73  ? 10.121 31.460 -7.162  0.50 44.33 ? 73   LYS B NZ  1 
ATOM   1810 N  N   . ASN B 1 74  ? 13.666 26.305 -10.727 1.00 43.46 ? 74   ASN B N   1 
ATOM   1811 C  CA  . ASN B 1 74  ? 14.334 26.294 -12.035 1.00 44.46 ? 74   ASN B CA  1 
ATOM   1812 C  C   . ASN B 1 74  ? 14.016 27.594 -12.775 1.00 45.79 ? 74   ASN B C   1 
ATOM   1813 O  O   . ASN B 1 74  ? 12.932 27.743 -13.327 1.00 46.37 ? 74   ASN B O   1 
ATOM   1814 C  CB  . ASN B 1 74  ? 13.904 25.072 -12.859 1.00 44.04 ? 74   ASN B CB  1 
ATOM   1815 C  CG  . ASN B 1 74  ? 14.774 24.858 -14.098 1.00 43.80 ? 74   ASN B CG  1 
ATOM   1816 O  OD1 . ASN B 1 74  ? 15.066 25.797 -14.839 1.00 43.43 ? 74   ASN B OD1 1 
ATOM   1817 N  ND2 . ASN B 1 74  ? 15.182 23.613 -14.330 1.00 38.68 ? 74   ASN B ND2 1 
ATOM   1818 N  N   . THR B 1 75  ? 14.963 28.532 -12.769 1.00 46.88 ? 75   THR B N   1 
ATOM   1819 C  CA  . THR B 1 75  ? 14.732 29.873 -13.325 1.00 48.58 ? 75   THR B CA  1 
ATOM   1820 C  C   . THR B 1 75  ? 14.478 29.868 -14.834 1.00 49.08 ? 75   THR B C   1 
ATOM   1821 O  O   . THR B 1 75  ? 13.771 30.736 -15.347 1.00 50.06 ? 75   THR B O   1 
ATOM   1822 C  CB  . THR B 1 75  ? 15.902 30.838 -13.007 1.00 49.26 ? 75   THR B CB  1 
ATOM   1823 O  OG1 . THR B 1 75  ? 17.152 30.206 -13.309 1.00 50.00 ? 75   THR B OG1 1 
ATOM   1824 C  CG2 . THR B 1 75  ? 15.879 31.233 -11.537 1.00 49.58 ? 75   THR B CG2 1 
ATOM   1825 N  N   . ASP B 1 76  ? 15.043 28.884 -15.531 1.00 48.52 ? 76   ASP B N   1 
ATOM   1826 C  CA  . ASP B 1 76  ? 14.857 28.750 -16.975 1.00 48.87 ? 76   ASP B CA  1 
ATOM   1827 C  C   . ASP B 1 76  ? 13.449 28.247 -17.308 1.00 48.20 ? 76   ASP B C   1 
ATOM   1828 O  O   . ASP B 1 76  ? 12.728 28.883 -18.079 1.00 49.20 ? 76   ASP B O   1 
ATOM   1829 C  CB  . ASP B 1 76  ? 15.906 27.800 -17.572 1.00 48.70 ? 76   ASP B CB  1 
ATOM   1830 C  CG  . ASP B 1 76  ? 17.337 28.254 -17.306 1.00 49.70 ? 76   ASP B CG  1 
ATOM   1831 O  OD1 . ASP B 1 76  ? 17.558 29.456 -17.033 1.00 49.14 ? 76   ASP B OD1 1 
ATOM   1832 O  OD2 . ASP B 1 76  ? 18.246 27.399 -17.372 1.00 50.10 ? 76   ASP B OD2 1 
ATOM   1833 N  N   . THR B 1 77  ? 13.064 27.114 -16.720 1.00 46.43 ? 77   THR B N   1 
ATOM   1834 C  CA  . THR B 1 77  ? 11.769 26.482 -17.009 1.00 45.58 ? 77   THR B CA  1 
ATOM   1835 C  C   . THR B 1 77  ? 10.625 27.006 -16.127 1.00 45.16 ? 77   THR B C   1 
ATOM   1836 O  O   . THR B 1 77  ? 9.457  26.954 -16.524 1.00 45.00 ? 77   THR B O   1 
ATOM   1837 C  CB  . THR B 1 77  ? 11.841 24.948 -16.860 1.00 44.63 ? 77   THR B CB  1 
ATOM   1838 O  OG1 . THR B 1 77  ? 12.003 24.601 -15.480 1.00 42.76 ? 77   THR B OG1 1 
ATOM   1839 C  CG2 . THR B 1 77  ? 12.994 24.379 -17.672 1.00 44.66 ? 77   THR B CG2 1 
ATOM   1840 N  N   . GLY B 1 78  ? 10.963 27.492 -14.934 1.00 44.15 ? 78   GLY B N   1 
ATOM   1841 C  CA  . GLY B 1 78  ? 9.981  28.064 -14.014 1.00 43.84 ? 78   GLY B CA  1 
ATOM   1842 C  C   . GLY B 1 78  ? 9.351  27.067 -13.056 1.00 42.85 ? 78   GLY B C   1 
ATOM   1843 O  O   . GLY B 1 78  ? 8.522  27.445 -12.229 1.00 42.91 ? 78   GLY B O   1 
ATOM   1844 N  N   . ALA B 1 79  ? 9.749  25.800 -13.154 1.00 42.10 ? 79   ALA B N   1 
ATOM   1845 C  CA  . ALA B 1 79  ? 9.153  24.735 -12.351 1.00 41.88 ? 79   ALA B CA  1 
ATOM   1846 C  C   . ALA B 1 79  ? 9.570  24.827 -10.878 1.00 41.90 ? 79   ALA B C   1 
ATOM   1847 O  O   . ALA B 1 79  ? 10.762 24.906 -10.570 1.00 41.46 ? 79   ALA B O   1 
ATOM   1848 C  CB  . ALA B 1 79  ? 9.529  23.380 -12.923 1.00 41.51 ? 79   ALA B CB  1 
ATOM   1849 N  N   . ILE B 1 80  ? 8.578  24.807 -9.983  1.00 42.15 ? 80   ILE B N   1 
ATOM   1850 C  CA  . ILE B 1 80  ? 8.795  24.908 -8.537  1.00 41.48 ? 80   ILE B CA  1 
ATOM   1851 C  C   . ILE B 1 80  ? 8.420  23.597 -7.840  1.00 41.14 ? 80   ILE B C   1 
ATOM   1852 O  O   . ILE B 1 80  ? 7.424  22.964 -8.193  1.00 41.35 ? 80   ILE B O   1 
ATOM   1853 C  CB  . ILE B 1 80  ? 7.928  26.031 -7.907  1.00 42.21 ? 80   ILE B CB  1 
ATOM   1854 C  CG1 . ILE B 1 80  ? 8.030  27.328 -8.710  1.00 43.67 ? 80   ILE B CG1 1 
ATOM   1855 C  CG2 . ILE B 1 80  ? 8.339  26.284 -6.459  1.00 41.37 ? 80   ILE B CG2 1 
ATOM   1856 C  CD1 . ILE B 1 80  ? 7.302  28.500 -8.068  1.00 46.07 ? 80   ILE B CD1 1 
ATOM   1857 N  N   . LYS B 1 81  ? 9.217  23.199 -6.851  1.00 40.90 ? 81   LYS B N   1 
ATOM   1858 C  CA  . LYS B 1 81  ? 8.825  22.128 -5.932  1.00 40.72 ? 81   LYS B CA  1 
ATOM   1859 C  C   . LYS B 1 81  ? 9.259  22.430 -4.497  1.00 40.66 ? 81   LYS B C   1 
ATOM   1860 O  O   . LYS B 1 81  ? 10.282 23.079 -4.268  1.00 39.70 ? 81   LYS B O   1 
ATOM   1861 C  CB  . LYS B 1 81  ? 9.356  20.764 -6.389  1.00 40.30 ? 81   LYS B CB  1 
ATOM   1862 C  CG  . LYS B 1 81  ? 10.871 20.628 -6.463  1.00 39.85 ? 81   LYS B CG  1 
ATOM   1863 C  CD  . LYS B 1 81  ? 11.309 19.165 -6.357  1.00 39.47 ? 81   LYS B CD  1 
ATOM   1864 C  CE  . LYS B 1 81  ? 10.811 18.315 -7.520  1.00 39.04 ? 81   LYS B CE  1 
ATOM   1865 N  NZ  . LYS B 1 81  ? 10.905 16.856 -7.223  1.00 38.51 ? 81   LYS B NZ  1 
ATOM   1866 N  N   . ARG B 1 82  ? 8.458  21.960 -3.543  1.00 41.52 ? 82   ARG B N   1 
ATOM   1867 C  CA  . ARG B 1 82  ? 8.679  22.221 -2.125  1.00 41.79 ? 82   ARG B CA  1 
ATOM   1868 C  C   . ARG B 1 82  ? 8.722  20.932 -1.320  1.00 41.39 ? 82   ARG B C   1 
ATOM   1869 O  O   . ARG B 1 82  ? 8.168  19.908 -1.722  1.00 41.44 ? 82   ARG B O   1 
ATOM   1870 C  CB  . ARG B 1 82  ? 7.565  23.101 -1.565  1.00 43.02 ? 82   ARG B CB  1 
ATOM   1871 C  CG  . ARG B 1 82  ? 7.507  24.490 -2.152  1.00 45.63 ? 82   ARG B CG  1 
ATOM   1872 C  CD  . ARG B 1 82  ? 6.341  25.270 -1.574  1.00 49.54 ? 82   ARG B CD  1 
ATOM   1873 N  NE  . ARG B 1 82  ? 6.298  26.632 -2.098  1.00 52.97 ? 82   ARG B NE  1 
ATOM   1874 C  CZ  . ARG B 1 82  ? 5.725  26.997 -3.245  1.00 55.35 ? 82   ARG B CZ  1 
ATOM   1875 N  NH1 . ARG B 1 82  ? 5.119  26.106 -4.028  1.00 55.42 ? 82   ARG B NH1 1 
ATOM   1876 N  NH2 . ARG B 1 82  ? 5.760  28.274 -3.612  1.00 57.40 ? 82   ARG B NH2 1 
ATOM   1877 N  N   . GLY B 1 83  ? 9.374  21.009 -0.167  1.00 40.98 ? 83   GLY B N   1 
ATOM   1878 C  CA  . GLY B 1 83  ? 9.457  19.889 0.758   1.00 40.68 ? 83   GLY B CA  1 
ATOM   1879 C  C   . GLY B 1 83  ? 10.146 20.314 2.037   1.00 39.99 ? 83   GLY B C   1 
ATOM   1880 O  O   . GLY B 1 83  ? 10.412 21.499 2.243   1.00 39.47 ? 83   GLY B O   1 
ATOM   1881 N  N   . THR B 1 84  ? 10.436 19.344 2.895   1.00 39.76 ? 84   THR B N   1 
ATOM   1882 C  CA  . THR B 1 84  ? 11.142 19.603 4.143   1.00 39.26 ? 84   THR B CA  1 
ATOM   1883 C  C   . THR B 1 84  ? 12.349 18.676 4.278   1.00 38.57 ? 84   THR B C   1 
ATOM   1884 O  O   . THR B 1 84  ? 12.283 17.497 3.919   1.00 38.60 ? 84   THR B O   1 
ATOM   1885 C  CB  . THR B 1 84  ? 10.205 19.446 5.362   1.00 39.80 ? 84   THR B CB  1 
ATOM   1886 O  OG1 . THR B 1 84  ? 9.357  18.307 5.177   1.00 39.36 ? 84   THR B OG1 1 
ATOM   1887 C  CG2 . THR B 1 84  ? 9.340  20.686 5.530   1.00 40.61 ? 84   THR B CG2 1 
ATOM   1888 N  N   . LEU B 1 85  ? 13.451 19.228 4.781   1.00 37.84 ? 85   LEU B N   1 
ATOM   1889 C  CA  . LEU B 1 85  ? 14.682 18.475 4.992   1.00 37.16 ? 85   LEU B CA  1 
ATOM   1890 C  C   . LEU B 1 85  ? 14.656 17.856 6.378   1.00 37.55 ? 85   LEU B C   1 
ATOM   1891 O  O   . LEU B 1 85  ? 14.720 18.565 7.381   1.00 37.96 ? 85   LEU B O   1 
ATOM   1892 C  CB  . LEU B 1 85  ? 15.904 19.390 4.855   1.00 36.63 ? 85   LEU B CB  1 
ATOM   1893 C  CG  . LEU B 1 85  ? 16.108 20.036 3.486   1.00 35.02 ? 85   LEU B CG  1 
ATOM   1894 C  CD1 . LEU B 1 85  ? 17.323 20.943 3.501   1.00 32.16 ? 85   LEU B CD1 1 
ATOM   1895 C  CD2 . LEU B 1 85  ? 16.245 18.970 2.411   1.00 34.96 ? 85   LEU B CD2 1 
ATOM   1896 N  N   . MET B 1 86  ? 14.556 16.531 6.429   1.00 38.02 ? 86   MET B N   1 
ATOM   1897 C  CA  . MET B 1 86  ? 14.490 15.807 7.696   1.00 38.48 ? 86   MET B CA  1 
ATOM   1898 C  C   . MET B 1 86  ? 15.893 15.612 8.283   1.00 37.23 ? 86   MET B C   1 
ATOM   1899 O  O   . MET B 1 86  ? 16.870 15.537 7.534   1.00 36.89 ? 86   MET B O   1 
ATOM   1900 C  CB  . MET B 1 86  ? 13.789 14.452 7.512   1.00 39.92 ? 86   MET B CB  1 
ATOM   1901 C  CG  . MET B 1 86  ? 14.418 13.526 6.463   1.00 43.57 ? 86   MET B CG  1 
ATOM   1902 S  SD  . MET B 1 86  ? 13.780 11.834 6.512   1.00 51.68 ? 86   MET B SD  1 
ATOM   1903 C  CE  . MET B 1 86  ? 14.487 11.242 8.051   1.00 51.03 ? 86   MET B CE  1 
ATOM   1904 N  N   . PRO B 1 87  ? 15.996 15.531 9.625   1.00 36.36 ? 87   PRO B N   1 
ATOM   1905 C  CA  . PRO B 1 87  ? 17.289 15.308 10.277  1.00 35.41 ? 87   PRO B CA  1 
ATOM   1906 C  C   . PRO B 1 87  ? 17.785 13.866 10.138  1.00 34.99 ? 87   PRO B C   1 
ATOM   1907 O  O   . PRO B 1 87  ? 16.996 12.924 10.223  1.00 35.06 ? 87   PRO B O   1 
ATOM   1908 C  CB  . PRO B 1 87  ? 16.998 15.638 11.744  1.00 35.50 ? 87   PRO B CB  1 
ATOM   1909 C  CG  . PRO B 1 87  ? 15.561 15.318 11.917  1.00 35.89 ? 87   PRO B CG  1 
ATOM   1910 C  CD  . PRO B 1 87  ? 14.902 15.649 10.610  1.00 36.56 ? 87   PRO B CD  1 
ATOM   1911 N  N   . MET B 1 88  ? 19.086 13.705 9.927   1.00 34.53 ? 88   MET B N   1 
ATOM   1912 C  CA  . MET B 1 88  ? 19.684 12.382 9.767   1.00 34.92 ? 88   MET B CA  1 
ATOM   1913 C  C   . MET B 1 88  ? 21.182 12.435 10.040  1.00 34.47 ? 88   MET B C   1 
ATOM   1914 O  O   . MET B 1 88  ? 21.755 13.518 10.149  1.00 33.91 ? 88   MET B O   1 
ATOM   1915 C  CB  . MET B 1 88  ? 19.433 11.858 8.352   1.00 35.21 ? 88   MET B CB  1 
ATOM   1916 C  CG  . MET B 1 88  ? 20.069 12.707 7.257   1.00 35.76 ? 88   MET B CG  1 
ATOM   1917 S  SD  . MET B 1 88  ? 19.610 12.183 5.599   1.00 38.31 ? 88   MET B SD  1 
ATOM   1918 C  CE  . MET B 1 88  ? 17.972 12.905 5.470   1.00 34.58 ? 88   MET B CE  1 
ATOM   1919 N  N   . VAL B 1 89  ? 21.811 11.266 10.142  1.00 34.94 ? 89   VAL B N   1 
ATOM   1920 C  CA  . VAL B 1 89  ? 23.257 11.188 10.356  1.00 34.92 ? 89   VAL B CA  1 
ATOM   1921 C  C   . VAL B 1 89  ? 23.947 10.346 9.283   1.00 35.82 ? 89   VAL B C   1 
ATOM   1922 O  O   . VAL B 1 89  ? 23.406 9.346  8.814   1.00 36.07 ? 89   VAL B O   1 
ATOM   1923 C  CB  . VAL B 1 89  ? 23.597 10.631 11.756  1.00 35.25 ? 89   VAL B CB  1 
ATOM   1924 C  CG1 . VAL B 1 89  ? 23.213 9.155  11.862  1.00 35.56 ? 89   VAL B CG1 1 
ATOM   1925 C  CG2 . VAL B 1 89  ? 25.071 10.836 12.068  1.00 33.70 ? 89   VAL B CG2 1 
ATOM   1926 N  N   . ALA B 1 90  ? 25.138 10.785 8.888   1.00 36.49 ? 90   ALA B N   1 
ATOM   1927 C  CA  . ALA B 1 90  ? 26.011 10.019 8.007   1.00 37.76 ? 90   ALA B CA  1 
ATOM   1928 C  C   . ALA B 1 90  ? 27.331 9.796  8.741   1.00 39.19 ? 90   ALA B C   1 
ATOM   1929 O  O   . ALA B 1 90  ? 27.463 10.178 9.905   1.00 38.86 ? 90   ALA B O   1 
ATOM   1930 C  CB  . ALA B 1 90  ? 26.233 10.766 6.710   1.00 37.25 ? 90   ALA B CB  1 
ATOM   1931 N  N   . ASP B 1 91  ? 28.304 9.187  8.068   1.00 41.21 ? 91   ASP B N   1 
ATOM   1932 C  CA  . ASP B 1 91  ? 29.590 8.864  8.701   1.00 42.87 ? 91   ASP B CA  1 
ATOM   1933 C  C   . ASP B 1 91  ? 30.435 10.093 9.065   1.00 42.58 ? 91   ASP B C   1 
ATOM   1934 O  O   . ASP B 1 91  ? 31.357 9.987  9.882   1.00 43.13 ? 91   ASP B O   1 
ATOM   1935 C  CB  . ASP B 1 91  ? 30.405 7.892  7.834   1.00 44.65 ? 91   ASP B CB  1 
ATOM   1936 C  CG  . ASP B 1 91  ? 30.805 8.480  6.488   1.00 46.48 ? 91   ASP B CG  1 
ATOM   1937 O  OD1 . ASP B 1 91  ? 30.319 9.575  6.123   1.00 46.63 ? 91   ASP B OD1 1 
ATOM   1938 O  OD2 . ASP B 1 91  ? 31.611 7.829  5.786   1.00 50.21 ? 91   ASP B OD2 1 
ATOM   1939 N  N   . ASP B 1 92  ? 30.124 11.241 8.458   1.00 41.65 ? 92   ASP B N   1 
ATOM   1940 C  CA  . ASP B 1 92  ? 30.782 12.510 8.795   1.00 41.09 ? 92   ASP B CA  1 
ATOM   1941 C  C   . ASP B 1 92  ? 29.907 13.410 9.682   1.00 39.42 ? 92   ASP B C   1 
ATOM   1942 O  O   . ASP B 1 92  ? 30.189 14.599 9.828   1.00 39.09 ? 92   ASP B O   1 
ATOM   1943 C  CB  . ASP B 1 92  ? 31.227 13.257 7.522   1.00 41.63 ? 92   ASP B CB  1 
ATOM   1944 C  CG  . ASP B 1 92  ? 30.058 13.773 6.689   1.00 40.96 ? 92   ASP B CG  1 
ATOM   1945 O  OD1 . ASP B 1 92  ? 29.046 13.054 6.563   1.00 41.43 ? 92   ASP B OD1 1 
ATOM   1946 O  OD2 . ASP B 1 92  ? 30.163 14.896 6.148   1.00 40.55 ? 92   ASP B OD2 1 
ATOM   1947 N  N   . GLY B 1 93  ? 28.856 12.842 10.272  1.00 38.67 ? 93   GLY B N   1 
ATOM   1948 C  CA  . GLY B 1 93  ? 28.056 13.547 11.274  1.00 37.24 ? 93   GLY B CA  1 
ATOM   1949 C  C   . GLY B 1 93  ? 26.636 13.851 10.842  1.00 36.22 ? 93   GLY B C   1 
ATOM   1950 O  O   . GLY B 1 93  ? 26.250 13.553 9.710   1.00 36.43 ? 93   GLY B O   1 
ATOM   1951 N  N   . PRO B 1 94  ? 25.847 14.457 11.750  1.00 35.35 ? 94   PRO B N   1 
ATOM   1952 C  CA  . PRO B 1 94  ? 24.441 14.757 11.496  1.00 34.58 ? 94   PRO B CA  1 
ATOM   1953 C  C   . PRO B 1 94  ? 24.222 15.924 10.534  1.00 33.99 ? 94   PRO B C   1 
ATOM   1954 O  O   . PRO B 1 94  ? 25.086 16.797 10.399  1.00 33.52 ? 94   PRO B O   1 
ATOM   1955 C  CB  . PRO B 1 94  ? 23.903 15.103 12.887  1.00 34.28 ? 94   PRO B CB  1 
ATOM   1956 C  CG  . PRO B 1 94  ? 25.076 15.624 13.618  1.00 34.14 ? 94   PRO B CG  1 
ATOM   1957 C  CD  . PRO B 1 94  ? 26.249 14.848 13.114  1.00 35.14 ? 94   PRO B CD  1 
ATOM   1958 N  N   . HIS B 1 95  ? 23.065 15.919 9.873   1.00 33.53 ? 95   HIS B N   1 
ATOM   1959 C  CA  . HIS B 1 95  ? 22.662 16.995 8.968   1.00 32.75 ? 95   HIS B CA  1 
ATOM   1960 C  C   . HIS B 1 95  ? 21.178 16.888 8.631   1.00 32.31 ? 95   HIS B C   1 
ATOM   1961 O  O   . HIS B 1 95  ? 20.518 15.915 8.999   1.00 32.19 ? 95   HIS B O   1 
ATOM   1962 C  CB  . HIS B 1 95  ? 23.483 16.958 7.675   1.00 33.10 ? 95   HIS B CB  1 
ATOM   1963 C  CG  . HIS B 1 95  ? 23.313 15.699 6.882   1.00 34.13 ? 95   HIS B CG  1 
ATOM   1964 N  ND1 . HIS B 1 95  ? 24.128 14.599 7.046   1.00 36.22 ? 95   HIS B ND1 1 
ATOM   1965 C  CD2 . HIS B 1 95  ? 22.425 15.368 5.915   1.00 34.82 ? 95   HIS B CD2 1 
ATOM   1966 C  CE1 . HIS B 1 95  ? 23.748 13.645 6.216   1.00 37.86 ? 95   HIS B CE1 1 
ATOM   1967 N  NE2 . HIS B 1 95  ? 22.718 14.087 5.516   1.00 36.17 ? 95   HIS B NE2 1 
ATOM   1968 N  N   . TYR B 1 96  ? 20.667 17.901 7.935   1.00 32.03 ? 96   TYR B N   1 
ATOM   1969 C  CA  . TYR B 1 96  ? 19.307 17.889 7.405   1.00 31.83 ? 96   TYR B CA  1 
ATOM   1970 C  C   . TYR B 1 96  ? 19.385 17.606 5.912   1.00 32.41 ? 96   TYR B C   1 
ATOM   1971 O  O   . TYR B 1 96  ? 20.109 18.290 5.193   1.00 32.79 ? 96   TYR B O   1 
ATOM   1972 C  CB  . TYR B 1 96  ? 18.626 19.239 7.640   1.00 31.59 ? 96   TYR B CB  1 
ATOM   1973 C  CG  . TYR B 1 96  ? 18.547 19.642 9.092   1.00 29.51 ? 96   TYR B CG  1 
ATOM   1974 C  CD1 . TYR B 1 96  ? 17.510 19.192 9.902   1.00 28.31 ? 96   TYR B CD1 1 
ATOM   1975 C  CD2 . TYR B 1 96  ? 19.509 20.474 9.657   1.00 28.23 ? 96   TYR B CD2 1 
ATOM   1976 C  CE1 . TYR B 1 96  ? 17.435 19.555 11.238  1.00 28.71 ? 96   TYR B CE1 1 
ATOM   1977 C  CE2 . TYR B 1 96  ? 19.441 20.846 10.992  1.00 28.86 ? 96   TYR B CE2 1 
ATOM   1978 C  CZ  . TYR B 1 96  ? 18.402 20.382 11.777  1.00 28.54 ? 96   TYR B CZ  1 
ATOM   1979 O  OH  . TYR B 1 96  ? 18.326 20.745 13.100  1.00 27.45 ? 96   TYR B OH  1 
ATOM   1980 N  N   . GLY B 1 97  ? 18.651 16.600 5.446   1.00 32.88 ? 97   GLY B N   1 
ATOM   1981 C  CA  . GLY B 1 97  ? 18.718 16.204 4.041   1.00 33.19 ? 97   GLY B CA  1 
ATOM   1982 C  C   . GLY B 1 97  ? 17.422 15.657 3.482   1.00 33.59 ? 97   GLY B C   1 
ATOM   1983 O  O   . GLY B 1 97  ? 16.472 15.400 4.220   1.00 33.86 ? 97   GLY B O   1 
ATOM   1984 N  N   . ALA B 1 98  ? 17.395 15.487 2.164   1.00 34.01 ? 98   ALA B N   1 
ATOM   1985 C  CA  . ALA B 1 98  ? 16.246 14.911 1.468   1.00 34.82 ? 98   ALA B CA  1 
ATOM   1986 C  C   . ALA B 1 98  ? 16.651 14.407 0.080   1.00 35.46 ? 98   ALA B C   1 
ATOM   1987 O  O   . ALA B 1 98  ? 17.413 15.068 -0.628  1.00 35.37 ? 98   ALA B O   1 
ATOM   1988 C  CB  . ALA B 1 98  ? 15.130 15.941 1.347   1.00 34.37 ? 98   ALA B CB  1 
ATOM   1989 N  N   . ASN B 1 99  ? 16.154 13.229 -0.293  1.00 36.15 ? 99   ASN B N   1 
ATOM   1990 C  CA  . ASN B 1 99  ? 16.293 12.733 -1.660  1.00 36.69 ? 99   ASN B CA  1 
ATOM   1991 C  C   . ASN B 1 99  ? 15.269 13.430 -2.540  1.00 36.75 ? 99   ASN B C   1 
ATOM   1992 O  O   . ASN B 1 99  ? 14.091 13.496 -2.191  1.00 36.76 ? 99   ASN B O   1 
ATOM   1993 C  CB  . ASN B 1 99  ? 16.087 11.214 -1.730  1.00 37.53 ? 99   ASN B CB  1 
ATOM   1994 C  CG  . ASN B 1 99  ? 17.294 10.427 -1.238  1.00 37.33 ? 99   ASN B CG  1 
ATOM   1995 O  OD1 . ASN B 1 99  ? 18.368 10.981 -1.021  1.00 35.09 ? 99   ASN B OD1 1 
ATOM   1996 N  ND2 . ASN B 1 99  ? 17.117 9.121  -1.068  1.00 36.86 ? 99   ASN B ND2 1 
ATOM   1997 N  N   . ILE B 1 100 ? 15.726 13.956 -3.673  1.00 37.07 ? 100  ILE B N   1 
ATOM   1998 C  CA  . ILE B 1 100 ? 14.872 14.713 -4.582  1.00 37.03 ? 100  ILE B CA  1 
ATOM   1999 C  C   . ILE B 1 100 ? 14.955 14.128 -5.985  1.00 37.84 ? 100  ILE B C   1 
ATOM   2000 O  O   . ILE B 1 100 ? 16.046 13.808 -6.468  1.00 37.51 ? 100  ILE B O   1 
ATOM   2001 C  CB  . ILE B 1 100 ? 15.286 16.205 -4.641  1.00 36.67 ? 100  ILE B CB  1 
ATOM   2002 C  CG1 . ILE B 1 100 ? 15.151 16.858 -3.261  1.00 35.70 ? 100  ILE B CG1 1 
ATOM   2003 C  CG2 . ILE B 1 100 ? 14.439 16.959 -5.662  1.00 35.63 ? 100  ILE B CG2 1 
ATOM   2004 C  CD1 . ILE B 1 100 ? 15.653 18.278 -3.214  1.00 33.77 ? 100  ILE B CD1 1 
ATOM   2005 N  N   . ALA B 1 101 ? 13.795 13.984 -6.623  1.00 38.63 ? 101  ALA B N   1 
ATOM   2006 C  CA  . ALA B 1 101 ? 13.717 13.584 -8.022  1.00 39.47 ? 101  ALA B CA  1 
ATOM   2007 C  C   . ALA B 1 101 ? 13.835 14.835 -8.885  1.00 40.09 ? 101  ALA B C   1 
ATOM   2008 O  O   . ALA B 1 101 ? 13.068 15.781 -8.712  1.00 40.41 ? 101  ALA B O   1 
ATOM   2009 C  CB  . ALA B 1 101 ? 12.407 12.873 -8.292  1.00 39.75 ? 101  ALA B CB  1 
ATOM   2010 N  N   . MET B 1 102 ? 14.802 14.845 -9.801  1.00 41.30 ? 102  MET B N   1 
ATOM   2011 C  CA  . MET B 1 102 ? 15.043 15.999 -10.672 1.00 42.19 ? 102  MET B CA  1 
ATOM   2012 C  C   . MET B 1 102 ? 14.666 15.656 -12.116 1.00 43.36 ? 102  MET B C   1 
ATOM   2013 O  O   . MET B 1 102 ? 13.566 15.985 -12.557 1.00 43.57 ? 102  MET B O   1 
ATOM   2014 C  CB  . MET B 1 102 ? 16.499 16.468 -10.557 1.00 42.12 ? 102  MET B CB  1 
ATOM   2015 C  CG  . MET B 1 102 ? 16.863 17.036 -9.185  1.00 42.10 ? 102  MET B CG  1 
ATOM   2016 S  SD  . MET B 1 102 ? 16.079 18.615 -8.798  1.00 43.61 ? 102  MET B SD  1 
ATOM   2017 C  CE  . MET B 1 102 ? 16.988 19.715 -9.881  1.00 40.31 ? 102  MET B CE  1 
ATOM   2018 N  N   . GLU B 1 103 ? 15.556 14.986 -12.845 1.00 44.67 ? 103  GLU B N   1 
ATOM   2019 C  CA  . GLU B 1 103 ? 15.238 14.530 -14.202 1.00 46.04 ? 103  GLU B CA  1 
ATOM   2020 C  C   . GLU B 1 103 ? 14.109 13.497 -14.167 1.00 46.92 ? 103  GLU B C   1 
ATOM   2021 O  O   . GLU B 1 103 ? 13.288 13.425 -15.083 1.00 46.89 ? 103  GLU B O   1 
ATOM   2022 C  CB  . GLU B 1 103 ? 16.467 13.923 -14.889 1.00 46.72 ? 103  GLU B CB  1 
ATOM   2023 C  CG  . GLU B 1 103 ? 17.589 14.912 -15.188 1.00 46.51 ? 103  GLU B CG  1 
ATOM   2024 C  CD  . GLU B 1 103 ? 18.653 14.951 -14.104 1.00 47.04 ? 103  GLU B CD  1 
ATOM   2025 O  OE1 . GLU B 1 103 ? 18.290 15.007 -12.911 1.00 46.87 ? 103  GLU B OE1 1 
ATOM   2026 O  OE2 . GLU B 1 103 ? 19.855 14.927 -14.446 1.00 49.50 ? 103  GLU B OE2 1 
ATOM   2027 N  N   . LYS B 1 104 ? 14.072 12.711 -13.094 1.00 48.02 ? 104  LYS B N   1 
ATOM   2028 C  CA  . LYS B 1 104 ? 13.051 11.684 -12.911 1.00 49.44 ? 104  LYS B CA  1 
ATOM   2029 C  C   . LYS B 1 104 ? 11.695 12.232 -12.452 1.00 49.61 ? 104  LYS B C   1 
ATOM   2030 O  O   . LYS B 1 104 ? 10.743 11.465 -12.341 1.00 50.33 ? 104  LYS B O   1 
ATOM   2031 C  CB  . LYS B 1 104 ? 13.547 10.614 -11.928 1.00 49.68 ? 104  LYS B CB  1 
ATOM   2032 C  CG  . LYS B 1 104 ? 14.652 9.738  -12.498 1.00 52.27 ? 104  LYS B CG  1 
ATOM   2033 C  CD  . LYS B 1 104 ? 15.212 8.770  -11.466 1.00 54.71 ? 104  LYS B CD  1 
ATOM   2034 C  CE  . LYS B 1 104 ? 16.256 7.855  -12.087 1.00 56.48 ? 104  LYS B CE  1 
ATOM   2035 N  NZ  . LYS B 1 104 ? 16.836 6.911  -11.098 1.00 57.75 ? 104  LYS B NZ  1 
ATOM   2036 N  N   . ASP B 1 105 ? 11.598 13.534 -12.172 1.00 49.57 ? 105  ASP B N   1 
ATOM   2037 C  CA  . ASP B 1 105 ? 10.299 14.146 -11.870 1.00 49.91 ? 105  ASP B CA  1 
ATOM   2038 C  C   . ASP B 1 105 ? 9.623  14.559 -13.177 1.00 50.74 ? 105  ASP B C   1 
ATOM   2039 O  O   . ASP B 1 105 ? 10.092 15.454 -13.883 1.00 50.80 ? 105  ASP B O   1 
ATOM   2040 C  CB  . ASP B 1 105 ? 10.437 15.348 -10.927 1.00 49.30 ? 105  ASP B CB  1 
ATOM   2041 C  CG  . ASP B 1 105 ? 9.092  15.823 -10.369 1.00 49.41 ? 105  ASP B CG  1 
ATOM   2042 O  OD1 . ASP B 1 105 ? 8.065  15.152 -10.597 1.00 50.92 ? 105  ASP B OD1 1 
ATOM   2043 O  OD2 . ASP B 1 105 ? 9.059  16.872 -9.695  1.00 49.58 ? 105  ASP B OD2 1 
ATOM   2044 N  N   . LYS B 1 106 ? 8.508  13.903 -13.479 1.00 51.68 ? 106  LYS B N   1 
ATOM   2045 C  CA  . LYS B 1 106 ? 7.830  14.061 -14.761 1.00 52.68 ? 106  LYS B CA  1 
ATOM   2046 C  C   . LYS B 1 106 ? 6.845  15.237 -14.710 1.00 52.35 ? 106  LYS B C   1 
ATOM   2047 O  O   . LYS B 1 106 ? 6.444  15.761 -15.749 1.00 52.37 ? 106  LYS B O   1 
ATOM   2048 C  CB  . LYS B 1 106 ? 7.077  12.777 -15.150 1.00 54.02 ? 106  LYS B CB  1 
ATOM   2049 C  CG  . LYS B 1 106 ? 7.559  11.457 -14.521 1.00 56.91 ? 106  LYS B CG  1 
ATOM   2050 C  CD  . LYS B 1 106 ? 8.968  11.058 -14.934 1.00 59.57 ? 106  LYS B CD  1 
ATOM   2051 C  CE  . LYS B 1 106 ? 9.384  9.749  -14.244 1.00 61.49 ? 106  LYS B CE  1 
ATOM   2052 N  NZ  . LYS B 1 106 ? 10.858 9.504  -14.284 1.00 60.29 ? 106  LYS B NZ  1 
ATOM   2053 N  N   . LYS B 1 107 ? 6.462  15.643 -13.498 1.00 52.13 ? 107  LYS B N   1 
ATOM   2054 C  CA  . LYS B 1 107 ? 5.473  16.708 -13.288 1.00 52.15 ? 107  LYS B CA  1 
ATOM   2055 C  C   . LYS B 1 107 ? 5.976  18.102 -13.655 1.00 51.25 ? 107  LYS B C   1 
ATOM   2056 O  O   . LYS B 1 107 ? 5.172  19.012 -13.858 1.00 51.93 ? 107  LYS B O   1 
ATOM   2057 C  CB  . LYS B 1 107 ? 5.019  16.740 -11.825 1.00 52.38 ? 107  LYS B CB  1 
ATOM   2058 C  CG  . LYS B 1 107 ? 4.349  15.467 -11.331 1.00 54.10 ? 107  LYS B CG  1 
ATOM   2059 C  CD  . LYS B 1 107 ? 3.646  15.690 -9.989  1.00 56.82 ? 107  LYS B CD  1 
ATOM   2060 C  CE  . LYS B 1 107 ? 4.610  16.075 -8.864  1.00 57.45 ? 107  LYS B CE  1 
ATOM   2061 N  NZ  . LYS B 1 107 ? 5.703  15.074 -8.667  1.00 56.05 ? 107  LYS B NZ  1 
ATOM   2062 N  N   . GLY B 1 108 ? 7.295  18.276 -13.707 1.00 49.83 ? 108  GLY B N   1 
ATOM   2063 C  CA  . GLY B 1 108 ? 7.888  19.566 -14.050 1.00 48.86 ? 108  GLY B CA  1 
ATOM   2064 C  C   . GLY B 1 108 ? 9.190  19.437 -14.810 1.00 47.73 ? 108  GLY B C   1 
ATOM   2065 O  O   . GLY B 1 108 ? 9.694  18.333 -15.020 1.00 47.21 ? 108  GLY B O   1 
ATOM   2066 N  N   . GLY B 1 109 ? 9.721  20.580 -15.232 1.00 47.13 ? 109  GLY B N   1 
ATOM   2067 C  CA  . GLY B 1 109 ? 11.015 20.644 -15.900 1.00 46.63 ? 109  GLY B CA  1 
ATOM   2068 C  C   . GLY B 1 109 ? 12.121 20.865 -14.890 1.00 45.19 ? 109  GLY B C   1 
ATOM   2069 O  O   . GLY B 1 109 ? 12.646 21.970 -14.765 1.00 44.54 ? 109  GLY B O   1 
ATOM   2070 N  N   . PHE B 1 110 ? 12.459 19.807 -14.161 1.00 44.42 ? 110  PHE B N   1 
ATOM   2071 C  CA  . PHE B 1 110 ? 13.542 19.848 -13.188 1.00 43.77 ? 110  PHE B CA  1 
ATOM   2072 C  C   . PHE B 1 110 ? 14.779 19.157 -13.755 1.00 43.81 ? 110  PHE B C   1 
ATOM   2073 O  O   . PHE B 1 110 ? 15.369 18.291 -13.113 1.00 43.35 ? 110  PHE B O   1 
ATOM   2074 C  CB  . PHE B 1 110 ? 13.114 19.183 -11.878 1.00 43.36 ? 110  PHE B CB  1 
ATOM   2075 C  CG  . PHE B 1 110 ? 11.902 19.806 -11.250 1.00 44.01 ? 110  PHE B CG  1 
ATOM   2076 C  CD1 . PHE B 1 110 ? 12.012 20.981 -10.522 1.00 44.03 ? 110  PHE B CD1 1 
ATOM   2077 C  CD2 . PHE B 1 110 ? 10.651 19.214 -11.382 1.00 45.18 ? 110  PHE B CD2 1 
ATOM   2078 C  CE1 . PHE B 1 110 ? 10.898 21.561 -9.942  1.00 44.96 ? 110  PHE B CE1 1 
ATOM   2079 C  CE2 . PHE B 1 110 ? 9.530  19.786 -10.800 1.00 45.29 ? 110  PHE B CE2 1 
ATOM   2080 C  CZ  . PHE B 1 110 ? 9.654  20.961 -10.079 1.00 45.56 ? 110  PHE B CZ  1 
ATOM   2081 N  N   . GLY B 1 111 ? 15.171 19.551 -14.963 1.00 44.40 ? 111  GLY B N   1 
ATOM   2082 C  CA  . GLY B 1 111 ? 16.366 19.010 -15.601 1.00 44.94 ? 111  GLY B CA  1 
ATOM   2083 C  C   . GLY B 1 111 ? 17.584 19.862 -15.304 1.00 44.90 ? 111  GLY B C   1 
ATOM   2084 O  O   . GLY B 1 111 ? 17.559 20.704 -14.409 1.00 44.55 ? 111  GLY B O   1 
ATOM   2085 N  N   . VAL B 1 112 ? 18.651 19.639 -16.063 1.00 45.41 ? 112  VAL B N   1 
ATOM   2086 C  CA  . VAL B 1 112 ? 19.862 20.450 -15.963 1.00 45.68 ? 112  VAL B CA  1 
ATOM   2087 C  C   . VAL B 1 112 ? 19.533 21.918 -16.258 1.00 45.76 ? 112  VAL B C   1 
ATOM   2088 O  O   . VAL B 1 112 ? 18.715 22.212 -17.135 1.00 46.20 ? 112  VAL B O   1 
ATOM   2089 C  CB  . VAL B 1 112 ? 20.953 19.938 -16.940 1.00 46.86 ? 112  VAL B CB  1 
ATOM   2090 C  CG1 . VAL B 1 112 ? 22.136 20.904 -17.006 1.00 48.12 ? 112  VAL B CG1 1 
ATOM   2091 C  CG2 . VAL B 1 112 ? 21.415 18.540 -16.535 1.00 46.13 ? 112  VAL B CG2 1 
ATOM   2092 N  N   . GLY B 1 113 ? 20.152 22.832 -15.512 1.00 45.43 ? 113  GLY B N   1 
ATOM   2093 C  CA  . GLY B 1 113 ? 19.929 24.265 -15.707 1.00 45.51 ? 113  GLY B CA  1 
ATOM   2094 C  C   . GLY B 1 113 ? 20.241 25.117 -14.492 1.00 44.95 ? 113  GLY B C   1 
ATOM   2095 O  O   . GLY B 1 113 ? 20.887 24.663 -13.549 1.00 44.18 ? 113  GLY B O   1 
ATOM   2096 N  N   . ASN B 1 114 ? 19.770 26.361 -14.527 1.00 45.57 ? 114  ASN B N   1 
ATOM   2097 C  CA  . ASN B 1 114 ? 20.007 27.333 -13.461 1.00 45.90 ? 114  ASN B CA  1 
ATOM   2098 C  C   . ASN B 1 114 ? 18.896 27.293 -12.415 1.00 45.09 ? 114  ASN B C   1 
ATOM   2099 O  O   . ASN B 1 114 ? 17.718 27.410 -12.755 1.00 45.29 ? 114  ASN B O   1 
ATOM   2100 C  CB  . ASN B 1 114 ? 20.108 28.739 -14.054 1.00 47.31 ? 114  ASN B CB  1 
ATOM   2101 C  CG  . ASN B 1 114 ? 21.239 28.868 -15.060 1.00 49.90 ? 114  ASN B CG  1 
ATOM   2102 O  OD1 . ASN B 1 114 ? 22.408 28.674 -14.725 1.00 52.77 ? 114  ASN B OD1 1 
ATOM   2103 N  ND2 . ASN B 1 114 ? 20.896 29.199 -16.301 1.00 51.86 ? 114  ASN B ND2 1 
ATOM   2104 N  N   . TYR B 1 115 ? 19.276 27.142 -11.146 1.00 44.64 ? 115  TYR B N   1 
ATOM   2105 C  CA  . TYR B 1 115 ? 18.310 26.985 -10.054 1.00 43.60 ? 115  TYR B CA  1 
ATOM   2106 C  C   . TYR B 1 115 ? 18.435 28.039 -8.964  1.00 43.57 ? 115  TYR B C   1 
ATOM   2107 O  O   . TYR B 1 115 ? 19.486 28.650 -8.784  1.00 44.35 ? 115  TYR B O   1 
ATOM   2108 C  CB  . TYR B 1 115 ? 18.457 25.603 -9.413  1.00 42.62 ? 115  TYR B CB  1 
ATOM   2109 C  CG  . TYR B 1 115 ? 17.812 24.505 -10.216 1.00 42.53 ? 115  TYR B CG  1 
ATOM   2110 C  CD1 . TYR B 1 115 ? 18.459 23.956 -11.319 1.00 43.91 ? 115  TYR B CD1 1 
ATOM   2111 C  CD2 . TYR B 1 115 ? 16.553 24.023 -9.884  1.00 40.60 ? 115  TYR B CD2 1 
ATOM   2112 C  CE1 . TYR B 1 115 ? 17.872 22.955 -12.065 1.00 42.55 ? 115  TYR B CE1 1 
ATOM   2113 C  CE2 . TYR B 1 115 ? 15.958 23.021 -10.623 1.00 40.81 ? 115  TYR B CE2 1 
ATOM   2114 C  CZ  . TYR B 1 115 ? 16.621 22.493 -11.710 1.00 42.51 ? 115  TYR B CZ  1 
ATOM   2115 O  OH  . TYR B 1 115 ? 16.030 21.500 -12.443 1.00 44.28 ? 115  TYR B OH  1 
ATOM   2116 N  N   . GLU B 1 116 ? 17.334 28.242 -8.249  1.00 43.55 ? 116  GLU B N   1 
ATOM   2117 C  CA  . GLU B 1 116 ? 17.329 28.980 -6.995  1.00 43.81 ? 116  GLU B CA  1 
ATOM   2118 C  C   . GLU B 1 116 ? 16.868 28.035 -5.889  1.00 42.37 ? 116  GLU B C   1 
ATOM   2119 O  O   . GLU B 1 116 ? 15.884 27.311 -6.054  1.00 41.88 ? 116  GLU B O   1 
ATOM   2120 C  CB  . GLU B 1 116 ? 16.402 30.193 -7.069  1.00 44.68 ? 116  GLU B CB  1 
ATOM   2121 C  CG  . GLU B 1 116 ? 16.895 31.285 -8.006  1.00 47.64 ? 116  GLU B CG  1 
ATOM   2122 C  CD  . GLU B 1 116 ? 16.041 32.541 -7.958  1.00 50.91 ? 116  GLU B CD  1 
ATOM   2123 O  OE1 . GLU B 1 116 ? 15.041 32.564 -7.207  1.00 52.01 ? 116  GLU B OE1 1 
ATOM   2124 O  OE2 . GLU B 1 116 ? 16.377 33.511 -8.674  1.00 53.20 ? 116  GLU B OE2 1 
ATOM   2125 N  N   . LEU B 1 117 ? 17.597 28.034 -4.778  1.00 41.64 ? 117  LEU B N   1 
ATOM   2126 C  CA  . LEU B 1 117 ? 17.227 27.262 -3.600  1.00 40.70 ? 117  LEU B CA  1 
ATOM   2127 C  C   . LEU B 1 117 ? 17.015 28.229 -2.440  1.00 40.94 ? 117  LEU B C   1 
ATOM   2128 O  O   . LEU B 1 117 ? 17.814 29.143 -2.232  1.00 41.43 ? 117  LEU B O   1 
ATOM   2129 C  CB  . LEU B 1 117 ? 18.316 26.239 -3.272  1.00 39.88 ? 117  LEU B CB  1 
ATOM   2130 C  CG  . LEU B 1 117 ? 18.144 25.389 -2.011  1.00 38.90 ? 117  LEU B CG  1 
ATOM   2131 C  CD1 . LEU B 1 117 ? 16.818 24.641 -2.019  1.00 37.67 ? 117  LEU B CD1 1 
ATOM   2132 C  CD2 . LEU B 1 117 ? 19.308 24.422 -1.879  1.00 37.61 ? 117  LEU B CD2 1 
ATOM   2133 N  N   . THR B 1 118 ? 15.923 28.032 -1.705  1.00 40.82 ? 118  THR B N   1 
ATOM   2134 C  CA  . THR B 1 118 ? 15.592 28.854 -0.546  1.00 40.98 ? 118  THR B CA  1 
ATOM   2135 C  C   . THR B 1 118 ? 15.298 27.937 0.636   1.00 40.76 ? 118  THR B C   1 
ATOM   2136 O  O   . THR B 1 118 ? 14.446 27.060 0.534   1.00 40.57 ? 118  THR B O   1 
ATOM   2137 C  CB  . THR B 1 118 ? 14.353 29.739 -0.823  1.00 41.51 ? 118  THR B CB  1 
ATOM   2138 O  OG1 . THR B 1 118 ? 14.625 30.619 -1.919  1.00 42.28 ? 118  THR B OG1 1 
ATOM   2139 C  CG2 . THR B 1 118 ? 13.981 30.566 0.399   1.00 41.51 ? 118  THR B CG2 1 
ATOM   2140 N  N   . PHE B 1 119 ? 16.015 28.123 1.743   1.00 41.27 ? 119  PHE B N   1 
ATOM   2141 C  CA  . PHE B 1 119 ? 15.672 27.448 2.996   1.00 41.34 ? 119  PHE B CA  1 
ATOM   2142 C  C   . PHE B 1 119 ? 14.816 28.392 3.835   1.00 42.44 ? 119  PHE B C   1 
ATOM   2143 O  O   . PHE B 1 119 ? 15.104 29.586 3.919   1.00 43.54 ? 119  PHE B O   1 
ATOM   2144 C  CB  . PHE B 1 119 ? 16.919 27.052 3.803   1.00 40.76 ? 119  PHE B CB  1 
ATOM   2145 C  CG  . PHE B 1 119 ? 17.774 25.981 3.162   1.00 40.29 ? 119  PHE B CG  1 
ATOM   2146 C  CD1 . PHE B 1 119 ? 17.206 24.869 2.546   1.00 40.77 ? 119  PHE B CD1 1 
ATOM   2147 C  CD2 . PHE B 1 119 ? 19.161 26.066 3.221   1.00 40.14 ? 119  PHE B CD2 1 
ATOM   2148 C  CE1 . PHE B 1 119 ? 18.008 23.884 1.972   1.00 40.89 ? 119  PHE B CE1 1 
ATOM   2149 C  CE2 . PHE B 1 119 ? 19.966 25.083 2.652   1.00 39.76 ? 119  PHE B CE2 1 
ATOM   2150 C  CZ  . PHE B 1 119 ? 19.390 23.992 2.028   1.00 39.36 ? 119  PHE B CZ  1 
ATOM   2151 N  N   . TYR B 1 120 ? 13.766 27.851 4.445   1.00 42.68 ? 120  TYR B N   1 
ATOM   2152 C  CA  . TYR B 1 120 ? 12.938 28.598 5.385   1.00 43.78 ? 120  TYR B CA  1 
ATOM   2153 C  C   . TYR B 1 120 ? 13.083 27.948 6.763   1.00 42.57 ? 120  TYR B C   1 
ATOM   2154 O  O   . TYR B 1 120 ? 12.437 26.941 7.058   1.00 42.12 ? 120  TYR B O   1 
ATOM   2155 C  CB  . TYR B 1 120 ? 11.479 28.610 4.916   1.00 45.12 ? 120  TYR B CB  1 
ATOM   2156 C  CG  . TYR B 1 120 ? 10.528 29.328 5.860   1.00 50.97 ? 120  TYR B CG  1 
ATOM   2157 C  CD1 . TYR B 1 120 ? 10.667 30.694 6.120   1.00 55.16 ? 120  TYR B CD1 1 
ATOM   2158 C  CD2 . TYR B 1 120 ? 9.483  28.643 6.489   1.00 54.89 ? 120  TYR B CD2 1 
ATOM   2159 C  CE1 . TYR B 1 120 ? 9.792  31.359 6.988   1.00 56.99 ? 120  TYR B CE1 1 
ATOM   2160 C  CE2 . TYR B 1 120 ? 8.605  29.298 7.356   1.00 56.10 ? 120  TYR B CE2 1 
ATOM   2161 C  CZ  . TYR B 1 120 ? 8.765  30.653 7.601   1.00 57.66 ? 120  TYR B CZ  1 
ATOM   2162 O  OH  . TYR B 1 120 ? 7.898  31.298 8.456   1.00 58.53 ? 120  TYR B OH  1 
ATOM   2163 N  N   . ILE B 1 121 ? 13.938 28.538 7.599   1.00 41.84 ? 121  ILE B N   1 
ATOM   2164 C  CA  . ILE B 1 121 ? 14.349 27.930 8.865   1.00 40.79 ? 121  ILE B CA  1 
ATOM   2165 C  C   . ILE B 1 121 ? 13.605 28.532 10.057  1.00 40.91 ? 121  ILE B C   1 
ATOM   2166 O  O   . ILE B 1 121 ? 13.578 29.750 10.219  1.00 41.49 ? 121  ILE B O   1 
ATOM   2167 C  CB  . ILE B 1 121 ? 15.869 28.110 9.097   1.00 40.47 ? 121  ILE B CB  1 
ATOM   2168 C  CG1 . ILE B 1 121 ? 16.663 27.691 7.854   1.00 41.21 ? 121  ILE B CG1 1 
ATOM   2169 C  CG2 . ILE B 1 121 ? 16.324 27.306 10.304  1.00 39.42 ? 121  ILE B CG2 1 
ATOM   2170 C  CD1 . ILE B 1 121 ? 18.169 27.792 8.023   1.00 40.87 ? 121  ILE B CD1 1 
ATOM   2171 N  N   . SER B 1 122 ? 13.009 27.668 10.881  1.00 40.58 ? 122  SER B N   1 
ATOM   2172 C  CA  . SER B 1 122 ? 12.376 28.067 12.145  1.00 40.85 ? 122  SER B CA  1 
ATOM   2173 C  C   . SER B 1 122 ? 13.141 27.456 13.323  1.00 40.29 ? 122  SER B C   1 
ATOM   2174 O  O   . SER B 1 122 ? 13.741 26.388 13.194  1.00 39.57 ? 122  SER B O   1 
ATOM   2175 C  CB  . SER B 1 122 ? 10.915 27.613 12.189  1.00 41.42 ? 122  SER B CB  1 
ATOM   2176 O  OG  . SER B 1 122 ? 10.126 28.308 11.241  1.00 41.95 ? 122  SER B OG  1 
ATOM   2177 N  N   . ASN B 1 123 ? 13.097 28.132 14.471  1.00 40.47 ? 123  ASN B N   1 
ATOM   2178 C  CA  . ASN B 1 123 ? 13.928 27.762 15.628  1.00 39.61 ? 123  ASN B CA  1 
ATOM   2179 C  C   . ASN B 1 123 ? 13.533 26.424 16.279  1.00 39.24 ? 123  ASN B C   1 
ATOM   2180 O  O   . ASN B 1 123 ? 12.456 25.888 15.989  1.00 39.19 ? 123  ASN B O   1 
ATOM   2181 C  CB  . ASN B 1 123 ? 13.968 28.907 16.664  1.00 40.20 ? 123  ASN B CB  1 
ATOM   2182 C  CG  . ASN B 1 123 ? 12.595 29.285 17.197  1.00 40.52 ? 123  ASN B CG  1 
ATOM   2183 O  OD1 . ASN B 1 123 ? 11.808 28.428 17.590  1.00 41.45 ? 123  ASN B OD1 1 
ATOM   2184 N  ND2 . ASN B 1 123 ? 12.313 30.581 17.225  1.00 40.46 ? 123  ASN B ND2 1 
ATOM   2185 N  N   . PRO B 1 124 ? 14.416 25.868 17.142  1.00 38.49 ? 124  PRO B N   1 
ATOM   2186 C  CA  . PRO B 1 124 ? 14.152 24.576 17.785  1.00 38.54 ? 124  PRO B CA  1 
ATOM   2187 C  C   . PRO B 1 124 ? 12.901 24.523 18.659  1.00 39.74 ? 124  PRO B C   1 
ATOM   2188 O  O   . PRO B 1 124 ? 12.336 23.447 18.851  1.00 39.57 ? 124  PRO B O   1 
ATOM   2189 C  CB  . PRO B 1 124 ? 15.398 24.359 18.648  1.00 38.03 ? 124  PRO B CB  1 
ATOM   2190 C  CG  . PRO B 1 124 ? 16.455 25.098 17.959  1.00 37.64 ? 124  PRO B CG  1 
ATOM   2191 C  CD  . PRO B 1 124 ? 15.785 26.331 17.439  1.00 37.89 ? 124  PRO B CD  1 
ATOM   2192 N  N   . GLU B 1 125 ? 12.480 25.675 19.178  1.00 41.07 ? 125  GLU B N   1 
ATOM   2193 C  CA  . GLU B 1 125 ? 11.316 25.766 20.061  1.00 42.66 ? 125  GLU B CA  1 
ATOM   2194 C  C   . GLU B 1 125 ? 10.018 25.322 19.378  1.00 43.52 ? 125  GLU B C   1 
ATOM   2195 O  O   . GLU B 1 125 ? 9.049  24.975 20.055  1.00 44.62 ? 125  GLU B O   1 
ATOM   2196 C  CB  . GLU B 1 125 ? 11.174 27.200 20.588  1.00 43.75 ? 125  GLU B CB  1 
ATOM   2197 C  CG  . GLU B 1 125 ? 10.244 27.360 21.777  1.00 47.18 ? 125  GLU B CG  1 
ATOM   2198 C  CD  . GLU B 1 125 ? 10.257 28.773 22.332  1.00 51.47 ? 125  GLU B CD  1 
ATOM   2199 O  OE1 . GLU B 1 125 ? 11.328 29.219 22.802  1.00 54.72 ? 125  GLU B OE1 1 
ATOM   2200 O  OE2 . GLU B 1 125 ? 9.197  29.435 22.301  1.00 54.45 ? 125  GLU B OE2 1 
ATOM   2201 N  N   . LYS B 1 126 ? 10.001 25.329 18.045  1.00 43.23 ? 126  LYS B N   1 
ATOM   2202 C  CA  . LYS B 1 126 ? 8.839  24.864 17.287  1.00 44.07 ? 126  LYS B CA  1 
ATOM   2203 C  C   . LYS B 1 126 ? 8.600  23.348 17.409  1.00 43.75 ? 126  LYS B C   1 
ATOM   2204 O  O   . LYS B 1 126 ? 7.469  22.884 17.241  1.00 44.73 ? 126  LYS B O   1 
ATOM   2205 C  CB  . LYS B 1 126 ? 8.967  25.263 15.815  1.00 43.88 ? 126  LYS B CB  1 
ATOM   2206 C  CG  . LYS B 1 126 ? 7.670  25.119 15.037  1.00 46.80 ? 126  LYS B CG  1 
ATOM   2207 C  CD  . LYS B 1 126 ? 7.714  25.834 13.699  1.00 48.67 ? 126  LYS B CD  1 
ATOM   2208 C  CE  . LYS B 1 126 ? 6.378  25.708 12.980  1.00 51.34 ? 126  LYS B CE  1 
ATOM   2209 N  NZ  . LYS B 1 126 ? 6.374  26.411 11.670  1.00 53.48 ? 126  LYS B NZ  1 
ATOM   2210 N  N   . GLN B 1 127 ? 9.656  22.585 17.699  1.00 42.48 ? 127  GLN B N   1 
ATOM   2211 C  CA  . GLN B 1 127 ? 9.543  21.136 17.922  1.00 42.09 ? 127  GLN B CA  1 
ATOM   2212 C  C   . GLN B 1 127 ? 9.651  20.754 19.408  1.00 41.82 ? 127  GLN B C   1 
ATOM   2213 O  O   . GLN B 1 127 ? 9.951  19.604 19.736  1.00 41.22 ? 127  GLN B O   1 
ATOM   2214 C  CB  . GLN B 1 127 ? 10.614 20.389 17.120  1.00 41.17 ? 127  GLN B CB  1 
ATOM   2215 C  CG  . GLN B 1 127 ? 10.545 20.628 15.621  1.00 41.87 ? 127  GLN B CG  1 
ATOM   2216 C  CD  . GLN B 1 127 ? 11.562 19.812 14.842  1.00 42.45 ? 127  GLN B CD  1 
ATOM   2217 O  OE1 . GLN B 1 127 ? 12.029 18.767 15.300  1.00 44.11 ? 127  GLN B OE1 1 
ATOM   2218 N  NE2 . GLN B 1 127 ? 11.906 20.286 13.650  1.00 43.14 ? 127  GLN B NE2 1 
ATOM   2219 N  N   . GLY B 1 128 ? 9.406  21.717 20.297  1.00 41.62 ? 128  GLY B N   1 
ATOM   2220 C  CA  . GLY B 1 128 ? 9.386  21.466 21.740  1.00 41.87 ? 128  GLY B CA  1 
ATOM   2221 C  C   . GLY B 1 128 ? 10.755 21.396 22.394  1.00 40.47 ? 128  GLY B C   1 
ATOM   2222 O  O   . GLY B 1 128 ? 10.933 20.701 23.396  1.00 41.16 ? 128  GLY B O   1 
ATOM   2223 N  N   . PHE B 1 129 ? 11.719 22.120 21.830  1.00 38.47 ? 129  PHE B N   1 
ATOM   2224 C  CA  . PHE B 1 129 ? 13.068 22.190 22.378  1.00 36.71 ? 129  PHE B CA  1 
ATOM   2225 C  C   . PHE B 1 129 ? 13.133 23.377 23.331  1.00 36.61 ? 129  PHE B C   1 
ATOM   2226 O  O   . PHE B 1 129 ? 12.874 24.516 22.939  1.00 36.62 ? 129  PHE B O   1 
ATOM   2227 C  CB  . PHE B 1 129 ? 14.094 22.343 21.253  1.00 35.61 ? 129  PHE B CB  1 
ATOM   2228 C  CG  . PHE B 1 129 ? 15.522 22.228 21.706  1.00 33.80 ? 129  PHE B CG  1 
ATOM   2229 C  CD1 . PHE B 1 129 ? 16.104 20.986 21.898  1.00 31.91 ? 129  PHE B CD1 1 
ATOM   2230 C  CD2 . PHE B 1 129 ? 16.287 23.367 21.930  1.00 32.81 ? 129  PHE B CD2 1 
ATOM   2231 C  CE1 . PHE B 1 129 ? 17.423 20.879 22.314  1.00 31.16 ? 129  PHE B CE1 1 
ATOM   2232 C  CE2 . PHE B 1 129 ? 17.603 23.269 22.343  1.00 30.94 ? 129  PHE B CE2 1 
ATOM   2233 C  CZ  . PHE B 1 129 ? 18.174 22.023 22.535  1.00 30.92 ? 129  PHE B CZ  1 
ATOM   2234 N  N   . GLY B 1 130 ? 13.474 23.105 24.585  1.00 36.52 ? 130  GLY B N   1 
ATOM   2235 C  CA  . GLY B 1 130 ? 13.447 24.124 25.623  1.00 36.59 ? 130  GLY B CA  1 
ATOM   2236 C  C   . GLY B 1 130 ? 14.732 24.915 25.702  1.00 35.47 ? 130  GLY B C   1 
ATOM   2237 O  O   . GLY B 1 130 ? 15.703 24.617 25.009  1.00 34.63 ? 130  GLY B O   1 
ATOM   2238 N  N   . ARG B 1 131 ? 14.723 25.940 26.548  1.00 35.52 ? 131  ARG B N   1 
ATOM   2239 C  CA  . ARG B 1 131 ? 15.924 26.690 26.874  1.00 34.75 ? 131  ARG B CA  1 
ATOM   2240 C  C   . ARG B 1 131 ? 15.792 27.267 28.278  1.00 35.27 ? 131  ARG B C   1 
ATOM   2241 O  O   . ARG B 1 131 ? 14.693 27.616 28.709  1.00 35.82 ? 131  ARG B O   1 
ATOM   2242 C  CB  . ARG B 1 131 ? 16.175 27.805 25.849  1.00 34.61 ? 131  ARG B CB  1 
ATOM   2243 C  CG  . ARG B 1 131 ? 15.289 29.035 26.005  1.00 35.67 ? 131  ARG B CG  1 
ATOM   2244 C  CD  . ARG B 1 131 ? 15.442 30.001 24.842  1.00 34.13 ? 131  ARG B CD  1 
ATOM   2245 N  NE  . ARG B 1 131 ? 14.428 31.056 24.882  1.00 34.11 ? 131  ARG B NE  1 
ATOM   2246 C  CZ  . ARG B 1 131 ? 14.537 32.208 25.544  1.00 33.80 ? 131  ARG B CZ  1 
ATOM   2247 N  NH1 . ARG B 1 131 ? 15.628 32.503 26.245  1.00 33.24 ? 131  ARG B NH1 1 
ATOM   2248 N  NH2 . ARG B 1 131 ? 13.538 33.082 25.503  1.00 36.46 ? 131  ARG B NH2 1 
ATOM   2249 N  N   . HIS B 1 132 ? 16.915 27.356 28.984  1.00 34.96 ? 132  HIS B N   1 
ATOM   2250 C  CA  . HIS B 1 132 ? 16.954 27.975 30.302  1.00 35.87 ? 132  HIS B CA  1 
ATOM   2251 C  C   . HIS B 1 132 ? 16.821 29.492 30.156  1.00 36.95 ? 132  HIS B C   1 
ATOM   2252 O  O   . HIS B 1 132 ? 17.441 30.086 29.270  1.00 36.12 ? 132  HIS B O   1 
ATOM   2253 C  CB  . HIS B 1 132 ? 18.271 27.650 31.005  1.00 35.45 ? 132  HIS B CB  1 
ATOM   2254 C  CG  . HIS B 1 132 ? 18.419 26.211 31.392  1.00 35.20 ? 132  HIS B CG  1 
ATOM   2255 N  ND1 . HIS B 1 132 ? 19.205 25.807 32.449  1.00 33.96 ? 132  HIS B ND1 1 
ATOM   2256 C  CD2 . HIS B 1 132 ? 17.883 25.083 30.868  1.00 35.46 ? 132  HIS B CD2 1 
ATOM   2257 C  CE1 . HIS B 1 132 ? 19.153 24.491 32.555  1.00 34.60 ? 132  HIS B CE1 1 
ATOM   2258 N  NE2 . HIS B 1 132 ? 18.356 24.028 31.610  1.00 33.77 ? 132  HIS B NE2 1 
ATOM   2259 N  N   . VAL B 1 133 ? 16.013 30.110 31.018  1.00 38.91 ? 133  VAL B N   1 
ATOM   2260 C  CA  . VAL B 1 133 ? 15.842 31.568 31.012  1.00 40.51 ? 133  VAL B CA  1 
ATOM   2261 C  C   . VAL B 1 133 ? 16.157 32.221 32.362  1.00 42.15 ? 133  VAL B C   1 
ATOM   2262 O  O   . VAL B 1 133 ? 15.875 33.400 32.555  1.00 43.02 ? 133  VAL B O   1 
ATOM   2263 C  CB  . VAL B 1 133 ? 14.418 31.977 30.553  1.00 41.44 ? 133  VAL B CB  1 
ATOM   2264 C  CG1 . VAL B 1 133 ? 14.170 31.508 29.129  1.00 39.96 ? 133  VAL B CG1 1 
ATOM   2265 C  CG2 . VAL B 1 133 ? 13.359 31.423 31.498  1.00 42.10 ? 133  VAL B CG2 1 
ATOM   2266 N  N   . ASP B 1 134 ? 16.754 31.467 33.283  1.00 43.44 ? 134  ASP B N   1 
ATOM   2267 C  CA  . ASP B 1 134 ? 17.182 32.030 34.571  1.00 45.86 ? 134  ASP B CA  1 
ATOM   2268 C  C   . ASP B 1 134 ? 18.463 32.857 34.406  1.00 46.89 ? 134  ASP B C   1 
ATOM   2269 O  O   . ASP B 1 134 ? 19.128 32.784 33.375  1.00 45.85 ? 134  ASP B O   1 
ATOM   2270 C  CB  . ASP B 1 134 ? 17.374 30.933 35.631  1.00 45.60 ? 134  ASP B CB  1 
ATOM   2271 C  CG  . ASP B 1 134 ? 18.331 29.840 35.187  1.00 45.18 ? 134  ASP B CG  1 
ATOM   2272 O  OD1 . ASP B 1 134 ? 17.966 29.070 34.272  1.00 44.18 ? 134  ASP B OD1 1 
ATOM   2273 O  OD2 . ASP B 1 134 ? 19.438 29.742 35.762  1.00 45.43 ? 134  ASP B OD2 1 
ATOM   2274 N  N   . GLU B 1 135 ? 18.799 33.648 35.423  1.00 49.36 ? 135  GLU B N   1 
ATOM   2275 C  CA  . GLU B 1 135 ? 19.972 34.520 35.359  1.00 50.62 ? 135  GLU B CA  1 
ATOM   2276 C  C   . GLU B 1 135 ? 21.276 33.725 35.379  1.00 50.07 ? 135  GLU B C   1 
ATOM   2277 O  O   . GLU B 1 135 ? 22.212 34.045 34.641  1.00 49.74 ? 135  GLU B O   1 
ATOM   2278 C  CB  . GLU B 1 135 ? 19.969 35.524 36.516  1.00 52.19 ? 135  GLU B CB  1 
ATOM   2279 C  CG  . GLU B 1 135 ? 21.053 36.601 36.406  1.00 54.79 ? 135  GLU B CG  1 
ATOM   2280 C  CD  . GLU B 1 135 ? 21.149 37.489 37.640  1.00 60.43 ? 135  GLU B CD  1 
ATOM   2281 O  OE1 . GLU B 1 135 ? 20.359 37.302 38.593  1.00 63.27 ? 135  GLU B OE1 1 
ATOM   2282 O  OE2 . GLU B 1 135 ? 22.021 38.386 37.651  1.00 63.72 ? 135  GLU B OE2 1 
ATOM   2283 N  N   . GLU B 1 136 ? 21.331 32.696 36.222  1.00 50.35 ? 136  GLU B N   1 
ATOM   2284 C  CA  . GLU B 1 136 ? 22.566 31.942 36.439  1.00 50.29 ? 136  GLU B CA  1 
ATOM   2285 C  C   . GLU B 1 136 ? 22.993 31.133 35.214  1.00 48.62 ? 136  GLU B C   1 
ATOM   2286 O  O   . GLU B 1 136 ? 24.176 31.124 34.866  1.00 48.20 ? 136  GLU B O   1 
ATOM   2287 C  CB  . GLU B 1 136 ? 22.422 31.015 37.655  1.00 51.20 ? 136  GLU B CB  1 
ATOM   2288 C  CG  . GLU B 1 136 ? 23.708 30.277 38.065  1.00 53.83 ? 136  GLU B CG  1 
ATOM   2289 C  CD  . GLU B 1 136 ? 24.852 31.214 38.437  1.00 58.56 ? 136  GLU B CD  1 
ATOM   2290 O  OE1 . GLU B 1 136 ? 24.582 32.305 38.990  1.00 62.15 ? 136  GLU B OE1 1 
ATOM   2291 O  OE2 . GLU B 1 136 ? 26.023 30.854 38.182  1.00 59.54 ? 136  GLU B OE2 1 
ATOM   2292 N  N   . THR B 1 137 ? 22.033 30.468 34.568  1.00 47.82 ? 137  THR B N   1 
ATOM   2293 C  CA  . THR B 1 137 ? 22.323 29.533 33.470  1.00 46.31 ? 137  THR B CA  1 
ATOM   2294 C  C   . THR B 1 137 ? 21.529 29.797 32.182  1.00 45.48 ? 137  THR B C   1 
ATOM   2295 O  O   . THR B 1 137 ? 21.461 28.930 31.310  1.00 44.66 ? 137  THR B O   1 
ATOM   2296 C  CB  . THR B 1 137 ? 22.037 28.076 33.909  1.00 46.28 ? 137  THR B CB  1 
ATOM   2297 O  OG1 . THR B 1 137 ? 20.629 27.903 34.123  1.00 45.58 ? 137  THR B OG1 1 
ATOM   2298 C  CG2 . THR B 1 137 ? 22.799 27.731 35.187  1.00 46.12 ? 137  THR B CG2 1 
ATOM   2299 N  N   . GLY B 1 138 ? 20.947 30.986 32.049  1.00 45.46 ? 138  GLY B N   1 
ATOM   2300 C  CA  . GLY B 1 138 ? 20.062 31.283 30.922  1.00 44.91 ? 138  GLY B CA  1 
ATOM   2301 C  C   . GLY B 1 138 ? 20.778 31.647 29.638  1.00 43.74 ? 138  GLY B C   1 
ATOM   2302 O  O   . GLY B 1 138 ? 21.954 32.019 29.653  1.00 43.62 ? 138  GLY B O   1 
ATOM   2303 N  N   . VAL B 1 139 ? 20.052 31.539 28.527  1.00 42.81 ? 139  VAL B N   1 
ATOM   2304 C  CA  . VAL B 1 139 ? 20.561 31.911 27.208  1.00 41.94 ? 139  VAL B CA  1 
ATOM   2305 C  C   . VAL B 1 139 ? 19.621 32.912 26.541  1.00 42.53 ? 139  VAL B C   1 
ATOM   2306 O  O   . VAL B 1 139 ? 18.527 33.181 27.036  1.00 42.97 ? 139  VAL B O   1 
ATOM   2307 C  CB  . VAL B 1 139 ? 20.729 30.678 26.286  1.00 40.88 ? 139  VAL B CB  1 
ATOM   2308 C  CG1 . VAL B 1 139 ? 21.756 29.721 26.861  1.00 39.01 ? 139  VAL B CG1 1 
ATOM   2309 C  CG2 . VAL B 1 139 ? 19.394 29.976 26.068  1.00 41.48 ? 139  VAL B CG2 1 
ATOM   2310 N  N   . GLY B 1 140 ? 20.063 33.459 25.414  1.00 42.68 ? 140  GLY B N   1 
ATOM   2311 C  CA  . GLY B 1 140 ? 19.304 34.464 24.685  1.00 43.47 ? 140  GLY B CA  1 
ATOM   2312 C  C   . GLY B 1 140 ? 18.084 33.923 23.963  1.00 43.51 ? 140  GLY B C   1 
ATOM   2313 O  O   . GLY B 1 140 ? 17.916 32.712 23.805  1.00 42.00 ? 140  GLY B O   1 
ATOM   2314 N  N   . LYS B 1 141 ? 17.240 34.850 23.522  1.00 45.25 ? 141  LYS B N   1 
ATOM   2315 C  CA  . LYS B 1 141 ? 15.990 34.546 22.829  1.00 45.90 ? 141  LYS B CA  1 
ATOM   2316 C  C   . LYS B 1 141 ? 16.280 33.910 21.473  1.00 44.59 ? 141  LYS B C   1 
ATOM   2317 O  O   . LYS B 1 141 ? 17.298 34.213 20.850  1.00 44.16 ? 141  LYS B O   1 
ATOM   2318 C  CB  . LYS B 1 141 ? 15.189 35.845 22.646  1.00 47.76 ? 141  LYS B CB  1 
ATOM   2319 C  CG  . LYS B 1 141 ? 13.744 35.676 22.195  1.00 51.01 ? 141  LYS B CG  1 
ATOM   2320 C  CD  . LYS B 1 141 ? 13.085 37.039 21.975  1.00 53.94 ? 141  LYS B CD  1 
ATOM   2321 C  CE  . LYS B 1 141 ? 11.683 36.918 21.389  1.00 55.28 ? 141  LYS B CE  1 
ATOM   2322 N  NZ  . LYS B 1 141 ? 10.699 36.397 22.379  1.00 57.18 ? 141  LYS B NZ  1 
ATOM   2323 N  N   . TRP B 1 142 ? 15.390 33.025 21.026  1.00 44.26 ? 142  TRP B N   1 
ATOM   2324 C  CA  . TRP B 1 142 ? 15.542 32.371 19.721  1.00 43.46 ? 142  TRP B CA  1 
ATOM   2325 C  C   . TRP B 1 142 ? 15.227 33.336 18.583  1.00 44.31 ? 142  TRP B C   1 
ATOM   2326 O  O   . TRP B 1 142 ? 14.392 34.232 18.722  1.00 45.61 ? 142  TRP B O   1 
ATOM   2327 C  CB  . TRP B 1 142 ? 14.634 31.141 19.594  1.00 42.99 ? 142  TRP B CB  1 
ATOM   2328 C  CG  . TRP B 1 142 ? 15.143 29.916 20.288  1.00 42.19 ? 142  TRP B CG  1 
ATOM   2329 C  CD1 . TRP B 1 142 ? 14.565 29.272 21.343  1.00 43.28 ? 142  TRP B CD1 1 
ATOM   2330 C  CD2 . TRP B 1 142 ? 16.328 29.179 19.969  1.00 41.10 ? 142  TRP B CD2 1 
ATOM   2331 N  NE1 . TRP B 1 142 ? 15.319 28.180 21.703  1.00 42.54 ? 142  TRP B NE1 1 
ATOM   2332 C  CE2 . TRP B 1 142 ? 16.408 28.101 20.876  1.00 41.46 ? 142  TRP B CE2 1 
ATOM   2333 C  CE3 . TRP B 1 142 ? 17.331 29.325 19.005  1.00 41.70 ? 142  TRP B CE3 1 
ATOM   2334 C  CZ2 . TRP B 1 142 ? 17.453 27.174 20.848  1.00 41.91 ? 142  TRP B CZ2 1 
ATOM   2335 C  CZ3 . TRP B 1 142 ? 18.368 28.405 18.977  1.00 41.59 ? 142  TRP B CZ3 1 
ATOM   2336 C  CH2 . TRP B 1 142 ? 18.421 27.344 19.894  1.00 41.21 ? 142  TRP B CH2 1 
ATOM   2337 N  N   . PHE B 1 143 ? 15.903 33.136 17.457  1.00 43.78 ? 143  PHE B N   1 
ATOM   2338 C  CA  . PHE B 1 143 ? 15.653 33.913 16.244  1.00 44.48 ? 143  PHE B CA  1 
ATOM   2339 C  C   . PHE B 1 143 ? 14.241 33.677 15.695  1.00 45.19 ? 143  PHE B C   1 
ATOM   2340 O  O   . PHE B 1 143 ? 13.667 32.599 15.875  1.00 44.26 ? 143  PHE B O   1 
ATOM   2341 C  CB  . PHE B 1 143 ? 16.693 33.571 15.165  1.00 43.75 ? 143  PHE B CB  1 
ATOM   2342 C  CG  . PHE B 1 143 ? 16.772 32.099 14.836  1.00 42.53 ? 143  PHE B CG  1 
ATOM   2343 C  CD1 . PHE B 1 143 ? 15.871 31.516 13.951  1.00 41.60 ? 143  PHE B CD1 1 
ATOM   2344 C  CD2 . PHE B 1 143 ? 17.750 31.298 15.413  1.00 41.58 ? 143  PHE B CD2 1 
ATOM   2345 C  CE1 . PHE B 1 143 ? 15.939 30.165 13.655  1.00 40.74 ? 143  PHE B CE1 1 
ATOM   2346 C  CE2 . PHE B 1 143 ? 17.827 29.945 15.117  1.00 40.11 ? 143  PHE B CE2 1 
ATOM   2347 C  CZ  . PHE B 1 143 ? 16.921 29.379 14.236  1.00 39.92 ? 143  PHE B CZ  1 
ATOM   2348 N  N   . GLU B 1 144 ? 13.694 34.694 15.029  1.00 46.76 ? 144  GLU B N   1 
ATOM   2349 C  CA  . GLU B 1 144 ? 12.408 34.576 14.337  1.00 47.89 ? 144  GLU B CA  1 
ATOM   2350 C  C   . GLU B 1 144 ? 12.627 33.880 12.993  1.00 46.66 ? 144  GLU B C   1 
ATOM   2351 O  O   . GLU B 1 144 ? 13.739 33.908 12.461  1.00 46.20 ? 144  GLU B O   1 
ATOM   2352 C  CB  . GLU B 1 144 ? 11.780 35.960 14.111  1.00 49.99 ? 144  GLU B CB  1 
ATOM   2353 C  CG  . GLU B 1 144 ? 11.459 36.744 15.391  1.00 53.41 ? 144  GLU B CG  1 
ATOM   2354 C  CD  . GLU B 1 144 ? 10.382 36.089 16.250  1.00 56.53 ? 144  GLU B CD  1 
ATOM   2355 O  OE1 . GLU B 1 144 ? 9.421  35.525 15.681  1.00 57.86 ? 144  GLU B OE1 1 
ATOM   2356 O  OE2 . GLU B 1 144 ? 10.496 36.149 17.496  1.00 57.81 ? 144  GLU B OE2 1 
ATOM   2357 N  N   . PRO B 1 145 ? 11.572 33.255 12.434  1.00 46.19 ? 145  PRO B N   1 
ATOM   2358 C  CA  . PRO B 1 145 ? 11.735 32.526 11.171  1.00 45.36 ? 145  PRO B CA  1 
ATOM   2359 C  C   . PRO B 1 145 ? 12.355 33.385 10.070  1.00 45.61 ? 145  PRO B C   1 
ATOM   2360 O  O   . PRO B 1 145 ? 11.976 34.547 9.910   1.00 46.66 ? 145  PRO B O   1 
ATOM   2361 C  CB  . PRO B 1 145 ? 10.300 32.131 10.805  1.00 46.00 ? 145  PRO B CB  1 
ATOM   2362 C  CG  . PRO B 1 145 ? 9.566  32.115 12.094  1.00 46.38 ? 145  PRO B CG  1 
ATOM   2363 C  CD  . PRO B 1 145 ? 10.188 33.181 12.937  1.00 46.78 ? 145  PRO B CD  1 
ATOM   2364 N  N   . PHE B 1 146 ? 13.301 32.816 9.325   1.00 45.02 ? 146  PHE B N   1 
ATOM   2365 C  CA  . PHE B 1 146 ? 14.031 33.569 8.299   1.00 45.46 ? 146  PHE B CA  1 
ATOM   2366 C  C   . PHE B 1 146 ? 14.343 32.740 7.051   1.00 45.32 ? 146  PHE B C   1 
ATOM   2367 O  O   . PHE B 1 146 ? 14.291 31.508 7.076   1.00 44.17 ? 146  PHE B O   1 
ATOM   2368 C  CB  . PHE B 1 146 ? 15.323 34.154 8.888   1.00 45.13 ? 146  PHE B CB  1 
ATOM   2369 C  CG  . PHE B 1 146 ? 16.381 33.125 9.199   1.00 42.31 ? 146  PHE B CG  1 
ATOM   2370 C  CD1 . PHE B 1 146 ? 16.304 32.350 10.350  1.00 40.25 ? 146  PHE B CD1 1 
ATOM   2371 C  CD2 . PHE B 1 146 ? 17.462 32.944 8.346   1.00 41.22 ? 146  PHE B CD2 1 
ATOM   2372 C  CE1 . PHE B 1 146 ? 17.283 31.406 10.638  1.00 38.44 ? 146  PHE B CE1 1 
ATOM   2373 C  CE2 . PHE B 1 146 ? 18.441 32.003 8.629   1.00 40.10 ? 146  PHE B CE2 1 
ATOM   2374 C  CZ  . PHE B 1 146 ? 18.351 31.233 9.778   1.00 38.22 ? 146  PHE B CZ  1 
ATOM   2375 N  N   . LYS B 1 147 ? 14.662 33.443 5.965   1.00 46.75 ? 147  LYS B N   1 
ATOM   2376 C  CA  . LYS B 1 147 ? 15.018 32.824 4.691   1.00 47.28 ? 147  LYS B CA  1 
ATOM   2377 C  C   . LYS B 1 147 ? 16.510 32.967 4.419   1.00 47.27 ? 147  LYS B C   1 
ATOM   2378 O  O   . LYS B 1 147 ? 17.133 33.949 4.828   1.00 48.14 ? 147  LYS B O   1 
ATOM   2379 C  CB  . LYS B 1 147 ? 14.272 33.497 3.533   1.00 48.58 ? 147  LYS B CB  1 
ATOM   2380 C  CG  . LYS B 1 147 ? 12.756 33.426 3.588   1.00 51.21 ? 147  LYS B CG  1 
ATOM   2381 C  CD  . LYS B 1 147 ? 12.145 34.250 2.450   1.00 54.41 ? 147  LYS B CD  1 
ATOM   2382 C  CE  . LYS B 1 147 ? 10.639 34.040 2.334   1.00 56.03 ? 147  LYS B CE  1 
ATOM   2383 N  NZ  . LYS B 1 147 ? 10.296 32.631 1.969   1.00 54.63 ? 147  LYS B NZ  1 
ATOM   2384 N  N   . VAL B 1 148 ? 17.069 31.987 3.715   1.00 46.62 ? 148  VAL B N   1 
ATOM   2385 C  CA  . VAL B 1 148 ? 18.390 32.122 3.106   1.00 46.79 ? 148  VAL B CA  1 
ATOM   2386 C  C   . VAL B 1 148 ? 18.290 31.670 1.649   1.00 47.68 ? 148  VAL B C   1 
ATOM   2387 O  O   . VAL B 1 148 ? 17.675 30.642 1.360   1.00 47.27 ? 148  VAL B O   1 
ATOM   2388 C  CB  . VAL B 1 148 ? 19.472 31.320 3.864   1.00 45.78 ? 148  VAL B CB  1 
ATOM   2389 C  CG1 . VAL B 1 148 ? 19.717 31.933 5.236   1.00 45.86 ? 148  VAL B CG1 1 
ATOM   2390 C  CG2 . VAL B 1 148 ? 19.082 29.865 3.996   1.00 43.27 ? 148  VAL B CG2 1 
ATOM   2391 N  N   . ASP B 1 149 ? 18.875 32.454 0.741   1.00 49.07 ? 149  ASP B N   1 
ATOM   2392 C  CA  . ASP B 1 149 ? 18.769 32.211 -0.703  1.00 49.77 ? 149  ASP B CA  1 
ATOM   2393 C  C   . ASP B 1 149 ? 20.083 31.716 -1.298  1.00 49.54 ? 149  ASP B C   1 
ATOM   2394 O  O   . ASP B 1 149 ? 21.158 32.181 -0.921  1.00 50.10 ? 149  ASP B O   1 
ATOM   2395 C  CB  . ASP B 1 149 ? 18.356 33.496 -1.429  1.00 51.29 ? 149  ASP B CB  1 
ATOM   2396 C  CG  . ASP B 1 149 ? 16.984 33.992 -1.015  1.00 53.42 ? 149  ASP B CG  1 
ATOM   2397 O  OD1 . ASP B 1 149 ? 16.088 33.157 -0.769  1.00 56.12 ? 149  ASP B OD1 1 
ATOM   2398 O  OD2 . ASP B 1 149 ? 16.795 35.224 -0.948  1.00 57.05 ? 149  ASP B OD2 1 
ATOM   2399 N  N   . TYR B 1 150 ? 19.978 30.780 -2.240  1.00 49.01 ? 150  TYR B N   1 
ATOM   2400 C  CA  . TYR B 1 150 ? 21.130 30.241 -2.958  1.00 49.09 ? 150  TYR B CA  1 
ATOM   2401 C  C   . TYR B 1 150 ? 20.856 30.216 -4.465  1.00 50.06 ? 150  TYR B C   1 
ATOM   2402 O  O   . TYR B 1 150 ? 19.720 29.995 -4.886  1.00 50.19 ? 150  TYR B O   1 
ATOM   2403 C  CB  . TYR B 1 150 ? 21.439 28.819 -2.479  1.00 48.10 ? 150  TYR B CB  1 
ATOM   2404 C  CG  . TYR B 1 150 ? 21.790 28.693 -1.010  1.00 46.29 ? 150  TYR B CG  1 
ATOM   2405 C  CD1 . TYR B 1 150 ? 20.805 28.468 -0.055  1.00 44.80 ? 150  TYR B CD1 1 
ATOM   2406 C  CD2 . TYR B 1 150 ? 23.109 28.775 -0.578  1.00 46.39 ? 150  TYR B CD2 1 
ATOM   2407 C  CE1 . TYR B 1 150 ? 21.125 28.340 1.291   1.00 43.98 ? 150  TYR B CE1 1 
ATOM   2408 C  CE2 . TYR B 1 150 ? 23.436 28.649 0.766   1.00 45.37 ? 150  TYR B CE2 1 
ATOM   2409 C  CZ  . TYR B 1 150 ? 22.442 28.432 1.693   1.00 43.54 ? 150  TYR B CZ  1 
ATOM   2410 O  OH  . TYR B 1 150 ? 22.770 28.308 3.021   1.00 43.05 ? 150  TYR B OH  1 
ATOM   2411 N  N   . LYS B 1 151 ? 21.900 30.449 -5.264  1.00 50.99 ? 151  LYS B N   1 
ATOM   2412 C  CA  . LYS B 1 151 ? 21.830 30.355 -6.730  1.00 51.43 ? 151  LYS B CA  1 
ATOM   2413 C  C   . LYS B 1 151 ? 22.897 29.386 -7.234  1.00 51.19 ? 151  LYS B C   1 
ATOM   2414 O  O   . LYS B 1 151 ? 24.094 29.635 -7.060  1.00 52.09 ? 151  LYS B O   1 
ATOM   2415 C  CB  . LYS B 1 151 ? 22.069 31.725 -7.379  1.00 52.77 ? 151  LYS B CB  1 
ATOM   2416 C  CG  . LYS B 1 151 ? 20.874 32.671 -7.391  1.00 53.47 ? 151  LYS B CG  1 
ATOM   2417 C  CD  . LYS B 1 151 ? 21.097 33.801 -8.399  1.00 56.27 ? 151  LYS B CD  1 
ATOM   2418 C  CE  . LYS B 1 151 ? 19.944 34.798 -8.437  1.00 57.22 ? 151  LYS B CE  1 
ATOM   2419 N  NZ  . LYS B 1 151 ? 20.085 35.868 -7.411  1.00 57.66 ? 151  LYS B NZ  1 
ATOM   2420 N  N   . PHE B 1 152 ? 22.475 28.288 -7.859  1.00 50.16 ? 152  PHE B N   1 
ATOM   2421 C  CA  . PHE B 1 152 ? 23.424 27.313 -8.405  1.00 49.97 ? 152  PHE B CA  1 
ATOM   2422 C  C   . PHE B 1 152 ? 23.009 26.766 -9.767  1.00 50.75 ? 152  PHE B C   1 
ATOM   2423 O  O   . PHE B 1 152 ? 21.873 26.946 -10.207 1.00 50.18 ? 152  PHE B O   1 
ATOM   2424 C  CB  . PHE B 1 152 ? 23.651 26.162 -7.417  1.00 48.59 ? 152  PHE B CB  1 
ATOM   2425 C  CG  . PHE B 1 152 ? 22.510 25.179 -7.334  1.00 44.77 ? 152  PHE B CG  1 
ATOM   2426 C  CD1 . PHE B 1 152 ? 21.351 25.493 -6.638  1.00 41.66 ? 152  PHE B CD1 1 
ATOM   2427 C  CD2 . PHE B 1 152 ? 22.610 23.928 -7.925  1.00 42.18 ? 152  PHE B CD2 1 
ATOM   2428 C  CE1 . PHE B 1 152 ? 20.306 24.581 -6.547  1.00 39.03 ? 152  PHE B CE1 1 
ATOM   2429 C  CE2 . PHE B 1 152 ? 21.567 23.013 -7.838  1.00 40.58 ? 152  PHE B CE2 1 
ATOM   2430 C  CZ  . PHE B 1 152 ? 20.415 23.341 -7.147  1.00 38.12 ? 152  PHE B CZ  1 
ATOM   2431 N  N   . LYS B 1 153 ? 23.962 26.112 -10.427 1.00 52.12 ? 153  LYS B N   1 
ATOM   2432 C  CA  . LYS B 1 153 ? 23.735 25.455 -11.706 1.00 53.30 ? 153  LYS B CA  1 
ATOM   2433 C  C   . LYS B 1 153 ? 23.759 23.943 -11.486 1.00 52.97 ? 153  LYS B C   1 
ATOM   2434 O  O   . LYS B 1 153 ? 24.783 23.382 -11.091 1.00 52.74 ? 153  LYS B O   1 
ATOM   2435 C  CB  . LYS B 1 153 ? 24.810 25.872 -12.717 1.00 55.15 ? 153  LYS B CB  1 
ATOM   2436 C  CG  . LYS B 1 153 ? 24.627 25.285 -14.119 1.00 58.09 ? 153  LYS B CG  1 
ATOM   2437 C  CD  . LYS B 1 153 ? 25.677 25.804 -15.103 1.00 62.64 ? 153  LYS B CD  1 
ATOM   2438 C  CE  . LYS B 1 153 ? 25.634 25.025 -16.419 1.00 64.92 ? 153  LYS B CE  1 
ATOM   2439 N  NZ  . LYS B 1 153 ? 26.629 25.506 -17.418 1.00 66.25 ? 153  LYS B NZ  1 
ATOM   2440 N  N   . TYR B 1 154 ? 22.622 23.295 -11.730 1.00 52.92 ? 154  TYR B N   1 
ATOM   2441 C  CA  . TYR B 1 154 ? 22.509 21.845 -11.601 1.00 52.91 ? 154  TYR B CA  1 
ATOM   2442 C  C   . TYR B 1 154 ? 23.109 21.171 -12.836 1.00 55.16 ? 154  TYR B C   1 
ATOM   2443 O  O   . TYR B 1 154 ? 22.661 21.411 -13.957 1.00 55.72 ? 154  TYR B O   1 
ATOM   2444 C  CB  . TYR B 1 154 ? 21.041 21.441 -11.423 1.00 51.76 ? 154  TYR B CB  1 
ATOM   2445 C  CG  . TYR B 1 154 ? 20.811 19.947 -11.387 1.00 48.89 ? 154  TYR B CG  1 
ATOM   2446 C  CD1 . TYR B 1 154 ? 21.492 19.143 -10.482 1.00 46.47 ? 154  TYR B CD1 1 
ATOM   2447 C  CD2 . TYR B 1 154 ? 19.907 19.339 -12.255 1.00 47.28 ? 154  TYR B CD2 1 
ATOM   2448 C  CE1 . TYR B 1 154 ? 21.288 17.774 -10.445 1.00 46.54 ? 154  TYR B CE1 1 
ATOM   2449 C  CE2 . TYR B 1 154 ? 19.694 17.967 -12.225 1.00 46.61 ? 154  TYR B CE2 1 
ATOM   2450 C  CZ  . TYR B 1 154 ? 20.388 17.190 -11.316 1.00 46.16 ? 154  TYR B CZ  1 
ATOM   2451 O  OH  . TYR B 1 154 ? 20.188 15.829 -11.276 1.00 45.15 ? 154  TYR B OH  1 
ATOM   2452 N  N   . THR B 1 155 ? 24.121 20.333 -12.623 1.00 56.98 ? 155  THR B N   1 
ATOM   2453 C  CA  . THR B 1 155 ? 24.857 19.700 -13.719 1.00 59.47 ? 155  THR B CA  1 
ATOM   2454 C  C   . THR B 1 155 ? 24.439 18.247 -13.970 1.00 61.02 ? 155  THR B C   1 
ATOM   2455 O  O   . THR B 1 155 ? 24.905 17.626 -14.928 1.00 62.12 ? 155  THR B O   1 
ATOM   2456 C  CB  . THR B 1 155 ? 26.374 19.746 -13.456 1.00 60.35 ? 155  THR B CB  1 
ATOM   2457 O  OG1 . THR B 1 155 ? 26.671 19.091 -12.215 1.00 60.00 ? 155  THR B OG1 1 
ATOM   2458 C  CG2 . THR B 1 155 ? 26.859 21.188 -13.396 1.00 60.05 ? 155  THR B CG2 1 
ATOM   2459 N  N   . GLY B 1 156 ? 23.562 17.715 -13.119 1.00 61.71 ? 156  GLY B N   1 
ATOM   2460 C  CA  . GLY B 1 156 ? 23.082 16.336 -13.241 1.00 63.12 ? 156  GLY B CA  1 
ATOM   2461 C  C   . GLY B 1 156 ? 23.415 15.514 -12.010 1.00 64.28 ? 156  GLY B C   1 
ATOM   2462 O  O   . GLY B 1 156 ? 23.956 16.037 -11.034 1.00 64.00 ? 156  GLY B O   1 
ATOM   2463 N  N   . THR B 1 157 ? 23.090 14.224 -12.058 1.00 66.31 ? 157  THR B N   1 
ATOM   2464 C  CA  . THR B 1 157 ? 23.401 13.300 -10.965 1.00 67.86 ? 157  THR B CA  1 
ATOM   2465 C  C   . THR B 1 157 ? 24.914 13.056 -10.898 1.00 70.40 ? 157  THR B C   1 
ATOM   2466 O  O   . THR B 1 157 ? 25.515 12.675 -11.905 1.00 71.60 ? 157  THR B O   1 
ATOM   2467 C  CB  . THR B 1 157 ? 22.686 11.942 -11.151 1.00 68.14 ? 157  THR B CB  1 
ATOM   2468 O  OG1 . THR B 1 157 ? 21.282 12.155 -11.336 1.00 67.70 ? 157  THR B OG1 1 
ATOM   2469 C  CG2 . THR B 1 157 ? 22.907 11.040 -9.942  1.00 67.41 ? 157  THR B CG2 1 
ATOM   2470 N  N   . PRO B 1 158 ? 25.538 13.284 -9.722  1.00 71.86 ? 158  PRO B N   1 
ATOM   2471 C  CA  . PRO B 1 158 ? 26.979 13.035 -9.580  1.00 74.36 ? 158  PRO B CA  1 
ATOM   2472 C  C   . PRO B 1 158 ? 27.374 11.560 -9.727  1.00 76.97 ? 158  PRO B C   1 
ATOM   2473 O  O   . PRO B 1 158 ? 26.714 10.685 -9.160  1.00 76.82 ? 158  PRO B O   1 
ATOM   2474 C  CB  . PRO B 1 158 ? 27.286 13.523 -8.157  1.00 73.46 ? 158  PRO B CB  1 
ATOM   2475 C  CG  . PRO B 1 158 ? 26.202 14.467 -7.831  1.00 71.32 ? 158  PRO B CG  1 
ATOM   2476 C  CD  . PRO B 1 158 ? 24.986 13.946 -8.525  1.00 70.56 ? 158  PRO B CD  1 
ATOM   2477 N  N   . LYS B 1 159 ? 28.443 11.304 -10.484 1.00 60.32 ? 159  LYS B N   1 
ATOM   2478 C  CA  . LYS B 1 159 ? 28.965 9.943  -10.680 1.00 61.29 ? 159  LYS B CA  1 
ATOM   2479 C  C   . LYS B 1 159 ? 30.432 9.967  -11.117 1.00 61.07 ? 159  LYS B C   1 
ATOM   2480 O  O   . LYS B 1 159 ? 31.340 9.866  -10.291 1.00 60.81 ? 159  LYS B O   1 
ATOM   2481 C  CB  . LYS B 1 159 ? 28.110 9.163  -11.696 1.00 61.69 ? 159  LYS B CB  1 
ATOM   2482 C  CG  . LYS B 1 159 ? 28.396 9.445  -13.183 1.00 64.14 ? 159  LYS B CG  1 
ATOM   2483 C  CD  . LYS B 1 159 ? 28.210 10.914 -13.557 1.00 66.34 ? 159  LYS B CD  1 
ATOM   2484 C  CE  . LYS B 1 159 ? 28.269 11.115 -15.067 1.00 67.19 ? 159  LYS B CE  1 
ATOM   2485 N  NZ  . LYS B 1 159 ? 28.053 12.537 -15.454 1.00 68.23 ? 159  LYS B NZ  1 
HETATM 2486 CU CU  . CU  C 2 .   ? 17.925 21.788 31.674  1.00 41.41 ? 200  CU  A CU  1 
HETATM 2487 MN MN  . MN  D 3 .   ? 25.493 20.962 32.720  0.25 42.73 ? 201  MN  A MN  1 
HETATM 2488 S  S   . SO4 E 4 .   ? 27.394 3.843  39.829  1.00 77.87 ? 300  SO4 A S   1 
HETATM 2489 O  O1  . SO4 E 4 .   ? 27.140 4.776  38.736  1.00 79.24 ? 300  SO4 A O1  1 
HETATM 2490 O  O2  . SO4 E 4 .   ? 27.170 4.537  41.093  1.00 77.21 ? 300  SO4 A O2  1 
HETATM 2491 O  O3  . SO4 E 4 .   ? 26.499 2.693  39.717  1.00 77.16 ? 300  SO4 A O3  1 
HETATM 2492 O  O4  . SO4 E 4 .   ? 28.777 3.378  39.760  1.00 78.42 ? 300  SO4 A O4  1 
HETATM 2493 CU CU  . CU  F 2 .   ? 21.545 12.927 4.222   1.00 44.49 ? 200  CU  B CU  1 
HETATM 2494 MN MN  . MN  G 3 .   ? 28.377 17.335 4.461   0.25 34.52 ? 201  MN  B MN  1 
HETATM 2495 S  S   . SO4 H 4 .   ? 24.482 32.702 -3.129  1.00 94.17 ? 300  SO4 B S   1 
HETATM 2496 O  O1  . SO4 H 4 .   ? 24.605 31.638 -4.121  1.00 93.60 ? 300  SO4 B O1  1 
HETATM 2497 O  O2  . SO4 H 4 .   ? 23.111 33.202 -3.117  1.00 94.97 ? 300  SO4 B O2  1 
HETATM 2498 O  O3  . SO4 H 4 .   ? 24.821 32.177 -1.809  1.00 93.61 ? 300  SO4 B O3  1 
HETATM 2499 O  O4  . SO4 H 4 .   ? 25.389 33.795 -3.473  1.00 94.47 ? 300  SO4 B O4  1 
HETATM 2500 O  O   . HOH I 5 .   ? 23.132 -0.975 25.232  1.00 25.32 ? 1001 HOH A O   1 
HETATM 2501 O  O   . HOH I 5 .   ? 26.301 19.532 25.168  1.00 26.28 ? 1002 HOH A O   1 
HETATM 2502 O  O   . HOH I 5 .   ? 21.896 -1.668 8.379   1.00 27.17 ? 1003 HOH A O   1 
HETATM 2503 O  O   . HOH I 5 .   ? 27.451 10.606 36.091  1.00 17.47 ? 1004 HOH A O   1 
HETATM 2504 O  O   . HOH I 5 .   ? 14.164 8.712  20.246  1.00 30.45 ? 1005 HOH A O   1 
HETATM 2505 O  O   . HOH I 5 .   ? 16.090 3.550  39.944  1.00 23.80 ? 1006 HOH A O   1 
HETATM 2506 O  O   . HOH I 5 .   ? 33.013 18.418 18.980  1.00 27.85 ? 1007 HOH A O   1 
HETATM 2507 O  O   . HOH I 5 .   ? 18.451 -1.532 16.212  1.00 45.54 ? 1008 HOH A O   1 
HETATM 2508 O  O   . HOH I 5 .   ? 4.244  20.025 49.450  1.00 46.98 ? 1009 HOH A O   1 
HETATM 2509 O  O   . HOH I 5 .   ? 9.032  16.290 40.517  1.00 18.41 ? 1010 HOH A O   1 
HETATM 2510 O  O   . HOH I 5 .   ? 28.524 13.407 28.480  1.00 26.74 ? 1011 HOH A O   1 
HETATM 2511 O  O   . HOH I 5 .   ? 8.141  29.126 39.422  1.00 28.94 ? 1012 HOH A O   1 
HETATM 2512 O  O   . HOH I 5 .   ? 25.398 17.480 17.788  1.00 45.82 ? 1013 HOH A O   1 
HETATM 2513 O  O   . HOH I 5 .   ? 32.782 4.106  20.650  1.00 29.55 ? 1014 HOH A O   1 
HETATM 2514 O  O   . HOH I 5 .   ? 4.308  22.920 37.781  1.00 45.60 ? 1015 HOH A O   1 
HETATM 2515 O  O   . HOH I 5 .   ? 13.187 5.324  26.650  1.00 26.61 ? 1016 HOH A O   1 
HETATM 2516 O  O   . HOH I 5 .   ? 5.429  10.273 53.182  1.00 23.37 ? 1017 HOH A O   1 
HETATM 2517 O  O   . HOH I 5 .   ? 26.066 31.036 26.895  1.00 34.07 ? 1018 HOH A O   1 
HETATM 2518 O  O   . HOH I 5 .   ? 25.613 6.120  19.240  1.00 39.16 ? 1019 HOH A O   1 
HETATM 2519 O  O   . HOH I 5 .   ? 26.793 17.548 47.900  1.00 37.39 ? 1020 HOH A O   1 
HETATM 2520 O  O   . HOH I 5 .   ? 19.980 -2.184 29.525  1.00 35.70 ? 1021 HOH A O   1 
HETATM 2521 O  O   . HOH I 5 .   ? 8.350  8.105  31.719  1.00 38.51 ? 1022 HOH A O   1 
HETATM 2522 O  O   . HOH I 5 .   ? 28.720 13.438 36.386  1.00 31.16 ? 1023 HOH A O   1 
HETATM 2523 O  O   . HOH I 5 .   ? 16.069 1.357  15.635  1.00 40.46 ? 1024 HOH A O   1 
HETATM 2524 O  O   . HOH I 5 .   ? 8.046  5.465  16.374  1.00 32.29 ? 1025 HOH A O   1 
HETATM 2525 O  O   . HOH I 5 .   ? 23.178 5.674  47.368  1.00 37.07 ? 1026 HOH A O   1 
HETATM 2526 O  O   . HOH I 5 .   ? 7.673  3.672  18.390  1.00 45.69 ? 1027 HOH A O   1 
HETATM 2527 O  O   . HOH I 5 .   ? 0.386  15.199 49.734  1.00 34.87 ? 1028 HOH A O   1 
HETATM 2528 O  O   . HOH J 5 .   ? 25.368 19.189 9.214   1.00 21.33 ? 1001 HOH B O   1 
HETATM 2529 O  O   . HOH J 5 .   ? 12.087 30.958 14.468  1.00 36.61 ? 1002 HOH B O   1 
HETATM 2530 O  O   . HOH J 5 .   ? 22.924 20.539 9.341   1.00 23.57 ? 1003 HOH B O   1 
HETATM 2531 O  O   . HOH J 5 .   ? 13.672 29.361 -4.679  1.00 24.24 ? 1004 HOH B O   1 
HETATM 2532 O  O   . HOH J 5 .   ? 24.097 19.708 19.038  1.00 28.71 ? 1005 HOH B O   1 
HETATM 2533 O  O   . HOH J 5 .   ? 8.500  25.602 0.998   1.00 31.16 ? 1006 HOH B O   1 
HETATM 2534 O  O   . HOH J 5 .   ? 27.199 15.284 6.772   1.00 28.79 ? 1007 HOH B O   1 
HETATM 2535 O  O   . HOH J 5 .   ? 31.083 24.693 11.032  1.00 37.15 ? 1008 HOH B O   1 
HETATM 2536 O  O   . HOH J 5 .   ? 11.816 33.791 19.383  1.00 44.65 ? 1009 HOH B O   1 
HETATM 2537 O  O   . HOH J 5 .   ? 27.831 24.571 8.461   1.00 28.15 ? 1010 HOH B O   1 
HETATM 2538 O  O   . HOH J 5 .   ? 28.067 26.503 25.688  1.00 24.13 ? 1011 HOH B O   1 
HETATM 2539 O  O   . HOH J 5 .   ? 8.020  21.662 13.240  1.00 40.68 ? 1012 HOH B O   1 
HETATM 2540 O  O   . HOH J 5 .   ? 10.636 30.129 0.978   1.00 29.82 ? 1013 HOH B O   1 
HETATM 2541 O  O   . HOH J 5 .   ? 8.965  32.673 16.094  1.00 34.46 ? 1014 HOH B O   1 
HETATM 2542 O  O   . HOH J 5 .   ? 20.361 25.574 -19.441 1.00 37.98 ? 1015 HOH B O   1 
HETATM 2543 O  O   . HOH J 5 .   ? 30.596 10.562 -6.936  1.00 42.00 ? 1016 HOH B O   1 
HETATM 2544 O  O   . HOH J 5 .   ? 23.816 33.497 31.973  1.00 38.49 ? 1017 HOH B O   1 
HETATM 2545 O  O   . HOH J 5 .   ? 21.524 30.035 16.748  1.00 36.34 ? 1018 HOH B O   1 
HETATM 2546 O  O   . HOH J 5 .   ? 8.642  17.443 -1.851  1.00 43.66 ? 1019 HOH B O   1 
HETATM 2547 O  O   . HOH J 5 .   ? 18.718 32.683 -10.961 1.00 29.38 ? 1020 HOH B O   1 
HETATM 2548 O  O   . HOH J 5 .   ? 17.704 37.440 -2.270  1.00 38.91 ? 1021 HOH B O   1 
HETATM 2549 O  O   . HOH J 5 .   ? 26.365 26.755 0.749   1.00 34.83 ? 1022 HOH B O   1 
HETATM 2550 O  O   . HOH J 5 .   ? 27.230 17.732 11.812  1.00 24.98 ? 1023 HOH B O   1 
HETATM 2551 O  O   . HOH J 5 .   ? 19.940 14.584 -17.630 1.00 43.63 ? 1024 HOH B O   1 
HETATM 2552 O  O   . HOH J 5 .   ? 32.214 30.736 21.267  1.00 36.29 ? 1025 HOH B O   1 
HETATM 2553 O  O   . HOH J 5 .   ? 10.163 26.368 8.843   1.00 50.87 ? 1026 HOH B O   1 
HETATM 2554 O  O   . HOH J 5 .   ? 31.226 27.410 13.616  1.00 38.59 ? 1027 HOH B O   1 
HETATM 2555 O  O   . HOH J 5 .   ? 18.660 17.009 -18.227 1.00 41.37 ? 1028 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
5    N N   . GLU A 3   ? 0.7331 0.8181 0.7365 -0.0643 0.0561  -0.0357 3    GLU A N   
6    C CA  . GLU A 3   ? 0.7050 0.7947 0.7161 -0.0525 0.0461  -0.0262 3    GLU A CA  
7    C C   . GLU A 3   ? 0.6747 0.7909 0.6935 -0.0511 0.0378  -0.0247 3    GLU A C   
8    O O   . GLU A 3   ? 0.6763 0.8115 0.6977 -0.0557 0.0369  -0.0292 3    GLU A O   
9    C CB  . GLU A 3   ? 0.7057 0.7884 0.7175 -0.0491 0.0455  -0.0239 3    GLU A CB  
10   C CG  . GLU A 3   ? 0.7471 0.8028 0.7503 -0.0464 0.0525  -0.0222 3    GLU A CG  
11   C CD  . GLU A 3   ? 0.7922 0.8423 0.7960 -0.0422 0.0512  -0.0191 3    GLU A CD  
12   O OE1 . GLU A 3   ? 0.8055 0.8712 0.8175 -0.0398 0.0440  -0.0173 3    GLU A OE1 
13   O OE2 . GLU A 3   ? 0.8315 0.8608 0.8264 -0.0405 0.0580  -0.0182 3    GLU A OE2 
14   N N   . VAL A 4   ? 0.6477 0.7655 0.6692 -0.0442 0.0324  -0.0183 4    VAL A N   
15   C CA  . VAL A 4   ? 0.6201 0.7587 0.6465 -0.0406 0.0253  -0.0148 4    VAL A CA  
16   C C   . VAL A 4   ? 0.6001 0.7366 0.6310 -0.0310 0.0193  -0.0072 4    VAL A C   
17   O O   . VAL A 4   ? 0.5964 0.7171 0.6275 -0.0260 0.0186  -0.0026 4    VAL A O   
18   C CB  . VAL A 4   ? 0.6184 0.7581 0.6435 -0.0394 0.0241  -0.0122 4    VAL A CB  
19   C CG1 . VAL A 4   ? 0.6058 0.7658 0.6334 -0.0351 0.0178  -0.0078 4    VAL A CG1 
20   C CG2 . VAL A 4   ? 0.6118 0.7503 0.6318 -0.0488 0.0310  -0.0202 4    VAL A CG2 
21   N N   . PRO A 5   ? 0.5811 0.7349 0.6154 -0.0284 0.0154  -0.0066 5    PRO A N   
22   C CA  . PRO A 5   ? 0.5667 0.7167 0.6045 -0.0194 0.0110  0.0000  5    PRO A CA  
23   C C   . PRO A 5   ? 0.5572 0.7036 0.5947 -0.0120 0.0073  0.0079  5    PRO A C   
24   O O   . PRO A 5   ? 0.5567 0.7134 0.5922 -0.0118 0.0062  0.0093  5    PRO A O   
25   C CB  . PRO A 5   ? 0.5677 0.7393 0.6082 -0.0185 0.0090  -0.0025 5    PRO A CB  
26   C CG  . PRO A 5   ? 0.5724 0.7648 0.6114 -0.0244 0.0099  -0.0078 5    PRO A CG  
27   C CD  . PRO A 5   ? 0.5801 0.7592 0.6151 -0.0334 0.0155  -0.0126 5    PRO A CD  
28   N N   . ILE A 6   ? 0.5457 0.6776 0.5846 -0.0067 0.0062  0.0126  6    ILE A N   
29   C CA  . ILE A 6   ? 0.5354 0.6598 0.5730 -0.0013 0.0045  0.0194  6    ILE A CA  
30   C C   . ILE A 6   ? 0.5341 0.6593 0.5724 0.0066  0.0024  0.0242  6    ILE A C   
31   O O   . ILE A 6   ? 0.5282 0.6442 0.5687 0.0084  0.0026  0.0242  6    ILE A O   
32   C CB  . ILE A 6   ? 0.5323 0.6398 0.5703 -0.0027 0.0062  0.0198  6    ILE A CB  
33   C CG1 . ILE A 6   ? 0.5197 0.6261 0.5558 -0.0081 0.0087  0.0164  6    ILE A CG1 
34   C CG2 . ILE A 6   ? 0.5314 0.6304 0.5680 0.0010  0.0058  0.0254  6    ILE A CG2 
35   C CD1 . ILE A 6   ? 0.4931 0.5877 0.5297 -0.0081 0.0101  0.0164  6    ILE A CD1 
36   N N   . GLY A 7   ? 0.5382 0.6745 0.5735 0.0121  0.0007  0.0284  7    GLY A N   
37   C CA  . GLY A 7   ? 0.5444 0.6802 0.5783 0.0220  -0.0003 0.0341  7    GLY A CA  
38   C C   . GLY A 7   ? 0.5390 0.6826 0.5774 0.0241  -0.0013 0.0307  7    GLY A C   
39   O O   . GLY A 7   ? 0.5268 0.6823 0.5687 0.0178  -0.0014 0.0238  7    GLY A O   
40   N N   . ASP A 8   ? 0.5457 0.6814 0.5832 0.0326  -0.0011 0.0351  8    ASP A N   
41   C CA  . ASP A 8   ? 0.5449 0.6873 0.5867 0.0357  -0.0018 0.0322  8    ASP A CA  
42   C C   . ASP A 8   ? 0.5376 0.6613 0.5822 0.0314  0.0000  0.0296  8    ASP A C   
43   O O   . ASP A 8   ? 0.5432 0.6483 0.5854 0.0307  0.0019  0.0323  8    ASP A O   
44   C CB  . ASP A 8   ? 0.5607 0.7066 0.5992 0.0493  -0.0023 0.0386  8    ASP A CB  
45   C CG  . ASP A 8   ? 0.5828 0.7483 0.6169 0.0562  -0.0043 0.0428  8    ASP A CG  
46   O OD1 . ASP A 8   ? 0.6015 0.7867 0.6377 0.0494  -0.0061 0.0379  8    ASP A OD1 
47   O OD2 . ASP A 8   ? 0.6012 0.7624 0.6288 0.0689  -0.0035 0.0510  8    ASP A OD2 
48   N N   . PRO A 9   ? 0.5253 0.6556 0.5746 0.0280  -0.0002 0.0238  9    PRO A N   
49   C CA  . PRO A 9   ? 0.5159 0.6315 0.5672 0.0249  0.0013  0.0215  9    PRO A CA  
50   C C   . PRO A 9   ? 0.5170 0.6234 0.5681 0.0327  0.0022  0.0245  9    PRO A C   
51   O O   . PRO A 9   ? 0.5251 0.6404 0.5756 0.0411  0.0014  0.0270  9    PRO A O   
52   C CB  . PRO A 9   ? 0.5109 0.6377 0.5655 0.0192  0.0015  0.0149  9    PRO A CB  
53   C CG  . PRO A 9   ? 0.5153 0.6644 0.5709 0.0222  0.0000  0.0137  9    PRO A CG  
54   C CD  . PRO A 9   ? 0.5212 0.6743 0.5734 0.0257  -0.0013 0.0185  9    PRO A CD  
55   N N   . LYS A 10  ? 0.5146 0.6044 0.5657 0.0300  0.0041  0.0238  10   LYS A N   
56   C CA  . LYS A 10  ? 0.5213 0.5993 0.5715 0.0353  0.0064  0.0252  10   LYS A CA  
57   C C   . LYS A 10  ? 0.5067 0.5864 0.5611 0.0329  0.0064  0.0199  10   LYS A C   
58   O O   . LYS A 10  ? 0.5021 0.5851 0.5586 0.0261  0.0056  0.0161  10   LYS A O   
59   C CB  . LYS A 10  ? 0.5319 0.5911 0.5784 0.0325  0.0097  0.0268  10   LYS A CB  
60   C CG  . LYS A 10  ? 0.5616 0.6124 0.6015 0.0377  0.0120  0.0332  10   LYS A CG  
61   C CD  . LYS A 10  ? 0.5664 0.6264 0.6050 0.0353  0.0096  0.0353  10   LYS A CD  
62   C CE  . LYS A 10  ? 0.5849 0.6382 0.6155 0.0422  0.0119  0.0427  10   LYS A CE  
63   N NZ  . LYS A 10  ? 0.5699 0.6304 0.5980 0.0545  0.0113  0.0471  10   LYS A NZ  
64   N N   . GLU A 11  ? 0.5034 0.5800 0.5582 0.0391  0.0079  0.0201  11   GLU A N   
65   C CA  . GLU A 11  ? 0.4926 0.5701 0.5509 0.0370  0.0083  0.0151  11   GLU A CA  
66   C C   . GLU A 11  ? 0.4867 0.5472 0.5432 0.0385  0.0122  0.0147  11   GLU A C   
67   O O   . GLU A 11  ? 0.4949 0.5489 0.5488 0.0466  0.0148  0.0173  11   GLU A O   
68   C CB  . GLU A 11  ? 0.4951 0.5894 0.5565 0.0421  0.0068  0.0136  11   GLU A CB  
69   C CG  . GLU A 11  ? 0.5099 0.6223 0.5734 0.0372  0.0044  0.0112  11   GLU A CG  
70   C CD  . GLU A 11  ? 0.5505 0.6829 0.6177 0.0401  0.0035  0.0077  11   GLU A CD  
71   O OE1 . GLU A 11  ? 0.5743 0.7064 0.6430 0.0464  0.0044  0.0072  11   GLU A OE1 
72   O OE2 . GLU A 11  ? 0.5733 0.7226 0.6417 0.0355  0.0024  0.0046  11   GLU A OE2 
73   N N   . LEU A 12  ? 0.4710 0.5249 0.5280 0.0309  0.0132  0.0110  12   LEU A N   
74   C CA  . LEU A 12  ? 0.4685 0.5081 0.5238 0.0293  0.0176  0.0085  12   LEU A CA  
75   C C   . LEU A 12  ? 0.4524 0.4954 0.5104 0.0219  0.0171  0.0026  12   LEU A C   
76   O O   . LEU A 12  ? 0.4428 0.4946 0.5022 0.0180  0.0141  0.0019  12   LEU A O   
77   C CB  . LEU A 12  ? 0.4782 0.5034 0.5284 0.0278  0.0212  0.0112  12   LEU A CB  
78   C CG  . LEU A 12  ? 0.4609 0.4885 0.5108 0.0210  0.0197  0.0115  12   LEU A CG  
79   C CD1 . LEU A 12  ? 0.4674 0.4790 0.5113 0.0195  0.0249  0.0137  12   LEU A CD1 
80   C CD2 . LEU A 12  ? 0.4518 0.4922 0.5031 0.0228  0.0149  0.0149  12   LEU A CD2 
81   N N   . ASN A 13  ? 0.4487 0.4843 0.5064 0.0206  0.0208  -0.0016 13   ASN A N   
82   C CA  . ASN A 13  ? 0.4318 0.4727 0.4915 0.0143  0.0207  -0.0077 13   ASN A CA  
83   C C   . ASN A 13  ? 0.4168 0.4715 0.4790 0.0147  0.0167  -0.0084 13   ASN A C   
84   O O   . ASN A 13  ? 0.4066 0.4682 0.4687 0.0107  0.0152  -0.0107 13   ASN A O   
85   C CB  . ASN A 13  ? 0.4250 0.4662 0.4837 0.0074  0.0212  -0.0095 13   ASN A CB  
86   C CG  . ASN A 13  ? 0.4196 0.4458 0.4745 0.0051  0.0266  -0.0094 13   ASN A CG  
87   O OD1 . ASN A 13  ? 0.4129 0.4379 0.4663 0.0027  0.0264  -0.0071 13   ASN A OD1 
88   N ND2 . ASN A 13  ? 0.3848 0.3980 0.4373 0.0058  0.0323  -0.0119 13   ASN A ND2 
89   N N   . GLY A 14  ? 0.4146 0.4737 0.4782 0.0197  0.0155  -0.0065 14   GLY A N   
90   C CA  . GLY A 14  ? 0.4085 0.4789 0.4733 0.0189  0.0132  -0.0076 14   GLY A CA  
91   C C   . GLY A 14  ? 0.4026 0.4776 0.4656 0.0164  0.0110  -0.0050 14   GLY A C   
92   O O   . GLY A 14  ? 0.4062 0.4861 0.4677 0.0140  0.0107  -0.0061 14   GLY A O   
93   N N   . MET A 15  ? 0.4008 0.4728 0.4630 0.0168  0.0103  -0.0016 15   MET A N   
94   C CA  . MET A 15  ? 0.3892 0.4641 0.4494 0.0144  0.0090  0.0004  15   MET A CA  
95   C C   . MET A 15  ? 0.3894 0.4674 0.4499 0.0165  0.0080  0.0034  15   MET A C   
96   O O   . MET A 15  ? 0.3858 0.4611 0.4469 0.0208  0.0083  0.0055  15   MET A O   
97   C CB  . MET A 15  ? 0.3821 0.4528 0.4405 0.0119  0.0089  0.0009  15   MET A CB  
98   C CG  . MET A 15  ? 0.3773 0.4493 0.4351 0.0102  0.0095  -0.0023 15   MET A CG  
99   S SD  . MET A 15  ? 0.3586 0.4325 0.4150 0.0080  0.0091  -0.0025 15   MET A SD  
100  C CE  . MET A 15  ? 0.3570 0.4236 0.4154 0.0057  0.0111  -0.0034 15   MET A CE  
101  N N   . GLU A 16  ? 0.3927 0.4761 0.4518 0.0137  0.0076  0.0036  16   GLU A N   
102  C CA  . GLU A 16  ? 0.4051 0.4938 0.4640 0.0144  0.0067  0.0057  16   GLU A CA  
103  C C   . GLU A 16  ? 0.4022 0.4850 0.4583 0.0116  0.0067  0.0075  16   GLU A C   
104  O O   . GLU A 16  ? 0.4006 0.4810 0.4540 0.0082  0.0080  0.0063  16   GLU A O   
105  C CB  . GLU A 16  ? 0.4125 0.5131 0.4716 0.0115  0.0072  0.0028  16   GLU A CB  
106  C CG  . GLU A 16  ? 0.4447 0.5561 0.5042 0.0123  0.0060  0.0039  16   GLU A CG  
107  C CD  . GLU A 16  ? 0.4973 0.6225 0.5567 0.0066  0.0076  -0.0010 16   GLU A CD  
108  O OE1 . GLU A 16  ? 0.4975 0.6166 0.5531 -0.0003 0.0108  -0.0036 16   GLU A OE1 
109  O OE2 . GLU A 16  ? 0.5441 0.6865 0.6065 0.0093  0.0063  -0.0024 16   GLU A OE2 
110  N N   . ILE A 17  ? 0.4073 0.4873 0.4632 0.0136  0.0060  0.0107  17   ILE A N   
111  C CA  . ILE A 17  ? 0.4088 0.4845 0.4627 0.0110  0.0062  0.0120  17   ILE A CA  
112  C C   . ILE A 17  ? 0.4032 0.4848 0.4558 0.0107  0.0055  0.0140  17   ILE A C   
113  O O   . ILE A 17  ? 0.3996 0.4822 0.4517 0.0143  0.0049  0.0172  17   ILE A O   
114  C CB  . ILE A 17  ? 0.4192 0.4865 0.4730 0.0114  0.0070  0.0132  17   ILE A CB  
115  C CG1 . ILE A 17  ? 0.4204 0.4846 0.4757 0.0113  0.0080  0.0101  17   ILE A CG1 
116  C CG2 . ILE A 17  ? 0.4065 0.4725 0.4589 0.0082  0.0073  0.0133  17   ILE A CG2 
117  C CD1 . ILE A 17  ? 0.4577 0.5143 0.5126 0.0096  0.0102  0.0092  17   ILE A CD1 
118  N N   . ALA A 18  ? 0.3990 0.4839 0.4499 0.0067  0.0064  0.0120  18   ALA A N   
119  C CA  . ALA A 18  ? 0.3997 0.4918 0.4492 0.0047  0.0063  0.0122  18   ALA A CA  
120  C C   . ALA A 18  ? 0.3982 0.4843 0.4450 0.0020  0.0075  0.0126  18   ALA A C   
121  O O   . ALA A 18  ? 0.3989 0.4776 0.4446 0.0016  0.0087  0.0119  18   ALA A O   
122  C CB  . ALA A 18  ? 0.3977 0.4993 0.4468 0.0008  0.0077  0.0079  18   ALA A CB  
123  N N   . ALA A 19  ? 0.3950 0.4860 0.4407 0.0010  0.0071  0.0138  19   ALA A N   
124  C CA  . ALA A 19  ? 0.3950 0.4821 0.4383 -0.0014 0.0084  0.0138  19   ALA A CA  
125  C C   . ALA A 19  ? 0.3979 0.4918 0.4387 -0.0060 0.0103  0.0108  19   ALA A C   
126  O O   . ALA A 19  ? 0.3994 0.5053 0.4409 -0.0066 0.0091  0.0101  19   ALA A O   
127  C CB  . ALA A 19  ? 0.3931 0.4781 0.4365 0.0004  0.0071  0.0177  19   ALA A CB  
128  N N   . VAL A 20  ? 0.4019 0.4892 0.4394 -0.0089 0.0136  0.0086  20   VAL A N   
129  C CA  . VAL A 20  ? 0.4081 0.4990 0.4421 -0.0145 0.0169  0.0047  20   VAL A CA  
130  C C   . VAL A 20  ? 0.4144 0.4978 0.4456 -0.0144 0.0192  0.0050  20   VAL A C   
131  O O   . VAL A 20  ? 0.4135 0.4907 0.4455 -0.0101 0.0181  0.0078  20   VAL A O   
132  C CB  . VAL A 20  ? 0.4148 0.5022 0.4452 -0.0195 0.0220  -0.0005 20   VAL A CB  
133  C CG1 . VAL A 20  ? 0.4042 0.5038 0.4380 -0.0206 0.0200  -0.0023 20   VAL A CG1 
134  C CG2 . VAL A 20  ? 0.4078 0.4791 0.4345 -0.0164 0.0251  0.0005  20   VAL A CG2 
135  N N   . TYR A 21  ? 0.4275 0.5134 0.4554 -0.0195 0.0225  0.0014  21   TYR A N   
136  C CA  . TYR A 21  ? 0.4383 0.5157 0.4623 -0.0193 0.0261  0.0007  21   TYR A CA  
137  C C   . TYR A 21  ? 0.4519 0.5256 0.4698 -0.0261 0.0331  -0.0054 21   TYR A C   
138  O O   . TYR A 21  ? 0.4501 0.5341 0.4680 -0.0327 0.0339  -0.0097 21   TYR A O   
139  C CB  . TYR A 21  ? 0.4338 0.5178 0.4605 -0.0176 0.0227  0.0038  21   TYR A CB  
140  C CG  . TYR A 21  ? 0.4447 0.5407 0.4708 -0.0225 0.0222  0.0021  21   TYR A CG  
141  C CD1 . TYR A 21  ? 0.4594 0.5548 0.4814 -0.0273 0.0269  -0.0024 21   TYR A CD1 
142  C CD2 . TYR A 21  ? 0.4547 0.5627 0.4835 -0.0213 0.0175  0.0054  21   TYR A CD2 
143  C CE1 . TYR A 21  ? 0.4608 0.5700 0.4822 -0.0320 0.0264  -0.0045 21   TYR A CE1 
144  C CE2 . TYR A 21  ? 0.4489 0.5706 0.4763 -0.0244 0.0168  0.0046  21   TYR A CE2 
145  C CZ  . TYR A 21  ? 0.4529 0.5763 0.4769 -0.0303 0.0209  -0.0007 21   TYR A CZ  
146  O OH  . TYR A 21  ? 0.4444 0.5836 0.4669 -0.0338 0.0202  -0.0022 21   TYR A OH  
147  N N   . LEU A 22  ? 0.4710 0.5303 0.4831 -0.0243 0.0387  -0.0063 22   LEU A N   
148  C CA  . LEU A 22  ? 0.4953 0.5451 0.4993 -0.0307 0.0477  -0.0125 22   LEU A CA  
149  C C   . LEU A 22  ? 0.5083 0.5480 0.5078 -0.0266 0.0517  -0.0120 22   LEU A C   
150  O O   . LEU A 22  ? 0.5053 0.5494 0.5091 -0.0196 0.0468  -0.0074 22   LEU A O   
151  C CB  . LEU A 22  ? 0.5079 0.5428 0.5053 -0.0322 0.0541  -0.0145 22   LEU A CB  
152  C CG  . LEU A 22  ? 0.5248 0.5464 0.5197 -0.0221 0.0540  -0.0087 22   LEU A CG  
153  C CD1 . LEU A 22  ? 0.5513 0.5520 0.5347 -0.0236 0.0641  -0.0109 22   LEU A CD1 
154  C CD2 . LEU A 22  ? 0.5200 0.5536 0.5237 -0.0183 0.0451  -0.0045 22   LEU A CD2 
155  N N   . GLN A 23  ? 0.5301 0.5569 0.5207 -0.0313 0.0613  -0.0174 23   GLN A N   
156  C CA  . GLN A 23  ? 0.5441 0.5597 0.5292 -0.0263 0.0665  -0.0174 23   GLN A CA  
157  C C   . GLN A 23  ? 0.5435 0.5499 0.5272 -0.0127 0.0654  -0.0107 23   GLN A C   
158  O O   . GLN A 23  ? 0.5455 0.5460 0.5279 -0.0087 0.0648  -0.0076 23   GLN A O   
159  C CB  . GLN A 23  ? 0.5708 0.5681 0.5440 -0.0332 0.0793  -0.0246 23   GLN A CB  
160  C CG  . GLN A 23  ? 0.6166 0.5890 0.5785 -0.0314 0.0887  -0.0245 23   GLN A CG  
161  C CD  . GLN A 23  ? 0.6557 0.6325 0.6188 -0.0407 0.0886  -0.0278 23   GLN A CD  
162  O OE1 . GLN A 23  ? 0.6670 0.6669 0.6397 -0.0475 0.0812  -0.0301 23   GLN A OE1 
163  N NE2 . GLN A 23  ? 0.6945 0.6492 0.6469 -0.0403 0.0973  -0.0279 23   GLN A NE2 
164  N N   . PRO A 24  ? 0.5452 0.5529 0.5290 -0.0054 0.0653  -0.0089 24   PRO A N   
165  C CA  . PRO A 24  ? 0.5445 0.5486 0.5270 0.0081  0.0643  -0.0034 24   PRO A CA  
166  C C   . PRO A 24  ? 0.5625 0.5428 0.5321 0.0145  0.0735  -0.0020 24   PRO A C   
167  O O   . PRO A 24  ? 0.5806 0.5426 0.5400 0.0092  0.0836  -0.0062 24   PRO A O   
168  C CB  . PRO A 24  ? 0.5485 0.5580 0.5317 0.0130  0.0652  -0.0039 24   PRO A CB  
169  C CG  . PRO A 24  ? 0.5428 0.5641 0.5314 0.0016  0.0627  -0.0081 24   PRO A CG  
170  C CD  . PRO A 24  ? 0.5444 0.5593 0.5296 -0.0092 0.0662  -0.0123 24   PRO A CD  
171  N N   . ILE A 25  ? 0.5644 0.5449 0.5335 0.0254  0.0707  0.0035  25   ILE A N   
172  C CA  . ILE A 25  ? 0.5895 0.5476 0.5451 0.0330  0.0790  0.0065  25   ILE A CA  
173  C C   . ILE A 25  ? 0.6017 0.5598 0.5526 0.0510  0.0796  0.0123  25   ILE A C   
174  O O   . ILE A 25  ? 0.5795 0.5605 0.5407 0.0564  0.0709  0.0140  25   ILE A O   
175  C CB  . ILE A 25  ? 0.5837 0.5420 0.5410 0.0291  0.0759  0.0079  25   ILE A CB  
176  C CG1 . ILE A 25  ? 0.5661 0.5464 0.5348 0.0349  0.0645  0.0119  25   ILE A CG1 
177  C CG2 . ILE A 25  ? 0.5591 0.5206 0.5209 0.0126  0.0756  0.0019  25   ILE A CG2 
178  C CD1 . ILE A 25  ? 0.5438 0.5212 0.5059 0.0504  0.0653  0.0179  25   ILE A CD1 
179  N N   . GLU A 26  ? 0.6394 0.5721 0.5739 0.0603  0.0907  0.0150  26   GLU A N   
180  C CA  A GLU A 26  ? 0.6596 0.5913 0.5866 0.0803  0.0925  0.0215  26   GLU A CA  
181  C CA  B GLU A 26  ? 0.6587 0.5909 0.5859 0.0803  0.0924  0.0215  26   GLU A CA  
182  C C   . GLU A 26  ? 0.6654 0.6006 0.5907 0.0875  0.0887  0.0271  26   GLU A C   
183  O O   . GLU A 26  ? 0.6775 0.5936 0.5944 0.0826  0.0942  0.0277  26   GLU A O   
184  C CB  A GLU A 26  ? 0.6941 0.5931 0.6012 0.0887  0.1078  0.0228  26   GLU A CB  
185  C CB  B GLU A 26  ? 0.6923 0.5927 0.6001 0.0890  0.1074  0.0228  26   GLU A CB  
186  C CG  A GLU A 26  ? 0.7021 0.5939 0.6086 0.0809  0.1137  0.0163  26   GLU A CG  
187  C CG  B GLU A 26  ? 0.6960 0.5924 0.6042 0.0829  0.1122  0.0167  26   GLU A CG  
188  C CD  A GLU A 26  ? 0.7360 0.5907 0.6209 0.0883  0.1309  0.0170  26   GLU A CD  
189  C CD  B GLU A 26  ? 0.6746 0.5963 0.5923 0.0930  0.1053  0.0175  26   GLU A CD  
190  O OE1 A GLU A 26  ? 0.7436 0.5780 0.6133 0.1019  0.1381  0.0239  26   GLU A OE1 
191  O OE1 B GLU A 26  ? 0.6409 0.5915 0.5714 0.0965  0.0935  0.0197  26   GLU A OE1 
192  O OE2 A GLU A 26  ? 0.7414 0.5863 0.6236 0.0807  0.1379  0.0107  26   GLU A OE2 
193  O OE2 B GLU A 26  ? 0.6746 0.5875 0.5867 0.0965  0.1125  0.0151  26   GLU A OE2 
194  N N   . MET A 27  ? 0.6658 0.6267 0.5991 0.0983  0.0798  0.0304  27   MET A N   
195  C CA  . MET A 27  ? 0.6743 0.6437 0.6074 0.1048  0.0752  0.0349  27   MET A CA  
196  C C   . MET A 27  ? 0.6975 0.6717 0.6209 0.1272  0.0771  0.0416  27   MET A C   
197  O O   . MET A 27  ? 0.6968 0.6890 0.6242 0.1367  0.0746  0.0415  27   MET A O   
198  C CB  . MET A 27  ? 0.6482 0.6485 0.6003 0.0956  0.0622  0.0315  27   MET A CB  
199  C CG  . MET A 27  ? 0.6522 0.6584 0.6054 0.0962  0.0579  0.0339  27   MET A CG  
200  S SD  . MET A 27  ? 0.6214 0.6644 0.5940 0.0904  0.0446  0.0302  27   MET A SD  
201  C CE  . MET A 27  ? 0.6420 0.7100 0.6140 0.1085  0.0423  0.0324  27   MET A CE  
202  N N   . GLU A 28  ? 0.7239 0.6833 0.6340 0.1360  0.0818  0.0476  28   GLU A N   
203  C CA  . GLU A 28  ? 0.7481 0.7184 0.6499 0.1579  0.0815  0.0548  28   GLU A CA  
204  C C   . GLU A 28  ? 0.7388 0.7337 0.6501 0.1556  0.0715  0.0549  28   GLU A C   
205  O O   . GLU A 28  ? 0.7345 0.7189 0.6471 0.1428  0.0711  0.0534  28   GLU A O   
206  C CB  . GLU A 28  ? 0.7893 0.7225 0.6657 0.1719  0.0956  0.0627  28   GLU A CB  
207  C CG  . GLU A 28  ? 0.8243 0.7352 0.6881 0.1815  0.1067  0.0641  28   GLU A CG  
208  C CD  . GLU A 28  ? 0.8719 0.7482 0.7083 0.2008  0.1210  0.0736  28   GLU A CD  
209  O OE1 . GLU A 28  ? 0.8807 0.7656 0.7095 0.2169  0.1192  0.0813  28   GLU A OE1 
210  O OE2 . GLU A 28  ? 0.9016 0.7414 0.7230 0.2001  0.1349  0.0734  28   GLU A OE2 
211  N N   . PRO A 29  ? 0.7433 0.7724 0.6609 0.1676  0.0638  0.0560  29   PRO A N   
212  C CA  . PRO A 29  ? 0.7612 0.8085 0.6767 0.1856  0.0638  0.0581  29   PRO A CA  
213  C C   . PRO A 29  ? 0.7561 0.8189 0.6860 0.1766  0.0600  0.0509  29   PRO A C   
214  O O   . PRO A 29  ? 0.7325 0.8049 0.6779 0.1574  0.0537  0.0440  29   PRO A O   
215  C CB  . PRO A 29  ? 0.7501 0.8355 0.6713 0.1954  0.0551  0.0589  29   PRO A CB  
216  C CG  . PRO A 29  ? 0.7216 0.8171 0.6574 0.1752  0.0473  0.0528  29   PRO A CG  
217  C CD  . PRO A 29  ? 0.7224 0.7790 0.6518 0.1621  0.0538  0.0535  29   PRO A CD  
218  N N   . ARG A 30  ? 0.7835 0.8483 0.7072 0.1916  0.0645  0.0529  30   ARG A N   
219  C CA  . ARG A 30  ? 0.7814 0.8597 0.7165 0.1850  0.0623  0.0465  30   ARG A CA  
220  C C   . ARG A 30  ? 0.7587 0.8842 0.7120 0.1818  0.0507  0.0407  30   ARG A C   
221  O O   . ARG A 30  ? 0.7551 0.9042 0.7097 0.1896  0.0457  0.0421  30   ARG A O   
222  C CB  . ARG A 30  ? 0.8128 0.8808 0.7352 0.2039  0.0710  0.0503  30   ARG A CB  
223  C CG  . ARG A 30  ? 0.8690 0.8899 0.7679 0.2137  0.0852  0.0575  30   ARG A CG  
224  C CD  . ARG A 30  ? 0.9012 0.8871 0.7981 0.1936  0.0921  0.0530  30   ARG A CD  
225  N NE  . ARG A 30  ? 0.9657 0.9120 0.8414 0.2042  0.1075  0.0570  30   ARG A NE  
226  C CZ  . ARG A 30  ? 1.0035 0.9108 0.8690 0.1912  0.1181  0.0550  30   ARG A CZ  
227  N NH1 . ARG A 30  ? 0.9833 0.8880 0.8584 0.1680  0.1142  0.0493  30   ARG A NH1 
228  N NH2 . ARG A 30  ? 1.0504 0.9215 0.8952 0.2019  0.1335  0.0582  30   ARG A NH2 
229  N N   . GLY A 31  ? 0.7437 0.8828 0.7102 0.1693  0.0473  0.0335  31   GLY A N   
230  C CA  . GLY A 31  ? 0.7225 0.9051 0.7049 0.1655  0.0386  0.0269  31   GLY A CA  
231  C C   . GLY A 31  ? 0.6979 0.8936 0.6937 0.1462  0.0311  0.0213  31   GLY A C   
232  O O   . GLY A 31  ? 0.6822 0.9076 0.6912 0.1375  0.0257  0.0142  31   GLY A O   
233  N N   . ILE A 32  ? 0.6941 0.8676 0.6861 0.1394  0.0315  0.0242  32   ILE A N   
234  C CA  . ILE A 32  ? 0.6740 0.8554 0.6774 0.1218  0.0255  0.0193  32   ILE A CA  
235  C C   . ILE A 32  ? 0.6484 0.8149 0.6588 0.1035  0.0255  0.0157  32   ILE A C   
236  O O   . ILE A 32  ? 0.6413 0.8234 0.6632 0.0904  0.0210  0.0099  32   ILE A O   
237  C CB  . ILE A 32  ? 0.6857 0.8512 0.6825 0.1223  0.0258  0.0236  32   ILE A CB  
238  C CG1 . ILE A 32  ? 0.7154 0.9006 0.7060 0.1398  0.0247  0.0270  32   ILE A CG1 
239  C CG2 . ILE A 32  ? 0.6800 0.8489 0.6880 0.1039  0.0206  0.0186  32   ILE A CG2 
240  C CD1 . ILE A 32  ? 0.7293 0.9566 0.7323 0.1364  0.0173  0.0200  32   ILE A CD1 
241  N N   . ASP A 33  ? 0.6354 0.7717 0.6375 0.1027  0.0314  0.0188  33   ASP A N   
242  C CA  . ASP A 33  ? 0.6067 0.7289 0.6137 0.0865  0.0317  0.0160  33   ASP A CA  
243  C C   . ASP A 33  ? 0.5936 0.7163 0.6009 0.0866  0.0346  0.0138  33   ASP A C   
244  O O   . ASP A 33  ? 0.6102 0.7369 0.6117 0.1004  0.0382  0.0154  33   ASP A O   
245  C CB  . ASP A 33  ? 0.6121 0.7033 0.6103 0.0827  0.0363  0.0192  33   ASP A CB  
246  C CG  . ASP A 33  ? 0.5996 0.6827 0.6042 0.0657  0.0346  0.0161  33   ASP A CG  
247  O OD1 . ASP A 33  ? 0.5783 0.6772 0.5937 0.0567  0.0289  0.0130  33   ASP A OD1 
248  O OD2 . ASP A 33  ? 0.5865 0.6477 0.5845 0.0614  0.0396  0.0167  33   ASP A OD2 
249  N N   . LEU A 34  ? 0.5599 0.6797 0.5737 0.0719  0.0333  0.0105  34   LEU A N   
250  C CA  . LEU A 34  ? 0.5417 0.6589 0.5551 0.0697  0.0366  0.0083  34   LEU A CA  
251  C C   . LEU A 34  ? 0.5496 0.6387 0.5505 0.0747  0.0448  0.0108  34   LEU A C   
252  O O   . LEU A 34  ? 0.5532 0.6227 0.5487 0.0706  0.0471  0.0126  34   LEU A O   
253  C CB  . LEU A 34  ? 0.5204 0.6396 0.5419 0.0531  0.0334  0.0051  34   LEU A CB  
254  C CG  . LEU A 34  ? 0.5077 0.6285 0.5300 0.0488  0.0359  0.0022  34   LEU A CG  
255  C CD1 . LEU A 34  ? 0.4621 0.6073 0.4892 0.0548  0.0349  -0.0005 34   LEU A CD1 
256  C CD2 . LEU A 34  ? 0.4618 0.5811 0.4892 0.0335  0.0331  0.0008  34   LEU A CD2 
257  N N   . ALA A 35  ? 0.5492 0.6365 0.5450 0.0829  0.0501  0.0102  35   ALA A N   
258  C CA  . ALA A 35  ? 0.5590 0.6173 0.5411 0.0876  0.0600  0.0117  35   ALA A CA  
259  C C   . ALA A 35  ? 0.5481 0.5908 0.5304 0.0710  0.0623  0.0081  35   ALA A C   
260  O O   . ALA A 35  ? 0.5270 0.5833 0.5195 0.0588  0.0566  0.0050  35   ALA A O   
261  C CB  . ALA A 35  ? 0.5677 0.6287 0.5446 0.1008  0.0654  0.0114  35   ALA A CB  
262  N N   . ALA A 36  ? 0.5597 0.5744 0.5296 0.0707  0.0714  0.0084  36   ALA A N   
263  C CA  . ALA A 36  ? 0.5540 0.5561 0.5232 0.0546  0.0743  0.0040  36   ALA A CA  
264  C C   . ALA A 36  ? 0.5434 0.5521 0.5162 0.0473  0.0753  -0.0010 36   ALA A C   
265  O O   . ALA A 36  ? 0.5319 0.5482 0.5113 0.0334  0.0714  -0.0043 36   ALA A O   
266  C CB  . ALA A 36  ? 0.5794 0.5501 0.5332 0.0552  0.0857  0.0041  36   ALA A CB  
267  N N   . SER A 37  ? 0.5481 0.5547 0.5159 0.0575  0.0806  -0.0014 37   SER A N   
268  C CA  . SER A 37  ? 0.5391 0.5518 0.5094 0.0516  0.0825  -0.0065 37   SER A CA  
269  C C   . SER A 37  ? 0.5096 0.5520 0.4945 0.0456  0.0721  -0.0075 37   SER A C   
270  O O   . SER A 37  ? 0.5089 0.5577 0.4974 0.0352  0.0715  -0.0115 37   SER A O   
271  C CB  . SER A 37  ? 0.5594 0.5624 0.5202 0.0661  0.0913  -0.0066 37   SER A CB  
272  O OG  . SER A 37  ? 0.5495 0.5696 0.5136 0.0820  0.0870  -0.0022 37   SER A OG  
273  N N   . LEU A 38  ? 0.4878 0.5478 0.4799 0.0516  0.0646  -0.0041 38   LEU A N   
274  C CA  . LEU A 38  ? 0.4616 0.5472 0.4660 0.0449  0.0563  -0.0053 38   LEU A CA  
275  C C   . LEU A 38  ? 0.4452 0.5327 0.4555 0.0313  0.0503  -0.0048 38   LEU A C   
276  O O   . LEU A 38  ? 0.4296 0.5330 0.4478 0.0241  0.0450  -0.0055 38   LEU A O   
277  C CB  . LEU A 38  ? 0.4554 0.5610 0.4649 0.0556  0.0519  -0.0035 38   LEU A CB  
278  C CG  . LEU A 38  ? 0.4480 0.5605 0.4536 0.0709  0.0564  -0.0041 38   LEU A CG  
279  C CD1 . LEU A 38  ? 0.4235 0.5565 0.4325 0.0830  0.0523  -0.0020 38   LEU A CD1 
280  C CD2 . LEU A 38  ? 0.4372 0.5640 0.4479 0.0659  0.0567  -0.0088 38   LEU A CD2 
281  N N   . ALA A 39  ? 0.4518 0.5227 0.4573 0.0282  0.0520  -0.0035 39   ALA A N   
282  C CA  . ALA A 39  ? 0.4383 0.5113 0.4486 0.0179  0.0466  -0.0025 39   ALA A CA  
283  C C   . ALA A 39  ? 0.4405 0.5056 0.4476 0.0073  0.0494  -0.0055 39   ALA A C   
284  O O   . ALA A 39  ? 0.4545 0.5084 0.4545 0.0067  0.0567  -0.0089 39   ALA A O   
285  C CB  . ALA A 39  ? 0.4350 0.5010 0.4439 0.0223  0.0453  0.0006  39   ALA A CB  
286  N N   . ASP A 40  ? 0.4301 0.5022 0.4422 -0.0008 0.0440  -0.0045 40   ASP A N   
287  C CA  . ASP A 40  ? 0.4307 0.5015 0.4407 -0.0105 0.0452  -0.0072 40   ASP A CA  
288  C C   . ASP A 40  ? 0.4283 0.4941 0.4380 -0.0132 0.0439  -0.0064 40   ASP A C   
289  O O   . ASP A 40  ? 0.4299 0.4916 0.4355 -0.0199 0.0477  -0.0103 40   ASP A O   
290  C CB  . ASP A 40  ? 0.4213 0.5073 0.4363 -0.0166 0.0402  -0.0063 40   ASP A CB  
291  C CG  . ASP A 40  ? 0.4309 0.5226 0.4454 -0.0167 0.0426  -0.0087 40   ASP A CG  
292  O OD1 . ASP A 40  ? 0.4578 0.5447 0.4671 -0.0195 0.0484  -0.0133 40   ASP A OD1 
293  O OD2 . ASP A 40  ? 0.3982 0.4993 0.4172 -0.0148 0.0393  -0.0065 40   ASP A OD2 
294  N N   . ILE A 41  ? 0.4183 0.4862 0.4323 -0.0089 0.0390  -0.0022 41   ILE A N   
295  C CA  . ILE A 41  ? 0.4104 0.4742 0.4244 -0.0105 0.0377  -0.0013 41   ILE A CA  
296  C C   . ILE A 41  ? 0.4085 0.4656 0.4221 -0.0024 0.0373  0.0015  41   ILE A C   
297  O O   . ILE A 41  ? 0.4073 0.4665 0.4215 0.0047  0.0370  0.0031  41   ILE A O   
298  C CB  . ILE A 41  ? 0.3997 0.4755 0.4197 -0.0146 0.0311  0.0009  41   ILE A CB  
299  C CG1 . ILE A 41  ? 0.3789 0.4611 0.4044 -0.0110 0.0261  0.0049  41   ILE A CG1 
300  C CG2 . ILE A 41  ? 0.3867 0.4716 0.4060 -0.0215 0.0312  -0.0012 41   ILE A CG2 
301  C CD1 . ILE A 41  ? 0.3633 0.4515 0.3923 -0.0132 0.0214  0.0080  41   ILE A CD1 
302  N N   . HIS A 42  ? 0.4098 0.4614 0.4222 -0.0037 0.0375  0.0018  42   HIS A N   
303  C CA  . HIS A 42  ? 0.4087 0.4565 0.4211 0.0028  0.0361  0.0048  42   HIS A CA  
304  C C   . HIS A 42  ? 0.3998 0.4546 0.4182 -0.0005 0.0305  0.0061  42   HIS A C   
305  O O   . HIS A 42  ? 0.4071 0.4602 0.4244 -0.0057 0.0316  0.0042  42   HIS A O   
306  C CB  . HIS A 42  ? 0.4225 0.4528 0.4250 0.0055  0.0437  0.0040  42   HIS A CB  
307  C CG  . HIS A 42  ? 0.4112 0.4377 0.4120 0.0136  0.0428  0.0076  42   HIS A CG  
308  N ND1 . HIS A 42  ? 0.4212 0.4518 0.4217 0.0239  0.0416  0.0105  42   HIS A ND1 
309  C CD2 . HIS A 42  ? 0.4226 0.4439 0.4216 0.0129  0.0430  0.0084  42   HIS A CD2 
310  C CE1 . HIS A 42  ? 0.4270 0.4555 0.4253 0.0295  0.0409  0.0132  42   HIS A CE1 
311  N NE2 . HIS A 42  ? 0.4427 0.4643 0.4401 0.0228  0.0419  0.0121  42   HIS A NE2 
312  N N   . LEU A 43  ? 0.3920 0.4554 0.4165 0.0020  0.0252  0.0085  43   LEU A N   
313  C CA  . LEU A 43  ? 0.3874 0.4553 0.4169 0.0000  0.0208  0.0099  43   LEU A CA  
314  C C   . LEU A 43  ? 0.3893 0.4518 0.4173 0.0033  0.0213  0.0104  43   LEU A C   
315  O O   . LEU A 43  ? 0.3875 0.4471 0.4128 0.0091  0.0228  0.0111  43   LEU A O   
316  C CB  . LEU A 43  ? 0.3816 0.4575 0.4165 0.0001  0.0170  0.0114  43   LEU A CB  
317  C CG  . LEU A 43  ? 0.3861 0.4640 0.4247 -0.0018 0.0137  0.0131  43   LEU A CG  
318  C CD1 . LEU A 43  ? 0.3648 0.4445 0.4026 -0.0051 0.0131  0.0140  43   LEU A CD1 
319  C CD2 . LEU A 43  ? 0.3816 0.4634 0.4233 -0.0028 0.0124  0.0137  43   LEU A CD2 
320  N N   . GLU A 44  ? 0.3938 0.4565 0.4233 0.0003  0.0201  0.0101  44   GLU A N   
321  C CA  . GLU A 44  ? 0.4011 0.4593 0.4293 0.0026  0.0206  0.0103  44   GLU A CA  
322  C C   . GLU A 44  ? 0.3940 0.4581 0.4280 0.0016  0.0163  0.0110  44   GLU A C   
323  O O   . GLU A 44  ? 0.3886 0.4579 0.4253 -0.0012 0.0145  0.0110  44   GLU A O   
324  C CB  . GLU A 44  ? 0.4075 0.4571 0.4292 -0.0005 0.0260  0.0079  44   GLU A CB  
325  C CG  . GLU A 44  ? 0.4382 0.4757 0.4511 0.0016  0.0325  0.0074  44   GLU A CG  
326  C CD  . GLU A 44  ? 0.4690 0.4937 0.4733 -0.0024 0.0400  0.0047  44   GLU A CD  
327  O OE1 . GLU A 44  ? 0.4866 0.5147 0.4928 -0.0076 0.0395  0.0025  44   GLU A OE1 
328  O OE2 . GLU A 44  ? 0.4931 0.5036 0.4880 -0.0007 0.0472  0.0043  44   GLU A OE2 
329  N N   . ALA A 45  ? 0.4015 0.4654 0.4368 0.0050  0.0150  0.0116  45   ALA A N   
330  C CA  . ALA A 45  ? 0.4019 0.4687 0.4415 0.0046  0.0123  0.0116  45   ALA A CA  
331  C C   . ALA A 45  ? 0.4106 0.4738 0.4476 0.0050  0.0141  0.0106  45   ALA A C   
332  O O   . ALA A 45  ? 0.4150 0.4748 0.4485 0.0083  0.0155  0.0109  45   ALA A O   
333  C CB  . ALA A 45  ? 0.3980 0.4683 0.4411 0.0064  0.0102  0.0117  45   ALA A CB  
334  N N   . ASP A 46  ? 0.4155 0.4811 0.4536 0.0019  0.0142  0.0092  46   ASP A N   
335  C CA  . ASP A 46  ? 0.4215 0.4855 0.4577 0.0008  0.0161  0.0074  46   ASP A CA  
336  C C   . ASP A 46  ? 0.4053 0.4737 0.4468 0.0030  0.0129  0.0076  46   ASP A C   
337  O O   . ASP A 46  ? 0.4019 0.4762 0.4476 0.0031  0.0107  0.0077  46   ASP A O   
338  C CB  . ASP A 46  ? 0.4291 0.4971 0.4642 -0.0046 0.0185  0.0043  46   ASP A CB  
339  C CG  . ASP A 46  ? 0.4857 0.5472 0.5144 -0.0083 0.0234  0.0028  46   ASP A CG  
340  O OD1 . ASP A 46  ? 0.5574 0.6070 0.5796 -0.0061 0.0272  0.0039  46   ASP A OD1 
341  O OD2 . ASP A 46  ? 0.5579 0.6267 0.5876 -0.0128 0.0237  0.0004  46   ASP A OD2 
342  N N   . ILE A 47  ? 0.3987 0.4641 0.4388 0.0056  0.0132  0.0077  47   ILE A N   
343  C CA  . ILE A 47  ? 0.3823 0.4510 0.4268 0.0071  0.0110  0.0069  47   ILE A CA  
344  C C   . ILE A 47  ? 0.3766 0.4439 0.4180 0.0070  0.0130  0.0053  47   ILE A C   
345  O O   . ILE A 47  ? 0.3748 0.4387 0.4112 0.0091  0.0147  0.0061  47   ILE A O   
346  C CB  . ILE A 47  ? 0.3785 0.4483 0.4248 0.0090  0.0094  0.0071  47   ILE A CB  
347  C CG1 . ILE A 47  ? 0.3812 0.4513 0.4288 0.0082  0.0086  0.0084  47   ILE A CG1 
348  C CG2 . ILE A 47  ? 0.3571 0.4285 0.4075 0.0091  0.0084  0.0051  47   ILE A CG2 
349  C CD1 . ILE A 47  ? 0.3962 0.4698 0.4457 0.0082  0.0079  0.0071  47   ILE A CD1 
350  N N   . HIS A 48  ? 0.3683 0.4397 0.4123 0.0051  0.0132  0.0034  48   HIS A N   
351  C CA  . HIS A 48  ? 0.3636 0.4348 0.4050 0.0039  0.0155  0.0013  48   HIS A CA  
352  C C   . HIS A 48  ? 0.3561 0.4334 0.4033 0.0055  0.0134  -0.0005 48   HIS A C   
353  O O   . HIS A 48  ? 0.3457 0.4270 0.3982 0.0073  0.0111  -0.0002 48   HIS A O   
354  C CB  . HIS A 48  ? 0.3645 0.4364 0.4025 -0.0013 0.0193  -0.0010 48   HIS A CB  
355  C CG  . HIS A 48  ? 0.3559 0.4188 0.3867 -0.0036 0.0232  0.0000  48   HIS A CG  
356  N ND1 . HIS A 48  ? 0.3485 0.4135 0.3806 -0.0051 0.0225  0.0001  48   HIS A ND1 
357  C CD2 . HIS A 48  ? 0.3567 0.4072 0.3776 -0.0038 0.0286  0.0010  48   HIS A CD2 
358  C CE1 . HIS A 48  ? 0.3635 0.4178 0.3877 -0.0068 0.0273  0.0006  48   HIS A CE1 
359  N NE2 . HIS A 48  ? 0.3472 0.3915 0.3639 -0.0055 0.0314  0.0015  48   HIS A NE2 
360  N N   . ALA A 49  ? 0.3643 0.4412 0.4093 0.0054  0.0149  -0.0020 49   ALA A N   
361  C CA  . ALA A 49  ? 0.3649 0.4468 0.4148 0.0069  0.0136  -0.0045 49   ALA A CA  
362  C C   . ALA A 49  ? 0.3664 0.4566 0.4202 0.0061  0.0139  -0.0068 49   ALA A C   
363  O O   . ALA A 49  ? 0.3753 0.4689 0.4267 0.0020  0.0162  -0.0083 49   ALA A O   
364  C CB  . ALA A 49  ? 0.3693 0.4501 0.4151 0.0068  0.0154  -0.0057 49   ALA A CB  
365  N N   . LEU A 50  ? 0.3644 0.4586 0.4238 0.0100  0.0121  -0.0076 50   LEU A N   
366  C CA  . LEU A 50  ? 0.3645 0.4700 0.4281 0.0118  0.0119  -0.0097 50   LEU A CA  
367  C C   . LEU A 50  ? 0.3642 0.4749 0.4286 0.0108  0.0137  -0.0138 50   LEU A C   
368  O O   . LEU A 50  ? 0.3614 0.4662 0.4221 0.0082  0.0152  -0.0146 50   LEU A O   
369  C CB  . LEU A 50  ? 0.3654 0.4705 0.4328 0.0189  0.0101  -0.0074 50   LEU A CB  
370  C CG  . LEU A 50  ? 0.3693 0.4726 0.4358 0.0203  0.0086  -0.0033 50   LEU A CG  
371  C CD1 . LEU A 50  ? 0.3688 0.4637 0.4356 0.0269  0.0086  -0.0001 50   LEU A CD1 
372  C CD2 . LEU A 50  ? 0.3567 0.4753 0.4243 0.0199  0.0079  -0.0041 50   LEU A CD2 
373  N N   . LYS A 51  ? 0.3657 0.4892 0.4345 0.0133  0.0135  -0.0164 51   LYS A N   
374  C CA  . LYS A 51  ? 0.3665 0.4963 0.4373 0.0136  0.0151  -0.0206 51   LYS A CA  
375  C C   . LYS A 51  ? 0.3664 0.4863 0.4381 0.0179  0.0149  -0.0203 51   LYS A C   
376  O O   . LYS A 51  ? 0.3654 0.4776 0.4380 0.0227  0.0139  -0.0175 51   LYS A O   
377  C CB  . LYS A 51  ? 0.3682 0.5166 0.4445 0.0176  0.0146  -0.0234 51   LYS A CB  
378  C CG  . LYS A 51  ? 0.3745 0.5382 0.4506 0.0111  0.0157  -0.0266 51   LYS A CG  
379  C CD  . LYS A 51  ? 0.3724 0.5590 0.4546 0.0174  0.0139  -0.0286 51   LYS A CD  
380  C CE  . LYS A 51  ? 0.3608 0.5691 0.4442 0.0088  0.0164  -0.0358 51   LYS A CE  
381  N NZ  . LYS A 51  ? 0.3364 0.5408 0.4147 -0.0013 0.0185  -0.0366 51   LYS A NZ  
382  N N   . ASN A 52  ? 0.3726 0.4924 0.4431 0.0153  0.0167  -0.0236 52   ASN A N   
383  C CA  . ASN A 52  ? 0.3810 0.4941 0.4523 0.0178  0.0173  -0.0253 52   ASN A CA  
384  C C   . ASN A 52  ? 0.3776 0.4784 0.4470 0.0179  0.0165  -0.0227 52   ASN A C   
385  O O   . ASN A 52  ? 0.3772 0.4712 0.4484 0.0213  0.0176  -0.0234 52   ASN A O   
386  C CB  . ASN A 52  ? 0.3902 0.5080 0.4666 0.0249  0.0181  -0.0274 52   ASN A CB  
387  C CG  . ASN A 52  ? 0.4037 0.5370 0.4828 0.0244  0.0192  -0.0317 52   ASN A CG  
388  O OD1 . ASN A 52  ? 0.4489 0.5840 0.5264 0.0200  0.0209  -0.0353 52   ASN A OD1 
389  N ND2 . ASN A 52  ? 0.4036 0.5500 0.4864 0.0289  0.0183  -0.0316 52   ASN A ND2 
390  N N   . ASN A 53  ? 0.3740 0.4719 0.4392 0.0141  0.0156  -0.0202 53   ASN A N   
391  C CA  . ASN A 53  ? 0.3696 0.4601 0.4332 0.0133  0.0149  -0.0186 53   ASN A CA  
392  C C   . ASN A 53  ? 0.3737 0.4635 0.4374 0.0121  0.0162  -0.0230 53   ASN A C   
393  O O   . ASN A 53  ? 0.3740 0.4693 0.4357 0.0104  0.0169  -0.0254 53   ASN A O   
394  C CB  . ASN A 53  ? 0.3659 0.4557 0.4243 0.0108  0.0140  -0.0155 53   ASN A CB  
395  C CG  . ASN A 53  ? 0.3589 0.4453 0.4163 0.0104  0.0130  -0.0143 53   ASN A CG  
396  O OD1 . ASN A 53  ? 0.3590 0.4484 0.4145 0.0094  0.0131  -0.0164 53   ASN A OD1 
397  N ND2 . ASN A 53  ? 0.3063 0.3888 0.3648 0.0109  0.0120  -0.0113 53   ASN A ND2 
398  N N   . PRO A 54  ? 0.3798 0.4629 0.4451 0.0121  0.0174  -0.0246 54   PRO A N   
399  C CA  . PRO A 54  ? 0.3847 0.4677 0.4502 0.0094  0.0199  -0.0307 54   PRO A CA  
400  C C   . PRO A 54  ? 0.3810 0.4726 0.4436 0.0054  0.0187  -0.0326 54   PRO A C   
401  O O   . PRO A 54  ? 0.3829 0.4798 0.4452 0.0027  0.0202  -0.0382 54   PRO A O   
402  C CB  . PRO A 54  ? 0.3960 0.4669 0.4623 0.0093  0.0230  -0.0317 54   PRO A CB  
403  C CG  . PRO A 54  ? 0.3926 0.4605 0.4582 0.0104  0.0208  -0.0257 54   PRO A CG  
404  C CD  . PRO A 54  ? 0.3815 0.4562 0.4474 0.0137  0.0176  -0.0214 54   PRO A CD  
405  N N   . ASN A 55  ? 0.3796 0.4735 0.4396 0.0056  0.0161  -0.0281 55   ASN A N   
406  C CA  . ASN A 55  ? 0.3733 0.4771 0.4294 0.0046  0.0147  -0.0285 55   ASN A CA  
407  C C   . ASN A 55  ? 0.3683 0.4758 0.4186 0.0074  0.0140  -0.0246 55   ASN A C   
408  O O   . ASN A 55  ? 0.3694 0.4829 0.4143 0.0095  0.0129  -0.0221 55   ASN A O   
409  C CB  . ASN A 55  ? 0.3694 0.4731 0.4253 0.0042  0.0134  -0.0260 55   ASN A CB  
410  C CG  . ASN A 55  ? 0.3672 0.4648 0.4270 0.0003  0.0155  -0.0298 55   ASN A CG  
411  O OD1 . ASN A 55  ? 0.3630 0.4502 0.4241 0.0013  0.0160  -0.0264 55   ASN A OD1 
412  N ND2 . ASN A 55  ? 0.3714 0.4750 0.4321 -0.0045 0.0177  -0.0371 55   ASN A ND2 
413  N N   . GLY A 56  ? 0.3628 0.4668 0.4133 0.0079  0.0152  -0.0241 56   GLY A N   
414  C CA  . GLY A 56  ? 0.3611 0.4670 0.4051 0.0087  0.0164  -0.0220 56   GLY A CA  
415  C C   . GLY A 56  ? 0.3568 0.4560 0.3946 0.0099  0.0173  -0.0161 56   GLY A C   
416  O O   . GLY A 56  ? 0.3654 0.4627 0.3954 0.0101  0.0199  -0.0140 56   GLY A O   
417  N N   . PHE A 57  ? 0.3504 0.4448 0.3907 0.0101  0.0161  -0.0136 57   PHE A N   
418  C CA  . PHE A 57  ? 0.3506 0.4378 0.3850 0.0103  0.0177  -0.0090 57   PHE A CA  
419  C C   . PHE A 57  ? 0.3532 0.4384 0.3886 0.0067  0.0202  -0.0103 57   PHE A C   
420  O O   . PHE A 57  ? 0.3376 0.4271 0.3809 0.0060  0.0187  -0.0130 57   PHE A O   
421  C CB  . PHE A 57  ? 0.3455 0.4300 0.3821 0.0114  0.0157  -0.0066 57   PHE A CB  
422  C CG  . PHE A 57  ? 0.3442 0.4318 0.3767 0.0151  0.0147  -0.0046 57   PHE A CG  
423  C CD1 . PHE A 57  ? 0.3313 0.4279 0.3685 0.0151  0.0123  -0.0080 57   PHE A CD1 
424  C CD2 . PHE A 57  ? 0.3419 0.4239 0.3650 0.0187  0.0168  0.0001  57   PHE A CD2 
425  C CE1 . PHE A 57  ? 0.3341 0.4388 0.3681 0.0184  0.0111  -0.0071 57   PHE A CE1 
426  C CE2 . PHE A 57  ? 0.3325 0.4204 0.3517 0.0241  0.0157  0.0023  57   PHE A CE2 
427  C CZ  . PHE A 57  ? 0.3388 0.4404 0.3640 0.0239  0.0123  -0.0015 57   PHE A CZ  
428  N N   . PRO A 58  ? 0.3711 0.4502 0.3975 0.0047  0.0246  -0.0086 58   PRO A N   
429  C CA  . PRO A 58  ? 0.3760 0.4555 0.4027 -0.0008 0.0279  -0.0112 58   PRO A CA  
430  C C   . PRO A 58  ? 0.3753 0.4567 0.4076 -0.0025 0.0264  -0.0116 58   PRO A C   
431  O O   . PRO A 58  ? 0.3703 0.4473 0.4025 -0.0001 0.0246  -0.0084 58   PRO A O   
432  C CB  . PRO A 58  ? 0.3881 0.4558 0.4011 -0.0032 0.0345  -0.0087 58   PRO A CB  
433  C CG  . PRO A 58  ? 0.3928 0.4576 0.3990 0.0027  0.0341  -0.0050 58   PRO A CG  
434  C CD  . PRO A 58  ? 0.3848 0.4566 0.3991 0.0075  0.0277  -0.0044 58   PRO A CD  
435  N N   . GLU A 59  ? 0.3789 0.4694 0.4160 -0.0063 0.0273  -0.0157 59   GLU A N   
436  C CA  . GLU A 59  ? 0.3780 0.4746 0.4200 -0.0077 0.0259  -0.0165 59   GLU A CA  
437  C C   . GLU A 59  ? 0.3770 0.4635 0.4110 -0.0119 0.0298  -0.0148 59   GLU A C   
438  O O   . GLU A 59  ? 0.3875 0.4659 0.4124 -0.0172 0.0361  -0.0159 59   GLU A O   
439  C CB  . GLU A 59  ? 0.3807 0.4930 0.4280 -0.0111 0.0269  -0.0221 59   GLU A CB  
440  C CG  . GLU A 59  ? 0.4067 0.5313 0.4606 -0.0098 0.0239  -0.0228 59   GLU A CG  
441  C CD  . GLU A 59  ? 0.4222 0.5667 0.4801 -0.0142 0.0257  -0.0292 59   GLU A CD  
442  O OE1 . GLU A 59  ? 0.4609 0.6098 0.5175 -0.0183 0.0291  -0.0335 59   GLU A OE1 
443  O OE2 . GLU A 59  ? 0.4363 0.5942 0.4983 -0.0136 0.0237  -0.0303 59   GLU A OE2 
444  N N   . GLY A 60  ? 0.3678 0.4530 0.4042 -0.0096 0.0269  -0.0122 60   GLY A N   
445  C CA  . GLY A 60  ? 0.3732 0.4491 0.4027 -0.0132 0.0306  -0.0110 60   GLY A CA  
446  C C   . GLY A 60  ? 0.3786 0.4387 0.3993 -0.0093 0.0325  -0.0061 60   GLY A C   
447  O O   . GLY A 60  ? 0.3888 0.4396 0.4036 -0.0104 0.0356  -0.0045 60   GLY A O   
448  N N   . PHE A 61  ? 0.3724 0.4308 0.3919 -0.0042 0.0309  -0.0039 61   PHE A N   
449  C CA  . PHE A 61  ? 0.3778 0.4264 0.3894 0.0015  0.0318  0.0009  61   PHE A CA  
450  C C   . PHE A 61  ? 0.3683 0.4199 0.3851 0.0056  0.0270  0.0031  61   PHE A C   
451  O O   . PHE A 61  ? 0.3566 0.4175 0.3832 0.0060  0.0219  0.0017  61   PHE A O   
452  C CB  . PHE A 61  ? 0.3840 0.4355 0.3937 0.0058  0.0306  0.0018  61   PHE A CB  
453  C CG  . PHE A 61  ? 0.4135 0.4541 0.4099 0.0055  0.0375  0.0035  61   PHE A CG  
454  C CD1 . PHE A 61  ? 0.4134 0.4473 0.4048 -0.0023 0.0440  0.0006  61   PHE A CD1 
455  C CD2 . PHE A 61  ? 0.4323 0.4705 0.4206 0.0128  0.0380  0.0077  61   PHE A CD2 
456  C CE1 . PHE A 61  ? 0.4274 0.4482 0.4047 -0.0034 0.0519  0.0023  61   PHE A CE1 
457  C CE2 . PHE A 61  ? 0.4587 0.4850 0.4327 0.0137  0.0450  0.0104  61   PHE A CE2 
458  C CZ  . PHE A 61  ? 0.4558 0.4713 0.4237 0.0052  0.0525  0.0079  61   PHE A CZ  
459  N N   . TRP A 62  ? 0.3734 0.4160 0.3827 0.0088  0.0296  0.0065  62   TRP A N   
460  C CA  . TRP A 62  ? 0.3620 0.4082 0.3754 0.0126  0.0257  0.0084  62   TRP A CA  
461  C C   . TRP A 62  ? 0.3518 0.4085 0.3702 0.0170  0.0208  0.0084  62   TRP A C   
462  O O   . TRP A 62  ? 0.3624 0.4203 0.3760 0.0205  0.0216  0.0092  62   TRP A O   
463  C CB  . TRP A 62  ? 0.3741 0.4090 0.3770 0.0168  0.0302  0.0121  62   TRP A CB  
464  C CG  . TRP A 62  ? 0.3755 0.4157 0.3824 0.0206  0.0267  0.0135  62   TRP A CG  
465  C CD1 . TRP A 62  ? 0.3855 0.4307 0.4003 0.0169  0.0236  0.0119  62   TRP A CD1 
466  C CD2 . TRP A 62  ? 0.3824 0.4250 0.3849 0.0293  0.0262  0.0168  62   TRP A CD2 
467  N NE1 . TRP A 62  ? 0.3835 0.4330 0.3995 0.0214  0.0216  0.0135  62   TRP A NE1 
468  C CE2 . TRP A 62  ? 0.3718 0.4213 0.3808 0.0291  0.0229  0.0161  62   TRP A CE2 
469  C CE3 . TRP A 62  ? 0.3986 0.4402 0.3918 0.0379  0.0283  0.0203  62   TRP A CE3 
470  C CZ2 . TRP A 62  ? 0.3723 0.4292 0.3800 0.0365  0.0216  0.0179  62   TRP A CZ2 
471  C CZ3 . TRP A 62  ? 0.3842 0.4342 0.3757 0.0467  0.0266  0.0227  62   TRP A CZ3 
472  C CH2 . TRP A 62  ? 0.3663 0.4247 0.3656 0.0455  0.0232  0.0210  62   TRP A CH2 
473  N N   . MET A 63  ? 0.3379 0.4021 0.3652 0.0161  0.0165  0.0069  63   MET A N   
474  C CA  . MET A 63  ? 0.3310 0.4051 0.3630 0.0179  0.0131  0.0052  63   MET A CA  
475  C C   . MET A 63  ? 0.3314 0.4103 0.3602 0.0229  0.0125  0.0071  63   MET A C   
476  O O   . MET A 63  ? 0.3277 0.4066 0.3586 0.0225  0.0118  0.0077  63   MET A O   
477  C CB  . MET A 63  ? 0.3274 0.4044 0.3685 0.0141  0.0105  0.0027  63   MET A CB  
478  C CG  . MET A 63  ? 0.3491 0.4242 0.3936 0.0115  0.0108  0.0011  63   MET A CG  
479  S SD  . MET A 63  ? 0.3573 0.4363 0.4024 0.0116  0.0113  -0.0021 63   MET A SD  
480  C CE  . MET A 63  ? 0.3172 0.4028 0.3659 0.0114  0.0097  -0.0053 63   MET A CE  
481  N N   . PRO A 64  ? 0.3314 0.4161 0.3546 0.0284  0.0129  0.0081  64   PRO A N   
482  C CA  . PRO A 64  ? 0.3378 0.4295 0.3567 0.0355  0.0127  0.0104  64   PRO A CA  
483  C C   . PRO A 64  ? 0.3305 0.4419 0.3562 0.0350  0.0089  0.0059  64   PRO A C   
484  O O   . PRO A 64  ? 0.3200 0.4370 0.3525 0.0290  0.0073  0.0010  64   PRO A O   
485  C CB  . PRO A 64  ? 0.3526 0.4403 0.3597 0.0431  0.0159  0.0145  64   PRO A CB  
486  C CG  . PRO A 64  ? 0.3399 0.4290 0.3490 0.0387  0.0155  0.0117  64   PRO A CG  
487  C CD  . PRO A 64  ? 0.3270 0.4141 0.3470 0.0294  0.0136  0.0073  64   PRO A CD  
488  N N   . TYR A 65  ? 0.3327 0.4548 0.3564 0.0411  0.0082  0.0071  65   TYR A N   
489  C CA  . TYR A 65  ? 0.3289 0.4742 0.3584 0.0404  0.0053  0.0018  65   TYR A CA  
490  C C   . TYR A 65  ? 0.3209 0.4683 0.3606 0.0295  0.0043  -0.0041 65   TYR A C   
491  O O   . TYR A 65  ? 0.3178 0.4830 0.3625 0.0255  0.0032  -0.0104 65   TYR A O   
492  C CB  . TYR A 65  ? 0.3313 0.4921 0.3592 0.0426  0.0041  -0.0009 65   TYR A CB  
493  C CG  . TYR A 65  ? 0.3219 0.4828 0.3377 0.0550  0.0055  0.0055  65   TYR A CG  
494  C CD1 . TYR A 65  ? 0.3206 0.5008 0.3316 0.0659  0.0045  0.0073  65   TYR A CD1 
495  C CD2 . TYR A 65  ? 0.3252 0.4675 0.3335 0.0563  0.0085  0.0099  65   TYR A CD2 
496  C CE1 . TYR A 65  ? 0.3342 0.5123 0.3317 0.0794  0.0067  0.0147  65   TYR A CE1 
497  C CE2 . TYR A 65  ? 0.3447 0.4835 0.3397 0.0676  0.0113  0.0165  65   TYR A CE2 
498  C CZ  . TYR A 65  ? 0.3409 0.4963 0.3297 0.0798  0.0106  0.0195  65   TYR A CZ  
499  O OH  . TYR A 65  ? 0.3319 0.4812 0.3051 0.0929  0.0142  0.0274  65   TYR A OH  
500  N N   . LEU A 66  ? 0.3210 0.4510 0.3627 0.0247  0.0053  -0.0023 66   LEU A N   
501  C CA  . LEU A 66  ? 0.3223 0.4508 0.3710 0.0162  0.0054  -0.0061 66   LEU A CA  
502  C C   . LEU A 66  ? 0.3296 0.4675 0.3797 0.0164  0.0052  -0.0069 66   LEU A C   
503  O O   . LEU A 66  ? 0.3311 0.4684 0.3769 0.0232  0.0052  -0.0026 66   LEU A O   
504  C CB  . LEU A 66  ? 0.3193 0.4289 0.3687 0.0131  0.0064  -0.0031 66   LEU A CB  
505  C CG  . LEU A 66  ? 0.3226 0.4238 0.3716 0.0124  0.0069  -0.0028 66   LEU A CG  
506  C CD1 . LEU A 66  ? 0.3173 0.4056 0.3675 0.0104  0.0075  -0.0001 66   LEU A CD1 
507  C CD2 . LEU A 66  ? 0.3043 0.4110 0.3571 0.0080  0.0073  -0.0085 66   LEU A CD2 
508  N N   . THR A 67  ? 0.3384 0.4840 0.3938 0.0085  0.0058  -0.0128 67   THR A N   
509  C CA  . THR A 67  ? 0.3466 0.5020 0.4041 0.0066  0.0062  -0.0146 67   THR A CA  
510  C C   . THR A 67  ? 0.3573 0.4956 0.4160 0.0007  0.0079  -0.0127 67   THR A C   
511  O O   . THR A 67  ? 0.3650 0.4950 0.4255 -0.0068 0.0102  -0.0155 67   THR A O   
512  C CB  . THR A 67  ? 0.3472 0.5246 0.4089 0.0001  0.0069  -0.0237 67   THR A CB  
513  O OG1 . THR A 67  ? 0.3340 0.5309 0.3943 0.0065  0.0048  -0.0255 67   THR A OG1 
514  C CG2 . THR A 67  ? 0.3541 0.5441 0.4181 -0.0021 0.0076  -0.0262 67   THR A CG2 
515  N N   . ILE A 68  ? 0.3657 0.4979 0.4221 0.0047  0.0075  -0.0077 68   ILE A N   
516  C CA  . ILE A 68  ? 0.3736 0.4911 0.4300 0.0006  0.0087  -0.0049 68   ILE A CA  
517  C C   . ILE A 68  ? 0.3798 0.5044 0.4372 -0.0017 0.0096  -0.0060 68   ILE A C   
518  O O   . ILE A 68  ? 0.3796 0.5118 0.4356 0.0040  0.0088  -0.0046 68   ILE A O   
519  C CB  . ILE A 68  ? 0.3753 0.4796 0.4281 0.0054  0.0081  0.0010  68   ILE A CB  
520  C CG1 . ILE A 68  ? 0.3841 0.4827 0.4358 0.0074  0.0076  0.0018  68   ILE A CG1 
521  C CG2 . ILE A 68  ? 0.3833 0.4766 0.4361 0.0016  0.0089  0.0036  68   ILE A CG2 
522  C CD1 . ILE A 68  ? 0.4047 0.4925 0.4528 0.0102  0.0079  0.0059  68   ILE A CD1 
523  N N   . ALA A 69  ? 0.3932 0.5139 0.4522 -0.0101 0.0121  -0.0085 69   ALA A N   
524  C CA  . ALA A 69  ? 0.4019 0.5257 0.4610 -0.0139 0.0137  -0.0090 69   ALA A CA  
525  C C   . ALA A 69  ? 0.4106 0.5160 0.4667 -0.0155 0.0149  -0.0036 69   ALA A C   
526  O O   . ALA A 69  ? 0.4141 0.5064 0.4687 -0.0161 0.0156  -0.0015 69   ALA A O   
527  C CB  . ALA A 69  ? 0.4008 0.5350 0.4624 -0.0233 0.0171  -0.0166 69   ALA A CB  
528  N N   . TYR A 70  ? 0.4163 0.5221 0.4711 -0.0154 0.0150  -0.0015 70   TYR A N   
529  C CA  . TYR A 70  ? 0.4243 0.5165 0.4758 -0.0164 0.0159  0.0036  70   TYR A CA  
530  C C   . TYR A 70  ? 0.4405 0.5321 0.4902 -0.0230 0.0192  0.0028  70   TYR A C   
531  O O   . TYR A 70  ? 0.4451 0.5492 0.4971 -0.0268 0.0206  -0.0020 70   TYR A O   
532  C CB  . TYR A 70  ? 0.4130 0.5038 0.4629 -0.0104 0.0134  0.0075  70   TYR A CB  
533  C CG  . TYR A 70  ? 0.4045 0.5043 0.4545 -0.0088 0.0135  0.0064  70   TYR A CG  
534  C CD1 . TYR A 70  ? 0.3982 0.4980 0.4467 -0.0124 0.0149  0.0073  70   TYR A CD1 
535  C CD2 . TYR A 70  ? 0.3996 0.5071 0.4499 -0.0028 0.0126  0.0050  70   TYR A CD2 
536  C CE1 . TYR A 70  ? 0.4039 0.5122 0.4525 -0.0107 0.0154  0.0058  70   TYR A CE1 
537  C CE2 . TYR A 70  ? 0.3965 0.5113 0.4461 0.0002  0.0134  0.0042  70   TYR A CE2 
538  C CZ  . TYR A 70  ? 0.3987 0.5141 0.4479 -0.0040 0.0147  0.0042  70   TYR A CZ  
539  O OH  . TYR A 70  ? 0.4473 0.5700 0.4958 -0.0007 0.0159  0.0030  70   TYR A OH  
540  N N   . GLU A 71  ? 0.4501 0.5285 0.4953 -0.0238 0.0207  0.0078  71   GLU A N   
541  C CA  . GLU A 71  ? 0.4610 0.5358 0.5023 -0.0293 0.0244  0.0088  71   GLU A CA  
542  C C   . GLU A 71  ? 0.4578 0.5265 0.4949 -0.0251 0.0229  0.0156  71   GLU A C   
543  O O   . GLU A 71  ? 0.4624 0.5214 0.4963 -0.0212 0.0225  0.0202  71   GLU A O   
544  C CB  . GLU A 71  ? 0.4788 0.5408 0.5159 -0.0360 0.0304  0.0076  71   GLU A CB  
545  C CG  . GLU A 71  ? 0.5040 0.5626 0.5364 -0.0440 0.0361  0.0068  71   GLU A CG  
546  C CD  . GLU A 71  ? 0.5422 0.5825 0.5677 -0.0510 0.0442  0.0060  71   GLU A CD  
547  O OE1 . GLU A 71  ? 0.5817 0.6035 0.6006 -0.0460 0.0459  0.0126  71   GLU A OE1 
548  O OE2 . GLU A 71  ? 0.5412 0.5858 0.5673 -0.0614 0.0495  -0.0015 71   GLU A OE2 
549  N N   . LEU A 72  ? 0.4526 0.5292 0.4896 -0.0257 0.0222  0.0155  72   LEU A N   
550  C CA  . LEU A 72  ? 0.4505 0.5258 0.4839 -0.0227 0.0207  0.0205  72   LEU A CA  
551  C C   . LEU A 72  ? 0.4634 0.5345 0.4909 -0.0271 0.0244  0.0231  72   LEU A C   
552  O O   . LEU A 72  ? 0.4560 0.5341 0.4843 -0.0318 0.0262  0.0198  72   LEU A O   
553  C CB  . LEU A 72  ? 0.4394 0.5251 0.4758 -0.0201 0.0181  0.0181  72   LEU A CB  
554  C CG  . LEU A 72  ? 0.4261 0.5133 0.4597 -0.0180 0.0167  0.0209  72   LEU A CG  
555  C CD1 . LEU A 72  ? 0.4353 0.5189 0.4683 -0.0140 0.0145  0.0236  72   LEU A CD1 
556  C CD2 . LEU A 72  ? 0.4185 0.5127 0.4539 -0.0171 0.0165  0.0172  72   LEU A CD2 
557  N N   . LYS A 73  ? 0.4797 0.5396 0.5003 -0.0248 0.0259  0.0294  73   LYS A N   
558  C CA  . LYS A 73  ? 0.5009 0.5535 0.5131 -0.0279 0.0304  0.0335  73   LYS A CA  
559  C C   . LYS A 73  ? 0.5026 0.5601 0.5104 -0.0229 0.0278  0.0391  73   LYS A C   
560  O O   . LYS A 73  ? 0.4944 0.5523 0.5010 -0.0160 0.0248  0.0430  73   LYS A O   
561  C CB  . LYS A 73  ? 0.5233 0.5566 0.5281 -0.0282 0.0359  0.0372  73   LYS A CB  
562  C CG  . LYS A 73  ? 0.5714 0.5922 0.5647 -0.0313 0.0425  0.0422  73   LYS A CG  
563  C CD  . LYS A 73  ? 0.6336 0.6315 0.6188 -0.0340 0.0507  0.0437  73   LYS A CD  
564  C CE  . LYS A 73  ? 0.6693 0.6508 0.6404 -0.0373 0.0591  0.0493  73   LYS A CE  
565  N NZ  . LYS A 73  ? 0.7094 0.6645 0.6707 -0.0417 0.0695  0.0497  73   LYS A NZ  
566  N N   . ASN A 74  ? 0.5079 0.5717 0.5134 -0.0268 0.0290  0.0388  74   ASN A N   
567  C CA  . ASN A 74  ? 0.5126 0.5816 0.5118 -0.0234 0.0277  0.0441  74   ASN A CA  
568  C C   . ASN A 74  ? 0.5352 0.5894 0.5223 -0.0218 0.0328  0.0522  74   ASN A C   
569  O O   . ASN A 74  ? 0.5487 0.5942 0.5309 -0.0284 0.0385  0.0519  74   ASN A O   
570  C CB  . ASN A 74  ? 0.5076 0.5891 0.5089 -0.0285 0.0275  0.0400  74   ASN A CB  
571  C CG  . ASN A 74  ? 0.5078 0.5980 0.5032 -0.0259 0.0260  0.0441  74   ASN A CG  
572  O OD1 . ASN A 74  ? 0.5259 0.6101 0.5117 -0.0225 0.0279  0.0516  74   ASN A OD1 
573  N ND2 . ASN A 74  ? 0.4970 0.6011 0.4969 -0.0272 0.0234  0.0391  74   ASN A ND2 
574  N N   . THR A 75  ? 0.5454 0.5967 0.5266 -0.0127 0.0314  0.0593  75   THR A N   
575  C CA  . THR A 75  ? 0.5698 0.6036 0.5371 -0.0080 0.0370  0.0686  75   THR A CA  
576  C C   . THR A 75  ? 0.5833 0.6186 0.5407 -0.0098 0.0400  0.0733  75   THR A C   
577  O O   . THR A 75  ? 0.6052 0.6216 0.5501 -0.0103 0.0474  0.0792  75   THR A O   
578  C CB  . THR A 75  ? 0.5748 0.6085 0.5379 0.0050  0.0344  0.0757  75   THR A CB  
579  O OG1 . THR A 75  ? 0.5578 0.6147 0.5227 0.0099  0.0281  0.0766  75   THR A OG1 
580  C CG2 . THR A 75  ? 0.5585 0.5894 0.5304 0.0065  0.0322  0.0713  75   THR A CG2 
581  N N   . ASP A 76  ? 0.5744 0.6308 0.5364 -0.0113 0.0351  0.0702  76   ASP A N   
582  C CA  . ASP A 76  ? 0.5920 0.6533 0.5454 -0.0131 0.0372  0.0739  76   ASP A CA  
583  C C   . ASP A 76  ? 0.5952 0.6507 0.5492 -0.0250 0.0426  0.0688  76   ASP A C   
584  O O   . ASP A 76  ? 0.6196 0.6595 0.5620 -0.0278 0.0498  0.0737  76   ASP A O   
585  C CB  . ASP A 76  ? 0.5820 0.6692 0.5403 -0.0117 0.0308  0.0709  76   ASP A CB  
586  C CG  . ASP A 76  ? 0.6034 0.7021 0.5611 -0.0011 0.0257  0.0748  76   ASP A CG  
587  O OD1 . ASP A 76  ? 0.6262 0.7146 0.5742 0.0083  0.0276  0.0839  76   ASP A OD1 
588  O OD2 . ASP A 76  ? 0.5986 0.7167 0.5649 -0.0022 0.0205  0.0683  76   ASP A OD2 
589  N N   . THR A 77  ? 0.5705 0.6384 0.5373 -0.0316 0.0396  0.0589  77   THR A N   
590  C CA  . THR A 77  ? 0.5634 0.6326 0.5325 -0.0420 0.0437  0.0527  77   THR A CA  
591  C C   . THR A 77  ? 0.5658 0.6200 0.5352 -0.0484 0.0496  0.0497  77   THR A C   
592  O O   . THR A 77  ? 0.5754 0.6287 0.5434 -0.0577 0.0550  0.0457  77   THR A O   
593  C CB  . THR A 77  ? 0.5436 0.6319 0.5254 -0.0447 0.0391  0.0433  77   THR A CB  
594  O OG1 . THR A 77  ? 0.5378 0.6268 0.5293 -0.0421 0.0357  0.0388  77   THR A OG1 
595  C CG2 . THR A 77  ? 0.5309 0.6339 0.5118 -0.0412 0.0350  0.0442  77   THR A CG2 
596  N N   . GLY A 78  ? 0.5581 0.6025 0.5296 -0.0442 0.0488  0.0506  78   GLY A N   
597  C CA  . GLY A 78  ? 0.5579 0.5883 0.5293 -0.0507 0.0547  0.0468  78   GLY A CA  
598  C C   . GLY A 78  ? 0.5313 0.5757 0.5168 -0.0560 0.0520  0.0360  78   GLY A C   
599  O O   . GLY A 78  ? 0.5302 0.5678 0.5172 -0.0617 0.0562  0.0313  78   GLY A O   
600  N N   . ALA A 79  ? 0.5076 0.5714 0.5022 -0.0536 0.0457  0.0319  79   ALA A N   
601  C CA  . ALA A 79  ? 0.4909 0.5693 0.4972 -0.0560 0.0433  0.0228  79   ALA A CA  
602  C C   . ALA A 79  ? 0.4868 0.5622 0.4987 -0.0515 0.0402  0.0214  79   ALA A C   
603  O O   . ALA A 79  ? 0.4871 0.5564 0.4976 -0.0441 0.0368  0.0266  79   ALA A O   
604  C CB  . ALA A 79  ? 0.4732 0.5685 0.4852 -0.0527 0.0386  0.0201  79   ALA A CB  
605  N N   . ILE A 80  ? 0.4849 0.5669 0.5030 -0.0562 0.0416  0.0141  80   ILE A N   
606  C CA  . ILE A 80  ? 0.4813 0.5623 0.5047 -0.0529 0.0392  0.0117  80   ILE A CA  
607  C C   . ILE A 80  ? 0.4720 0.5733 0.5051 -0.0521 0.0361  0.0040  80   ILE A C   
608  O O   . ILE A 80  ? 0.4770 0.5915 0.5127 -0.0581 0.0386  -0.0019 80   ILE A O   
609  C CB  . ILE A 80  ? 0.4950 0.5618 0.5140 -0.0598 0.0456  0.0103  80   ILE A CB  
610  C CG1 . ILE A 80  ? 0.5185 0.5620 0.5256 -0.0579 0.0496  0.0192  80   ILE A CG1 
611  C CG2 . ILE A 80  ? 0.4884 0.5572 0.5134 -0.0571 0.0431  0.0067  80   ILE A CG2 
612  C CD1 . ILE A 80  ? 0.5460 0.5701 0.5460 -0.0648 0.0583  0.0181  80   ILE A CD1 
613  N N   . LYS A 81  ? 0.4620 0.5664 0.4997 -0.0442 0.0310  0.0044  81   LYS A N   
614  C CA  . LYS A 81  ? 0.4547 0.5763 0.4997 -0.0409 0.0284  -0.0014 81   LYS A CA  
615  C C   . LYS A 81  ? 0.4545 0.5737 0.5021 -0.0373 0.0263  -0.0021 81   LYS A C   
616  O O   . LYS A 81  ? 0.4570 0.5616 0.5017 -0.0351 0.0255  0.0024  81   LYS A O   
617  C CB  . LYS A 81  ? 0.4448 0.5737 0.4911 -0.0333 0.0253  -0.0004 81   LYS A CB  
618  C CG  . LYS A 81  ? 0.4427 0.5600 0.4864 -0.0270 0.0224  0.0050  81   LYS A CG  
619  C CD  . LYS A 81  ? 0.4323 0.5553 0.4773 -0.0196 0.0209  0.0039  81   LYS A CD  
620  C CE  . LYS A 81  ? 0.4180 0.5478 0.4620 -0.0204 0.0226  0.0024  81   LYS A CE  
621  N NZ  . LYS A 81  ? 0.3794 0.5125 0.4233 -0.0124 0.0228  0.0008  81   LYS A NZ  
622  N N   . ARG A 82  ? 0.4525 0.5882 0.5054 -0.0363 0.0254  -0.0082 82   ARG A N   
623  C CA  . ARG A 82  ? 0.4525 0.5893 0.5078 -0.0331 0.0235  -0.0097 82   ARG A CA  
624  C C   . ARG A 82  ? 0.4376 0.5896 0.4963 -0.0234 0.0198  -0.0110 82   ARG A C   
625  O O   . ARG A 82  ? 0.4377 0.6039 0.4979 -0.0203 0.0197  -0.0131 82   ARG A O   
626  C CB  . ARG A 82  ? 0.4681 0.6107 0.5250 -0.0427 0.0273  -0.0166 82   ARG A CB  
627  C CG  . ARG A 82  ? 0.5172 0.6387 0.5683 -0.0512 0.0326  -0.0145 82   ARG A CG  
628  C CD  . ARG A 82  ? 0.5665 0.6916 0.6179 -0.0629 0.0386  -0.0229 82   ARG A CD  
629  N NE  . ARG A 82  ? 0.6210 0.7220 0.6640 -0.0708 0.0458  -0.0203 82   ARG A NE  
630  C CZ  . ARG A 82  ? 0.6633 0.7588 0.7012 -0.0770 0.0505  -0.0191 82   ARG A CZ  
631  N NH1 . ARG A 82  ? 0.6510 0.7651 0.6926 -0.0770 0.0485  -0.0212 82   ARG A NH1 
632  N NH2 . ARG A 82  ? 0.7103 0.7807 0.7384 -0.0824 0.0578  -0.0154 82   ARG A NH2 
633  N N   . GLY A 83  ? 0.4291 0.5770 0.4878 -0.0178 0.0174  -0.0094 83   GLY A N   
634  C CA  . GLY A 83  ? 0.4181 0.5770 0.4775 -0.0075 0.0149  -0.0095 83   GLY A CA  
635  C C   . GLY A 83  ? 0.4126 0.5664 0.4716 -0.0046 0.0132  -0.0085 83   GLY A C   
636  O O   . GLY A 83  ? 0.4122 0.5592 0.4722 -0.0114 0.0141  -0.0099 83   GLY A O   
637  N N   . THR A 84  ? 0.4092 0.5650 0.4660 0.0057  0.0115  -0.0061 84   THR A N   
638  C CA  . THR A 84  ? 0.4021 0.5528 0.4575 0.0091  0.0101  -0.0047 84   THR A CA  
639  C C   . THR A 84  ? 0.4046 0.5402 0.4542 0.0169  0.0103  0.0010  84   THR A C   
640  O O   . THR A 84  ? 0.4097 0.5436 0.4558 0.0225  0.0117  0.0031  84   THR A O   
641  C CB  . THR A 84  ? 0.4018 0.5744 0.4591 0.0136  0.0088  -0.0088 84   THR A CB  
642  O OG1 . THR A 84  ? 0.3933 0.5784 0.4483 0.0240  0.0087  -0.0078 84   THR A OG1 
643  C CG2 . THR A 84  ? 0.3914 0.5795 0.4544 0.0031  0.0098  -0.0167 84   THR A CG2 
644  N N   . LEU A 85  ? 0.4075 0.5315 0.4556 0.0163  0.0098  0.0030  85   LEU A N   
645  C CA  . LEU A 85  ? 0.4060 0.5161 0.4481 0.0218  0.0111  0.0072  85   LEU A CA  
646  C C   . LEU A 85  ? 0.4122 0.5277 0.4507 0.0300  0.0109  0.0079  85   LEU A C   
647  O O   . LEU A 85  ? 0.4145 0.5362 0.4557 0.0282  0.0092  0.0059  85   LEU A O   
648  C CB  . LEU A 85  ? 0.3987 0.4955 0.4413 0.0161  0.0108  0.0085  85   LEU A CB  
649  C CG  . LEU A 85  ? 0.3798 0.4723 0.4248 0.0093  0.0108  0.0088  85   LEU A CG  
650  C CD1 . LEU A 85  ? 0.3617 0.4450 0.4070 0.0064  0.0102  0.0103  85   LEU A CD1 
651  C CD2 . LEU A 85  ? 0.3770 0.4670 0.4190 0.0102  0.0126  0.0099  85   LEU A CD2 
652  N N   . MET A 86  ? 0.4239 0.5364 0.4552 0.0394  0.0134  0.0109  86   MET A N   
653  C CA  . MET A 86  ? 0.4331 0.5498 0.4583 0.0497  0.0141  0.0131  86   MET A CA  
654  C C   . MET A 86  ? 0.4262 0.5222 0.4434 0.0512  0.0174  0.0169  86   MET A C   
655  O O   . MET A 86  ? 0.4285 0.5076 0.4423 0.0476  0.0207  0.0181  86   MET A O   
656  C CB  . MET A 86  ? 0.4544 0.5793 0.4745 0.0615  0.0160  0.0149  86   MET A CB  
657  C CG  . MET A 86  ? 0.5029 0.6545 0.5310 0.0609  0.0128  0.0101  86   MET A CG  
658  S SD  . MET A 86  ? 0.6011 0.7814 0.6342 0.0619  0.0086  0.0055  86   MET A SD  
659  C CE  . MET A 86  ? 0.6026 0.7881 0.6238 0.0822  0.0103  0.0116  86   MET A CE  
660  N N   . PRO A 87  ? 0.4162 0.5147 0.4299 0.0557  0.0170  0.0181  87   PRO A N   
661  C CA  . PRO A 87  ? 0.4089 0.4881 0.4140 0.0566  0.0210  0.0214  87   PRO A CA  
662  C C   . PRO A 87  ? 0.4154 0.4774 0.4069 0.0657  0.0279  0.0262  87   PRO A C   
663  O O   . PRO A 87  ? 0.4188 0.4879 0.4051 0.0774  0.0290  0.0289  87   PRO A O   
664  C CB  . PRO A 87  ? 0.4088 0.4986 0.4132 0.0603  0.0187  0.0214  87   PRO A CB  
665  C CG  . PRO A 87  ? 0.4018 0.5162 0.4100 0.0665  0.0152  0.0196  87   PRO A CG  
666  C CD  . PRO A 87  ? 0.4132 0.5342 0.4305 0.0594  0.0132  0.0158  87   PRO A CD  
667  N N   . MET A 88  ? 0.4131 0.4534 0.3986 0.0602  0.0334  0.0268  88   MET A N   
668  C CA  . MET A 88  ? 0.4290 0.4474 0.3997 0.0666  0.0423  0.0306  88   MET A CA  
669  C C   . MET A 88  ? 0.4339 0.4313 0.3982 0.0576  0.0484  0.0295  88   MET A C   
670  O O   . MET A 88  ? 0.4203 0.4230 0.3934 0.0470  0.0447  0.0258  88   MET A O   
671  C CB  . MET A 88  ? 0.4297 0.4459 0.4010 0.0668  0.0442  0.0294  88   MET A CB  
672  C CG  . MET A 88  ? 0.4203 0.4354 0.4003 0.0525  0.0428  0.0245  88   MET A CG  
673  S SD  . MET A 88  ? 0.4019 0.4222 0.3857 0.0523  0.0428  0.0225  88   MET A SD  
674  C CE  . MET A 88  ? 0.3740 0.4239 0.3709 0.0548  0.0332  0.0214  88   MET A CE  
675  N N   . VAL A 89  ? 0.4561 0.4296 0.4045 0.0620  0.0585  0.0325  89   VAL A N   
676  C CA  . VAL A 89  ? 0.4668 0.4196 0.4073 0.0521  0.0664  0.0304  89   VAL A CA  
677  C C   . VAL A 89  ? 0.4899 0.4237 0.4230 0.0467  0.0754  0.0277  89   VAL A C   
678  O O   . VAL A 89  ? 0.4984 0.4243 0.4243 0.0558  0.0795  0.0304  89   VAL A O   
679  C CB  . VAL A 89  ? 0.4841 0.4211 0.4092 0.0594  0.0731  0.0355  89   VAL A CB  
680  C CG1 . VAL A 89  ? 0.5094 0.4282 0.4169 0.0748  0.0816  0.0422  89   VAL A CG1 
681  C CG2 . VAL A 89  ? 0.4777 0.3974 0.3968 0.0463  0.0807  0.0317  89   VAL A CG2 
682  N N   . ALA A 90  ? 0.4978 0.4266 0.4330 0.0317  0.0784  0.0216  90   ALA A N   
683  C CA  . ALA A 90  ? 0.5170 0.4288 0.4448 0.0232  0.0880  0.0169  90   ALA A CA  
684  C C   . ALA A 90  ? 0.5417 0.4351 0.4589 0.0123  0.0983  0.0131  90   ALA A C   
685  O O   . ALA A 90  ? 0.5398 0.4318 0.4542 0.0137  0.0981  0.0154  90   ALA A O   
686  C CB  . ALA A 90  ? 0.4966 0.4277 0.4394 0.0135  0.0811  0.0111  90   ALA A CB  
687  N N   . ASP A 91  ? 0.5653 0.4456 0.4766 0.0005  0.1077  0.0064  91   ASP A N   
688  C CA  . ASP A 91  ? 0.5964 0.4602 0.4972 -0.0125 0.1191  0.0007  91   ASP A CA  
689  C C   . ASP A 91  ? 0.5756 0.4636 0.4904 -0.0238 0.1114  -0.0046 91   ASP A C   
690  O O   . ASP A 91  ? 0.5870 0.4665 0.4949 -0.0323 0.1184  -0.0080 91   ASP A O   
691  C CB  . ASP A 91  ? 0.6249 0.4705 0.5157 -0.0241 0.1321  -0.0069 91   ASP A CB  
692  C CG  . ASP A 91  ? 0.6305 0.5017 0.5370 -0.0353 0.1250  -0.0149 91   ASP A CG  
693  O OD1 . ASP A 91  ? 0.6426 0.5400 0.5654 -0.0296 0.1107  -0.0121 91   ASP A OD1 
694  O OD2 . ASP A 91  ? 0.6878 0.5526 0.5892 -0.0501 0.1346  -0.0243 91   ASP A OD2 
695  N N   . ASP A 92  ? 0.5484 0.4656 0.4817 -0.0234 0.0977  -0.0053 92   ASP A N   
696  C CA  . ASP A 92  ? 0.5301 0.4711 0.4769 -0.0297 0.0892  -0.0085 92   ASP A CA  
697  C C   . ASP A 92  ? 0.5128 0.4640 0.4665 -0.0181 0.0793  -0.0015 92   ASP A C   
698  O O   . ASP A 92  ? 0.4943 0.4677 0.4620 -0.0191 0.0695  -0.0025 92   ASP A O   
699  C CB  . ASP A 92  ? 0.5125 0.4780 0.4734 -0.0371 0.0820  -0.0141 92   ASP A CB  
700  C CG  . ASP A 92  ? 0.5206 0.4966 0.4903 -0.0277 0.0727  -0.0091 92   ASP A CG  
701  O OD1 . ASP A 92  ? 0.5553 0.5214 0.5207 -0.0161 0.0721  -0.0025 92   ASP A OD1 
702  O OD2 . ASP A 92  ? 0.5178 0.5133 0.4981 -0.0318 0.0663  -0.0120 92   ASP A OD2 
703  N N   . GLY A 93  ? 0.5185 0.4537 0.4615 -0.0068 0.0827  0.0053  93   GLY A N   
704  C CA  . GLY A 93  ? 0.5003 0.4450 0.4475 0.0031  0.0751  0.0109  93   GLY A CA  
705  C C   . GLY A 93  ? 0.4746 0.4361 0.4325 0.0126  0.0647  0.0145  93   GLY A C   
706  O O   . GLY A 93  ? 0.4686 0.4334 0.4303 0.0126  0.0632  0.0137  93   GLY A O   
707  N N   . PRO A 94  ? 0.4543 0.4275 0.4172 0.0196  0.0579  0.0178  94   PRO A N   
708  C CA  . PRO A 94  ? 0.4374 0.4268 0.4090 0.0278  0.0494  0.0203  94   PRO A CA  
709  C C   . PRO A 94  ? 0.4144 0.4213 0.4016 0.0212  0.0414  0.0165  94   PRO A C   
710  O O   . PRO A 94  ? 0.4077 0.4195 0.4010 0.0128  0.0400  0.0128  94   PRO A O   
711  C CB  . PRO A 94  ? 0.4364 0.4331 0.4077 0.0341  0.0461  0.0230  94   PRO A CB  
712  C CG  . PRO A 94  ? 0.4387 0.4308 0.4090 0.0258  0.0488  0.0202  94   PRO A CG  
713  C CD  . PRO A 94  ? 0.4534 0.4267 0.4141 0.0186  0.0583  0.0180  94   PRO A CD  
714  N N   . HIS A 95  ? 0.4028 0.4194 0.3955 0.0258  0.0369  0.0177  95   HIS A N   
715  C CA  . HIS A 95  ? 0.3854 0.4166 0.3909 0.0210  0.0301  0.0152  95   HIS A CA  
716  C C   . HIS A 95  ? 0.3736 0.4162 0.3834 0.0271  0.0258  0.0166  95   HIS A C   
717  O O   . HIS A 95  ? 0.3781 0.4205 0.3818 0.0357  0.0275  0.0192  95   HIS A O   
718  C CB  . HIS A 95  ? 0.3852 0.4132 0.3917 0.0135  0.0321  0.0126  95   HIS A CB  
719  C CG  . HIS A 95  ? 0.3948 0.4134 0.3940 0.0162  0.0372  0.0133  95   HIS A CG  
720  N ND1 . HIS A 95  ? 0.4230 0.4235 0.4100 0.0161  0.0461  0.0133  95   HIS A ND1 
721  C CD2 . HIS A 95  ? 0.3823 0.4060 0.3841 0.0188  0.0355  0.0139  95   HIS A CD2 
722  C CE1 . HIS A 95  ? 0.4056 0.3998 0.3878 0.0194  0.0497  0.0139  95   HIS A CE1 
723  N NE2 . HIS A 95  ? 0.3887 0.3982 0.3803 0.0212  0.0429  0.0142  95   HIS A NE2 
724  N N   . TYR A 96  ? 0.3652 0.4186 0.3847 0.0227  0.0209  0.0147  96   TYR A N   
725  C CA  . TYR A 96  ? 0.3616 0.4264 0.3856 0.0254  0.0179  0.0144  96   TYR A CA  
726  C C   . TYR A 96  ? 0.3650 0.4277 0.3898 0.0220  0.0189  0.0140  96   TYR A C   
727  O O   . TYR A 96  ? 0.3658 0.4267 0.3937 0.0155  0.0182  0.0129  96   TYR A O   
728  C CB  . TYR A 96  ? 0.3524 0.4283 0.3851 0.0217  0.0133  0.0121  96   TYR A CB  
729  C CG  . TYR A 96  ? 0.3369 0.4174 0.3695 0.0242  0.0122  0.0114  96   TYR A CG  
730  C CD1 . TYR A 96  ? 0.3333 0.4258 0.3649 0.0300  0.0112  0.0109  96   TYR A CD1 
731  C CD2 . TYR A 96  ? 0.3286 0.4040 0.3620 0.0210  0.0121  0.0109  96   TYR A CD2 
732  C CE1 . TYR A 96  ? 0.3372 0.4361 0.3684 0.0321  0.0101  0.0099  96   TYR A CE1 
733  C CE2 . TYR A 96  ? 0.3274 0.4072 0.3605 0.0229  0.0113  0.0099  96   TYR A CE2 
734  C CZ  . TYR A 96  ? 0.3460 0.4374 0.3778 0.0282  0.0103  0.0094  96   TYR A CZ  
735  O OH  . TYR A 96  ? 0.3416 0.4394 0.3728 0.0298  0.0095  0.0080  96   TYR A OH  
736  N N   . GLY A 97  ? 0.3748 0.4391 0.3965 0.0271  0.0206  0.0147  97   GLY A N   
737  C CA  . GLY A 97  ? 0.3804 0.4427 0.4022 0.0240  0.0221  0.0139  97   GLY A CA  
738  C C   . GLY A 97  ? 0.3862 0.4579 0.4089 0.0290  0.0219  0.0137  97   GLY A C   
739  O O   . GLY A 97  ? 0.3878 0.4694 0.4104 0.0361  0.0208  0.0141  97   GLY A O   
740  N N   . ALA A 98  ? 0.3906 0.4616 0.4139 0.0253  0.0231  0.0126  98   ALA A N   
741  C CA  . ALA A 98  ? 0.3948 0.4753 0.4191 0.0293  0.0234  0.0118  98   ALA A CA  
742  C C   . ALA A 98  ? 0.3985 0.4732 0.4210 0.0248  0.0263  0.0106  98   ALA A C   
743  O O   . ALA A 98  ? 0.3927 0.4656 0.4179 0.0164  0.0250  0.0099  98   ALA A O   
744  C CB  . ALA A 98  ? 0.3825 0.4805 0.4154 0.0260  0.0188  0.0097  98   ALA A CB  
745  N N   . ASN A 99  ? 0.4084 0.4811 0.4259 0.0313  0.0303  0.0105  99   ASN A N   
746  C CA  . ASN A 99  ? 0.4084 0.4789 0.4249 0.0272  0.0330  0.0085  99   ASN A CA  
747  C C   . ASN A 99  ? 0.3981 0.4853 0.4231 0.0220  0.0285  0.0069  99   ASN A C   
748  O O   . ASN A 99  ? 0.3912 0.4926 0.4209 0.0250  0.0256  0.0064  99   ASN A O   
749  C CB  . ASN A 99  ? 0.4232 0.4871 0.4318 0.0369  0.0392  0.0086  99   ASN A CB  
750  C CG  . ASN A 99  ? 0.4335 0.4742 0.4307 0.0392  0.0468  0.0095  99   ASN A CG  
751  O OD1 . ASN A 99  ? 0.4220 0.4537 0.4180 0.0317  0.0474  0.0089  99   ASN A OD1 
752  N ND2 . ASN A 99  ? 0.4228 0.4533 0.4105 0.0498  0.0535  0.0108  99   ASN A ND2 
753  N N   . ILE A 100 ? 0.3981 0.4843 0.4244 0.0136  0.0285  0.0058  100  ILE A N   
754  C CA  . ILE A 100 ? 0.3921 0.4902 0.4242 0.0076  0.0254  0.0050  100  ILE A CA  
755  C C   . ILE A 100 ? 0.3993 0.4978 0.4293 0.0042  0.0281  0.0032  100  ILE A C   
756  O O   . ILE A 100 ? 0.4070 0.4968 0.4327 0.0010  0.0307  0.0025  100  ILE A O   
757  C CB  . ILE A 100 ? 0.3864 0.4834 0.4214 0.0007  0.0219  0.0068  100  ILE A CB  
758  C CG1 . ILE A 100 ? 0.3756 0.4728 0.4131 0.0033  0.0195  0.0078  100  ILE A CG1 
759  C CG2 . ILE A 100 ? 0.3784 0.4829 0.4163 -0.0053 0.0206  0.0068  100  ILE A CG2 
760  C CD1 . ILE A 100 ? 0.3687 0.4633 0.4085 -0.0017 0.0168  0.0096  100  ILE A CD1 
761  N N   . ALA A 101 ? 0.4007 0.5110 0.4336 0.0040  0.0279  0.0016  101  ALA A N   
762  C CA  . ALA A 101 ? 0.4000 0.5129 0.4315 0.0000  0.0303  -0.0003 101  ALA A CA  
763  C C   . ALA A 101 ? 0.3970 0.5117 0.4297 -0.0091 0.0278  0.0013  101  ALA A C   
764  O O   . ALA A 101 ? 0.3978 0.5176 0.4339 -0.0122 0.0253  0.0026  101  ALA A O   
765  C CB  . ALA A 101 ? 0.3988 0.5254 0.4329 0.0035  0.0313  -0.0029 101  ALA A CB  
766  N N   . MET A 102 ? 0.4022 0.5128 0.4313 -0.0133 0.0291  0.0010  102  MET A N   
767  C CA  . MET A 102 ? 0.4016 0.5154 0.4301 -0.0199 0.0270  0.0035  102  MET A CA  
768  C C   . MET A 102 ? 0.4114 0.5320 0.4379 -0.0239 0.0292  0.0016  102  MET A C   
769  O O   . MET A 102 ? 0.4113 0.5384 0.4393 -0.0262 0.0290  0.0022  102  MET A O   
770  C CB  . MET A 102 ? 0.3973 0.5063 0.4233 -0.0216 0.0261  0.0045  102  MET A CB  
771  C CG  . MET A 102 ? 0.3912 0.4945 0.4193 -0.0184 0.0237  0.0067  102  MET A CG  
772  S SD  . MET A 102 ? 0.3846 0.4890 0.4153 -0.0191 0.0200  0.0116  102  MET A SD  
773  C CE  . MET A 102 ? 0.3746 0.4818 0.4018 -0.0214 0.0183  0.0151  102  MET A CE  
774  N N   . GLU A 103 ? 0.4303 0.5498 0.4531 -0.0257 0.0320  -0.0014 103  GLU A N   
775  C CA  . GLU A 103 ? 0.4506 0.5771 0.4714 -0.0293 0.0346  -0.0042 103  GLU A CA  
776  C C   . GLU A 103 ? 0.4659 0.5951 0.4888 -0.0248 0.0373  -0.0072 103  GLU A C   
777  O O   . GLU A 103 ? 0.4694 0.6077 0.4931 -0.0275 0.0381  -0.0082 103  GLU A O   
778  C CB  . GLU A 103 ? 0.4564 0.5814 0.4726 -0.0330 0.0380  -0.0084 103  GLU A CB  
779  C CG  . GLU A 103 ? 0.4600 0.5902 0.4742 -0.0379 0.0353  -0.0067 103  GLU A CG  
780  C CD  . GLU A 103 ? 0.4743 0.5977 0.4880 -0.0373 0.0354  -0.0077 103  GLU A CD  
781  O OE1 . GLU A 103 ? 0.4634 0.5782 0.4796 -0.0322 0.0344  -0.0057 103  GLU A OE1 
782  O OE2 . GLU A 103 ? 0.4882 0.6168 0.4992 -0.0425 0.0366  -0.0112 103  GLU A OE2 
783  N N   . LYS A 104 ? 0.4831 0.6055 0.5063 -0.0174 0.0390  -0.0083 104  LYS A N   
784  C CA  . LYS A 104 ? 0.4984 0.6253 0.5229 -0.0101 0.0416  -0.0108 104  LYS A CA  
785  C C   . LYS A 104 ? 0.4966 0.6362 0.5274 -0.0085 0.0382  -0.0097 104  LYS A C   
786  O O   . LYS A 104 ? 0.4991 0.6481 0.5320 -0.0020 0.0396  -0.0121 104  LYS A O   
787  C CB  . LYS A 104 ? 0.5075 0.6217 0.5278 -0.0009 0.0456  -0.0115 104  LYS A CB  
788  C CG  . LYS A 104 ? 0.5454 0.6454 0.5583 -0.0037 0.0515  -0.0145 104  LYS A CG  
789  C CD  . LYS A 104 ? 0.6114 0.6970 0.6175 0.0063  0.0587  -0.0160 104  LYS A CD  
790  C CE  . LYS A 104 ? 0.6441 0.7344 0.6487 0.0114  0.0634  -0.0194 104  LYS A CE  
791  N NZ  . LYS A 104 ? 0.6610 0.7332 0.6560 0.0223  0.0723  -0.0205 104  LYS A NZ  
792  N N   . ASP A 105 ? 0.4952 0.6359 0.5283 -0.0142 0.0343  -0.0066 105  ASP A N   
793  C CA  . ASP A 105 ? 0.4970 0.6491 0.5352 -0.0160 0.0325  -0.0070 105  ASP A CA  
794  C C   . ASP A 105 ? 0.5024 0.6666 0.5414 -0.0215 0.0346  -0.0099 105  ASP A C   
795  O O   . ASP A 105 ? 0.5055 0.6671 0.5412 -0.0287 0.0351  -0.0083 105  ASP A O   
796  C CB  . ASP A 105 ? 0.4939 0.6400 0.5324 -0.0214 0.0296  -0.0032 105  ASP A CB  
797  C CG  . ASP A 105 ? 0.4962 0.6513 0.5393 -0.0232 0.0290  -0.0050 105  ASP A CG  
798  O OD1 . ASP A 105 ? 0.5132 0.6803 0.5582 -0.0280 0.0309  -0.0084 105  ASP A OD1 
799  O OD2 . ASP A 105 ? 0.5318 0.6831 0.5766 -0.0207 0.0269  -0.0039 105  ASP A OD2 
800  N N   . LYS A 106 ? 0.5079 0.6870 0.5508 -0.0174 0.0358  -0.0143 106  LYS A N   
801  C CA  . LYS A 106 ? 0.5170 0.7103 0.5612 -0.0219 0.0384  -0.0182 106  LYS A CA  
802  C C   . LYS A 106 ? 0.5148 0.7126 0.5596 -0.0339 0.0388  -0.0181 106  LYS A C   
803  O O   . LYS A 106 ? 0.5138 0.7190 0.5575 -0.0401 0.0414  -0.0203 106  LYS A O   
804  C CB  . LYS A 106 ? 0.5208 0.7323 0.5695 -0.0131 0.0397  -0.0233 106  LYS A CB  
805  C CG  . LYS A 106 ? 0.5395 0.7656 0.5939 -0.0118 0.0375  -0.0255 106  LYS A CG  
806  C CD  . LYS A 106 ? 0.5598 0.8056 0.6176 0.0007  0.0381  -0.0296 106  LYS A CD  
807  C CE  . LYS A 106 ? 0.5661 0.8275 0.6290 0.0030  0.0354  -0.0317 106  LYS A CE  
808  N NZ  . LYS A 106 ? 0.5847 0.8755 0.6522 0.0133  0.0358  -0.0370 106  LYS A NZ  
809  N N   . LYS A 107 ? 0.5151 0.7068 0.5605 -0.0373 0.0370  -0.0158 107  LYS A N   
810  C CA  . LYS A 107 ? 0.5204 0.7101 0.5637 -0.0487 0.0392  -0.0151 107  LYS A CA  
811  C C   . LYS A 107 ? 0.5183 0.6930 0.5538 -0.0533 0.0399  -0.0090 107  LYS A C   
812  O O   . LYS A 107 ? 0.5242 0.6982 0.5553 -0.0619 0.0434  -0.0083 107  LYS A O   
813  C CB  . LYS A 107 ? 0.5221 0.7069 0.5671 -0.0505 0.0382  -0.0146 107  LYS A CB  
814  C CG  . LYS A 107 ? 0.5447 0.7472 0.5971 -0.0454 0.0368  -0.0206 107  LYS A CG  
815  C CD  . LYS A 107 ? 0.5837 0.7845 0.6377 -0.0504 0.0370  -0.0220 107  LYS A CD  
816  C CE  . LYS A 107 ? 0.6068 0.8103 0.6591 -0.0648 0.0425  -0.0261 107  LYS A CE  
817  N NZ  . LYS A 107 ? 0.6048 0.8189 0.6613 -0.0701 0.0439  -0.0326 107  LYS A NZ  
818  N N   . GLY A 108 ? 0.5122 0.6760 0.5451 -0.0476 0.0371  -0.0047 108  GLY A N   
819  C CA  . GLY A 108 ? 0.5142 0.6689 0.5399 -0.0500 0.0371  0.0006  108  GLY A CA  
820  C C   . GLY A 108 ? 0.5147 0.6555 0.5360 -0.0507 0.0358  0.0072  108  GLY A C   
821  O O   . GLY A 108 ? 0.5186 0.6549 0.5421 -0.0512 0.0358  0.0072  108  GLY A O   
822  N N   . GLY A 109 ? 0.5115 0.6471 0.5264 -0.0503 0.0350  0.0125  109  GLY A N   
823  C CA  . GLY A 109 ? 0.5143 0.6379 0.5235 -0.0489 0.0341  0.0197  109  GLY A CA  
824  C C   . GLY A 109 ? 0.5053 0.6241 0.5180 -0.0427 0.0302  0.0207  109  GLY A C   
825  O O   . GLY A 109 ? 0.5052 0.6143 0.5146 -0.0406 0.0296  0.0258  109  GLY A O   
826  N N   . PHE A 110 ? 0.4954 0.6198 0.5138 -0.0395 0.0283  0.0158  110  PHE A N   
827  C CA  . PHE A 110 ? 0.4885 0.6085 0.5098 -0.0344 0.0254  0.0159  110  PHE A CA  
828  C C   . PHE A 110 ? 0.4830 0.6067 0.5030 -0.0329 0.0243  0.0146  110  PHE A C   
829  O O   . PHE A 110 ? 0.4766 0.5980 0.4991 -0.0300 0.0237  0.0119  110  PHE A O   
830  C CB  . PHE A 110 ? 0.4860 0.6070 0.5137 -0.0317 0.0254  0.0114  110  PHE A CB  
831  C CG  . PHE A 110 ? 0.4928 0.6120 0.5226 -0.0339 0.0262  0.0113  110  PHE A CG  
832  C CD1 . PHE A 110 ? 0.4856 0.5953 0.5144 -0.0331 0.0251  0.0149  110  PHE A CD1 
833  C CD2 . PHE A 110 ? 0.5064 0.6347 0.5392 -0.0371 0.0285  0.0068  110  PHE A CD2 
834  C CE1 . PHE A 110 ? 0.5017 0.6088 0.5318 -0.0365 0.0270  0.0136  110  PHE A CE1 
835  C CE2 . PHE A 110 ? 0.5167 0.6455 0.5514 -0.0411 0.0301  0.0050  110  PHE A CE2 
836  C CZ  . PHE A 110 ? 0.5218 0.6387 0.5548 -0.0413 0.0297  0.0082  110  PHE A CZ  
837  N N   . GLY A 111 ? 0.4824 0.6120 0.4975 -0.0357 0.0248  0.0160  111  GLY A N   
838  C CA  . GLY A 111 ? 0.4750 0.6112 0.4881 -0.0363 0.0245  0.0134  111  GLY A CA  
839  C C   . GLY A 111 ? 0.4743 0.6125 0.4851 -0.0339 0.0214  0.0176  111  GLY A C   
840  O O   . GLY A 111 ? 0.4671 0.5984 0.4785 -0.0303 0.0196  0.0222  111  GLY A O   
841  N N   . VAL A 112 ? 0.4744 0.6239 0.4827 -0.0359 0.0211  0.0152  112  VAL A N   
842  C CA  . VAL A 112 ? 0.4697 0.6276 0.4760 -0.0333 0.0180  0.0180  112  VAL A CA  
843  C C   . VAL A 112 ? 0.4674 0.6233 0.4689 -0.0280 0.0161  0.0276  112  VAL A C   
844  O O   . VAL A 112 ? 0.4775 0.6330 0.4737 -0.0289 0.0175  0.0313  112  VAL A O   
845  C CB  . VAL A 112 ? 0.4753 0.6511 0.4787 -0.0377 0.0185  0.0130  112  VAL A CB  
846  C CG1 . VAL A 112 ? 0.4791 0.6697 0.4806 -0.0342 0.0148  0.0158  112  VAL A CG1 
847  C CG2 . VAL A 112 ? 0.4753 0.6490 0.4816 -0.0436 0.0224  0.0029  112  VAL A CG2 
848  N N   . GLY A 113 ? 0.4572 0.6100 0.4592 -0.0223 0.0137  0.0316  113  GLY A N   
849  C CA  . GLY A 113 ? 0.4612 0.6083 0.4569 -0.0158 0.0132  0.0412  113  GLY A CA  
850  C C   . GLY A 113 ? 0.4567 0.5962 0.4544 -0.0095 0.0115  0.0443  113  GLY A C   
851  O O   . GLY A 113 ? 0.4442 0.5865 0.4484 -0.0103 0.0100  0.0390  113  GLY A O   
852  N N   . ASN A 114 ? 0.4668 0.5953 0.4578 -0.0033 0.0128  0.0528  114  ASN A N   
853  C CA  . ASN A 114 ? 0.4685 0.5876 0.4600 0.0034  0.0122  0.0564  114  ASN A CA  
854  C C   . ASN A 114 ? 0.4676 0.5673 0.4631 -0.0006 0.0151  0.0541  114  ASN A C   
855  O O   . ASN A 114 ? 0.4745 0.5645 0.4674 -0.0056 0.0188  0.0543  114  ASN A O   
856  C CB  . ASN A 114 ? 0.4862 0.6010 0.4665 0.0133  0.0135  0.0671  114  ASN A CB  
857  C CG  . ASN A 114 ? 0.4923 0.6315 0.4686 0.0193  0.0099  0.0695  114  ASN A CG  
858  O OD1 . ASN A 114 ? 0.4961 0.6535 0.4786 0.0205  0.0059  0.0648  114  ASN A OD1 
859  N ND2 . ASN A 114 ? 0.5030 0.6441 0.4685 0.0227  0.0117  0.0765  114  ASN A ND2 
860  N N   . TYR A 115 ? 0.4615 0.5580 0.4632 0.0010  0.0135  0.0514  115  TYR A N   
861  C CA  . TYR A 115 ? 0.4586 0.5418 0.4652 -0.0030 0.0155  0.0477  115  TYR A CA  
862  C C   . TYR A 115 ? 0.4660 0.5379 0.4726 0.0020  0.0162  0.0500  115  TYR A C   
863  O O   . TYR A 115 ? 0.4664 0.5433 0.4720 0.0092  0.0139  0.0530  115  TYR A O   
864  C CB  . TYR A 115 ? 0.4440 0.5349 0.4592 -0.0077 0.0136  0.0395  115  TYR A CB  
865  C CG  . TYR A 115 ? 0.4402 0.5361 0.4560 -0.0136 0.0149  0.0359  115  TYR A CG  
866  C CD1 . TYR A 115 ? 0.4429 0.5509 0.4564 -0.0148 0.0140  0.0351  115  TYR A CD1 
867  C CD2 . TYR A 115 ? 0.4366 0.5274 0.4553 -0.0179 0.0171  0.0324  115  TYR A CD2 
868  C CE1 . TYR A 115 ? 0.4591 0.5712 0.4729 -0.0199 0.0158  0.0314  115  TYR A CE1 
869  C CE2 . TYR A 115 ? 0.4324 0.5293 0.4518 -0.0222 0.0185  0.0289  115  TYR A CE2 
870  C CZ  . TYR A 115 ? 0.4483 0.5545 0.4651 -0.0230 0.0180  0.0286  115  TYR A CZ  
871  O OH  . TYR A 115 ? 0.4225 0.5342 0.4397 -0.0270 0.0198  0.0248  115  TYR A OH  
872  N N   . GLU A 116 ? 0.4704 0.5290 0.4784 -0.0022 0.0195  0.0477  116  GLU A N   
873  C CA  . GLU A 116 ? 0.4738 0.5218 0.4834 0.0002  0.0206  0.0473  116  GLU A CA  
874  C C   . GLU A 116 ? 0.4540 0.5049 0.4723 -0.0054 0.0196  0.0395  116  GLU A C   
875  O O   . GLU A 116 ? 0.4500 0.5012 0.4699 -0.0119 0.0216  0.0358  116  GLU A O   
876  C CB  . GLU A 116 ? 0.4974 0.5252 0.4983 0.0000  0.0273  0.0516  116  GLU A CB  
877  C CG  . GLU A 116 ? 0.5435 0.5642 0.5334 0.0093  0.0293  0.0611  116  GLU A CG  
878  C CD  . GLU A 116 ? 0.5991 0.5946 0.5776 0.0085  0.0382  0.0655  116  GLU A CD  
879  O OE1 . GLU A 116 ? 0.6294 0.6131 0.6100 0.0012  0.0426  0.0601  116  GLU A OE1 
880  O OE2 . GLU A 116 ? 0.6378 0.6252 0.6043 0.0150  0.0415  0.0742  116  GLU A OE2 
881  N N   . LEU A 117 ? 0.4450 0.4996 0.4686 -0.0023 0.0166  0.0373  117  LEU A N   
882  C CA  . LEU A 117 ? 0.4353 0.4928 0.4657 -0.0056 0.0157  0.0310  117  LEU A CA  
883  C C   . LEU A 117 ? 0.4428 0.4907 0.4738 -0.0047 0.0175  0.0300  117  LEU A C   
884  O O   . LEU A 117 ? 0.4460 0.4901 0.4756 0.0008  0.0170  0.0331  117  LEU A O   
885  C CB  . LEU A 117 ? 0.4227 0.4908 0.4572 -0.0036 0.0119  0.0286  117  LEU A CB  
886  C CG  . LEU A 117 ? 0.4078 0.4777 0.4472 -0.0045 0.0111  0.0237  117  LEU A CG  
887  C CD1 . LEU A 117 ? 0.3920 0.4645 0.4329 -0.0082 0.0124  0.0203  117  LEU A CD1 
888  C CD2 . LEU A 117 ? 0.3967 0.4728 0.4373 -0.0030 0.0093  0.0220  117  LEU A CD2 
889  N N   . THR A 118 ? 0.4398 0.4861 0.4733 -0.0102 0.0198  0.0252  118  THR A N   
890  C CA  . THR A 118 ? 0.4412 0.4803 0.4757 -0.0112 0.0220  0.0223  118  THR A CA  
891  C C   . THR A 118 ? 0.4276 0.4780 0.4687 -0.0128 0.0194  0.0163  118  THR A C   
892  O O   . THR A 118 ? 0.4179 0.4778 0.4614 -0.0162 0.0191  0.0129  118  THR A O   
893  C CB  . THR A 118 ? 0.4546 0.4816 0.4843 -0.0178 0.0288  0.0209  118  THR A CB  
894  O OG1 . THR A 118 ? 0.4775 0.4929 0.4988 -0.0158 0.0321  0.0275  118  THR A OG1 
895  C CG2 . THR A 118 ? 0.4608 0.4779 0.4902 -0.0187 0.0322  0.0179  118  THR A CG2 
896  N N   . PHE A 119 ? 0.4266 0.4768 0.4702 -0.0095 0.0178  0.0152  119  PHE A N   
897  C CA  . PHE A 119 ? 0.4196 0.4791 0.4677 -0.0103 0.0161  0.0101  119  PHE A CA  
898  C C   . PHE A 119 ? 0.4280 0.4840 0.4765 -0.0152 0.0198  0.0052  119  PHE A C   
899  O O   . PHE A 119 ? 0.4394 0.4819 0.4846 -0.0158 0.0234  0.0065  119  PHE A O   
900  C CB  . PHE A 119 ? 0.4135 0.4752 0.4632 -0.0048 0.0128  0.0112  119  PHE A CB  
901  C CG  . PHE A 119 ? 0.4052 0.4712 0.4542 -0.0018 0.0104  0.0138  119  PHE A CG  
902  C CD1 . PHE A 119 ? 0.4031 0.4746 0.4517 -0.0029 0.0103  0.0133  119  PHE A CD1 
903  C CD2 . PHE A 119 ? 0.3999 0.4652 0.4486 0.0014  0.0090  0.0157  119  PHE A CD2 
904  C CE1 . PHE A 119 ? 0.3970 0.4704 0.4441 -0.0011 0.0094  0.0147  119  PHE A CE1 
905  C CE2 . PHE A 119 ? 0.4017 0.4712 0.4493 0.0020  0.0080  0.0165  119  PHE A CE2 
906  C CZ  . PHE A 119 ? 0.3903 0.4624 0.4366 0.0005  0.0086  0.0159  119  PHE A CZ  
907  N N   . TYR A 120 ? 0.4310 0.4997 0.4830 -0.0184 0.0194  -0.0006 120  TYR A N   
908  C CA  . TYR A 120 ? 0.4438 0.5140 0.4969 -0.0243 0.0228  -0.0073 120  TYR A CA  
909  C C   . TYR A 120 ? 0.4294 0.5127 0.4861 -0.0208 0.0193  -0.0104 120  TYR A C   
910  O O   . TYR A 120 ? 0.4227 0.5225 0.4816 -0.0190 0.0167  -0.0124 120  TYR A O   
911  C CB  . TYR A 120 ? 0.4508 0.5290 0.5042 -0.0332 0.0266  -0.0132 120  TYR A CB  
912  C CG  . TYR A 120 ? 0.4839 0.5469 0.5320 -0.0378 0.0317  -0.0104 120  TYR A CG  
913  C CD1 . TYR A 120 ? 0.5173 0.5606 0.5598 -0.0426 0.0387  -0.0109 120  TYR A CD1 
914  C CD2 . TYR A 120 ? 0.5068 0.5735 0.5541 -0.0370 0.0303  -0.0070 120  TYR A CD2 
915  C CE1 . TYR A 120 ? 0.5442 0.5711 0.5794 -0.0459 0.0443  -0.0072 120  TYR A CE1 
916  C CE2 . TYR A 120 ? 0.5327 0.5857 0.5739 -0.0410 0.0352  -0.0039 120  TYR A CE2 
917  C CZ  . TYR A 120 ? 0.5619 0.5946 0.5966 -0.0451 0.0423  -0.0035 120  TYR A CZ  
918  O OH  . TYR A 120 ? 0.6040 0.6208 0.6304 -0.0481 0.0480  0.0006  120  TYR A OH  
919  N N   . ILE A 121 ? 0.4228 0.4988 0.4793 -0.0189 0.0195  -0.0104 121  ILE A N   
920  C CA  . ILE A 121 ? 0.4060 0.4916 0.4644 -0.0144 0.0162  -0.0116 121  ILE A CA  
921  C C   . ILE A 121 ? 0.4054 0.4969 0.4653 -0.0196 0.0187  -0.0192 121  ILE A C   
922  O O   . ILE A 121 ? 0.4081 0.4872 0.4667 -0.0244 0.0233  -0.0217 121  ILE A O   
923  C CB  . ILE A 121 ? 0.3980 0.4738 0.4553 -0.0080 0.0141  -0.0061 121  ILE A CB  
924  C CG1 . ILE A 121 ? 0.3915 0.4630 0.4472 -0.0046 0.0125  0.0000  121  ILE A CG1 
925  C CG2 . ILE A 121 ? 0.3959 0.4806 0.4538 -0.0038 0.0114  -0.0069 121  ILE A CG2 
926  C CD1 . ILE A 121 ? 0.3991 0.4656 0.4540 0.0002  0.0108  0.0038  121  ILE A CD1 
927  N N   . SER A 122 ? 0.4001 0.5107 0.4619 -0.0181 0.0161  -0.0228 122  SER A N   
928  C CA  . SER A 122 ? 0.3992 0.5207 0.4626 -0.0225 0.0176  -0.0307 122  SER A CA  
929  C C   . SER A 122 ? 0.3905 0.5183 0.4531 -0.0148 0.0138  -0.0283 122  SER A C   
930  O O   . SER A 122 ? 0.3841 0.5135 0.4448 -0.0067 0.0104  -0.0222 122  SER A O   
931  C CB  . SER A 122 ? 0.3980 0.5425 0.4636 -0.0279 0.0183  -0.0382 122  SER A CB  
932  O OG  . SER A 122 ? 0.4194 0.5576 0.4850 -0.0366 0.0229  -0.0411 122  SER A OG  
933  N N   . ASN A 123 ? 0.3878 0.5181 0.4511 -0.0177 0.0153  -0.0336 123  ASN A N   
934  C CA  . ASN A 123 ? 0.3767 0.5105 0.4385 -0.0113 0.0126  -0.0314 123  ASN A CA  
935  C C   . ASN A 123 ? 0.3719 0.5273 0.4318 -0.0049 0.0090  -0.0308 123  ASN A C   
936  O O   . ASN A 123 ? 0.3712 0.5431 0.4322 -0.0059 0.0085  -0.0339 123  ASN A O   
937  C CB  . ASN A 123 ? 0.3840 0.5147 0.4467 -0.0164 0.0157  -0.0377 123  ASN A CB  
938  C CG  . ASN A 123 ? 0.3722 0.5227 0.4368 -0.0240 0.0177  -0.0482 123  ASN A CG  
939  O OD1 . ASN A 123 ? 0.3590 0.5326 0.4236 -0.0215 0.0147  -0.0499 123  ASN A OD1 
940  N ND2 . ASN A 123 ? 0.3549 0.4968 0.4203 -0.0331 0.0234  -0.0556 123  ASN A ND2 
941  N N   . PRO A 124 ? 0.3741 0.5294 0.4301 0.0023  0.0071  -0.0267 124  PRO A N   
942  C CA  . PRO A 124 ? 0.3814 0.5537 0.4329 0.0109  0.0046  -0.0242 124  PRO A CA  
943  C C   . PRO A 124 ? 0.3961 0.5967 0.4489 0.0095  0.0038  -0.0319 124  PRO A C   
944  O O   . PRO A 124 ? 0.3976 0.6161 0.4467 0.0179  0.0016  -0.0297 124  PRO A O   
945  C CB  . PRO A 124 ? 0.3797 0.5410 0.4257 0.0167  0.0045  -0.0188 124  PRO A CB  
946  C CG  . PRO A 124 ? 0.3779 0.5171 0.4259 0.0132  0.0059  -0.0161 124  PRO A CG  
947  C CD  . PRO A 124 ? 0.3726 0.5101 0.4271 0.0042  0.0076  -0.0225 124  PRO A CD  
948  N N   . GLU A 125 ? 0.4127 0.6181 0.4697 -0.0003 0.0060  -0.0409 125  GLU A N   
949  C CA  . GLU A 125 ? 0.4268 0.6624 0.4854 -0.0037 0.0057  -0.0502 125  GLU A CA  
950  C C   . GLU A 125 ? 0.4295 0.6873 0.4909 -0.0056 0.0052  -0.0546 125  GLU A C   
951  O O   . GLU A 125 ? 0.4342 0.7237 0.4956 -0.0035 0.0033  -0.0598 125  GLU A O   
952  C CB  . GLU A 125 ? 0.4367 0.6702 0.4990 -0.0162 0.0099  -0.0605 125  GLU A CB  
953  C CG  . GLU A 125 ? 0.4763 0.7015 0.5359 -0.0136 0.0099  -0.0591 125  GLU A CG  
954  C CD  . GLU A 125 ? 0.5273 0.7521 0.5900 -0.0254 0.0147  -0.0703 125  GLU A CD  
955  O OE1 . GLU A 125 ? 0.5616 0.7948 0.6277 -0.0364 0.0185  -0.0801 125  GLU A OE1 
956  O OE2 . GLU A 125 ? 0.5505 0.7661 0.6118 -0.0243 0.0154  -0.0698 125  GLU A OE2 
957  N N   . LYS A 126 ? 0.4303 0.6736 0.4941 -0.0094 0.0068  -0.0528 126  LYS A N   
958  C CA  . LYS A 126 ? 0.4310 0.6936 0.4975 -0.0110 0.0065  -0.0563 126  LYS A CA  
959  C C   . LYS A 126 ? 0.4226 0.7050 0.4851 0.0042  0.0019  -0.0499 126  LYS A C   
960  O O   . LYS A 126 ? 0.4191 0.7309 0.4837 0.0052  0.0008  -0.0550 126  LYS A O   
961  C CB  . LYS A 126 ? 0.4355 0.6745 0.5035 -0.0160 0.0090  -0.0531 126  LYS A CB  
962  C CG  . LYS A 126 ? 0.4627 0.7186 0.5347 -0.0241 0.0111  -0.0604 126  LYS A CG  
963  C CD  . LYS A 126 ? 0.4871 0.7158 0.5595 -0.0321 0.0153  -0.0585 126  LYS A CD  
964  C CE  . LYS A 126 ? 0.5159 0.7600 0.5914 -0.0408 0.0181  -0.0655 126  LYS A CE  
965  N NZ  . LYS A 126 ? 0.5109 0.7734 0.5868 -0.0301 0.0135  -0.0610 126  LYS A NZ  
966  N N   . GLN A 127 ? 0.4142 0.6803 0.4700 0.0161  0.0000  -0.0393 127  GLN A N   
967  C CA  . GLN A 127 ? 0.4122 0.6896 0.4609 0.0324  -0.0025 -0.0315 127  GLN A CA  
968  C C   . GLN A 127 ? 0.4150 0.7060 0.4571 0.0415  -0.0041 -0.0297 127  GLN A C   
969  O O   . GLN A 127 ? 0.4256 0.7152 0.4584 0.0565  -0.0048 -0.0206 127  GLN A O   
970  C CB  . GLN A 127 ? 0.4101 0.6572 0.4535 0.0393  -0.0016 -0.0206 127  GLN A CB  
971  C CG  . GLN A 127 ? 0.4111 0.6505 0.4591 0.0343  -0.0006 -0.0210 127  GLN A CG  
972  C CD  . GLN A 127 ? 0.4045 0.6185 0.4467 0.0414  0.0005  -0.0113 127  GLN A CD  
973  O OE1 . GLN A 127 ? 0.4064 0.6135 0.4396 0.0529  0.0010  -0.0041 127  GLN A OE1 
974  N NE2 . GLN A 127 ? 0.4309 0.6304 0.4771 0.0341  0.0017  -0.0114 127  GLN A NE2 
975  N N   . GLY A 128 ? 0.4096 0.7126 0.4553 0.0328  -0.0038 -0.0381 128  GLY A N   
976  C CA  . GLY A 128 ? 0.4071 0.7272 0.4468 0.0403  -0.0054 -0.0376 128  GLY A CA  
977  C C   . GLY A 128 ? 0.3980 0.6911 0.4306 0.0444  -0.0043 -0.0298 128  GLY A C   
978  O O   . GLY A 128 ? 0.4045 0.7070 0.4287 0.0543  -0.0052 -0.0257 128  GLY A O   
979  N N   . PHE A 129 ? 0.3826 0.6439 0.4180 0.0369  -0.0020 -0.0279 129  PHE A N   
980  C CA  . PHE A 129 ? 0.3723 0.6092 0.4025 0.0386  -0.0004 -0.0220 129  PHE A CA  
981  C C   . PHE A 129 ? 0.3725 0.6129 0.4073 0.0287  0.0004  -0.0303 129  PHE A C   
982  O O   . PHE A 129 ? 0.3747 0.6091 0.4176 0.0170  0.0020  -0.0375 129  PHE A O   
983  C CB  . PHE A 129 ? 0.3628 0.5688 0.3944 0.0356  0.0013  -0.0170 129  PHE A CB  
984  C CG  . PHE A 129 ? 0.3367 0.5201 0.3624 0.0378  0.0034  -0.0109 129  PHE A CG  
985  C CD1 . PHE A 129 ? 0.3382 0.5105 0.3528 0.0480  0.0051  -0.0018 129  PHE A CD1 
986  C CD2 . PHE A 129 ? 0.3237 0.4964 0.3540 0.0295  0.0045  -0.0147 129  PHE A CD2 
987  C CE1 . PHE A 129 ? 0.3171 0.4689 0.3257 0.0481  0.0081  0.0025  129  PHE A CE1 
988  C CE2 . PHE A 129 ? 0.3282 0.4835 0.3537 0.0308  0.0066  -0.0102 129  PHE A CE2 
989  C CZ  . PHE A 129 ? 0.3202 0.4655 0.3350 0.0391  0.0085  -0.0020 129  PHE A CZ  
990  N N   . GLY A 130 ? 0.3734 0.6220 0.4018 0.0338  0.0000  -0.0291 130  GLY A N   
991  C CA  . GLY A 130 ? 0.3719 0.6265 0.4039 0.0252  0.0011  -0.0375 130  GLY A CA  
992  C C   . GLY A 130 ? 0.3679 0.5949 0.4004 0.0211  0.0035  -0.0354 130  GLY A C   
993  O O   . GLY A 130 ? 0.3655 0.5700 0.3951 0.0247  0.0044  -0.0274 130  GLY A O   
994  N N   . ARG A 131 ? 0.3655 0.5961 0.4018 0.0133  0.0051  -0.0434 131  ARG A N   
995  C CA  . ARG A 131 ? 0.3644 0.5738 0.4012 0.0104  0.0074  -0.0424 131  ARG A CA  
996  C C   . ARG A 131 ? 0.3665 0.5887 0.4024 0.0073  0.0084  -0.0491 131  ARG A C   
997  O O   . ARG A 131 ? 0.3666 0.6103 0.4054 0.0019  0.0085  -0.0584 131  ARG A O   
998  C CB  . ARG A 131 ? 0.3614 0.5517 0.4064 0.0024  0.0098  -0.0457 131  ARG A CB  
999  C CG  . ARG A 131 ? 0.3657 0.5628 0.4170 -0.0081 0.0127  -0.0575 131  ARG A CG  
1000 C CD  . ARG A 131 ? 0.3607 0.5369 0.4171 -0.0138 0.0158  -0.0587 131  ARG A CD  
1001 N NE  . ARG A 131 ? 0.3802 0.5591 0.4404 -0.0246 0.0206  -0.0703 131  ARG A NE  
1002 C CZ  . ARG A 131 ? 0.3742 0.5450 0.4355 -0.0296 0.0250  -0.0768 131  ARG A CZ  
1003 N NH1 . ARG A 131 ? 0.3745 0.5366 0.4346 -0.0245 0.0245  -0.0729 131  ARG A NH1 
1004 N NH2 . ARG A 131 ? 0.3909 0.5621 0.4541 -0.0404 0.0309  -0.0879 131  ARG A NH2 
1005 N N   . HIS A 132 ? 0.3702 0.5809 0.4020 0.0098  0.0096  -0.0453 132  HIS A N   
1006 C CA  . HIS A 132 ? 0.3774 0.5976 0.4085 0.0063  0.0110  -0.0517 132  HIS A CA  
1007 C C   . HIS A 132 ? 0.3821 0.5945 0.4226 -0.0041 0.0143  -0.0617 132  HIS A C   
1008 O O   . HIS A 132 ? 0.3820 0.5738 0.4271 -0.0059 0.0157  -0.0599 132  HIS A O   
1009 C CB  . HIS A 132 ? 0.3783 0.5865 0.4023 0.0111  0.0122  -0.0449 132  HIS A CB  
1010 C CG  . HIS A 132 ? 0.3723 0.5858 0.3838 0.0215  0.0112  -0.0355 132  HIS A CG  
1011 N ND1 . HIS A 132 ? 0.3646 0.5753 0.3665 0.0254  0.0132  -0.0311 132  HIS A ND1 
1012 C CD2 . HIS A 132 ? 0.3820 0.6022 0.3877 0.0297  0.0093  -0.0292 132  HIS A CD2 
1013 C CE1 . HIS A 132 ? 0.3703 0.5832 0.3598 0.0357  0.0131  -0.0220 132  HIS A CE1 
1014 N NE2 . HIS A 132 ? 0.3637 0.5828 0.3555 0.0392  0.0106  -0.0206 132  HIS A NE2 
1015 N N   . VAL A 133 ? 0.3922 0.6208 0.4344 -0.0105 0.0160  -0.0722 133  VAL A N   
1016 C CA  . VAL A 133 ? 0.4022 0.6207 0.4510 -0.0202 0.0209  -0.0823 133  VAL A CA  
1017 C C   . VAL A 133 ? 0.4177 0.6420 0.4653 -0.0228 0.0232  -0.0885 133  VAL A C   
1018 O O   . VAL A 133 ? 0.4234 0.6421 0.4752 -0.0307 0.0283  -0.0983 133  VAL A O   
1019 C CB  . VAL A 133 ? 0.4042 0.6337 0.4573 -0.0299 0.0234  -0.0929 133  VAL A CB  
1020 C CG1 . VAL A 133 ? 0.3876 0.6107 0.4423 -0.0281 0.0216  -0.0873 133  VAL A CG1 
1021 C CG2 . VAL A 133 ? 0.3912 0.6551 0.4419 -0.0324 0.0219  -0.1005 133  VAL A CG2 
1022 N N   . ASP A 134 ? 0.4312 0.6648 0.4721 -0.0159 0.0205  -0.0826 134  ASP A N   
1023 C CA  . ASP A 134 ? 0.4504 0.6917 0.4891 -0.0180 0.0225  -0.0879 134  ASP A CA  
1024 C C   . ASP A 134 ? 0.4661 0.6844 0.5082 -0.0185 0.0258  -0.0873 134  ASP A C   
1025 O O   . ASP A 134 ? 0.4627 0.6616 0.5077 -0.0157 0.0256  -0.0810 134  ASP A O   
1026 C CB  . ASP A 134 ? 0.4507 0.7081 0.4790 -0.0100 0.0194  -0.0809 134  ASP A CB  
1027 C CG  . ASP A 134 ? 0.4637 0.7028 0.4859 -0.0015 0.0183  -0.0676 134  ASP A CG  
1028 O OD1 . ASP A 134 ? 0.4693 0.6933 0.4942 0.0005  0.0175  -0.0619 134  ASP A OD1 
1029 O OD2 . ASP A 134 ? 0.4958 0.7359 0.5101 0.0023  0.0191  -0.0632 134  ASP A OD2 
1030 N N   . GLU A 135 ? 0.4917 0.7148 0.5338 -0.0218 0.0286  -0.0941 135  GLU A N   
1031 C CA  . GLU A 135 ? 0.5079 0.7130 0.5541 -0.0221 0.0322  -0.0954 135  GLU A CA  
1032 C C   . GLU A 135 ? 0.5051 0.7000 0.5484 -0.0151 0.0303  -0.0845 135  GLU A C   
1033 O O   . GLU A 135 ? 0.5037 0.6822 0.5517 -0.0133 0.0315  -0.0821 135  GLU A O   
1034 C CB  . GLU A 135 ? 0.5212 0.7360 0.5675 -0.0270 0.0360  -0.1057 135  GLU A CB  
1035 C CG  . GLU A 135 ? 0.5569 0.7543 0.6084 -0.0271 0.0406  -0.1090 135  GLU A CG  
1036 C CD  . GLU A 135 ? 0.6059 0.8073 0.6594 -0.0341 0.0465  -0.1226 135  GLU A CD  
1037 O OE1 . GLU A 135 ? 0.6230 0.8345 0.6764 -0.0415 0.0485  -0.1314 135  GLU A OE1 
1038 O OE2 . GLU A 135 ? 0.6434 0.8386 0.6988 -0.0326 0.0496  -0.1251 135  GLU A OE2 
1039 N N   . GLU A 136 ? 0.5061 0.7110 0.5405 -0.0111 0.0279  -0.0782 136  GLU A N   
1040 C CA  . GLU A 136 ? 0.5091 0.7041 0.5386 -0.0067 0.0280  -0.0693 136  GLU A CA  
1041 C C   . GLU A 136 ? 0.4940 0.6755 0.5235 -0.0029 0.0261  -0.0605 136  GLU A C   
1042 O O   . GLU A 136 ? 0.4932 0.6617 0.5271 -0.0027 0.0271  -0.0585 136  GLU A O   
1043 C CB  . GLU A 136 ? 0.5222 0.7286 0.5395 -0.0036 0.0279  -0.0650 136  GLU A CB  
1044 C CG  . GLU A 136 ? 0.5661 0.7614 0.5770 -0.0019 0.0305  -0.0584 136  GLU A CG  
1045 C CD  . GLU A 136 ? 0.6224 0.8260 0.6191 0.0008  0.0322  -0.0542 136  GLU A CD  
1046 O OE1 . GLU A 136 ? 0.6555 0.8760 0.6507 -0.0005 0.0320  -0.0601 136  GLU A OE1 
1047 O OE2 . GLU A 136 ? 0.6283 0.8208 0.6144 0.0041  0.0344  -0.0452 136  GLU A OE2 
1048 N N   . THR A 137 ? 0.4815 0.6681 0.5064 0.0002  0.0234  -0.0559 137  THR A N   
1049 C CA  . THR A 137 ? 0.4683 0.6430 0.4911 0.0042  0.0219  -0.0471 137  THR A CA  
1050 C C   . THR A 137 ? 0.4473 0.6192 0.4777 0.0029  0.0200  -0.0487 137  THR A C   
1051 O O   . THR A 137 ? 0.4398 0.6037 0.4687 0.0062  0.0186  -0.0420 137  THR A O   
1052 C CB  . THR A 137 ? 0.4809 0.6604 0.4906 0.0111  0.0212  -0.0386 137  THR A CB  
1053 O OG1 . THR A 137 ? 0.4732 0.6725 0.4816 0.0129  0.0185  -0.0415 137  THR A OG1 
1054 C CG2 . THR A 137 ? 0.4941 0.6724 0.4935 0.0124  0.0244  -0.0356 137  THR A CG2 
1055 N N   . GLY A 138 ? 0.4341 0.6111 0.4719 -0.0023 0.0208  -0.0577 138  GLY A N   
1056 C CA  . GLY A 138 ? 0.4241 0.5989 0.4674 -0.0049 0.0201  -0.0601 138  GLY A CA  
1057 C C   . GLY A 138 ? 0.4133 0.5686 0.4620 -0.0045 0.0209  -0.0569 138  GLY A C   
1058 O O   . GLY A 138 ? 0.4129 0.5583 0.4640 -0.0037 0.0225  -0.0564 138  GLY A O   
1059 N N   . VAL A 139 ? 0.4081 0.5603 0.4586 -0.0048 0.0196  -0.0550 139  VAL A N   
1060 C CA  . VAL A 139 ? 0.4048 0.5401 0.4596 -0.0042 0.0203  -0.0518 139  VAL A CA  
1061 C C   . VAL A 139 ? 0.4151 0.5461 0.4741 -0.0098 0.0232  -0.0584 139  VAL A C   
1062 O O   . VAL A 139 ? 0.4201 0.5631 0.4791 -0.0153 0.0245  -0.0658 139  VAL A O   
1063 C CB  . VAL A 139 ? 0.3962 0.5279 0.4483 0.0001  0.0172  -0.0429 139  VAL A CB  
1064 C CG1 . VAL A 139 ? 0.3853 0.5187 0.4308 0.0044  0.0163  -0.0370 139  VAL A CG1 
1065 C CG2 . VAL A 139 ? 0.3831 0.5247 0.4342 -0.0007 0.0155  -0.0435 139  VAL A CG2 
1066 N N   . GLY A 140 ? 0.4235 0.5379 0.4853 -0.0088 0.0248  -0.0558 140  GLY A N   
1067 C CA  . GLY A 140 ? 0.4389 0.5432 0.5025 -0.0140 0.0295  -0.0610 140  GLY A CA  
1068 C C   . GLY A 140 ? 0.4439 0.5526 0.5071 -0.0176 0.0285  -0.0607 140  GLY A C   
1069 O O   . GLY A 140 ? 0.4361 0.5564 0.4979 -0.0147 0.0237  -0.0559 140  GLY A O   
1070 N N   . LYS A 141 ? 0.4605 0.5587 0.5241 -0.0238 0.0339  -0.0660 141  LYS A N   
1071 C CA  . LYS A 141 ? 0.4641 0.5664 0.5276 -0.0290 0.0343  -0.0672 141  LYS A CA  
1072 C C   . LYS A 141 ? 0.4587 0.5546 0.5220 -0.0228 0.0302  -0.0570 141  LYS A C   
1073 O O   . LYS A 141 ? 0.4564 0.5384 0.5196 -0.0164 0.0296  -0.0501 141  LYS A O   
1074 C CB  . LYS A 141 ? 0.4843 0.5712 0.5466 -0.0379 0.0430  -0.0749 141  LYS A CB  
1075 C CG  . LYS A 141 ? 0.5146 0.6132 0.5768 -0.0489 0.0482  -0.0883 141  LYS A CG  
1076 C CD  . LYS A 141 ? 0.5451 0.6234 0.6042 -0.0589 0.0589  -0.0959 141  LYS A CD  
1077 C CE  . LYS A 141 ? 0.5627 0.6562 0.6218 -0.0731 0.0647  -0.1113 141  LYS A CE  
1078 N NZ  . LYS A 141 ? 0.5980 0.6680 0.6524 -0.0845 0.0773  -0.1193 141  LYS A NZ  
1079 N N   . TRP A 142 ? 0.4554 0.5638 0.5188 -0.0249 0.0277  -0.0567 142  TRP A N   
1080 C CA  . TRP A 142 ? 0.4465 0.5492 0.5096 -0.0209 0.0249  -0.0486 142  TRP A CA  
1081 C C   . TRP A 142 ? 0.4539 0.5370 0.5162 -0.0247 0.0303  -0.0487 142  TRP A C   
1082 O O   . TRP A 142 ? 0.4640 0.5386 0.5253 -0.0318 0.0370  -0.0560 142  TRP A O   
1083 C CB  . TRP A 142 ? 0.4442 0.5669 0.5074 -0.0215 0.0214  -0.0491 142  TRP A CB  
1084 C CG  . TRP A 142 ? 0.4360 0.5728 0.4972 -0.0139 0.0162  -0.0447 142  TRP A CG  
1085 C CD1 . TRP A 142 ? 0.4433 0.6016 0.5032 -0.0134 0.0145  -0.0487 142  TRP A CD1 
1086 C CD2 . TRP A 142 ? 0.4147 0.5440 0.4733 -0.0056 0.0130  -0.0353 142  TRP A CD2 
1087 N NE1 . TRP A 142 ? 0.4428 0.6049 0.4983 -0.0042 0.0108  -0.0413 142  TRP A NE1 
1088 C CE2 . TRP A 142 ? 0.4119 0.5553 0.4665 -0.0003 0.0103  -0.0335 142  TRP A CE2 
1089 C CE3 . TRP A 142 ? 0.4355 0.5484 0.4941 -0.0026 0.0127  -0.0286 142  TRP A CE3 
1090 C CZ2 . TRP A 142 ? 0.4140 0.5515 0.4637 0.0070  0.0087  -0.0255 142  TRP A CZ2 
1091 C CZ3 . TRP A 142 ? 0.4395 0.5503 0.4946 0.0035  0.0104  -0.0219 142  TRP A CZ3 
1092 C CH2 . TRP A 142 ? 0.4267 0.5478 0.4771 0.0078  0.0090  -0.0205 142  TRP A CH2 
1093 N N   . PHE A 143 ? 0.4484 0.5236 0.5101 -0.0201 0.0281  -0.0407 143  PHE A N   
1094 C CA  . PHE A 143 ? 0.4559 0.5128 0.5152 -0.0222 0.0328  -0.0388 143  PHE A CA  
1095 C C   . PHE A 143 ? 0.4609 0.5240 0.5199 -0.0315 0.0357  -0.0444 143  PHE A C   
1096 O O   . PHE A 143 ? 0.4476 0.5317 0.5090 -0.0328 0.0316  -0.0465 143  PHE A O   
1097 C CB  . PHE A 143 ? 0.4479 0.4977 0.5065 -0.0141 0.0290  -0.0287 143  PHE A CB  
1098 C CG  . PHE A 143 ? 0.4278 0.4925 0.4880 -0.0113 0.0227  -0.0248 143  PHE A CG  
1099 C CD1 . PHE A 143 ? 0.4196 0.4893 0.4797 -0.0145 0.0223  -0.0244 143  PHE A CD1 
1100 C CD2 . PHE A 143 ? 0.4144 0.4868 0.4754 -0.0057 0.0183  -0.0216 143  PHE A CD2 
1101 C CE1 . PHE A 143 ? 0.4060 0.4875 0.4665 -0.0108 0.0174  -0.0208 143  PHE A CE1 
1102 C CE2 . PHE A 143 ? 0.3961 0.4779 0.4563 -0.0027 0.0143  -0.0179 143  PHE A CE2 
1103 C CZ  . PHE A 143 ? 0.4052 0.4913 0.4652 -0.0046 0.0138  -0.0174 143  PHE A CZ  
1104 N N   . GLU A 144 ? 0.4826 0.5275 0.5378 -0.0374 0.0434  -0.0468 144  GLU A N   
1105 C CA  . GLU A 144 ? 0.4966 0.5447 0.5507 -0.0471 0.0474  -0.0516 144  GLU A CA  
1106 C C   . GLU A 144 ? 0.4901 0.5387 0.5441 -0.0421 0.0429  -0.0429 144  GLU A C   
1107 O O   . GLU A 144 ? 0.4917 0.5307 0.5448 -0.0327 0.0395  -0.0337 144  GLU A O   
1108 C CB  . GLU A 144 ? 0.5249 0.5482 0.5725 -0.0554 0.0589  -0.0563 144  GLU A CB  
1109 C CG  . GLU A 144 ? 0.5580 0.5816 0.6050 -0.0643 0.0656  -0.0681 144  GLU A CG  
1110 C CD  . GLU A 144 ? 0.5865 0.6368 0.6372 -0.0770 0.0663  -0.0801 144  GLU A CD  
1111 O OE1 . GLU A 144 ? 0.6031 0.6516 0.6513 -0.0873 0.0722  -0.0849 144  GLU A OE1 
1112 O OE2 . GLU A 144 ? 0.5822 0.6567 0.6377 -0.0766 0.0613  -0.0850 144  GLU A OE2 
1113 N N   . PRO A 145 ? 0.4853 0.5471 0.5405 -0.0488 0.0430  -0.0466 145  PRO A N   
1114 C CA  . PRO A 145 ? 0.4800 0.5417 0.5348 -0.0452 0.0399  -0.0394 145  PRO A CA  
1115 C C   . PRO A 145 ? 0.4917 0.5265 0.5406 -0.0415 0.0436  -0.0315 145  PRO A C   
1116 O O   . PRO A 145 ? 0.5137 0.5289 0.5571 -0.0468 0.0521  -0.0340 145  PRO A O   
1117 C CB  . PRO A 145 ? 0.4849 0.5600 0.5405 -0.0563 0.0434  -0.0475 145  PRO A CB  
1118 C CG  . PRO A 145 ? 0.4803 0.5758 0.5394 -0.0622 0.0439  -0.0581 145  PRO A CG  
1119 C CD  . PRO A 145 ? 0.4882 0.5693 0.5456 -0.0602 0.0462  -0.0586 145  PRO A CD  
1120 N N   . PHE A 146 ? 0.4823 0.5165 0.5316 -0.0322 0.0378  -0.0222 146  PHE A N   
1121 C CA  . PHE A 146 ? 0.4871 0.5010 0.5308 -0.0267 0.0401  -0.0140 146  PHE A CA  
1122 C C   . PHE A 146 ? 0.4780 0.4972 0.5217 -0.0235 0.0358  -0.0076 146  PHE A C   
1123 O O   . PHE A 146 ? 0.4652 0.5015 0.5130 -0.0255 0.0318  -0.0097 146  PHE A O   
1124 C CB  . PHE A 146 ? 0.4851 0.4929 0.5290 -0.0170 0.0378  -0.0095 146  PHE A CB  
1125 C CG  . PHE A 146 ? 0.4502 0.4738 0.4991 -0.0102 0.0293  -0.0059 146  PHE A CG  
1126 C CD1 . PHE A 146 ? 0.4192 0.4576 0.4726 -0.0109 0.0257  -0.0103 146  PHE A CD1 
1127 C CD2 . PHE A 146 ? 0.4430 0.4663 0.4910 -0.0036 0.0258  0.0015  146  PHE A CD2 
1128 C CE1 . PHE A 146 ? 0.3937 0.4426 0.4496 -0.0054 0.0199  -0.0069 146  PHE A CE1 
1129 C CE2 . PHE A 146 ? 0.4209 0.4568 0.4724 0.0006  0.0198  0.0035  146  PHE A CE2 
1130 C CZ  . PHE A 146 ? 0.4057 0.4525 0.4606 -0.0004 0.0174  -0.0005 146  PHE A CZ  
1131 N N   . LYS A 147 ? 0.4884 0.4935 0.5269 -0.0177 0.0370  0.0000  147  LYS A N   
1132 C CA  . LYS A 147 ? 0.4907 0.5011 0.5288 -0.0143 0.0331  0.0061  147  LYS A CA  
1133 C C   . LYS A 147 ? 0.4935 0.4988 0.5291 -0.0040 0.0306  0.0141  147  LYS A C   
1134 O O   . LYS A 147 ? 0.5077 0.5000 0.5392 0.0009  0.0340  0.0166  147  LYS A O   
1135 C CB  . LYS A 147 ? 0.5073 0.5097 0.5402 -0.0211 0.0385  0.0061  147  LYS A CB  
1136 C CG  . LYS A 147 ? 0.5464 0.5237 0.5693 -0.0205 0.0470  0.0098  147  LYS A CG  
1137 C CD  . LYS A 147 ? 0.5795 0.5488 0.5958 -0.0269 0.0523  0.0111  147  LYS A CD  
1138 C CE  . LYS A 147 ? 0.6155 0.5564 0.6189 -0.0239 0.0614  0.0172  147  LYS A CE  
1139 N NZ  . LYS A 147 ? 0.6251 0.5481 0.6242 -0.0290 0.0703  0.0114  147  LYS A NZ  
1140 N N   . VAL A 148 ? 0.4835 0.5004 0.5212 -0.0007 0.0252  0.0177  148  VAL A N   
1141 C CA  . VAL A 148 ? 0.4810 0.4989 0.5165 0.0078  0.0226  0.0243  148  VAL A CA  
1142 C C   . VAL A 148 ? 0.4892 0.5098 0.5215 0.0073  0.0218  0.0285  148  VAL A C   
1143 O O   . VAL A 148 ? 0.4793 0.5086 0.5145 0.0022  0.0200  0.0258  148  VAL A O   
1144 C CB  . VAL A 148 ? 0.4643 0.4965 0.5056 0.0113  0.0169  0.0230  148  VAL A CB  
1145 C CG1 . VAL A 148 ? 0.4518 0.4809 0.4952 0.0135  0.0179  0.0203  148  VAL A CG1 
1146 C CG2 . VAL A 148 ? 0.4330 0.4766 0.4786 0.0063  0.0139  0.0192  148  VAL A CG2 
1147 N N   . ASP A 149 ? 0.5111 0.5249 0.5369 0.0137  0.0236  0.0352  149  ASP A N   
1148 C CA  . ASP A 149 ? 0.5226 0.5389 0.5439 0.0139  0.0233  0.0397  149  ASP A CA  
1149 C C   . ASP A 149 ? 0.5126 0.5460 0.5361 0.0198  0.0175  0.0422  149  ASP A C   
1150 O O   . ASP A 149 ? 0.5171 0.5556 0.5416 0.0269  0.0157  0.0436  149  ASP A O   
1151 C CB  . ASP A 149 ? 0.5516 0.5491 0.5618 0.0177  0.0298  0.0462  149  ASP A CB  
1152 C CG  . ASP A 149 ? 0.5927 0.5713 0.5992 0.0099  0.0375  0.0425  149  ASP A CG  
1153 O OD1 . ASP A 149 ? 0.6338 0.6182 0.6473 0.0012  0.0369  0.0346  149  ASP A OD1 
1154 O OD2 . ASP A 149 ? 0.6623 0.6203 0.6579 0.0123  0.0449  0.0473  149  ASP A OD2 
1155 N N   . TYR A 150 ? 0.5036 0.5473 0.5280 0.0161  0.0152  0.0418  150  TYR A N   
1156 C CA  . TYR A 150 ? 0.5020 0.5627 0.5273 0.0195  0.0111  0.0431  150  TYR A CA  
1157 C C   . TYR A 150 ? 0.5126 0.5751 0.5316 0.0200  0.0119  0.0477  150  TYR A C   
1158 O O   . TYR A 150 ? 0.5238 0.5756 0.5392 0.0155  0.0154  0.0486  150  TYR A O   
1159 C CB  . TYR A 150 ? 0.4883 0.5607 0.5204 0.0137  0.0081  0.0366  150  TYR A CB  
1160 C CG  . TYR A 150 ? 0.4822 0.5533 0.5195 0.0129  0.0075  0.0322  150  TYR A CG  
1161 C CD1 . TYR A 150 ? 0.4726 0.5353 0.5120 0.0088  0.0091  0.0290  150  TYR A CD1 
1162 C CD2 . TYR A 150 ? 0.4988 0.5796 0.5388 0.0160  0.0054  0.0307  150  TYR A CD2 
1163 C CE1 . TYR A 150 ? 0.4655 0.5283 0.5088 0.0085  0.0085  0.0253  150  TYR A CE1 
1164 C CE2 . TYR A 150 ? 0.4997 0.5791 0.5436 0.0150  0.0053  0.0269  150  TYR A CE2 
1165 C CZ  . TYR A 150 ? 0.4950 0.5647 0.5402 0.0117  0.0067  0.0246  150  TYR A CZ  
1166 O OH  . TYR A 150 ? 0.5223 0.5916 0.5704 0.0112  0.0066  0.0211  150  TYR A OH  
1167 N N   . LYS A 151 ? 0.5127 0.5909 0.5302 0.0249  0.0089  0.0501  151  LYS A N   
1168 C CA  . LYS A 151 ? 0.5210 0.6060 0.5329 0.0252  0.0089  0.0538  151  LYS A CA  
1169 C C   . LYS A 151 ? 0.5071 0.6150 0.5234 0.0222  0.0049  0.0490  151  LYS A C   
1170 O O   . LYS A 151 ? 0.4996 0.6216 0.5192 0.0255  0.0023  0.0469  151  LYS A O   
1171 C CB  . LYS A 151 ? 0.5403 0.6218 0.5424 0.0363  0.0106  0.0631  151  LYS A CB  
1172 C CG  . LYS A 151 ? 0.5766 0.6312 0.5702 0.0374  0.0171  0.0683  151  LYS A CG  
1173 C CD  . LYS A 151 ? 0.6243 0.6729 0.6053 0.0503  0.0199  0.0789  151  LYS A CD  
1174 C CE  . LYS A 151 ? 0.6573 0.6749 0.6273 0.0497  0.0287  0.0840  151  LYS A CE  
1175 N NZ  . LYS A 151 ? 0.6595 0.6590 0.6328 0.0463  0.0325  0.0796  151  LYS A NZ  
1176 N N   . PHE A 152 ? 0.5041 0.6159 0.5204 0.0151  0.0053  0.0462  152  PHE A N   
1177 C CA  . PHE A 152 ? 0.4943 0.6254 0.5134 0.0106  0.0032  0.0406  152  PHE A CA  
1178 C C   . PHE A 152 ? 0.5015 0.6381 0.5165 0.0068  0.0041  0.0412  152  PHE A C   
1179 O O   . PHE A 152 ? 0.5030 0.6277 0.5135 0.0069  0.0063  0.0456  152  PHE A O   
1180 C CB  . PHE A 152 ? 0.4816 0.6103 0.5074 0.0036  0.0038  0.0326  152  PHE A CB  
1181 C CG  . PHE A 152 ? 0.4555 0.5725 0.4822 -0.0022 0.0061  0.0302  152  PHE A CG  
1182 C CD1 . PHE A 152 ? 0.4199 0.5218 0.4469 -0.0015 0.0075  0.0323  152  PHE A CD1 
1183 C CD2 . PHE A 152 ? 0.4416 0.5640 0.4686 -0.0083 0.0075  0.0249  152  PHE A CD2 
1184 C CE1 . PHE A 152 ? 0.4085 0.5046 0.4369 -0.0062 0.0094  0.0295  152  PHE A CE1 
1185 C CE2 . PHE A 152 ? 0.4005 0.5139 0.4282 -0.0118 0.0097  0.0228  152  PHE A CE2 
1186 C CZ  . PHE A 152 ? 0.3985 0.5006 0.4273 -0.0103 0.0102  0.0252  152  PHE A CZ  
1187 N N   . LYS A 153 ? 0.5096 0.6647 0.5258 0.0026  0.0030  0.0359  153  LYS A N   
1188 C CA  . LYS A 153 ? 0.5257 0.6889 0.5383 -0.0017 0.0038  0.0349  153  LYS A CA  
1189 C C   . LYS A 153 ? 0.5195 0.6818 0.5361 -0.0114 0.0061  0.0258  153  LYS A C   
1190 O O   . LYS A 153 ? 0.5161 0.6882 0.5355 -0.0156 0.0065  0.0189  153  LYS A O   
1191 C CB  . LYS A 153 ? 0.5354 0.7236 0.5442 0.0019  0.0014  0.0362  153  LYS A CB  
1192 C CG  . LYS A 153 ? 0.5714 0.7700 0.5754 -0.0019 0.0021  0.0357  153  LYS A CG  
1193 C CD  . LYS A 153 ? 0.6217 0.8476 0.6209 0.0036  -0.0006 0.0383  153  LYS A CD  
1194 C CE  . LYS A 153 ? 0.6454 0.8857 0.6407 -0.0025 0.0002  0.0351  153  LYS A CE  
1195 N NZ  . LYS A 153 ? 0.6625 0.8835 0.6531 -0.0037 0.0028  0.0403  153  LYS A NZ  
1196 N N   . TYR A 154 ? 0.5254 0.6754 0.5417 -0.0148 0.0085  0.0255  154  TYR A N   
1197 C CA  . TYR A 154 ? 0.5269 0.6739 0.5454 -0.0217 0.0116  0.0180  154  TYR A CA  
1198 C C   . TYR A 154 ? 0.5450 0.7070 0.5604 -0.0271 0.0129  0.0136  154  TYR A C   
1199 O O   . TYR A 154 ? 0.5510 0.7168 0.5628 -0.0272 0.0129  0.0166  154  TYR A O   
1200 C CB  . TYR A 154 ? 0.5174 0.6497 0.5369 -0.0221 0.0135  0.0190  154  TYR A CB  
1201 C CG  . TYR A 154 ? 0.4814 0.6100 0.5021 -0.0264 0.0171  0.0122  154  TYR A CG  
1202 C CD1 . TYR A 154 ? 0.4467 0.5697 0.4689 -0.0272 0.0190  0.0075  154  TYR A CD1 
1203 C CD2 . TYR A 154 ? 0.4481 0.5775 0.4670 -0.0291 0.0193  0.0108  154  TYR A CD2 
1204 C CE1 . TYR A 154 ? 0.4202 0.5364 0.4412 -0.0295 0.0237  0.0023  154  TYR A CE1 
1205 C CE2 . TYR A 154 ? 0.4322 0.5570 0.4512 -0.0313 0.0233  0.0050  154  TYR A CE2 
1206 C CZ  . TYR A 154 ? 0.4075 0.5247 0.4270 -0.0310 0.0257  0.0011  154  TYR A CZ  
1207 O OH  . TYR A 154 ? 0.4332 0.5426 0.4506 -0.0315 0.0310  -0.0037 154  TYR A OH  
1208 N N   . THR A 155 ? 0.5642 0.7348 0.5805 -0.0324 0.0147  0.0059  155  THR A N   
1209 C CA  . THR A 155 ? 0.5844 0.7720 0.5978 -0.0391 0.0166  -0.0001 155  THR A CA  
1210 C C   . THR A 155 ? 0.6081 0.7861 0.6202 -0.0459 0.0224  -0.0070 155  THR A C   
1211 O O   . THR A 155 ? 0.6113 0.8011 0.6205 -0.0526 0.0250  -0.0131 155  THR A O   
1212 C CB  . THR A 155 ? 0.5818 0.7873 0.5961 -0.0431 0.0166  -0.0066 155  THR A CB  
1213 O OG1 . THR A 155 ? 0.5758 0.7674 0.5925 -0.0462 0.0201  -0.0115 155  THR A OG1 
1214 C CG2 . THR A 155 ? 0.5681 0.7893 0.5829 -0.0348 0.0108  0.0000  155  THR A CG2 
1215 N N   . GLY A 156 ? 0.6355 0.7931 0.6492 -0.0437 0.0246  -0.0062 156  GLY A N   
1216 C CA  . GLY A 156 ? 0.6653 0.8120 0.6770 -0.0472 0.0304  -0.0116 156  GLY A CA  
1217 C C   . GLY A 156 ? 0.6934 0.8231 0.7046 -0.0473 0.0353  -0.0156 156  GLY A C   
1218 O O   . GLY A 156 ? 0.6940 0.8228 0.7063 -0.0474 0.0347  -0.0161 156  GLY A O   
1219 N N   . THR A 157 ? 0.7302 0.8466 0.7389 -0.0465 0.0407  -0.0182 157  THR A N   
1220 C CA  . THR A 157 ? 0.7608 0.8582 0.7665 -0.0443 0.0465  -0.0206 157  THR A CA  
1221 C C   . THR A 157 ? 0.7954 0.8895 0.7958 -0.0530 0.0533  -0.0288 157  THR A C   
1222 O O   . THR A 157 ? 0.8009 0.9028 0.7982 -0.0612 0.0573  -0.0356 157  THR A O   
1223 C CB  . THR A 157 ? 0.7680 0.8532 0.7708 -0.0395 0.0513  -0.0212 157  THR A CB  
1224 O OG1 . THR A 157 ? 0.7748 0.8403 0.7723 -0.0357 0.0579  -0.0227 157  THR A OG1 
1225 C CG2 . THR A 157 ? 0.7650 0.8549 0.7641 -0.0459 0.0561  -0.0273 157  THR A CG2 
1226 N N   . PRO A 158 ? 0.8245 0.9079 0.8236 -0.0522 0.0554  -0.0290 158  PRO A N   
1227 C CA  . PRO A 158 ? 0.8573 0.9377 0.8511 -0.0621 0.0628  -0.0375 158  PRO A CA  
1228 C C   . PRO A 158 ? 0.9004 0.9543 0.8838 -0.0639 0.0752  -0.0426 158  PRO A C   
1229 O O   . PRO A 158 ? 0.9172 0.9645 0.8945 -0.0733 0.0833  -0.0502 158  PRO A O   
1230 C CB  . PRO A 158 ? 0.8510 0.9346 0.8486 -0.0602 0.0583  -0.0343 158  PRO A CB  
1231 C CG  . PRO A 158 ? 0.8292 0.9036 0.8303 -0.0480 0.0530  -0.0250 158  PRO A CG  
1232 C CD  . PRO A 158 ? 0.8146 0.8907 0.8172 -0.0433 0.0508  -0.0218 158  PRO A CD  
1246 N N   . GLU B 3   ? 0.6775 1.1448 0.7255 0.0756  -0.0027 -0.0684 3    GLU B N   
1247 C CA  . GLU B 3   ? 0.6604 1.1024 0.7113 0.0593  0.0007  -0.0538 3    GLU B CA  
1248 C C   . GLU B 3   ? 0.6353 1.1026 0.6915 0.0400  0.0064  -0.0435 3    GLU B C   
1249 O O   . GLU B 3   ? 0.6346 1.1342 0.6948 0.0343  0.0082  -0.0437 3    GLU B O   
1250 C CB  . GLU B 3   ? 0.6659 1.0944 0.7177 0.0626  -0.0012 -0.0538 3    GLU B CB  
1251 C CG  . GLU B 3   ? 0.6892 1.0763 0.7393 0.0543  -0.0004 -0.0432 3    GLU B CG  
1252 C CD  . GLU B 3   ? 0.7257 1.1040 0.7769 0.0542  -0.0013 -0.0417 3    GLU B CD  
1253 O OE1 . GLU B 3   ? 0.7494 1.1437 0.8055 0.0424  0.0019  -0.0353 3    GLU B OE1 
1254 O OE2 . GLU B 3   ? 0.7579 1.1111 0.8031 0.0648  -0.0059 -0.0465 3    GLU B OE2 
1255 N N   . VAL B 4   ? 0.6146 1.0669 0.6691 0.0295  0.0084  -0.0344 4    VAL B N   
1256 C CA  . VAL B 4   ? 0.5985 1.0676 0.6535 0.0109  0.0119  -0.0238 4    VAL B CA  
1257 C C   . VAL B 4   ? 0.5847 1.0244 0.6387 -0.0012 0.0123  -0.0110 4    VAL B C   
1258 O O   . VAL B 4   ? 0.5838 0.9895 0.6368 0.0014  0.0114  -0.0074 4    VAL B O   
1259 C CB  . VAL B 4   ? 0.5989 1.0707 0.6507 0.0076  0.0125  -0.0219 4    VAL B CB  
1260 C CG1 . VAL B 4   ? 0.6044 1.0919 0.6535 -0.0121 0.0148  -0.0108 4    VAL B CG1 
1261 C CG2 . VAL B 4   ? 0.5990 1.0967 0.6499 0.0214  0.0115  -0.0357 4    VAL B CG2 
1262 N N   . PRO B 5   ? 0.5737 1.0274 0.6269 -0.0149 0.0134  -0.0045 5    PRO B N   
1263 C CA  . PRO B 5   ? 0.5660 0.9897 0.6154 -0.0250 0.0125  0.0064  5    PRO B CA  
1264 C C   . PRO B 5   ? 0.5620 0.9669 0.6049 -0.0357 0.0117  0.0171  5    PRO B C   
1265 O O   . PRO B 5   ? 0.5624 0.9855 0.6023 -0.0423 0.0121  0.0188  5    PRO B O   
1266 C CB  . PRO B 5   ? 0.5713 1.0190 0.6192 -0.0373 0.0127  0.0091  5    PRO B CB  
1267 C CG  . PRO B 5   ? 0.5749 1.0679 0.6239 -0.0416 0.0144  0.0046  5    PRO B CG  
1268 C CD  . PRO B 5   ? 0.5756 1.0747 0.6296 -0.0226 0.0148  -0.0071 5    PRO B CD  
1269 N N   . ILE B 6   ? 0.5537 0.9230 0.5937 -0.0363 0.0100  0.0237  6    ILE B N   
1270 C CA  . ILE B 6   ? 0.5515 0.8995 0.5846 -0.0432 0.0077  0.0331  6    ILE B CA  
1271 C C   . ILE B 6   ? 0.5625 0.8925 0.5851 -0.0558 0.0043  0.0428  6    ILE B C   
1272 O O   . ILE B 6   ? 0.5622 0.8680 0.5843 -0.0514 0.0034  0.0437  6    ILE B O   
1273 C CB  . ILE B 6   ? 0.5450 0.8667 0.5823 -0.0312 0.0076  0.0315  6    ILE B CB  
1274 C CG1 . ILE B 6   ? 0.5253 0.8603 0.5689 -0.0213 0.0093  0.0230  6    ILE B CG1 
1275 C CG2 . ILE B 6   ? 0.5367 0.8371 0.5670 -0.0360 0.0043  0.0405  6    ILE B CG2 
1276 C CD1 . ILE B 6   ? 0.5114 0.8244 0.5584 -0.0124 0.0091  0.0216  6    ILE B CD1 
1277 N N   . GLY B 7   ? 0.5734 0.9142 0.5855 -0.0720 0.0019  0.0501  7    GLY B N   
1278 C CA  . GLY B 7   ? 0.5933 0.9117 0.5900 -0.0862 -0.0034 0.0605  7    GLY B CA  
1279 C C   . GLY B 7   ? 0.5970 0.9162 0.5929 -0.0906 -0.0035 0.0598  7    GLY B C   
1280 O O   . GLY B 7   ? 0.5827 0.9297 0.5896 -0.0859 0.0006  0.0518  7    GLY B O   
1281 N N   . ASP B 8   ? 0.6193 0.9068 0.6008 -0.0987 -0.0092 0.0678  8    ASP B N   
1282 C CA  . ASP B 8   ? 0.6265 0.9092 0.6044 -0.1044 -0.0105 0.0683  8    ASP B CA  
1283 C C   . ASP B 8   ? 0.6122 0.8692 0.5972 -0.0872 -0.0091 0.0632  8    ASP B C   
1284 O O   . ASP B 8   ? 0.6124 0.8424 0.5961 -0.0771 -0.0106 0.0640  8    ASP B O   
1285 C CB  . ASP B 8   ? 0.6634 0.9217 0.6175 -0.1241 -0.0188 0.0800  8    ASP B CB  
1286 C CG  . ASP B 8   ? 0.6956 0.9799 0.6391 -0.1460 -0.0207 0.0866  8    ASP B CG  
1287 O OD1 . ASP B 8   ? 0.6963 1.0267 0.6524 -0.1480 -0.0147 0.0810  8    ASP B OD1 
1288 O OD2 . ASP B 8   ? 0.7464 1.0046 0.6672 -0.1613 -0.0290 0.0974  8    ASP B OD2 
1289 N N   . PRO B 9   ? 0.5988 0.8659 0.5909 -0.0840 -0.0066 0.0578  9    PRO B N   
1290 C CA  . PRO B 9   ? 0.5864 0.8286 0.5825 -0.0705 -0.0057 0.0539  9    PRO B CA  
1291 C C   . PRO B 9   ? 0.6014 0.8071 0.5807 -0.0768 -0.0119 0.0608  9    PRO B C   
1292 O O   . PRO B 9   ? 0.6123 0.8181 0.5795 -0.0926 -0.0161 0.0662  9    PRO B O   
1293 C CB  . PRO B 9   ? 0.5716 0.8386 0.5782 -0.0669 -0.0023 0.0464  9    PRO B CB  
1294 C CG  . PRO B 9   ? 0.5889 0.8864 0.5914 -0.0838 -0.0036 0.0494  9    PRO B CG  
1295 C CD  . PRO B 9   ? 0.5948 0.8995 0.5915 -0.0926 -0.0047 0.0548  9    PRO B CD  
1296 N N   . LYS B 10  ? 0.5977 0.7736 0.5752 -0.0646 -0.0129 0.0603  10   LYS B N   
1297 C CA  . LYS B 10  ? 0.6121 0.7503 0.5721 -0.0664 -0.0196 0.0652  10   LYS B CA  
1298 C C   . LYS B 10  ? 0.5973 0.7261 0.5582 -0.0623 -0.0184 0.0614  10   LYS B C   
1299 O O   . LYS B 10  ? 0.5743 0.7186 0.5504 -0.0527 -0.0122 0.0543  10   LYS B O   
1300 C CB  . LYS B 10  ? 0.6190 0.7337 0.5769 -0.0530 -0.0215 0.0650  10   LYS B CB  
1301 C CG  . LYS B 10  ? 0.6455 0.7677 0.6034 -0.0544 -0.0228 0.0682  10   LYS B CG  
1302 C CD  . LYS B 10  ? 0.6939 0.8071 0.6313 -0.0728 -0.0309 0.0777  10   LYS B CD  
1303 C CE  . LYS B 10  ? 0.7043 0.8188 0.6387 -0.0729 -0.0336 0.0814  10   LYS B CE  
1304 N NZ  . LYS B 10  ? 0.6602 0.8116 0.6153 -0.0686 -0.0251 0.0760  10   LYS B NZ  
1305 N N   . GLU B 11  ? 0.6112 0.7121 0.5534 -0.0698 -0.0254 0.0662  11   GLU B N   
1306 C CA  . GLU B 11  ? 0.6060 0.6915 0.5455 -0.0653 -0.0255 0.0629  11   GLU B CA  
1307 C C   . GLU B 11  ? 0.6104 0.6561 0.5356 -0.0554 -0.0309 0.0634  11   GLU B C   
1308 O O   . GLU B 11  ? 0.6410 0.6577 0.5436 -0.0637 -0.0402 0.0693  11   GLU B O   
1309 C CB  . GLU B 11  ? 0.6234 0.7133 0.5524 -0.0834 -0.0296 0.0670  11   GLU B CB  
1310 C CG  . GLU B 11  ? 0.6320 0.7672 0.5764 -0.0908 -0.0243 0.0646  11   GLU B CG  
1311 C CD  . GLU B 11  ? 0.6735 0.8193 0.6131 -0.1041 -0.0266 0.0656  11   GLU B CD  
1312 O OE1 . GLU B 11  ? 0.7201 0.8373 0.6398 -0.1146 -0.0339 0.0711  11   GLU B OE1 
1313 O OE2 . GLU B 11  ? 0.6592 0.8420 0.6142 -0.1034 -0.0218 0.0604  11   GLU B OE2 
1314 N N   . LEU B 12  ? 0.5808 0.6257 0.5178 -0.0376 -0.0256 0.0569  12   LEU B N   
1315 C CA  . LEU B 12  ? 0.5856 0.6007 0.5123 -0.0245 -0.0295 0.0552  12   LEU B CA  
1316 C C   . LEU B 12  ? 0.5550 0.5716 0.4913 -0.0116 -0.0233 0.0476  12   LEU B C   
1317 O O   . LEU B 12  ? 0.5216 0.5627 0.4757 -0.0086 -0.0152 0.0435  12   LEU B O   
1318 C CB  . LEU B 12  ? 0.5856 0.6027 0.5163 -0.0155 -0.0299 0.0553  12   LEU B CB  
1319 C CG  . LEU B 12  ? 0.6024 0.6137 0.5207 -0.0269 -0.0372 0.0631  12   LEU B CG  
1320 C CD1 . LEU B 12  ? 0.6196 0.6437 0.5485 -0.0180 -0.0351 0.0620  12   LEU B CD1 
1321 C CD2 . LEU B 12  ? 0.6458 0.6153 0.5349 -0.0304 -0.0499 0.0681  12   LEU B CD2 
1322 N N   . ASN B 13  ? 0.5651 0.5537 0.4870 -0.0043 -0.0278 0.0458  13   ASN B N   
1323 C CA  . ASN B 13  ? 0.5486 0.5374 0.4768 0.0083  -0.0223 0.0385  13   ASN B CA  
1324 C C   . ASN B 13  ? 0.5251 0.5312 0.4642 0.0029  -0.0158 0.0363  13   ASN B C   
1325 O O   . ASN B 13  ? 0.5052 0.5264 0.4576 0.0103  -0.0085 0.0314  13   ASN B O   
1326 C CB  . ASN B 13  ? 0.5296 0.5332 0.4715 0.0225  -0.0168 0.0339  13   ASN B CB  
1327 C CG  . ASN B 13  ? 0.5379 0.5253 0.4692 0.0312  -0.0240 0.0348  13   ASN B CG  
1328 O OD1 . ASN B 13  ? 0.5260 0.4840 0.4381 0.0367  -0.0321 0.0343  13   ASN B OD1 
1329 N ND2 . ASN B 13  ? 0.4882 0.4931 0.4307 0.0332  -0.0220 0.0358  13   ASN B ND2 
1330 N N   . GLY B 14  ? 0.5285 0.5325 0.4605 -0.0106 -0.0194 0.0402  14   GLY B N   
1331 C CA  . GLY B 14  ? 0.5106 0.5306 0.4512 -0.0152 -0.0151 0.0380  14   GLY B CA  
1332 C C   . GLY B 14  ? 0.4791 0.5306 0.4394 -0.0143 -0.0084 0.0356  14   GLY B C   
1333 O O   . GLY B 14  ? 0.4601 0.5217 0.4281 -0.0113 -0.0044 0.0316  14   GLY B O   
1334 N N   . MET B 15  ? 0.4749 0.5395 0.4409 -0.0164 -0.0082 0.0381  15   MET B N   
1335 C CA  . MET B 15  ? 0.4544 0.5466 0.4368 -0.0145 -0.0030 0.0354  15   MET B CA  
1336 C C   . MET B 15  ? 0.4569 0.5667 0.4407 -0.0244 -0.0050 0.0393  15   MET B C   
1337 O O   . MET B 15  ? 0.4656 0.5645 0.4394 -0.0303 -0.0096 0.0447  15   MET B O   
1338 C CB  . MET B 15  ? 0.4432 0.5364 0.4336 -0.0033 0.0011  0.0323  15   MET B CB  
1339 C CG  . MET B 15  ? 0.4471 0.5294 0.4370 0.0055  0.0043  0.0281  15   MET B CG  
1340 S SD  . MET B 15  ? 0.4221 0.5125 0.4216 0.0154  0.0092  0.0250  15   MET B SD  
1341 C CE  . MET B 15  ? 0.4083 0.4869 0.4002 0.0189  0.0042  0.0283  15   MET B CE  
1342 N N   . GLU B 16  ? 0.4570 0.5937 0.4519 -0.0257 -0.0022 0.0363  16   GLU B N   
1343 C CA  . GLU B 16  ? 0.4634 0.6238 0.4623 -0.0330 -0.0025 0.0382  16   GLU B CA  
1344 C C   . GLU B 16  ? 0.4521 0.6213 0.4613 -0.0239 0.0012  0.0351  16   GLU B C   
1345 O O   . GLU B 16  ? 0.4408 0.6183 0.4588 -0.0153 0.0044  0.0291  16   GLU B O   
1346 C CB  . GLU B 16  ? 0.4619 0.6505 0.4667 -0.0377 -0.0021 0.0350  16   GLU B CB  
1347 C CG  . GLU B 16  ? 0.4860 0.7043 0.4938 -0.0467 -0.0023 0.0366  16   GLU B CG  
1348 C CD  . GLU B 16  ? 0.5093 0.7627 0.5266 -0.0456 -0.0010 0.0303  16   GLU B CD  
1349 O OE1 . GLU B 16  ? 0.5290 0.7826 0.5526 -0.0335 0.0002  0.0234  16   GLU B OE1 
1350 O OE2 . GLU B 16  ? 0.5131 0.7947 0.5304 -0.0566 -0.0019 0.0320  16   GLU B OE2 
1351 N N   . ILE B 17  ? 0.4596 0.6251 0.4656 -0.0264 -0.0002 0.0394  17   ILE B N   
1352 C CA  . ILE B 17  ? 0.4533 0.6260 0.4678 -0.0189 0.0026  0.0372  17   ILE B CA  
1353 C C   . ILE B 17  ? 0.4500 0.6471 0.4676 -0.0255 0.0025  0.0382  17   ILE B C   
1354 O O   . ILE B 17  ? 0.4631 0.6594 0.4720 -0.0358 -0.0010 0.0445  17   ILE B O   
1355 C CB  . ILE B 17  ? 0.4641 0.6159 0.4732 -0.0143 0.0006  0.0404  17   ILE B CB  
1356 C CG1 . ILE B 17  ? 0.4705 0.5991 0.4733 -0.0088 0.0000  0.0394  17   ILE B CG1 
1357 C CG2 . ILE B 17  ? 0.4352 0.5961 0.4545 -0.0062 0.0041  0.0372  17   ILE B CG2 
1358 C CD1 . ILE B 17  ? 0.4957 0.6054 0.4918 -0.0021 -0.0031 0.0412  17   ILE B CD1 
1359 N N   . ALA B 18  ? 0.4335 0.6506 0.4613 -0.0197 0.0057  0.0320  18   ALA B N   
1360 C CA  . ALA B 18  ? 0.4273 0.6709 0.4586 -0.0236 0.0061  0.0310  18   ALA B CA  
1361 C C   . ALA B 18  ? 0.4206 0.6682 0.4589 -0.0146 0.0083  0.0268  18   ALA B C   
1362 O O   . ALA B 18  ? 0.4202 0.6539 0.4613 -0.0062 0.0096  0.0238  18   ALA B O   
1363 C CB  . ALA B 18  ? 0.4187 0.6878 0.4537 -0.0249 0.0066  0.0260  18   ALA B CB  
1364 N N   . ALA B 19  ? 0.4154 0.6827 0.4551 -0.0179 0.0083  0.0267  19   ALA B N   
1365 C CA  . ALA B 19  ? 0.4061 0.6776 0.4506 -0.0109 0.0095  0.0229  19   ALA B CA  
1366 C C   . ALA B 19  ? 0.4030 0.7038 0.4505 -0.0099 0.0101  0.0170  19   ALA B C   
1367 O O   . ALA B 19  ? 0.4063 0.7278 0.4516 -0.0189 0.0099  0.0194  19   ALA B O   
1368 C CB  . ALA B 19  ? 0.4119 0.6731 0.4534 -0.0143 0.0083  0.0295  19   ALA B CB  
1369 N N   . VAL B 20  ? 0.3992 0.7017 0.4502 0.0006  0.0103  0.0091  20   VAL B N   
1370 C CA  . VAL B 20  ? 0.3998 0.7275 0.4522 0.0053  0.0100  0.0015  20   VAL B CA  
1371 C C   . VAL B 20  ? 0.4006 0.7180 0.4526 0.0132  0.0090  -0.0028 20   VAL B C   
1372 O O   . VAL B 20  ? 0.3994 0.6928 0.4508 0.0148  0.0088  -0.0006 20   VAL B O   
1373 C CB  . VAL B 20  ? 0.3984 0.7399 0.4519 0.0131  0.0088  -0.0071 20   VAL B CB  
1374 C CG1 . VAL B 20  ? 0.4012 0.7561 0.4551 0.0037  0.0096  -0.0029 20   VAL B CG1 
1375 C CG2 . VAL B 20  ? 0.3974 0.7129 0.4489 0.0232  0.0068  -0.0114 20   VAL B CG2 
1376 N N   . TYR B 21  ? 0.4022 0.7389 0.4535 0.0172  0.0082  -0.0090 21   TYR B N   
1377 C CA  . TYR B 21  ? 0.4098 0.7356 0.4581 0.0248  0.0059  -0.0143 21   TYR B CA  
1378 C C   . TYR B 21  ? 0.4192 0.7605 0.4638 0.0366  0.0029  -0.0265 21   TYR B C   
1379 O O   . TYR B 21  ? 0.4171 0.7888 0.4638 0.0371  0.0039  -0.0302 21   TYR B O   
1380 C CB  . TYR B 21  ? 0.4098 0.7362 0.4586 0.0180  0.0068  -0.0085 21   TYR B CB  
1381 C CG  . TYR B 21  ? 0.4147 0.7697 0.4631 0.0141  0.0078  -0.0091 21   TYR B CG  
1382 C CD1 . TYR B 21  ? 0.4280 0.7970 0.4770 0.0025  0.0098  -0.0013 21   TYR B CD1 
1383 C CD2 . TYR B 21  ? 0.4167 0.7834 0.4619 0.0210  0.0060  -0.0174 21   TYR B CD2 
1384 C CE1 . TYR B 21  ? 0.4179 0.8145 0.4649 -0.0035 0.0106  -0.0011 21   TYR B CE1 
1385 C CE2 . TYR B 21  ? 0.4186 0.8141 0.4630 0.0170  0.0073  -0.0182 21   TYR B CE2 
1386 C CZ  . TYR B 21  ? 0.4059 0.8175 0.4515 0.0040  0.0100  -0.0098 21   TYR B CZ  
1387 O OH  . TYR B 21  ? 0.4140 0.8554 0.4571 -0.0021 0.0112  -0.0099 21   TYR B OH  
1388 N N   . LEU B 22  ? 0.4366 0.7568 0.4742 0.0458  -0.0015 -0.0329 22   LEU B N   
1389 C CA  . LEU B 22  ? 0.4532 0.7801 0.4834 0.0601  -0.0067 -0.0459 22   LEU B CA  
1390 C C   . LEU B 22  ? 0.4666 0.7801 0.4883 0.0633  -0.0105 -0.0496 22   LEU B C   
1391 O O   . LEU B 22  ? 0.4573 0.7615 0.4809 0.0535  -0.0085 -0.0419 22   LEU B O   
1392 C CB  . LEU B 22  ? 0.4660 0.7728 0.4897 0.0702  -0.0117 -0.0516 22   LEU B CB  
1393 C CG  . LEU B 22  ? 0.4597 0.7628 0.4892 0.0652  -0.0090 -0.0458 22   LEU B CG  
1394 C CD1 . LEU B 22  ? 0.4666 0.7411 0.4962 0.0550  -0.0068 -0.0358 22   LEU B CD1 
1395 C CD2 . LEU B 22  ? 0.4805 0.7770 0.5031 0.0787  -0.0150 -0.0550 22   LEU B CD2 
1396 N N   . GLN B 23  ? 0.4907 0.8033 0.5021 0.0777  -0.0170 -0.0620 23   GLN B N   
1397 C CA  . GLN B 23  ? 0.5112 0.8028 0.5097 0.0819  -0.0231 -0.0669 23   GLN B CA  
1398 C C   . GLN B 23  ? 0.5165 0.7676 0.5072 0.0758  -0.0265 -0.0614 23   GLN B C   
1399 O O   . GLN B 23  ? 0.5057 0.7446 0.4980 0.0740  -0.0258 -0.0578 23   GLN B O   
1400 C CB  . GLN B 23  ? 0.5371 0.8317 0.5226 0.1013  -0.0312 -0.0828 23   GLN B CB  
1401 C CG  . GLN B 23  ? 0.5743 0.8455 0.5486 0.1145  -0.0392 -0.0903 23   GLN B CG  
1402 C CD  . GLN B 23  ? 0.5952 0.8935 0.5808 0.1190  -0.0356 -0.0918 23   GLN B CD  
1403 O OE1 . GLN B 23  ? 0.5720 0.9027 0.5737 0.1090  -0.0267 -0.0851 23   GLN B OE1 
1404 N NE2 . GLN B 23  ? 0.6279 0.9111 0.6033 0.1336  -0.0435 -0.1003 23   GLN B NE2 
1405 N N   . PRO B 24  ? 0.5336 0.7658 0.5153 0.0712  -0.0301 -0.0604 24   PRO B N   
1406 C CA  . PRO B 24  ? 0.5472 0.7450 0.5204 0.0628  -0.0334 -0.0550 24   PRO B CA  
1407 C C   . PRO B 24  ? 0.5728 0.7421 0.5301 0.0717  -0.0416 -0.0612 24   PRO B C   
1408 O O   . PRO B 24  ? 0.5941 0.7562 0.5373 0.0863  -0.0499 -0.0727 24   PRO B O   
1409 C CB  . PRO B 24  ? 0.5597 0.7456 0.5223 0.0586  -0.0381 -0.0562 24   PRO B CB  
1410 C CG  . PRO B 24  ? 0.5452 0.7632 0.5174 0.0605  -0.0337 -0.0577 24   PRO B CG  
1411 C CD  . PRO B 24  ? 0.5383 0.7811 0.5162 0.0723  -0.0316 -0.0643 24   PRO B CD  
1412 N N   . ILE B 25  ? 0.5738 0.7271 0.5322 0.0637  -0.0398 -0.0540 25   ILE B N   
1413 C CA  . ILE B 25  ? 0.5986 0.7244 0.5420 0.0704  -0.0473 -0.0582 25   ILE B CA  
1414 C C   . ILE B 25  ? 0.6333 0.7198 0.5566 0.0608  -0.0547 -0.0553 25   ILE B C   
1415 O O   . ILE B 25  ? 0.6232 0.7080 0.5522 0.0448  -0.0496 -0.0456 25   ILE B O   
1416 C CB  . ILE B 25  ? 0.5787 0.7130 0.5349 0.0673  -0.0406 -0.0522 25   ILE B CB  
1417 C CG1 . ILE B 25  ? 0.5500 0.7226 0.5240 0.0738  -0.0340 -0.0542 25   ILE B CG1 
1418 C CG2 . ILE B 25  ? 0.6025 0.7065 0.5416 0.0735  -0.0490 -0.0560 25   ILE B CG2 
1419 C CD1 . ILE B 25  ? 0.5350 0.7185 0.5025 0.0920  -0.0404 -0.0672 25   ILE B CD1 
1420 N N   . GLU B 26  ? 0.6787 0.7340 0.5768 0.0706  -0.0676 -0.0640 26   GLU B N   
1421 C CA  . GLU B 26  ? 0.7224 0.7349 0.5957 0.0600  -0.0770 -0.0611 26   GLU B CA  
1422 C C   . GLU B 26  ? 0.7267 0.7266 0.5998 0.0525  -0.0749 -0.0543 26   GLU B C   
1423 O O   . GLU B 26  ? 0.7283 0.7248 0.5992 0.0648  -0.0776 -0.0590 26   GLU B O   
1424 C CB  . GLU B 26  ? 0.7667 0.7439 0.6091 0.0740  -0.0935 -0.0729 26   GLU B CB  
1425 C CG  . GLU B 26  ? 0.8221 0.7588 0.6372 0.0599  -0.1038 -0.0700 26   GLU B CG  
1426 C CD  . GLU B 26  ? 0.8419 0.7955 0.6646 0.0508  -0.0997 -0.0678 26   GLU B CD  
1427 O OE1 . GLU B 26  ? 0.8692 0.8316 0.6895 0.0650  -0.1032 -0.0775 26   GLU B OE1 
1428 O OE2 . GLU B 26  ? 0.8468 0.8068 0.6776 0.0301  -0.0933 -0.0570 26   GLU B OE2 
1429 N N   . MET B 27  ? 0.7305 0.7267 0.6062 0.0325  -0.0700 -0.0437 27   MET B N   
1430 C CA  . MET B 27  ? 0.7317 0.7245 0.6115 0.0237  -0.0651 -0.0364 27   MET B CA  
1431 C C   . MET B 27  ? 0.7633 0.7192 0.6175 0.0075  -0.0730 -0.0314 27   MET B C   
1432 O O   . MET B 27  ? 0.7777 0.7194 0.6178 -0.0030 -0.0784 -0.0302 27   MET B O   
1433 C CB  . MET B 27  ? 0.6990 0.7291 0.6080 0.0149  -0.0502 -0.0282 27   MET B CB  
1434 C CG  . MET B 27  ? 0.7077 0.7497 0.6302 0.0177  -0.0430 -0.0253 27   MET B CG  
1435 S SD  . MET B 27  ? 0.7649 0.8352 0.7110 0.0043  -0.0292 -0.0149 27   MET B SD  
1436 C CE  . MET B 27  ? 0.7503 0.7969 0.6781 -0.0143 -0.0326 -0.0090 27   MET B CE  
1437 N N   . GLU B 28  ? 0.7782 0.7188 0.6249 0.0042  -0.0739 -0.0283 28   GLU B N   
1438 C CA  . GLU B 28  ? 0.8154 0.7245 0.6382 -0.0145 -0.0799 -0.0219 28   GLU B CA  
1439 C C   . GLU B 28  ? 0.8047 0.7294 0.6409 -0.0252 -0.0694 -0.0138 28   GLU B C   
1440 O O   . GLU B 28  ? 0.7812 0.7237 0.6348 -0.0140 -0.0627 -0.0151 28   GLU B O   
1441 C CB  . GLU B 28  ? 0.8591 0.7186 0.6459 -0.0074 -0.0973 -0.0276 28   GLU B CB  
1442 C CG  . GLU B 28  ? 0.8970 0.7306 0.6611 -0.0017 -0.1106 -0.0348 28   GLU B CG  
1443 C CD  . GLU B 28  ? 0.9678 0.7420 0.6874 -0.0059 -0.1297 -0.0362 28   GLU B CD  
1444 O OE1 . GLU B 28  ? 0.9938 0.7458 0.7001 0.0039  -0.1366 -0.0390 28   GLU B OE1 
1445 O OE2 . GLU B 28  ? 1.0025 0.7506 0.6985 -0.0195 -0.1388 -0.0344 28   GLU B OE2 
1446 N N   . PRO B 29  ? 0.8301 0.7495 0.6573 -0.0474 -0.0681 -0.0057 29   PRO B N   
1447 C CA  . PRO B 29  ? 0.8700 0.7669 0.6733 -0.0652 -0.0769 -0.0028 29   PRO B CA  
1448 C C   . PRO B 29  ? 0.8613 0.7845 0.6801 -0.0681 -0.0722 -0.0028 29   PRO B C   
1449 O O   . PRO B 29  ? 0.8253 0.7885 0.6754 -0.0612 -0.0600 -0.0025 29   PRO B O   
1450 C CB  . PRO B 29  ? 0.8753 0.7740 0.6726 -0.0883 -0.0726 0.0065  29   PRO B CB  
1451 C CG  . PRO B 29  ? 0.8344 0.7741 0.6646 -0.0824 -0.0570 0.0085  29   PRO B CG  
1452 C CD  . PRO B 29  ? 0.8132 0.7549 0.6555 -0.0574 -0.0566 0.0012  29   PRO B CD  
1453 N N   . ARG B 30  ? 0.9021 0.8001 0.6969 -0.0784 -0.0831 -0.0031 30   ARG B N   
1454 C CA  . ARG B 30  ? 0.9019 0.8203 0.7075 -0.0810 -0.0809 -0.0039 30   ARG B CA  
1455 C C   . ARG B 30  ? 0.8819 0.8348 0.7041 -0.1017 -0.0706 0.0047  30   ARG B C   
1456 O O   . ARG B 30  ? 0.8943 0.8445 0.7077 -0.1199 -0.0695 0.0113  30   ARG B O   
1457 C CB  . ARG B 30  ? 0.9525 0.8286 0.7237 -0.0840 -0.0977 -0.0081 30   ARG B CB  
1458 C CG  . ARG B 30  ? 0.9982 0.8490 0.7573 -0.0579 -0.1075 -0.0195 30   ARG B CG  
1459 C CD  . ARG B 30  ? 1.0868 0.8768 0.7997 -0.0602 -0.1279 -0.0231 30   ARG B CD  
1460 N NE  . ARG B 30  ? 1.1419 0.9131 0.8359 -0.0631 -0.1382 -0.0270 30   ARG B NE  
1461 C CZ  . ARG B 30  ? 1.2181 0.9334 0.8691 -0.0633 -0.1579 -0.0316 30   ARG B CZ  
1462 N NH1 . ARG B 30  ? 1.2616 0.9330 0.8832 -0.0608 -0.1701 -0.0325 30   ARG B NH1 
1463 N NH2 . ARG B 30  ? 1.2448 0.9453 0.8799 -0.0658 -0.1667 -0.0353 30   ARG B NH2 
1464 N N   . GLY B 31  ? 0.8532 0.8407 0.6992 -0.0981 -0.0632 0.0042  31   GLY B N   
1465 C CA  . GLY B 31  ? 0.8334 0.8600 0.6989 -0.1132 -0.0535 0.0109  31   GLY B CA  
1466 C C   . GLY B 31  ? 0.7904 0.8567 0.6889 -0.1029 -0.0391 0.0122  31   GLY B C   
1467 O O   . GLY B 31  ? 0.7679 0.8709 0.6882 -0.1052 -0.0312 0.0147  31   GLY B O   
1468 N N   . ILE B 32  ? 0.7795 0.8369 0.6802 -0.0909 -0.0369 0.0104  32   ILE B N   
1469 C CA  . ILE B 32  ? 0.7422 0.8300 0.6691 -0.0819 -0.0250 0.0118  32   ILE B CA  
1470 C C   . ILE B 32  ? 0.7000 0.8115 0.6501 -0.0655 -0.0196 0.0088  32   ILE B C   
1471 O O   . ILE B 32  ? 0.6762 0.8174 0.6481 -0.0619 -0.0106 0.0110  32   ILE B O   
1472 C CB  . ILE B 32  ? 0.7522 0.8204 0.6717 -0.0749 -0.0255 0.0106  32   ILE B CB  
1473 C CG1 . ILE B 32  ? 0.7444 0.8404 0.6849 -0.0722 -0.0140 0.0134  32   ILE B CG1 
1474 C CG2 . ILE B 32  ? 0.7421 0.7934 0.6590 -0.0557 -0.0305 0.0039  32   ILE B CG2 
1475 C CD1 . ILE B 32  ? 0.7545 0.8318 0.6861 -0.0688 -0.0145 0.0132  32   ILE B CD1 
1476 N N   . ASP B 33  ? 0.6895 0.7872 0.6329 -0.0558 -0.0259 0.0035  33   ASP B N   
1477 C CA  . ASP B 33  ? 0.6535 0.7715 0.6152 -0.0415 -0.0218 0.0007  33   ASP B CA  
1478 C C   . ASP B 33  ? 0.6483 0.7647 0.6040 -0.0424 -0.0275 -0.0020 33   ASP B C   
1479 O O   . ASP B 33  ? 0.6758 0.7675 0.6096 -0.0504 -0.0365 -0.0036 33   ASP B O   
1480 C CB  . ASP B 33  ? 0.6506 0.7584 0.6115 -0.0258 -0.0230 -0.0043 33   ASP B CB  
1481 C CG  . ASP B 33  ? 0.6217 0.7543 0.6019 -0.0140 -0.0174 -0.0057 33   ASP B CG  
1482 O OD1 . ASP B 33  ? 0.5954 0.7518 0.5928 -0.0162 -0.0102 -0.0011 33   ASP B OD1 
1483 O OD2 . ASP B 33  ? 0.6016 0.7300 0.5782 -0.0024 -0.0208 -0.0117 33   ASP B OD2 
1484 N N   . LEU B 34  ? 0.6091 0.7498 0.5820 -0.0349 -0.0229 -0.0025 34   LEU B N   
1485 C CA  . LEU B 34  ? 0.6031 0.7446 0.5713 -0.0337 -0.0277 -0.0058 34   LEU B CA  
1486 C C   . LEU B 34  ? 0.6132 0.7280 0.5620 -0.0237 -0.0367 -0.0141 34   LEU B C   
1487 O O   . LEU B 34  ? 0.6104 0.7220 0.5604 -0.0115 -0.0361 -0.0180 34   LEU B O   
1488 C CB  . LEU B 34  ? 0.5770 0.7482 0.5660 -0.0261 -0.0213 -0.0048 34   LEU B CB  
1489 C CG  . LEU B 34  ? 0.5696 0.7474 0.5564 -0.0257 -0.0249 -0.0073 34   LEU B CG  
1490 C CD1 . LEU B 34  ? 0.5643 0.7455 0.5480 -0.0404 -0.0272 -0.0035 34   LEU B CD1 
1491 C CD2 . LEU B 34  ? 0.5224 0.7261 0.5269 -0.0177 -0.0191 -0.0060 34   LEU B CD2 
1492 N N   . ALA B 35  ? 0.6219 0.7180 0.5518 -0.0285 -0.0457 -0.0173 35   ALA B N   
1493 C CA  . ALA B 35  ? 0.6362 0.7029 0.5433 -0.0177 -0.0564 -0.0265 35   ALA B CA  
1494 C C   . ALA B 35  ? 0.6132 0.6988 0.5311 0.0006  -0.0538 -0.0335 35   ALA B C   
1495 O O   . ALA B 35  ? 0.5857 0.7018 0.5229 0.0011  -0.0464 -0.0311 35   ALA B O   
1496 C CB  . ALA B 35  ? 0.6637 0.7062 0.5473 -0.0272 -0.0672 -0.0284 35   ALA B CB  
1497 N N   . ALA B 36  ? 0.6214 0.6897 0.5258 0.0154  -0.0606 -0.0424 36   ALA B N   
1498 C CA  . ALA B 36  ? 0.5996 0.6895 0.5130 0.0330  -0.0584 -0.0503 36   ALA B CA  
1499 C C   . ALA B 36  ? 0.5961 0.6948 0.5057 0.0365  -0.0612 -0.0556 36   ALA B C   
1500 O O   . ALA B 36  ? 0.5782 0.7081 0.5026 0.0440  -0.0553 -0.0579 36   ALA B O   
1501 C CB  . ALA B 36  ? 0.6151 0.6855 0.5133 0.0491  -0.0663 -0.0598 36   ALA B CB  
1502 N N   . SER B 37  ? 0.6162 0.6872 0.5045 0.0296  -0.0708 -0.0571 37   SER B N   
1503 C CA  . SER B 37  ? 0.6221 0.6976 0.5039 0.0317  -0.0746 -0.0622 37   SER B CA  
1504 C C   . SER B 37  ? 0.5848 0.6923 0.4883 0.0197  -0.0650 -0.0534 37   SER B C   
1505 O O   . SER B 37  ? 0.5814 0.7058 0.4877 0.0240  -0.0644 -0.0570 37   SER B O   
1506 C CB  . SER B 37  ? 0.6653 0.6973 0.5148 0.0260  -0.0890 -0.0658 37   SER B CB  
1507 O OG  . SER B 37  ? 0.6835 0.7004 0.5291 0.0049  -0.0892 -0.0553 37   SER B OG  
1508 N N   . LEU B 38  ? 0.5581 0.6744 0.4760 0.0058  -0.0580 -0.0425 38   LEU B N   
1509 C CA  . LEU B 38  ? 0.5266 0.6721 0.4645 -0.0041 -0.0500 -0.0342 38   LEU B CA  
1510 C C   . LEU B 38  ? 0.4868 0.6641 0.4491 0.0015  -0.0392 -0.0302 38   LEU B C   
1511 O O   . LEU B 38  ? 0.4621 0.6615 0.4401 -0.0047 -0.0334 -0.0233 38   LEU B O   
1512 C CB  . LEU B 38  ? 0.5304 0.6703 0.4690 -0.0219 -0.0494 -0.0254 38   LEU B CB  
1513 C CG  . LEU B 38  ? 0.5724 0.6817 0.4858 -0.0340 -0.0603 -0.0265 38   LEU B CG  
1514 C CD1 . LEU B 38  ? 0.5638 0.6759 0.4808 -0.0527 -0.0578 -0.0174 38   LEU B CD1 
1515 C CD2 . LEU B 38  ? 0.5899 0.7012 0.4959 -0.0358 -0.0654 -0.0297 38   LEU B CD2 
1516 N N   . ALA B 39  ? 0.4798 0.6583 0.4437 0.0131  -0.0376 -0.0345 39   ALA B N   
1517 C CA  . ALA B 39  ? 0.4495 0.6543 0.4331 0.0165  -0.0286 -0.0304 39   ALA B CA  
1518 C C   . ALA B 39  ? 0.4434 0.6673 0.4285 0.0280  -0.0277 -0.0373 39   ALA B C   
1519 O O   . ALA B 39  ? 0.4628 0.6789 0.4338 0.0371  -0.0342 -0.0471 39   ALA B O   
1520 C CB  . ALA B 39  ? 0.4434 0.6391 0.4300 0.0172  -0.0261 -0.0280 39   ALA B CB  
1521 N N   . ASP B 40  ? 0.4202 0.6693 0.4209 0.0272  -0.0203 -0.0322 40   ASP B N   
1522 C CA  . ASP B 40  ? 0.4135 0.6871 0.4169 0.0347  -0.0182 -0.0372 40   ASP B CA  
1523 C C   . ASP B 40  ? 0.3975 0.6819 0.4085 0.0385  -0.0141 -0.0368 40   ASP B C   
1524 O O   . ASP B 40  ? 0.4036 0.7054 0.4131 0.0471  -0.0143 -0.0442 40   ASP B O   
1525 C CB  . ASP B 40  ? 0.4051 0.7010 0.4167 0.0277  -0.0143 -0.0311 40   ASP B CB  
1526 C CG  . ASP B 40  ? 0.4299 0.7202 0.4336 0.0252  -0.0188 -0.0331 40   ASP B CG  
1527 O OD1 . ASP B 40  ? 0.4916 0.7761 0.4823 0.0332  -0.0242 -0.0432 40   ASP B OD1 
1528 O OD2 . ASP B 40  ? 0.4333 0.7250 0.4430 0.0159  -0.0175 -0.0250 40   ASP B OD2 
1529 N N   . ILE B 41  ? 0.3828 0.6595 0.4016 0.0322  -0.0106 -0.0286 41   ILE B N   
1530 C CA  . ILE B 41  ? 0.3700 0.6527 0.3942 0.0347  -0.0075 -0.0279 41   ILE B CA  
1531 C C   . ILE B 41  ? 0.3673 0.6260 0.3903 0.0331  -0.0081 -0.0250 41   ILE B C   
1532 O O   . ILE B 41  ? 0.3722 0.6136 0.3921 0.0277  -0.0096 -0.0219 41   ILE B O   
1533 C CB  . ILE B 41  ? 0.3543 0.6579 0.3894 0.0271  -0.0017 -0.0195 41   ILE B CB  
1534 C CG1 . ILE B 41  ? 0.3362 0.6295 0.3771 0.0182  0.0004  -0.0093 41   ILE B CG1 
1535 C CG2 . ILE B 41  ? 0.3463 0.6753 0.3811 0.0264  -0.0010 -0.0215 41   ILE B CG2 
1536 C CD1 . ILE B 41  ? 0.3278 0.6333 0.3747 0.0115  0.0037  -0.0009 41   ILE B CD1 
1537 N N   . HIS B 42  ? 0.3605 0.6209 0.3857 0.0368  -0.0068 -0.0261 42   HIS B N   
1538 C CA  . HIS B 42  ? 0.3594 0.6004 0.3843 0.0346  -0.0063 -0.0226 42   HIS B CA  
1539 C C   . HIS B 42  ? 0.3443 0.5971 0.3797 0.0301  -0.0007 -0.0159 42   HIS B C   
1540 O O   . HIS B 42  ? 0.3418 0.6065 0.3788 0.0339  -0.0002 -0.0186 42   HIS B O   
1541 C CB  . HIS B 42  ? 0.3744 0.6002 0.3882 0.0443  -0.0120 -0.0310 42   HIS B CB  
1542 C CG  . HIS B 42  ? 0.3835 0.5875 0.3943 0.0413  -0.0123 -0.0275 42   HIS B CG  
1543 N ND1 . HIS B 42  ? 0.4030 0.5845 0.4065 0.0344  -0.0143 -0.0243 42   HIS B ND1 
1544 C CD2 . HIS B 42  ? 0.3976 0.6004 0.4109 0.0432  -0.0108 -0.0268 42   HIS B CD2 
1545 C CE1 . HIS B 42  ? 0.4156 0.5832 0.4169 0.0323  -0.0137 -0.0218 42   HIS B CE1 
1546 N NE2 . HIS B 42  ? 0.4308 0.6097 0.4380 0.0382  -0.0118 -0.0233 42   HIS B NE2 
1547 N N   . LEU B 43  ? 0.3403 0.5902 0.3817 0.0223  0.0025  -0.0075 43   LEU B N   
1548 C CA  . LEU B 43  ? 0.3368 0.5919 0.3847 0.0181  0.0062  -0.0008 43   LEU B CA  
1549 C C   . LEU B 43  ? 0.3443 0.5857 0.3907 0.0200  0.0066  -0.0013 43   LEU B C   
1550 O O   . LEU B 43  ? 0.3515 0.5762 0.3932 0.0212  0.0051  -0.0031 43   LEU B O   
1551 C CB  . LEU B 43  ? 0.3314 0.5846 0.3839 0.0125  0.0080  0.0067  43   LEU B CB  
1552 C CG  . LEU B 43  ? 0.3262 0.5785 0.3815 0.0090  0.0099  0.0135  43   LEU B CG  
1553 C CD1 . LEU B 43  ? 0.3049 0.5716 0.3590 0.0056  0.0097  0.0151  43   LEU B CD1 
1554 C CD2 . LEU B 43  ? 0.3219 0.5715 0.3801 0.0070  0.0098  0.0191  43   LEU B CD2 
1555 N N   . GLU B 44  ? 0.3478 0.5961 0.3965 0.0187  0.0081  0.0007  44   GLU B N   
1556 C CA  . GLU B 44  ? 0.3552 0.5928 0.4020 0.0208  0.0081  -0.0003 44   GLU B CA  
1557 C C   . GLU B 44  ? 0.3490 0.5856 0.3984 0.0151  0.0104  0.0064  44   GLU B C   
1558 O O   . GLU B 44  ? 0.3437 0.5926 0.3945 0.0100  0.0108  0.0103  44   GLU B O   
1559 C CB  . GLU B 44  ? 0.3626 0.6105 0.4067 0.0275  0.0053  -0.0080 44   GLU B CB  
1560 C CG  . GLU B 44  ? 0.3941 0.6234 0.4313 0.0339  0.0020  -0.0129 44   GLU B CG  
1561 C CD  . GLU B 44  ? 0.4431 0.6825 0.4764 0.0441  -0.0023 -0.0222 44   GLU B CD  
1562 O OE1 . GLU B 44  ? 0.4564 0.6858 0.4813 0.0518  -0.0075 -0.0290 44   GLU B OE1 
1563 O OE2 . GLU B 44  ? 0.4777 0.7353 0.5153 0.0447  -0.0015 -0.0232 44   GLU B OE2 
1564 N N   . ALA B 45  ? 0.3575 0.5777 0.4053 0.0155  0.0112  0.0079  45   ALA B N   
1565 C CA  . ALA B 45  ? 0.3628 0.5770 0.4101 0.0116  0.0123  0.0132  45   ALA B CA  
1566 C C   . ALA B 45  ? 0.3685 0.5768 0.4129 0.0135  0.0117  0.0104  45   ALA B C   
1567 O O   . ALA B 45  ? 0.3655 0.5602 0.4071 0.0168  0.0117  0.0081  45   ALA B O   
1568 C CB  . ALA B 45  ? 0.3643 0.5657 0.4120 0.0114  0.0139  0.0170  45   ALA B CB  
1569 N N   . ASP B 46  ? 0.3747 0.5941 0.4187 0.0103  0.0107  0.0110  46   ASP B N   
1570 C CA  . ASP B 46  ? 0.3799 0.5970 0.4216 0.0117  0.0095  0.0085  46   ASP B CA  
1571 C C   . ASP B 46  ? 0.3710 0.5745 0.4089 0.0060  0.0099  0.0143  46   ASP B C   
1572 O O   . ASP B 46  ? 0.3618 0.5707 0.3975 -0.0016 0.0090  0.0190  46   ASP B O   
1573 C CB  . ASP B 46  ? 0.3855 0.6282 0.4293 0.0117  0.0078  0.0045  46   ASP B CB  
1574 C CG  . ASP B 46  ? 0.4183 0.6717 0.4634 0.0212  0.0060  -0.0037 46   ASP B CG  
1575 O OD1 . ASP B 46  ? 0.4542 0.6902 0.4954 0.0284  0.0042  -0.0077 46   ASP B OD1 
1576 O OD2 . ASP B 46  ? 0.4483 0.7270 0.4964 0.0211  0.0057  -0.0065 46   ASP B OD2 
1577 N N   . ILE B 47  ? 0.3712 0.5557 0.4061 0.0092  0.0107  0.0139  47   ILE B N   
1578 C CA  . ILE B 47  ? 0.3748 0.5434 0.4045 0.0062  0.0109  0.0181  47   ILE B CA  
1579 C C   . ILE B 47  ? 0.3652 0.5254 0.3910 0.0077  0.0101  0.0156  47   ILE B C   
1580 O O   . ILE B 47  ? 0.3652 0.5159 0.3896 0.0123  0.0110  0.0126  47   ILE B O   
1581 C CB  . ILE B 47  ? 0.3788 0.5340 0.4080 0.0092  0.0131  0.0197  47   ILE B CB  
1582 C CG1 . ILE B 47  ? 0.3812 0.5446 0.4143 0.0087  0.0132  0.0220  47   ILE B CG1 
1583 C CG2 . ILE B 47  ? 0.3891 0.5277 0.4112 0.0085  0.0123  0.0226  47   ILE B CG2 
1584 C CD1 . ILE B 47  ? 0.3915 0.5485 0.4261 0.0130  0.0151  0.0225  47   ILE B CD1 
1585 N N   . HIS B 48  ? 0.3575 0.5211 0.3800 0.0023  0.0078  0.0172  48   HIS B N   
1586 C CA  . HIS B 48  ? 0.3475 0.5042 0.3659 0.0030  0.0064  0.0152  48   HIS B CA  
1587 C C   . HIS B 48  ? 0.3544 0.4965 0.3645 -0.0033 0.0049  0.0198  48   HIS B C   
1588 O O   . HIS B 48  ? 0.3596 0.4995 0.3661 -0.0095 0.0035  0.0246  48   HIS B O   
1589 C CB  . HIS B 48  ? 0.3367 0.5153 0.3587 0.0033  0.0038  0.0112  48   HIS B CB  
1590 C CG  . HIS B 48  ? 0.3191 0.5094 0.3461 0.0115  0.0036  0.0053  48   HIS B CG  
1591 N ND1 . HIS B 48  ? 0.3048 0.5120 0.3370 0.0110  0.0044  0.0050  48   HIS B ND1 
1592 C CD2 . HIS B 48  ? 0.3014 0.4858 0.3264 0.0205  0.0015  -0.0004 48   HIS B CD2 
1593 C CE1 . HIS B 48  ? 0.3154 0.5269 0.3490 0.0200  0.0030  -0.0013 48   HIS B CE1 
1594 N NE2 . HIS B 48  ? 0.2964 0.4928 0.3248 0.0258  0.0007  -0.0046 48   HIS B NE2 
1595 N N   . ALA B 49  ? 0.3617 0.4917 0.3667 -0.0019 0.0042  0.0183  49   ALA B N   
1596 C CA  . ALA B 49  ? 0.3759 0.4884 0.3707 -0.0070 0.0020  0.0217  49   ALA B CA  
1597 C C   . ALA B 49  ? 0.3835 0.5068 0.3748 -0.0179 -0.0021 0.0247  49   ALA B C   
1598 O O   . ALA B 49  ? 0.3705 0.5156 0.3677 -0.0191 -0.0030 0.0220  49   ALA B O   
1599 C CB  . ALA B 49  ? 0.3791 0.4769 0.3690 -0.0024 0.0027  0.0188  49   ALA B CB  
1600 N N   . LEU B 50  ? 0.4088 0.5168 0.3892 -0.0258 -0.0054 0.0300  50   LEU B N   
1601 C CA  . LEU B 50  ? 0.4267 0.5409 0.3997 -0.0398 -0.0104 0.0342  50   LEU B CA  
1602 C C   . LEU B 50  ? 0.4437 0.5451 0.4084 -0.0420 -0.0131 0.0333  50   LEU B C   
1603 O O   . LEU B 50  ? 0.4369 0.5235 0.4010 -0.0324 -0.0109 0.0296  50   LEU B O   
1604 C CB  . LEU B 50  ? 0.4464 0.5434 0.4061 -0.0489 -0.0149 0.0411  50   LEU B CB  
1605 C CG  . LEU B 50  ? 0.4418 0.5484 0.4064 -0.0487 -0.0136 0.0433  50   LEU B CG  
1606 C CD1 . LEU B 50  ? 0.4419 0.5194 0.3893 -0.0532 -0.0195 0.0495  50   LEU B CD1 
1607 C CD2 . LEU B 50  ? 0.4142 0.5559 0.3863 -0.0587 -0.0132 0.0443  50   LEU B CD2 
1608 N N   . LYS B 51  ? 0.4686 0.5773 0.4263 -0.0562 -0.0179 0.0369  51   LYS B N   
1609 C CA  . LYS B 51  ? 0.4895 0.5847 0.4367 -0.0614 -0.0218 0.0372  51   LYS B CA  
1610 C C   . LYS B 51  ? 0.5102 0.5643 0.4409 -0.0582 -0.0243 0.0390  51   LYS B C   
1611 O O   . LYS B 51  ? 0.5204 0.5573 0.4423 -0.0595 -0.0266 0.0427  51   LYS B O   
1612 C CB  . LYS B 51  ? 0.5058 0.6178 0.4467 -0.0806 -0.0273 0.0420  51   LYS B CB  
1613 C CG  . LYS B 51  ? 0.5397 0.6460 0.4718 -0.0879 -0.0318 0.0419  51   LYS B CG  
1614 C CD  . LYS B 51  ? 0.5839 0.7154 0.5116 -0.1091 -0.0368 0.0468  51   LYS B CD  
1615 C CE  . LYS B 51  ? 0.6161 0.7367 0.5309 -0.1198 -0.0428 0.0483  51   LYS B CE  
1616 N NZ  . LYS B 51  ? 0.5864 0.7186 0.5122 -0.1071 -0.0405 0.0409  51   LYS B NZ  
1617 N N   . ASN B 52  ? 0.5158 0.5546 0.4415 -0.0528 -0.0244 0.0357  52   ASN B N   
1618 C CA  . ASN B 52  ? 0.5384 0.5404 0.4477 -0.0478 -0.0268 0.0355  52   ASN B CA  
1619 C C   . ASN B 52  ? 0.5298 0.5214 0.4421 -0.0340 -0.0227 0.0333  52   ASN B C   
1620 O O   . ASN B 52  ? 0.5523 0.5186 0.4506 -0.0321 -0.0268 0.0349  52   ASN B O   
1621 C CB  . ASN B 52  ? 0.5718 0.5502 0.4592 -0.0619 -0.0361 0.0414  52   ASN B CB  
1622 C CG  . ASN B 52  ? 0.5905 0.5789 0.4730 -0.0773 -0.0407 0.0437  52   ASN B CG  
1623 O OD1 . ASN B 52  ? 0.5921 0.5869 0.4792 -0.0736 -0.0389 0.0397  52   ASN B OD1 
1624 N ND2 . ASN B 52  ? 0.6240 0.6144 0.4958 -0.0958 -0.0473 0.0505  52   ASN B ND2 
1625 N N   . ASN B 53  ? 0.5028 0.5135 0.4320 -0.0245 -0.0155 0.0293  53   ASN B N   
1626 C CA  . ASN B 53  ? 0.4930 0.4999 0.4269 -0.0126 -0.0110 0.0270  53   ASN B CA  
1627 C C   . ASN B 53  ? 0.5038 0.4872 0.4266 -0.0033 -0.0107 0.0235  53   ASN B C   
1628 O O   . ASN B 53  ? 0.5090 0.4890 0.4295 -0.0016 -0.0091 0.0205  53   ASN B O   
1629 C CB  . ASN B 53  ? 0.4703 0.5005 0.4216 -0.0067 -0.0043 0.0237  53   ASN B CB  
1630 C CG  . ASN B 53  ? 0.4631 0.4941 0.4201 0.0028  0.0001  0.0218  53   ASN B CG  
1631 O OD1 . ASN B 53  ? 0.4889 0.5125 0.4437 0.0103  0.0034  0.0183  53   ASN B OD1 
1632 N ND2 . ASN B 53  ? 0.4384 0.4814 0.4029 0.0020  0.0005  0.0239  53   ASN B ND2 
1633 N N   . PRO B 54  ? 0.5111 0.4792 0.4263 0.0035  -0.0127 0.0233  54   PRO B N   
1634 C CA  . PRO B 54  ? 0.5259 0.4734 0.4289 0.0141  -0.0134 0.0187  54   PRO B CA  
1635 C C   . PRO B 54  ? 0.5098 0.4712 0.4230 0.0246  -0.0048 0.0128  54   PRO B C   
1636 O O   . PRO B 54  ? 0.5215 0.4713 0.4254 0.0328  -0.0042 0.0081  54   PRO B O   
1637 C CB  . PRO B 54  ? 0.5467 0.4776 0.4396 0.0201  -0.0190 0.0196  54   PRO B CB  
1638 C CG  . PRO B 54  ? 0.5208 0.4730 0.4286 0.0169  -0.0166 0.0230  54   PRO B CG  
1639 C CD  . PRO B 54  ? 0.5127 0.4832 0.4297 0.0034  -0.0149 0.0266  54   PRO B CD  
1640 N N   . ASN B 55  ? 0.4831 0.4688 0.4133 0.0235  0.0012  0.0131  55   ASN B N   
1641 C CA  . ASN B 55  ? 0.4719 0.4712 0.4100 0.0296  0.0087  0.0088  55   ASN B CA  
1642 C C   . ASN B 55  ? 0.4610 0.4680 0.4031 0.0236  0.0113  0.0088  55   ASN B C   
1643 O O   . ASN B 55  ? 0.4506 0.4700 0.3995 0.0246  0.0164  0.0071  55   ASN B O   
1644 C CB  . ASN B 55  ? 0.4601 0.4776 0.4110 0.0333  0.0124  0.0089  55   ASN B CB  
1645 C CG  . ASN B 55  ? 0.4732 0.4830 0.4197 0.0402  0.0084  0.0091  55   ASN B CG  
1646 O OD1 . ASN B 55  ? 0.4974 0.5103 0.4479 0.0369  0.0056  0.0129  55   ASN B OD1 
1647 N ND2 . ASN B 55  ? 0.4797 0.4785 0.4163 0.0506  0.0075  0.0045  55   ASN B ND2 
1648 N N   . GLY B 56  ? 0.4614 0.4603 0.3977 0.0169  0.0068  0.0106  56   GLY B N   
1649 C CA  . GLY B 56  ? 0.4495 0.4513 0.3860 0.0134  0.0074  0.0097  56   GLY B CA  
1650 C C   . GLY B 56  ? 0.4278 0.4461 0.3752 0.0099  0.0070  0.0108  56   GLY B C   
1651 O O   . GLY B 56  ? 0.4208 0.4398 0.3667 0.0084  0.0057  0.0097  56   GLY B O   
1652 N N   . PHE B 57  ? 0.4137 0.4446 0.3707 0.0096  0.0074  0.0124  57   PHE B N   
1653 C CA  . PHE B 57  ? 0.3971 0.4443 0.3636 0.0083  0.0067  0.0122  57   PHE B CA  
1654 C C   . PHE B 57  ? 0.3962 0.4516 0.3634 0.0028  0.0017  0.0133  57   PHE B C   
1655 O O   . PHE B 57  ? 0.4062 0.4619 0.3713 -0.0027 -0.0007 0.0164  57   PHE B O   
1656 C CB  . PHE B 57  ? 0.3864 0.4456 0.3624 0.0100  0.0091  0.0131  57   PHE B CB  
1657 C CG  . PHE B 57  ? 0.3662 0.4262 0.3443 0.0139  0.0136  0.0113  57   PHE B CG  
1658 C CD1 . PHE B 57  ? 0.3740 0.4295 0.3499 0.0171  0.0172  0.0110  57   PHE B CD1 
1659 C CD2 . PHE B 57  ? 0.3567 0.4223 0.3376 0.0143  0.0135  0.0096  57   PHE B CD2 
1660 C CE1 . PHE B 57  ? 0.3855 0.4469 0.3637 0.0185  0.0215  0.0095  57   PHE B CE1 
1661 C CE2 . PHE B 57  ? 0.3684 0.4338 0.3487 0.0147  0.0168  0.0089  57   PHE B CE2 
1662 C CZ  . PHE B 57  ? 0.3726 0.4383 0.3525 0.0158  0.0214  0.0091  57   PHE B CZ  
1663 N N   . PRO B 58  ? 0.3896 0.4522 0.3584 0.0042  -0.0005 0.0106  58   PRO B N   
1664 C CA  . PRO B 58  ? 0.3911 0.4692 0.3626 0.0002  -0.0052 0.0103  58   PRO B CA  
1665 C C   . PRO B 58  ? 0.3860 0.4857 0.3667 -0.0031 -0.0054 0.0117  58   PRO B C   
1666 O O   . PRO B 58  ? 0.3816 0.4860 0.3683 0.0005  -0.0026 0.0114  58   PRO B O   
1667 C CB  . PRO B 58  ? 0.3852 0.4676 0.3575 0.0069  -0.0077 0.0057  58   PRO B CB  
1668 C CG  . PRO B 58  ? 0.3923 0.4536 0.3566 0.0102  -0.0053 0.0052  58   PRO B CG  
1669 C CD  . PRO B 58  ? 0.3928 0.4481 0.3583 0.0093  0.0001  0.0076  58   PRO B CD  
1670 N N   . GLU B 59  ? 0.3926 0.5067 0.3736 -0.0112 -0.0090 0.0134  59   GLU B N   
1671 C CA  . GLU B 59  ? 0.3890 0.5276 0.3775 -0.0164 -0.0093 0.0148  59   GLU B CA  
1672 C C   . GLU B 59  ? 0.3737 0.5334 0.3728 -0.0068 -0.0086 0.0091  59   GLU B C   
1673 O O   . GLU B 59  ? 0.3728 0.5395 0.3732 0.0000  -0.0114 0.0039  59   GLU B O   
1674 C CB  . GLU B 59  ? 0.3960 0.5510 0.3820 -0.0286 -0.0136 0.0172  59   GLU B CB  
1675 C CG  . GLU B 59  ? 0.4285 0.6066 0.4185 -0.0384 -0.0138 0.0206  59   GLU B CG  
1676 C CD  . GLU B 59  ? 0.4731 0.6696 0.4589 -0.0542 -0.0183 0.0239  59   GLU B CD  
1677 O OE1 . GLU B 59  ? 0.4566 0.6488 0.4374 -0.0566 -0.0214 0.0231  59   GLU B OE1 
1678 O OE2 . GLU B 59  ? 0.4990 0.7152 0.4856 -0.0654 -0.0188 0.0275  59   GLU B OE2 
1679 N N   . GLY B 60  ? 0.3662 0.5336 0.3711 -0.0056 -0.0059 0.0097  60   GLY B N   
1680 C CA  . GLY B 60  ? 0.3566 0.5417 0.3694 0.0036  -0.0059 0.0039  60   GLY B CA  
1681 C C   . GLY B 60  ? 0.3568 0.5229 0.3682 0.0124  -0.0039 0.0019  60   GLY B C   
1682 O O   . GLY B 60  ? 0.3529 0.5282 0.3690 0.0175  -0.0034 -0.0008 60   GLY B O   
1683 N N   . PHE B 61  ? 0.3673 0.5081 0.3713 0.0132  -0.0029 0.0033  61   PHE B N   
1684 C CA  . PHE B 61  ? 0.3660 0.4899 0.3668 0.0184  -0.0010 0.0021  61   PHE B CA  
1685 C C   . PHE B 61  ? 0.3567 0.4831 0.3625 0.0172  0.0028  0.0045  61   PHE B C   
1686 O O   . PHE B 61  ? 0.3556 0.4825 0.3630 0.0120  0.0051  0.0088  61   PHE B O   
1687 C CB  . PHE B 61  ? 0.3777 0.4786 0.3696 0.0169  0.0005  0.0040  61   PHE B CB  
1688 C CG  . PHE B 61  ? 0.3948 0.4853 0.3787 0.0209  -0.0034 0.0007  61   PHE B CG  
1689 C CD1 . PHE B 61  ? 0.4118 0.5141 0.3966 0.0244  -0.0090 -0.0028 61   PHE B CD1 
1690 C CD2 . PHE B 61  ? 0.4203 0.4906 0.3949 0.0208  -0.0021 0.0013  61   PHE B CD2 
1691 C CE1 . PHE B 61  ? 0.4319 0.5224 0.4077 0.0293  -0.0140 -0.0060 61   PHE B CE1 
1692 C CE2 . PHE B 61  ? 0.4392 0.4968 0.4036 0.0235  -0.0067 -0.0009 61   PHE B CE2 
1693 C CZ  . PHE B 61  ? 0.4412 0.5071 0.4059 0.0284  -0.0131 -0.0046 61   PHE B CZ  
1694 N N   . TRP B 62  ? 0.3550 0.4809 0.3614 0.0220  0.0025  0.0016  62   TRP B N   
1695 C CA  . TRP B 62  ? 0.3497 0.4768 0.3600 0.0209  0.0058  0.0035  62   TRP B CA  
1696 C C   . TRP B 62  ? 0.3499 0.4628 0.3570 0.0179  0.0099  0.0069  62   TRP B C   
1697 O O   . TRP B 62  ? 0.3574 0.4567 0.3573 0.0180  0.0100  0.0063  62   TRP B O   
1698 C CB  . TRP B 62  ? 0.3536 0.4781 0.3612 0.0257  0.0032  -0.0005 62   TRP B CB  
1699 C CG  . TRP B 62  ? 0.3642 0.4907 0.3752 0.0239  0.0060  0.0009  62   TRP B CG  
1700 C CD1 . TRP B 62  ? 0.3837 0.5255 0.4029 0.0226  0.0079  0.0025  62   TRP B CD1 
1701 C CD2 . TRP B 62  ? 0.3845 0.4985 0.3897 0.0221  0.0065  0.0012  62   TRP B CD2 
1702 N NE1 . TRP B 62  ? 0.3902 0.5300 0.4102 0.0213  0.0096  0.0034  62   TRP B NE1 
1703 C CE2 . TRP B 62  ? 0.3856 0.5096 0.3973 0.0203  0.0089  0.0027  62   TRP B CE2 
1704 C CE3 . TRP B 62  ? 0.3920 0.4877 0.3859 0.0203  0.0049  0.0008  62   TRP B CE3 
1705 C CZ2 . TRP B 62  ? 0.3956 0.5141 0.4041 0.0166  0.0098  0.0035  62   TRP B CZ2 
1706 C CZ3 . TRP B 62  ? 0.4063 0.4960 0.3957 0.0152  0.0058  0.0021  62   TRP B CZ3 
1707 C CH2 . TRP B 62  ? 0.4118 0.5139 0.4091 0.0133  0.0084  0.0033  62   TRP B CH2 
1708 N N   . MET B 63  ? 0.3436 0.4609 0.3554 0.0160  0.0129  0.0102  63   MET B N   
1709 C CA  . MET B 63  ? 0.3470 0.4555 0.3566 0.0158  0.0164  0.0120  63   MET B CA  
1710 C C   . MET B 63  ? 0.3359 0.4465 0.3469 0.0160  0.0189  0.0110  63   MET B C   
1711 O O   . MET B 63  ? 0.3206 0.4411 0.3375 0.0161  0.0193  0.0116  63   MET B O   
1712 C CB  . MET B 63  ? 0.3535 0.4641 0.3653 0.0154  0.0167  0.0153  63   MET B CB  
1713 C CG  . MET B 63  ? 0.3886 0.4948 0.3958 0.0120  0.0133  0.0174  63   MET B CG  
1714 S SD  . MET B 63  ? 0.4575 0.5461 0.4546 0.0121  0.0127  0.0165  63   MET B SD  
1715 C CE  . MET B 63  ? 0.4491 0.5276 0.4426 0.0178  0.0157  0.0162  63   MET B CE  
1716 N N   . PRO B 64  ? 0.3427 0.4444 0.3470 0.0147  0.0202  0.0100  64   PRO B N   
1717 C CA  . PRO B 64  ? 0.3479 0.4510 0.3504 0.0115  0.0215  0.0096  64   PRO B CA  
1718 C C   . PRO B 64  ? 0.3463 0.4590 0.3527 0.0105  0.0266  0.0106  64   PRO B C   
1719 O O   . PRO B 64  ? 0.3446 0.4586 0.3526 0.0143  0.0288  0.0108  64   PRO B O   
1720 C CB  . PRO B 64  ? 0.3626 0.4507 0.3530 0.0086  0.0194  0.0085  64   PRO B CB  
1721 C CG  . PRO B 64  ? 0.3642 0.4473 0.3525 0.0105  0.0210  0.0088  64   PRO B CG  
1722 C CD  . PRO B 64  ? 0.3490 0.4388 0.3452 0.0144  0.0205  0.0096  64   PRO B CD  
1723 N N   . TYR B 65  ? 0.3486 0.4679 0.3551 0.0058  0.0275  0.0108  65   TYR B N   
1724 C CA  . TYR B 65  ? 0.3493 0.4838 0.3600 0.0039  0.0323  0.0111  65   TYR B CA  
1725 C C   . TYR B 65  ? 0.3456 0.4934 0.3672 0.0112  0.0338  0.0112  65   TYR B C   
1726 O O   . TYR B 65  ? 0.3475 0.5086 0.3725 0.0138  0.0374  0.0101  65   TYR B O   
1727 C CB  . TYR B 65  ? 0.3547 0.4878 0.3585 0.0018  0.0359  0.0102  65   TYR B CB  
1728 C CG  . TYR B 65  ? 0.3584 0.4775 0.3486 -0.0071 0.0339  0.0109  65   TYR B CG  
1729 C CD1 . TYR B 65  ? 0.3461 0.4701 0.3301 -0.0180 0.0345  0.0122  65   TYR B CD1 
1730 C CD2 . TYR B 65  ? 0.3754 0.4753 0.3571 -0.0054 0.0304  0.0106  65   TYR B CD2 
1731 C CE1 . TYR B 65  ? 0.3688 0.4748 0.3361 -0.0274 0.0309  0.0136  65   TYR B CE1 
1732 C CE2 . TYR B 65  ? 0.3578 0.4415 0.3246 -0.0127 0.0270  0.0112  65   TYR B CE2 
1733 C CZ  . TYR B 65  ? 0.3677 0.4525 0.3262 -0.0238 0.0270  0.0130  65   TYR B CZ  
1734 O OH  . TYR B 65  ? 0.3849 0.4489 0.3247 -0.0322 0.0220  0.0144  65   TYR B OH  
1735 N N   . LEU B 66  ? 0.3452 0.4905 0.3709 0.0146  0.0306  0.0123  66   LEU B N   
1736 C CA  . LEU B 66  ? 0.3457 0.4997 0.3785 0.0203  0.0303  0.0132  66   LEU B CA  
1737 C C   . LEU B 66  ? 0.3460 0.5162 0.3858 0.0183  0.0311  0.0135  66   LEU B C   
1738 O O   . LEU B 66  ? 0.3442 0.5151 0.3832 0.0123  0.0300  0.0136  66   LEU B O   
1739 C CB  . LEU B 66  ? 0.3438 0.4905 0.3765 0.0217  0.0263  0.0151  66   LEU B CB  
1740 C CG  . LEU B 66  ? 0.3402 0.4726 0.3663 0.0229  0.0244  0.0156  66   LEU B CG  
1741 C CD1 . LEU B 66  ? 0.3394 0.4710 0.3656 0.0202  0.0207  0.0177  66   LEU B CD1 
1742 C CD2 . LEU B 66  ? 0.3086 0.4354 0.3313 0.0291  0.0242  0.0156  66   LEU B CD2 
1743 N N   . THR B 67  ? 0.3532 0.5354 0.3984 0.0242  0.0321  0.0131  67   THR B N   
1744 C CA  . THR B 67  ? 0.3544 0.5539 0.4073 0.0234  0.0320  0.0136  67   THR B CA  
1745 C C   . THR B 67  ? 0.3558 0.5516 0.4110 0.0273  0.0279  0.0159  67   THR B C   
1746 O O   . THR B 67  ? 0.3589 0.5484 0.4121 0.0346  0.0256  0.0165  67   THR B O   
1747 C CB  . THR B 67  ? 0.3569 0.5757 0.4147 0.0288  0.0348  0.0111  67   THR B CB  
1748 O OG1 . THR B 67  ? 0.3698 0.5941 0.4242 0.0236  0.0391  0.0091  67   THR B OG1 
1749 C CG2 . THR B 67  ? 0.3594 0.5991 0.4257 0.0272  0.0345  0.0114  67   THR B CG2 
1750 N N   . ILE B 68  ? 0.3569 0.5547 0.4138 0.0220  0.0263  0.0172  68   ILE B N   
1751 C CA  . ILE B 68  ? 0.3635 0.5600 0.4215 0.0234  0.0226  0.0197  68   ILE B CA  
1752 C C   . ILE B 68  ? 0.3666 0.5781 0.4307 0.0222  0.0218  0.0202  68   ILE B C   
1753 O O   . ILE B 68  ? 0.3695 0.5855 0.4341 0.0163  0.0222  0.0191  68   ILE B O   
1754 C CB  . ILE B 68  ? 0.3595 0.5477 0.4135 0.0191  0.0210  0.0199  68   ILE B CB  
1755 C CG1 . ILE B 68  ? 0.3693 0.5441 0.4174 0.0197  0.0213  0.0195  68   ILE B CG1 
1756 C CG2 . ILE B 68  ? 0.3546 0.5456 0.4089 0.0187  0.0179  0.0227  68   ILE B CG2 
1757 C CD1 . ILE B 68  ? 0.3762 0.5478 0.4214 0.0167  0.0195  0.0187  68   ILE B CD1 
1758 N N   . ALA B 69  ? 0.3699 0.5869 0.4367 0.0282  0.0197  0.0216  69   ALA B N   
1759 C CA  . ALA B 69  ? 0.3691 0.6003 0.4414 0.0279  0.0180  0.0225  69   ALA B CA  
1760 C C   . ALA B 69  ? 0.3731 0.5977 0.4419 0.0277  0.0137  0.0260  69   ALA B C   
1761 O O   . ALA B 69  ? 0.3816 0.5930 0.4439 0.0310  0.0107  0.0284  69   ALA B O   
1762 C CB  . ALA B 69  ? 0.3672 0.6124 0.4447 0.0357  0.0179  0.0210  69   ALA B CB  
1763 N N   . TYR B 70  ? 0.3742 0.6070 0.4452 0.0228  0.0129  0.0266  70   TYR B N   
1764 C CA  . TYR B 70  ? 0.3796 0.6099 0.4467 0.0207  0.0093  0.0299  70   TYR B CA  
1765 C C   . TYR B 70  ? 0.3910 0.6311 0.4607 0.0229  0.0059  0.0319  70   TYR B C   
1766 O O   . TYR B 70  ? 0.3933 0.6464 0.4697 0.0242  0.0069  0.0300  70   TYR B O   
1767 C CB  . TYR B 70  ? 0.3728 0.6055 0.4385 0.0145  0.0104  0.0281  70   TYR B CB  
1768 C CG  . TYR B 70  ? 0.3675 0.6103 0.4367 0.0117  0.0112  0.0250  70   TYR B CG  
1769 C CD1 . TYR B 70  ? 0.3594 0.6121 0.4299 0.0101  0.0089  0.0261  70   TYR B CD1 
1770 C CD2 . TYR B 70  ? 0.3730 0.6129 0.4417 0.0096  0.0132  0.0213  70   TYR B CD2 
1771 C CE1 . TYR B 70  ? 0.3499 0.6093 0.4213 0.0069  0.0086  0.0231  70   TYR B CE1 
1772 C CE2 . TYR B 70  ? 0.3811 0.6255 0.4490 0.0056  0.0122  0.0189  70   TYR B CE2 
1773 C CZ  . TYR B 70  ? 0.3684 0.6226 0.4379 0.0043  0.0100  0.0196  70   TYR B CZ  
1774 O OH  . TYR B 70  ? 0.3984 0.6548 0.4652 -0.0003 0.0082  0.0170  70   TYR B OH  
1775 N N   . GLU B 71  ? 0.4042 0.6384 0.4675 0.0220  0.0015  0.0362  71   GLU B N   
1776 C CA  . GLU B 71  ? 0.4123 0.6536 0.4757 0.0231  -0.0026 0.0388  71   GLU B CA  
1777 C C   . GLU B 71  ? 0.4183 0.6598 0.4753 0.0150  -0.0044 0.0420  71   GLU B C   
1778 O O   . GLU B 71  ? 0.4319 0.6615 0.4788 0.0120  -0.0080 0.0466  71   GLU B O   
1779 C CB  . GLU B 71  ? 0.4281 0.6597 0.4864 0.0321  -0.0085 0.0413  71   GLU B CB  
1780 C CG  . GLU B 71  ? 0.4510 0.6895 0.5090 0.0352  -0.0141 0.0436  71   GLU B CG  
1781 C CD  . GLU B 71  ? 0.5038 0.7261 0.5516 0.0451  -0.0226 0.0463  71   GLU B CD  
1782 O OE1 . GLU B 71  ? 0.4907 0.7146 0.5419 0.0568  -0.0232 0.0424  71   GLU B OE1 
1783 O OE2 . GLU B 71  ? 0.5472 0.7548 0.5818 0.0413  -0.0292 0.0521  71   GLU B OE2 
1784 N N   . LEU B 72  ? 0.4096 0.6647 0.4710 0.0108  -0.0023 0.0395  72   LEU B N   
1785 C CA  . LEU B 72  ? 0.4109 0.6720 0.4671 0.0040  -0.0032 0.0410  72   LEU B CA  
1786 C C   . LEU B 72  ? 0.4200 0.6857 0.4736 0.0036  -0.0081 0.0449  72   LEU B C   
1787 O O   . LEU B 72  ? 0.4160 0.6915 0.4758 0.0059  -0.0082 0.0428  72   LEU B O   
1788 C CB  . LEU B 72  ? 0.4005 0.6719 0.4603 0.0018  0.0004  0.0349  72   LEU B CB  
1789 C CG  . LEU B 72  ? 0.3954 0.6772 0.4503 -0.0033 0.0005  0.0339  72   LEU B CG  
1790 C CD1 . LEU B 72  ? 0.3961 0.6751 0.4454 -0.0075 0.0009  0.0366  72   LEU B CD1 
1791 C CD2 . LEU B 72  ? 0.3926 0.6808 0.4495 -0.0015 0.0027  0.0260  72   LEU B CD2 
1792 N N   A LYS B 73  ? 0.4333 0.6909 0.4762 -0.0002 -0.0127 0.0511  73   LYS B N   
1793 N N   B LYS B 73  ? 0.4331 0.6910 0.4759 -0.0005 -0.0126 0.0510  73   LYS B N   
1794 C CA  A LYS B 73  ? 0.4413 0.6996 0.4782 -0.0012 -0.0187 0.0558  73   LYS B CA  
1795 C CA  B LYS B 73  ? 0.4413 0.6994 0.4781 -0.0012 -0.0187 0.0558  73   LYS B CA  
1796 C C   A LYS B 73  ? 0.4464 0.7112 0.4740 -0.0123 -0.0194 0.0592  73   LYS B C   
1797 C C   B LYS B 73  ? 0.4467 0.7112 0.4740 -0.0123 -0.0195 0.0593  73   LYS B C   
1798 O O   A LYS B 73  ? 0.4491 0.7104 0.4698 -0.0192 -0.0184 0.0612  73   LYS B O   
1799 O O   B LYS B 73  ? 0.4500 0.7107 0.4701 -0.0194 -0.0187 0.0615  73   LYS B O   
1800 C CB  A LYS B 73  ? 0.4581 0.6963 0.4858 0.0045  -0.0262 0.0610  73   LYS B CB  
1801 C CB  B LYS B 73  ? 0.4577 0.6951 0.4854 0.0044  -0.0259 0.0609  73   LYS B CB  
1802 C CG  A LYS B 73  ? 0.4773 0.7111 0.4946 0.0034  -0.0344 0.0668  73   LYS B CG  
1803 C CG  B LYS B 73  ? 0.4768 0.7089 0.4944 0.0046  -0.0344 0.0665  73   LYS B CG  
1804 C CD  A LYS B 73  ? 0.5032 0.7105 0.5061 0.0097  -0.0441 0.0718  73   LYS B CD  
1805 C CD  B LYS B 73  ? 0.5010 0.7071 0.5057 0.0120  -0.0434 0.0707  73   LYS B CD  
1806 C CE  A LYS B 73  ? 0.5165 0.7159 0.5063 0.0090  -0.0540 0.0779  73   LYS B CE  
1807 C CE  B LYS B 73  ? 0.4871 0.6918 0.5018 0.0257  -0.0413 0.0648  73   LYS B CE  
1808 N NZ  A LYS B 73  ? 0.4929 0.7093 0.4950 0.0191  -0.0549 0.0741  73   LYS B NZ  
1809 N NZ  B LYS B 73  ? 0.5009 0.6810 0.5023 0.0369  -0.0514 0.0669  73   LYS B NZ  
1810 N N   . ASN B 74  ? 0.4492 0.7257 0.4763 -0.0146 -0.0210 0.0596  74   ASN B N   
1811 C CA  . ASN B 74  ? 0.4608 0.7488 0.4794 -0.0245 -0.0220 0.0623  74   ASN B CA  
1812 C C   . ASN B 74  ? 0.4875 0.7611 0.4910 -0.0285 -0.0308 0.0716  74   ASN B C   
1813 O O   . ASN B 74  ? 0.4956 0.7667 0.4993 -0.0231 -0.0357 0.0731  74   ASN B O   
1814 C CB  . ASN B 74  ? 0.4470 0.7533 0.4730 -0.0228 -0.0195 0.0565  74   ASN B CB  
1815 C CG  . ASN B 74  ? 0.4410 0.7637 0.4592 -0.0321 -0.0188 0.0568  74   ASN B CG  
1816 O OD1 . ASN B 74  ? 0.4415 0.7615 0.4472 -0.0404 -0.0231 0.0643  74   ASN B OD1 
1817 N ND2 . ASN B 74  ? 0.3689 0.7080 0.3926 -0.0306 -0.0141 0.0485  74   ASN B ND2 
1818 N N   . THR B 75  ? 0.5096 0.7729 0.4986 -0.0386 -0.0336 0.0779  75   THR B N   
1819 C CA  . THR B 75  ? 0.5449 0.7863 0.5143 -0.0436 -0.0440 0.0877  75   THR B CA  
1820 C C   . THR B 75  ? 0.5510 0.8014 0.5123 -0.0500 -0.0480 0.0916  75   THR B C   
1821 O O   . THR B 75  ? 0.5740 0.8056 0.5222 -0.0484 -0.0579 0.0980  75   THR B O   
1822 C CB  . THR B 75  ? 0.5639 0.7914 0.5161 -0.0570 -0.0468 0.0945  75   THR B CB  
1823 O OG1 . THR B 75  ? 0.5632 0.8178 0.5185 -0.0689 -0.0391 0.0921  75   THR B OG1 
1824 C CG2 . THR B 75  ? 0.5736 0.7818 0.5282 -0.0492 -0.0468 0.0926  75   THR B CG2 
1825 N N   . ASP B 76  ? 0.5324 0.8107 0.5003 -0.0559 -0.0411 0.0872  76   ASP B N   
1826 C CA  . ASP B 76  ? 0.5352 0.8255 0.4960 -0.0622 -0.0438 0.0898  76   ASP B CA  
1827 C C   . ASP B 76  ? 0.5230 0.8143 0.4939 -0.0498 -0.0461 0.0864  76   ASP B C   
1828 O O   . ASP B 76  ? 0.5426 0.8235 0.5033 -0.0496 -0.0546 0.0923  76   ASP B O   
1829 C CB  . ASP B 76  ? 0.5213 0.8432 0.4860 -0.0702 -0.0355 0.0842  76   ASP B CB  
1830 C CG  . ASP B 76  ? 0.5343 0.8634 0.4903 -0.0835 -0.0328 0.0870  76   ASP B CG  
1831 O OD1 . ASP B 76  ? 0.5396 0.8470 0.4804 -0.0919 -0.0391 0.0962  76   ASP B OD1 
1832 O OD2 . ASP B 76  ? 0.5276 0.8845 0.4912 -0.0854 -0.0250 0.0796  76   ASP B OD2 
1833 N N   . THR B 77  ? 0.4903 0.7937 0.4799 -0.0402 -0.0394 0.0771  77   THR B N   
1834 C CA  . THR B 77  ? 0.4740 0.7834 0.4741 -0.0310 -0.0409 0.0733  77   THR B CA  
1835 C C   . THR B 77  ? 0.4715 0.7665 0.4778 -0.0188 -0.0452 0.0738  77   THR B C   
1836 O O   . THR B 77  ? 0.4668 0.7654 0.4774 -0.0121 -0.0497 0.0735  77   THR B O   
1837 C CB  . THR B 77  ? 0.4512 0.7792 0.4650 -0.0285 -0.0330 0.0633  77   THR B CB  
1838 O OG1 . THR B 77  ? 0.4259 0.7491 0.4496 -0.0230 -0.0280 0.0587  77   THR B OG1 
1839 C CG2 . THR B 77  ? 0.4480 0.7926 0.4560 -0.0371 -0.0289 0.0604  77   THR B CG2 
1840 N N   . GLY B 78  ? 0.4630 0.7445 0.4698 -0.0156 -0.0438 0.0739  78   GLY B N   
1841 C CA  . GLY B 78  ? 0.4617 0.7308 0.4730 -0.0029 -0.0477 0.0734  78   GLY B CA  
1842 C C   . GLY B 78  ? 0.4384 0.7209 0.4687 0.0046  -0.0408 0.0653  78   GLY B C   
1843 O O   . GLY B 78  ? 0.4387 0.7170 0.4745 0.0152  -0.0427 0.0636  78   GLY B O   
1844 N N   . ALA B 79  ? 0.4210 0.7191 0.4593 -0.0007 -0.0335 0.0600  79   ALA B N   
1845 C CA  . ALA B 79  ? 0.4099 0.7187 0.4625 0.0032  -0.0281 0.0531  79   ALA B CA  
1846 C C   . ALA B 79  ? 0.4120 0.7116 0.4683 0.0064  -0.0236 0.0508  79   ALA B C   
1847 O O   . ALA B 79  ? 0.4106 0.7030 0.4615 0.0018  -0.0208 0.0512  79   ALA B O   
1848 C CB  . ALA B 79  ? 0.4002 0.7216 0.4551 -0.0032 -0.0238 0.0481  79   ALA B CB  
1849 N N   . ILE B 80  ? 0.4112 0.7138 0.4765 0.0140  -0.0231 0.0482  80   ILE B N   
1850 C CA  . ILE B 80  ? 0.4042 0.6990 0.4727 0.0178  -0.0191 0.0458  80   ILE B CA  
1851 C C   . ILE B 80  ? 0.3926 0.6991 0.4711 0.0155  -0.0131 0.0399  80   ILE B C   
1852 O O   . ILE B 80  ? 0.3882 0.7097 0.4731 0.0147  -0.0137 0.0380  80   ILE B O   
1853 C CB  . ILE B 80  ? 0.4152 0.7043 0.4841 0.0293  -0.0235 0.0468  80   ILE B CB  
1854 C CG1 . ILE B 80  ? 0.4433 0.7170 0.4987 0.0322  -0.0324 0.0530  80   ILE B CG1 
1855 C CG2 . ILE B 80  ? 0.4081 0.6864 0.4773 0.0327  -0.0198 0.0448  80   ILE B CG2 
1856 C CD1 . ILE B 80  ? 0.4788 0.7411 0.5305 0.0461  -0.0388 0.0530  80   ILE B CD1 
1857 N N   . LYS B 81  ? 0.3924 0.6909 0.4705 0.0134  -0.0083 0.0375  81   LYS B N   
1858 C CA  . LYS B 81  ? 0.3863 0.6901 0.4704 0.0113  -0.0039 0.0328  81   LYS B CA  
1859 C C   . LYS B 81  ? 0.3892 0.6824 0.4731 0.0143  -0.0005 0.0318  81   LYS B C   
1860 O O   . LYS B 81  ? 0.3833 0.6634 0.4614 0.0152  -0.0006 0.0336  81   LYS B O   
1861 C CB  . LYS B 81  ? 0.3819 0.6863 0.4628 0.0038  -0.0025 0.0294  81   LYS B CB  
1862 C CG  . LYS B 81  ? 0.3819 0.6762 0.4558 0.0022  -0.0012 0.0283  81   LYS B CG  
1863 C CD  . LYS B 81  ? 0.3795 0.6706 0.4494 -0.0013 -0.0002 0.0226  81   LYS B CD  
1864 C CE  . LYS B 81  ? 0.3724 0.6710 0.4399 -0.0050 -0.0032 0.0206  81   LYS B CE  
1865 N NZ  . LYS B 81  ? 0.3708 0.6608 0.4316 -0.0083 -0.0041 0.0149  81   LYS B NZ  
1866 N N   . ARG B 82  ? 0.3958 0.6962 0.4855 0.0145  0.0022  0.0290  82   ARG B N   
1867 C CA  . ARG B 82  ? 0.4018 0.6944 0.4914 0.0174  0.0055  0.0277  82   ARG B CA  
1868 C C   . ARG B 82  ? 0.3972 0.6892 0.4861 0.0100  0.0093  0.0244  82   ARG B C   
1869 O O   . ARG B 82  ? 0.3948 0.6953 0.4843 0.0029  0.0088  0.0232  82   ARG B O   
1870 C CB  . ARG B 82  ? 0.4122 0.7150 0.5074 0.0263  0.0049  0.0272  82   ARG B CB  
1871 C CG  . ARG B 82  ? 0.4485 0.7448 0.5403 0.0358  -0.0007 0.0301  82   ARG B CG  
1872 C CD  . ARG B 82  ? 0.4926 0.8002 0.5892 0.0478  -0.0023 0.0277  82   ARG B CD  
1873 N NE  . ARG B 82  ? 0.5428 0.8378 0.6320 0.0584  -0.0100 0.0302  82   ARG B NE  
1874 C CZ  . ARG B 82  ? 0.5710 0.8719 0.6598 0.0621  -0.0162 0.0322  82   ARG B CZ  
1875 N NH1 . ARG B 82  ? 0.5622 0.8842 0.6592 0.0560  -0.0151 0.0318  82   ARG B NH1 
1876 N NH2 . ARG B 82  ? 0.6065 0.8897 0.6845 0.0718  -0.0246 0.0349  82   ARG B NH2 
1877 N N   . GLY B 83  ? 0.3971 0.6771 0.4829 0.0109  0.0120  0.0235  83   GLY B N   
1878 C CA  . GLY B 83  ? 0.3960 0.6712 0.4782 0.0041  0.0146  0.0209  83   GLY B CA  
1879 C C   . GLY B 83  ? 0.3926 0.6550 0.4718 0.0073  0.0171  0.0204  83   GLY B C   
1880 O O   . GLY B 83  ? 0.3870 0.6454 0.4671 0.0146  0.0169  0.0218  83   GLY B O   
1881 N N   . THR B 84  ? 0.3946 0.6481 0.4680 0.0015  0.0185  0.0185  84   THR B N   
1882 C CA  . THR B 84  ? 0.3939 0.6345 0.4632 0.0036  0.0206  0.0179  84   THR B CA  
1883 C C   . THR B 84  ? 0.3939 0.6174 0.4541 0.0008  0.0186  0.0160  84   THR B C   
1884 O O   . THR B 84  ? 0.3977 0.6170 0.4519 -0.0047 0.0161  0.0143  84   THR B O   
1885 C CB  . THR B 84  ? 0.3983 0.6459 0.4680 0.0005  0.0240  0.0171  84   THR B CB  
1886 O OG1 . THR B 84  ? 0.3905 0.6467 0.4582 -0.0097 0.0235  0.0169  84   THR B OG1 
1887 C CG2 . THR B 84  ? 0.4006 0.6637 0.4787 0.0089  0.0258  0.0172  84   THR B CG2 
1888 N N   . LEU B 85  ? 0.3888 0.6020 0.4469 0.0053  0.0189  0.0158  85   LEU B N   
1889 C CA  . LEU B 85  ? 0.3871 0.5871 0.4375 0.0052  0.0166  0.0131  85   LEU B CA  
1890 C C   . LEU B 85  ? 0.3987 0.5863 0.4417 0.0022  0.0172  0.0119  85   LEU B C   
1891 O O   . LEU B 85  ? 0.4045 0.5894 0.4484 0.0040  0.0199  0.0130  85   LEU B O   
1892 C CB  . LEU B 85  ? 0.3802 0.5793 0.4321 0.0100  0.0164  0.0137  85   LEU B CB  
1893 C CG  . LEU B 85  ? 0.3547 0.5649 0.4108 0.0110  0.0153  0.0156  85   LEU B CG  
1894 C CD1 . LEU B 85  ? 0.3190 0.5286 0.3741 0.0122  0.0148  0.0170  85   LEU B CD1 
1895 C CD2 . LEU B 85  ? 0.3529 0.5681 0.4070 0.0100  0.0127  0.0124  85   LEU B CD2 
1896 N N   . MET B 86  ? 0.4111 0.5888 0.4446 -0.0028 0.0139  0.0099  86   MET B N   
1897 C CA  . MET B 86  ? 0.4256 0.5883 0.4482 -0.0078 0.0131  0.0094  86   MET B CA  
1898 C C   . MET B 86  ? 0.4174 0.5641 0.4328 -0.0020 0.0101  0.0066  86   MET B C   
1899 O O   . MET B 86  ? 0.4127 0.5600 0.4288 0.0044  0.0072  0.0037  86   MET B O   
1900 C CB  . MET B 86  ? 0.4506 0.6046 0.4614 -0.0174 0.0088  0.0090  86   MET B CB  
1901 C CG  . MET B 86  ? 0.5032 0.6464 0.5058 -0.0144 0.0020  0.0052  86   MET B CG  
1902 S SD  . MET B 86  ? 0.6207 0.7415 0.6014 -0.0264 -0.0060 0.0046  86   MET B SD  
1903 C CE  . MET B 86  ? 0.6276 0.7204 0.5909 -0.0272 -0.0100 0.0038  86   MET B CE  
1904 N N   . PRO B 87  ? 0.4125 0.5478 0.4211 -0.0042 0.0107  0.0072  87   PRO B N   
1905 C CA  . PRO B 87  ? 0.4079 0.5284 0.4091 0.0013  0.0072  0.0045  87   PRO B CA  
1906 C C   . PRO B 87  ? 0.4145 0.5151 0.3997 0.0021  -0.0011 0.0005  87   PRO B C   
1907 O O   . PRO B 87  ? 0.4233 0.5119 0.3968 -0.0061 -0.0043 0.0014  87   PRO B O   
1908 C CB  . PRO B 87  ? 0.4124 0.5266 0.4099 -0.0025 0.0104  0.0068  87   PRO B CB  
1909 C CG  . PRO B 87  ? 0.4161 0.5358 0.4117 -0.0127 0.0130  0.0095  87   PRO B CG  
1910 C CD  . PRO B 87  ? 0.4145 0.5528 0.4218 -0.0120 0.0148  0.0101  87   PRO B CD  
1911 N N   . MET B 88  ? 0.4104 0.5077 0.3938 0.0120  -0.0054 -0.0041 88   MET B N   
1912 C CA  . MET B 88  ? 0.4274 0.5049 0.3943 0.0170  -0.0150 -0.0097 88   MET B CA  
1913 C C   . MET B 88  ? 0.4218 0.4996 0.3883 0.0291  -0.0186 -0.0150 88   MET B C   
1914 O O   . MET B 88  ? 0.4041 0.5002 0.3841 0.0317  -0.0133 -0.0138 88   MET B O   
1915 C CB  . MET B 88  ? 0.4293 0.5122 0.3961 0.0187  -0.0179 -0.0126 88   MET B CB  
1916 C CG  . MET B 88  ? 0.4217 0.5318 0.4050 0.0260  -0.0139 -0.0145 88   MET B CG  
1917 S SD  . MET B 88  ? 0.4513 0.5696 0.4347 0.0265  -0.0162 -0.0172 88   MET B SD  
1918 C CE  . MET B 88  ? 0.3969 0.5260 0.3908 0.0131  -0.0088 -0.0086 88   MET B CE  
1919 N N   . VAL B 89  ? 0.4402 0.4976 0.3896 0.0366  -0.0287 -0.0211 89   VAL B N   
1920 C CA  . VAL B 89  ? 0.4391 0.4999 0.3877 0.0503  -0.0334 -0.0277 89   VAL B CA  
1921 C C   . VAL B 89  ? 0.4517 0.5147 0.3942 0.0634  -0.0413 -0.0370 89   VAL B C   
1922 O O   . VAL B 89  ? 0.4665 0.5097 0.3941 0.0630  -0.0479 -0.0392 89   VAL B O   
1923 C CB  . VAL B 89  ? 0.4579 0.4915 0.3899 0.0513  -0.0399 -0.0281 89   VAL B CB  
1924 C CG1 . VAL B 89  ? 0.4828 0.4800 0.3882 0.0510  -0.0514 -0.0306 89   VAL B CG1 
1925 C CG2 . VAL B 89  ? 0.4333 0.4781 0.3691 0.0649  -0.0431 -0.0341 89   VAL B CG2 
1926 N N   . ALA B 90  ? 0.4479 0.5370 0.4015 0.0746  -0.0406 -0.0426 90   ALA B N   
1927 C CA  . ALA B 90  ? 0.4631 0.5599 0.4114 0.0904  -0.0482 -0.0535 90   ALA B CA  
1928 C C   . ALA B 90  ? 0.4817 0.5809 0.4261 0.1043  -0.0546 -0.0606 90   ALA B C   
1929 O O   . ALA B 90  ? 0.4804 0.5713 0.4247 0.0999  -0.0533 -0.0562 90   ALA B O   
1930 C CB  . ALA B 90  ? 0.4380 0.5728 0.4045 0.0906  -0.0411 -0.0543 90   ALA B CB  
1931 N N   . ASP B 91  ? 0.5041 0.6164 0.4451 0.1219  -0.0617 -0.0722 91   ASP B N   
1932 C CA  . ASP B 91  ? 0.5249 0.6424 0.4615 0.1381  -0.0694 -0.0809 91   ASP B CA  
1933 C C   . ASP B 91  ? 0.5016 0.6570 0.4593 0.1344  -0.0610 -0.0781 91   ASP B C   
1934 O O   . ASP B 91  ? 0.5085 0.6664 0.4636 0.1436  -0.0662 -0.0825 91   ASP B O   
1935 C CB  . ASP B 91  ? 0.5476 0.6736 0.4752 0.1603  -0.0797 -0.0958 91   ASP B CB  
1936 C CG  . ASP B 91  ? 0.5484 0.7226 0.4950 0.1622  -0.0720 -0.0995 91   ASP B CG  
1937 O OD1 . ASP B 91  ? 0.5375 0.7323 0.5016 0.1450  -0.0597 -0.0897 91   ASP B OD1 
1938 O OD2 . ASP B 91  ? 0.5914 0.7824 0.5338 0.1814  -0.0790 -0.1129 91   ASP B OD2 
1939 N N   . ASP B 92  ? 0.4743 0.6573 0.4506 0.1207  -0.0492 -0.0707 92   ASP B N   
1940 C CA  . ASP B 92  ? 0.4514 0.6651 0.4447 0.1128  -0.0415 -0.0659 92   ASP B CA  
1941 C C   . ASP B 92  ? 0.4355 0.6306 0.4316 0.0954  -0.0344 -0.0533 92   ASP B C   
1942 O O   . ASP B 92  ? 0.4205 0.6357 0.4288 0.0857  -0.0277 -0.0475 92   ASP B O   
1943 C CB  . ASP B 92  ? 0.4381 0.6963 0.4473 0.1096  -0.0349 -0.0667 92   ASP B CB  
1944 C CG  . ASP B 92  ? 0.4293 0.6836 0.4431 0.0960  -0.0276 -0.0584 92   ASP B CG  
1945 O OD1 . ASP B 92  ? 0.4484 0.6735 0.4522 0.0960  -0.0301 -0.0575 92   ASP B OD1 
1946 O OD2 . ASP B 92  ? 0.4112 0.6917 0.4375 0.0848  -0.0202 -0.0525 92   ASP B OD2 
1947 N N   . GLY B 93  ? 0.4428 0.6002 0.4261 0.0913  -0.0366 -0.0494 93   GLY B N   
1948 C CA  . GLY B 93  ? 0.4302 0.5704 0.4140 0.0776  -0.0309 -0.0395 93   GLY B CA  
1949 C C   . GLY B 93  ? 0.4193 0.5512 0.4056 0.0656  -0.0246 -0.0321 93   GLY B C   
1950 O O   . GLY B 93  ? 0.4190 0.5580 0.4071 0.0664  -0.0243 -0.0337 93   GLY B O   
1951 N N   . PRO B 94  ? 0.4126 0.5314 0.3990 0.0549  -0.0195 -0.0244 94   PRO B N   
1952 C CA  . PRO B 94  ? 0.4039 0.5172 0.3927 0.0445  -0.0138 -0.0179 94   PRO B CA  
1953 C C   . PRO B 94  ? 0.3830 0.5207 0.3875 0.0399  -0.0067 -0.0140 94   PRO B C   
1954 O O   . PRO B 94  ? 0.3683 0.5242 0.3811 0.0404  -0.0048 -0.0137 94   PRO B O   
1955 C CB  . PRO B 94  ? 0.4071 0.5039 0.3912 0.0373  -0.0111 -0.0127 94   PRO B CB  
1956 C CG  . PRO B 94  ? 0.4029 0.5052 0.3890 0.0415  -0.0122 -0.0142 94   PRO B CG  
1957 C CD  . PRO B 94  ? 0.4140 0.5237 0.3973 0.0533  -0.0196 -0.0223 94   PRO B CD  
1958 N N   . HIS B 95  ? 0.3767 0.5139 0.3834 0.0344  -0.0037 -0.0108 95   HIS B N   
1959 C CA  . HIS B 95  ? 0.3566 0.5122 0.3754 0.0300  0.0017  -0.0065 95   HIS B CA  
1960 C C   . HIS B 95  ? 0.3524 0.5034 0.3718 0.0241  0.0043  -0.0029 95   HIS B C   
1961 O O   . HIS B 95  ? 0.3589 0.4946 0.3692 0.0220  0.0019  -0.0037 95   HIS B O   
1962 C CB  . HIS B 95  ? 0.3523 0.5290 0.3762 0.0345  0.0002  -0.0103 95   HIS B CB  
1963 C CG  . HIS B 95  ? 0.3687 0.5418 0.3861 0.0397  -0.0043 -0.0160 95   HIS B CG  
1964 N ND1 . HIS B 95  ? 0.4008 0.5668 0.4085 0.0495  -0.0114 -0.0240 95   HIS B ND1 
1965 C CD2 . HIS B 95  ? 0.3771 0.5511 0.3947 0.0371  -0.0040 -0.0153 95   HIS B CD2 
1966 C CE1 . HIS B 95  ? 0.4258 0.5861 0.4266 0.0529  -0.0155 -0.0281 95   HIS B CE1 
1967 N NE2 . HIS B 95  ? 0.4005 0.5662 0.4075 0.0446  -0.0108 -0.0227 95   HIS B NE2 
1968 N N   . TYR B 96  ? 0.3413 0.5054 0.3701 0.0209  0.0085  0.0012  96   TYR B N   
1969 C CA  . TYR B 96  ? 0.3371 0.5034 0.3687 0.0167  0.0107  0.0041  96   TYR B CA  
1970 C C   . TYR B 96  ? 0.3393 0.5180 0.3740 0.0180  0.0090  0.0024  96   TYR B C   
1971 O O   . TYR B 96  ? 0.3379 0.5302 0.3776 0.0193  0.0095  0.0028  96   TYR B O   
1972 C CB  . TYR B 96  ? 0.3302 0.5014 0.3686 0.0145  0.0151  0.0092  96   TYR B CB  
1973 C CG  . TYR B 96  ? 0.3084 0.4689 0.3436 0.0140  0.0170  0.0103  96   TYR B CG  
1974 C CD1 . TYR B 96  ? 0.2963 0.4511 0.3281 0.0108  0.0188  0.0106  96   TYR B CD1 
1975 C CD2 . TYR B 96  ? 0.2935 0.4510 0.3280 0.0156  0.0169  0.0110  96   TYR B CD2 
1976 C CE1 . TYR B 96  ? 0.3053 0.4521 0.3333 0.0104  0.0209  0.0112  96   TYR B CE1 
1977 C CE2 . TYR B 96  ? 0.3064 0.4533 0.3368 0.0155  0.0183  0.0116  96   TYR B CE2 
1978 C CZ  . TYR B 96  ? 0.3051 0.4469 0.3324 0.0135  0.0205  0.0114  96   TYR B CZ  
1979 O OH  . TYR B 96  ? 0.2958 0.4288 0.3183 0.0134  0.0223  0.0116  96   TYR B OH  
1980 N N   . GLY B 97  ? 0.3483 0.5224 0.3783 0.0163  0.0068  0.0006  97   GLY B N   
1981 C CA  . GLY B 97  ? 0.3486 0.5329 0.3796 0.0180  0.0046  -0.0017 97   GLY B CA  
1982 C C   . GLY B 97  ? 0.3546 0.5374 0.3841 0.0126  0.0040  -0.0004 97   GLY B C   
1983 O O   . GLY B 97  ? 0.3617 0.5363 0.3884 0.0068  0.0048  0.0019  97   GLY B O   
1984 N N   . ALA B 98  ? 0.3559 0.5492 0.3871 0.0136  0.0025  -0.0019 98   ALA B N   
1985 C CA  . ALA B 98  ? 0.3667 0.5601 0.3959 0.0083  0.0010  -0.0012 98   ALA B CA  
1986 C C   . ALA B 98  ? 0.3735 0.5739 0.3999 0.0119  -0.0024 -0.0055 98   ALA B C   
1987 O O   . ALA B 98  ? 0.3652 0.5810 0.3976 0.0160  -0.0008 -0.0060 98   ALA B O   
1988 C CB  . ALA B 98  ? 0.3529 0.5595 0.3932 0.0037  0.0056  0.0050  98   ALA B CB  
1989 N N   . ASN B 99  ? 0.3898 0.5784 0.4052 0.0095  -0.0076 -0.0087 99   ASN B N   
1990 C CA  . ASN B 99  ? 0.3959 0.5906 0.4076 0.0124  -0.0111 -0.0130 99   ASN B CA  
1991 C C   . ASN B 99  ? 0.3875 0.5992 0.4095 0.0062  -0.0078 -0.0075 99   ASN B C   
1992 O O   . ASN B 99  ? 0.3870 0.5979 0.4115 -0.0017 -0.0066 -0.0029 99   ASN B O   
1993 C CB  . ASN B 99  ? 0.4206 0.5918 0.4134 0.0118  -0.0195 -0.0186 99   ASN B CB  
1994 C CG  . ASN B 99  ? 0.4281 0.5825 0.4077 0.0225  -0.0255 -0.0265 99   ASN B CG  
1995 O OD1 . ASN B 99  ? 0.3934 0.5597 0.3801 0.0308  -0.0228 -0.0287 99   ASN B OD1 
1996 N ND2 . ASN B 99  ? 0.4385 0.5645 0.3974 0.0221  -0.0346 -0.0309 99   ASN B ND2 
1997 N N   . ILE B 100 ? 0.3840 0.6129 0.4113 0.0097  -0.0066 -0.0081 100  ILE B N   
1998 C CA  . ILE B 100 ? 0.3754 0.6199 0.4113 0.0050  -0.0045 -0.0027 100  ILE B CA  
1999 C C   . ILE B 100 ? 0.3853 0.6364 0.4158 0.0062  -0.0080 -0.0069 100  ILE B C   
2000 O O   . ILE B 100 ? 0.3815 0.6366 0.4069 0.0129  -0.0094 -0.0130 100  ILE B O   
2001 C CB  . ILE B 100 ? 0.3628 0.6214 0.4091 0.0061  0.0000  0.0025  100  ILE B CB  
2002 C CG1 . ILE B 100 ? 0.3515 0.6027 0.4022 0.0056  0.0030  0.0063  100  ILE B CG1 
2003 C CG2 . ILE B 100 ? 0.3433 0.6147 0.3954 0.0025  0.0002  0.0078  100  ILE B CG2 
2004 C CD1 . ILE B 100 ? 0.3228 0.5812 0.3792 0.0064  0.0057  0.0112  100  ILE B CD1 
2005 N N   . ALA B 101 ? 0.3941 0.6482 0.4253 0.0001  -0.0095 -0.0042 101  ALA B N   
2006 C CA  . ALA B 101 ? 0.4037 0.6653 0.4303 0.0002  -0.0126 -0.0071 101  ALA B CA  
2007 C C   . ALA B 101 ? 0.4016 0.6838 0.4378 0.0001  -0.0092 -0.0021 101  ALA B C   
2008 O O   . ALA B 101 ? 0.4008 0.6888 0.4459 -0.0032 -0.0070 0.0049  101  ALA B O   
2009 C CB  . ALA B 101 ? 0.4107 0.6665 0.4331 -0.0078 -0.0164 -0.0060 101  ALA B CB  
2010 N N   . MET B 102 ? 0.4144 0.7076 0.4470 0.0041  -0.0094 -0.0060 102  MET B N   
2011 C CA  . MET B 102 ? 0.4179 0.7292 0.4556 0.0019  -0.0070 -0.0007 102  MET B CA  
2012 C C   . MET B 102 ? 0.4312 0.7520 0.4642 0.0000  -0.0099 -0.0023 102  MET B C   
2013 O O   . MET B 102 ? 0.4322 0.7546 0.4685 -0.0047 -0.0113 0.0029  102  MET B O   
2014 C CB  . MET B 102 ? 0.4136 0.7356 0.4512 0.0051  -0.0042 -0.0026 102  MET B CB  
2015 C CG  . MET B 102 ? 0.4144 0.7281 0.4568 0.0057  -0.0015 0.0002  102  MET B CG  
2016 S SD  . MET B 102 ? 0.4322 0.7427 0.4820 0.0000  0.0001  0.0119  102  MET B SD  
2017 C CE  . MET B 102 ? 0.3856 0.7138 0.4322 -0.0054 0.0006  0.0165  102  MET B CE  
2018 N N   . GLU B 103 ? 0.4478 0.7763 0.4729 0.0047  -0.0111 -0.0103 103  GLU B N   
2019 C CA  . GLU B 103 ? 0.4647 0.8011 0.4833 0.0036  -0.0142 -0.0132 103  GLU B CA  
2020 C C   . GLU B 103 ? 0.4836 0.8024 0.4966 0.0015  -0.0192 -0.0154 103  GLU B C   
2021 O O   . GLU B 103 ? 0.4824 0.8053 0.4938 -0.0031 -0.0218 -0.0134 103  GLU B O   
2022 C CB  . GLU B 103 ? 0.4720 0.8211 0.4819 0.0112  -0.0147 -0.0234 103  GLU B CB  
2023 C CG  . GLU B 103 ? 0.4596 0.8336 0.4737 0.0100  -0.0098 -0.0213 103  GLU B CG  
2024 C CD  . GLU B 103 ? 0.4651 0.8401 0.4821 0.0156  -0.0074 -0.0246 103  GLU B CD  
2025 O OE1 . GLU B 103 ? 0.4678 0.8238 0.4890 0.0154  -0.0072 -0.0214 103  GLU B OE1 
2026 O OE2 . GLU B 103 ? 0.4895 0.8866 0.5045 0.0199  -0.0056 -0.0308 103  GLU B OE2 
2027 N N   . LYS B 104 ? 0.5054 0.8047 0.5143 0.0037  -0.0212 -0.0189 104  LYS B N   
2028 C CA  . LYS B 104 ? 0.5326 0.8128 0.5331 -0.0010 -0.0267 -0.0204 104  LYS B CA  
2029 C C   . LYS B 104 ? 0.5305 0.8126 0.5415 -0.0108 -0.0252 -0.0111 104  LYS B C   
2030 O O   . LYS B 104 ? 0.5452 0.8167 0.5504 -0.0179 -0.0294 -0.0111 104  LYS B O   
2031 C CB  . LYS B 104 ? 0.5477 0.8036 0.5361 0.0036  -0.0307 -0.0273 104  LYS B CB  
2032 C CG  . LYS B 104 ? 0.5868 0.8382 0.5608 0.0153  -0.0353 -0.0391 104  LYS B CG  
2033 C CD  . LYS B 104 ? 0.6310 0.8560 0.5916 0.0222  -0.0406 -0.0460 104  LYS B CD  
2034 C CE  . LYS B 104 ? 0.6603 0.8808 0.6049 0.0368  -0.0468 -0.0595 104  LYS B CE  
2035 N NZ  . LYS B 104 ? 0.6909 0.8829 0.6201 0.0457  -0.0538 -0.0667 104  LYS B NZ  
2036 N N   . ASP B 105 ? 0.5209 0.8164 0.5459 -0.0112 -0.0199 -0.0037 105  ASP B N   
2037 C CA  . ASP B 105 ? 0.5196 0.8216 0.5549 -0.0173 -0.0190 0.0036  105  ASP B CA  
2038 C C   . ASP B 105 ? 0.5243 0.8412 0.5620 -0.0200 -0.0211 0.0068  105  ASP B C   
2039 O O   . ASP B 105 ? 0.5209 0.8482 0.5610 -0.0173 -0.0198 0.0096  105  ASP B O   
2040 C CB  . ASP B 105 ? 0.5071 0.8127 0.5534 -0.0144 -0.0141 0.0091  105  ASP B CB  
2041 C CG  . ASP B 105 ? 0.5030 0.8153 0.5590 -0.0180 -0.0135 0.0144  105  ASP B CG  
2042 O OD1 . ASP B 105 ? 0.5213 0.8371 0.5763 -0.0244 -0.0164 0.0140  105  ASP B OD1 
2043 O OD2 . ASP B 105 ? 0.5015 0.8167 0.5655 -0.0144 -0.0106 0.0185  105  ASP B OD2 
2044 N N   . LYS B 106 ? 0.5366 0.8543 0.5724 -0.0268 -0.0250 0.0068  106  LYS B N   
2045 C CA  . LYS B 106 ? 0.5449 0.8755 0.5810 -0.0298 -0.0283 0.0088  106  LYS B CA  
2046 C C   . LYS B 106 ? 0.5308 0.8776 0.5806 -0.0299 -0.0274 0.0164  106  LYS B C   
2047 O O   . LYS B 106 ? 0.5266 0.8849 0.5780 -0.0299 -0.0300 0.0194  106  LYS B O   
2048 C CB  . LYS B 106 ? 0.5674 0.8916 0.5934 -0.0379 -0.0341 0.0051  106  LYS B CB  
2049 C CG  . LYS B 106 ? 0.6170 0.9171 0.6281 -0.0395 -0.0369 -0.0017 106  LYS B CG  
2050 C CD  . LYS B 106 ? 0.6579 0.9478 0.6576 -0.0300 -0.0375 -0.0093 106  LYS B CD  
2051 C CE  . LYS B 106 ? 0.6971 0.9593 0.6797 -0.0295 -0.0424 -0.0165 106  LYS B CE  
2052 N NZ  . LYS B 106 ? 0.6868 0.9422 0.6616 -0.0166 -0.0422 -0.0246 106  LYS B NZ  
2053 N N   . LYS B 107 ? 0.5249 0.8721 0.5834 -0.0289 -0.0245 0.0188  107  LYS B N   
2054 C CA  . LYS B 107 ? 0.5160 0.8785 0.5869 -0.0262 -0.0244 0.0242  107  LYS B CA  
2055 C C   . LYS B 107 ? 0.5036 0.8669 0.5766 -0.0183 -0.0241 0.0288  107  LYS B C   
2056 O O   . LYS B 107 ? 0.5066 0.8804 0.5860 -0.0143 -0.0267 0.0328  107  LYS B O   
2057 C CB  . LYS B 107 ? 0.5162 0.8796 0.5942 -0.0263 -0.0210 0.0244  107  LYS B CB  
2058 C CG  . LYS B 107 ? 0.5392 0.9024 0.6137 -0.0371 -0.0219 0.0216  107  LYS B CG  
2059 C CD  . LYS B 107 ? 0.5676 0.9401 0.6509 -0.0382 -0.0184 0.0227  107  LYS B CD  
2060 C CE  . LYS B 107 ? 0.5810 0.9381 0.6637 -0.0321 -0.0138 0.0222  107  LYS B CE  
2061 N NZ  . LYS B 107 ? 0.5759 0.9086 0.6450 -0.0352 -0.0141 0.0185  107  LYS B NZ  
2062 N N   . GLY B 108 ? 0.4915 0.8439 0.5579 -0.0163 -0.0219 0.0280  108  GLY B N   
2063 C CA  . GLY B 108 ? 0.4804 0.8309 0.5449 -0.0123 -0.0223 0.0331  108  GLY B CA  
2064 C C   . GLY B 108 ? 0.4700 0.8184 0.5249 -0.0146 -0.0213 0.0316  108  GLY B C   
2065 O O   . GLY B 108 ? 0.4653 0.8130 0.5153 -0.0164 -0.0202 0.0253  108  GLY B O   
2066 N N   . GLY B 109 ? 0.4642 0.8117 0.5148 -0.0145 -0.0224 0.0371  109  GLY B N   
2067 C CA  . GLY B 109 ? 0.4597 0.8103 0.5013 -0.0181 -0.0208 0.0365  109  GLY B CA  
2068 C C   . GLY B 109 ? 0.4435 0.7880 0.4852 -0.0171 -0.0165 0.0354  109  GLY B C   
2069 O O   . GLY B 109 ? 0.4381 0.7784 0.4758 -0.0193 -0.0170 0.0413  109  GLY B O   
2070 N N   . PHE B 110 ? 0.4336 0.7758 0.4781 -0.0144 -0.0132 0.0281  110  PHE B N   
2071 C CA  . PHE B 110 ? 0.4269 0.7646 0.4716 -0.0126 -0.0094 0.0259  110  PHE B CA  
2072 C C   . PHE B 110 ? 0.4255 0.7747 0.4641 -0.0125 -0.0077 0.0191  110  PHE B C   
2073 O O   . PHE B 110 ? 0.4207 0.7670 0.4591 -0.0079 -0.0060 0.0118  110  PHE B O   
2074 C CB  . PHE B 110 ? 0.4235 0.7499 0.4739 -0.0087 -0.0079 0.0223  110  PHE B CB  
2075 C CG  . PHE B 110 ? 0.4314 0.7522 0.4887 -0.0076 -0.0089 0.0273  110  PHE B CG  
2076 C CD1 . PHE B 110 ? 0.4332 0.7473 0.4923 -0.0058 -0.0084 0.0324  110  PHE B CD1 
2077 C CD2 . PHE B 110 ? 0.4438 0.7677 0.5050 -0.0084 -0.0109 0.0263  110  PHE B CD2 
2078 C CE1 . PHE B 110 ? 0.4440 0.7551 0.5089 -0.0021 -0.0098 0.0354  110  PHE B CE1 
2079 C CE2 . PHE B 110 ? 0.4423 0.7674 0.5109 -0.0063 -0.0117 0.0298  110  PHE B CE2 
2080 C CZ  . PHE B 110 ? 0.4471 0.7661 0.5177 -0.0019 -0.0111 0.0338  110  PHE B CZ  
2081 N N   . GLY B 111 ? 0.4304 0.7934 0.4630 -0.0171 -0.0085 0.0211  111  GLY B N   
2082 C CA  . GLY B 111 ? 0.4333 0.8138 0.4602 -0.0166 -0.0065 0.0142  111  GLY B CA  
2083 C C   . GLY B 111 ? 0.4298 0.8206 0.4553 -0.0211 -0.0036 0.0171  111  GLY B C   
2084 O O   . GLY B 111 ? 0.4284 0.8073 0.4567 -0.0233 -0.0032 0.0234  111  GLY B O   
2085 N N   . VAL B 112 ? 0.4302 0.8445 0.4505 -0.0227 -0.0016 0.0122  112  VAL B N   
2086 C CA  . VAL B 112 ? 0.4288 0.8599 0.4467 -0.0300 0.0010  0.0153  112  VAL B CA  
2087 C C   . VAL B 112 ? 0.4344 0.8576 0.4464 -0.0430 -0.0014 0.0291  112  VAL B C   
2088 O O   . VAL B 112 ? 0.4433 0.8617 0.4504 -0.0467 -0.0049 0.0342  112  VAL B O   
2089 C CB  . VAL B 112 ? 0.4341 0.8991 0.4471 -0.0302 0.0035  0.0071  112  VAL B CB  
2090 C CG1 . VAL B 112 ? 0.4436 0.9315 0.4529 -0.0422 0.0062  0.0121  112  VAL B CG1 
2091 C CG2 . VAL B 112 ? 0.4223 0.8919 0.4384 -0.0148 0.0043  -0.0075 112  VAL B CG2 
2092 N N   . GLY B 113 ? 0.4321 0.8512 0.4426 -0.0495 -0.0008 0.0349  113  GLY B N   
2093 C CA  . GLY B 113 ? 0.4410 0.8466 0.4415 -0.0619 -0.0051 0.0480  113  GLY B CA  
2094 C C   . GLY B 113 ? 0.4400 0.8279 0.4397 -0.0647 -0.0059 0.0533  113  GLY B C   
2095 O O   . GLY B 113 ? 0.4261 0.8189 0.4333 -0.0596 -0.0021 0.0473  113  GLY B O   
2096 N N   . ASN B 114 ? 0.4590 0.8245 0.4478 -0.0723 -0.0120 0.0644  114  ASN B N   
2097 C CA  . ASN B 114 ? 0.4720 0.8159 0.4558 -0.0760 -0.0145 0.0704  114  ASN B CA  
2098 C C   . ASN B 114 ? 0.4678 0.7853 0.4601 -0.0618 -0.0161 0.0689  114  ASN B C   
2099 O O   . ASN B 114 ? 0.4745 0.7793 0.4670 -0.0556 -0.0201 0.0708  114  ASN B O   
2100 C CB  . ASN B 114 ? 0.5019 0.8309 0.4648 -0.0915 -0.0223 0.0831  114  ASN B CB  
2101 C CG  . ASN B 114 ? 0.5283 0.8864 0.4810 -0.1090 -0.0206 0.0857  114  ASN B CG  
2102 O OD1 . ASN B 114 ? 0.5561 0.9371 0.5115 -0.1154 -0.0156 0.0824  114  ASN B OD1 
2103 N ND2 . ASN B 114 ? 0.5566 0.9163 0.4972 -0.1171 -0.0249 0.0915  114  ASN B ND2 
2104 N N   . TYR B 115 ? 0.4616 0.7735 0.4608 -0.0570 -0.0129 0.0652  115  TYR B N   
2105 C CA  . TYR B 115 ? 0.4521 0.7442 0.4601 -0.0441 -0.0130 0.0625  115  TYR B CA  
2106 C C   . TYR B 115 ? 0.4620 0.7301 0.4631 -0.0451 -0.0162 0.0674  115  TYR B C   
2107 O O   . TYR B 115 ? 0.4750 0.7432 0.4669 -0.0559 -0.0170 0.0712  115  TYR B O   
2108 C CB  . TYR B 115 ? 0.4307 0.7352 0.4532 -0.0349 -0.0064 0.0520  115  TYR B CB  
2109 C CG  . TYR B 115 ? 0.4234 0.7402 0.4524 -0.0295 -0.0051 0.0464  115  TYR B CG  
2110 C CD1 . TYR B 115 ? 0.4341 0.7734 0.4607 -0.0337 -0.0036 0.0432  115  TYR B CD1 
2111 C CD2 . TYR B 115 ? 0.3996 0.7068 0.4360 -0.0208 -0.0056 0.0441  115  TYR B CD2 
2112 C CE1 . TYR B 115 ? 0.4129 0.7605 0.4431 -0.0287 -0.0033 0.0377  115  TYR B CE1 
2113 C CE2 . TYR B 115 ? 0.3978 0.7146 0.4381 -0.0178 -0.0053 0.0394  115  TYR B CE2 
2114 C CZ  . TYR B 115 ? 0.4146 0.7494 0.4511 -0.0214 -0.0044 0.0362  115  TYR B CZ  
2115 O OH  . TYR B 115 ? 0.4341 0.7757 0.4724 -0.0184 -0.0050 0.0312  115  TYR B OH  
2116 N N   . GLU B 116 ? 0.4668 0.7159 0.4717 -0.0340 -0.0184 0.0668  116  GLU B N   
2117 C CA  . GLU B 116 ? 0.4788 0.7059 0.4799 -0.0305 -0.0204 0.0683  116  GLU B CA  
2118 C C   . GLU B 116 ? 0.4541 0.6847 0.4708 -0.0190 -0.0143 0.0602  116  GLU B C   
2119 O O   . GLU B 116 ? 0.4422 0.6800 0.4689 -0.0112 -0.0126 0.0562  116  GLU B O   
2120 C CB  . GLU B 116 ? 0.5028 0.7034 0.4915 -0.0262 -0.0296 0.0743  116  GLU B CB  
2121 C CG  . GLU B 116 ? 0.5515 0.7398 0.5188 -0.0394 -0.0378 0.0839  116  GLU B CG  
2122 C CD  . GLU B 116 ? 0.6094 0.7644 0.5602 -0.0332 -0.0492 0.0894  116  GLU B CD  
2123 O OE1 . GLU B 116 ? 0.6239 0.7700 0.5821 -0.0171 -0.0500 0.0848  116  GLU B OE1 
2124 O OE2 . GLU B 116 ? 0.6514 0.7893 0.5803 -0.0445 -0.0581 0.0981  116  GLU B OE2 
2125 N N   . LEU B 117 ? 0.4461 0.6720 0.4637 -0.0196 -0.0115 0.0582  117  LEU B N   
2126 C CA  . LEU B 117 ? 0.4307 0.6560 0.4596 -0.0103 -0.0067 0.0517  117  LEU B CA  
2127 C C   . LEU B 117 ? 0.4433 0.6460 0.4660 -0.0062 -0.0095 0.0537  117  LEU B C   
2128 O O   . LEU B 117 ? 0.4575 0.6479 0.4685 -0.0132 -0.0130 0.0582  117  LEU B O   
2129 C CB  . LEU B 117 ? 0.4132 0.6538 0.4481 -0.0129 -0.0012 0.0461  117  LEU B CB  
2130 C CG  . LEU B 117 ? 0.3992 0.6366 0.4423 -0.0055 0.0028  0.0399  117  LEU B CG  
2131 C CD1 . LEU B 117 ? 0.3807 0.6193 0.4313 0.0013  0.0041  0.0367  117  LEU B CD1 
2132 C CD2 . LEU B 117 ? 0.3772 0.6283 0.4232 -0.0070 0.0060  0.0344  117  LEU B CD2 
2133 N N   . THR B 118 ? 0.4409 0.6392 0.4706 0.0044  -0.0082 0.0501  118  THR B N   
2134 C CA  . THR B 118 ? 0.4510 0.6302 0.4757 0.0110  -0.0104 0.0501  118  THR B CA  
2135 C C   . THR B 118 ? 0.4424 0.6281 0.4782 0.0166  -0.0038 0.0436  118  THR B C   
2136 O O   . THR B 118 ? 0.4320 0.6315 0.4780 0.0204  -0.0005 0.0400  118  THR B O   
2137 C CB  . THR B 118 ? 0.4629 0.6315 0.4827 0.0207  -0.0169 0.0517  118  THR B CB  
2138 O OG1 . THR B 118 ? 0.4809 0.6388 0.4867 0.0146  -0.0245 0.0585  118  THR B OG1 
2139 C CG2 . THR B 118 ? 0.4712 0.6209 0.4848 0.0302  -0.0195 0.0499  118  THR B CG2 
2140 N N   . PHE B 119 ? 0.4534 0.6289 0.4856 0.0155  -0.0024 0.0427  119  PHE B N   
2141 C CA  . PHE B 119 ? 0.4513 0.6287 0.4906 0.0207  0.0026  0.0374  119  PHE B CA  
2142 C C   . PHE B 119 ? 0.4711 0.6353 0.5058 0.0303  0.0001  0.0366  119  PHE B C   
2143 O O   . PHE B 119 ? 0.4956 0.6406 0.5179 0.0313  -0.0056 0.0398  119  PHE B O   
2144 C CB  . PHE B 119 ? 0.4455 0.6200 0.4832 0.0154  0.0053  0.0360  119  PHE B CB  
2145 C CG  . PHE B 119 ? 0.4328 0.6227 0.4753 0.0094  0.0077  0.0342  119  PHE B CG  
2146 C CD1 . PHE B 119 ? 0.4319 0.6350 0.4819 0.0107  0.0099  0.0312  119  PHE B CD1 
2147 C CD2 . PHE B 119 ? 0.4315 0.6233 0.4700 0.0031  0.0073  0.0349  119  PHE B CD2 
2148 C CE1 . PHE B 119 ? 0.4288 0.6437 0.4808 0.0076  0.0109  0.0282  119  PHE B CE1 
2149 C CE2 . PHE B 119 ? 0.4198 0.6284 0.4625 0.0004  0.0090  0.0316  119  PHE B CE2 
2150 C CZ  . PHE B 119 ? 0.4094 0.6279 0.4581 0.0037  0.0105  0.0279  119  PHE B CZ  
2151 N N   . TYR B 120 ? 0.4678 0.6425 0.5111 0.0371  0.0040  0.0320  120  TYR B N   
2152 C CA  . TYR B 120 ? 0.4848 0.6531 0.5253 0.0480  0.0029  0.0291  120  TYR B CA  
2153 C C   . TYR B 120 ? 0.4677 0.6381 0.5113 0.0471  0.0090  0.0252  120  TYR B C   
2154 O O   . TYR B 120 ? 0.4534 0.6409 0.5060 0.0459  0.0143  0.0221  120  TYR B O   
2155 C CB  . TYR B 120 ? 0.4938 0.6788 0.5417 0.0568  0.0021  0.0268  120  TYR B CB  
2156 C CG  . TYR B 120 ? 0.5685 0.7535 0.6147 0.0705  0.0011  0.0219  120  TYR B CG  
2157 C CD1 . TYR B 120 ? 0.6344 0.7951 0.6663 0.0797  -0.0062 0.0223  120  TYR B CD1 
2158 C CD2 . TYR B 120 ? 0.6061 0.8159 0.6635 0.0741  0.0071  0.0166  120  TYR B CD2 
2159 C CE1 . TYR B 120 ? 0.6583 0.8194 0.6875 0.0951  -0.0078 0.0162  120  TYR B CE1 
2160 C CE2 . TYR B 120 ? 0.6198 0.8352 0.6763 0.0877  0.0066  0.0109  120  TYR B CE2 
2161 C CZ  . TYR B 120 ? 0.6522 0.8434 0.6950 0.0996  -0.0008 0.0101  120  TYR B CZ  
2162 O OH  . TYR B 120 ? 0.6619 0.8591 0.7028 0.1156  -0.0018 0.0030  120  TYR B OH  
2163 N N   . ILE B 121 ? 0.4679 0.6197 0.5021 0.0463  0.0077  0.0257  121  ILE B N   
2164 C CA  . ILE B 121 ? 0.4547 0.6055 0.4896 0.0437  0.0127  0.0229  121  ILE B CA  
2165 C C   . ILE B 121 ? 0.4588 0.6053 0.4900 0.0535  0.0134  0.0187  121  ILE B C   
2166 O O   . ILE B 121 ? 0.4752 0.6049 0.4961 0.0609  0.0079  0.0187  121  ILE B O   
2167 C CB  . ILE B 121 ? 0.4581 0.5940 0.4854 0.0359  0.0109  0.0256  121  ILE B CB  
2168 C CG1 . ILE B 121 ? 0.4642 0.6074 0.4940 0.0275  0.0096  0.0290  121  ILE B CG1 
2169 C CG2 . ILE B 121 ? 0.4446 0.5804 0.4729 0.0332  0.0154  0.0227  121  ILE B CG2 
2170 C CD1 . ILE B 121 ? 0.4639 0.6008 0.4880 0.0194  0.0083  0.0310  121  ILE B CD1 
2171 N N   . SER B 122 ? 0.4476 0.6088 0.4853 0.0532  0.0196  0.0149  122  SER B N   
2172 C CA  . SER B 122 ? 0.4517 0.6139 0.4863 0.0612  0.0219  0.0100  122  SER B CA  
2173 C C   . SER B 122 ? 0.4484 0.6031 0.4791 0.0541  0.0257  0.0094  122  SER B C   
2174 O O   . SER B 122 ? 0.4378 0.5943 0.4713 0.0441  0.0277  0.0114  122  SER B O   
2175 C CB  . SER B 122 ? 0.4462 0.6368 0.4906 0.0655  0.0261  0.0060  122  SER B CB  
2176 O OG  . SER B 122 ? 0.4494 0.6475 0.4967 0.0750  0.0217  0.0055  122  SER B OG  
2177 N N   . ASN B 123 ? 0.4564 0.6018 0.4793 0.0604  0.0258  0.0062  123  ASN B N   
2178 C CA  . ASN B 123 ? 0.4514 0.5855 0.4681 0.0545  0.0281  0.0059  123  ASN B CA  
2179 C C   . ASN B 123 ? 0.4400 0.5898 0.4612 0.0468  0.0344  0.0046  123  ASN B C   
2180 O O   . ASN B 123 ? 0.4295 0.6012 0.4583 0.0461  0.0377  0.0033  123  ASN B O   
2181 C CB  . ASN B 123 ? 0.4680 0.5862 0.4731 0.0635  0.0258  0.0026  123  ASN B CB  
2182 C CG  . ASN B 123 ? 0.4661 0.6008 0.4727 0.0756  0.0285  -0.0038 123  ASN B CG  
2183 O OD1 . ASN B 123 ? 0.4673 0.6260 0.4813 0.0726  0.0349  -0.0062 123  ASN B OD1 
2184 N ND2 . ASN B 123 ? 0.4725 0.5944 0.4702 0.0891  0.0227  -0.0069 123  ASN B ND2 
2185 N N   . PRO B 124 ? 0.4365 0.5744 0.4515 0.0398  0.0353  0.0054  124  PRO B N   
2186 C CA  . PRO B 124 ? 0.4345 0.5806 0.4491 0.0309  0.0394  0.0051  124  PRO B CA  
2187 C C   . PRO B 124 ? 0.4437 0.6081 0.4581 0.0322  0.0448  0.0014  124  PRO B C   
2188 O O   . PRO B 124 ? 0.4371 0.6142 0.4520 0.0227  0.0480  0.0020  124  PRO B O   
2189 C CB  . PRO B 124 ? 0.4378 0.5637 0.4432 0.0268  0.0376  0.0061  124  PRO B CB  
2190 C CG  . PRO B 124 ? 0.4371 0.5503 0.4425 0.0294  0.0326  0.0081  124  PRO B CG  
2191 C CD  . PRO B 124 ? 0.4388 0.5547 0.4460 0.0383  0.0313  0.0073  124  PRO B CD  
2192 N N   . GLU B 125 ? 0.4606 0.6266 0.4729 0.0435  0.0452  -0.0025 125  GLU B N   
2193 C CA  . GLU B 125 ? 0.4736 0.6616 0.4857 0.0471  0.0506  -0.0076 125  GLU B CA  
2194 C C   . GLU B 125 ? 0.4700 0.6903 0.4932 0.0459  0.0537  -0.0087 125  GLU B C   
2195 O O   . GLU B 125 ? 0.4749 0.7209 0.4993 0.0430  0.0592  -0.0119 125  GLU B O   
2196 C CB  . GLU B 125 ? 0.4915 0.6726 0.4979 0.0632  0.0485  -0.0131 125  GLU B CB  
2197 C CG  . GLU B 125 ? 0.5291 0.7308 0.5325 0.0683  0.0541  -0.0198 125  GLU B CG  
2198 C CD  . GLU B 125 ? 0.5910 0.7793 0.5851 0.0858  0.0505  -0.0260 125  GLU B CD  
2199 O OE1 . GLU B 125 ? 0.6462 0.8037 0.6291 0.0854  0.0465  -0.0244 125  GLU B OE1 
2200 O OE2 . GLU B 125 ? 0.6210 0.8297 0.6180 0.1004  0.0508  -0.0330 125  GLU B OE2 
2201 N N   . LYS B 126 ? 0.4633 0.6846 0.4943 0.0470  0.0503  -0.0061 126  LYS B N   
2202 C CA  . LYS B 126 ? 0.4605 0.7117 0.5022 0.0448  0.0524  -0.0066 126  LYS B CA  
2203 C C   . LYS B 126 ? 0.4531 0.7147 0.4943 0.0262  0.0557  -0.0032 126  LYS B C   
2204 O O   . LYS B 126 ? 0.4535 0.7451 0.5008 0.0210  0.0590  -0.0043 126  LYS B O   
2205 C CB  . LYS B 126 ? 0.4576 0.7038 0.5057 0.0502  0.0471  -0.0042 126  LYS B CB  
2206 C CG  . LYS B 126 ? 0.4801 0.7585 0.5395 0.0523  0.0483  -0.0059 126  LYS B CG  
2207 C CD  . LYS B 126 ? 0.5044 0.7767 0.5681 0.0614  0.0422  -0.0045 126  LYS B CD  
2208 C CE  . LYS B 126 ? 0.5229 0.8294 0.5981 0.0644  0.0429  -0.0067 126  LYS B CE  
2209 N NZ  . LYS B 126 ? 0.5513 0.8510 0.6293 0.0735  0.0363  -0.0051 126  LYS B NZ  
2210 N N   . GLN B 127 ? 0.4483 0.6848 0.4806 0.0161  0.0540  0.0006  127  GLN B N   
2211 C CA  . GLN B 127 ? 0.4453 0.6824 0.4712 -0.0014 0.0548  0.0039  127  GLN B CA  
2212 C C   . GLN B 127 ? 0.4478 0.6796 0.4614 -0.0090 0.0577  0.0036  127  GLN B C   
2213 O O   . GLN B 127 ? 0.4483 0.6670 0.4508 -0.0231 0.0560  0.0071  127  GLN B O   
2214 C CB  . GLN B 127 ? 0.4434 0.6552 0.4656 -0.0063 0.0491  0.0078  127  GLN B CB  
2215 C CG  . GLN B 127 ? 0.4471 0.6641 0.4796 -0.0011 0.0463  0.0086  127  GLN B CG  
2216 C CD  . GLN B 127 ? 0.4627 0.6591 0.4911 -0.0056 0.0410  0.0112  127  GLN B CD  
2217 O OE1 . GLN B 127 ? 0.4926 0.6735 0.5099 -0.0145 0.0388  0.0124  127  GLN B OE1 
2218 N NE2 . GLN B 127 ? 0.4690 0.6650 0.5049 0.0010  0.0383  0.0117  127  GLN B NE2 
2219 N N   . GLY B 128 ? 0.4425 0.6825 0.4560 0.0005  0.0612  -0.0007 128  GLY B N   
2220 C CA  . GLY B 128 ? 0.4498 0.6892 0.4517 -0.0061 0.0647  -0.0017 128  GLY B CA  
2221 C C   . GLY B 128 ? 0.4479 0.6518 0.4380 -0.0066 0.0609  0.0002  128  GLY B C   
2222 O O   . GLY B 128 ? 0.4636 0.6593 0.4409 -0.0174 0.0617  0.0019  128  GLY B O   
2223 N N   . PHE B 129 ? 0.4280 0.6119 0.4216 0.0042  0.0565  0.0003  129  PHE B N   
2224 C CA  . PHE B 129 ? 0.4186 0.5730 0.4030 0.0049  0.0525  0.0017  129  PHE B CA  
2225 C C   . PHE B 129 ? 0.4195 0.5711 0.4001 0.0152  0.0542  -0.0025 129  PHE B C   
2226 O O   . PHE B 129 ? 0.4163 0.5723 0.4026 0.0277  0.0537  -0.0056 129  PHE B O   
2227 C CB  . PHE B 129 ? 0.4081 0.5467 0.3978 0.0090  0.0468  0.0039  129  PHE B CB  
2228 C CG  . PHE B 129 ? 0.3963 0.5099 0.3779 0.0082  0.0422  0.0053  129  PHE B CG  
2229 C CD1 . PHE B 129 ? 0.3792 0.4802 0.3527 -0.0004 0.0389  0.0076  129  PHE B CD1 
2230 C CD2 . PHE B 129 ? 0.3880 0.4899 0.3685 0.0163  0.0401  0.0042  129  PHE B CD2 
2231 C CE1 . PHE B 129 ? 0.3786 0.4599 0.3453 0.0005  0.0341  0.0080  129  PHE B CE1 
2232 C CE2 . PHE B 129 ? 0.3727 0.4559 0.3466 0.0148  0.0358  0.0054  129  PHE B CE2 
2233 C CZ  . PHE B 129 ? 0.3772 0.4521 0.3454 0.0078  0.0331  0.0069  129  PHE B CZ  
2234 N N   . GLY B 130 ? 0.4257 0.5675 0.3943 0.0100  0.0553  -0.0027 130  GLY B N   
2235 C CA  . GLY B 130 ? 0.4293 0.5690 0.3918 0.0188  0.0571  -0.0073 130  GLY B CA  
2236 C C   . GLY B 130 ? 0.4260 0.5377 0.3839 0.0254  0.0514  -0.0069 130  GLY B C   
2237 O O   . GLY B 130 ? 0.4195 0.5166 0.3795 0.0224  0.0465  -0.0030 130  GLY B O   
2238 N N   . ARG B 131 ? 0.4309 0.5371 0.3816 0.0342  0.0518  -0.0114 131  ARG B N   
2239 C CA  . ARG B 131 ? 0.4328 0.5118 0.3755 0.0377  0.0462  -0.0109 131  ARG B CA  
2240 C C   . ARG B 131 ? 0.4453 0.5194 0.3753 0.0421  0.0480  -0.0158 131  ARG B C   
2241 O O   . ARG B 131 ? 0.4462 0.5390 0.3757 0.0490  0.0528  -0.0214 131  ARG B O   
2242 C CB  . ARG B 131 ? 0.4327 0.5025 0.3795 0.0471  0.0410  -0.0109 131  ARG B CB  
2243 C CG  . ARG B 131 ? 0.4461 0.5196 0.3895 0.0618  0.0409  -0.0173 131  ARG B CG  
2244 C CD  . ARG B 131 ? 0.4297 0.4919 0.3750 0.0694  0.0343  -0.0161 131  ARG B CD  
2245 N NE  . ARG B 131 ? 0.4293 0.4958 0.3707 0.0858  0.0331  -0.0230 131  ARG B NE  
2246 C CZ  . ARG B 131 ? 0.4373 0.4833 0.3636 0.0966  0.0282  -0.0278 131  ARG B CZ  
2247 N NH1 . ARG B 131 ? 0.4431 0.4630 0.3568 0.0909  0.0244  -0.0259 131  ARG B NH1 
2248 N NH2 . ARG B 131 ? 0.4704 0.5217 0.3929 0.1139  0.0262  -0.0352 131  ARG B NH2 
2249 N N   . HIS B 132 ? 0.4524 0.5037 0.3723 0.0385  0.0441  -0.0142 132  HIS B N   
2250 C CA  . HIS B 132 ? 0.4714 0.5138 0.3775 0.0426  0.0448  -0.0187 132  HIS B CA  
2251 C C   . HIS B 132 ? 0.4903 0.5219 0.3917 0.0570  0.0409  -0.0237 132  HIS B C   
2252 O O   . HIS B 132 ? 0.4841 0.5006 0.3874 0.0589  0.0346  -0.0209 132  HIS B O   
2253 C CB  . HIS B 132 ? 0.4767 0.4969 0.3733 0.0344  0.0404  -0.0152 132  HIS B CB  
2254 C CG  . HIS B 132 ? 0.4727 0.4969 0.3678 0.0221  0.0422  -0.0112 132  HIS B CG  
2255 N ND1 . HIS B 132 ? 0.4660 0.4751 0.3488 0.0158  0.0398  -0.0099 132  HIS B ND1 
2256 C CD2 . HIS B 132 ? 0.4690 0.5075 0.3707 0.0146  0.0449  -0.0083 132  HIS B CD2 
2257 C CE1 . HIS B 132 ? 0.4740 0.4859 0.3548 0.0056  0.0403  -0.0062 132  HIS B CE1 
2258 N NE2 . HIS B 132 ? 0.4542 0.4831 0.3457 0.0041  0.0433  -0.0051 132  HIS B NE2 
2259 N N   . VAL B 133 ? 0.5155 0.5541 0.4088 0.0670  0.0439  -0.0312 133  VAL B N   
2260 C CA  . VAL B 133 ? 0.5439 0.5674 0.4279 0.0829  0.0385  -0.0373 133  VAL B CA  
2261 C C   . VAL B 133 ? 0.5768 0.5826 0.4421 0.0874  0.0368  -0.0426 133  VAL B C   
2262 O O   . VAL B 133 ? 0.5960 0.5886 0.4498 0.1022  0.0321  -0.0494 133  VAL B O   
2263 C CB  . VAL B 133 ? 0.5449 0.5936 0.4358 0.0976  0.0416  -0.0443 133  VAL B CB  
2264 C CG1 . VAL B 133 ? 0.5163 0.5780 0.4238 0.0939  0.0417  -0.0390 133  VAL B CG1 
2265 C CG2 . VAL B 133 ? 0.5417 0.6239 0.4338 0.0984  0.0512  -0.0503 133  VAL B CG2 
2266 N N   . ASP B 134 ? 0.5956 0.5987 0.4561 0.0754  0.0394  -0.0397 134  ASP B N   
2267 C CA  . ASP B 134 ? 0.6385 0.6231 0.4806 0.0779  0.0372  -0.0439 134  ASP B CA  
2268 C C   . ASP B 134 ? 0.6672 0.6153 0.4991 0.0761  0.0268  -0.0405 134  ASP B C   
2269 O O   . ASP B 134 ? 0.6538 0.5944 0.4939 0.0699  0.0223  -0.0339 134  ASP B O   
2270 C CB  . ASP B 134 ? 0.6334 0.6268 0.4721 0.0649  0.0428  -0.0416 134  ASP B CB  
2271 C CG  . ASP B 134 ? 0.6275 0.6152 0.4738 0.0493  0.0408  -0.0319 134  ASP B CG  
2272 O OD1 . ASP B 134 ? 0.6046 0.6088 0.4650 0.0447  0.0434  -0.0281 134  ASP B OD1 
2273 O OD2 . ASP B 134 ? 0.6404 0.6077 0.4779 0.0424  0.0361  -0.0288 134  ASP B OD2 
2274 N N   . GLU B 135 ? 0.7117 0.6386 0.5249 0.0807  0.0228  -0.0452 135  GLU B N   
2275 C CA  . GLU B 135 ? 0.7437 0.6355 0.5440 0.0775  0.0121  -0.0422 135  GLU B CA  
2276 C C   . GLU B 135 ? 0.7367 0.6238 0.5419 0.0601  0.0102  -0.0334 135  GLU B C   
2277 O O   . GLU B 135 ? 0.7368 0.6099 0.5432 0.0532  0.0032  -0.0277 135  GLU B O   
2278 C CB  . GLU B 135 ? 0.7789 0.6482 0.5557 0.0866  0.0079  -0.0500 135  GLU B CB  
2279 C CG  . GLU B 135 ? 0.8307 0.6607 0.5904 0.0831  -0.0047 -0.0473 135  GLU B CG  
2280 C CD  . GLU B 135 ? 0.9190 0.7237 0.6531 0.0903  -0.0096 -0.0548 135  GLU B CD  
2281 O OE1 . GLU B 135 ? 0.9514 0.7710 0.6816 0.0994  -0.0027 -0.0628 135  GLU B OE1 
2282 O OE2 . GLU B 135 ? 0.9779 0.7482 0.6947 0.0860  -0.0207 -0.0527 135  GLU B OE2 
2283 N N   . GLU B 136 ? 0.7354 0.6353 0.5424 0.0530  0.0160  -0.0326 136  GLU B N   
2284 C CA  . GLU B 136 ? 0.7359 0.6301 0.5445 0.0394  0.0130  -0.0260 136  GLU B CA  
2285 C C   . GLU B 136 ? 0.7046 0.6110 0.5314 0.0322  0.0127  -0.0191 136  GLU B C   
2286 O O   . GLU B 136 ? 0.7015 0.5997 0.5302 0.0248  0.0064  -0.0144 136  GLU B O   
2287 C CB  . GLU B 136 ? 0.7468 0.6488 0.5496 0.0344  0.0182  -0.0269 136  GLU B CB  
2288 C CG  . GLU B 136 ? 0.7837 0.6770 0.5846 0.0229  0.0135  -0.0212 136  GLU B CG  
2289 C CD  . GLU B 136 ? 0.8553 0.7250 0.6445 0.0208  0.0047  -0.0209 136  GLU B CD  
2290 O OE1 . GLU B 136 ? 0.9105 0.7653 0.6852 0.0274  0.0028  -0.0262 136  GLU B OE1 
2291 O OE2 . GLU B 136 ? 0.8673 0.7341 0.6609 0.0127  -0.0009 -0.0159 136  GLU B OE2 
2292 N N   . THR B 137 ? 0.6830 0.6109 0.5228 0.0345  0.0191  -0.0191 137  THR B N   
2293 C CA  . THR B 137 ? 0.6544 0.5948 0.5103 0.0282  0.0193  -0.0135 137  THR B CA  
2294 C C   . THR B 137 ? 0.6356 0.5884 0.5039 0.0339  0.0213  -0.0135 137  THR B C   
2295 O O   . THR B 137 ? 0.6163 0.5829 0.4976 0.0299  0.0230  -0.0100 137  THR B O   
2296 C CB  . THR B 137 ? 0.6488 0.6021 0.5072 0.0215  0.0241  -0.0117 137  THR B CB  
2297 O OG1 . THR B 137 ? 0.6338 0.6046 0.4931 0.0251  0.0319  -0.0154 137  THR B OG1 
2298 C CG2 . THR B 137 ? 0.6557 0.5959 0.5006 0.0159  0.0215  -0.0113 137  THR B CG2 
2299 N N   . GLY B 138 ? 0.6394 0.5855 0.5021 0.0440  0.0199  -0.0178 138  GLY B N   
2300 C CA  . GLY B 138 ? 0.6253 0.5830 0.4979 0.0513  0.0213  -0.0187 138  GLY B CA  
2301 C C   . GLY B 138 ? 0.6111 0.5610 0.4897 0.0477  0.0150  -0.0133 138  GLY B C   
2302 O O   . GLY B 138 ? 0.6172 0.5505 0.4895 0.0407  0.0086  -0.0098 138  GLY B O   
2303 N N   . VAL B 139 ? 0.5906 0.5549 0.4809 0.0515  0.0170  -0.0126 139  VAL B N   
2304 C CA  . VAL B 139 ? 0.5795 0.5390 0.4750 0.0483  0.0116  -0.0076 139  VAL B CA  
2305 C C   . VAL B 139 ? 0.5894 0.5447 0.4819 0.0601  0.0089  -0.0105 139  VAL B C   
2306 O O   . VAL B 139 ? 0.5937 0.5554 0.4833 0.0721  0.0120  -0.0171 139  VAL B O   
2307 C CB  . VAL B 139 ? 0.5533 0.5336 0.4663 0.0406  0.0152  -0.0032 139  VAL B CB  
2308 C CG1 . VAL B 139 ? 0.5291 0.5102 0.4428 0.0311  0.0154  -0.0008 139  VAL B CG1 
2309 C CG2 . VAL B 139 ? 0.5499 0.5529 0.4732 0.0456  0.0224  -0.0058 139  VAL B CG2 
2310 N N   . GLY B 140 ? 0.5945 0.5403 0.4867 0.0569  0.0026  -0.0059 140  GLY B N   
2311 C CA  . GLY B 140 ? 0.6096 0.5459 0.4959 0.0677  -0.0024 -0.0077 140  GLY B CA  
2312 C C   . GLY B 140 ? 0.5960 0.5590 0.4981 0.0755  0.0034  -0.0099 140  GLY B C   
2313 O O   . GLY B 140 ? 0.5632 0.5513 0.4813 0.0696  0.0110  -0.0084 140  GLY B O   
2314 N N   . LYS B 141 ? 0.6227 0.5783 0.5181 0.0891  -0.0013 -0.0135 141  LYS B N   
2315 C CA  . LYS B 141 ? 0.6180 0.5992 0.5268 0.0988  0.0027  -0.0165 141  LYS B CA  
2316 C C   . LYS B 141 ? 0.5926 0.5857 0.5157 0.0882  0.0034  -0.0091 141  LYS B C   
2317 O O   . LYS B 141 ? 0.5946 0.5705 0.5124 0.0781  -0.0024 -0.0026 141  LYS B O   
2318 C CB  . LYS B 141 ? 0.6516 0.6165 0.5464 0.1174  -0.0055 -0.0224 141  LYS B CB  
2319 C CG  . LYS B 141 ? 0.6788 0.6733 0.5860 0.1318  -0.0017 -0.0282 141  LYS B CG  
2320 C CD  . LYS B 141 ? 0.7285 0.7019 0.6188 0.1525  -0.0125 -0.0344 141  LYS B CD  
2321 C CE  . LYS B 141 ? 0.7304 0.7358 0.6339 0.1677  -0.0100 -0.0403 141  LYS B CE  
2322 N NZ  . LYS B 141 ? 0.7386 0.7816 0.6522 0.1766  0.0001  -0.0497 141  LYS B NZ  
2323 N N   . TRP B 142 ? 0.5724 0.5964 0.5126 0.0897  0.0105  -0.0103 142  TRP B N   
2324 C CA  . TRP B 142 ? 0.5538 0.5904 0.5071 0.0811  0.0112  -0.0043 142  TRP B CA  
2325 C C   . TRP B 142 ? 0.5698 0.5953 0.5182 0.0883  0.0032  -0.0028 142  TRP B C   
2326 O O   . TRP B 142 ? 0.5913 0.6102 0.5313 0.1037  -0.0010 -0.0082 142  TRP B O   
2327 C CB  . TRP B 142 ? 0.5307 0.6013 0.5012 0.0795  0.0201  -0.0060 142  TRP B CB  
2328 C CG  . TRP B 142 ? 0.5163 0.5951 0.4914 0.0674  0.0263  -0.0044 142  TRP B CG  
2329 C CD1 . TRP B 142 ? 0.5250 0.6184 0.5011 0.0668  0.0329  -0.0082 142  TRP B CD1 
2330 C CD2 . TRP B 142 ? 0.5037 0.5765 0.4813 0.0547  0.0255  0.0010  142  TRP B CD2 
2331 N NE1 . TRP B 142 ? 0.5156 0.6077 0.4927 0.0541  0.0353  -0.0048 142  TRP B NE1 
2332 C CE2 . TRP B 142 ? 0.5055 0.5856 0.4840 0.0480  0.0307  0.0002  142  TRP B CE2 
2333 C CE3 . TRP B 142 ? 0.5141 0.5777 0.4923 0.0484  0.0207  0.0061  142  TRP B CE3 
2334 C CZ2 . TRP B 142 ? 0.5123 0.5881 0.4919 0.0379  0.0301  0.0036  142  TRP B CZ2 
2335 C CZ3 . TRP B 142 ? 0.5114 0.5762 0.4927 0.0383  0.0213  0.0090  142  TRP B CZ3 
2336 C CH2 . TRP B 142 ? 0.5047 0.5744 0.4866 0.0344  0.0254  0.0074  142  TRP B CH2 
2337 N N   . PHE B 143 ? 0.5624 0.5861 0.5148 0.0776  0.0007  0.0041  143  PHE B N   
2338 C CA  . PHE B 143 ? 0.5762 0.5902 0.5236 0.0813  -0.0069 0.0071  143  PHE B CA  
2339 C C   . PHE B 143 ? 0.5733 0.6112 0.5325 0.0932  -0.0042 0.0030  143  PHE B C   
2340 O O   . PHE B 143 ? 0.5464 0.6137 0.5216 0.0917  0.0046  0.0006  143  PHE B O   
2341 C CB  . PHE B 143 ? 0.5656 0.5799 0.5167 0.0654  -0.0084 0.0153  143  PHE B CB  
2342 C CG  . PHE B 143 ? 0.5338 0.5774 0.5045 0.0574  0.0004  0.0161  143  PHE B CG  
2343 C CD1 . PHE B 143 ? 0.5105 0.5758 0.4942 0.0605  0.0035  0.0156  143  PHE B CD1 
2344 C CD2 . PHE B 143 ? 0.5193 0.5669 0.4936 0.0473  0.0044  0.0172  143  PHE B CD2 
2345 C CE1 . PHE B 143 ? 0.4874 0.5750 0.4856 0.0530  0.0101  0.0162  143  PHE B CE1 
2346 C CE2 . PHE B 143 ? 0.4887 0.5580 0.4771 0.0415  0.0106  0.0173  143  PHE B CE2 
2347 C CZ  . PHE B 143 ? 0.4765 0.5643 0.4760 0.0440  0.0132  0.0169  143  PHE B CZ  
2348 N N   . GLU B 144 ? 0.6010 0.6253 0.5504 0.1043  -0.0129 0.0023  144  GLU B N   
2349 C CA  . GLU B 144 ? 0.6041 0.6513 0.5642 0.1160  -0.0122 -0.0011 144  GLU B CA  
2350 C C   . GLU B 144 ? 0.5800 0.6407 0.5520 0.1040  -0.0107 0.0057  144  GLU B C   
2351 O O   . GLU B 144 ? 0.5809 0.6267 0.5477 0.0903  -0.0135 0.0128  144  GLU B O   
2352 C CB  . GLU B 144 ? 0.6441 0.6684 0.5868 0.1343  -0.0241 -0.0048 144  GLU B CB  
2353 C CG  . GLU B 144 ? 0.6970 0.7068 0.6254 0.1500  -0.0270 -0.0134 144  GLU B CG  
2354 C CD  . GLU B 144 ? 0.7183 0.7671 0.6624 0.1604  -0.0167 -0.0227 144  GLU B CD  
2355 O OE1 . GLU B 144 ? 0.7181 0.8011 0.6792 0.1645  -0.0121 -0.0248 144  GLU B OE1 
2356 O OE2 . GLU B 144 ? 0.7372 0.7836 0.6758 0.1634  -0.0133 -0.0279 144  GLU B OE2 
2357 N N   . PRO B 145 ? 0.5586 0.6497 0.5464 0.1087  -0.0064 0.0033  145  PRO B N   
2358 C CA  . PRO B 145 ? 0.5401 0.6446 0.5388 0.0977  -0.0048 0.0091  145  PRO B CA  
2359 C C   . PRO B 145 ? 0.5560 0.6353 0.5416 0.0941  -0.0148 0.0158  145  PRO B C   
2360 O O   . PRO B 145 ? 0.5811 0.6395 0.5519 0.1058  -0.0244 0.0148  145  PRO B O   
2361 C CB  . PRO B 145 ? 0.5330 0.6690 0.5455 0.1073  -0.0018 0.0044  145  PRO B CB  
2362 C CG  . PRO B 145 ? 0.5323 0.6825 0.5470 0.1173  0.0029  -0.0035 145  PRO B CG  
2363 C CD  . PRO B 145 ? 0.5547 0.6720 0.5507 0.1237  -0.0028 -0.0051 145  PRO B CD  
2364 N N   . PHE B 146 ? 0.5468 0.6278 0.5360 0.0781  -0.0131 0.0223  146  PHE B N   
2365 C CA  . PHE B 146 ? 0.5638 0.6239 0.5396 0.0705  -0.0217 0.0295  146  PHE B CA  
2366 C C   . PHE B 146 ? 0.5519 0.6310 0.5387 0.0589  -0.0186 0.0342  146  PHE B C   
2367 O O   . PHE B 146 ? 0.5237 0.6274 0.5268 0.0546  -0.0100 0.0321  146  PHE B O   
2368 C CB  . PHE B 146 ? 0.5734 0.6077 0.5336 0.0606  -0.0253 0.0332  146  PHE B CB  
2369 C CG  . PHE B 146 ? 0.5292 0.5785 0.4999 0.0468  -0.0173 0.0344  146  PHE B CG  
2370 C CD1 . PHE B 146 ? 0.4962 0.5568 0.4763 0.0493  -0.0095 0.0292  146  PHE B CD1 
2371 C CD2 . PHE B 146 ? 0.5146 0.5672 0.4843 0.0317  -0.0182 0.0405  146  PHE B CD2 
2372 C CE1 . PHE B 146 ? 0.4671 0.5386 0.4546 0.0385  -0.0039 0.0299  146  PHE B CE1 
2373 C CE2 . PHE B 146 ? 0.4922 0.5601 0.4712 0.0219  -0.0119 0.0403  146  PHE B CE2 
2374 C CZ  . PHE B 146 ? 0.4630 0.5385 0.4504 0.0261  -0.0053 0.0349  146  PHE B CZ  
2375 N N   . LYS B 147 ? 0.5785 0.6438 0.5538 0.0537  -0.0266 0.0403  147  LYS B N   
2376 C CA  . LYS B 147 ? 0.5774 0.6591 0.5599 0.0426  -0.0248 0.0448  147  LYS B CA  
2377 C C   . LYS B 147 ? 0.5825 0.6570 0.5562 0.0256  -0.0261 0.0508  147  LYS B C   
2378 O O   . LYS B 147 ? 0.6080 0.6570 0.5639 0.0212  -0.0327 0.0541  147  LYS B O   
2379 C CB  . LYS B 147 ? 0.5984 0.6736 0.5735 0.0478  -0.0330 0.0479  147  LYS B CB  
2380 C CG  . LYS B 147 ? 0.6247 0.7122 0.6088 0.0651  -0.0330 0.0420  147  LYS B CG  
2381 C CD  . LYS B 147 ? 0.6726 0.7487 0.6457 0.0709  -0.0435 0.0455  147  LYS B CD  
2382 C CE  . LYS B 147 ? 0.6821 0.7790 0.6675 0.0876  -0.0431 0.0392  147  LYS B CE  
2383 N NZ  . LYS B 147 ? 0.6445 0.7783 0.6528 0.0816  -0.0326 0.0373  147  LYS B NZ  
2384 N N   . VAL B 148 ? 0.5626 0.6606 0.5479 0.0160  -0.0204 0.0518  148  VAL B N   
2385 C CA  . VAL B 148 ? 0.5665 0.6665 0.5447 -0.0001 -0.0219 0.0573  148  VAL B CA  
2386 C C   . VAL B 148 ? 0.5697 0.6884 0.5533 -0.0051 -0.0214 0.0597  148  VAL B C   
2387 O O   . VAL B 148 ? 0.5527 0.6914 0.5517 0.0006  -0.0157 0.0553  148  VAL B O   
2388 C CB  . VAL B 148 ? 0.5464 0.6601 0.5328 -0.0063 -0.0153 0.0543  148  VAL B CB  
2389 C CG1 . VAL B 148 ? 0.5573 0.6501 0.5350 -0.0039 -0.0171 0.0532  148  VAL B CG1 
2390 C CG2 . VAL B 148 ? 0.5005 0.6375 0.5060 0.0000  -0.0069 0.0478  148  VAL B CG2 
2391 N N   . ASP B 149 ? 0.5949 0.7059 0.5637 -0.0170 -0.0279 0.0670  149  ASP B N   
2392 C CA  . ASP B 149 ? 0.5982 0.7243 0.5683 -0.0226 -0.0286 0.0701  149  ASP B CA  
2393 C C   . ASP B 149 ? 0.5865 0.7366 0.5590 -0.0378 -0.0247 0.0716  149  ASP B C   
2394 O O   . ASP B 149 ? 0.5978 0.7445 0.5611 -0.0492 -0.0262 0.0747  149  ASP B O   
2395 C CB  . ASP B 149 ? 0.6332 0.7333 0.5822 -0.0251 -0.0400 0.0776  149  ASP B CB  
2396 C CG  . ASP B 149 ? 0.6676 0.7479 0.6142 -0.0070 -0.0450 0.0748  149  ASP B CG  
2397 O OD1 . ASP B 149 ? 0.6897 0.7875 0.6549 0.0055  -0.0388 0.0680  149  ASP B OD1 
2398 O OD2 . ASP B 149 ? 0.7317 0.7793 0.6566 -0.0054 -0.0560 0.0791  149  ASP B OD2 
2399 N N   . TYR B 150 ? 0.5673 0.7431 0.5514 -0.0377 -0.0200 0.0690  150  TYR B N   
2400 C CA  . TYR B 150 ? 0.5581 0.7618 0.5451 -0.0494 -0.0163 0.0688  150  TYR B CA  
2401 C C   . TYR B 150 ? 0.5675 0.7830 0.5513 -0.0544 -0.0182 0.0721  150  TYR B C   
2402 O O   . TYR B 150 ? 0.5691 0.7804 0.5574 -0.0450 -0.0191 0.0710  150  TYR B O   
2403 C CB  . TYR B 150 ? 0.5319 0.7584 0.5370 -0.0417 -0.0080 0.0593  150  TYR B CB  
2404 C CG  . TYR B 150 ? 0.5108 0.7285 0.5192 -0.0371 -0.0058 0.0557  150  TYR B CG  
2405 C CD1 . TYR B 150 ? 0.4953 0.6974 0.5093 -0.0248 -0.0045 0.0522  150  TYR B CD1 
2406 C CD2 . TYR B 150 ? 0.5094 0.7375 0.5155 -0.0456 -0.0049 0.0555  150  TYR B CD2 
2407 C CE1 . TYR B 150 ? 0.4870 0.6811 0.5029 -0.0212 -0.0025 0.0490  150  TYR B CE1 
2408 C CE2 . TYR B 150 ? 0.4984 0.7181 0.5071 -0.0414 -0.0033 0.0522  150  TYR B CE2 
2409 C CZ  . TYR B 150 ? 0.4800 0.6813 0.4930 -0.0293 -0.0021 0.0491  150  TYR B CZ  
2410 O OH  . TYR B 150 ? 0.4761 0.6691 0.4903 -0.0258 -0.0007 0.0461  150  TYR B OH  
2411 N N   . LYS B 151 ? 0.5763 0.8088 0.5522 -0.0700 -0.0188 0.0761  151  LYS B N   
2412 C CA  . LYS B 151 ? 0.5778 0.8263 0.5500 -0.0769 -0.0198 0.0790  151  LYS B CA  
2413 C C   . LYS B 151 ? 0.5580 0.8470 0.5400 -0.0818 -0.0127 0.0730  151  LYS B C   
2414 O O   . LYS B 151 ? 0.5657 0.8700 0.5434 -0.0937 -0.0117 0.0742  151  LYS B O   
2415 C CB  . LYS B 151 ? 0.6087 0.8396 0.5567 -0.0937 -0.0288 0.0907  151  LYS B CB  
2416 C CG  . LYS B 151 ? 0.6349 0.8270 0.5696 -0.0871 -0.0383 0.0963  151  LYS B CG  
2417 C CD  . LYS B 151 ? 0.6842 0.8611 0.5927 -0.1046 -0.0483 0.1078  151  LYS B CD  
2418 C CE  . LYS B 151 ? 0.7158 0.8507 0.6075 -0.0962 -0.0600 0.1131  151  LYS B CE  
2419 N NZ  . LYS B 151 ? 0.7398 0.8371 0.6136 -0.0973 -0.0682 0.1169  151  LYS B NZ  
2420 N N   . PHE B 152 ? 0.5348 0.8419 0.5289 -0.0724 -0.0084 0.0661  152  PHE B N   
2421 C CA  . PHE B 152 ? 0.5172 0.8621 0.5191 -0.0735 -0.0027 0.0586  152  PHE B CA  
2422 C C   . PHE B 152 ? 0.5214 0.8827 0.5242 -0.0725 -0.0021 0.0567  152  PHE B C   
2423 O O   . PHE B 152 ? 0.5208 0.8643 0.5212 -0.0687 -0.0054 0.0601  152  PHE B O   
2424 C CB  . PHE B 152 ? 0.4927 0.8441 0.5092 -0.0593 0.0022  0.0478  152  PHE B CB  
2425 C CG  . PHE B 152 ? 0.4447 0.7855 0.4706 -0.0442 0.0034  0.0418  152  PHE B CG  
2426 C CD1 . PHE B 152 ? 0.4146 0.7266 0.4415 -0.0380 0.0012  0.0447  152  PHE B CD1 
2427 C CD2 . PHE B 152 ? 0.4031 0.7637 0.4356 -0.0365 0.0061  0.0327  152  PHE B CD2 
2428 C CE1 . PHE B 152 ? 0.3806 0.6866 0.4157 -0.0269 0.0024  0.0397  152  PHE B CE1 
2429 C CE2 . PHE B 152 ? 0.3848 0.7336 0.4232 -0.0254 0.0062  0.0279  152  PHE B CE2 
2430 C CZ  . PHE B 152 ? 0.3618 0.6848 0.4018 -0.0218 0.0046  0.0318  152  PHE B CZ  
2431 N N   . LYS B 153 ? 0.5258 0.9229 0.5315 -0.0752 0.0019  0.0506  153  LYS B N   
2432 C CA  . LYS B 153 ? 0.5339 0.9507 0.5403 -0.0734 0.0031  0.0467  153  LYS B CA  
2433 C C   . LYS B 153 ? 0.5214 0.9504 0.5406 -0.0561 0.0071  0.0330  153  LYS B C   
2434 O O   . LYS B 153 ? 0.5097 0.9603 0.5339 -0.0521 0.0102  0.0250  153  LYS B O   
2435 C CB  . LYS B 153 ? 0.5491 0.9996 0.5464 -0.0896 0.0041  0.0495  153  LYS B CB  
2436 C CG  . LYS B 153 ? 0.5795 1.0522 0.5753 -0.0890 0.0053  0.0457  153  LYS B CG  
2437 C CD  . LYS B 153 ? 0.6288 1.1372 0.6140 -0.1074 0.0064  0.0494  153  LYS B CD  
2438 C CE  . LYS B 153 ? 0.6483 1.1847 0.6335 -0.1040 0.0087  0.0425  153  LYS B CE  
2439 N NZ  . LYS B 153 ? 0.6556 1.2312 0.6301 -0.1229 0.0105  0.0458  153  LYS B NZ  
2440 N N   . TYR B 154 ? 0.5246 0.9385 0.5475 -0.0462 0.0059  0.0303  154  TYR B N   
2441 C CA  . TYR B 154 ? 0.5205 0.9388 0.5508 -0.0313 0.0076  0.0182  154  TYR B CA  
2442 C C   . TYR B 154 ? 0.5394 0.9893 0.5671 -0.0303 0.0090  0.0107  154  TYR B C   
2443 O O   . TYR B 154 ? 0.5466 1.0017 0.5689 -0.0363 0.0078  0.0145  154  TYR B O   
2444 C CB  . TYR B 154 ? 0.5139 0.9054 0.5473 -0.0241 0.0053  0.0189  154  TYR B CB  
2445 C CG  . TYR B 154 ? 0.4768 0.8674 0.5133 -0.0116 0.0053  0.0077  154  TYR B CG  
2446 C CD1 . TYR B 154 ? 0.4454 0.8356 0.4846 -0.0026 0.0062  -0.0007 154  TYR B CD1 
2447 C CD2 . TYR B 154 ? 0.4580 0.8456 0.4927 -0.0093 0.0032  0.0058  154  TYR B CD2 
2448 C CE1 . TYR B 154 ? 0.4490 0.8325 0.4865 0.0085  0.0041  -0.0107 154  TYR B CE1 
2449 C CE2 . TYR B 154 ? 0.4516 0.8338 0.4853 0.0006  0.0016  -0.0040 154  TYR B CE2 
2450 C CZ  . TYR B 154 ? 0.4471 0.8255 0.4811 0.0095  0.0017  -0.0122 154  TYR B CZ  
2451 O OH  . TYR B 154 ? 0.4397 0.8071 0.4685 0.0192  -0.0018 -0.0219 154  TYR B OH  
2452 N N   . THR B 155 ? 0.5543 1.0256 0.5850 -0.0216 0.0111  -0.0004 155  THR B N   
2453 C CA  . THR B 155 ? 0.5751 1.0814 0.6030 -0.0184 0.0125  -0.0096 155  THR B CA  
2454 C C   . THR B 155 ? 0.5973 1.0965 0.6247 -0.0014 0.0102  -0.0220 155  THR B C   
2455 O O   . THR B 155 ? 0.6040 1.1286 0.6275 0.0038  0.0105  -0.0311 155  THR B O   
2456 C CB  . THR B 155 ? 0.5736 1.1156 0.6038 -0.0187 0.0155  -0.0156 155  THR B CB  
2457 O OG1 . THR B 155 ? 0.5714 1.1011 0.6073 -0.0054 0.0146  -0.0229 155  THR B OG1 
2458 C CG2 . THR B 155 ? 0.5677 1.1191 0.5947 -0.0392 0.0169  -0.0029 155  THR B CG2 
2459 N N   . GLY B 156 ? 0.6168 1.0814 0.6464 0.0061  0.0075  -0.0225 156  GLY B N   
2460 C CA  . GLY B 156 ? 0.6409 1.0910 0.6664 0.0198  0.0037  -0.0329 156  GLY B CA  
2461 C C   . GLY B 156 ? 0.6609 1.0944 0.6869 0.0321  0.0014  -0.0406 156  GLY B C   
2462 O O   . GLY B 156 ? 0.6555 1.0893 0.6867 0.0302  0.0033  -0.0375 156  GLY B O   
2463 N N   . THR B 157 ? 0.6948 1.1114 0.7131 0.0442  -0.0037 -0.0503 157  THR B N   
2464 C CA  . THR B 157 ? 0.7226 1.1190 0.7367 0.0566  -0.0080 -0.0583 157  THR B CA  
2465 C C   . THR B 157 ? 0.7450 1.1706 0.7593 0.0682  -0.0078 -0.0694 157  THR B C   
2466 O O   . THR B 157 ? 0.7526 1.2048 0.7628 0.0754  -0.0084 -0.0787 157  THR B O   
2467 C CB  . THR B 157 ? 0.7400 1.1078 0.7410 0.0654  -0.0155 -0.0661 157  THR B CB  
2468 O OG1 . THR B 157 ? 0.7408 1.0888 0.7424 0.0537  -0.0155 -0.0564 157  THR B OG1 
2469 C CG2 . THR B 157 ? 0.7427 1.0826 0.7359 0.0760  -0.0214 -0.0724 157  THR B CG2 
2470 N N   . PRO B 158 ? 0.7626 1.1861 0.7817 0.0705  -0.0072 -0.0689 158  PRO B N   
2471 C CA  . PRO B 158 ? 0.7837 1.2377 0.8039 0.0824  -0.0076 -0.0799 158  PRO B CA  
2472 C C   . PRO B 158 ? 0.8232 1.2703 0.8308 0.1046  -0.0159 -0.0970 158  PRO B C   
2473 O O   . PRO B 158 ? 0.8386 1.2443 0.8356 0.1111  -0.0227 -0.0992 158  PRO B O   
2474 C CB  . PRO B 158 ? 0.7739 1.2169 0.8003 0.0793  -0.0065 -0.0744 158  PRO B CB  
2475 C CG  . PRO B 158 ? 0.7526 1.1733 0.7838 0.0621  -0.0027 -0.0588 158  PRO B CG  
2476 C CD  . PRO B 158 ? 0.7523 1.1513 0.7771 0.0610  -0.0052 -0.0576 158  PRO B CD  
2500 O O   . HOH I .   ? 0.2994 0.3038 0.3587 0.0520  -0.0005 -0.0167 1001 HOH A O   
2501 O O   . HOH I .   ? 0.2706 0.3826 0.3452 0.0101  -0.0260 0.0154  1002 HOH A O   
2502 O O   . HOH I .   ? 0.2504 0.4554 0.3263 -0.0996 0.0539  -0.1119 1003 HOH A O   
2503 O O   . HOH I .   ? 0.1395 0.2801 0.2439 0.0907  -0.0655 0.0150  1004 HOH A O   
2504 O O   . HOH I .   ? 0.2899 0.4899 0.3768 0.0033  -0.0398 0.0010  1005 HOH A O   
2505 O O   . HOH I .   ? 0.3284 0.2848 0.2908 0.0234  -0.0172 0.0367  1006 HOH A O   
2506 O O   . HOH I .   ? 0.2726 0.4480 0.3374 -0.0585 0.0122  -0.0449 1007 HOH A O   
2507 O O   . HOH I .   ? 0.5152 0.6337 0.5815 -0.0500 0.0335  -0.0663 1008 HOH A O   
2508 O O   . HOH I .   ? 0.4584 0.7009 0.6254 -0.0227 0.0140  -0.0893 1009 HOH A O   
2509 O O   . HOH I .   ? 0.1312 0.3046 0.2637 0.0243  -0.0280 -0.0142 1010 HOH A O   
2510 O O   . HOH I .   ? 0.2400 0.4081 0.3677 0.0472  -0.0415 -0.0059 1011 HOH A O   
2511 O O   . HOH I .   ? 0.2678 0.3810 0.4506 0.1197  -0.0312 -0.0162 1012 HOH A O   
2512 O O   . HOH I .   ? 0.5314 0.6479 0.5614 -0.0157 -0.0241 0.0207  1013 HOH A O   
2513 O O   . HOH I .   ? 0.2521 0.4483 0.4220 0.0615  -0.0133 -0.0758 1014 HOH A O   
2514 O O   . HOH I .   ? 0.4250 0.6703 0.6370 0.0989  -0.0488 -0.0367 1015 HOH A O   
2515 O O   . HOH I .   ? 0.2684 0.3978 0.3447 -0.0037 -0.0163 -0.0080 1016 HOH A O   
2516 O O   . HOH I .   ? 0.2824 0.3721 0.2331 -0.1213 0.0445  -0.0522 1017 HOH A O   
2517 O O   . HOH I .   ? 0.4747 0.3894 0.4301 -0.0243 0.0265  0.0307  1018 HOH A O   
2518 O O   . HOH I .   ? 0.4088 0.5600 0.5190 0.0140  -0.0145 -0.0276 1019 HOH A O   
2519 O O   . HOH I .   ? 0.3758 0.5904 0.4542 0.0484  -0.0666 0.0003  1020 HOH A O   
2520 O O   . HOH I .   ? 0.4776 0.4037 0.4750 0.0420  0.0068  0.0036  1021 HOH A O   
2521 O O   . HOH I .   ? 0.3967 0.5743 0.4922 -0.0094 -0.0180 -0.0211 1022 HOH A O   
2522 O O   . HOH I .   ? 0.2943 0.4733 0.4161 0.0774  -0.0627 0.0030  1023 HOH A O   
2523 O O   . HOH I .   ? 0.4281 0.6113 0.4978 -0.0552 0.0114  -0.0527 1024 HOH A O   
2524 O O   . HOH I .   ? 0.2672 0.6035 0.3561 -0.0464 -0.0304 -0.0516 1025 HOH A O   
2525 O O   . HOH I .   ? 0.4998 0.4861 0.4225 0.0973  -0.0763 0.0710  1026 HOH A O   
2526 O O   . HOH I .   ? 0.4471 0.7529 0.5357 -0.0621 -0.0104 -0.0646 1027 HOH A O   
2527 O O   . HOH I .   ? 0.3050 0.5825 0.4371 -0.0869 0.0417  -0.1253 1028 HOH A O   
2528 O O   . HOH J .   ? 0.1310 0.4794 0.2000 0.0568  -0.0440 -0.0298 1001 HOH B O   
2529 O O   . HOH J .   ? 0.3511 0.6661 0.3735 0.0727  -0.0173 0.0419  1002 HOH B O   
2530 O O   . HOH J .   ? 0.1656 0.5042 0.2256 0.0515  -0.0370 -0.0113 1003 HOH B O   
2531 O O   . HOH J .   ? 0.1792 0.5386 0.2029 -0.0175 -0.0311 0.0393  1004 HOH B O   
2532 O O   . HOH J .   ? 0.2558 0.5418 0.2931 0.0714  -0.0490 0.0064  1005 HOH B O   
2533 O O   . HOH J .   ? 0.2647 0.5985 0.3205 0.0203  -0.0269 0.0523  1006 HOH B O   
2534 O O   . HOH J .   ? 0.2113 0.5800 0.3024 0.0685  -0.0628 -0.0646 1007 HOH B O   
2535 O O   . HOH J .   ? 0.3259 0.6999 0.3858 0.0468  -0.0349 -0.0383 1008 HOH B O   
2536 O O   . HOH J .   ? 0.4602 0.7736 0.4626 0.1025  -0.0189 0.0324  1009 HOH B O   
2537 O O   . HOH J .   ? 0.2131 0.5878 0.2685 0.0392  -0.0293 -0.0268 1010 HOH B O   
2538 O O   . HOH J .   ? 0.2211 0.4804 0.2154 0.0907  -0.0464 0.0000  1011 HOH B O   
2539 O O   . HOH J .   ? 0.3821 0.7244 0.4391 0.0492  -0.0174 0.0730  1012 HOH B O   
2540 O O   . HOH J .   ? 0.2571 0.5823 0.2933 0.0142  -0.0297 0.0502  1013 HOH B O   
2541 O O   . HOH J .   ? 0.3198 0.6477 0.3416 0.0902  -0.0156 0.0434  1014 HOH B O   
2542 O O   . HOH J .   ? 0.2973 0.8718 0.2738 -0.0810 -0.0186 -0.0221 1015 HOH B O   
2543 O O   . HOH J .   ? 0.3083 0.8608 0.4264 0.0903  -0.0739 -0.1851 1016 HOH B O   
2544 O O   . HOH J .   ? 0.4274 0.6743 0.3605 0.1316  -0.0426 0.0023  1017 HOH B O   
2545 O O   . HOH J .   ? 0.3581 0.6527 0.3698 0.0666  -0.0271 0.0169  1018 HOH B O   
2546 O O   . HOH J .   ? 0.4154 0.7495 0.4938 0.0196  -0.0488 0.0363  1019 HOH B O   
2547 O O   . HOH J .   ? 0.2328 0.6657 0.2178 -0.0806 -0.0343 0.0413  1020 HOH B O   
2548 O O   . HOH J .   ? 0.3855 0.7142 0.3787 -0.0419 -0.0537 0.0576  1021 HOH B O   
2549 O O   . HOH J .   ? 0.2822 0.7140 0.3269 0.0006  -0.0194 -0.0202 1022 HOH B O   
2550 O O   . HOH J .   ? 0.1807 0.5143 0.2540 0.0676  -0.0556 -0.0379 1023 HOH B O   
2551 O O   . HOH J .   ? 0.3586 0.9014 0.3974 0.0170  -0.0510 -0.1097 1024 HOH B O   
2552 O O   . HOH J .   ? 0.3618 0.6430 0.3738 0.0699  -0.0498 -0.0153 1025 HOH B O   
2553 O O   . HOH J .   ? 0.5186 0.8472 0.5667 0.0467  -0.0177 0.0520  1026 HOH B O   
2554 O O   . HOH J .   ? 0.3579 0.7056 0.4026 0.0470  -0.0360 -0.0253 1027 HOH B O   
2555 O O   . HOH J .   ? 0.3376 0.8730 0.3612 -0.0053 -0.0419 -0.0821 1028 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  MET 27  27  27  MET MET A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  TRP 62  62  62  TRP TRP A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 TRP 142 142 142 TRP TRP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
B 1 1   GLY 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  MET 15  15  15  MET MET B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  ILE 17  17  17  ILE ILE B . n 
B 1 18  ALA 18  18  18  ALA ALA B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  TYR 21  21  21  TYR TYR B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  MET 27  27  27  MET MET B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  ILE 41  41  41  ILE ILE B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ASN 52  52  52  ASN ASN B . n 
B 1 53  ASN 53  53  53  ASN ASN B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  GLY 60  60  60  GLY GLY B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  TRP 62  62  62  TRP TRP B . n 
B 1 63  MET 63  63  63  MET MET B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  TYR 65  65  65  TYR TYR B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  THR 67  67  67  THR THR B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  LYS 73  73  73  LYS LYS B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  ASP 76  76  76  ASP ASP B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  MET 86  86  86  MET MET B . n 
B 1 87  PRO 87  87  87  PRO PRO B . n 
B 1 88  MET 88  88  88  MET MET B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ASN 99  99  99  ASN ASN B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 MET 102 102 102 MET MET B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 GLY 113 113 113 GLY GLY B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 TYR 120 120 120 TYR TYR B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ASN 123 123 123 ASN ASN B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 GLN 127 127 127 GLN GLN B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 GLY 130 130 130 GLY GLY B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 HIS 132 132 132 HIS HIS B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 THR 137 137 137 THR THR B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 TRP 142 142 142 TRP TRP B . n 
B 1 143 PHE 143 143 143 PHE PHE B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 TYR 150 150 150 TYR TYR B . n 
B 1 151 LYS 151 151 151 LYS LYS B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 TYR 154 154 154 TYR TYR B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3420  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  14360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? B HIS 95  ? B HIS 95  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 99.8  ? 
2  NE2 ? B HIS 95  ? B HIS 95  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 NE2 ? B HIS 42  ? B HIS 42  ? 1_555 134.6 ? 
3  NE2 ? A HIS 132 ? A HIS 132 ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 NE2 ? B HIS 42  ? B HIS 42  ? 1_555 112.8 ? 
4  NE2 ? B HIS 95  ? B HIS 95  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 SD  ? B MET 88  ? B MET 88  ? 1_555 105.0 ? 
5  NE2 ? A HIS 132 ? A HIS 132 ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 SD  ? B MET 88  ? B MET 88  ? 1_555 91.8  ? 
6  NE2 ? B HIS 42  ? B HIS 42  ? 1_555 CU ? F CU . ? B CU 200 ? 1_555 SD  ? B MET 88  ? B MET 88  ? 1_555 104.7 ? 
7  NE2 ? A HIS 95  ? A HIS 95  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 NE2 ? A HIS 42  ? A HIS 42  ? 1_555 117.7 ? 
8  NE2 ? A HIS 95  ? A HIS 95  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 97.1  ? 
9  NE2 ? A HIS 42  ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 105.7 ? 
10 NE2 ? A HIS 95  ? A HIS 95  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 116.2 ? 
11 NE2 ? A HIS 42  ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 118.8 ? 
12 NE2 ? B HIS 132 ? B HIS 132 ? 1_555 CU ? C CU . ? A CU 200 ? 1_555 SD  ? A MET 88  ? A MET 88  ? 1_555 94.1  ? 
13 OD2 ? A ASP 92  ? A ASP 92  ? 1_555 MN ? D MN . ? A MN 201 ? 1_555 OE1 ? A GLU 44  ? A GLU 44  ? 1_555 130.5 ? 
14 OD2 ? A ASP 92  ? A ASP 92  ? 1_555 MN ? D MN . ? A MN 201 ? 1_555 OE2 ? A GLU 3   ? A GLU 3   ? 1_555 72.4  ? 
15 OE1 ? A GLU 44  ? A GLU 44  ? 1_555 MN ? D MN . ? A MN 201 ? 1_555 OE2 ? A GLU 3   ? A GLU 3   ? 1_555 111.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 19.2368 12.1731 31.0875 0.0202 0.0958 0.0658 0.0062 0.0094  0.0111 1.0945 0.3169 2.2138 -0.0489 
-0.9871 0.4807 0.0518  0.0232 -0.0521 0.0031 -0.0478 0.0115  -0.0304 -0.1115 -0.0040 
'X-RAY DIFFRACTION' 2 ? refined 17.9650 10.7123 30.1171 0.0525 0.1663 0.1487 0.0416 -0.0430 0.0234 1.1246 0.9067 2.3646 0.4248  
-0.5610 1.0352 -0.0725 0.0943 -0.0483 0.0376 0.0137  -0.0049 0.1586  -0.0943 0.0589  
'X-RAY DIFFRACTION' 3 ? refined 18.6582 22.2643 4.9558  0.0128 0.2103 0.0633 0.0125 0.0152  0.0193 0.7760 0.5513 3.0343 0.2374  
1.0562  0.3192 -0.0264 0.1918 0.0403  0.0499 0.0364  0.0530  -0.0558 0.0424  -0.0099 
'X-RAY DIFFRACTION' 4 ? refined 20.2695 25.1062 6.3906  0.0312 0.3781 0.0764 0.0333 -0.0240 0.0078 0.8158 0.4028 0.8331 0.1006  
0.8227  0.0924 -0.0465 0.1416 -0.0745 0.0172 0.1525  -0.0111 -0.0253 0.1202  -0.1060 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 3    A 158  ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 1001 A 1028 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 B 3    B 158  ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 B 1001 B 1028 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice 'data collection' . ? 1 
REFMAC  refinement        . ? 2 
XDS     'data reduction'  . ? 3 
XSCALE  'data scaling'    . ? 4 
REFMAC  phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 102 ? ? -110.53 -80.58 
2 1 MET B 102 ? ? -111.01 -81.67 
3 1 PHE B 110 ? ? -103.13 50.99  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 1 ? A GLY 1 
2 1 Y 1 B GLY 1 ? B GLY 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION'    CU  
3 'MANGANESE (II) ION' MN  
4 'SULFATE ION'        SO4 
5 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CU  1  200  200  CU  CU  A . 
D 3 MN  1  201  201  MN  MN  A . 
E 4 SO4 1  300  300  SO4 SO4 A . 
F 2 CU  1  200  200  CU  CU  B . 
G 3 MN  1  201  201  MN  MN  B . 
H 4 SO4 1  300  300  SO4 SO4 B . 
I 5 HOH 1  1001 1001 HOH HOH A . 
I 5 HOH 2  1002 1002 HOH HOH A . 
I 5 HOH 3  1003 1003 HOH HOH A . 
I 5 HOH 4  1004 1004 HOH HOH A . 
I 5 HOH 5  1005 1005 HOH HOH A . 
I 5 HOH 6  1006 1006 HOH HOH A . 
I 5 HOH 7  1007 1007 HOH HOH A . 
I 5 HOH 8  1008 1008 HOH HOH A . 
I 5 HOH 9  1009 1009 HOH HOH A . 
I 5 HOH 10 1010 1010 HOH HOH A . 
I 5 HOH 11 1011 1011 HOH HOH A . 
I 5 HOH 12 1012 1012 HOH HOH A . 
I 5 HOH 13 1013 1013 HOH HOH A . 
I 5 HOH 14 1014 1014 HOH HOH A . 
I 5 HOH 15 1015 1015 HOH HOH A . 
I 5 HOH 16 1016 1016 HOH HOH A . 
I 5 HOH 17 1017 1017 HOH HOH A . 
I 5 HOH 18 1018 1018 HOH HOH A . 
I 5 HOH 19 1019 1019 HOH HOH A . 
I 5 HOH 20 1020 1020 HOH HOH A . 
I 5 HOH 21 1021 1021 HOH HOH A . 
I 5 HOH 22 1022 1022 HOH HOH A . 
I 5 HOH 23 1023 1023 HOH HOH A . 
I 5 HOH 24 1024 1024 HOH HOH A . 
I 5 HOH 25 1025 1025 HOH HOH A . 
I 5 HOH 26 1026 1026 HOH HOH A . 
I 5 HOH 27 1027 1027 HOH HOH A . 
I 5 HOH 28 1028 1028 HOH HOH A . 
J 5 HOH 1  1001 1001 HOH HOH B . 
J 5 HOH 2  1002 1002 HOH HOH B . 
J 5 HOH 3  1003 1003 HOH HOH B . 
J 5 HOH 4  1004 1004 HOH HOH B . 
J 5 HOH 5  1005 1005 HOH HOH B . 
J 5 HOH 6  1006 1006 HOH HOH B . 
J 5 HOH 7  1007 1007 HOH HOH B . 
J 5 HOH 8  1008 1008 HOH HOH B . 
J 5 HOH 9  1009 1009 HOH HOH B . 
J 5 HOH 10 1010 1010 HOH HOH B . 
J 5 HOH 11 1011 1011 HOH HOH B . 
J 5 HOH 12 1012 1012 HOH HOH B . 
J 5 HOH 13 1013 1013 HOH HOH B . 
J 5 HOH 14 1014 1014 HOH HOH B . 
J 5 HOH 15 1015 1015 HOH HOH B . 
J 5 HOH 16 1016 1016 HOH HOH B . 
J 5 HOH 17 1017 1017 HOH HOH B . 
J 5 HOH 18 1018 1018 HOH HOH B . 
J 5 HOH 19 1019 1019 HOH HOH B . 
J 5 HOH 20 1020 1020 HOH HOH B . 
J 5 HOH 21 1021 1021 HOH HOH B . 
J 5 HOH 22 1022 1022 HOH HOH B . 
J 5 HOH 23 1023 1023 HOH HOH B . 
J 5 HOH 24 1024 1024 HOH HOH B . 
J 5 HOH 25 1025 1025 HOH HOH B . 
J 5 HOH 26 1026 1026 HOH HOH B . 
J 5 HOH 27 1027 1027 HOH HOH B . 
J 5 HOH 28 1028 1028 HOH HOH B . 
#